data_6SEF
# 
_entry.id   6SEF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6SEF         
WWPDB D_1292103570 
EMDB  EMD-10154    
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'Class2C : CENP-A nucleosome in complex with CENP-C central region' 
_pdbx_database_related.db_id          EMD-10154 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6SEF 
_pdbx_database_status.recvd_initial_deposition_date   2019-07-29 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Ali-Ahmad, A.' 1 0000-0002-9021-5405 
'Bilokapic, S.' 2 0000-0003-2199-2929 
'Schafer, I.B.' 3 ?                   
'Halic, M.'     4 0000-0002-0061-7372 
'Sekulic, N.'   5 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Embo Rep.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1469-3178 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            20 
_citation.language                  ? 
_citation.page_first                e48913 
_citation.page_last                 e48913 
_citation.title                     'CENP-C unwraps the human CENP-A nucleosome through the H2A C-terminal tail.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.15252/embr.201948913 
_citation.pdbx_database_id_PubMed   31475439 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ali-Ahmad, A.' 1 ?                   
primary 'Bilokapic, S.' 2 ?                   
primary 'Schafer, I.B.' 3 ?                   
primary 'Halic, M.'     4 0000-0002-0061-7372 
primary 'Sekulic, N.'   5 0000-0002-8027-9114 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6SEF 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.00 
_cell.length_a_esd                 ? 
_cell.length_b                     1.00 
_cell.length_b_esd                 ? 
_cell.length_c                     1.00 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6SEF 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Histone H3-like centromeric protein A' 16023.630 2 ? ? ? ? 
2 polymer man 'Histone H4'                            11394.426 2 ? ? ? ? 
3 polymer man 'Histone H2A type 2-A'                  14125.549 2 ? ? ? ? 
4 polymer man 'Histone H2B type 1-C/E/F/G/I'          13937.213 2 ? ? ? ? 
5 polymer man 'DNA (145-MER)'                         44520.383 1 ? ? ? ? 
6 polymer man 'DNA (145-MER)'                         44991.660 1 ? ? ? ? 
7 polymer man 'Centromere protein C'                  14204.750 1 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Centromere autoantigen A,Centromere protein A,CENP-A'                                                                
3 'Histone H2A.2,Histone H2A/o'                                                                                         
4 'Histone H2B.1 A,Histone H2B.a,H2B/a,Histone H2B.g,H2B/g,Histone H2B.h,H2B/h,Histone H2B.k,H2B/k,Histone H2B.l,H2B/l' 
7 'CENP-C,Centromere autoantigen C,Centromere protein C 1,CENP-C 1,Interphase centromere complex protein 7'             
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTR
GVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG
;
;MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTR
GVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG
;
A,E ? 
2 'polypeptide(L)'        no no 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
;
;MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
;
C,G ? 
4 'polypeptide(L)'        no no 
;MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
;MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DG)(DA)(DA)(DT)(DC)(DC)(DC)(DG)(DG)(DT)(DG)(DC)(DC)(DG)(DA)(DG)
(DG)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DA)(DT)(DT)(DG)(DG)(DT)(DC)(DG)(DT)(DA)(DG)(DA)
(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DA)(DG)(DC)(DA)(DC)(DC)(DG)(DC)(DT)(DT)(DA)(DA)(DA)
(DC)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DG)(DC)(DT)(DG)(DT)(DC)(DC)(DC)(DC)
(DC)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DA)(DA)(DC)(DC)(DG)(DC)(DC)(DA)(DA)(DG)(DG)(DG)
(DG)(DA)(DT)(DT)(DA)(DC)(DT)(DC)(DC)(DC)(DT)(DA)(DG)(DT)(DC)(DT)(DC)(DC)(DA)(DG)
(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DT)(DC)(DA)(DG)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DC)(DA)
(DT)(DC)(DG)(DA)(DT)
;
;ATCAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCC
CGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCGAT
;
I   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DG)(DA)(DT)(DG)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DC)(DT)(DG)(DA)(DC)(DA)
(DC)(DG)(DT)(DG)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DC)(DT)(DA)(DG)(DG)(DG)(DA)(DG)
(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DT)(DT)(DG)(DG)(DC)(DG)(DG)(DT)(DT)(DA)(DA)(DA)
(DA)(DC)(DG)(DC)(DG)(DG)(DG)(DG)(DG)(DA)(DC)(DA)(DG)(DC)(DG)(DC)(DG)(DT)(DA)(DC)
(DG)(DT)(DG)(DC)(DG)(DT)(DT)(DT)(DA)(DA)(DG)(DC)(DG)(DG)(DT)(DG)(DC)(DT)(DA)(DG)
(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DT)(DA)(DC)(DG)(DA)(DC)(DC)(DA)(DA)(DT)(DT)(DG)(DA)
(DG)(DC)(DG)(DG)(DC)(DC)(DT)(DC)(DG)(DG)(DC)(DA)(DC)(DC)(DG)(DG)(DG)(DA)(DT)(DT)
(DC)(DT)(DG)(DA)(DT)
;
;ATCGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTAC
GTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTGAT
;
J   ? 
7 'polypeptide(L)'        no no 
;GPLGSPEFGRATMAKPAEEQLDVGQSKDENIHTSHITQDEFQRNSDRNMEEHEEMGNDCVSKKQMPPVGSKKSSTRKDKE
ESKKKRFSSESKNKLVPEEVTSTVTKSRRISRRPSDWWVVKSEE
;
;GPLGSPEFGRATMAKPAEEQLDVGQSKDENIHTSHITQDEFQRNSDRNMEEHEEMGNDCVSKKQMPPVGSKKSSTRKDKE
ESKKKRFSSESKNKLVPEEVTSTVTKSRRISRRPSDWWVVKSEE
;
V   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   PRO n 
1 4   ARG n 
1 5   ARG n 
1 6   ARG n 
1 7   SER n 
1 8   ARG n 
1 9   LYS n 
1 10  PRO n 
1 11  GLU n 
1 12  ALA n 
1 13  PRO n 
1 14  ARG n 
1 15  ARG n 
1 16  ARG n 
1 17  SER n 
1 18  PRO n 
1 19  SER n 
1 20  PRO n 
1 21  THR n 
1 22  PRO n 
1 23  THR n 
1 24  PRO n 
1 25  GLY n 
1 26  PRO n 
1 27  SER n 
1 28  ARG n 
1 29  ARG n 
1 30  GLY n 
1 31  PRO n 
1 32  SER n 
1 33  LEU n 
1 34  GLY n 
1 35  ALA n 
1 36  SER n 
1 37  SER n 
1 38  HIS n 
1 39  GLN n 
1 40  HIS n 
1 41  SER n 
1 42  ARG n 
1 43  ARG n 
1 44  ARG n 
1 45  GLN n 
1 46  GLY n 
1 47  TRP n 
1 48  LEU n 
1 49  LYS n 
1 50  GLU n 
1 51  ILE n 
1 52  ARG n 
1 53  LYS n 
1 54  LEU n 
1 55  GLN n 
1 56  LYS n 
1 57  SER n 
1 58  THR n 
1 59  HIS n 
1 60  LEU n 
1 61  LEU n 
1 62  ILE n 
1 63  ARG n 
1 64  LYS n 
1 65  LEU n 
1 66  PRO n 
1 67  PHE n 
1 68  SER n 
1 69  ARG n 
1 70  LEU n 
1 71  ALA n 
1 72  ARG n 
1 73  GLU n 
1 74  ILE n 
1 75  CYS n 
1 76  VAL n 
1 77  LYS n 
1 78  PHE n 
1 79  THR n 
1 80  ARG n 
1 81  GLY n 
1 82  VAL n 
1 83  ASP n 
1 84  PHE n 
1 85  ASN n 
1 86  TRP n 
1 87  GLN n 
1 88  ALA n 
1 89  GLN n 
1 90  ALA n 
1 91  LEU n 
1 92  LEU n 
1 93  ALA n 
1 94  LEU n 
1 95  GLN n 
1 96  GLU n 
1 97  ALA n 
1 98  ALA n 
1 99  GLU n 
1 100 ALA n 
1 101 PHE n 
1 102 LEU n 
1 103 VAL n 
1 104 HIS n 
1 105 LEU n 
1 106 PHE n 
1 107 GLU n 
1 108 ASP n 
1 109 ALA n 
1 110 TYR n 
1 111 LEU n 
1 112 LEU n 
1 113 THR n 
1 114 LEU n 
1 115 HIS n 
1 116 ALA n 
1 117 GLY n 
1 118 ARG n 
1 119 VAL n 
1 120 THR n 
1 121 LEU n 
1 122 PHE n 
1 123 PRO n 
1 124 LYS n 
1 125 ASP n 
1 126 VAL n 
1 127 GLN n 
1 128 LEU n 
1 129 ALA n 
1 130 ARG n 
1 131 ARG n 
1 132 ILE n 
1 133 ARG n 
1 134 GLY n 
1 135 LEU n 
1 136 GLU n 
1 137 GLU n 
1 138 GLY n 
1 139 LEU n 
1 140 GLY n 
2 1   MET n 
2 2   SER n 
2 3   GLY n 
2 4   ARG n 
2 5   GLY n 
2 6   LYS n 
2 7   GLY n 
2 8   GLY n 
2 9   LYS n 
2 10  GLY n 
2 11  LEU n 
2 12  GLY n 
2 13  LYS n 
2 14  GLY n 
2 15  GLY n 
2 16  ALA n 
2 17  LYS n 
2 18  ARG n 
2 19  HIS n 
2 20  ARG n 
2 21  LYS n 
2 22  VAL n 
2 23  LEU n 
2 24  ARG n 
2 25  ASP n 
2 26  ASN n 
2 27  ILE n 
2 28  GLN n 
2 29  GLY n 
2 30  ILE n 
2 31  THR n 
2 32  LYS n 
2 33  PRO n 
2 34  ALA n 
2 35  ILE n 
2 36  ARG n 
2 37  ARG n 
2 38  LEU n 
2 39  ALA n 
2 40  ARG n 
2 41  ARG n 
2 42  GLY n 
2 43  GLY n 
2 44  VAL n 
2 45  LYS n 
2 46  ARG n 
2 47  ILE n 
2 48  SER n 
2 49  GLY n 
2 50  LEU n 
2 51  ILE n 
2 52  TYR n 
2 53  GLU n 
2 54  GLU n 
2 55  THR n 
2 56  ARG n 
2 57  GLY n 
2 58  VAL n 
2 59  LEU n 
2 60  LYS n 
2 61  VAL n 
2 62  PHE n 
2 63  LEU n 
2 64  GLU n 
2 65  ASN n 
2 66  VAL n 
2 67  ILE n 
2 68  ARG n 
2 69  ASP n 
2 70  ALA n 
2 71  VAL n 
2 72  THR n 
2 73  TYR n 
2 74  THR n 
2 75  GLU n 
2 76  HIS n 
2 77  ALA n 
2 78  LYS n 
2 79  ARG n 
2 80  LYS n 
2 81  THR n 
2 82  VAL n 
2 83  THR n 
2 84  ALA n 
2 85  MET n 
2 86  ASP n 
2 87  VAL n 
2 88  VAL n 
2 89  TYR n 
2 90  ALA n 
2 91  LEU n 
2 92  LYS n 
2 93  ARG n 
2 94  GLN n 
2 95  GLY n 
2 96  ARG n 
2 97  THR n 
2 98  LEU n 
2 99  TYR n 
2 100 GLY n 
2 101 PHE n 
2 102 GLY n 
2 103 GLY n 
3 1   MET n 
3 2   SER n 
3 3   GLY n 
3 4   ARG n 
3 5   GLY n 
3 6   LYS n 
3 7   GLN n 
3 8   GLY n 
3 9   GLY n 
3 10  LYS n 
3 11  ALA n 
3 12  ARG n 
3 13  ALA n 
3 14  LYS n 
3 15  ALA n 
3 16  LYS n 
3 17  SER n 
3 18  ARG n 
3 19  SER n 
3 20  SER n 
3 21  ARG n 
3 22  ALA n 
3 23  GLY n 
3 24  LEU n 
3 25  GLN n 
3 26  PHE n 
3 27  PRO n 
3 28  VAL n 
3 29  GLY n 
3 30  ARG n 
3 31  VAL n 
3 32  HIS n 
3 33  ARG n 
3 34  LEU n 
3 35  LEU n 
3 36  ARG n 
3 37  LYS n 
3 38  GLY n 
3 39  ASN n 
3 40  TYR n 
3 41  ALA n 
3 42  GLU n 
3 43  ARG n 
3 44  VAL n 
3 45  GLY n 
3 46  ALA n 
3 47  GLY n 
3 48  ALA n 
3 49  PRO n 
3 50  VAL n 
3 51  TYR n 
3 52  MET n 
3 53  ALA n 
3 54  ALA n 
3 55  VAL n 
3 56  LEU n 
3 57  GLU n 
3 58  TYR n 
3 59  LEU n 
3 60  THR n 
3 61  ALA n 
3 62  GLU n 
3 63  ILE n 
3 64  LEU n 
3 65  GLU n 
3 66  LEU n 
3 67  ALA n 
3 68  GLY n 
3 69  ASN n 
3 70  ALA n 
3 71  ALA n 
3 72  ARG n 
3 73  ASP n 
3 74  ASN n 
3 75  LYS n 
3 76  LYS n 
3 77  THR n 
3 78  ARG n 
3 79  ILE n 
3 80  ILE n 
3 81  PRO n 
3 82  ARG n 
3 83  HIS n 
3 84  LEU n 
3 85  GLN n 
3 86  LEU n 
3 87  ALA n 
3 88  ILE n 
3 89  ARG n 
3 90  ASN n 
3 91  ASP n 
3 92  GLU n 
3 93  GLU n 
3 94  LEU n 
3 95  ASN n 
3 96  LYS n 
3 97  LEU n 
3 98  LEU n 
3 99  GLY n 
3 100 LYS n 
3 101 VAL n 
3 102 THR n 
3 103 ILE n 
3 104 ALA n 
3 105 GLN n 
3 106 GLY n 
3 107 GLY n 
3 108 VAL n 
3 109 LEU n 
3 110 PRO n 
3 111 ASN n 
3 112 ILE n 
3 113 GLN n 
3 114 ALA n 
3 115 VAL n 
3 116 LEU n 
3 117 LEU n 
3 118 PRO n 
3 119 LYS n 
3 120 LYS n 
3 121 THR n 
3 122 GLU n 
3 123 SER n 
3 124 HIS n 
3 125 HIS n 
3 126 LYS n 
3 127 ALA n 
3 128 LYS n 
3 129 GLY n 
3 130 LYS n 
4 1   MET n 
4 2   PRO n 
4 3   GLU n 
4 4   PRO n 
4 5   ALA n 
4 6   LYS n 
4 7   SER n 
4 8   ALA n 
4 9   PRO n 
4 10  ALA n 
4 11  PRO n 
4 12  LYS n 
4 13  LYS n 
4 14  GLY n 
4 15  SER n 
4 16  LYS n 
4 17  LYS n 
4 18  ALA n 
4 19  VAL n 
4 20  THR n 
4 21  LYS n 
4 22  ALA n 
4 23  GLN n 
4 24  LYS n 
4 25  LYS n 
4 26  ASP n 
4 27  GLY n 
4 28  LYS n 
4 29  LYS n 
4 30  ARG n 
4 31  LYS n 
4 32  ARG n 
4 33  SER n 
4 34  ARG n 
4 35  LYS n 
4 36  GLU n 
4 37  SER n 
4 38  TYR n 
4 39  SER n 
4 40  VAL n 
4 41  TYR n 
4 42  VAL n 
4 43  TYR n 
4 44  LYS n 
4 45  VAL n 
4 46  LEU n 
4 47  LYS n 
4 48  GLN n 
4 49  VAL n 
4 50  HIS n 
4 51  PRO n 
4 52  ASP n 
4 53  THR n 
4 54  GLY n 
4 55  ILE n 
4 56  SER n 
4 57  SER n 
4 58  LYS n 
4 59  ALA n 
4 60  MET n 
4 61  GLY n 
4 62  ILE n 
4 63  MET n 
4 64  ASN n 
4 65  SER n 
4 66  PHE n 
4 67  VAL n 
4 68  ASN n 
4 69  ASP n 
4 70  ILE n 
4 71  PHE n 
4 72  GLU n 
4 73  ARG n 
4 74  ILE n 
4 75  ALA n 
4 76  GLY n 
4 77  GLU n 
4 78  ALA n 
4 79  SER n 
4 80  ARG n 
4 81  LEU n 
4 82  ALA n 
4 83  HIS n 
4 84  TYR n 
4 85  ASN n 
4 86  LYS n 
4 87  ARG n 
4 88  SER n 
4 89  THR n 
4 90  ILE n 
4 91  THR n 
4 92  SER n 
4 93  ARG n 
4 94  GLU n 
4 95  ILE n 
4 96  GLN n 
4 97  THR n 
4 98  ALA n 
4 99  VAL n 
4 100 ARG n 
4 101 LEU n 
4 102 LEU n 
4 103 LEU n 
4 104 PRO n 
4 105 GLY n 
4 106 GLU n 
4 107 LEU n 
4 108 ALA n 
4 109 LYS n 
4 110 HIS n 
4 111 ALA n 
4 112 VAL n 
4 113 SER n 
4 114 GLU n 
4 115 GLY n 
4 116 THR n 
4 117 LYS n 
4 118 ALA n 
4 119 VAL n 
4 120 THR n 
4 121 LYS n 
4 122 TYR n 
4 123 THR n 
4 124 SER n 
4 125 SER n 
4 126 LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DA  n 
5 5   DG  n 
5 6   DA  n 
5 7   DA  n 
5 8   DT  n 
5 9   DC  n 
5 10  DC  n 
5 11  DC  n 
5 12  DG  n 
5 13  DG  n 
5 14  DT  n 
5 15  DG  n 
5 16  DC  n 
5 17  DC  n 
5 18  DG  n 
5 19  DA  n 
5 20  DG  n 
5 21  DG  n 
5 22  DC  n 
5 23  DC  n 
5 24  DG  n 
5 25  DC  n 
5 26  DT  n 
5 27  DC  n 
5 28  DA  n 
5 29  DA  n 
5 30  DT  n 
5 31  DT  n 
5 32  DG  n 
5 33  DG  n 
5 34  DT  n 
5 35  DC  n 
5 36  DG  n 
5 37  DT  n 
5 38  DA  n 
5 39  DG  n 
5 40  DA  n 
5 41  DC  n 
5 42  DA  n 
5 43  DG  n 
5 44  DC  n 
5 45  DT  n 
5 46  DC  n 
5 47  DT  n 
5 48  DA  n 
5 49  DG  n 
5 50  DC  n 
5 51  DA  n 
5 52  DC  n 
5 53  DC  n 
5 54  DG  n 
5 55  DC  n 
5 56  DT  n 
5 57  DT  n 
5 58  DA  n 
5 59  DA  n 
5 60  DA  n 
5 61  DC  n 
5 62  DG  n 
5 63  DC  n 
5 64  DA  n 
5 65  DC  n 
5 66  DG  n 
5 67  DT  n 
5 68  DA  n 
5 69  DC  n 
5 70  DG  n 
5 71  DC  n 
5 72  DG  n 
5 73  DC  n 
5 74  DT  n 
5 75  DG  n 
5 76  DT  n 
5 77  DC  n 
5 78  DC  n 
5 79  DC  n 
5 80  DC  n 
5 81  DC  n 
5 82  DG  n 
5 83  DC  n 
5 84  DG  n 
5 85  DT  n 
5 86  DT  n 
5 87  DT  n 
5 88  DT  n 
5 89  DA  n 
5 90  DA  n 
5 91  DC  n 
5 92  DC  n 
5 93  DG  n 
5 94  DC  n 
5 95  DC  n 
5 96  DA  n 
5 97  DA  n 
5 98  DG  n 
5 99  DG  n 
5 100 DG  n 
5 101 DG  n 
5 102 DA  n 
5 103 DT  n 
5 104 DT  n 
5 105 DA  n 
5 106 DC  n 
5 107 DT  n 
5 108 DC  n 
5 109 DC  n 
5 110 DC  n 
5 111 DT  n 
5 112 DA  n 
5 113 DG  n 
5 114 DT  n 
5 115 DC  n 
5 116 DT  n 
5 117 DC  n 
5 118 DC  n 
5 119 DA  n 
5 120 DG  n 
5 121 DG  n 
5 122 DC  n 
5 123 DA  n 
5 124 DC  n 
5 125 DG  n 
5 126 DT  n 
5 127 DG  n 
5 128 DT  n 
5 129 DC  n 
5 130 DA  n 
5 131 DG  n 
5 132 DA  n 
5 133 DT  n 
5 134 DA  n 
5 135 DT  n 
5 136 DA  n 
5 137 DT  n 
5 138 DA  n 
5 139 DC  n 
5 140 DA  n 
5 141 DT  n 
5 142 DC  n 
5 143 DG  n 
5 144 DA  n 
5 145 DT  n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DG  n 
6 5   DA  n 
6 6   DT  n 
6 7   DG  n 
6 8   DT  n 
6 9   DA  n 
6 10  DT  n 
6 11  DA  n 
6 12  DT  n 
6 13  DA  n 
6 14  DT  n 
6 15  DC  n 
6 16  DT  n 
6 17  DG  n 
6 18  DA  n 
6 19  DC  n 
6 20  DA  n 
6 21  DC  n 
6 22  DG  n 
6 23  DT  n 
6 24  DG  n 
6 25  DC  n 
6 26  DC  n 
6 27  DT  n 
6 28  DG  n 
6 29  DG  n 
6 30  DA  n 
6 31  DG  n 
6 32  DA  n 
6 33  DC  n 
6 34  DT  n 
6 35  DA  n 
6 36  DG  n 
6 37  DG  n 
6 38  DG  n 
6 39  DA  n 
6 40  DG  n 
6 41  DT  n 
6 42  DA  n 
6 43  DA  n 
6 44  DT  n 
6 45  DC  n 
6 46  DC  n 
6 47  DC  n 
6 48  DC  n 
6 49  DT  n 
6 50  DT  n 
6 51  DG  n 
6 52  DG  n 
6 53  DC  n 
6 54  DG  n 
6 55  DG  n 
6 56  DT  n 
6 57  DT  n 
6 58  DA  n 
6 59  DA  n 
6 60  DA  n 
6 61  DA  n 
6 62  DC  n 
6 63  DG  n 
6 64  DC  n 
6 65  DG  n 
6 66  DG  n 
6 67  DG  n 
6 68  DG  n 
6 69  DG  n 
6 70  DA  n 
6 71  DC  n 
6 72  DA  n 
6 73  DG  n 
6 74  DC  n 
6 75  DG  n 
6 76  DC  n 
6 77  DG  n 
6 78  DT  n 
6 79  DA  n 
6 80  DC  n 
6 81  DG  n 
6 82  DT  n 
6 83  DG  n 
6 84  DC  n 
6 85  DG  n 
6 86  DT  n 
6 87  DT  n 
6 88  DT  n 
6 89  DA  n 
6 90  DA  n 
6 91  DG  n 
6 92  DC  n 
6 93  DG  n 
6 94  DG  n 
6 95  DT  n 
6 96  DG  n 
6 97  DC  n 
6 98  DT  n 
6 99  DA  n 
6 100 DG  n 
6 101 DA  n 
6 102 DG  n 
6 103 DC  n 
6 104 DT  n 
6 105 DG  n 
6 106 DT  n 
6 107 DC  n 
6 108 DT  n 
6 109 DA  n 
6 110 DC  n 
6 111 DG  n 
6 112 DA  n 
6 113 DC  n 
6 114 DC  n 
6 115 DA  n 
6 116 DA  n 
6 117 DT  n 
6 118 DT  n 
6 119 DG  n 
6 120 DA  n 
6 121 DG  n 
6 122 DC  n 
6 123 DG  n 
6 124 DG  n 
6 125 DC  n 
6 126 DC  n 
6 127 DT  n 
6 128 DC  n 
6 129 DG  n 
6 130 DG  n 
6 131 DC  n 
6 132 DA  n 
6 133 DC  n 
6 134 DC  n 
6 135 DG  n 
6 136 DG  n 
6 137 DG  n 
6 138 DA  n 
6 139 DT  n 
6 140 DT  n 
6 141 DC  n 
6 142 DT  n 
6 143 DG  n 
6 144 DA  n 
6 145 DT  n 
7 1   GLY n 
7 2   PRO n 
7 3   LEU n 
7 4   GLY n 
7 5   SER n 
7 6   PRO n 
7 7   GLU n 
7 8   PHE n 
7 9   GLY n 
7 10  ARG n 
7 11  ALA n 
7 12  THR n 
7 13  MET n 
7 14  ALA n 
7 15  LYS n 
7 16  PRO n 
7 17  ALA n 
7 18  GLU n 
7 19  GLU n 
7 20  GLN n 
7 21  LEU n 
7 22  ASP n 
7 23  VAL n 
7 24  GLY n 
7 25  GLN n 
7 26  SER n 
7 27  LYS n 
7 28  ASP n 
7 29  GLU n 
7 30  ASN n 
7 31  ILE n 
7 32  HIS n 
7 33  THR n 
7 34  SER n 
7 35  HIS n 
7 36  ILE n 
7 37  THR n 
7 38  GLN n 
7 39  ASP n 
7 40  GLU n 
7 41  PHE n 
7 42  GLN n 
7 43  ARG n 
7 44  ASN n 
7 45  SER n 
7 46  ASP n 
7 47  ARG n 
7 48  ASN n 
7 49  MET n 
7 50  GLU n 
7 51  GLU n 
7 52  HIS n 
7 53  GLU n 
7 54  GLU n 
7 55  MET n 
7 56  GLY n 
7 57  ASN n 
7 58  ASP n 
7 59  CYS n 
7 60  VAL n 
7 61  SER n 
7 62  LYS n 
7 63  LYS n 
7 64  GLN n 
7 65  MET n 
7 66  PRO n 
7 67  PRO n 
7 68  VAL n 
7 69  GLY n 
7 70  SER n 
7 71  LYS n 
7 72  LYS n 
7 73  SER n 
7 74  SER n 
7 75  THR n 
7 76  ARG n 
7 77  LYS n 
7 78  ASP n 
7 79  LYS n 
7 80  GLU n 
7 81  GLU n 
7 82  SER n 
7 83  LYS n 
7 84  LYS n 
7 85  LYS n 
7 86  ARG n 
7 87  PHE n 
7 88  SER n 
7 89  SER n 
7 90  GLU n 
7 91  SER n 
7 92  LYS n 
7 93  ASN n 
7 94  LYS n 
7 95  LEU n 
7 96  VAL n 
7 97  PRO n 
7 98  GLU n 
7 99  GLU n 
7 100 VAL n 
7 101 THR n 
7 102 SER n 
7 103 THR n 
7 104 VAL n 
7 105 THR n 
7 106 LYS n 
7 107 SER n 
7 108 ARG n 
7 109 ARG n 
7 110 ILE n 
7 111 SER n 
7 112 ARG n 
7 113 ARG n 
7 114 PRO n 
7 115 SER n 
7 116 ASP n 
7 117 TRP n 
7 118 TRP n 
7 119 VAL n 
7 120 VAL n 
7 121 LYS n 
7 122 SER n 
7 123 GLU n 
7 124 GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 140 Human ? CENPA ? ? ? ? ? ? 'Homo sapiens'        9606  ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 103 Human ? 
;HIST1H4A, H4/A, H4FA, HIST1H4B, H4/I, H4FI, HIST1H4C, H4/G, H4FG, HIST1H4D, H4/B, H4FB, HIST1H4E, H4/J, H4FJ, HIST1H4F, H4/C, H4FC, HIST1H4H, H4/H, H4FH, HIST1H4I, H4/M, H4FM, HIST1H4J, H4/E, H4FE, HIST1H4K, H4/D, H4FD, HIST1H4L, H4/K, H4FK, HIST2H4A, H4/N, H4F2, H4FN, HIST2H4, HIST2H4B, H4/O, H4FO, HIST4H4
;
? ? ? ? ? ? 'Homo sapiens'        9606  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 130 Human ? 'HIST2H2AA3, H2AFO, HIST2H2AA, HIST2H2AA4' ? ? ? ? ? ? 'Homo sapiens'        9606  
? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 126 Human ? 
'HIST1H2BC, H2BFL, HIST1H2BE, H2BFH, HIST1H2BF, H2BFG, HIST1H2BG, H2BFA, HIST1H2BI, H2BFK' ? ? ? ? ? ? 'Homo sapiens'        9606  
? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 145 ?     ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6 1 sample 'Biological sequence' 1 145 ?     ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7 1 sample 'Biological sequence' 1 124 Human ? 'CENPC, CENPC1, ICEN7' ? ? ? ? ? ? 'Homo sapiens'        9606  ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP CENPA_HUMAN P49450 ? 1 
;MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTR
GVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG
;
1   
2 UNP H4_HUMAN    P62805 ? 2 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
1   
3 UNP H2A2A_HUMAN Q6FI13 ? 3 
;MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
;
1   
4 UNP H2B1C_HUMAN P62807 ? 4 
;MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
1   
5 PDB 6SEF        6SEF   ? 5 ? 1   
6 PDB 6SEF        6SEF   ? 6 ? 1   
7 UNP CENPC_HUMAN Q03188 ? 7 
;MAKPAEEQLDVGQSKDENIHTSHITQDEFQRNSDRNMEEHEEMGNDCVSKKQMPPVGSKKSSTRKDKEESKKKRFSSESK
NKLVPEEVTSTVTKSRRISRRPSDWWVVKSEE
;
426 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6SEF A 1  ? 140 ? P49450 1   ? 140 ? 1   140 
2  2 6SEF B 1  ? 103 ? P62805 1   ? 103 ? 0   102 
3  3 6SEF C 1  ? 130 ? Q6FI13 1   ? 130 ? 0   129 
4  4 6SEF D 1  ? 126 ? P62807 1   ? 126 ? 0   125 
5  1 6SEF E 1  ? 140 ? P49450 1   ? 140 ? 1   140 
6  2 6SEF F 1  ? 103 ? P62805 1   ? 103 ? 0   102 
7  3 6SEF G 1  ? 130 ? Q6FI13 1   ? 130 ? 0   129 
8  4 6SEF H 1  ? 126 ? P62807 1   ? 126 ? 0   125 
9  5 6SEF I 1  ? 145 ? 6SEF   -72 ? 72  ? -72 72  
10 6 6SEF J 1  ? 145 ? 6SEF   -72 ? 72  ? -72 72  
11 7 6SEF V 13 ? 124 ? Q03188 426 ? 537 ? 426 537 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
11 6SEF GLY V 1  ? UNP Q03188 ? ? 'expression tag' 414 1  
11 6SEF PRO V 2  ? UNP Q03188 ? ? 'expression tag' 415 2  
11 6SEF LEU V 3  ? UNP Q03188 ? ? 'expression tag' 416 3  
11 6SEF GLY V 4  ? UNP Q03188 ? ? 'expression tag' 417 4  
11 6SEF SER V 5  ? UNP Q03188 ? ? 'expression tag' 418 5  
11 6SEF PRO V 6  ? UNP Q03188 ? ? 'expression tag' 419 6  
11 6SEF GLU V 7  ? UNP Q03188 ? ? 'expression tag' 420 7  
11 6SEF PHE V 8  ? UNP Q03188 ? ? 'expression tag' 421 8  
11 6SEF GLY V 9  ? UNP Q03188 ? ? 'expression tag' 422 9  
11 6SEF ARG V 10 ? UNP Q03188 ? ? 'expression tag' 423 10 
11 6SEF ALA V 11 ? UNP Q03188 ? ? 'expression tag' 424 11 
11 6SEF THR V 12 ? UNP Q03188 ? ? 'expression tag' 425 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6SEF 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6SEF 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            . 
_refine.ls_d_res_low                             ? 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       'CDL v1.2' 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.0069  ? 12730 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 0.8418  ? 18433 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 0.0517  ? 2086  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.0049  ? 1322  ? f_plane_restr      ? ? 
'ELECTRON MICROSCOPY' ? 25.9246 ? 6608  ? f_dihedral_angle_d ? ? 
# 
_struct.entry_id                     6SEF 
_struct.title                        'Class2C : CENP-A nucleosome in complex with CENP-C central region' 
_struct.pdbx_descriptor              
'Histone H3-like centromeric protein A, Histone H4, Histone H2A type 2-A, Histone H2B type 1-C/E/F/G/I/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6SEF 
_struct_keywords.text            'CENP-A, nucleosome, centromere, centromeric chromatin, NUCLEAR PROTEIN' 
_struct_keywords.pdbx_keywords   'NUCLEAR PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 46  ? SER A 57  ? GLY A 46  SER A 57  1 ? 12 
HELX_P HELX_P2  AA2 LYS A 64  ? VAL A 76  ? LYS A 64  VAL A 76  1 ? 13 
HELX_P HELX_P3  AA3 GLN A 87  ? ALA A 116 ? GLN A 87  ALA A 116 1 ? 30 
HELX_P HELX_P4  AA4 PHE A 122 ? GLY A 134 ? PHE A 122 GLY A 134 1 ? 13 
HELX_P HELX_P5  AA5 GLY A 134 ? LEU A 139 ? GLY A 134 LEU A 139 1 ? 6  
HELX_P HELX_P6  AA6 THR B 31  ? GLY B 42  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  AA7 LEU B 50  ? ALA B 77  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  AA8 THR B 83  ? GLY B 95  ? THR B 82  GLY B 94  1 ? 13 
HELX_P HELX_P9  AA9 PRO C 27  ? GLY C 38  ? PRO C 26  GLY C 37  1 ? 12 
HELX_P HELX_P10 AB1 ALA C 46  ? ASP C 73  ? ALA C 45  ASP C 72  1 ? 28 
HELX_P HELX_P11 AB2 ILE C 80  ? ASP C 91  ? ILE C 79  ASP C 90  1 ? 12 
HELX_P HELX_P12 AB3 ASP C 91  ? LEU C 98  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P13 AB4 TYR D 38  ? HIS D 50  ? TYR D 37  HIS D 49  1 ? 13 
HELX_P HELX_P14 AB5 SER D 56  ? ASN D 85  ? SER D 55  ASN D 84  1 ? 30 
HELX_P HELX_P15 AB6 THR D 91  ? LEU D 103 ? THR D 90  LEU D 102 1 ? 13 
HELX_P HELX_P16 AB7 PRO D 104 ? THR D 123 ? PRO D 103 THR D 122 1 ? 20 
HELX_P HELX_P17 AB8 GLY E 46  ? SER E 57  ? GLY E 46  SER E 57  1 ? 12 
HELX_P HELX_P18 AB9 ARG E 63  ? THR E 79  ? ARG E 63  THR E 79  1 ? 17 
HELX_P HELX_P19 AC1 GLN E 87  ? GLY E 117 ? GLN E 87  GLY E 117 1 ? 31 
HELX_P HELX_P20 AC2 PHE E 122 ? GLY E 134 ? PHE E 122 GLY E 134 1 ? 13 
HELX_P HELX_P21 AC3 ASN F 26  ? ILE F 30  ? ASN F 25  ILE F 29  5 ? 5  
HELX_P HELX_P22 AC4 THR F 31  ? GLY F 42  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P23 AC5 LEU F 50  ? GLU F 53  ? LEU F 49  GLU F 52  5 ? 4  
HELX_P HELX_P24 AC6 GLU F 54  ? ALA F 77  ? GLU F 53  ALA F 76  1 ? 24 
HELX_P HELX_P25 AC7 THR F 83  ? GLY F 95  ? THR F 82  GLY F 94  1 ? 13 
HELX_P HELX_P26 AC8 SER G 17  ? ALA G 22  ? SER G 16  ALA G 21  1 ? 6  
HELX_P HELX_P27 AC9 PRO G 27  ? GLY G 38  ? PRO G 26  GLY G 37  1 ? 12 
HELX_P HELX_P28 AD1 GLY G 47  ? ASP G 73  ? GLY G 46  ASP G 72  1 ? 27 
HELX_P HELX_P29 AD2 ILE G 80  ? ARG G 89  ? ILE G 79  ARG G 88  1 ? 10 
HELX_P HELX_P30 AD3 ASP G 91  ? LEU G 98  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P31 AD4 SER H 39  ? HIS H 50  ? SER H 38  HIS H 49  1 ? 12 
HELX_P HELX_P32 AD5 SER H 56  ? ASN H 85  ? SER H 55  ASN H 84  1 ? 30 
HELX_P HELX_P33 AD6 THR H 91  ? LEU H 103 ? THR H 90  LEU H 102 1 ? 13 
HELX_P HELX_P34 AD7 PRO H 104 ? THR H 123 ? PRO H 103 THR H 122 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? I DA 1   N1 ? ? ? 1_555 J DT 145 N3 ? ? I DA -72 J DT 72  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2   hydrog ? ? I DA 1   N6 ? ? ? 1_555 J DT 145 O4 ? ? I DA -72 J DT 72  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3   hydrog ? ? I DT 2   N3 ? ? ? 1_555 J DA 144 N1 ? ? I DT -71 J DA 71  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4   hydrog ? ? I DT 2   O4 ? ? ? 1_555 J DA 144 N6 ? ? I DT -71 J DA 71  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5   hydrog ? ? I DC 3   N3 ? ? ? 1_555 J DG 143 N1 ? ? I DC -70 J DG 70  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6   hydrog ? ? I DC 3   N4 ? ? ? 1_555 J DG 143 O6 ? ? I DC -70 J DG 70  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7   hydrog ? ? I DC 3   O2 ? ? ? 1_555 J DG 143 N2 ? ? I DC -70 J DG 70  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8   hydrog ? ? I DA 4   N1 ? ? ? 1_555 J DT 142 N3 ? ? I DA -69 J DT 69  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9   hydrog ? ? I DA 4   N6 ? ? ? 1_555 J DT 142 O4 ? ? I DA -69 J DT 69  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10  hydrog ? ? I DG 5   N1 ? ? ? 1_555 J DC 141 N3 ? ? I DG -68 J DC 68  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11  hydrog ? ? I DG 5   N2 ? ? ? 1_555 J DC 141 O2 ? ? I DG -68 J DC 68  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12  hydrog ? ? I DG 5   O6 ? ? ? 1_555 J DC 141 N4 ? ? I DG -68 J DC 68  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13  hydrog ? ? I DA 6   N1 ? ? ? 1_555 J DT 140 N3 ? ? I DA -67 J DT 67  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14  hydrog ? ? I DA 6   N6 ? ? ? 1_555 J DT 140 O4 ? ? I DA -67 J DT 67  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15  hydrog ? ? I DA 7   N1 ? ? ? 1_555 J DT 139 N3 ? ? I DA -66 J DT 66  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16  hydrog ? ? I DA 7   N6 ? ? ? 1_555 J DT 139 O4 ? ? I DA -66 J DT 66  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17  hydrog ? ? I DT 8   N3 ? ? ? 1_555 J DA 138 N1 ? ? I DT -65 J DA 65  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18  hydrog ? ? I DT 8   O4 ? ? ? 1_555 J DA 138 N6 ? ? I DT -65 J DA 65  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19  hydrog ? ? I DC 9   N3 ? ? ? 1_555 J DG 137 N1 ? ? I DC -64 J DG 64  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20  hydrog ? ? I DC 9   N4 ? ? ? 1_555 J DG 137 O6 ? ? I DC -64 J DG 64  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21  hydrog ? ? I DC 9   O2 ? ? ? 1_555 J DG 137 N2 ? ? I DC -64 J DG 64  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22  hydrog ? ? I DC 10  N3 ? ? ? 1_555 J DG 136 N1 ? ? I DC -63 J DG 63  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23  hydrog ? ? I DC 10  N4 ? ? ? 1_555 J DG 136 O6 ? ? I DC -63 J DG 63  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24  hydrog ? ? I DC 10  O2 ? ? ? 1_555 J DG 136 N2 ? ? I DC -63 J DG 63  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25  hydrog ? ? I DC 11  N3 ? ? ? 1_555 J DG 135 N1 ? ? I DC -62 J DG 62  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26  hydrog ? ? I DC 11  N4 ? ? ? 1_555 J DG 135 O6 ? ? I DC -62 J DG 62  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27  hydrog ? ? I DC 11  O2 ? ? ? 1_555 J DG 135 N2 ? ? I DC -62 J DG 62  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28  hydrog ? ? I DG 12  N1 ? ? ? 1_555 J DC 134 N3 ? ? I DG -61 J DC 61  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29  hydrog ? ? I DG 12  N2 ? ? ? 1_555 J DC 134 O2 ? ? I DG -61 J DC 61  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30  hydrog ? ? I DG 12  O6 ? ? ? 1_555 J DC 134 N4 ? ? I DG -61 J DC 61  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31  hydrog ? ? I DG 13  N1 ? ? ? 1_555 J DC 133 N3 ? ? I DG -60 J DC 60  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32  hydrog ? ? I DG 13  N2 ? ? ? 1_555 J DC 133 O2 ? ? I DG -60 J DC 60  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33  hydrog ? ? I DG 13  O6 ? ? ? 1_555 J DC 133 N4 ? ? I DG -60 J DC 60  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34  hydrog ? ? I DT 14  N3 ? ? ? 1_555 J DA 132 N1 ? ? I DT -59 J DA 59  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35  hydrog ? ? I DT 14  O4 ? ? ? 1_555 J DA 132 N6 ? ? I DT -59 J DA 59  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36  hydrog ? ? I DG 15  N1 ? ? ? 1_555 J DC 131 N3 ? ? I DG -58 J DC 58  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37  hydrog ? ? I DG 15  N2 ? ? ? 1_555 J DC 131 O2 ? ? I DG -58 J DC 58  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38  hydrog ? ? I DG 15  O6 ? ? ? 1_555 J DC 131 N4 ? ? I DG -58 J DC 58  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39  hydrog ? ? I DC 16  N3 ? ? ? 1_555 J DG 130 N1 ? ? I DC -57 J DG 57  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40  hydrog ? ? I DC 16  N4 ? ? ? 1_555 J DG 130 O6 ? ? I DC -57 J DG 57  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41  hydrog ? ? I DC 16  O2 ? ? ? 1_555 J DG 130 N2 ? ? I DC -57 J DG 57  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42  hydrog ? ? I DC 17  N3 ? ? ? 1_555 J DG 129 N1 ? ? I DC -56 J DG 56  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43  hydrog ? ? I DC 17  N4 ? ? ? 1_555 J DG 129 O6 ? ? I DC -56 J DG 56  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44  hydrog ? ? I DC 17  O2 ? ? ? 1_555 J DG 129 N2 ? ? I DC -56 J DG 56  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45  hydrog ? ? I DG 18  N1 ? ? ? 1_555 J DC 128 N3 ? ? I DG -55 J DC 55  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46  hydrog ? ? I DG 18  N2 ? ? ? 1_555 J DC 128 O2 ? ? I DG -55 J DC 55  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47  hydrog ? ? I DG 18  O6 ? ? ? 1_555 J DC 128 N4 ? ? I DG -55 J DC 55  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48  hydrog ? ? I DA 19  N1 ? ? ? 1_555 J DT 127 N3 ? ? I DA -54 J DT 54  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49  hydrog ? ? I DA 19  N6 ? ? ? 1_555 J DT 127 O4 ? ? I DA -54 J DT 54  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50  hydrog ? ? I DG 20  N1 ? ? ? 1_555 J DC 126 N3 ? ? I DG -53 J DC 53  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51  hydrog ? ? I DG 20  N2 ? ? ? 1_555 J DC 126 O2 ? ? I DG -53 J DC 53  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52  hydrog ? ? I DG 20  O6 ? ? ? 1_555 J DC 126 N4 ? ? I DG -53 J DC 53  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53  hydrog ? ? I DG 21  N1 ? ? ? 1_555 J DC 125 N3 ? ? I DG -52 J DC 52  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54  hydrog ? ? I DG 21  N2 ? ? ? 1_555 J DC 125 O2 ? ? I DG -52 J DC 52  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55  hydrog ? ? I DG 21  O6 ? ? ? 1_555 J DC 125 N4 ? ? I DG -52 J DC 52  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56  hydrog ? ? I DC 22  N3 ? ? ? 1_555 J DG 124 N1 ? ? I DC -51 J DG 51  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57  hydrog ? ? I DC 22  N4 ? ? ? 1_555 J DG 124 O6 ? ? I DC -51 J DG 51  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58  hydrog ? ? I DC 22  O2 ? ? ? 1_555 J DG 124 N2 ? ? I DC -51 J DG 51  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59  hydrog ? ? I DC 23  N3 ? ? ? 1_555 J DG 123 N1 ? ? I DC -50 J DG 50  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60  hydrog ? ? I DC 23  N4 ? ? ? 1_555 J DG 123 O6 ? ? I DC -50 J DG 50  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61  hydrog ? ? I DC 23  O2 ? ? ? 1_555 J DG 123 N2 ? ? I DC -50 J DG 50  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog62  hydrog ? ? I DG 24  N1 ? ? ? 1_555 J DC 122 N3 ? ? I DG -49 J DC 49  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63  hydrog ? ? I DG 24  N2 ? ? ? 1_555 J DC 122 O2 ? ? I DG -49 J DC 49  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64  hydrog ? ? I DG 24  O6 ? ? ? 1_555 J DC 122 N4 ? ? I DG -49 J DC 49  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65  hydrog ? ? I DC 25  N3 ? ? ? 1_555 J DG 121 N1 ? ? I DC -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66  hydrog ? ? I DC 25  N4 ? ? ? 1_555 J DG 121 O6 ? ? I DC -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog67  hydrog ? ? I DC 25  O2 ? ? ? 1_555 J DG 121 N2 ? ? I DC -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog68  hydrog ? ? I DT 26  N3 ? ? ? 1_555 J DA 120 N1 ? ? I DT -47 J DA 47  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog69  hydrog ? ? I DT 26  O4 ? ? ? 1_555 J DA 120 N6 ? ? I DT -47 J DA 47  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog70  hydrog ? ? I DC 27  N3 ? ? ? 1_555 J DG 119 N1 ? ? I DC -46 J DG 46  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog71  hydrog ? ? I DC 27  N4 ? ? ? 1_555 J DG 119 O6 ? ? I DC -46 J DG 46  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog72  hydrog ? ? I DC 27  O2 ? ? ? 1_555 J DG 119 N2 ? ? I DC -46 J DG 46  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog73  hydrog ? ? I DA 28  N1 ? ? ? 1_555 J DT 118 N3 ? ? I DA -45 J DT 45  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog74  hydrog ? ? I DA 28  N6 ? ? ? 1_555 J DT 118 O4 ? ? I DA -45 J DT 45  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog75  hydrog ? ? I DA 29  N1 ? ? ? 1_555 J DT 117 N3 ? ? I DA -44 J DT 44  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog76  hydrog ? ? I DA 29  N6 ? ? ? 1_555 J DT 117 O4 ? ? I DA -44 J DT 44  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog77  hydrog ? ? I DT 30  N3 ? ? ? 1_555 J DA 116 N1 ? ? I DT -43 J DA 43  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog78  hydrog ? ? I DT 30  O4 ? ? ? 1_555 J DA 116 N6 ? ? I DT -43 J DA 43  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog79  hydrog ? ? I DT 31  N3 ? ? ? 1_555 J DA 115 N1 ? ? I DT -42 J DA 42  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog80  hydrog ? ? I DT 31  O4 ? ? ? 1_555 J DA 115 N6 ? ? I DT -42 J DA 42  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog81  hydrog ? ? I DG 32  N1 ? ? ? 1_555 J DC 114 N3 ? ? I DG -41 J DC 41  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog82  hydrog ? ? I DG 32  N2 ? ? ? 1_555 J DC 114 O2 ? ? I DG -41 J DC 41  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog83  hydrog ? ? I DG 32  O6 ? ? ? 1_555 J DC 114 N4 ? ? I DG -41 J DC 41  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog84  hydrog ? ? I DG 33  N1 ? ? ? 1_555 J DA 112 N1 ? ? I DG -40 J DA 39  1_555 ? ? ? ? ? ? TYPE_8_PAIR  ? ? 
hydrog85  hydrog ? ? I DG 33  O6 ? ? ? 1_555 J DA 112 N6 ? ? I DG -40 J DA 39  1_555 ? ? ? ? ? ? TYPE_8_PAIR  ? ? 
hydrog86  hydrog ? ? I DG 33  N1 ? ? ? 1_555 J DC 113 N3 ? ? I DG -40 J DC 40  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog87  hydrog ? ? I DG 33  N2 ? ? ? 1_555 J DC 113 O2 ? ? I DG -40 J DC 40  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog88  hydrog ? ? I DG 33  O6 ? ? ? 1_555 J DC 113 N4 ? ? I DG -40 J DC 40  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog89  hydrog ? ? I DT 34  N3 ? ? ? 1_555 J DA 112 N1 ? ? I DT -39 J DA 39  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog90  hydrog ? ? I DT 34  O4 ? ? ? 1_555 J DA 112 N6 ? ? I DT -39 J DA 39  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog91  hydrog ? ? I DC 35  N3 ? ? ? 1_555 J DG 111 N1 ? ? I DC -38 J DG 38  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog92  hydrog ? ? I DC 35  N4 ? ? ? 1_555 J DG 111 O6 ? ? I DC -38 J DG 38  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog93  hydrog ? ? I DC 35  O2 ? ? ? 1_555 J DG 111 N2 ? ? I DC -38 J DG 38  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog94  hydrog ? ? I DG 36  N1 ? ? ? 1_555 J DC 110 N3 ? ? I DG -37 J DC 37  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog95  hydrog ? ? I DG 36  N2 ? ? ? 1_555 J DC 110 O2 ? ? I DG -37 J DC 37  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog96  hydrog ? ? I DG 36  O6 ? ? ? 1_555 J DC 110 N4 ? ? I DG -37 J DC 37  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog97  hydrog ? ? I DT 37  N3 ? ? ? 1_555 J DA 109 N1 ? ? I DT -36 J DA 36  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog98  hydrog ? ? I DT 37  O4 ? ? ? 1_555 J DA 109 N6 ? ? I DT -36 J DA 36  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog99  hydrog ? ? I DA 38  N1 ? ? ? 1_555 J DT 108 N3 ? ? I DA -35 J DT 35  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog100 hydrog ? ? I DA 38  N6 ? ? ? 1_555 J DT 108 O4 ? ? I DA -35 J DT 35  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog101 hydrog ? ? I DG 39  N1 ? ? ? 1_555 J DC 107 N3 ? ? I DG -34 J DC 34  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog102 hydrog ? ? I DG 39  N2 ? ? ? 1_555 J DC 107 O2 ? ? I DG -34 J DC 34  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog103 hydrog ? ? I DG 39  O6 ? ? ? 1_555 J DC 107 N4 ? ? I DG -34 J DC 34  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog104 hydrog ? ? I DA 40  N1 ? ? ? 1_555 J DT 106 N3 ? ? I DA -33 J DT 33  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog105 hydrog ? ? I DA 40  N6 ? ? ? 1_555 J DT 106 O4 ? ? I DA -33 J DT 33  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog106 hydrog ? ? I DC 41  N3 ? ? ? 1_555 J DG 105 N1 ? ? I DC -32 J DG 32  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog107 hydrog ? ? I DC 41  N4 ? ? ? 1_555 J DG 105 O6 ? ? I DC -32 J DG 32  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog108 hydrog ? ? I DC 41  O2 ? ? ? 1_555 J DG 105 N2 ? ? I DC -32 J DG 32  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog109 hydrog ? ? I DA 42  N1 ? ? ? 1_555 J DT 104 N3 ? ? I DA -31 J DT 31  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog110 hydrog ? ? I DA 42  N6 ? ? ? 1_555 J DT 104 O4 ? ? I DA -31 J DT 31  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog111 hydrog ? ? I DG 43  N1 ? ? ? 1_555 J DC 103 N3 ? ? I DG -30 J DC 30  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog112 hydrog ? ? I DG 43  N2 ? ? ? 1_555 J DC 103 O2 ? ? I DG -30 J DC 30  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog113 hydrog ? ? I DG 43  O6 ? ? ? 1_555 J DC 103 N4 ? ? I DG -30 J DC 30  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog114 hydrog ? ? I DC 44  N3 ? ? ? 1_555 J DG 102 N1 ? ? I DC -29 J DG 29  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog115 hydrog ? ? I DC 44  N4 ? ? ? 1_555 J DG 102 O6 ? ? I DC -29 J DG 29  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog116 hydrog ? ? I DC 44  O2 ? ? ? 1_555 J DG 102 N2 ? ? I DC -29 J DG 29  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog117 hydrog ? ? I DT 45  N3 ? ? ? 1_555 J DA 101 N1 ? ? I DT -28 J DA 28  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog118 hydrog ? ? I DT 45  O4 ? ? ? 1_555 J DA 101 N6 ? ? I DT -28 J DA 28  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog119 hydrog ? ? I DC 46  N3 ? ? ? 1_555 J DG 100 N1 ? ? I DC -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog120 hydrog ? ? I DC 46  N4 ? ? ? 1_555 J DG 100 O6 ? ? I DC -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog121 hydrog ? ? I DC 46  O2 ? ? ? 1_555 J DG 100 N2 ? ? I DC -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog122 hydrog ? ? I DT 47  N3 ? ? ? 1_555 J DA 99  N1 ? ? I DT -26 J DA 26  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog123 hydrog ? ? I DT 47  O4 ? ? ? 1_555 J DA 99  N6 ? ? I DT -26 J DA 26  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog124 hydrog ? ? I DA 48  N1 ? ? ? 1_555 J DT 98  N3 ? ? I DA -25 J DT 25  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog125 hydrog ? ? I DA 48  N6 ? ? ? 1_555 J DT 98  O4 ? ? I DA -25 J DT 25  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog126 hydrog ? ? I DG 49  N1 ? ? ? 1_555 J DC 97  N3 ? ? I DG -24 J DC 24  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog127 hydrog ? ? I DG 49  N2 ? ? ? 1_555 J DC 97  O2 ? ? I DG -24 J DC 24  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog128 hydrog ? ? I DG 49  O6 ? ? ? 1_555 J DC 97  N4 ? ? I DG -24 J DC 24  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog129 hydrog ? ? I DC 50  N3 ? ? ? 1_555 J DG 96  N1 ? ? I DC -23 J DG 23  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog130 hydrog ? ? I DC 50  N4 ? ? ? 1_555 J DG 96  O6 ? ? I DC -23 J DG 23  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog131 hydrog ? ? I DC 50  O2 ? ? ? 1_555 J DG 96  N2 ? ? I DC -23 J DG 23  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog132 hydrog ? ? I DA 51  N1 ? ? ? 1_555 J DT 95  N3 ? ? I DA -22 J DT 22  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog133 hydrog ? ? I DA 51  N6 ? ? ? 1_555 J DT 95  O4 ? ? I DA -22 J DT 22  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog134 hydrog ? ? I DC 52  N3 ? ? ? 1_555 J DG 94  N1 ? ? I DC -21 J DG 21  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog135 hydrog ? ? I DC 52  N4 ? ? ? 1_555 J DG 94  O6 ? ? I DC -21 J DG 21  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog136 hydrog ? ? I DC 52  O2 ? ? ? 1_555 J DG 94  N2 ? ? I DC -21 J DG 21  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog137 hydrog ? ? I DC 53  N3 ? ? ? 1_555 J DG 93  N1 ? ? I DC -20 J DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog138 hydrog ? ? I DC 53  N4 ? ? ? 1_555 J DG 93  O6 ? ? I DC -20 J DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog139 hydrog ? ? I DC 53  O2 ? ? ? 1_555 J DG 93  N2 ? ? I DC -20 J DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog140 hydrog ? ? I DG 54  N1 ? ? ? 1_555 J DC 92  N3 ? ? I DG -19 J DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog141 hydrog ? ? I DG 54  N2 ? ? ? 1_555 J DC 92  O2 ? ? I DG -19 J DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog142 hydrog ? ? I DG 54  O6 ? ? ? 1_555 J DC 92  N4 ? ? I DG -19 J DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog143 hydrog ? ? I DC 55  N3 ? ? ? 1_555 J DG 91  N1 ? ? I DC -18 J DG 18  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog144 hydrog ? ? I DC 55  N4 ? ? ? 1_555 J DG 91  O6 ? ? I DC -18 J DG 18  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog145 hydrog ? ? I DC 55  O2 ? ? ? 1_555 J DG 91  N2 ? ? I DC -18 J DG 18  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog146 hydrog ? ? I DT 56  N3 ? ? ? 1_555 J DA 90  N1 ? ? I DT -17 J DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog147 hydrog ? ? I DT 56  O4 ? ? ? 1_555 J DA 90  N6 ? ? I DT -17 J DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog148 hydrog ? ? I DT 57  N3 ? ? ? 1_555 J DA 89  N1 ? ? I DT -16 J DA 16  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog149 hydrog ? ? I DT 57  O4 ? ? ? 1_555 J DA 89  N6 ? ? I DT -16 J DA 16  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog150 hydrog ? ? I DA 58  N1 ? ? ? 1_555 J DT 88  N3 ? ? I DA -15 J DT 15  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog151 hydrog ? ? I DA 58  N6 ? ? ? 1_555 J DT 88  O4 ? ? I DA -15 J DT 15  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog152 hydrog ? ? I DA 59  N1 ? ? ? 1_555 J DT 87  N3 ? ? I DA -14 J DT 14  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog153 hydrog ? ? I DA 59  N6 ? ? ? 1_555 J DT 87  O4 ? ? I DA -14 J DT 14  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog154 hydrog ? ? I DA 60  N1 ? ? ? 1_555 J DT 86  N3 ? ? I DA -13 J DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog155 hydrog ? ? I DA 60  N6 ? ? ? 1_555 J DT 86  O4 ? ? I DA -13 J DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog156 hydrog ? ? I DC 61  N3 ? ? ? 1_555 J DG 85  N1 ? ? I DC -12 J DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog157 hydrog ? ? I DC 61  N4 ? ? ? 1_555 J DG 85  O6 ? ? I DC -12 J DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog158 hydrog ? ? I DC 61  O2 ? ? ? 1_555 J DG 85  N2 ? ? I DC -12 J DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog159 hydrog ? ? I DG 62  N1 ? ? ? 1_555 J DC 84  N3 ? ? I DG -11 J DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog160 hydrog ? ? I DG 62  N2 ? ? ? 1_555 J DC 84  O2 ? ? I DG -11 J DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog161 hydrog ? ? I DG 62  O6 ? ? ? 1_555 J DC 84  N4 ? ? I DG -11 J DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog162 hydrog ? ? I DC 63  N3 ? ? ? 1_555 J DG 83  N1 ? ? I DC -10 J DG 10  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog163 hydrog ? ? I DC 63  N4 ? ? ? 1_555 J DG 83  O6 ? ? I DC -10 J DG 10  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog164 hydrog ? ? I DC 63  O2 ? ? ? 1_555 J DG 83  N2 ? ? I DC -10 J DG 10  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog165 hydrog ? ? I DA 64  N1 ? ? ? 1_555 J DG 81  N1 ? ? I DA -9  J DG 8   1_555 ? ? ? ? ? ? TYPE_8_PAIR  ? ? 
hydrog166 hydrog ? ? I DA 64  N6 ? ? ? 1_555 J DG 81  O6 ? ? I DA -9  J DG 8   1_555 ? ? ? ? ? ? TYPE_8_PAIR  ? ? 
hydrog167 hydrog ? ? I DA 64  N1 ? ? ? 1_555 J DT 82  N3 ? ? I DA -9  J DT 9   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog168 hydrog ? ? I DA 64  N6 ? ? ? 1_555 J DT 82  O4 ? ? I DA -9  J DT 9   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog169 hydrog ? ? I DC 65  N3 ? ? ? 1_555 J DG 81  N1 ? ? I DC -8  J DG 8   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog170 hydrog ? ? I DC 65  N4 ? ? ? 1_555 J DG 81  O6 ? ? I DC -8  J DG 8   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog171 hydrog ? ? I DC 65  O2 ? ? ? 1_555 J DG 81  N2 ? ? I DC -8  J DG 8   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog172 hydrog ? ? I DG 66  N1 ? ? ? 1_555 J DC 80  N3 ? ? I DG -7  J DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog173 hydrog ? ? I DG 66  N2 ? ? ? 1_555 J DC 80  O2 ? ? I DG -7  J DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog174 hydrog ? ? I DG 66  O6 ? ? ? 1_555 J DC 80  N4 ? ? I DG -7  J DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog175 hydrog ? ? I DT 67  N3 ? ? ? 1_555 J DA 79  N1 ? ? I DT -6  J DA 6   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog176 hydrog ? ? I DT 67  O4 ? ? ? 1_555 J DA 79  N6 ? ? I DT -6  J DA 6   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog177 hydrog ? ? I DA 68  N1 ? ? ? 1_555 J DT 78  N3 ? ? I DA -5  J DT 5   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog178 hydrog ? ? I DA 68  N6 ? ? ? 1_555 J DT 78  O4 ? ? I DA -5  J DT 5   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog179 hydrog ? ? I DC 69  N3 ? ? ? 1_555 J DG 77  N1 ? ? I DC -4  J DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog180 hydrog ? ? I DC 69  N4 ? ? ? 1_555 J DG 77  O6 ? ? I DC -4  J DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog181 hydrog ? ? I DC 69  O2 ? ? ? 1_555 J DG 77  N2 ? ? I DC -4  J DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog182 hydrog ? ? I DG 70  N1 ? ? ? 1_555 J DC 76  N3 ? ? I DG -3  J DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog183 hydrog ? ? I DG 70  N2 ? ? ? 1_555 J DC 76  O2 ? ? I DG -3  J DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog184 hydrog ? ? I DG 70  O6 ? ? ? 1_555 J DC 76  N4 ? ? I DG -3  J DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog185 hydrog ? ? I DC 71  N3 ? ? ? 1_555 J DG 75  N1 ? ? I DC -2  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog186 hydrog ? ? I DC 71  N4 ? ? ? 1_555 J DG 75  O6 ? ? I DC -2  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog187 hydrog ? ? I DC 71  O2 ? ? ? 1_555 J DG 75  N2 ? ? I DC -2  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog188 hydrog ? ? I DG 72  N1 ? ? ? 1_555 J DC 74  N3 ? ? I DG -1  J DC 1   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog189 hydrog ? ? I DG 72  N2 ? ? ? 1_555 J DC 74  O2 ? ? I DG -1  J DC 1   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog190 hydrog ? ? I DG 72  O6 ? ? ? 1_555 J DC 74  N4 ? ? I DG -1  J DC 1   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog191 hydrog ? ? I DC 73  N3 ? ? ? 1_555 J DG 73  N1 ? ? I DC 0   J DG 0   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog192 hydrog ? ? I DC 73  N4 ? ? ? 1_555 J DG 73  O6 ? ? I DC 0   J DG 0   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog193 hydrog ? ? I DC 73  O2 ? ? ? 1_555 J DG 73  N2 ? ? I DC 0   J DG 0   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog194 hydrog ? ? I DT 74  N3 ? ? ? 1_555 J DA 72  N1 ? ? I DT 1   J DA -1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog195 hydrog ? ? I DT 74  O4 ? ? ? 1_555 J DA 72  N6 ? ? I DT 1   J DA -1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog196 hydrog ? ? I DG 75  N1 ? ? ? 1_555 J DA 70  N1 ? ? I DG 2   J DA -3  1_555 ? ? ? ? ? ? TYPE_8_PAIR  ? ? 
hydrog197 hydrog ? ? I DG 75  O6 ? ? ? 1_555 J DA 70  N6 ? ? I DG 2   J DA -3  1_555 ? ? ? ? ? ? TYPE_8_PAIR  ? ? 
hydrog198 hydrog ? ? I DG 75  N1 ? ? ? 1_555 J DC 71  N3 ? ? I DG 2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog199 hydrog ? ? I DG 75  N2 ? ? ? 1_555 J DC 71  O2 ? ? I DG 2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog200 hydrog ? ? I DG 75  O6 ? ? ? 1_555 J DC 71  N4 ? ? I DG 2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog201 hydrog ? ? I DT 76  N3 ? ? ? 1_555 J DA 70  N1 ? ? I DT 3   J DA -3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog202 hydrog ? ? I DT 76  O4 ? ? ? 1_555 J DA 70  N6 ? ? I DT 3   J DA -3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog203 hydrog ? ? I DC 77  N3 ? ? ? 1_555 J DG 69  N1 ? ? I DC 4   J DG -4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog204 hydrog ? ? I DC 77  N4 ? ? ? 1_555 J DG 69  O6 ? ? I DC 4   J DG -4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog205 hydrog ? ? I DC 77  O2 ? ? ? 1_555 J DG 69  N2 ? ? I DC 4   J DG -4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog206 hydrog ? ? I DC 78  N3 ? ? ? 1_555 J DG 68  N1 ? ? I DC 5   J DG -5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog207 hydrog ? ? I DC 78  N4 ? ? ? 1_555 J DG 68  O6 ? ? I DC 5   J DG -5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog208 hydrog ? ? I DC 78  O2 ? ? ? 1_555 J DG 68  N2 ? ? I DC 5   J DG -5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog209 hydrog ? ? I DC 79  N3 ? ? ? 1_555 J DG 67  N1 ? ? I DC 6   J DG -6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog210 hydrog ? ? I DC 79  N4 ? ? ? 1_555 J DG 67  O6 ? ? I DC 6   J DG -6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog211 hydrog ? ? I DC 79  O2 ? ? ? 1_555 J DG 67  N2 ? ? I DC 6   J DG -6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog212 hydrog ? ? I DC 80  N3 ? ? ? 1_555 J DG 66  N1 ? ? I DC 7   J DG -7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog213 hydrog ? ? I DC 80  N4 ? ? ? 1_555 J DG 66  O6 ? ? I DC 7   J DG -7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog214 hydrog ? ? I DC 80  O2 ? ? ? 1_555 J DG 66  N2 ? ? I DC 7   J DG -7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog215 hydrog ? ? I DC 81  N3 ? ? ? 1_555 J DG 65  N1 ? ? I DC 8   J DG -8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog216 hydrog ? ? I DC 81  N4 ? ? ? 1_555 J DG 65  O6 ? ? I DC 8   J DG -8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog217 hydrog ? ? I DC 81  O2 ? ? ? 1_555 J DG 65  N2 ? ? I DC 8   J DG -8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog218 hydrog ? ? I DG 82  N1 ? ? ? 1_555 J DC 64  N3 ? ? I DG 9   J DC -9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog219 hydrog ? ? I DG 82  N2 ? ? ? 1_555 J DC 64  O2 ? ? I DG 9   J DC -9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog220 hydrog ? ? I DG 82  O6 ? ? ? 1_555 J DC 64  N4 ? ? I DG 9   J DC -9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog221 hydrog ? ? I DC 83  N3 ? ? ? 1_555 J DG 63  N1 ? ? I DC 10  J DG -10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog222 hydrog ? ? I DC 83  N4 ? ? ? 1_555 J DG 63  O6 ? ? I DC 10  J DG -10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog223 hydrog ? ? I DC 83  O2 ? ? ? 1_555 J DG 63  N2 ? ? I DC 10  J DG -10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog224 hydrog ? ? I DG 84  N1 ? ? ? 1_555 J DC 62  N3 ? ? I DG 11  J DC -11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog225 hydrog ? ? I DG 84  N2 ? ? ? 1_555 J DC 62  O2 ? ? I DG 11  J DC -11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog226 hydrog ? ? I DG 84  O6 ? ? ? 1_555 J DC 62  N4 ? ? I DG 11  J DC -11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog227 hydrog ? ? I DT 85  N3 ? ? ? 1_555 J DA 61  N1 ? ? I DT 12  J DA -12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog228 hydrog ? ? I DT 85  O4 ? ? ? 1_555 J DA 61  N6 ? ? I DT 12  J DA -12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog229 hydrog ? ? I DT 86  N3 ? ? ? 1_555 J DA 60  N1 ? ? I DT 13  J DA -13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog230 hydrog ? ? I DT 86  O4 ? ? ? 1_555 J DA 60  N6 ? ? I DT 13  J DA -13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog231 hydrog ? ? I DT 87  N3 ? ? ? 1_555 J DA 59  N1 ? ? I DT 14  J DA -14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog232 hydrog ? ? I DT 87  O4 ? ? ? 1_555 J DA 59  N6 ? ? I DT 14  J DA -14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog233 hydrog ? ? I DT 88  N3 ? ? ? 1_555 J DA 58  N1 ? ? I DT 15  J DA -15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog234 hydrog ? ? I DT 88  O4 ? ? ? 1_555 J DA 58  N6 ? ? I DT 15  J DA -15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog235 hydrog ? ? I DA 89  N1 ? ? ? 1_555 J DT 57  N3 ? ? I DA 16  J DT -16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog236 hydrog ? ? I DA 89  N6 ? ? ? 1_555 J DT 57  O4 ? ? I DA 16  J DT -16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog237 hydrog ? ? I DA 90  N1 ? ? ? 1_555 J DT 56  N3 ? ? I DA 17  J DT -17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog238 hydrog ? ? I DA 90  N6 ? ? ? 1_555 J DT 56  O4 ? ? I DA 17  J DT -17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog239 hydrog ? ? I DC 91  N3 ? ? ? 1_555 J DG 55  N1 ? ? I DC 18  J DG -18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog240 hydrog ? ? I DC 91  N4 ? ? ? 1_555 J DG 55  O6 ? ? I DC 18  J DG -18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog241 hydrog ? ? I DC 91  O2 ? ? ? 1_555 J DG 55  N2 ? ? I DC 18  J DG -18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog242 hydrog ? ? I DC 92  N3 ? ? ? 1_555 J DG 54  N1 ? ? I DC 19  J DG -19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog243 hydrog ? ? I DC 92  N4 ? ? ? 1_555 J DG 54  O6 ? ? I DC 19  J DG -19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog244 hydrog ? ? I DC 92  O2 ? ? ? 1_555 J DG 54  N2 ? ? I DC 19  J DG -19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog245 hydrog ? ? I DG 93  N1 ? ? ? 1_555 J DC 53  N3 ? ? I DG 20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog246 hydrog ? ? I DG 93  N2 ? ? ? 1_555 J DC 53  O2 ? ? I DG 20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog247 hydrog ? ? I DG 93  O6 ? ? ? 1_555 J DC 53  N4 ? ? I DG 20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog248 hydrog ? ? I DC 94  N3 ? ? ? 1_555 J DG 52  N1 ? ? I DC 21  J DG -21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog249 hydrog ? ? I DC 94  N4 ? ? ? 1_555 J DG 52  O6 ? ? I DC 21  J DG -21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog250 hydrog ? ? I DC 94  O2 ? ? ? 1_555 J DG 52  N2 ? ? I DC 21  J DG -21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog251 hydrog ? ? I DC 95  N3 ? ? ? 1_555 J DG 51  N1 ? ? I DC 22  J DG -22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog252 hydrog ? ? I DC 95  N4 ? ? ? 1_555 J DG 51  O6 ? ? I DC 22  J DG -22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog253 hydrog ? ? I DC 95  O2 ? ? ? 1_555 J DG 51  N2 ? ? I DC 22  J DG -22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog254 hydrog ? ? I DA 96  N1 ? ? ? 1_555 J DT 50  N3 ? ? I DA 23  J DT -23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog255 hydrog ? ? I DA 96  N6 ? ? ? 1_555 J DT 50  O4 ? ? I DA 23  J DT -23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog256 hydrog ? ? I DA 97  N1 ? ? ? 1_555 J DT 49  N3 ? ? I DA 24  J DT -24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog257 hydrog ? ? I DA 97  N6 ? ? ? 1_555 J DT 49  O4 ? ? I DA 24  J DT -24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog258 hydrog ? ? I DG 98  N1 ? ? ? 1_555 J DC 48  N3 ? ? I DG 25  J DC -25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog259 hydrog ? ? I DG 98  N2 ? ? ? 1_555 J DC 48  O2 ? ? I DG 25  J DC -25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog260 hydrog ? ? I DG 98  O6 ? ? ? 1_555 J DC 48  N4 ? ? I DG 25  J DC -25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog261 hydrog ? ? I DG 99  N1 ? ? ? 1_555 J DC 47  N3 ? ? I DG 26  J DC -26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog262 hydrog ? ? I DG 99  N2 ? ? ? 1_555 J DC 47  O2 ? ? I DG 26  J DC -26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog263 hydrog ? ? I DG 99  O6 ? ? ? 1_555 J DC 47  N4 ? ? I DG 26  J DC -26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog264 hydrog ? ? I DG 100 N1 ? ? ? 1_555 J DC 46  N3 ? ? I DG 27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog265 hydrog ? ? I DG 100 N2 ? ? ? 1_555 J DC 46  O2 ? ? I DG 27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog266 hydrog ? ? I DG 100 O6 ? ? ? 1_555 J DC 46  N4 ? ? I DG 27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog267 hydrog ? ? I DG 101 N1 ? ? ? 1_555 J DC 45  N3 ? ? I DG 28  J DC -28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog268 hydrog ? ? I DG 101 N2 ? ? ? 1_555 J DC 45  O2 ? ? I DG 28  J DC -28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog269 hydrog ? ? I DG 101 O6 ? ? ? 1_555 J DC 45  N4 ? ? I DG 28  J DC -28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog270 hydrog ? ? I DA 102 N1 ? ? ? 1_555 J DT 44  N3 ? ? I DA 29  J DT -29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog271 hydrog ? ? I DA 102 N6 ? ? ? 1_555 J DT 44  O4 ? ? I DA 29  J DT -29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog272 hydrog ? ? I DT 103 N3 ? ? ? 1_555 J DA 43  N1 ? ? I DT 30  J DA -30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog273 hydrog ? ? I DT 103 O4 ? ? ? 1_555 J DA 43  N6 ? ? I DT 30  J DA -30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog274 hydrog ? ? I DT 104 N3 ? ? ? 1_555 J DA 42  N1 ? ? I DT 31  J DA -31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog275 hydrog ? ? I DT 104 O4 ? ? ? 1_555 J DA 42  N6 ? ? I DT 31  J DA -31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog276 hydrog ? ? I DA 105 N1 ? ? ? 1_555 J DT 41  N3 ? ? I DA 32  J DT -32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog277 hydrog ? ? I DA 105 N6 ? ? ? 1_555 J DT 41  O4 ? ? I DA 32  J DT -32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog278 hydrog ? ? I DC 106 N3 ? ? ? 1_555 J DG 40  N1 ? ? I DC 33  J DG -33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog279 hydrog ? ? I DC 106 N4 ? ? ? 1_555 J DG 40  O6 ? ? I DC 33  J DG -33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog280 hydrog ? ? I DC 106 O2 ? ? ? 1_555 J DG 40  N2 ? ? I DC 33  J DG -33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog281 hydrog ? ? I DT 107 N3 ? ? ? 1_555 J DA 39  N1 ? ? I DT 34  J DA -34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog282 hydrog ? ? I DT 107 O4 ? ? ? 1_555 J DA 39  N6 ? ? I DT 34  J DA -34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog283 hydrog ? ? I DC 108 N3 ? ? ? 1_555 J DG 38  N1 ? ? I DC 35  J DG -35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog284 hydrog ? ? I DC 108 N4 ? ? ? 1_555 J DG 38  O6 ? ? I DC 35  J DG -35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog285 hydrog ? ? I DC 108 O2 ? ? ? 1_555 J DG 38  N2 ? ? I DC 35  J DG -35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog286 hydrog ? ? I DC 109 N3 ? ? ? 1_555 J DG 37  N1 ? ? I DC 36  J DG -36 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog287 hydrog ? ? I DC 109 N4 ? ? ? 1_555 J DG 37  O6 ? ? I DC 36  J DG -36 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog288 hydrog ? ? I DC 109 O2 ? ? ? 1_555 J DG 37  N2 ? ? I DC 36  J DG -36 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog289 hydrog ? ? I DC 110 N3 ? ? ? 1_555 J DG 36  N1 ? ? I DC 37  J DG -37 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog290 hydrog ? ? I DC 110 N4 ? ? ? 1_555 J DG 36  O6 ? ? I DC 37  J DG -37 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog291 hydrog ? ? I DC 110 O2 ? ? ? 1_555 J DG 36  N2 ? ? I DC 37  J DG -37 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog292 hydrog ? ? I DT 111 N3 ? ? ? 1_555 J DA 35  N1 ? ? I DT 38  J DA -38 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog293 hydrog ? ? I DT 111 O4 ? ? ? 1_555 J DA 35  N6 ? ? I DT 38  J DA -38 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog294 hydrog ? ? I DA 112 N1 ? ? ? 1_555 J DT 34  N3 ? ? I DA 39  J DT -39 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog295 hydrog ? ? I DA 112 N6 ? ? ? 1_555 J DT 34  O4 ? ? I DA 39  J DT -39 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog296 hydrog ? ? I DG 113 N1 ? ? ? 1_555 J DC 33  N3 ? ? I DG 40  J DC -40 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog297 hydrog ? ? I DG 113 N2 ? ? ? 1_555 J DC 33  O2 ? ? I DG 40  J DC -40 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog298 hydrog ? ? I DG 113 O6 ? ? ? 1_555 J DC 33  N4 ? ? I DG 40  J DC -40 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog299 hydrog ? ? I DT 114 N3 ? ? ? 1_555 J DA 32  N1 ? ? I DT 41  J DA -41 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog300 hydrog ? ? I DT 114 O4 ? ? ? 1_555 J DA 32  N6 ? ? I DT 41  J DA -41 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog301 hydrog ? ? I DC 115 N3 ? ? ? 1_555 J DG 31  N1 ? ? I DC 42  J DG -42 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog302 hydrog ? ? I DC 115 N4 ? ? ? 1_555 J DG 31  O6 ? ? I DC 42  J DG -42 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog303 hydrog ? ? I DC 115 O2 ? ? ? 1_555 J DG 31  N2 ? ? I DC 42  J DG -42 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog304 hydrog ? ? I DT 116 N3 ? ? ? 1_555 J DA 30  N1 ? ? I DT 43  J DA -43 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog305 hydrog ? ? I DT 116 O4 ? ? ? 1_555 J DA 30  N6 ? ? I DT 43  J DA -43 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog306 hydrog ? ? I DC 117 N3 ? ? ? 1_555 J DG 29  N1 ? ? I DC 44  J DG -44 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog307 hydrog ? ? I DC 117 N4 ? ? ? 1_555 J DG 29  O6 ? ? I DC 44  J DG -44 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog308 hydrog ? ? I DC 117 O2 ? ? ? 1_555 J DG 29  N2 ? ? I DC 44  J DG -44 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog309 hydrog ? ? I DC 118 N3 ? ? ? 1_555 J DG 28  N1 ? ? I DC 45  J DG -45 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog310 hydrog ? ? I DC 118 N4 ? ? ? 1_555 J DG 28  O6 ? ? I DC 45  J DG -45 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog311 hydrog ? ? I DC 118 O2 ? ? ? 1_555 J DG 28  N2 ? ? I DC 45  J DG -45 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog312 hydrog ? ? I DA 119 N1 ? ? ? 1_555 J DT 27  N3 ? ? I DA 46  J DT -46 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog313 hydrog ? ? I DA 119 N6 ? ? ? 1_555 J DT 27  O4 ? ? I DA 46  J DT -46 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog314 hydrog ? ? I DG 120 N1 ? ? ? 1_555 J DC 26  N3 ? ? I DG 47  J DC -47 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog315 hydrog ? ? I DG 120 N2 ? ? ? 1_555 J DC 26  O2 ? ? I DG 47  J DC -47 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog316 hydrog ? ? I DG 120 O6 ? ? ? 1_555 J DC 26  N4 ? ? I DG 47  J DC -47 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog317 hydrog ? ? I DG 121 N1 ? ? ? 1_555 J DC 25  N3 ? ? I DG 48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog318 hydrog ? ? I DG 121 N2 ? ? ? 1_555 J DC 25  O2 ? ? I DG 48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog319 hydrog ? ? I DG 121 O6 ? ? ? 1_555 J DC 25  N4 ? ? I DG 48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog320 hydrog ? ? I DC 122 N3 ? ? ? 1_555 J DG 24  N1 ? ? I DC 49  J DG -49 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog321 hydrog ? ? I DC 122 N4 ? ? ? 1_555 J DG 24  O6 ? ? I DC 49  J DG -49 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog322 hydrog ? ? I DC 122 O2 ? ? ? 1_555 J DG 24  N2 ? ? I DC 49  J DG -49 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog323 hydrog ? ? I DA 123 N1 ? ? ? 1_555 J DG 22  N1 ? ? I DA 50  J DG -51 1_555 ? ? ? ? ? ? TYPE_8_PAIR  ? ? 
hydrog324 hydrog ? ? I DA 123 N6 ? ? ? 1_555 J DG 22  O6 ? ? I DA 50  J DG -51 1_555 ? ? ? ? ? ? TYPE_8_PAIR  ? ? 
hydrog325 hydrog ? ? I DA 123 N1 ? ? ? 1_555 J DT 23  N3 ? ? I DA 50  J DT -50 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog326 hydrog ? ? I DA 123 N6 ? ? ? 1_555 J DT 23  O4 ? ? I DA 50  J DT -50 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog327 hydrog ? ? I DC 124 N3 ? ? ? 1_555 J DG 22  N1 ? ? I DC 51  J DG -51 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog328 hydrog ? ? I DC 124 N4 ? ? ? 1_555 J DG 22  O6 ? ? I DC 51  J DG -51 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog329 hydrog ? ? I DC 124 O2 ? ? ? 1_555 J DG 22  N2 ? ? I DC 51  J DG -51 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog330 hydrog ? ? I DG 125 N1 ? ? ? 1_555 J DC 21  N3 ? ? I DG 52  J DC -52 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog331 hydrog ? ? I DG 125 N2 ? ? ? 1_555 J DC 21  O2 ? ? I DG 52  J DC -52 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog332 hydrog ? ? I DG 125 O6 ? ? ? 1_555 J DC 21  N4 ? ? I DG 52  J DC -52 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog333 hydrog ? ? I DT 126 N3 ? ? ? 1_555 J DA 20  N1 ? ? I DT 53  J DA -53 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog334 hydrog ? ? I DT 126 O4 ? ? ? 1_555 J DA 20  N6 ? ? I DT 53  J DA -53 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog335 hydrog ? ? I DG 127 N1 ? ? ? 1_555 J DC 19  N3 ? ? I DG 54  J DC -54 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog336 hydrog ? ? I DG 127 N2 ? ? ? 1_555 J DC 19  O2 ? ? I DG 54  J DC -54 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog337 hydrog ? ? I DG 127 O6 ? ? ? 1_555 J DC 19  N4 ? ? I DG 54  J DC -54 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog338 hydrog ? ? I DT 128 N3 ? ? ? 1_555 J DA 18  N1 ? ? I DT 55  J DA -55 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog339 hydrog ? ? I DT 128 O4 ? ? ? 1_555 J DA 18  N6 ? ? I DT 55  J DA -55 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog340 hydrog ? ? I DC 129 N3 ? ? ? 1_555 J DG 17  N1 ? ? I DC 56  J DG -56 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog341 hydrog ? ? I DC 129 N4 ? ? ? 1_555 J DG 17  O6 ? ? I DC 56  J DG -56 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog342 hydrog ? ? I DC 129 O2 ? ? ? 1_555 J DG 17  N2 ? ? I DC 56  J DG -56 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog343 hydrog ? ? I DA 130 N1 ? ? ? 1_555 J DT 16  N3 ? ? I DA 57  J DT -57 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog344 hydrog ? ? I DA 130 N6 ? ? ? 1_555 J DT 16  O4 ? ? I DA 57  J DT -57 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog345 hydrog ? ? I DG 131 N1 ? ? ? 1_555 J DC 15  N3 ? ? I DG 58  J DC -58 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog346 hydrog ? ? I DG 131 N2 ? ? ? 1_555 J DC 15  O2 ? ? I DG 58  J DC -58 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog347 hydrog ? ? I DG 131 O6 ? ? ? 1_555 J DC 15  N4 ? ? I DG 58  J DC -58 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog348 hydrog ? ? I DA 132 N1 ? ? ? 1_555 J DT 14  N3 ? ? I DA 59  J DT -59 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog349 hydrog ? ? I DA 132 N6 ? ? ? 1_555 J DT 14  O4 ? ? I DA 59  J DT -59 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog350 hydrog ? ? I DT 133 N3 ? ? ? 1_555 J DA 13  N1 ? ? I DT 60  J DA -60 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog351 hydrog ? ? I DT 133 O4 ? ? ? 1_555 J DA 13  N6 ? ? I DT 60  J DA -60 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog352 hydrog ? ? I DA 134 N1 ? ? ? 1_555 J DT 12  N3 ? ? I DA 61  J DT -61 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog353 hydrog ? ? I DA 134 N6 ? ? ? 1_555 J DT 12  O4 ? ? I DA 61  J DT -61 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog354 hydrog ? ? I DT 135 N3 ? ? ? 1_555 J DA 11  N1 ? ? I DT 62  J DA -62 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog355 hydrog ? ? I DT 135 O4 ? ? ? 1_555 J DA 11  N6 ? ? I DT 62  J DA -62 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog356 hydrog ? ? I DA 136 N1 ? ? ? 1_555 J DT 10  N3 ? ? I DA 63  J DT -63 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog357 hydrog ? ? I DA 136 N6 ? ? ? 1_555 J DT 10  O4 ? ? I DA 63  J DT -63 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog358 hydrog ? ? I DT 137 N3 ? ? ? 1_555 J DA 9   N1 ? ? I DT 64  J DA -64 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog359 hydrog ? ? I DT 137 O4 ? ? ? 1_555 J DA 9   N6 ? ? I DT 64  J DA -64 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog360 hydrog ? ? I DA 138 N1 ? ? ? 1_555 J DT 8   N3 ? ? I DA 65  J DT -65 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog361 hydrog ? ? I DA 138 N6 ? ? ? 1_555 J DT 8   O4 ? ? I DA 65  J DT -65 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog362 hydrog ? ? I DC 139 N3 ? ? ? 1_555 J DG 7   N1 ? ? I DC 66  J DG -66 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog363 hydrog ? ? I DC 139 N4 ? ? ? 1_555 J DG 7   O6 ? ? I DC 66  J DG -66 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog364 hydrog ? ? I DC 139 O2 ? ? ? 1_555 J DG 7   N2 ? ? I DC 66  J DG -66 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog365 hydrog ? ? I DA 140 N1 ? ? ? 1_555 J DT 6   N3 ? ? I DA 67  J DT -67 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog366 hydrog ? ? I DA 140 N6 ? ? ? 1_555 J DT 6   O4 ? ? I DA 67  J DT -67 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog367 hydrog ? ? I DT 141 N3 ? ? ? 1_555 J DA 5   N1 ? ? I DT 68  J DA -68 1_555 ? ? ? ? ? ? 'DT-DA PAIR' ? ? 
hydrog368 hydrog ? ? I DC 142 N3 ? ? ? 1_555 J DG 4   N1 ? ? I DC 69  J DG -69 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog369 hydrog ? ? I DC 142 N4 ? ? ? 1_555 J DG 4   O6 ? ? I DC 69  J DG -69 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog370 hydrog ? ? I DC 142 O2 ? ? ? 1_555 J DG 4   N2 ? ? I DC 69  J DG -69 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog371 hydrog ? ? I DG 143 N1 ? ? ? 1_555 J DC 3   N3 ? ? I DG 70  J DC -70 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog372 hydrog ? ? I DG 143 N2 ? ? ? 1_555 J DC 3   O2 ? ? I DG 70  J DC -70 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog373 hydrog ? ? I DG 143 O6 ? ? ? 1_555 J DC 3   N4 ? ? I DG 70  J DC -70 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog374 hydrog ? ? I DT 145 N3 ? ? ? 1_555 J DA 1   N1 ? ? I DT 72  J DA -72 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog375 hydrog ? ? I DT 145 O4 ? ? ? 1_555 J DA 1   N6 ? ? I DT 72  J DA -72 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA2 1 2 ? parallel 
AA3 1 2 ? parallel 
AA4 1 2 ? parallel 
AA5 1 2 ? parallel 
AA6 1 2 ? parallel 
AA7 1 2 ? parallel 
AA8 1 2 ? parallel 
AA9 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ASN A 85  ? TRP A 86  ? ASN A 85  TRP A 86  
AA1 2 THR B 81  ? VAL B 82  ? THR B 80  VAL B 81  
AA2 1 THR A 120 ? LEU A 121 ? THR A 120 LEU A 121 
AA2 2 ARG B 46  ? ILE B 47  ? ARG B 45  ILE B 46  
AA3 1 ARG C 43  ? VAL C 44  ? ARG C 42  VAL C 43  
AA3 2 THR D 89  ? ILE D 90  ? THR D 88  ILE D 89  
AA4 1 ARG C 78  ? ILE C 79  ? ARG C 77  ILE C 78  
AA4 2 GLY D 54  ? ILE D 55  ? GLY D 53  ILE D 54  
AA5 1 VAL C 101 ? ILE C 103 ? VAL C 100 ILE C 102 
AA5 2 THR F 97  ? TYR F 99  ? THR F 96  TYR F 98  
AA6 1 ASN E 85  ? TRP E 86  ? ASN E 85  TRP E 86  
AA6 2 THR F 81  ? VAL F 82  ? THR F 80  VAL F 81  
AA7 1 THR E 120 ? LEU E 121 ? THR E 120 LEU E 121 
AA7 2 ARG F 46  ? ILE F 47  ? ARG F 45  ILE F 46  
AA8 1 ARG G 43  ? VAL G 44  ? ARG G 42  VAL G 43  
AA8 2 THR H 89  ? ILE H 90  ? THR H 88  ILE H 89  
AA9 1 ARG G 78  ? ILE G 79  ? ARG G 77  ILE G 78  
AA9 2 GLY H 54  ? ILE H 55  ? GLY H 53  ILE H 54  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ASN A 85  ? N ASN A 85  O VAL B 82 ? O VAL B 81 
AA2 1 2 N LEU A 121 ? N LEU A 121 O ARG B 46 ? O ARG B 45 
AA3 1 2 N ARG C 43  ? N ARG C 42  O ILE D 90 ? O ILE D 89 
AA4 1 2 N ILE C 79  ? N ILE C 78  O GLY D 54 ? O GLY D 53 
AA5 1 2 N THR C 102 ? N THR C 101 O TYR F 99 ? O TYR F 98 
AA6 1 2 N ASN E 85  ? N ASN E 85  O VAL F 82 ? O VAL F 81 
AA7 1 2 N LEU E 121 ? N LEU E 121 O ARG F 46 ? O ARG F 45 
AA8 1 2 N ARG G 43  ? N ARG G 42  O ILE H 90 ? O ILE H 89 
AA9 1 2 N ILE G 79  ? N ILE G 78  O GLY H 54 ? O GLY H 53 
# 
_atom_sites.entry_id                    6SEF 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N     . ARG A 1 42  ? 106.04300 74.08500  75.75000  1.000 212.13400 ? 42  ARG A N     1 
ATOM 2     C CA    . ARG A 1 42  ? 105.96300 75.47800  75.32900  1.000 212.13400 ? 42  ARG A CA    1 
ATOM 3     C C     . ARG A 1 42  ? 104.78700 76.18700  75.99300  1.000 212.13400 ? 42  ARG A C     1 
ATOM 4     O O     . ARG A 1 42  ? 103.63100 75.94100  75.65000  1.000 212.13400 ? 42  ARG A O     1 
ATOM 5     C CB    . ARG A 1 42  ? 105.83500 75.57400  73.80700  1.000 212.13400 ? 42  ARG A CB    1 
ATOM 6     C CG    . ARG A 1 42  ? 107.13900 75.38600  73.04700  1.000 212.13400 ? 42  ARG A CG    1 
ATOM 7     C CD    . ARG A 1 42  ? 106.91300 75.51500  71.54800  1.000 212.13400 ? 42  ARG A CD    1 
ATOM 8     N NE    . ARG A 1 42  ? 108.10600 75.18500  70.77400  1.000 212.13400 ? 42  ARG A NE    1 
ATOM 9     C CZ    . ARG A 1 42  ? 108.42000 73.95700  70.37200  1.000 212.13400 ? 42  ARG A CZ    1 
ATOM 10    N NH1   . ARG A 1 42  ? 109.52600 73.74800  69.67000  1.000 212.13400 ? 42  ARG A NH1   1 
ATOM 11    N NH2   . ARG A 1 42  ? 107.62700 72.93800  70.67000  1.000 212.13400 ? 42  ARG A NH2   1 
ATOM 12    N N     . ARG A 1 43  ? 105.08800 77.07100  76.94100  1.000 211.23534 ? 43  ARG A N     1 
ATOM 13    C CA    . ARG A 1 43  ? 104.07600 77.83300  77.66300  1.000 211.23534 ? 43  ARG A CA    1 
ATOM 14    C C     . ARG A 1 43  ? 104.27100 79.30700  77.34700  1.000 211.23534 ? 43  ARG A C     1 
ATOM 15    O O     . ARG A 1 43  ? 105.32600 79.87400  77.65100  1.000 211.23534 ? 43  ARG A O     1 
ATOM 16    C CB    . ARG A 1 43  ? 104.17100 77.57800  79.16800  1.000 211.23534 ? 43  ARG A CB    1 
ATOM 17    C CG    . ARG A 1 43  ? 104.13000 76.10800  79.53900  1.000 211.23534 ? 43  ARG A CG    1 
ATOM 18    C CD    . ARG A 1 43  ? 104.17900 75.90900  81.04200  1.000 211.23534 ? 43  ARG A CD    1 
ATOM 19    N NE    . ARG A 1 43  ? 105.52500 76.08600  81.57700  1.000 211.23534 ? 43  ARG A NE    1 
ATOM 20    C CZ    . ARG A 1 43  ? 105.78900 76.41400  82.83800  1.000 211.23534 ? 43  ARG A CZ    1 
ATOM 21    N NH1   . ARG A 1 43  ? 107.04400 76.55500  83.24200  1.000 211.23534 ? 43  ARG A NH1   1 
ATOM 22    N NH2   . ARG A 1 43  ? 104.79600 76.60100  83.69700  1.000 211.23534 ? 43  ARG A NH2   1 
ATOM 23    N N     . ARG A 1 44  ? 103.26700 79.91900  76.72800  1.000 218.88214 ? 44  ARG A N     1 
ATOM 24    C CA    . ARG A 1 44  ? 103.33800 81.32200  76.34700  1.000 218.88214 ? 44  ARG A CA    1 
ATOM 25    C C     . ARG A 1 44  ? 102.79500 82.22000  77.45300  1.000 218.88214 ? 44  ARG A C     1 
ATOM 26    O O     . ARG A 1 44  ? 101.89300 81.82600  78.19900  1.000 218.88214 ? 44  ARG A O     1 
ATOM 27    C CB    . ARG A 1 44  ? 102.56100 81.55400  75.05000  1.000 218.88214 ? 44  ARG A CB    1 
ATOM 28    C CG    . ARG A 1 44  ? 102.98100 80.62800  73.91500  1.000 218.88214 ? 44  ARG A CG    1 
ATOM 29    C CD    . ARG A 1 44  ? 104.27900 81.08100  73.26400  1.000 218.88214 ? 44  ARG A CD    1 
ATOM 30    N NE    . ARG A 1 44  ? 105.44700 80.41100  73.83000  1.000 218.88214 ? 44  ARG A NE    1 
ATOM 31    C CZ    . ARG A 1 44  ? 105.95300 79.27100  73.37500  1.000 218.88214 ? 44  ARG A CZ    1 
ATOM 32    N NH1   . ARG A 1 44  ? 107.01800 78.74300  73.95800  1.000 218.88214 ? 44  ARG A NH1   1 
ATOM 33    N NH2   . ARG A 1 44  ? 105.39300 78.65600  72.34400  1.000 218.88214 ? 44  ARG A NH2   1 
ATOM 34    N N     . GLN A 1 45  ? 103.31700 83.45800  77.48300  1.000 213.37494 ? 45  GLN A N     1 
ATOM 35    C CA    . GLN A 1 45  ? 103.04300 84.54200  78.46000  1.000 213.37494 ? 45  GLN A CA    1 
ATOM 36    C C     . GLN A 1 45  ? 102.88000 84.02700  79.89400  1.000 213.37494 ? 45  GLN A C     1 
ATOM 37    O O     . GLN A 1 45  ? 101.96400 84.39500  80.63000  1.000 213.37494 ? 45  GLN A O     1 
ATOM 38    C CB    . GLN A 1 45  ? 101.85200 85.41500  78.00800  1.000 213.37494 ? 45  GLN A CB    1 
ATOM 39    C CG    . GLN A 1 45  ? 100.49200 84.74500  77.75000  1.000 213.37494 ? 45  GLN A CG    1 
ATOM 40    C CD    . GLN A 1 45  ? 99.43300  85.10100  78.77800  1.000 213.37494 ? 45  GLN A CD    1 
ATOM 41    O OE1   . GLN A 1 45  ? 99.69300  85.81800  79.74200  1.000 213.37494 ? 45  GLN A OE1   1 
ATOM 42    N NE2   . GLN A 1 45  ? 98.22600  84.58900  78.57500  1.000 213.37494 ? 45  GLN A NE2   1 
ATOM 43    N N     . GLY A 1 46  ? 103.83600 83.20400  80.30900  1.000 185.22611 ? 46  GLY A N     1 
ATOM 44    C CA    . GLY A 1 46  ? 103.81500 82.61300  81.62800  1.000 185.22611 ? 46  GLY A CA    1 
ATOM 45    C C     . GLY A 1 46  ? 104.21000 83.49700  82.78300  1.000 185.22611 ? 46  GLY A C     1 
ATOM 46    O O     . GLY A 1 46  ? 104.14800 83.03100  83.92300  1.000 185.22611 ? 46  GLY A O     1 
ATOM 47    N N     . TRP A 1 47  ? 104.60800 84.75000  82.54300  1.000 165.96278 ? 47  TRP A N     1 
ATOM 48    C CA    . TRP A 1 47  ? 105.00600 85.60900  83.65400  1.000 165.96278 ? 47  TRP A CA    1 
ATOM 49    C C     . TRP A 1 47  ? 103.81000 86.01400  84.49900  1.000 165.96278 ? 47  TRP A C     1 
ATOM 50    O O     . TRP A 1 47  ? 103.96900 86.31500  85.68800  1.000 165.96278 ? 47  TRP A O     1 
ATOM 51    C CB    . TRP A 1 47  ? 105.72000 86.85600  83.14200  1.000 165.96278 ? 47  TRP A CB    1 
ATOM 52    C CG    . TRP A 1 47  ? 104.97700 87.57000  82.07300  1.000 165.96278 ? 47  TRP A CG    1 
ATOM 53    C CD1   . TRP A 1 47  ? 105.10600 87.39600  80.73100  1.000 165.96278 ? 47  TRP A CD1   1 
ATOM 54    C CD2   . TRP A 1 47  ? 103.99600 88.59400  82.25300  1.000 165.96278 ? 47  TRP A CD2   1 
ATOM 55    N NE1   . TRP A 1 47  ? 104.25700 88.24100  80.06100  1.000 165.96278 ? 47  TRP A NE1   1 
ATOM 56    C CE2   . TRP A 1 47  ? 103.56600 88.98900  80.97600  1.000 165.96278 ? 47  TRP A CE2   1 
ATOM 57    C CE3   . TRP A 1 47  ? 103.44000 89.21500  83.37200  1.000 165.96278 ? 47  TRP A CE3   1 
ATOM 58    C CZ2   . TRP A 1 47  ? 102.60300 89.97300  80.78700  1.000 165.96278 ? 47  TRP A CZ2   1 
ATOM 59    C CZ3   . TRP A 1 47  ? 102.48400 90.18800  83.18300  1.000 165.96278 ? 47  TRP A CZ3   1 
ATOM 60    C CH2   . TRP A 1 47  ? 102.07600 90.56100  81.90100  1.000 165.96278 ? 47  TRP A CH2   1 
ATOM 61    N N     . LEU A 1 48  ? 102.61500 86.02500  83.90200  1.000 165.80112 ? 48  LEU A N     1 
ATOM 62    C CA    . LEU A 1 48  ? 101.40300 86.35400  84.64100  1.000 165.80112 ? 48  LEU A CA    1 
ATOM 63    C C     . LEU A 1 48  ? 101.10900 85.30300  85.70100  1.000 165.80112 ? 48  LEU A C     1 
ATOM 64    O O     . LEU A 1 48  ? 100.73400 85.64000  86.83100  1.000 165.80112 ? 48  LEU A O     1 
ATOM 65    C CB    . LEU A 1 48  ? 100.22400 86.48400  83.68300  1.000 165.80112 ? 48  LEU A CB    1 
ATOM 66    C CG    . LEU A 1 48  ? 98.91800  86.92100  84.33900  1.000 165.80112 ? 48  LEU A CG    1 
ATOM 67    C CD1   . LEU A 1 48  ? 98.97100  88.39600  84.67200  1.000 165.80112 ? 48  LEU A CD1   1 
ATOM 68    C CD2   . LEU A 1 48  ? 97.73700  86.61100  83.44200  1.000 165.80112 ? 48  LEU A CD2   1 
ATOM 69    N N     . LYS A 1 49  ? 101.27400 84.02800  85.34300  1.000 179.27662 ? 49  LYS A N     1 
ATOM 70    C CA    . LYS A 1 49  ? 101.07400 82.94300  86.29600  1.000 179.27662 ? 49  LYS A CA    1 
ATOM 71    C C     . LYS A 1 49  ? 102.09200 83.01000  87.42600  1.000 179.27662 ? 49  LYS A C     1 
ATOM 72    O O     . LYS A 1 49  ? 101.74600 82.77800  88.59100  1.000 179.27662 ? 49  LYS A O     1 
ATOM 73    C CB    . LYS A 1 49  ? 101.16800 81.60400  85.57000  1.000 179.27662 ? 49  LYS A CB    1 
ATOM 74    C CG    . LYS A 1 49  ? 99.94700  81.27900  84.73800  1.000 179.27662 ? 49  LYS A CG    1 
ATOM 75    C CD    . LYS A 1 49  ? 100.10700 79.96100  84.00800  1.000 179.27662 ? 49  LYS A CD    1 
ATOM 76    C CE    . LYS A 1 49  ? 99.13200  79.86800  82.84600  1.000 179.27662 ? 49  LYS A CE    1 
ATOM 77    N NZ    . LYS A 1 49  ? 98.37200  78.59400  82.84300  1.000 179.27662 ? 49  LYS A NZ    1 
ATOM 78    N N     . GLU A 1 50  ? 103.34800 83.34000  87.09800  1.000 164.08959 ? 50  GLU A N     1 
ATOM 79    C CA    . GLU A 1 50  ? 104.37800 83.49300  88.12100  1.000 164.08959 ? 50  GLU A CA    1 
ATOM 80    C C     . GLU A 1 50  ? 104.05600 84.63300  89.06900  1.000 164.08959 ? 50  GLU A C     1 
ATOM 81    O O     . GLU A 1 50  ? 104.20300 84.48900  90.28600  1.000 164.08959 ? 50  GLU A O     1 
ATOM 82    C CB    . GLU A 1 50  ? 105.74500 83.73200  87.48700  1.000 164.08959 ? 50  GLU A CB    1 
ATOM 83    C CG    . GLU A 1 50  ? 106.17500 82.70700  86.47300  1.000 164.08959 ? 50  GLU A CG    1 
ATOM 84    C CD    . GLU A 1 50  ? 107.50700 83.05800  85.83900  1.000 164.08959 ? 50  GLU A CD    1 
ATOM 85    O OE1   . GLU A 1 50  ? 108.55300 82.65000  86.38600  1.000 164.08959 ? 50  GLU A OE1   1 
ATOM 86    O OE2   . GLU A 1 50  ? 107.51300 83.74700  84.79800  1.000 164.08959 ? 50  GLU A OE2   1 
ATOM 87    N N     . ILE A 1 51  ? 103.62400 85.77300  88.52400  1.000 150.67593 ? 51  ILE A N     1 
ATOM 88    C CA    . ILE A 1 51  ? 103.27900 86.92500  89.35200  1.000 150.67593 ? 51  ILE A CA    1 
ATOM 89    C C     . ILE A 1 51  ? 102.10200 86.60200  90.26300  1.000 150.67593 ? 51  ILE A C     1 
ATOM 90    O O     . ILE A 1 51  ? 102.13600 86.89800  91.46500  1.000 150.67593 ? 51  ILE A O     1 
ATOM 91    C CB    . ILE A 1 51  ? 103.00300 88.14900  88.46400  1.000 150.67593 ? 51  ILE A CB    1 
ATOM 92    C CG1   . ILE A 1 51  ? 104.31700 88.74200  87.98000  1.000 150.67593 ? 51  ILE A CG1   1 
ATOM 93    C CG2   . ILE A 1 51  ? 102.24600 89.21500  89.21200  1.000 150.67593 ? 51  ILE A CG2   1 
ATOM 94    C CD1   . ILE A 1 51  ? 104.14200 89.77000  86.89800  1.000 150.67593 ? 51  ILE A CD1   1 
ATOM 95    N N     . ARG A 1 52  ? 101.06500 85.95700  89.71500  1.000 147.36726 ? 52  ARG A N     1 
ATOM 96    C CA    . ARG A 1 52  ? 99.89800  85.59900  90.51600  1.000 147.36726 ? 52  ARG A CA    1 
ATOM 97    C C     . ARG A 1 52  ? 100.25100 84.60200  91.61300  1.000 147.36726 ? 52  ARG A C     1 
ATOM 98    O O     . ARG A 1 52  ? 99.78800  84.73800  92.75300  1.000 147.36726 ? 52  ARG A O     1 
ATOM 99    C CB    . ARG A 1 52  ? 98.79900  85.02900  89.62900  1.000 147.36726 ? 52  ARG A CB    1 
ATOM 100   C CG    . ARG A 1 52  ? 97.41600  85.20400  90.21500  1.000 147.36726 ? 52  ARG A CG    1 
ATOM 101   C CD    . ARG A 1 52  ? 96.34400  85.05100  89.16000  1.000 147.36726 ? 52  ARG A CD    1 
ATOM 102   N NE    . ARG A 1 52  ? 96.36200  86.13200  88.18300  1.000 147.36726 ? 52  ARG A NE    1 
ATOM 103   C CZ    . ARG A 1 52  ? 95.66400  86.11800  87.05400  1.000 147.36726 ? 52  ARG A CZ    1 
ATOM 104   N NH1   . ARG A 1 52  ? 95.73200  87.14200  86.21500  1.000 147.36726 ? 52  ARG A NH1   1 
ATOM 105   N NH2   . ARG A 1 52  ? 94.89400  85.07800  86.76500  1.000 147.36726 ? 52  ARG A NH2   1 
ATOM 106   N N     . LYS A 1 53  ? 101.07500 83.60000  91.29400  1.000 139.54627 ? 53  LYS A N     1 
ATOM 107   C CA    . LYS A 1 53  ? 101.44500 82.60600  92.29300  1.000 139.54627 ? 53  LYS A CA    1 
ATOM 108   C C     . LYS A 1 53  ? 102.33300 83.21100  93.37400  1.000 139.54627 ? 53  LYS A C     1 
ATOM 109   O O     . LYS A 1 53  ? 102.15800 82.91400  94.56200  1.000 139.54627 ? 53  LYS A O     1 
ATOM 110   C CB    . LYS A 1 53  ? 102.13400 81.42400  91.61500  1.000 139.54627 ? 53  LYS A CB    1 
ATOM 111   C CG    . LYS A 1 53  ? 102.82700 80.46400  92.56200  1.000 139.54627 ? 53  LYS A CG    1 
ATOM 112   C CD    . LYS A 1 53  ? 103.56600 79.37900  91.81300  1.000 139.54627 ? 53  LYS A CD    1 
ATOM 113   C CE    . LYS A 1 53  ? 104.63600 79.97300  90.92200  1.000 139.54627 ? 53  LYS A CE    1 
ATOM 114   N NZ    . LYS A 1 53  ? 105.34700 78.92800  90.14300  1.000 139.54627 ? 53  LYS A NZ    1 
ATOM 115   N N     . LEU A 1 54  ? 103.25100 84.10400  92.99500  1.000 138.41929 ? 54  LEU A N     1 
ATOM 116   C CA    . LEU A 1 54  ? 104.14700 84.68900  93.98500  1.000 138.41929 ? 54  LEU A CA    1 
ATOM 117   C C     . LEU A 1 54  ? 103.43400 85.70200  94.86500  1.000 138.41929 ? 54  LEU A C     1 
ATOM 118   O O     . LEU A 1 54  ? 103.76200 85.82500  96.04900  1.000 138.41929 ? 54  LEU A O     1 
ATOM 119   C CB    . LEU A 1 54  ? 105.34700 85.33300  93.30200  1.000 138.41929 ? 54  LEU A CB    1 
ATOM 120   C CG    . LEU A 1 54  ? 106.38000 84.35800  92.74200  1.000 138.41929 ? 54  LEU A CG    1 
ATOM 121   C CD1   . LEU A 1 54  ? 107.61100 85.10100  92.30100  1.000 138.41929 ? 54  LEU A CD1   1 
ATOM 122   C CD2   . LEU A 1 54  ? 106.74000 83.30400  93.76800  1.000 138.41929 ? 54  LEU A CD2   1 
ATOM 123   N N     . GLN A 1 55  ? 102.45100 86.41600  94.32600  1.000 138.90580 ? 55  GLN A N     1 
ATOM 124   C CA    . GLN A 1 55  ? 101.70400 87.33500  95.16600  1.000 138.90580 ? 55  GLN A CA    1 
ATOM 125   C C     . GLN A 1 55  ? 100.65100 86.60800  95.97800  1.000 138.90580 ? 55  GLN A C     1 
ATOM 126   O O     . GLN A 1 55  ? 100.20500 87.12700  97.00300  1.000 138.90580 ? 55  GLN A O     1 
ATOM 127   C CB    . GLN A 1 55  ? 101.04800 88.42100  94.31600  1.000 138.90580 ? 55  GLN A CB    1 
ATOM 128   C CG    . GLN A 1 55  ? 102.03300 89.34200  93.63100  1.000 138.90580 ? 55  GLN A CG    1 
ATOM 129   C CD    . GLN A 1 55  ? 101.50100 90.74500  93.46000  1.000 138.90580 ? 55  GLN A CD    1 
ATOM 130   O OE1   . GLN A 1 55  ? 100.34500 90.94100  93.09600  1.000 138.90580 ? 55  GLN A OE1   1 
ATOM 131   N NE2   . GLN A 1 55  ? 102.34900 91.73400  93.70800  1.000 138.90580 ? 55  GLN A NE2   1 
ATOM 132   N N     . LYS A 1 56  ? 100.26400 85.41000  95.55100  1.000 129.98372 ? 56  LYS A N     1 
ATOM 133   C CA    . LYS A 1 56  ? 99.32700  84.61900  96.33000  1.000 129.98372 ? 56  LYS A CA    1 
ATOM 134   C C     . LYS A 1 56  ? 100.02800 83.86200  97.44700  1.000 129.98372 ? 56  LYS A C     1 
ATOM 135   O O     . LYS A 1 56  ? 99.42400  83.60900  98.49400  1.000 129.98372 ? 56  LYS A O     1 
ATOM 136   C CB    . LYS A 1 56  ? 98.57900  83.66000  95.40700  1.000 129.98372 ? 56  LYS A CB    1 
ATOM 137   C CG    . LYS A 1 56  ? 97.31800  83.06500  95.99700  1.000 129.98372 ? 56  LYS A CG    1 
ATOM 138   C CD    . LYS A 1 56  ? 96.64100  82.15900  94.99000  1.000 129.98372 ? 56  LYS A CD    1 
ATOM 139   C CE    . LYS A 1 56  ? 96.06300  82.97900  93.84500  1.000 129.98372 ? 56  LYS A CE    1 
ATOM 140   N NZ    . LYS A 1 56  ? 95.34700  82.14200  92.84500  1.000 129.98372 ? 56  LYS A NZ    1 
ATOM 141   N N     . SER A 1 57  ? 101.29400 83.50400  97.25500  1.000 131.31409 ? 57  SER A N     1 
ATOM 142   C CA    . SER A 1 57  ? 102.03300 82.79400  98.28300  1.000 131.31409 ? 57  SER A CA    1 
ATOM 143   C C     . SER A 1 57  ? 102.50000 83.76300  99.36100  1.000 131.31409 ? 57  SER A C     1 
ATOM 144   O O     . SER A 1 57  ? 102.30300 84.97700  99.27500  1.000 131.31409 ? 57  SER A O     1 
ATOM 145   C CB    . SER A 1 57  ? 103.22400 82.06400  97.67400  1.000 131.31409 ? 57  SER A CB    1 
ATOM 146   O OG    . SER A 1 57  ? 104.35000 82.92100  97.61100  1.000 131.31409 ? 57  SER A OG    1 
ATOM 147   N N     . THR A 1 58  ? 103.13400 83.21800  100.39400 1.000 123.14005 ? 58  THR A N     1 
ATOM 148   C CA    . THR A 1 58  ? 103.61500 84.06900  101.47400 1.000 123.14005 ? 58  THR A CA    1 
ATOM 149   C C     . THR A 1 58  ? 104.92500 83.59100  102.08700 1.000 123.14005 ? 58  THR A C     1 
ATOM 150   O O     . THR A 1 58  ? 105.28500 84.07700  103.16400 1.000 123.14005 ? 58  THR A O     1 
ATOM 151   C CB    . THR A 1 58  ? 102.56800 84.16500  102.56800 1.000 123.14005 ? 58  THR A CB    1 
ATOM 152   O OG1   . THR A 1 58  ? 103.09700 84.92000  103.66300 1.000 123.14005 ? 58  THR A OG1   1 
ATOM 153   C CG2   . THR A 1 58  ? 102.19800 82.77600  103.05000 1.000 123.14005 ? 58  THR A CG2   1 
ATOM 154   N N     . HIS A 1 59  ? 105.64800 82.67600  101.46000 1.000 124.50615 ? 59  HIS A N     1 
ATOM 155   C CA    . HIS A 1 59  ? 106.89300 82.19400  102.02900 1.000 124.50615 ? 59  HIS A CA    1 
ATOM 156   C C     . HIS A 1 59  ? 108.05100 83.11300  101.65700 1.000 124.50615 ? 59  HIS A C     1 
ATOM 157   O O     . HIS A 1 59  ? 107.93900 83.98400  100.79300 1.000 124.50615 ? 59  HIS A O     1 
ATOM 158   C CB    . HIS A 1 59  ? 107.16300 80.76300  101.57300 1.000 124.50615 ? 59  HIS A CB    1 
ATOM 159   C CG    . HIS A 1 59  ? 107.33100 80.62400  100.09400 1.000 124.50615 ? 59  HIS A CG    1 
ATOM 160   N ND1   . HIS A 1 59  ? 106.27300 80.36300  99.25000  1.000 124.50615 ? 59  HIS A ND1   1 
ATOM 161   C CD2   . HIS A 1 59  ? 108.43100 80.69300  99.30900  1.000 124.50615 ? 59  HIS A CD2   1 
ATOM 162   C CE1   . HIS A 1 59  ? 106.71300 80.28800  98.00700  1.000 124.50615 ? 59  HIS A CE1   1 
ATOM 163   N NE2   . HIS A 1 59  ? 108.01900 80.48300  98.01600  1.000 124.50615 ? 59  HIS A NE2   1 
ATOM 164   N N     . LEU A 1 60  ? 109.17400 82.91000  102.33600 1.000 122.21769 ? 60  LEU A N     1 
ATOM 165   C CA    . LEU A 1 60  ? 110.36900 83.70000  102.07500 1.000 122.21769 ? 60  LEU A CA    1 
ATOM 166   C C     . LEU A 1 60  ? 110.99400 83.28300  100.75400 1.000 122.21769 ? 60  LEU A C     1 
ATOM 167   O O     . LEU A 1 60  ? 111.06000 82.09600  100.42900 1.000 122.21769 ? 60  LEU A O     1 
ATOM 168   C CB    . LEU A 1 60  ? 111.37400 83.53400  103.20900 1.000 122.21769 ? 60  LEU A CB    1 
ATOM 169   C CG    . LEU A 1 60  ? 111.34600 84.60200  104.30000 1.000 122.21769 ? 60  LEU A CG    1 
ATOM 170   C CD1   . LEU A 1 60  ? 110.09100 84.49800  105.14400 1.000 122.21769 ? 60  LEU A CD1   1 
ATOM 171   C CD2   . LEU A 1 60  ? 112.56900 84.46900  105.17100 1.000 122.21769 ? 60  LEU A CD2   1 
ATOM 172   N N     . LEU A 1 61  ? 111.45000 84.26800  99.98700  1.000 128.07414 ? 61  LEU A N     1 
ATOM 173   C CA    . LEU A 1 61  ? 111.96400 83.97800  98.65600  1.000 128.07414 ? 61  LEU A CA    1 
ATOM 174   C C     . LEU A 1 61  ? 113.45000 83.64300  98.65200  1.000 128.07414 ? 61  LEU A C     1 
ATOM 175   O O     . LEU A 1 61  ? 113.85300 82.63300  98.06700  1.000 128.07414 ? 61  LEU A O     1 
ATOM 176   C CB    . LEU A 1 61  ? 111.67900 85.16100  97.73600  1.000 128.07414 ? 61  LEU A CB    1 
ATOM 177   C CG    . LEU A 1 61  ? 110.22800 85.63700  97.79400  1.000 128.07414 ? 61  LEU A CG    1 
ATOM 178   C CD1   . LEU A 1 61  ? 110.02500 86.79000  96.85000  1.000 128.07414 ? 61  LEU A CD1   1 
ATOM 179   C CD2   . LEU A 1 61  ? 109.26500 84.51100  97.45700  1.000 128.07414 ? 61  LEU A CD2   1 
ATOM 180   N N     . ILE A 1 62  ? 114.27800 84.47400  99.28200  1.000 129.88722 ? 62  ILE A N     1 
ATOM 181   C CA    . ILE A 1 62  ? 115.71000 84.20500  99.32300  1.000 129.88722 ? 62  ILE A CA    1 
ATOM 182   C C     . ILE A 1 62  ? 115.99100 83.05700  100.28900 1.000 129.88722 ? 62  ILE A C     1 
ATOM 183   O O     . ILE A 1 62  ? 115.26700 82.84800  101.27000 1.000 129.88722 ? 62  ILE A O     1 
ATOM 184   C CB    . ILE A 1 62  ? 116.49000 85.47300  99.71000  1.000 129.88722 ? 62  ILE A CB    1 
ATOM 185   C CG1   . ILE A 1 62  ? 115.80600 86.70300  99.12600  1.000 129.88722 ? 62  ILE A CG1   1 
ATOM 186   C CG2   . ILE A 1 62  ? 117.91600 85.41300  99.19600  1.000 129.88722 ? 62  ILE A CG2   1 
ATOM 187   C CD1   . ILE A 1 62  ? 116.50700 87.99800  99.45600  1.000 129.88722 ? 62  ILE A CD1   1 
ATOM 188   N N     . ARG A 1 63  ? 117.04700 82.30000  100.00200 1.000 141.35320 ? 63  ARG A N     1 
ATOM 189   C CA    . ARG A 1 63  ? 117.44000 81.16500  100.82100 1.000 141.35320 ? 63  ARG A CA    1 
ATOM 190   C C     . ARG A 1 63  ? 117.96000 81.62300  102.18200 1.000 141.35320 ? 63  ARG A C     1 
ATOM 191   O O     . ARG A 1 63  ? 118.22500 82.80300  102.41600 1.000 141.35320 ? 63  ARG A O     1 
ATOM 192   C CB    . ARG A 1 63  ? 118.50700 80.34300  100.10600 1.000 141.35320 ? 63  ARG A CB    1 
ATOM 193   C CG    . ARG A 1 63  ? 118.26700 80.18000  98.62200  1.000 141.35320 ? 63  ARG A CG    1 
ATOM 194   C CD    . ARG A 1 63  ? 117.38900 78.97400  98.35700  1.000 141.35320 ? 63  ARG A CD    1 
ATOM 195   N NE    . ARG A 1 63  ? 115.98000 79.34300  98.31900  1.000 141.35320 ? 63  ARG A NE    1 
ATOM 196   C CZ    . ARG A 1 63  ? 114.98500 78.47100  98.23000  1.000 141.35320 ? 63  ARG A CZ    1 
ATOM 197   N NH1   . ARG A 1 63  ? 115.24600 77.17200  98.17100  1.000 141.35320 ? 63  ARG A NH1   1 
ATOM 198   N NH2   . ARG A 1 63  ? 113.73200 78.89700  98.20200  1.000 141.35320 ? 63  ARG A NH2   1 
ATOM 199   N N     . LYS A 1 64  ? 118.11700 80.66000  103.08800 1.000 136.85860 ? 64  LYS A N     1 
ATOM 200   C CA    . LYS A 1 64  ? 118.49600 80.97900  104.45800 1.000 136.85860 ? 64  LYS A CA    1 
ATOM 201   C C     . LYS A 1 64  ? 120.00200 80.94200  104.68000 1.000 136.85860 ? 64  LYS A C     1 
ATOM 202   O O     . LYS A 1 64  ? 120.54700 81.82700  105.34900 1.000 136.85860 ? 64  LYS A O     1 
ATOM 203   C CB    . LYS A 1 64  ? 117.81800 80.00700  105.41700 1.000 136.85860 ? 64  LYS A CB    1 
ATOM 204   C CG    . LYS A 1 64  ? 116.34800 79.80400  105.13400 1.000 136.85860 ? 64  LYS A CG    1 
ATOM 205   C CD    . LYS A 1 64  ? 115.64000 79.21300  106.34000 1.000 136.85860 ? 64  LYS A CD    1 
ATOM 206   C CE    . LYS A 1 64  ? 114.15900 79.01500  106.07100 1.000 136.85860 ? 64  LYS A CE    1 
ATOM 207   N NZ    . LYS A 1 64  ? 113.38100 78.86800  107.33000 1.000 136.85860 ? 64  LYS A NZ    1 
ATOM 208   N N     . LEU A 1 65  ? 120.68400 79.93600  104.12700 1.000 139.34867 ? 65  LEU A N     1 
ATOM 209   C CA    . LEU A 1 65  ? 122.12500 79.80900  104.35300 1.000 139.34867 ? 65  LEU A CA    1 
ATOM 210   C C     . LEU A 1 65  ? 122.95900 80.91400  103.70600 1.000 139.34867 ? 65  LEU A C     1 
ATOM 211   O O     . LEU A 1 65  ? 123.84300 81.45200  104.39700 1.000 139.34867 ? 65  LEU A O     1 
ATOM 212   C CB    . LEU A 1 65  ? 122.61000 78.41200  103.94500 1.000 139.34867 ? 65  LEU A CB    1 
ATOM 213   C CG    . LEU A 1 65  ? 122.59800 77.28600  104.98300 1.000 139.34867 ? 65  LEU A CG    1 
ATOM 214   C CD1   . LEU A 1 65  ? 123.45300 77.68600  106.17500 1.000 139.34867 ? 65  LEU A CD1   1 
ATOM 215   C CD2   . LEU A 1 65  ? 121.20000 76.88100  105.42300 1.000 139.34867 ? 65  LEU A CD2   1 
ATOM 216   N N     . PRO A 1 66  ? 122.79000 81.28000  102.41700 1.000 137.29958 ? 66  PRO A N     1 
ATOM 217   C CA    . PRO A 1 66  ? 123.59000 82.40500  101.90900 1.000 137.29958 ? 66  PRO A CA    1 
ATOM 218   C C     . PRO A 1 66  ? 123.24800 83.72200  102.56300 1.000 137.29958 ? 66  PRO A C     1 
ATOM 219   O O     . PRO A 1 66  ? 124.13800 84.56500  102.72100 1.000 137.29958 ? 66  PRO A O     1 
ATOM 220   C CB    . PRO A 1 66  ? 123.26900 82.43200  100.41100 1.000 137.29958 ? 66  PRO A CB    1 
ATOM 221   C CG    . PRO A 1 66  ? 121.97900 81.79400  100.29300 1.000 137.29958 ? 66  PRO A CG    1 
ATOM 222   C CD    . PRO A 1 66  ? 121.96700 80.72700  101.32000 1.000 137.29958 ? 66  PRO A CD    1 
ATOM 223   N N     . PHE A 1 67  ? 121.98700 83.91600  102.94700 1.000 125.65698 ? 67  PHE A N     1 
ATOM 224   C CA    . PHE A 1 67  ? 121.60900 85.12700  103.66000 1.000 125.65698 ? 67  PHE A CA    1 
ATOM 225   C C     . PHE A 1 67  ? 122.29800 85.20400  105.01300 1.000 125.65698 ? 67  PHE A C     1 
ATOM 226   O O     . PHE A 1 67  ? 122.79100 86.26800  105.40200 1.000 125.65698 ? 67  PHE A O     1 
ATOM 227   C CB    . PHE A 1 67  ? 120.09500 85.18800  103.82100 1.000 125.65698 ? 67  PHE A CB    1 
ATOM 228   C CG    . PHE A 1 67  ? 119.60600 86.49600  104.33700 1.000 125.65698 ? 67  PHE A CG    1 
ATOM 229   C CD1   . PHE A 1 67  ? 119.38900 87.54400  103.46700 1.000 125.65698 ? 67  PHE A CD1   1 
ATOM 230   C CD2   . PHE A 1 67  ? 119.35800 86.68100  105.68300 1.000 125.65698 ? 67  PHE A CD2   1 
ATOM 231   C CE1   . PHE A 1 67  ? 118.94400 88.75500  103.92800 1.000 125.65698 ? 67  PHE A CE1   1 
ATOM 232   C CE2   . PHE A 1 67  ? 118.91500 87.89200  106.15100 1.000 125.65698 ? 67  PHE A CE2   1 
ATOM 233   C CZ    . PHE A 1 67  ? 118.70700 88.93000  105.27200 1.000 125.65698 ? 67  PHE A CZ    1 
ATOM 234   N N     . SER A 1 68  ? 122.34400 84.08500  105.74100 1.000 136.45835 ? 68  SER A N     1 
ATOM 235   C CA    . SER A 1 68  ? 123.03900 84.06100  107.02500 1.000 136.45835 ? 68  SER A CA    1 
ATOM 236   C C     . SER A 1 68  ? 124.53900 84.26900  106.85300 1.000 136.45835 ? 68  SER A C     1 
ATOM 237   O O     . SER A 1 68  ? 125.17300 84.94900  107.67200 1.000 136.45835 ? 68  SER A O     1 
ATOM 238   C CB    . SER A 1 68  ? 122.76200 82.74500  107.74500 1.000 136.45835 ? 68  SER A CB    1 
ATOM 239   O OG    . SER A 1 68  ? 123.74400 82.49700  108.73600 1.000 136.45835 ? 68  SER A OG    1 
ATOM 240   N N     . ARG A 1 69  ? 125.11700 83.68800  105.79700 1.000 138.80741 ? 69  ARG A N     1 
ATOM 241   C CA    . ARG A 1 69  ? 126.53400 83.88100  105.50400 1.000 138.80741 ? 69  ARG A CA    1 
ATOM 242   C C     . ARG A 1 69  ? 126.84500 85.34500  105.21900 1.000 138.80741 ? 69  ARG A C     1 
ATOM 243   O O     . ARG A 1 69  ? 127.82000 85.89900  105.74300 1.000 138.80741 ? 69  ARG A O     1 
ATOM 244   C CB    . ARG A 1 69  ? 126.94700 82.99800  104.32800 1.000 138.80741 ? 69  ARG A CB    1 
ATOM 245   C CG    . ARG A 1 69  ? 127.25200 81.56700  104.72300 1.000 138.80741 ? 69  ARG A CG    1 
ATOM 246   C CD    . ARG A 1 69  ? 128.08100 80.86600  103.66800 1.000 138.80741 ? 69  ARG A CD    1 
ATOM 247   N NE    . ARG A 1 69  ? 127.55400 81.09800  102.33000 1.000 138.80741 ? 69  ARG A NE    1 
ATOM 248   C CZ    . ARG A 1 69  ? 126.64300 80.33000  101.74800 1.000 138.80741 ? 69  ARG A CZ    1 
ATOM 249   N NH1   . ARG A 1 69  ? 126.21700 80.61100  100.52700 1.000 138.80741 ? 69  ARG A NH1   1 
ATOM 250   N NH2   . ARG A 1 69  ? 126.15400 79.27800  102.38800 1.000 138.80741 ? 69  ARG A NH2   1 
ATOM 251   N N     . LEU A 1 70  ? 126.01600 85.98600  104.39200 1.000 137.36077 ? 70  LEU A N     1 
ATOM 252   C CA    . LEU A 1 70  ? 126.20800 87.39300  104.06300 1.000 137.36077 ? 70  LEU A CA    1 
ATOM 253   C C     . LEU A 1 70  ? 126.02000 88.27800  105.28400 1.000 137.36077 ? 70  LEU A C     1 
ATOM 254   O O     . LEU A 1 70  ? 126.77800 89.23500  105.47800 1.000 137.36077 ? 70  LEU A O     1 
ATOM 255   C CB    . LEU A 1 70  ? 125.24000 87.80100  102.95600 1.000 137.36077 ? 70  LEU A CB    1 
ATOM 256   C CG    . LEU A 1 70  ? 125.01100 89.29200  102.72900 1.000 137.36077 ? 70  LEU A CG    1 
ATOM 257   C CD1   . LEU A 1 70  ? 126.24800 89.91600  102.12400 1.000 137.36077 ? 70  LEU A CD1   1 
ATOM 258   C CD2   . LEU A 1 70  ? 123.80700 89.50900  101.83800 1.000 137.36077 ? 70  LEU A CD2   1 
ATOM 259   N N     . ALA A 1 71  ? 125.03900 87.95000  106.12900 1.000 134.29926 ? 71  ALA A N     1 
ATOM 260   C CA    . ALA A 1 71  ? 124.79800 88.72000  107.34300 1.000 134.29926 ? 71  ALA A CA    1 
ATOM 261   C C     . ALA A 1 71  ? 125.97700 88.63500  108.29700 1.000 134.29926 ? 71  ALA A C     1 
ATOM 262   O O     . ALA A 1 71  ? 126.38400 89.64600  108.87500 1.000 134.29926 ? 71  ALA A O     1 
ATOM 263   C CB    . ALA A 1 71  ? 123.52400 88.23700  108.02700 1.000 134.29926 ? 71  ALA A CB    1 
ATOM 264   N N     . ARG A 1 72  ? 126.54100 87.43900  108.47000 1.000 135.65448 ? 72  ARG A N     1 
ATOM 265   C CA    . ARG A 1 72  ? 127.72000 87.30400  109.31800 1.000 135.65448 ? 72  ARG A CA    1 
ATOM 266   C C     . ARG A 1 72  ? 128.92900 88.02100  108.72000 1.000 135.65448 ? 72  ARG A C     1 
ATOM 267   O O     . ARG A 1 72  ? 129.71500 88.63700  109.45300 1.000 135.65448 ? 72  ARG A O     1 
ATOM 268   C CB    . ARG A 1 72  ? 128.01700 85.83000  109.55700 1.000 135.65448 ? 72  ARG A CB    1 
ATOM 269   C CG    . ARG A 1 72  ? 127.16500 85.21900  110.65100 1.000 135.65448 ? 72  ARG A CG    1 
ATOM 270   C CD    . ARG A 1 72  ? 127.25600 83.70800  110.63000 1.000 135.65448 ? 72  ARG A CD    1 
ATOM 271   N NE    . ARG A 1 72  ? 126.03100 83.06900  111.09300 1.000 135.65448 ? 72  ARG A NE    1 
ATOM 272   C CZ    . ARG A 1 72  ? 125.74300 82.84600  112.37000 1.000 135.65448 ? 72  ARG A CZ    1 
ATOM 273   N NH1   . ARG A 1 72  ? 126.59200 83.20400  113.32000 1.000 135.65448 ? 72  ARG A NH1   1 
ATOM 274   N NH2   . ARG A 1 72  ? 124.60600 82.25500  112.69900 1.000 135.65448 ? 72  ARG A NH2   1 
ATOM 275   N N     . GLU A 1 73  ? 129.07900 87.98100  107.39200 1.000 141.89987 ? 73  GLU A N     1 
ATOM 276   C CA    . GLU A 1 73  ? 130.23200 88.62100  106.76400 1.000 141.89987 ? 73  GLU A CA    1 
ATOM 277   C C     . GLU A 1 73  ? 130.13200 90.14100  106.81900 1.000 141.89987 ? 73  GLU A C     1 
ATOM 278   O O     . GLU A 1 73  ? 131.15200 90.83000  106.92800 1.000 141.89987 ? 73  GLU A O     1 
ATOM 279   C CB    . GLU A 1 73  ? 130.36100 88.13400  105.31500 1.000 141.89987 ? 73  GLU A CB    1 
ATOM 280   C CG    . GLU A 1 73  ? 131.39200 88.86600  104.45700 1.000 141.89987 ? 73  GLU A CG    1 
ATOM 281   C CD    . GLU A 1 73  ? 131.56100 88.27000  103.08000 1.000 141.89987 ? 73  GLU A CD    1 
ATOM 282   O OE1   . GLU A 1 73  ? 131.56400 87.03100  102.96800 1.000 141.89987 ? 73  GLU A OE1   1 
ATOM 283   O OE2   . GLU A 1 73  ? 131.68000 89.04300  102.10700 1.000 141.89987 ? 73  GLU A OE2   1 
ATOM 284   N N     . ILE A 1 74  ? 128.92100 90.68100  106.84900 1.000 133.65618 ? 74  ILE A N     1 
ATOM 285   C CA    . ILE A 1 74  ? 128.79000 92.12600  106.96200 1.000 133.65618 ? 74  ILE A CA    1 
ATOM 286   C C     . ILE A 1 74  ? 128.71000 92.55600  108.42600 1.000 133.65618 ? 74  ILE A C     1 
ATOM 287   O O     . ILE A 1 74  ? 128.95700 93.73000  108.73700 1.000 133.65618 ? 74  ILE A O     1 
ATOM 288   C CB    . ILE A 1 74  ? 127.59900 92.59800  106.10400 1.000 133.65618 ? 74  ILE A CB    1 
ATOM 289   C CG1   . ILE A 1 74  ? 127.62600 94.10700  105.86400 1.000 133.65618 ? 74  ILE A CG1   1 
ATOM 290   C CG2   . ILE A 1 74  ? 126.29200 92.18800  106.70700 1.000 133.65618 ? 74  ILE A CG2   1 
ATOM 291   C CD1   . ILE A 1 74  ? 126.71200 94.55500  104.75800 1.000 133.65618 ? 74  ILE A CD1   1 
ATOM 292   N N     . CYS A 1 75  ? 128.42700 91.63200  109.34500 1.000 135.65537 ? 75  CYS A N     1 
ATOM 293   C CA    . CYS A 1 75  ? 128.44000 91.96000  110.76400 1.000 135.65537 ? 75  CYS A CA    1 
ATOM 294   C C     . CYS A 1 75  ? 129.81400 91.81900  111.38600 1.000 135.65537 ? 75  CYS A C     1 
ATOM 295   O O     . CYS A 1 75  ? 130.04700 92.37100  112.46500 1.000 135.65537 ? 75  CYS A O     1 
ATOM 296   C CB    . CYS A 1 75  ? 127.46800 91.07600  111.54600 1.000 135.65537 ? 75  CYS A CB    1 
ATOM 297   S SG    . CYS A 1 75  ? 128.20000 89.56400  112.18600 1.000 135.65537 ? 75  CYS A SG    1 
ATOM 298   N N     . VAL A 1 76  ? 130.72800 91.08300  110.74700 1.000 137.96883 ? 76  VAL A N     1 
ATOM 299   C CA    . VAL A 1 76  ? 132.08700 90.98700  111.26900 1.000 137.96883 ? 76  VAL A CA    1 
ATOM 300   C C     . VAL A 1 76  ? 132.86900 92.29400  111.14600 1.000 137.96883 ? 76  VAL A C     1 
ATOM 301   O O     . VAL A 1 76  ? 133.93600 92.43100  111.75200 1.000 137.96883 ? 76  VAL A O     1 
ATOM 302   C CB    . VAL A 1 76  ? 132.84000 89.83300  110.57000 1.000 137.96883 ? 76  VAL A CB    1 
ATOM 303   C CG1   . VAL A 1 76  ? 133.41700 90.27700  109.23300 1.000 137.96883 ? 76  VAL A CG1   1 
ATOM 304   C CG2   . VAL A 1 76  ? 133.89800 89.20600  111.48500 1.000 137.96883 ? 76  VAL A CG2   1 
ATOM 305   N N     . LYS A 1 77  ? 132.34500 93.28400  110.42300 1.000 135.57761 ? 77  LYS A N     1 
ATOM 306   C CA    . LYS A 1 77  ? 133.04600 94.55100  110.26900 1.000 135.57761 ? 77  LYS A CA    1 
ATOM 307   C C     . LYS A 1 77  ? 132.90500 95.45500  111.48800 1.000 135.57761 ? 77  LYS A C     1 
ATOM 308   O O     . LYS A 1 77  ? 133.88800 96.06100  111.92500 1.000 135.57761 ? 77  LYS A O     1 
ATOM 309   C CB    . LYS A 1 77  ? 132.52300 95.27900  109.03300 1.000 135.57761 ? 77  LYS A CB    1 
ATOM 310   C CG    . LYS A 1 77  ? 133.42600 96.38500  108.52900 1.000 135.57761 ? 77  LYS A CG    1 
ATOM 311   C CD    . LYS A 1 77  ? 132.91700 96.95700  107.21100 1.000 135.57761 ? 77  LYS A CD    1 
ATOM 312   C CE    . LYS A 1 77  ? 132.67300 95.87400  106.16900 1.000 135.57761 ? 77  LYS A CE    1 
ATOM 313   N NZ    . LYS A 1 77  ? 133.93300 95.23000  105.71500 1.000 135.57761 ? 77  LYS A NZ    1 
ATOM 314   N N     . PHE A 1 78  ? 131.70700 95.55700  112.06000 1.000 135.33393 ? 78  PHE A N     1 
ATOM 315   C CA    . PHE A 1 78  ? 131.47200 96.51200  113.13500 1.000 135.33393 ? 78  PHE A CA    1 
ATOM 316   C C     . PHE A 1 78  ? 131.63300 95.91800  114.51700 1.000 135.33393 ? 78  PHE A C     1 
ATOM 317   O O     . PHE A 1 78  ? 131.48000 96.63700  115.50700 1.000 135.33393 ? 78  PHE A O     1 
ATOM 318   C CB    . PHE A 1 78  ? 130.06500 97.08500  113.01700 1.000 135.33393 ? 78  PHE A CB    1 
ATOM 319   C CG    . PHE A 1 78  ? 129.78400 97.67800  111.69200 1.000 135.33393 ? 78  PHE A CG    1 
ATOM 320   C CD1   . PHE A 1 78  ? 130.32000 98.90000  111.34200 1.000 135.33393 ? 78  PHE A CD1   1 
ATOM 321   C CD2   . PHE A 1 78  ? 128.99800 97.00200  110.78100 1.000 135.33393 ? 78  PHE A CD2   1 
ATOM 322   C CE1   . PHE A 1 78  ? 130.07200 99.44400  110.10600 1.000 135.33393 ? 78  PHE A CE1   1 
ATOM 323   C CE2   . PHE A 1 78  ? 128.74300 97.53800  109.54600 1.000 135.33393 ? 78  PHE A CE2   1 
ATOM 324   C CZ    . PHE A 1 78  ? 129.28100 98.76100  109.20900 1.000 135.33393 ? 78  PHE A CZ    1 
ATOM 325   N N     . THR A 1 79  ? 131.94400 94.63900  114.61200 1.000 148.55900 ? 79  THR A N     1 
ATOM 326   C CA    . THR A 1 79  ? 132.13700 93.98100  115.89000 1.000 148.55900 ? 79  THR A CA    1 
ATOM 327   C C     . THR A 1 79  ? 133.57400 94.05100  116.36600 1.000 148.55900 ? 79  THR A C     1 
ATOM 328   O O     . THR A 1 79  ? 133.94700 93.29500  117.26800 1.000 148.55900 ? 79  THR A O     1 
ATOM 329   C CB    . THR A 1 79  ? 131.69300 92.53300  115.78600 1.000 148.55900 ? 79  THR A CB    1 
ATOM 330   O OG1   . THR A 1 79  ? 131.82000 91.89700  117.06300 1.000 148.55900 ? 79  THR A OG1   1 
ATOM 331   C CG2   . THR A 1 79  ? 132.53400 91.83200  114.76100 1.000 148.55900 ? 79  THR A CG2   1 
ATOM 332   N N     . ARG A 1 80  ? 134.38700 94.91200  115.74800 1.000 162.47537 ? 80  ARG A N     1 
ATOM 333   C CA    . ARG A 1 80  ? 135.79600 95.19400  116.03100 1.000 162.47537 ? 80  ARG A CA    1 
ATOM 334   C C     . ARG A 1 80  ? 136.70300 93.95500  115.95700 1.000 162.47537 ? 80  ARG A C     1 
ATOM 335   O O     . ARG A 1 80  ? 137.89100 94.03800  116.29400 1.000 162.47537 ? 80  ARG A O     1 
ATOM 336   C CB    . ARG A 1 80  ? 135.94000 95.94500  117.37700 1.000 162.47537 ? 80  ARG A CB    1 
ATOM 337   C CG    . ARG A 1 80  ? 136.09900 95.13800  118.67100 1.000 162.47537 ? 80  ARG A CG    1 
ATOM 338   C CD    . ARG A 1 80  ? 136.14100 96.04000  119.88200 1.000 162.47537 ? 80  ARG A CD    1 
ATOM 339   N NE    . ARG A 1 80  ? 135.22500 97.16600  119.72900 1.000 162.47537 ? 80  ARG A NE    1 
ATOM 340   C CZ    . ARG A 1 80  ? 133.99500 97.19700  120.23200 1.000 162.47537 ? 80  ARG A CZ    1 
ATOM 341   N NH1   . ARG A 1 80  ? 133.22700 98.26200  120.04800 1.000 162.47537 ? 80  ARG A NH1   1 
ATOM 342   N NH2   . ARG A 1 80  ? 133.52600 96.15800  120.90700 1.000 162.47537 ? 80  ARG A NH2   1 
ATOM 343   N N     . GLY A 1 81  ? 136.21000 92.84100  115.41900 1.000 157.62543 ? 81  GLY A N     1 
ATOM 344   C CA    . GLY A 1 81  ? 137.02500 91.67500  115.13500 1.000 157.62543 ? 81  GLY A CA    1 
ATOM 345   C C     . GLY A 1 81  ? 136.66100 90.40900  115.88400 1.000 157.62543 ? 81  GLY A C     1 
ATOM 346   O O     . GLY A 1 81  ? 137.27500 89.36800  115.61400 1.000 157.62543 ? 81  GLY A O     1 
ATOM 347   N N     . VAL A 1 82  ? 135.69800 90.40800  116.80200 1.000 151.71342 ? 82  VAL A N     1 
ATOM 348   C CA    . VAL A 1 82  ? 135.35200 89.21000  117.56200 1.000 151.71342 ? 82  VAL A CA    1 
ATOM 349   C C     . VAL A 1 82  ? 134.06100 88.62700  116.99800 1.000 151.71342 ? 82  VAL A C     1 
ATOM 350   O O     . VAL A 1 82  ? 133.11000 89.36100  116.71500 1.000 151.71342 ? 82  VAL A O     1 
ATOM 351   C CB    . VAL A 1 82  ? 135.25400 89.52000  119.07000 1.000 151.71342 ? 82  VAL A CB    1 
ATOM 352   C CG1   . VAL A 1 82  ? 134.31000 90.68800  119.36500 1.000 151.71342 ? 82  VAL A CG1   1 
ATOM 353   C CG2   . VAL A 1 82  ? 134.85600 88.28500  119.86100 1.000 151.71342 ? 82  VAL A CG2   1 
ATOM 354   N N     . ASP A 1 83  ? 134.03900 87.31100  116.79300 1.000 152.18490 ? 83  ASP A N     1 
ATOM 355   C CA    . ASP A 1 83  ? 132.86200 86.66400  116.22900 1.000 152.18490 ? 83  ASP A CA    1 
ATOM 356   C C     . ASP A 1 83  ? 131.67200 86.73000  117.18000 1.000 152.18490 ? 83  ASP A C     1 
ATOM 357   O O     . ASP A 1 83  ? 131.82100 86.67700  118.40300 1.000 152.18490 ? 83  ASP A O     1 
ATOM 358   C CB    . ASP A 1 83  ? 133.18300 85.21600  115.82900 1.000 152.18490 ? 83  ASP A CB    1 
ATOM 359   C CG    . ASP A 1 83  ? 133.91600 84.42300  116.91600 1.000 152.18490 ? 83  ASP A CG    1 
ATOM 360   O OD1   . ASP A 1 83  ? 134.83800 83.66600  116.54800 1.000 152.18490 ? 83  ASP A OD1   1 
ATOM 361   O OD2   . ASP A 1 83  ? 133.58400 84.51300  118.11400 1.000 152.18490 ? 83  ASP A OD2   1 
ATOM 362   N N     . PHE A 1 84  ? 130.48400 86.88200  116.60700 1.000 138.04830 ? 84  PHE A N     1 
ATOM 363   C CA    . PHE A 1 84  ? 129.25900 87.01100  117.37300 1.000 138.04830 ? 84  PHE A CA    1 
ATOM 364   C C     . PHE A 1 84  ? 128.29700 85.89300  117.02000 1.000 138.04830 ? 84  PHE A C     1 
ATOM 365   O O     . PHE A 1 84  ? 128.31800 85.35700  115.91000 1.000 138.04830 ? 84  PHE A O     1 
ATOM 366   C CB    . PHE A 1 84  ? 128.57400 88.35300  117.11700 1.000 138.04830 ? 84  PHE A CB    1 
ATOM 367   C CG    . PHE A 1 84  ? 129.04300 89.45600  118.01200 1.000 138.04830 ? 84  PHE A CG    1 
ATOM 368   C CD1   . PHE A 1 84  ? 130.07600 89.25600  118.90700 1.000 138.04830 ? 84  PHE A CD1   1 
ATOM 369   C CD2   . PHE A 1 84  ? 128.43300 90.69100  117.97100 1.000 138.04830 ? 84  PHE A CD2   1 
ATOM 370   C CE1   . PHE A 1 84  ? 130.50100 90.26800  119.73200 1.000 138.04830 ? 84  PHE A CE1   1 
ATOM 371   C CE2   . PHE A 1 84  ? 128.85200 91.70600  118.79700 1.000 138.04830 ? 84  PHE A CE2   1 
ATOM 372   C CZ    . PHE A 1 84  ? 129.88700 91.49600  119.67600 1.000 138.04830 ? 84  PHE A CZ    1 
ATOM 373   N N     . ASN A 1 85  ? 127.44400 85.55900  117.97400 1.000 136.02130 ? 85  ASN A N     1 
ATOM 374   C CA    . ASN A 1 85  ? 126.42600 84.55600  117.73900 1.000 136.02130 ? 85  ASN A CA    1 
ATOM 375   C C     . ASN A 1 85  ? 125.14900 85.22200  117.26100 1.000 136.02130 ? 85  ASN A C     1 
ATOM 376   O O     . ASN A 1 85  ? 124.97800 86.43800  117.35000 1.000 136.02130 ? 85  ASN A O     1 
ATOM 377   C CB    . ASN A 1 85  ? 126.16900 83.73700  118.99800 1.000 136.02130 ? 85  ASN A CB    1 
ATOM 378   C CG    . ASN A 1 85  ? 127.36000 82.90000  119.38500 1.000 136.02130 ? 85  ASN A CG    1 
ATOM 379   O OD1   . ASN A 1 85  ? 128.05300 82.36100  118.52600 1.000 136.02130 ? 85  ASN A OD1   1 
ATOM 380   N ND2   . ASN A 1 85  ? 127.61300 82.78900  120.68100 1.000 136.02130 ? 85  ASN A ND2   1 
ATOM 381   N N     . TRP A 1 86  ? 124.25600 84.40800  116.72100 1.000 129.26574 ? 86  TRP A N     1 
ATOM 382   C CA    . TRP A 1 86  ? 123.02400 84.91300  116.14600 1.000 129.26574 ? 86  TRP A CA    1 
ATOM 383   C C     . TRP A 1 86  ? 121.89800 83.96900  116.50700 1.000 129.26574 ? 86  TRP A C     1 
ATOM 384   O O     . TRP A 1 86  ? 121.99400 82.76700  116.25300 1.000 129.26574 ? 86  TRP A O     1 
ATOM 385   C CB    . TRP A 1 86  ? 123.15100 85.03000  114.63200 1.000 129.26574 ? 86  TRP A CB    1 
ATOM 386   C CG    . TRP A 1 86  ? 123.97400 86.17900  114.21800 1.000 129.26574 ? 86  TRP A CG    1 
ATOM 387   C CD1   . TRP A 1 86  ? 125.32800 86.22000  114.12100 1.000 129.26574 ? 86  TRP A CD1   1 
ATOM 388   C CD2   . TRP A 1 86  ? 123.50200 87.46200  113.81800 1.000 129.26574 ? 86  TRP A CD2   1 
ATOM 389   N NE1   . TRP A 1 86  ? 125.73400 87.45600  113.70000 1.000 129.26574 ? 86  TRP A NE1   1 
ATOM 390   C CE2   . TRP A 1 86  ? 124.62900 88.23800  113.50200 1.000 129.26574 ? 86  TRP A CE2   1 
ATOM 391   C CE3   . TRP A 1 86  ? 122.23600 88.03200  113.69800 1.000 129.26574 ? 86  TRP A CE3   1 
ATOM 392   C CZ2   . TRP A 1 86  ? 124.52900 89.55100  113.07800 1.000 129.26574 ? 86  TRP A CZ2   1 
ATOM 393   C CZ3   . TRP A 1 86  ? 122.13900 89.33400  113.27600 1.000 129.26574 ? 86  TRP A CZ3   1 
ATOM 394   C CH2   . TRP A 1 86  ? 123.27700 90.08100  112.97100 1.000 129.26574 ? 86  TRP A CH2   1 
ATOM 395   N N     . GLN A 1 87  ? 120.84700 84.51100  117.10900 1.000 128.46805 ? 87  GLN A N     1 
ATOM 396   C CA    . GLN A 1 87  ? 119.70600 83.70400  117.49700 1.000 128.46805 ? 87  GLN A CA    1 
ATOM 397   C C     . GLN A 1 87  ? 118.97100 83.18300  116.26700 1.000 128.46805 ? 87  GLN A C     1 
ATOM 398   O O     . GLN A 1 87  ? 119.13500 83.68100  115.15100 1.000 128.46805 ? 87  GLN A O     1 
ATOM 399   C CB    . GLN A 1 87  ? 118.76600 84.51800  118.37500 1.000 128.46805 ? 87  GLN A CB    1 
ATOM 400   C CG    . GLN A 1 87  ? 119.06500 84.38100  119.84700 1.000 128.46805 ? 87  GLN A CG    1 
ATOM 401   C CD    . GLN A 1 87  ? 117.94700 84.90300  120.71300 1.000 128.46805 ? 87  GLN A CD    1 
ATOM 402   O OE1   . GLN A 1 87  ? 117.02100 85.54700  120.22500 1.000 128.46805 ? 87  GLN A OE1   1 
ATOM 403   N NE2   . GLN A 1 87  ? 118.02900 84.63600  122.00800 1.000 128.46805 ? 87  GLN A NE2   1 
ATOM 404   N N     . ALA A 1 88  ? 118.14500 82.16400  116.49100 1.000 125.83896 ? 88  ALA A N     1 
ATOM 405   C CA    . ALA A 1 88  ? 117.42400 81.54500  115.38800 1.000 125.83896 ? 88  ALA A CA    1 
ATOM 406   C C     . ALA A 1 88  ? 116.34600 82.46200  114.83800 1.000 125.83896 ? 88  ALA A C     1 
ATOM 407   O O     . ALA A 1 88  ? 116.08400 82.45600  113.63200 1.000 125.83896 ? 88  ALA A O     1 
ATOM 408   C CB    . ALA A 1 88  ? 116.81600 80.21900  115.83500 1.000 125.83896 ? 88  ALA A CB    1 
ATOM 409   N N     . GLN A 1 89  ? 115.71800 83.25600  115.69700 1.000 117.35566 ? 89  GLN A N     1 
ATOM 410   C CA    . GLN A 1 89  ? 114.67300 84.15700  115.24100 1.000 117.35566 ? 89  GLN A CA    1 
ATOM 411   C C     . GLN A 1 89  ? 115.22000 85.47300  114.71500 1.000 117.35566 ? 89  GLN A C     1 
ATOM 412   O O     . GLN A 1 89  ? 114.52200 86.15100  113.95300 1.000 117.35566 ? 89  GLN A O     1 
ATOM 413   C CB    . GLN A 1 89  ? 113.68000 84.41500  116.36800 1.000 117.35566 ? 89  GLN A CB    1 
ATOM 414   C CG    . GLN A 1 89  ? 112.85500 83.20600  116.72200 1.000 117.35566 ? 89  GLN A CG    1 
ATOM 415   C CD    . GLN A 1 89  ? 111.89400 82.83000  115.61800 1.000 117.35566 ? 89  GLN A CD    1 
ATOM 416   O OE1   . GLN A 1 89  ? 110.83800 83.44200  115.46700 1.000 117.35566 ? 89  GLN A OE1   1 
ATOM 417   N NE2   . GLN A 1 89  ? 112.25300 81.82000  114.83700 1.000 117.35566 ? 89  GLN A NE2   1 
ATOM 418   N N     . ALA A 1 90  ? 116.43800 85.84700  115.11300 1.000 119.98294 ? 90  ALA A N     1 
ATOM 419   C CA    . ALA A 1 90  ? 117.02900 87.10300  114.66100 1.000 119.98294 ? 90  ALA A CA    1 
ATOM 420   C C     . ALA A 1 90  ? 117.26800 87.10000  113.16000 1.000 119.98294 ? 90  ALA A C     1 
ATOM 421   O O     . ALA A 1 90  ? 116.94000 88.07000  112.46700 1.000 119.98294 ? 90  ALA A O     1 
ATOM 422   C CB    . ALA A 1 90  ? 118.33500 87.35500  115.40500 1.000 119.98294 ? 90  ALA A CB    1 
ATOM 423   N N     . LEU A 1 91  ? 117.82800 86.00600  112.64100 1.000 117.38709 ? 91  LEU A N     1 
ATOM 424   C CA    . LEU A 1 91  ? 118.07200 85.89500  111.20900 1.000 117.38709 ? 91  LEU A CA    1 
ATOM 425   C C     . LEU A 1 91  ? 116.76900 85.86100  110.42800 1.000 117.38709 ? 91  LEU A C     1 
ATOM 426   O O     . LEU A 1 91  ? 116.67600 86.44100  109.34000 1.000 117.38709 ? 91  LEU A O     1 
ATOM 427   C CB    . LEU A 1 91  ? 118.90000 84.64900  110.92100 1.000 117.38709 ? 91  LEU A CB    1 
ATOM 428   C CG    . LEU A 1 91  ? 120.36900 84.79800  111.30400 1.000 117.38709 ? 91  LEU A CG    1 
ATOM 429   C CD1   . LEU A 1 91  ? 121.10200 83.48800  111.11000 1.000 117.38709 ? 91  LEU A CD1   1 
ATOM 430   C CD2   . LEU A 1 91  ? 121.02000 85.90600  110.50500 1.000 117.38709 ? 91  LEU A CD2   1 
ATOM 431   N N     . LEU A 1 92  ? 115.75000 85.20200  110.97900 1.000 117.32984 ? 92  LEU A N     1 
ATOM 432   C CA    . LEU A 1 92  ? 114.44500 85.15400  110.33200 1.000 117.32984 ? 92  LEU A CA    1 
ATOM 433   C C     . LEU A 1 92  ? 113.80500 86.53400  110.26300 1.000 117.32984 ? 92  LEU A C     1 
ATOM 434   O O     . LEU A 1 92  ? 113.27200 86.92500  109.21500 1.000 117.32984 ? 92  LEU A O     1 
ATOM 435   C CB    . LEU A 1 92  ? 113.53300 84.17900  111.07100 1.000 117.32984 ? 92  LEU A CB    1 
ATOM 436   C CG    . LEU A 1 92  ? 113.42800 82.76700  110.50100 1.000 117.32984 ? 92  LEU A CG    1 
ATOM 437   C CD1   . LEU A 1 92  ? 112.95000 82.82900  109.06600 1.000 117.32984 ? 92  LEU A CD1   1 
ATOM 438   C CD2   . LEU A 1 92  ? 114.75000 82.02200  110.59000 1.000 117.32984 ? 92  LEU A CD2   1 
ATOM 439   N N     . ALA A 1 93  ? 113.85500 87.28600  111.36700 1.000 117.27599 ? 93  ALA A N     1 
ATOM 440   C CA    . ALA A 1 93  ? 113.29900 88.63500  111.38200 1.000 117.27599 ? 93  ALA A CA    1 
ATOM 441   C C     . ALA A 1 93  ? 114.06500 89.55600  110.44300 1.000 117.27599 ? 93  ALA A C     1 
ATOM 442   O O     . ALA A 1 93  ? 113.46700 90.40600  109.77100 1.000 117.27599 ? 93  ALA A O     1 
ATOM 443   C CB    . ALA A 1 93  ? 113.30900 89.18600  112.80400 1.000 117.27599 ? 93  ALA A CB    1 
ATOM 444   N N     . LEU A 1 94  ? 115.38700 89.38300  110.37700 1.000 117.36647 ? 94  LEU A N     1 
ATOM 445   C CA    . LEU A 1 94  ? 116.21000 90.16800  109.46700 1.000 117.36647 ? 94  LEU A CA    1 
ATOM 446   C C     . LEU A 1 94  ? 115.84800 89.89500  108.01700 1.000 117.36647 ? 94  LEU A C     1 
ATOM 447   O O     . LEU A 1 94  ? 115.71500 90.82600  107.21500 1.000 117.36647 ? 94  LEU A O     1 
ATOM 448   C CB    . LEU A 1 94  ? 117.68100 89.85200  109.71000 1.000 117.36647 ? 94  LEU A CB    1 
ATOM 449   C CG    . LEU A 1 94  ? 118.68300 90.88400  109.22000 1.000 117.36647 ? 94  LEU A CG    1 
ATOM 450   C CD1   . LEU A 1 94  ? 118.35900 92.23700  109.79300 1.000 117.36647 ? 94  LEU A CD1   1 
ATOM 451   C CD2   . LEU A 1 94  ? 120.06800 90.45600  109.63100 1.000 117.36647 ? 94  LEU A CD2   1 
ATOM 452   N N     . GLN A 1 95  ? 115.68500 88.61700  107.66800 1.000 122.73026 ? 95  GLN A N     1 
ATOM 453   C CA    . GLN A 1 95  ? 115.31600 88.25300  106.30500 1.000 122.73026 ? 95  GLN A CA    1 
ATOM 454   C C     . GLN A 1 95  ? 113.93100 88.76800  105.94800 1.000 122.73026 ? 95  GLN A C     1 
ATOM 455   O O     . GLN A 1 95  ? 113.70400 89.22100  104.81800 1.000 122.73026 ? 95  GLN A O     1 
ATOM 456   C CB    . GLN A 1 95  ? 115.40400 86.74300  106.12900 1.000 122.73026 ? 95  GLN A CB    1 
ATOM 457   C CG    . GLN A 1 95  ? 115.84700 86.33600  104.74500 1.000 122.73026 ? 95  GLN A CG    1 
ATOM 458   C CD    . GLN A 1 95  ? 116.04600 84.84900  104.61700 1.000 122.73026 ? 95  GLN A CD    1 
ATOM 459   O OE1   . GLN A 1 95  ? 116.54900 84.20100  105.53100 1.000 122.73026 ? 95  GLN A OE1   1 
ATOM 460   N NE2   . GLN A 1 95  ? 115.65400 84.29400  103.47800 1.000 122.73026 ? 95  GLN A NE2   1 
ATOM 461   N N     . GLU A 1 96  ? 113.00000 88.71700  106.90200 1.000 122.88348 ? 96  GLU A N     1 
ATOM 462   C CA    . GLU A 1 96  ? 111.65400 89.23100  106.66900 1.000 122.88348 ? 96  GLU A CA    1 
ATOM 463   C C     . GLU A 1 96  ? 111.66600 90.73400  106.41600 1.000 122.88348 ? 96  GLU A C     1 
ATOM 464   O O     . GLU A 1 96  ? 111.02200 91.22100  105.47600 1.000 122.88348 ? 96  GLU A O     1 
ATOM 465   C CB    . GLU A 1 96  ? 110.75900 88.89600  107.85700 1.000 122.88348 ? 96  GLU A CB    1 
ATOM 466   C CG    . GLU A 1 96  ? 109.32400 89.32500  107.66100 1.000 122.88348 ? 96  GLU A CG    1 
ATOM 467   C CD    . GLU A 1 96  ? 108.52900 88.31900  106.86300 1.000 122.88348 ? 96  GLU A CD    1 
ATOM 468   O OE1   . GLU A 1 96  ? 108.94400 87.14500  106.81200 1.000 122.88348 ? 96  GLU A OE1   1 
ATOM 469   O OE2   . GLU A 1 96  ? 107.48400 88.69600  106.29400 1.000 122.88348 ? 96  GLU A OE2   1 
ATOM 470   N N     . ALA A 1 97  ? 112.39100 91.48100  107.25300 1.000 119.48922 ? 97  ALA A N     1 
ATOM 471   C CA    . ALA A 1 97  ? 112.48900 92.92700  107.07600 1.000 119.48922 ? 97  ALA A CA    1 
ATOM 472   C C     . ALA A 1 97  ? 113.15800 93.28600  105.75900 1.000 119.48922 ? 97  ALA A C     1 
ATOM 473   O O     . ALA A 1 97  ? 112.72000 94.21600  105.06800 1.000 119.48922 ? 97  ALA A O     1 
ATOM 474   C CB    . ALA A 1 97  ? 113.25600 93.54300  108.23900 1.000 119.48922 ? 97  ALA A CB    1 
ATOM 475   N N     . ALA A 1 98  ? 114.20800 92.54500  105.39400 1.000 122.62577 ? 98  ALA A N     1 
ATOM 476   C CA    . ALA A 1 98  ? 114.92600 92.81100  104.15300 1.000 122.62577 ? 98  ALA A CA    1 
ATOM 477   C C     . ALA A 1 98  ? 114.04200 92.57100  102.93800 1.000 122.62577 ? 98  ALA A C     1 
ATOM 478   O O     . ALA A 1 98  ? 114.00100 93.39900  102.01900 1.000 122.62577 ? 98  ALA A O     1 
ATOM 479   C CB    . ALA A 1 98  ? 116.18300 91.95200  104.08200 1.000 122.62577 ? 98  ALA A CB    1 
ATOM 480   N N     . GLU A 1 99  ? 113.32300 91.44300  102.91600 1.000 132.01322 ? 99  GLU A N     1 
ATOM 481   C CA    . GLU A 1 99  ? 112.46500 91.16800  101.77000 1.000 132.01322 ? 99  GLU A CA    1 
ATOM 482   C C     . GLU A 1 99  ? 111.29000 92.13600  101.69600 1.000 132.01322 ? 99  GLU A C     1 
ATOM 483   O O     . GLU A 1 99  ? 110.87900 92.50300  100.59200 1.000 132.01322 ? 99  GLU A O     1 
ATOM 484   C CB    . GLU A 1 99  ? 111.98800 89.71000  101.77000 1.000 132.01322 ? 99  GLU A CB    1 
ATOM 485   C CG    . GLU A 1 99  ? 110.99700 89.30700  102.84800 1.000 132.01322 ? 99  GLU A CG    1 
ATOM 486   C CD    . GLU A 1 99  ? 109.55200 89.43500  102.39600 1.000 132.01322 ? 99  GLU A CD    1 
ATOM 487   O OE1   . GLU A 1 99  ? 108.64600 89.37800  103.25300 1.000 132.01322 ? 99  GLU A OE1   1 
ATOM 488   O OE2   . GLU A 1 99  ? 109.32900 89.63300  101.18500 1.000 132.01322 ? 99  GLU A OE2   1 
ATOM 489   N N     . ALA A 1 100 ? 110.75000 92.56900  102.84100 1.000 126.96614 ? 100 ALA A N     1 
ATOM 490   C CA    . ALA A 1 100 ? 109.66100 93.54100  102.82500 1.000 126.96614 ? 100 ALA A CA    1 
ATOM 491   C C     . ALA A 1 100 ? 110.12700 94.87900  102.26900 1.000 126.96614 ? 100 ALA A C     1 
ATOM 492   O O     . ALA A 1 100 ? 109.44400 95.48800  101.43300 1.000 126.96614 ? 100 ALA A O     1 
ATOM 493   C CB    . ALA A 1 100 ? 109.08600 93.71000  104.22800 1.000 126.96614 ? 100 ALA A CB    1 
ATOM 494   N N     . PHE A 1 101 ? 111.28500 95.35400  102.74000 1.000 120.24159 ? 101 PHE A N     1 
ATOM 495   C CA    . PHE A 1 101 ? 111.84300 96.60600  102.24400 1.000 120.24159 ? 101 PHE A CA    1 
ATOM 496   C C     . PHE A 1 101 ? 112.14700 96.52700  100.75300 1.000 120.24159 ? 101 PHE A C     1 
ATOM 497   O O     . PHE A 1 101 ? 111.85500 97.46700  100.00100 1.000 120.24159 ? 101 PHE A O     1 
ATOM 498   C CB    . PHE A 1 101 ? 113.09800 96.95000  103.04000 1.000 120.24159 ? 101 PHE A CB    1 
ATOM 499   C CG    . PHE A 1 101 ? 113.89100 98.06700  102.45900 1.000 120.24159 ? 101 PHE A CG    1 
ATOM 500   C CD1   . PHE A 1 101 ? 113.42100 99.36400  102.52300 1.000 120.24159 ? 101 PHE A CD1   1 
ATOM 501   C CD2   . PHE A 1 101 ? 115.11200 97.82700  101.86300 1.000 120.24159 ? 101 PHE A CD2   1 
ATOM 502   C CE1   . PHE A 1 101 ? 114.15000 100.39900 101.99400 1.000 120.24159 ? 101 PHE A CE1   1 
ATOM 503   C CE2   . PHE A 1 101 ? 115.84700 98.85700  101.33400 1.000 120.24159 ? 101 PHE A CE2   1 
ATOM 504   C CZ    . PHE A 1 101 ? 115.36500 100.14600 101.39900 1.000 120.24159 ? 101 PHE A CZ    1 
ATOM 505   N N     . LEU A 1 102 ? 112.69200 95.39400  100.30200 1.000 122.48258 ? 102 LEU A N     1 
ATOM 506   C CA    . LEU A 1 102 ? 113.03800 95.24600  98.89400  1.000 122.48258 ? 102 LEU A CA    1 
ATOM 507   C C     . LEU A 1 102 ? 111.80200 95.17800  98.01000  1.000 122.48258 ? 102 LEU A C     1 
ATOM 508   O O     . LEU A 1 102 ? 111.77700 95.78500  96.93100  1.000 122.48258 ? 102 LEU A O     1 
ATOM 509   C CB    . LEU A 1 102 ? 113.90000 94.00700  98.69300  1.000 122.48258 ? 102 LEU A CB    1 
ATOM 510   C CG    . LEU A 1 102 ? 115.39100 94.27900  98.53100  1.000 122.48258 ? 102 LEU A CG    1 
ATOM 511   C CD1   . LEU A 1 102 ? 115.59800 95.15300  97.31600  1.000 122.48258 ? 102 LEU A CD1   1 
ATOM 512   C CD2   . LEU A 1 102 ? 115.98300 94.93200  99.75800  1.000 122.48258 ? 102 LEU A CD2   1 
ATOM 513   N N     . VAL A 1 103 ? 110.76800 94.45000  98.44400  1.000 125.49576 ? 103 VAL A N     1 
ATOM 514   C CA    . VAL A 1 103 ? 109.56400 94.35500  97.63000  1.000 125.49576 ? 103 VAL A CA    1 
ATOM 515   C C     . VAL A 1 103 ? 108.83400 95.69300  97.58700  1.000 125.49576 ? 103 VAL A C     1 
ATOM 516   O O     . VAL A 1 103 ? 108.25900 96.05000  96.55100  1.000 125.49576 ? 103 VAL A O     1 
ATOM 517   C CB    . VAL A 1 103 ? 108.66800 93.18100  98.09500  1.000 125.49576 ? 103 VAL A CB    1 
ATOM 518   C CG1   . VAL A 1 103 ? 107.92600 93.45300  99.38500  1.000 125.49576 ? 103 VAL A CG1   1 
ATOM 519   C CG2   . VAL A 1 103 ? 107.67900 92.82800  97.02500  1.000 125.49576 ? 103 VAL A CG2   1 
ATOM 520   N N     . HIS A 1 104 ? 108.88700 96.48000  98.67100  1.000 128.07810 ? 104 HIS A N     1 
ATOM 521   C CA    . HIS A 1 104 ? 108.28600 97.80800  98.62700  1.000 128.07810 ? 104 HIS A CA    1 
ATOM 522   C C     . HIS A 1 104 ? 109.05200 98.73400  97.69800  1.000 128.07810 ? 104 HIS A C     1 
ATOM 523   O O     . HIS A 1 104 ? 108.44000 99.51200  96.95600  1.000 128.07810 ? 104 HIS A O     1 
ATOM 524   C CB    . HIS A 1 104 ? 108.17100 98.39000  100.02600 1.000 128.07810 ? 104 HIS A CB    1 
ATOM 525   C CG    . HIS A 1 104 ? 106.84900 98.11200  100.66000 1.000 128.07810 ? 104 HIS A CG    1 
ATOM 526   N ND1   . HIS A 1 104 ? 106.59200 96.96200  101.37200 1.000 128.07810 ? 104 HIS A ND1   1 
ATOM 527   C CD2   . HIS A 1 104 ? 105.69400 98.81700  100.65300 1.000 128.07810 ? 104 HIS A CD2   1 
ATOM 528   C CE1   . HIS A 1 104 ? 105.34000 96.97800  101.79400 1.000 128.07810 ? 104 HIS A CE1   1 
ATOM 529   N NE2   . HIS A 1 104 ? 104.77400 98.09400  101.37200 1.000 128.07810 ? 104 HIS A NE2   1 
ATOM 530   N N     . LEU A 1 105 ? 110.38400 98.66100  97.72600  1.000 123.15885 ? 105 LEU A N     1 
ATOM 531   C CA    . LEU A 1 105 ? 111.18800 99.46300  96.81200  1.000 123.15885 ? 105 LEU A CA    1 
ATOM 532   C C     . LEU A 1 105 ? 110.90700 99.10700  95.35800  1.000 123.15885 ? 105 LEU A C     1 
ATOM 533   O O     . LEU A 1 105 ? 110.78500 99.99800  94.50900  1.000 123.15885 ? 105 LEU A O     1 
ATOM 534   C CB    . LEU A 1 105 ? 112.66800 99.27500  97.12200  1.000 123.15885 ? 105 LEU A CB    1 
ATOM 535   C CG    . LEU A 1 105 ? 113.61900 100.10300 96.26500  1.000 123.15885 ? 105 LEU A CG    1 
ATOM 536   C CD1   . LEU A 1 105 ? 113.30400 101.57300 96.39800  1.000 123.15885 ? 105 LEU A CD1   1 
ATOM 537   C CD2   . LEU A 1 105 ? 115.05200 99.83000  96.65900  1.000 123.15885 ? 105 LEU A CD2   1 
ATOM 538   N N     . PHE A 1 106 ? 110.76400 97.81500  95.06000  1.000 122.42913 ? 106 PHE A N     1 
ATOM 539   C CA    . PHE A 1 106 ? 110.49700 97.41000  93.68300  1.000 122.42913 ? 106 PHE A CA    1 
ATOM 540   C C     . PHE A 1 106 ? 109.10300 97.81500  93.22000  1.000 122.42913 ? 106 PHE A C     1 
ATOM 541   O O     . PHE A 1 106 ? 108.94500 98.29900  92.09100  1.000 122.42913 ? 106 PHE A O     1 
ATOM 542   C CB    . PHE A 1 106 ? 110.69000 95.90800  93.52600  1.000 122.42913 ? 106 PHE A CB    1 
ATOM 543   C CG    . PHE A 1 106 ? 112.10800 95.51200  93.29400  1.000 122.42913 ? 106 PHE A CG    1 
ATOM 544   C CD1   . PHE A 1 106 ? 113.03000 96.43800  92.84400  1.000 122.42913 ? 106 PHE A CD1   1 
ATOM 545   C CD2   . PHE A 1 106 ? 112.51800 94.21100  93.50700  1.000 122.42913 ? 106 PHE A CD2   1 
ATOM 546   C CE1   . PHE A 1 106 ? 114.33800 96.07900  92.62400  1.000 122.42913 ? 106 PHE A CE1   1 
ATOM 547   C CE2   . PHE A 1 106 ? 113.82500 93.84400  93.28600  1.000 122.42913 ? 106 PHE A CE2   1 
ATOM 548   C CZ    . PHE A 1 106 ? 114.73700 94.78000  92.84500  1.000 122.42913 ? 106 PHE A CZ    1 
ATOM 549   N N     . GLU A 1 107 ? 108.08200 97.62700  94.06500  1.000 135.71538 ? 107 GLU A N     1 
ATOM 550   C CA    . GLU A 1 107 ? 106.73800 98.03800  93.66900  1.000 135.71538 ? 107 GLU A CA    1 
ATOM 551   C C     . GLU A 1 107 ? 106.63600 99.55100  93.53200  1.000 135.71538 ? 107 GLU A C     1 
ATOM 552   O O     . GLU A 1 107 ? 105.85600 100.03900 92.71000  1.000 135.71538 ? 107 GLU A O     1 
ATOM 553   C CB    . GLU A 1 107 ? 105.67800 97.48400  94.62600  1.000 135.71538 ? 107 GLU A CB    1 
ATOM 554   C CG    . GLU A 1 107 ? 105.69000 98.00900  96.03800  1.000 135.71538 ? 107 GLU A CG    1 
ATOM 555   C CD    . GLU A 1 107 ? 104.74200 99.16400  96.24400  1.000 135.71538 ? 107 GLU A CD    1 
ATOM 556   O OE1   . GLU A 1 107 ? 104.80700 99.80100  97.31500  1.000 135.71538 ? 107 GLU A OE1   1 
ATOM 557   O OE2   . GLU A 1 107 ? 103.93400 99.43400  95.33400  1.000 135.71538 ? 107 GLU A OE2   1 
ATOM 558   N N     . ASP A 1 108 ? 107.40400 100.31200 94.31600  1.000 141.48660 ? 108 ASP A N     1 
ATOM 559   C CA    . ASP A 1 108 ? 107.35900 101.75300 94.13000  1.000 141.48660 ? 108 ASP A CA    1 
ATOM 560   C C     . ASP A 1 108 ? 108.14900 102.19300 92.90600  1.000 141.48660 ? 108 ASP A C     1 
ATOM 561   O O     . ASP A 1 108 ? 107.75200 103.15000 92.23700  1.000 141.48660 ? 108 ASP A O     1 
ATOM 562   C CB    . ASP A 1 108 ? 107.88700 102.47700 95.36700  1.000 141.48660 ? 108 ASP A CB    1 
ATOM 563   C CG    . ASP A 1 108 ? 106.87800 102.51700 96.49100  1.000 141.48660 ? 108 ASP A CG    1 
ATOM 564   O OD1   . ASP A 1 108 ? 107.18400 102.01500 97.59200  1.000 141.48660 ? 108 ASP A OD1   1 
ATOM 565   O OD2   . ASP A 1 108 ? 105.77100 103.04900 96.27300  1.000 141.48660 ? 108 ASP A OD2   1 
ATOM 566   N N     . ALA A 1 109 ? 109.22700 101.48700 92.56300  1.000 131.54285 ? 109 ALA A N     1 
ATOM 567   C CA    . ALA A 1 109 ? 109.97800 101.86400 91.37400  1.000 131.54285 ? 109 ALA A CA    1 
ATOM 568   C C     . ALA A 1 109 ? 109.24200 101.48200 90.10200  1.000 131.54285 ? 109 ALA A C     1 
ATOM 569   O O     . ALA A 1 109 ? 109.46800 102.09700 89.05000  1.000 131.54285 ? 109 ALA A O     1 
ATOM 570   C CB    . ALA A 1 109 ? 111.36000 101.21900 91.39800  1.000 131.54285 ? 109 ALA A CB    1 
ATOM 571   N N     . TYR A 1 110 ? 108.37200 100.47100 90.17900  1.000 136.10771 ? 110 TYR A N     1 
ATOM 572   C CA    . TYR A 1 110 ? 107.57100 100.10000 89.01800  1.000 136.10771 ? 110 TYR A CA    1 
ATOM 573   C C     . TYR A 1 110 ? 106.64800 101.22500 88.57400  1.000 136.10771 ? 110 TYR A C     1 
ATOM 574   O O     . TYR A 1 110 ? 106.39900 101.37800 87.37200  1.000 136.10771 ? 110 TYR A O     1 
ATOM 575   C CB    . TYR A 1 110 ? 106.75300 98.84700  89.29000  1.000 136.10771 ? 110 TYR A CB    1 
ATOM 576   C CG    . TYR A 1 110 ? 106.31700 98.19900  88.00700  1.000 136.10771 ? 110 TYR A CG    1 
ATOM 577   C CD1   . TYR A 1 110 ? 107.23600 97.93400  87.00600  1.000 136.10771 ? 110 TYR A CD1   1 
ATOM 578   C CD2   . TYR A 1 110 ? 104.98600 97.89300  87.77500  1.000 136.10771 ? 110 TYR A CD2   1 
ATOM 579   C CE1   . TYR A 1 110 ? 106.85400 97.35600  85.82200  1.000 136.10771 ? 110 TYR A CE1   1 
ATOM 580   C CE2   . TYR A 1 110 ? 104.58900 97.31400  86.58900  1.000 136.10771 ? 110 TYR A CE2   1 
ATOM 581   C CZ    . TYR A 1 110 ? 105.52800 97.04800  85.61700  1.000 136.10771 ? 110 TYR A CZ    1 
ATOM 582   O OH    . TYR A 1 110 ? 105.13600 96.46900  84.43400  1.000 136.10771 ? 110 TYR A OH    1 
ATOM 583   N N     . LEU A 1 111 ? 106.13800 102.01600 89.52200  1.000 132.73489 ? 111 LEU A N     1 
ATOM 584   C CA    . LEU A 1 111 ? 105.31700 103.16700 89.16900  1.000 132.73489 ? 111 LEU A CA    1 
ATOM 585   C C     . LEU A 1 111 ? 106.12200 104.19000 88.38600  1.000 132.73489 ? 111 LEU A C     1 
ATOM 586   O O     . LEU A 1 111 ? 105.62000 104.78100 87.42400  1.000 132.73489 ? 111 LEU A O     1 
ATOM 587   C CB    . LEU A 1 111 ? 104.73000 103.80200 90.42300  1.000 132.73489 ? 111 LEU A CB    1 
ATOM 588   C CG    . LEU A 1 111 ? 103.87800 102.87300 91.27800  1.000 132.73489 ? 111 LEU A CG    1 
ATOM 589   C CD1   . LEU A 1 111 ? 103.36100 103.60500 92.49900  1.000 132.73489 ? 111 LEU A CD1   1 
ATOM 590   C CD2   . LEU A 1 111 ? 102.73000 102.34000 90.45200  1.000 132.73489 ? 111 LEU A CD2   1 
ATOM 591   N N     . LEU A 1 112 ? 107.37100 104.41400 88.79000  1.000 134.17711 ? 112 LEU A N     1 
ATOM 592   C CA    . LEU A 1 112 ? 108.22700 105.34300 88.06600  1.000 134.17711 ? 112 LEU A CA    1 
ATOM 593   C C     . LEU A 1 112 ? 108.56000 104.83000 86.67300  1.000 134.17711 ? 112 LEU A C     1 
ATOM 594   O O     . LEU A 1 112 ? 108.65000 105.61900 85.72500  1.000 134.17711 ? 112 LEU A O     1 
ATOM 595   C CB    . LEU A 1 112 ? 109.50400 105.59700 88.85500  1.000 134.17711 ? 112 LEU A CB    1 
ATOM 596   C CG    . LEU A 1 112 ? 109.31900 106.46000 90.09600  1.000 134.17711 ? 112 LEU A CG    1 
ATOM 597   C CD1   . LEU A 1 112 ? 110.64700 106.70100 90.78100  1.000 134.17711 ? 112 LEU A CD1   1 
ATOM 598   C CD2   . LEU A 1 112 ? 108.67700 107.77000 89.71400  1.000 134.17711 ? 112 LEU A CD2   1 
ATOM 599   N N     . THR A 1 113 ? 108.74900 103.51700 86.53100  1.000 137.13964 ? 113 THR A N     1 
ATOM 600   C CA    . THR A 1 113 ? 109.01900 102.96800 85.20300  1.000 137.13964 ? 113 THR A CA    1 
ATOM 601   C C     . THR A 1 113 ? 107.80100 103.07300 84.29800  1.000 137.13964 ? 113 THR A C     1 
ATOM 602   O O     . THR A 1 113 ? 107.93900 103.33900 83.10000  1.000 137.13964 ? 113 THR A O     1 
ATOM 603   C CB    . THR A 1 113 ? 109.47400 101.52200 85.29900  1.000 137.13964 ? 113 THR A CB    1 
ATOM 604   O OG1   . THR A 1 113 ? 108.45800 100.74600 85.93900  1.000 137.13964 ? 113 THR A OG1   1 
ATOM 605   C CG2   . THR A 1 113 ? 110.74500 101.44900 86.10000  1.000 137.13964 ? 113 THR A CG2   1 
ATOM 606   N N     . LEU A 1 114 ? 106.60500 102.85500 84.84500  1.000 138.70398 ? 114 LEU A N     1 
ATOM 607   C CA    . LEU A 1 114 ? 105.40500 103.03100 84.03700  1.000 138.70398 ? 114 LEU A CA    1 
ATOM 608   C C     . LEU A 1 114 ? 105.16100 104.49700 83.72300  1.000 138.70398 ? 114 LEU A C     1 
ATOM 609   O O     . LEU A 1 114 ? 104.54000 104.81800 82.70400  1.000 138.70398 ? 114 LEU A O     1 
ATOM 610   C CB    . LEU A 1 114 ? 104.18800 102.44800 84.74300  1.000 138.70398 ? 114 LEU A CB    1 
ATOM 611   C CG    . LEU A 1 114 ? 104.19700 100.94000 84.93300  1.000 138.70398 ? 114 LEU A CG    1 
ATOM 612   C CD1   . LEU A 1 114 ? 103.01700 100.52500 85.77100  1.000 138.70398 ? 114 LEU A CD1   1 
ATOM 613   C CD2   . LEU A 1 114 ? 104.14600 100.27200 83.58200  1.000 138.70398 ? 114 LEU A CD2   1 
ATOM 614   N N     . HIS A 1 115 ? 105.64300 105.39300 84.58200  1.000 139.01973 ? 115 HIS A N     1 
ATOM 615   C CA    . HIS A 1 115 ? 105.47800 106.81500 84.33000  1.000 139.01973 ? 115 HIS A CA    1 
ATOM 616   C C     . HIS A 1 115 ? 106.34700 107.27700 83.17300  1.000 139.01973 ? 115 HIS A C     1 
ATOM 617   O O     . HIS A 1 115 ? 105.97600 108.20700 82.45200  1.000 139.01973 ? 115 HIS A O     1 
ATOM 618   C CB    . HIS A 1 115 ? 105.81000 107.59700 85.59300  1.000 139.01973 ? 115 HIS A CB    1 
ATOM 619   C CG    . HIS A 1 115 ? 105.78000 109.07900 85.41300  1.000 139.01973 ? 115 HIS A CG    1 
ATOM 620   N ND1   . HIS A 1 115 ? 106.84200 109.89000 85.74600  1.000 139.01973 ? 115 HIS A ND1   1 
ATOM 621   C CD2   . HIS A 1 115 ? 104.81500 109.89800 84.93700  1.000 139.01973 ? 115 HIS A CD2   1 
ATOM 622   C CE1   . HIS A 1 115 ? 106.53200 111.14700 85.48300  1.000 139.01973 ? 115 HIS A CE1   1 
ATOM 623   N NE2   . HIS A 1 115 ? 105.30700 111.17900 84.99100  1.000 139.01973 ? 115 HIS A NE2   1 
ATOM 624   N N     . ALA A 1 116 ? 107.48300 106.62500 82.95700  1.000 140.50856 ? 116 ALA A N     1 
ATOM 625   C CA    . ALA A 1 116 ? 108.36900 107.01300 81.87200  1.000 140.50856 ? 116 ALA A CA    1 
ATOM 626   C C     . ALA A 1 116 ? 107.91400 106.48800 80.51900  1.000 140.50856 ? 116 ALA A C     1 
ATOM 627   O O     . ALA A 1 116 ? 108.59500 106.73300 79.52000  1.000 140.50856 ? 116 ALA A O     1 
ATOM 628   C CB    . ALA A 1 116 ? 109.79300 106.53700 82.15600  1.000 140.50856 ? 116 ALA A CB    1 
ATOM 629   N N     . GLY A 1 117 ? 106.79400 105.77300 80.45600  1.000 142.32713 ? 117 GLY A N     1 
ATOM 630   C CA    . GLY A 1 117 ? 106.29300 105.25800 79.20500  1.000 142.32713 ? 117 GLY A CA    1 
ATOM 631   C C     . GLY A 1 117 ? 106.88000 103.94200 78.75200  1.000 142.32713 ? 117 GLY A C     1 
ATOM 632   O O     . GLY A 1 117 ? 106.55000 103.48700 77.65100  1.000 142.32713 ? 117 GLY A O     1 
ATOM 633   N N     . ARG A 1 118 ? 107.73400 103.31500 79.54700  1.000 146.18645 ? 118 ARG A N     1 
ATOM 634   C CA    . ARG A 1 118 ? 108.33100 102.03500 79.19800  1.000 146.18645 ? 118 ARG A CA    1 
ATOM 635   C C     . ARG A 1 118 ? 107.86400 100.98700 80.19600  1.000 146.18645 ? 118 ARG A C     1 
ATOM 636   O O     . ARG A 1 118 ? 107.05800 101.26600 81.08300  1.000 146.18645 ? 118 ARG A O     1 
ATOM 637   C CB    . ARG A 1 118 ? 109.85600 102.12800 79.16200  1.000 146.18645 ? 118 ARG A CB    1 
ATOM 638   C CG    . ARG A 1 118 ? 110.43800 102.98800 80.24700  1.000 146.18645 ? 118 ARG A CG    1 
ATOM 639   C CD    . ARG A 1 118 ? 111.91900 102.72700 80.41100  1.000 146.18645 ? 118 ARG A CD    1 
ATOM 640   N NE    . ARG A 1 118 ? 112.57500 103.83200 81.09800  1.000 146.18645 ? 118 ARG A NE    1 
ATOM 641   C CZ    . ARG A 1 118 ? 112.63400 103.95900 82.41800  1.000 146.18645 ? 118 ARG A CZ    1 
ATOM 642   N NH1   . ARG A 1 118 ? 112.07200 103.04900 83.20200  1.000 146.18645 ? 118 ARG A NH1   1 
ATOM 643   N NH2   . ARG A 1 118 ? 113.25100 104.99900 82.95800  1.000 146.18645 ? 118 ARG A NH2   1 
ATOM 644   N N     . VAL A 1 119 ? 108.36600 99.76600  80.04300  1.000 138.31553 ? 119 VAL A N     1 
ATOM 645   C CA    . VAL A 1 119 ? 107.97200 98.68000  80.92800  1.000 138.31553 ? 119 VAL A CA    1 
ATOM 646   C C     . VAL A 1 119 ? 109.15400 97.99900  81.61500  1.000 138.31553 ? 119 VAL A C     1 
ATOM 647   O O     . VAL A 1 119 ? 108.96400 97.38300  82.67500  1.000 138.31553 ? 119 VAL A O     1 
ATOM 648   C CB    . VAL A 1 119 ? 107.10400 97.64900  80.17000  1.000 138.31553 ? 119 VAL A CB    1 
ATOM 649   C CG1   . VAL A 1 119 ? 107.94400 96.66500  79.37900  1.000 138.31553 ? 119 VAL A CG1   1 
ATOM 650   C CG2   . VAL A 1 119 ? 106.13900 96.94400  81.10700  1.000 138.31553 ? 119 VAL A CG2   1 
ATOM 651   N N     . THR A 1 120 ? 110.37100 98.11200  81.09600  1.000 137.43257 ? 120 THR A N     1 
ATOM 652   C CA    . THR A 1 120 ? 111.52600 97.50500  81.73600  1.000 137.43257 ? 120 THR A CA    1 
ATOM 653   C C     . THR A 1 120 ? 112.02400 98.37200  82.88500  1.000 137.43257 ? 120 THR A C     1 
ATOM 654   O O     . THR A 1 120 ? 111.80500 99.58400  82.91500  1.000 137.43257 ? 120 THR A O     1 
ATOM 655   C CB    . THR A 1 120 ? 112.65200 97.29200  80.73000  1.000 137.43257 ? 120 THR A CB    1 
ATOM 656   O OG1   . THR A 1 120 ? 113.13400 98.56300  80.28100  1.000 137.43257 ? 120 THR A OG1   1 
ATOM 657   C CG2   . THR A 1 120 ? 112.15200 96.49500  79.54700  1.000 137.43257 ? 120 THR A CG2   1 
ATOM 658   N N     . LEU A 1 121 ? 112.70000 97.73600  83.83700  1.000 130.43287 ? 121 LEU A N     1 
ATOM 659   C CA    . LEU A 1 121 ? 113.23500 98.42500  85.00400  1.000 130.43287 ? 121 LEU A CA    1 
ATOM 660   C C     . LEU A 1 121 ? 114.68000 98.82800  84.77500  1.000 130.43287 ? 121 LEU A C     1 
ATOM 661   O O     . LEU A 1 121 ? 115.50400 98.00500  84.37400  1.000 130.43287 ? 121 LEU A O     1 
ATOM 662   C CB    . LEU A 1 121 ? 113.16100 97.54600  86.24600  1.000 130.43287 ? 121 LEU A CB    1 
ATOM 663   C CG    . LEU A 1 121 ? 112.13200 97.99500  87.26000  1.000 130.43287 ? 121 LEU A CG    1 
ATOM 664   C CD1   . LEU A 1 121 ? 110.78400 97.83100  86.65300  1.000 130.43287 ? 121 LEU A CD1   1 
ATOM 665   C CD2   . LEU A 1 121 ? 112.26200 97.16700  88.51500  1.000 130.43287 ? 121 LEU A CD2   1 
ATOM 666   N N     . PHE A 1 122 ? 114.98200 100.06700 85.04200  1.000 137.12601 ? 122 PHE A N     1 
ATOM 667   C CA    . PHE A 1 122 ? 116.33800 100.53800 84.89100  1.000 137.12601 ? 122 PHE A CA    1 
ATOM 668   C C     . PHE A 1 122 ? 116.89200 100.92400 86.25500  1.000 137.12601 ? 122 PHE A C     1 
ATOM 669   O O     . PHE A 1 122 ? 116.12300 101.28900 87.14900  1.000 137.12601 ? 122 PHE A O     1 
ATOM 670   C CB    . PHE A 1 122 ? 116.39000 101.73600 83.93500  1.000 137.12601 ? 122 PHE A CB    1 
ATOM 671   C CG    . PHE A 1 122 ? 116.17000 101.37100 82.49800  1.000 137.12601 ? 122 PHE A CG    1 
ATOM 672   C CD1   . PHE A 1 122 ? 116.40100 100.08200 82.05400  1.000 137.12601 ? 122 PHE A CD1   1 
ATOM 673   C CD2   . PHE A 1 122 ? 115.71800 102.31700 81.59500  1.000 137.12601 ? 122 PHE A CD2   1 
ATOM 674   C CE1   . PHE A 1 122 ? 116.19600 99.74300  80.73500  1.000 137.12601 ? 122 PHE A CE1   1 
ATOM 675   C CE2   . PHE A 1 122 ? 115.50900 101.98400 80.27300  1.000 137.12601 ? 122 PHE A CE2   1 
ATOM 676   C CZ    . PHE A 1 122 ? 115.74900 100.69300 79.84400  1.000 137.12601 ? 122 PHE A CZ    1 
ATOM 677   N N     . PRO A 1 123 ? 118.20700 100.80700 86.46700  1.000 139.08051 ? 123 PRO A N     1 
ATOM 678   C CA    . PRO A 1 123 ? 118.77600 101.19600 87.76800  1.000 139.08051 ? 123 PRO A CA    1 
ATOM 679   C C     . PRO A 1 123 ? 118.61900 102.66800 88.09800  1.000 139.08051 ? 123 PRO A C     1 
ATOM 680   O O     . PRO A 1 123 ? 118.57200 103.02300 89.28400  1.000 139.08051 ? 123 PRO A O     1 
ATOM 681   C CB    . PRO A 1 123 ? 120.25200 100.80200 87.63300  1.000 139.08051 ? 123 PRO A CB    1 
ATOM 682   C CG    . PRO A 1 123 ? 120.50400 100.73800 86.17700  1.000 139.08051 ? 123 PRO A CG    1 
ATOM 683   C CD    . PRO A 1 123 ? 119.23400 100.26400 85.56400  1.000 139.08051 ? 123 PRO A CD    1 
ATOM 684   N N     . LYS A 1 124 ? 118.56300 103.53600 87.08400  1.000 136.42898 ? 124 LYS A N     1 
ATOM 685   C CA    . LYS A 1 124 ? 118.30800 104.95000 87.33000  1.000 136.42898 ? 124 LYS A CA    1 
ATOM 686   C C     . LYS A 1 124 ? 116.94200 105.16500 87.96300  1.000 136.42898 ? 124 LYS A C     1 
ATOM 687   O O     . LYS A 1 124 ? 116.78300 106.05900 88.79700  1.000 136.42898 ? 124 LYS A O     1 
ATOM 688   C CB    . LYS A 1 124 ? 118.42500 105.73700 86.02800  1.000 136.42898 ? 124 LYS A CB    1 
ATOM 689   C CG    . LYS A 1 124 ? 117.73800 105.07600 84.85300  1.000 136.42898 ? 124 LYS A CG    1 
ATOM 690   C CD    . LYS A 1 124 ? 117.60700 106.01500 83.66900  1.000 136.42898 ? 124 LYS A CD    1 
ATOM 691   C CE    . LYS A 1 124 ? 116.91700 107.31000 84.05300  1.000 136.42898 ? 124 LYS A CE    1 
ATOM 692   N NZ    . LYS A 1 124 ? 116.56500 108.10900 82.84900  1.000 136.42898 ? 124 LYS A NZ    1 
ATOM 693   N N     . ASP A 1 125 ? 115.96400 104.32900 87.61000  1.000 140.69962 ? 125 ASP A N     1 
ATOM 694   C CA    . ASP A 1 125 ? 114.62700 104.44600 88.18000  1.000 140.69962 ? 125 ASP A CA    1 
ATOM 695   C C     . ASP A 1 125 ? 114.61500 104.09900 89.66400  1.000 140.69962 ? 125 ASP A C     1 
ATOM 696   O O     . ASP A 1 125 ? 114.00800 104.81300 90.46800  1.000 140.69962 ? 125 ASP A O     1 
ATOM 697   C CB    . ASP A 1 125 ? 113.66200 103.55800 87.40900  1.000 140.69962 ? 125 ASP A CB    1 
ATOM 698   C CG    . ASP A 1 125 ? 113.77100 103.76200 85.92400  1.000 140.69962 ? 125 ASP A CG    1 
ATOM 699   O OD1   . ASP A 1 125 ? 114.07500 104.89800 85.50800  1.000 140.69962 ? 125 ASP A OD1   1 
ATOM 700   O OD2   . ASP A 1 125 ? 113.56500 102.79400 85.17000  1.000 140.69962 ? 125 ASP A OD2   1 
ATOM 701   N N     . VAL A 1 126 ? 115.27300 103.00300 90.04900  1.000 135.93596 ? 126 VAL A N     1 
ATOM 702   C CA    . VAL A 1 126 ? 115.29400 102.64300 91.46200  1.000 135.93596 ? 126 VAL A CA    1 
ATOM 703   C C     . VAL A 1 126 ? 116.16900 103.61200 92.25600  1.000 135.93596 ? 126 VAL A C     1 
ATOM 704   O O     . VAL A 1 126 ? 115.87700 103.90000 93.42500  1.000 135.93596 ? 126 VAL A O     1 
ATOM 705   C CB    . VAL A 1 126 ? 115.70200 101.16300 91.63600  1.000 135.93596 ? 126 VAL A CB    1 
ATOM 706   C CG1   . VAL A 1 126 ? 117.16000 100.91000 91.31400  1.000 135.93596 ? 126 VAL A CG1   1 
ATOM 707   C CG2   . VAL A 1 126 ? 115.38700 100.68200 93.02700  1.000 135.93596 ? 126 VAL A CG2   1 
ATOM 708   N N     . GLN A 1 127 ? 117.20600 104.17900 91.62700  1.000 137.11359 ? 127 GLN A N     1 
ATOM 709   C CA    . GLN A 1 127 ? 117.98900 105.21900 92.28500  1.000 137.11359 ? 127 GLN A CA    1 
ATOM 710   C C     . GLN A 1 127 ? 117.15500 106.46900 92.51800  1.000 137.11359 ? 127 GLN A C     1 
ATOM 711   O O     . GLN A 1 127 ? 117.23200 107.08400 93.58800  1.000 137.11359 ? 127 GLN A O     1 
ATOM 712   C CB    . GLN A 1 127 ? 119.21800 105.56100 91.45300  1.000 137.11359 ? 127 GLN A CB    1 
ATOM 713   C CG    . GLN A 1 127 ? 120.35100 104.58400 91.59700  1.000 137.11359 ? 127 GLN A CG    1 
ATOM 714   C CD    . GLN A 1 127 ? 121.26000 104.59700 90.39300  1.000 137.11359 ? 127 GLN A CD    1 
ATOM 715   O OE1   . GLN A 1 127 ? 120.96900 105.25200 89.39400  1.000 137.11359 ? 127 GLN A OE1   1 
ATOM 716   N NE2   . GLN A 1 127 ? 122.36900 103.87300 90.47700  1.000 137.11359 ? 127 GLN A NE2   1 
ATOM 717   N N     . LEU A 1 128 ? 116.33600 106.83900 91.53400  1.000 131.67281 ? 128 LEU A N     1 
ATOM 718   C CA    . LEU A 1 128 ? 115.46700 107.99700 91.67700  1.000 131.67281 ? 128 LEU A CA    1 
ATOM 719   C C     . LEU A 1 128 ? 114.40000 107.76100 92.73000  1.000 131.67281 ? 128 LEU A C     1 
ATOM 720   O O     . LEU A 1 128 ? 114.03500 108.68300 93.46600  1.000 131.67281 ? 128 LEU A O     1 
ATOM 721   C CB    . LEU A 1 128 ? 114.80300 108.31500 90.34600  1.000 131.67281 ? 128 LEU A CB    1 
ATOM 722   C CG    . LEU A 1 128 ? 114.21400 109.71200 90.33400  1.000 131.67281 ? 128 LEU A CG    1 
ATOM 723   C CD1   . LEU A 1 128 ? 115.37100 110.68500 90.36100  1.000 131.67281 ? 128 LEU A CD1   1 
ATOM 724   C CD2   . LEU A 1 128 ? 113.32500 109.92400 89.13900  1.000 131.67281 ? 128 LEU A CD2   1 
ATOM 725   N N     . ALA A 1 129 ? 113.87800 106.53400 92.79500  1.000 138.53195 ? 129 ALA A N     1 
ATOM 726   C CA    . ALA A 1 129 ? 112.90700 106.18200 93.82300  1.000 138.53195 ? 129 ALA A CA    1 
ATOM 727   C C     . ALA A 1 129 ? 113.51600 106.29300 95.21000  1.000 138.53195 ? 129 ALA A C     1 
ATOM 728   O O     . ALA A 1 129 ? 112.89200 106.84000 96.12600  1.000 138.53195 ? 129 ALA A O     1 
ATOM 729   C CB    . ALA A 1 129 ? 112.37300 104.77400 93.58200  1.000 138.53195 ? 129 ALA A CB    1 
ATOM 730   N N     . ARG A 1 130 ? 114.74100 105.79100 95.37700  1.000 140.93978 ? 130 ARG A N     1 
ATOM 731   C CA    . ARG A 1 130 ? 115.41900 105.92200 96.66000  1.000 140.93978 ? 130 ARG A CA    1 
ATOM 732   C C     . ARG A 1 130 ? 115.71800 107.37500 96.98900  1.000 140.93978 ? 130 ARG A C     1 
ATOM 733   O O     . ARG A 1 130 ? 115.71000 107.75800 98.16400  1.000 140.93978 ? 130 ARG A O     1 
ATOM 734   C CB    . ARG A 1 130 ? 116.71200 105.11500 96.66300  1.000 140.93978 ? 130 ARG A CB    1 
ATOM 735   C CG    . ARG A 1 130 ? 116.53900 103.67800 97.07700  1.000 140.93978 ? 130 ARG A CG    1 
ATOM 736   C CD    . ARG A 1 130 ? 117.87200 102.97800 97.05300  1.000 140.93978 ? 130 ARG A CD    1 
ATOM 737   N NE    . ARG A 1 130 ? 118.90400 103.80100 97.66900  1.000 140.93978 ? 130 ARG A NE    1 
ATOM 738   C CZ    . ARG A 1 130 ? 120.10600 104.00000 97.14300  1.000 140.93978 ? 130 ARG A CZ    1 
ATOM 739   N NH1   . ARG A 1 130 ? 120.98700 104.76600 97.76800  1.000 140.93978 ? 130 ARG A NH1   1 
ATOM 740   N NH2   . ARG A 1 130 ? 120.42700 103.43600 95.99000  1.000 140.93978 ? 130 ARG A NH2   1 
ATOM 741   N N     . ARG A 1 131 ? 115.97900 108.19300 95.97200  1.000 132.98887 ? 131 ARG A N     1 
ATOM 742   C CA    . ARG A 1 131 ? 116.27200 109.59600 96.22500  1.000 132.98887 ? 131 ARG A CA    1 
ATOM 743   C C     . ARG A 1 131 ? 115.01800 110.36400 96.62400  1.000 132.98887 ? 131 ARG A C     1 
ATOM 744   O O     . ARG A 1 131 ? 115.06900 111.21700 97.51600  1.000 132.98887 ? 131 ARG A O     1 
ATOM 745   C CB    . ARG A 1 131 ? 116.93200 110.21700 95.00200  1.000 132.98887 ? 131 ARG A CB    1 
ATOM 746   C CG    . ARG A 1 131 ? 117.65700 111.49300 95.31700  1.000 132.98887 ? 131 ARG A CG    1 
ATOM 747   C CD    . ARG A 1 131 ? 118.50100 111.93100 94.14700  1.000 132.98887 ? 131 ARG A CD    1 
ATOM 748   N NE    . ARG A 1 131 ? 119.21800 113.16200 94.44400  1.000 132.98887 ? 131 ARG A NE    1 
ATOM 749   C CZ    . ARG A 1 131 ? 118.70500 114.37700 94.30000  1.000 132.98887 ? 131 ARG A CZ    1 
ATOM 750   N NH1   . ARG A 1 131 ? 119.43300 115.44100 94.59900  1.000 132.98887 ? 131 ARG A NH1   1 
ATOM 751   N NH2   . ARG A 1 131 ? 117.46500 114.52700 93.86000  1.000 132.98887 ? 131 ARG A NH2   1 
ATOM 752   N N     . ILE A 1 132 ? 113.88900 110.08900 95.97100  1.000 130.32698 ? 132 ILE A N     1 
ATOM 753   C CA    . ILE A 1 132 ? 112.67300 110.82500 96.29800  1.000 130.32698 ? 132 ILE A CA    1 
ATOM 754   C C     . ILE A 1 132 ? 112.08300 110.32400 97.61600  1.000 130.32698 ? 132 ILE A C     1 
ATOM 755   O O     . ILE A 1 132 ? 111.42200 111.08800 98.33300  1.000 130.32698 ? 132 ILE A O     1 
ATOM 756   C CB    . ILE A 1 132 ? 111.65700 110.75700 95.13800  1.000 130.32698 ? 132 ILE A CB    1 
ATOM 757   C CG1   . ILE A 1 132 ? 110.48600 111.70800 95.39200  1.000 130.32698 ? 132 ILE A CG1   1 
ATOM 758   C CG2   . ILE A 1 132 ? 111.13300 109.35600 94.92700  1.000 130.32698 ? 132 ILE A CG2   1 
ATOM 759   C CD1   . ILE A 1 132 ? 109.37500 111.62700 94.41400  1.000 130.32698 ? 132 ILE A CD1   1 
ATOM 760   N N     . ARG A 1 133 ? 112.34400 109.06000 97.97900  1.000 151.48685 ? 133 ARG A N     1 
ATOM 761   C CA    . ARG A 1 133 ? 111.84500 108.50700 99.23700  1.000 151.48685 ? 133 ARG A CA    1 
ATOM 762   C C     . ARG A 1 133 ? 112.41100 109.24100 100.44500 1.000 151.48685 ? 133 ARG A C     1 
ATOM 763   O O     . ARG A 1 133 ? 111.73600 109.35300 101.47200 1.000 151.48685 ? 133 ARG A O     1 
ATOM 764   C CB    . ARG A 1 133 ? 112.17400 107.01700 99.31700  1.000 151.48685 ? 133 ARG A CB    1 
ATOM 765   C CG    . ARG A 1 133 ? 111.10200 106.09100 98.74300  1.000 151.48685 ? 133 ARG A CG    1 
ATOM 766   C CD    . ARG A 1 133 ? 111.40200 104.63900 99.08200  1.000 151.48685 ? 133 ARG A CD    1 
ATOM 767   N NE    . ARG A 1 133 ? 110.59200 104.11400 100.17200 1.000 151.48685 ? 133 ARG A NE    1 
ATOM 768   C CZ    . ARG A 1 133 ? 109.45900 103.44900 99.99000  1.000 151.48685 ? 133 ARG A CZ    1 
ATOM 769   N NH1   . ARG A 1 133 ? 108.77200 102.99800 101.02800 1.000 151.48685 ? 133 ARG A NH1   1 
ATOM 770   N NH2   . ARG A 1 133 ? 109.02100 103.22300 98.76300  1.000 151.48685 ? 133 ARG A NH2   1 
ATOM 771   N N     . GLY A 1 134 ? 113.61800 109.77300 100.33300 1.000 173.17278 ? 134 GLY A N     1 
ATOM 772   C CA    . GLY A 1 134 ? 114.24300 110.50200 101.41600 1.000 173.17278 ? 134 GLY A CA    1 
ATOM 773   C C     . GLY A 1 134 ? 115.59000 109.91800 101.80100 1.000 173.17278 ? 134 GLY A C     1 
ATOM 774   O O     . GLY A 1 134 ? 116.02100 108.87600 101.31100 1.000 173.17278 ? 134 GLY A O     1 
ATOM 775   N N     . LEU A 1 135 ? 116.26600 110.65200 102.69000 1.000 180.05755 ? 135 LEU A N     1 
ATOM 776   C CA    . LEU A 1 135 ? 117.58100 110.23000 103.15600 1.000 180.05755 ? 135 LEU A CA    1 
ATOM 777   C C     . LEU A 1 135 ? 117.48800 109.00400 104.05500 1.000 180.05755 ? 135 LEU A C     1 
ATOM 778   O O     . LEU A 1 135 ? 118.27700 108.06400 103.91400 1.000 180.05755 ? 135 LEU A O     1 
ATOM 779   C CB    . LEU A 1 135 ? 118.25600 111.37600 103.90300 1.000 180.05755 ? 135 LEU A CB    1 
ATOM 780   C CG    . LEU A 1 135 ? 118.54700 112.63800 103.09900 1.000 180.05755 ? 135 LEU A CG    1 
ATOM 781   C CD1   . LEU A 1 135 ? 119.16000 113.69500 103.99600 1.000 180.05755 ? 135 LEU A CD1   1 
ATOM 782   C CD2   . LEU A 1 135 ? 119.45900 112.32900 101.92700 1.000 180.05755 ? 135 LEU A CD2   1 
ATOM 783   N N     . GLU A 1 136 ? 116.53600 108.99700 104.98700 1.000 191.42324 ? 136 GLU A N     1 
ATOM 784   C CA    . GLU A 1 136 ? 116.38100 107.85200 105.87700 1.000 191.42324 ? 136 GLU A CA    1 
ATOM 785   C C     . GLU A 1 136 ? 115.58500 106.73400 105.21500 1.000 191.42324 ? 136 GLU A C     1 
ATOM 786   O O     . GLU A 1 136 ? 115.89100 105.55000 105.39900 1.000 191.42324 ? 136 GLU A O     1 
ATOM 787   C CB    . GLU A 1 136 ? 115.72700 108.30000 107.18400 1.000 191.42324 ? 136 GLU A CB    1 
ATOM 788   C CG    . GLU A 1 136 ? 115.35400 107.17400 108.12900 1.000 191.42324 ? 136 GLU A CG    1 
ATOM 789   C CD    . GLU A 1 136 ? 116.53600 106.28700 108.47000 1.000 191.42324 ? 136 GLU A CD    1 
ATOM 790   O OE1   . GLU A 1 136 ? 116.36100 105.05100 108.46400 1.000 191.42324 ? 136 GLU A OE1   1 
ATOM 791   O OE2   . GLU A 1 136 ? 117.63400 106.81400 108.75000 1.000 191.42324 ? 136 GLU A OE2   1 
ATOM 792   N N     . GLU A 1 137 ? 114.59600 107.09200 104.39800 1.000 182.43200 ? 137 GLU A N     1 
ATOM 793   C CA    . GLU A 1 137 ? 113.71600 106.10300 103.78800 1.000 182.43200 ? 137 GLU A CA    1 
ATOM 794   C C     . GLU A 1 137 ? 114.35700 105.40700 102.59400 1.000 182.43200 ? 137 GLU A C     1 
ATOM 795   O O     . GLU A 1 137 ? 114.04800 104.24100 102.32800 1.000 182.43200 ? 137 GLU A O     1 
ATOM 796   C CB    . GLU A 1 137 ? 112.39700 106.75700 103.37600 1.000 182.43200 ? 137 GLU A CB    1 
ATOM 797   C CG    . GLU A 1 137 ? 111.61100 107.38800 104.52500 1.000 182.43200 ? 137 GLU A CG    1 
ATOM 798   C CD    . GLU A 1 137 ? 111.99200 108.83100 104.80900 1.000 182.43200 ? 137 GLU A CD    1 
ATOM 799   O OE1   . GLU A 1 137 ? 111.36300 109.44900 105.69300 1.000 182.43200 ? 137 GLU A OE1   1 
ATOM 800   O OE2   . GLU A 1 137 ? 112.93600 109.33900 104.17000 1.000 182.43200 ? 137 GLU A OE2   1 
ATOM 801   N N     . GLY A 1 138 ? 115.23200 106.08700 101.86500 1.000 170.79397 ? 138 GLY A N     1 
ATOM 802   C CA    . GLY A 1 138 ? 115.81400 105.49000 100.68300 1.000 170.79397 ? 138 GLY A CA    1 
ATOM 803   C C     . GLY A 1 138 ? 117.13600 104.82600 100.99100 1.000 170.79397 ? 138 GLY A C     1 
ATOM 804   O O     . GLY A 1 138 ? 117.59000 103.95300 100.24800 1.000 170.79397 ? 138 GLY A O     1 
ATOM 805   N N     . LEU A 1 139 ? 117.75800 105.22400 102.09400 1.000 172.06430 ? 139 LEU A N     1 
ATOM 806   C CA    . LEU A 1 139 ? 119.04700 104.66900 102.48100 1.000 172.06430 ? 139 LEU A CA    1 
ATOM 807   C C     . LEU A 1 139 ? 118.92800 103.99600 103.84000 1.000 172.06430 ? 139 LEU A C     1 
ATOM 808   O O     . LEU A 1 139 ? 117.83400 103.62100 104.25800 1.000 172.06430 ? 139 LEU A O     1 
ATOM 809   C CB    . LEU A 1 139 ? 120.12700 105.75400 102.52400 1.000 172.06430 ? 139 LEU A CB    1 
ATOM 810   C CG    . LEU A 1 139 ? 120.82400 106.17300 101.22500 1.000 172.06430 ? 139 LEU A CG    1 
ATOM 811   C CD1   . LEU A 1 139 ? 119.96500 107.12300 100.40100 1.000 172.06430 ? 139 LEU A CD1   1 
ATOM 812   C CD2   . LEU A 1 139 ? 122.17600 106.80100 101.52600 1.000 172.06430 ? 139 LEU A CD2   1 
ATOM 813   N N     . ARG B 2 24  ? 133.58600 83.81600  95.16000  1.000 157.39556 ? 23  ARG B N     1 
ATOM 814   C CA    . ARG B 2 24  ? 132.96400 83.01000  96.20000  1.000 157.39556 ? 23  ARG B CA    1 
ATOM 815   C C     . ARG B 2 24  ? 132.41800 83.93500  97.28400  1.000 157.39556 ? 23  ARG B C     1 
ATOM 816   O O     . ARG B 2 24  ? 132.06000 83.49600  98.37700  1.000 157.39556 ? 23  ARG B O     1 
ATOM 817   C CB    . ARG B 2 24  ? 133.97900 82.02500  96.78500  1.000 157.39556 ? 23  ARG B CB    1 
ATOM 818   C CG    . ARG B 2 24  ? 133.38600 80.72600  97.29500  1.000 157.39556 ? 23  ARG B CG    1 
ATOM 819   C CD    . ARG B 2 24  ? 134.47000 79.68700  97.49500  1.000 157.39556 ? 23  ARG B CD    1 
ATOM 820   N NE    . ARG B 2 24  ? 133.99100 78.53300  98.24800  1.000 157.39556 ? 23  ARG B NE    1 
ATOM 821   C CZ    . ARG B 2 24  ? 133.37600 77.49000  97.70100  1.000 157.39556 ? 23  ARG B CZ    1 
ATOM 822   N NH1   . ARG B 2 24  ? 133.16200 77.45100  96.39300  1.000 157.39556 ? 23  ARG B NH1   1 
ATOM 823   N NH2   . ARG B 2 24  ? 132.97400 76.48300  98.46200  1.000 157.39556 ? 23  ARG B NH2   1 
ATOM 824   N N     . ASP B 2 25  ? 132.38400 85.22500  96.95500  1.000 151.32988 ? 24  ASP B N     1 
ATOM 825   C CA    . ASP B 2 25  ? 131.89900 86.25200  97.86800  1.000 151.32988 ? 24  ASP B CA    1 
ATOM 826   C C     . ASP B 2 25  ? 130.42600 86.06200  98.21000  1.000 151.32988 ? 24  ASP B C     1 
ATOM 827   O O     . ASP B 2 25  ? 129.60200 85.74900  97.34700  1.000 151.32988 ? 24  ASP B O     1 
ATOM 828   C CB    . ASP B 2 25  ? 132.11700 87.63000  97.25100  1.000 151.32988 ? 24  ASP B CB    1 
ATOM 829   C CG    . ASP B 2 25  ? 131.54900 87.73200  95.85000  1.000 151.32988 ? 24  ASP B CG    1 
ATOM 830   O OD1   . ASP B 2 25  ? 131.31200 86.67800  95.22500  1.000 151.32988 ? 24  ASP B OD1   1 
ATOM 831   O OD2   . ASP B 2 25  ? 131.34700 88.86300  95.36700  1.000 151.32988 ? 24  ASP B OD2   1 
ATOM 832   N N     . ASN B 2 26  ? 130.09700 86.24500  99.49100  1.000 147.44058 ? 25  ASN B N     1 
ATOM 833   C CA    . ASN B 2 26  ? 128.73100 86.09500  99.98900  1.000 147.44058 ? 25  ASN B CA    1 
ATOM 834   C C     . ASN B 2 26  ? 127.75200 87.13900  99.46000  1.000 147.44058 ? 25  ASN B C     1 
ATOM 835   O O     . ASN B 2 26  ? 126.57400 87.06400  99.81600  1.000 147.44058 ? 25  ASN B O     1 
ATOM 836   C CB    . ASN B 2 26  ? 128.71100 86.11700  101.51300 1.000 147.44058 ? 25  ASN B CB    1 
ATOM 837   C CG    . ASN B 2 26  ? 129.46900 84.96500  102.11300 1.000 147.44058 ? 25  ASN B CG    1 
ATOM 838   O OD1   . ASN B 2 26  ? 129.96200 84.09300  101.40000 1.000 147.44058 ? 25  ASN B OD1   1 
ATOM 839   N ND2   . ASN B 2 26  ? 129.58000 84.95800  103.43400 1.000 147.44058 ? 25  ASN B ND2   1 
ATOM 840   N N     . ILE B 2 27  ? 128.16900 88.09000  98.62700  1.000 142.72683 ? 26  ILE B N     1 
ATOM 841   C CA    . ILE B 2 27  ? 127.23200 89.09000  98.14100  1.000 142.72683 ? 26  ILE B CA    1 
ATOM 842   C C     . ILE B 2 27  ? 126.61900 88.64200  96.82300  1.000 142.72683 ? 26  ILE B C     1 
ATOM 843   O O     . ILE B 2 27  ? 125.48400 89.03000  96.51500  1.000 142.72683 ? 26  ILE B O     1 
ATOM 844   C CB    . ILE B 2 27  ? 127.91300 90.47000  98.04100  1.000 142.72683 ? 26  ILE B CB    1 
ATOM 845   C CG1   . ILE B 2 27  ? 126.89000 91.59500  97.85000  1.000 142.72683 ? 26  ILE B CG1   1 
ATOM 846   C CG2   . ILE B 2 27  ? 128.96100 90.50100  96.94600  1.000 142.72683 ? 26  ILE B CG2   1 
ATOM 847   C CD1   . ILE B 2 27  ? 125.73000 91.55000  98.80200  1.000 142.72683 ? 26  ILE B CD1   1 
ATOM 848   N N     . GLN B 2 28  ? 127.29700 87.78100  96.07000  1.000 144.43387 ? 27  GLN B N     1 
ATOM 849   C CA    . GLN B 2 28  ? 126.70500 87.21800  94.87000  1.000 144.43387 ? 27  GLN B CA    1 
ATOM 850   C C     . GLN B 2 28  ? 125.88700 85.97700  95.17400  1.000 144.43387 ? 27  GLN B C     1 
ATOM 851   O O     . GLN B 2 28  ? 125.44500 85.29900  94.24400  1.000 144.43387 ? 27  GLN B O     1 
ATOM 852   C CB    . GLN B 2 28  ? 127.78500 86.89700  93.84100  1.000 144.43387 ? 27  GLN B CB    1 
ATOM 853   C CG    . GLN B 2 28  ? 128.59600 88.10700  93.44400  1.000 144.43387 ? 27  GLN B CG    1 
ATOM 854   C CD    . GLN B 2 28  ? 127.87800 88.96200  92.41800  1.000 144.43387 ? 27  GLN B CD    1 
ATOM 855   O OE1   . GLN B 2 28  ? 127.23200 88.44600  91.50600  1.000 144.43387 ? 27  GLN B OE1   1 
ATOM 856   N NE2   . GLN B 2 28  ? 127.98400 90.27700  92.56400  1.000 144.43387 ? 27  GLN B NE2   1 
ATOM 857   N N     . GLY B 2 29  ? 125.70800 85.65700  96.45800  1.000 146.31139 ? 28  GLY B N     1 
ATOM 858   C CA    . GLY B 2 29  ? 124.85900 84.54600  96.84400  1.000 146.31139 ? 28  GLY B CA    1 
ATOM 859   C C     . GLY B 2 29  ? 123.40800 84.77600  96.48300  1.000 146.31139 ? 28  GLY B C     1 
ATOM 860   O O     . GLY B 2 29  ? 122.67300 83.82800  96.20000  1.000 146.31139 ? 28  GLY B O     1 
ATOM 861   N N     . ILE B 2 30  ? 122.97400 86.03000  96.50300  1.000 139.09012 ? 29  ILE B N     1 
ATOM 862   C CA    . ILE B 2 30  ? 121.63600 86.39000  96.06200  1.000 139.09012 ? 29  ILE B CA    1 
ATOM 863   C C     . ILE B 2 30  ? 121.59200 86.27300  94.54700  1.000 139.09012 ? 29  ILE B C     1 
ATOM 864   O O     . ILE B 2 30  ? 121.94300 87.21400  93.82800  1.000 139.09012 ? 29  ILE B O     1 
ATOM 865   C CB    . ILE B 2 30  ? 121.27400 87.80700  96.53200  1.000 139.09012 ? 29  ILE B CB    1 
ATOM 866   C CG1   . ILE B 2 30  ? 121.88300 88.07600  97.91000  1.000 139.09012 ? 29  ILE B CG1   1 
ATOM 867   C CG2   . ILE B 2 30  ? 119.77100 87.99700  96.54900  1.000 139.09012 ? 29  ILE B CG2   1 
ATOM 868   C CD1   . ILE B 2 30  ? 121.20200 87.33900  99.04400  1.000 139.09012 ? 29  ILE B CD1   1 
ATOM 869   N N     . THR B 2 31  ? 121.17300 85.10900  94.06100  1.000 140.03065 ? 30  THR B N     1 
ATOM 870   C CA    . THR B 2 31  ? 121.20200 84.78800  92.64300  1.000 140.03065 ? 30  THR B CA    1 
ATOM 871   C C     . THR B 2 31  ? 120.19500 85.61700  91.85200  1.000 140.03065 ? 30  THR B C     1 
ATOM 872   O O     . THR B 2 31  ? 119.35600 86.33200  92.40400  1.000 140.03065 ? 30  THR B O     1 
ATOM 873   C CB    . THR B 2 31  ? 120.90000 83.31000  92.42600  1.000 140.03065 ? 30  THR B CB    1 
ATOM 874   O OG1   . THR B 2 31  ? 119.52300 83.06500  92.73300  1.000 140.03065 ? 30  THR B OG1   1 
ATOM 875   C CG2   . THR B 2 31  ? 121.77600 82.45100  93.31400  1.000 140.03065 ? 30  THR B CG2   1 
ATOM 876   N N     . LYS B 2 32  ? 120.30100 85.50400  90.52800  1.000 131.91541 ? 31  LYS B N     1 
ATOM 877   C CA    . LYS B 2 32  ? 119.35200 86.17800  89.64900  1.000 131.91541 ? 31  LYS B CA    1 
ATOM 878   C C     . LYS B 2 32  ? 117.90600 85.70100  89.80800  1.000 131.91541 ? 31  LYS B C     1 
ATOM 879   O O     . LYS B 2 32  ? 117.02000 86.57100  89.80600  1.000 131.91541 ? 31  LYS B O     1 
ATOM 880   C CB    . LYS B 2 32  ? 119.78500 86.05500  88.18000  1.000 131.91541 ? 31  LYS B CB    1 
ATOM 881   C CG    . LYS B 2 32  ? 121.20500 86.44000  87.86400  1.000 131.91541 ? 31  LYS B CG    1 
ATOM 882   C CD    . LYS B 2 32  ? 121.44800 86.24400  86.37200  1.000 131.91541 ? 31  LYS B CD    1 
ATOM 883   C CE    . LYS B 2 32  ? 122.76400 86.84700  85.92000  1.000 131.91541 ? 31  LYS B CE    1 
ATOM 884   N NZ    . LYS B 2 32  ? 123.92200 86.25700  86.64500  1.000 131.91541 ? 31  LYS B NZ    1 
ATOM 885   N N     . PRO B 2 33  ? 117.57500 84.39200  89.90000  1.000 132.63356 ? 32  PRO B N     1 
ATOM 886   C CA    . PRO B 2 33  ? 116.16000 84.04000  90.12300  1.000 132.63356 ? 32  PRO B CA    1 
ATOM 887   C C     . PRO B 2 33  ? 115.59000 84.51700  91.44500  1.000 132.63356 ? 32  PRO B C     1 
ATOM 888   O O     . PRO B 2 33  ? 114.37300 84.69700  91.53700  1.000 132.63356 ? 32  PRO B O     1 
ATOM 889   C CB    . PRO B 2 33  ? 116.15400 82.51000  90.04200  1.000 132.63356 ? 32  PRO B CB    1 
ATOM 890   C CG    . PRO B 2 33  ? 117.31400 82.16900  89.26500  1.000 132.63356 ? 32  PRO B CG    1 
ATOM 891   C CD    . PRO B 2 33  ? 118.34600 83.15700  89.63600  1.000 132.63356 ? 32  PRO B CD    1 
ATOM 892   N N     . ALA B 2 34  ? 116.41900 84.70800  92.47300  1.000 131.14575 ? 33  ALA B N     1 
ATOM 893   C CA    . ALA B 2 34  ? 115.91600 85.21800  93.74500  1.000 131.14575 ? 33  ALA B CA    1 
ATOM 894   C C     . ALA B 2 34  ? 115.43200 86.65600  93.60900  1.000 131.14575 ? 33  ALA B C     1 
ATOM 895   O O     . ALA B 2 34  ? 114.30800 86.98700  94.01100  1.000 131.14575 ? 33  ALA B O     1 
ATOM 896   C CB    . ALA B 2 34  ? 116.99900 85.11300  94.81400  1.000 131.14575 ? 33  ALA B CB    1 
ATOM 897   N N     . ILE B 2 35  ? 116.27200 87.52000  93.03300  1.000 125.14387 ? 34  ILE B N     1 
ATOM 898   C CA    . ILE B 2 35  ? 115.89300 88.90700  92.79200  1.000 125.14387 ? 34  ILE B CA    1 
ATOM 899   C C     . ILE B 2 35  ? 114.75600 88.98000  91.79100  1.000 125.14387 ? 34  ILE B C     1 
ATOM 900   O O     . ILE B 2 35  ? 113.87800 89.84800  91.89100  1.000 125.14387 ? 34  ILE B O     1 
ATOM 901   C CB    . ILE B 2 35  ? 117.11600 89.69800  92.30000  1.000 125.14387 ? 34  ILE B CB    1 
ATOM 902   C CG1   . ILE B 2 35  ? 118.32100 89.42700  93.19400  1.000 125.14387 ? 34  ILE B CG1   1 
ATOM 903   C CG2   . ILE B 2 35  ? 116.81200 91.16400  92.26000  1.000 125.14387 ? 34  ILE B CG2   1 
ATOM 904   C CD1   . ILE B 2 35  ? 119.63800 89.66300  92.50400  1.000 125.14387 ? 34  ILE B CD1   1 
ATOM 905   N N     . ARG B 2 36  ? 114.73400 88.04800  90.83700  1.000 132.89763 ? 35  ARG B N     1 
ATOM 906   C CA    . ARG B 2 36  ? 113.64400 87.99900  89.87600  1.000 132.89763 ? 35  ARG B CA    1 
ATOM 907   C C     . ARG B 2 36  ? 112.33100 87.67200  90.56200  1.000 132.89763 ? 35  ARG B C     1 
ATOM 908   O O     . ARG B 2 36  ? 111.32100 88.32200  90.29600  1.000 132.89763 ? 35  ARG B O     1 
ATOM 909   C CB    . ARG B 2 36  ? 113.94500 86.97900  88.78300  1.000 132.89763 ? 35  ARG B CB    1 
ATOM 910   C CG    . ARG B 2 36  ? 113.00700 87.06300  87.60000  1.000 132.89763 ? 35  ARG B CG    1 
ATOM 911   C CD    . ARG B 2 36  ? 113.60200 86.34900  86.41800  1.000 132.89763 ? 35  ARG B CD    1 
ATOM 912   N NE    . ARG B 2 36  ? 114.99100 86.74200  86.23300  1.000 132.89763 ? 35  ARG B NE    1 
ATOM 913   C CZ    . ARG B 2 36  ? 115.86100 86.06700  85.49300  1.000 132.89763 ? 35  ARG B CZ    1 
ATOM 914   N NH1   . ARG B 2 36  ? 117.11000 86.49500  85.37800  1.000 132.89763 ? 35  ARG B NH1   1 
ATOM 915   N NH2   . ARG B 2 36  ? 115.48000 84.96000  84.87400  1.000 132.89763 ? 35  ARG B NH2   1 
ATOM 916   N N     . ARG B 2 37  ? 112.33500 86.69400  91.47200  1.000 128.20781 ? 36  ARG B N     1 
ATOM 917   C CA    . ARG B 2 37  ? 111.12300 86.35100  92.20900  1.000 128.20781 ? 36  ARG B CA    1 
ATOM 918   C C     . ARG B 2 37  ? 110.68100 87.49000  93.11500  1.000 128.20781 ? 36  ARG B C     1 
ATOM 919   O O     . ARG B 2 37  ? 109.47700 87.71300  93.29100  1.000 128.20781 ? 36  ARG B O     1 
ATOM 920   C CB    . ARG B 2 37  ? 111.33200 85.08000  93.02400  1.000 128.20781 ? 36  ARG B CB    1 
ATOM 921   C CG    . ARG B 2 37  ? 111.29700 83.81000  92.20200  1.000 128.20781 ? 36  ARG B CG    1 
ATOM 922   C CD    . ARG B 2 37  ? 111.39800 82.57900  93.08300  1.000 128.20781 ? 36  ARG B CD    1 
ATOM 923   N NE    . ARG B 2 37  ? 112.17200 82.83700  94.29000  1.000 128.20781 ? 36  ARG B NE    1 
ATOM 924   C CZ    . ARG B 2 37  ? 113.47700 82.62800  94.39600  1.000 128.20781 ? 36  ARG B CZ    1 
ATOM 925   N NH1   . ARG B 2 37  ? 114.16100 82.15700  93.36400  1.000 128.20781 ? 36  ARG B NH1   1 
ATOM 926   N NH2   . ARG B 2 37  ? 114.09800 82.89300  95.53500  1.000 128.20781 ? 36  ARG B NH2   1 
ATOM 927   N N     . LEU B 2 38  ? 111.64100 88.21500  93.69300  1.000 125.63297 ? 37  LEU B N     1 
ATOM 928   C CA    . LEU B 2 38  ? 111.31100 89.39300  94.49000  1.000 125.63297 ? 37  LEU B CA    1 
ATOM 929   C C     . LEU B 2 38  ? 110.60800 90.45000  93.64800  1.000 125.63297 ? 37  LEU B C     1 
ATOM 930   O O     . LEU B 2 38  ? 109.58900 91.01600  94.06200  1.000 125.63297 ? 37  LEU B O     1 
ATOM 931   C CB    . LEU B 2 38  ? 112.57600 89.96300  95.12100  1.000 125.63297 ? 37  LEU B CB    1 
ATOM 932   C CG    . LEU B 2 38  ? 112.78500 89.60600  96.58800  1.000 125.63297 ? 37  LEU B CG    1 
ATOM 933   C CD1   . LEU B 2 38  ? 114.09000 90.17900  97.09400  1.000 125.63297 ? 37  LEU B CD1   1 
ATOM 934   C CD2   . LEU B 2 38  ? 111.63000 90.13100  97.40700  1.000 125.63297 ? 37  LEU B CD2   1 
ATOM 935   N N     . ALA B 2 39  ? 111.13000 90.70900  92.45000  1.000 129.10680 ? 38  ALA B N     1 
ATOM 936   C CA    . ALA B 2 39  ? 110.51500 91.69500  91.56900  1.000 129.10680 ? 38  ALA B CA    1 
ATOM 937   C C     . ALA B 2 39  ? 109.15300 91.23300  91.06700  1.000 129.10680 ? 38  ALA B C     1 
ATOM 938   O O     . ALA B 2 39  ? 108.23500 92.04800  90.92600  1.000 129.10680 ? 38  ALA B O     1 
ATOM 939   C CB    . ALA B 2 39  ? 111.44200 91.99700  90.39700  1.000 129.10680 ? 38  ALA B CB    1 
ATOM 940   N N     . ARG B 2 40  ? 109.00600 89.93500  90.78600  1.000 133.96142 ? 39  ARG B N     1 
ATOM 941   C CA    . ARG B 2 40  ? 107.71400 89.40900  90.35500  1.000 133.96142 ? 39  ARG B CA    1 
ATOM 942   C C     . ARG B 2 40  ? 106.68400 89.51800  91.46700  1.000 133.96142 ? 39  ARG B C     1 
ATOM 943   O O     . ARG B 2 40  ? 105.50000 89.75300  91.20000  1.000 133.96142 ? 39  ARG B O     1 
ATOM 944   C CB    . ARG B 2 40  ? 107.83800 87.96000  89.88700  1.000 133.96142 ? 39  ARG B CB    1 
ATOM 945   C CG    . ARG B 2 40  ? 108.68300 87.75200  88.64500  1.000 133.96142 ? 39  ARG B CG    1 
ATOM 946   C CD    . ARG B 2 40  ? 107.96900 88.11700  87.36700  1.000 133.96142 ? 39  ARG B CD    1 
ATOM 947   N NE    . ARG B 2 40  ? 108.90400 88.23100  86.25100  1.000 133.96142 ? 39  ARG B NE    1 
ATOM 948   C CZ    . ARG B 2 40  ? 109.38100 87.20200  85.55700  1.000 133.96142 ? 39  ARG B CZ    1 
ATOM 949   N NH1   . ARG B 2 40  ? 109.01600 85.96200  85.85200  1.000 133.96142 ? 39  ARG B NH1   1 
ATOM 950   N NH2   . ARG B 2 40  ? 110.22800 87.41300  84.56000  1.000 133.96142 ? 39  ARG B NH2   1 
ATOM 951   N N     . ARG B 2 41  ? 107.11000 89.31100  92.71400  1.000 128.70836 ? 40  ARG B N     1 
ATOM 952   C CA    . ARG B 2 41  ? 106.22800 89.56700  93.84400  1.000 128.70836 ? 40  ARG B CA    1 
ATOM 953   C C     . ARG B 2 41  ? 105.87900 91.04400  93.92200  1.000 128.70836 ? 40  ARG B C     1 
ATOM 954   O O     . ARG B 2 41  ? 104.73600 91.41000  94.21300  1.000 128.70836 ? 40  ARG B O     1 
ATOM 955   C CB    . ARG B 2 41  ? 106.89000 89.09300  95.13700  1.000 128.70836 ? 40  ARG B CB    1 
ATOM 956   C CG    . ARG B 2 41  ? 106.16200 89.48900  96.40400  1.000 128.70836 ? 40  ARG B CG    1 
ATOM 957   C CD    . ARG B 2 41  ? 106.65400 88.69100  97.59200  1.000 128.70836 ? 40  ARG B CD    1 
ATOM 958   N NE    . ARG B 2 41  ? 105.95700 87.41800  97.71500  1.000 128.70836 ? 40  ARG B NE    1 
ATOM 959   C CZ    . ARG B 2 41  ? 105.94800 86.67900  98.81600  1.000 128.70836 ? 40  ARG B CZ    1 
ATOM 960   N NH1   . ARG B 2 41  ? 106.60200 87.08800  99.89400  1.000 128.70836 ? 40  ARG B NH1   1 
ATOM 961   N NH2   . ARG B 2 41  ? 105.28900 85.52900  98.83800  1.000 128.70836 ? 40  ARG B NH2   1 
ATOM 962   N N     . GLY B 2 42  ? 106.83900 91.90800  93.59800  1.000 125.35753 ? 41  GLY B N     1 
ATOM 963   C CA    . GLY B 2 42  ? 106.58400 93.33500  93.54700  1.000 125.35753 ? 41  GLY B CA    1 
ATOM 964   C C     . GLY B 2 42  ? 105.71000 93.79300  92.40000  1.000 125.35753 ? 41  GLY B C     1 
ATOM 965   O O     . GLY B 2 42  ? 105.30100 94.95800  92.39300  1.000 125.35753 ? 41  GLY B O     1 
ATOM 966   N N     . GLY B 2 43  ? 105.41800 92.92600  91.43700  1.000 129.42625 ? 42  GLY B N     1 
ATOM 967   C CA    . GLY B 2 43  ? 104.57500 93.30700  90.32600  1.000 129.42625 ? 42  GLY B CA    1 
ATOM 968   C C     . GLY B 2 43  ? 105.31800 93.79000  89.10700  1.000 129.42625 ? 42  GLY B C     1 
ATOM 969   O O     . GLY B 2 43  ? 104.73300 94.49400  88.28000  1.000 129.42625 ? 42  GLY B O     1 
ATOM 970   N N     . VAL B 2 44  ? 106.58300 93.43700  88.96900  1.000 134.25715 ? 43  VAL B N     1 
ATOM 971   C CA    . VAL B 2 44  ? 107.40200 93.88700  87.85500  1.000 134.25715 ? 43  VAL B CA    1 
ATOM 972   C C     . VAL B 2 44  ? 107.20100 92.94400  86.68000  1.000 134.25715 ? 43  VAL B C     1 
ATOM 973   O O     . VAL B 2 44  ? 107.23000 91.72000  86.84400  1.000 134.25715 ? 43  VAL B O     1 
ATOM 974   C CB    . VAL B 2 44  ? 108.87700 93.94600  88.27200  1.000 134.25715 ? 43  VAL B CB    1 
ATOM 975   C CG1   . VAL B 2 44  ? 109.73900 94.37600  87.12500  1.000 134.25715 ? 43  VAL B CG1   1 
ATOM 976   C CG2   . VAL B 2 44  ? 109.03700 94.89900  89.43300  1.000 134.25715 ? 43  VAL B CG2   1 
ATOM 977   N N     . LYS B 2 45  ? 106.99700 93.50900  85.49200  1.000 136.84696 ? 44  LYS B N     1 
ATOM 978   C CA    . LYS B 2 45  ? 106.80900 92.69600  84.29900  1.000 136.84696 ? 44  LYS B CA    1 
ATOM 979   C C     . LYS B 2 45  ? 108.14000 92.31500  83.65500  1.000 136.84696 ? 44  LYS B C     1 
ATOM 980   O O     . LYS B 2 45  ? 108.43700 91.13000  83.49200  1.000 136.84696 ? 44  LYS B O     1 
ATOM 981   C CB    . LYS B 2 45  ? 105.92000 93.43400  83.29700  1.000 136.84696 ? 44  LYS B CB    1 
ATOM 982   C CG    . LYS B 2 45  ? 105.68800 92.65900  82.02300  1.000 136.84696 ? 44  LYS B CG    1 
ATOM 983   C CD    . LYS B 2 45  ? 104.78100 93.41200  81.07300  1.000 136.84696 ? 44  LYS B CD    1 
ATOM 984   C CE    . LYS B 2 45  ? 104.71200 92.71300  79.72800  1.000 136.84696 ? 44  LYS B CE    1 
ATOM 985   N NZ    . LYS B 2 45  ? 106.05000 92.64900  79.07400  1.000 136.84696 ? 44  LYS B NZ    1 
ATOM 986   N N     . ARG B 2 46  ? 108.94500 93.30200  83.27800  1.000 135.88810 ? 45  ARG B N     1 
ATOM 987   C CA    . ARG B 2 46  ? 110.22400 93.05500  82.63000  1.000 135.88810 ? 45  ARG B CA    1 
ATOM 988   C C     . ARG B 2 46  ? 111.34700 93.70000  83.42300  1.000 135.88810 ? 45  ARG B C     1 
ATOM 989   O O     . ARG B 2 46  ? 111.20200 94.81800  83.92000  1.000 135.88810 ? 45  ARG B O     1 
ATOM 990   C CB    . ARG B 2 46  ? 110.21800 93.57600  81.20300  1.000 135.88810 ? 45  ARG B CB    1 
ATOM 991   C CG    . ARG B 2 46  ? 109.43900 92.68100  80.26200  1.000 135.88810 ? 45  ARG B CG    1 
ATOM 992   C CD    . ARG B 2 46  ? 109.45100 93.21600  78.85000  1.000 135.88810 ? 45  ARG B CD    1 
ATOM 993   N NE    . ARG B 2 46  ? 110.80900 93.49000  78.40600  1.000 135.88810 ? 45  ARG B NE    1 
ATOM 994   C CZ    . ARG B 2 46  ? 111.45700 92.75200  77.51600  1.000 135.88810 ? 45  ARG B CZ    1 
ATOM 995   N NH1   . ARG B 2 46  ? 110.86600 91.69400  76.98400  1.000 135.88810 ? 45  ARG B NH1   1 
ATOM 996   N NH2   . ARG B 2 46  ? 112.69300 93.06700  77.16100  1.000 135.88810 ? 45  ARG B NH2   1 
ATOM 997   N N     . ILE B 2 47  ? 112.47100 92.99800  83.52900  1.000 132.00172 ? 46  ILE B N     1 
ATOM 998   C CA    . ILE B 2 47  ? 113.62200 93.45200  84.29800  1.000 132.00172 ? 46  ILE B CA    1 
ATOM 999   C C     . ILE B 2 47  ? 114.83700 93.50200  83.38500  1.000 132.00172 ? 46  ILE B C     1 
ATOM 1000  O O     . ILE B 2 47  ? 115.08000 92.56600  82.61800  1.000 132.00172 ? 46  ILE B O     1 
ATOM 1001  C CB    . ILE B 2 47  ? 113.90500 92.51300  85.48900  1.000 132.00172 ? 46  ILE B CB    1 
ATOM 1002  C CG1   . ILE B 2 47  ? 112.64900 92.26000  86.31400  1.000 132.00172 ? 46  ILE B CG1   1 
ATOM 1003  C CG2   . ILE B 2 47  ? 114.96700 93.09000  86.39100  1.000 132.00172 ? 46  ILE B CG2   1 
ATOM 1004  C CD1   . ILE B 2 47  ? 112.05000 90.88700  86.10400  1.000 132.00172 ? 46  ILE B CD1   1 
ATOM 1005  N N     . SER B 2 48  ? 115.61000 94.58000  83.47600  1.000 129.71145 ? 47  SER B N     1 
ATOM 1006  C CA    . SER B 2 48  ? 116.83900 94.64100  82.70800  1.000 129.71145 ? 47  SER B CA    1 
ATOM 1007  C C     . SER B 2 48  ? 117.93500 93.85600  83.41400  1.000 129.71145 ? 47  SER B C     1 
ATOM 1008  O O     . SER B 2 48  ? 117.82800 93.50400  84.58900  1.000 129.71145 ? 47  SER B O     1 
ATOM 1009  C CB    . SER B 2 48  ? 117.29300 96.07800  82.50100  1.000 129.71145 ? 47  SER B CB    1 
ATOM 1010  O OG    . SER B 2 48  ? 118.01900 96.53100  83.62700  1.000 129.71145 ? 47  SER B OG    1 
ATOM 1011  N N     . GLY B 2 49  ? 119.01900 93.60100  82.68300  1.000 132.26659 ? 48  GLY B N     1 
ATOM 1012  C CA    . GLY B 2 49  ? 120.10500 92.80200  83.21600  1.000 132.26659 ? 48  GLY B CA    1 
ATOM 1013  C C     . GLY B 2 49  ? 120.97200 93.51500  84.22700  1.000 132.26659 ? 48  GLY B C     1 
ATOM 1014  O O     . GLY B 2 49  ? 121.66400 92.85500  85.00700  1.000 132.26659 ? 48  GLY B O     1 
ATOM 1015  N N     . LEU B 2 50  ? 120.95400 94.84000  84.23600  1.000 131.79166 ? 49  LEU B N     1 
ATOM 1016  C CA    . LEU B 2 50  ? 121.78100 95.60800  85.15400  1.000 131.79166 ? 49  LEU B CA    1 
ATOM 1017  C C     . LEU B 2 50  ? 121.13400 95.81500  86.51400  1.000 131.79166 ? 49  LEU B C     1 
ATOM 1018  O O     . LEU B 2 50  ? 121.71400 96.50200  87.36100  1.000 131.79166 ? 49  LEU B O     1 
ATOM 1019  C CB    . LEU B 2 50  ? 122.11900 96.96100  84.53300  1.000 131.79166 ? 49  LEU B CB    1 
ATOM 1020  C CG    . LEU B 2 50  ? 122.72700 96.85900  83.13700  1.000 131.79166 ? 49  LEU B CG    1 
ATOM 1021  C CD1   . LEU B 2 50  ? 123.04800 98.23600  82.60000  1.000 131.79166 ? 49  LEU B CD1   1 
ATOM 1022  C CD2   . LEU B 2 50  ? 123.97600 95.99800  83.17500  1.000 131.79166 ? 49  LEU B CD2   1 
ATOM 1023  N N     . ILE B 2 51  ? 119.96700 95.22500  86.75500  1.000 131.71184 ? 50  ILE B N     1 
ATOM 1024  C CA    . ILE B 2 51  ? 119.30400 95.40900  88.03700  1.000 131.71184 ? 50  ILE B CA    1 
ATOM 1025  C C     . ILE B 2 51  ? 119.93500 94.52500  89.09800  1.000 131.71184 ? 50  ILE B C     1 
ATOM 1026  O O     . ILE B 2 51  ? 120.11300 94.95500  90.24100  1.000 131.71184 ? 50  ILE B O     1 
ATOM 1027  C CB    . ILE B 2 51  ? 117.79800 95.13900  87.88400  1.000 131.71184 ? 50  ILE B CB    1 
ATOM 1028  C CG1   . ILE B 2 51  ? 117.21800 96.05800  86.81500  1.000 131.71184 ? 50  ILE B CG1   1 
ATOM 1029  C CG2   . ILE B 2 51  ? 117.06400 95.33700  89.19400  1.000 131.71184 ? 50  ILE B CG2   1 
ATOM 1030  C CD1   . ILE B 2 51  ? 117.24500 97.51600  87.19400  1.000 131.71184 ? 50  ILE B CD1   1 
ATOM 1031  N N     . TYR B 2 52  ? 120.31400 93.29800  88.71800  1.000 133.19143 ? 51  TYR B N     1 
ATOM 1032  C CA    . TYR B 2 52  ? 120.87500 92.32700  89.65600  1.000 133.19143 ? 51  TYR B CA    1 
ATOM 1033  C C     . TYR B 2 52  ? 122.16900 92.80900  90.29400  1.000 133.19143 ? 51  TYR B C     1 
ATOM 1034  O O     . TYR B 2 52  ? 122.44700 92.48200  91.45300  1.000 133.19143 ? 51  TYR B O     1 
ATOM 1035  C CB    . TYR B 2 52  ? 121.11600 91.00000  88.94800  1.000 133.19143 ? 51  TYR B CB    1 
ATOM 1036  C CG    . TYR B 2 52  ? 119.94700 90.52300  88.13600  1.000 133.19143 ? 51  TYR B CG    1 
ATOM 1037  C CD1   . TYR B 2 52  ? 118.69300 90.39000  88.71100  1.000 133.19143 ? 51  TYR B CD1   1 
ATOM 1038  C CD2   . TYR B 2 52  ? 120.09500 90.19600  86.79700  1.000 133.19143 ? 51  TYR B CD2   1 
ATOM 1039  C CE1   . TYR B 2 52  ? 117.61900 89.94400  87.97900  1.000 133.19143 ? 51  TYR B CE1   1 
ATOM 1040  C CE2   . TYR B 2 52  ? 119.02400 89.75000  86.05400  1.000 133.19143 ? 51  TYR B CE2   1 
ATOM 1041  C CZ    . TYR B 2 52  ? 117.79000 89.62800  86.65100  1.000 133.19143 ? 51  TYR B CZ    1 
ATOM 1042  O OH    . TYR B 2 52  ? 116.71900 89.18400  85.91700  1.000 133.19143 ? 51  TYR B OH    1 
ATOM 1043  N N     . GLU B 2 53  ? 122.96600 93.58400  89.56900  1.000 140.15617 ? 52  GLU B N     1 
ATOM 1044  C CA    . GLU B 2 53  ? 124.17400 94.12900  90.15900  1.000 140.15617 ? 52  GLU B CA    1 
ATOM 1045  C C     . GLU B 2 53  ? 123.89000 95.36700  90.99300  1.000 140.15617 ? 52  GLU B C     1 
ATOM 1046  O O     . GLU B 2 53  ? 124.68400 95.70300  91.87500  1.000 140.15617 ? 52  GLU B O     1 
ATOM 1047  C CB    . GLU B 2 53  ? 125.18500 94.45800  89.06500  1.000 140.15617 ? 52  GLU B CB    1 
ATOM 1048  C CG    . GLU B 2 53  ? 126.62400 94.40500  89.52100  1.000 140.15617 ? 52  GLU B CG    1 
ATOM 1049  C CD    . GLU B 2 53  ? 127.13400 95.75800  89.96000  1.000 140.15617 ? 52  GLU B CD    1 
ATOM 1050  O OE1   . GLU B 2 53  ? 128.22500 95.81900  90.56200  1.000 140.15617 ? 52  GLU B OE1   1 
ATOM 1051  O OE2   . GLU B 2 53  ? 126.43200 96.76000  89.71600  1.000 140.15617 ? 52  GLU B OE2   1 
ATOM 1052  N N     . GLU B 2 54  ? 122.75900 96.02600  90.76000  1.000 140.07771 ? 53  GLU B N     1 
ATOM 1053  C CA    . GLU B 2 54  ? 122.45200 97.25600  91.47800  1.000 140.07771 ? 53  GLU B CA    1 
ATOM 1054  C C     . GLU B 2 54  ? 121.85400 96.98100  92.84800  1.000 140.07771 ? 53  GLU B C     1 
ATOM 1055  O O     . GLU B 2 54  ? 122.34200 97.50700  93.85500  1.000 140.07771 ? 53  GLU B O     1 
ATOM 1056  C CB    . GLU B 2 54  ? 121.50100 98.11700  90.65000  1.000 140.07771 ? 53  GLU B CB    1 
ATOM 1057  C CG    . GLU B 2 54  ? 121.67300 99.60500  90.86300  1.000 140.07771 ? 53  GLU B CG    1 
ATOM 1058  C CD    . GLU B 2 54  ? 120.88300 100.11400 92.05300  1.000 140.07771 ? 53  GLU B CD    1 
ATOM 1059  O OE1   . GLU B 2 54  ? 119.95700 99.40500  92.49800  1.000 140.07771 ? 53  GLU B OE1   1 
ATOM 1060  O OE2   . GLU B 2 54  ? 121.18500 101.22200 92.54300  1.000 140.07771 ? 53  GLU B OE2   1 
ATOM 1061  N N     . THR B 2 55  ? 120.78400 96.17800  92.89700  1.000 133.18792 ? 54  THR B N     1 
ATOM 1062  C CA    . THR B 2 55  ? 120.08800 95.90400  94.15200  1.000 133.18792 ? 54  THR B CA    1 
ATOM 1063  C C     . THR B 2 55  ? 120.98200 95.20100  95.16500  1.000 133.18792 ? 54  THR B C     1 
ATOM 1064  O O     . THR B 2 55  ? 120.78700 95.37300  96.37500  1.000 133.18792 ? 54  THR B O     1 
ATOM 1065  C CB    . THR B 2 55  ? 118.82300 95.08800  93.89800  1.000 133.18792 ? 54  THR B CB    1 
ATOM 1066  O OG1   . THR B 2 55  ? 118.24000 94.71800  95.15000  1.000 133.18792 ? 54  THR B OG1   1 
ATOM 1067  C CG2   . THR B 2 55  ? 119.13700 93.84400  93.12600  1.000 133.18792 ? 54  THR B CG2   1 
ATOM 1068  N N     . ARG B 2 56  ? 121.96600 94.42500  94.68900  1.000 135.35002 ? 55  ARG B N     1 
ATOM 1069  C CA    . ARG B 2 56  ? 122.94800 93.79700  95.56400  1.000 135.35002 ? 55  ARG B CA    1 
ATOM 1070  C C     . ARG B 2 56  ? 123.70800 94.82400  96.38400  1.000 135.35002 ? 55  ARG B C     1 
ATOM 1071  O O     . ARG B 2 56  ? 124.11300 94.53900  97.51500  1.000 135.35002 ? 55  ARG B O     1 
ATOM 1072  C CB    . ARG B 2 56  ? 123.93000 92.96700  94.74200  1.000 135.35002 ? 55  ARG B CB    1 
ATOM 1073  C CG    . ARG B 2 56  ? 123.67700 91.47800  94.78700  1.000 135.35002 ? 55  ARG B CG    1 
ATOM 1074  C CD    . ARG B 2 56  ? 124.60900 90.74200  93.84700  1.000 135.35002 ? 55  ARG B CD    1 
ATOM 1075  N NE    . ARG B 2 56  ? 124.10600 89.41400  93.51900  1.000 135.35002 ? 55  ARG B NE    1 
ATOM 1076  C CZ    . ARG B 2 56  ? 124.20100 88.85800  92.31900  1.000 135.35002 ? 55  ARG B CZ    1 
ATOM 1077  N NH1   . ARG B 2 56  ? 124.78200 89.51600  91.32800  1.000 135.35002 ? 55  ARG B NH1   1 
ATOM 1078  N NH2   . ARG B 2 56  ? 123.71600 87.64300  92.11100  1.000 135.35002 ? 55  ARG B NH2   1 
ATOM 1079  N N     . GLY B 2 57  ? 123.89200 96.02300  95.84700  1.000 131.85234 ? 56  GLY B N     1 
ATOM 1080  C CA    . GLY B 2 57  ? 124.44200 97.09300  96.64000  1.000 131.85234 ? 56  GLY B CA    1 
ATOM 1081  C C     . GLY B 2 57  ? 123.42000 97.64200  97.60900  1.000 131.85234 ? 56  GLY B C     1 
ATOM 1082  O O     . GLY B 2 57  ? 123.73500 97.83700  98.78800  1.000 131.85234 ? 56  GLY B O     1 
ATOM 1083  N N     . VAL B 2 58  ? 122.19100 97.86000  97.11800  1.000 125.45095 ? 57  VAL B N     1 
ATOM 1084  C CA    . VAL B 2 58  ? 121.11000 98.39700  97.94600  1.000 125.45095 ? 57  VAL B CA    1 
ATOM 1085  C C     . VAL B 2 58  ? 120.81200 97.47900  99.12000  1.000 125.45095 ? 57  VAL B C     1 
ATOM 1086  O O     . VAL B 2 58  ? 120.81800 97.91000  100.28100 1.000 125.45095 ? 57  VAL B O     1 
ATOM 1087  C CB    . VAL B 2 58  ? 119.85500 98.63300  97.09400  1.000 125.45095 ? 57  VAL B CB    1 
ATOM 1088  C CG1   . VAL B 2 58  ? 118.72400 99.12600  97.96100  1.000 125.45095 ? 57  VAL B CG1   1 
ATOM 1089  C CG2   . VAL B 2 58  ? 120.15500 99.62400  95.99700  1.000 125.45095 ? 57  VAL B CG2   1 
ATOM 1090  N N     . LEU B 2 59  ? 120.60400 96.18700  98.83500  1.000 121.93739 ? 58  LEU B N     1 
ATOM 1091  C CA    . LEU B 2 59  ? 120.41700 95.18100  99.88000  1.000 121.93739 ? 58  LEU B CA    1 
ATOM 1092  C C     . LEU B 2 59  ? 121.62200 95.09700  100.80300 1.000 121.93739 ? 58  LEU B C     1 
ATOM 1093  O O     . LEU B 2 59  ? 121.48500 94.68600  101.95800 1.000 121.93739 ? 58  LEU B O     1 
ATOM 1094  C CB    . LEU B 2 59  ? 120.09500 93.82400  99.24400  1.000 121.93739 ? 58  LEU B CB    1 
ATOM 1095  C CG    . LEU B 2 59  ? 119.85900 92.50900  100.00700 1.000 121.93739 ? 58  LEU B CG    1 
ATOM 1096  C CD1   . LEU B 2 59  ? 119.06400 91.60400  99.09600  1.000 121.93739 ? 58  LEU B CD1   1 
ATOM 1097  C CD2   . LEU B 2 59  ? 121.11300 91.74900  100.42400 1.000 121.93739 ? 58  LEU B CD2   1 
ATOM 1098  N N     . LYS B 2 60  ? 122.80100 95.48600  100.32100 1.000 120.98820 ? 59  LYS B N     1 
ATOM 1099  C CA    . LYS B 2 60  ? 123.95200 95.57800  101.20300 1.000 120.98820 ? 59  LYS B CA    1 
ATOM 1100  C C     . LYS B 2 60  ? 123.78400 96.73500  102.17300 1.000 120.98820 ? 59  LYS B C     1 
ATOM 1101  O O     . LYS B 2 60  ? 123.92600 96.55800  103.39000 1.000 120.98820 ? 59  LYS B O     1 
ATOM 1102  C CB    . LYS B 2 60  ? 125.22600 95.74400  100.38300 1.000 120.98820 ? 59  LYS B CB    1 
ATOM 1103  C CG    . LYS B 2 60  ? 126.49000 95.66100  101.19700 1.000 120.98820 ? 59  LYS B CG    1 
ATOM 1104  C CD    . LYS B 2 60  ? 127.66300 96.24200  100.44500 1.000 120.98820 ? 59  LYS B CD    1 
ATOM 1105  C CE    . LYS B 2 60  ? 128.96600 95.84700  101.10600 1.000 120.98820 ? 59  LYS B CE    1 
ATOM 1106  N NZ    . LYS B 2 60  ? 129.07200 94.37100  101.22900 1.000 120.98820 ? 59  LYS B NZ    1 
ATOM 1107  N N     . VAL B 2 61  ? 123.47100 97.92300  101.64200 1.000 122.57258 ? 60  VAL B N     1 
ATOM 1108  C CA    . VAL B 2 61  ? 123.39100 99.13900  102.44900 1.000 122.57258 ? 60  VAL B CA    1 
ATOM 1109  C C     . VAL B 2 61  ? 122.29200 99.02100  103.49300 1.000 122.57258 ? 60  VAL B C     1 
ATOM 1110  O O     . VAL B 2 61  ? 122.48900 99.37200  104.66400 1.000 122.57258 ? 60  VAL B O     1 
ATOM 1111  C CB    . VAL B 2 61  ? 123.19400 100.36200 101.53700 1.000 122.57258 ? 60  VAL B CB    1 
ATOM 1112  C CG1   . VAL B 2 61  ? 122.95400 101.61500 102.35400 1.000 122.57258 ? 60  VAL B CG1   1 
ATOM 1113  C CG2   . VAL B 2 61  ? 124.41200 100.54200 100.65600 1.000 122.57258 ? 60  VAL B CG2   1 
ATOM 1114  N N     . PHE B 2 62  ? 121.12500 98.51100  103.08900 1.000 118.27517 ? 61  PHE B N     1 
ATOM 1115  C CA    . PHE B 2 62  ? 120.04600 98.26300  104.03700 1.000 118.27517 ? 61  PHE B CA    1 
ATOM 1116  C C     . PHE B 2 62  ? 120.44600 97.23900  105.08900 1.000 118.27517 ? 61  PHE B C     1 
ATOM 1117  O O     . PHE B 2 62  ? 119.98400 97.31000  106.23100 1.000 118.27517 ? 61  PHE B O     1 
ATOM 1118  C CB    . PHE B 2 62  ? 118.79700 97.78700  103.30600 1.000 118.27517 ? 61  PHE B CB    1 
ATOM 1119  C CG    . PHE B 2 62  ? 117.63000 97.54400  104.20800 1.000 118.27517 ? 61  PHE B CG    1 
ATOM 1120  C CD1   . PHE B 2 62  ? 116.96000 98.60600  104.78300 1.000 118.27517 ? 61  PHE B CD1   1 
ATOM 1121  C CD2   . PHE B 2 62  ? 117.22200 96.25700  104.50800 1.000 118.27517 ? 61  PHE B CD2   1 
ATOM 1122  C CE1   . PHE B 2 62  ? 115.88500 98.39100  105.61700 1.000 118.27517 ? 61  PHE B CE1   1 
ATOM 1123  C CE2   . PHE B 2 62  ? 116.15200 96.03400  105.34500 1.000 118.27517 ? 61  PHE B CE2   1 
ATOM 1124  C CZ    . PHE B 2 62  ? 115.48300 97.10200  105.90000 1.000 118.27517 ? 61  PHE B CZ    1 
ATOM 1125  N N     . LEU B 2 63  ? 121.32100 96.30300  104.74200 1.000 118.64378 ? 62  LEU B N     1 
ATOM 1126  C CA    . LEU B 2 63  ? 121.80800 95.36100  105.73200 1.000 118.64378 ? 62  LEU B CA    1 
ATOM 1127  C C     . LEU B 2 63  ? 123.05800 95.86100  106.41900 1.000 118.64378 ? 62  LEU B C     1 
ATOM 1128  O O     . LEU B 2 63  ? 123.56100 95.19100  107.32000 1.000 118.64378 ? 62  LEU B O     1 
ATOM 1129  C CB    . LEU B 2 63  ? 122.09900 94.00300  105.09600 1.000 118.64378 ? 62  LEU B CB    1 
ATOM 1130  C CG    . LEU B 2 63  ? 121.03000 92.91700  105.18000 1.000 118.64378 ? 62  LEU B CG    1 
ATOM 1131  C CD1   . LEU B 2 63  ? 120.97100 92.42000  106.59700 1.000 118.64378 ? 62  LEU B CD1   1 
ATOM 1132  C CD2   . LEU B 2 63  ? 119.66700 93.40200  104.73200 1.000 118.64378 ? 62  LEU B CD2   1 
ATOM 1133  N N     . GLU B 2 64  ? 123.56700 97.01500  106.01300 1.000 131.03460 ? 63  GLU B N     1 
ATOM 1134  C CA    . GLU B 2 64  ? 124.67200 97.63900  106.71300 1.000 131.03460 ? 63  GLU B CA    1 
ATOM 1135  C C     . GLU B 2 64  ? 124.18700 98.62300  107.76200 1.000 131.03460 ? 63  GLU B C     1 
ATOM 1136  O O     . GLU B 2 64  ? 124.91500 98.90900  108.71500 1.000 131.03460 ? 63  GLU B O     1 
ATOM 1137  C CB    . GLU B 2 64  ? 125.58700 98.33700  105.70300 1.000 131.03460 ? 63  GLU B CB    1 
ATOM 1138  C CG    . GLU B 2 64  ? 126.95900 98.74400  106.21300 1.000 131.03460 ? 63  GLU B CG    1 
ATOM 1139  C CD    . GLU B 2 64  ? 127.01400 100.20800 106.60300 1.000 131.03460 ? 63  GLU B CD    1 
ATOM 1140  O OE1   . GLU B 2 64  ? 128.08500 100.68600 107.02500 1.000 131.03460 ? 63  GLU B OE1   1 
ATOM 1141  O OE2   . GLU B 2 64  ? 125.97800 100.88600 106.49400 1.000 131.03460 ? 63  GLU B OE2   1 
ATOM 1142  N N     . ASN B 2 65  ? 122.96400 99.12200  107.62200 1.000 127.41280 ? 64  ASN B N     1 
ATOM 1143  C CA    . ASN B 2 65  ? 122.43400 100.08400 108.57300 1.000 127.41280 ? 64  ASN B CA    1 
ATOM 1144  C C     . ASN B 2 65  ? 121.71000 99.43400  109.73300 1.000 127.41280 ? 64  ASN B C     1 
ATOM 1145  O O     . ASN B 2 65  ? 121.78300 99.94600  110.85200 1.000 127.41280 ? 64  ASN B O     1 
ATOM 1146  C CB    . ASN B 2 65  ? 121.46700 101.04500 107.88300 1.000 127.41280 ? 64  ASN B CB    1 
ATOM 1147  C CG    . ASN B 2 65  ? 122.16200 102.00300 106.95800 1.000 127.41280 ? 64  ASN B CG    1 
ATOM 1148  O OD1   . ASN B 2 65  ? 123.26400 101.74100 106.49400 1.000 127.41280 ? 64  ASN B OD1   1 
ATOM 1149  N ND2   . ASN B 2 65  ? 121.52300 103.13400 106.69000 1.000 127.41280 ? 64  ASN B ND2   1 
ATOM 1150  N N     . VAL B 2 66  ? 121.01800 98.32100  109.49700 1.000 114.26082 ? 65  VAL B N     1 
ATOM 1151  C CA    . VAL B 2 66  ? 120.20200 97.71800  110.54700 1.000 114.26082 ? 65  VAL B CA    1 
ATOM 1152  C C     . VAL B 2 66  ? 121.08000 97.06800  111.60300 1.000 114.26082 ? 65  VAL B C     1 
ATOM 1153  O O     . VAL B 2 66  ? 120.99600 97.40400  112.79100 1.000 114.26082 ? 65  VAL B O     1 
ATOM 1154  C CB    . VAL B 2 66  ? 119.20900 96.70900  109.95200 1.000 114.26082 ? 65  VAL B CB    1 
ATOM 1155  C CG1   . VAL B 2 66  ? 118.47200 95.99800  111.05800 1.000 114.26082 ? 65  VAL B CG1   1 
ATOM 1156  C CG2   . VAL B 2 66  ? 118.22500 97.42100  109.05900 1.000 114.26082 ? 65  VAL B CG2   1 
ATOM 1157  N N     . ILE B 2 67  ? 121.92800 96.12600  111.18100 1.000 113.31182 ? 66  ILE B N     1 
ATOM 1158  C CA    . ILE B 2 67  ? 122.73900 95.35500  112.11900 1.000 113.31182 ? 66  ILE B CA    1 
ATOM 1159  C C     . ILE B 2 67  ? 123.72700 96.23700  112.86400 1.000 113.31182 ? 66  ILE B C     1 
ATOM 1160  O O     . ILE B 2 67  ? 124.03200 95.96700  114.02900 1.000 113.31182 ? 66  ILE B O     1 
ATOM 1161  C CB    . ILE B 2 67  ? 123.43000 94.17700  111.41200 1.000 113.31182 ? 66  ILE B CB    1 
ATOM 1162  C CG1   . ILE B 2 67  ? 124.45300 94.65900  110.40600 1.000 113.31182 ? 66  ILE B CG1   1 
ATOM 1163  C CG2   . ILE B 2 67  ? 122.40700 93.31800  110.71000 1.000 113.31182 ? 66  ILE B CG2   1 
ATOM 1164  C CD1   . ILE B 2 67  ? 125.25700 93.58300  109.88500 1.000 113.31182 ? 66  ILE B CD1   1 
ATOM 1165  N N     . ARG B 2 68  ? 124.22500 97.30700  112.22000 1.000 123.06196 ? 67  ARG B N     1 
ATOM 1166  C CA    . ARG B 2 68  ? 125.10600 98.26400  112.88300 1.000 123.06196 ? 67  ARG B CA    1 
ATOM 1167  C C     . ARG B 2 68  ? 124.41600 98.93400  114.05800 1.000 123.06196 ? 67  ARG B C     1 
ATOM 1168  O O     . ARG B 2 68  ? 125.07200 99.33800  115.02200 1.000 123.06196 ? 67  ARG B O     1 
ATOM 1169  C CB    . ARG B 2 68  ? 125.58200 99.32100  111.89000 1.000 123.06196 ? 67  ARG B CB    1 
ATOM 1170  C CG    . ARG B 2 68  ? 126.83200 100.05700 112.32400 1.000 123.06196 ? 67  ARG B CG    1 
ATOM 1171  C CD    . ARG B 2 68  ? 127.18300 101.17700 111.36200 1.000 123.06196 ? 67  ARG B CD    1 
ATOM 1172  N NE    . ARG B 2 68  ? 126.30000 102.33000 111.50200 1.000 123.06196 ? 67  ARG B NE    1 
ATOM 1173  C CZ    . ARG B 2 68  ? 125.36400 102.66200 110.61900 1.000 123.06196 ? 67  ARG B CZ    1 
ATOM 1174  N NH1   . ARG B 2 68  ? 125.19000 101.92900 109.52900 1.000 123.06196 ? 67  ARG B NH1   1 
ATOM 1175  N NH2   . ARG B 2 68  ? 124.60400 103.72700 110.82400 1.000 123.06196 ? 67  ARG B NH2   1 
ATOM 1176  N N     . ASP B 2 69  ? 123.09600 99.04900  113.99900 1.000 125.91020 ? 68  ASP B N     1 
ATOM 1177  C CA    . ASP B 2 69  ? 122.36200 99.48100  115.17100 1.000 125.91020 ? 68  ASP B CA    1 
ATOM 1178  C C     . ASP B 2 69  ? 122.15400 98.32500  116.13300 1.000 125.91020 ? 68  ASP B C     1 
ATOM 1179  O O     . ASP B 2 69  ? 122.28600 98.50400  117.35100 1.000 125.91020 ? 68  ASP B O     1 
ATOM 1180  C CB    . ASP B 2 69  ? 121.02700 100.07600 114.74600 1.000 125.91020 ? 68  ASP B CB    1 
ATOM 1181  C CG    . ASP B 2 69  ? 121.17800 101.10300 113.65200 1.000 125.91020 ? 68  ASP B CG    1 
ATOM 1182  O OD1   . ASP B 2 69  ? 120.18600 101.37900 112.94500 1.000 125.91020 ? 68  ASP B OD1   1 
ATOM 1183  O OD2   . ASP B 2 69  ? 122.30000 101.62300 113.48200 1.000 125.91020 ? 68  ASP B OD2   1 
ATOM 1184  N N     . ALA B 2 70  ? 121.85600 97.14000  115.58600 1.000 117.95527 ? 69  ALA B N     1 
ATOM 1185  C CA    . ALA B 2 70  ? 121.55800 95.95900  116.39200 1.000 117.95527 ? 69  ALA B CA    1 
ATOM 1186  C C     . ALA B 2 70  ? 122.71800 95.59300  117.30000 1.000 117.95527 ? 69  ALA B C     1 
ATOM 1187  O O     . ALA B 2 70  ? 122.52600 95.38400  118.50500 1.000 117.95527 ? 69  ALA B O     1 
ATOM 1188  C CB    . ALA B 2 70  ? 121.19600 94.78300  115.49100 1.000 117.95527 ? 69  ALA B CB    1 
ATOM 1189  N N     . VAL B 2 71  ? 123.93200 95.54100  116.73800 1.000 117.28963 ? 70  VAL B N     1 
ATOM 1190  C CA    . VAL B 2 71  ? 125.13500 95.26900  117.52100 1.000 117.28963 ? 70  VAL B CA    1 
ATOM 1191  C C     . VAL B 2 71  ? 125.31900 96.31700  118.61400 1.000 117.28963 ? 70  VAL B C     1 
ATOM 1192  O O     . VAL B 2 71  ? 125.75900 95.98700  119.72400 1.000 117.28963 ? 70  VAL B O     1 
ATOM 1193  C CB    . VAL B 2 71  ? 126.37000 95.15100  116.59500 1.000 117.28963 ? 70  VAL B CB    1 
ATOM 1194  C CG1   . VAL B 2 71  ? 126.66200 96.43100  115.83400 1.000 117.28963 ? 70  VAL B CG1   1 
ATOM 1195  C CG2   . VAL B 2 71  ? 127.58900 94.72200  117.36400 1.000 117.28963 ? 70  VAL B CG2   1 
ATOM 1196  N N     . THR B 2 72  ? 124.91500 97.56800  118.34500 1.000 122.12457 ? 71  THR B N     1 
ATOM 1197  C CA    . THR B 2 72  ? 124.95000 98.61600  119.35700 1.000 122.12457 ? 71  THR B CA    1 
ATOM 1198  C C     . THR B 2 72  ? 124.05900 98.26800  120.53400 1.000 122.12457 ? 71  THR B C     1 
ATOM 1199  O O     . THR B 2 72  ? 124.46700 98.41300  121.69100 1.000 122.12457 ? 71  THR B O     1 
ATOM 1200  C CB    . THR B 2 72  ? 124.52800 99.94400  118.74700 1.000 122.12457 ? 71  THR B CB    1 
ATOM 1201  O OG1   . THR B 2 72  ? 125.19800 100.11700 117.49500 1.000 122.12457 ? 71  THR B OG1   1 
ATOM 1202  C CG2   . THR B 2 72  ? 124.89400 101.07700 119.67100 1.000 122.12457 ? 71  THR B CG2   1 
ATOM 1203  N N     . TYR B 2 73  ? 122.85700 97.75800  120.25600 1.000 124.28863 ? 72  TYR B N     1 
ATOM 1204  C CA    . TYR B 2 73  ? 121.98500 97.30400  121.32800 1.000 124.28863 ? 72  TYR B CA    1 
ATOM 1205  C C     . TYR B 2 73  ? 122.55600 96.10300  122.06400 1.000 124.28863 ? 72  TYR B C     1 
ATOM 1206  O O     . TYR B 2 73  ? 122.18700 95.86700  123.21600 1.000 124.28863 ? 72  TYR B O     1 
ATOM 1207  C CB    . TYR B 2 73  ? 120.60500 96.96600  120.78200 1.000 124.28863 ? 72  TYR B CB    1 
ATOM 1208  C CG    . TYR B 2 73  ? 119.70700 98.16200  120.61300 1.000 124.28863 ? 72  TYR B CG    1 
ATOM 1209  C CD1   . TYR B 2 73  ? 119.13300 98.77900  121.71200 1.000 124.28863 ? 72  TYR B CD1   1 
ATOM 1210  C CD2   . TYR B 2 73  ? 119.42400 98.66800  119.35400 1.000 124.28863 ? 72  TYR B CD2   1 
ATOM 1211  C CE1   . TYR B 2 73  ? 118.30600 99.87000  121.56400 1.000 124.28863 ? 72  TYR B CE1   1 
ATOM 1212  C CE2   . TYR B 2 73  ? 118.59700 99.75600  119.19500 1.000 124.28863 ? 72  TYR B CE2   1 
ATOM 1213  C CZ    . TYR B 2 73  ? 118.04300 100.35400 120.30400 1.000 124.28863 ? 72  TYR B CZ    1 
ATOM 1214  O OH    . TYR B 2 73  ? 117.22000 101.44200 120.15100 1.000 124.28863 ? 72  TYR B OH    1 
ATOM 1215  N N     . THR B 2 74  ? 123.45400 95.35200  121.43800 1.000 127.08279 ? 73  THR B N     1 
ATOM 1216  C CA    . THR B 2 74  ? 124.14900 94.29600  122.14600 1.000 127.08279 ? 73  THR B CA    1 
ATOM 1217  C C     . THR B 2 74  ? 125.46900 94.76400  122.72200 1.000 127.08279 ? 73  THR B C     1 
ATOM 1218  O O     . THR B 2 74  ? 126.07500 94.03400  123.50900 1.000 127.08279 ? 73  THR B O     1 
ATOM 1219  C CB    . THR B 2 74  ? 124.40500 93.11100  121.22500 1.000 127.08279 ? 73  THR B CB    1 
ATOM 1220  O OG1   . THR B 2 74  ? 125.46000 93.44300  120.31700 1.000 127.08279 ? 73  THR B OG1   1 
ATOM 1221  C CG2   . THR B 2 74  ? 123.15300 92.77200  120.44800 1.000 127.08279 ? 73  THR B CG2   1 
ATOM 1222  N N     . GLU B 2 75  ? 125.93400 95.95200  122.35300 1.000 134.19744 ? 74  GLU B N     1 
ATOM 1223  C CA    . GLU B 2 75  ? 127.16300 96.43900  122.95600 1.000 134.19744 ? 74  GLU B CA    1 
ATOM 1224  C C     . GLU B 2 75  ? 126.88900 97.09000  124.29700 1.000 134.19744 ? 74  GLU B C     1 
ATOM 1225  O O     . GLU B 2 75  ? 127.77900 97.13100  125.15200 1.000 134.19744 ? 74  GLU B O     1 
ATOM 1226  C CB    . GLU B 2 75  ? 127.87200 97.43000  122.03500 1.000 134.19744 ? 74  GLU B CB    1 
ATOM 1227  C CG    . GLU B 2 75  ? 128.66900 96.80300  120.90600 1.000 134.19744 ? 74  GLU B CG    1 
ATOM 1228  C CD    . GLU B 2 75  ? 128.90500 97.77100  119.76000 1.000 134.19744 ? 74  GLU B CD    1 
ATOM 1229  O OE1   . GLU B 2 75  ? 129.40000 97.33300  118.70100 1.000 134.19744 ? 74  GLU B OE1   1 
ATOM 1230  O OE2   . GLU B 2 75  ? 128.59400 98.97100  119.91600 1.000 134.19744 ? 74  GLU B OE2   1 
ATOM 1231  N N     . HIS B 2 76  ? 125.68000 97.62000  124.48500 1.000 131.62129 ? 75  HIS B N     1 
ATOM 1232  C CA    . HIS B 2 76  ? 125.33300 98.20900  125.77000 1.000 131.62129 ? 75  HIS B CA    1 
ATOM 1233  C C     . HIS B 2 76  ? 125.22800 97.14100  126.84400 1.000 131.62129 ? 75  HIS B C     1 
ATOM 1234  O O     . HIS B 2 76  ? 125.66100 97.35100  127.98200 1.000 131.62129 ? 75  HIS B O     1 
ATOM 1235  C CB    . HIS B 2 76  ? 124.02600 98.98200  125.66700 1.000 131.62129 ? 75  HIS B CB    1 
ATOM 1236  C CG    . HIS B 2 76  ? 123.51400 99.44800  126.98800 1.000 131.62129 ? 75  HIS B CG    1 
ATOM 1237  N ND1   . HIS B 2 76  ? 122.49900 98.80800  127.66400 1.000 131.62129 ? 75  HIS B ND1   1 
ATOM 1238  C CD2   . HIS B 2 76  ? 123.89400 100.48400 127.76900 1.000 131.62129 ? 75  HIS B CD2   1 
ATOM 1239  C CE1   . HIS B 2 76  ? 122.27100 99.43700  128.80300 1.000 131.62129 ? 75  HIS B CE1   1 
ATOM 1240  N NE2   . HIS B 2 76  ? 123.10300 100.45700 128.89100 1.000 131.62129 ? 75  HIS B NE2   1 
ATOM 1241  N N     . ALA B 2 77  ? 124.67200 95.99100  126.50300 1.000 128.72393 ? 76  ALA B N     1 
ATOM 1242  C CA    . ALA B 2 77  ? 124.63400 94.89600  127.45100 1.000 128.72393 ? 76  ALA B CA    1 
ATOM 1243  C C     . ALA B 2 77  ? 125.90600 94.08100  127.30200 1.000 128.72393 ? 76  ALA B C     1 
ATOM 1244  O O     . ALA B 2 77  ? 126.63700 94.20400  126.32000 1.000 128.72393 ? 76  ALA B O     1 
ATOM 1245  C CB    . ALA B 2 77  ? 123.40700 94.01600  127.23200 1.000 128.72393 ? 76  ALA B CB    1 
ATOM 1246  N N     . LYS B 2 78  ? 126.18300 93.25900  128.30300 1.000 137.21683 ? 77  LYS B N     1 
ATOM 1247  C CA    . LYS B 2 78  ? 127.39500 92.44500  128.28600 1.000 137.21683 ? 77  LYS B CA    1 
ATOM 1248  C C     . LYS B 2 78  ? 127.08900 91.09900  127.63300 1.000 137.21683 ? 77  LYS B C     1 
ATOM 1249  O O     . LYS B 2 78  ? 127.10700 90.03900  128.26000 1.000 137.21683 ? 77  LYS B O     1 
ATOM 1250  C CB    . LYS B 2 78  ? 127.94500 92.28500  129.69500 1.000 137.21683 ? 77  LYS B CB    1 
ATOM 1251  C CG    . LYS B 2 78  ? 128.17000 93.60300  130.41900 1.000 137.21683 ? 77  LYS B CG    1 
ATOM 1252  C CD    . LYS B 2 78  ? 128.95300 94.60000  129.57800 1.000 137.21683 ? 77  LYS B CD    1 
ATOM 1253  C CE    . LYS B 2 78  ? 128.93900 95.96100  130.23700 1.000 137.21683 ? 77  LYS B CE    1 
ATOM 1254  N NZ    . LYS B 2 78  ? 127.54400 96.39100  130.52400 1.000 137.21683 ? 77  LYS B NZ    1 
ATOM 1255  N N     . ARG B 2 79  ? 126.79300 91.16000  126.33900 1.000 138.53967 ? 78  ARG B N     1 
ATOM 1256  C CA    . ARG B 2 79  ? 126.45300 89.97700  125.56900 1.000 138.53967 ? 78  ARG B CA    1 
ATOM 1257  C C     . ARG B 2 79  ? 127.26900 89.95200  124.29000 1.000 138.53967 ? 78  ARG B C     1 
ATOM 1258  O O     . ARG B 2 79  ? 127.83600 90.96200  123.87200 1.000 138.53967 ? 78  ARG B O     1 
ATOM 1259  C CB    . ARG B 2 79  ? 124.96200 89.94300  125.23400 1.000 138.53967 ? 78  ARG B CB    1 
ATOM 1260  C CG    . ARG B 2 79  ? 124.08300 89.73700  126.44300 1.000 138.53967 ? 78  ARG B CG    1 
ATOM 1261  C CD    . ARG B 2 79  ? 122.66400 89.42800  126.05300 1.000 138.53967 ? 78  ARG B CD    1 
ATOM 1262  N NE    . ARG B 2 79  ? 122.15300 90.38400  125.08500 1.000 138.53967 ? 78  ARG B NE    1 
ATOM 1263  C CZ    . ARG B 2 79  ? 120.88000 90.45500  124.72300 1.000 138.53967 ? 78  ARG B CZ    1 
ATOM 1264  N NH1   . ARG B 2 79  ? 119.99500 89.62800  125.25400 1.000 138.53967 ? 78  ARG B NH1   1 
ATOM 1265  N NH2   . ARG B 2 79  ? 120.49200 91.35300  123.83200 1.000 138.53967 ? 78  ARG B NH2   1 
ATOM 1266  N N     . LYS B 2 80  ? 127.33300 88.77600  123.67300 1.000 144.99250 ? 79  LYS B N     1 
ATOM 1267  C CA    . LYS B 2 80  ? 128.05700 88.61000  122.42200 1.000 144.99250 ? 79  LYS B CA    1 
ATOM 1268  C C     . LYS B 2 80  ? 127.18400 88.02500  121.32500 1.000 144.99250 ? 79  LYS B C     1 
ATOM 1269  O O     . LYS B 2 80  ? 127.70700 87.60200  120.28900 1.000 144.99250 ? 79  LYS B O     1 
ATOM 1270  C CB    . LYS B 2 80  ? 129.29500 87.73400  122.62200 1.000 144.99250 ? 79  LYS B CB    1 
ATOM 1271  C CG    . LYS B 2 80  ? 130.50400 88.48900  123.12900 1.000 144.99250 ? 79  LYS B CG    1 
ATOM 1272  C CD    . LYS B 2 80  ? 131.61800 87.54000  123.51300 1.000 144.99250 ? 79  LYS B CD    1 
ATOM 1273  C CE    . LYS B 2 80  ? 131.43600 87.04000  124.93200 1.000 144.99250 ? 79  LYS B CE    1 
ATOM 1274  N NZ    . LYS B 2 80  ? 132.00400 87.99300  125.92200 1.000 144.99250 ? 79  LYS B NZ    1 
ATOM 1275  N N     . THR B 2 81  ? 125.87300 87.98700  121.51900 1.000 137.76256 ? 80  THR B N     1 
ATOM 1276  C CA    . THR B 2 81  ? 124.96500 87.46200  120.51700 1.000 137.76256 ? 80  THR B CA    1 
ATOM 1277  C C     . THR B 2 81  ? 123.96500 88.53800  120.12000 1.000 137.76256 ? 80  THR B C     1 
ATOM 1278  O O     . THR B 2 81  ? 123.71300 89.49100  120.86000 1.000 137.76256 ? 80  THR B O     1 
ATOM 1279  C CB    . THR B 2 81  ? 124.23000 86.22000  121.01500 1.000 137.76256 ? 80  THR B CB    1 
ATOM 1280  O OG1   . THR B 2 81  ? 123.33100 85.76700  119.99800 1.000 137.76256 ? 80  THR B OG1   1 
ATOM 1281  C CG2   . THR B 2 81  ? 123.44800 86.53500  122.26600 1.000 137.76256 ? 80  THR B CG2   1 
ATOM 1282  N N     . VAL B 2 82  ? 123.40300 88.38300  118.93300 1.000 125.75699 ? 81  VAL B N     1 
ATOM 1283  C CA    . VAL B 2 82  ? 122.41500 89.31200  118.41000 1.000 125.75699 ? 81  VAL B CA    1 
ATOM 1284  C C     . VAL B 2 82  ? 121.07100 88.61400  118.53100 1.000 125.75699 ? 81  VAL B C     1 
ATOM 1285  O O     . VAL B 2 82  ? 120.70700 87.79900  117.68400 1.000 125.75699 ? 81  VAL B O     1 
ATOM 1286  C CB    . VAL B 2 82  ? 122.71800 89.70000  116.96500 1.000 125.75699 ? 81  VAL B CB    1 
ATOM 1287  C CG1   . VAL B 2 82  ? 121.90800 90.90700  116.57100 1.000 125.75699 ? 81  VAL B CG1   1 
ATOM 1288  C CG2   . VAL B 2 82  ? 124.19200 89.96600  116.79800 1.000 125.75699 ? 81  VAL B CG2   1 
ATOM 1289  N N     . THR B 2 83  ? 120.32600 88.92900  119.58000 1.000 120.02787 ? 82  THR B N     1 
ATOM 1290  C CA    . THR B 2 83  ? 119.04500 88.27500  119.76100 1.000 120.02787 ? 82  THR B CA    1 
ATOM 1291  C C     . THR B 2 83  ? 117.99500 88.90000  118.85400 1.000 120.02787 ? 82  THR B C     1 
ATOM 1292  O O     . THR B 2 83  ? 118.20600 89.94400  118.23700 1.000 120.02787 ? 82  THR B O     1 
ATOM 1293  C CB    . THR B 2 83  ? 118.59100 88.36100  121.21000 1.000 120.02787 ? 82  THR B CB    1 
ATOM 1294  O OG1   . THR B 2 83  ? 117.97900 89.63600  121.43200 1.000 120.02787 ? 82  THR B OG1   1 
ATOM 1295  C CG2   . THR B 2 83  ? 119.77500 88.20000  122.13700 1.000 120.02787 ? 82  THR B CG2   1 
ATOM 1296  N N     . ALA B 2 84  ? 116.83700 88.24400  118.79200 1.000 119.49232 ? 83  ALA B N     1 
ATOM 1297  C CA    . ALA B 2 84  ? 115.73300 88.73700  117.98300 1.000 119.49232 ? 83  ALA B CA    1 
ATOM 1298  C C     . ALA B 2 84  ? 115.13600 90.01900  118.53300 1.000 119.49232 ? 83  ALA B C     1 
ATOM 1299  O O     . ALA B 2 84  ? 114.45700 90.73800  117.79800 1.000 119.49232 ? 83  ALA B O     1 
ATOM 1300  C CB    . ALA B 2 84  ? 114.64500 87.67600  117.88000 1.000 119.49232 ? 83  ALA B CB    1 
ATOM 1301  N N     . MET B 2 85  ? 115.32200 90.29300  119.81700 1.000 123.50215 ? 84  MET B N     1 
ATOM 1302  C CA    . MET B 2 85  ? 114.80600 91.53200  120.37400 1.000 123.50215 ? 84  MET B CA    1 
ATOM 1303  C C     . MET B 2 85  ? 115.61300 92.73000  119.88800 1.000 123.50215 ? 84  MET B C     1 
ATOM 1304  O O     . MET B 2 85  ? 115.05500 93.80600  119.64200 1.000 123.50215 ? 84  MET B O     1 
ATOM 1305  C CB    . MET B 2 85  ? 114.80600 91.45200  121.89600 1.000 123.50215 ? 84  MET B CB    1 
ATOM 1306  C CG    . MET B 2 85  ? 113.76100 92.32600  122.53100 1.000 123.50215 ? 84  MET B CG    1 
ATOM 1307  S SD    . MET B 2 85  ? 112.17300 91.47600  122.56400 1.000 123.50215 ? 84  MET B SD    1 
ATOM 1308  C CE    . MET B 2 85  ? 111.19500 92.52300  121.49300 1.000 123.50215 ? 84  MET B CE    1 
ATOM 1309  N N     . ASP B 2 86  ? 116.93100 92.56400  119.76300 1.000 122.19277 ? 85  ASP B N     1 
ATOM 1310  C CA    . ASP B 2 86  ? 117.78400 93.66300  119.32200 1.000 122.19277 ? 85  ASP B CA    1 
ATOM 1311  C C     . ASP B 2 86  ? 117.51900 94.07200  117.88000 1.000 122.19277 ? 85  ASP B C     1 
ATOM 1312  O O     . ASP B 2 86  ? 117.55200 95.26700  117.56200 1.000 122.19277 ? 85  ASP B O     1 
ATOM 1313  C CB    . ASP B 2 86  ? 119.24700 93.27700  119.49300 1.000 122.19277 ? 85  ASP B CB    1 
ATOM 1314  C CG    . ASP B 2 86  ? 119.54800 92.76100  120.87900 1.000 122.19277 ? 85  ASP B CG    1 
ATOM 1315  O OD1   . ASP B 2 86  ? 119.42600 91.53900  121.09000 1.000 122.19277 ? 85  ASP B OD1   1 
ATOM 1316  O OD2   . ASP B 2 86  ? 119.91000 93.57200  121.75700 1.000 122.19277 ? 85  ASP B OD2   1 
ATOM 1317  N N     . VAL B 2 87  ? 117.25700 93.10800  116.99400 1.000 110.25949 ? 86  VAL B N     1 
ATOM 1318  C CA    . VAL B 2 87  ? 116.99900 93.44300  115.59500 1.000 110.25949 ? 86  VAL B CA    1 
ATOM 1319  C C     . VAL B 2 87  ? 115.69500 94.23000  115.45600 1.000 110.25949 ? 86  VAL B C     1 
ATOM 1320  O O     . VAL B 2 87  ? 115.64900 95.25200  114.76000 1.000 110.25949 ? 86  VAL B O     1 
ATOM 1321  C CB    . VAL B 2 87  ? 117.07900 92.19400  114.68800 1.000 110.25949 ? 86  VAL B CB    1 
ATOM 1322  C CG1   . VAL B 2 87  ? 116.09600 91.10600  115.03900 1.000 110.25949 ? 86  VAL B CG1   1 
ATOM 1323  C CG2   . VAL B 2 87  ? 116.90900 92.58600  113.23800 1.000 110.25949 ? 86  VAL B CG2   1 
ATOM 1324  N N     . VAL B 2 88  ? 114.62400 93.77900  116.11500 1.000 114.52790 ? 87  VAL B N     1 
ATOM 1325  C CA    . VAL B 2 88  ? 113.35800 94.49100  116.01000 1.000 114.52790 ? 87  VAL B CA    1 
ATOM 1326  C C     . VAL B 2 88  ? 113.44100 95.83500  116.73100 1.000 114.52790 ? 87  VAL B C     1 
ATOM 1327  O O     . VAL B 2 88  ? 112.79800 96.80500  116.31200 1.000 114.52790 ? 87  VAL B O     1 
ATOM 1328  C CB    . VAL B 2 88  ? 112.20000 93.59600  116.50500 1.000 114.52790 ? 87  VAL B CB    1 
ATOM 1329  C CG1   . VAL B 2 88  ? 112.29500 93.30000  117.98000 1.000 114.52790 ? 87  VAL B CG1   1 
ATOM 1330  C CG2   . VAL B 2 88  ? 110.85100 94.19600  116.16100 1.000 114.52790 ? 87  VAL B CG2   1 
ATOM 1331  N N     . TYR B 2 89  ? 114.27800 95.94100  117.77200 1.000 121.55805 ? 88  TYR B N     1 
ATOM 1332  C CA    . TYR B 2 89  ? 114.48800 97.23100  118.42300 1.000 121.55805 ? 88  TYR B CA    1 
ATOM 1333  C C     . TYR B 2 89  ? 115.18300 98.21400  117.49300 1.000 121.55805 ? 88  TYR B C     1 
ATOM 1334  O O     . TYR B 2 89  ? 114.79000 99.38500  117.41400 1.000 121.55805 ? 88  TYR B O     1 
ATOM 1335  C CB    . TYR B 2 89  ? 115.30000 97.06200  119.70200 1.000 121.55805 ? 88  TYR B CB    1 
ATOM 1336  C CG    . TYR B 2 89  ? 114.47800 96.64400  120.89000 1.000 121.55805 ? 88  TYR B CG    1 
ATOM 1337  C CD1   . TYR B 2 89  ? 113.09400 96.72500  120.86300 1.000 121.55805 ? 88  TYR B CD1   1 
ATOM 1338  C CD2   . TYR B 2 89  ? 115.08700 96.17700  122.04200 1.000 121.55805 ? 88  TYR B CD2   1 
ATOM 1339  C CE1   . TYR B 2 89  ? 112.34100 96.34100  121.94400 1.000 121.55805 ? 88  TYR B CE1   1 
ATOM 1340  C CE2   . TYR B 2 89  ? 114.34400 95.79800  123.13100 1.000 121.55805 ? 88  TYR B CE2   1 
ATOM 1341  C CZ    . TYR B 2 89  ? 112.97100 95.88000  123.07500 1.000 121.55805 ? 88  TYR B CZ    1 
ATOM 1342  O OH    . TYR B 2 89  ? 112.22300 95.49800  124.16000 1.000 121.55805 ? 88  TYR B OH    1 
ATOM 1343  N N     . ALA B 2 90  ? 116.22300 97.75200  116.79100 1.000 118.39262 ? 89  ALA B N     1 
ATOM 1344  C CA    . ALA B 2 90  ? 116.91800 98.59900  115.82700 1.000 118.39262 ? 89  ALA B CA    1 
ATOM 1345  C C     . ALA B 2 90  ? 116.00200 99.00300  114.68100 1.000 118.39262 ? 89  ALA B C     1 
ATOM 1346  O O     . ALA B 2 90  ? 116.06000 100.14200 114.20000 1.000 118.39262 ? 89  ALA B O     1 
ATOM 1347  C CB    . ALA B 2 90  ? 118.14500 97.86900  115.29400 1.000 118.39262 ? 89  ALA B CB    1 
ATOM 1348  N N     . LEU B 2 91  ? 115.13500 98.08800  114.25100 1.000 118.52231 ? 90  LEU B N     1 
ATOM 1349  C CA    . LEU B 2 91  ? 114.18500 98.40200  113.19200 1.000 118.52231 ? 90  LEU B CA    1 
ATOM 1350  C C     . LEU B 2 91  ? 113.16700 99.43800  113.64500 1.000 118.52231 ? 90  LEU B C     1 
ATOM 1351  O O     . LEU B 2 91  ? 112.79300 100.32800 112.87200 1.000 118.52231 ? 90  LEU B O     1 
ATOM 1352  C CB    . LEU B 2 91  ? 113.48500 97.12900  112.73900 1.000 118.52231 ? 90  LEU B CB    1 
ATOM 1353  C CG    . LEU B 2 91  ? 114.28500 96.22800  111.81000 1.000 118.52231 ? 90  LEU B CG    1 
ATOM 1354  C CD1   . LEU B 2 91  ? 113.58400 94.90000  111.68700 1.000 118.52231 ? 90  LEU B CD1   1 
ATOM 1355  C CD2   . LEU B 2 91  ? 114.43300 96.88200  110.46100 1.000 118.52231 ? 90  LEU B CD2   1 
ATOM 1356  N N     . LYS B 2 92  ? 112.71300 99.33900  114.89700 1.000 122.96838 ? 91  LYS B N     1 
ATOM 1357  C CA    . LYS B 2 92  ? 111.77500 100.32400 115.42400 1.000 122.96838 ? 91  LYS B CA    1 
ATOM 1358  C C     . LYS B 2 92  ? 112.43600 101.68300 115.59000 1.000 122.96838 ? 91  LYS B C     1 
ATOM 1359  O O     . LYS B 2 92  ? 111.78500 102.71900 115.41900 1.000 122.96838 ? 91  LYS B O     1 
ATOM 1360  C CB    . LYS B 2 92  ? 111.18300 99.83700  116.74400 1.000 122.96838 ? 91  LYS B CB    1 
ATOM 1361  C CG    . LYS B 2 92  ? 109.97300 100.63500 117.19400 1.000 122.96838 ? 91  LYS B CG    1 
ATOM 1362  C CD    . LYS B 2 92  ? 109.15300 99.88800  118.22800 1.000 122.96838 ? 91  LYS B CD    1 
ATOM 1363  C CE    . LYS B 2 92  ? 109.98300 99.51100  119.43800 1.000 122.96838 ? 91  LYS B CE    1 
ATOM 1364  N NZ    . LYS B 2 92  ? 110.65100 100.69300 120.04500 1.000 122.96838 ? 91  LYS B NZ    1 
ATOM 1365  N N     . ARG B 2 93  ? 113.71900 101.69800 115.95300 1.000 123.51250 ? 92  ARG B N     1 
ATOM 1366  C CA    . ARG B 2 93  ? 114.43800 102.96500 116.01500 1.000 123.51250 ? 92  ARG B CA    1 
ATOM 1367  C C     . ARG B 2 93  ? 114.59800 103.56500 114.62400 1.000 123.51250 ? 92  ARG B C     1 
ATOM 1368  O O     . ARG B 2 93  ? 114.56000 104.78900 114.46600 1.000 123.51250 ? 92  ARG B O     1 
ATOM 1369  C CB    . ARG B 2 93  ? 115.80300 102.77700 116.67000 1.000 123.51250 ? 92  ARG B CB    1 
ATOM 1370  C CG    . ARG B 2 93  ? 116.34100 104.00800 117.39600 1.000 123.51250 ? 92  ARG B CG    1 
ATOM 1371  C CD    . ARG B 2 93  ? 117.16600 104.87500 116.48200 1.000 123.51250 ? 92  ARG B CD    1 
ATOM 1372  N NE    . ARG B 2 93  ? 118.02700 104.06500 115.63600 1.000 123.51250 ? 92  ARG B NE    1 
ATOM 1373  C CZ    . ARG B 2 93  ? 118.19300 104.27800 114.33700 1.000 123.51250 ? 92  ARG B CZ    1 
ATOM 1374  N NH1   . ARG B 2 93  ? 117.55100 105.27200 113.74100 1.000 123.51250 ? 92  ARG B NH1   1 
ATOM 1375  N NH2   . ARG B 2 93  ? 118.99500 103.49700 113.63200 1.000 123.51250 ? 92  ARG B NH2   1 
ATOM 1376  N N     . GLN B 2 94  ? 114.80000 102.72100 113.60900 1.000 126.75821 ? 93  GLN B N     1 
ATOM 1377  C CA    . GLN B 2 94  ? 114.92000 103.22800 112.24500 1.000 126.75821 ? 93  GLN B CA    1 
ATOM 1378  C C     . GLN B 2 94  ? 113.59300 103.76100 111.73000 1.000 126.75821 ? 93  GLN B C     1 
ATOM 1379  O O     . GLN B 2 94  ? 113.56300 104.72500 110.96000 1.000 126.75821 ? 93  GLN B O     1 
ATOM 1380  C CB    . GLN B 2 94  ? 115.44500 102.14300 111.31400 1.000 126.75821 ? 93  GLN B CB    1 
ATOM 1381  C CG    . GLN B 2 94  ? 116.94200 102.00300 111.32900 1.000 126.75821 ? 93  GLN B CG    1 
ATOM 1382  C CD    . GLN B 2 94  ? 117.47800 101.59600 109.98000 1.000 126.75821 ? 93  GLN B CD    1 
ATOM 1383  O OE1   . GLN B 2 94  ? 116.72400 101.45900 109.01900 1.000 126.75821 ? 93  GLN B OE1   1 
ATOM 1384  N NE2   . GLN B 2 94  ? 118.78700 101.41100 109.89500 1.000 126.75821 ? 93  GLN B NE2   1 
ATOM 1385  N N     . GLY B 2 95  ? 112.49300 103.13200 112.11500 1.000 122.82091 ? 94  GLY B N     1 
ATOM 1386  C CA    . GLY B 2 95  ? 111.20000 103.59700 111.66300 1.000 122.82091 ? 94  GLY B CA    1 
ATOM 1387  C C     . GLY B 2 95  ? 110.30100 102.48000 111.19400 1.000 122.82091 ? 94  GLY B C     1 
ATOM 1388  O O     . GLY B 2 95  ? 109.13100 102.40600 111.57600 1.000 122.82091 ? 94  GLY B O     1 
ATOM 1389  N N     . ARG B 2 96  ? 110.83800 101.60400 110.36200 1.000 123.90230 ? 95  ARG B N     1 
ATOM 1390  C CA    . ARG B 2 96  ? 110.09600 100.46200 109.85000 1.000 123.90230 ? 95  ARG B CA    1 
ATOM 1391  C C     . ARG B 2 96  ? 110.26200 99.32000  110.84300 1.000 123.90230 ? 95  ARG B C     1 
ATOM 1392  O O     . ARG B 2 96  ? 111.32600 98.70300  110.91500 1.000 123.90230 ? 95  ARG B O     1 
ATOM 1393  C CB    . ARG B 2 96  ? 110.59800 100.10000 108.45500 1.000 123.90230 ? 95  ARG B CB    1 
ATOM 1394  C CG    . ARG B 2 96  ? 112.09100 100.33800 108.26900 1.000 123.90230 ? 95  ARG B CG    1 
ATOM 1395  C CD    . ARG B 2 96  ? 112.59400 99.75900  106.97200 1.000 123.90230 ? 95  ARG B CD    1 
ATOM 1396  N NE    . ARG B 2 96  ? 112.03300 100.47200 105.83200 1.000 123.90230 ? 95  ARG B NE    1 
ATOM 1397  C CZ    . ARG B 2 96  ? 112.53800 101.59300 105.32900 1.000 123.90230 ? 95  ARG B CZ    1 
ATOM 1398  N NH1   . ARG B 2 96  ? 113.62200 102.13500 105.86700 1.000 123.90230 ? 95  ARG B NH1   1 
ATOM 1399  N NH2   . ARG B 2 96  ? 111.95800 102.17300 104.28900 1.000 123.90230 ? 95  ARG B NH2   1 
ATOM 1400  N N     . THR B 2 97  ? 109.22000 99.03100  111.61000 1.000 118.33513 ? 96  THR B N     1 
ATOM 1401  C CA    . THR B 2 97  ? 109.32100 97.98500  112.61300 1.000 118.33513 ? 96  THR B CA    1 
ATOM 1402  C C     . THR B 2 97  ? 108.50800 96.76000  112.22500 1.000 118.33513 ? 96  THR B C     1 
ATOM 1403  O O     . THR B 2 97  ? 107.69500 96.78200  111.29900 1.000 118.33513 ? 96  THR B O     1 
ATOM 1404  C CB    . THR B 2 97  ? 108.88800 98.51100  113.98200 1.000 118.33513 ? 96  THR B CB    1 
ATOM 1405  O OG1   . THR B 2 97  ? 109.04600 97.48100  114.96300 1.000 118.33513 ? 96  THR B OG1   1 
ATOM 1406  C CG2   . THR B 2 97  ? 107.47200 98.99100  113.95900 1.000 118.33513 ? 96  THR B CG2   1 
ATOM 1407  N N     . LEU B 2 98  ? 108.73700 95.68500  112.97200 1.000 116.65987 ? 97  LEU B N     1 
ATOM 1408  C CA    . LEU B 2 98  ? 108.12300 94.39300  112.71200 1.000 116.65987 ? 97  LEU B CA    1 
ATOM 1409  C C     . LEU B 2 98  ? 107.30700 93.91700  113.89700 1.000 116.65987 ? 97  LEU B C     1 
ATOM 1410  O O     . LEU B 2 98  ? 107.69300 94.11500  115.05100 1.000 116.65987 ? 97  LEU B O     1 
ATOM 1411  C CB    . LEU B 2 98  ? 109.18700 93.34500  112.41600 1.000 116.65987 ? 97  LEU B CB    1 
ATOM 1412  C CG    . LEU B 2 98  ? 109.56300 93.10600  110.96600 1.000 116.65987 ? 97  LEU B CG    1 
ATOM 1413  C CD1   . LEU B 2 98  ? 110.73400 92.15600  110.91500 1.000 116.65987 ? 97  LEU B CD1   1 
ATOM 1414  C CD2   . LEU B 2 98  ? 108.37400 92.51700  110.24500 1.000 116.65987 ? 97  LEU B CD2   1 
ATOM 1415  N N     . TYR B 2 99  ? 106.18900 93.27500  113.60300 1.000 118.05287 ? 98  TYR B N     1 
ATOM 1416  C CA    . TYR B 2 99  ? 105.35500 92.69100  114.63400 1.000 118.05287 ? 98  TYR B CA    1 
ATOM 1417  C C     . TYR B 2 99  ? 105.66600 91.20500  114.78200 1.000 118.05287 ? 98  TYR B C     1 
ATOM 1418  O O     . TYR B 2 99  ? 106.26800 90.58200  113.90600 1.000 118.05287 ? 98  TYR B O     1 
ATOM 1419  C CB    . TYR B 2 99  ? 103.87300 92.88500  114.32800 1.000 118.05287 ? 98  TYR B CB    1 
ATOM 1420  C CG    . TYR B 2 99  ? 103.35100 94.24300  114.70200 1.000 118.05287 ? 98  TYR B CG    1 
ATOM 1421  C CD1   . TYR B 2 99  ? 102.48700 94.93100  113.86900 1.000 118.05287 ? 98  TYR B CD1   1 
ATOM 1422  C CD2   . TYR B 2 99  ? 103.79000 94.87300  115.85300 1.000 118.05287 ? 98  TYR B CD2   1 
ATOM 1423  C CE1   . TYR B 2 99  ? 102.01300 96.17800  114.21300 1.000 118.05287 ? 98  TYR B CE1   1 
ATOM 1424  C CE2   . TYR B 2 99  ? 103.34400 96.12500  116.19200 1.000 118.05287 ? 98  TYR B CE2   1 
ATOM 1425  C CZ    . TYR B 2 99  ? 102.45600 96.77400  115.37000 1.000 118.05287 ? 98  TYR B CZ    1 
ATOM 1426  O OH    . TYR B 2 99  ? 102.00100 98.02200  115.71700 1.000 118.05287 ? 98  TYR B OH    1 
ATOM 1427  N N     . GLY B 2 100 ? 105.25000 90.64200  115.91300 1.000 115.41565 ? 99  GLY B N     1 
ATOM 1428  C CA    . GLY B 2 100 ? 105.38900 89.21700  116.14600 1.000 115.41565 ? 99  GLY B CA    1 
ATOM 1429  C C     . GLY B 2 100 ? 106.70300 88.71900  116.70200 1.000 115.41565 ? 99  GLY B C     1 
ATOM 1430  O O     . GLY B 2 100 ? 106.99000 87.52400  116.57500 1.000 115.41565 ? 99  GLY B O     1 
ATOM 1431  N N     . PHE B 2 101 ? 107.52300 89.57800  117.29700 1.000 112.22662 ? 100 PHE B N     1 
ATOM 1432  C CA    . PHE B 2 101 ? 108.78800 89.10800  117.85300 1.000 112.22662 ? 100 PHE B CA    1 
ATOM 1433  C C     . PHE B 2 101 ? 109.11100 89.77700  119.18300 1.000 112.22662 ? 100 PHE B C     1 
ATOM 1434  O O     . PHE B 2 101 ? 108.25100 90.40100  119.80100 1.000 112.22662 ? 100 PHE B O     1 
ATOM 1435  C CB    . PHE B 2 101 ? 109.92200 89.34900  116.86300 1.000 112.22662 ? 100 PHE B CB    1 
ATOM 1436  C CG    . PHE B 2 101 ? 109.80300 88.54700  115.60500 1.000 112.22662 ? 100 PHE B CG    1 
ATOM 1437  C CD1   . PHE B 2 101 ? 109.32100 89.12900  114.44700 1.000 112.22662 ? 100 PHE B CD1   1 
ATOM 1438  C CD2   . PHE B 2 101 ? 110.14900 87.21100  115.58300 1.000 112.22662 ? 100 PHE B CD2   1 
ATOM 1439  C CE1   . PHE B 2 101 ? 109.20200 88.39900  113.28600 1.000 112.22662 ? 100 PHE B CE1   1 
ATOM 1440  C CE2   . PHE B 2 101 ? 110.03200 86.47100  114.42100 1.000 112.22662 ? 100 PHE B CE2   1 
ATOM 1441  C CZ    . PHE B 2 101 ? 109.55800 87.06900  113.27200 1.000 112.22662 ? 100 PHE B CZ    1 
ATOM 1442  N N     . SER C 3 17  ? 130.89900 125.68600 142.36800 1.000 131.47451 ? 16  SER C N     1 
ATOM 1443  C CA    . SER C 3 17  ? 131.33400 126.13000 141.05100 1.000 131.47451 ? 16  SER C CA    1 
ATOM 1444  C C     . SER C 3 17  ? 131.85300 124.96000 140.23600 1.000 131.47451 ? 16  SER C C     1 
ATOM 1445  O O     . SER C 3 17  ? 133.04300 124.88500 139.93900 1.000 131.47451 ? 16  SER C O     1 
ATOM 1446  C CB    . SER C 3 17  ? 132.41900 127.19100 141.18900 1.000 131.47451 ? 16  SER C CB    1 
ATOM 1447  O OG    . SER C 3 17  ? 133.62200 126.60500 141.65200 1.000 131.47451 ? 16  SER C OG    1 
ATOM 1448  N N     . ARG C 3 18  ? 130.95700 124.04500 139.87500 1.000 137.44797 ? 17  ARG C N     1 
ATOM 1449  C CA    . ARG C 3 18  ? 131.32300 122.85900 139.11400 1.000 137.44797 ? 17  ARG C CA    1 
ATOM 1450  C C     . ARG C 3 18  ? 130.76200 122.85200 137.69900 1.000 137.44797 ? 17  ARG C C     1 
ATOM 1451  O O     . ARG C 3 18  ? 130.76300 121.80200 137.04900 1.000 137.44797 ? 17  ARG C O     1 
ATOM 1452  C CB    . ARG C 3 18  ? 130.89500 121.60300 139.87100 1.000 137.44797 ? 17  ARG C CB    1 
ATOM 1453  C CG    . ARG C 3 18  ? 131.87200 121.23000 140.98400 1.000 137.44797 ? 17  ARG C CG    1 
ATOM 1454  C CD    . ARG C 3 18  ? 131.60400 119.84900 141.55800 1.000 137.44797 ? 17  ARG C CD    1 
ATOM 1455  N NE    . ARG C 3 18  ? 132.34800 118.79200 140.88400 1.000 137.44797 ? 17  ARG C NE    1 
ATOM 1456  C CZ    . ARG C 3 18  ? 133.61400 118.48500 141.14300 1.000 137.44797 ? 17  ARG C CZ    1 
ATOM 1457  N NH1   . ARG C 3 18  ? 134.29200 119.15200 142.06500 1.000 137.44797 ? 17  ARG C NH1   1 
ATOM 1458  N NH2   . ARG C 3 18  ? 134.20300 117.50100 140.48000 1.000 137.44797 ? 17  ARG C NH2   1 
ATOM 1459  N N     . SER C 3 19  ? 130.24200 123.98100 137.22000 1.000 133.12705 ? 18  SER C N     1 
ATOM 1460  C CA    . SER C 3 19  ? 129.78500 124.04000 135.83700 1.000 133.12705 ? 18  SER C CA    1 
ATOM 1461  C C     . SER C 3 19  ? 130.95800 123.97500 134.87300 1.000 133.12705 ? 18  SER C C     1 
ATOM 1462  O O     . SER C 3 19  ? 130.88700 123.30300 133.83900 1.000 133.12705 ? 18  SER C O     1 
ATOM 1463  C CB    . SER C 3 19  ? 128.97700 125.31300 135.60700 1.000 133.12705 ? 18  SER C CB    1 
ATOM 1464  O OG    . SER C 3 19  ? 129.82500 126.38400 135.23600 1.000 133.12705 ? 18  SER C OG    1 
ATOM 1465  N N     . SER C 3 20  ? 132.04600 124.66700 135.19800 1.000 129.68470 ? 19  SER C N     1 
ATOM 1466  C CA    . SER C 3 20  ? 133.27300 124.61900 134.42000 1.000 129.68470 ? 19  SER C CA    1 
ATOM 1467  C C     . SER C 3 20  ? 134.27200 123.63800 135.00300 1.000 129.68470 ? 19  SER C C     1 
ATOM 1468  O O     . SER C 3 20  ? 135.47900 123.80500 134.80900 1.000 129.68470 ? 19  SER C O     1 
ATOM 1469  C CB    . SER C 3 20  ? 133.89800 126.00800 134.33600 1.000 129.68470 ? 19  SER C CB    1 
ATOM 1470  O OG    . SER C 3 20  ? 134.53100 126.33800 135.55900 1.000 129.68470 ? 19  SER C OG    1 
ATOM 1471  N N     . ARG C 3 21  ? 133.79000 122.64200 135.74500 1.000 137.39864 ? 20  ARG C N     1 
ATOM 1472  C CA    . ARG C 3 21  ? 134.68100 121.66400 136.35300 1.000 137.39864 ? 20  ARG C CA    1 
ATOM 1473  C C     . ARG C 3 21  ? 135.34600 120.79800 135.29600 1.000 137.39864 ? 20  ARG C C     1 
ATOM 1474  O O     . ARG C 3 21  ? 136.54100 120.49900 135.38900 1.000 137.39864 ? 20  ARG C O     1 
ATOM 1475  C CB    . ARG C 3 21  ? 133.90500 120.80300 137.34400 1.000 137.39864 ? 20  ARG C CB    1 
ATOM 1476  C CG    . ARG C 3 21  ? 134.76100 119.80400 138.05800 1.000 137.39864 ? 20  ARG C CG    1 
ATOM 1477  C CD    . ARG C 3 21  ? 135.74300 120.52100 138.95700 1.000 137.39864 ? 20  ARG C CD    1 
ATOM 1478  N NE    . ARG C 3 21  ? 136.89400 119.68600 139.28000 1.000 137.39864 ? 20  ARG C NE    1 
ATOM 1479  C CZ    . ARG C 3 21  ? 137.95300 119.53300 138.49100 1.000 137.39864 ? 20  ARG C CZ    1 
ATOM 1480  N NH1   . ARG C 3 21  ? 138.01200 120.16300 137.32400 1.000 137.39864 ? 20  ARG C NH1   1 
ATOM 1481  N NH2   . ARG C 3 21  ? 138.95500 118.75000 138.86800 1.000 137.39864 ? 20  ARG C NH2   1 
ATOM 1482  N N     . ALA C 3 22  ? 134.59200 120.39800 134.27900 1.000 130.73214 ? 21  ALA C N     1 
ATOM 1483  C CA    . ALA C 3 22  ? 135.12400 119.60000 133.18900 1.000 130.73214 ? 21  ALA C CA    1 
ATOM 1484  C C     . ALA C 3 22  ? 135.64400 120.45000 132.04200 1.000 130.73214 ? 21  ALA C C     1 
ATOM 1485  O O     . ALA C 3 22  ? 135.99300 119.90300 130.99300 1.000 130.73214 ? 21  ALA C O     1 
ATOM 1486  C CB    . ALA C 3 22  ? 134.05700 118.63800 132.67200 1.000 130.73214 ? 21  ALA C CB    1 
ATOM 1487  N N     . GLY C 3 23  ? 135.71000 121.76400 132.21700 1.000 126.36657 ? 22  GLY C N     1 
ATOM 1488  C CA    . GLY C 3 23  ? 136.19800 122.62800 131.15800 1.000 126.36657 ? 22  GLY C CA    1 
ATOM 1489  C C     . GLY C 3 23  ? 135.23300 122.80400 130.00800 1.000 126.36657 ? 22  GLY C C     1 
ATOM 1490  O O     . GLY C 3 23  ? 135.65100 122.77800 128.84500 1.000 126.36657 ? 22  GLY C O     1 
ATOM 1491  N N     . LEU C 3 24  ? 133.95000 122.96600 130.30200 1.000 123.53923 ? 23  LEU C N     1 
ATOM 1492  C CA    . LEU C 3 24  ? 132.93000 123.13800 129.28200 1.000 123.53923 ? 23  LEU C CA    1 
ATOM 1493  C C     . LEU C 3 24  ? 132.25500 124.48800 129.45000 1.000 123.53923 ? 23  LEU C C     1 
ATOM 1494  O O     . LEU C 3 24  ? 132.44800 125.19000 130.44400 1.000 123.53923 ? 23  LEU C O     1 
ATOM 1495  C CB    . LEU C 3 24  ? 131.88400 122.02600 129.34800 1.000 123.53923 ? 23  LEU C CB    1 
ATOM 1496  C CG    . LEU C 3 24  ? 132.44800 120.61900 129.47000 1.000 123.53923 ? 23  LEU C CG    1 
ATOM 1497  C CD1   . LEU C 3 24  ? 131.31900 119.61800 129.61000 1.000 123.53923 ? 23  LEU C CD1   1 
ATOM 1498  C CD2   . LEU C 3 24  ? 133.30600 120.30700 128.25900 1.000 123.53923 ? 23  LEU C CD2   1 
ATOM 1499  N N     . GLN C 3 25  ? 131.44300 124.84100 128.46200 1.000 122.35775 ? 24  GLN C N     1 
ATOM 1500  C CA    . GLN C 3 25  ? 130.71500 126.09700 128.49100 1.000 122.35775 ? 24  GLN C CA    1 
ATOM 1501  C C     . GLN C 3 25  ? 129.26100 125.92500 128.88300 1.000 122.35775 ? 24  GLN C C     1 
ATOM 1502  O O     . GLN C 3 25  ? 128.68900 126.82000 129.51100 1.000 122.35775 ? 24  GLN C O     1 
ATOM 1503  C CB    . GLN C 3 25  ? 130.78300 126.77900 127.12500 1.000 122.35775 ? 24  GLN C CB    1 
ATOM 1504  C CG    . GLN C 3 25  ? 132.18400 126.92400 126.59000 1.000 122.35775 ? 24  GLN C CG    1 
ATOM 1505  C CD    . GLN C 3 25  ? 133.13900 127.45700 127.62700 1.000 122.35775 ? 24  GLN C CD    1 
ATOM 1506  O OE1   . GLN C 3 25  ? 132.96600 128.56200 128.13900 1.000 122.35775 ? 24  GLN C OE1   1 
ATOM 1507  N NE2   . GLN C 3 25  ? 134.15900 126.67300 127.94700 1.000 122.35775 ? 24  GLN C NE2   1 
ATOM 1508  N N     . PHE C 3 26  ? 128.66200 124.80600 128.53600 1.000 118.47921 ? 25  PHE C N     1 
ATOM 1509  C CA    . PHE C 3 26  ? 127.27900 124.55000 128.88300 1.000 118.47921 ? 25  PHE C CA    1 
ATOM 1510  C C     . PHE C 3 26  ? 127.16600 124.17300 130.35400 1.000 118.47921 ? 25  PHE C C     1 
ATOM 1511  O O     . PHE C 3 26  ? 128.06500 123.53600 130.90600 1.000 118.47921 ? 25  PHE C O     1 
ATOM 1512  C CB    . PHE C 3 26  ? 126.72200 123.43500 128.01200 1.000 118.47921 ? 25  PHE C CB    1 
ATOM 1513  C CG    . PHE C 3 26  ? 126.29400 123.90000 126.66700 1.000 118.47921 ? 25  PHE C CG    1 
ATOM 1514  C CD1   . PHE C 3 26  ? 127.22800 124.13400 125.68100 1.000 118.47921 ? 25  PHE C CD1   1 
ATOM 1515  C CD2   . PHE C 3 26  ? 124.96100 124.13100 126.39600 1.000 118.47921 ? 25  PHE C CD2   1 
ATOM 1516  C CE1   . PHE C 3 26  ? 126.84300 124.57300 124.44500 1.000 118.47921 ? 25  PHE C CE1   1 
ATOM 1517  C CE2   . PHE C 3 26  ? 124.56700 124.57000 125.15600 1.000 118.47921 ? 25  PHE C CE2   1 
ATOM 1518  C CZ    . PHE C 3 26  ? 125.51100 124.79100 124.17900 1.000 118.47921 ? 25  PHE C CZ    1 
ATOM 1519  N N     . PRO C 3 27  ? 126.08200 124.56200 131.01700 1.000 119.94070 ? 26  PRO C N     1 
ATOM 1520  C CA    . PRO C 3 27  ? 125.95600 124.26200 132.44100 1.000 119.94070 ? 26  PRO C CA    1 
ATOM 1521  C C     . PRO C 3 27  ? 125.62100 122.80400 132.66800 1.000 119.94070 ? 26  PRO C C     1 
ATOM 1522  O O     . PRO C 3 27  ? 124.91000 122.17000 131.88700 1.000 119.94070 ? 26  PRO C O     1 
ATOM 1523  C CB    . PRO C 3 27  ? 124.80000 125.16100 132.88800 1.000 119.94070 ? 26  PRO C CB    1 
ATOM 1524  C CG    . PRO C 3 27  ? 123.96700 125.29400 131.68200 1.000 119.94070 ? 26  PRO C CG    1 
ATOM 1525  C CD    . PRO C 3 27  ? 124.89900 125.27700 130.50700 1.000 119.94070 ? 26  PRO C CD    1 
ATOM 1526  N N     . VAL C 3 28  ? 126.15100 122.26800 133.75900 1.000 118.67625 ? 27  VAL C N     1 
ATOM 1527  C CA    . VAL C 3 28  ? 125.84900 120.88800 134.08700 1.000 118.67625 ? 27  VAL C CA    1 
ATOM 1528  C C     . VAL C 3 28  ? 124.66200 120.78900 135.02900 1.000 118.67625 ? 27  VAL C C     1 
ATOM 1529  O O     . VAL C 3 28  ? 123.97900 119.75800 135.04000 1.000 118.67625 ? 27  VAL C O     1 
ATOM 1530  C CB    . VAL C 3 28  ? 127.07300 120.18300 134.69500 1.000 118.67625 ? 27  VAL C CB    1 
ATOM 1531  C CG1   . VAL C 3 28  ? 128.12300 119.96000 133.63200 1.000 118.67625 ? 27  VAL C CG1   1 
ATOM 1532  C CG2   . VAL C 3 28  ? 127.64100 120.98800 135.84700 1.000 118.67625 ? 27  VAL C CG2   1 
ATOM 1533  N N     . GLY C 3 29  ? 124.37600 121.83500 135.79200 1.000 123.04310 ? 28  GLY C N     1 
ATOM 1534  C CA    . GLY C 3 29  ? 123.27200 121.79700 136.72300 1.000 123.04310 ? 28  GLY C CA    1 
ATOM 1535  C C     . GLY C 3 29  ? 121.92500 121.95400 136.06100 1.000 123.04310 ? 28  GLY C C     1 
ATOM 1536  O O     . GLY C 3 29  ? 120.95100 121.31900 136.47700 1.000 123.04310 ? 28  GLY C O     1 
ATOM 1537  N N     . ARG C 3 30  ? 121.86100 122.80400 135.03400 1.000 123.87391 ? 29  ARG C N     1 
ATOM 1538  C CA    . ARG C 3 30  ? 120.60600 123.02900 134.32300 1.000 123.87391 ? 29  ARG C CA    1 
ATOM 1539  C C     . ARG C 3 30  ? 120.14800 121.77300 133.60000 1.000 123.87391 ? 29  ARG C C     1 
ATOM 1540  O O     . ARG C 3 30  ? 118.97200 121.39600 133.67600 1.000 123.87391 ? 29  ARG C O     1 
ATOM 1541  C CB    . ARG C 3 30  ? 120.75900 124.19100 133.34600 1.000 123.87391 ? 29  ARG C CB    1 
ATOM 1542  C CG    . ARG C 3 30  ? 120.46600 125.53500 133.97500 1.000 123.87391 ? 29  ARG C CG    1 
ATOM 1543  C CD    . ARG C 3 30  ? 120.70500 126.66500 133.00400 1.000 123.87391 ? 29  ARG C CD    1 
ATOM 1544  N NE    . ARG C 3 30  ? 119.46500 127.12400 132.39500 1.000 123.87391 ? 29  ARG C NE    1 
ATOM 1545  C CZ    . ARG C 3 30  ? 119.18300 127.00300 131.10500 1.000 123.87391 ? 29  ARG C CZ    1 
ATOM 1546  N NH1   . ARG C 3 30  ? 120.05500 126.43500 130.28800 1.000 123.87391 ? 29  ARG C NH1   1 
ATOM 1547  N NH2   . ARG C 3 30  ? 118.03100 127.45200 130.63300 1.000 123.87391 ? 29  ARG C NH2   1 
ATOM 1548  N N     . VAL C 3 31  ? 121.06600 121.11100 132.89500 1.000 115.28876 ? 30  VAL C N     1 
ATOM 1549  C CA    . VAL C 3 31  ? 120.71600 119.86900 132.22100 1.000 115.28876 ? 30  VAL C CA    1 
ATOM 1550  C C     . VAL C 3 31  ? 120.43400 118.76600 133.23800 1.000 115.28876 ? 30  VAL C C     1 
ATOM 1551  O O     . VAL C 3 31  ? 119.63800 117.86400 132.96900 1.000 115.28876 ? 30  VAL C O     1 
ATOM 1552  C CB    . VAL C 3 31  ? 121.80500 119.49000 131.19600 1.000 115.28876 ? 30  VAL C CB    1 
ATOM 1553  C CG1   . VAL C 3 31  ? 123.09200 119.04700 131.86700 1.000 115.28876 ? 30  VAL C CG1   1 
ATOM 1554  C CG2   . VAL C 3 31  ? 121.29500 118.43900 130.22600 1.000 115.28876 ? 30  VAL C CG2   1 
ATOM 1555  N N     . HIS C 3 32  ? 121.04400 118.83300 134.42600 1.000 114.60206 ? 31  HIS C N     1 
ATOM 1556  C CA    . HIS C 3 32  ? 120.73100 117.87200 135.47700 1.000 114.60206 ? 31  HIS C CA    1 
ATOM 1557  C C     . HIS C 3 32  ? 119.30300 118.04400 135.97000 1.000 114.60206 ? 31  HIS C C     1 
ATOM 1558  O O     . HIS C 3 32  ? 118.58400 117.05600 136.16000 1.000 114.60206 ? 31  HIS C O     1 
ATOM 1559  C CB    . HIS C 3 32  ? 121.70700 118.01400 136.63600 1.000 114.60206 ? 31  HIS C CB    1 
ATOM 1560  C CG    . HIS C 3 32  ? 121.98900 116.72900 137.34300 1.000 114.60206 ? 31  HIS C CG    1 
ATOM 1561  N ND1   . HIS C 3 32  ? 122.83200 116.64600 138.42900 1.000 114.60206 ? 31  HIS C ND1   1 
ATOM 1562  C CD2   . HIS C 3 32  ? 121.53300 115.47400 137.12300 1.000 114.60206 ? 31  HIS C CD2   1 
ATOM 1563  C CE1   . HIS C 3 32  ? 122.89300 115.39300 138.84100 1.000 114.60206 ? 31  HIS C CE1   1 
ATOM 1564  N NE2   . HIS C 3 32  ? 122.11000 114.66200 138.06800 1.000 114.60206 ? 31  HIS C NE2   1 
ATOM 1565  N N     . ARG C 3 33  ? 118.88800 119.29300 136.19700 1.000 120.66834 ? 32  ARG C N     1 
ATOM 1566  C CA    . ARG C 3 33  ? 117.51200 119.55800 136.59900 1.000 120.66834 ? 32  ARG C CA    1 
ATOM 1567  C C     . ARG C 3 33  ? 116.53700 119.17600 135.49700 1.000 120.66834 ? 32  ARG C C     1 
ATOM 1568  O O     . ARG C 3 33  ? 115.44900 118.66000 135.77400 1.000 120.66834 ? 32  ARG C O     1 
ATOM 1569  C CB    . ARG C 3 33  ? 117.34200 121.02900 136.96800 1.000 120.66834 ? 32  ARG C CB    1 
ATOM 1570  C CG    . ARG C 3 33  ? 116.02300 121.33600 137.65200 1.000 120.66834 ? 32  ARG C CG    1 
ATOM 1571  C CD    . ARG C 3 33  ? 115.79100 122.82800 137.76000 1.000 120.66834 ? 32  ARG C CD    1 
ATOM 1572  N NE    . ARG C 3 33  ? 115.97300 123.49000 136.47600 1.000 120.66834 ? 32  ARG C NE    1 
ATOM 1573  C CZ    . ARG C 3 33  ? 115.01000 123.64000 135.57500 1.000 120.66834 ? 32  ARG C CZ    1 
ATOM 1574  N NH1   . ARG C 3 33  ? 113.79300 123.17700 135.82000 1.000 120.66834 ? 32  ARG C NH1   1 
ATOM 1575  N NH2   . ARG C 3 33  ? 115.26300 124.25500 134.43000 1.000 120.66834 ? 32  ARG C NH2   1 
ATOM 1576  N N     . LEU C 3 34  ? 116.92000 119.41200 134.24100 1.000 118.69700 ? 33  LEU C N     1 
ATOM 1577  C CA    . LEU C 3 34  ? 116.07500 119.01600 133.12100 1.000 118.69700 ? 33  LEU C CA    1 
ATOM 1578  C C     . LEU C 3 34  ? 115.95100 117.50300 133.02300 1.000 118.69700 ? 33  LEU C C     1 
ATOM 1579  O O     . LEU C 3 34  ? 114.88300 116.98800 132.68300 1.000 118.69700 ? 33  LEU C O     1 
ATOM 1580  C CB    . LEU C 3 34  ? 116.61100 119.59800 131.81900 1.000 118.69700 ? 33  LEU C CB    1 
ATOM 1581  C CG    . LEU C 3 34  ? 115.94400 120.90700 131.39200 1.000 118.69700 ? 33  LEU C CG    1 
ATOM 1582  C CD1   . LEU C 3 34  ? 116.34900 121.26000 129.98600 1.000 118.69700 ? 33  LEU C CD1   1 
ATOM 1583  C CD2   . LEU C 3 34  ? 114.43200 120.82100 131.48600 1.000 118.69700 ? 33  LEU C CD2   1 
ATOM 1584  N N     . LEU C 3 35  ? 117.03400 116.77900 133.29500 1.000 109.74530 ? 34  LEU C N     1 
ATOM 1585  C CA    . LEU C 3 35  ? 116.97400 115.32300 133.28900 1.000 109.74530 ? 34  LEU C CA    1 
ATOM 1586  C C     . LEU C 3 35  ? 116.12100 114.80200 134.43400 1.000 109.74530 ? 34  LEU C C     1 
ATOM 1587  O O     . LEU C 3 35  ? 115.36500 113.84100 134.26200 1.000 109.74530 ? 34  LEU C O     1 
ATOM 1588  C CB    . LEU C 3 35  ? 118.38400 114.75100 133.37300 1.000 109.74530 ? 34  LEU C CB    1 
ATOM 1589  C CG    . LEU C 3 35  ? 119.05700 114.37600 132.05800 1.000 109.74530 ? 34  LEU C CG    1 
ATOM 1590  C CD1   . LEU C 3 35  ? 120.28600 113.54800 132.33900 1.000 109.74530 ? 34  LEU C CD1   1 
ATOM 1591  C CD2   . LEU C 3 35  ? 118.10000 113.61200 131.16900 1.000 109.74530 ? 34  LEU C CD2   1 
ATOM 1592  N N     . ARG C 3 36  ? 116.22800 115.42400 135.60700 1.000 116.77678 ? 35  ARG C N     1 
ATOM 1593  C CA    . ARG C 3 36  ? 115.44800 114.97000 136.75000 1.000 116.77678 ? 35  ARG C CA    1 
ATOM 1594  C C     . ARG C 3 36  ? 113.97500 115.32400 136.60700 1.000 116.77678 ? 35  ARG C C     1 
ATOM 1595  O O     . ARG C 3 36  ? 113.11800 114.62300 137.15400 1.000 116.77678 ? 35  ARG C O     1 
ATOM 1596  C CB    . ARG C 3 36  ? 116.01400 115.55800 138.03600 1.000 116.77678 ? 35  ARG C CB    1 
ATOM 1597  C CG    . ARG C 3 36  ? 117.23600 114.82700 138.54500 1.000 116.77678 ? 35  ARG C CG    1 
ATOM 1598  C CD    . ARG C 3 36  ? 117.45700 115.09500 140.02000 1.000 116.77678 ? 35  ARG C CD    1 
ATOM 1599  N NE    . ARG C 3 36  ? 117.77800 116.49800 140.25500 1.000 116.77678 ? 35  ARG C NE    1 
ATOM 1600  C CZ    . ARG C 3 36  ? 119.00300 117.00800 140.18500 1.000 116.77678 ? 35  ARG C CZ    1 
ATOM 1601  N NH1   . ARG C 3 36  ? 120.02800 116.22800 139.88600 1.000 116.77678 ? 35  ARG C NH1   1 
ATOM 1602  N NH2   . ARG C 3 36  ? 119.20200 118.29800 140.40800 1.000 116.77678 ? 35  ARG C NH2   1 
ATOM 1603  N N     . LYS C 3 37  ? 113.65700 116.39000 135.87700 1.000 118.02092 ? 36  LYS C N     1 
ATOM 1604  C CA    . LYS C 3 37  ? 112.27200 116.80100 135.71700 1.000 118.02092 ? 36  LYS C CA    1 
ATOM 1605  C C     . LYS C 3 37  ? 111.63200 116.25600 134.45400 1.000 118.02092 ? 36  LYS C C     1 
ATOM 1606  O O     . LYS C 3 37  ? 110.40200 116.27000 134.34700 1.000 118.02092 ? 36  LYS C O     1 
ATOM 1607  C CB    . LYS C 3 37  ? 112.17200 118.33000 135.69300 1.000 118.02092 ? 36  LYS C CB    1 
ATOM 1608  C CG    . LYS C 3 37  ? 111.61900 118.93600 136.96300 1.000 118.02092 ? 36  LYS C CG    1 
ATOM 1609  C CD    . LYS C 3 37  ? 112.57800 118.72900 138.11400 1.000 118.02092 ? 36  LYS C CD    1 
ATOM 1610  C CE    . LYS C 3 37  ? 112.00200 119.24800 139.41100 1.000 118.02092 ? 36  LYS C CE    1 
ATOM 1611  N NZ    . LYS C 3 37  ? 112.96100 119.06200 140.53100 1.000 118.02092 ? 36  LYS C NZ    1 
ATOM 1612  N N     . GLY C 3 38  ? 112.42700 115.76900 133.50500 1.000 125.82831 ? 37  GLY C N     1 
ATOM 1613  C CA    . GLY C 3 38  ? 111.88500 115.23500 132.27400 1.000 125.82831 ? 37  GLY C CA    1 
ATOM 1614  C C     . GLY C 3 38  ? 111.24500 113.87600 132.41300 1.000 125.82831 ? 37  GLY C C     1 
ATOM 1615  O O     . GLY C 3 38  ? 110.61300 113.42000 131.45300 1.000 125.82831 ? 37  GLY C O     1 
ATOM 1616  N N     . ASN C 3 39  ? 111.41700 113.22700 133.57200 1.000 128.11772 ? 38  ASN C N     1 
ATOM 1617  C CA    . ASN C 3 39  ? 110.82700 111.92600 133.89700 1.000 128.11772 ? 38  ASN C CA    1 
ATOM 1618  C C     . ASN C 3 39  ? 111.25000 110.85000 132.90200 1.000 128.11772 ? 38  ASN C C     1 
ATOM 1619  O O     . ASN C 3 39  ? 110.46900 109.96800 132.54500 1.000 128.11772 ? 38  ASN C O     1 
ATOM 1620  C CB    . ASN C 3 39  ? 109.30200 112.01500 133.99900 1.000 128.11772 ? 38  ASN C CB    1 
ATOM 1621  C CG    . ASN C 3 39  ? 108.75900 111.27200 135.19300 1.000 128.11772 ? 38  ASN C CG    1 
ATOM 1622  O OD1   . ASN C 3 39  ? 109.39200 110.35100 135.70600 1.000 128.11772 ? 38  ASN C OD1   1 
ATOM 1623  N ND2   . ASN C 3 39  ? 107.57800 111.67300 135.65100 1.000 128.11772 ? 38  ASN C ND2   1 
ATOM 1624  N N     . TYR C 3 40  ? 112.49700 110.93600 132.43900 1.000 122.41484 ? 39  TYR C N     1 
ATOM 1625  C CA    . TYR C 3 40  ? 113.01500 109.91700 131.53500 1.000 122.41484 ? 39  TYR C CA    1 
ATOM 1626  C C     . TYR C 3 40  ? 113.27100 108.61400 132.27400 1.000 122.41484 ? 39  TYR C C     1 
ATOM 1627  O O     . TYR C 3 40  ? 113.00900 107.52900 131.74500 1.000 122.41484 ? 39  TYR C O     1 
ATOM 1628  C CB    . TYR C 3 40  ? 114.28900 110.42300 130.87400 1.000 122.41484 ? 39  TYR C CB    1 
ATOM 1629  C CG    . TYR C 3 40  ? 114.04800 111.64500 130.03200 1.000 122.41484 ? 39  TYR C CG    1 
ATOM 1630  C CD1   . TYR C 3 40  ? 113.45600 111.54200 128.78300 1.000 122.41484 ? 39  TYR C CD1   1 
ATOM 1631  C CD2   . TYR C 3 40  ? 114.40000 112.90400 130.49200 1.000 122.41484 ? 39  TYR C CD2   1 
ATOM 1632  C CE1   . TYR C 3 40  ? 113.22600 112.65700 128.01400 1.000 122.41484 ? 39  TYR C CE1   1 
ATOM 1633  C CE2   . TYR C 3 40  ? 114.17700 114.02500 129.72900 1.000 122.41484 ? 39  TYR C CE2   1 
ATOM 1634  C CZ    . TYR C 3 40  ? 113.58900 113.89600 128.49100 1.000 122.41484 ? 39  TYR C CZ    1 
ATOM 1635  O OH    . TYR C 3 40  ? 113.36200 115.01300 127.72400 1.000 122.41484 ? 39  TYR C OH    1 
ATOM 1636  N N     . ALA C 3 41  ? 113.76400 108.70300 133.50200 1.000 129.81017 ? 40  ALA C N     1 
ATOM 1637  C CA    . ALA C 3 41  ? 113.96300 107.53900 134.34800 1.000 129.81017 ? 40  ALA C CA    1 
ATOM 1638  C C     . ALA C 3 41  ? 113.92500 108.01400 135.78700 1.000 129.81017 ? 40  ALA C C     1 
ATOM 1639  O O     . ALA C 3 41  ? 114.08600 109.20300 136.06900 1.000 129.81017 ? 40  ALA C O     1 
ATOM 1640  C CB    . ALA C 3 41  ? 115.27200 106.81500 134.04500 1.000 129.81017 ? 40  ALA C CB    1 
ATOM 1641  N N     . GLU C 3 42  ? 113.71400 107.06700 136.69700 1.000 150.08380 ? 41  GLU C N     1 
ATOM 1642  C CA    . GLU C 3 42  ? 113.61200 107.41800 138.10600 1.000 150.08380 ? 41  GLU C CA    1 
ATOM 1643  C C     . GLU C 3 42  ? 114.94800 107.82500 138.71000 1.000 150.08380 ? 41  GLU C C     1 
ATOM 1644  O O     . GLU C 3 42  ? 114.96400 108.45500 139.76900 1.000 150.08380 ? 41  GLU C O     1 
ATOM 1645  C CB    . GLU C 3 42  ? 113.00300 106.25600 138.88600 1.000 150.08380 ? 41  GLU C CB    1 
ATOM 1646  C CG    . GLU C 3 42  ? 113.84800 105.00400 138.91600 1.000 150.08380 ? 41  GLU C CG    1 
ATOM 1647  C CD    . GLU C 3 42  ? 114.63600 104.87100 140.20000 1.000 150.08380 ? 41  GLU C CD    1 
ATOM 1648  O OE1   . GLU C 3 42  ? 114.25900 105.52000 141.19700 1.000 150.08380 ? 41  GLU C OE1   1 
ATOM 1649  O OE2   . GLU C 3 42  ? 115.63000 104.11800 140.21300 1.000 150.08380 ? 41  GLU C OE2   1 
ATOM 1650  N N     . ARG C 3 43  ? 116.06100 107.48500 138.07300 1.000 146.13332 ? 42  ARG C N     1 
ATOM 1651  C CA    . ARG C 3 43  ? 117.36600 107.81900 138.61300 1.000 146.13332 ? 42  ARG C CA    1 
ATOM 1652  C C     . ARG C 3 43  ? 118.27900 108.26900 137.48700 1.000 146.13332 ? 42  ARG C C     1 
ATOM 1653  O O     . ARG C 3 43  ? 118.14100 107.82900 136.34500 1.000 146.13332 ? 42  ARG C O     1 
ATOM 1654  C CB    . ARG C 3 43  ? 117.98000 106.62700 139.33700 1.000 146.13332 ? 42  ARG C CB    1 
ATOM 1655  C CG    . ARG C 3 43  ? 117.76600 106.63400 140.82300 1.000 146.13332 ? 42  ARG C CG    1 
ATOM 1656  C CD    . ARG C 3 43  ? 118.42700 105.43700 141.47400 1.000 146.13332 ? 42  ARG C CD    1 
ATOM 1657  N NE    . ARG C 3 43  ? 118.50500 105.59400 142.91900 1.000 146.13332 ? 42  ARG C NE    1 
ATOM 1658  C CZ    . ARG C 3 43  ? 117.51500 105.30000 143.75400 1.000 146.13332 ? 42  ARG C CZ    1 
ATOM 1659  N NH1   . ARG C 3 43  ? 117.67300 105.47700 145.05800 1.000 146.13332 ? 42  ARG C NH1   1 
ATOM 1660  N NH2   . ARG C 3 43  ? 116.36500 104.82900 143.29000 1.000 146.13332 ? 42  ARG C NH2   1 
ATOM 1661  N N     . VAL C 3 44  ? 119.21800 109.14800 137.81900 1.000 123.73034 ? 43  VAL C N     1 
ATOM 1662  C CA    . VAL C 3 44  ? 120.17400 109.66100 136.85100 1.000 123.73034 ? 43  VAL C CA    1 
ATOM 1663  C C     . VAL C 3 44  ? 121.57600 109.49800 137.40800 1.000 123.73034 ? 43  VAL C C     1 
ATOM 1664  O O     . VAL C 3 44  ? 121.79800 109.57500 138.62000 1.000 123.73034 ? 43  VAL C O     1 
ATOM 1665  C CB    . VAL C 3 44  ? 119.90600 111.13400 136.49800 1.000 123.73034 ? 43  VAL C CB    1 
ATOM 1666  C CG1   . VAL C 3 44  ? 118.73000 111.23800 135.55800 1.000 123.73034 ? 43  VAL C CG1   1 
ATOM 1667  C CG2   . VAL C 3 44  ? 119.65600 111.94100 137.75000 1.000 123.73034 ? 43  VAL C CG2   1 
ATOM 1668  N N     . GLY C 3 45  ? 122.52500 109.25400 136.51400 1.000 125.32219 ? 44  GLY C N     1 
ATOM 1669  C CA    . GLY C 3 45  ? 123.90200 109.07400 136.90800 1.000 125.32219 ? 44  GLY C CA    1 
ATOM 1670  C C     . GLY C 3 45  ? 124.59900 110.39300 137.16400 1.000 125.32219 ? 44  GLY C C     1 
ATOM 1671  O O     . GLY C 3 45  ? 124.03600 111.47700 137.02300 1.000 125.32219 ? 44  GLY C O     1 
ATOM 1672  N N     . ALA C 3 46  ? 125.86600 110.29100 137.54800 1.000 120.42428 ? 45  ALA C N     1 
ATOM 1673  C CA    . ALA C 3 46  ? 126.64800 111.48100 137.84700 1.000 120.42428 ? 45  ALA C CA    1 
ATOM 1674  C C     . ALA C 3 46  ? 127.31000 112.05100 136.60300 1.000 120.42428 ? 45  ALA C C     1 
ATOM 1675  O O     . ALA C 3 46  ? 127.25600 113.26100 136.37000 1.000 120.42428 ? 45  ALA C O     1 
ATOM 1676  C CB    . ALA C 3 46  ? 127.70700 111.16700 138.90200 1.000 120.42428 ? 45  ALA C CB    1 
ATOM 1677  N N     . GLY C 3 47  ? 127.93600 111.19900 135.79900 1.000 125.78378 ? 46  GLY C N     1 
ATOM 1678  C CA    . GLY C 3 47  ? 128.60700 111.67100 134.60500 1.000 125.78378 ? 46  GLY C CA    1 
ATOM 1679  C C     . GLY C 3 47  ? 127.72500 111.87700 133.40000 1.000 125.78378 ? 46  GLY C C     1 
ATOM 1680  O O     . GLY C 3 47  ? 128.20300 112.39800 132.38700 1.000 125.78378 ? 46  GLY C O     1 
ATOM 1681  N N     . ALA C 3 48  ? 126.45700 111.48000 133.48500 1.000 120.46820 ? 47  ALA C N     1 
ATOM 1682  C CA    . ALA C 3 48  ? 125.54200 111.67200 132.36200 1.000 120.46820 ? 47  ALA C CA    1 
ATOM 1683  C C     . ALA C 3 48  ? 125.26900 113.14000 132.02500 1.000 120.46820 ? 47  ALA C C     1 
ATOM 1684  O O     . ALA C 3 48  ? 125.27700 113.46700 130.82400 1.000 120.46820 ? 47  ALA C O     1 
ATOM 1685  C CB    . ALA C 3 48  ? 124.24900 110.88400 132.60700 1.000 120.46820 ? 47  ALA C CB    1 
ATOM 1686  N N     . PRO C 3 49  ? 124.99600 114.06100 132.97700 1.000 116.59069 ? 48  PRO C N     1 
ATOM 1687  C CA    . PRO C 3 49  ? 124.86700 115.46900 132.56100 1.000 116.59069 ? 48  PRO C CA    1 
ATOM 1688  C C     . PRO C 3 49  ? 126.13700 116.04400 131.96800 1.000 116.59069 ? 48  PRO C C     1 
ATOM 1689  O O     . PRO C 3 49  ? 126.05500 116.83100 131.01900 1.000 116.59069 ? 48  PRO C O     1 
ATOM 1690  C CB    . PRO C 3 49  ? 124.47500 116.19000 133.85500 1.000 116.59069 ? 48  PRO C CB    1 
ATOM 1691  C CG    . PRO C 3 49  ? 124.87300 115.31100 134.92500 1.000 116.59069 ? 48  PRO C CG    1 
ATOM 1692  C CD    . PRO C 3 49  ? 124.66100 113.94400 134.41100 1.000 116.59069 ? 48  PRO C CD    1 
ATOM 1693  N N     . VAL C 3 50  ? 127.30300 115.66000 132.49300 1.000 117.36931 ? 49  VAL C N     1 
ATOM 1694  C CA    . VAL C 3 50  ? 128.57300 116.15300 131.96600 1.000 117.36931 ? 49  VAL C CA    1 
ATOM 1695  C C     . VAL C 3 50  ? 128.78600 115.67800 130.53700 1.000 117.36931 ? 49  VAL C C     1 
ATOM 1696  O O     . VAL C 3 50  ? 129.16300 116.46000 129.65300 1.000 117.36931 ? 49  VAL C O     1 
ATOM 1697  C CB    . VAL C 3 50  ? 129.72600 115.70000 132.87300 1.000 117.36931 ? 49  VAL C CB    1 
ATOM 1698  C CG1   . VAL C 3 50  ? 130.99100 116.43000 132.51000 1.000 117.36931 ? 49  VAL C CG1   1 
ATOM 1699  C CG2   . VAL C 3 50  ? 129.37100 115.92200 134.32300 1.000 117.36931 ? 49  VAL C CG2   1 
ATOM 1700  N N     . TYR C 3 51  ? 128.52100 114.39500 130.29000 1.000 120.86157 ? 50  TYR C N     1 
ATOM 1701  C CA    . TYR C 3 51  ? 128.65200 113.82500 128.95400 1.000 120.86157 ? 50  TYR C CA    1 
ATOM 1702  C C     . TYR C 3 51  ? 127.68300 114.46300 127.96700 1.000 120.86157 ? 50  TYR C C     1 
ATOM 1703  O O     . TYR C 3 51  ? 128.06100 114.78100 126.83000 1.000 120.86157 ? 50  TYR C O     1 
ATOM 1704  C CB    . TYR C 3 51  ? 128.42500 112.32200 129.04100 1.000 120.86157 ? 50  TYR C CB    1 
ATOM 1705  C CG    . TYR C 3 51  ? 129.04100 111.49700 127.94600 1.000 120.86157 ? 50  TYR C CG    1 
ATOM 1706  C CD1   . TYR C 3 51  ? 130.23400 110.82500 128.15100 1.000 120.86157 ? 50  TYR C CD1   1 
ATOM 1707  C CD2   . TYR C 3 51  ? 128.40400 111.34800 126.72600 1.000 120.86157 ? 50  TYR C CD2   1 
ATOM 1708  C CE1   . TYR C 3 51  ? 130.79200 110.05200 127.16300 1.000 120.86157 ? 50  TYR C CE1   1 
ATOM 1709  C CE2   . TYR C 3 51  ? 128.95200 110.57700 125.73100 1.000 120.86157 ? 50  TYR C CE2   1 
ATOM 1710  C CZ    . TYR C 3 51  ? 130.14700 109.93100 125.95500 1.000 120.86157 ? 50  TYR C CZ    1 
ATOM 1711  O OH    . TYR C 3 51  ? 130.70100 109.15700 124.96400 1.000 120.86157 ? 50  TYR C OH    1 
ATOM 1712  N N     . MET C 3 52  ? 126.43200 114.65800 128.38600 1.000 118.97374 ? 51  MET C N     1 
ATOM 1713  C CA    . MET C 3 52  ? 125.44400 115.26700 127.50400 1.000 118.97374 ? 51  MET C CA    1 
ATOM 1714  C C     . MET C 3 52  ? 125.77100 116.72400 127.20500 1.000 118.97374 ? 51  MET C C     1 
ATOM 1715  O O     . MET C 3 52  ? 125.61200 117.17400 126.06300 1.000 118.97374 ? 51  MET C O     1 
ATOM 1716  C CB    . MET C 3 52  ? 124.05400 115.12500 128.10400 1.000 118.97374 ? 51  MET C CB    1 
ATOM 1717  C CG    . MET C 3 52  ? 122.96300 115.25900 127.08000 1.000 118.97374 ? 51  MET C CG    1 
ATOM 1718  S SD    . MET C 3 52  ? 121.35200 114.85100 127.74500 1.000 118.97374 ? 51  MET C SD    1 
ATOM 1719  C CE    . MET C 3 52  ? 121.76300 113.40900 128.71800 1.000 118.97374 ? 51  MET C CE    1 
ATOM 1720  N N     . ALA C 3 53  ? 126.20000 117.48000 128.21800 1.000 117.08741 ? 52  ALA C N     1 
ATOM 1721  C CA    . ALA C 3 53  ? 126.60000 118.86300 127.99200 1.000 117.08741 ? 52  ALA C CA    1 
ATOM 1722  C C     . ALA C 3 53  ? 127.79000 118.94100 127.04800 1.000 117.08741 ? 52  ALA C C     1 
ATOM 1723  O O     . ALA C 3 53  ? 127.84500 119.82100 126.18000 1.000 117.08741 ? 52  ALA C O     1 
ATOM 1724  C CB    . ALA C 3 53  ? 126.92300 119.53900 129.32100 1.000 117.08741 ? 52  ALA C CB    1 
ATOM 1725  N N     . ALA C 3 54  ? 128.72600 117.99600 127.17200 1.000 117.45989 ? 53  ALA C N     1 
ATOM 1726  C CA    . ALA C 3 54  ? 129.88500 117.98000 126.28900 1.000 117.45989 ? 53  ALA C CA    1 
ATOM 1727  C C     . ALA C 3 54  ? 129.49100 117.68200 124.84800 1.000 117.45989 ? 53  ALA C C     1 
ATOM 1728  O O     . ALA C 3 54  ? 129.98800 118.33600 123.92000 1.000 117.45989 ? 53  ALA C O     1 
ATOM 1729  C CB    . ALA C 3 54  ? 130.90100 116.95900 126.78800 1.000 117.45989 ? 53  ALA C CB    1 
ATOM 1730  N N     . VAL C 3 55  ? 128.60600 116.70100 124.63700 1.000 119.57390 ? 54  VAL C N     1 
ATOM 1731  C CA    . VAL C 3 55  ? 128.22800 116.36600 123.26500 1.000 119.57390 ? 54  VAL C CA    1 
ATOM 1732  C C     . VAL C 3 55  ? 127.39400 117.48500 122.64000 1.000 119.57390 ? 54  VAL C C     1 
ATOM 1733  O O     . VAL C 3 55  ? 127.54000 117.77800 121.44100 1.000 119.57390 ? 54  VAL C O     1 
ATOM 1734  C CB    . VAL C 3 55  ? 127.54600 114.97900 123.18800 1.000 119.57390 ? 54  VAL C CB    1 
ATOM 1735  C CG1   . VAL C 3 55  ? 126.16700 114.94100 123.80200 1.000 119.57390 ? 54  VAL C CG1   1 
ATOM 1736  C CG2   . VAL C 3 55  ? 127.48600 114.49700 121.75300 1.000 119.57390 ? 54  VAL C CG2   1 
ATOM 1737  N N     . LEU C 3 56  ? 126.55800 118.16500 123.43600 1.000 116.72052 ? 55  LEU C N     1 
ATOM 1738  C CA    . LEU C 3 56  ? 125.79400 119.28800 122.90500 1.000 116.72052 ? 55  LEU C CA    1 
ATOM 1739  C C     . LEU C 3 56  ? 126.70900 120.45200 122.55300 1.000 116.72052 ? 55  LEU C C     1 
ATOM 1740  O O     . LEU C 3 56  ? 126.50900 121.11700 121.52700 1.000 116.72052 ? 55  LEU C O     1 
ATOM 1741  C CB    . LEU C 3 56  ? 124.72800 119.72000 123.90500 1.000 116.72052 ? 55  LEU C CB    1 
ATOM 1742  C CG    . LEU C 3 56  ? 123.56700 118.73600 124.01900 1.000 116.72052 ? 55  LEU C CG    1 
ATOM 1743  C CD1   . LEU C 3 56  ? 122.71400 119.03200 125.24000 1.000 116.72052 ? 55  LEU C CD1   1 
ATOM 1744  C CD2   . LEU C 3 56  ? 122.73900 118.74200 122.76300 1.000 116.72052 ? 55  LEU C CD2   1 
ATOM 1745  N N     . GLU C 3 57  ? 127.72900 120.69000 123.38200 1.000 120.27803 ? 56  GLU C N     1 
ATOM 1746  C CA    . GLU C 3 57  ? 128.70000 121.73600 123.09500 1.000 120.27803 ? 56  GLU C CA    1 
ATOM 1747  C C     . GLU C 3 57  ? 129.48600 121.43200 121.82800 1.000 120.27803 ? 56  GLU C C     1 
ATOM 1748  O O     . GLU C 3 57  ? 129.75400 122.33500 121.02800 1.000 120.27803 ? 56  GLU C O     1 
ATOM 1749  C CB    . GLU C 3 57  ? 129.64100 121.90500 124.28400 1.000 120.27803 ? 56  GLU C CB    1 
ATOM 1750  C CG    . GLU C 3 57  ? 130.65500 123.01400 124.12200 1.000 120.27803 ? 56  GLU C CG    1 
ATOM 1751  C CD    . GLU C 3 57  ? 132.03300 122.48900 123.79300 1.000 120.27803 ? 56  GLU C CD    1 
ATOM 1752  O OE1   . GLU C 3 57  ? 132.17100 121.25900 123.62900 1.000 120.27803 ? 56  GLU C OE1   1 
ATOM 1753  O OE2   . GLU C 3 57  ? 132.97700 123.30100 123.69900 1.000 120.27803 ? 56  GLU C OE2   1 
ATOM 1754  N N     . TYR C 3 58  ? 129.84900 120.16400 121.61900 1.000 123.58297 ? 57  TYR C N     1 
ATOM 1755  C CA    . TYR C 3 58  ? 130.55500 119.79500 120.39400 1.000 123.58297 ? 57  TYR C CA    1 
ATOM 1756  C C     . TYR C 3 58  ? 129.68900 120.00000 119.15600 1.000 123.58297 ? 57  TYR C C     1 
ATOM 1757  O O     . TYR C 3 58  ? 130.17000 120.51900 118.13700 1.000 123.58297 ? 57  TYR C O     1 
ATOM 1758  C CB    . TYR C 3 58  ? 131.03400 118.35100 120.46200 1.000 123.58297 ? 57  TYR C CB    1 
ATOM 1759  C CG    . TYR C 3 58  ? 131.52000 117.85000 119.12600 1.000 123.58297 ? 57  TYR C CG    1 
ATOM 1760  C CD1   . TYR C 3 58  ? 132.67000 118.36900 118.55300 1.000 123.58297 ? 57  TYR C CD1   1 
ATOM 1761  C CD2   . TYR C 3 58  ? 130.83300 116.86000 118.43900 1.000 123.58297 ? 57  TYR C CD2   1 
ATOM 1762  C CE1   . TYR C 3 58  ? 133.12000 117.92200 117.33000 1.000 123.58297 ? 57  TYR C CE1   1 
ATOM 1763  C CE2   . TYR C 3 58  ? 131.27700 116.40500 117.21800 1.000 123.58297 ? 57  TYR C CE2   1 
ATOM 1764  C CZ    . TYR C 3 58  ? 132.42000 116.93900 116.67000 1.000 123.58297 ? 57  TYR C CZ    1 
ATOM 1765  O OH    . TYR C 3 58  ? 132.86300 116.48600 115.45200 1.000 123.58297 ? 57  TYR C OH    1 
ATOM 1766  N N     . LEU C 3 59  ? 128.41800 119.58500 119.22500 1.000 114.47729 ? 58  LEU C N     1 
ATOM 1767  C CA    . LEU C 3 59  ? 127.51100 119.74300 118.08900 1.000 114.47729 ? 58  LEU C CA    1 
ATOM 1768  C C     . LEU C 3 59  ? 127.30900 121.21100 117.73700 1.000 114.47729 ? 58  LEU C C     1 
ATOM 1769  O O     . LEU C 3 59  ? 127.38600 121.60100 116.55900 1.000 114.47729 ? 58  LEU C O     1 
ATOM 1770  C CB    . LEU C 3 59  ? 126.17000 119.08400 118.39400 1.000 114.47729 ? 58  LEU C CB    1 
ATOM 1771  C CG    . LEU C 3 59  ? 126.10000 117.58800 118.12100 1.000 114.47729 ? 58  LEU C CG    1 
ATOM 1772  C CD1   . LEU C 3 59  ? 124.71100 117.07200 118.41200 1.000 114.47729 ? 58  LEU C CD1   1 
ATOM 1773  C CD2   . LEU C 3 59  ? 126.48600 117.30300 116.68900 1.000 114.47729 ? 58  LEU C CD2   1 
ATOM 1774  N N     . THR C 3 60  ? 127.05700 122.04400 118.75300 1.000 117.79913 ? 59  THR C N     1 
ATOM 1775  C CA    . THR C 3 60  ? 126.84800 123.45800 118.47900 1.000 117.79913 ? 59  THR C CA    1 
ATOM 1776  C C     . THR C 3 60  ? 128.13100 124.13600 118.01600 1.000 117.79913 ? 59  THR C C     1 
ATOM 1777  O O     . THR C 3 60  ? 128.06500 125.04700 117.18900 1.000 117.79913 ? 59  THR C O     1 
ATOM 1778  C CB    . THR C 3 60  ? 126.22400 124.17300 119.68300 1.000 117.79913 ? 59  THR C CB    1 
ATOM 1779  O OG1   . THR C 3 60  ? 125.84300 125.49400 119.29600 1.000 117.79913 ? 59  THR C OG1   1 
ATOM 1780  C CG2   . THR C 3 60  ? 127.15300 124.28000 120.85700 1.000 117.79913 ? 59  THR C CG2   1 
ATOM 1781  N N     . ALA C 3 61  ? 129.30000 123.67200 118.47300 1.000 121.31322 ? 60  ALA C N     1 
ATOM 1782  C CA    . ALA C 3 61  ? 130.55300 124.25000 118.00700 1.000 121.31322 ? 60  ALA C CA    1 
ATOM 1783  C C     . ALA C 3 61  ? 130.79500 123.93300 116.54100 1.000 121.31322 ? 60  ALA C C     1 
ATOM 1784  O O     . ALA C 3 61  ? 131.24500 124.80200 115.78100 1.000 121.31322 ? 60  ALA C O     1 
ATOM 1785  C CB    . ALA C 3 61  ? 131.71300 123.74100 118.85700 1.000 121.31322 ? 60  ALA C CB    1 
ATOM 1786  N N     . GLU C 3 62  ? 130.47000 122.70500 116.12600 1.000 122.94127 ? 61  GLU C N     1 
ATOM 1787  C CA    . GLU C 3 62  ? 130.60800 122.32800 114.72200 1.000 122.94127 ? 61  GLU C CA    1 
ATOM 1788  C C     . GLU C 3 62  ? 129.69100 123.15200 113.82600 1.000 122.94127 ? 61  GLU C C     1 
ATOM 1789  O O     . GLU C 3 62  ? 130.13800 123.73000 112.82000 1.000 122.94127 ? 61  GLU C O     1 
ATOM 1790  C CB    . GLU C 3 62  ? 130.31900 120.83900 114.55600 1.000 122.94127 ? 61  GLU C CB    1 
ATOM 1791  C CG    . GLU C 3 62  ? 130.42200 120.36000 113.12900 1.000 122.94127 ? 61  GLU C CG    1 
ATOM 1792  C CD    . GLU C 3 62  ? 131.85200 120.08800 112.72300 1.000 122.94127 ? 61  GLU C CD    1 
ATOM 1793  O OE1   . GLU C 3 62  ? 132.67300 119.79300 113.61400 1.000 122.94127 ? 61  GLU C OE1   1 
ATOM 1794  O OE2   . GLU C 3 62  ? 132.16000 120.17200 111.51600 1.000 122.94127 ? 61  GLU C OE2   1 
ATOM 1795  N N     . ILE C 3 63  ? 128.40400 123.22700 114.18400 1.000 115.52724 ? 62  ILE C N     1 
ATOM 1796  C CA    . ILE C 3 63  ? 127.46800 123.96900 113.34100 1.000 115.52724 ? 62  ILE C CA    1 
ATOM 1797  C C     . ILE C 3 63  ? 127.76900 125.46800 113.35300 1.000 115.52724 ? 62  ILE C C     1 
ATOM 1798  O O     . ILE C 3 63  ? 127.59900 126.14800 112.33200 1.000 115.52724 ? 62  ILE C O     1 
ATOM 1799  C CB    . ILE C 3 63  ? 126.01100 123.64700 113.73200 1.000 115.52724 ? 62  ILE C CB    1 
ATOM 1800  C CG1   . ILE C 3 63  ? 125.05100 124.08000 112.62700 1.000 115.52724 ? 62  ILE C CG1   1 
ATOM 1801  C CG2   . ILE C 3 63  ? 125.61500 124.24000 115.06100 1.000 115.52724 ? 62  ILE C CG2   1 
ATOM 1802  C CD1   . ILE C 3 63  ? 123.60700 123.79000 112.93600 1.000 115.52724 ? 62  ILE C CD1   1 
ATOM 1803  N N     . LEU C 3 64  ? 128.30400 125.99500 114.45500 1.000 123.40173 ? 63  LEU C N     1 
ATOM 1804  C CA    . LEU C 3 64  ? 128.61500 127.41300 114.50200 1.000 123.40173 ? 63  LEU C CA    1 
ATOM 1805  C C     . LEU C 3 64  ? 129.87200 127.74700 113.72100 1.000 123.40173 ? 63  LEU C C     1 
ATOM 1806  O O     . LEU C 3 64  ? 129.94700 128.82600 113.13300 1.000 123.40173 ? 63  LEU C O     1 
ATOM 1807  C CB    . LEU C 3 64  ? 128.73900 127.86000 115.95400 1.000 123.40173 ? 63  LEU C CB    1 
ATOM 1808  C CG    . LEU C 3 64  ? 127.40100 128.20600 116.61200 1.000 123.40173 ? 63  LEU C CG    1 
ATOM 1809  C CD1   . LEU C 3 64  ? 127.63300 128.92000 117.91300 1.000 123.40173 ? 63  LEU C CD1   1 
ATOM 1810  C CD2   . LEU C 3 64  ? 126.52400 129.04400 115.70100 1.000 123.40173 ? 63  LEU C CD2   1 
ATOM 1811  N N     . GLU C 3 65  ? 130.85400 126.84300 113.68900 1.000 140.56411 ? 64  GLU C N     1 
ATOM 1812  C CA    . GLU C 3 65  ? 132.01400 127.04800 112.82600 1.000 140.56411 ? 64  GLU C CA    1 
ATOM 1813  C C     . GLU C 3 65  ? 131.61900 127.02800 111.35400 1.000 140.56411 ? 64  GLU C C     1 
ATOM 1814  O O     . GLU C 3 65  ? 132.09700 127.86000 110.56300 1.000 140.56411 ? 64  GLU C O     1 
ATOM 1815  C CB    . GLU C 3 65  ? 133.07300 125.98700 113.11700 1.000 140.56411 ? 64  GLU C CB    1 
ATOM 1816  C CG    . GLU C 3 65  ? 134.27100 126.01600 112.18300 1.000 140.56411 ? 64  GLU C CG    1 
ATOM 1817  C CD    . GLU C 3 65  ? 134.87400 127.40000 112.03300 1.000 140.56411 ? 64  GLU C CD    1 
ATOM 1818  O OE1   . GLU C 3 65  ? 135.23800 128.01100 113.05600 1.000 140.56411 ? 64  GLU C OE1   1 
ATOM 1819  O OE2   . GLU C 3 65  ? 134.98700 127.88000 110.88700 1.000 140.56411 ? 64  GLU C OE2   1 
ATOM 1820  N N     . LEU C 3 66  ? 130.74600 126.08700 110.96900 1.000 132.65333 ? 65  LEU C N     1 
ATOM 1821  C CA    . LEU C 3 66  ? 130.26500 126.05000 109.58700 1.000 132.65333 ? 65  LEU C CA    1 
ATOM 1822  C C     . LEU C 3 66  ? 129.50000 127.31900 109.22800 1.000 132.65333 ? 65  LEU C C     1 
ATOM 1823  O O     . LEU C 3 66  ? 129.68300 127.88000 108.13800 1.000 132.65333 ? 65  LEU C O     1 
ATOM 1824  C CB    . LEU C 3 66  ? 129.39400 124.81800 109.35700 1.000 132.65333 ? 65  LEU C CB    1 
ATOM 1825  C CG    . LEU C 3 66  ? 130.07300 123.56400 108.80100 1.000 132.65333 ? 65  LEU C CG    1 
ATOM 1826  C CD1   . LEU C 3 66  ? 130.67700 123.87500 107.44500 1.000 132.65333 ? 65  LEU C CD1   1 
ATOM 1827  C CD2   . LEU C 3 66  ? 131.12500 122.98800 109.73200 1.000 132.65333 ? 65  LEU C CD2   1 
ATOM 1828  N N     . ALA C 3 67  ? 128.66400 127.80400 110.14900 1.000 132.31222 ? 66  ALA C N     1 
ATOM 1829  C CA    . ALA C 3 67  ? 127.94200 129.04900 109.91600 1.000 132.31222 ? 66  ALA C CA    1 
ATOM 1830  C C     . ALA C 3 67  ? 128.87700 130.25100 109.86200 1.000 132.31222 ? 66  ALA C C     1 
ATOM 1831  O O     . ALA C 3 67  ? 128.63100 131.18600 109.09600 1.000 132.31222 ? 66  ALA C O     1 
ATOM 1832  C CB    . ALA C 3 67  ? 126.89000 129.24300 111.00100 1.000 132.31222 ? 66  ALA C CB    1 
ATOM 1833  N N     . GLY C 3 68  ? 129.95000 130.24000 110.65600 1.000 133.26147 ? 67  GLY C N     1 
ATOM 1834  C CA    . GLY C 3 68  ? 130.91800 131.32300 110.60000 1.000 133.26147 ? 67  GLY C CA    1 
ATOM 1835  C C     . GLY C 3 68  ? 131.64300 131.38100 109.27200 1.000 133.26147 ? 67  GLY C C     1 
ATOM 1836  O O     . GLY C 3 68  ? 131.92400 132.46500 108.75700 1.000 133.26147 ? 67  GLY C O     1 
ATOM 1837  N N     . ASN C 3 69  ? 131.94400 130.21400 108.69900 1.000 138.65502 ? 68  ASN C N     1 
ATOM 1838  C CA    . ASN C 3 69  ? 132.48800 130.17200 107.34200 1.000 138.65502 ? 68  ASN C CA    1 
ATOM 1839  C C     . ASN C 3 69  ? 131.47700 130.70900 106.33400 1.000 138.65502 ? 68  ASN C C     1 
ATOM 1840  O O     . ASN C 3 69  ? 131.81400 131.52500 105.46200 1.000 138.65502 ? 68  ASN C O     1 
ATOM 1841  C CB    . ASN C 3 69  ? 132.89600 128.74600 106.99100 1.000 138.65502 ? 68  ASN C CB    1 
ATOM 1842  C CG    . ASN C 3 69  ? 133.93600 128.20100 107.93600 1.000 138.65502 ? 68  ASN C CG    1 
ATOM 1843  O OD1   . ASN C 3 69  ? 133.93800 127.01400 108.25900 1.000 138.65502 ? 68  ASN C OD1   1 
ATOM 1844  N ND2   . ASN C 3 69  ? 134.82400 129.07000 108.39900 1.000 138.65502 ? 68  ASN C ND2   1 
ATOM 1845  N N     . ALA C 3 70  ? 130.22300 130.26000 106.44900 1.000 139.14259 ? 69  ALA C N     1 
ATOM 1846  C CA    . ALA C 3 70  ? 129.15100 130.69300 105.55700 1.000 139.14259 ? 69  ALA C CA    1 
ATOM 1847  C C     . ALA C 3 70  ? 128.76700 132.15800 105.73600 1.000 139.14259 ? 69  ALA C C     1 
ATOM 1848  O O     . ALA C 3 70  ? 128.00700 132.68500 104.91900 1.000 139.14259 ? 69  ALA C O     1 
ATOM 1849  C CB    . ALA C 3 70  ? 127.91800 129.81900 105.76600 1.000 139.14259 ? 69  ALA C CB    1 
ATOM 1850  N N     . ALA C 3 71  ? 129.21600 132.80300 106.80400 1.000 134.32558 ? 70  ALA C N     1 
ATOM 1851  C CA    . ALA C 3 71  ? 129.02900 134.23500 106.96700 1.000 134.32558 ? 70  ALA C CA    1 
ATOM 1852  C C     . ALA C 3 71  ? 130.24500 135.03700 106.55000 1.000 134.32558 ? 70  ALA C C     1 
ATOM 1853  O O     . ALA C 3 71  ? 130.09600 136.15300 106.04400 1.000 134.32558 ? 70  ALA C O     1 
ATOM 1854  C CB    . ALA C 3 71  ? 128.69800 134.57000 108.42000 1.000 134.32558 ? 70  ALA C CB    1 
ATOM 1855  N N     . ARG C 3 72  ? 131.44500 134.49100 106.74800 1.000 139.02470 ? 71  ARG C N     1 
ATOM 1856  C CA    . ARG C 3 72  ? 132.64600 135.20100 106.34200 1.000 139.02470 ? 71  ARG C CA    1 
ATOM 1857  C C     . ARG C 3 72  ? 132.80500 135.20800 104.83200 1.000 139.02470 ? 71  ARG C C     1 
ATOM 1858  O O     . ARG C 3 72  ? 133.35600 136.16500 104.27700 1.000 139.02470 ? 71  ARG C O     1 
ATOM 1859  C CB    . ARG C 3 72  ? 133.87100 134.56800 106.99900 1.000 139.02470 ? 71  ARG C CB    1 
ATOM 1860  C CG    . ARG C 3 72  ? 135.13800 135.40300 106.91600 1.000 139.02470 ? 71  ARG C CG    1 
ATOM 1861  C CD    . ARG C 3 72  ? 136.33900 134.62100 107.41400 1.000 139.02470 ? 71  ARG C CD    1 
ATOM 1862  N NE    . ARG C 3 72  ? 136.45900 133.32900 106.74500 1.000 139.02470 ? 71  ARG C NE    1 
ATOM 1863  C CZ    . ARG C 3 72  ? 136.39000 132.15300 107.36300 1.000 139.02470 ? 71  ARG C CZ    1 
ATOM 1864  N NH1   . ARG C 3 72  ? 136.20000 132.10100 108.67300 1.000 139.02470 ? 71  ARG C NH1   1 
ATOM 1865  N NH2   . ARG C 3 72  ? 136.51000 131.03100 106.66900 1.000 139.02470 ? 71  ARG C NH2   1 
ATOM 1866  N N     . ASP C 3 73  ? 132.31000 134.17600 104.14200 1.000 153.20432 ? 72  ASP C N     1 
ATOM 1867  C CA    . ASP C 3 73  ? 132.36000 134.25900 102.68200 1.000 153.20432 ? 72  ASP C CA    1 
ATOM 1868  C C     . ASP C 3 73  ? 131.31900 135.21200 102.08400 1.000 153.20432 ? 72  ASP C C     1 
ATOM 1869  O O     . ASP C 3 73  ? 131.27300 135.34900 100.85800 1.000 153.20432 ? 72  ASP C O     1 
ATOM 1870  C CB    . ASP C 3 73  ? 132.24200 132.86500 102.05300 1.000 153.20432 ? 72  ASP C CB    1 
ATOM 1871  C CG    . ASP C 3 73  ? 130.82200 132.33800 102.01600 1.000 153.20432 ? 72  ASP C CG    1 
ATOM 1872  O OD1   . ASP C 3 73  ? 130.03100 132.62600 102.93200 1.000 153.20432 ? 72  ASP C OD1   1 
ATOM 1873  O OD2   . ASP C 3 73  ? 130.48800 131.63400 101.04100 1.000 153.20432 ? 72  ASP C OD2   1 
ATOM 1874  N N     . ASN C 3 74  ? 130.48700 135.85600 102.90300 1.000 147.92762 ? 73  ASN C N     1 
ATOM 1875  C CA    . ASN C 3 74  ? 129.51300 136.82900 102.43800 1.000 147.92762 ? 73  ASN C CA    1 
ATOM 1876  C C     . ASN C 3 74  ? 129.78400 138.22000 102.97900 1.000 147.92762 ? 73  ASN C C     1 
ATOM 1877  O O     . ASN C 3 74  ? 128.96300 139.11800 102.75300 1.000 147.92762 ? 73  ASN C O     1 
ATOM 1878  C CB    . ASN C 3 74  ? 128.09200 136.40500 102.82600 1.000 147.92762 ? 73  ASN C CB    1 
ATOM 1879  C CG    . ASN C 3 74  ? 127.51200 135.39000 101.87400 1.000 147.92762 ? 73  ASN C CG    1 
ATOM 1880  O OD1   . ASN C 3 74  ? 126.68500 134.56400 102.25400 1.000 147.92762 ? 73  ASN C OD1   1 
ATOM 1881  N ND2   . ASN C 3 74  ? 127.93100 135.45800 100.61800 1.000 147.92762 ? 73  ASN C ND2   1 
ATOM 1882  N N     . LYS C 3 75  ? 130.89800 138.40200 103.70400 1.000 152.12289 ? 74  LYS C N     1 
ATOM 1883  C CA    . LYS C 3 75  ? 131.32400 139.68100 104.28300 1.000 152.12289 ? 74  LYS C CA    1 
ATOM 1884  C C     . LYS C 3 75  ? 130.27200 140.24300 105.23900 1.000 152.12289 ? 74  LYS C C     1 
ATOM 1885  O O     . LYS C 3 75  ? 129.86200 141.40100 105.14500 1.000 152.12289 ? 74  LYS C O     1 
ATOM 1886  C CB    . LYS C 3 75  ? 131.69500 140.68100 103.18300 1.000 152.12289 ? 74  LYS C CB    1 
ATOM 1887  C CG    . LYS C 3 75  ? 132.70400 140.11200 102.19400 1.000 152.12289 ? 74  LYS C CG    1 
ATOM 1888  C CD    . LYS C 3 75  ? 132.70900 140.86700 100.88000 1.000 152.12289 ? 74  LYS C CD    1 
ATOM 1889  C CE    . LYS C 3 75  ? 131.32000 140.91100 100.26800 1.000 152.12289 ? 74  LYS C CE    1 
ATOM 1890  N NZ    . LYS C 3 75  ? 131.26000 141.84600 99.11500  1.000 152.12289 ? 74  LYS C NZ    1 
ATOM 1891  N N     . LYS C 3 76  ? 129.82100 139.39100 106.15800 1.000 155.43551 ? 75  LYS C N     1 
ATOM 1892  C CA    . LYS C 3 76  ? 128.82100 139.74800 107.15700 1.000 155.43551 ? 75  LYS C CA    1 
ATOM 1893  C C     . LYS C 3 76  ? 129.30700 139.27500 108.51700 1.000 155.43551 ? 75  LYS C C     1 
ATOM 1894  O O     . LYS C 3 76  ? 129.55300 138.08100 108.70600 1.000 155.43551 ? 75  LYS C O     1 
ATOM 1895  C CB    . LYS C 3 76  ? 127.46600 139.10600 106.84500 1.000 155.43551 ? 75  LYS C CB    1 
ATOM 1896  C CG    . LYS C 3 76  ? 126.92000 139.36100 105.45800 1.000 155.43551 ? 75  LYS C CG    1 
ATOM 1897  C CD    . LYS C 3 76  ? 126.40100 140.77000 105.32700 1.000 155.43551 ? 75  LYS C CD    1 
ATOM 1898  C CE    . LYS C 3 76  ? 125.51900 140.89900 104.10300 1.000 155.43551 ? 75  LYS C CE    1 
ATOM 1899  N NZ    . LYS C 3 76  ? 124.59700 139.73500 103.98200 1.000 155.43551 ? 75  LYS C NZ    1 
ATOM 1900  N N     . THR C 3 77  ? 129.46900 140.20700 109.45500 1.000 160.73463 ? 76  THR C N     1 
ATOM 1901  C CA    . THR C 3 77  ? 129.88100 139.84300 110.80400 1.000 160.73463 ? 76  THR C CA    1 
ATOM 1902  C C     . THR C 3 77  ? 128.72500 139.37600 111.67400 1.000 160.73463 ? 76  THR C C     1 
ATOM 1903  O O     . THR C 3 77  ? 128.96400 138.86700 112.77300 1.000 160.73463 ? 76  THR C O     1 
ATOM 1904  C CB    . THR C 3 77  ? 130.56600 141.02400 111.48800 1.000 160.73463 ? 76  THR C CB    1 
ATOM 1905  O OG1   . THR C 3 77  ? 129.60100 142.05300 111.73600 1.000 160.73463 ? 76  THR C OG1   1 
ATOM 1906  C CG2   . THR C 3 77  ? 131.67500 141.57600 110.61200 1.000 160.73463 ? 76  THR C CG2   1 
ATOM 1907  N N     . ARG C 3 78  ? 127.49100 139.52500 111.21000 1.000 160.33343 ? 77  ARG C N     1 
ATOM 1908  C CA    . ARG C 3 78  ? 126.30100 139.11900 111.94500 1.000 160.33343 ? 77  ARG C CA    1 
ATOM 1909  C C     . ARG C 3 78  ? 125.70000 137.90200 111.26200 1.000 160.33343 ? 77  ARG C C     1 
ATOM 1910  O O     . ARG C 3 78  ? 125.38600 137.95600 110.06800 1.000 160.33343 ? 77  ARG C O     1 
ATOM 1911  C CB    . ARG C 3 78  ? 125.28000 140.25400 111.99400 1.000 160.33343 ? 77  ARG C CB    1 
ATOM 1912  C CG    . ARG C 3 78  ? 124.31000 140.18600 113.15100 1.000 160.33343 ? 77  ARG C CG    1 
ATOM 1913  C CD    . ARG C 3 78  ? 123.71500 141.55400 113.43000 1.000 160.33343 ? 77  ARG C CD    1 
ATOM 1914  N NE    . ARG C 3 78  ? 124.58500 142.38000 114.25700 1.000 160.33343 ? 77  ARG C NE    1 
ATOM 1915  C CZ    . ARG C 3 78  ? 124.79200 143.67600 114.05200 1.000 160.33343 ? 77  ARG C CZ    1 
ATOM 1916  N NH1   . ARG C 3 78  ? 124.19400 144.29200 113.04400 1.000 160.33343 ? 77  ARG C NH1   1 
ATOM 1917  N NH2   . ARG C 3 78  ? 125.59700 144.35600 114.85400 1.000 160.33343 ? 77  ARG C NH2   1 
ATOM 1918  N N     . ILE C 3 79  ? 125.57200 136.80000 112.00300 1.000 143.82557 ? 78  ILE C N     1 
ATOM 1919  C CA    . ILE C 3 79  ? 125.01900 135.58500 111.42200 1.000 143.82557 ? 78  ILE C CA    1 
ATOM 1920  C C     . ILE C 3 79  ? 123.52100 135.78300 111.18300 1.000 143.82557 ? 78  ILE C C     1 
ATOM 1921  O O     . ILE C 3 79  ? 122.84900 136.56400 111.87200 1.000 143.82557 ? 78  ILE C O     1 
ATOM 1922  C CB    . ILE C 3 79  ? 125.32100 134.36500 112.31800 1.000 143.82557 ? 78  ILE C CB    1 
ATOM 1923  C CG1   . ILE C 3 79  ? 125.15000 133.07000 111.55100 1.000 143.82557 ? 78  ILE C CG1   1 
ATOM 1924  C CG2   . ILE C 3 79  ? 124.37600 134.24600 113.45900 1.000 143.82557 ? 78  ILE C CG2   1 
ATOM 1925  C CD1   . ILE C 3 79  ? 126.22600 132.86700 110.57900 1.000 143.82557 ? 78  ILE C CD1   1 
ATOM 1926  N N     . ILE C 3 80  ? 123.00900 135.14300 110.13900 1.000 130.18473 ? 79  ILE C N     1 
ATOM 1927  C CA    . ILE C 3 80  ? 121.59400 135.22100 109.78500 1.000 130.18473 ? 79  ILE C CA    1 
ATOM 1928  C C     . ILE C 3 80  ? 121.07400 133.79700 109.64700 1.000 130.18473 ? 79  ILE C C     1 
ATOM 1929  O O     . ILE C 3 80  ? 121.86500 132.86400 109.43900 1.000 130.18473 ? 79  ILE C O     1 
ATOM 1930  C CB    . ILE C 3 80  ? 121.37900 136.02100 108.47800 1.000 130.18473 ? 79  ILE C CB    1 
ATOM 1931  C CG1   . ILE C 3 80  ? 122.18800 135.40100 107.34300 1.000 130.18473 ? 79  ILE C CG1   1 
ATOM 1932  C CG2   . ILE C 3 80  ? 121.70500 137.48500 108.68200 1.000 130.18473 ? 79  ILE C CG2   1 
ATOM 1933  C CD1   . ILE C 3 80  ? 122.06500 136.14000 106.03600 1.000 130.18473 ? 79  ILE C CD1   1 
ATOM 1934  N N     . PRO C 3 81  ? 119.75900 133.58600 109.80400 1.000 120.25596 ? 80  PRO C N     1 
ATOM 1935  C CA    . PRO C 3 81  ? 119.20800 132.23400 109.59800 1.000 120.25596 ? 80  PRO C CA    1 
ATOM 1936  C C     . PRO C 3 81  ? 119.40700 131.67400 108.19900 1.000 120.25596 ? 80  PRO C C     1 
ATOM 1937  O O     . PRO C 3 81  ? 119.30000 130.45600 108.02400 1.000 120.25596 ? 80  PRO C O     1 
ATOM 1938  C CB    . PRO C 3 81  ? 117.72000 132.40500 109.92400 1.000 120.25596 ? 80  PRO C CB    1 
ATOM 1939  C CG    . PRO C 3 81  ? 117.46700 133.85500 109.89500 1.000 120.25596 ? 80  PRO C CG    1 
ATOM 1940  C CD    . PRO C 3 81  ? 118.73200 134.49500 110.33800 1.000 120.25596 ? 80  PRO C CD    1 
ATOM 1941  N N     . ARG C 3 82  ? 119.67800 132.51500 107.20100 1.000 122.68649 ? 81  ARG C N     1 
ATOM 1942  C CA    . ARG C 3 82  ? 120.00200 132.00600 105.87500 1.000 122.68649 ? 81  ARG C CA    1 
ATOM 1943  C C     . ARG C 3 82  ? 121.32900 131.25800 105.88700 1.000 122.68649 ? 81  ARG C C     1 
ATOM 1944  O O     . ARG C 3 82  ? 121.43700 130.16800 105.30900 1.000 122.68649 ? 81  ARG C O     1 
ATOM 1945  C CB    . ARG C 3 82  ? 120.03400 133.16000 104.87500 1.000 122.68649 ? 81  ARG C CB    1 
ATOM 1946  C CG    . ARG C 3 82  ? 120.84800 132.90700 103.62000 1.000 122.68649 ? 81  ARG C CG    1 
ATOM 1947  C CD    . ARG C 3 82  ? 120.09700 132.00000 102.67000 1.000 122.68649 ? 81  ARG C CD    1 
ATOM 1948  N NE    . ARG C 3 82  ? 120.84800 131.70500 101.45800 1.000 122.68649 ? 81  ARG C NE    1 
ATOM 1949  C CZ    . ARG C 3 82  ? 120.29600 131.23400 100.34700 1.000 122.68649 ? 81  ARG C CZ    1 
ATOM 1950  N NH1   . ARG C 3 82  ? 118.99300 131.00300 100.30000 1.000 122.68649 ? 81  ARG C NH1   1 
ATOM 1951  N NH2   . ARG C 3 82  ? 121.04500 130.99000 99.28400  1.000 122.68649 ? 81  ARG C NH2   1 
ATOM 1952  N N     . HIS C 3 83  ? 122.34200 131.82300 106.55300 1.000 127.72385 ? 82  HIS C N     1 
ATOM 1953  C CA    . HIS C 3 83  ? 123.62700 131.14200 106.67800 1.000 127.72385 ? 82  HIS C CA    1 
ATOM 1954  C C     . HIS C 3 83  ? 123.52000 129.84700 107.46400 1.000 127.72385 ? 82  HIS C C     1 
ATOM 1955  O O     . HIS C 3 83  ? 124.27200 128.90600 107.19500 1.000 127.72385 ? 82  HIS C O     1 
ATOM 1956  C CB    . HIS C 3 83  ? 124.65500 132.04700 107.34400 1.000 127.72385 ? 82  HIS C CB    1 
ATOM 1957  C CG    . HIS C 3 83  ? 124.92500 133.31000 106.59800 1.000 127.72385 ? 82  HIS C CG    1 
ATOM 1958  N ND1   . HIS C 3 83  ? 125.44800 134.43000 107.20300 1.000 127.72385 ? 82  HIS C ND1   1 
ATOM 1959  C CD2   . HIS C 3 83  ? 124.75300 133.63000 105.29500 1.000 127.72385 ? 82  HIS C CD2   1 
ATOM 1960  C CE1   . HIS C 3 83  ? 125.58700 135.38800 106.30500 1.000 127.72385 ? 82  HIS C CE1   1 
ATOM 1961  N NE2   . HIS C 3 83  ? 125.17100 134.92800 105.13900 1.000 127.72385 ? 82  HIS C NE2   1 
ATOM 1962  N N     . LEU C 3 84  ? 122.61900 129.78900 108.44900 1.000 125.29999 ? 83  LEU C N     1 
ATOM 1963  C CA    . LEU C 3 84  ? 122.40000 128.54700 109.18300 1.000 125.29999 ? 83  LEU C CA    1 
ATOM 1964  C C     . LEU C 3 84  ? 121.88000 127.45200 108.27000 1.000 125.29999 ? 83  LEU C C     1 
ATOM 1965  O O     . LEU C 3 84  ? 122.34500 126.31000 108.33700 1.000 125.29999 ? 83  LEU C O     1 
ATOM 1966  C CB    . LEU C 3 84  ? 121.44300 128.77800 110.34400 1.000 125.29999 ? 83  LEU C CB    1 
ATOM 1967  C CG    . LEU C 3 84  ? 122.10100 129.50400 111.50900 1.000 125.29999 ? 83  LEU C CG    1 
ATOM 1968  C CD1   . LEU C 3 84  ? 121.11000 129.71000 112.62300 1.000 125.29999 ? 83  LEU C CD1   1 
ATOM 1969  C CD2   . LEU C 3 84  ? 123.27800 128.70200 112.00300 1.000 125.29999 ? 83  LEU C CD2   1 
ATOM 1970  N N     . GLN C 3 85  ? 120.91200 127.78500 107.41400 1.000 130.02982 ? 84  GLN C N     1 
ATOM 1971  C CA    . GLN C 3 85  ? 120.39700 126.81900 106.45200 1.000 130.02982 ? 84  GLN C CA    1 
ATOM 1972  C C     . GLN C 3 85  ? 121.47400 126.40400 105.45900 1.000 130.02982 ? 84  GLN C C     1 
ATOM 1973  O O     . GLN C 3 85  ? 121.58400 125.22200 105.11600 1.000 130.02982 ? 84  GLN C O     1 
ATOM 1974  C CB    . GLN C 3 85  ? 119.19100 127.40400 105.72400 1.000 130.02982 ? 84  GLN C CB    1 
ATOM 1975  C CG    . GLN C 3 85  ? 118.61800 126.50800 104.65300 1.000 130.02982 ? 84  GLN C CG    1 
ATOM 1976  C CD    . GLN C 3 85  ? 117.58100 125.55800 105.19100 1.000 130.02982 ? 84  GLN C CD    1 
ATOM 1977  O OE1   . GLN C 3 85  ? 117.90400 124.45700 105.63100 1.000 130.02982 ? 84  GLN C OE1   1 
ATOM 1978  N NE2   . GLN C 3 85  ? 116.32600 125.97800 105.16600 1.000 130.02982 ? 84  GLN C NE2   1 
ATOM 1979  N N     . LEU C 3 86  ? 122.28900 127.36400 105.00700 1.000 132.66337 ? 85  LEU C N     1 
ATOM 1980  C CA    . LEU C 3 86  ? 123.39000 127.05500 104.09600 1.000 132.66337 ? 85  LEU C CA    1 
ATOM 1981  C C     . LEU C 3 86  ? 124.39600 126.10000 104.72600 1.000 132.66337 ? 85  LEU C C     1 
ATOM 1982  O O     . LEU C 3 86  ? 124.82700 125.13000 104.09000 1.000 132.66337 ? 85  LEU C O     1 
ATOM 1983  C CB    . LEU C 3 86  ? 124.08600 128.33800 103.66000 1.000 132.66337 ? 85  LEU C CB    1 
ATOM 1984  C CG    . LEU C 3 86  ? 123.70100 128.82100 102.26400 1.000 132.66337 ? 85  LEU C CG    1 
ATOM 1985  C CD1   . LEU C 3 86  ? 124.38300 130.13800 101.94000 1.000 132.66337 ? 85  LEU C CD1   1 
ATOM 1986  C CD2   . LEU C 3 86  ? 124.02800 127.76400 101.22600 1.000 132.66337 ? 85  LEU C CD2   1 
ATOM 1987  N N     . ALA C 3 87  ? 124.76000 126.34800 105.98300 1.000 133.15227 ? 86  ALA C N     1 
ATOM 1988  C CA    . ALA C 3 87  ? 125.72900 125.49600 106.65900 1.000 133.15227 ? 86  ALA C CA    1 
ATOM 1989  C C     . ALA C 3 87  ? 125.14600 124.12600 106.97400 1.000 133.15227 ? 86  ALA C C     1 
ATOM 1990  O O     . ALA C 3 87  ? 125.85400 123.11400 106.90800 1.000 133.15227 ? 86  ALA C O     1 
ATOM 1991  C CB    . ALA C 3 87  ? 126.21800 126.17600 107.93400 1.000 133.15227 ? 86  ALA C CB    1 
ATOM 1992  N N     . ILE C 3 88  ? 123.85900 124.06500 107.31300 1.000 129.47080 ? 87  ILE C N     1 
ATOM 1993  C CA    . ILE C 3 88  ? 123.26400 122.77700 107.62900 1.000 129.47080 ? 87  ILE C CA    1 
ATOM 1994  C C     . ILE C 3 88  ? 122.96600 121.96600 106.37500 1.000 129.47080 ? 87  ILE C C     1 
ATOM 1995  O O     . ILE C 3 88  ? 122.82300 120.74200 106.45900 1.000 129.47080 ? 87  ILE C O     1 
ATOM 1996  C CB    . ILE C 3 88  ? 122.00700 122.97900 108.49200 1.000 129.47080 ? 87  ILE C CB    1 
ATOM 1997  C CG1   . ILE C 3 88  ? 121.76600 121.77000 109.38600 1.000 129.47080 ? 87  ILE C CG1   1 
ATOM 1998  C CG2   . ILE C 3 88  ? 120.76800 123.24000 107.65100 1.000 129.47080 ? 87  ILE C CG2   1 
ATOM 1999  C CD1   . ILE C 3 88  ? 121.09600 122.12700 110.67300 1.000 129.47080 ? 87  ILE C CD1   1 
ATOM 2000  N N     . ARG C 3 89  ? 122.89800 122.60000 105.20800 1.000 134.37066 ? 88  ARG C N     1 
ATOM 2001  C CA    . ARG C 3 89  ? 122.65600 121.85700 103.98500 1.000 134.37066 ? 88  ARG C CA    1 
ATOM 2002  C C     . ARG C 3 89  ? 123.91800 121.56100 103.19100 1.000 134.37066 ? 88  ARG C C     1 
ATOM 2003  O O     . ARG C 3 89  ? 123.88400 120.68000 102.32800 1.000 134.37066 ? 88  ARG C O     1 
ATOM 2004  C CB    . ARG C 3 89  ? 121.66100 122.60200 103.09400 1.000 134.37066 ? 88  ARG C CB    1 
ATOM 2005  C CG    . ARG C 3 89  ? 120.23600 122.68300 103.61900 1.000 134.37066 ? 88  ARG C CG    1 
ATOM 2006  C CD    . ARG C 3 89  ? 119.74800 121.36900 104.19000 1.000 134.37066 ? 88  ARG C CD    1 
ATOM 2007  N NE    . ARG C 3 89  ? 118.52800 121.55300 104.96900 1.000 134.37066 ? 88  ARG C NE    1 
ATOM 2008  C CZ    . ARG C 3 89  ? 117.81700 120.56100 105.49200 1.000 134.37066 ? 88  ARG C CZ    1 
ATOM 2009  N NH1   . ARG C 3 89  ? 118.19800 119.30300 105.32100 1.000 134.37066 ? 88  ARG C NH1   1 
ATOM 2010  N NH2   . ARG C 3 89  ? 116.71900 120.82500 106.18500 1.000 134.37066 ? 88  ARG C NH2   1 
ATOM 2011  N N     . ASN C 3 90  ? 125.01800 122.27400 103.43900 1.000 139.08272 ? 89  ASN C N     1 
ATOM 2012  C CA    . ASN C 3 90  ? 126.25100 121.96500 102.72300 1.000 139.08272 ? 89  ASN C CA    1 
ATOM 2013  C C     . ASN C 3 90  ? 126.85200 120.65500 103.21300 1.000 139.08272 ? 89  ASN C C     1 
ATOM 2014  O O     . ASN C 3 90  ? 127.18600 119.77800 102.41100 1.000 139.08272 ? 89  ASN C O     1 
ATOM 2015  C CB    . ASN C 3 90  ? 127.25600 123.10100 102.88000 1.000 139.08272 ? 89  ASN C CB    1 
ATOM 2016  C CG    . ASN C 3 90  ? 127.13900 124.12900 101.78600 1.000 139.08272 ? 89  ASN C CG    1 
ATOM 2017  O OD1   . ASN C 3 90  ? 126.87500 123.79500 100.63300 1.000 139.08272 ? 89  ASN C OD1   1 
ATOM 2018  N ND2   . ASN C 3 90  ? 127.33800 125.39000 102.13800 1.000 139.08272 ? 89  ASN C ND2   1 
ATOM 2019  N N     . ASP C 3 91  ? 127.00800 120.51100 104.52500 1.000 153.08541 ? 90  ASP C N     1 
ATOM 2020  C CA    . ASP C 3 91  ? 127.54500 119.27900 105.08600 1.000 153.08541 ? 90  ASP C CA    1 
ATOM 2021  C C     . ASP C 3 91  ? 126.53200 118.14600 105.00000 1.000 153.08541 ? 90  ASP C C     1 
ATOM 2022  O O     . ASP C 3 91  ? 125.34800 118.32400 105.29500 1.000 153.08541 ? 90  ASP C O     1 
ATOM 2023  C CB    . ASP C 3 91  ? 127.95900 119.48200 106.53700 1.000 153.08541 ? 90  ASP C CB    1 
ATOM 2024  C CG    . ASP C 3 91  ? 128.69200 118.28500 107.09400 1.000 153.08541 ? 90  ASP C CG    1 
ATOM 2025  O OD1   . ASP C 3 91  ? 128.03800 117.45400 107.75600 1.000 153.08541 ? 90  ASP C OD1   1 
ATOM 2026  O OD2   . ASP C 3 91  ? 129.91100 118.16400 106.85500 1.000 153.08541 ? 90  ASP C OD2   1 
ATOM 2027  N N     . GLU C 3 92  ? 127.01100 116.96600 104.60900 1.000 164.05700 ? 91  GLU C N     1 
ATOM 2028  C CA    . GLU C 3 92  ? 126.12400 115.82300 104.43400 1.000 164.05700 ? 91  GLU C CA    1 
ATOM 2029  C C     . GLU C 3 92  ? 125.74400 115.16500 105.75500 1.000 164.05700 ? 91  GLU C C     1 
ATOM 2030  O O     . GLU C 3 92  ? 124.66600 114.56900 105.85200 1.000 164.05700 ? 91  GLU C O     1 
ATOM 2031  C CB    . GLU C 3 92  ? 126.76300 114.79600 103.49700 1.000 164.05700 ? 91  GLU C CB    1 
ATOM 2032  C CG    . GLU C 3 92  ? 128.06000 114.17600 104.00000 1.000 164.05700 ? 91  GLU C CG    1 
ATOM 2033  C CD    . GLU C 3 92  ? 129.28400 114.96700 103.58800 1.000 164.05700 ? 91  GLU C CD    1 
ATOM 2034  O OE1   . GLU C 3 92  ? 130.39800 114.61600 104.02800 1.000 164.05700 ? 91  GLU C OE1   1 
ATOM 2035  O OE2   . GLU C 3 92  ? 129.12700 115.94600 102.83000 1.000 164.05700 ? 91  GLU C OE2   1 
ATOM 2036  N N     . GLU C 3 93  ? 126.59600 115.25100 106.77800 1.000 152.74011 ? 92  GLU C N     1 
ATOM 2037  C CA    . GLU C 3 93  ? 126.25900 114.61700 108.04600 1.000 152.74011 ? 92  GLU C CA    1 
ATOM 2038  C C     . GLU C 3 93  ? 125.23400 115.42000 108.82500 1.000 152.74011 ? 92  GLU C C     1 
ATOM 2039  O O     . GLU C 3 93  ? 124.32100 114.84100 109.42400 1.000 152.74011 ? 92  GLU C O     1 
ATOM 2040  C CB    . GLU C 3 93  ? 127.50700 114.41700 108.89100 1.000 152.74011 ? 92  GLU C CB    1 
ATOM 2041  C CG    . GLU C 3 93  ? 128.46200 113.41200 108.33300 1.000 152.74011 ? 92  GLU C CG    1 
ATOM 2042  C CD    . GLU C 3 93  ? 129.11700 112.62400 109.43500 1.000 152.74011 ? 92  GLU C CD    1 
ATOM 2043  O OE1   . GLU C 3 93  ? 129.77000 113.26000 110.28700 1.000 152.74011 ? 92  GLU C OE1   1 
ATOM 2044  O OE2   . GLU C 3 93  ? 128.96500 111.38400 109.46700 1.000 152.74011 ? 92  GLU C OE2   1 
ATOM 2045  N N     . LEU C 3 94  ? 125.38700 116.74600 108.85100 1.000 146.36618 ? 93  LEU C N     1 
ATOM 2046  C CA    . LEU C 3 94  ? 124.40500 117.59200 109.52000 1.000 146.36618 ? 93  LEU C CA    1 
ATOM 2047  C C     . LEU C 3 94  ? 123.05900 117.50700 108.82200 1.000 146.36618 ? 93  LEU C C     1 
ATOM 2048  O O     . LEU C 3 94  ? 122.00800 117.54600 109.47200 1.000 146.36618 ? 93  LEU C O     1 
ATOM 2049  C CB    . LEU C 3 94  ? 124.89400 119.03600 109.56000 1.000 146.36618 ? 93  LEU C CB    1 
ATOM 2050  C CG    . LEU C 3 94  ? 125.61000 119.48800 110.83100 1.000 146.36618 ? 93  LEU C CG    1 
ATOM 2051  C CD1   . LEU C 3 94  ? 124.75000 119.20200 112.04700 1.000 146.36618 ? 93  LEU C CD1   1 
ATOM 2052  C CD2   . LEU C 3 94  ? 126.97400 118.83500 110.96400 1.000 146.36618 ? 93  LEU C CD2   1 
ATOM 2053  N N     . ASN C 3 95  ? 123.07900 117.37700 107.49600 1.000 150.35462 ? 94  ASN C N     1 
ATOM 2054  C CA    . ASN C 3 95  ? 121.84500 117.20700 106.74600 1.000 150.35462 ? 94  ASN C CA    1 
ATOM 2055  C C     . ASN C 3 95  ? 121.21100 115.86000 107.04500 1.000 150.35462 ? 94  ASN C C     1 
ATOM 2056  O O     . ASN C 3 95  ? 119.98300 115.74400 107.09800 1.000 150.35462 ? 94  ASN C O     1 
ATOM 2057  C CB    . ASN C 3 95  ? 122.12200 117.35500 105.25500 1.000 150.35462 ? 94  ASN C CB    1 
ATOM 2058  C CG    . ASN C 3 95  ? 120.90000 117.10600 104.41500 1.000 150.35462 ? 94  ASN C CG    1 
ATOM 2059  O OD1   . ASN C 3 95  ? 119.79900 117.52600 104.76600 1.000 150.35462 ? 94  ASN C OD1   1 
ATOM 2060  N ND2   . ASN C 3 95  ? 121.08200 116.42800 103.29200 1.000 150.35462 ? 94  ASN C ND2   1 
ATOM 2061  N N     . LYS C 3 96  ? 122.03600 114.83100 107.24100 1.000 151.71266 ? 95  LYS C N     1 
ATOM 2062  C CA    . LYS C 3 96  ? 121.50300 113.52500 107.60200 1.000 151.71266 ? 95  LYS C CA    1 
ATOM 2063  C C     . LYS C 3 96  ? 120.93100 113.52500 109.01000 1.000 151.71266 ? 95  LYS C C     1 
ATOM 2064  O O     . LYS C 3 96  ? 119.96000 112.81200 109.28200 1.000 151.71266 ? 95  LYS C O     1 
ATOM 2065  C CB    . LYS C 3 96  ? 122.58700 112.45900 107.47100 1.000 151.71266 ? 95  LYS C CB    1 
ATOM 2066  C CG    . LYS C 3 96  ? 122.05900 111.10700 107.03800 1.000 151.71266 ? 95  LYS C CG    1 
ATOM 2067  C CD    . LYS C 3 96  ? 123.18300 110.20300 106.57400 1.000 151.71266 ? 95  LYS C CD    1 
ATOM 2068  C CE    . LYS C 3 96  ? 123.58200 110.51400 105.14300 1.000 151.71266 ? 95  LYS C CE    1 
ATOM 2069  N NZ    . LYS C 3 96  ? 122.47700 110.24100 104.18600 1.000 151.71266 ? 95  LYS C NZ    1 
ATOM 2070  N N     . LEU C 3 97  ? 121.51400 114.31100 109.91300 1.000 138.14816 ? 96  LEU C N     1 
ATOM 2071  C CA    . LEU C 3 97  ? 120.97200 114.39700 111.26300 1.000 138.14816 ? 96  LEU C CA    1 
ATOM 2072  C C     . LEU C 3 97  ? 119.68000 115.20100 111.28500 1.000 138.14816 ? 96  LEU C C     1 
ATOM 2073  O O     . LEU C 3 97  ? 118.72500 114.83500 111.97800 1.000 138.14816 ? 96  LEU C O     1 
ATOM 2074  C CB    . LEU C 3 97  ? 122.00600 115.00800 112.20400 1.000 138.14816 ? 96  LEU C CB    1 
ATOM 2075  C CG    . LEU C 3 97  ? 121.52800 115.39000 113.60200 1.000 138.14816 ? 96  LEU C CG    1 
ATOM 2076  C CD1   . LEU C 3 97  ? 121.06000 114.17000 114.35700 1.000 138.14816 ? 96  LEU C CD1   1 
ATOM 2077  C CD2   . LEU C 3 97  ? 122.63800 116.07600 114.35200 1.000 138.14816 ? 96  LEU C CD2   1 
ATOM 2078  N N     . LEU C 3 98  ? 119.62000 116.27900 110.51400 1.000 132.19275 ? 97  LEU C N     1 
ATOM 2079  C CA    . LEU C 3 98  ? 118.44300 117.13600 110.46800 1.000 132.19275 ? 97  LEU C CA    1 
ATOM 2080  C C     . LEU C 3 98  ? 117.84000 117.00400 109.07500 1.000 132.19275 ? 97  LEU C C     1 
ATOM 2081  O O     . LEU C 3 98  ? 118.03300 117.85400 108.20600 1.000 132.19275 ? 97  LEU C O     1 
ATOM 2082  C CB    . LEU C 3 98  ? 118.81100 118.56200 110.78500 1.000 132.19275 ? 97  LEU C CB    1 
ATOM 2083  C CG    . LEU C 3 98  ? 119.15900 118.87500 112.23800 1.000 132.19275 ? 97  LEU C CG    1 
ATOM 2084  C CD1   . LEU C 3 98  ? 120.65700 118.83600 112.46300 1.000 132.19275 ? 97  LEU C CD1   1 
ATOM 2085  C CD2   . LEU C 3 98  ? 118.59200 120.21000 112.64900 1.000 132.19275 ? 97  LEU C CD2   1 
ATOM 2086  N N     . GLY C 3 99  ? 117.10100 115.92000 108.86800 1.000 128.61154 ? 98  GLY C N     1 
ATOM 2087  C CA    . GLY C 3 99  ? 116.49200 115.67600 107.57900 1.000 128.61154 ? 98  GLY C CA    1 
ATOM 2088  C C     . GLY C 3 99  ? 115.06300 116.15600 107.47900 1.000 128.61154 ? 98  GLY C C     1 
ATOM 2089  O O     . GLY C 3 99  ? 114.65000 116.70100 106.45300 1.000 128.61154 ? 98  GLY C O     1 
ATOM 2090  N N     . LYS C 3 100 ? 114.29600 115.96100 108.54700 1.000 119.59291 ? 99  LYS C N     1 
ATOM 2091  C CA    . LYS C 3 100 ? 112.89700 116.35600 108.59000 1.000 119.59291 ? 99  LYS C CA    1 
ATOM 2092  C C     . LYS C 3 100 ? 112.69200 117.69900 109.27400 1.000 119.59291 ? 99  LYS C C     1 
ATOM 2093  O O     . LYS C 3 100 ? 111.67700 117.90700 109.94500 1.000 119.59291 ? 99  LYS C O     1 
ATOM 2094  C CB    . LYS C 3 100 ? 112.08000 115.27000 109.28000 1.000 119.59291 ? 99  LYS C CB    1 
ATOM 2095  C CG    . LYS C 3 100 ? 112.04000 113.97200 108.50200 1.000 119.59291 ? 99  LYS C CG    1 
ATOM 2096  C CD    . LYS C 3 100 ? 111.24300 112.91400 109.23500 1.000 119.59291 ? 99  LYS C CD    1 
ATOM 2097  C CE    . LYS C 3 100 ? 111.19500 111.62200 108.44100 1.000 119.59291 ? 99  LYS C CE    1 
ATOM 2098  N NZ    . LYS C 3 100 ? 110.43000 110.56000 109.14900 1.000 119.59291 ? 99  LYS C NZ    1 
ATOM 2099  N N     . VAL C 3 101 ? 113.63700 118.61500 109.12000 1.000 119.32741 ? 100 VAL C N     1 
ATOM 2100  C CA    . VAL C 3 101 ? 113.56600 119.91300 109.76500 1.000 119.32741 ? 100 VAL C CA    1 
ATOM 2101  C C     . VAL C 3 101 ? 113.33800 120.98900 108.70700 1.000 119.32741 ? 100 VAL C C     1 
ATOM 2102  O O     . VAL C 3 101 ? 113.55600 120.78400 107.50900 1.000 119.32741 ? 100 VAL C O     1 
ATOM 2103  C CB    . VAL C 3 101 ? 114.85300 120.18100 110.57500 1.000 119.32741 ? 100 VAL C CB    1 
ATOM 2104  C CG1   . VAL C 3 101 ? 115.98900 120.59600 109.66100 1.000 119.32741 ? 100 VAL C CG1   1 
ATOM 2105  C CG2   . VAL C 3 101 ? 114.62600 121.17200 111.69300 1.000 119.32741 ? 100 VAL C CG2   1 
ATOM 2106  N N     . THR C 3 102 ? 112.83500 122.13600 109.16000 1.000 116.85263 ? 101 THR C N     1 
ATOM 2107  C CA    . THR C 3 102 ? 112.59700 123.30600 108.32300 1.000 116.85263 ? 101 THR C CA    1 
ATOM 2108  C C     . THR C 3 102 ? 113.07900 124.53000 109.08500 1.000 116.85263 ? 101 THR C C     1 
ATOM 2109  O O     . THR C 3 102 ? 112.64800 124.76400 110.21600 1.000 116.85263 ? 101 THR C O     1 
ATOM 2110  C CB    . THR C 3 102 ? 111.11900 123.45300 107.96200 1.000 116.85263 ? 101 THR C CB    1 
ATOM 2111  O OG1   . THR C 3 102 ? 110.32900 123.32800 109.14900 1.000 116.85263 ? 101 THR C OG1   1 
ATOM 2112  C CG2   . THR C 3 102 ? 110.69200 122.40600 106.94900 1.000 116.85263 ? 101 THR C CG2   1 
ATOM 2113  N N     . ILE C 3 103 ? 113.99800 125.27800 108.49200 1.000 121.97035 ? 102 ILE C N     1 
ATOM 2114  C CA    . ILE C 3 103 ? 114.54600 126.47900 109.10900 1.000 121.97035 ? 102 ILE C CA    1 
ATOM 2115  C C     . ILE C 3 103 ? 113.73100 127.68100 108.65900 1.000 121.97035 ? 102 ILE C C     1 
ATOM 2116  O O     . ILE C 3 103 ? 113.50700 127.87100 107.45900 1.000 121.97035 ? 102 ILE C O     1 
ATOM 2117  C CB    . ILE C 3 103 ? 116.02700 126.65200 108.74400 1.000 121.97035 ? 102 ILE C CB    1 
ATOM 2118  C CG1   . ILE C 3 103 ? 116.82100 125.43200 109.19700 1.000 121.97035 ? 102 ILE C CG1   1 
ATOM 2119  C CG2   . ILE C 3 103 ? 116.59100 127.91300 109.36100 1.000 121.97035 ? 102 ILE C CG2   1 
ATOM 2120  C CD1   . ILE C 3 103 ? 116.86300 125.27500 110.69100 1.000 121.97035 ? 102 ILE C CD1   1 
ATOM 2121  N N     . ALA C 3 104 ? 113.27300 128.48600 109.61700 1.000 125.59270 ? 103 ALA C N     1 
ATOM 2122  C CA    . ALA C 3 104 ? 112.50900 129.68100 109.28600 1.000 125.59270 ? 103 ALA C CA    1 
ATOM 2123  C C     . ALA C 3 104 ? 113.40000 130.71200 108.60500 1.000 125.59270 ? 103 ALA C C     1 
ATOM 2124  O O     . ALA C 3 104 ? 114.54300 130.92900 109.01700 1.000 125.59270 ? 103 ALA C O     1 
ATOM 2125  C CB    . ALA C 3 104 ? 111.88200 130.27600 110.54300 1.000 125.59270 ? 103 ALA C CB    1 
ATOM 2126  N N     . GLN C 3 105 ? 112.85900 131.33600 107.55000 1.000 129.11404 ? 104 GLN C N     1 
ATOM 2127  C CA    . GLN C 3 105 ? 113.55500 132.31600 106.70300 1.000 129.11404 ? 104 GLN C CA    1 
ATOM 2128  C C     . GLN C 3 105 ? 114.82900 131.74200 106.09700 1.000 129.11404 ? 104 GLN C C     1 
ATOM 2129  O O     . GLN C 3 105 ? 115.80800 132.45700 105.88400 1.000 129.11404 ? 104 GLN C O     1 
ATOM 2130  C CB    . GLN C 3 105 ? 113.86000 133.62300 107.44100 1.000 129.11404 ? 104 GLN C CB    1 
ATOM 2131  C CG    . GLN C 3 105 ? 112.63600 134.39500 107.86200 1.000 129.11404 ? 104 GLN C CG    1 
ATOM 2132  C CD    . GLN C 3 105 ? 112.16300 134.00400 109.23700 1.000 129.11404 ? 104 GLN C CD    1 
ATOM 2133  O OE1   . GLN C 3 105 ? 112.96300 133.64900 110.10100 1.000 129.11404 ? 104 GLN C OE1   1 
ATOM 2134  N NE2   . GLN C 3 105 ? 110.85500 134.06800 109.45300 1.000 129.11404 ? 104 GLN C NE2   1 
ATOM 2135  N N     . GLY C 3 106 ? 114.83000 130.44500 105.82700 1.000 127.65876 ? 105 GLY C N     1 
ATOM 2136  C CA    . GLY C 3 106 ? 115.97400 129.81000 105.21900 1.000 127.65876 ? 105 GLY C CA    1 
ATOM 2137  C C     . GLY C 3 106 ? 115.64600 129.41100 103.80300 1.000 127.65876 ? 105 GLY C C     1 
ATOM 2138  O O     . GLY C 3 106 ? 114.74800 128.59700 103.57300 1.000 127.65876 ? 105 GLY C O     1 
ATOM 2139  N N     . GLY C 3 107 ? 116.35000 129.98500 102.84500 1.000 128.14405 ? 106 GLY C N     1 
ATOM 2140  C CA    . GLY C 3 107 ? 116.05500 129.70400 101.46300 1.000 128.14405 ? 106 GLY C CA    1 
ATOM 2141  C C     . GLY C 3 107 ? 116.56000 128.34700 101.03000 1.000 128.14405 ? 106 GLY C C     1 
ATOM 2142  O O     . GLY C 3 107 ? 117.39600 127.72300 101.67900 1.000 128.14405 ? 106 GLY C O     1 
ATOM 2143  N N     . VAL C 3 108 ? 116.01400 127.88300 99.90900  1.000 126.34397 ? 107 VAL C N     1 
ATOM 2144  C CA    . VAL C 3 108 ? 116.43600 126.61400 99.34600  1.000 126.34397 ? 107 VAL C CA    1 
ATOM 2145  C C     . VAL C 3 108 ? 117.84100 126.76800 98.76700  1.000 126.34397 ? 107 VAL C C     1 
ATOM 2146  O O     . VAL C 3 108 ? 118.29800 127.87700 98.46700  1.000 126.34397 ? 107 VAL C O     1 
ATOM 2147  C CB    . VAL C 3 108 ? 115.41800 126.16500 98.28200  1.000 126.34397 ? 107 VAL C CB    1 
ATOM 2148  C CG1   . VAL C 3 108 ? 115.51500 124.67300 97.97200  1.000 126.34397 ? 107 VAL C CG1   1 
ATOM 2149  C CG2   . VAL C 3 108 ? 114.01400 126.51800 98.73000  1.000 126.34397 ? 107 VAL C CG2   1 
ATOM 2150  N N     . LEU C 3 109 ? 118.55300 125.64600 98.67900  1.000 131.25469 ? 108 LEU C N     1 
ATOM 2151  C CA    . LEU C 3 109 ? 119.91200 125.63200 98.16000  1.000 131.25469 ? 108 LEU C CA    1 
ATOM 2152  C C     . LEU C 3 109 ? 119.94500 126.10400 96.70900  1.000 131.25469 ? 108 LEU C C     1 
ATOM 2153  O O     . LEU C 3 109 ? 119.04700 125.76900 95.92900  1.000 131.25469 ? 108 LEU C O     1 
ATOM 2154  C CB    . LEU C 3 109 ? 120.48600 124.22400 98.24000  1.000 131.25469 ? 108 LEU C CB    1 
ATOM 2155  C CG    . LEU C 3 109 ? 121.02600 123.77000 99.58300  1.000 131.25469 ? 108 LEU C CG    1 
ATOM 2156  C CD1   . LEU C 3 109 ? 121.46100 122.32600 99.44900  1.000 131.25469 ? 108 LEU C CD1   1 
ATOM 2157  C CD2   . LEU C 3 109 ? 122.17300 124.66200 100.01200 1.000 131.25469 ? 108 LEU C CD2   1 
ATOM 2158  N N     . PRO C 3 110 ? 120.94900 126.88700 96.31800  1.000 134.33656 ? 109 PRO C N     1 
ATOM 2159  C CA    . PRO C 3 110 ? 121.02400 127.35000 94.92600  1.000 134.33656 ? 109 PRO C CA    1 
ATOM 2160  C C     . PRO C 3 110 ? 121.38100 126.23400 93.96000  1.000 134.33656 ? 109 PRO C C     1 
ATOM 2161  O O     . PRO C 3 110 ? 122.52900 126.10800 93.52400  1.000 134.33656 ? 109 PRO C O     1 
ATOM 2162  C CB    . PRO C 3 110 ? 122.11100 128.42800 94.97500  1.000 134.33656 ? 109 PRO C CB    1 
ATOM 2163  C CG    . PRO C 3 110 ? 122.95600 128.05700 96.14000  1.000 134.33656 ? 109 PRO C CG    1 
ATOM 2164  C CD    . PRO C 3 110 ? 122.04000 127.42800 97.14500  1.000 134.33656 ? 109 PRO C CD    1 
ATOM 2165  N N     . ASN C 3 111 ? 120.39200 125.42100 93.61300  1.000 132.31884 ? 110 ASN C N     1 
ATOM 2166  C CA    . ASN C 3 111 ? 120.57900 124.30000 92.71100  1.000 132.31884 ? 110 ASN C CA    1 
ATOM 2167  C C     . ASN C 3 111 ? 119.68200 124.46000 91.49600  1.000 132.31884 ? 110 ASN C C     1 
ATOM 2168  O O     . ASN C 3 111 ? 118.56100 124.96600 91.59200  1.000 132.31884 ? 110 ASN C O     1 
ATOM 2169  C CB    . ASN C 3 111 ? 120.28100 122.98100 93.41200  1.000 132.31884 ? 110 ASN C CB    1 
ATOM 2170  C CG    . ASN C 3 111 ? 121.35400 122.60600 94.40400  1.000 132.31884 ? 110 ASN C CG    1 
ATOM 2171  O OD1   . ASN C 3 111 ? 121.69800 123.39200 95.28500  1.000 132.31884 ? 110 ASN C OD1   1 
ATOM 2172  N ND2   . ASN C 3 111 ? 121.89400 121.40200 94.26900  1.000 132.31884 ? 110 ASN C ND2   1 
ATOM 2173  N N     . ILE C 3 112 ? 120.18900 124.01700 90.35200  1.000 129.42023 ? 111 ILE C N     1 
ATOM 2174  C CA    . ILE C 3 112 ? 119.46300 124.09900 89.09600  1.000 129.42023 ? 111 ILE C CA    1 
ATOM 2175  C C     . ILE C 3 112 ? 119.53000 122.76600 88.36200  1.000 129.42023 ? 111 ILE C C     1 
ATOM 2176  O O     . ILE C 3 112 ? 118.50400 122.19900 87.98900  1.000 129.42023 ? 111 ILE C O     1 
ATOM 2177  C CB    . ILE C 3 112 ? 120.01200 125.23200 88.22100  1.000 129.42023 ? 111 ILE C CB    1 
ATOM 2178  C CG1   . ILE C 3 112 ? 121.54100 125.25500 88.28900  1.000 129.42023 ? 111 ILE C CG1   1 
ATOM 2179  C CG2   . ILE C 3 112 ? 119.43800 126.56800 88.65300  1.000 129.42023 ? 111 ILE C CG2   1 
ATOM 2180  C CD1   . ILE C 3 112 ? 122.18500 126.17700 87.28300  1.000 129.42023 ? 111 ILE C CD1   1 
ATOM 2181  N N     . ARG D 4 34  ? 109.38400 133.64900 134.82600 1.000 143.16090 ? 33  ARG D N     1 
ATOM 2182  C CA    . ARG D 4 34  ? 110.63200 133.87100 134.10700 1.000 143.16090 ? 33  ARG D CA    1 
ATOM 2183  C C     . ARG D 4 34  ? 110.75000 132.93200 132.91600 1.000 143.16090 ? 33  ARG D C     1 
ATOM 2184  O O     . ARG D 4 34  ? 109.90600 132.06300 132.71300 1.000 143.16090 ? 33  ARG D O     1 
ATOM 2185  C CB    . ARG D 4 34  ? 111.83000 133.68800 135.03500 1.000 143.16090 ? 33  ARG D CB    1 
ATOM 2186  C CG    . ARG D 4 34  ? 111.76600 134.53200 136.28700 1.000 143.16090 ? 33  ARG D CG    1 
ATOM 2187  C CD    . ARG D 4 34  ? 113.03000 134.38200 137.10400 1.000 143.16090 ? 33  ARG D CD    1 
ATOM 2188  N NE    . ARG D 4 34  ? 114.07700 135.28100 136.63100 1.000 143.16090 ? 33  ARG D NE    1 
ATOM 2189  C CZ    . ARG D 4 34  ? 115.26800 135.40600 137.20500 1.000 143.16090 ? 33  ARG D CZ    1 
ATOM 2190  N NH1   . ARG D 4 34  ? 115.56600 134.68500 138.27600 1.000 143.16090 ? 33  ARG D NH1   1 
ATOM 2191  N NH2   . ARG D 4 34  ? 116.16000 136.25200 136.71000 1.000 143.16090 ? 33  ARG D NH2   1 
ATOM 2192  N N     . LYS D 4 35  ? 111.80700 133.11400 132.13100 1.000 142.44923 ? 34  LYS D N     1 
ATOM 2193  C CA    . LYS D 4 35  ? 112.04500 132.31800 130.93800 1.000 142.44923 ? 34  LYS D CA    1 
ATOM 2194  C C     . LYS D 4 35  ? 113.45100 131.74000 130.97800 1.000 142.44923 ? 34  LYS D C     1 
ATOM 2195  O O     . LYS D 4 35  ? 114.38700 132.39700 131.44300 1.000 142.44923 ? 34  LYS D O     1 
ATOM 2196  C CB    . LYS D 4 35  ? 111.85400 133.15900 129.67400 1.000 142.44923 ? 34  LYS D CB    1 
ATOM 2197  C CG    . LYS D 4 35  ? 111.69600 132.35000 128.40300 1.000 142.44923 ? 34  LYS D CG    1 
ATOM 2198  C CD    . LYS D 4 35  ? 111.23500 133.21900 127.24900 1.000 142.44923 ? 34  LYS D CD    1 
ATOM 2199  C CE    . LYS D 4 35  ? 111.39500 132.49600 125.92400 1.000 142.44923 ? 34  LYS D CE    1 
ATOM 2200  N NZ    . LYS D 4 35  ? 111.01100 133.35500 124.77500 1.000 142.44923 ? 34  LYS D NZ    1 
ATOM 2201  N N     . GLU D 4 36  ? 113.59300 130.51000 130.49300 1.000 142.16698 ? 35  GLU D N     1 
ATOM 2202  C CA    . GLU D 4 36  ? 114.87300 129.82300 130.43400 1.000 142.16698 ? 35  GLU D CA    1 
ATOM 2203  C C     . GLU D 4 36  ? 115.30600 129.63800 128.98600 1.000 142.16698 ? 35  GLU D C     1 
ATOM 2204  O O     . GLU D 4 36  ? 114.47900 129.41900 128.09800 1.000 142.16698 ? 35  GLU D O     1 
ATOM 2205  C CB    . GLU D 4 36  ? 114.79600 128.45700 131.12000 1.000 142.16698 ? 35  GLU D CB    1 
ATOM 2206  C CG    . GLU D 4 36  ? 114.64100 128.52100 132.62700 1.000 142.16698 ? 35  GLU D CG    1 
ATOM 2207  C CD    . GLU D 4 36  ? 115.96000 128.70600 133.34600 1.000 142.16698 ? 35  GLU D CD    1 
ATOM 2208  O OE1   . GLU D 4 36  ? 117.01800 128.59800 132.69400 1.000 142.16698 ? 35  GLU D OE1   1 
ATOM 2209  O OE2   . GLU D 4 36  ? 115.93900 128.95300 134.56900 1.000 142.16698 ? 35  GLU D OE2   1 
ATOM 2210  N N     . SER D 4 37  ? 116.61600 129.70000 128.76300 1.000 127.33441 ? 36  SER D N     1 
ATOM 2211  C CA    . SER D 4 37  ? 117.17700 129.56100 127.42600 1.000 127.33441 ? 36  SER D CA    1 
ATOM 2212  C C     . SER D 4 37  ? 118.65700 129.23900 127.53700 1.000 127.33441 ? 36  SER D C     1 
ATOM 2213  O O     . SER D 4 37  ? 119.26300 129.35800 128.60300 1.000 127.33441 ? 36  SER D O     1 
ATOM 2214  C CB    . SER D 4 37  ? 116.99400 130.83300 126.60100 1.000 127.33441 ? 36  SER D CB    1 
ATOM 2215  O OG    . SER D 4 37  ? 117.95700 130.87600 125.56300 1.000 127.33441 ? 36  SER D OG    1 
ATOM 2216  N N     . TYR D 4 38  ? 119.23300 128.83000 126.41000 1.000 122.34757 ? 37  TYR D N     1 
ATOM 2217  C CA    . TYR D 4 38  ? 120.66200 128.57400 126.30500 1.000 122.34757 ? 37  TYR D CA    1 
ATOM 2218  C C     . TYR D 4 38  ? 121.37000 129.67800 125.53500 1.000 122.34757 ? 37  TYR D C     1 
ATOM 2219  O O     . TYR D 4 38  ? 122.37100 129.42300 124.86500 1.000 122.34757 ? 37  TYR D O     1 
ATOM 2220  C CB    . TYR D 4 38  ? 120.94100 127.23000 125.63600 1.000 122.34757 ? 37  TYR D CB    1 
ATOM 2221  C CG    . TYR D 4 38  ? 120.16700 126.06400 126.18100 1.000 122.34757 ? 37  TYR D CG    1 
ATOM 2222  C CD1   . TYR D 4 38  ? 120.68500 125.29200 127.20800 1.000 122.34757 ? 37  TYR D CD1   1 
ATOM 2223  C CD2   . TYR D 4 38  ? 118.93900 125.71000 125.64800 1.000 122.34757 ? 37  TYR D CD2   1 
ATOM 2224  C CE1   . TYR D 4 38  ? 119.99300 124.21800 127.70400 1.000 122.34757 ? 37  TYR D CE1   1 
ATOM 2225  C CE2   . TYR D 4 38  ? 118.24000 124.63800 126.13700 1.000 122.34757 ? 37  TYR D CE2   1 
ATOM 2226  C CZ    . TYR D 4 38  ? 118.77300 123.89600 127.16400 1.000 122.34757 ? 37  TYR D CZ    1 
ATOM 2227  O OH    . TYR D 4 38  ? 118.07400 122.82400 127.65100 1.000 122.34757 ? 37  TYR D OH    1 
ATOM 2228  N N     . SER D 4 39  ? 120.86200 130.90700 125.62800 1.000 121.60725 ? 38  SER D N     1 
ATOM 2229  C CA    . SER D 4 39  ? 121.37500 131.98500 124.79200 1.000 121.60725 ? 38  SER D CA    1 
ATOM 2230  C C     . SER D 4 39  ? 122.77300 132.42200 125.19900 1.000 121.60725 ? 38  SER D C     1 
ATOM 2231  O O     . SER D 4 39  ? 123.57300 132.80000 124.33900 1.000 121.60725 ? 38  SER D O     1 
ATOM 2232  C CB    . SER D 4 39  ? 120.41900 133.17000 124.83900 1.000 121.60725 ? 38  SER D CB    1 
ATOM 2233  O OG    . SER D 4 39  ? 119.08200 132.73700 124.67400 1.000 121.60725 ? 38  SER D OG    1 
ATOM 2234  N N     . VAL D 4 40  ? 123.09000 132.37300 126.48900 1.000 121.09270 ? 39  VAL D N     1 
ATOM 2235  C CA    . VAL D 4 40  ? 124.38800 132.85800 126.93900 1.000 121.09270 ? 39  VAL D CA    1 
ATOM 2236  C C     . VAL D 4 40  ? 125.49300 131.86200 126.59400 1.000 121.09270 ? 39  VAL D C     1 
ATOM 2237  O O     . VAL D 4 40  ? 126.59800 132.25400 126.19500 1.000 121.09270 ? 39  VAL D O     1 
ATOM 2238  C CB    . VAL D 4 40  ? 124.32100 133.19100 128.44400 1.000 121.09270 ? 39  VAL D CB    1 
ATOM 2239  C CG1   . VAL D 4 40  ? 123.75300 132.03100 129.25000 1.000 121.09270 ? 39  VAL D CG1   1 
ATOM 2240  C CG2   . VAL D 4 40  ? 125.67800 133.61900 128.98400 1.000 121.09270 ? 39  VAL D CG2   1 
ATOM 2241  N N     . TYR D 4 41  ? 125.20000 130.56300 126.67700 1.000 124.16927 ? 40  TYR D N     1 
ATOM 2242  C CA    . TYR D 4 41  ? 126.23000 129.55600 126.45200 1.000 124.16927 ? 40  TYR D CA    1 
ATOM 2243  C C     . TYR D 4 41  ? 126.59900 129.44200 124.98300 1.000 124.16927 ? 40  TYR D C     1 
ATOM 2244  O O     . TYR D 4 41  ? 127.77900 129.28100 124.65000 1.000 124.16927 ? 40  TYR D O     1 
ATOM 2245  C CB    . TYR D 4 41  ? 125.76900 128.21400 127.00200 1.000 124.16927 ? 40  TYR D CB    1 
ATOM 2246  C CG    . TYR D 4 41  ? 125.07100 128.35500 128.31800 1.000 124.16927 ? 40  TYR D CG    1 
ATOM 2247  C CD1   . TYR D 4 41  ? 125.77900 128.73100 129.44800 1.000 124.16927 ? 40  TYR D CD1   1 
ATOM 2248  C CD2   . TYR D 4 41  ? 123.71200 128.13400 128.43500 1.000 124.16927 ? 40  TYR D CD2   1 
ATOM 2249  C CE1   . TYR D 4 41  ? 125.16000 128.87000 130.65900 1.000 124.16927 ? 40  TYR D CE1   1 
ATOM 2250  C CE2   . TYR D 4 41  ? 123.08000 128.27200 129.64600 1.000 124.16927 ? 40  TYR D CE2   1 
ATOM 2251  C CZ    . TYR D 4 41  ? 123.81100 128.64400 130.75300 1.000 124.16927 ? 40  TYR D CZ    1 
ATOM 2252  O OH    . TYR D 4 41  ? 123.19300 128.78000 131.96900 1.000 124.16927 ? 40  TYR D OH    1 
ATOM 2253  N N     . VAL D 4 42  ? 125.60700 129.50500 124.09300 1.000 121.05221 ? 41  VAL D N     1 
ATOM 2254  C CA    . VAL D 4 42  ? 125.92300 129.51000 122.67300 1.000 121.05221 ? 41  VAL D CA    1 
ATOM 2255  C C     . VAL D 4 42  ? 126.65200 130.78800 122.29300 1.000 121.05221 ? 41  VAL D C     1 
ATOM 2256  O O     . VAL D 4 42  ? 127.49300 130.77600 121.39000 1.000 121.05221 ? 41  VAL D O     1 
ATOM 2257  C CB    . VAL D 4 42  ? 124.66400 129.26700 121.82200 1.000 121.05221 ? 41  VAL D CB    1 
ATOM 2258  C CG1   . VAL D 4 42  ? 124.04800 127.94600 122.20000 1.000 121.05221 ? 41  VAL D CG1   1 
ATOM 2259  C CG2   . VAL D 4 42  ? 123.66100 130.35900 122.00600 1.000 121.05221 ? 41  VAL D CG2   1 
ATOM 2260  N N     . TYR D 4 43  ? 126.37900 131.89500 122.99000 1.000 130.64071 ? 42  TYR D N     1 
ATOM 2261  C CA    . TYR D 4 43  ? 127.12400 133.12100 122.75200 1.000 130.64071 ? 42  TYR D CA    1 
ATOM 2262  C C     . TYR D 4 43  ? 128.57900 132.96400 123.16000 1.000 130.64071 ? 42  TYR D C     1 
ATOM 2263  O O     . TYR D 4 43  ? 129.48000 133.41000 122.44200 1.000 130.64071 ? 42  TYR D O     1 
ATOM 2264  C CB    . TYR D 4 43  ? 126.49200 134.27300 123.52300 1.000 130.64071 ? 42  TYR D CB    1 
ATOM 2265  C CG    . TYR D 4 43  ? 126.91700 135.62700 123.02900 1.000 130.64071 ? 42  TYR D CG    1 
ATOM 2266  C CD1   . TYR D 4 43  ? 126.32300 136.19500 121.91500 1.000 130.64071 ? 42  TYR D CD1   1 
ATOM 2267  C CD2   . TYR D 4 43  ? 127.93800 136.32400 123.65800 1.000 130.64071 ? 42  TYR D CD2   1 
ATOM 2268  C CE1   . TYR D 4 43  ? 126.71500 137.43200 121.45400 1.000 130.64071 ? 42  TYR D CE1   1 
ATOM 2269  C CE2   . TYR D 4 43  ? 128.33900 137.56000 123.20500 1.000 130.64071 ? 42  TYR D CE2   1 
ATOM 2270  C CZ    . TYR D 4 43  ? 127.72500 138.10900 122.10200 1.000 130.64071 ? 42  TYR D CZ    1 
ATOM 2271  O OH    . TYR D 4 43  ? 128.12300 139.34200 121.64700 1.000 130.64071 ? 42  TYR D OH    1 
ATOM 2272  N N     . LYS D 4 44  ? 128.82400 132.31100 124.29800 1.000 126.48566 ? 43  LYS D N     1 
ATOM 2273  C CA    . LYS D 4 44  ? 130.19400 132.07400 124.74100 1.000 126.48566 ? 43  LYS D CA    1 
ATOM 2274  C C     . LYS D 4 44  ? 130.94000 131.13600 123.80300 1.000 126.48566 ? 43  LYS D C     1 
ATOM 2275  O O     . LYS D 4 44  ? 132.10300 131.38800 123.46700 1.000 126.48566 ? 43  LYS D O     1 
ATOM 2276  C CB    . LYS D 4 44  ? 130.20100 131.51900 126.15900 1.000 126.48566 ? 43  LYS D CB    1 
ATOM 2277  C CG    . LYS D 4 44  ? 129.88700 132.55600 127.20900 1.000 126.48566 ? 43  LYS D CG    1 
ATOM 2278  C CD    . LYS D 4 44  ? 129.88400 131.94100 128.58700 1.000 126.48566 ? 43  LYS D CD    1 
ATOM 2279  C CE    . LYS D 4 44  ? 129.53900 132.96800 129.64400 1.000 126.48566 ? 43  LYS D CE    1 
ATOM 2280  N NZ    . LYS D 4 44  ? 129.52600 132.35700 131.00100 1.000 126.48566 ? 43  LYS D NZ    1 
ATOM 2281  N N     . VAL D 4 45  ? 130.29400 130.05500 123.36500 1.000 129.12296 ? 44  VAL D N     1 
ATOM 2282  C CA    . VAL D 4 45  ? 130.97400 129.13200 122.46000 1.000 129.12296 ? 44  VAL D CA    1 
ATOM 2283  C C     . VAL D 4 45  ? 131.15600 129.76400 121.08400 1.000 129.12296 ? 44  VAL D C     1 
ATOM 2284  O O     . VAL D 4 45  ? 132.13600 129.46900 120.38800 1.000 129.12296 ? 44  VAL D O     1 
ATOM 2285  C CB    . VAL D 4 45  ? 130.25400 127.76500 122.40800 1.000 129.12296 ? 44  VAL D CB    1 
ATOM 2286  C CG1   . VAL D 4 45  ? 129.03700 127.76600 121.49700 1.000 129.12296 ? 44  VAL D CG1   1 
ATOM 2287  C CG2   . VAL D 4 45  ? 131.22500 126.67900 121.98900 1.000 129.12296 ? 44  VAL D CG2   1 
ATOM 2288  N N     . LEU D 4 46  ? 130.26000 130.67200 120.68600 1.000 132.77006 ? 45  LEU D N     1 
ATOM 2289  C CA    . LEU D 4 46  ? 130.43600 131.37400 119.42600 1.000 132.77006 ? 45  LEU D CA    1 
ATOM 2290  C C     . LEU D 4 46  ? 131.59200 132.35200 119.51500 1.000 132.77006 ? 45  LEU D C     1 
ATOM 2291  O O     . LEU D 4 46  ? 132.35500 132.50300 118.55700 1.000 132.77006 ? 45  LEU D O     1 
ATOM 2292  C CB    . LEU D 4 46  ? 129.13300 132.07500 119.04300 1.000 132.77006 ? 45  LEU D CB    1 
ATOM 2293  C CG    . LEU D 4 46  ? 129.01400 132.82000 117.71100 1.000 132.77006 ? 45  LEU D CG    1 
ATOM 2294  C CD1   . LEU D 4 46  ? 127.63500 132.60100 117.13200 1.000 132.77006 ? 45  LEU D CD1   1 
ATOM 2295  C CD2   . LEU D 4 46  ? 129.21500 134.29400 117.90800 1.000 132.77006 ? 45  LEU D CD2   1 
ATOM 2296  N N     . LYS D 4 47  ? 131.73000 133.03200 120.65500 1.000 130.91268 ? 46  LYS D N     1 
ATOM 2297  C CA    . LYS D 4 47  ? 132.87600 133.90800 120.85400 1.000 130.91268 ? 46  LYS D CA    1 
ATOM 2298  C C     . LYS D 4 47  ? 134.17100 133.11500 120.93900 1.000 130.91268 ? 46  LYS D C     1 
ATOM 2299  O O     . LYS D 4 47  ? 135.23300 133.62300 120.56600 1.000 130.91268 ? 46  LYS D O     1 
ATOM 2300  C CB    . LYS D 4 47  ? 132.68000 134.76100 122.10300 1.000 130.91268 ? 46  LYS D CB    1 
ATOM 2301  C CG    . LYS D 4 47  ? 131.66200 135.86700 121.89800 1.000 130.91268 ? 46  LYS D CG    1 
ATOM 2302  C CD    . LYS D 4 47  ? 132.20300 136.98100 121.02500 1.000 130.91268 ? 46  LYS D CD    1 
ATOM 2303  C CE    . LYS D 4 47  ? 131.25300 138.16500 121.01400 1.000 130.91268 ? 46  LYS D CE    1 
ATOM 2304  N NZ    . LYS D 4 47  ? 131.78700 139.31300 120.23300 1.000 130.91268 ? 46  LYS D NZ    1 
ATOM 2305  N N     . GLN D 4 48  ? 134.09900 131.87600 121.42700 1.000 132.00913 ? 47  GLN D N     1 
ATOM 2306  C CA    . GLN D 4 48  ? 135.28800 131.03600 121.48900 1.000 132.00913 ? 47  GLN D CA    1 
ATOM 2307  C C     . GLN D 4 48  ? 135.70800 130.56600 120.10300 1.000 132.00913 ? 47  GLN D C     1 
ATOM 2308  O O     . GLN D 4 48  ? 136.89900 130.57800 119.77100 1.000 132.00913 ? 47  GLN D O     1 
ATOM 2309  C CB    . GLN D 4 48  ? 135.03100 129.84000 122.40100 1.000 132.00913 ? 47  GLN D CB    1 
ATOM 2310  C CG    . GLN D 4 48  ? 136.15700 128.82800 122.42900 1.000 132.00913 ? 47  GLN D CG    1 
ATOM 2311  C CD    . GLN D 4 48  ? 135.80700 127.60000 123.23500 1.000 132.00913 ? 47  GLN D CD    1 
ATOM 2312  O OE1   . GLN D 4 48  ? 134.76700 127.54800 123.88600 1.000 132.00913 ? 47  GLN D OE1   1 
ATOM 2313  N NE2   . GLN D 4 48  ? 136.67300 126.59600 123.18900 1.000 132.00913 ? 47  GLN D NE2   1 
ATOM 2314  N N     . VAL D 4 49  ? 134.74800 130.16100 119.27400 1.000 135.98367 ? 48  VAL D N     1 
ATOM 2315  C CA    . VAL D 4 49  ? 135.10300 129.65900 117.95200 1.000 135.98367 ? 48  VAL D CA    1 
ATOM 2316  C C     . VAL D 4 49  ? 135.42600 130.81300 116.99700 1.000 135.98367 ? 48  VAL D C     1 
ATOM 2317  O O     . VAL D 4 49  ? 136.21700 130.64800 116.06300 1.000 135.98367 ? 48  VAL D O     1 
ATOM 2318  C CB    . VAL D 4 49  ? 133.99000 128.73000 117.42200 1.000 135.98367 ? 48  VAL D CB    1 
ATOM 2319  C CG1   . VAL D 4 49  ? 132.71200 129.48900 117.08100 1.000 135.98367 ? 48  VAL D CG1   1 
ATOM 2320  C CG2   . VAL D 4 49  ? 134.47700 127.89200 116.25400 1.000 135.98367 ? 48  VAL D CG2   1 
ATOM 2321  N N     . HIS D 4 50  ? 134.85600 131.99700 117.22300 1.000 133.69434 ? 49  HIS D N     1 
ATOM 2322  C CA    . HIS D 4 50  ? 135.08600 133.17000 116.39200 1.000 133.69434 ? 49  HIS D CA    1 
ATOM 2323  C C     . HIS D 4 50  ? 135.12600 134.40300 117.27800 1.000 133.69434 ? 49  HIS D C     1 
ATOM 2324  O O     . HIS D 4 50  ? 134.12300 134.73900 117.91600 1.000 133.69434 ? 49  HIS D O     1 
ATOM 2325  C CB    . HIS D 4 50  ? 133.98900 133.32900 115.34500 1.000 133.69434 ? 49  HIS D CB    1 
ATOM 2326  C CG    . HIS D 4 50  ? 133.99300 132.26800 114.29700 1.000 133.69434 ? 49  HIS D CG    1 
ATOM 2327  N ND1   . HIS D 4 50  ? 132.95800 131.37300 114.14300 1.000 133.69434 ? 49  HIS D ND1   1 
ATOM 2328  C CD2   . HIS D 4 50  ? 134.89900 131.96400 113.34000 1.000 133.69434 ? 49  HIS D CD2   1 
ATOM 2329  C CE1   . HIS D 4 50  ? 133.23000 130.55900 113.14000 1.000 133.69434 ? 49  HIS D CE1   1 
ATOM 2330  N NE2   . HIS D 4 50  ? 134.40100 130.89700 112.63400 1.000 133.69434 ? 49  HIS D NE2   1 
ATOM 2331  N N     . PRO D 4 51  ? 136.25000 135.11500 117.33500 1.000 140.85217 ? 50  PRO D N     1 
ATOM 2332  C CA    . PRO D 4 51  ? 136.35900 136.22100 118.29300 1.000 140.85217 ? 50  PRO D CA    1 
ATOM 2333  C C     . PRO D 4 51  ? 135.63000 137.48700 117.88400 1.000 140.85217 ? 50  PRO D C     1 
ATOM 2334  O O     . PRO D 4 51  ? 135.32900 138.30700 118.76100 1.000 140.85217 ? 50  PRO D O     1 
ATOM 2335  C CB    . PRO D 4 51  ? 137.87100 136.46400 118.36700 1.000 140.85217 ? 50  PRO D CB    1 
ATOM 2336  C CG    . PRO D 4 51  ? 138.37100 136.04300 117.02600 1.000 140.85217 ? 50  PRO D CG    1 
ATOM 2337  C CD    . PRO D 4 51  ? 137.48900 134.91400 116.56600 1.000 140.85217 ? 50  PRO D CD    1 
ATOM 2338  N N     . ASP D 4 52  ? 135.33200 137.68300 116.60200 1.000 137.85269 ? 51  ASP D N     1 
ATOM 2339  C CA    . ASP D 4 52  ? 134.76200 138.94200 116.13900 1.000 137.85269 ? 51  ASP D CA    1 
ATOM 2340  C C     . ASP D 4 52  ? 133.43000 138.78300 115.41800 1.000 137.85269 ? 51  ASP D C     1 
ATOM 2341  O O     . ASP D 4 52  ? 132.94400 139.75200 114.82600 1.000 137.85269 ? 51  ASP D O     1 
ATOM 2342  C CB    . ASP D 4 52  ? 135.75900 139.65700 115.22700 1.000 137.85269 ? 51  ASP D CB    1 
ATOM 2343  C CG    . ASP D 4 52  ? 136.19300 138.79600 114.06700 1.000 137.85269 ? 51  ASP D CG    1 
ATOM 2344  O OD1   . ASP D 4 52  ? 136.06700 137.55900 114.17400 1.000 137.85269 ? 51  ASP D OD1   1 
ATOM 2345  O OD2   . ASP D 4 52  ? 136.65900 139.35200 113.05200 1.000 137.85269 ? 51  ASP D OD2   1 
ATOM 2346  N N     . THR D 4 53  ? 132.82800 137.60500 115.44500 1.000 136.67862 ? 52  THR D N     1 
ATOM 2347  C CA    . THR D 4 53  ? 131.58000 137.35300 114.74000 1.000 136.67862 ? 52  THR D CA    1 
ATOM 2348  C C     . THR D 4 53  ? 130.39900 137.52600 115.68300 1.000 136.67862 ? 52  THR D C     1 
ATOM 2349  O O     . THR D 4 53  ? 130.45000 137.10000 116.83700 1.000 136.67862 ? 52  THR D O     1 
ATOM 2350  C CB    . THR D 4 53  ? 131.57600 135.95000 114.13700 1.000 136.67862 ? 52  THR D CB    1 
ATOM 2351  O OG1   . THR D 4 53  ? 132.80200 135.74000 113.43000 1.000 136.67862 ? 52  THR D OG1   1 
ATOM 2352  C CG2   . THR D 4 53  ? 130.42800 135.79300 113.15800 1.000 136.67862 ? 52  THR D CG2   1 
ATOM 2353  N N     . GLY D 4 54  ? 129.35800 138.21000 115.20800 1.000 142.37916 ? 53  GLY D N     1 
ATOM 2354  C CA    . GLY D 4 54  ? 128.15700 138.41700 115.98400 1.000 142.37916 ? 53  GLY D CA    1 
ATOM 2355  C C     . GLY D 4 54  ? 127.03500 137.46600 115.58800 1.000 142.37916 ? 53  GLY D C     1 
ATOM 2356  O O     . GLY D 4 54  ? 127.13700 136.70000 114.63700 1.000 142.37916 ? 53  GLY D O     1 
ATOM 2357  N N     . ILE D 4 55  ? 125.94500 137.53000 116.35000 1.000 136.80532 ? 54  ILE D N     1 
ATOM 2358  C CA    . ILE D 4 55  ? 124.79300 136.65800 116.15200 1.000 136.80532 ? 54  ILE D CA    1 
ATOM 2359  C C     . ILE D 4 55  ? 123.51400 137.48100 116.22800 1.000 136.80532 ? 54  ILE D C     1 
ATOM 2360  O O     . ILE D 4 55  ? 123.41300 138.41500 117.03100 1.000 136.80532 ? 54  ILE D O     1 
ATOM 2361  C CB    . ILE D 4 55  ? 124.80300 135.49700 117.17600 1.000 136.80532 ? 54  ILE D CB    1 
ATOM 2362  C CG1   . ILE D 4 55  ? 123.59400 134.56700 117.02200 1.000 136.80532 ? 54  ILE D CG1   1 
ATOM 2363  C CG2   . ILE D 4 55  ? 124.93500 136.01600 118.59500 1.000 136.80532 ? 54  ILE D CG2   1 
ATOM 2364  C CD1   . ILE D 4 55  ? 123.83900 133.16400 117.50300 1.000 136.80532 ? 54  ILE D CD1   1 
ATOM 2365  N N     . SER D 4 56  ? 122.54500 137.15900 115.37200 1.000 136.21394 ? 55  SER D N     1 
ATOM 2366  C CA    . SER D 4 56  ? 121.27400 137.85900 115.37400 1.000 136.21394 ? 55  SER D CA    1 
ATOM 2367  C C     . SER D 4 56  ? 120.33100 137.24400 116.40100 1.000 136.21394 ? 55  SER D C     1 
ATOM 2368  O O     . SER D 4 56  ? 120.67700 136.30700 117.12100 1.000 136.21394 ? 55  SER D O     1 
ATOM 2369  C CB    . SER D 4 56  ? 120.63300 137.81600 113.99300 1.000 136.21394 ? 55  SER D CB    1 
ATOM 2370  O OG    . SER D 4 56  ? 119.83600 136.65200 113.86200 1.000 136.21394 ? 55  SER D OG    1 
ATOM 2371  N N     . SER D 4 57  ? 119.10700 137.76400 116.45200 1.000 129.15336 ? 56  SER D N     1 
ATOM 2372  C CA    . SER D 4 57  ? 118.11900 137.28700 117.40900 1.000 129.15336 ? 56  SER D CA    1 
ATOM 2373  C C     . SER D 4 57  ? 117.35300 136.07700 116.90600 1.000 129.15336 ? 56  SER D C     1 
ATOM 2374  O O     . SER D 4 57  ? 116.97400 135.21300 117.70200 1.000 129.15336 ? 56  SER D O     1 
ATOM 2375  C CB    . SER D 4 57  ? 117.12500 138.39500 117.73600 1.000 129.15336 ? 56  SER D CB    1 
ATOM 2376  O OG    . SER D 4 57  ? 116.07400 138.40300 116.78900 1.000 129.15336 ? 56  SER D OG    1 
ATOM 2377  N N     . LYS D 4 58  ? 117.07400 136.02300 115.60600 1.000 126.54146 ? 57  LYS D N     1 
ATOM 2378  C CA    . LYS D 4 58  ? 116.36700 134.87600 115.05300 1.000 126.54146 ? 57  LYS D CA    1 
ATOM 2379  C C     . LYS D 4 58  ? 117.23600 133.62900 115.08400 1.000 126.54146 ? 57  LYS D C     1 
ATOM 2380  O O     . LYS D 4 58  ? 116.75600 132.53900 115.42300 1.000 126.54146 ? 57  LYS D O     1 
ATOM 2381  C CB    . LYS D 4 58  ? 115.89700 135.18300 113.63900 1.000 126.54146 ? 57  LYS D CB    1 
ATOM 2382  C CG    . LYS D 4 58  ? 114.79900 136.22200 113.59100 1.000 126.54146 ? 57  LYS D CG    1 
ATOM 2383  C CD    . LYS D 4 58  ? 113.68100 135.76000 112.68200 1.000 126.54146 ? 57  LYS D CD    1 
ATOM 2384  C CE    . LYS D 4 58  ? 112.45200 136.62900 112.82600 1.000 126.54146 ? 57  LYS D CE    1 
ATOM 2385  N NZ    . LYS D 4 58  ? 111.32300 136.10200 112.01400 1.000 126.54146 ? 57  LYS D NZ    1 
ATOM 2386  N N     . ALA D 4 59  ? 118.51600 133.77600 114.72700 1.000 129.65763 ? 58  ALA D N     1 
ATOM 2387  C CA    . ALA D 4 59  ? 119.46100 132.66900 114.80800 1.000 129.65763 ? 58  ALA D CA    1 
ATOM 2388  C C     . ALA D 4 59  ? 119.62500 132.17000 116.23400 1.000 129.65763 ? 58  ALA D C     1 
ATOM 2389  O O     . ALA D 4 59  ? 119.86300 130.97700 116.44600 1.000 129.65763 ? 58  ALA D O     1 
ATOM 2390  C CB    . ALA D 4 59  ? 120.81100 133.09800 114.24500 1.000 129.65763 ? 58  ALA D CB    1 
ATOM 2391  N N     . MET D 4 60  ? 119.48300 133.06700 117.21300 1.000 127.93817 ? 59  MET D N     1 
ATOM 2392  C CA    . MET D 4 60  ? 119.50600 132.68500 118.62100 1.000 127.93817 ? 59  MET D CA    1 
ATOM 2393  C C     . MET D 4 60  ? 118.38700 131.70600 118.94400 1.000 127.93817 ? 59  MET D C     1 
ATOM 2394  O O     . MET D 4 60  ? 118.62400 130.64700 119.54000 1.000 127.93817 ? 59  MET D O     1 
ATOM 2395  C CB    . MET D 4 60  ? 119.38400 133.93200 119.49000 1.000 127.93817 ? 59  MET D CB    1 
ATOM 2396  C CG    . MET D 4 60  ? 119.55200 133.66400 120.95000 1.000 127.93817 ? 59  MET D CG    1 
ATOM 2397  S SD    . MET D 4 60  ? 121.01200 132.66800 121.20000 1.000 127.93817 ? 59  MET D SD    1 
ATOM 2398  C CE    . MET D 4 60  ? 122.29000 133.88700 120.92600 1.000 127.93817 ? 59  MET D CE    1 
ATOM 2399  N N     . GLY D 4 61  ? 117.15600 132.05200 118.56000 1.000 121.69987 ? 60  GLY D N     1 
ATOM 2400  C CA    . GLY D 4 61  ? 116.03300 131.15600 118.77200 1.000 121.69987 ? 60  GLY D CA    1 
ATOM 2401  C C     . GLY D 4 61  ? 116.13900 129.86500 117.98600 1.000 121.69987 ? 60  GLY D C     1 
ATOM 2402  O O     . GLY D 4 61  ? 115.70800 128.81100 118.46700 1.000 121.69987 ? 60  GLY D O     1 
ATOM 2403  N N     . ILE D 4 62  ? 116.72000 129.92800 116.78200 1.000 117.00291 ? 61  ILE D N     1 
ATOM 2404  C CA    . ILE D 4 62  ? 116.93800 128.72300 115.98200 1.000 117.00291 ? 61  ILE D CA    1 
ATOM 2405  C C     . ILE D 4 62  ? 117.87000 127.76200 116.70500 1.000 117.00291 ? 61  ILE D C     1 
ATOM 2406  O O     . ILE D 4 62  ? 117.56500 126.57200 116.85400 1.000 117.00291 ? 61  ILE D O     1 
ATOM 2407  C CB    . ILE D 4 62  ? 117.49300 129.09500 114.59600 1.000 117.00291 ? 61  ILE D CB    1 
ATOM 2408  C CG1   . ILE D 4 62  ? 116.40700 129.73500 113.73000 1.000 117.00291 ? 61  ILE D CG1   1 
ATOM 2409  C CG2   . ILE D 4 62  ? 118.11600 127.88100 113.91400 1.000 117.00291 ? 61  ILE D CG2   1 
ATOM 2410  C CD1   . ILE D 4 62  ? 115.55000 128.76200 112.94900 1.000 117.00291 ? 61  ILE D CD1   1 
ATOM 2411  N N     . MET D 4 63  ? 119.00500 128.27200 117.18500 1.000 119.69129 ? 62  MET D N     1 
ATOM 2412  C CA    . MET D 4 63  ? 119.96300 127.43000 117.89200 1.000 119.69129 ? 62  MET D CA    1 
ATOM 2413  C C     . MET D 4 63  ? 119.39200 126.91200 119.20500 1.000 119.69129 ? 62  MET D C     1 
ATOM 2414  O O     . MET D 4 63  ? 119.66600 125.76900 119.59400 1.000 119.69129 ? 62  MET D O     1 
ATOM 2415  C CB    . MET D 4 63  ? 121.25800 128.19600 118.13900 1.000 119.69129 ? 62  MET D CB    1 
ATOM 2416  C CG    . MET D 4 63  ? 121.99800 128.57200 116.86800 1.000 119.69129 ? 62  MET D CG    1 
ATOM 2417  S SD    . MET D 4 63  ? 122.68800 127.19600 115.94800 1.000 119.69129 ? 62  MET D SD    1 
ATOM 2418  C CE    . MET D 4 63  ? 123.42200 126.26300 117.27200 1.000 119.69129 ? 62  MET D CE    1 
ATOM 2419  N N     . ASN D 4 64  ? 118.59900 127.74100 119.89100 1.000 121.05167 ? 63  ASN D N     1 
ATOM 2420  C CA    . ASN D 4 64  ? 117.94500 127.32500 121.12800 1.000 121.05167 ? 63  ASN D CA    1 
ATOM 2421  C C     . ASN D 4 64  ? 117.00200 126.15300 120.89600 1.000 121.05167 ? 63  ASN D C     1 
ATOM 2422  O O     . ASN D 4 64  ? 117.06500 125.13600 121.60400 1.000 121.05167 ? 63  ASN D O     1 
ATOM 2423  C CB    . ASN D 4 64  ? 117.18300 128.50500 121.72000 1.000 121.05167 ? 63  ASN D CB    1 
ATOM 2424  C CG    . ASN D 4 64  ? 117.35000 128.61400 123.20900 1.000 121.05167 ? 63  ASN D CG    1 
ATOM 2425  O OD1   . ASN D 4 64  ? 118.42600 128.36200 123.74900 1.000 121.05167 ? 63  ASN D OD1   1 
ATOM 2426  N ND2   . ASN D 4 64  ? 116.27900 128.98300 123.89000 1.000 121.05167 ? 63  ASN D ND2   1 
ATOM 2427  N N     . SER D 4 65  ? 116.12300 126.27900 119.89700 1.000 112.50258 ? 64  SER D N     1 
ATOM 2428  C CA    . SER D 4 65  ? 115.18500 125.20700 119.58600 1.000 112.50258 ? 64  SER D CA    1 
ATOM 2429  C C     . SER D 4 65  ? 115.91300 123.95900 119.10300 1.000 112.50258 ? 64  SER D C     1 
ATOM 2430  O O     . SER D 4 65  ? 115.50600 122.83400 119.42100 1.000 112.50258 ? 64  SER D O     1 
ATOM 2431  C CB    . SER D 4 65  ? 114.17900 125.68200 118.54500 1.000 112.50258 ? 64  SER D CB    1 
ATOM 2432  O OG    . SER D 4 65  ? 113.22300 124.67600 118.28200 1.000 112.50258 ? 64  SER D OG    1 
ATOM 2433  N N     . PHE D 4 66  ? 117.00300 124.14500 118.35400 1.000 115.15595 ? 65  PHE D N     1 
ATOM 2434  C CA    . PHE D 4 66  ? 117.77700 123.02200 117.83800 1.000 115.15595 ? 65  PHE D CA    1 
ATOM 2435  C C     . PHE D 4 66  ? 118.41800 122.22100 118.96100 1.000 115.15595 ? 65  PHE D C     1 
ATOM 2436  O O     . PHE D 4 66  ? 118.33600 120.98500 118.98000 1.000 115.15595 ? 65  PHE D O     1 
ATOM 2437  C CB    . PHE D 4 66  ? 118.84700 123.54000 116.88100 1.000 115.15595 ? 65  PHE D CB    1 
ATOM 2438  C CG    . PHE D 4 66  ? 120.02000 122.61900 116.71600 1.000 115.15595 ? 65  PHE D CG    1 
ATOM 2439  C CD1   . PHE D 4 66  ? 119.90700 121.47000 115.95700 1.000 115.15595 ? 65  PHE D CD1   1 
ATOM 2440  C CD2   . PHE D 4 66  ? 121.24400 122.91400 117.29700 1.000 115.15595 ? 65  PHE D CD2   1 
ATOM 2441  C CE1   . PHE D 4 66  ? 120.98400 120.62900 115.79200 1.000 115.15595 ? 65  PHE D CE1   1 
ATOM 2442  C CE2   . PHE D 4 66  ? 122.32200 122.07100 117.13800 1.000 115.15595 ? 65  PHE D CE2   1 
ATOM 2443  C CZ    . PHE D 4 66  ? 122.19100 120.92800 116.38700 1.000 115.15595 ? 65  PHE D CZ    1 
ATOM 2444  N N     . VAL D 4 67  ? 119.08400 122.90900 119.89300 1.000 114.34650 ? 66  VAL D N     1 
ATOM 2445  C CA    . VAL D 4 67  ? 119.73600 122.20100 120.98700 1.000 114.34650 ? 66  VAL D CA    1 
ATOM 2446  C C     . VAL D 4 67  ? 118.70200 121.56600 121.91200 1.000 114.34650 ? 66  VAL D C     1 
ATOM 2447  O O     . VAL D 4 67  ? 118.93800 120.47100 122.44300 1.000 114.34650 ? 66  VAL D O     1 
ATOM 2448  C CB    . VAL D 4 67  ? 120.73700 123.12200 121.71900 1.000 114.34650 ? 66  VAL D CB    1 
ATOM 2449  C CG1   . VAL D 4 67  ? 120.06200 124.18300 122.55200 1.000 114.34650 ? 66  VAL D CG1   1 
ATOM 2450  C CG2   . VAL D 4 67  ? 121.67300 122.30900 122.57600 1.000 114.34650 ? 66  VAL D CG2   1 
ATOM 2451  N N     . ASN D 4 68  ? 117.52200 122.19000 122.06700 1.000 113.36107 ? 67  ASN D N     1 
ATOM 2452  C CA    . ASN D 4 68  ? 116.46500 121.57300 122.86300 1.000 113.36107 ? 67  ASN D CA    1 
ATOM 2453  C C     . ASN D 4 68  ? 115.96000 120.29000 122.21700 1.000 113.36107 ? 67  ASN D C     1 
ATOM 2454  O O     . ASN D 4 68  ? 115.76400 119.27900 122.90400 1.000 113.36107 ? 67  ASN D O     1 
ATOM 2455  C CB    . ASN D 4 68  ? 115.31200 122.54900 123.06400 1.000 113.36107 ? 67  ASN D CB    1 
ATOM 2456  C CG    . ASN D 4 68  ? 115.31800 123.16900 124.43800 1.000 113.36107 ? 67  ASN D CG    1 
ATOM 2457  O OD1   . ASN D 4 68  ? 115.86200 122.60400 125.38200 1.000 113.36107 ? 67  ASN D OD1   1 
ATOM 2458  N ND2   . ASN D 4 68  ? 114.70000 124.33300 124.56300 1.000 113.36107 ? 67  ASN D ND2   1 
ATOM 2459  N N     . ASP D 4 69  ? 115.76900 120.31300 120.89500 1.000 120.80640 ? 68  ASP D N     1 
ATOM 2460  C CA    . ASP D 4 69  ? 115.31000 119.12700 120.18000 1.000 120.80640 ? 68  ASP D CA    1 
ATOM 2461  C C     . ASP D 4 69  ? 116.32700 117.99400 120.23500 1.000 120.80640 ? 68  ASP D C     1 
ATOM 2462  O O     . ASP D 4 69  ? 115.95200 116.83200 120.44100 1.000 120.80640 ? 68  ASP D O     1 
ATOM 2463  C CB    . ASP D 4 69  ? 115.00900 119.48400 118.72900 1.000 120.80640 ? 68  ASP D CB    1 
ATOM 2464  C CG    . ASP D 4 69  ? 114.92100 118.26700 117.84500 1.000 120.80640 ? 68  ASP D CG    1 
ATOM 2465  O OD1   . ASP D 4 69  ? 114.07400 117.39400 118.12000 1.000 120.80640 ? 68  ASP D OD1   1 
ATOM 2466  O OD2   . ASP D 4 69  ? 115.70300 118.17700 116.87700 1.000 120.80640 ? 68  ASP D OD2   1 
ATOM 2467  N N     . ILE D 4 70  ? 117.61200 118.31500 120.06400 1.000 115.43883 ? 69  ILE D N     1 
ATOM 2468  C CA    . ILE D 4 70  ? 118.65600 117.29100 120.11600 1.000 115.43883 ? 69  ILE D CA    1 
ATOM 2469  C C     . ILE D 4 70  ? 118.74200 116.67800 121.50700 1.000 115.43883 ? 69  ILE D C     1 
ATOM 2470  O O     . ILE D 4 70  ? 118.85100 115.44700 121.65700 1.000 115.43883 ? 69  ILE D O     1 
ATOM 2471  C CB    . ILE D 4 70  ? 119.99800 117.88500 119.66100 1.000 115.43883 ? 69  ILE D CB    1 
ATOM 2472  C CG1   . ILE D 4 70  ? 119.93700 118.17500 118.16900 1.000 115.43883 ? 69  ILE D CG1   1 
ATOM 2473  C CG2   . ILE D 4 70  ? 121.14200 116.93900 119.93400 1.000 115.43883 ? 69  ILE D CG2   1 
ATOM 2474  C CD1   . ILE D 4 70  ? 119.76500 116.94400 117.32000 1.000 115.43883 ? 69  ILE D CD1   1 
ATOM 2475  N N     . PHE D 4 71  ? 118.67900 117.52400 122.54300 1.000 111.80835 ? 70  PHE D N     1 
ATOM 2476  C CA    . PHE D 4 71  ? 118.71700 117.04200 123.91800 1.000 111.80835 ? 70  PHE D CA    1 
ATOM 2477  C C     . PHE D 4 71  ? 117.53800 116.13300 124.21900 1.000 111.80835 ? 70  PHE D C     1 
ATOM 2478  O O     . PHE D 4 71  ? 117.71000 115.07800 124.84100 1.000 111.80835 ? 70  PHE D O     1 
ATOM 2479  C CB    . PHE D 4 71  ? 118.73400 118.22800 124.87900 1.000 111.80835 ? 70  PHE D CB    1 
ATOM 2480  C CG    . PHE D 4 71  ? 118.10800 117.94100 126.20900 1.000 111.80835 ? 70  PHE D CG    1 
ATOM 2481  C CD1   . PHE D 4 71  ? 118.77700 117.18300 127.15100 1.000 111.80835 ? 70  PHE D CD1   1 
ATOM 2482  C CD2   . PHE D 4 71  ? 116.85900 118.45200 126.52800 1.000 111.80835 ? 70  PHE D CD2   1 
ATOM 2483  C CE1   . PHE D 4 71  ? 118.21000 116.91600 128.37200 1.000 111.80835 ? 70  PHE D CE1   1 
ATOM 2484  C CE2   . PHE D 4 71  ? 116.28600 118.18800 127.75000 1.000 111.80835 ? 70  PHE D CE2   1 
ATOM 2485  C CZ    . PHE D 4 71  ? 116.96500 117.41900 128.67500 1.000 111.80835 ? 70  PHE D CZ    1 
ATOM 2486  N N     . GLU D 4 72  ? 116.33700 116.53700 123.79600 1.000 123.29359 ? 71  GLU D N     1 
ATOM 2487  C CA    . GLU D 4 72  ? 115.14900 115.72200 124.02300 1.000 123.29359 ? 71  GLU D CA    1 
ATOM 2488  C C     . GLU D 4 72  ? 115.25400 114.38500 123.30400 1.000 123.29359 ? 71  GLU D C     1 
ATOM 2489  O O     . GLU D 4 72  ? 114.85900 113.35000 123.85400 1.000 123.29359 ? 71  GLU D O     1 
ATOM 2490  C CB    . GLU D 4 72  ? 113.89600 116.47300 123.57900 1.000 123.29359 ? 71  GLU D CB    1 
ATOM 2491  C CG    . GLU D 4 72  ? 112.59300 115.86100 124.08300 1.000 123.29359 ? 71  GLU D CG    1 
ATOM 2492  C CD    . GLU D 4 72  ? 112.00700 114.83900 123.13200 1.000 123.29359 ? 71  GLU D CD    1 
ATOM 2493  O OE1   . GLU D 4 72  ? 112.24400 114.95800 121.91200 1.000 123.29359 ? 71  GLU D OE1   1 
ATOM 2494  O OE2   . GLU D 4 72  ? 111.31900 113.91100 123.60500 1.000 123.29359 ? 71  GLU D OE2   1 
ATOM 2495  N N     . ARG D 4 73  ? 115.76200 114.39700 122.06800 1.000 115.28425 ? 72  ARG D N     1 
ATOM 2496  C CA    . ARG D 4 73  ? 115.90200 113.17100 121.29100 1.000 115.28425 ? 72  ARG D CA    1 
ATOM 2497  C C     . ARG D 4 73  ? 116.84000 112.18300 121.96800 1.000 115.28425 ? 72  ARG D C     1 
ATOM 2498  O O     . ARG D 4 73  ? 116.48100 111.01400 122.16700 1.000 115.28425 ? 72  ARG D O     1 
ATOM 2499  C CB    . ARG D 4 73  ? 116.39600 113.50800 119.88700 1.000 115.28425 ? 72  ARG D CB    1 
ATOM 2500  C CG    . ARG D 4 73  ? 115.28000 113.55400 118.87100 1.000 115.28425 ? 72  ARG D CG    1 
ATOM 2501  C CD    . ARG D 4 73  ? 115.64800 114.37100 117.65000 1.000 115.28425 ? 72  ARG D CD    1 
ATOM 2502  N NE    . ARG D 4 73  ? 116.52400 113.66600 116.72800 1.000 115.28425 ? 72  ARG D NE    1 
ATOM 2503  C CZ    . ARG D 4 73  ? 116.90800 114.16500 115.56100 1.000 115.28425 ? 72  ARG D CZ    1 
ATOM 2504  N NH1   . ARG D 4 73  ? 116.48800 115.36200 115.18500 1.000 115.28425 ? 72  ARG D NH1   1 
ATOM 2505  N NH2   . ARG D 4 73  ? 117.70600 113.46800 114.76700 1.000 115.28425 ? 72  ARG D NH2   1 
ATOM 2506  N N     . ILE D 4 74  ? 118.03500 112.64100 122.35300 1.000 113.83460 ? 73  ILE D N     1 
ATOM 2507  C CA    . ILE D 4 74  ? 118.98000 111.71000 122.96700 1.000 113.83460 ? 73  ILE D CA    1 
ATOM 2508  C C     . ILE D 4 74  ? 118.51600 111.27600 124.35500 1.000 113.83460 ? 73  ILE D C     1 
ATOM 2509  O O     . ILE D 4 74  ? 118.73000 110.12100 124.74100 1.000 113.83460 ? 73  ILE D O     1 
ATOM 2510  C CB    . ILE D 4 74  ? 120.41800 112.26700 122.97900 1.000 113.83460 ? 73  ILE D CB    1 
ATOM 2511  C CG1   . ILE D 4 74  ? 120.54300 113.53600 123.81500 1.000 113.83460 ? 73  ILE D CG1   1 
ATOM 2512  C CG2   . ILE D 4 74  ? 120.90300 112.48700 121.55600 1.000 113.83460 ? 73  ILE D CG2   1 
ATOM 2513  C CD1   . ILE D 4 74  ? 121.89500 114.19800 123.69800 1.000 113.83460 ? 73  ILE D CD1   1 
ATOM 2514  N N     . ALA D 4 75  ? 117.84400 112.15500 125.10800 1.000 120.45435 ? 74  ALA D N     1 
ATOM 2515  C CA    . ALA D 4 75  ? 117.36300 111.76900 126.43000 1.000 120.45435 ? 74  ALA D CA    1 
ATOM 2516  C C     . ALA D 4 75  ? 116.25100 110.73300 126.34100 1.000 120.45435 ? 74  ALA D C     1 
ATOM 2517  O O     . ALA D 4 75  ? 116.26300 109.74500 127.08500 1.000 120.45435 ? 74  ALA D O     1 
ATOM 2518  C CB    . ALA D 4 75  ? 116.88300 112.99900 127.19500 1.000 120.45435 ? 74  ALA D CB    1 
ATOM 2519  N N     . GLY D 4 76  ? 115.29300 110.93500 125.43100 1.000 125.83976 ? 75  GLY D N     1 
ATOM 2520  C CA    . GLY D 4 76  ? 114.23600 109.95500 125.24300 1.000 125.83976 ? 75  GLY D CA    1 
ATOM 2521  C C     . GLY D 4 76  ? 114.75200 108.62400 124.73800 1.000 125.83976 ? 75  GLY D C     1 
ATOM 2522  O O     . GLY D 4 76  ? 114.28800 107.56300 125.17000 1.000 125.83976 ? 75  GLY D O     1 
ATOM 2523  N N     . GLU D 4 77  ? 115.71100 108.66200 123.80800 1.000 127.77833 ? 76  GLU D N     1 
ATOM 2524  C CA    . GLU D 4 77  ? 116.28700 107.42900 123.28600 1.000 127.77833 ? 76  GLU D CA    1 
ATOM 2525  C C     . GLU D 4 77  ? 117.04200 106.66900 124.37300 1.000 127.77833 ? 76  GLU D C     1 
ATOM 2526  O O     . GLU D 4 77  ? 116.95700 105.43600 124.45300 1.000 127.77833 ? 76  GLU D O     1 
ATOM 2527  C CB    . GLU D 4 77  ? 117.19500 107.74600 122.10500 1.000 127.77833 ? 76  GLU D CB    1 
ATOM 2528  C CG    . GLU D 4 77  ? 117.10800 106.71200 121.02200 1.000 127.77833 ? 76  GLU D CG    1 
ATOM 2529  C CD    . GLU D 4 77  ? 117.89200 105.48400 121.35200 1.000 127.77833 ? 76  GLU D CD    1 
ATOM 2530  O OE1   . GLU D 4 77  ? 118.89100 105.60900 122.08800 1.000 127.77833 ? 76  GLU D OE1   1 
ATOM 2531  O OE2   . GLU D 4 77  ? 117.49800 104.39400 120.89200 1.000 127.77833 ? 76  GLU D OE2   1 
ATOM 2532  N N     . ALA D 4 78  ? 117.78900 107.39100 125.21700 1.000 117.90988 ? 77  ALA D N     1 
ATOM 2533  C CA    . ALA D 4 78  ? 118.49900 106.75700 126.32300 1.000 117.90988 ? 77  ALA D CA    1 
ATOM 2534  C C     . ALA D 4 78  ? 117.52800 106.17700 127.33600 1.000 117.90988 ? 77  ALA D C     1 
ATOM 2535  O O     . ALA D 4 78  ? 117.78900 105.11700 127.91500 1.000 117.90988 ? 77  ALA D O     1 
ATOM 2536  C CB    . ALA D 4 78  ? 119.42400 107.76000 127.00000 1.000 117.90988 ? 77  ALA D CB    1 
ATOM 2537  N N     . SER D 4 79  ? 116.40900 106.86700 127.56500 1.000 122.83084 ? 78  SER D N     1 
ATOM 2538  C CA    . SER D 4 79  ? 115.38900 106.35700 128.47300 1.000 122.83084 ? 78  SER D CA    1 
ATOM 2539  C C     . SER D 4 79  ? 114.78100 105.06700 127.94800 1.000 122.83084 ? 78  SER D C     1 
ATOM 2540  O O     . SER D 4 79  ? 114.56900 104.11700 128.71200 1.000 122.83084 ? 78  SER D O     1 
ATOM 2541  C CB    . SER D 4 79  ? 114.30000 107.40300 128.67800 1.000 122.83084 ? 78  SER D CB    1 
ATOM 2542  O OG    . SER D 4 79  ? 113.18100 106.83700 129.33000 1.000 122.83084 ? 78  SER D OG    1 
ATOM 2543  N N     . ARG D 4 80  ? 114.50200 105.01800 126.64300 1.000 126.65381 ? 79  ARG D N     1 
ATOM 2544  C CA    . ARG D 4 80  ? 113.97500 103.80000 126.03700 1.000 126.65381 ? 79  ARG D CA    1 
ATOM 2545  C C     . ARG D 4 80  ? 114.97600 102.65700 126.12200 1.000 126.65381 ? 79  ARG D C     1 
ATOM 2546  O O     . ARG D 4 80  ? 114.59500 101.51400 126.39300 1.000 126.65381 ? 79  ARG D O     1 
ATOM 2547  C CB    . ARG D 4 80  ? 113.58200 104.05400 124.58500 1.000 126.65381 ? 79  ARG D CB    1 
ATOM 2548  C CG    . ARG D 4 80  ? 112.29200 104.82000 124.43000 1.000 126.65381 ? 79  ARG D CG    1 
ATOM 2549  C CD    . ARG D 4 80  ? 111.77400 104.71500 123.01300 1.000 126.65381 ? 79  ARG D CD    1 
ATOM 2550  N NE    . ARG D 4 80  ? 112.73300 105.22800 122.04400 1.000 126.65381 ? 79  ARG D NE    1 
ATOM 2551  C CZ    . ARG D 4 80  ? 112.83400 106.50800 121.70600 1.000 126.65381 ? 79  ARG D CZ    1 
ATOM 2552  N NH1   . ARG D 4 80  ? 112.03400 107.40700 122.26000 1.000 126.65381 ? 79  ARG D NH1   1 
ATOM 2553  N NH2   . ARG D 4 80  ? 113.73200 106.89300 120.81200 1.000 126.65381 ? 79  ARG D NH2   1 
ATOM 2554  N N     . LEU D 4 81  ? 116.25700 102.94500 125.88500 1.000 124.50379 ? 80  LEU D N     1 
ATOM 2555  C CA    . LEU D 4 81  ? 117.28700 101.91400 125.98400 1.000 124.50379 ? 80  LEU D CA    1 
ATOM 2556  C C     . LEU D 4 81  ? 117.43000 101.39100 127.41200 1.000 124.50379 ? 80  LEU D C     1 
ATOM 2557  O O     . LEU D 4 81  ? 117.58800 100.17800 127.63100 1.000 124.50379 ? 80  LEU D O     1 
ATOM 2558  C CB    . LEU D 4 81  ? 118.60700 102.47500 125.46700 1.000 124.50379 ? 80  LEU D CB    1 
ATOM 2559  C CG    . LEU D 4 81  ? 119.74000 101.50300 125.17700 1.000 124.50379 ? 80  LEU D CG    1 
ATOM 2560  C CD1   . LEU D 4 81  ? 120.43600 101.94200 123.91500 1.000 124.50379 ? 80  LEU D CD1   1 
ATOM 2561  C CD2   . LEU D 4 81  ? 120.72700 101.48200 126.32000 1.000 124.50379 ? 80  LEU D CD2   1 
ATOM 2562  N N     . ALA D 4 82  ? 117.35500 102.28900 128.39600 1.000 124.56992 ? 81  ALA D N     1 
ATOM 2563  C CA    . ALA D 4 82  ? 117.47900 101.87500 129.78800 1.000 124.56992 ? 81  ALA D CA    1 
ATOM 2564  C C     . ALA D 4 82  ? 116.27800 101.05200 130.21400 1.000 124.56992 ? 81  ALA D C     1 
ATOM 2565  O O     . ALA D 4 82  ? 116.41600 100.09000 130.97700 1.000 124.56992 ? 81  ALA D O     1 
ATOM 2566  C CB    . ALA D 4 82  ? 117.64000 103.09400 130.68900 1.000 124.56992 ? 81  ALA D CB    1 
ATOM 2567  N N     . HIS D 4 83  ? 115.09100 101.41900 129.73000 1.000 126.32630 ? 82  HIS D N     1 
ATOM 2568  C CA    . HIS D 4 83  ? 113.91100 100.61600 130.01200 1.000 126.32630 ? 82  HIS D CA    1 
ATOM 2569  C C     . HIS D 4 83  ? 113.97200 99.27800  129.28600 1.000 126.32630 ? 82  HIS D C     1 
ATOM 2570  O O     . HIS D 4 83  ? 113.39900 98.29200  129.76100 1.000 126.32630 ? 82  HIS D O     1 
ATOM 2571  C CB    . HIS D 4 83  ? 112.65700 101.39000 129.62300 1.000 126.32630 ? 82  HIS D CB    1 
ATOM 2572  C CG    . HIS D 4 83  ? 111.39500 100.61400 129.80200 1.000 126.32630 ? 82  HIS D CG    1 
ATOM 2573  N ND1   . HIS D 4 83  ? 110.80800 99.90600  128.77700 1.000 126.32630 ? 82  HIS D ND1   1 
ATOM 2574  C CD2   . HIS D 4 83  ? 110.61700 100.41800 130.89000 1.000 126.32630 ? 82  HIS D CD2   1 
ATOM 2575  C CE1   . HIS D 4 83  ? 109.71500 99.31600  129.22400 1.000 126.32630 ? 82  HIS D CE1   1 
ATOM 2576  N NE2   . HIS D 4 83  ? 109.57600 99.61000  130.50300 1.000 126.32630 ? 82  HIS D NE2   1 
ATOM 2577  N N     . TYR D 4 84  ? 114.65000 99.23200  128.13600 1.000 130.62900 ? 83  TYR D N     1 
ATOM 2578  C CA    . TYR D 4 84  ? 114.82800 97.97200  127.42500 1.000 130.62900 ? 83  TYR D CA    1 
ATOM 2579  C C     . TYR D 4 84  ? 115.69900 97.01500  128.21500 1.000 130.62900 ? 83  TYR D C     1 
ATOM 2580  O O     . TYR D 4 84  ? 115.42600 95.81200  128.25900 1.000 130.62900 ? 83  TYR D O     1 
ATOM 2581  C CB    . TYR D 4 84  ? 115.46500 98.20700  126.05800 1.000 130.62900 ? 83  TYR D CB    1 
ATOM 2582  C CG    . TYR D 4 84  ? 114.53400 98.70400  124.99200 1.000 130.62900 ? 83  TYR D CG    1 
ATOM 2583  C CD1   . TYR D 4 84  ? 113.16100 98.64900  125.15900 1.000 130.62900 ? 83  TYR D CD1   1 
ATOM 2584  C CD2   . TYR D 4 84  ? 115.03300 99.21800  123.80700 1.000 130.62900 ? 83  TYR D CD2   1 
ATOM 2585  C CE1   . TYR D 4 84  ? 112.30800 99.10300  124.17700 1.000 130.62900 ? 83  TYR D CE1   1 
ATOM 2586  C CE2   . TYR D 4 84  ? 114.19300 99.67000  122.81900 1.000 130.62900 ? 83  TYR D CE2   1 
ATOM 2587  C CZ    . TYR D 4 84  ? 112.83200 99.61200  123.00900 1.000 130.62900 ? 83  TYR D CZ    1 
ATOM 2588  O OH    . TYR D 4 84  ? 111.99000 100.06600 122.02300 1.000 130.62900 ? 83  TYR D OH    1 
ATOM 2589  N N     . ASN D 4 85  ? 116.74600 97.52700  128.85500 1.000 127.05378 ? 84  ASN D N     1 
ATOM 2590  C CA    . ASN D 4 85  ? 117.68500 96.64900  129.53600 1.000 127.05378 ? 84  ASN D CA    1 
ATOM 2591  C C     . ASN D 4 85  ? 117.40900 96.51300  131.02800 1.000 127.05378 ? 84  ASN D C     1 
ATOM 2592  O O     . ASN D 4 85  ? 118.33100 96.17800  131.78000 1.000 127.05378 ? 84  ASN D O     1 
ATOM 2593  C CB    . ASN D 4 85  ? 119.11200 97.12900  129.29200 1.000 127.05378 ? 84  ASN D CB    1 
ATOM 2594  C CG    . ASN D 4 85  ? 119.63300 96.70000  127.94200 1.000 127.05378 ? 84  ASN D CG    1 
ATOM 2595  O OD1   . ASN D 4 85  ? 120.49300 97.35200  127.35600 1.000 127.05378 ? 84  ASN D OD1   1 
ATOM 2596  N ND2   . ASN D 4 85  ? 119.10900 95.59600  127.43500 1.000 127.05378 ? 84  ASN D ND2   1 
ATOM 2597  N N     . LYS D 4 86  ? 116.16100 96.75800  131.45500 1.000 128.44608 ? 85  LYS D N     1 
ATOM 2598  C CA    . LYS D 4 86  ? 115.70600 96.63000  132.85000 1.000 128.44608 ? 85  LYS D CA    1 
ATOM 2599  C C     . LYS D 4 86  ? 116.53300 97.48600  133.80500 1.000 128.44608 ? 85  LYS D C     1 
ATOM 2600  O O     . LYS D 4 86  ? 116.81400 97.09200  134.93600 1.000 128.44608 ? 85  LYS D O     1 
ATOM 2601  C CB    . LYS D 4 86  ? 115.70200 95.17100  133.31100 1.000 128.44608 ? 85  LYS D CB    1 
ATOM 2602  C CG    . LYS D 4 86  ? 114.98500 94.22200  132.38000 1.000 128.44608 ? 85  LYS D CG    1 
ATOM 2603  C CD    . LYS D 4 86  ? 113.50300 94.51900  132.33500 1.000 128.44608 ? 85  LYS D CD    1 
ATOM 2604  C CE    . LYS D 4 86  ? 112.78200 93.55400  131.41400 1.000 128.44608 ? 85  LYS D CE    1 
ATOM 2605  N NZ    . LYS D 4 86  ? 111.33900 93.88900  131.28400 1.000 128.44608 ? 85  LYS D NZ    1 
ATOM 2606  N N     . ARG D 4 87  ? 116.92400 98.66500  133.34500 1.000 143.73777 ? 86  ARG D N     1 
ATOM 2607  C CA    . ARG D 4 87  ? 117.72900 99.58200  134.12800 1.000 143.73777 ? 86  ARG D CA    1 
ATOM 2608  C C     . ARG D 4 87  ? 116.88400 100.77200 134.54800 1.000 143.73777 ? 86  ARG D C     1 
ATOM 2609  O O     . ARG D 4 87  ? 115.96000 101.17900 133.84100 1.000 143.73777 ? 86  ARG D O     1 
ATOM 2610  C CB    . ARG D 4 87  ? 118.94000 100.07400 133.33600 1.000 143.73777 ? 86  ARG D CB    1 
ATOM 2611  C CG    . ARG D 4 87  ? 119.96300 99.00000  133.02900 1.000 143.73777 ? 86  ARG D CG    1 
ATOM 2612  C CD    . ARG D 4 87  ? 120.41600 98.25800  134.25900 1.000 143.73777 ? 86  ARG D CD    1 
ATOM 2613  N NE    . ARG D 4 87  ? 121.38000 97.22600  133.90000 1.000 143.73777 ? 86  ARG D NE    1 
ATOM 2614  C CZ    . ARG D 4 87  ? 121.85500 96.32400  134.74800 1.000 143.73777 ? 86  ARG D CZ    1 
ATOM 2615  N NH1   . ARG D 4 87  ? 121.45400 96.32600  136.01100 1.000 143.73777 ? 86  ARG D NH1   1 
ATOM 2616  N NH2   . ARG D 4 87  ? 122.73000 95.41800  134.33400 1.000 143.73777 ? 86  ARG D NH2   1 
ATOM 2617  N N     . SER D 4 88  ? 117.20900 101.32600 135.70800 1.000 148.58959 ? 87  SER D N     1 
ATOM 2618  C CA    . SER D 4 88  ? 116.48800 102.46600 136.23900 1.000 148.58959 ? 87  SER D CA    1 
ATOM 2619  C C     . SER D 4 88  ? 117.37700 103.68200 136.42700 1.000 148.58959 ? 87  SER D C     1 
ATOM 2620  O O     . SER D 4 88  ? 116.88100 104.73900 136.82900 1.000 148.58959 ? 87  SER D O     1 
ATOM 2621  C CB    . SER D 4 88  ? 115.82600 102.09600 137.56900 1.000 148.58959 ? 87  SER D CB    1 
ATOM 2622  O OG    . SER D 4 88  ? 116.71000 101.32700 138.36200 1.000 148.58959 ? 87  SER D OG    1 
ATOM 2623  N N     . THR D 4 89  ? 118.66900 103.56700 136.14500 1.000 141.55895 ? 88  THR D N     1 
ATOM 2624  C CA    . THR D 4 89  ? 119.60800 104.66700 136.27600 1.000 141.55895 ? 88  THR D CA    1 
ATOM 2625  C C     . THR D 4 89  ? 120.16100 105.03600 134.91000 1.000 141.55895 ? 88  THR D C     1 
ATOM 2626  O O     . THR D 4 89  ? 120.47100 104.15900 134.10100 1.000 141.55895 ? 88  THR D O     1 
ATOM 2627  C CB    . THR D 4 89  ? 120.77600 104.29100 137.18700 1.000 141.55895 ? 88  THR D CB    1 
ATOM 2628  O OG1   . THR D 4 89  ? 121.47600 103.18000 136.61700 1.000 141.55895 ? 88  THR D OG1   1 
ATOM 2629  C CG2   . THR D 4 89  ? 120.28200 103.88300 138.55700 1.000 141.55895 ? 88  THR D CG2   1 
ATOM 2630  N N     . ILE D 4 90  ? 120.28400 106.33400 134.65200 1.000 131.41327 ? 89  ILE D N     1 
ATOM 2631  C CA    . ILE D 4 90  ? 120.82400 106.78000 133.37700 1.000 131.41327 ? 89  ILE D CA    1 
ATOM 2632  C C     . ILE D 4 90  ? 122.29700 107.07200 133.61600 1.000 131.41327 ? 89  ILE D C     1 
ATOM 2633  O O     . ILE D 4 90  ? 122.68500 108.20900 133.90200 1.000 131.41327 ? 89  ILE D O     1 
ATOM 2634  C CB    . ILE D 4 90  ? 120.07900 108.00500 132.82100 1.000 131.41327 ? 89  ILE D CB    1 
ATOM 2635  C CG1   . ILE D 4 90  ? 118.58900 107.71500 132.76500 1.000 131.41327 ? 89  ILE D CG1   1 
ATOM 2636  C CG2   . ILE D 4 90  ? 120.57900 108.36300 131.43200 1.000 131.41327 ? 89  ILE D CG2   1 
ATOM 2637  C CD1   . ILE D 4 90  ? 118.21000 106.68700 131.73700 1.000 131.41327 ? 89  ILE D CD1   1 
ATOM 2638  N N     . THR D 4 91  ? 123.11700 106.03600 133.54500 1.000 134.95740 ? 90  THR D N     1 
ATOM 2639  C CA    . THR D 4 91  ? 124.55100 106.21000 133.65000 1.000 134.95740 ? 90  THR D CA    1 
ATOM 2640  C C     . THR D 4 91  ? 125.06900 106.68100 132.29300 1.000 134.95740 ? 90  THR D C     1 
ATOM 2641  O O     . THR D 4 91  ? 124.38900 106.54800 131.27200 1.000 134.95740 ? 90  THR D O     1 
ATOM 2642  C CB    . THR D 4 91  ? 125.19300 104.89000 134.10500 1.000 134.95740 ? 90  THR D CB    1 
ATOM 2643  O OG1   . THR D 4 91  ? 124.43000 104.36500 135.19400 1.000 134.95740 ? 90  THR D OG1   1 
ATOM 2644  C CG2   . THR D 4 91  ? 126.61300 105.08200 134.64400 1.000 134.95740 ? 90  THR D CG2   1 
ATOM 2645  N N     . SER D 4 92  ? 126.26100 107.28700 132.30100 1.000 130.46420 ? 91  SER D N     1 
ATOM 2646  C CA    . SER D 4 92  ? 126.89400 107.84500 131.10900 1.000 130.46420 ? 91  SER D CA    1 
ATOM 2647  C C     . SER D 4 92  ? 127.06700 106.84400 129.97100 1.000 130.46420 ? 91  SER D C     1 
ATOM 2648  O O     . SER D 4 92  ? 127.16700 107.26300 128.81300 1.000 130.46420 ? 91  SER D O     1 
ATOM 2649  C CB    . SER D 4 92  ? 128.25600 108.41400 131.48700 1.000 130.46420 ? 91  SER D CB    1 
ATOM 2650  O OG    . SER D 4 92  ? 128.91900 107.54300 132.38300 1.000 130.46420 ? 91  SER D OG    1 
ATOM 2651  N N     . ARG D 4 93  ? 127.12900 105.54300 130.27100 1.000 129.68162 ? 92  ARG D N     1 
ATOM 2652  C CA    . ARG D 4 93  ? 127.20800 104.53600 129.21900 1.000 129.68162 ? 92  ARG D CA    1 
ATOM 2653  C C     . ARG D 4 93  ? 125.95100 104.52100 128.36800 1.000 129.68162 ? 92  ARG D C     1 
ATOM 2654  O O     . ARG D 4 93  ? 126.02400 104.31400 127.14900 1.000 129.68162 ? 92  ARG D O     1 
ATOM 2655  C CB    . ARG D 4 93  ? 127.43200 103.15800 129.82400 1.000 129.68162 ? 92  ARG D CB    1 
ATOM 2656  C CG    . ARG D 4 93  ? 128.75000 102.97300 130.52900 1.000 129.68162 ? 92  ARG D CG    1 
ATOM 2657  C CD    . ARG D 4 93  ? 128.88300 101.55400 131.06100 1.000 129.68162 ? 92  ARG D CD    1 
ATOM 2658  N NE    . ARG D 4 93  ? 128.82100 100.56100 129.98900 1.000 129.68162 ? 92  ARG D NE    1 
ATOM 2659  C CZ    . ARG D 4 93  ? 127.80000 99.73300  129.78400 1.000 129.68162 ? 92  ARG D CZ    1 
ATOM 2660  N NH1   . ARG D 4 93  ? 126.74200 99.77500  130.58200 1.000 129.68162 ? 92  ARG D NH1   1 
ATOM 2661  N NH2   . ARG D 4 93  ? 127.83400 98.87300  128.77700 1.000 129.68162 ? 92  ARG D NH2   1 
ATOM 2662  N N     . GLU D 4 94  ? 124.78900 104.70800 129.00300 1.000 133.61518 ? 93  GLU D N     1 
ATOM 2663  C CA    . GLU D 4 94  ? 123.51300 104.68800 128.29500 1.000 133.61518 ? 93  GLU D CA    1 
ATOM 2664  C C     . GLU D 4 94  ? 123.44200 105.78400 127.24600 1.000 133.61518 ? 93  GLU D C     1 
ATOM 2665  O O     . GLU D 4 94  ? 123.13200 105.51900 126.08100 1.000 133.61518 ? 93  GLU D O     1 
ATOM 2666  C CB    . GLU D 4 94  ? 122.35800 104.82900 129.28100 1.000 133.61518 ? 93  GLU D CB    1 
ATOM 2667  C CG    . GLU D 4 94  ? 121.83900 103.51900 129.81600 1.000 133.61518 ? 93  GLU D CG    1 
ATOM 2668  C CD    . GLU D 4 94  ? 122.72100 102.95600 130.89800 1.000 133.61518 ? 93  GLU D CD    1 
ATOM 2669  O OE1   . GLU D 4 94  ? 123.48300 103.73800 131.50300 1.000 133.61518 ? 93  GLU D OE1   1 
ATOM 2670  O OE2   . GLU D 4 94  ? 122.65000 101.73500 131.14700 1.000 133.61518 ? 93  GLU D OE2   1 
ATOM 2671  N N     . ILE D 4 95  ? 123.72500 107.02600 127.64200 1.000 121.62467 ? 94  ILE D N     1 
ATOM 2672  C CA    . ILE D 4 95  ? 123.67300 108.11700 126.67900 1.000 121.62467 ? 94  ILE D CA    1 
ATOM 2673  C C     . ILE D 4 95  ? 124.81500 108.02300 125.68000 1.000 121.62467 ? 94  ILE D C     1 
ATOM 2674  O O     . ILE D 4 95  ? 124.70300 108.55000 124.57100 1.000 121.62467 ? 94  ILE D O     1 
ATOM 2675  C CB    . ILE D 4 95  ? 123.65200 109.48000 127.38400 1.000 121.62467 ? 94  ILE D CB    1 
ATOM 2676  C CG1   . ILE D 4 95  ? 124.88200 109.66300 128.24500 1.000 121.62467 ? 94  ILE D CG1   1 
ATOM 2677  C CG2   . ILE D 4 95  ? 122.42300 109.61500 128.24300 1.000 121.62467 ? 94  ILE D CG2   1 
ATOM 2678  C CD1   . ILE D 4 95  ? 125.02900 111.05900 128.65200 1.000 121.62467 ? 94  ILE D CD1   1 
ATOM 2679  N N     . GLN D 4 96  ? 125.92700 107.38100 126.04900 1.000 121.98443 ? 95  GLN D N     1 
ATOM 2680  C CA    . GLN D 4 96  ? 126.99300 107.13300 125.08200 1.000 121.98443 ? 95  GLN D CA    1 
ATOM 2681  C C     . GLN D 4 96  ? 126.50400 106.22800 123.96100 1.000 121.98443 ? 95  GLN D C     1 
ATOM 2682  O O     . GLN D 4 96  ? 126.68600 106.53400 122.77600 1.000 121.98443 ? 95  GLN D O     1 
ATOM 2683  C CB    . GLN D 4 96  ? 128.21500 106.53300 125.76800 1.000 121.98443 ? 95  GLN D CB    1 
ATOM 2684  C CG    . GLN D 4 96  ? 129.16100 105.84000 124.81200 1.000 121.98443 ? 95  GLN D CG    1 
ATOM 2685  C CD    . GLN D 4 96  ? 130.54800 105.70100 125.37800 1.000 121.98443 ? 95  GLN D CD    1 
ATOM 2686  O OE1   . GLN D 4 96  ? 131.02200 106.57200 126.10500 1.000 121.98443 ? 95  GLN D OE1   1 
ATOM 2687  N NE2   . GLN D 4 96  ? 131.21200 104.60100 125.05200 1.000 121.98443 ? 95  GLN D NE2   1 
ATOM 2688  N N     . THR D 4 97  ? 125.88100 105.10400 124.32200 1.000 126.92973 ? 96  THR D N     1 
ATOM 2689  C CA    . THR D 4 97  ? 125.29000 104.23200 123.31300 1.000 126.92973 ? 96  THR D CA    1 
ATOM 2690  C C     . THR D 4 97  ? 124.17100 104.93500 122.55900 1.000 126.92973 ? 96  THR D C     1 
ATOM 2691  O O     . THR D 4 97  ? 123.99900 104.71200 121.35700 1.000 126.92973 ? 96  THR D O     1 
ATOM 2692  C CB    . THR D 4 97  ? 124.75700 102.95900 123.96000 1.000 126.92973 ? 96  THR D CB    1 
ATOM 2693  O OG1   . THR D 4 97  ? 123.88100 103.31100 125.03500 1.000 126.92973 ? 96  THR D OG1   1 
ATOM 2694  C CG2   . THR D 4 97  ? 125.89900 102.12500 124.50300 1.000 126.92973 ? 96  THR D CG2   1 
ATOM 2695  N N     . ALA D 4 98  ? 123.41800 105.79300 123.24900 1.000 124.27169 ? 97  ALA D N     1 
ATOM 2696  C CA    . ALA D 4 98  ? 122.33500 106.54200 122.62100 1.000 124.27169 ? 97  ALA D CA    1 
ATOM 2697  C C     . ALA D 4 98  ? 122.85100 107.49200 121.55000 1.000 124.27169 ? 97  ALA D C     1 
ATOM 2698  O O     . ALA D 4 98  ? 122.30100 107.55300 120.44900 1.000 124.27169 ? 97  ALA D O     1 
ATOM 2699  C CB    . ALA D 4 98  ? 121.55000 107.30900 123.68100 1.000 124.27169 ? 97  ALA D CB    1 
ATOM 2700  N N     . VAL D 4 99  ? 123.89800 108.25600 121.86200 1.000 123.57132 ? 98  VAL D N     1 
ATOM 2701  C CA    . VAL D 4 99  ? 124.42300 109.20100 120.88500 1.000 123.57132 ? 98  VAL D CA    1 
ATOM 2702  C C     . VAL D 4 99  ? 125.15500 108.45800 119.77200 1.000 123.57132 ? 98  VAL D C     1 
ATOM 2703  O O     . VAL D 4 99  ? 125.11400 108.87700 118.60600 1.000 123.57132 ? 98  VAL D O     1 
ATOM 2704  C CB    . VAL D 4 99  ? 125.29000 110.27500 121.58200 1.000 123.57132 ? 98  VAL D CB    1 
ATOM 2705  C CG1   . VAL D 4 99  ? 126.58700 109.73000 122.14100 1.000 123.57132 ? 98  VAL D CG1   1 
ATOM 2706  C CG2   . VAL D 4 99  ? 125.57600 111.42000 120.65400 1.000 123.57132 ? 98  VAL D CG2   1 
ATOM 2707  N N     . ARG D 4 100 ? 125.76800 107.31400 120.09700 1.000 129.38334 ? 99  ARG D N     1 
ATOM 2708  C CA    . ARG D 4 100 ? 126.41800 106.47200 119.10300 1.000 129.38334 ? 99  ARG D CA    1 
ATOM 2709  C C     . ARG D 4 100 ? 125.40600 105.87300 118.13900 1.000 129.38334 ? 99  ARG D C     1 
ATOM 2710  O O     . ARG D 4 100 ? 125.71300 105.66100 116.96100 1.000 129.38334 ? 99  ARG D O     1 
ATOM 2711  C CB    . ARG D 4 100 ? 127.19700 105.38500 119.83500 1.000 129.38334 ? 99  ARG D CB    1 
ATOM 2712  C CG    . ARG D 4 100 ? 128.03000 104.46500 118.99600 1.000 129.38334 ? 99  ARG D CG    1 
ATOM 2713  C CD    . ARG D 4 100 ? 128.38700 103.25500 119.82700 1.000 129.38334 ? 99  ARG D CD    1 
ATOM 2714  N NE    . ARG D 4 100 ? 129.52800 102.53300 119.28900 1.000 129.38334 ? 99  ARG D NE    1 
ATOM 2715  C CZ    . ARG D 4 100 ? 130.78300 102.79700 119.62900 1.000 129.38334 ? 99  ARG D CZ    1 
ATOM 2716  N NH1   . ARG D 4 100 ? 131.04000 103.76200 120.50100 1.000 129.38334 ? 99  ARG D NH1   1 
ATOM 2717  N NH2   . ARG D 4 100 ? 131.77900 102.10200 119.10100 1.000 129.38334 ? 99  ARG D NH2   1 
ATOM 2718  N N     . LEU D 4 101 ? 124.20200 105.59700 118.62500 1.000 125.02648 ? 100 LEU D N     1 
ATOM 2719  C CA    . LEU D 4 101 ? 123.13900 105.06100 117.79100 1.000 125.02648 ? 100 LEU D CA    1 
ATOM 2720  C C     . LEU D 4 101 ? 122.42000 106.15200 117.00500 1.000 125.02648 ? 100 LEU D C     1 
ATOM 2721  O O     . LEU D 4 101 ? 122.05700 105.94700 115.84300 1.000 125.02648 ? 100 LEU D O     1 
ATOM 2722  C CB    . LEU D 4 101 ? 122.16200 104.29900 118.68200 1.000 125.02648 ? 100 LEU D CB    1 
ATOM 2723  C CG    . LEU D 4 101 ? 120.80500 103.84800 118.16500 1.000 125.02648 ? 100 LEU D CG    1 
ATOM 2724  C CD1   . LEU D 4 101 ? 120.97800 102.97000 116.96500 1.000 125.02648 ? 100 LEU D CD1   1 
ATOM 2725  C CD2   . LEU D 4 101 ? 120.09500 103.08800 119.26000 1.000 125.02648 ? 100 LEU D CD2   1 
ATOM 2726  N N     . LEU D 4 102 ? 122.21200 107.31400 117.61700 1.000 128.49676 ? 101 LEU D N     1 
ATOM 2727  C CA    . LEU D 4 102 ? 121.44700 108.38300 116.98600 1.000 128.49676 ? 101 LEU D CA    1 
ATOM 2728  C C     . LEU D 4 102 ? 122.25300 109.12300 115.92700 1.000 128.49676 ? 101 LEU D C     1 
ATOM 2729  O O     . LEU D 4 102 ? 121.81000 109.26200 114.78400 1.000 128.49676 ? 101 LEU D O     1 
ATOM 2730  C CB    . LEU D 4 102 ? 120.95000 109.35700 118.05200 1.000 128.49676 ? 101 LEU D CB    1 
ATOM 2731  C CG    . LEU D 4 102 ? 119.87900 110.34300 117.60000 1.000 128.49676 ? 101 LEU D CG    1 
ATOM 2732  C CD1   . LEU D 4 102 ? 118.75100 110.37500 118.60600 1.000 128.49676 ? 101 LEU D CD1   1 
ATOM 2733  C CD2   . LEU D 4 102 ? 120.47500 111.72900 117.43500 1.000 128.49676 ? 101 LEU D CD2   1 
ATOM 2734  N N     . LEU D 4 103 ? 123.42200 109.63500 116.30500 1.000 132.09916 ? 102 LEU D N     1 
ATOM 2735  C CA    . LEU D 4 103 ? 124.23400 110.43100 115.40400 1.000 132.09916 ? 102 LEU D CA    1 
ATOM 2736  C C     . LEU D 4 103 ? 124.79600 109.58700 114.26400 1.000 132.09916 ? 102 LEU D C     1 
ATOM 2737  O O     . LEU D 4 103 ? 124.87500 108.36200 114.37400 1.000 132.09916 ? 102 LEU D O     1 
ATOM 2738  C CB    . LEU D 4 103 ? 125.38000 111.07000 116.18300 1.000 132.09916 ? 102 LEU D CB    1 
ATOM 2739  C CG    . LEU D 4 103 ? 125.04200 112.25700 117.07600 1.000 132.09916 ? 102 LEU D CG    1 
ATOM 2740  C CD1   . LEU D 4 103 ? 126.29100 113.06900 117.31800 1.000 132.09916 ? 102 LEU D CD1   1 
ATOM 2741  C CD2   . LEU D 4 103 ? 123.96300 113.12600 116.47800 1.000 132.09916 ? 102 LEU D CD2   1 
ATOM 2742  N N     . PRO D 4 104 ? 125.16400 110.22200 113.12600 1.000 146.83351 ? 103 PRO D N     1 
ATOM 2743  C CA    . PRO D 4 104 ? 125.83700 109.47600 112.05000 1.000 146.83351 ? 103 PRO D CA    1 
ATOM 2744  C C     . PRO D 4 104 ? 127.20700 108.93100 112.44200 1.000 146.83351 ? 103 PRO D C     1 
ATOM 2745  O O     . PRO D 4 104 ? 127.68200 109.15000 113.56100 1.000 146.83351 ? 103 PRO D O     1 
ATOM 2746  C CB    . PRO D 4 104 ? 125.93900 110.50300 110.91600 1.000 146.83351 ? 103 PRO D CB    1 
ATOM 2747  C CG    . PRO D 4 104 ? 125.71700 111.81800 111.54900 1.000 146.83351 ? 103 PRO D CG    1 
ATOM 2748  C CD    . PRO D 4 104 ? 124.79000 111.57500 112.68600 1.000 146.83351 ? 103 PRO D CD    1 
ATOM 2749  N N     . GLY D 4 105 ? 127.86000 108.24500 111.50200 1.000 152.11453 ? 104 GLY D N     1 
ATOM 2750  C CA    . GLY D 4 105 ? 129.07400 107.50800 111.83100 1.000 152.11453 ? 104 GLY D CA    1 
ATOM 2751  C C     . GLY D 4 105 ? 130.26100 108.37000 112.22200 1.000 152.11453 ? 104 GLY D C     1 
ATOM 2752  O O     . GLY D 4 105 ? 130.91100 108.11200 113.23800 1.000 152.11453 ? 104 GLY D O     1 
ATOM 2753  N N     . GLU D 4 106 ? 130.57300 109.38700 111.41800 1.000 148.57587 ? 105 GLU D N     1 
ATOM 2754  C CA    . GLU D 4 106 ? 131.78500 110.16700 111.65700 1.000 148.57587 ? 105 GLU D CA    1 
ATOM 2755  C C     . GLU D 4 106 ? 131.67500 111.01900 112.91700 1.000 148.57587 ? 105 GLU D C     1 
ATOM 2756  O O     . GLU D 4 106 ? 132.59600 111.02600 113.74500 1.000 148.57587 ? 105 GLU D O     1 
ATOM 2757  C CB    . GLU D 4 106 ? 132.10900 111.02400 110.43400 1.000 148.57587 ? 105 GLU D CB    1 
ATOM 2758  C CG    . GLU D 4 106 ? 132.92800 112.26600 110.72500 1.000 148.57587 ? 105 GLU D CG    1 
ATOM 2759  C CD    . GLU D 4 106 ? 134.35900 111.94800 111.10200 1.000 148.57587 ? 105 GLU D CD    1 
ATOM 2760  O OE1   . GLU D 4 106 ? 134.86500 110.87400 110.71200 1.000 148.57587 ? 105 GLU D OE1   1 
ATOM 2761  O OE2   . GLU D 4 106 ? 134.97800 112.77400 111.80100 1.000 148.57587 ? 105 GLU D OE2   1 
ATOM 2762  N N     . LEU D 4 107 ? 130.55700 111.74700 113.06500 1.000 139.54252 ? 106 LEU D N     1 
ATOM 2763  C CA    . LEU D 4 107 ? 130.35100 112.64800 114.20000 1.000 139.54252 ? 106 LEU D CA    1 
ATOM 2764  C C     . LEU D 4 107 ? 130.43900 111.91800 115.53000 1.000 139.54252 ? 106 LEU D C     1 
ATOM 2765  O O     . LEU D 4 107 ? 131.03800 112.43200 116.48600 1.000 139.54252 ? 106 LEU D O     1 
ATOM 2766  C CB    . LEU D 4 107 ? 128.99700 113.34000 114.08500 1.000 139.54252 ? 106 LEU D CB    1 
ATOM 2767  C CG    . LEU D 4 107 ? 128.91300 114.58600 113.21400 1.000 139.54252 ? 106 LEU D CG    1 
ATOM 2768  C CD1   . LEU D 4 107 ? 127.56000 115.24500 113.38600 1.000 139.54252 ? 106 LEU D CD1   1 
ATOM 2769  C CD2   . LEU D 4 107 ? 130.02500 115.54800 113.57600 1.000 139.54252 ? 106 LEU D CD2   1 
ATOM 2770  N N     . ALA D 4 108 ? 129.85400 110.71700 115.59800 1.000 143.66353 ? 107 ALA D N     1 
ATOM 2771  C CA    . ALA D 4 108 ? 129.93000 109.89300 116.79900 1.000 143.66353 ? 107 ALA D CA    1 
ATOM 2772  C C     . ALA D 4 108 ? 131.37200 109.58100 117.16700 1.000 143.66353 ? 107 ALA D C     1 
ATOM 2773  O O     . ALA D 4 108 ? 131.72700 109.59600 118.35200 1.000 143.66353 ? 107 ALA D O     1 
ATOM 2774  C CB    . ALA D 4 108 ? 129.13800 108.60300 116.59900 1.000 143.66353 ? 107 ALA D CB    1 
ATOM 2775  N N     . LYS D 4 109 ? 132.22700 109.36600 116.15200 1.000 145.50821 ? 108 LYS D N     1 
ATOM 2776  C CA    . LYS D 4 109 ? 133.65500 109.13100 116.36600 1.000 145.50821 ? 108 LYS D CA    1 
ATOM 2777  C C     . LYS D 4 109 ? 134.31800 110.27800 117.11100 1.000 145.50821 ? 108 LYS D C     1 
ATOM 2778  O O     . LYS D 4 109 ? 135.28800 110.06100 117.84500 1.000 145.50821 ? 108 LYS D O     1 
ATOM 2779  C CB    . LYS D 4 109 ? 134.35900 108.91000 115.03200 1.000 145.50821 ? 108 LYS D CB    1 
ATOM 2780  C CG    . LYS D 4 109 ? 134.01900 107.59500 114.36000 1.000 145.50821 ? 108 LYS D CG    1 
ATOM 2781  C CD    . LYS D 4 109 ? 135.20200 107.03100 113.58200 1.000 145.50821 ? 108 LYS D CD    1 
ATOM 2782  C CE    . LYS D 4 109 ? 135.85400 108.08000 112.68900 1.000 145.50821 ? 108 LYS D CE    1 
ATOM 2783  N NZ    . LYS D 4 109 ? 134.97900 108.47200 111.55000 1.000 145.50821 ? 108 LYS D NZ    1 
ATOM 2784  N N     . HIS D 4 110 ? 133.81900 111.49600 116.93700 1.000 137.33583 ? 109 HIS D N     1 
ATOM 2785  C CA    . HIS D 4 110 ? 134.29600 112.59600 117.75200 1.000 137.33583 ? 109 HIS D CA    1 
ATOM 2786  C C     . HIS D 4 110 ? 133.48000 112.77900 119.01700 1.000 137.33583 ? 109 HIS D C     1 
ATOM 2787  O O     . HIS D 4 110 ? 134.04300 113.17400 120.04600 1.000 137.33583 ? 109 HIS D O     1 
ATOM 2788  C CB    . HIS D 4 110 ? 134.29100 113.88500 116.94200 1.000 137.33583 ? 109 HIS D CB    1 
ATOM 2789  C CG    . HIS D 4 110 ? 135.30200 113.89100 115.84600 1.000 137.33583 ? 109 HIS D CG    1 
ATOM 2790  N ND1   . HIS D 4 110 ? 135.26400 114.78800 114.80100 1.000 137.33583 ? 109 HIS D ND1   1 
ATOM 2791  C CD2   . HIS D 4 110 ? 136.37700 113.10000 115.62700 1.000 137.33583 ? 109 HIS D CD2   1 
ATOM 2792  C CE1   . HIS D 4 110 ? 136.28100 114.55500 113.99100 1.000 137.33583 ? 109 HIS D CE1   1 
ATOM 2793  N NE2   . HIS D 4 110 ? 136.96900 113.53300 114.46800 1.000 137.33583 ? 109 HIS D NE2   1 
ATOM 2794  N N     . ALA D 4 111 ? 132.17500 112.48000 118.95100 1.000 130.74312 ? 110 ALA D N     1 
ATOM 2795  C CA    . ALA D 4 111 ? 131.27900 112.68400 120.08700 1.000 130.74312 ? 110 ALA D CA    1 
ATOM 2796  C C     . ALA D 4 111 ? 131.70200 111.86000 121.29200 1.000 130.74312 ? 110 ALA D C     1 
ATOM 2797  O O     . ALA D 4 111 ? 131.88900 112.39900 122.38900 1.000 130.74312 ? 110 ALA D O     1 
ATOM 2798  C CB    . ALA D 4 111 ? 129.84700 112.34600 119.68400 1.000 130.74312 ? 110 ALA D CB    1 
ATOM 2799  N N     . VAL D 4 112 ? 131.89000 110.55300 121.09600 1.000 131.95511 ? 111 VAL D N     1 
ATOM 2800  C CA    . VAL D 4 112 ? 132.41900 109.69200 122.15000 1.000 131.95511 ? 111 VAL D CA    1 
ATOM 2801  C C     . VAL D 4 112 ? 133.84200 110.09700 122.51500 1.000 131.95511 ? 111 VAL D C     1 
ATOM 2802  O O     . VAL D 4 112 ? 134.27800 109.91000 123.65700 1.000 131.95511 ? 111 VAL D O     1 
ATOM 2803  C CB    . VAL D 4 112 ? 132.32700 108.21700 121.71600 1.000 131.95511 ? 111 VAL D CB    1 
ATOM 2804  C CG1   . VAL D 4 112 ? 132.53400 107.28700 122.89400 1.000 131.95511 ? 111 VAL D CG1   1 
ATOM 2805  C CG2   . VAL D 4 112 ? 130.97400 107.95000 121.09700 1.000 131.95511 ? 111 VAL D CG2   1 
ATOM 2806  N N     . SER D 4 113 ? 134.56600 110.71700 121.58600 1.000 138.37070 ? 112 SER D N     1 
ATOM 2807  C CA    . SER D 4 113 ? 135.89200 111.20000 121.92100 1.000 138.37070 ? 112 SER D CA    1 
ATOM 2808  C C     . SER D 4 113 ? 135.84400 112.52100 122.66100 1.000 138.37070 ? 112 SER D C     1 
ATOM 2809  O O     . SER D 4 113 ? 136.85900 112.93200 123.23000 1.000 138.37070 ? 112 SER D O     1 
ATOM 2810  C CB    . SER D 4 113 ? 136.73000 111.36500 120.65900 1.000 138.37070 ? 112 SER D CB    1 
ATOM 2811  O OG    . SER D 4 113 ? 136.65400 112.70000 120.19600 1.000 138.37070 ? 112 SER D OG    1 
ATOM 2812  N N     . GLU D 4 114 ? 134.69600 113.19000 122.67000 1.000 131.99411 ? 113 GLU D N     1 
ATOM 2813  C CA    . GLU D 4 114 ? 134.57000 114.46600 123.35300 1.000 131.99411 ? 113 GLU D CA    1 
ATOM 2814  C C     . GLU D 4 114 ? 133.90000 114.35300 124.70800 1.000 131.99411 ? 113 GLU D C     1 
ATOM 2815  O O     . GLU D 4 114 ? 134.18400 115.16000 125.59600 1.000 131.99411 ? 113 GLU D O     1 
ATOM 2816  C CB    . GLU D 4 114 ? 133.78500 115.45400 122.48900 1.000 131.99411 ? 113 GLU D CB    1 
ATOM 2817  C CG    . GLU D 4 114 ? 134.67200 116.33800 121.64600 1.000 131.99411 ? 113 GLU D CG    1 
ATOM 2818  C CD    . GLU D 4 114 ? 135.56900 117.21200 122.48800 1.000 131.99411 ? 113 GLU D CD    1 
ATOM 2819  O OE1   . GLU D 4 114 ? 135.08700 117.75800 123.50200 1.000 131.99411 ? 113 GLU D OE1   1 
ATOM 2820  O OE2   . GLU D 4 114 ? 136.76000 117.34400 122.14300 1.000 131.99411 ? 113 GLU D OE2   1 
ATOM 2821  N N     . GLY D 4 115 ? 133.02700 113.36400 124.88700 1.000 124.76633 ? 114 GLY D N     1 
ATOM 2822  C CA    . GLY D 4 115 ? 132.34600 113.21800 126.16000 1.000 124.76633 ? 114 GLY D CA    1 
ATOM 2823  C C     . GLY D 4 115 ? 133.24600 112.65700 127.24100 1.000 124.76633 ? 114 GLY D C     1 
ATOM 2824  O O     . GLY D 4 115 ? 133.35100 113.23000 128.33000 1.000 124.76633 ? 114 GLY D O     1 
ATOM 2825  N N     . THR D 4 116 ? 133.90000 111.52700 126.94900 1.000 126.40038 ? 115 THR D N     1 
ATOM 2826  C CA    . THR D 4 116 ? 134.78600 110.87200 127.90800 1.000 126.40038 ? 115 THR D CA    1 
ATOM 2827  C C     . THR D 4 116 ? 135.92500 111.77900 128.34000 1.000 126.40038 ? 115 THR D C     1 
ATOM 2828  O O     . THR D 4 116 ? 136.28900 111.80000 129.52300 1.000 126.40038 ? 115 THR D O     1 
ATOM 2829  C CB    . THR D 4 116 ? 135.34800 109.59000 127.30600 1.000 126.40038 ? 115 THR D CB    1 
ATOM 2830  O OG1   . THR D 4 116 ? 136.22500 109.92600 126.22700 1.000 126.40038 ? 115 THR D OG1   1 
ATOM 2831  C CG2   . THR D 4 116 ? 134.22900 108.72100 126.78500 1.000 126.40038 ? 115 THR D CG2   1 
ATOM 2832  N N     . LYS D 4 117 ? 136.48500 112.54500 127.39300 1.000 125.94185 ? 116 LYS D N     1 
ATOM 2833  C CA    . LYS D 4 117 ? 137.53000 113.51800 127.70100 1.000 125.94185 ? 116 LYS D CA    1 
ATOM 2834  C C     . LYS D 4 117 ? 137.05900 114.54900 128.71700 1.000 125.94185 ? 116 LYS D C     1 
ATOM 2835  O O     . LYS D 4 117 ? 137.86000 115.05000 129.51300 1.000 125.94185 ? 116 LYS D O     1 
ATOM 2836  C CB    . LYS D 4 117 ? 138.00700 114.20600 126.42500 1.000 125.94185 ? 116 LYS D CB    1 
ATOM 2837  C CG    . LYS D 4 117 ? 139.35300 114.90200 126.57600 1.000 125.94185 ? 116 LYS D CG    1 
ATOM 2838  C CD    . LYS D 4 117 ? 139.62500 115.88100 125.44900 1.000 125.94185 ? 116 LYS D CD    1 
ATOM 2839  C CE    . LYS D 4 117 ? 138.58200 116.97600 125.40200 1.000 125.94185 ? 116 LYS D CE    1 
ATOM 2840  N NZ    . LYS D 4 117 ? 138.55000 117.74100 126.67600 1.000 125.94185 ? 116 LYS D NZ    1 
ATOM 2841  N N     . ALA D 4 118 ? 135.76300 114.85700 128.72600 1.000 127.47338 ? 117 ALA D N     1 
ATOM 2842  C CA    . ALA D 4 118 ? 135.23200 115.70600 129.77900 1.000 127.47338 ? 117 ALA D CA    1 
ATOM 2843  C C     . ALA D 4 118 ? 135.03800 114.92300 131.07000 1.000 127.47338 ? 117 ALA D C     1 
ATOM 2844  O O     . ALA D 4 118 ? 135.35900 115.42900 132.15200 1.000 127.47338 ? 117 ALA D O     1 
ATOM 2845  C CB    . ALA D 4 118 ? 133.91300 116.33100 129.33400 1.000 127.47338 ? 117 ALA D CB    1 
ATOM 2846  N N     . VAL D 4 119 ? 134.53100 113.68600 130.96000 1.000 128.46038 ? 118 VAL D N     1 
ATOM 2847  C CA    . VAL D 4 119 ? 134.27300 112.84600 132.13100 1.000 128.46038 ? 118 VAL D CA    1 
ATOM 2848  C C     . VAL D 4 119 ? 135.56300 112.56200 132.88300 1.000 128.46038 ? 118 VAL D C     1 
ATOM 2849  O O     . VAL D 4 119 ? 135.63600 112.72300 134.10900 1.000 128.46038 ? 118 VAL D O     1 
ATOM 2850  C CB    . VAL D 4 119 ? 133.56900 111.54600 131.71000 1.000 128.46038 ? 118 VAL D CB    1 
ATOM 2851  C CG1   . VAL D 4 119 ? 133.43300 110.61000 132.88900 1.000 128.46038 ? 118 VAL D CG1   1 
ATOM 2852  C CG2   . VAL D 4 119 ? 132.20700 111.86100 131.14700 1.000 128.46038 ? 118 VAL D CG2   1 
ATOM 2853  N N     . THR D 4 120 ? 136.60900 112.16600 132.14800 1.000 133.41916 ? 119 THR D N     1 
ATOM 2854  C CA    . THR D 4 120 ? 137.93600 111.97100 132.72800 1.000 133.41916 ? 119 THR D CA    1 
ATOM 2855  C C     . THR D 4 120 ? 138.48300 113.24800 133.35200 1.000 133.41916 ? 119 THR D C     1 
ATOM 2856  O O     . THR D 4 120 ? 139.30600 113.18600 134.27100 1.000 133.41916 ? 119 THR D O     1 
ATOM 2857  C CB    . THR D 4 120 ? 138.90300 111.46700 131.66400 1.000 133.41916 ? 119 THR D CB    1 
ATOM 2858  O OG1   . THR D 4 120 ? 138.79500 112.29400 130.50200 1.000 133.41916 ? 119 THR D OG1   1 
ATOM 2859  C CG2   . THR D 4 120 ? 138.57500 110.03600 131.29100 1.000 133.41916 ? 119 THR D CG2   1 
ATOM 2860  N N     . LYS D 4 121 ? 138.03100 114.41000 132.88400 1.000 134.25695 ? 120 LYS D N     1 
ATOM 2861  C CA    . LYS D 4 121 ? 138.40600 115.64100 133.55700 1.000 134.25695 ? 120 LYS D CA    1 
ATOM 2862  C C     . LYS D 4 121 ? 137.54000 115.86700 134.78400 1.000 134.25695 ? 120 LYS D C     1 
ATOM 2863  O O     . LYS D 4 121 ? 138.03500 116.33900 135.81200 1.000 134.25695 ? 120 LYS D O     1 
ATOM 2864  C CB    . LYS D 4 121 ? 138.28900 116.82100 132.60000 1.000 134.25695 ? 120 LYS D CB    1 
ATOM 2865  C CG    . LYS D 4 121 ? 139.07600 118.03500 133.03300 1.000 134.25695 ? 120 LYS D CG    1 
ATOM 2866  C CD    . LYS D 4 121 ? 139.34400 118.94800 131.85900 1.000 134.25695 ? 120 LYS D CD    1 
ATOM 2867  C CE    . LYS D 4 121 ? 140.17000 120.14700 132.27700 1.000 134.25695 ? 120 LYS D CE    1 
ATOM 2868  N NZ    . LYS D 4 121 ? 140.49700 121.01400 131.11400 1.000 134.25695 ? 120 LYS D NZ    1 
ATOM 2869  N N     . TYR D 4 122 ? 136.24700 115.53800 134.68400 1.000 136.85606 ? 121 TYR D N     1 
ATOM 2870  C CA    . TYR D 4 122 ? 135.33500 115.72200 135.80800 1.000 136.85606 ? 121 TYR D CA    1 
ATOM 2871  C C     . TYR D 4 122 ? 135.69900 114.83300 136.98700 1.000 136.85606 ? 121 TYR D C     1 
ATOM 2872  O O     . TYR D 4 122 ? 135.51300 115.22600 138.14300 1.000 136.85606 ? 121 TYR D O     1 
ATOM 2873  C CB    . TYR D 4 122 ? 133.90000 115.45500 135.36700 1.000 136.85606 ? 121 TYR D CB    1 
ATOM 2874  C CG    . TYR D 4 122 ? 132.91700 115.54200 136.50000 1.000 136.85606 ? 121 TYR D CG    1 
ATOM 2875  C CD1   . TYR D 4 122 ? 132.73500 116.72800 137.18900 1.000 136.85606 ? 121 TYR D CD1   1 
ATOM 2876  C CD2   . TYR D 4 122 ? 132.18800 114.43400 136.89300 1.000 136.85606 ? 121 TYR D CD2   1 
ATOM 2877  C CE1   . TYR D 4 122 ? 131.84500 116.81100 138.23300 1.000 136.85606 ? 121 TYR D CE1   1 
ATOM 2878  C CE2   . TYR D 4 122 ? 131.29300 114.50700 137.93300 1.000 136.85606 ? 121 TYR D CE2   1 
ATOM 2879  C CZ    . TYR D 4 122 ? 131.12700 115.69700 138.59900 1.000 136.85606 ? 121 TYR D CZ    1 
ATOM 2880  O OH    . TYR D 4 122 ? 130.23600 115.77600 139.64000 1.000 136.85606 ? 121 TYR D OH    1 
ATOM 2881  N N     . THR D 4 123 ? 136.24600 113.65600 136.72200 1.000 138.25947 ? 122 THR D N     1 
ATOM 2882  C CA    . THR D 4 123 ? 136.72200 112.79600 137.79200 1.000 138.25947 ? 122 THR D CA    1 
ATOM 2883  C C     . THR D 4 123 ? 138.10100 113.19500 138.29100 1.000 138.25947 ? 122 THR D C     1 
ATOM 2884  O O     . THR D 4 123 ? 138.64000 112.52000 139.17200 1.000 138.25947 ? 122 THR D O     1 
ATOM 2885  C CB    . THR D 4 123 ? 136.75100 111.34500 137.32300 1.000 138.25947 ? 122 THR D CB    1 
ATOM 2886  O OG1   . THR D 4 123 ? 137.46400 111.26600 136.08400 1.000 138.25947 ? 122 THR D OG1   1 
ATOM 2887  C CG2   . THR D 4 123 ? 135.33800 110.83400 137.12100 1.000 138.25947 ? 122 THR D CG2   1 
ATOM 2888  N N     . SER D 4 124 ? 138.68600 114.26800 137.75400 1.000 141.44972 ? 123 SER D N     1 
ATOM 2889  C CA    . SER D 4 124 ? 140.00100 114.70100 138.20000 1.000 141.44972 ? 123 SER D CA    1 
ATOM 2890  C C     . SER D 4 124 ? 139.97100 115.37300 139.56400 1.000 141.44972 ? 123 SER D C     1 
ATOM 2891  O O     . SER D 4 124 ? 141.03400 115.55300 140.16500 1.000 141.44972 ? 123 SER D O     1 
ATOM 2892  C CB    . SER D 4 124 ? 140.60900 115.65900 137.17900 1.000 141.44972 ? 123 SER D CB    1 
ATOM 2893  O OG    . SER D 4 124 ? 139.86500 116.86100 137.11700 1.000 141.44972 ? 123 SER D OG    1 
ATOM 2894  N N     . SER D 4 125 ? 138.79800 115.74400 140.06400 1.000 140.84461 ? 124 SER D N     1 
ATOM 2895  C CA    . SER D 4 125 ? 138.70400 116.37300 141.37200 1.000 140.84461 ? 124 SER D CA    1 
ATOM 2896  C C     . SER D 4 125 ? 138.75600 115.31900 142.46900 1.000 140.84461 ? 124 SER D C     1 
ATOM 2897  O O     . SER D 4 125 ? 138.20100 114.23100 142.32100 1.000 140.84461 ? 124 SER D O     1 
ATOM 2898  C CB    . SER D 4 125 ? 137.42300 117.19400 141.48700 1.000 140.84461 ? 124 SER D CB    1 
ATOM 2899  O OG    . SER D 4 125 ? 136.28500 116.39900 141.21500 1.000 140.84461 ? 124 SER D OG    1 
ATOM 2900  N N     . ARG E 1 42  ? 114.10300 143.84400 74.17500  1.000 239.19285 ? 42  ARG E N     1 
ATOM 2901  C CA    . ARG E 1 42  ? 113.71500 142.44700 74.03100  1.000 239.19285 ? 42  ARG E CA    1 
ATOM 2902  C C     . ARG E 1 42  ? 114.41600 141.59800 75.08000  1.000 239.19285 ? 42  ARG E C     1 
ATOM 2903  O O     . ARG E 1 42  ? 115.64200 141.47900 75.06900  1.000 239.19285 ? 42  ARG E O     1 
ATOM 2904  C CB    . ARG E 1 42  ? 114.04900 141.93800 72.62900  1.000 239.19285 ? 42  ARG E CB    1 
ATOM 2905  C CG    . ARG E 1 42  ? 112.94200 142.15800 71.61100  1.000 239.19285 ? 42  ARG E CG    1 
ATOM 2906  C CD    . ARG E 1 42  ? 113.30300 141.55700 70.26200  1.000 239.19285 ? 42  ARG E CD    1 
ATOM 2907  N NE    . ARG E 1 42  ? 112.31600 141.88600 69.23900  1.000 239.19285 ? 42  ARG E NE    1 
ATOM 2908  C CZ    . ARG E 1 42  ? 112.36000 142.98100 68.48700  1.000 239.19285 ? 42  ARG E CZ    1 
ATOM 2909  N NH1   . ARG E 1 42  ? 111.42200 143.20100 67.57800  1.000 239.19285 ? 42  ARG E NH1   1 
ATOM 2910  N NH2   . ARG E 1 42  ? 113.34800 143.85300 68.63800  1.000 239.19285 ? 42  ARG E NH2   1 
ATOM 2911  N N     . ARG E 1 43  ? 113.64300 140.99700 75.98200  1.000 226.91647 ? 43  ARG E N     1 
ATOM 2912  C CA    . ARG E 1 43  ? 114.18700 140.16200 77.04800  1.000 226.91647 ? 43  ARG E CA    1 
ATOM 2913  C C     . ARG E 1 43  ? 113.73500 138.73500 76.75500  1.000 226.91647 ? 43  ARG E C     1 
ATOM 2914  O O     . ARG E 1 43  ? 112.57900 138.38100 77.00400  1.000 226.91647 ? 43  ARG E O     1 
ATOM 2915  C CB    . ARG E 1 43  ? 113.65000 140.63800 78.39200  1.000 226.91647 ? 43  ARG E CB    1 
ATOM 2916  C CG    . ARG E 1 43  ? 114.20300 141.95100 78.88700  1.000 226.91647 ? 43  ARG E CG    1 
ATOM 2917  C CD    . ARG E 1 43  ? 113.56700 142.27500 80.22800  1.000 226.91647 ? 43  ARG E CD    1 
ATOM 2918  N NE    . ARG E 1 43  ? 114.24100 143.34000 80.96000  1.000 226.91647 ? 43  ARG E NE    1 
ATOM 2919  C CZ    . ARG E 1 43  ? 113.79100 143.84500 82.10300  1.000 226.91647 ? 43  ARG E CZ    1 
ATOM 2920  N NH1   . ARG E 1 43  ? 114.46300 144.81500 82.70900  1.000 226.91647 ? 43  ARG E NH1   1 
ATOM 2921  N NH2   . ARG E 1 43  ? 112.66700 143.38600 82.63700  1.000 226.91647 ? 43  ARG E NH2   1 
ATOM 2922  N N     . ARG E 1 44  ? 114.63900 137.91600 76.22900  1.000 221.90289 ? 44  ARG E N     1 
ATOM 2923  C CA    . ARG E 1 44  ? 114.33700 136.51800 75.96400  1.000 221.90289 ? 44  ARG E CA    1 
ATOM 2924  C C     . ARG E 1 44  ? 115.03200 135.62000 76.98000  1.000 221.90289 ? 44  ARG E C     1 
ATOM 2925  O O     . ARG E 1 44  ? 116.10800 135.95600 77.48400  1.000 221.90289 ? 44  ARG E O     1 
ATOM 2926  C CB    . ARG E 1 44  ? 114.75100 136.13700 74.54000  1.000 221.90289 ? 44  ARG E CB    1 
ATOM 2927  C CG    . ARG E 1 44  ? 114.03300 136.94400 73.45800  1.000 221.90289 ? 44  ARG E CG    1 
ATOM 2928  C CD    . ARG E 1 44  ? 112.59200 136.50300 73.23300  1.000 221.90289 ? 44  ARG E CD    1 
ATOM 2929  N NE    . ARG E 1 44  ? 111.65600 137.26100 74.06300  1.000 221.90289 ? 44  ARG E NE    1 
ATOM 2930  C CZ    . ARG E 1 44  ? 111.13700 138.43900 73.73000  1.000 221.90289 ? 44  ARG E CZ    1 
ATOM 2931  N NH1   . ARG E 1 44  ? 110.29500 139.05100 74.55300  1.000 221.90289 ? 44  ARG E NH1   1 
ATOM 2932  N NH2   . ARG E 1 44  ? 111.45600 139.00700 72.57500  1.000 221.90289 ? 44  ARG E NH2   1 
ATOM 2933  N N     . GLN E 1 45  ? 114.40200 134.46800 77.25900  1.000 203.11273 ? 45  GLN E N     1 
ATOM 2934  C CA    . GLN E 1 45  ? 114.88300 133.45700 78.21700  1.000 203.11273 ? 45  GLN E CA    1 
ATOM 2935  C C     . GLN E 1 45  ? 115.15100 134.04100 79.60300  1.000 203.11273 ? 45  GLN E C     1 
ATOM 2936  O O     . GLN E 1 45  ? 116.08300 133.64000 80.30200  1.000 203.11273 ? 45  GLN E O     1 
ATOM 2937  C CB    . GLN E 1 45  ? 116.11700 132.72700 77.68400  1.000 203.11273 ? 45  GLN E CB    1 
ATOM 2938  C CG    . GLN E 1 45  ? 115.81600 131.82500 76.50100  1.000 203.11273 ? 45  GLN E CG    1 
ATOM 2939  C CD    . GLN E 1 45  ? 116.51000 132.27500 75.23600  1.000 203.11273 ? 45  GLN E CD    1 
ATOM 2940  O OE1   . GLN E 1 45  ? 116.98600 133.40500 75.14500  1.000 203.11273 ? 45  GLN E OE1   1 
ATOM 2941  N NE2   . GLN E 1 45  ? 116.56200 131.39300 74.24400  1.000 203.11273 ? 45  GLN E NE2   1 
ATOM 2942  N N     . GLY E 1 46  ? 114.32700 135.00100 80.00400  1.000 180.64884 ? 46  GLY E N     1 
ATOM 2943  C CA    . GLY E 1 46  ? 114.50300 135.68100 81.26700  1.000 180.64884 ? 46  GLY E CA    1 
ATOM 2944  C C     . GLY E 1 46  ? 114.08900 134.92600 82.50500  1.000 180.64884 ? 46  GLY E C     1 
ATOM 2945  O O     . GLY E 1 46  ? 114.17100 135.49100 83.59700  1.000 180.64884 ? 46  GLY E O     1 
ATOM 2946  N N     . TRP E 1 47  ? 113.65800 133.66800 82.38600  1.000 160.25383 ? 47  TRP E N     1 
ATOM 2947  C CA    . TRP E 1 47  ? 113.24300 132.92200 83.56900  1.000 160.25383 ? 47  TRP E CA    1 
ATOM 2948  C C     . TRP E 1 47  ? 114.41100 132.52600 84.46000  1.000 160.25383 ? 47  TRP E C     1 
ATOM 2949  O O     . TRP E 1 47  ? 114.22000 132.39700 85.67000  1.000 160.25383 ? 47  TRP E O     1 
ATOM 2950  C CB    . TRP E 1 47  ? 112.46000 131.67600 83.16900  1.000 160.25383 ? 47  TRP E CB    1 
ATOM 2951  C CG    . TRP E 1 47  ? 113.19700 130.77000 82.25600  1.000 160.25383 ? 47  TRP E CG    1 
ATOM 2952  C CD1   . TRP E 1 47  ? 113.20100 130.81000 80.89700  1.000 160.25383 ? 47  TRP E CD1   1 
ATOM 2953  C CD2   . TRP E 1 47  ? 114.04100 129.68000 82.62800  1.000 160.25383 ? 47  TRP E CD2   1 
ATOM 2954  N NE1   . TRP E 1 47  ? 113.99600 129.81200 80.39600  1.000 160.25383 ? 47  TRP E NE1   1 
ATOM 2955  C CE2   . TRP E 1 47  ? 114.52200 129.10000 81.44000  1.000 160.25383 ? 47  TRP E CE2   1 
ATOM 2956  C CE3   . TRP E 1 47  ? 114.43400 129.13400 83.84900  1.000 160.25383 ? 47  TRP E CE3   1 
ATOM 2957  C CZ2   . TRP E 1 47  ? 115.37900 128.00600 81.43800  1.000 160.25383 ? 47  TRP E CZ2   1 
ATOM 2958  C CZ3   . TRP E 1 47  ? 115.28200 128.04500 83.84400  1.000 160.25383 ? 47  TRP E CZ3   1 
ATOM 2959  C CH2   . TRP E 1 47  ? 115.74600 127.49300 82.64800  1.000 160.25383 ? 47  TRP E CH2   1 
ATOM 2960  N N     . LEU E 1 48  ? 115.60900 132.32900 83.89300  1.000 156.97625 ? 48  LEU E N     1 
ATOM 2961  C CA    . LEU E 1 48  ? 116.76800 131.93100 84.69500  1.000 156.97625 ? 48  LEU E CA    1 
ATOM 2962  C C     . LEU E 1 48  ? 117.14700 132.99800 85.71200  1.000 156.97625 ? 48  LEU E C     1 
ATOM 2963  O O     . LEU E 1 48  ? 117.54000 132.67800 86.84300  1.000 156.97625 ? 48  LEU E O     1 
ATOM 2964  C CB    . LEU E 1 48  ? 117.96400 131.64100 83.79500  1.000 156.97625 ? 48  LEU E CB    1 
ATOM 2965  C CG    . LEU E 1 48  ? 117.88200 130.42300 82.88600  1.000 156.97625 ? 48  LEU E CG    1 
ATOM 2966  C CD1   . LEU E 1 48  ? 117.58500 130.86500 81.46800  1.000 156.97625 ? 48  LEU E CD1   1 
ATOM 2967  C CD2   . LEU E 1 48  ? 119.16900 129.62400 82.94900  1.000 156.97625 ? 48  LEU E CD2   1 
ATOM 2968  N N     . LYS E 1 49  ? 117.04900 134.26800 85.31700  1.000 164.09213 ? 49  LYS E N     1 
ATOM 2969  C CA    . LYS E 1 49  ? 117.30900 135.36600 86.23900  1.000 164.09213 ? 49  LYS E CA    1 
ATOM 2970  C C     . LYS E 1 49  ? 116.30300 135.36300 87.38000  1.000 164.09213 ? 49  LYS E C     1 
ATOM 2971  O O     . LYS E 1 49  ? 116.66100 135.61100 88.53700  1.000 164.09213 ? 49  LYS E O     1 
ATOM 2972  C CB    . LYS E 1 49  ? 117.27200 136.69100 85.48200  1.000 164.09213 ? 49  LYS E CB    1 
ATOM 2973  C CG    . LYS E 1 49  ? 117.75600 137.88300 86.28200  1.000 164.09213 ? 49  LYS E CG    1 
ATOM 2974  C CD    . LYS E 1 49  ? 116.62700 138.85300 86.57500  1.000 164.09213 ? 49  LYS E CD    1 
ATOM 2975  C CE    . LYS E 1 49  ? 116.98400 139.77400 87.73000  1.000 164.09213 ? 49  LYS E CE    1 
ATOM 2976  N NZ    . LYS E 1 49  ? 115.80200 140.51600 88.24300  1.000 164.09213 ? 49  LYS E NZ    1 
ATOM 2977  N N     . GLU E 1 50  ? 115.04000 135.06400 87.06700  1.000 160.07356 ? 50  GLU E N     1 
ATOM 2978  C CA    . GLU E 1 50  ? 114.00600 134.96000 88.08900  1.000 160.07356 ? 50  GLU E CA    1 
ATOM 2979  C C     . GLU E 1 50  ? 114.26500 133.79400 89.03200  1.000 160.07356 ? 50  GLU E C     1 
ATOM 2980  O O     . GLU E 1 50  ? 114.03700 133.91500 90.24200  1.000 160.07356 ? 50  GLU E O     1 
ATOM 2981  C CB    . GLU E 1 50  ? 112.64600 134.81200 87.42100  1.000 160.07356 ? 50  GLU E CB    1 
ATOM 2982  C CG    . GLU E 1 50  ? 112.42400 135.82400 86.32700  1.000 160.07356 ? 50  GLU E CG    1 
ATOM 2983  C CD    . GLU E 1 50  ? 111.34200 135.40500 85.36100  1.000 160.07356 ? 50  GLU E CD    1 
ATOM 2984  O OE1   . GLU E 1 50  ? 110.56700 134.48800 85.70000  1.000 160.07356 ? 50  GLU E OE1   1 
ATOM 2985  O OE2   . GLU E 1 50  ? 111.27700 135.98100 84.25500  1.000 160.07356 ? 50  GLU E OE2   1 
ATOM 2986  N N     . ILE E 1 51  ? 114.72300 132.66200 88.48700  1.000 146.02076 ? 51  ILE E N     1 
ATOM 2987  C CA    . ILE E 1 51  ? 115.09600 131.50700 89.30400  1.000 146.02076 ? 51  ILE E CA    1 
ATOM 2988  C C     . ILE E 1 51  ? 116.19700 131.88500 90.28100  1.000 146.02076 ? 51  ILE E C     1 
ATOM 2989  O O     . ILE E 1 51  ? 116.09900 131.61100 91.48100  1.000 146.02076 ? 51  ILE E O     1 
ATOM 2990  C CB    . ILE E 1 51  ? 115.52600 130.32700 88.41400  1.000 146.02076 ? 51  ILE E CB    1 
ATOM 2991  C CG1   . ILE E 1 51  ? 114.36200 129.81900 87.55900  1.000 146.02076 ? 51  ILE E CG1   1 
ATOM 2992  C CG2   . ILE E 1 51  ? 116.11600 129.20500 89.25600  1.000 146.02076 ? 51  ILE E CG2   1 
ATOM 2993  C CD1   . ILE E 1 51  ? 113.39800 128.91300 88.25000  1.000 146.02076 ? 51  ILE E CD1   1 
ATOM 2994  N N     . ARG E 1 52  ? 117.25700 132.52900 89.77700  1.000 146.63067 ? 52  ARG E N     1 
ATOM 2995  C CA    . ARG E 1 52  ? 118.38100 132.90600 90.63300  1.000 146.63067 ? 52  ARG E CA    1 
ATOM 2996  C C     . ARG E 1 52  ? 117.97200 133.92500 91.68800  1.000 146.63067 ? 52  ARG E C     1 
ATOM 2997  O O     . ARG E 1 52  ? 118.39600 133.83000 92.84700  1.000 146.63067 ? 52  ARG E O     1 
ATOM 2998  C CB    . ARG E 1 52  ? 119.53200 133.45100 89.79700  1.000 146.63067 ? 52  ARG E CB    1 
ATOM 2999  C CG    . ARG E 1 52  ? 120.37700 132.38300 89.15700  1.000 146.63067 ? 52  ARG E CG    1 
ATOM 3000  C CD    . ARG E 1 52  ? 121.22300 132.96300 88.04700  1.000 146.63067 ? 52  ARG E CD    1 
ATOM 3001  N NE    . ARG E 1 52  ? 122.18400 131.98800 87.54800  1.000 146.63067 ? 52  ARG E NE    1 
ATOM 3002  C CZ    . ARG E 1 52  ? 121.99900 131.25100 86.46000  1.000 146.63067 ? 52  ARG E CZ    1 
ATOM 3003  N NH1   . ARG E 1 52  ? 122.92900 130.38700 86.08100  1.000 146.63067 ? 52  ARG E NH1   1 
ATOM 3004  N NH2   . ARG E 1 52  ? 120.88300 131.37600 85.75300  1.000 146.63067 ? 52  ARG E NH2   1 
ATOM 3005  N N     . LYS E 1 53  ? 117.14500 134.90000 91.30500  1.000 150.30858 ? 53  LYS E N     1 
ATOM 3006  C CA    . LYS E 1 53  ? 116.70000 135.91700 92.25000  1.000 150.30858 ? 53  LYS E CA    1 
ATOM 3007  C C     . LYS E 1 53  ? 115.81500 135.31400 93.33400  1.000 150.30858 ? 53  LYS E C     1 
ATOM 3008  O O     . LYS E 1 53  ? 115.95800 135.64500 94.51700  1.000 150.30858 ? 53  LYS E O     1 
ATOM 3009  C CB    . LYS E 1 53  ? 115.96400 137.02500 91.49700  1.000 150.30858 ? 53  LYS E CB    1 
ATOM 3010  C CG    . LYS E 1 53  ? 114.92500 137.77900 92.30600  1.000 150.30858 ? 53  LYS E CG    1 
ATOM 3011  C CD    . LYS E 1 53  ? 114.08600 138.68100 91.42500  1.000 150.30858 ? 53  LYS E CD    1 
ATOM 3012  C CE    . LYS E 1 53  ? 113.39800 137.88700 90.32900  1.000 150.30858 ? 53  LYS E CE    1 
ATOM 3013  N NZ    . LYS E 1 53  ? 112.62100 138.75500 89.40700  1.000 150.30858 ? 53  LYS E NZ    1 
ATOM 3014  N N     . LEU E 1 54  ? 114.93900 134.38300 92.96100  1.000 143.87131 ? 54  LEU E N     1 
ATOM 3015  C CA    . LEU E 1 54  ? 114.04700 133.79000 93.94500  1.000 143.87131 ? 54  LEU E CA    1 
ATOM 3016  C C     . LEU E 1 54  ? 114.75800 132.76200 94.81000  1.000 143.87131 ? 54  LEU E C     1 
ATOM 3017  O O     . LEU E 1 54  ? 114.34300 132.52700 95.94900  1.000 143.87131 ? 54  LEU E O     1 
ATOM 3018  C CB    . LEU E 1 54  ? 112.84200 133.16100 93.24900  1.000 143.87131 ? 54  LEU E CB    1 
ATOM 3019  C CG    . LEU E 1 54  ? 111.57800 134.02300 93.22000  1.000 143.87131 ? 54  LEU E CG    1 
ATOM 3020  C CD1   . LEU E 1 54  ? 111.77400 135.30200 92.43100  1.000 143.87131 ? 54  LEU E CD1   1 
ATOM 3021  C CD2   . LEU E 1 54  ? 110.41500 133.25200 92.65800  1.000 143.87131 ? 54  LEU E CD2   1 
ATOM 3022  N N     . GLN E 1 55  ? 115.82500 132.15000 94.30100  1.000 138.80514 ? 55  GLN E N     1 
ATOM 3023  C CA    . GLN E 1 55  ? 116.57200 131.19600 95.10600  1.000 138.80514 ? 55  GLN E CA    1 
ATOM 3024  C C     . GLN E 1 55  ? 117.54900 131.90100 96.02800  1.000 138.80514 ? 55  GLN E C     1 
ATOM 3025  O O     . GLN E 1 55  ? 117.90700 131.35700 97.07600  1.000 138.80514 ? 55  GLN E O     1 
ATOM 3026  C CB    . GLN E 1 55  ? 117.30800 130.21300 94.20000  1.000 138.80514 ? 55  GLN E CB    1 
ATOM 3027  C CG    . GLN E 1 55  ? 116.41000 129.15500 93.59200  1.000 138.80514 ? 55  GLN E CG    1 
ATOM 3028  C CD    . GLN E 1 55  ? 117.12800 127.85300 93.33200  1.000 138.80514 ? 55  GLN E CD    1 
ATOM 3029  O OE1   . GLN E 1 55  ? 118.32200 127.83700 93.03800  1.000 138.80514 ? 55  GLN E OE1   1 
ATOM 3030  N NE2   . GLN E 1 55  ? 116.40000 126.74900 93.42400  1.000 138.80514 ? 55  GLN E NE2   1 
ATOM 3031  N N     . LYS E 1 56  ? 117.98500 133.10400 95.66000  1.000 135.58125 ? 56  LYS E N     1 
ATOM 3032  C CA    . LYS E 1 56  ? 118.86900 133.85900 96.53500  1.000 135.58125 ? 56  LYS E CA    1 
ATOM 3033  C C     . LYS E 1 56  ? 118.10700 134.51600 97.67600  1.000 135.58125 ? 56  LYS E C     1 
ATOM 3034  O O     . LYS E 1 56  ? 118.64200 134.64800 98.78100  1.000 135.58125 ? 56  LYS E O     1 
ATOM 3035  C CB    . LYS E 1 56  ? 119.62900 134.91100 95.72700  1.000 135.58125 ? 56  LYS E CB    1 
ATOM 3036  C CG    . LYS E 1 56  ? 120.76500 135.57700 96.48100  1.000 135.58125 ? 56  LYS E CG    1 
ATOM 3037  C CD    . LYS E 1 56  ? 121.55000 136.50000 95.58100  1.000 135.58125 ? 56  LYS E CD    1 
ATOM 3038  C CE    . LYS E 1 56  ? 122.58700 135.71800 94.80000  1.000 135.58125 ? 56  LYS E CE    1 
ATOM 3039  N NZ    . LYS E 1 56  ? 123.52700 136.61600 94.08300  1.000 135.58125 ? 56  LYS E NZ    1 
ATOM 3040  N N     . SER E 1 57  ? 116.85700 134.89700 97.44200  1.000 141.25842 ? 57  SER E N     1 
ATOM 3041  C CA    . SER E 1 57  ? 116.07000 135.56400 98.46200  1.000 141.25842 ? 57  SER E CA    1 
ATOM 3042  C C     . SER E 1 57  ? 115.57100 134.56300 99.49700  1.000 141.25842 ? 57  SER E C     1 
ATOM 3043  O O     . SER E 1 57  ? 115.67800 133.34700 99.33300  1.000 141.25842 ? 57  SER E O     1 
ATOM 3044  C CB    . SER E 1 57  ? 114.89200 136.29300 97.82700  1.000 141.25842 ? 57  SER E CB    1 
ATOM 3045  O OG    . SER E 1 57  ? 114.28500 135.48300 96.83800  1.000 141.25842 ? 57  SER E OG    1 
ATOM 3046  N N     . THR E 1 58  ? 115.01800 135.09700 100.58500 1.000 138.08308 ? 58  THR E N     1 
ATOM 3047  C CA    . THR E 1 58  ? 114.53800 134.27200 101.68300 1.000 138.08308 ? 58  THR E CA    1 
ATOM 3048  C C     . THR E 1 58  ? 113.18100 134.68900 102.22100 1.000 138.08308 ? 58  THR E C     1 
ATOM 3049  O O     . THR E 1 58  ? 112.66500 134.01700 103.11700 1.000 138.08308 ? 58  THR E O     1 
ATOM 3050  C CB    . THR E 1 58  ? 115.53500 134.29800 102.84600 1.000 138.08308 ? 58  THR E CB    1 
ATOM 3051  O OG1   . THR E 1 58  ? 115.98700 135.64000 103.04800 1.000 138.08308 ? 58  THR E OG1   1 
ATOM 3052  C CG2   . THR E 1 58  ? 116.71200 133.40100 102.57700 1.000 138.08308 ? 58  THR E CG2   1 
ATOM 3053  N N     . HIS E 1 59  ? 112.59100 135.76500 101.71500 1.000 138.36725 ? 59  HIS E N     1 
ATOM 3054  C CA    . HIS E 1 59  ? 111.32500 136.25100 102.23100 1.000 138.36725 ? 59  HIS E CA    1 
ATOM 3055  C C     . HIS E 1 59  ? 110.17100 135.35300 101.79500 1.000 138.36725 ? 59  HIS E C     1 
ATOM 3056  O O     . HIS E 1 59  ? 110.30900 134.47700 100.93900 1.000 138.36725 ? 59  HIS E O     1 
ATOM 3057  C CB    . HIS E 1 59  ? 111.10500 137.68900 101.77400 1.000 138.36725 ? 59  HIS E CB    1 
ATOM 3058  C CG    . HIS E 1 59  ? 111.04000 137.84100 100.28800 1.000 138.36725 ? 59  HIS E CG    1 
ATOM 3059  N ND1   . HIS E 1 59  ? 112.08700 138.35400 99.55500  1.000 138.36725 ? 59  HIS E ND1   1 
ATOM 3060  C CD2   . HIS E 1 59  ? 110.05600 137.57000 99.39900  1.000 138.36725 ? 59  HIS E CD2   1 
ATOM 3061  C CE1   . HIS E 1 59  ? 111.75700 138.37700 98.27700  1.000 138.36725 ? 59  HIS E CE1   1 
ATOM 3062  N NE2   . HIS E 1 59  ? 110.52900 137.90600 98.15500  1.000 138.36725 ? 59  HIS E NE2   1 
ATOM 3063  N N     . LEU E 1 60  ? 109.01500 135.59200 102.40400 1.000 127.25220 ? 60  LEU E N     1 
ATOM 3064  C CA    . LEU E 1 60  ? 107.82700 134.80600 102.10700 1.000 127.25220 ? 60  LEU E CA    1 
ATOM 3065  C C     . LEU E 1 60  ? 107.26900 135.22200 100.75500 1.000 127.25220 ? 60  LEU E C     1 
ATOM 3066  O O     . LEU E 1 60  ? 107.30900 136.39900 100.38900 1.000 127.25220 ? 60  LEU E O     1 
ATOM 3067  C CB    . LEU E 1 60  ? 106.77100 135.00000 103.19000 1.000 127.25220 ? 60  LEU E CB    1 
ATOM 3068  C CG    . LEU E 1 60  ? 107.11100 134.69800 104.65400 1.000 127.25220 ? 60  LEU E CG    1 
ATOM 3069  C CD1   . LEU E 1 60  ? 105.83000 134.47800 105.43000 1.000 127.25220 ? 60  LEU E CD1   1 
ATOM 3070  C CD2   . LEU E 1 60  ? 108.04800 133.51000 104.83400 1.000 127.25220 ? 60  LEU E CD2   1 
ATOM 3071  N N     . LEU E 1 61  ? 106.73500 134.26000 100.01000 1.000 131.08843 ? 61  LEU E N     1 
ATOM 3072  C CA    . LEU E 1 61  ? 106.22600 134.57500 98.68400  1.000 131.08843 ? 61  LEU E CA    1 
ATOM 3073  C C     . LEU E 1 61  ? 104.72900 134.81600 98.64700  1.000 131.08843 ? 61  LEU E C     1 
ATOM 3074  O O     . LEU E 1 61  ? 104.26100 135.56900 97.79000  1.000 131.08843 ? 61  LEU E O     1 
ATOM 3075  C CB    . LEU E 1 61  ? 106.57400 133.44600 97.71400  1.000 131.08843 ? 61  LEU E CB    1 
ATOM 3076  C CG    . LEU E 1 61  ? 107.99200 132.90600 97.87300  1.000 131.08843 ? 61  LEU E CG    1 
ATOM 3077  C CD1   . LEU E 1 61  ? 108.18000 131.67000 97.02600  1.000 131.08843 ? 61  LEU E CD1   1 
ATOM 3078  C CD2   . LEU E 1 61  ? 109.00900 133.96900 97.50400  1.000 131.08843 ? 61  LEU E CD2   1 
ATOM 3079  N N     . ILE E 1 62  ? 103.97500 134.23100 99.54300  1.000 124.90816 ? 62  ILE E N     1 
ATOM 3080  C CA    . ILE E 1 62  ? 102.53100 134.41300 99.55300  1.000 124.90816 ? 62  ILE E CA    1 
ATOM 3081  C C     . ILE E 1 62  ? 102.19800 135.56600 100.48500 1.000 124.90816 ? 62  ILE E C     1 
ATOM 3082  O O     . ILE E 1 62  ? 102.85300 135.74700 101.51700 1.000 124.90816 ? 62  ILE E O     1 
ATOM 3083  C CB    . ILE E 1 62  ? 101.82800 133.11400 99.98100  1.000 124.90816 ? 62  ILE E CB    1 
ATOM 3084  C CG1   . ILE E 1 62  ? 102.44300 131.93000 99.24200  1.000 124.90816 ? 62  ILE E CG1   1 
ATOM 3085  C CG2   . ILE E 1 62  ? 100.35200 133.18800 99.68800  1.000 124.90816 ? 62  ILE E CG2   1 
ATOM 3086  C CD1   . ILE E 1 62  ? 101.80700 130.60600 99.58200  1.000 124.90816 ? 62  ILE E CD1   1 
ATOM 3087  N N     . ARG E 1 63  ? 101.19900 136.36600 100.11700 1.000 139.54010 ? 63  ARG E N     1 
ATOM 3088  C CA    . ARG E 1 63  ? 100.77200 137.46200 100.96900 1.000 139.54010 ? 63  ARG E CA    1 
ATOM 3089  C C     . ARG E 1 63  ? 100.13400 136.92600 102.24600 1.000 139.54010 ? 63  ARG E C     1 
ATOM 3090  O O     . ARG E 1 63  ? 99.67900  135.78300 102.31000 1.000 139.54010 ? 63  ARG E O     1 
ATOM 3091  C CB    . ARG E 1 63  ? 99.79500  138.36800 100.22800 1.000 139.54010 ? 63  ARG E CB    1 
ATOM 3092  C CG    . ARG E 1 63  ? 100.21800 138.69700 98.80800  1.000 139.54010 ? 63  ARG E CG    1 
ATOM 3093  C CD    . ARG E 1 63  ? 100.98100 139.99900 98.78000  1.000 139.54010 ? 63  ARG E CD    1 
ATOM 3094  N NE    . ARG E 1 63  ? 102.37700 139.79300 99.14500  1.000 139.54010 ? 63  ARG E NE    1 
ATOM 3095  C CZ    . ARG E 1 63  ? 103.17800 140.74500 99.60400  1.000 139.54010 ? 63  ARG E CZ    1 
ATOM 3096  N NH1   . ARG E 1 63  ? 102.72100 141.97900 99.76100  1.000 139.54010 ? 63  ARG E NH1   1 
ATOM 3097  N NH2   . ARG E 1 63  ? 104.43600 140.46300 99.91200  1.000 139.54010 ? 63  ARG E NH2   1 
ATOM 3098  N N     . LYS E 1 64  ? 100.06400 137.78500 103.25900 1.000 138.54468 ? 64  LYS E N     1 
ATOM 3099  C CA    . LYS E 1 64  ? 99.63400  137.34200 104.57800 1.000 138.54468 ? 64  LYS E CA    1 
ATOM 3100  C C     . LYS E 1 64  ? 98.12600  137.39100 104.76000 1.000 138.54468 ? 64  LYS E C     1 
ATOM 3101  O O     . LYS E 1 64  ? 97.56200  136.50700 105.41200 1.000 138.54468 ? 64  LYS E O     1 
ATOM 3102  C CB    . LYS E 1 64  ? 100.28100 138.19500 105.66600 1.000 138.54468 ? 64  LYS E CB    1 
ATOM 3103  C CG    . LYS E 1 64  ? 101.72200 138.54700 105.42400 1.000 138.54468 ? 64  LYS E CG    1 
ATOM 3104  C CD    . LYS E 1 64  ? 102.17600 139.58400 106.43300 1.000 138.54468 ? 64  LYS E CD    1 
ATOM 3105  C CE    . LYS E 1 64  ? 103.56100 140.09800 106.09900 1.000 138.54468 ? 64  LYS E CE    1 
ATOM 3106  N NZ    . LYS E 1 64  ? 104.22700 140.73500 107.26600 1.000 138.54468 ? 64  LYS E NZ    1 
ATOM 3107  N N     . LEU E 1 65  ? 97.46700  138.42300 104.22800 1.000 138.29177 ? 65  LEU E N     1 
ATOM 3108  C CA    . LEU E 1 65  ? 96.02400  138.55600 104.42900 1.000 138.29177 ? 65  LEU E CA    1 
ATOM 3109  C C     . LEU E 1 65  ? 95.20000  137.44800 103.77200 1.000 138.29177 ? 65  LEU E C     1 
ATOM 3110  O O     . LEU E 1 65  ? 94.32400  136.88900 104.46000 1.000 138.29177 ? 65  LEU E O     1 
ATOM 3111  C CB    . LEU E 1 65  ? 95.55600  139.95100 104.00100 1.000 138.29177 ? 65  LEU E CB    1 
ATOM 3112  C CG    . LEU E 1 65  ? 94.31700  140.49700 104.70100 1.000 138.29177 ? 65  LEU E CG    1 
ATOM 3113  C CD1   . LEU E 1 65  ? 94.31400  140.14800 106.17700 1.000 138.29177 ? 65  LEU E CD1   1 
ATOM 3114  C CD2   . LEU E 1 65  ? 94.24000  141.99600 104.50200 1.000 138.29177 ? 65  LEU E CD2   1 
ATOM 3115  N N     . PRO E 1 66  ? 95.38200  137.08800 102.48300 1.000 131.37915 ? 66  PRO E N     1 
ATOM 3116  C CA    . PRO E 1 66  ? 94.58800  135.96400 101.96500 1.000 131.37915 ? 66  PRO E CA    1 
ATOM 3117  C C     . PRO E 1 66  ? 94.93700  134.63700 102.60700 1.000 131.37915 ? 66  PRO E C     1 
ATOM 3118  O O     . PRO E 1 66  ? 94.04600  133.79600 102.76900 1.000 131.37915 ? 66  PRO E O     1 
ATOM 3119  C CB    . PRO E 1 66  ? 94.90600  135.95900 100.46700 1.000 131.37915 ? 66  PRO E CB    1 
ATOM 3120  C CG    . PRO E 1 66  ? 96.19100  136.59000 100.35300 1.000 131.37915 ? 66  PRO E CG    1 
ATOM 3121  C CD    . PRO E 1 66  ? 96.21200  137.64700 101.39200 1.000 131.37915 ? 66  PRO E CD    1 
ATOM 3122  N N     . PHE E 1 67  ? 96.20000  134.43300 102.98600 1.000 120.95182 ? 67  PHE E N     1 
ATOM 3123  C CA    . PHE E 1 67  ? 96.58300  133.20700 103.67400 1.000 120.95182 ? 67  PHE E CA    1 
ATOM 3124  C C     . PHE E 1 67  ? 95.91900  133.10300 105.03700 1.000 120.95182 ? 67  PHE E C     1 
ATOM 3125  O O     . PHE E 1 67  ? 95.49200  132.01700 105.43900 1.000 120.95182 ? 67  PHE E O     1 
ATOM 3126  C CB    . PHE E 1 67  ? 98.09800  133.13500 103.81100 1.000 120.95182 ? 67  PHE E CB    1 
ATOM 3127  C CG    . PHE E 1 67  ? 98.59300  131.81200 104.29000 1.000 120.95182 ? 67  PHE E CG    1 
ATOM 3128  C CD1   . PHE E 1 67  ? 98.80200  130.78100 103.39900 1.000 120.95182 ? 67  PHE E CD1   1 
ATOM 3129  C CD2   . PHE E 1 67  ? 98.88100  131.60700 105.62600 1.000 120.95182 ? 67  PHE E CD2   1 
ATOM 3130  C CE1   . PHE E 1 67  ? 99.26100  129.56100 103.83600 1.000 120.95182 ? 67  PHE E CE1   1 
ATOM 3131  C CE2   . PHE E 1 67  ? 99.33800  130.38900 106.06800 1.000 120.95182 ? 67  PHE E CE2   1 
ATOM 3132  C CZ    . PHE E 1 67  ? 99.53300  129.36600 105.17200 1.000 120.95182 ? 67  PHE E CZ    1 
ATOM 3133  N N     . SER E 1 68  ? 95.84600  134.21300 105.77000 1.000 130.23715 ? 68  SER E N     1 
ATOM 3134  C CA    . SER E 1 68  ? 95.16000  134.20800 107.05500 1.000 130.23715 ? 68  SER E CA    1 
ATOM 3135  C C     . SER E 1 68  ? 93.66600  133.97200 106.88000 1.000 130.23715 ? 68  SER E C     1 
ATOM 3136  O O     . SER E 1 68  ? 93.04400  133.28500 107.70200 1.000 130.23715 ? 68  SER E O     1 
ATOM 3137  C CB    . SER E 1 68  ? 95.41800  135.51800 107.78700 1.000 130.23715 ? 68  SER E CB    1 
ATOM 3138  O OG    . SER E 1 68  ? 95.08600  136.61200 106.95800 1.000 130.23715 ? 68  SER E OG    1 
ATOM 3139  N N     . ARG E 1 69  ? 93.07400  134.54200 105.82300 1.000 130.71180 ? 69  ARG E N     1 
ATOM 3140  C CA    . ARG E 1 69  ? 91.66400  134.28100 105.54300 1.000 130.71180 ? 69  ARG E CA    1 
ATOM 3141  C C     . ARG E 1 69  ? 91.43100  132.80900 105.22600 1.000 130.71180 ? 69  ARG E C     1 
ATOM 3142  O O     . ARG E 1 69  ? 90.44100  132.21900 105.67400 1.000 130.71180 ? 69  ARG E O     1 
ATOM 3143  C CB    . ARG E 1 69  ? 91.17000  135.15900 104.39700 1.000 130.71180 ? 69  ARG E CB    1 
ATOM 3144  C CG    . ARG E 1 69  ? 90.86900  136.58500 104.80900 1.000 130.71180 ? 69  ARG E CG    1 
ATOM 3145  C CD    . ARG E 1 69  ? 89.87300  137.22700 103.86500 1.000 130.71180 ? 69  ARG E CD    1 
ATOM 3146  N NE    . ARG E 1 69  ? 90.26100  137.05600 102.47200 1.000 130.71180 ? 69  ARG E NE    1 
ATOM 3147  C CZ    . ARG E 1 69  ? 91.07400  137.87900 101.82200 1.000 130.71180 ? 69  ARG E CZ    1 
ATOM 3148  N NH1   . ARG E 1 69  ? 91.37500  137.64900 100.55300 1.000 130.71180 ? 69  ARG E NH1   1 
ATOM 3149  N NH2   . ARG E 1 69  ? 91.58900  138.93000 102.44100 1.000 130.71180 ? 69  ARG E NH2   1 
ATOM 3150  N N     . LEU E 1 70  ? 92.34200  132.20200 104.46400 1.000 128.47601 ? 70  LEU E N     1 
ATOM 3151  C CA    . LEU E 1 70  ? 92.23700  130.78200 104.14900 1.000 128.47601 ? 70  LEU E CA    1 
ATOM 3152  C C     . LEU E 1 70  ? 92.41200  129.91700 105.38700 1.000 128.47601 ? 70  LEU E C     1 
ATOM 3153  O O     . LEU E 1 70  ? 91.70500  128.91800 105.55500 1.000 128.47601 ? 70  LEU E O     1 
ATOM 3154  C CB    . LEU E 1 70  ? 93.28400  130.41000 103.10500 1.000 128.47601 ? 70  LEU E CB    1 
ATOM 3155  C CG    . LEU E 1 70  ? 93.28700  128.95000 102.66500 1.000 128.47601 ? 70  LEU E CG    1 
ATOM 3156  C CD1   . LEU E 1 70  ? 91.93400  128.57200 102.11300 1.000 128.47601 ? 70  LEU E CD1   1 
ATOM 3157  C CD2   . LEU E 1 70  ? 94.37500  128.70000 101.64400 1.000 128.47601 ? 70  LEU E CD2   1 
ATOM 3158  N N     . ALA E 1 71  ? 93.34400  130.29000 106.26500 1.000 128.14569 ? 71  ALA E N     1 
ATOM 3159  C CA    . ALA E 1 71  ? 93.55000  129.55000 107.50400 1.000 128.14569 ? 71  ALA E CA    1 
ATOM 3160  C C     . ALA E 1 71  ? 92.32900  129.62800 108.40400 1.000 128.14569 ? 71  ALA E C     1 
ATOM 3161  O O     . ALA E 1 71  ? 91.94500  128.63200 109.02400 1.000 128.14569 ? 71  ALA E O     1 
ATOM 3162  C CB    . ALA E 1 71  ? 94.78300  130.07500 108.23000 1.000 128.14569 ? 71  ALA E CB    1 
ATOM 3163  N N     . ARG E 1 72  ? 91.70100  130.80000 108.47800 1.000 130.24290 ? 72  ARG E N     1 
ATOM 3164  C CA    . ARG E 1 72  ? 90.48700  130.93200 109.27400 1.000 130.24290 ? 72  ARG E CA    1 
ATOM 3165  C C     . ARG E 1 72  ? 89.33400  130.15700 108.64900 1.000 130.24290 ? 72  ARG E C     1 
ATOM 3166  O O     . ARG E 1 72  ? 88.52900  129.54600 109.36200 1.000 130.24290 ? 72  ARG E O     1 
ATOM 3167  C CB    . ARG E 1 72  ? 90.13700  132.40500 109.44100 1.000 130.24290 ? 72  ARG E CB    1 
ATOM 3168  C CG    . ARG E 1 72  ? 90.94600  133.08100 110.52700 1.000 130.24290 ? 72  ARG E CG    1 
ATOM 3169  C CD    . ARG E 1 72  ? 90.97200  134.58200 110.34400 1.000 130.24290 ? 72  ARG E CD    1 
ATOM 3170  N NE    . ARG E 1 72  ? 92.25700  135.15500 110.72400 1.000 130.24290 ? 72  ARG E NE    1 
ATOM 3171  C CZ    . ARG E 1 72  ? 92.59300  135.47900 111.96700 1.000 130.24290 ? 72  ARG E CZ    1 
ATOM 3172  N NH1   . ARG E 1 72  ? 91.73900  135.28900 112.96200 1.000 130.24290 ? 72  ARG E NH1   1 
ATOM 3173  N NH2   . ARG E 1 72  ? 93.78600  135.99700 112.21400 1.000 130.24290 ? 72  ARG E NH2   1 
ATOM 3174  N N     . GLU E 1 73  ? 89.25300  130.15900 107.31600 1.000 139.75664 ? 73  GLU E N     1 
ATOM 3175  C CA    . GLU E 1 73  ? 88.23200  129.39300 106.61300 1.000 139.75664 ? 73  GLU E CA    1 
ATOM 3176  C C     . GLU E 1 73  ? 88.41600  127.89400 106.81200 1.000 139.75664 ? 73  GLU E C     1 
ATOM 3177  O O     . GLU E 1 73  ? 87.43400  127.14600 106.86900 1.000 139.75664 ? 73  GLU E O     1 
ATOM 3178  C CB    . GLU E 1 73  ? 88.29000  129.74300 105.12600 1.000 139.75664 ? 73  GLU E CB    1 
ATOM 3179  C CG    . GLU E 1 73  ? 87.27400  129.04500 104.24500 1.000 139.75664 ? 73  GLU E CG    1 
ATOM 3180  C CD    . GLU E 1 73  ? 85.91900  129.70700 104.29100 1.000 139.75664 ? 73  GLU E CD    1 
ATOM 3181  O OE1   . GLU E 1 73  ? 84.93800  129.08500 103.83300 1.000 139.75664 ? 73  GLU E OE1   1 
ATOM 3182  O OE2   . GLU E 1 73  ? 85.83600  130.85800 104.76700 1.000 139.75664 ? 73  GLU E OE2   1 
ATOM 3183  N N     . ILE E 1 74  ? 89.65800  127.44500 106.96000 1.000 139.11016 ? 74  ILE E N     1 
ATOM 3184  C CA    . ILE E 1 74  ? 89.90500  126.03600 107.23400 1.000 139.11016 ? 74  ILE E CA    1 
ATOM 3185  C C     . ILE E 1 74  ? 89.59400  125.71000 108.68500 1.000 139.11016 ? 74  ILE E C     1 
ATOM 3186  O O     . ILE E 1 74  ? 88.94000  124.70400 108.98100 1.000 139.11016 ? 74  ILE E O     1 
ATOM 3187  C CB    . ILE E 1 74  ? 91.35900  125.68500 106.86400 1.000 139.11016 ? 74  ILE E CB    1 
ATOM 3188  C CG1   . ILE E 1 74  ? 91.54200  125.65700 105.34600 1.000 139.11016 ? 74  ILE E CG1   1 
ATOM 3189  C CG2   . ILE E 1 74  ? 91.78700  124.36200 107.46700 1.000 139.11016 ? 74  ILE E CG2   1 
ATOM 3190  C CD1   . ILE E 1 74  ? 90.54200  124.79500 104.61800 1.000 139.11016 ? 74  ILE E CD1   1 
ATOM 3191  N N     . CYS E 1 75  ? 89.99900  126.58700 109.60400 1.000 145.29019 ? 75  CYS E N     1 
ATOM 3192  C CA    . CYS E 1 75  ? 89.82300  126.32700 111.02500 1.000 145.29019 ? 75  CYS E CA    1 
ATOM 3193  C C     . CYS E 1 75  ? 88.37600  126.42700 111.47500 1.000 145.29019 ? 75  CYS E C     1 
ATOM 3194  O O     . CYS E 1 75  ? 88.02400  125.81600 112.48700 1.000 145.29019 ? 75  CYS E O     1 
ATOM 3195  C CB    . CYS E 1 75  ? 90.67900  127.29000 111.84400 1.000 145.29019 ? 75  CYS E CB    1 
ATOM 3196  S SG    . CYS E 1 75  ? 89.86100  128.84000 112.26100 1.000 145.29019 ? 75  CYS E SG    1 
ATOM 3197  N N     . VAL E 1 76  ? 87.53000  127.17400 110.75900 1.000 143.02166 ? 76  VAL E N     1 
ATOM 3198  C CA    . VAL E 1 76  ? 86.14200  127.32200 111.18600 1.000 143.02166 ? 76  VAL E CA    1 
ATOM 3199  C C     . VAL E 1 76  ? 85.34600  126.02700 111.01400 1.000 143.02166 ? 76  VAL E C     1 
ATOM 3200  O O     . VAL E 1 76  ? 84.28500  125.86600 111.62700 1.000 143.02166 ? 76  VAL E O     1 
ATOM 3201  C CB    . VAL E 1 76  ? 85.48900  128.50100 110.43300 1.000 143.02166 ? 76  VAL E CB    1 
ATOM 3202  C CG1   . VAL E 1 76  ? 85.11100  128.10900 109.01300 1.000 143.02166 ? 76  VAL E CG1   1 
ATOM 3203  C CG2   . VAL E 1 76  ? 84.29700  129.07400 111.20000 1.000 143.02166 ? 76  VAL E CG2   1 
ATOM 3204  N N     . LYS E 1 77  ? 85.85900  125.07000 110.24400 1.000 140.69249 ? 77  LYS E N     1 
ATOM 3205  C CA    . LYS E 1 77  ? 85.10600  123.85500 109.96600 1.000 140.69249 ? 77  LYS E CA    1 
ATOM 3206  C C     . LYS E 1 77  ? 85.16100  122.86100 111.11700 1.000 140.69249 ? 77  LYS E C     1 
ATOM 3207  O O     . LYS E 1 77  ? 84.16600  122.18700 111.39800 1.000 140.69249 ? 77  LYS E O     1 
ATOM 3208  C CB    . LYS E 1 77  ? 85.63400  123.20800 108.69000 1.000 140.69249 ? 77  LYS E CB    1 
ATOM 3209  C CG    . LYS E 1 77  ? 85.20900  123.92000 107.42200 1.000 140.69249 ? 77  LYS E CG    1 
ATOM 3210  C CD    . LYS E 1 77  ? 85.80300  123.26200 106.19000 1.000 140.69249 ? 77  LYS E CD    1 
ATOM 3211  C CE    . LYS E 1 77  ? 85.44000  121.78900 106.11900 1.000 140.69249 ? 77  LYS E CE    1 
ATOM 3212  N NZ    . LYS E 1 77  ? 83.97900  121.58700 105.94700 1.000 140.69249 ? 77  LYS E NZ    1 
ATOM 3213  N N     . PHE E 1 78  ? 86.29600  122.75700 111.80100 1.000 142.55074 ? 78  PHE E N     1 
ATOM 3214  C CA    . PHE E 1 78  ? 86.46600  121.74400 112.83200 1.000 142.55074 ? 78  PHE E CA    1 
ATOM 3215  C C     . PHE E 1 78  ? 86.20200  122.25800 114.23300 1.000 142.55074 ? 78  PHE E C     1 
ATOM 3216  O O     . PHE E 1 78  ? 86.22900  121.47100 115.18200 1.000 142.55074 ? 78  PHE E O     1 
ATOM 3217  C CB    . PHE E 1 78  ? 87.88300  121.17800 112.77500 1.000 142.55074 ? 78  PHE E CB    1 
ATOM 3218  C CG    . PHE E 1 78  ? 88.18600  120.45700 111.51200 1.000 142.55074 ? 78  PHE E CG    1 
ATOM 3219  C CD1   . PHE E 1 78  ? 87.73400  119.16600 111.31600 1.000 142.55074 ? 78  PHE E CD1   1 
ATOM 3220  C CD2   . PHE E 1 78  ? 88.90800  121.07500 110.51000 1.000 142.55074 ? 78  PHE E CD2   1 
ATOM 3221  C CE1   . PHE E 1 78  ? 88.01000  118.49600 110.14500 1.000 142.55074 ? 78  PHE E CE1   1 
ATOM 3222  C CE2   . PHE E 1 78  ? 89.18600  120.41400 109.33700 1.000 142.55074 ? 78  PHE E CE2   1 
ATOM 3223  C CZ    . PHE E 1 78  ? 88.73600  119.12100 109.15400 1.000 142.55074 ? 78  PHE E CZ    1 
ATOM 3224  N N     . THR E 1 79  ? 85.94300  123.54600 114.39000 1.000 150.03868 ? 79  THR E N     1 
ATOM 3225  C CA    . THR E 1 79  ? 85.67700  124.12200 115.69500 1.000 150.03868 ? 79  THR E CA    1 
ATOM 3226  C C     . THR E 1 79  ? 84.19100  124.19700 116.00500 1.000 150.03868 ? 79  THR E C     1 
ATOM 3227  O O     . THR E 1 79  ? 83.80300  124.91700 116.93100 1.000 150.03868 ? 79  THR E O     1 
ATOM 3228  C CB    . THR E 1 79  ? 86.30100  125.50700 115.78000 1.000 150.03868 ? 79  THR E CB    1 
ATOM 3229  O OG1   . THR E 1 79  ? 86.06700  126.06000 117.07900 1.000 150.03868 ? 79  THR E OG1   1 
ATOM 3230  C CG2   . THR E 1 79  ? 85.70100  126.39700 114.72600 1.000 150.03868 ? 79  THR E CG2   1 
ATOM 3231  N N     . ARG E 1 80  ? 83.36500  123.48300 115.22900 1.000 161.31920 ? 80  ARG E N     1 
ATOM 3232  C CA    . ARG E 1 80  ? 81.90300  123.34600 115.36000 1.000 161.31920 ? 80  ARG E CA    1 
ATOM 3233  C C     . ARG E 1 80  ? 81.15600  124.68700 115.46100 1.000 161.31920 ? 80  ARG E C     1 
ATOM 3234  O O     . ARG E 1 80  ? 80.00800  124.73700 115.91400 1.000 161.31920 ? 80  ARG E O     1 
ATOM 3235  C CB    . ARG E 1 80  ? 81.53000  122.38700 116.51000 1.000 161.31920 ? 80  ARG E CB    1 
ATOM 3236  C CG    . ARG E 1 80  ? 81.59200  122.87600 117.96000 1.000 161.31920 ? 80  ARG E CG    1 
ATOM 3237  C CD    . ARG E 1 80  ? 81.12000  121.79800 118.91800 1.000 161.31920 ? 80  ARG E CD    1 
ATOM 3238  N NE    . ARG E 1 80  ? 81.44100  120.46100 118.42900 1.000 161.31920 ? 80  ARG E NE    1 
ATOM 3239  C CZ    . ARG E 1 80  ? 82.56700  119.81300 118.70900 1.000 161.31920 ? 80  ARG E CZ    1 
ATOM 3240  N NH1   . ARG E 1 80  ? 82.77400  118.59800 118.22000 1.000 161.31920 ? 80  ARG E NH1   1 
ATOM 3241  N NH2   . ARG E 1 80  ? 83.49000  120.38400 119.47100 1.000 161.31920 ? 80  ARG E NH2   1 
ATOM 3242  N N     . GLY E 1 81  ? 81.74800  125.77900 114.97900 1.000 159.28590 ? 81  GLY E N     1 
ATOM 3243  C CA    . GLY E 1 81  ? 81.01600  127.02700 114.89600 1.000 159.28590 ? 81  GLY E CA    1 
ATOM 3244  C C     . GLY E 1 81  ? 81.63100  128.23700 115.56800 1.000 159.28590 ? 81  GLY E C     1 
ATOM 3245  O O     . GLY E 1 81  ? 81.58500  129.33300 115.00100 1.000 159.28590 ? 81  GLY E O     1 
ATOM 3246  N N     . VAL E 1 82  ? 82.15900  128.06800 116.78400 1.000 148.96524 ? 82  VAL E N     1 
ATOM 3247  C CA    . VAL E 1 82  ? 82.67100  129.20000 117.54900 1.000 148.96524 ? 82  VAL E CA    1 
ATOM 3248  C C     . VAL E 1 82  ? 83.89800  129.78700 116.86200 1.000 148.96524 ? 82  VAL E C     1 
ATOM 3249  O O     . VAL E 1 82  ? 84.64200  129.09300 116.16500 1.000 148.96524 ? 82  VAL E O     1 
ATOM 3250  C CB    . VAL E 1 82  ? 82.98700  128.77400 118.99300 1.000 148.96524 ? 82  VAL E CB    1 
ATOM 3251  C CG1   . VAL E 1 82  ? 81.70100  128.50200 119.74700 1.000 148.96524 ? 82  VAL E CG1   1 
ATOM 3252  C CG2   . VAL E 1 82  ? 83.86200  127.54700 119.00400 1.000 148.96524 ? 82  VAL E CG2   1 
ATOM 3253  N N     . ASP E 1 83  ? 84.11200  131.08100 117.05200 1.000 149.84818 ? 83  ASP E N     1 
ATOM 3254  C CA    . ASP E 1 83  ? 85.22100  131.76500 116.40500 1.000 149.84818 ? 83  ASP E CA    1 
ATOM 3255  C C     . ASP E 1 83  ? 86.44700  131.72500 117.30200 1.000 149.84818 ? 83  ASP E C     1 
ATOM 3256  O O     . ASP E 1 83  ? 86.35500  131.98200 118.50500 1.000 149.84818 ? 83  ASP E O     1 
ATOM 3257  C CB    . ASP E 1 83  ? 84.85100  133.21100 116.08000 1.000 149.84818 ? 83  ASP E CB    1 
ATOM 3258  C CG    . ASP E 1 83  ? 85.90900  133.91000 115.24800 1.000 149.84818 ? 83  ASP E CG    1 
ATOM 3259  O OD1   . ASP E 1 83  ? 85.78600  133.91400 114.00500 1.000 149.84818 ? 83  ASP E OD1   1 
ATOM 3260  O OD2   . ASP E 1 83  ? 86.86300  134.46100 115.83700 1.000 149.84818 ? 83  ASP E OD2   1 
ATOM 3261  N N     . PHE E 1 84  ? 87.59000  131.39600 116.71500 1.000 132.36718 ? 84  PHE E N     1 
ATOM 3262  C CA    . PHE E 1 84  ? 88.83700  131.33300 117.45300 1.000 132.36718 ? 84  PHE E CA    1 
ATOM 3263  C C     . PHE E 1 84  ? 89.72800  132.50300 117.08300 1.000 132.36718 ? 84  PHE E C     1 
ATOM 3264  O O     . PHE E 1 84  ? 89.60900  133.09400 116.00900 1.000 132.36718 ? 84  PHE E O     1 
ATOM 3265  C CB    . PHE E 1 84  ? 89.57600  130.02800 117.17200 1.000 132.36718 ? 84  PHE E CB    1 
ATOM 3266  C CG    . PHE E 1 84  ? 89.18200  128.91500 118.07800 1.000 132.36718 ? 84  PHE E CG    1 
ATOM 3267  C CD1   . PHE E 1 84  ? 88.13400  129.07200 118.97000 1.000 132.36718 ? 84  PHE E CD1   1 
ATOM 3268  C CD2   . PHE E 1 84  ? 89.86000  127.71500 118.05400 1.000 132.36718 ? 84  PHE E CD2   1 
ATOM 3269  C CE1   . PHE E 1 84  ? 87.76500  128.05100 119.80500 1.000 132.36718 ? 84  PHE E CE1   1 
ATOM 3270  C CE2   . PHE E 1 84  ? 89.49600  126.69200 118.89500 1.000 132.36718 ? 84  PHE E CE2   1 
ATOM 3271  C CZ    . PHE E 1 84  ? 88.44700  126.85900 119.76400 1.000 132.36718 ? 84  PHE E CZ    1 
ATOM 3272  N N     . ASN E 1 85  ? 90.63000  132.82900 117.99000 1.000 132.82417 ? 85  ASN E N     1 
ATOM 3273  C CA    . ASN E 1 85  ? 91.58400  133.89300 117.75600 1.000 132.82417 ? 85  ASN E CA    1 
ATOM 3274  C C     . ASN E 1 85  ? 92.92800  133.28800 117.39800 1.000 132.82417 ? 85  ASN E C     1 
ATOM 3275  O O     . ASN E 1 85  ? 93.24000  132.15800 117.77200 1.000 132.82417 ? 85  ASN E O     1 
ATOM 3276  C CB    . ASN E 1 85  ? 91.71400  134.79300 118.97800 1.000 132.82417 ? 85  ASN E CB    1 
ATOM 3277  C CG    . ASN E 1 85  ? 90.41100  135.45500 119.33800 1.000 132.82417 ? 85  ASN E CG    1 
ATOM 3278  O OD1   . ASN E 1 85  ? 89.64400  135.85500 118.46300 1.000 132.82417 ? 85  ASN E OD1   1 
ATOM 3279  N ND2   . ASN E 1 85  ? 90.14300  135.56900 120.63300 1.000 132.82417 ? 85  ASN E ND2   1 
ATOM 3280  N N     . TRP E 1 86  ? 93.71900  134.04600 116.66200 1.000 127.32608 ? 86  TRP E N     1 
ATOM 3281  C CA    . TRP E 1 86  ? 95.01000  133.58000 116.20100 1.000 127.32608 ? 86  TRP E CA    1 
ATOM 3282  C C     . TRP E 1 86  ? 96.10500  134.48600 116.72600 1.000 127.32608 ? 86  TRP E C     1 
ATOM 3283  O O     . TRP E 1 86  ? 95.90500  135.68800 116.91200 1.000 127.32608 ? 86  TRP E O     1 
ATOM 3284  C CB    . TRP E 1 86  ? 95.06300  133.53900 114.68500 1.000 127.32608 ? 86  TRP E CB    1 
ATOM 3285  C CG    . TRP E 1 86  ? 94.24300  132.45500 114.12900 1.000 127.32608 ? 86  TRP E CG    1 
ATOM 3286  C CD1   . TRP E 1 86  ? 92.89000  132.42700 114.02200 1.000 127.32608 ? 86  TRP E CD1   1 
ATOM 3287  C CD2   . TRP E 1 86  ? 94.71700  131.21800 113.60400 1.000 127.32608 ? 86  TRP E CD2   1 
ATOM 3288  N NE1   . TRP E 1 86  ? 92.48700  131.24500 113.45700 1.000 127.32608 ? 86  TRP E NE1   1 
ATOM 3289  C CE2   . TRP E 1 86  ? 93.59400  130.48200 113.19600 1.000 127.32608 ? 86  TRP E CE2   1 
ATOM 3290  C CE3   . TRP E 1 86  ? 95.98500  130.65600 113.44800 1.000 127.32608 ? 86  TRP E CE3   1 
ATOM 3291  C CZ2   . TRP E 1 86  ? 93.69800  129.22000 112.63500 1.000 127.32608 ? 86  TRP E CZ2   1 
ATOM 3292  C CZ3   . TRP E 1 86  ? 96.08700  129.40300 112.89700 1.000 127.32608 ? 86  TRP E CZ3   1 
ATOM 3293  C CH2   . TRP E 1 86  ? 94.95100  128.69800 112.49400 1.000 127.32608 ? 86  TRP E CH2   1 
ATOM 3294  N N     . GLN E 1 87  ? 97.26200  133.90000 116.97400 1.000 119.31999 ? 87  GLN E N     1 
ATOM 3295  C CA    . GLN E 1 87  ? 98.38400  134.70600 117.40300 1.000 119.31999 ? 87  GLN E CA    1 
ATOM 3296  C C     . GLN E 1 87  ? 99.09900  135.25600 116.18100 1.000 119.31999 ? 87  GLN E C     1 
ATOM 3297  O O     . GLN E 1 87  ? 98.94000  134.76000 115.06500 1.000 119.31999 ? 87  GLN E O     1 
ATOM 3298  C CB    . GLN E 1 87  ? 99.34500  133.89400 118.26000 1.000 119.31999 ? 87  GLN E CB    1 
ATOM 3299  C CG    . GLN E 1 87  ? 98.96800  133.86000 119.71900 1.000 119.31999 ? 87  GLN E CG    1 
ATOM 3300  C CD    . GLN E 1 87  ? 100.17600 133.80900 120.61800 1.000 119.31999 ? 87  GLN E CD    1 
ATOM 3301  O OE1   . GLN E 1 87  ? 101.27400 133.47600 120.17900 1.000 119.31999 ? 87  GLN E OE1   1 
ATOM 3302  N NE2   . GLN E 1 87  ? 99.98200  134.13300 121.88600 1.000 119.31999 ? 87  GLN E NE2   1 
ATOM 3303  N N     . ALA E 1 88  ? 99.89400  136.29800 116.40800 1.000 119.57682 ? 88  ALA E N     1 
ATOM 3304  C CA    . ALA E 1 88  ? 100.57800 136.95100 115.30200 1.000 119.57682 ? 88  ALA E CA    1 
ATOM 3305  C C     . ALA E 1 88  ? 101.69100 136.08500 114.74100 1.000 119.57682 ? 88  ALA E C     1 
ATOM 3306  O O     . ALA E 1 88  ? 101.98900 136.16300 113.54700 1.000 119.57682 ? 88  ALA E O     1 
ATOM 3307  C CB    . ALA E 1 88  ? 101.13300 138.30000 115.75000 1.000 119.57682 ? 88  ALA E CB    1 
ATOM 3308  N N     . GLN E 1 89  ? 102.30300 135.25200 115.57200 1.000 110.23749 ? 89  GLN E N     1 
ATOM 3309  C CA    . GLN E 1 89  ? 103.40000 134.42100 115.11000 1.000 110.23749 ? 89  GLN E CA    1 
ATOM 3310  C C     . GLN E 1 89  ? 102.94100 133.06400 114.61300 1.000 110.23749 ? 89  GLN E C     1 
ATOM 3311  O O     . GLN E 1 89  ? 103.67500 132.42200 113.85000 1.000 110.23749 ? 89  GLN E O     1 
ATOM 3312  C CB    . GLN E 1 89  ? 104.42200 134.23300 116.22800 1.000 110.23749 ? 89  GLN E CB    1 
ATOM 3313  C CG    . GLN E 1 89  ? 105.17300 135.49500 116.55800 1.000 110.23749 ? 89  GLN E CG    1 
ATOM 3314  C CD    . GLN E 1 89  ? 106.07200 135.94100 115.42600 1.000 110.23749 ? 89  GLN E CD    1 
ATOM 3315  O OE1   . GLN E 1 89  ? 107.13800 135.36900 115.20500 1.000 110.23749 ? 89  GLN E OE1   1 
ATOM 3316  N NE2   . GLN E 1 89  ? 105.64900 136.96900 114.70100 1.000 110.23749 ? 89  GLN E NE2   1 
ATOM 3317  N N     . ALA E 1 90  ? 101.75600 132.61800 115.03500 1.000 113.25759 ? 90  ALA E N     1 
ATOM 3318  C CA    . ALA E 1 90  ? 101.24300 131.31900 114.61700 1.000 113.25759 ? 90  ALA E CA    1 
ATOM 3319  C C     . ALA E 1 90  ? 100.98800 131.28000 113.11900 1.000 113.25759 ? 90  ALA E C     1 
ATOM 3320  O O     . ALA E 1 90  ? 101.35600 130.31400 112.44000 1.000 113.25759 ? 90  ALA E O     1 
ATOM 3321  C CB    . ALA E 1 90  ? 99.96400  130.99600 115.38400 1.000 113.25759 ? 90  ALA E CB    1 
ATOM 3322  N N     . LEU E 1 91  ? 100.36200 132.32900 112.58700 1.000 110.65754 ? 91  LEU E N     1 
ATOM 3323  C CA    . LEU E 1 91  ? 100.09000 132.39200 111.15700 1.000 110.65754 ? 91  LEU E CA    1 
ATOM 3324  C C     . LEU E 1 91  ? 101.37800 132.49100 110.35100 1.000 110.65754 ? 91  LEU E C     1 
ATOM 3325  O O     . LEU E 1 91  ? 101.48200 131.90500 109.26700 1.000 110.65754 ? 91  LEU E O     1 
ATOM 3326  C CB    . LEU E 1 91  ? 99.16000  133.56200 110.86500 1.000 110.65754 ? 91  LEU E CB    1 
ATOM 3327  C CG    . LEU E 1 91  ? 97.72200  133.19900 111.23200 1.000 110.65754 ? 91  LEU E CG    1 
ATOM 3328  C CD1   . LEU E 1 91  ? 96.81400  134.41800 111.21500 1.000 110.65754 ? 91  LEU E CD1   1 
ATOM 3329  C CD2   . LEU E 1 91  ? 97.19700  132.11500 110.31700 1.000 110.65754 ? 91  LEU E CD2   1 
ATOM 3330  N N     . LEU E 1 92  ? 102.37200 133.21100 110.87300 1.000 105.31581 ? 92  LEU E N     1 
ATOM 3331  C CA    . LEU E 1 92  ? 103.66500 133.30200 110.20300 1.000 105.31581 ? 92  LEU E CA    1 
ATOM 3332  C C     . LEU E 1 92  ? 104.36500 131.95100 110.16000 1.000 105.31581 ? 92  LEU E C     1 
ATOM 3333  O O     . LEU E 1 92  ? 104.92100 131.56800 109.12100 1.000 105.31581 ? 92  LEU E O     1 
ATOM 3334  C CB    . LEU E 1 92  ? 104.55100 134.32900 110.90400 1.000 105.31581 ? 92  LEU E CB    1 
ATOM 3335  C CG    . LEU E 1 92  ? 104.58900 135.74700 110.34200 1.000 105.31581 ? 92  LEU E CG    1 
ATOM 3336  C CD1   . LEU E 1 92  ? 105.01200 135.69500 108.89500 1.000 105.31581 ? 92  LEU E CD1   1 
ATOM 3337  C CD2   . LEU E 1 92  ? 103.25600 136.45100 110.47900 1.000 105.31581 ? 92  LEU E CD2   1 
ATOM 3338  N N     . ALA E 1 93  ? 104.33500 131.21500 111.27400 1.000 110.99419 ? 93  ALA E N     1 
ATOM 3339  C CA    . ALA E 1 93  ? 104.94200 129.88800 111.31300 1.000 110.99419 ? 93  ALA E CA    1 
ATOM 3340  C C     . ALA E 1 93  ? 104.22200 128.92000 110.38400 1.000 110.99419 ? 93  ALA E C     1 
ATOM 3341  O O     . ALA E 1 93  ? 104.86400 128.10800 109.70200 1.000 110.99419 ? 93  ALA E O     1 
ATOM 3342  C CB    . ALA E 1 93  ? 104.94100 129.35600 112.74300 1.000 110.99419 ? 93  ALA E CB    1 
ATOM 3343  N N     . LEU E 1 94  ? 102.89200 129.01800 110.32600 1.000 111.16580 ? 94  LEU E N     1 
ATOM 3344  C CA    . LEU E 1 94  ? 102.11800 128.16200 109.43700 1.000 111.16580 ? 94  LEU E CA    1 
ATOM 3345  C C     . LEU E 1 94  ? 102.42500 128.46100 107.97800 1.000 111.16580 ? 94  LEU E C     1 
ATOM 3346  O O     . LEU E 1 94  ? 102.54800 127.53600 107.16500 1.000 111.16580 ? 94  LEU E O     1 
ATOM 3347  C CB    . LEU E 1 94  ? 100.63100 128.33800 109.71800 1.000 111.16580 ? 94  LEU E CB    1 
ATOM 3348  C CG    . LEU E 1 94  ? 99.71000  127.32200 109.05300 1.000 111.16580 ? 94  LEU E CG    1 
ATOM 3349  C CD1   . LEU E 1 94  ? 100.08300 125.92800 109.49200 1.000 111.16580 ? 94  LEU E CD1   1 
ATOM 3350  C CD2   . LEU E 1 94  ? 98.26800  127.61000 109.38800 1.000 111.16580 ? 94  LEU E CD2   1 
ATOM 3351  N N     . GLN E 1 95  ? 102.57000 129.74400 107.63300 1.000 122.43494 ? 95  GLN E N     1 
ATOM 3352  C CA    . GLN E 1 95  ? 102.92000 130.11100 106.26600 1.000 122.43494 ? 95  GLN E CA    1 
ATOM 3353  C C     . GLN E 1 95  ? 104.31400 129.62900 105.89600 1.000 122.43494 ? 95  GLN E C     1 
ATOM 3354  O O     . GLN E 1 95  ? 104.53200 129.16700 104.76800 1.000 122.43494 ? 95  GLN E O     1 
ATOM 3355  C CB    . GLN E 1 95  ? 102.81800 131.62000 106.07800 1.000 122.43494 ? 95  GLN E CB    1 
ATOM 3356  C CG    . GLN E 1 95  ? 102.45200 132.02100 104.67000 1.000 122.43494 ? 95  GLN E CG    1 
ATOM 3357  C CD    . GLN E 1 95  ? 102.56500 133.50800 104.44500 1.000 122.43494 ? 95  GLN E CD    1 
ATOM 3358  O OE1   . GLN E 1 95  ? 102.24700 134.30600 105.32300 1.000 122.43494 ? 95  GLN E OE1   1 
ATOM 3359  N NE2   . GLN E 1 95  ? 103.03700 133.89300 103.26700 1.000 122.43494 ? 95  GLN E NE2   1 
ATOM 3360  N N     . GLU E 1 96  ? 105.26300 129.72600 106.83300 1.000 123.24270 ? 96  GLU E N     1 
ATOM 3361  C CA    . GLU E 1 96  ? 106.61200 129.23000 106.58000 1.000 123.24270 ? 96  GLU E CA    1 
ATOM 3362  C C     . GLU E 1 96  ? 106.62000 127.72400 106.34800 1.000 123.24270 ? 96  GLU E C     1 
ATOM 3363  O O     . GLU E 1 96  ? 107.27800 127.23500 105.41600 1.000 123.24270 ? 96  GLU E O     1 
ATOM 3364  C CB    . GLU E 1 96  ? 107.52900 129.59600 107.74300 1.000 123.24270 ? 96  GLU E CB    1 
ATOM 3365  C CG    . GLU E 1 96  ? 108.96300 129.14200 107.55800 1.000 123.24270 ? 96  GLU E CG    1 
ATOM 3366  C CD    . GLU E 1 96  ? 109.83900 130.21000 106.94000 1.000 123.24270 ? 96  GLU E CD    1 
ATOM 3367  O OE1   . GLU E 1 96  ? 109.46800 131.39800 107.01600 1.000 123.24270 ? 96  GLU E OE1   1 
ATOM 3368  O OE2   . GLU E 1 96  ? 110.89900 129.86500 106.37800 1.000 123.24270 ? 96  GLU E OE2   1 
ATOM 3369  N N     . ALA E 1 97  ? 105.86600 126.98100 107.16000 1.000 123.22189 ? 97  ALA E N     1 
ATOM 3370  C CA    . ALA E 1 97  ? 105.81400 125.53200 106.99900 1.000 123.22189 ? 97  ALA E CA    1 
ATOM 3371  C C     . ALA E 1 97  ? 105.14500 125.13100 105.68900 1.000 123.22189 ? 97  ALA E C     1 
ATOM 3372  O O     . ALA E 1 97  ? 105.59700 124.19300 105.01800 1.000 123.22189 ? 97  ALA E O     1 
ATOM 3373  C CB    . ALA E 1 97  ? 105.08500 124.90700 108.18100 1.000 123.22189 ? 97  ALA E CB    1 
ATOM 3374  N N     . ALA E 1 98  ? 104.07700 125.83900 105.30600 1.000 126.41258 ? 98  ALA E N     1 
ATOM 3375  C CA    . ALA E 1 98  ? 103.39100 125.53800 104.05300 1.000 126.41258 ? 98  ALA E CA    1 
ATOM 3376  C C     . ALA E 1 98  ? 104.27500 125.83200 102.85000 1.000 126.41258 ? 98  ALA E C     1 
ATOM 3377  O O     . ALA E 1 98  ? 104.27500 125.06700 101.87600 1.000 126.41258 ? 98  ALA E O     1 
ATOM 3378  C CB    . ALA E 1 98  ? 102.08900 126.32500 103.96600 1.000 126.41258 ? 98  ALA E CB    1 
ATOM 3379  N N     . GLU E 1 99  ? 105.02000 126.94000 102.89700 1.000 132.04921 ? 99  GLU E N     1 
ATOM 3380  C CA    . GLU E 1 99  ? 105.95300 127.25900 101.82300 1.000 132.04921 ? 99  GLU E CA    1 
ATOM 3381  C C     . GLU E 1 99  ? 107.04700 126.20800 101.70500 1.000 132.04921 ? 99  GLU E C     1 
ATOM 3382  O O     . GLU E 1 99  ? 107.43700 125.83700 100.59100 1.000 132.04921 ? 99  GLU E O     1 
ATOM 3383  C CB    . GLU E 1 99  ? 106.56200 128.63500 102.05500 1.000 132.04921 ? 99  GLU E CB    1 
ATOM 3384  C CG    . GLU E 1 99  ? 105.83000 129.74600 101.35200 1.000 132.04921 ? 99  GLU E CG    1 
ATOM 3385  C CD    . GLU E 1 99  ? 106.50200 131.08400 101.54500 1.000 132.04921 ? 99  GLU E CD    1 
ATOM 3386  O OE1   . GLU E 1 99  ? 107.10400 131.29500 102.61700 1.000 132.04921 ? 99  GLU E OE1   1 
ATOM 3387  O OE2   . GLU E 1 99  ? 106.41600 131.93200 100.64100 1.000 132.04921 ? 99  GLU E OE2   1 
ATOM 3388  N N     . ALA E 1 100 ? 107.56900 125.73300 102.84200 1.000 129.38423 ? 100 ALA E N     1 
ATOM 3389  C CA    . ALA E 1 100 ? 108.58500 124.68100 102.81400 1.000 129.38423 ? 100 ALA E CA    1 
ATOM 3390  C C     . ALA E 1 100 ? 108.04100 123.38400 102.21900 1.000 129.38423 ? 100 ALA E C     1 
ATOM 3391  O O     . ALA E 1 100 ? 108.72200 122.72300 101.42100 1.000 129.38423 ? 100 ALA E O     1 
ATOM 3392  C CB    . ALA E 1 100 ? 109.12400 124.44300 104.22000 1.000 129.38423 ? 100 ALA E CB    1 
ATOM 3393  N N     . PHE E 1 101 ? 106.81500 123.01100 102.60000 1.000 121.07809 ? 101 PHE E N     1 
ATOM 3394  C CA    . PHE E 1 101 ? 106.16200 121.82700 102.04300 1.000 121.07809 ? 101 PHE E CA    1 
ATOM 3395  C C     . PHE E 1 101 ? 105.98900 121.93700 100.53400 1.000 121.07809 ? 101 PHE E C     1 
ATOM 3396  O O     . PHE E 1 101 ? 106.28600 120.99200 99.78700  1.000 121.07809 ? 101 PHE E O     1 
ATOM 3397  C CB    . PHE E 1 101 ? 104.80700 121.63200 102.71400 1.000 121.07809 ? 101 PHE E CB    1 
ATOM 3398  C CG    . PHE E 1 101 ? 104.17200 120.32000 102.41900 1.000 121.07809 ? 101 PHE E CG    1 
ATOM 3399  C CD1   . PHE E 1 101 ? 104.76400 119.14300 102.82500 1.000 121.07809 ? 101 PHE E CD1   1 
ATOM 3400  C CD2   . PHE E 1 101 ? 102.98000 120.26700 101.72600 1.000 121.07809 ? 101 PHE E CD2   1 
ATOM 3401  C CE1   . PHE E 1 101 ? 104.17400 117.93500 102.54900 1.000 121.07809 ? 101 PHE E CE1   1 
ATOM 3402  C CE2   . PHE E 1 101 ? 102.38600 119.06400 101.44700 1.000 121.07809 ? 101 PHE E CE2   1 
ATOM 3403  C CZ    . PHE E 1 101 ? 102.98300 117.89600 101.85700 1.000 121.07809 ? 101 PHE E CZ    1 
ATOM 3404  N N     . LEU E 1 102 ? 105.51100 123.09300 100.07100 1.000 124.44675 ? 102 LEU E N     1 
ATOM 3405  C CA    . LEU E 1 102 ? 105.25800 123.27300 98.64900  1.000 124.44675 ? 102 LEU E CA    1 
ATOM 3406  C C     . LEU E 1 102 ? 106.55200 123.29200 97.85300  1.000 124.44675 ? 102 LEU E C     1 
ATOM 3407  O O     . LEU E 1 102 ? 106.60600 122.75100 96.74100  1.000 124.44675 ? 102 LEU E O     1 
ATOM 3408  C CB    . LEU E 1 102 ? 104.48300 124.55800 98.41900  1.000 124.44675 ? 102 LEU E CB    1 
ATOM 3409  C CG    . LEU E 1 102 ? 103.01500 124.47100 98.79500  1.000 124.44675 ? 102 LEU E CG    1 
ATOM 3410  C CD1   . LEU E 1 102 ? 102.41400 125.82600 98.59300  1.000 124.44675 ? 102 LEU E CD1   1 
ATOM 3411  C CD2   . LEU E 1 102 ? 102.31800 123.43900 97.94200  1.000 124.44675 ? 102 LEU E CD2   1 
ATOM 3412  N N     . VAL E 1 103 ? 107.60100 123.91100 98.40200  1.000 126.79266 ? 103 VAL E N     1 
ATOM 3413  C CA    . VAL E 1 103 ? 108.86300 123.95100 97.68000  1.000 126.79266 ? 103 VAL E CA    1 
ATOM 3414  C C     . VAL E 1 103 ? 109.49100 122.56100 97.62300  1.000 126.79266 ? 103 VAL E C     1 
ATOM 3415  O O     . VAL E 1 103 ? 110.11000 122.21300 96.61300  1.000 126.79266 ? 103 VAL E O     1 
ATOM 3416  C CB    . VAL E 1 103 ? 109.80000 125.04200 98.25100  1.000 126.79266 ? 103 VAL E CB    1 
ATOM 3417  C CG1   . VAL E 1 103 ? 110.55900 124.61500 99.48900  1.000 126.79266 ? 103 VAL E CG1   1 
ATOM 3418  C CG2   . VAL E 1 103 ? 110.76600 125.49800 97.19100  1.000 126.79266 ? 103 VAL E CG2   1 
ATOM 3419  N N     . HIS E 1 104 ? 109.30700 121.73000 98.66400  1.000 130.74450 ? 104 HIS E N     1 
ATOM 3420  C CA    . HIS E 1 104 ? 109.75500 120.33800 98.59500  1.000 130.74450 ? 104 HIS E CA    1 
ATOM 3421  C C     . HIS E 1 104 ? 109.01900 119.56500 97.51300  1.000 130.74450 ? 104 HIS E C     1 
ATOM 3422  O O     . HIS E 1 104 ? 109.64200 118.81900 96.74700  1.000 130.74450 ? 104 HIS E O     1 
ATOM 3423  C CB    . HIS E 1 104 ? 109.58900 119.63700 99.93700  1.000 130.74450 ? 104 HIS E CB    1 
ATOM 3424  C CG    . HIS E 1 104 ? 110.71000 119.89200 100.88800 1.000 130.74450 ? 104 HIS E CG    1 
ATOM 3425  N ND1   . HIS E 1 104 ? 110.58800 120.71700 101.98400 1.000 130.74450 ? 104 HIS E ND1   1 
ATOM 3426  C CD2   . HIS E 1 104 ? 111.98000 119.42600 100.90400 1.000 130.74450 ? 104 HIS E CD2   1 
ATOM 3427  C CE1   . HIS E 1 104 ? 111.73700 120.74700 102.63700 1.000 130.74450 ? 104 HIS E CE1   1 
ATOM 3428  N NE2   . HIS E 1 104 ? 112.59800 119.97300 102.00200 1.000 130.74450 ? 104 HIS E NE2   1 
ATOM 3429  N N     . LEU E 1 105 ? 107.68700 119.69400 97.47300  1.000 128.33063 ? 105 LEU E N     1 
ATOM 3430  C CA    . LEU E 1 105 ? 106.89100 118.99800 96.46100  1.000 128.33063 ? 105 LEU E CA    1 
ATOM 3431  C C     . LEU E 1 105 ? 107.29200 119.40500 95.05100  1.000 128.33063 ? 105 LEU E C     1 
ATOM 3432  O O     . LEU E 1 105 ? 107.43100 118.55900 94.16200  1.000 128.33063 ? 105 LEU E O     1 
ATOM 3433  C CB    . LEU E 1 105 ? 105.40200 119.24900 96.67500  1.000 128.33063 ? 105 LEU E CB    1 
ATOM 3434  C CG    . LEU E 1 105 ? 104.64400 118.06800 97.27300  1.000 128.33063 ? 105 LEU E CG    1 
ATOM 3435  C CD1   . LEU E 1 105 ? 105.20300 117.68100 98.62200  1.000 128.33063 ? 105 LEU E CD1   1 
ATOM 3436  C CD2   . LEU E 1 105 ? 103.16000 118.36800 97.36300  1.000 128.33063 ? 105 LEU E CD2   1 
ATOM 3437  N N     . PHE E 1 106 ? 107.45000 120.70100 94.81500  1.000 127.23428 ? 106 PHE E N     1 
ATOM 3438  C CA    . PHE E 1 106 ? 107.81600 121.13000 93.47500  1.000 127.23428 ? 106 PHE E CA    1 
ATOM 3439  C C     . PHE E 1 106 ? 109.23600 120.70900 93.11400  1.000 127.23428 ? 106 PHE E C     1 
ATOM 3440  O O     . PHE E 1 106 ? 109.48200 120.23800 91.99500  1.000 127.23428 ? 106 PHE E O     1 
ATOM 3441  C CB    . PHE E 1 106 ? 107.62700 122.63200 93.34500  1.000 127.23428 ? 106 PHE E CB    1 
ATOM 3442  C CG    . PHE E 1 106 ? 106.20600 123.01900 93.12100  1.000 127.23428 ? 106 PHE E CG    1 
ATOM 3443  C CD1   . PHE E 1 106 ? 105.35100 122.16900 92.44800  1.000 127.23428 ? 106 PHE E CD1   1 
ATOM 3444  C CD2   . PHE E 1 106 ? 105.71600 124.21800 93.59400  1.000 127.23428 ? 106 PHE E CD2   1 
ATOM 3445  C CE1   . PHE E 1 106 ? 104.03900 122.50800 92.24700  1.000 127.23428 ? 106 PHE E CE1   1 
ATOM 3446  C CE2   . PHE E 1 106 ? 104.40200 124.56600 93.39000  1.000 127.23428 ? 106 PHE E CE2   1 
ATOM 3447  C CZ    . PHE E 1 106 ? 103.56400 123.70800 92.71700  1.000 127.23428 ? 106 PHE E CZ    1 
ATOM 3448  N N     . GLU E 1 107 ? 110.17300 120.80700 94.06100  1.000 135.28553 ? 107 GLU E N     1 
ATOM 3449  C CA    . GLU E 1 107 ? 111.55100 120.46500 93.74400  1.000 135.28553 ? 107 GLU E CA    1 
ATOM 3450  C C     . GLU E 1 107 ? 111.78500 118.96700 93.60900  1.000 135.28553 ? 107 GLU E C     1 
ATOM 3451  O O     . GLU E 1 107 ? 112.74300 118.57700 92.93700  1.000 135.28553 ? 107 GLU E O     1 
ATOM 3452  C CB    . GLU E 1 107 ? 112.48800 121.07200 94.79300  1.000 135.28553 ? 107 GLU E CB    1 
ATOM 3453  C CG    . GLU E 1 107 ? 112.67100 120.26400 96.06500  1.000 135.28553 ? 107 GLU E CG    1 
ATOM 3454  C CD    . GLU E 1 107 ? 113.57500 120.95700 97.06400  1.000 135.28553 ? 107 GLU E CD    1 
ATOM 3455  O OE1   . GLU E 1 107 ? 113.17000 121.08800 98.23900  1.000 135.28553 ? 107 GLU E OE1   1 
ATOM 3456  O OE2   . GLU E 1 107 ? 114.68700 121.37200 96.67700  1.000 135.28553 ? 107 GLU E OE2   1 
ATOM 3457  N N     . ASP E 1 108 ? 110.96000 118.11100 94.21800  1.000 144.57263 ? 108 ASP E N     1 
ATOM 3458  C CA    . ASP E 1 108 ? 111.13100 116.69500 93.91500  1.000 144.57263 ? 108 ASP E CA    1 
ATOM 3459  C C     . ASP E 1 108 ? 110.23500 116.22500 92.77500  1.000 144.57263 ? 108 ASP E C     1 
ATOM 3460  O O     . ASP E 1 108 ? 110.47300 115.14300 92.23100  1.000 144.57263 ? 108 ASP E O     1 
ATOM 3461  C CB    . ASP E 1 108 ? 111.01400 115.80700 95.17500  1.000 144.57263 ? 108 ASP E CB    1 
ATOM 3462  C CG    . ASP E 1 108 ? 109.65200 115.82500 95.84600  1.000 144.57263 ? 108 ASP E CG    1 
ATOM 3463  O OD1   . ASP E 1 108 ? 109.54000 115.19200 96.91700  1.000 144.57263 ? 108 ASP E OD1   1 
ATOM 3464  O OD2   . ASP E 1 108 ? 108.69700 116.42300 95.34600  1.000 144.57263 ? 108 ASP E OD2   1 
ATOM 3465  N N     . ALA E 1 109 ? 109.21900 116.99900 92.39000  1.000 135.66817 ? 109 ALA E N     1 
ATOM 3466  C CA    . ALA E 1 109 ? 108.41300 116.57500 91.25600  1.000 135.66817 ? 109 ALA E CA    1 
ATOM 3467  C C     . ALA E 1 109 ? 109.00400 117.02500 89.93000  1.000 135.66817 ? 109 ALA E C     1 
ATOM 3468  O O     . ALA E 1 109 ? 108.76400 116.37500 88.90200  1.000 135.66817 ? 109 ALA E O     1 
ATOM 3469  C CB    . ALA E 1 109 ? 106.98700 117.10800 91.39000  1.000 135.66817 ? 109 ALA E CB    1 
ATOM 3470  N N     . TYR E 1 110 ? 109.77900 118.11800 89.92900  1.000 141.50119 ? 110 TYR E N     1 
ATOM 3471  C CA    . TYR E 1 110 ? 110.39700 118.57400 88.68600  1.000 141.50119 ? 110 TYR E CA    1 
ATOM 3472  C C     . TYR E 1 110 ? 111.42200 117.57100 88.17600  1.000 141.50119 ? 110 TYR E C     1 
ATOM 3473  O O     . TYR E 1 110 ? 111.57500 117.38600 86.96100  1.000 141.50119 ? 110 TYR E O     1 
ATOM 3474  C CB    . TYR E 1 110 ? 111.05200 119.93700 88.87000  1.000 141.50119 ? 110 TYR E CB    1 
ATOM 3475  C CG    . TYR E 1 110 ? 111.46400 120.54600 87.55600  1.000 141.50119 ? 110 TYR E CG    1 
ATOM 3476  C CD1   . TYR E 1 110 ? 110.62200 120.49000 86.46000  1.000 141.50119 ? 110 TYR E CD1   1 
ATOM 3477  C CD2   . TYR E 1 110 ? 112.70700 121.13700 87.39800  1.000 141.50119 ? 110 TYR E CD2   1 
ATOM 3478  C CE1   . TYR E 1 110 ? 110.98700 121.02500 85.25300  1.000 141.50119 ? 110 TYR E CE1   1 
ATOM 3479  C CE2   . TYR E 1 110 ? 113.08600 121.67800 86.18900  1.000 141.50119 ? 110 TYR E CE2   1 
ATOM 3480  C CZ    . TYR E 1 110 ? 112.21900 121.61800 85.12200  1.000 141.50119 ? 110 TYR E CZ    1 
ATOM 3481  O OH    . TYR E 1 110 ? 112.58800 122.15400 83.91200  1.000 141.50119 ? 110 TYR E OH    1 
ATOM 3482  N N     . LEU E 1 111 ? 112.13300 116.91500 89.09000  1.000 137.49487 ? 111 LEU E N     1 
ATOM 3483  C CA    . LEU E 1 111 ? 113.06700 115.88000 88.67700  1.000 137.49487 ? 111 LEU E CA    1 
ATOM 3484  C C     . LEU E 1 111 ? 112.34000 114.64700 88.15300  1.000 137.49487 ? 111 LEU E C     1 
ATOM 3485  O O     . LEU E 1 111 ? 112.87300 113.94500 87.28800  1.000 137.49487 ? 111 LEU E O     1 
ATOM 3486  C CB    . LEU E 1 111 ? 114.04000 115.59300 89.82300  1.000 137.49487 ? 111 LEU E CB    1 
ATOM 3487  C CG    . LEU E 1 111 ? 113.62400 115.09000 91.20500  1.000 137.49487 ? 111 LEU E CG    1 
ATOM 3488  C CD1   . LEU E 1 111 ? 113.36700 113.61100 91.27900  1.000 137.49487 ? 111 LEU E CD1   1 
ATOM 3489  C CD2   . LEU E 1 111 ? 114.67200 115.49800 92.22300  1.000 137.49487 ? 111 LEU E CD2   1 
ATOM 3490  N N     . LEU E 1 112 ? 111.14200 114.35900 88.66300  1.000 134.98174 ? 112 LEU E N     1 
ATOM 3491  C CA    . LEU E 1 112 ? 110.31500 113.32100 88.05200  1.000 134.98174 ? 112 LEU E CA    1 
ATOM 3492  C C     . LEU E 1 112 ? 109.90800 113.68600 86.63600  1.000 134.98174 ? 112 LEU E C     1 
ATOM 3493  O O     . LEU E 1 112 ? 109.83800 112.81300 85.76400  1.000 134.98174 ? 112 LEU E O     1 
ATOM 3494  C CB    . LEU E 1 112 ? 109.07300 113.05400 88.88800  1.000 134.98174 ? 112 LEU E CB    1 
ATOM 3495  C CG    . LEU E 1 112 ? 109.16200 111.77800 89.70400  1.000 134.98174 ? 112 LEU E CG    1 
ATOM 3496  C CD1   . LEU E 1 112 ? 110.07400 111.97900 90.85900  1.000 134.98174 ? 112 LEU E CD1   1 
ATOM 3497  C CD2   . LEU E 1 112 ? 107.77700 111.40800 90.18100  1.000 134.98174 ? 112 LEU E CD2   1 
ATOM 3498  N N     . THR E 1 113 ? 109.58800 114.95800 86.40300  1.000 140.70016 ? 113 THR E N     1 
ATOM 3499  C CA    . THR E 1 113 ? 109.21800 115.37800 85.05400  1.000 140.70016 ? 113 THR E CA    1 
ATOM 3500  C C     . THR E 1 113 ? 110.39900 115.25400 84.10800  1.000 140.70016 ? 113 THR E C     1 
ATOM 3501  O O     . THR E 1 113 ? 110.26100 114.73000 82.99800  1.000 140.70016 ? 113 THR E O     1 
ATOM 3502  C CB    . THR E 1 113 ? 108.69800 116.80400 85.04500  1.000 140.70016 ? 113 THR E CB    1 
ATOM 3503  O OG1   . THR E 1 113 ? 109.71600 117.66500 85.54500  1.000 140.70016 ? 113 THR E OG1   1 
ATOM 3504  C CG2   . THR E 1 113 ? 107.48800 116.91200 85.91100  1.000 140.70016 ? 113 THR E CG2   1 
ATOM 3505  N N     . LEU E 1 114 ? 111.57600 115.72400 84.53100  1.000 145.43389 ? 114 LEU E N     1 
ATOM 3506  C CA    . LEU E 1 114 ? 112.74000 115.56300 83.66800  1.000 145.43389 ? 114 LEU E CA    1 
ATOM 3507  C C     . LEU E 1 114 ? 113.19800 114.11300 83.59200  1.000 145.43389 ? 114 LEU E C     1 
ATOM 3508  O O     . LEU E 1 114 ? 113.98600 113.77700 82.70300  1.000 145.43389 ? 114 LEU E O     1 
ATOM 3509  C CB    . LEU E 1 114 ? 113.88800 116.47300 84.11100  1.000 145.43389 ? 114 LEU E CB    1 
ATOM 3510  C CG    . LEU E 1 114 ? 114.73100 116.26300 85.36600  1.000 145.43389 ? 114 LEU E CG    1 
ATOM 3511  C CD1   . LEU E 1 114 ? 116.01300 115.48400 85.09000  1.000 145.43389 ? 114 LEU E CD1   1 
ATOM 3512  C CD2   . LEU E 1 114 ? 115.06200 117.61500 85.98000  1.000 145.43389 ? 114 LEU E CD2   1 
ATOM 3513  N N     . HIS E 1 115 ? 112.72500 113.25300 84.49300  1.000 138.75394 ? 115 HIS E N     1 
ATOM 3514  C CA    . HIS E 1 115 ? 112.98600 111.82900 84.36600  1.000 138.75394 ? 115 HIS E CA    1 
ATOM 3515  C C     . HIS E 1 115 ? 112.13000 111.21300 83.27400  1.000 138.75394 ? 115 HIS E C     1 
ATOM 3516  O O     . HIS E 1 115 ? 112.54600 110.24300 82.63200  1.000 138.75394 ? 115 HIS E O     1 
ATOM 3517  C CB    . HIS E 1 115 ? 112.71800 111.12400 85.69100  1.000 138.75394 ? 115 HIS E CB    1 
ATOM 3518  C CG    . HIS E 1 115 ? 112.84300 109.63700 85.61600  1.000 138.75394 ? 115 HIS E CG    1 
ATOM 3519  N ND1   . HIS E 1 115 ? 111.83400 108.78700 86.01300  1.000 138.75394 ? 115 HIS E ND1   1 
ATOM 3520  C CD2   . HIS E 1 115 ? 113.84800 108.84800 85.17400  1.000 138.75394 ? 115 HIS E CD2   1 
ATOM 3521  C CE1   . HIS E 1 115 ? 112.21700 107.53800 85.82600  1.000 138.75394 ? 115 HIS E CE1   1 
ATOM 3522  N NE2   . HIS E 1 115 ? 113.43500 107.54700 85.31800  1.000 138.75394 ? 115 HIS E NE2   1 
ATOM 3523  N N     . ALA E 1 116 ? 110.95300 111.77900 83.02200  1.000 141.47342 ? 116 ALA E N     1 
ATOM 3524  C CA    . ALA E 1 116 ? 110.11200 111.25800 81.96000  1.000 141.47342 ? 116 ALA E CA    1 
ATOM 3525  C C     . ALA E 1 116 ? 110.55300 111.75600 80.59700  1.000 141.47342 ? 116 ALA E C     1 
ATOM 3526  O O     . ALA E 1 116 ? 110.14200 111.18700 79.58100  1.000 141.47342 ? 116 ALA E O     1 
ATOM 3527  C CB    . ALA E 1 116 ? 108.65300 111.63600 82.20200  1.000 141.47342 ? 116 ALA E CB    1 
ATOM 3528  N N     . GLY E 1 117 ? 111.37000 112.80400 80.55200  1.000 142.85507 ? 117 GLY E N     1 
ATOM 3529  C CA    . GLY E 1 117 ? 111.90200 113.33600 79.31900  1.000 142.85507 ? 117 GLY E CA    1 
ATOM 3530  C C     . GLY E 1 117 ? 111.43300 114.73100 78.97900  1.000 142.85507 ? 117 GLY E C     1 
ATOM 3531  O O     . GLY E 1 117 ? 112.06100 115.39100 78.14400  1.000 142.85507 ? 117 GLY E O     1 
ATOM 3532  N N     . ARG E 1 118 ? 110.36800 115.20800 79.60500  1.000 144.50503 ? 118 ARG E N     1 
ATOM 3533  C CA    . ARG E 1 118 ? 109.82600 116.52200 79.30700  1.000 144.50503 ? 118 ARG E CA    1 
ATOM 3534  C C     . ARG E 1 118 ? 110.22400 117.51500 80.38900  1.000 144.50503 ? 118 ARG E C     1 
ATOM 3535  O O     . ARG E 1 118 ? 110.77400 117.15300 81.42800  1.000 144.50503 ? 118 ARG E O     1 
ATOM 3536  C CB    . ARG E 1 118 ? 108.30700 116.45600 79.17800  1.000 144.50503 ? 118 ARG E CB    1 
ATOM 3537  C CG    . ARG E 1 118 ? 107.65700 115.49200 80.12200  1.000 144.50503 ? 118 ARG E CG    1 
ATOM 3538  C CD    . ARG E 1 118 ? 106.16200 115.67000 80.09400  1.000 144.50503 ? 118 ARG E CD    1 
ATOM 3539  N NE    . ARG E 1 118 ? 105.47700 114.48100 80.57100  1.000 144.50503 ? 118 ARG E NE    1 
ATOM 3540  C CZ    . ARG E 1 118 ? 105.17300 114.27400 81.84400  1.000 144.50503 ? 118 ARG E CZ    1 
ATOM 3541  N NH1   . ARG E 1 118 ? 105.49600 115.18100 82.75100  1.000 144.50503 ? 118 ARG E NH1   1 
ATOM 3542  N NH2   . ARG E 1 118 ? 104.54500 113.16800 82.20800  1.000 144.50503 ? 118 ARG E NH2   1 
ATOM 3543  N N     . VAL E 1 119 ? 109.95200 118.79000 80.12500  1.000 142.41647 ? 119 VAL E N     1 
ATOM 3544  C CA    . VAL E 1 119 ? 110.29700 119.85600 81.05900  1.000 142.41647 ? 119 VAL E CA    1 
ATOM 3545  C C     . VAL E 1 119 ? 109.08200 120.52700 81.67400  1.000 142.41647 ? 119 VAL E C     1 
ATOM 3546  O O     . VAL E 1 119 ? 109.25200 121.37900 82.56000  1.000 142.41647 ? 119 VAL E O     1 
ATOM 3547  C CB    . VAL E 1 119 ? 111.19700 120.91700 80.39600  1.000 142.41647 ? 119 VAL E CB    1 
ATOM 3548  C CG1   . VAL E 1 119 ? 112.40600 120.26100 79.77300  1.000 142.41647 ? 119 VAL E CG1   1 
ATOM 3549  C CG2   . VAL E 1 119 ? 110.41500 121.67000 79.35000  1.000 142.41647 ? 119 VAL E CG2   1 
ATOM 3550  N N     . THR E 1 120 ? 107.87400 120.18600 81.24600  1.000 140.16848 ? 120 THR E N     1 
ATOM 3551  C CA    . THR E 1 120 ? 106.67500 120.79400 81.79900  1.000 140.16848 ? 120 THR E CA    1 
ATOM 3552  C C     . THR E 1 120 ? 106.20100 119.97000 82.98400  1.000 140.16848 ? 120 THR E C     1 
ATOM 3553  O O     . THR E 1 120 ? 106.04800 118.75100 82.87500  1.000 140.16848 ? 120 THR E O     1 
ATOM 3554  C CB    . THR E 1 120 ? 105.57300 120.86400 80.75000  1.000 140.16848 ? 120 THR E CB    1 
ATOM 3555  O OG1   . THR E 1 120 ? 105.44900 119.58600 80.12100  1.000 140.16848 ? 120 THR E OG1   1 
ATOM 3556  C CG2   . THR E 1 120 ? 105.91500 121.88700 79.70800  1.000 140.16848 ? 120 THR E CG2   1 
ATOM 3557  N N     . LEU E 1 121 ? 105.96000 120.63600 84.10700  1.000 130.56322 ? 121 LEU E N     1 
ATOM 3558  C CA    . LEU E 1 121 ? 105.42900 119.94900 85.27400  1.000 130.56322 ? 121 LEU E CA    1 
ATOM 3559  C C     . LEU E 1 121 ? 103.96100 119.60900 85.06200  1.000 130.56322 ? 121 LEU E C     1 
ATOM 3560  O O     . LEU E 1 121 ? 103.18200 120.43500 84.58700  1.000 130.56322 ? 121 LEU E O     1 
ATOM 3561  C CB    . LEU E 1 121 ? 105.60900 120.81500 86.51500  1.000 130.56322 ? 121 LEU E CB    1 
ATOM 3562  C CG    . LEU E 1 121 ? 104.97300 120.34100 87.81600  1.000 130.56322 ? 121 LEU E CG    1 
ATOM 3563  C CD1   . LEU E 1 121 ? 105.54800 119.02100 88.25100  1.000 130.56322 ? 121 LEU E CD1   1 
ATOM 3564  C CD2   . LEU E 1 121 ? 105.18400 121.37800 88.88600  1.000 130.56322 ? 121 LEU E CD2   1 
ATOM 3565  N N     . PHE E 1 122 ? 103.58400 118.38500 85.40800  1.000 136.41381 ? 122 PHE E N     1 
ATOM 3566  C CA    . PHE E 1 122 ? 102.22100 117.92900 85.20900  1.000 136.41381 ? 122 PHE E CA    1 
ATOM 3567  C C     . PHE E 1 122 ? 101.59800 117.50100 86.53000  1.000 136.41381 ? 122 PHE E C     1 
ATOM 3568  O O     . PHE E 1 122 ? 102.30800 117.04500 87.43000  1.000 136.41381 ? 122 PHE E O     1 
ATOM 3569  C CB    . PHE E 1 122 ? 102.16700 116.76000 84.21700  1.000 136.41381 ? 122 PHE E CB    1 
ATOM 3570  C CG    . PHE E 1 122 ? 102.12800 117.18500 82.78700  1.000 136.41381 ? 122 PHE E CG    1 
ATOM 3571  C CD1   . PHE E 1 122 ? 101.75900 118.47300 82.44500  1.000 136.41381 ? 122 PHE E CD1   1 
ATOM 3572  C CD2   . PHE E 1 122 ? 102.42500 116.28800 81.78100  1.000 136.41381 ? 122 PHE E CD2   1 
ATOM 3573  C CE1   . PHE E 1 122 ? 101.71000 118.86400 81.12600  1.000 136.41381 ? 122 PHE E CE1   1 
ATOM 3574  C CE2   . PHE E 1 122 ? 102.37900 116.67200 80.46000  1.000 136.41381 ? 122 PHE E CE2   1 
ATOM 3575  C CZ    . PHE E 1 122 ? 102.02000 117.96300 80.13300  1.000 136.41381 ? 122 PHE E CZ    1 
ATOM 3576  N N     . PRO E 1 123 ? 100.27800 117.65000 86.67900  1.000 135.80354 ? 123 PRO E N     1 
ATOM 3577  C CA    . PRO E 1 123 ? 99.63000  117.22800 87.92900  1.000 135.80354 ? 123 PRO E CA    1 
ATOM 3578  C C     . PRO E 1 123 ? 99.69000  115.73800 88.18800  1.000 135.80354 ? 123 PRO E C     1 
ATOM 3579  O O     . PRO E 1 123 ? 99.69800  115.33400 89.35800  1.000 135.80354 ? 123 PRO E O     1 
ATOM 3580  C CB    . PRO E 1 123 ? 98.18600  117.71000 87.75200  1.000 135.80354 ? 123 PRO E CB    1 
ATOM 3581  C CG    . PRO E 1 123 ? 98.00400  117.85200 86.29900  1.000 135.80354 ? 123 PRO E CG    1 
ATOM 3582  C CD    . PRO E 1 123 ? 99.32000  118.28400 85.75900  1.000 135.80354 ? 123 PRO E CD    1 
ATOM 3583  N N     . LYS E 1 124 ? 99.69300  114.90800 87.14100  1.000 132.75736 ? 124 LYS E N     1 
ATOM 3584  C CA    . LYS E 1 124 ? 99.85100  113.47300 87.35000  1.000 132.75736 ? 124 LYS E CA    1 
ATOM 3585  C C     . LYS E 1 124 ? 101.20800 113.15900 87.95500  1.000 132.75736 ? 124 LYS E C     1 
ATOM 3586  O O     . LYS E 1 124 ? 101.32300 112.24800 88.78100  1.000 132.75736 ? 124 LYS E O     1 
ATOM 3587  C CB    . LYS E 1 124 ? 99.66600  112.71000 86.04000  1.000 132.75736 ? 124 LYS E CB    1 
ATOM 3588  C CG    . LYS E 1 124 ? 100.43100 113.26800 84.85900  1.000 132.75736 ? 124 LYS E CG    1 
ATOM 3589  C CD    . LYS E 1 124 ? 100.66500 112.18400 83.82300  1.000 132.75736 ? 124 LYS E CD    1 
ATOM 3590  C CE    . LYS E 1 124 ? 101.45600 111.02600 84.41200  1.000 132.75736 ? 124 LYS E CE    1 
ATOM 3591  N NZ    . LYS E 1 124 ? 101.88200 110.04100 83.38100  1.000 132.75736 ? 124 LYS E NZ    1 
ATOM 3592  N N     . ASP E 1 125 ? 102.23200 113.92600 87.58200  1.000 139.77680 ? 125 ASP E N     1 
ATOM 3593  C CA    . ASP E 1 125 ? 103.56200 113.72900 88.13700  1.000 139.77680 ? 125 ASP E CA    1 
ATOM 3594  C C     . ASP E 1 125 ? 103.61400 114.09200 89.61400  1.000 139.77680 ? 125 ASP E C     1 
ATOM 3595  O O     . ASP E 1 125 ? 104.20500 113.35700 90.41000  1.000 139.77680 ? 125 ASP E O     1 
ATOM 3596  C CB    . ASP E 1 125 ? 104.57300 114.53300 87.33400  1.000 139.77680 ? 125 ASP E CB    1 
ATOM 3597  C CG    . ASP E 1 125 ? 104.46500 114.25600 85.85700  1.000 139.77680 ? 125 ASP E CG    1 
ATOM 3598  O OD1   . ASP E 1 125 ? 103.91700 113.19300 85.50100  1.000 139.77680 ? 125 ASP E OD1   1 
ATOM 3599  O OD2   . ASP E 1 125 ? 104.91400 115.08900 85.05000  1.000 139.77680 ? 125 ASP E OD2   1 
ATOM 3600  N N     . VAL E 1 126 ? 103.00400 115.21200 90.00600  1.000 131.25282 ? 126 VAL E N     1 
ATOM 3601  C CA    . VAL E 1 126 ? 103.01800 115.56500 91.42000  1.000 131.25282 ? 126 VAL E CA    1 
ATOM 3602  C C     . VAL E 1 126 ? 102.12000 114.62600 92.22300  1.000 131.25282 ? 126 VAL E C     1 
ATOM 3603  O O     . VAL E 1 126 ? 102.40100 114.34700 93.39400  1.000 131.25282 ? 126 VAL E O     1 
ATOM 3604  C CB    . VAL E 1 126 ? 102.67600 117.05700 91.61900  1.000 131.25282 ? 126 VAL E CB    1 
ATOM 3605  C CG1   . VAL E 1 126 ? 101.19400 117.34500 91.50000  1.000 131.25282 ? 126 VAL E CG1   1 
ATOM 3606  C CG2   . VAL E 1 126 ? 103.19800 117.53900 92.95300  1.000 131.25282 ? 126 VAL E CG2   1 
ATOM 3607  N N     . GLN E 1 127 ? 101.06700 114.08000 91.60600  1.000 133.03482 ? 127 GLN E N     1 
ATOM 3608  C CA    . GLN E 1 127 ? 100.24600 113.09100 92.29300  1.000 133.03482 ? 127 GLN E CA    1 
ATOM 3609  C C     . GLN E 1 127 ? 101.02100 111.80200 92.51300  1.000 133.03482 ? 127 GLN E C     1 
ATOM 3610  O O     . GLN E 1 127 ? 100.94000 111.19700 93.58800  1.000 133.03482 ? 127 GLN E O     1 
ATOM 3611  C CB    . GLN E 1 127 ? 98.97100  112.82300 91.50400  1.000 133.03482 ? 127 GLN E CB    1 
ATOM 3612  C CG    . GLN E 1 127 ? 97.88000  113.82800 91.77500  1.000 133.03482 ? 127 GLN E CG    1 
ATOM 3613  C CD    . GLN E 1 127 ? 96.95500  114.01500 90.59500  1.000 133.03482 ? 127 GLN E CD    1 
ATOM 3614  O OE1   . GLN E 1 127 ? 97.17200  113.44500 89.52600  1.000 133.03482 ? 127 GLN E OE1   1 
ATOM 3615  N NE2   . GLN E 1 127 ? 95.92200  114.82900 90.77600  1.000 133.03482 ? 127 GLN E NE2   1 
ATOM 3616  N N     . LEU E 1 128 ? 101.77800 111.37300 91.50200  1.000 138.90893 ? 128 LEU E N     1 
ATOM 3617  C CA    . LEU E 1 128 ? 102.63700 110.20300 91.64100  1.000 138.90893 ? 128 LEU E CA    1 
ATOM 3618  C C     . LEU E 1 128 ? 103.72700 110.44000 92.67700  1.000 138.90893 ? 128 LEU E C     1 
ATOM 3619  O O     . LEU E 1 128 ? 104.08400 109.53100 93.43500  1.000 138.90893 ? 128 LEU E O     1 
ATOM 3620  C CB    . LEU E 1 128 ? 103.25200 109.85800 90.29100  1.000 138.90893 ? 128 LEU E CB    1 
ATOM 3621  C CG    . LEU E 1 128 ? 104.28700 108.74500 90.30600  1.000 138.90893 ? 128 LEU E CG    1 
ATOM 3622  C CD1   . LEU E 1 128 ? 103.61400 107.43500 90.64500  1.000 138.90893 ? 128 LEU E CD1   1 
ATOM 3623  C CD2   . LEU E 1 128 ? 104.99900 108.66900 88.99600  1.000 138.90893 ? 128 LEU E CD2   1 
ATOM 3624  N N     . ALA E 1 129 ? 104.25000 111.66700 92.73300  1.000 149.26863 ? 129 ALA E N     1 
ATOM 3625  C CA    . ALA E 1 129 ? 105.25500 112.02100 93.72800  1.000 149.26863 ? 129 ALA E CA    1 
ATOM 3626  C C     . ALA E 1 129 ? 104.68400 111.93700 95.13100  1.000 149.26863 ? 129 ALA E C     1 
ATOM 3627  O O     . ALA E 1 129 ? 105.35800 111.47100 96.05500  1.000 149.26863 ? 129 ALA E O     1 
ATOM 3628  C CB    . ALA E 1 129 ? 105.78900 113.42300 93.45800  1.000 149.26863 ? 129 ALA E CB    1 
ATOM 3629  N N     . ARG E 1 130 ? 103.45100 112.40500 95.30900  1.000 155.37499 ? 130 ARG E N     1 
ATOM 3630  C CA    . ARG E 1 130 ? 102.79300 112.28100 96.60200  1.000 155.37499 ? 130 ARG E CA    1 
ATOM 3631  C C     . ARG E 1 130 ? 102.53500 110.82200 96.95000  1.000 155.37499 ? 130 ARG E C     1 
ATOM 3632  O O     . ARG E 1 130 ? 102.65500 110.42900 98.11500  1.000 155.37499 ? 130 ARG E O     1 
ATOM 3633  C CB    . ARG E 1 130 ? 101.49000 113.07500 96.58700  1.000 155.37499 ? 130 ARG E CB    1 
ATOM 3634  C CG    . ARG E 1 130 ? 101.65200 114.50200 97.05100  1.000 155.37499 ? 130 ARG E CG    1 
ATOM 3635  C CD    . ARG E 1 130 ? 100.31800 115.21300 97.14700  1.000 155.37499 ? 130 ARG E CD    1 
ATOM 3636  N NE    . ARG E 1 130 ? 99.35600  114.53900 98.00700  1.000 155.37499 ? 130 ARG E NE    1 
ATOM 3637  C CZ    . ARG E 1 130 ? 98.07700  114.38400 97.68700  1.000 155.37499 ? 130 ARG E CZ    1 
ATOM 3638  N NH1   . ARG E 1 130 ? 97.24800  113.76500 98.51200  1.000 155.37499 ? 130 ARG E NH1   1 
ATOM 3639  N NH2   . ARG E 1 130 ? 97.62400  114.85300 96.53400  1.000 155.37499 ? 130 ARG E NH2   1 
ATOM 3640  N N     . ARG E 1 131 ? 102.16500 110.01300 95.95300  1.000 146.19737 ? 131 ARG E N     1 
ATOM 3641  C CA    . ARG E 1 131 ? 101.91900 108.59600 96.19900  1.000 146.19737 ? 131 ARG E CA    1 
ATOM 3642  C C     . ARG E 1 131 ? 103.18900 107.86000 96.60500  1.000 146.19737 ? 131 ARG E C     1 
ATOM 3643  O O     . ARG E 1 131 ? 103.17300 107.04200 97.53200  1.000 146.19737 ? 131 ARG E O     1 
ATOM 3644  C CB    . ARG E 1 131 ? 101.30200 107.94100 94.96700  1.000 146.19737 ? 131 ARG E CB    1 
ATOM 3645  C CG    . ARG E 1 131 ? 101.14100 106.44000 95.10300  1.000 146.19737 ? 131 ARG E CG    1 
ATOM 3646  C CD    . ARG E 1 131 ? 100.63300 105.82900 93.84000  1.000 146.19737 ? 131 ARG E CD    1 
ATOM 3647  N NE    . ARG E 1 131 ? 99.33900  106.39000 93.49100  1.000 146.19737 ? 131 ARG E NE    1 
ATOM 3648  C CZ    . ARG E 1 131 ? 98.65100  106.05100 92.41000  1.000 146.19737 ? 131 ARG E CZ    1 
ATOM 3649  N NH1   . ARG E 1 131 ? 99.13800  105.14800 91.57000  1.000 146.19737 ? 131 ARG E NH1   1 
ATOM 3650  N NH2   . ARG E 1 131 ? 97.47600  106.61300 92.17000  1.000 146.19737 ? 131 ARG E NH2   1 
ATOM 3651  N N     . ILE E 1 132 ? 104.31000 108.18300 95.96700  1.000 135.21096 ? 132 ILE E N     1 
ATOM 3652  C CA    . ILE E 1 132 ? 105.54100 107.44200 96.20000  1.000 135.21096 ? 132 ILE E CA    1 
ATOM 3653  C C     . ILE E 1 132 ? 106.38900 108.02600 97.31800  1.000 135.21096 ? 132 ILE E C     1 
ATOM 3654  O O     . ILE E 1 132 ? 107.29700 107.34200 97.81400  1.000 135.21096 ? 132 ILE E O     1 
ATOM 3655  C CB    . ILE E 1 132 ? 106.33700 107.36600 94.88200  1.000 135.21096 ? 132 ILE E CB    1 
ATOM 3656  C CG1   . ILE E 1 132 ? 107.24200 106.13700 94.85400  1.000 135.21096 ? 132 ILE E CG1   1 
ATOM 3657  C CG2   . ILE E 1 132 ? 107.13100 108.63400 94.65000  1.000 135.21096 ? 132 ILE E CG2   1 
ATOM 3658  C CD1   . ILE E 1 132 ? 108.14400 106.08000 93.65800  1.000 135.21096 ? 132 ILE E CD1   1 
ATOM 3659  N N     . ARG E 1 133 ? 106.12100 109.25900 97.75000  1.000 150.16231 ? 133 ARG E N     1 
ATOM 3660  C CA    . ARG E 1 133 ? 106.94000 109.84600 98.80000  1.000 150.16231 ? 133 ARG E CA    1 
ATOM 3661  C C     . ARG E 1 133 ? 106.68900 109.21100 100.15700 1.000 150.16231 ? 133 ARG E C     1 
ATOM 3662  O O     . ARG E 1 133 ? 107.57400 109.24200 101.01400 1.000 150.16231 ? 133 ARG E O     1 
ATOM 3663  C CB    . ARG E 1 133 ? 106.70100 111.35200 98.85800  1.000 150.16231 ? 133 ARG E CB    1 
ATOM 3664  C CG    . ARG E 1 133 ? 107.96000 112.15500 99.13300  1.000 150.16231 ? 133 ARG E CG    1 
ATOM 3665  C CD    . ARG E 1 133 ? 107.63400 113.57000 99.56100  1.000 150.16231 ? 133 ARG E CD    1 
ATOM 3666  N NE    . ARG E 1 133 ? 108.71600 114.17300 100.33100 1.000 150.16231 ? 133 ARG E NE    1 
ATOM 3667  C CZ    . ARG E 1 133 ? 108.72400 115.43700 100.73800 1.000 150.16231 ? 133 ARG E CZ    1 
ATOM 3668  N NH1   . ARG E 1 133 ? 109.74800 115.90500 101.43600 1.000 150.16231 ? 133 ARG E NH1   1 
ATOM 3669  N NH2   . ARG E 1 133 ? 107.70100 116.22800 100.46100 1.000 150.16231 ? 133 ARG E NH2   1 
ATOM 3670  N N     . GLY E 1 134 ? 105.53000 108.61100 100.35800 1.000 163.41187 ? 134 GLY E N     1 
ATOM 3671  C CA    . GLY E 1 134 ? 105.20000 107.95800 101.60300 1.000 163.41187 ? 134 GLY E CA    1 
ATOM 3672  C C     . GLY E 1 134 ? 103.92400 108.51900 102.19100 1.000 163.41187 ? 134 GLY E C     1 
ATOM 3673  O O     . GLY E 1 134 ? 103.31600 109.44800 101.66200 1.000 163.41187 ? 134 GLY E O     1 
ATOM 3674  N N     . LEU E 1 135 ? 103.52200 107.93000 103.31300 1.000 183.17427 ? 135 LEU E N     1 
ATOM 3675  C CA    . LEU E 1 135 ? 102.30700 108.39900 103.96000 1.000 183.17427 ? 135 LEU E CA    1 
ATOM 3676  C C     . LEU E 1 135 ? 102.54800 109.68900 104.73100 1.000 183.17427 ? 135 LEU E C     1 
ATOM 3677  O O     . LEU E 1 135 ? 101.63500 110.50900 104.85500 1.000 183.17427 ? 135 LEU E O     1 
ATOM 3678  C CB    . LEU E 1 135 ? 101.75800 107.32000 104.89600 1.000 183.17427 ? 135 LEU E CB    1 
ATOM 3679  C CG    . LEU E 1 135 ? 100.32100 107.45700 105.40500 1.000 183.17427 ? 135 LEU E CG    1 
ATOM 3680  C CD1   . LEU E 1 135 ? 99.60700  106.12400 105.31400 1.000 183.17427 ? 135 LEU E CD1   1 
ATOM 3681  C CD2   . LEU E 1 135 ? 100.29200 107.96400 106.83300 1.000 183.17427 ? 135 LEU E CD2   1 
ATOM 3682  N N     . GLU E 1 136 ? 103.74600 109.87400 105.27900 1.000 176.42859 ? 136 GLU E N     1 
ATOM 3683  C CA    . GLU E 1 136 ? 104.06000 111.04600 106.08400 1.000 176.42859 ? 136 GLU E CA    1 
ATOM 3684  C C     . GLU E 1 136 ? 104.94600 112.06800 105.38000 1.000 176.42859 ? 136 GLU E C     1 
ATOM 3685  O O     . GLU E 1 136 ? 105.20100 113.13400 105.94600 1.000 176.42859 ? 136 GLU E O     1 
ATOM 3686  C CB    . GLU E 1 136 ? 104.73200 110.60800 107.38800 1.000 176.42859 ? 136 GLU E CB    1 
ATOM 3687  C CG    . GLU E 1 136 ? 105.90400 109.65700 107.18800 1.000 176.42859 ? 136 GLU E CG    1 
ATOM 3688  C CD    . GLU E 1 136 ? 107.24000 110.37300 107.12900 1.000 176.42859 ? 136 GLU E CD    1 
ATOM 3689  O OE1   . GLU E 1 136 ? 107.28500 111.57700 107.45200 1.000 176.42859 ? 136 GLU E OE1   1 
ATOM 3690  O OE2   . GLU E 1 136 ? 108.24400 109.73100 106.75600 1.000 176.42859 ? 136 GLU E OE2   1 
ATOM 3691  N N     . GLU E 1 137 ? 105.42500 111.78000 104.17500 1.000 166.58857 ? 137 GLU E N     1 
ATOM 3692  C CA    . GLU E 1 137 ? 106.32000 112.69600 103.47600 1.000 166.58857 ? 137 GLU E CA    1 
ATOM 3693  C C     . GLU E 1 137 ? 105.64800 113.51000 102.38300 1.000 166.58857 ? 137 GLU E C     1 
ATOM 3694  O O     . GLU E 1 137 ? 105.99300 114.67900 102.19000 1.000 166.58857 ? 137 GLU E O     1 
ATOM 3695  C CB    . GLU E 1 137 ? 107.49800 111.92600 102.87800 1.000 166.58857 ? 137 GLU E CB    1 
ATOM 3696  C CG    . GLU E 1 137 ? 108.49500 111.45800 103.91000 1.000 166.58857 ? 137 GLU E CG    1 
ATOM 3697  C CD    . GLU E 1 137 ? 109.36600 112.58600 104.41000 1.000 166.58857 ? 137 GLU E CD    1 
ATOM 3698  O OE1   . GLU E 1 137 ? 109.66100 113.50600 103.61900 1.000 166.58857 ? 137 GLU E OE1   1 
ATOM 3699  O OE2   . GLU E 1 137 ? 109.74800 112.55900 105.59700 1.000 166.58857 ? 137 GLU E OE2   1 
ATOM 3700  N N     . GLY E 1 138 ? 104.69100 112.92700 101.67400 1.000 163.00593 ? 138 GLY E N     1 
ATOM 3701  C CA    . GLY E 1 138 ? 104.01900 113.60000 100.58200 1.000 163.00593 ? 138 GLY E CA    1 
ATOM 3702  C C     . GLY E 1 138 ? 102.64800 114.08900 100.97700 1.000 163.00593 ? 138 GLY E C     1 
ATOM 3703  O O     . GLY E 1 138 ? 102.14200 115.07100 100.42900 1.000 163.00593 ? 138 GLY E O     1 
ATOM 3704  N N     . LEU E 1 139 ? 102.03500 113.39800 101.92500 1.000 169.72732 ? 139 LEU E N     1 
ATOM 3705  C CA    . LEU E 1 139 ? 100.71000 113.75500 102.39400 1.000 169.72732 ? 139 LEU E CA    1 
ATOM 3706  C C     . LEU E 1 139 ? 100.77100 114.78700 103.50800 1.000 169.72732 ? 139 LEU E C     1 
ATOM 3707  O O     . LEU E 1 139 ? 100.04900 115.78100 103.47500 1.000 169.72732 ? 139 LEU E O     1 
ATOM 3708  C CB    . LEU E 1 139 ? 100.00000 112.51600 102.90400 1.000 169.72732 ? 139 LEU E CB    1 
ATOM 3709  C CG    . LEU E 1 139 ? 98.48800  112.49300 102.98700 1.000 169.72732 ? 139 LEU E CG    1 
ATOM 3710  C CD1   . LEU E 1 139 ? 97.88700  113.15500 101.77600 1.000 169.72732 ? 139 LEU E CD1   1 
ATOM 3711  C CD2   . LEU E 1 139 ? 98.08600  111.05600 103.10200 1.000 169.72732 ? 139 LEU E CD2   1 
ATOM 3712  N N     . ASN F 2 26  ? 87.16500  131.27800 99.02700  1.000 130.51880 ? 25  ASN F N     1 
ATOM 3713  C CA    . ASN F 2 26  ? 88.22900  131.87500 99.82300  1.000 130.51880 ? 25  ASN F CA    1 
ATOM 3714  C C     . ASN F 2 26  ? 89.55300  131.16900 99.59700  1.000 130.51880 ? 25  ASN F C     1 
ATOM 3715  O O     . ASN F 2 26  ? 90.60000  131.64000 100.03100 1.000 130.51880 ? 25  ASN F O     1 
ATOM 3716  C CB    . ASN F 2 26  ? 87.87500  131.83000 101.30400 1.000 130.51880 ? 25  ASN F CB    1 
ATOM 3717  C CG    . ASN F 2 26  ? 86.67500  132.67600 101.63300 1.000 130.51880 ? 25  ASN F CG    1 
ATOM 3718  O OD1   . ASN F 2 26  ? 86.06500  133.27400 100.74800 1.000 130.51880 ? 25  ASN F OD1   1 
ATOM 3719  N ND2   . ASN F 2 26  ? 86.32200  132.73200 102.91200 1.000 130.51880 ? 25  ASN F ND2   1 
ATOM 3720  N N     . ILE F 2 27  ? 89.50300  130.02600 98.90600  1.000 129.98316 ? 26  ILE F N     1 
ATOM 3721  C CA    . ILE F 2 27  ? 90.71900  129.28200 98.58800  1.000 129.98316 ? 26  ILE F CA    1 
ATOM 3722  C C     . ILE F 2 27  ? 91.46200  129.85500 97.39800  1.000 129.98316 ? 26  ILE F C     1 
ATOM 3723  O O     . ILE F 2 27  ? 92.50700  129.31600 97.01600  1.000 129.98316 ? 26  ILE F O     1 
ATOM 3724  C CB    . ILE F 2 27  ? 90.38900  127.80100 98.32800  1.000 129.98316 ? 26  ILE F CB    1 
ATOM 3725  C CG1   . ILE F 2 27  ? 89.56700  127.66800 97.04900  1.000 129.98316 ? 26  ILE F CG1   1 
ATOM 3726  C CG2   . ILE F 2 27  ? 89.63400  127.21500 99.50300  1.000 129.98316 ? 26  ILE F CG2   1 
ATOM 3727  C CD1   . ILE F 2 27  ? 89.17500  126.24500 96.71900  1.000 129.98316 ? 26  ILE F CD1   1 
ATOM 3728  N N     . GLN F 2 28  ? 90.96200  130.93300 96.80300  1.000 134.22293 ? 27  GLN F N     1 
ATOM 3729  C CA    . GLN F 2 28  ? 91.60500  131.59600 95.67800  1.000 134.22293 ? 27  GLN F CA    1 
ATOM 3730  C C     . GLN F 2 28  ? 92.71800  132.53300 96.11100  1.000 134.22293 ? 27  GLN F C     1 
ATOM 3731  O O     . GLN F 2 28  ? 93.28600  133.22000 95.25700  1.000 134.22293 ? 27  GLN F O     1 
ATOM 3732  C CB    . GLN F 2 28  ? 90.58200  132.39100 94.86500  1.000 134.22293 ? 27  GLN F CB    1 
ATOM 3733  C CG    . GLN F 2 28  ? 89.70300  131.56500 93.95000  1.000 134.22293 ? 27  GLN F CG    1 
ATOM 3734  C CD    . GLN F 2 28  ? 88.63600  130.80800 94.70300  1.000 134.22293 ? 27  GLN F CD    1 
ATOM 3735  O OE1   . GLN F 2 28  ? 88.49600  129.59700 94.55200  1.000 134.22293 ? 27  GLN F OE1   1 
ATOM 3736  N NE2   . GLN F 2 28  ? 87.89000  131.51800 95.54300  1.000 134.22293 ? 27  GLN F NE2   1 
ATOM 3737  N N     . GLY F 2 29  ? 93.00800  132.59200 97.41200  1.000 134.98775 ? 28  GLY F N     1 
ATOM 3738  C CA    . GLY F 2 29  ? 94.06800  133.45600 97.90500  1.000 134.98775 ? 28  GLY F CA    1 
ATOM 3739  C C     . GLY F 2 29  ? 95.43500  133.07200 97.37800  1.000 134.98775 ? 28  GLY F C     1 
ATOM 3740  O O     . GLY F 2 29  ? 96.21300  133.92800 96.95200  1.000 134.98775 ? 28  GLY F O     1 
ATOM 3741  N N     . ILE F 2 30  ? 95.74700  131.78200 97.40100  1.000 125.47732 ? 29  ILE F N     1 
ATOM 3742  C CA    . ILE F 2 30  ? 96.98500  131.30300 96.80600  1.000 125.47732 ? 29  ILE F CA    1 
ATOM 3743  C C     . ILE F 2 30  ? 96.82100  131.39800 95.29600  1.000 125.47732 ? 29  ILE F C     1 
ATOM 3744  O O     . ILE F 2 30  ? 96.43600  130.42700 94.63700  1.000 125.47732 ? 29  ILE F O     1 
ATOM 3745  C CB    . ILE F 2 30  ? 97.29300  129.86500 97.24900  1.000 125.47732 ? 29  ILE F CB    1 
ATOM 3746  C CG1   . ILE F 2 30  ? 96.96600  129.68400 98.72900  1.000 125.47732 ? 29  ILE F CG1   1 
ATOM 3747  C CG2   . ILE F 2 30  ? 98.75200  129.54300 97.00000  1.000 125.47732 ? 29  ILE F CG2   1 
ATOM 3748  C CD1   . ILE F 2 30  ? 97.84100  130.46800 99.66400  1.000 125.47732 ? 29  ILE F CD1   1 
ATOM 3749  N N     . THR F 2 31  ? 97.09800  132.57500 94.74400  1.000 130.26837 ? 30  THR F N     1 
ATOM 3750  C CA    . THR F 2 31  ? 96.79300  132.85500 93.35300  1.000 130.26837 ? 30  THR F CA    1 
ATOM 3751  C C     . THR F 2 31  ? 97.81000  132.21500 92.41800  1.000 130.26837 ? 30  THR F C     1 
ATOM 3752  O O     . THR F 2 31  ? 98.79400  131.60800 92.84200  1.000 130.26837 ? 30  THR F O     1 
ATOM 3753  C CB    . THR F 2 31  ? 96.75300  134.35500 93.11400  1.000 130.26837 ? 30  THR F CB    1 
ATOM 3754  O OG1   . THR F 2 31  ? 96.53900  134.59400 91.72000  1.000 130.26837 ? 30  THR F OG1   1 
ATOM 3755  C CG2   . THR F 2 31  ? 98.06900  134.97500 93.52900  1.000 130.26837 ? 30  THR F CG2   1 
ATOM 3756  N N     . LYS F 2 32  ? 97.58100  132.41700 91.11400  1.000 126.75394 ? 31  LYS F N     1 
ATOM 3757  C CA    . LYS F 2 32  ? 98.43300  131.80100 90.09500  1.000 126.75394 ? 31  LYS F CA    1 
ATOM 3758  C C     . LYS F 2 32  ? 99.87100  132.32100 90.10000  1.000 126.75394 ? 31  LYS F C     1 
ATOM 3759  O O     . LYS F 2 32  ? 100.78800 131.48400 90.03500  1.000 126.75394 ? 31  LYS F O     1 
ATOM 3760  C CB    . LYS F 2 32  ? 97.76100  131.91400 88.72000  1.000 126.75394 ? 31  LYS F CB    1 
ATOM 3761  C CG    . LYS F 2 32  ? 98.69800  131.74300 87.54000  1.000 126.75394 ? 31  LYS F CG    1 
ATOM 3762  C CD    . LYS F 2 32  ? 97.93800  131.33900 86.28700  1.000 126.75394 ? 31  LYS F CD    1 
ATOM 3763  C CE    . LYS F 2 32  ? 96.83200  132.32600 85.95500  1.000 126.75394 ? 31  LYS F CE    1 
ATOM 3764  N NZ    . LYS F 2 32  ? 97.36900  133.59200 85.39100  1.000 126.75394 ? 31  LYS F NZ    1 
ATOM 3765  N N     . PRO F 2 33  ? 100.16000 133.63700 90.14200  1.000 130.52528 ? 32  PRO F N     1 
ATOM 3766  C CA    . PRO F 2 33  ? 101.57500 134.03900 90.25400  1.000 130.52528 ? 32  PRO F CA    1 
ATOM 3767  C C     . PRO F 2 33  ? 102.24200 133.61500 91.55100  1.000 130.52528 ? 32  PRO F C     1 
ATOM 3768  O O     . PRO F 2 33  ? 103.47100 133.48600 91.57400  1.000 130.52528 ? 32  PRO F O     1 
ATOM 3769  C CB    . PRO F 2 33  ? 101.52800 135.56700 90.13100  1.000 130.52528 ? 32  PRO F CB    1 
ATOM 3770  C CG    . PRO F 2 33  ? 100.16800 135.93700 90.45600  1.000 130.52528 ? 32  PRO F CG    1 
ATOM 3771  C CD    . PRO F 2 33  ? 99.32400  134.84000 89.94400  1.000 130.52528 ? 32  PRO F CD    1 
ATOM 3772  N N     . ALA F 2 34  ? 101.48300 133.40100 92.62800  1.000 127.84061 ? 33  ALA F N     1 
ATOM 3773  C CA    . ALA F 2 34  ? 102.08200 132.93900 93.87500  1.000 127.84061 ? 33  ALA F CA    1 
ATOM 3774  C C     . ALA F 2 34  ? 102.59700 131.51100 93.74900  1.000 127.84061 ? 33  ALA F C     1 
ATOM 3775  O O     . ALA F 2 34  ? 103.74200 131.22000 94.11800  1.000 127.84061 ? 33  ALA F O     1 
ATOM 3776  C CB    . ALA F 2 34  ? 101.07100 133.04900 95.01300  1.000 127.84061 ? 33  ALA F CB    1 
ATOM 3777  N N     . ILE F 2 35  ? 101.75900 130.60300 93.23800  1.000 121.92000 ? 34  ILE F N     1 
ATOM 3778  C CA    . ILE F 2 35  ? 102.19200 129.23000 92.99300  1.000 121.92000 ? 34  ILE F CA    1 
ATOM 3779  C C     . ILE F 2 35  ? 103.28900 129.19300 91.94700  1.000 121.92000 ? 34  ILE F C     1 
ATOM 3780  O O     . ILE F 2 35  ? 104.19500 128.34900 92.01000  1.000 121.92000 ? 34  ILE F O     1 
ATOM 3781  C CB    . ILE F 2 35  ? 100.99600 128.35200 92.59300  1.000 121.92000 ? 34  ILE F CB    1 
ATOM 3782  C CG1   . ILE F 2 35  ? 99.82800  128.59500 93.53900  1.000 121.92000 ? 34  ILE F CG1   1 
ATOM 3783  C CG2   . ILE F 2 35  ? 101.37700 126.90600 92.62900  1.000 121.92000 ? 34  ILE F CG2   1 
ATOM 3784  C CD1   . ILE F 2 35  ? 98.49000  128.33700 92.92200  1.000 121.92000 ? 34  ILE F CD1   1 
ATOM 3785  N N     . ARG F 2 36  ? 103.23300 130.11200 90.98100  1.000 133.62245 ? 35  ARG F N     1 
ATOM 3786  C CA    . ARG F 2 36  ? 104.29100 130.22200 89.98900  1.000 133.62245 ? 35  ARG F CA    1 
ATOM 3787  C C     . ARG F 2 36  ? 105.61300 130.57700 90.64900  1.000 133.62245 ? 35  ARG F C     1 
ATOM 3788  O O     . ARG F 2 36  ? 106.64100 129.96100 90.35900  1.000 133.62245 ? 35  ARG F O     1 
ATOM 3789  C CB    . ARG F 2 36  ? 103.91800 131.25800 88.93700  1.000 133.62245 ? 35  ARG F CB    1 
ATOM 3790  C CG    . ARG F 2 36  ? 104.68700 131.09500 87.65800  1.000 133.62245 ? 35  ARG F CG    1 
ATOM 3791  C CD    . ARG F 2 36  ? 104.02500 131.84600 86.53900  1.000 133.62245 ? 35  ARG F CD    1 
ATOM 3792  N NE    . ARG F 2 36  ? 104.63600 131.52500 85.25900  1.000 133.62245 ? 35  ARG F NE    1 
ATOM 3793  C CZ    . ARG F 2 36  ? 104.53700 132.29000 84.18000  1.000 133.62245 ? 35  ARG F CZ    1 
ATOM 3794  N NH1   . ARG F 2 36  ? 103.84800 133.42000 84.23300  1.000 133.62245 ? 35  ARG F NH1   1 
ATOM 3795  N NH2   . ARG F 2 36  ? 105.12600 131.92600 83.05000  1.000 133.62245 ? 35  ARG F NH2   1 
ATOM 3796  N N     . ARG F 2 37  ? 105.59500 131.55000 91.56400  1.000 129.88041 ? 36  ARG F N     1 
ATOM 3797  C CA    . ARG F 2 37  ? 106.80600 131.93200 92.28300  1.000 129.88041 ? 36  ARG F CA    1 
ATOM 3798  C C     . ARG F 2 37  ? 107.30600 130.81300 93.18600  1.000 129.88041 ? 36  ARG F C     1 
ATOM 3799  O O     . ARG F 2 37  ? 108.52000 130.64800 93.34800  1.000 129.88041 ? 36  ARG F O     1 
ATOM 3800  C CB    . ARG F 2 37  ? 106.56100 133.19700 93.09800  1.000 129.88041 ? 36  ARG F CB    1 
ATOM 3801  C CG    . ARG F 2 37  ? 106.71300 134.46700 92.29200  1.000 129.88041 ? 36  ARG F CG    1 
ATOM 3802  C CD    . ARG F 2 37  ? 106.64900 135.69100 93.17600  1.000 129.88041 ? 36  ARG F CD    1 
ATOM 3803  N NE    . ARG F 2 37  ? 105.58300 135.59700 94.16300  1.000 129.88041 ? 36  ARG F NE    1 
ATOM 3804  C CZ    . ARG F 2 37  ? 104.33500 135.99000 93.94600  1.000 129.88041 ? 36  ARG F CZ    1 
ATOM 3805  N NH1   . ARG F 2 37  ? 103.99600 136.50800 92.77500  1.000 129.88041 ? 36  ARG F NH1   1 
ATOM 3806  N NH2   . ARG F 2 37  ? 103.42600 135.87300 94.90000  1.000 129.88041 ? 36  ARG F NH2   1 
ATOM 3807  N N     . LEU F 2 38  ? 106.39100 130.03600 93.76900  1.000 128.39484 ? 37  LEU F N     1 
ATOM 3808  C CA    . LEU F 2 38  ? 106.79900 128.89200 94.58000  1.000 128.39484 ? 37  LEU F CA    1 
ATOM 3809  C C     . LEU F 2 38  ? 107.50200 127.83900 93.73600  1.000 128.39484 ? 37  LEU F C     1 
ATOM 3810  O O     . LEU F 2 38  ? 108.52500 127.28200 94.15000  1.000 128.39484 ? 37  LEU F O     1 
ATOM 3811  C CB    . LEU F 2 38  ? 105.59300 128.28500 95.28300  1.000 128.39484 ? 37  LEU F CB    1 
ATOM 3812  C CG    . LEU F 2 38  ? 105.09400 129.07400 96.48500  1.000 128.39484 ? 37  LEU F CG    1 
ATOM 3813  C CD1   . LEU F 2 38  ? 103.61400 128.83500 96.70800  1.000 128.39484 ? 37  LEU F CD1   1 
ATOM 3814  C CD2   . LEU F 2 38  ? 105.89600 128.69300 97.71100  1.000 128.39484 ? 37  LEU F CD2   1 
ATOM 3815  N N     . ALA F 2 39  ? 106.97000 127.56300 92.54400  1.000 131.80651 ? 38  ALA F N     1 
ATOM 3816  C CA    . ALA F 2 39  ? 107.62000 126.62300 91.63800  1.000 131.80651 ? 38  ALA F CA    1 
ATOM 3817  C C     . ALA F 2 39  ? 108.95500 127.15700 91.13500  1.000 131.80651 ? 38  ALA F C     1 
ATOM 3818  O O     . ALA F 2 39  ? 109.89200 126.37900 90.92100  1.000 131.80651 ? 38  ALA F O     1 
ATOM 3819  C CB    . ALA F 2 39  ? 106.69400 126.30500 90.46900  1.000 131.80651 ? 38  ALA F CB    1 
ATOM 3820  N N     . ARG F 2 40  ? 109.05400 128.47200 90.92000  1.000 132.05355 ? 39  ARG F N     1 
ATOM 3821  C CA    . ARG F 2 40  ? 110.33000 129.06000 90.52200  1.000 132.05355 ? 39  ARG F CA    1 
ATOM 3822  C C     . ARG F 2 40  ? 111.36200 128.90800 91.62700  1.000 132.05355 ? 39  ARG F C     1 
ATOM 3823  O O     . ARG F 2 40  ? 112.53400 128.62900 91.35700  1.000 132.05355 ? 39  ARG F O     1 
ATOM 3824  C CB    . ARG F 2 40  ? 110.16700 130.53500 90.15700  1.000 132.05355 ? 39  ARG F CB    1 
ATOM 3825  C CG    . ARG F 2 40  ? 109.33900 130.82600 88.92200  1.000 132.05355 ? 39  ARG F CG    1 
ATOM 3826  C CD    . ARG F 2 40  ? 109.91300 130.23800 87.65800  1.000 132.05355 ? 39  ARG F CD    1 
ATOM 3827  N NE    . ARG F 2 40  ? 108.92400 130.25800 86.58400  1.000 132.05355 ? 39  ARG F NE    1 
ATOM 3828  C CZ    . ARG F 2 40  ? 108.68500 131.30400 85.80000  1.000 132.05355 ? 39  ARG F CZ    1 
ATOM 3829  N NH1   . ARG F 2 40  ? 107.76100 131.22600 84.85400  1.000 132.05355 ? 39  ARG F NH1   1 
ATOM 3830  N NH2   . ARG F 2 40  ? 109.36200 132.43100 85.96100  1.000 132.05355 ? 39  ARG F NH2   1 
ATOM 3831  N N     . ARG F 2 41  ? 110.95000 129.10300 92.88000  1.000 135.18912 ? 40  ARG F N     1 
ATOM 3832  C CA    . ARG F 2 41  ? 111.86400 128.83900 93.98500  1.000 135.18912 ? 40  ARG F CA    1 
ATOM 3833  C C     . ARG F 2 41  ? 112.18800 127.35500 94.09000  1.000 135.18912 ? 40  ARG F C     1 
ATOM 3834  O O     . ARG F 2 41  ? 113.26600 126.99000 94.56900  1.000 135.18912 ? 40  ARG F O     1 
ATOM 3835  C CB    . ARG F 2 41  ? 111.28800 129.35900 95.29700  1.000 135.18912 ? 40  ARG F CB    1 
ATOM 3836  C CG    . ARG F 2 41  ? 112.35800 129.71300 96.31000  1.000 135.18912 ? 40  ARG F CG    1 
ATOM 3837  C CD    . ARG F 2 41  ? 111.83500 129.65300 97.72800  1.000 135.18912 ? 40  ARG F CD    1 
ATOM 3838  N NE    . ARG F 2 41  ? 111.46600 130.97100 98.23500  1.000 135.18912 ? 40  ARG F NE    1 
ATOM 3839  C CZ    . ARG F 2 41  ? 112.32400 131.84700 98.74800  1.000 135.18912 ? 40  ARG F CZ    1 
ATOM 3840  N NH1   . ARG F 2 41  ? 113.61400 131.55400 98.82700  1.000 135.18912 ? 40  ARG F NH1   1 
ATOM 3841  N NH2   . ARG F 2 41  ? 111.89300 133.02000 99.18600  1.000 135.18912 ? 40  ARG F NH2   1 
ATOM 3842  N N     . GLY F 2 42  ? 111.28500 126.49300 93.63800  1.000 129.16936 ? 41  GLY F N     1 
ATOM 3843  C CA    . GLY F 2 42  ? 111.56000 125.07600 93.60900  1.000 129.16936 ? 41  GLY F CA    1 
ATOM 3844  C C     . GLY F 2 42  ? 112.41200 124.59300 92.46000  1.000 129.16936 ? 41  GLY F C     1 
ATOM 3845  O O     . GLY F 2 42  ? 112.66600 123.39100 92.35800  1.000 129.16936 ? 41  GLY F O     1 
ATOM 3846  N N     . GLY F 2 43  ? 112.86900 125.48300 91.58700  1.000 132.18126 ? 42  GLY F N     1 
ATOM 3847  C CA    . GLY F 2 43  ? 113.70900 125.08800 90.47900  1.000 132.18126 ? 42  GLY F CA    1 
ATOM 3848  C C     . GLY F 2 43  ? 112.97200 124.65200 89.23400  1.000 132.18126 ? 42  GLY F C     1 
ATOM 3849  O O     . GLY F 2 43  ? 113.62100 124.27500 88.25300  1.000 132.18126 ? 42  GLY F O     1 
ATOM 3850  N N     . VAL F 2 44  ? 111.65300 124.69400 89.23700  1.000 140.78478 ? 43  VAL F N     1 
ATOM 3851  C CA    . VAL F 2 44  ? 110.86900 124.27800 88.08300  1.000 140.78478 ? 43  VAL F CA    1 
ATOM 3852  C C     . VAL F 2 44  ? 110.95400 125.35000 87.01100  1.000 140.78478 ? 43  VAL F C     1 
ATOM 3853  O O     . VAL F 2 44  ? 110.93600 126.54800 87.31100  1.000 140.78478 ? 43  VAL F O     1 
ATOM 3854  C CB    . VAL F 2 44  ? 109.41200 124.02900 88.50400  1.000 140.78478 ? 43  VAL F CB    1 
ATOM 3855  C CG1   . VAL F 2 44  ? 108.65900 123.27600 87.43900  1.000 140.78478 ? 43  VAL F CG1   1 
ATOM 3856  C CG2   . VAL F 2 44  ? 109.37500 123.27100 89.81000  1.000 140.78478 ? 43  VAL F CG2   1 
ATOM 3857  N N     . LYS F 2 45  ? 111.05000 124.93100 85.75000  1.000 145.96723 ? 44  LYS F N     1 
ATOM 3858  C CA    . LYS F 2 45  ? 111.12400 125.88100 84.64800  1.000 145.96723 ? 44  LYS F CA    1 
ATOM 3859  C C     . LYS F 2 45  ? 109.75400 126.13800 84.03200  1.000 145.96723 ? 44  LYS F C     1 
ATOM 3860  O O     . LYS F 2 45  ? 109.24200 127.25800 84.09200  1.000 145.96723 ? 44  LYS F O     1 
ATOM 3861  C CB    . LYS F 2 45  ? 112.10000 125.39200 83.57400  1.000 145.96723 ? 44  LYS F CB    1 
ATOM 3862  C CG    . LYS F 2 45  ? 112.27400 126.39500 82.45800  1.000 145.96723 ? 44  LYS F CG    1 
ATOM 3863  C CD    . LYS F 2 45  ? 112.47000 125.72600 81.11200  1.000 145.96723 ? 44  LYS F CD    1 
ATOM 3864  C CE    . LYS F 2 45  ? 112.23000 126.71700 79.97800  1.000 145.96723 ? 44  LYS F CE    1 
ATOM 3865  N NZ    . LYS F 2 45  ? 112.59400 126.17200 78.63800  1.000 145.96723 ? 44  LYS F NZ    1 
ATOM 3866  N N     . ARG F 2 46  ? 109.14500 125.11900 83.44400  1.000 143.16553 ? 45  ARG F N     1 
ATOM 3867  C CA    . ARG F 2 46  ? 107.84300 125.27000 82.81900  1.000 143.16553 ? 45  ARG F CA    1 
ATOM 3868  C C     . ARG F 2 46  ? 106.74300 124.73200 83.71900  1.000 143.16553 ? 45  ARG F C     1 
ATOM 3869  O O     . ARG F 2 46  ? 106.92900 123.75700 84.44800  1.000 143.16553 ? 45  ARG F O     1 
ATOM 3870  C CB    . ARG F 2 46  ? 107.80400 124.57900 81.46100  1.000 143.16553 ? 45  ARG F CB    1 
ATOM 3871  C CG    . ARG F 2 46  ? 108.57400 125.33300 80.40000  1.000 143.16553 ? 45  ARG F CG    1 
ATOM 3872  C CD    . ARG F 2 46  ? 108.29800 124.77600 79.02800  1.000 143.16553 ? 45  ARG F CD    1 
ATOM 3873  N NE    . ARG F 2 46  ? 106.90000 124.93900 78.65900  1.000 143.16553 ? 45  ARG F NE    1 
ATOM 3874  C CZ    . ARG F 2 46  ? 106.42300 125.98600 78.00000  1.000 143.16553 ? 45  ARG F CZ    1 
ATOM 3875  N NH1   . ARG F 2 46  ? 107.23900 126.96400 77.63700  1.000 143.16553 ? 45  ARG F NH1   1 
ATOM 3876  N NH2   . ARG F 2 46  ? 105.13300 126.05600 77.70700  1.000 143.16553 ? 45  ARG F NH2   1 
ATOM 3877  N N     . ILE F 2 47  ? 105.58600 125.38100 83.65100  1.000 135.77821 ? 46  ILE F N     1 
ATOM 3878  C CA    . ILE F 2 47  ? 104.44100 125.08100 84.50100  1.000 135.77821 ? 46  ILE F CA    1 
ATOM 3879  C C     . ILE F 2 47  ? 103.22200 124.91000 83.61300  1.000 135.77821 ? 46  ILE F C     1 
ATOM 3880  O O     . ILE F 2 47  ? 102.86500 125.82700 82.87100  1.000 135.77821 ? 46  ILE F O     1 
ATOM 3881  C CB    . ILE F 2 47  ? 104.20900 126.19500 85.53500  1.000 135.77821 ? 46  ILE F CB    1 
ATOM 3882  C CG1   . ILE F 2 47  ? 105.25600 126.12400 86.64000  1.000 135.77821 ? 46  ILE F CG1   1 
ATOM 3883  C CG2   . ILE F 2 47  ? 102.82800 126.12300 86.13600  1.000 135.77821 ? 46  ILE F CG2   1 
ATOM 3884  C CD1   . ILE F 2 47  ? 105.27300 124.79900 87.33800  1.000 135.77821 ? 46  ILE F CD1   1 
ATOM 3885  N N     . SER F 2 48  ? 102.59600 123.74000 83.66900  1.000 136.04808 ? 47  SER F N     1 
ATOM 3886  C CA    . SER F 2 48  ? 101.39600 123.54100 82.87600  1.000 136.04808 ? 47  SER F CA    1 
ATOM 3887  C C     . SER F 2 48  ? 100.23000 124.32300 83.46400  1.000 136.04808 ? 47  SER F C     1 
ATOM 3888  O O     . SER F 2 48  ? 100.22700 124.70400 84.63500  1.000 136.04808 ? 47  SER F O     1 
ATOM 3889  C CB    . SER F 2 48  ? 101.02400 122.06700 82.79800  1.000 136.04808 ? 47  SER F CB    1 
ATOM 3890  O OG    . SER F 2 48  ? 99.77900  121.91100 82.14700  1.000 136.04808 ? 47  SER F OG    1 
ATOM 3891  N N     . GLY F 2 49  ? 99.22100  124.54900 82.63400  1.000 140.60038 ? 48  GLY F N     1 
ATOM 3892  C CA    . GLY F 2 49  ? 98.06700  125.30000 83.07800  1.000 140.60038 ? 48  GLY F CA    1 
ATOM 3893  C C     . GLY F 2 49  ? 97.08300  124.53000 83.92400  1.000 140.60038 ? 48  GLY F C     1 
ATOM 3894  O O     . GLY F 2 49  ? 96.12600  125.12300 84.42900  1.000 140.60038 ? 48  GLY F O     1 
ATOM 3895  N N     . LEU F 2 50  ? 97.29200  123.23000 84.09500  1.000 153.42235 ? 49  LEU F N     1 
ATOM 3896  C CA    . LEU F 2 50  ? 96.39500  122.39600 84.88000  1.000 153.42235 ? 49  LEU F CA    1 
ATOM 3897  C C     . LEU F 2 50  ? 96.88700  122.17400 86.30200  1.000 153.42235 ? 49  LEU F C     1 
ATOM 3898  O O     . LEU F 2 50  ? 96.26500  121.41200 87.04700  1.000 153.42235 ? 49  LEU F O     1 
ATOM 3899  C CB    . LEU F 2 50  ? 96.19400  121.04900 84.18500  1.000 153.42235 ? 49  LEU F CB    1 
ATOM 3900  C CG    . LEU F 2 50  ? 94.93100  120.84200 83.34600  1.000 153.42235 ? 49  LEU F CG    1 
ATOM 3901  C CD1   . LEU F 2 50  ? 94.87200  121.81300 82.17900  1.000 153.42235 ? 49  LEU F CD1   1 
ATOM 3902  C CD2   . LEU F 2 50  ? 94.86500  119.41100 82.84600  1.000 153.42235 ? 49  LEU F CD2   1 
ATOM 3903  N N     . ILE F 2 51  ? 97.97600  122.82900 86.70300  1.000 145.54207 ? 50  ILE F N     1 
ATOM 3904  C CA    . ILE F 2 51  ? 98.49800  122.60400 88.04400  1.000 145.54207 ? 50  ILE F CA    1 
ATOM 3905  C C     . ILE F 2 51  ? 97.70300  123.37500 89.08000  1.000 145.54207 ? 50  ILE F C     1 
ATOM 3906  O O     . ILE F 2 51  ? 97.45200  122.86100 90.17600  1.000 145.54207 ? 50  ILE F O     1 
ATOM 3907  C CB    . ILE F 2 51  ? 99.99200  122.95300 88.10500  1.000 145.54207 ? 50  ILE F CB    1 
ATOM 3908  C CG1   . ILE F 2 51  ? 100.70900 122.33700 86.91100  1.000 145.54207 ? 50  ILE F CG1   1 
ATOM 3909  C CG2   . ILE F 2 51  ? 100.61200 122.45600 89.39200  1.000 145.54207 ? 50  ILE F CG2   1 
ATOM 3910  C CD1   . ILE F 2 51  ? 102.17700 122.59600 86.89500  1.000 145.54207 ? 50  ILE F CD1   1 
ATOM 3911  N N     . TYR F 2 52  ? 97.21600  124.56700 88.73500  1.000 134.77425 ? 51  TYR F N     1 
ATOM 3912  C CA    . TYR F 2 52  ? 96.51200  125.44300 89.66900  1.000 134.77425 ? 51  TYR F CA    1 
ATOM 3913  C C     . TYR F 2 52  ? 95.18500  124.91000 90.20500  1.000 134.77425 ? 51  TYR F C     1 
ATOM 3914  O O     . TYR F 2 52  ? 94.54500  125.56800 91.02900  1.000 134.77425 ? 51  TYR F O     1 
ATOM 3915  C CB    . TYR F 2 52  ? 96.29700  126.80600 89.01500  1.000 134.77425 ? 51  TYR F CB    1 
ATOM 3916  C CG    . TYR F 2 52  ? 97.54400  127.35700 88.36800  1.000 134.77425 ? 51  TYR F CG    1 
ATOM 3917  C CD1   . TYR F 2 52  ? 98.57400  127.87100 89.14200  1.000 134.77425 ? 51  TYR F CD1   1 
ATOM 3918  C CD2   . TYR F 2 52  ? 97.69600  127.35500 86.99200  1.000 134.77425 ? 51  TYR F CD2   1 
ATOM 3919  C CE1   . TYR F 2 52  ? 99.71600  128.37500 88.56400  1.000 134.77425 ? 51  TYR F CE1   1 
ATOM 3920  C CE2   . TYR F 2 52  ? 98.83800  127.85200 86.40400  1.000 134.77425 ? 51  TYR F CE2   1 
ATOM 3921  C CZ    . TYR F 2 52  ? 99.84200  128.36300 87.19600  1.000 134.77425 ? 51  TYR F CZ    1 
ATOM 3922  O OH    . TYR F 2 52  ? 100.98000 128.86500 86.61700  1.000 134.77425 ? 51  TYR F OH    1 
ATOM 3923  N N     . GLU F 2 53  ? 94.75700  123.73300 89.76300  1.000 133.74248 ? 52  GLU F N     1 
ATOM 3924  C CA    . GLU F 2 53  ? 93.56100  123.10600 90.29200  1.000 133.74248 ? 52  GLU F CA    1 
ATOM 3925  C C     . GLU F 2 53  ? 93.87600  122.03600 91.32400  1.000 133.74248 ? 52  GLU F C     1 
ATOM 3926  O O     . GLU F 2 53  ? 92.96100  121.57100 92.01000  1.000 133.74248 ? 52  GLU F O     1 
ATOM 3927  C CB    . GLU F 2 53  ? 92.72900  122.50100 89.16100  1.000 133.74248 ? 52  GLU F CB    1 
ATOM 3928  C CG    . GLU F 2 53  ? 92.02400  123.54000 88.32000  1.000 133.74248 ? 52  GLU F CG    1 
ATOM 3929  C CD    . GLU F 2 53  ? 91.46800  124.67200 89.15800  1.000 133.74248 ? 52  GLU F CD    1 
ATOM 3930  O OE1   . GLU F 2 53  ? 91.98400  125.80300 89.04900  1.000 133.74248 ? 52  GLU F OE1   1 
ATOM 3931  O OE2   . GLU F 2 53  ? 90.51800  124.43000 89.93200  1.000 133.74248 ? 52  GLU F OE2   1 
ATOM 3932  N N     . GLU F 2 54  ? 95.13500  121.63700 91.44900  1.000 140.86718 ? 53  GLU F N     1 
ATOM 3933  C CA    . GLU F 2 54  ? 95.52500  120.61500 92.40400  1.000 140.86718 ? 53  GLU F CA    1 
ATOM 3934  C C     . GLU F 2 54  ? 96.50300  121.09600 93.45600  1.000 140.86718 ? 53  GLU F C     1 
ATOM 3935  O O     . GLU F 2 54  ? 96.53000  120.52200 94.54700  1.000 140.86718 ? 53  GLU F O     1 
ATOM 3936  C CB    . GLU F 2 54  ? 96.14300  119.40800 91.68500  1.000 140.86718 ? 53  GLU F CB    1 
ATOM 3937  C CG    . GLU F 2 54  ? 95.18300  118.67400 90.78100  1.000 140.86718 ? 53  GLU F CG    1 
ATOM 3938  C CD    . GLU F 2 54  ? 94.32800  117.68400 91.54200  1.000 140.86718 ? 53  GLU F CD    1 
ATOM 3939  O OE1   . GLU F 2 54  ? 94.73400  117.28000 92.65100  1.000 140.86718 ? 53  GLU F OE1   1 
ATOM 3940  O OE2   . GLU F 2 54  ? 93.25100  117.30800 91.03500  1.000 140.86718 ? 53  GLU F OE2   1 
ATOM 3941  N N     . THR F 2 55  ? 97.31800  122.11100 93.15900  1.000 145.22604 ? 54  THR F N     1 
ATOM 3942  C CA    . THR F 2 55  ? 98.19500  122.66800 94.18500  1.000 145.22604 ? 54  THR F CA    1 
ATOM 3943  C C     . THR F 2 55  ? 97.39300  123.33000 95.30000  1.000 145.22604 ? 54  THR F C     1 
ATOM 3944  O O     . THR F 2 55  ? 97.77600  123.25200 96.47400  1.000 145.22604 ? 54  THR F O     1 
ATOM 3945  C CB    . THR F 2 55  ? 99.20200  123.63500 93.56500  1.000 145.22604 ? 54  THR F CB    1 
ATOM 3946  O OG1   . THR F 2 55  ? 99.92200  124.31100 94.60300  1.000 145.22604 ? 54  THR F OG1   1 
ATOM 3947  C CG2   . THR F 2 55  ? 98.52200  124.63700 92.67500  1.000 145.22604 ? 54  THR F CG2   1 
ATOM 3948  N N     . ARG F 2 56  ? 96.27400  123.97200 94.95300  1.000 140.73519 ? 55  ARG F N     1 
ATOM 3949  C CA    . ARG F 2 56  ? 95.38200  124.51200 95.96900  1.000 140.73519 ? 55  ARG F CA    1 
ATOM 3950  C C     . ARG F 2 56  ? 94.79400  123.40100 96.82300  1.000 140.73519 ? 55  ARG F C     1 
ATOM 3951  O O     . ARG F 2 56  ? 94.66800  123.55000 98.04300  1.000 140.73519 ? 55  ARG F O     1 
ATOM 3952  C CB    . ARG F 2 56  ? 94.28400  125.34200 95.31400  1.000 140.73519 ? 55  ARG F CB    1 
ATOM 3953  C CG    . ARG F 2 56  ? 94.69500  126.77700 95.09500  1.000 140.73519 ? 55  ARG F CG    1 
ATOM 3954  C CD    . ARG F 2 56  ? 93.84800  127.47100 94.05500  1.000 140.73519 ? 55  ARG F CD    1 
ATOM 3955  N NE    . ARG F 2 56  ? 94.53600  128.64400 93.53100  1.000 140.73519 ? 55  ARG F NE    1 
ATOM 3956  C CZ    . ARG F 2 56  ? 94.40500  129.09600 92.29200  1.000 140.73519 ? 55  ARG F CZ    1 
ATOM 3957  N NH1   . ARG F 2 56  ? 95.07300  130.17400 91.90700  1.000 140.73519 ? 55  ARG F NH1   1 
ATOM 3958  N NH2   . ARG F 2 56  ? 93.60000  128.47700 91.44200  1.000 140.73519 ? 55  ARG F NH2   1 
ATOM 3959  N N     . GLY F 2 57  ? 94.47500  122.26300 96.20500  1.000 142.58765 ? 56  GLY F N     1 
ATOM 3960  C CA    . GLY F 2 57  ? 93.94000  121.14400 96.96200  1.000 142.58765 ? 56  GLY F CA    1 
ATOM 3961  C C     . GLY F 2 57  ? 94.95400  120.51800 97.90300  1.000 142.58765 ? 56  GLY F C     1 
ATOM 3962  O O     . GLY F 2 57  ? 94.61800  120.15400 99.03500  1.000 142.58765 ? 56  GLY F O     1 
ATOM 3963  N N     . VAL F 2 58  ? 96.20200  120.37200 97.45300  1.000 140.74372 ? 57  VAL F N     1 
ATOM 3964  C CA    . VAL F 2 58  ? 97.21200  119.78900 98.33400  1.000 140.74372 ? 57  VAL F CA    1 
ATOM 3965  C C     . VAL F 2 58  ? 97.58400  120.75800 99.45600  1.000 140.74372 ? 57  VAL F C     1 
ATOM 3966  O O     . VAL F 2 58  ? 97.85000  120.32900 100.58900 1.000 140.74372 ? 57  VAL F O     1 
ATOM 3967  C CB    . VAL F 2 58  ? 98.43400  119.27300 97.54500  1.000 140.74372 ? 57  VAL F CB    1 
ATOM 3968  C CG1   . VAL F 2 58  ? 97.98400  118.28600 96.48100  1.000 140.74372 ? 57  VAL F CG1   1 
ATOM 3969  C CG2   . VAL F 2 58  ? 99.26200  120.37700 96.92700  1.000 140.74372 ? 57  VAL F CG2   1 
ATOM 3970  N N     . LEU F 2 59  ? 97.59600  122.07000 99.17600  1.000 135.50415 ? 58  LEU F N     1 
ATOM 3971  C CA    . LEU F 2 59  ? 97.75600  123.05000 100.24600 1.000 135.50415 ? 58  LEU F CA    1 
ATOM 3972  C C     . LEU F 2 59  ? 96.60600  122.95300 101.23700 1.000 135.50415 ? 58  LEU F C     1 
ATOM 3973  O O     . LEU F 2 59  ? 96.81300  123.04500 102.45500 1.000 135.50415 ? 58  LEU F O     1 
ATOM 3974  C CB    . LEU F 2 59  ? 97.84000  124.46100 99.66600  1.000 135.50415 ? 58  LEU F CB    1 
ATOM 3975  C CG    . LEU F 2 59  ? 98.36700  125.62300 100.52200 1.000 135.50415 ? 58  LEU F CG    1 
ATOM 3976  C CD1   . LEU F 2 59  ? 98.99400  126.64500 99.61000  1.000 135.50415 ? 58  LEU F CD1   1 
ATOM 3977  C CD2   . LEU F 2 59  ? 97.31700  126.30900 101.38400 1.000 135.50415 ? 58  LEU F CD2   1 
ATOM 3978  N N     . LYS F 2 60  ? 95.38800  122.76400 100.72100 1.000 134.48531 ? 59  LYS F N     1 
ATOM 3979  C CA    . LYS F 2 60  ? 94.21000  122.67000 101.57000 1.000 134.48531 ? 59  LYS F CA    1 
ATOM 3980  C C     . LYS F 2 60  ? 94.27300  121.45000 102.47500 1.000 134.48531 ? 59  LYS F C     1 
ATOM 3981  O O     . LYS F 2 60  ? 93.96100  121.54700 103.66300 1.000 134.48531 ? 59  LYS F O     1 
ATOM 3982  C CB    . LYS F 2 60  ? 92.95300  122.63700 100.70200 1.000 134.48531 ? 59  LYS F CB    1 
ATOM 3983  C CG    . LYS F 2 60  ? 91.64900  122.63900 101.47000 1.000 134.48531 ? 59  LYS F CG    1 
ATOM 3984  C CD    . LYS F 2 60  ? 90.49100  122.27400 100.55700 1.000 134.48531 ? 59  LYS F CD    1 
ATOM 3985  C CE    . LYS F 2 60  ? 89.26200  123.11600 100.84600 1.000 134.48531 ? 59  LYS F CE    1 
ATOM 3986  N NZ    . LYS F 2 60  ? 88.82000  122.97500 102.25600 1.000 134.48531 ? 59  LYS F NZ    1 
ATOM 3987  N N     . VAL F 2 61  ? 94.71100  120.30500 101.94900 1.000 131.93589 ? 60  VAL F N     1 
ATOM 3988  C CA    . VAL F 2 61  ? 94.75600  119.10800 102.78600 1.000 131.93589 ? 60  VAL F CA    1 
ATOM 3989  C C     . VAL F 2 61  ? 95.89200  119.19700 103.80800 1.000 131.93589 ? 60  VAL F C     1 
ATOM 3990  O O     . VAL F 2 61  ? 95.73600  118.75700 104.95800 1.000 131.93589 ? 60  VAL F O     1 
ATOM 3991  C CB    . VAL F 2 61  ? 94.80300  117.82100 101.93400 1.000 131.93589 ? 60  VAL F CB    1 
ATOM 3992  C CG1   . VAL F 2 61  ? 96.07200  117.66300 101.14100 1.000 131.93589 ? 60  VAL F CG1   1 
ATOM 3993  C CG2   . VAL F 2 61  ? 94.60000  116.63000 102.80700 1.000 131.93589 ? 60  VAL F CG2   1 
ATOM 3994  N N     . PHE F 2 62  ? 97.03300  119.79000 103.42500 1.000 115.90700 ? 61  PHE F N     1 
ATOM 3995  C CA    . PHE F 2 62  ? 98.12100  119.99400 104.37700 1.000 115.90700 ? 61  PHE F CA    1 
ATOM 3996  C C     . PHE F 2 62  ? 97.69100  120.89700 105.52300 1.000 115.90700 ? 61  PHE F C     1 
ATOM 3997  O O     . PHE F 2 62  ? 97.96500  120.60700 106.69700 1.000 115.90700 ? 61  PHE F O     1 
ATOM 3998  C CB    . PHE F 2 62  ? 99.32900  120.58700 103.66200 1.000 115.90700 ? 61  PHE F CB    1 
ATOM 3999  C CG    . PHE F 2 62  ? 100.42800 121.00000 104.58300 1.000 115.90700 ? 61  PHE F CG    1 
ATOM 4000  C CD1   . PHE F 2 62  ? 101.25500 120.05500 105.15000 1.000 115.90700 ? 61  PHE F CD1   1 
ATOM 4001  C CD2   . PHE F 2 62  ? 100.64000 122.33700 104.87600 1.000 115.90700 ? 61  PHE F CD2   1 
ATOM 4002  C CE1   . PHE F 2 62  ? 102.27000 120.43000 105.99800 1.000 115.90700 ? 61  PHE F CE1   1 
ATOM 4003  C CE2   . PHE F 2 62  ? 101.65100 122.71900 105.72500 1.000 115.90700 ? 61  PHE F CE2   1 
ATOM 4004  C CZ    . PHE F 2 62  ? 102.46800 121.76400 106.28700 1.000 115.90700 ? 61  PHE F CZ    1 
ATOM 4005  N N     . LEU F 2 63  ? 96.98700  121.97900 105.19900 1.000 115.93706 ? 62  LEU F N     1 
ATOM 4006  C CA    . LEU F 2 63  ? 96.50800  122.87100 106.24000 1.000 115.93706 ? 62  LEU F CA    1 
ATOM 4007  C C     . LEU F 2 63  ? 95.42700  122.20900 107.07800 1.000 115.93706 ? 62  LEU F C     1 
ATOM 4008  O O     . LEU F 2 63  ? 95.41800  122.35700 108.30000 1.000 115.93706 ? 62  LEU F O     1 
ATOM 4009  C CB    . LEU F 2 63  ? 96.00200  124.16400 105.61500 1.000 115.93706 ? 62  LEU F CB    1 
ATOM 4010  C CG    . LEU F 2 63  ? 97.09900  125.15800 105.23400 1.000 115.93706 ? 62  LEU F CG    1 
ATOM 4011  C CD1   . LEU F 2 63  ? 96.50500  126.53200 105.07700 1.000 115.93706 ? 62  LEU F CD1   1 
ATOM 4012  C CD2   . LEU F 2 63  ? 98.23000  125.19500 106.24800 1.000 115.93706 ? 62  LEU F CD2   1 
ATOM 4013  N N     . GLU F 2 64  ? 94.53300  121.44300 106.45200 1.000 129.33223 ? 63  GLU F N     1 
ATOM 4014  C CA    . GLU F 2 64  ? 93.48100  120.76200 107.19600 1.000 129.33223 ? 63  GLU F CA    1 
ATOM 4015  C C     . GLU F 2 64  ? 94.03100  119.69900 108.13100 1.000 129.33223 ? 63  GLU F C     1 
ATOM 4016  O O     . GLU F 2 64  ? 93.38000  119.37000 109.12500 1.000 129.33223 ? 63  GLU F O     1 
ATOM 4017  C CB    . GLU F 2 64  ? 92.47500  120.13400 106.23600 1.000 129.33223 ? 63  GLU F CB    1 
ATOM 4018  C CG    . GLU F 2 64  ? 91.47200  121.11900 105.67400 1.000 129.33223 ? 63  GLU F CG    1 
ATOM 4019  C CD    . GLU F 2 64  ? 90.18700  120.46100 105.23000 1.000 129.33223 ? 63  GLU F CD    1 
ATOM 4020  O OE1   . GLU F 2 64  ? 89.41000  120.03200 106.10400 1.000 129.33223 ? 63  GLU F OE1   1 
ATOM 4021  O OE2   . GLU F 2 64  ? 89.95200  120.37600 104.00600 1.000 129.33223 ? 63  GLU F OE2   1 
ATOM 4022  N N     . ASN F 2 65  ? 95.21000  119.16200 107.84200 1.000 115.35579 ? 64  ASN F N     1 
ATOM 4023  C CA    . ASN F 2 65  ? 95.83300  118.25900 108.79800 1.000 115.35579 ? 64  ASN F CA    1 
ATOM 4024  C C     . ASN F 2 65  ? 96.50200  119.02600 109.93500 1.000 115.35579 ? 64  ASN F C     1 
ATOM 4025  O O     . ASN F 2 65  ? 96.24400  118.75300 111.12100 1.000 115.35579 ? 64  ASN F O     1 
ATOM 4026  C CB    . ASN F 2 65  ? 96.83700  117.36700 108.07900 1.000 115.35579 ? 64  ASN F CB    1 
ATOM 4027  C CG    . ASN F 2 65  ? 96.99400  116.03300 108.74800 1.000 115.35579 ? 64  ASN F CG    1 
ATOM 4028  O OD1   . ASN F 2 65  ? 96.40200  115.78300 109.79600 1.000 115.35579 ? 64  ASN F OD1   1 
ATOM 4029  N ND2   . ASN F 2 65  ? 97.79100  115.16200 108.15100 1.000 115.35579 ? 64  ASN F ND2   1 
ATOM 4030  N N     . VAL F 2 66  ? 97.34900  120.00100 109.58200 1.000 106.21890 ? 65  VAL F N     1 
ATOM 4031  C CA    . VAL F 2 66  ? 98.18600  120.68000 110.57000 1.000 106.21890 ? 65  VAL F CA    1 
ATOM 4032  C C     . VAL F 2 66  ? 97.33600  121.50100 111.52800 1.000 106.21890 ? 65  VAL F C     1 
ATOM 4033  O O     . VAL F 2 66  ? 97.52500  121.44900 112.75000 1.000 106.21890 ? 65  VAL F O     1 
ATOM 4034  C CB    . VAL F 2 66  ? 99.23900  121.54800 109.86500 1.000 106.21890 ? 65  VAL F CB    1 
ATOM 4035  C CG1   . VAL F 2 66  ? 99.98800  122.39500 110.86200 1.000 106.21890 ? 65  VAL F CG1   1 
ATOM 4036  C CG2   . VAL F 2 66  ? 100.20800 120.67200 109.11400 1.000 106.21890 ? 65  VAL F CG2   1 
ATOM 4037  N N     . ILE F 2 67  ? 96.39000  122.26800 110.98600 1.000 111.10520 ? 66  ILE F N     1 
ATOM 4038  C CA    . ILE F 2 67  ? 95.53900  123.12300 111.80000 1.000 111.10520 ? 66  ILE F CA    1 
ATOM 4039  C C     . ILE F 2 67  ? 94.64000  122.29700 112.70900 1.000 111.10520 ? 66  ILE F C     1 
ATOM 4040  O O     . ILE F 2 67  ? 94.40100  122.67700 113.85800 1.000 111.10520 ? 66  ILE F O     1 
ATOM 4041  C CB    . ILE F 2 67  ? 94.74100  124.07600 110.89000 1.000 111.10520 ? 66  ILE F CB    1 
ATOM 4042  C CG1   . ILE F 2 67  ? 95.69500  124.97700 110.10900 1.000 111.10520 ? 66  ILE F CG1   1 
ATOM 4043  C CG2   . ILE F 2 67  ? 93.77100  124.93700 111.66800 1.000 111.10520 ? 66  ILE F CG2   1 
ATOM 4044  C CD1   . ILE F 2 67  ? 95.04600  125.65700 108.93100 1.000 111.10520 ? 66  ILE F CD1   1 
ATOM 4045  N N     . ARG F 2 68  ? 94.16900  121.13600 112.24000 1.000 116.97868 ? 67  ARG F N     1 
ATOM 4046  C CA    . ARG F 2 68  ? 93.33900  120.30100 113.10600 1.000 116.97868 ? 67  ARG F CA    1 
ATOM 4047  C C     . ARG F 2 68  ? 94.15500  119.71900 114.25900 1.000 116.97868 ? 67  ARG F C     1 
ATOM 4048  O O     . ARG F 2 68  ? 93.66400  119.65200 115.39900 1.000 116.97868 ? 67  ARG F O     1 
ATOM 4049  C CB    . ARG F 2 68  ? 92.61400  119.21700 112.29200 1.000 116.97868 ? 67  ARG F CB    1 
ATOM 4050  C CG    . ARG F 2 68  ? 93.21700  117.81900 112.25800 1.000 116.97868 ? 67  ARG F CG    1 
ATOM 4051  C CD    . ARG F 2 68  ? 92.46700  116.87200 111.34700 1.000 116.97868 ? 67  ARG F CD    1 
ATOM 4052  N NE    . ARG F 2 68  ? 93.35400  115.82400 110.85100 1.000 116.97868 ? 67  ARG F NE    1 
ATOM 4053  C CZ    . ARG F 2 68  ? 93.58400  114.67900 111.48400 1.000 116.97868 ? 67  ARG F CZ    1 
ATOM 4054  N NH1   . ARG F 2 68  ? 92.99400  114.42800 112.64400 1.000 116.97868 ? 67  ARG F NH1   1 
ATOM 4055  N NH2   . ARG F 2 68  ? 94.40900  113.78600 110.96000 1.000 116.97868 ? 67  ARG F NH2   1 
ATOM 4056  N N     . ASP F 2 69  ? 95.41800  119.35200 114.00000 1.000 117.56967 ? 68  ASP F N     1 
ATOM 4057  C CA    . ASP F 2 69  ? 96.26500  118.87200 115.08800 1.000 117.56967 ? 68  ASP F CA    1 
ATOM 4058  C C     . ASP F 2 69  ? 96.55900  119.97900 116.09500 1.000 117.56967 ? 68  ASP F C     1 
ATOM 4059  O O     . ASP F 2 69  ? 96.45500  119.76400 117.30900 1.000 117.56967 ? 68  ASP F O     1 
ATOM 4060  C CB    . ASP F 2 69  ? 97.55400  118.28700 114.52700 1.000 117.56967 ? 68  ASP F CB    1 
ATOM 4061  C CG    . ASP F 2 69  ? 97.33400  116.97100 113.82600 1.000 117.56967 ? 68  ASP F CG    1 
ATOM 4062  O OD1   . ASP F 2 69  ? 96.16200  116.56100 113.69100 1.000 117.56967 ? 68  ASP F OD1   1 
ATOM 4063  O OD2   . ASP F 2 69  ? 98.33200  116.34000 113.42100 1.000 117.56967 ? 68  ASP F OD2   1 
ATOM 4064  N N     . ALA F 2 70  ? 96.87400  121.18200 115.60800 1.000 114.90852 ? 69  ALA F N     1 
ATOM 4065  C CA    . ALA F 2 70  ? 97.14500  122.29900 116.50900 1.000 114.90852 ? 69  ALA F CA    1 
ATOM 4066  C C     . ALA F 2 70  ? 95.90600  122.71300 117.28600 1.000 114.90852 ? 69  ALA F C     1 
ATOM 4067  O O     . ALA F 2 70  ? 96.00400  123.10600 118.45400 1.000 114.90852 ? 69  ALA F O     1 
ATOM 4068  C CB    . ALA F 2 70  ? 97.69600  123.48700 115.72800 1.000 114.90852 ? 69  ALA F CB    1 
ATOM 4069  N N     . VAL F 2 71  ? 94.73300  122.61500 116.67100 1.000 113.45583 ? 70  VAL F N     1 
ATOM 4070  C CA    . VAL F 2 71  ? 93.54600  123.07300 117.36500 1.000 113.45583 ? 70  VAL F CA    1 
ATOM 4071  C C     . VAL F 2 71  ? 93.09700  122.06500 118.41500 1.000 113.45583 ? 70  VAL F C     1 
ATOM 4072  O O     . VAL F 2 71  ? 92.58700  122.46700 119.46600 1.000 113.45583 ? 70  VAL F O     1 
ATOM 4073  C CB    . VAL F 2 71  ? 92.43900  123.44500 116.36100 1.000 113.45583 ? 70  VAL F CB    1 
ATOM 4074  C CG1   . VAL F 2 71  ? 91.62900  122.25300 115.87900 1.000 113.45583 ? 70  VAL F CG1   1 
ATOM 4075  C CG2   . VAL F 2 71  ? 91.52900  124.46600 116.97600 1.000 113.45583 ? 70  VAL F CG2   1 
ATOM 4076  N N     . THR F 2 72  ? 93.30600  120.75800 118.20200 1.000 116.26766 ? 71  THR F N     1 
ATOM 4077  C CA    . THR F 2 72  ? 93.02000  119.84900 119.30600 1.000 116.26766 ? 71  THR F CA    1 
ATOM 4078  C C     . THR F 2 72  ? 94.08200  119.95700 120.39300 1.000 116.26766 ? 71  THR F C     1 
ATOM 4079  O O     . THR F 2 72  ? 93.77000  119.74000 121.57400 1.000 116.26766 ? 71  THR F O     1 
ATOM 4080  C CB    . THR F 2 72  ? 92.81900  118.41000 118.81900 1.000 116.26766 ? 71  THR F CB    1 
ATOM 4081  O OG1   . THR F 2 72  ? 92.35500  117.60700 119.90900 1.000 116.26766 ? 71  THR F OG1   1 
ATOM 4082  C CG2   . THR F 2 72  ? 94.06600  117.80200 118.25200 1.000 116.26766 ? 71  THR F CG2   1 
ATOM 4083  N N     . TYR F 2 73  ? 95.32400  120.30300 120.01600 1.000 116.78100 ? 72  TYR F N     1 
ATOM 4084  C CA    . TYR F 2 73  ? 96.34700  120.64100 121.00200 1.000 116.78100 ? 72  TYR F CA    1 
ATOM 4085  C C     . TYR F 2 73  ? 95.89800  121.78900 121.89700 1.000 116.78100 ? 72  TYR F C     1 
ATOM 4086  O O     . TYR F 2 73  ? 96.09800  121.74800 123.11500 1.000 116.78100 ? 72  TYR F O     1 
ATOM 4087  C CB    . TYR F 2 73  ? 97.65900  120.99400 120.31000 1.000 116.78100 ? 72  TYR F CB    1 
ATOM 4088  C CG    . TYR F 2 73  ? 98.62000  119.84300 120.18100 1.000 116.78100 ? 72  TYR F CG    1 
ATOM 4089  C CD1   . TYR F 2 73  ? 99.07200  119.16300 121.29600 1.000 116.78100 ? 72  TYR F CD1   1 
ATOM 4090  C CD2   . TYR F 2 73  ? 99.09200  119.45100 118.94300 1.000 116.78100 ? 72  TYR F CD2   1 
ATOM 4091  C CE1   . TYR F 2 73  ? 99.96000  118.11400 121.17500 1.000 116.78100 ? 72  TYR F CE1   1 
ATOM 4092  C CE2   . TYR F 2 73  ? 99.97100  118.40200 118.81300 1.000 116.78100 ? 72  TYR F CE2   1 
ATOM 4093  C CZ    . TYR F 2 73  ? 100.40200 117.73700 119.93300 1.000 116.78100 ? 72  TYR F CZ    1 
ATOM 4094  O OH    . TYR F 2 73  ? 101.28300 116.69100 119.80600 1.000 116.78100 ? 72  TYR F OH    1 
ATOM 4095  N N     . THR F 2 74  ? 95.30600  122.82800 121.30900 1.000 117.97121 ? 73  THR F N     1 
ATOM 4096  C CA    . THR F 2 74  ? 94.83000  123.94100 122.12700 1.000 117.97121 ? 73  THR F CA    1 
ATOM 4097  C C     . THR F 2 74  ? 93.61100  123.55300 122.94400 1.000 117.97121 ? 73  THR F C     1 
ATOM 4098  O O     . THR F 2 74  ? 93.49800  123.93000 124.11400 1.000 117.97121 ? 73  THR F O     1 
ATOM 4099  C CB    . THR F 2 74  ? 94.46400  125.13300 121.26000 1.000 117.97121 ? 73  THR F CB    1 
ATOM 4100  O OG1   . THR F 2 74  ? 93.51200  124.72000 120.27400 1.000 117.97121 ? 73  THR F OG1   1 
ATOM 4101  C CG2   . THR F 2 74  ? 95.67200  125.66900 120.59700 1.000 117.97121 ? 73  THR F CG2   1 
ATOM 4102  N N     . GLU F 2 75  ? 92.68700  122.81000 122.34000 1.000 122.09151 ? 74  GLU F N     1 
ATOM 4103  C CA    . GLU F 2 75  ? 91.46000  122.42600 123.02100 1.000 122.09151 ? 74  GLU F CA    1 
ATOM 4104  C C     . GLU F 2 75  ? 91.67400  121.47800 124.18300 1.000 122.09151 ? 74  GLU F C     1 
ATOM 4105  O O     . GLU F 2 75  ? 90.76500  121.35200 125.01100 1.000 122.09151 ? 74  GLU F O     1 
ATOM 4106  C CB    . GLU F 2 75  ? 90.46100  121.84800 122.03400 1.000 122.09151 ? 74  GLU F CB    1 
ATOM 4107  C CG    . GLU F 2 75  ? 89.72800  122.95100 121.33900 1.000 122.09151 ? 74  GLU F CG    1 
ATOM 4108  C CD    . GLU F 2 75  ? 88.85900  123.71900 122.32000 1.000 122.09151 ? 74  GLU F CD    1 
ATOM 4109  O OE1   . GLU F 2 75  ? 88.24300  123.08100 123.20100 1.000 122.09151 ? 74  GLU F OE1   1 
ATOM 4110  O OE2   . GLU F 2 75  ? 88.83000  124.96200 122.25200 1.000 122.09151 ? 74  GLU F OE2   1 
ATOM 4111  N N     . HIS F 2 76  ? 92.78700  120.73600 124.20600 1.000 120.55835 ? 75  HIS F N     1 
ATOM 4112  C CA    . HIS F 2 76  ? 93.10800  119.96200 125.40300 1.000 120.55835 ? 75  HIS F CA    1 
ATOM 4113  C C     . HIS F 2 76  ? 93.19800  120.86300 126.62400 1.000 120.55835 ? 75  HIS F C     1 
ATOM 4114  O O     . HIS F 2 76  ? 92.67900  120.52800 127.69400 1.000 120.55835 ? 75  HIS F O     1 
ATOM 4115  C CB    . HIS F 2 76  ? 94.41000  119.19700 125.24900 1.000 120.55835 ? 75  HIS F CB    1 
ATOM 4116  C CG    . HIS F 2 76  ? 94.84400  118.55100 126.52100 1.000 120.55835 ? 75  HIS F CG    1 
ATOM 4117  N ND1   . HIS F 2 76  ? 95.93500  118.97900 127.24200 1.000 120.55835 ? 75  HIS F ND1   1 
ATOM 4118  C CD2   . HIS F 2 76  ? 94.28800  117.54700 127.23700 1.000 120.55835 ? 75  HIS F CD2   1 
ATOM 4119  C CE1   . HIS F 2 76  ? 96.05500  118.24000 128.33000 1.000 120.55835 ? 75  HIS F CE1   1 
ATOM 4120  N NE2   . HIS F 2 76  ? 95.06700  117.36600 128.35100 1.000 120.55835 ? 75  HIS F NE2   1 
ATOM 4121  N N     . ALA F 2 77  ? 93.85400  122.00400 126.48500 1.000 123.37963 ? 76  ALA F N     1 
ATOM 4122  C CA    . ALA F 2 77  ? 93.87900  122.96700 127.56600 1.000 123.37963 ? 76  ALA F CA    1 
ATOM 4123  C C     . ALA F 2 77  ? 92.63000  123.83000 127.47200 1.000 123.37963 ? 76  ALA F C     1 
ATOM 4124  O O     . ALA F 2 77  ? 91.87500  123.77100 126.50100 1.000 123.37963 ? 76  ALA F O     1 
ATOM 4125  C CB    . ALA F 2 77  ? 95.13900  123.82500 127.50500 1.000 123.37963 ? 76  ALA F CB    1 
ATOM 4126  N N     . LYS F 2 78  ? 92.39900  124.63000 128.50400 1.000 124.03442 ? 77  LYS F N     1 
ATOM 4127  C CA    . LYS F 2 78  ? 91.20600  125.47400 128.54700 1.000 124.03442 ? 77  LYS F CA    1 
ATOM 4128  C C     . LYS F 2 78  ? 91.49300  126.85600 127.96300 1.000 124.03442 ? 77  LYS F C     1 
ATOM 4129  O O     . LYS F 2 78  ? 91.40200  127.88100 128.63100 1.000 124.03442 ? 77  LYS F O     1 
ATOM 4130  C CB    . LYS F 2 78  ? 90.66200  125.55800 129.96700 1.000 124.03442 ? 77  LYS F CB    1 
ATOM 4131  C CG    . LYS F 2 78  ? 90.35000  124.20600 130.60800 1.000 124.03442 ? 77  LYS F CG    1 
ATOM 4132  C CD    . LYS F 2 78  ? 89.60700  123.27200 129.65500 1.000 124.03442 ? 77  LYS F CD    1 
ATOM 4133  C CE    . LYS F 2 78  ? 88.13400  123.61400 129.56300 1.000 124.03442 ? 77  LYS F CE    1 
ATOM 4134  N NZ    . LYS F 2 78  ? 87.45600  122.80000 128.51900 1.000 124.03442 ? 77  LYS F NZ    1 
ATOM 4135  N N     . ARG F 2 79  ? 91.84900  126.86300 126.68300 1.000 136.28111 ? 78  ARG F N     1 
ATOM 4136  C CA    . ARG F 2 79  ? 92.14300  128.09200 125.97000 1.000 136.28111 ? 78  ARG F CA    1 
ATOM 4137  C C     . ARG F 2 79  ? 91.33300  128.12000 124.68400 1.000 136.28111 ? 78  ARG F C     1 
ATOM 4138  O O     . ARG F 2 79  ? 90.79700  127.10100 124.24600 1.000 136.28111 ? 78  ARG F O     1 
ATOM 4139  C CB    . ARG F 2 79  ? 93.63200  128.21400 125.65300 1.000 136.28111 ? 78  ARG F CB    1 
ATOM 4140  C CG    . ARG F 2 79  ? 94.49600  128.45500 126.86900 1.000 136.28111 ? 78  ARG F CG    1 
ATOM 4141  C CD    . ARG F 2 79  ? 95.77200  129.16600 126.48700 1.000 136.28111 ? 78  ARG F CD    1 
ATOM 4142  N NE    . ARG F 2 79  ? 96.28300  128.70100 125.20500 1.000 136.28111 ? 78  ARG F NE    1 
ATOM 4143  C CZ    . ARG F 2 79  ? 97.20300  127.75700 125.07000 1.000 136.28111 ? 78  ARG F CZ    1 
ATOM 4144  N NH1   . ARG F 2 79  ? 97.71900  127.17500 126.14200 1.000 136.28111 ? 78  ARG F NH1   1 
ATOM 4145  N NH2   . ARG F 2 79  ? 97.60800  127.39700 123.86300 1.000 136.28111 ? 78  ARG F NH2   1 
ATOM 4146  N N     . LYS F 2 80  ? 91.23900  129.30500 124.07900 1.000 133.96793 ? 79  LYS F N     1 
ATOM 4147  C CA    . LYS F 2 80  ? 90.47600  129.46300 122.85100 1.000 133.96793 ? 79  LYS F CA    1 
ATOM 4148  C C     . LYS F 2 80  ? 91.26600  130.08500 121.71100 1.000 133.96793 ? 79  LYS F C     1 
ATOM 4149  O O     . LYS F 2 80  ? 90.71800  130.23400 120.61400 1.000 133.96793 ? 79  LYS F O     1 
ATOM 4150  C CB    . LYS F 2 80  ? 89.22500  130.31200 123.10400 1.000 133.96793 ? 79  LYS F CB    1 
ATOM 4151  C CG    . LYS F 2 80  ? 88.22100  129.65600 124.01600 1.000 133.96793 ? 79  LYS F CG    1 
ATOM 4152  C CD    . LYS F 2 80  ? 87.08000  130.59300 124.33100 1.000 133.96793 ? 79  LYS F CD    1 
ATOM 4153  C CE    . LYS F 2 80  ? 86.16600  129.98300 125.37200 1.000 133.96793 ? 79  LYS F CE    1 
ATOM 4154  N NZ    . LYS F 2 80  ? 86.94800  129.41000 126.49900 1.000 133.96793 ? 79  LYS F NZ    1 
ATOM 4155  N N     . THR F 2 81  ? 92.52500  130.44400 121.92900 1.000 135.16371 ? 80  THR F N     1 
ATOM 4156  C CA    . THR F 2 81  ? 93.35900  131.04800 120.90200 1.000 135.16371 ? 80  THR F CA    1 
ATOM 4157  C C     . THR F 2 81  ? 94.49900  130.11000 120.55100 1.000 135.16371 ? 80  THR F C     1 
ATOM 4158  O O     . THR F 2 81  ? 95.25100  129.68000 121.43100 1.000 135.16371 ? 80  THR F O     1 
ATOM 4159  C CB    . THR F 2 81  ? 93.93000  132.39200 121.35000 1.000 135.16371 ? 80  THR F CB    1 
ATOM 4160  O OG1   . THR F 2 81  ? 95.07600  132.16800 122.17900 1.000 135.16371 ? 80  THR F OG1   1 
ATOM 4161  C CG2   . THR F 2 81  ? 92.90400  133.20200 122.09400 1.000 135.16371 ? 80  THR F CG2   1 
ATOM 4162  N N     . VAL F 2 82  ? 94.63000  129.80800 119.27100 1.000 122.53629 ? 81  VAL F N     1 
ATOM 4163  C CA    . VAL F 2 82  ? 95.71400  128.96100 118.80300 1.000 122.53629 ? 81  VAL F CA    1 
ATOM 4164  C C     . VAL F 2 82  ? 96.99700  129.77900 118.81400 1.000 122.53629 ? 81  VAL F C     1 
ATOM 4165  O O     . VAL F 2 82  ? 97.04900  130.88700 118.27200 1.000 122.53629 ? 81  VAL F O     1 
ATOM 4166  C CB    . VAL F 2 82  ? 95.40300  128.40700 117.40500 1.000 122.53629 ? 81  VAL F CB    1 
ATOM 4167  C CG1   . VAL F 2 82  ? 94.49500  127.21200 117.50500 1.000 122.53629 ? 81  VAL F CG1   1 
ATOM 4168  C CG2   . VAL F 2 82  ? 94.70500  129.44000 116.58400 1.000 122.53629 ? 81  VAL F CG2   1 
ATOM 4169  N N     . THR F 2 83  ? 98.01800  129.26400 119.47900 1.000 117.08936 ? 82  THR F N     1 
ATOM 4170  C CA    . THR F 2 83  ? 99.28300  129.96700 119.60000 1.000 117.08936 ? 82  THR F CA    1 
ATOM 4171  C C     . THR F 2 83  ? 100.31200 129.32500 118.68700 1.000 117.08936 ? 82  THR F C     1 
ATOM 4172  O O     . THR F 2 83  ? 100.09700 128.25000 118.12800 1.000 117.08936 ? 82  THR F O     1 
ATOM 4173  C CB    . THR F 2 83  ? 99.78600  129.95200 121.04200 1.000 117.08936 ? 82  THR F CB    1 
ATOM 4174  O OG1   . THR F 2 83  ? 100.43800 128.70400 121.29400 1.000 117.08936 ? 82  THR F OG1   1 
ATOM 4175  C CG2   . THR F 2 83  ? 98.62500  130.10800 121.99800 1.000 117.08936 ? 82  THR F CG2   1 
ATOM 4176  N N     . ALA F 2 84  ? 101.45200 130.00100 118.55100 1.000 110.54269 ? 83  ALA F N     1 
ATOM 4177  C CA    . ALA F 2 84  ? 102.52400 129.48200 117.71500 1.000 110.54269 ? 83  ALA F CA    1 
ATOM 4178  C C     . ALA F 2 84  ? 103.17000 128.24000 118.30100 1.000 110.54269 ? 83  ALA F C     1 
ATOM 4179  O O     . ALA F 2 84  ? 103.75200 127.44900 117.55500 1.000 110.54269 ? 83  ALA F O     1 
ATOM 4180  C CB    . ALA F 2 84  ? 103.58500 130.55600 117.50100 1.000 110.54269 ? 83  ALA F CB    1 
ATOM 4181  N N     . MET F 2 85  ? 103.08000 128.05400 119.61500 1.000 113.16825 ? 84  MET F N     1 
ATOM 4182  C CA    . MET F 2 85  ? 103.62900 126.85900 120.24000 1.000 113.16825 ? 84  MET F CA    1 
ATOM 4183  C C     . MET F 2 85  ? 102.84100 125.61700 119.85300 1.000 113.16825 ? 84  MET F C     1 
ATOM 4184  O O     . MET F 2 85  ? 103.41500 124.54100 119.65700 1.000 113.16825 ? 84  MET F O     1 
ATOM 4185  C CB    . MET F 2 85  ? 103.64600 127.03500 121.75400 1.000 113.16825 ? 84  MET F CB    1 
ATOM 4186  C CG    . MET F 2 85  ? 104.55700 126.07200 122.46100 1.000 113.16825 ? 84  MET F CG    1 
ATOM 4187  S SD    . MET F 2 85  ? 106.13700 125.91600 121.62400 1.000 113.16825 ? 84  MET F SD    1 
ATOM 4188  C CE    . MET F 2 85  ? 106.84800 127.51300 121.98800 1.000 113.16825 ? 84  MET F CE    1 
ATOM 4189  N N     . ASP F 2 86  ? 101.52200 125.74100 119.76200 1.000 115.67792 ? 85  ASP F N     1 
ATOM 4190  C CA    . ASP F 2 86  ? 100.70400 124.59700 119.39200 1.000 115.67792 ? 85  ASP F CA    1 
ATOM 4191  C C     . ASP F 2 86  ? 100.89100 124.20500 117.93500 1.000 115.67792 ? 85  ASP F C     1 
ATOM 4192  O O     . ASP F 2 86  ? 100.81100 123.01800 117.60400 1.000 115.67792 ? 85  ASP F O     1 
ATOM 4193  C CB    . ASP F 2 86  ? 99.25400  124.91400 119.69100 1.000 115.67792 ? 85  ASP F CB    1 
ATOM 4194  C CG    . ASP F 2 86  ? 99.07600  125.42100 121.09300 1.000 115.67792 ? 85  ASP F CG    1 
ATOM 4195  O OD1   . ASP F 2 86  ? 99.46800  126.57600 121.35200 1.000 115.67792 ? 85  ASP F OD1   1 
ATOM 4196  O OD2   . ASP F 2 86  ? 98.55000  124.67000 121.93700 1.000 115.67792 ? 85  ASP F OD2   1 
ATOM 4197  N N     . VAL F 2 87  ? 101.14500 125.17700 117.06200 1.000 105.04724 ? 86  VAL F N     1 
ATOM 4198  C CA    . VAL F 2 87  ? 101.39300 124.87400 115.65800 1.000 105.04724 ? 86  VAL F CA    1 
ATOM 4199  C C     . VAL F 2 87  ? 102.68100 124.07900 115.50300 1.000 105.04724 ? 86  VAL F C     1 
ATOM 4200  O O     . VAL F 2 87  ? 102.71700 123.06000 114.80300 1.000 105.04724 ? 86  VAL F O     1 
ATOM 4201  C CB    . VAL F 2 87  ? 101.41400 126.17100 114.83400 1.000 105.04724 ? 86  VAL F CB    1 
ATOM 4202  C CG1   . VAL F 2 87  ? 102.03300 125.94400 113.47500 1.000 105.04724 ? 86  VAL F CG1   1 
ATOM 4203  C CG2   . VAL F 2 87  ? 100.00900 126.68900 114.68000 1.000 105.04724 ? 86  VAL F CG2   1 
ATOM 4204  N N     . VAL F 2 88  ? 103.74900 124.51600 116.17300 1.000 108.78966 ? 87  VAL F N     1 
ATOM 4205  C CA    . VAL F 2 88  ? 105.01000 123.79400 116.06300 1.000 108.78966 ? 87  VAL F CA    1 
ATOM 4206  C C     . VAL F 2 88  ? 104.92200 122.44800 116.78000 1.000 108.78966 ? 87  VAL F C     1 
ATOM 4207  O O     . VAL F 2 88  ? 105.56100 121.47600 116.36000 1.000 108.78966 ? 87  VAL F O     1 
ATOM 4208  C CB    . VAL F 2 88  ? 106.18700 124.67600 116.54200 1.000 108.78966 ? 87  VAL F CB    1 
ATOM 4209  C CG1   . VAL F 2 88  ? 106.14800 124.94800 118.01600 1.000 108.78966 ? 87  VAL F CG1   1 
ATOM 4210  C CG2   . VAL F 2 88  ? 107.51200 124.06300 116.16500 1.000 108.78966 ? 87  VAL F CG2   1 
ATOM 4211  N N     . TYR F 2 89  ? 104.09100 122.34400 117.82500 1.000 114.84128 ? 88  TYR F N     1 
ATOM 4212  C CA    . TYR F 2 89  ? 103.84700 121.04700 118.45100 1.000 114.84128 ? 88  TYR F CA    1 
ATOM 4213  C C     . TYR F 2 89  ? 103.15000 120.09300 117.48900 1.000 114.84128 ? 88  TYR F C     1 
ATOM 4214  O O     . TYR F 2 89  ? 103.50800 118.91200 117.40400 1.000 114.84128 ? 88  TYR F O     1 
ATOM 4215  C CB    . TYR F 2 89  ? 103.01000 121.21800 119.71300 1.000 114.84128 ? 88  TYR F CB    1 
ATOM 4216  C CG    . TYR F 2 89  ? 103.78400 121.71400 120.90400 1.000 114.84128 ? 88  TYR F CG    1 
ATOM 4217  C CD1   . TYR F 2 89  ? 105.17000 121.72800 120.90100 1.000 114.84128 ? 88  TYR F CD1   1 
ATOM 4218  C CD2   . TYR F 2 89  ? 103.12500 122.18000 122.03100 1.000 114.84128 ? 88  TYR F CD2   1 
ATOM 4219  C CE1   . TYR F 2 89  ? 105.87700 122.18900 121.99100 1.000 114.84128 ? 88  TYR F CE1   1 
ATOM 4220  C CE2   . TYR F 2 89  ? 103.82100 122.63800 123.12600 1.000 114.84128 ? 88  TYR F CE2   1 
ATOM 4221  C CZ    . TYR F 2 89  ? 105.19500 122.64000 123.10000 1.000 114.84128 ? 88  TYR F CZ    1 
ATOM 4222  O OH    . TYR F 2 89  ? 105.89300 123.10100 124.19100 1.000 114.84128 ? 88  TYR F OH    1 
ATOM 4223  N N     . ALA F 2 90  ? 102.14900 120.59500 116.76400 1.000 112.40398 ? 89  ALA F N     1 
ATOM 4224  C CA    . ALA F 2 90  ? 101.44400 119.79000 115.77400 1.000 112.40398 ? 89  ALA F CA    1 
ATOM 4225  C C     . ALA F 2 90  ? 102.36600 119.36300 114.64500 1.000 112.40398 ? 89  ALA F C     1 
ATOM 4226  O O     . ALA F 2 90  ? 102.29900 118.22300 114.17100 1.000 112.40398 ? 89  ALA F O     1 
ATOM 4227  C CB    . ALA F 2 90  ? 100.27100 120.58700 115.22000 1.000 112.40398 ? 89  ALA F CB    1 
ATOM 4228  N N     . LEU F 2 91  ? 103.23900 120.26900 114.21400 1.000 112.87397 ? 90  LEU F N     1 
ATOM 4229  C CA    . LEU F 2 91  ? 104.19300 119.96400 113.15700 1.000 112.87397 ? 90  LEU F CA    1 
ATOM 4230  C C     . LEU F 2 91  ? 105.20100 118.91400 113.60400 1.000 112.87397 ? 90  LEU F C     1 
ATOM 4231  O O     . LEU F 2 91  ? 105.58700 118.04000 112.81800 1.000 112.87397 ? 90  LEU F O     1 
ATOM 4232  C CB    . LEU F 2 91  ? 104.89500 121.24500 112.73300 1.000 112.87397 ? 90  LEU F CB    1 
ATOM 4233  C CG    . LEU F 2 91  ? 104.05000 122.05400 111.75600 1.000 112.87397 ? 90  LEU F CG    1 
ATOM 4234  C CD1   . LEU F 2 91  ? 104.64900 123.42600 111.57500 1.000 112.87397 ? 90  LEU F CD1   1 
ATOM 4235  C CD2   . LEU F 2 91  ? 103.92800 121.33500 110.43500 1.000 112.87397 ? 90  LEU F CD2   1 
ATOM 4236  N N     . LYS F 2 92  ? 105.63900 118.99200 114.86100 1.000 119.97450 ? 91  LYS F N     1 
ATOM 4237  C CA    . LYS F 2 92  ? 106.55200 117.99200 115.40200 1.000 119.97450 ? 91  LYS F CA    1 
ATOM 4238  C C     . LYS F 2 92  ? 105.87800 116.63300 115.52700 1.000 119.97450 ? 91  LYS F C     1 
ATOM 4239  O O     . LYS F 2 92  ? 106.49400 115.60100 115.23800 1.000 119.97450 ? 91  LYS F O     1 
ATOM 4240  C CB    . LYS F 2 92  ? 107.07900 118.46200 116.75900 1.000 119.97450 ? 91  LYS F CB    1 
ATOM 4241  C CG    . LYS F 2 92  ? 107.90700 117.44100 117.51300 1.000 119.97450 ? 91  LYS F CG    1 
ATOM 4242  C CD    . LYS F 2 92  ? 109.35600 117.43500 117.08400 1.000 119.97450 ? 91  LYS F CD    1 
ATOM 4243  C CE    . LYS F 2 92  ? 110.19200 116.64800 118.07900 1.000 119.97450 ? 91  LYS F CE    1 
ATOM 4244  N NZ    . LYS F 2 92  ? 111.60200 116.48300 117.63900 1.000 119.97450 ? 91  LYS F NZ    1 
ATOM 4245  N N     . ARG F 2 93  ? 104.61100 116.61200 115.94600 1.000 110.70933 ? 92  ARG F N     1 
ATOM 4246  C CA    . ARG F 2 93  ? 103.88700 115.34900 116.01700 1.000 110.70933 ? 92  ARG F CA    1 
ATOM 4247  C C     . ARG F 2 93  ? 103.63700 114.75600 114.63800 1.000 110.70933 ? 92  ARG F C     1 
ATOM 4248  O O     . ARG F 2 93  ? 103.62400 113.53100 114.48900 1.000 110.70933 ? 92  ARG F O     1 
ATOM 4249  C CB    . ARG F 2 93  ? 102.57100 115.53500 116.76100 1.000 110.70933 ? 92  ARG F CB    1 
ATOM 4250  C CG    . ARG F 2 93  ? 101.99000 114.23700 117.27400 1.000 110.70933 ? 92  ARG F CG    1 
ATOM 4251  C CD    . ARG F 2 93  ? 100.49600 114.21800 117.10500 1.000 110.70933 ? 92  ARG F CD    1 
ATOM 4252  N NE    . ARG F 2 93  ? 100.12600 114.50800 115.72900 1.000 110.70933 ? 92  ARG F NE    1 
ATOM 4253  C CZ    . ARG F 2 93  ? 100.02100 113.58800 114.78200 1.000 110.70933 ? 92  ARG F CZ    1 
ATOM 4254  N NH1   . ARG F 2 93  ? 100.26200 112.31700 115.06700 1.000 110.70933 ? 92  ARG F NH1   1 
ATOM 4255  N NH2   . ARG F 2 93  ? 99.67700  113.93700 113.55200 1.000 110.70933 ? 92  ARG F NH2   1 
ATOM 4256  N N     . GLN F 2 94  ? 103.44200 115.59700 113.62300 1.000 110.71380 ? 93  GLN F N     1 
ATOM 4257  C CA    . GLN F 2 94  ? 103.24400 115.06900 112.27700 1.000 110.71380 ? 93  GLN F CA    1 
ATOM 4258  C C     . GLN F 2 94  ? 104.54900 114.56200 111.67800 1.000 110.71380 ? 93  GLN F C     1 
ATOM 4259  O O     . GLN F 2 94  ? 104.56100 113.53300 110.99500 1.000 110.71380 ? 93  GLN F O     1 
ATOM 4260  C CB    . GLN F 2 94  ? 102.62800 116.13100 111.37800 1.000 110.71380 ? 93  GLN F CB    1 
ATOM 4261  C CG    . GLN F 2 94  ? 101.17400 116.38600 111.66000 1.000 110.71380 ? 93  GLN F CG    1 
ATOM 4262  C CD    . GLN F 2 94  ? 100.43400 116.87900 110.44200 1.000 110.71380 ? 93  GLN F CD    1 
ATOM 4263  O OE1   . GLN F 2 94  ? 100.97500 116.89600 109.33800 1.000 110.71380 ? 93  GLN F OE1   1 
ATOM 4264  N NE2   . GLN F 2 94  ? 99.19500  117.31000 110.64000 1.000 110.71380 ? 93  GLN F NE2   1 
ATOM 4265  N N     . GLY F 2 95  ? 105.65400 115.26200 111.91700 1.000 114.46077 ? 94  GLY F N     1 
ATOM 4266  C CA    . GLY F 2 95  ? 106.93300 114.77300 111.44200 1.000 114.46077 ? 94  GLY F CA    1 
ATOM 4267  C C     . GLY F 2 95  ? 107.88500 115.80000 110.86600 1.000 114.46077 ? 94  GLY F C     1 
ATOM 4268  O O     . GLY F 2 95  ? 109.06700 115.50500 110.68300 1.000 114.46077 ? 94  GLY F O     1 
ATOM 4269  N N     . ARG F 2 96  ? 107.40200 116.99500 110.56100 1.000 124.65788 ? 95  ARG F N     1 
ATOM 4270  C CA    . ARG F 2 96  ? 108.24100 118.04800 109.99200 1.000 124.65788 ? 95  ARG F CA    1 
ATOM 4271  C C     . ARG F 2 96  ? 108.40200 119.14600 111.03800 1.000 124.65788 ? 95  ARG F C     1 
ATOM 4272  O O     . ARG F 2 96  ? 107.58500 120.06200 111.12600 1.000 124.65788 ? 95  ARG F O     1 
ATOM 4273  C CB    . ARG F 2 96  ? 107.66600 118.58400 108.69200 1.000 124.65788 ? 95  ARG F CB    1 
ATOM 4274  C CG    . ARG F 2 96  ? 107.23000 117.49900 107.73900 1.000 124.65788 ? 95  ARG F CG    1 
ATOM 4275  C CD    . ARG F 2 96  ? 106.42300 118.05600 106.59500 1.000 124.65788 ? 95  ARG F CD    1 
ATOM 4276  N NE    . ARG F 2 96  ? 106.01300 117.00000 105.67800 1.000 124.65788 ? 95  ARG F NE    1 
ATOM 4277  C CZ    . ARG F 2 96  ? 104.90400 116.28400 105.81700 1.000 124.65788 ? 95  ARG F CZ    1 
ATOM 4278  N NH1   . ARG F 2 96  ? 104.60600 115.34200 104.93500 1.000 124.65788 ? 95  ARG F NH1   1 
ATOM 4279  N NH2   . ARG F 2 96  ? 104.09000 116.51400 106.83700 1.000 124.65788 ? 95  ARG F NH2   1 
ATOM 4280  N N     . THR F 2 97  ? 109.45400 119.03700 111.84000 1.000 116.92430 ? 96  THR F N     1 
ATOM 4281  C CA    . THR F 2 97  ? 109.71200 120.03700 112.86300 1.000 116.92430 ? 96  THR F CA    1 
ATOM 4282  C C     . THR F 2 97  ? 110.19000 121.34800 112.24900 1.000 116.92430 ? 96  THR F C     1 
ATOM 4283  O O     . THR F 2 97  ? 110.78400 121.38200 111.16900 1.000 116.92430 ? 96  THR F O     1 
ATOM 4284  C CB    . THR F 2 97  ? 110.73200 119.52400 113.87100 1.000 116.92430 ? 96  THR F CB    1 
ATOM 4285  O OG1   . THR F 2 97  ? 111.05600 120.57000 114.79300 1.000 116.92430 ? 96  THR F OG1   1 
ATOM 4286  C CG2   . THR F 2 97  ? 111.98000 119.04500 113.17200 1.000 116.92430 ? 96  THR F CG2   1 
ATOM 4287  N N     . LEU F 2 98  ? 109.89500 122.43800 112.94900 1.000 113.99464 ? 97  LEU F N     1 
ATOM 4288  C CA    . LEU F 2 98  ? 110.20000 123.79000 112.50800 1.000 113.99464 ? 97  LEU F CA    1 
ATOM 4289  C C     . LEU F 2 98  ? 110.91300 124.53400 113.62400 1.000 113.99464 ? 97  LEU F C     1 
ATOM 4290  O O     . LEU F 2 98  ? 110.40600 124.59500 114.74500 1.000 113.99464 ? 97  LEU F O     1 
ATOM 4291  C CB    . LEU F 2 98  ? 108.91100 124.51600 112.12400 1.000 113.99464 ? 97  LEU F CB    1 
ATOM 4292  C CG    . LEU F 2 98  ? 108.92600 125.99700 111.75800 1.000 113.99464 ? 97  LEU F CG    1 
ATOM 4293  C CD1   . LEU F 2 98  ? 109.75200 126.26700 110.52700 1.000 113.99464 ? 97  LEU F CD1   1 
ATOM 4294  C CD2   . LEU F 2 98  ? 107.50800 126.48200 111.55400 1.000 113.99464 ? 97  LEU F CD2   1 
ATOM 4295  N N     . TYR F 2 99  ? 112.08400 125.08300 113.33800 1.000 113.67798 ? 98  TYR F N     1 
ATOM 4296  C CA    . TYR F 2 99  ? 112.81900 125.80500 114.36500 1.000 113.67798 ? 98  TYR F CA    1 
ATOM 4297  C C     . TYR F 2 99  ? 112.58700 127.30600 114.25900 1.000 113.67798 ? 98  TYR F C     1 
ATOM 4298  O O     . TYR F 2 99  ? 112.11500 127.82200 113.24400 1.000 113.67798 ? 98  TYR F O     1 
ATOM 4299  C CB    . TYR F 2 99  ? 114.32200 125.53600 114.31000 1.000 113.67798 ? 98  TYR F CB    1 
ATOM 4300  C CG    . TYR F 2 99  ? 114.73800 124.13100 114.62600 1.000 113.67798 ? 98  TYR F CG    1 
ATOM 4301  C CD1   . TYR F 2 99  ? 114.00100 123.35300 115.49600 1.000 113.67798 ? 98  TYR F CD1   1 
ATOM 4302  C CD2   . TYR F 2 99  ? 115.94100 123.63100 114.16300 1.000 113.67798 ? 98  TYR F CD2   1 
ATOM 4303  C CE1   . TYR F 2 99  ? 114.40000 122.08000 115.82000 1.000 113.67798 ? 98  TYR F CE1   1 
ATOM 4304  C CE2   . TYR F 2 99  ? 116.36000 122.36900 114.49800 1.000 113.67798 ? 98  TYR F CE2   1 
ATOM 4305  C CZ    . TYR F 2 99  ? 115.58000 121.59300 115.31800 1.000 113.67798 ? 98  TYR F CZ    1 
ATOM 4306  O OH    . TYR F 2 99  ? 115.98200 120.32300 115.64700 1.000 113.67798 ? 98  TYR F OH    1 
ATOM 4307  N N     . GLY F 2 100 ? 112.92900 128.00300 115.33800 1.000 111.50555 ? 99  GLY F N     1 
ATOM 4308  C CA    . GLY F 2 100 ? 112.83400 129.44700 115.39400 1.000 111.50555 ? 99  GLY F CA    1 
ATOM 4309  C C     . GLY F 2 100 ? 111.73100 129.99400 116.27000 1.000 111.50555 ? 99  GLY F C     1 
ATOM 4310  O O     . GLY F 2 100 ? 111.97500 130.88200 117.09000 1.000 111.50555 ? 99  GLY F O     1 
ATOM 4311  N N     . PHE F 2 101 ? 110.52300 129.46700 116.13200 1.000 106.79426 ? 100 PHE F N     1 
ATOM 4312  C CA    . PHE F 2 101 ? 109.40300 129.97100 116.91000 1.000 106.79426 ? 100 PHE F CA    1 
ATOM 4313  C C     . PHE F 2 101 ? 109.19700 129.20700 118.20300 1.000 106.79426 ? 100 PHE F C     1 
ATOM 4314  O O     . PHE F 2 101 ? 108.40100 129.64300 119.03900 1.000 106.79426 ? 100 PHE F O     1 
ATOM 4315  C CB    . PHE F 2 101 ? 108.11700 129.93100 116.08800 1.000 106.79426 ? 100 PHE F CB    1 
ATOM 4316  C CG    . PHE F 2 101 ? 108.28800 130.39900 114.68100 1.000 106.79426 ? 100 PHE F CG    1 
ATOM 4317  C CD1   . PHE F 2 101 ? 108.27800 131.74800 114.39100 1.000 106.79426 ? 100 PHE F CD1   1 
ATOM 4318  C CD2   . PHE F 2 101 ? 108.44800 129.49700 113.64600 1.000 106.79426 ? 100 PHE F CD2   1 
ATOM 4319  C CE1   . PHE F 2 101 ? 108.42800 132.19400 113.09500 1.000 106.79426 ? 100 PHE F CE1   1 
ATOM 4320  C CE2   . PHE F 2 101 ? 108.60000 129.93600 112.34600 1.000 106.79426 ? 100 PHE F CE2   1 
ATOM 4321  C CZ    . PHE F 2 101 ? 108.58900 131.28800 112.07300 1.000 106.79426 ? 100 PHE F CZ    1 
ATOM 4322  N N     . GLY F 2 102 ? 109.89600 128.09500 118.39400 1.000 112.47863 ? 101 GLY F N     1 
ATOM 4323  C CA    . GLY F 2 102 ? 109.74600 127.30300 119.59700 1.000 112.47863 ? 101 GLY F CA    1 
ATOM 4324  C C     . GLY F 2 102 ? 110.40900 127.92600 120.80400 1.000 112.47863 ? 101 GLY F C     1 
ATOM 4325  O O     . GLY F 2 102 ? 111.44800 127.45200 121.27100 1.000 112.47863 ? 101 GLY F O     1 
ATOM 4326  N N     . GLY F 2 103 ? 109.80400 128.98900 121.32200 1.000 121.39172 ? 102 GLY F N     1 
ATOM 4327  C CA    . GLY F 2 103 ? 110.32100 129.69000 122.47900 1.000 121.39172 ? 102 GLY F CA    1 
ATOM 4328  C C     . GLY F 2 103 ? 110.17500 131.19100 122.34300 1.000 121.39172 ? 102 GLY F C     1 
ATOM 4329  O O     . GLY F 2 103 ? 109.20000 131.67500 121.76700 1.000 121.39172 ? 102 GLY F O     1 
ATOM 4330  N N     . ARG G 3 12  ? 85.97000  91.88800  154.72500 1.000 163.36916 ? 11  ARG G N     1 
ATOM 4331  C CA    . ARG G 3 12  ? 85.88300  92.77200  153.56900 1.000 163.36916 ? 11  ARG G CA    1 
ATOM 4332  C C     . ARG G 3 12  ? 84.96600  92.18300  152.50600 1.000 163.36916 ? 11  ARG G C     1 
ATOM 4333  O O     . ARG G 3 12  ? 84.46400  91.07100  152.65800 1.000 163.36916 ? 11  ARG G O     1 
ATOM 4334  C CB    . ARG G 3 12  ? 87.27000  93.03700  152.99100 1.000 163.36916 ? 11  ARG G CB    1 
ATOM 4335  C CG    . ARG G 3 12  ? 88.06300  91.78500  152.71600 1.000 163.36916 ? 11  ARG G CG    1 
ATOM 4336  C CD    . ARG G 3 12  ? 88.94100  91.95600  151.49600 1.000 163.36916 ? 11  ARG G CD    1 
ATOM 4337  N NE    . ARG G 3 12  ? 89.65000  90.72400  151.17600 1.000 163.36916 ? 11  ARG G NE    1 
ATOM 4338  C CZ    . ARG G 3 12  ? 90.82800  90.38500  151.68700 1.000 163.36916 ? 11  ARG G CZ    1 
ATOM 4339  N NH1   . ARG G 3 12  ? 91.39300  89.24100  151.33600 1.000 163.36916 ? 11  ARG G NH1   1 
ATOM 4340  N NH2   . ARG G 3 12  ? 91.44100  91.18800  152.54500 1.000 163.36916 ? 11  ARG G NH2   1 
ATOM 4341  N N     . ALA G 3 13  ? 84.76100  92.92700  151.42300 1.000 162.78334 ? 12  ALA G N     1 
ATOM 4342  C CA    . ALA G 3 13  ? 83.86800  92.48600  150.36400 1.000 162.78334 ? 12  ALA G CA    1 
ATOM 4343  C C     . ALA G 3 13  ? 84.57900  91.53300  149.40700 1.000 162.78334 ? 12  ALA G C     1 
ATOM 4344  O O     . ALA G 3 13  ? 85.75300  91.19000  149.57500 1.000 162.78334 ? 12  ALA G O     1 
ATOM 4345  C CB    . ALA G 3 13  ? 83.30500  93.69000  149.61400 1.000 162.78334 ? 12  ALA G CB    1 
ATOM 4346  N N     . LYS G 3 14  ? 83.84000  91.08600  148.39300 1.000 149.34334 ? 13  LYS G N     1 
ATOM 4347  C CA    . LYS G 3 14  ? 84.38200  90.16700  147.40400 1.000 149.34334 ? 13  LYS G CA    1 
ATOM 4348  C C     . LYS G 3 14  ? 85.35000  90.88200  146.46900 1.000 149.34334 ? 13  LYS G C     1 
ATOM 4349  O O     . LYS G 3 14  ? 85.15300  92.04600  146.11100 1.000 149.34334 ? 13  LYS G O     1 
ATOM 4350  C CB    . LYS G 3 14  ? 83.25000  89.52800  146.60300 1.000 149.34334 ? 13  LYS G CB    1 
ATOM 4351  C CG    . LYS G 3 14  ? 83.61900  88.21000  145.93600 1.000 149.34334 ? 13  LYS G CG    1 
ATOM 4352  C CD    . LYS G 3 14  ? 84.13600  87.20100  146.95400 1.000 149.34334 ? 13  LYS G CD    1 
ATOM 4353  C CE    . LYS G 3 14  ? 84.85800  86.03900  146.28200 1.000 149.34334 ? 13  LYS G CE    1 
ATOM 4354  N NZ    . LYS G 3 14  ? 86.10700  86.46500  145.59600 1.000 149.34334 ? 13  LYS G NZ    1 
ATOM 4355  N N     . ALA G 3 15  ? 86.39100  90.16400  146.06000 1.000 147.68872 ? 14  ALA G N     1 
ATOM 4356  C CA    . ALA G 3 15  ? 87.43000  90.69900  145.19100 1.000 147.68872 ? 14  ALA G CA    1 
ATOM 4357  C C     . ALA G 3 15  ? 86.94900  90.83800  143.75300 1.000 147.68872 ? 14  ALA G C     1 
ATOM 4358  O O     . ALA G 3 15  ? 87.10300  89.91300  142.95100 1.000 147.68872 ? 14  ALA G O     1 
ATOM 4359  C CB    . ALA G 3 15  ? 88.67400  89.81200  145.24400 1.000 147.68872 ? 14  ALA G CB    1 
ATOM 4360  N N     . LYS G 3 16  ? 86.36300  91.97900  143.41600 1.000 138.15961 ? 15  LYS G N     1 
ATOM 4361  C CA    . LYS G 3 16  ? 85.87900  92.23700  142.06800 1.000 138.15961 ? 15  LYS G CA    1 
ATOM 4362  C C     . LYS G 3 16  ? 86.90600  93.08100  141.33000 1.000 138.15961 ? 15  LYS G C     1 
ATOM 4363  O O     . LYS G 3 16  ? 87.28400  94.15700  141.80400 1.000 138.15961 ? 15  LYS G O     1 
ATOM 4364  C CB    . LYS G 3 16  ? 84.53500  92.95800  142.11000 1.000 138.15961 ? 15  LYS G CB    1 
ATOM 4365  C CG    . LYS G 3 16  ? 83.44100  92.17500  142.80500 1.000 138.15961 ? 15  LYS G CG    1 
ATOM 4366  C CD    . LYS G 3 16  ? 82.07200  92.78300  142.55300 1.000 138.15961 ? 15  LYS G CD    1 
ATOM 4367  C CE    . LYS G 3 16  ? 82.04500  94.25500  142.93400 1.000 138.15961 ? 15  LYS G CE    1 
ATOM 4368  N NZ    . LYS G 3 16  ? 80.91600  94.97100  142.28900 1.000 138.15961 ? 15  LYS G NZ    1 
ATOM 4369  N N     . SER G 3 17  ? 87.37600  92.58200  140.19200 1.000 136.22825 ? 16  SER G N     1 
ATOM 4370  C CA    . SER G 3 17  ? 88.32300  93.33800  139.38900 1.000 136.22825 ? 16  SER G CA    1 
ATOM 4371  C C     . SER G 3 17  ? 87.62100  94.51200  138.72200 1.000 136.22825 ? 16  SER G C     1 
ATOM 4372  O O     . SER G 3 17  ? 86.42700  94.45300  138.41800 1.000 136.22825 ? 16  SER G O     1 
ATOM 4373  C CB    . SER G 3 17  ? 88.96600  92.44700  138.33300 1.000 136.22825 ? 16  SER G CB    1 
ATOM 4374  O OG    . SER G 3 17  ? 89.81000  93.20700  137.49000 1.000 136.22825 ? 16  SER G OG    1 
ATOM 4375  N N     . ARG G 3 18  ? 88.37200  95.59800  138.51200 1.000 134.89532 ? 17  ARG G N     1 
ATOM 4376  C CA    . ARG G 3 18  ? 87.78600  96.76500  137.86500 1.000 134.89532 ? 17  ARG G CA    1 
ATOM 4377  C C     . ARG G 3 18  ? 87.44800  96.51700  136.40300 1.000 134.89532 ? 17  ARG G C     1 
ATOM 4378  O O     . ARG G 3 18  ? 86.61900  97.24000  135.84600 1.000 134.89532 ? 17  ARG G O     1 
ATOM 4379  C CB    . ARG G 3 18  ? 88.70800  97.97700  137.95600 1.000 134.89532 ? 17  ARG G CB    1 
ATOM 4380  C CG    . ARG G 3 18  ? 90.17700  97.67100  137.87300 1.000 134.89532 ? 17  ARG G CG    1 
ATOM 4381  C CD    . ARG G 3 18  ? 90.97500  98.95300  138.00900 1.000 134.89532 ? 17  ARG G CD    1 
ATOM 4382  N NE    . ARG G 3 18  ? 91.18900  99.34900  139.39100 1.000 134.89532 ? 17  ARG G NE    1 
ATOM 4383  C CZ    . ARG G 3 18  ? 92.30900  99.10100  140.05500 1.000 134.89532 ? 17  ARG G CZ    1 
ATOM 4384  N NH1   . ARG G 3 18  ? 93.30200  98.46500  139.45200 1.000 134.89532 ? 17  ARG G NH1   1 
ATOM 4385  N NH2   . ARG G 3 18  ? 92.44000  99.49000  141.31200 1.000 134.89532 ? 17  ARG G NH2   1 
ATOM 4386  N N     . SER G 3 19  ? 88.05800  95.51500  135.77200 1.000 129.78740 ? 18  SER G N     1 
ATOM 4387  C CA    . SER G 3 19  ? 87.69400  95.19400  134.40000 1.000 129.78740 ? 18  SER G CA    1 
ATOM 4388  C C     . SER G 3 19  ? 86.30600  94.58600  134.32800 1.000 129.78740 ? 18  SER G C     1 
ATOM 4389  O O     . SER G 3 19  ? 85.60600  94.75300  133.32500 1.000 129.78740 ? 18  SER G O     1 
ATOM 4390  C CB    . SER G 3 19  ? 88.72400  94.24700  133.80000 1.000 129.78740 ? 18  SER G CB    1 
ATOM 4391  O OG    . SER G 3 19  ? 90.02300  94.56900  134.26400 1.000 129.78740 ? 18  SER G OG    1 
ATOM 4392  N N     . SER G 3 20  ? 85.88600  93.90100  135.38700 1.000 133.36549 ? 19  SER G N     1 
ATOM 4393  C CA    . SER G 3 20  ? 84.54600  93.33800  135.42000 1.000 133.36549 ? 19  SER G CA    1 
ATOM 4394  C C     . SER G 3 20  ? 83.50900  94.41400  135.68800 1.000 133.36549 ? 19  SER G C     1 
ATOM 4395  O O     . SER G 3 20  ? 82.41000  94.37200  135.12700 1.000 133.36549 ? 19  SER G O     1 
ATOM 4396  C CB    . SER G 3 20  ? 84.46600  92.24500  136.48300 1.000 133.36549 ? 19  SER G CB    1 
ATOM 4397  O OG    . SER G 3 20  ? 84.91100  92.73400  137.73600 1.000 133.36549 ? 19  SER G OG    1 
ATOM 4398  N N     . ARG G 3 21  ? 83.84000  95.38700  136.53400 1.000 137.01304 ? 20  ARG G N     1 
ATOM 4399  C CA    . ARG G 3 21  ? 82.91000  96.46800  136.81900 1.000 137.01304 ? 20  ARG G CA    1 
ATOM 4400  C C     . ARG G 3 21  ? 82.85900  97.51000  135.71300 1.000 137.01304 ? 20  ARG G C     1 
ATOM 4401  O O     . ARG G 3 21  ? 81.95700  98.35200  135.72100 1.000 137.01304 ? 20  ARG G O     1 
ATOM 4402  C CB    . ARG G 3 21  ? 83.26600  97.14400  138.14400 1.000 137.01304 ? 20  ARG G CB    1 
ATOM 4403  C CG    . ARG G 3 21  ? 84.34400  98.19400  138.02600 1.000 137.01304 ? 20  ARG G CG    1 
ATOM 4404  C CD    . ARG G 3 21  ? 84.43300  99.04600  139.26900 1.000 137.01304 ? 20  ARG G CD    1 
ATOM 4405  N NE    . ARG G 3 21  ? 84.99000  98.31300  140.39700 1.000 137.01304 ? 20  ARG G NE    1 
ATOM 4406  C CZ    . ARG G 3 21  ? 85.03000  98.78500  141.63600 1.000 137.01304 ? 20  ARG G CZ    1 
ATOM 4407  N NH1   . ARG G 3 21  ? 84.54400  99.98900  141.90100 1.000 137.01304 ? 20  ARG G NH1   1 
ATOM 4408  N NH2   . ARG G 3 21  ? 85.55800  98.05600  142.60900 1.000 137.01304 ? 20  ARG G NH2   1 
ATOM 4409  N N     . ALA G 3 22  ? 83.79500  97.48000  134.76700 1.000 132.06145 ? 21  ALA G N     1 
ATOM 4410  C CA    . ALA G 3 22  ? 83.79200  98.42200  133.65900 1.000 132.06145 ? 21  ALA G CA    1 
ATOM 4411  C C     . ALA G 3 22  ? 83.17600  97.84700  132.39600 1.000 132.06145 ? 21  ALA G C     1 
ATOM 4412  O O     . ALA G 3 22  ? 83.03100  98.57800  131.41100 1.000 132.06145 ? 21  ALA G O     1 
ATOM 4413  C CB    . ALA G 3 22  ? 85.21400  98.89500  133.35200 1.000 132.06145 ? 21  ALA G CB    1 
ATOM 4414  N N     . GLY G 3 23  ? 82.82100  96.56700  132.39700 1.000 126.06557 ? 22  GLY G N     1 
ATOM 4415  C CA    . GLY G 3 23  ? 82.21900  95.96600  131.22600 1.000 126.06557 ? 22  GLY G CA    1 
ATOM 4416  C C     . GLY G 3 23  ? 83.18300  95.75200  130.08800 1.000 126.06557 ? 22  GLY G C     1 
ATOM 4417  O O     . GLY G 3 23  ? 82.78300  95.82100  128.92400 1.000 126.06557 ? 22  GLY G O     1 
ATOM 4418  N N     . LEU G 3 24  ? 84.44900  95.50400  130.39100 1.000 123.96894 ? 23  LEU G N     1 
ATOM 4419  C CA    . LEU G 3 24  ? 85.46300  95.29200  129.37600 1.000 123.96894 ? 23  LEU G CA    1 
ATOM 4420  C C     . LEU G 3 24  ? 86.17600  93.97900  129.64000 1.000 123.96894 ? 23  LEU G C     1 
ATOM 4421  O O     . LEU G 3 24  ? 86.08700  93.40500  130.72600 1.000 123.96894 ? 23  LEU G O     1 
ATOM 4422  C CB    . LEU G 3 24  ? 86.48000  96.42900  129.34500 1.000 123.96894 ? 23  LEU G CB    1 
ATOM 4423  C CG    . LEU G 3 24  ? 85.91800  97.83100  129.15600 1.000 123.96894 ? 23  LEU G CG    1 
ATOM 4424  C CD1   . LEU G 3 24  ? 86.98800  98.85100  129.45700 1.000 123.96894 ? 23  LEU G CD1   1 
ATOM 4425  C CD2   . LEU G 3 24  ? 85.41100  97.99400  127.73800 1.000 123.96894 ? 23  LEU G CD2   1 
ATOM 4426  N N     . GLN G 3 25  ? 86.88900  93.50900  128.62300 1.000 126.52988 ? 24  GLN G N     1 
ATOM 4427  C CA    . GLN G 3 25  ? 87.63400  92.27000  128.73900 1.000 126.52988 ? 24  GLN G CA    1 
ATOM 4428  C C     . GLN G 3 25  ? 89.11000  92.48300  129.01200 1.000 126.52988 ? 24  GLN G C     1 
ATOM 4429  O O     . GLN G 3 25  ? 89.74100  91.60500  129.60400 1.000 126.52988 ? 24  GLN G O     1 
ATOM 4430  C CB    . GLN G 3 25  ? 87.47700  91.43900  127.46500 1.000 126.52988 ? 24  GLN G CB    1 
ATOM 4431  C CG    . GLN G 3 25  ? 86.04800  91.06400  127.16700 1.000 126.52988 ? 24  GLN G CG    1 
ATOM 4432  C CD    . GLN G 3 25  ? 85.32200  90.57600  128.39700 1.000 126.52988 ? 24  GLN G CD    1 
ATOM 4433  O OE1   . GLN G 3 25  ? 85.66700  89.53900  128.96100 1.000 126.52988 ? 24  GLN G OE1   1 
ATOM 4434  N NE2   . GLN G 3 25  ? 84.31100  91.32100  128.82300 1.000 126.52988 ? 24  GLN G NE2   1 
ATOM 4435  N N     . PHE G 3 26  ? 89.65900  93.62200  128.63600 1.000 126.25472 ? 25  PHE G N     1 
ATOM 4436  C CA    . PHE G 3 26  ? 91.06700  93.88300  128.87200 1.000 126.25472 ? 25  PHE G CA    1 
ATOM 4437  C C     . PHE G 3 26  ? 91.31300  94.21400  130.33900 1.000 126.25472 ? 25  PHE G C     1 
ATOM 4438  O O     . PHE G 3 26  ? 90.45500  94.80500  130.99700 1.000 126.25472 ? 25  PHE G O     1 
ATOM 4439  C CB    . PHE G 3 26  ? 91.53800  95.02900  127.99300 1.000 126.25472 ? 25  PHE G CB    1 
ATOM 4440  C CG    . PHE G 3 26  ? 92.02600  94.58300  126.66500 1.000 126.25472 ? 25  PHE G CG    1 
ATOM 4441  C CD1   . PHE G 3 26  ? 91.13900  94.14400  125.70200 1.000 126.25472 ? 25  PHE G CD1   1 
ATOM 4442  C CD2   . PHE G 3 26  ? 93.37700  94.58800  126.38100 1.000 126.25472 ? 25  PHE G CD2   1 
ATOM 4443  C CE1   . PHE G 3 26  ? 91.59200  93.72100  124.47600 1.000 126.25472 ? 25  PHE G CE1   1 
ATOM 4444  C CE2   . PHE G 3 26  ? 93.83600  94.17100  125.15500 1.000 126.25472 ? 25  PHE G CE2   1 
ATOM 4445  C CZ    . PHE G 3 26  ? 92.94100  93.73600  124.20200 1.000 126.25472 ? 25  PHE G CZ    1 
ATOM 4446  N N     . PRO G 3 27  ? 92.47000  93.82900  130.88300 1.000 125.21628 ? 26  PRO G N     1 
ATOM 4447  C CA    . PRO G 3 27  ? 92.72300  94.08300  132.30600 1.000 125.21628 ? 26  PRO G CA    1 
ATOM 4448  C C     . PRO G 3 27  ? 92.99600  95.55700  132.54700 1.000 125.21628 ? 26  PRO G C     1 
ATOM 4449  O O     . PRO G 3 27  ? 93.77000  96.18800  131.82700 1.000 125.21628 ? 26  PRO G O     1 
ATOM 4450  C CB    . PRO G 3 27  ? 93.95000  93.22000  132.60800 1.000 125.21628 ? 26  PRO G CB    1 
ATOM 4451  C CG    . PRO G 3 27  ? 94.65900  93.12900  131.31200 1.000 125.21628 ? 26  PRO G CG    1 
ATOM 4452  C CD    . PRO G 3 27  ? 93.60000  93.12900  130.24700 1.000 125.21628 ? 26  PRO G CD    1 
ATOM 4453  N N     . VAL G 3 28  ? 92.34800  96.10500  133.56500 1.000 122.34321 ? 27  VAL G N     1 
ATOM 4454  C CA    . VAL G 3 28  ? 92.58300  97.50000  133.88700 1.000 122.34321 ? 27  VAL G CA    1 
ATOM 4455  C C     . VAL G 3 28  ? 93.68900  97.64400  134.92400 1.000 122.34321 ? 27  VAL G C     1 
ATOM 4456  O O     . VAL G 3 28  ? 94.42100  98.63600  134.91100 1.000 122.34321 ? 27  VAL G O     1 
ATOM 4457  C CB    . VAL G 3 28  ? 91.27400  98.15900  134.34300 1.000 122.34321 ? 27  VAL G CB    1 
ATOM 4458  C CG1   . VAL G 3 28  ? 91.40300  99.67000  134.35900 1.000 122.34321 ? 27  VAL G CG1   1 
ATOM 4459  C CG2   . VAL G 3 28  ? 90.16300  97.76300  133.41400 1.000 122.34321 ? 27  VAL G CG2   1 
ATOM 4460  N N     . GLY G 3 29  ? 93.85800  96.65900  135.80300 1.000 127.63286 ? 28  GLY G N     1 
ATOM 4461  C CA    . GLY G 3 29  ? 94.93500  96.74100  136.77000 1.000 127.63286 ? 28  GLY G CA    1 
ATOM 4462  C C     . GLY G 3 29  ? 96.29900  96.53500  136.14800 1.000 127.63286 ? 28  GLY G C     1 
ATOM 4463  O O     . GLY G 3 29  ? 97.28100  97.14900  136.58100 1.000 127.63286 ? 28  GLY G O     1 
ATOM 4464  N N     . ARG G 3 30  ? 96.37400  95.69100  135.11700 1.000 124.51773 ? 29  ARG G N     1 
ATOM 4465  C CA    . ARG G 3 30  ? 97.64000  95.43800  134.43900 1.000 124.51773 ? 29  ARG G CA    1 
ATOM 4466  C C     . ARG G 3 30  ? 98.14800  96.68200  133.72500 1.000 124.51773 ? 29  ARG G C     1 
ATOM 4467  O O     . ARG G 3 30  ? 99.31900  97.05400  133.86600 1.000 124.51773 ? 29  ARG G O     1 
ATOM 4468  C CB    . ARG G 3 30  ? 97.48200  94.28600  133.45300 1.000 124.51773 ? 29  ARG G CB    1 
ATOM 4469  C CG    . ARG G 3 30  ? 98.71200  94.03500  132.61300 1.000 124.51773 ? 29  ARG G CG    1 
ATOM 4470  C CD    . ARG G 3 30  ? 98.57300  92.75500  131.83300 1.000 124.51773 ? 29  ARG G CD    1 
ATOM 4471  N NE    . ARG G 3 30  ? 98.47200  91.59300  132.70200 1.000 124.51773 ? 29  ARG G NE    1 
ATOM 4472  C CZ    . ARG G 3 30  ? 99.06700  90.43300  132.46000 1.000 124.51773 ? 29  ARG G CZ    1 
ATOM 4473  N NH1   . ARG G 3 30  ? 99.80600  90.27800  131.37000 1.000 124.51773 ? 29  ARG G NH1   1 
ATOM 4474  N NH2   . ARG G 3 30  ? 98.92100  89.42700  133.30800 1.000 124.51773 ? 29  ARG G NH2   1 
ATOM 4475  N N     . VAL G 3 31  ? 97.28000  97.33800  132.95200 1.000 119.59522 ? 30  VAL G N     1 
ATOM 4476  C CA    . VAL G 3 31  ? 97.68200  98.56800  132.27900 1.000 119.59522 ? 30  VAL G CA    1 
ATOM 4477  C C     . VAL G 3 31  ? 97.92400  99.68700  133.28300 1.000 119.59522 ? 30  VAL G C     1 
ATOM 4478  O O     . VAL G 3 31  ? 98.72000  100.59200 133.02100 1.000 119.59522 ? 30  VAL G O     1 
ATOM 4479  C CB    . VAL G 3 31  ? 96.66000  98.96000  131.19900 1.000 119.59522 ? 30  VAL G CB    1 
ATOM 4480  C CG1   . VAL G 3 31  ? 96.62400  97.89800  130.12600 1.000 119.59522 ? 30  VAL G CG1   1 
ATOM 4481  C CG2   . VAL G 3 31  ? 95.29100  99.13600  131.78400 1.000 119.59522 ? 30  VAL G CG2   1 
ATOM 4482  N N     . HIS G 3 32  ? 97.25000  99.64900  134.43700 1.000 115.04807 ? 31  HIS G N     1 
ATOM 4483  C CA    . HIS G 3 32  ? 97.52000  100.61600 135.49600 1.000 115.04807 ? 31  HIS G CA    1 
ATOM 4484  C C     . HIS G 3 32  ? 98.93800  100.45800 136.01900 1.000 115.04807 ? 31  HIS G C     1 
ATOM 4485  O O     . HIS G 3 32  ? 99.66500  101.44500 136.18500 1.000 115.04807 ? 31  HIS G O     1 
ATOM 4486  C CB    . HIS G 3 32  ? 96.50700  100.45200 136.62500 1.000 115.04807 ? 31  HIS G CB    1 
ATOM 4487  C CG    . HIS G 3 32  ? 96.47700  101.59700 137.58600 1.000 115.04807 ? 31  HIS G CG    1 
ATOM 4488  N ND1   . HIS G 3 32  ? 95.78000  101.55100 138.77300 1.000 115.04807 ? 31  HIS G ND1   1 
ATOM 4489  C CD2   . HIS G 3 32  ? 97.07500  102.80900 137.54800 1.000 115.04807 ? 31  HIS G CD2   1 
ATOM 4490  C CE1   . HIS G 3 32  ? 95.93300  102.69400 139.41500 1.000 115.04807 ? 31  HIS G CE1   1 
ATOM 4491  N NE2   . HIS G 3 32  ? 96.72100  103.47200 138.69600 1.000 115.04807 ? 31  HIS G NE2   1 
ATOM 4492  N N     . ARG G 3 33  ? 99.34600  99.21500  136.28100 1.000 118.10304 ? 32  ARG G N     1 
ATOM 4493  C CA    . ARG G 3 33  ? 100.71400 98.96000  136.72000 1.000 118.10304 ? 32  ARG G CA    1 
ATOM 4494  C C     . ARG G 3 33  ? 101.71900 99.30500  135.62900 1.000 118.10304 ? 32  ARG G C     1 
ATOM 4495  O O     . ARG G 3 33  ? 102.81200 99.80800  135.92100 1.000 118.10304 ? 32  ARG G O     1 
ATOM 4496  C CB    . ARG G 3 33  ? 100.86300 97.50300  137.14800 1.000 118.10304 ? 32  ARG G CB    1 
ATOM 4497  C CG    . ARG G 3 33  ? 102.11800 97.22800  137.95000 1.000 118.10304 ? 32  ARG G CG    1 
ATOM 4498  C CD    . ARG G 3 33  ? 103.15300 96.47700  137.13900 1.000 118.10304 ? 32  ARG G CD    1 
ATOM 4499  N NE    . ARG G 3 33  ? 102.60300 95.25100  136.57500 1.000 118.10304 ? 32  ARG G NE    1 
ATOM 4500  C CZ    . ARG G 3 33  ? 103.12900 94.60700  135.54100 1.000 118.10304 ? 32  ARG G CZ    1 
ATOM 4501  N NH1   . ARG G 3 33  ? 104.22200 95.07500  134.95700 1.000 118.10304 ? 32  ARG G NH1   1 
ATOM 4502  N NH2   . ARG G 3 33  ? 102.56400 93.49500  135.09300 1.000 118.10304 ? 32  ARG G NH2   1 
ATOM 4503  N N     . LEU G 3 34  ? 101.35900 99.05400  134.36900 1.000 112.53683 ? 33  LEU G N     1 
ATOM 4504  C CA    . LEU G 3 34  ? 102.25500 99.36800  133.26200 1.000 112.53683 ? 33  LEU G CA    1 
ATOM 4505  C C     . LEU G 3 34  ? 102.43500 100.87100 133.09900 1.000 112.53683 ? 33  LEU G C     1 
ATOM 4506  O O     . LEU G 3 34  ? 103.53500 101.33700 132.78800 1.000 112.53683 ? 33  LEU G O     1 
ATOM 4507  C CB    . LEU G 3 34  ? 101.73400 98.74400  131.97400 1.000 112.53683 ? 33  LEU G CB    1 
ATOM 4508  C CG    . LEU G 3 34  ? 102.05700 97.25600  131.88200 1.000 112.53683 ? 33  LEU G CG    1 
ATOM 4509  C CD1   . LEU G 3 34  ? 101.35400 96.62400  130.70700 1.000 112.53683 ? 33  LEU G CD1   1 
ATOM 4510  C CD2   . LEU G 3 34  ? 103.55000 97.05200  131.78200 1.000 112.53683 ? 33  LEU G CD2   1 
ATOM 4511  N N     . LEU G 3 35  ? 101.36800 101.64200 133.29800 1.000 110.03290 ? 34  LEU G N     1 
ATOM 4512  C CA    . LEU G 3 35  ? 101.49500 103.09100 133.25200 1.000 110.03290 ? 34  LEU G CA    1 
ATOM 4513  C C     . LEU G 3 35  ? 102.24900 103.62500 134.45500 1.000 110.03290 ? 34  LEU G C     1 
ATOM 4514  O O     . LEU G 3 35  ? 102.98800 104.60700 134.33200 1.000 110.03290 ? 34  LEU G O     1 
ATOM 4515  C CB    . LEU G 3 35  ? 100.12000 103.74400 133.18800 1.000 110.03290 ? 34  LEU G CB    1 
ATOM 4516  C CG    . LEU G 3 35  ? 99.45600  103.78800 131.82400 1.000 110.03290 ? 34  LEU G CG    1 
ATOM 4517  C CD1   . LEU G 3 35  ? 98.10000  104.44000 131.94200 1.000 110.03290 ? 34  LEU G CD1   1 
ATOM 4518  C CD2   . LEU G 3 35  ? 100.33900 104.55500 130.86700 1.000 110.03290 ? 34  LEU G CD2   1 
ATOM 4519  N N     . ARG G 3 36  ? 102.08200 102.99300 135.61800 1.000 119.80175 ? 35  ARG G N     1 
ATOM 4520  C CA    . ARG G 3 36  ? 102.80700 103.43700 136.80100 1.000 119.80175 ? 35  ARG G CA    1 
ATOM 4521  C C     . ARG G 3 36  ? 104.29400 103.14300 136.69700 1.000 119.80175 ? 35  ARG G C     1 
ATOM 4522  O O     . ARG G 3 36  ? 105.10800 103.89000 137.24700 1.000 119.80175 ? 35  ARG G O     1 
ATOM 4523  C CB    . ARG G 3 36  ? 102.21800 102.78300 138.04400 1.000 119.80175 ? 35  ARG G CB    1 
ATOM 4524  C CG    . ARG G 3 36  ? 100.99800 103.50000 138.56800 1.000 119.80175 ? 35  ARG G CG    1 
ATOM 4525  C CD    . ARG G 3 36  ? 100.88300 103.34900 140.06600 1.000 119.80175 ? 35  ARG G CD    1 
ATOM 4526  N NE    . ARG G 3 36  ? 100.99600 101.95300 140.47100 1.000 119.80175 ? 35  ARG G NE    1 
ATOM 4527  C CZ    . ARG G 3 36  ? 99.97700  101.10200 140.50500 1.000 119.80175 ? 35  ARG G CZ    1 
ATOM 4528  N NH1   . ARG G 3 36  ? 98.76500  101.50300 140.15300 1.000 119.80175 ? 35  ARG G NH1   1 
ATOM 4529  N NH2   . ARG G 3 36  ? 100.16900 99.84800  140.88800 1.000 119.80175 ? 35  ARG G NH2   1 
ATOM 4530  N N     . LYS G 3 37  ? 104.66900 102.08300 135.99300 1.000 117.67373 ? 36  LYS G N     1 
ATOM 4531  C CA    . LYS G 3 37  ? 106.07300 101.74900 135.82600 1.000 117.67373 ? 36  LYS G CA    1 
ATOM 4532  C C     . LYS G 3 37  ? 106.61600 102.19200 134.48100 1.000 117.67373 ? 36  LYS G C     1 
ATOM 4533  O O     . LYS G 3 37  ? 107.80300 101.99600 134.21200 1.000 117.67373 ? 36  LYS G O     1 
ATOM 4534  C CB    . LYS G 3 37  ? 106.28200 100.24600 135.99400 1.000 117.67373 ? 36  LYS G CB    1 
ATOM 4535  C CG    . LYS G 3 37  ? 105.83900 99.72200  137.34400 1.000 117.67373 ? 36  LYS G CG    1 
ATOM 4536  C CD    . LYS G 3 37  ? 106.57600 100.41100 138.47700 1.000 117.67373 ? 36  LYS G CD    1 
ATOM 4537  C CE    . LYS G 3 37  ? 107.99800 99.89600  138.59700 1.000 117.67373 ? 36  LYS G CE    1 
ATOM 4538  N NZ    . LYS G 3 37  ? 108.67400 100.41800 139.81500 1.000 117.67373 ? 36  LYS G NZ    1 
ATOM 4539  N N     . GLY G 3 38  ? 105.78400 102.79200 133.64000 1.000 113.33662 ? 37  GLY G N     1 
ATOM 4540  C CA    . GLY G 3 38  ? 106.20300 103.23800 132.33200 1.000 113.33662 ? 37  GLY G CA    1 
ATOM 4541  C C     . GLY G 3 38  ? 106.94400 104.54800 132.27100 1.000 113.33662 ? 37  GLY G C     1 
ATOM 4542  O O     . GLY G 3 38  ? 107.35700 104.93600 131.17400 1.000 113.33662 ? 37  GLY G O     1 
ATOM 4543  N N     . ASN G 3 39  ? 107.09700 105.23600 133.40900 1.000 116.93910 ? 38  ASN G N     1 
ATOM 4544  C CA    . ASN G 3 39  ? 107.83300 106.50000 133.52800 1.000 116.93910 ? 38  ASN G CA    1 
ATOM 4545  C C     . ASN G 3 39  ? 107.28000 107.59100 132.61800 1.000 116.93910 ? 38  ASN G C     1 
ATOM 4546  O O     . ASN G 3 39  ? 108.03300 108.39500 132.07100 1.000 116.93910 ? 38  ASN G O     1 
ATOM 4547  C CB    . ASN G 3 39  ? 109.32900 106.30200 133.27700 1.000 116.93910 ? 38  ASN G CB    1 
ATOM 4548  C CG    . ASN G 3 39  ? 109.97200 105.41900 134.31800 1.000 116.93910 ? 38  ASN G CG    1 
ATOM 4549  O OD1   . ASN G 3 39  ? 109.28200 104.73200 135.07200 1.000 116.93910 ? 38  ASN G OD1   1 
ATOM 4550  N ND2   . ASN G 3 39  ? 111.29700 105.42300 134.36400 1.000 116.93910 ? 38  ASN G ND2   1 
ATOM 4551  N N     . TYR G 3 40  ? 105.96600 107.61500 132.42600 1.000 110.93209 ? 39  TYR G N     1 
ATOM 4552  C CA    . TYR G 3 40  ? 105.37200 108.68000 131.63500 1.000 110.93209 ? 39  TYR G CA    1 
ATOM 4553  C C     . TYR G 3 40  ? 105.07700 109.91400 132.47200 1.000 110.93209 ? 39  TYR G C     1 
ATOM 4554  O O     . TYR G 3 40  ? 105.28300 111.04000 132.01100 1.000 110.93209 ? 39  TYR G O     1 
ATOM 4555  C CB    . TYR G 3 40  ? 104.09300 108.17600 130.97500 1.000 110.93209 ? 39  TYR G CB    1 
ATOM 4556  C CG    . TYR G 3 40  ? 104.31800 106.93100 130.16200 1.000 110.93209 ? 39  TYR G CG    1 
ATOM 4557  C CD1   . TYR G 3 40  ? 105.02900 106.97800 128.97300 1.000 110.93209 ? 39  TYR G CD1   1 
ATOM 4558  C CD2   . TYR G 3 40  ? 103.82700 105.70700 130.58400 1.000 110.93209 ? 39  TYR G CD2   1 
ATOM 4559  C CE1   . TYR G 3 40  ? 105.24400 105.84300 128.22900 1.000 110.93209 ? 39  TYR G CE1   1 
ATOM 4560  C CE2   . TYR G 3 40  ? 104.03200 104.56800 129.84200 1.000 110.93209 ? 39  TYR G CE2   1 
ATOM 4561  C CZ    . TYR G 3 40  ? 104.74600 104.64200 128.67000 1.000 110.93209 ? 39  TYR G CZ    1 
ATOM 4562  O OH    . TYR G 3 40  ? 104.95700 103.50700 127.92900 1.000 110.93209 ? 39  TYR G OH    1 
ATOM 4563  N N     . ALA G 3 41  ? 104.61300 109.71400 133.70000 1.000 121.33156 ? 40  ALA G N     1 
ATOM 4564  C CA    . ALA G 3 41  ? 104.35200 110.79000 134.64200 1.000 121.33156 ? 40  ALA G CA    1 
ATOM 4565  C C     . ALA G 3 41  ? 104.33900 110.18600 136.03200 1.000 121.33156 ? 40  ALA G C     1 
ATOM 4566  O O     . ALA G 3 41  ? 103.99900 109.01400 136.20000 1.000 121.33156 ? 40  ALA G O     1 
ATOM 4567  C CB    . ALA G 3 41  ? 103.03400 111.50800 134.35900 1.000 121.33156 ? 40  ALA G CB    1 
ATOM 4568  N N     . GLU G 3 42  ? 104.72000 110.99100 137.02400 1.000 136.18192 ? 41  GLU G N     1 
ATOM 4569  C CA    . GLU G 3 42  ? 104.77400 110.49900 138.39700 1.000 136.18192 ? 41  GLU G CA    1 
ATOM 4570  C C     . GLU G 3 42  ? 103.40100 110.17700 138.97300 1.000 136.18192 ? 41  GLU G C     1 
ATOM 4571  O O     . GLU G 3 42  ? 103.32400 109.46300 139.97800 1.000 136.18192 ? 41  GLU G O     1 
ATOM 4572  C CB    . GLU G 3 42  ? 105.46900 111.51300 139.30100 1.000 136.18192 ? 41  GLU G CB    1 
ATOM 4573  C CG    . GLU G 3 42  ? 104.79600 112.86000 139.34100 1.000 136.18192 ? 41  GLU G CG    1 
ATOM 4574  C CD    . GLU G 3 42  ? 105.41700 113.83600 138.37400 1.000 136.18192 ? 41  GLU G CD    1 
ATOM 4575  O OE1   . GLU G 3 42  ? 105.95200 114.86800 138.83000 1.000 136.18192 ? 41  GLU G OE1   1 
ATOM 4576  O OE2   . GLU G 3 42  ? 105.37100 113.56800 137.15500 1.000 136.18192 ? 41  GLU G OE2   1 
ATOM 4577  N N     . ARG G 3 43  ? 102.32200 110.67700 138.38100 1.000 137.76426 ? 42  ARG G N     1 
ATOM 4578  C CA    . ARG G 3 43  ? 100.98300 110.39500 138.87400 1.000 137.76426 ? 42  ARG G CA    1 
ATOM 4579  C C     . ARG G 3 43  ? 100.09000 109.97200 137.72600 1.000 137.76426 ? 42  ARG G C     1 
ATOM 4580  O O     . ARG G 3 43  ? 100.06700 110.62400 136.68000 1.000 137.76426 ? 42  ARG G O     1 
ATOM 4581  C CB    . ARG G 3 43  ? 100.38500 111.60400 139.58300 1.000 137.76426 ? 42  ARG G CB    1 
ATOM 4582  C CG    . ARG G 3 43  ? 100.83200 111.73200 141.01400 1.000 137.76426 ? 42  ARG G CG    1 
ATOM 4583  C CD    . ARG G 3 43  ? 101.02900 113.17600 141.40300 1.000 137.76426 ? 42  ARG G CD    1 
ATOM 4584  N NE    . ARG G 3 43  ? 101.58200 113.28700 142.74500 1.000 137.76426 ? 42  ARG G NE    1 
ATOM 4585  C CZ    . ARG G 3 43  ? 100.85400 113.26000 143.85400 1.000 137.76426 ? 42  ARG G CZ    1 
ATOM 4586  N NH1   . ARG G 3 43  ? 99.53700  113.12500 143.78300 1.000 137.76426 ? 42  ARG G NH1   1 
ATOM 4587  N NH2   . ARG G 3 43  ? 101.44400 113.36700 145.03500 1.000 137.76426 ? 42  ARG G NH2   1 
ATOM 4588  N N     . VAL G 3 44  ? 99.36300  108.87800 137.91900 1.000 119.67171 ? 43  VAL G N     1 
ATOM 4589  C CA    . VAL G 3 44  ? 98.43900  108.35500 136.92600 1.000 119.67171 ? 43  VAL G CA    1 
ATOM 4590  C C     . VAL G 3 44  ? 97.03700  108.45700 137.50100 1.000 119.67171 ? 43  VAL G C     1 
ATOM 4591  O O     . VAL G 3 44  ? 96.81800  108.15500 138.67700 1.000 119.67171 ? 43  VAL G O     1 
ATOM 4592  C CB    . VAL G 3 44  ? 98.77200  106.89900 136.54800 1.000 119.67171 ? 43  VAL G CB    1 
ATOM 4593  C CG1   . VAL G 3 44  ? 98.04000  106.49800 135.28600 1.000 119.67171 ? 43  VAL G CG1   1 
ATOM 4594  C CG2   . VAL G 3 44  ? 100.26600 106.72500 136.37600 1.000 119.67171 ? 43  VAL G CG2   1 
ATOM 4595  N N     . GLY G 3 45  ? 96.09100  108.87800 136.67200 1.000 116.94048 ? 44  GLY G N     1 
ATOM 4596  C CA    . GLY G 3 45  ? 94.72600  109.04600 137.11300 1.000 116.94048 ? 44  GLY G CA    1 
ATOM 4597  C C     . GLY G 3 45  ? 94.00800  107.72700 137.32400 1.000 116.94048 ? 44  GLY G C     1 
ATOM 4598  O O     . GLY G 3 45  ? 94.52700  106.63900 137.08100 1.000 116.94048 ? 44  GLY G O     1 
ATOM 4599  N N     . ALA G 3 46  ? 92.76500  107.83900 137.79300 1.000 115.22638 ? 45  ALA G N     1 
ATOM 4600  C CA    . ALA G 3 46  ? 91.96500  106.64800 138.04500 1.000 115.22638 ? 45  ALA G CA    1 
ATOM 4601  C C     . ALA G 3 46  ? 91.27100  106.17400 136.78100 1.000 115.22638 ? 45  ALA G C     1 
ATOM 4602  O O     . ALA G 3 46  ? 91.28900  104.98100 136.46400 1.000 115.22638 ? 45  ALA G O     1 
ATOM 4603  C CB    . ALA G 3 46  ? 90.93800  106.92300 139.13900 1.000 115.22638 ? 45  ALA G CB    1 
ATOM 4604  N N     . GLY G 3 47  ? 90.65500  107.08800 136.04800 1.000 119.74048 ? 46  GLY G N     1 
ATOM 4605  C CA    . GLY G 3 47  ? 89.99500  106.70200 134.82400 1.000 119.74048 ? 46  GLY G CA    1 
ATOM 4606  C C     . GLY G 3 47  ? 90.89600  106.57800 133.62600 1.000 119.74048 ? 46  GLY G C     1 
ATOM 4607  O O     . GLY G 3 47  ? 90.42500  106.21600 132.54500 1.000 119.74048 ? 46  GLY G O     1 
ATOM 4608  N N     . ALA G 3 48  ? 92.18900  106.86600 133.78900 1.000 114.53500 ? 47  ALA G N     1 
ATOM 4609  C CA    . ALA G 3 48  ? 93.11300  106.74500 132.66200 1.000 114.53500 ? 47  ALA G CA    1 
ATOM 4610  C C     . ALA G 3 48  ? 93.33200  105.30300 132.20400 1.000 114.53500 ? 47  ALA G C     1 
ATOM 4611  O O     . ALA G 3 48  ? 93.30200  105.07300 130.98300 1.000 114.53500 ? 47  ALA G O     1 
ATOM 4612  C CB    . ALA G 3 48  ? 94.42600  107.46700 132.98200 1.000 114.53500 ? 47  ALA G CB    1 
ATOM 4613  N N     . PRO G 3 49  ? 93.58600  104.30300 133.07200 1.000 113.95111 ? 48  PRO G N     1 
ATOM 4614  C CA    . PRO G 3 49  ? 93.68100  102.93800 132.53200 1.000 113.95111 ? 48  PRO G CA    1 
ATOM 4615  C C     . PRO G 3 49  ? 92.36700  102.40100 131.99600 1.000 113.95111 ? 48  PRO G C     1 
ATOM 4616  O O     . PRO G 3 49  ? 92.39000  101.52500 131.12600 1.000 113.95111 ? 48  PRO G O     1 
ATOM 4617  C CB    . PRO G 3 49  ? 94.17700  102.11200 133.72400 1.000 113.95111 ? 48  PRO G CB    1 
ATOM 4618  C CG    . PRO G 3 49  ? 93.78300  102.85800 134.89100 1.000 113.95111 ? 48  PRO G CG    1 
ATOM 4619  C CD    . PRO G 3 49  ? 93.92200  104.28400 134.51300 1.000 113.95111 ? 48  PRO G CD    1 
ATOM 4620  N N     . VAL G 3 50  ? 91.22900  102.89700 132.48400 1.000 115.36808 ? 49  VAL G N     1 
ATOM 4621  C CA    . VAL G 3 50  ? 89.93500  102.42200 132.00300 1.000 115.36808 ? 49  VAL G CA    1 
ATOM 4622  C C     . VAL G 3 50  ? 89.70600  102.84500 130.55800 1.000 115.36808 ? 49  VAL G C     1 
ATOM 4623  O O     . VAL G 3 50  ? 89.27300  102.04000 129.72100 1.000 115.36808 ? 49  VAL G O     1 
ATOM 4624  C CB    . VAL G 3 50  ? 88.81300  102.93300 132.91900 1.000 115.36808 ? 49  VAL G CB    1 
ATOM 4625  C CG1   . VAL G 3 50  ? 87.51400  102.23000 132.59500 1.000 115.36808 ? 49  VAL G CG1   1 
ATOM 4626  C CG2   . VAL G 3 50  ? 89.19000  102.71500 134.36800 1.000 115.36808 ? 49  VAL G CG2   1 
ATOM 4627  N N     . TYR G 3 51  ? 89.99000  104.11300 130.25100 1.000 116.96382 ? 50  TYR G N     1 
ATOM 4628  C CA    . TYR G 3 51  ? 89.90800  104.62300 128.88400 1.000 116.96382 ? 50  TYR G CA    1 
ATOM 4629  C C     . TYR G 3 51  ? 90.83300  103.85500 127.95300 1.000 116.96382 ? 50  TYR G C     1 
ATOM 4630  O O     . TYR G 3 51  ? 90.45400  103.50600 126.82500 1.000 116.96382 ? 50  TYR G O     1 
ATOM 4631  C CB    . TYR G 3 51  ? 90.28400  106.10400 128.88200 1.000 116.96382 ? 50  TYR G CB    1 
ATOM 4632  C CG    . TYR G 3 51  ? 89.56000  106.99200 127.89600 1.000 116.96382 ? 50  TYR G CG    1 
ATOM 4633  C CD1   . TYR G 3 51  ? 88.48100  107.76400 128.29900 1.000 116.96382 ? 50  TYR G CD1   1 
ATOM 4634  C CD2   . TYR G 3 51  ? 89.96800  107.07700 126.57400 1.000 116.96382 ? 50  TYR G CD2   1 
ATOM 4635  C CE1   . TYR G 3 51  ? 87.82600  108.59300 127.41500 1.000 116.96382 ? 50  TYR G CE1   1 
ATOM 4636  C CE2   . TYR G 3 51  ? 89.31400  107.90000 125.68100 1.000 116.96382 ? 50  TYR G CE2   1 
ATOM 4637  C CZ    . TYR G 3 51  ? 88.24200  108.65300 126.10600 1.000 116.96382 ? 50  TYR G CZ    1 
ATOM 4638  O OH    . TYR G 3 51  ? 87.59100  109.47600 125.22000 1.000 116.96382 ? 50  TYR G OH    1 
ATOM 4639  N N     . MET G 3 52  ? 92.05100  103.58500 128.42400 1.000 118.95892 ? 51  MET G N     1 
ATOM 4640  C CA    . MET G 3 52  ? 93.04600  102.86700 127.63800 1.000 118.95892 ? 51  MET G CA    1 
ATOM 4641  C C     . MET G 3 52  ? 92.59600  101.44500 127.34200 1.000 118.95892 ? 51  MET G C     1 
ATOM 4642  O O     . MET G 3 52  ? 92.74100  100.95800 126.21300 1.000 118.95892 ? 51  MET G O     1 
ATOM 4643  C CB    . MET G 3 52  ? 94.36800  102.86700 128.39100 1.000 118.95892 ? 51  MET G CB    1 
ATOM 4644  C CG    . MET G 3 52  ? 95.50800  102.31100 127.61500 1.000 118.95892 ? 51  MET G CG    1 
ATOM 4645  S SD    . MET G 3 52  ? 95.83700  103.57200 126.38400 1.000 118.95892 ? 51  MET G SD    1 
ATOM 4646  C CE    . MET G 3 52  ? 97.60000  103.50000 126.29100 1.000 118.95892 ? 51  MET G CE    1 
ATOM 4647  N N     . ALA G 3 53  ? 92.06000  100.76400 128.35600 1.000 115.26736 ? 52  ALA G N     1 
ATOM 4648  C CA    . ALA G 3 53  ? 91.55100  99.41100  128.17900 1.000 115.26736 ? 52  ALA G CA    1 
ATOM 4649  C C     . ALA G 3 53  ? 90.38900  99.39300  127.20400 1.000 115.26736 ? 52  ALA G C     1 
ATOM 4650  O O     . ALA G 3 53  ? 90.28300  98.47900  126.38100 1.000 115.26736 ? 52  ALA G O     1 
ATOM 4651  C CB    . ALA G 3 53  ? 91.13200  98.82400  129.52400 1.000 115.26736 ? 52  ALA G CB    1 
ATOM 4652  N N     . ALA G 3 54  ? 89.52200  100.40800 127.27000 1.000 115.10298 ? 53  ALA G N     1 
ATOM 4653  C CA    . ALA G 3 54  ? 88.37500  100.46700 126.37000 1.000 115.10298 ? 53  ALA G CA    1 
ATOM 4654  C C     . ALA G 3 54  ? 88.81400  100.64300 124.92400 1.000 115.10298 ? 53  ALA G C     1 
ATOM 4655  O O     . ALA G 3 54  ? 88.31400  99.95100  124.03000 1.000 115.10298 ? 53  ALA G O     1 
ATOM 4656  C CB    . ALA G 3 54  ? 87.44300  101.60000 126.78300 1.000 115.10298 ? 53  ALA G CB    1 
ATOM 4657  N N     . VAL G 3 55  ? 89.74000  101.57400 124.67400 1.000 117.27124 ? 54  VAL G N     1 
ATOM 4658  C CA    . VAL G 3 55  ? 90.16600  101.80300 123.29400 1.000 117.27124 ? 54  VAL G CA    1 
ATOM 4659  C C     . VAL G 3 55  ? 90.96700  100.61700 122.76300 1.000 117.27124 ? 54  VAL G C     1 
ATOM 4660  O O     . VAL G 3 55  ? 90.85900  100.28000 121.57800 1.000 117.27124 ? 54  VAL G O     1 
ATOM 4661  C CB    . VAL G 3 55  ? 90.90700  103.14700 123.13400 1.000 117.27124 ? 54  VAL G CB    1 
ATOM 4662  C CG1   . VAL G 3 55  ? 90.02400  104.27000 123.61700 1.000 117.27124 ? 54  VAL G CG1   1 
ATOM 4663  C CG2   . VAL G 3 55  ? 92.22700  103.18200 123.87300 1.000 117.27124 ? 54  VAL G CG2   1 
ATOM 4664  N N     . LEU G 3 56  ? 91.75600  99.95100  123.61400 1.000 117.31790 ? 55  LEU G N     1 
ATOM 4665  C CA    . LEU G 3 56  ? 92.48400  98.77000  123.16500 1.000 117.31790 ? 55  LEU G CA    1 
ATOM 4666  C C     . LEU G 3 56  ? 91.52500  97.63000  122.85500 1.000 117.31790 ? 55  LEU G C     1 
ATOM 4667  O O     . LEU G 3 56  ? 91.71900  96.89400  121.87800 1.000 117.31790 ? 55  LEU G O     1 
ATOM 4668  C CB    . LEU G 3 56  ? 93.50800  98.34700  124.21400 1.000 117.31790 ? 55  LEU G CB    1 
ATOM 4669  C CG    . LEU G 3 56  ? 94.94200  98.81000  123.96500 1.000 117.31790 ? 55  LEU G CG    1 
ATOM 4670  C CD1   . LEU G 3 56  ? 95.41300  98.24100  122.66200 1.000 117.31790 ? 55  LEU G CD1   1 
ATOM 4671  C CD2   . LEU G 3 56  ? 95.08300  100.31300 123.95000 1.000 117.31790 ? 55  LEU G CD2   1 
ATOM 4672  N N     . GLU G 3 57  ? 90.48000  97.48500  123.67300 1.000 122.71492 ? 56  GLU G N     1 
ATOM 4673  C CA    . GLU G 3 57  ? 89.45800  96.48000  123.42900 1.000 122.71492 ? 56  GLU G CA    1 
ATOM 4674  C C     . GLU G 3 57  ? 88.72100  96.74700  122.12600 1.000 122.71492 ? 56  GLU G C     1 
ATOM 4675  O O     . GLU G 3 57  ? 88.47400  95.82000  121.34400 1.000 122.71492 ? 56  GLU G O     1 
ATOM 4676  C CB    . GLU G 3 57  ? 88.49300  96.46400  124.61000 1.000 122.71492 ? 56  GLU G CB    1 
ATOM 4677  C CG    . GLU G 3 57  ? 87.32800  95.52600  124.47800 1.000 122.71492 ? 56  GLU G CG    1 
ATOM 4678  C CD    . GLU G 3 57  ? 86.05000  96.27400  124.16900 1.000 122.71492 ? 56  GLU G CD    1 
ATOM 4679  O OE1   . GLU G 3 57  ? 86.13500  97.49300  123.91000 1.000 122.71492 ? 56  GLU G OE1   1 
ATOM 4680  O OE2   . GLU G 3 57  ? 84.96500  95.65800  124.20000 1.000 122.71492 ? 56  GLU G OE2   1 
ATOM 4681  N N     . TYR G 3 58  ? 88.41100  98.01700  121.85600 1.000 129.55442 ? 57  TYR G N     1 
ATOM 4682  C CA    . TYR G 3 58  ? 87.74600  98.38200  120.61000 1.000 129.55442 ? 57  TYR G CA    1 
ATOM 4683  C C     . TYR G 3 58  ? 88.63300  98.11600  119.40000 1.000 129.55442 ? 57  TYR G C     1 
ATOM 4684  O O     . TYR G 3 58  ? 88.15700  97.60700  118.37700 1.000 129.55442 ? 57  TYR G O     1 
ATOM 4685  C CB    . TYR G 3 58  ? 87.32900  99.84600  120.64500 1.000 129.55442 ? 57  TYR G CB    1 
ATOM 4686  C CG    . TYR G 3 58  ? 86.82900  100.34300 119.31800 1.000 129.55442 ? 57  TYR G CG    1 
ATOM 4687  C CD1   . TYR G 3 58  ? 85.69200  99.79900  118.74100 1.000 129.55442 ? 57  TYR G CD1   1 
ATOM 4688  C CD2   . TYR G 3 58  ? 87.49400  101.34800 118.63700 1.000 129.55442 ? 57  TYR G CD2   1 
ATOM 4689  C CE1   . TYR G 3 58  ? 85.22700  100.24500 117.52500 1.000 129.55442 ? 57  TYR G CE1   1 
ATOM 4690  C CE2   . TYR G 3 58  ? 87.03700  101.80300 117.41900 1.000 129.55442 ? 57  TYR G CE2   1 
ATOM 4691  C CZ    . TYR G 3 58  ? 85.90300  101.24800 116.86900 1.000 129.55442 ? 57  TYR G CZ    1 
ATOM 4692  O OH    . TYR G 3 58  ? 85.44200  101.69600 115.65300 1.000 129.55442 ? 57  TYR G OH    1 
ATOM 4693  N N     . LEU G 3 59  ? 89.91800  98.47300  119.49700 1.000 127.80428 ? 58  LEU G N     1 
ATOM 4694  C CA    . LEU G 3 59  ? 90.85100  98.25100  118.39500 1.000 127.80428 ? 58  LEU G CA    1 
ATOM 4695  C C     . LEU G 3 59  ? 91.03300  96.76700  118.09900 1.000 127.80428 ? 58  LEU G C     1 
ATOM 4696  O O     . LEU G 3 59  ? 91.05400  96.35700  116.92800 1.000 127.80428 ? 58  LEU G O     1 
ATOM 4697  C CB    . LEU G 3 59  ? 92.19400  98.90200  118.71300 1.000 127.80428 ? 58  LEU G CB    1 
ATOM 4698  C CG    . LEU G 3 59  ? 92.45000  100.26700 118.07800 1.000 127.80428 ? 58  LEU G CG    1 
ATOM 4699  C CD1   . LEU G 3 59  ? 92.50300  100.11100 116.58000 1.000 127.80428 ? 58  LEU G CD1   1 
ATOM 4700  C CD2   . LEU G 3 59  ? 91.40500  101.29200 118.45700 1.000 127.80428 ? 58  LEU G CD2   1 
ATOM 4701  N N     . THR G 3 60  ? 91.16400  95.94900  119.14900 1.000 128.42372 ? 59  THR G N     1 
ATOM 4702  C CA    . THR G 3 60  ? 91.30700  94.51300  118.95300 1.000 128.42372 ? 59  THR G CA    1 
ATOM 4703  C C     . THR G 3 60  ? 90.05100  93.91800  118.35400 1.000 128.42372 ? 59  THR G C     1 
ATOM 4704  O O     . THR G 3 60  ? 90.13400  93.00900  117.52300 1.000 128.42372 ? 59  THR G O     1 
ATOM 4705  C CB    . THR G 3 60  ? 91.62300  93.81900  120.26300 1.000 128.42372 ? 59  THR G CB    1 
ATOM 4706  O OG1   . THR G 3 60  ? 90.81500  94.38000  121.29900 1.000 128.42372 ? 59  THR G OG1   1 
ATOM 4707  C CG2   . THR G 3 60  ? 93.04600  94.00900  120.59400 1.000 128.42372 ? 59  THR G CG2   1 
ATOM 4708  N N     . ALA G 3 61  ? 88.88300  94.41100  118.77400 1.000 139.19671 ? 60  ALA G N     1 
ATOM 4709  C CA    . ALA G 3 61  ? 87.63500  93.92700  118.20300 1.000 139.19671 ? 60  ALA G CA    1 
ATOM 4710  C C     . ALA G 3 61  ? 87.55900  94.26200  116.72100 1.000 139.19671 ? 60  ALA G C     1 
ATOM 4711  O O     . ALA G 3 61  ? 87.13800  93.42800  115.91200 1.000 139.19671 ? 60  ALA G O     1 
ATOM 4712  C CB    . ALA G 3 61  ? 86.44900  94.52400  118.95400 1.000 139.19671 ? 60  ALA G CB    1 
ATOM 4713  N N     . GLU G 3 62  ? 87.97000  95.48000  116.35400 1.000 148.17963 ? 61  GLU G N     1 
ATOM 4714  C CA    . GLU G 3 62  ? 87.92500  95.90400  114.95900 1.000 148.17963 ? 61  GLU G CA    1 
ATOM 4715  C C     . GLU G 3 62  ? 88.85600  95.07300  114.08500 1.000 148.17963 ? 61  GLU G C     1 
ATOM 4716  O O     . GLU G 3 62  ? 88.44300  94.55700  113.03500 1.000 148.17963 ? 61  GLU G O     1 
ATOM 4717  C CB    . GLU G 3 62  ? 88.29100  97.38600  114.85800 1.000 148.17963 ? 61  GLU G CB    1 
ATOM 4718  C CG    . GLU G 3 62  ? 88.34000  98.01300  113.44500 1.000 148.17963 ? 61  GLU G CG    1 
ATOM 4719  C CD    . GLU G 3 62  ? 87.06500  97.93500  112.58400 1.000 148.17963 ? 61  GLU G CD    1 
ATOM 4720  O OE1   . GLU G 3 62  ? 85.98400  97.47900  113.01700 1.000 148.17963 ? 61  GLU G OE1   1 
ATOM 4721  O OE2   . GLU G 3 62  ? 87.16600  98.34900  111.41400 1.000 148.17963 ? 61  GLU G OE2   1 
ATOM 4722  N N     . ILE G 3 63  ? 90.07100  94.81700  114.56800 1.000 128.49856 ? 62  ILE G N     1 
ATOM 4723  C CA    . ILE G 3 63  ? 91.00800  94.06000  113.74900 1.000 128.49856 ? 62  ILE G CA    1 
ATOM 4724  C C     . ILE G 3 63  ? 90.64400  92.57800  113.72400 1.000 128.49856 ? 62  ILE G C     1 
ATOM 4725  O O     . ILE G 3 63  ? 90.81700  91.91800  112.69500 1.000 128.49856 ? 62  ILE G O     1 
ATOM 4726  C CB    . ILE G 3 63  ? 92.45700  94.31800  114.21000 1.000 128.49856 ? 62  ILE G CB    1 
ATOM 4727  C CG1   . ILE G 3 63  ? 93.45900  93.77900  113.19400 1.000 128.49856 ? 62  ILE G CG1   1 
ATOM 4728  C CG2   . ILE G 3 63  ? 92.73800  93.77300  115.59000 1.000 128.49856 ? 62  ILE G CG2   1 
ATOM 4729  C CD1   . ILE G 3 63  ? 94.85900  94.25300  113.44000 1.000 128.49856 ? 62  ILE G CD1   1 
ATOM 4730  N N     . LEU G 3 64  ? 90.06900  92.04300  114.80000 1.000 130.09537 ? 63  LEU G N     1 
ATOM 4731  C CA    . LEU G 3 64  ? 89.70100  90.64000  114.79200 1.000 130.09537 ? 63  LEU G CA    1 
ATOM 4732  C C     . LEU G 3 64  ? 88.45600  90.39800  113.95600 1.000 130.09537 ? 63  LEU G C     1 
ATOM 4733  O O     . LEU G 3 64  ? 88.34700  89.34700  113.31900 1.000 130.09537 ? 63  LEU G O     1 
ATOM 4734  C CB    . LEU G 3 64  ? 89.49300  90.15100  116.22000 1.000 130.09537 ? 63  LEU G CB    1 
ATOM 4735  C CG    . LEU G 3 64  ? 90.80500  89.81200  116.91500 1.000 130.09537 ? 63  LEU G CG    1 
ATOM 4736  C CD1   . LEU G 3 64  ? 90.56000  89.43000  118.34900 1.000 130.09537 ? 63  LEU G CD1   1 
ATOM 4737  C CD2   . LEU G 3 64  ? 91.51100  88.69800  116.18500 1.000 130.09537 ? 63  LEU G CD2   1 
ATOM 4738  N N     . GLU G 3 65  ? 87.51500  91.34800  113.94600 1.000 146.23230 ? 64  GLU G N     1 
ATOM 4739  C CA    . GLU G 3 65  ? 86.36900  91.25600  113.04800 1.000 146.23230 ? 64  GLU G CA    1 
ATOM 4740  C C     . GLU G 3 65  ? 86.79500  91.29800  111.58700 1.000 146.23230 ? 64  GLU G C     1 
ATOM 4741  O O     . GLU G 3 65  ? 86.28800  90.52100  110.76300 1.000 146.23230 ? 64  GLU G O     1 
ATOM 4742  C CB    . GLU G 3 65  ? 85.38500  92.38400  113.35100 1.000 146.23230 ? 64  GLU G CB    1 
ATOM 4743  C CG    . GLU G 3 65  ? 84.15700  92.43500  112.44700 1.000 146.23230 ? 64  GLU G CG    1 
ATOM 4744  C CD    . GLU G 3 65  ? 83.39900  91.12000  112.35400 1.000 146.23230 ? 64  GLU G CD    1 
ATOM 4745  O OE1   . GLU G 3 65  ? 83.25500  90.42700  113.37800 1.000 146.23230 ? 64  GLU G OE1   1 
ATOM 4746  O OE2   . GLU G 3 65  ? 82.93200  90.77900  111.25100 1.000 146.23230 ? 64  GLU G OE2   1 
ATOM 4747  N N     . LEU G 3 66  ? 87.73600  92.18900  111.25000 1.000 141.13660 ? 65  LEU G N     1 
ATOM 4748  C CA    . LEU G 3 66  ? 88.25100  92.22200  109.88200 1.000 141.13660 ? 65  LEU G CA    1 
ATOM 4749  C C     . LEU G 3 66  ? 88.97600  90.92900  109.53300 1.000 141.13660 ? 65  LEU G C     1 
ATOM 4750  O O     . LEU G 3 66  ? 88.85100  90.42500  108.41100 1.000 141.13660 ? 65  LEU G O     1 
ATOM 4751  C CB    . LEU G 3 66  ? 89.14200  93.44200  109.65000 1.000 141.13660 ? 65  LEU G CB    1 
ATOM 4752  C CG    . LEU G 3 66  ? 88.54500  94.81000  109.27400 1.000 141.13660 ? 65  LEU G CG    1 
ATOM 4753  C CD1   . LEU G 3 66  ? 88.14300  94.74600  107.81200 1.000 141.13660 ? 65  LEU G CD1   1 
ATOM 4754  C CD2   . LEU G 3 66  ? 87.34700  95.26800  110.08000 1.000 141.13660 ? 65  LEU G CD2   1 
ATOM 4755  N N     . ALA G 3 67  ? 89.73800  90.38300  110.48200 1.000 139.31962 ? 66  ALA G N     1 
ATOM 4756  C CA    . ALA G 3 67  ? 90.44200  89.12700  110.25200 1.000 139.31962 ? 66  ALA G CA    1 
ATOM 4757  C C     . ALA G 3 67  ? 89.47100  87.97200  110.04200 1.000 139.31962 ? 66  ALA G C     1 
ATOM 4758  O O     . ALA G 3 67  ? 89.70100  87.10500  109.19000 1.000 139.31962 ? 66  ALA G O     1 
ATOM 4759  C CB    . ALA G 3 67  ? 91.36700  88.83400  111.42700 1.000 139.31962 ? 66  ALA G CB    1 
ATOM 4760  N N     . GLY G 3 68  ? 88.38100  87.94500  110.81300 1.000 140.09345 ? 67  GLY G N     1 
ATOM 4761  C CA    . GLY G 3 68  ? 87.37300  86.91300  110.63100 1.000 140.09345 ? 67  GLY G CA    1 
ATOM 4762  C C     . GLY G 3 68  ? 86.68700  87.00800  109.28300 1.000 140.09345 ? 67  GLY G C     1 
ATOM 4763  O O     . GLY G 3 68  ? 86.42000  85.98700  108.64100 1.000 140.09345 ? 67  GLY G O     1 
ATOM 4764  N N     . ASN G 3 69  ? 86.40200  88.23500  108.83200 1.000 145.12570 ? 68  ASN G N     1 
ATOM 4765  C CA    . ASN G 3 69  ? 85.83300  88.41200  107.49900 1.000 145.12570 ? 68  ASN G CA    1 
ATOM 4766  C C     . ASN G 3 69  ? 86.82100  87.98700  106.42200 1.000 145.12570 ? 68  ASN G C     1 
ATOM 4767  O O     . ASN G 3 69  ? 86.42800  87.42400  105.39500 1.000 145.12570 ? 68  ASN G O     1 
ATOM 4768  C CB    . ASN G 3 69  ? 85.43000  89.86500  107.27200 1.000 145.12570 ? 68  ASN G CB    1 
ATOM 4769  C CG    . ASN G 3 69  ? 84.21800  90.26200  108.06700 1.000 145.12570 ? 68  ASN G CG    1 
ATOM 4770  O OD1   . ASN G 3 69  ? 84.22800  91.28200  108.75200 1.000 145.12570 ? 68  ASN G OD1   1 
ATOM 4771  N ND2   . ASN G 3 69  ? 83.16600  89.45900  107.98900 1.000 145.12570 ? 68  ASN G ND2   1 
ATOM 4772  N N     . ALA G 3 70  ? 88.11000  88.22600  106.65100 1.000 139.26993 ? 69  ALA G N     1 
ATOM 4773  C CA    . ALA G 3 70  ? 89.11800  87.84800  105.67600 1.000 139.26993 ? 69  ALA G CA    1 
ATOM 4774  C C     . ALA G 3 70  ? 89.40000  86.35800  105.67500 1.000 139.26993 ? 69  ALA G C     1 
ATOM 4775  O O     . ALA G 3 70  ? 89.96900  85.85000  104.70700 1.000 139.26993 ? 69  ALA G O     1 
ATOM 4776  C CB    . ALA G 3 70  ? 90.41500  88.60900  105.94100 1.000 139.26993 ? 69  ALA G CB    1 
ATOM 4777  N N     . ALA G 3 71  ? 89.06200  85.65600  106.74900 1.000 134.20384 ? 70  ALA G N     1 
ATOM 4778  C CA    . ALA G 3 71  ? 89.29400  84.22200  106.79600 1.000 134.20384 ? 70  ALA G CA    1 
ATOM 4779  C C     . ALA G 3 71  ? 88.05200  83.40000  106.49100 1.000 134.20384 ? 70  ALA G C     1 
ATOM 4780  O O     . ALA G 3 71  ? 88.18000  82.19900  106.23800 1.000 134.20384 ? 70  ALA G O     1 
ATOM 4781  C CB    . ALA G 3 71  ? 89.83800  83.81400  108.16600 1.000 134.20384 ? 70  ALA G CB    1 
ATOM 4782  N N     . ARG G 3 72  ? 86.86300  84.00700  106.52400 1.000 139.28854 ? 71  ARG G N     1 
ATOM 4783  C CA    . ARG G 3 72  ? 85.64600  83.24000  106.27300 1.000 139.28854 ? 71  ARG G CA    1 
ATOM 4784  C C     . ARG G 3 72  ? 85.54300  82.79500  104.82000 1.000 139.28854 ? 71  ARG G C     1 
ATOM 4785  O O     . ARG G 3 72  ? 85.13500  81.66200  104.54200 1.000 139.28854 ? 71  ARG G O     1 
ATOM 4786  C CB    . ARG G 3 72  ? 84.42100  84.06900  106.64300 1.000 139.28854 ? 71  ARG G CB    1 
ATOM 4787  C CG    . ARG G 3 72  ? 83.12600  83.28900  106.60600 1.000 139.28854 ? 71  ARG G CG    1 
ATOM 4788  C CD    . ARG G 3 72  ? 81.98500  84.05400  107.25200 1.000 139.28854 ? 71  ARG G CD    1 
ATOM 4789  N NE    . ARG G 3 72  ? 82.04700  84.03700  108.70900 1.000 139.28854 ? 71  ARG G NE    1 
ATOM 4790  C CZ    . ARG G 3 72  ? 82.44900  85.06200  109.45300 1.000 139.28854 ? 71  ARG G CZ    1 
ATOM 4791  N NH1   . ARG G 3 72  ? 82.47100  84.95600  110.77500 1.000 139.28854 ? 71  ARG G NH1   1 
ATOM 4792  N NH2   . ARG G 3 72  ? 82.82300  86.19600  108.87400 1.000 139.28854 ? 71  ARG G NH2   1 
ATOM 4793  N N     . ASP G 3 73  ? 85.91100  83.67100  103.88300 1.000 141.73090 ? 72  ASP G N     1 
ATOM 4794  C CA    . ASP G 3 73  ? 85.78200  83.35600  102.46400 1.000 141.73090 ? 72  ASP G CA    1 
ATOM 4795  C C     . ASP G 3 73  ? 86.75700  82.27800  102.00900 1.000 141.73090 ? 72  ASP G C     1 
ATOM 4796  O O     . ASP G 3 73  ? 86.49200  81.58500  101.02200 1.000 141.73090 ? 72  ASP G O     1 
ATOM 4797  C CB    . ASP G 3 73  ? 85.96900  84.62200  101.64100 1.000 141.73090 ? 72  ASP G CB    1 
ATOM 4798  C CG    . ASP G 3 73  ? 87.25300  85.33900  101.97400 1.000 141.73090 ? 72  ASP G CG    1 
ATOM 4799  O OD1   . ASP G 3 73  ? 87.92500  84.93300  102.94300 1.000 141.73090 ? 72  ASP G OD1   1 
ATOM 4800  O OD2   . ASP G 3 73  ? 87.59200  86.30900  101.26900 1.000 141.73090 ? 72  ASP G OD2   1 
ATOM 4801  N N     . ASN G 3 74  ? 87.87900  82.12300  102.70000 1.000 143.78799 ? 73  ASN G N     1 
ATOM 4802  C CA    . ASN G 3 74  ? 88.84900  81.10000  102.34000 1.000 143.78799 ? 73  ASN G CA    1 
ATOM 4803  C C     . ASN G 3 74  ? 88.51200  79.73300  102.90400 1.000 143.78799 ? 73  ASN G C     1 
ATOM 4804  O O     . ASN G 3 74  ? 89.31800  78.81300  102.72700 1.000 143.78799 ? 73  ASN G O     1 
ATOM 4805  C CB    . ASN G 3 74  ? 90.24200  81.51100  102.80900 1.000 143.78799 ? 73  ASN G CB    1 
ATOM 4806  C CG    . ASN G 3 74  ? 90.85000  82.57800  101.94200 1.000 143.78799 ? 73  ASN G CG    1 
ATOM 4807  O OD1   . ASN G 3 74  ? 91.67500  82.29400  101.07600 1.000 143.78799 ? 73  ASN G OD1   1 
ATOM 4808  N ND2   . ASN G 3 74  ? 90.44000  83.81900  102.16100 1.000 143.78799 ? 73  ASN G ND2   1 
ATOM 4809  N N     . LYS G 3 75  ? 87.35100  79.60100  103.55800 1.000 150.13944 ? 74  LYS G N     1 
ATOM 4810  C CA    . LYS G 3 75  ? 86.89500  78.36900  104.20900 1.000 150.13944 ? 74  LYS G CA    1 
ATOM 4811  C C     . LYS G 3 75  ? 87.89700  77.90100  105.26000 1.000 150.13944 ? 74  LYS G C     1 
ATOM 4812  O O     . LYS G 3 75  ? 88.17800  76.70900  105.39300 1.000 150.13944 ? 74  LYS G O     1 
ATOM 4813  C CB    . LYS G 3 75  ? 86.59400  77.25900  103.19800 1.000 150.13944 ? 74  LYS G CB    1 
ATOM 4814  C CG    . LYS G 3 75  ? 85.12500  77.13000  102.83900 1.000 150.13944 ? 74  LYS G CG    1 
ATOM 4815  C CD    . LYS G 3 75  ? 84.68400  78.27500  101.95100 1.000 150.13944 ? 74  LYS G CD    1 
ATOM 4816  C CE    . LYS G 3 75  ? 85.48000  78.29800  100.65700 1.000 150.13944 ? 74  LYS G CE    1 
ATOM 4817  N NZ    . LYS G 3 75  ? 85.13100  79.47100  99.80900  1.000 150.13944 ? 74  LYS G NZ    1 
ATOM 4818  N N     . LYS G 3 76  ? 88.45100  78.85400  106.00300 1.000 158.82803 ? 75  LYS G N     1 
ATOM 4819  C CA    . LYS G 3 76  ? 89.42700  78.58200  107.04700 1.000 158.82803 ? 75  LYS G CA    1 
ATOM 4820  C C     . LYS G 3 76  ? 88.88500  79.10600  108.36500 1.000 158.82803 ? 75  LYS G C     1 
ATOM 4821  O O     . LYS G 3 76  ? 88.41900  80.24700  108.43700 1.000 158.82803 ? 75  LYS G O     1 
ATOM 4822  C CB    . LYS G 3 76  ? 90.77000  79.24300  106.73800 1.000 158.82803 ? 75  LYS G CB    1 
ATOM 4823  C CG    . LYS G 3 76  ? 91.28000  78.99000  105.34200 1.000 158.82803 ? 75  LYS G CG    1 
ATOM 4824  C CD    . LYS G 3 76  ? 91.46800  77.51600  105.07500 1.000 158.82803 ? 75  LYS G CD    1 
ATOM 4825  C CE    . LYS G 3 76  ? 92.11000  77.29700  103.71800 1.000 158.82803 ? 75  LYS G CE    1 
ATOM 4826  N NZ    . LYS G 3 76  ? 91.68900  78.34300  102.74600 1.000 158.82803 ? 75  LYS G NZ    1 
ATOM 4827  N N     . THR G 3 77  ? 88.93200  78.27200  109.40100 1.000 169.19463 ? 76  THR G N     1 
ATOM 4828  C CA    . THR G 3 77  ? 88.46800  78.65600  110.72500 1.000 169.19463 ? 76  THR G CA    1 
ATOM 4829  C C     . THR G 3 77  ? 89.60800  79.02800  111.66300 1.000 169.19463 ? 76  THR G C     1 
ATOM 4830  O O     . THR G 3 77  ? 89.41400  79.06100  112.88200 1.000 169.19463 ? 76  THR G O     1 
ATOM 4831  C CB    . THR G 3 77  ? 87.64300  77.52800  111.33600 1.000 169.19463 ? 76  THR G CB    1 
ATOM 4832  O OG1   . THR G 3 77  ? 88.52400  76.50600  111.81500 1.000 169.19463 ? 76  THR G OG1   1 
ATOM 4833  C CG2   . THR G 3 77  ? 86.70400  76.93700  110.29600 1.000 169.19463 ? 76  THR G CG2   1 
ATOM 4834  N N     . ARG G 3 78  ? 90.78800  79.31300  111.12500 1.000 155.61229 ? 77  ARG G N     1 
ATOM 4835  C CA    . ARG G 3 78  ? 91.94800  79.67300  111.92500 1.000 155.61229 ? 77  ARG G CA    1 
ATOM 4836  C C     . ARG G 3 78  ? 92.58900  80.92700  111.35800 1.000 155.61229 ? 77  ARG G C     1 
ATOM 4837  O O     . ARG G 3 78  ? 92.77300  81.04600  110.14400 1.000 155.61229 ? 77  ARG G O     1 
ATOM 4838  C CB    . ARG G 3 78  ? 92.96000  78.52900  111.97200 1.000 155.61229 ? 77  ARG G CB    1 
ATOM 4839  C CG    . ARG G 3 78  ? 94.13000  78.77000  112.90100 1.000 155.61229 ? 77  ARG G CG    1 
ATOM 4840  C CD    . ARG G 3 78  ? 94.73900  77.47100  113.37800 1.000 155.61229 ? 77  ARG G CD    1 
ATOM 4841  N NE    . ARG G 3 78  ? 93.78800  76.67600  114.14400 1.000 155.61229 ? 77  ARG G NE    1 
ATOM 4842  C CZ    . ARG G 3 78  ? 93.78300  75.35000  114.18100 1.000 155.61229 ? 77  ARG G CZ    1 
ATOM 4843  N NH1   . ARG G 3 78  ? 94.68200  74.66300  113.49200 1.000 155.61229 ? 77  ARG G NH1   1 
ATOM 4844  N NH2   . ARG G 3 78  ? 92.88500  74.71300  114.91900 1.000 155.61229 ? 77  ARG G NH2   1 
ATOM 4845  N N     . ILE G 3 79  ? 92.93700  81.85600  112.24000 1.000 136.68195 ? 78  ILE G N     1 
ATOM 4846  C CA    . ILE G 3 79  ? 93.53500  83.11500  111.81800 1.000 136.68195 ? 78  ILE G CA    1 
ATOM 4847  C C     . ILE G 3 79  ? 95.03000  82.89800  111.64700 1.000 136.68195 ? 78  ILE G C     1 
ATOM 4848  O O     . ILE G 3 79  ? 95.73200  82.55200  112.60200 1.000 136.68195 ? 78  ILE G O     1 
ATOM 4849  C CB    . ILE G 3 79  ? 93.24900  84.23100  112.83100 1.000 136.68195 ? 78  ILE G CB    1 
ATOM 4850  C CG1   . ILE G 3 79  ? 91.78000  84.64400  112.77000 1.000 136.68195 ? 78  ILE G CG1   1 
ATOM 4851  C CG2   . ILE G 3 79  ? 94.13300  85.43100  112.56500 1.000 136.68195 ? 78  ILE G CG2   1 
ATOM 4852  C CD1   . ILE G 3 79  ? 91.32700  85.08700  111.41100 1.000 136.68195 ? 78  ILE G CD1   1 
ATOM 4853  N N     . ILE G 3 80  ? 95.51700  83.09300  110.42900 1.000 121.51121 ? 79  ILE G N     1 
ATOM 4854  C CA    . ILE G 3 80  ? 96.93400  82.95500  110.11700 1.000 121.51121 ? 79  ILE G CA    1 
ATOM 4855  C C     . ILE G 3 80  ? 97.45800  84.37500  109.93900 1.000 121.51121 ? 79  ILE G C     1 
ATOM 4856  O O     . ILE G 3 80  ? 96.64300  85.29400  109.77600 1.000 121.51121 ? 79  ILE G O     1 
ATOM 4857  C CB    . ILE G 3 80  ? 97.13500  82.08000  108.87000 1.000 121.51121 ? 79  ILE G CB    1 
ATOM 4858  C CG1   . ILE G 3 80  ? 96.76700  82.86000  107.60900 1.000 121.51121 ? 79  ILE G CG1   1 
ATOM 4859  C CG2   . ILE G 3 80  ? 96.31400  80.81600  108.99100 1.000 121.51121 ? 79  ILE G CG2   1 
ATOM 4860  C CD1   . ILE G 3 80  ? 96.83500  82.04700  106.34100 1.000 121.51121 ? 79  ILE G CD1   1 
ATOM 4861  N N     . PRO G 3 81  ? 98.76900  84.62600  110.03600 1.000 114.26605 ? 80  PRO G N     1 
ATOM 4862  C CA    . PRO G 3 81  ? 99.26800  85.99700  109.83500 1.000 114.26605 ? 80  PRO G CA    1 
ATOM 4863  C C     . PRO G 3 81  ? 99.00800  86.58500  108.45600 1.000 114.26605 ? 80  PRO G C     1 
ATOM 4864  O O     . PRO G 3 81  ? 99.04200  87.81100  108.31800 1.000 114.26605 ? 80  PRO G O     1 
ATOM 4865  C CB    . PRO G 3 81  ? 100.77000 85.86700  110.11000 1.000 114.26605 ? 80  PRO G CB    1 
ATOM 4866  C CG    . PRO G 3 81  ? 101.06600 84.43000  110.03200 1.000 114.26605 ? 80  PRO G CG    1 
ATOM 4867  C CD    . PRO G 3 81  ? 99.84600  83.73900  110.50400 1.000 114.26605 ? 80  PRO G CD    1 
ATOM 4868  N N     . ARG G 3 82  ? 98.76000  85.76300  107.43800 1.000 111.42911 ? 81  ARG G N     1 
ATOM 4869  C CA    . ARG G 3 82  ? 98.42300  86.29800  106.12400 1.000 111.42911 ? 81  ARG G CA    1 
ATOM 4870  C C     . ARG G 3 82  ? 97.06200  86.98500  106.14300 1.000 111.42911 ? 81  ARG G C     1 
ATOM 4871  O O     . ARG G 3 82  ? 96.88300  88.04600  105.52500 1.000 111.42911 ? 81  ARG G O     1 
ATOM 4872  C CB    . ARG G 3 82  ? 98.47200  85.17300  105.09300 1.000 111.42911 ? 81  ARG G CB    1 
ATOM 4873  C CG    . ARG G 3 82  ? 97.65500  85.40500  103.84500 1.000 111.42911 ? 81  ARG G CG    1 
ATOM 4874  C CD    . ARG G 3 82  ? 98.43100  86.17800  102.80900 1.000 111.42911 ? 81  ARG G CD    1 
ATOM 4875  N NE    . ARG G 3 82  ? 97.68500  86.28200  101.56100 1.000 111.42911 ? 81  ARG G NE    1 
ATOM 4876  C CZ    . ARG G 3 82  ? 98.02800  87.07200  100.55000 1.000 111.42911 ? 81  ARG G CZ    1 
ATOM 4877  N NH1   . ARG G 3 82  ? 99.10800  87.83200  100.63700 1.000 111.42911 ? 81  ARG G NH1   1 
ATOM 4878  N NH2   . ARG G 3 82  ? 97.28900  87.10000  99.45100  1.000 111.42911 ? 81  ARG G NH2   1 
ATOM 4879  N N     . HIS G 3 83  ? 96.10100  86.39700  106.86400 1.000 120.83592 ? 82  HIS G N     1 
ATOM 4880  C CA    . HIS G 3 83  ? 94.77500  86.99300  107.00300 1.000 120.83592 ? 82  HIS G CA    1 
ATOM 4881  C C     . HIS G 3 83  ? 94.83200  88.35500  107.67800 1.000 120.83592 ? 82  HIS G C     1 
ATOM 4882  O O     . HIS G 3 83  ? 94.06700  89.25800  107.32300 1.000 120.83592 ? 82  HIS G O     1 
ATOM 4883  C CB    . HIS G 3 83  ? 93.86300  86.07300  107.80700 1.000 120.83592 ? 82  HIS G CB    1 
ATOM 4884  C CG    . HIS G 3 83  ? 93.64600  84.73700  107.18100 1.000 120.83592 ? 82  HIS G CG    1 
ATOM 4885  N ND1   . HIS G 3 83  ? 93.45400  83.59300  107.92300 1.000 120.83592 ? 82  HIS G ND1   1 
ATOM 4886  C CD2   . HIS G 3 83  ? 93.57800  84.36100  105.88400 1.000 120.83592 ? 82  HIS G CD2   1 
ATOM 4887  C CE1   . HIS G 3 83  ? 93.28200  82.56800  107.10900 1.000 120.83592 ? 82  HIS G CE1   1 
ATOM 4888  N NE2   . HIS G 3 83  ? 93.35300  83.00800  105.86600 1.000 120.83592 ? 82  HIS G NE2   1 
ATOM 4889  N N     . LEU G 3 84  ? 95.72200  88.51400  108.66100 1.000 120.53834 ? 83  LEU G N     1 
ATOM 4890  C CA    . LEU G 3 84  ? 95.86500  89.79600  109.34400 1.000 120.53834 ? 83  LEU G CA    1 
ATOM 4891  C C     . LEU G 3 84  ? 96.34700  90.88300  108.39500 1.000 120.53834 ? 83  LEU G C     1 
ATOM 4892  O O     . LEU G 3 84  ? 95.84600  92.01100  108.43300 1.000 120.53834 ? 83  LEU G O     1 
ATOM 4893  C CB    . LEU G 3 84  ? 96.81400  89.65000  110.52900 1.000 120.53834 ? 83  LEU G CB    1 
ATOM 4894  C CG    . LEU G 3 84  ? 96.16500  89.05200  111.77700 1.000 120.53834 ? 83  LEU G CG    1 
ATOM 4895  C CD1   . LEU G 3 84  ? 97.10200  89.09100  112.95600 1.000 120.53834 ? 83  LEU G CD1   1 
ATOM 4896  C CD2   . LEU G 3 84  ? 94.90000  89.80000  112.11500 1.000 120.53834 ? 83  LEU G CD2   1 
ATOM 4897  N N     . GLN G 3 85  ? 97.30300  90.55300  107.52600 1.000 123.89334 ? 84  GLN G N     1 
ATOM 4898  C CA    . GLN G 3 85  ? 97.77900  91.51500  106.53900 1.000 123.89334 ? 84  GLN G CA    1 
ATOM 4899  C C     . GLN G 3 85  ? 96.69400  91.85800  105.52900 1.000 123.89334 ? 84  GLN G C     1 
ATOM 4900  O O     . GLN G 3 85  ? 96.50200  93.03500  105.19400 1.000 123.89334 ? 84  GLN G O     1 
ATOM 4901  C CB    . GLN G 3 85  ? 99.01200  90.96600  105.83100 1.000 123.89334 ? 84  GLN G CB    1 
ATOM 4902  C CG    . GLN G 3 85  ? 99.53800  91.84500  104.72000 1.000 123.89334 ? 84  GLN G CG    1 
ATOM 4903  C CD    . GLN G 3 85  ? 100.52400 92.86600  105.22100 1.000 123.89334 ? 84  GLN G CD    1 
ATOM 4904  O OE1   . GLN G 3 85  ? 100.15500 93.99000  105.54800 1.000 123.89334 ? 84  GLN G OE1   1 
ATOM 4905  N NE2   . GLN G 3 85  ? 101.78800 92.47800  105.29800 1.000 123.89334 ? 84  GLN G NE2   1 
ATOM 4906  N N     . LEU G 3 86  ? 95.97200  90.84100  105.04200 1.000 129.68358 ? 85  LEU G N     1 
ATOM 4907  C CA    . LEU G 3 86  ? 94.89400  91.07900  104.08600 1.000 129.68358 ? 85  LEU G CA    1 
ATOM 4908  C C     . LEU G 3 86  ? 93.77400  91.91700  104.69100 1.000 129.68358 ? 85  LEU G C     1 
ATOM 4909  O O     . LEU G 3 86  ? 93.15700  92.72900  103.99400 1.000 129.68358 ? 85  LEU G O     1 
ATOM 4910  C CB    . LEU G 3 86  ? 94.35600  89.74600  103.57200 1.000 129.68358 ? 85  LEU G CB    1 
ATOM 4911  C CG    . LEU G 3 86  ? 93.26500  89.80800  102.50700 1.000 129.68358 ? 85  LEU G CG    1 
ATOM 4912  C CD1   . LEU G 3 86  ? 93.71900  90.65500  101.33500 1.000 129.68358 ? 85  LEU G CD1   1 
ATOM 4913  C CD2   . LEU G 3 86  ? 92.90200  88.41300  102.04500 1.000 129.68358 ? 85  LEU G CD2   1 
ATOM 4914  N N     . ALA G 3 87  ? 93.52700  91.76700  105.98700 1.000 129.31984 ? 86  ALA G N     1 
ATOM 4915  C CA    . ALA G 3 87  ? 92.49100  92.55600  106.63300 1.000 129.31984 ? 86  ALA G CA    1 
ATOM 4916  C C     . ALA G 3 87  ? 92.96600  93.96100  106.95800 1.000 129.31984 ? 86  ALA G C     1 
ATOM 4917  O O     . ALA G 3 87  ? 92.17600  94.90700  106.89100 1.000 129.31984 ? 86  ALA G O     1 
ATOM 4918  C CB    . ALA G 3 87  ? 92.02200  91.86000  107.90800 1.000 129.31984 ? 86  ALA G CB    1 
ATOM 4919  N N     . ILE G 3 88  ? 94.24300  94.11900  107.30500 1.000 128.60743 ? 87  ILE G N     1 
ATOM 4920  C CA    . ILE G 3 88  ? 94.74800  95.43200  107.66700 1.000 128.60743 ? 87  ILE G CA    1 
ATOM 4921  C C     . ILE G 3 88  ? 95.02600  96.29300  106.44200 1.000 128.60743 ? 87  ILE G C     1 
ATOM 4922  O O     . ILE G 3 88  ? 95.01900  97.52400  106.55100 1.000 128.60743 ? 87  ILE G O     1 
ATOM 4923  C CB    . ILE G 3 88  ? 95.99600  95.28300  108.56000 1.000 128.60743 ? 87  ILE G CB    1 
ATOM 4924  C CG1   . ILE G 3 88  ? 96.24000  96.54300  109.37500 1.000 128.60743 ? 87  ILE G CG1   1 
ATOM 4925  C CG2   . ILE G 3 88  ? 97.24500  95.00700  107.76200 1.000 128.60743 ? 87  ILE G CG2   1 
ATOM 4926  C CD1   . ILE G 3 88  ? 95.40500  96.60500  110.59800 1.000 128.60743 ? 87  ILE G CD1   1 
ATOM 4927  N N     . ARG G 3 89  ? 95.22900  95.70500  105.26500 1.000 130.85638 ? 88  ARG G N     1 
ATOM 4928  C CA    . ARG G 3 89  ? 95.47500  96.51700  104.08500 1.000 130.85638 ? 88  ARG G CA    1 
ATOM 4929  C C     . ARG G 3 89  ? 94.22600  96.74800  103.25300 1.000 130.85638 ? 88  ARG G C     1 
ATOM 4930  O O     . ARG G 3 89  ? 94.32500  97.28200  102.14600 1.000 130.85638 ? 88  ARG G O     1 
ATOM 4931  C CB    . ARG G 3 89  ? 96.54900  95.87700  103.21800 1.000 130.85638 ? 88  ARG G CB    1 
ATOM 4932  C CG    . ARG G 3 89  ? 97.91600  95.72300  103.85100 1.000 130.85638 ? 88  ARG G CG    1 
ATOM 4933  C CD    . ARG G 3 89  ? 98.44400  96.98300  104.49800 1.000 130.85638 ? 88  ARG G CD    1 
ATOM 4934  N NE    . ARG G 3 89  ? 99.66500  96.68800  105.24100 1.000 130.85638 ? 88  ARG G NE    1 
ATOM 4935  C CZ    . ARG G 3 89  ? 100.45600 97.60300  105.78600 1.000 130.85638 ? 88  ARG G CZ    1 
ATOM 4936  N NH1   . ARG G 3 89  ? 101.54300 97.23100  106.44100 1.000 130.85638 ? 88  ARG G NH1   1 
ATOM 4937  N NH2   . ARG G 3 89  ? 100.16100 98.88700  105.67900 1.000 130.85638 ? 88  ARG G NH2   1 
ATOM 4938  N N     . ASN G 3 90  ? 93.05900  96.35900  103.75000 1.000 149.14636 ? 89  ASN G N     1 
ATOM 4939  C CA    . ASN G 3 90  ? 91.80500  96.58700  103.05100 1.000 149.14636 ? 89  ASN G CA    1 
ATOM 4940  C C     . ASN G 3 90  ? 90.96900  97.65700  103.72600 1.000 149.14636 ? 89  ASN G C     1 
ATOM 4941  O O     . ASN G 3 90  ? 89.86500  97.95300  103.26200 1.000 149.14636 ? 89  ASN G O     1 
ATOM 4942  C CB    . ASN G 3 90  ? 91.00800  95.29100  102.91300 1.000 149.14636 ? 89  ASN G CB    1 
ATOM 4943  C CG    . ASN G 3 90  ? 91.55800  94.39400  101.83200 1.000 149.14636 ? 89  ASN G CG    1 
ATOM 4944  O OD1   . ASN G 3 90  ? 92.46100  94.78300  101.09500 1.000 149.14636 ? 89  ASN G OD1   1 
ATOM 4945  N ND2   . ASN G 3 90  ? 91.01100  93.19300  101.72000 1.000 149.14636 ? 89  ASN G ND2   1 
ATOM 4946  N N     . ASP G 3 91  ? 91.47000  98.24200  104.80700 1.000 175.26684 ? 90  ASP G N     1 
ATOM 4947  C CA    . ASP G 3 91  ? 90.77900  99.27700  105.55600 1.000 175.26684 ? 90  ASP G CA    1 
ATOM 4948  C C     . ASP G 3 91  ? 91.61500  100.53500 105.42000 1.000 175.26684 ? 90  ASP G C     1 
ATOM 4949  O O     . ASP G 3 91  ? 92.81400  100.51800 105.70400 1.000 175.26684 ? 90  ASP G O     1 
ATOM 4950  C CB    . ASP G 3 91  ? 90.58800  98.89900  107.02600 1.000 175.26684 ? 90  ASP G CB    1 
ATOM 4951  C CG    . ASP G 3 91  ? 89.89800  99.99400  107.83000 1.000 175.26684 ? 90  ASP G CG    1 
ATOM 4952  O OD1   . ASP G 3 91  ? 90.53800  101.00400 108.19300 1.000 175.26684 ? 90  ASP G OD1   1 
ATOM 4953  O OD2   . ASP G 3 91  ? 88.69000  99.84600  108.09600 1.000 175.26684 ? 90  ASP G OD2   1 
ATOM 4954  N N     . GLU G 3 92  ? 90.96700  101.61700 104.99400 1.000 197.67394 ? 91  GLU G N     1 
ATOM 4955  C CA    . GLU G 3 92  ? 91.63700  102.89700 104.78100 1.000 197.67394 ? 91  GLU G CA    1 
ATOM 4956  C C     . GLU G 3 92  ? 92.21300  103.48400 106.07000 1.000 197.67394 ? 91  GLU G C     1 
ATOM 4957  O O     . GLU G 3 92  ? 93.32400  104.02500 106.06300 1.000 197.67394 ? 91  GLU G O     1 
ATOM 4958  C CB    . GLU G 3 92  ? 90.67600  103.88800 104.11300 1.000 197.67394 ? 91  GLU G CB    1 
ATOM 4959  C CG    . GLU G 3 92  ? 90.12500  103.57000 102.67900 1.000 197.67394 ? 91  GLU G CG    1 
ATOM 4960  C CD    . GLU G 3 92  ? 89.33300  102.27100 102.50900 1.000 197.67394 ? 91  GLU G CD    1 
ATOM 4961  O OE1   . GLU G 3 92  ? 88.87900  101.69200 103.51900 1.000 197.67394 ? 91  GLU G OE1   1 
ATOM 4962  O OE2   . GLU G 3 92  ? 89.17800  101.82200 101.35400 1.000 197.67394 ? 91  GLU G OE2   1 
ATOM 4963  N N     . GLU G 3 93  ? 91.48600  103.38800 107.18200 1.000 169.52573 ? 92  GLU G N     1 
ATOM 4964  C CA    . GLU G 3 93  ? 91.96600  103.98200 108.42900 1.000 169.52573 ? 92  GLU G CA    1 
ATOM 4965  C C     . GLU G 3 93  ? 93.02800  103.12200 109.09400 1.000 169.52573 ? 92  GLU G C     1 
ATOM 4966  O O     . GLU G 3 93  ? 94.02800  103.64300 109.60600 1.000 169.52573 ? 92  GLU G O     1 
ATOM 4967  C CB    . GLU G 3 93  ? 90.80900  104.19600 109.38700 1.000 169.52573 ? 92  GLU G CB    1 
ATOM 4968  C CG    . GLU G 3 93  ? 89.81000  105.19500 108.90500 1.000 169.52573 ? 92  GLU G CG    1 
ATOM 4969  C CD    . GLU G 3 93  ? 88.82200  105.52100 109.98000 1.000 169.52573 ? 92  GLU G CD    1 
ATOM 4970  O OE1   . GLU G 3 93  ? 89.08500  106.44900 110.77600 1.000 169.52573 ? 92  GLU G OE1   1 
ATOM 4971  O OE2   . GLU G 3 93  ? 87.80100  104.81100 110.06200 1.000 169.52573 ? 92  GLU G OE2   1 
ATOM 4972  N N     . LEU G 3 94  ? 92.81500  101.80700 109.09800 1.000 160.38147 ? 93  LEU G N     1 
ATOM 4973  C CA    . LEU G 3 94  ? 93.79700  100.88500 109.64900 1.000 160.38147 ? 93  LEU G CA    1 
ATOM 4974  C C     . LEU G 3 94  ? 95.08600  100.90500 108.84500 1.000 160.38147 ? 93  LEU G C     1 
ATOM 4975  O O     . LEU G 3 94  ? 96.15800  100.66200 109.40400 1.000 160.38147 ? 93  LEU G O     1 
ATOM 4976  C CB    . LEU G 3 94  ? 93.23000  99.47000  109.72500 1.000 160.38147 ? 93  LEU G CB    1 
ATOM 4977  C CG    . LEU G 3 94  ? 92.44800  99.06600  110.98200 1.000 160.38147 ? 93  LEU G CG    1 
ATOM 4978  C CD1   . LEU G 3 94  ? 93.32800  99.26000  112.20300 1.000 160.38147 ? 93  LEU G CD1   1 
ATOM 4979  C CD2   . LEU G 3 94  ? 91.12700  99.79200  111.17100 1.000 160.38147 ? 93  LEU G CD2   1 
ATOM 4980  N N     . ASN G 3 95  ? 95.00100  101.16400 107.53900 1.000 162.58996 ? 94  ASN G N     1 
ATOM 4981  C CA    . ASN G 3 95  ? 96.21700  101.31400 106.75100 1.000 162.58996 ? 94  ASN G CA    1 
ATOM 4982  C C     . ASN G 3 95  ? 96.98500  102.56300 107.15600 1.000 162.58996 ? 94  ASN G C     1 
ATOM 4983  O O     . ASN G 3 95  ? 98.21700  102.56200 107.14400 1.000 162.58996 ? 94  ASN G O     1 
ATOM 4984  C CB    . ASN G 3 95  ? 95.88200  101.37900 105.26600 1.000 162.58996 ? 94  ASN G CB    1 
ATOM 4985  C CG    . ASN G 3 95  ? 97.10800  101.43100 104.40000 1.000 162.58996 ? 94  ASN G CG    1 
ATOM 4986  O OD1   . ASN G 3 95  ? 97.39900  102.45000 103.77700 1.000 162.58996 ? 94  ASN G OD1   1 
ATOM 4987  N ND2   . ASN G 3 95  ? 97.83500  100.32800 104.34400 1.000 162.58996 ? 94  ASN G ND2   1 
ATOM 4988  N N     . LYS G 3 96  ? 96.28100  103.63700 107.51800 1.000 156.10443 ? 95  LYS G N     1 
ATOM 4989  C CA    . LYS G 3 96  ? 96.97400  104.82100 108.01200 1.000 156.10443 ? 95  LYS G CA    1 
ATOM 4990  C C     . LYS G 3 96  ? 97.59600  104.56900 109.37300 1.000 156.10443 ? 95  LYS G C     1 
ATOM 4991  O O     . LYS G 3 96  ? 98.69300  105.05900 109.66100 1.000 156.10443 ? 95  LYS G O     1 
ATOM 4992  C CB    . LYS G 3 96  ? 96.02800  106.01300 108.09700 1.000 156.10443 ? 95  LYS G CB    1 
ATOM 4993  C CG    . LYS G 3 96  ? 96.00200  106.89000 106.86800 1.000 156.10443 ? 95  LYS G CG    1 
ATOM 4994  C CD    . LYS G 3 96  ? 95.73800  108.32500 107.28400 1.000 156.10443 ? 95  LYS G CD    1 
ATOM 4995  C CE    . LYS G 3 96  ? 95.42800  109.22000 106.10400 1.000 156.10443 ? 95  LYS G CE    1 
ATOM 4996  N NZ    . LYS G 3 96  ? 95.07300  110.58900 106.57000 1.000 156.10443 ? 95  LYS G NZ    1 
ATOM 4997  N N     . LEU G 3 97  ? 96.91100  103.80700 110.22100 1.000 134.50504 ? 96  LEU G N     1 
ATOM 4998  C CA    . LEU G 3 97  ? 97.47500  103.49800 111.52600 1.000 134.50504 ? 96  LEU G CA    1 
ATOM 4999  C C     . LEU G 3 97  ? 98.64300  102.53100 111.42000 1.000 134.50504 ? 96  LEU G C     1 
ATOM 5000  O O     . LEU G 3 97  ? 99.58600  102.60400 112.21400 1.000 134.50504 ? 96  LEU G O     1 
ATOM 5001  C CB    . LEU G 3 97  ? 96.39200  102.91600 112.42700 1.000 134.50504 ? 96  LEU G CB    1 
ATOM 5002  C CG    . LEU G 3 97  ? 96.77700  102.69900 113.88500 1.000 134.50504 ? 96  LEU G CG    1 
ATOM 5003  C CD1   . LEU G 3 97  ? 97.33900  103.97700 114.46600 1.000 134.50504 ? 96  LEU G CD1   1 
ATOM 5004  C CD2   . LEU G 3 97  ? 95.59100  102.22000 114.67800 1.000 134.50504 ? 96  LEU G CD2   1 
ATOM 5005  N N     . LEU G 3 98  ? 98.62300  101.65600 110.42500 1.000 125.68829 ? 97  LEU G N     1 
ATOM 5006  C CA    . LEU G 3 98  ? 99.67700  100.66900 110.27900 1.000 125.68829 ? 97  LEU G CA    1 
ATOM 5007  C C     . LEU G 3 98  ? 100.38600 100.84100 108.95000 1.000 125.68829 ? 97  LEU G C     1 
ATOM 5008  O O     . LEU G 3 98  ? 100.63100 99.86500  108.23700 1.000 125.68829 ? 97  LEU G O     1 
ATOM 5009  C CB    . LEU G 3 98  ? 99.09800  99.26100  110.39000 1.000 125.68829 ? 97  LEU G CB    1 
ATOM 5010  C CG    . LEU G 3 98  ? 98.85900  98.72700  111.80000 1.000 125.68829 ? 97  LEU G CG    1 
ATOM 5011  C CD1   . LEU G 3 98  ? 97.53000  99.17600  112.36500 1.000 125.68829 ? 97  LEU G CD1   1 
ATOM 5012  C CD2   . LEU G 3 98  ? 98.95100  97.22000  111.80300 1.000 125.68829 ? 97  LEU G CD2   1 
ATOM 5013  N N     . GLY G 3 99  ? 100.72400 102.07600 108.61000 1.000 131.09518 ? 98  GLY G N     1 
ATOM 5014  C CA    . GLY G 3 99  ? 101.41300 102.32800 107.36500 1.000 131.09518 ? 98  GLY G CA    1 
ATOM 5015  C C     . GLY G 3 99  ? 102.90600 102.21000 107.52300 1.000 131.09518 ? 98  GLY G C     1 
ATOM 5016  O O     . GLY G 3 99  ? 103.60100 101.68600 106.65000 1.000 131.09518 ? 98  GLY G O     1 
ATOM 5017  N N     . LYS G 3 100 ? 103.40700 102.69000 108.65200 1.000 121.54846 ? 99  LYS G N     1 
ATOM 5018  C CA    . LYS G 3 100 ? 104.83400 102.62900 108.90800 1.000 121.54846 ? 99  LYS G CA    1 
ATOM 5019  C C     . LYS G 3 100 ? 105.28900 101.22700 109.29200 1.000 121.54846 ? 99  LYS G C     1 
ATOM 5020  O O     . LYS G 3 100 ? 106.48400 100.93100 109.20800 1.000 121.54846 ? 99  LYS G O     1 
ATOM 5021  C CB    . LYS G 3 100 ? 105.19400 103.64800 109.99200 1.000 121.54846 ? 99  LYS G CB    1 
ATOM 5022  C CG    . LYS G 3 100 ? 106.66100 104.03200 110.03800 1.000 121.54846 ? 99  LYS G CG    1 
ATOM 5023  C CD    . LYS G 3 100 ? 107.13400 104.45800 108.65600 1.000 121.54846 ? 99  LYS G CD    1 
ATOM 5024  C CE    . LYS G 3 100 ? 108.56600 104.94400 108.67700 1.000 121.54846 ? 99  LYS G CE    1 
ATOM 5025  N NZ    . LYS G 3 100 ? 109.13500 105.00700 107.30500 1.000 121.54846 ? 99  LYS G NZ    1 
ATOM 5026  N N     . VAL G 3 101 ? 104.36900 100.34300 109.66000 1.000 118.26728 ? 100 VAL G N     1 
ATOM 5027  C CA    . VAL G 3 101 ? 104.73000 99.02700  110.15200 1.000 118.26728 ? 100 VAL G CA    1 
ATOM 5028  C C     . VAL G 3 101 ? 104.59100 98.01800  109.01900 1.000 118.26728 ? 100 VAL G C     1 
ATOM 5029  O O     . VAL G 3 101 ? 103.90700 98.24800  108.01800 1.000 118.26728 ? 100 VAL G O     1 
ATOM 5030  C CB    . VAL G 3 101 ? 103.86300 98.62900  111.37400 1.000 118.26728 ? 100 VAL G CB    1 
ATOM 5031  C CG1   . VAL G 3 101 ? 102.52400 98.09300  110.94300 1.000 118.26728 ? 100 VAL G CG1   1 
ATOM 5032  C CG2   . VAL G 3 101 ? 104.57000 97.62700  112.25500 1.000 118.26728 ? 100 VAL G CG2   1 
ATOM 5033  N N     . THR G 3 102 ? 105.28500 96.89400  109.16100 1.000 114.04400 ? 101 THR G N     1 
ATOM 5034  C CA    . THR G 3 102 ? 105.14700 95.76500  108.26100 1.000 114.04400 ? 101 THR G CA    1 
ATOM 5035  C C     . THR G 3 102 ? 104.91600 94.50300  109.07900 1.000 114.04400 ? 101 THR G C     1 
ATOM 5036  O O     . THR G 3 102 ? 105.42100 94.35600  110.19400 1.000 114.04400 ? 101 THR G O     1 
ATOM 5037  C CB    . THR G 3 102 ? 106.37500 95.62100  107.34500 1.000 114.04400 ? 101 THR G CB    1 
ATOM 5038  O OG1   . THR G 3 102 ? 106.20000 94.49700  106.47500 1.000 114.04400 ? 101 THR G OG1   1 
ATOM 5039  C CG2   . THR G 3 102 ? 107.66100 95.48200  108.13600 1.000 114.04400 ? 101 THR G CG2   1 
ATOM 5040  N N     . ILE G 3 103 ? 104.11700 93.60700  108.52100 1.000 114.22480 ? 102 ILE G N     1 
ATOM 5041  C CA    . ILE G 3 103 ? 103.69500 92.39200  109.19900 1.000 114.22480 ? 102 ILE G CA    1 
ATOM 5042  C C     . ILE G 3 103 ? 104.53200 91.23800  108.68000 1.000 114.22480 ? 102 ILE G C     1 
ATOM 5043  O O     . ILE G 3 103 ? 104.66500 91.06300  107.46300 1.000 114.22480 ? 102 ILE G O     1 
ATOM 5044  C CB    . ILE G 3 103 ? 102.19500 92.13600  108.98400 1.000 114.22480 ? 102 ILE G CB    1 
ATOM 5045  C CG1   . ILE G 3 103 ? 101.36000 93.19900  109.69700 1.000 114.22480 ? 102 ILE G CG1   1 
ATOM 5046  C CG2   . ILE G 3 103 ? 101.79700 90.75700  109.45500 1.000 114.22480 ? 102 ILE G CG2   1 
ATOM 5047  C CD1   . ILE G 3 103 ? 100.84200 94.29300  108.80100 1.000 114.22480 ? 102 ILE G CD1   1 
ATOM 5048  N N     . ALA G 3 104 ? 105.10600 90.46000  109.59100 1.000 115.30945 ? 103 ALA G N     1 
ATOM 5049  C CA    . ALA G 3 104 ? 105.88900 89.30600  109.18800 1.000 115.30945 ? 103 ALA G CA    1 
ATOM 5050  C C     . ALA G 3 104 ? 104.98800 88.23000  108.60300 1.000 115.30945 ? 103 ALA G C     1 
ATOM 5051  O O     . ALA G 3 104 ? 103.82700 88.08600  108.99800 1.000 115.30945 ? 103 ALA G O     1 
ATOM 5052  C CB    . ALA G 3 104 ? 106.66500 88.74400  110.37500 1.000 115.30945 ? 103 ALA G CB    1 
ATOM 5053  N N     . GLN G 3 105 ? 105.54600 87.48600  107.64000 1.000 115.55150 ? 104 GLN G N     1 
ATOM 5054  C CA    . GLN G 3 105 ? 104.88100 86.38700  106.93300 1.000 115.55150 ? 104 GLN G CA    1 
ATOM 5055  C C     . GLN G 3 105 ? 103.58900 86.84500  106.26400 1.000 115.55150 ? 104 GLN G C     1 
ATOM 5056  O O     . GLN G 3 105 ? 102.58700 86.13000  106.25000 1.000 115.55150 ? 104 GLN G O     1 
ATOM 5057  C CB    . GLN G 3 105 ? 104.61900 85.20900  107.86900 1.000 115.55150 ? 104 GLN G CB    1 
ATOM 5058  C CG    . GLN G 3 105 ? 105.86500 84.70000  108.53800 1.000 115.55150 ? 104 GLN G CG    1 
ATOM 5059  C CD    . GLN G 3 105 ? 105.61200 83.44100  109.32000 1.000 115.55150 ? 104 GLN G CD    1 
ATOM 5060  O OE1   . GLN G 3 105 ? 104.48800 82.94600  109.36600 1.000 115.55150 ? 104 GLN G OE1   1 
ATOM 5061  N NE2   . GLN G 3 105 ? 106.65400 82.91800  109.95500 1.000 115.55150 ? 104 GLN G NE2   1 
ATOM 5062  N N     . GLY G 3 106 ? 103.61000 88.05100  105.71100 1.000 113.81592 ? 105 GLY G N     1 
ATOM 5063  C CA    . GLY G 3 106 ? 102.44600 88.58200  105.03800 1.000 113.81592 ? 105 GLY G CA    1 
ATOM 5064  C C     . GLY G 3 106 ? 102.74000 89.02500  103.62500 1.000 113.81592 ? 105 GLY G C     1 
ATOM 5065  O O     . GLY G 3 106 ? 103.56600 89.91600  103.40600 1.000 113.81592 ? 105 GLY G O     1 
ATOM 5066  N N     . GLY G 3 107 ? 102.07800 88.40800  102.65700 1.000 117.04222 ? 106 GLY G N     1 
ATOM 5067  C CA    . GLY G 3 107 ? 102.31500 88.73600  101.27000 1.000 117.04222 ? 106 GLY G CA    1 
ATOM 5068  C C     . GLY G 3 107 ? 101.71400 90.07300  100.88500 1.000 117.04222 ? 106 GLY G C     1 
ATOM 5069  O O     . GLY G 3 107 ? 100.90900 90.66900  101.59700 1.000 117.04222 ? 106 GLY G O     1 
ATOM 5070  N N     . VAL G 3 108 ? 102.12300 90.54400  99.72600  1.000 121.09096 ? 107 VAL G N     1 
ATOM 5071  C CA    . VAL G 3 108 ? 101.64300 91.81300  99.19800  1.000 121.09096 ? 107 VAL G CA    1 
ATOM 5072  C C     . VAL G 3 108 ? 100.26700 91.60300  98.57900  1.000 121.09096 ? 107 VAL G C     1 
ATOM 5073  O O     . VAL G 3 108 ? 99.92200  90.49600  98.15100  1.000 121.09096 ? 107 VAL G O     1 
ATOM 5074  C CB    . VAL G 3 108 ? 102.66600 92.37000  98.18400  1.000 121.09096 ? 107 VAL G CB    1 
ATOM 5075  C CG1   . VAL G 3 108 ? 102.41400 93.83700  97.86000  1.000 121.09096 ? 107 VAL G CG1   1 
ATOM 5076  C CG2   . VAL G 3 108 ? 104.06900 92.20000  98.72400  1.000 121.09096 ? 107 VAL G CG2   1 
ATOM 5077  N N     . LEU G 3 109 ? 99.45100  92.65400  98.61000  1.000 129.80459 ? 108 LEU G N     1 
ATOM 5078  C CA    . LEU G 3 109 ? 98.10700  92.62000  98.05200  1.000 129.80459 ? 108 LEU G CA    1 
ATOM 5079  C C     . LEU G 3 109 ? 98.17800  92.36500  96.55100  1.000 129.80459 ? 108 LEU G C     1 
ATOM 5080  O O     . LEU G 3 109 ? 99.02600  92.94600  95.86900  1.000 129.80459 ? 108 LEU G O     1 
ATOM 5081  C CB    . LEU G 3 109 ? 97.39600  93.94900  98.27900  1.000 129.80459 ? 108 LEU G CB    1 
ATOM 5082  C CG    . LEU G 3 109 ? 97.14600  94.50200  99.67100  1.000 129.80459 ? 108 LEU G CG    1 
ATOM 5083  C CD1   . LEU G 3 109 ? 98.28300  95.43900  100.03900 1.000 129.80459 ? 108 LEU G CD1   1 
ATOM 5084  C CD2   . LEU G 3 109 ? 95.82200  95.23200  99.66900  1.000 129.80459 ? 108 LEU G CD2   1 
ATOM 5085  N N     . PRO G 3 110 ? 97.34200  91.49300  96.01100  1.000 137.68330 ? 109 PRO G N     1 
ATOM 5086  C CA    . PRO G 3 110 ? 97.39900  91.23700  94.56500  1.000 137.68330 ? 109 PRO G CA    1 
ATOM 5087  C C     . PRO G 3 110 ? 96.84800  92.38100  93.72300  1.000 137.68330 ? 109 PRO G C     1 
ATOM 5088  O O     . PRO G 3 110 ? 95.63300  92.57900  93.63600  1.000 137.68330 ? 109 PRO G O     1 
ATOM 5089  C CB    . PRO G 3 110 ? 96.56300  89.96200  94.40900  1.000 137.68330 ? 109 PRO G CB    1 
ATOM 5090  C CG    . PRO G 3 110 ? 95.62700  89.97300  95.57700  1.000 137.68330 ? 109 PRO G CG    1 
ATOM 5091  C CD    . PRO G 3 110 ? 96.34700  90.65300  96.70000  1.000 137.68330 ? 109 PRO G CD    1 
ATOM 5092  N N     . ASN G 3 111 ? 97.74100  93.14400  93.09400  1.000 147.76462 ? 110 ASN G N     1 
ATOM 5093  C CA    . ASN G 3 111 ? 97.35700  94.25800  92.23600  1.000 147.76462 ? 110 ASN G CA    1 
ATOM 5094  C C     . ASN G 3 111 ? 98.16800  94.21100  90.95000  1.000 147.76462 ? 110 ASN G C     1 
ATOM 5095  O O     . ASN G 3 111 ? 99.39800  94.11200  90.99400  1.000 147.76462 ? 110 ASN G O     1 
ATOM 5096  C CB    . ASN G 3 111 ? 97.56200  95.60900  92.93200  1.000 147.76462 ? 110 ASN G CB    1 
ATOM 5097  C CG    . ASN G 3 111 ? 98.89700  95.71000  93.65000  1.000 147.76462 ? 110 ASN G CG    1 
ATOM 5098  O OD1   . ASN G 3 111 ? 99.64100  94.73900  93.74800  1.000 147.76462 ? 110 ASN G OD1   1 
ATOM 5099  N ND2   . ASN G 3 111 ? 99.20800  96.90100  94.14800  1.000 147.76462 ? 110 ASN G ND2   1 
ATOM 5100  N N     . ILE G 3 112 ? 97.49200  94.26100  89.80600  1.000 155.22191 ? 111 ILE G N     1 
ATOM 5101  C CA    . ILE G 3 112 ? 98.17400  94.25500  88.51800  1.000 155.22191 ? 111 ILE G CA    1 
ATOM 5102  C C     . ILE G 3 112 ? 97.86600  95.55700  87.79000  1.000 155.22191 ? 111 ILE G C     1 
ATOM 5103  O O     . ILE G 3 112 ? 96.69600  95.91000  87.60400  1.000 155.22191 ? 111 ILE G O     1 
ATOM 5104  C CB    . ILE G 3 112 ? 97.74100  93.05100  87.66300  1.000 155.22191 ? 111 ILE G CB    1 
ATOM 5105  C CG1   . ILE G 3 112 ? 97.91400  91.74700  88.44000  1.000 155.22191 ? 111 ILE G CG1   1 
ATOM 5106  C CG2   . ILE G 3 112 ? 98.53400  93.00800  86.37000  1.000 155.22191 ? 111 ILE G CG2   1 
ATOM 5107  C CD1   . ILE G 3 112 ? 99.31800  91.50100  88.90200  1.000 155.22191 ? 111 ILE G CD1   1 
ATOM 5108  N N     . GLN G 3 113 ? 98.91500  96.26200  87.37600  1.000 155.62770 ? 112 GLN G N     1 
ATOM 5109  C CA    . GLN G 3 113 ? 98.75700  97.49600  86.61800  1.000 155.62770 ? 112 GLN G CA    1 
ATOM 5110  C C     . GLN G 3 113 ? 98.31800  97.19400  85.19000  1.000 155.62770 ? 112 GLN G C     1 
ATOM 5111  O O     . GLN G 3 113 ? 98.65400  96.15200  84.62300  1.000 155.62770 ? 112 GLN G O     1 
ATOM 5112  C CB    . GLN G 3 113 ? 100.04900 98.31000  86.62100  1.000 155.62770 ? 112 GLN G CB    1 
ATOM 5113  C CG    . GLN G 3 113 ? 100.21800 99.18000  87.85500  1.000 155.62770 ? 112 GLN G CG    1 
ATOM 5114  C CD    . GLN G 3 113 ? 100.58700 98.38800  89.08500  1.000 155.62770 ? 112 GLN G CD    1 
ATOM 5115  O OE1   . GLN G 3 113 ? 101.49500 97.55900  89.05400  1.000 155.62770 ? 112 GLN G OE1   1 
ATOM 5116  N NE2   . GLN G 3 113 ? 99.88200  98.63800  90.17900  1.000 155.62770 ? 112 GLN G NE2   1 
ATOM 5117  N N     . ALA G 3 114 ? 97.54900  98.11300  84.61400  1.000 153.27582 ? 113 ALA G N     1 
ATOM 5118  C CA    . ALA G 3 114 ? 97.06700  97.95100  83.24500  1.000 153.27582 ? 113 ALA G CA    1 
ATOM 5119  C C     . ALA G 3 114 ? 98.20700  98.10400  82.23900  1.000 153.27582 ? 113 ALA G C     1 
ATOM 5120  O O     . ALA G 3 114 ? 98.88000  97.13100  81.89400  1.000 153.27582 ? 113 ALA G O     1 
ATOM 5121  C CB    . ALA G 3 114 ? 95.96600  98.95200  82.94800  1.000 153.27582 ? 113 ALA G CB    1 
ATOM 5122  N N     . GLU H 4 36  ? 104.03400 89.55600  132.04400 1.000 141.68238 ? 35  GLU H N     1 
ATOM 5123  C CA    . GLU H 4 36  ? 104.33400 88.87900  130.78800 1.000 141.68238 ? 35  GLU H CA    1 
ATOM 5124  C C     . GLU H 4 36  ? 103.27400 89.14800  129.73200 1.000 141.68238 ? 35  GLU H C     1 
ATOM 5125  O O     . GLU H 4 36  ? 102.28700 89.83800  129.98700 1.000 141.68238 ? 35  GLU H O     1 
ATOM 5126  C CB    . GLU H 4 36  ? 104.50500 87.37700  131.00300 1.000 141.68238 ? 35  GLU H CB    1 
ATOM 5127  C CG    . GLU H 4 36  ? 105.56100 87.02400  132.04100 1.000 141.68238 ? 35  GLU H CG    1 
ATOM 5128  C CD    . GLU H 4 36  ? 105.62800 85.54000  132.31000 1.000 141.68238 ? 35  GLU H CD    1 
ATOM 5129  O OE1   . GLU H 4 36  ? 106.29800 85.13100  133.28300 1.000 141.68238 ? 35  GLU H OE1   1 
ATOM 5130  O OE2   . GLU H 4 36  ? 104.99500 84.78400  131.54900 1.000 141.68238 ? 35  GLU H OE2   1 
ATOM 5131  N N     . SER H 4 37  ? 103.51800 88.59600  128.54500 1.000 141.40286 ? 36  SER H N     1 
ATOM 5132  C CA    . SER H 4 37  ? 102.63000 88.76400  127.40300 1.000 141.40286 ? 36  SER H CA    1 
ATOM 5133  C C     . SER H 4 37  ? 101.25200 88.18500  127.67300 1.000 141.40286 ? 36  SER H C     1 
ATOM 5134  O O     . SER H 4 37  ? 101.11600 87.11900  128.27800 1.000 141.40286 ? 36  SER H O     1 
ATOM 5135  C CB    . SER H 4 37  ? 103.22800 88.07700  126.18400 1.000 141.40286 ? 36  SER H CB    1 
ATOM 5136  O OG    . SER H 4 37  ? 102.21500 87.77200  125.24100 1.000 141.40286 ? 36  SER H OG    1 
ATOM 5137  N N     . TYR H 4 38  ? 100.22500 88.89700  127.23000 1.000 129.90450 ? 37  TYR H N     1 
ATOM 5138  C CA    . TYR H 4 38  ? 98.85600  88.46000  127.45100 1.000 129.90450 ? 37  TYR H CA    1 
ATOM 5139  C C     . TYR H 4 38  ? 98.23100  87.93600  126.16500 1.000 129.90450 ? 37  TYR H C     1 
ATOM 5140  O O     . TYR H 4 38  ? 98.04300  88.67600  125.19600 1.000 129.90450 ? 37  TYR H O     1 
ATOM 5141  C CB    . TYR H 4 38  ? 98.05800  89.60200  128.07700 1.000 129.90450 ? 37  TYR H CB    1 
ATOM 5142  C CG    . TYR H 4 38  ? 98.39800  91.00500  127.60000 1.000 129.90450 ? 37  TYR H CG    1 
ATOM 5143  C CD1   . TYR H 4 38  ? 99.09800  91.86700  128.43000 1.000 129.90450 ? 37  TYR H CD1   1 
ATOM 5144  C CD2   . TYR H 4 38  ? 97.94800  91.50300  126.38700 1.000 129.90450 ? 37  TYR H CD2   1 
ATOM 5145  C CE1   . TYR H 4 38  ? 99.39900  93.15500  128.04300 1.000 129.90450 ? 37  TYR H CE1   1 
ATOM 5146  C CE2   . TYR H 4 38  ? 98.24500  92.78900  125.99300 1.000 129.90450 ? 37  TYR H CE2   1 
ATOM 5147  C CZ    . TYR H 4 38  ? 98.96700  93.61000  126.82500 1.000 129.90450 ? 37  TYR H CZ    1 
ATOM 5148  O OH    . TYR H 4 38  ? 99.26500  94.89100  126.43600 1.000 129.90450 ? 37  TYR H OH    1 
ATOM 5149  N N     . SER H 4 39  ? 97.95000  86.63900  126.15200 1.000 131.40114 ? 38  SER H N     1 
ATOM 5150  C CA    . SER H 4 39  ? 97.28000  85.99900  125.03800 1.000 131.40114 ? 38  SER H CA    1 
ATOM 5151  C C     . SER H 4 39  ? 95.86500  85.57500  125.38100 1.000 131.40114 ? 38  SER H C     1 
ATOM 5152  O O     . SER H 4 39  ? 95.16900  85.03300  124.52000 1.000 131.40114 ? 38  SER H O     1 
ATOM 5153  C CB    . SER H 4 39  ? 98.08600  84.78200  124.58400 1.000 131.40114 ? 38  SER H CB    1 
ATOM 5154  O OG    . SER H 4 39  ? 99.46700  85.08900  124.52200 1.000 131.40114 ? 38  SER H OG    1 
ATOM 5155  N N     . VAL H 4 40  ? 95.41600  85.81500  126.60900 1.000 133.75280 ? 39  VAL H N     1 
ATOM 5156  C CA    . VAL H 4 40  ? 94.08200  85.39700  127.01700 1.000 133.75280 ? 39  VAL H CA    1 
ATOM 5157  C C     . VAL H 4 40  ? 93.01500  86.33000  126.44400 1.000 133.75280 ? 39  VAL H C     1 
ATOM 5158  O O     . VAL H 4 40  ? 92.17000  85.87500  125.66600 1.000 133.75280 ? 39  VAL H O     1 
ATOM 5159  C CB    . VAL H 4 40  ? 94.01400  85.14400  128.54600 1.000 133.75280 ? 39  VAL H CB    1 
ATOM 5160  C CG1   . VAL H 4 40  ? 95.02100  84.08300  128.88500 1.000 133.75280 ? 39  VAL H CG1   1 
ATOM 5161  C CG2   . VAL H 4 40  ? 94.43900  86.32400  129.40400 1.000 133.75280 ? 39  VAL H CG2   1 
ATOM 5162  N N     . TYR H 4 41  ? 92.97900  87.58900  126.88500 1.000 136.40563 ? 40  TYR H N     1 
ATOM 5163  C CA    . TYR H 4 41  ? 92.04200  88.62900  126.47200 1.000 136.40563 ? 40  TYR H CA    1 
ATOM 5164  C C     . TYR H 4 41  ? 91.79400  88.72400  124.97100 1.000 136.40563 ? 40  TYR H C     1 
ATOM 5165  O O     . TYR H 4 41  ? 90.66400  88.98600  124.54800 1.000 136.40563 ? 40  TYR H O     1 
ATOM 5166  C CB    . TYR H 4 41  ? 92.52500  89.97000  127.00600 1.000 136.40563 ? 40  TYR H CB    1 
ATOM 5167  C CG    . TYR H 4 41  ? 93.09300  89.85600  128.39200 1.000 136.40563 ? 40  TYR H CG    1 
ATOM 5168  C CD1   . TYR H 4 41  ? 92.25600  89.71400  129.48200 1.000 136.40563 ? 40  TYR H CD1   1 
ATOM 5169  C CD2   . TYR H 4 41  ? 94.45700  89.92400  128.61700 1.000 136.40563 ? 40  TYR H CD2   1 
ATOM 5170  C CE1   . TYR H 4 41  ? 92.75200  89.61700  130.75300 1.000 136.40563 ? 40  TYR H CE1   1 
ATOM 5171  C CE2   . TYR H 4 41  ? 94.96800  89.82900  129.89200 1.000 136.40563 ? 40  TYR H CE2   1 
ATOM 5172  C CZ    . TYR H 4 41  ? 94.10700  89.67400  130.95300 1.000 136.40563 ? 40  TYR H CZ    1 
ATOM 5173  O OH    . TYR H 4 41  ? 94.60300  89.58200  132.22700 1.000 136.40563 ? 40  TYR H OH    1 
ATOM 5174  N N     . VAL H 4 42  ? 92.83900  88.50600  124.16700 1.000 132.98467 ? 41  VAL H N     1 
ATOM 5175  C CA    . VAL H 4 42  ? 92.67900  88.46800  122.71700 1.000 132.98467 ? 41  VAL H CA    1 
ATOM 5176  C C     . VAL H 4 42  ? 91.78600  87.30300  122.31200 1.000 132.98467 ? 41  VAL H C     1 
ATOM 5177  O O     . VAL H 4 42  ? 90.86400  87.45900  121.50300 1.000 132.98467 ? 41  VAL H O     1 
ATOM 5178  C CB    . VAL H 4 42  ? 94.05800  88.39900  122.03700 1.000 132.98467 ? 41  VAL H CB    1 
ATOM 5179  C CG1   . VAL H 4 42  ? 93.93200  87.99400  120.57900 1.000 132.98467 ? 41  VAL H CG1   1 
ATOM 5180  C CG2   . VAL H 4 42  ? 94.76900  89.72400  122.16700 1.000 132.98467 ? 41  VAL H CG2   1 
ATOM 5181  N N     . TYR H 4 43  ? 92.02400  86.12800  122.90100 1.000 139.39957 ? 42  TYR H N     1 
ATOM 5182  C CA    . TYR H 4 43  ? 91.18800  84.96300  122.63100 1.000 139.39957 ? 42  TYR H CA    1 
ATOM 5183  C C     . TYR H 4 43  ? 89.76800  85.18700  123.13200 1.000 139.39957 ? 42  TYR H C     1 
ATOM 5184  O O     . TYR H 4 43  ? 88.80300  84.75200  122.49300 1.000 139.39957 ? 42  TYR H O     1 
ATOM 5185  C CB    . TYR H 4 43  ? 91.79800  83.72000  123.27200 1.000 139.39957 ? 42  TYR H CB    1 
ATOM 5186  C CG    . TYR H 4 43  ? 91.33800  82.41900  122.67100 1.000 139.39957 ? 42  TYR H CG    1 
ATOM 5187  C CD1   . TYR H 4 43  ? 91.99500  81.87300  121.58000 1.000 139.39957 ? 42  TYR H CD1   1 
ATOM 5188  C CD2   . TYR H 4 43  ? 90.24700  81.73700  123.19100 1.000 139.39957 ? 42  TYR H CD2   1 
ATOM 5189  C CE1   . TYR H 4 43  ? 91.58400  80.67800  121.02300 1.000 139.39957 ? 42  TYR H CE1   1 
ATOM 5190  C CE2   . TYR H 4 43  ? 89.82300  80.54000  122.64000 1.000 139.39957 ? 42  TYR H CE2   1 
ATOM 5191  C CZ    . TYR H 4 43  ? 90.49800  80.01600  121.55600 1.000 139.39957 ? 42  TYR H CZ    1 
ATOM 5192  O OH    . TYR H 4 43  ? 90.08700  78.82700  121.00000 1.000 139.39957 ? 42  TYR H OH    1 
ATOM 5193  N N     . LYS H 4 44  ? 89.63200  85.87600  124.26900 1.000 134.25648 ? 43  LYS H N     1 
ATOM 5194  C CA    . LYS H 4 44  ? 88.31700  86.16400  124.83400 1.000 134.25648 ? 43  LYS H CA    1 
ATOM 5195  C C     . LYS H 4 44  ? 87.50700  87.07300  123.92100 1.000 134.25648 ? 43  LYS H C     1 
ATOM 5196  O O     . LYS H 4 44  ? 86.34600  86.78300  123.60700 1.000 134.25648 ? 43  LYS H O     1 
ATOM 5197  C CB    . LYS H 4 44  ? 88.47000  86.80800  126.20800 1.000 134.25648 ? 43  LYS H CB    1 
ATOM 5198  C CG    . LYS H 4 44  ? 88.64100  85.82900  127.34200 1.000 134.25648 ? 43  LYS H CG    1 
ATOM 5199  C CD    . LYS H 4 44  ? 88.64300  86.55200  128.67200 1.000 134.25648 ? 43  LYS H CD    1 
ATOM 5200  C CE    . LYS H 4 44  ? 88.63700  85.56800  129.82100 1.000 134.25648 ? 43  LYS H CE    1 
ATOM 5201  N NZ    . LYS H 4 44  ? 89.80900  84.65800  129.75700 1.000 134.25648 ? 43  LYS H NZ    1 
ATOM 5202  N N     . VAL H 4 45  ? 88.11100  88.17500  123.47400 1.000 131.71197 ? 44  VAL H N     1 
ATOM 5203  C CA    . VAL H 4 45  ? 87.39200  89.09500  122.60100 1.000 131.71197 ? 44  VAL H CA    1 
ATOM 5204  C C     . VAL H 4 45  ? 87.17300  88.46600  121.23100 1.000 131.71197 ? 44  VAL H C     1 
ATOM 5205  O O     . VAL H 4 45  ? 86.16800  88.75000  120.57100 1.000 131.71197 ? 44  VAL H O     1 
ATOM 5206  C CB    . VAL H 4 45  ? 88.10800  90.46300  122.52900 1.000 131.71197 ? 44  VAL H CB    1 
ATOM 5207  C CG1   . VAL H 4 45  ? 89.43800  90.38700  121.80800 1.000 131.71197 ? 44  VAL H CG1   1 
ATOM 5208  C CG2   . VAL H 4 45  ? 87.21100  91.52200  121.90500 1.000 131.71197 ? 44  VAL H CG2   1 
ATOM 5209  N N     . LEU H 4 46  ? 88.06500  87.56200  120.80500 1.000 140.61305 ? 45  LEU H N     1 
ATOM 5210  C CA    . LEU H 4 46  ? 87.86500  86.86800  119.54000 1.000 140.61305 ? 45  LEU H CA    1 
ATOM 5211  C C     . LEU H 4 46  ? 86.67800  85.92100  119.61500 1.000 140.61305 ? 45  LEU H C     1 
ATOM 5212  O O     . LEU H 4 46  ? 85.88000  85.85300  118.67800 1.000 140.61305 ? 45  LEU H O     1 
ATOM 5213  C CB    . LEU H 4 46  ? 89.12700  86.10500  119.15100 1.000 140.61305 ? 45  LEU H CB    1 
ATOM 5214  C CG    . LEU H 4 46  ? 89.01500  85.30400  117.85600 1.000 140.61305 ? 45  LEU H CG    1 
ATOM 5215  C CD1   . LEU H 4 46  ? 88.67000  86.22000  116.69500 1.000 140.61305 ? 45  LEU H CD1   1 
ATOM 5216  C CD2   . LEU H 4 46  ? 90.28800  84.54300  117.57400 1.000 140.61305 ? 45  LEU H CD2   1 
ATOM 5217  N N     . LYS H 4 47  ? 86.53900  85.19500  120.72700 1.000 142.77695 ? 46  LYS H N     1 
ATOM 5218  C CA    . LYS H 4 47  ? 85.36600  84.34700  120.90100 1.000 142.77695 ? 46  LYS H CA    1 
ATOM 5219  C C     . LYS H 4 47  ? 84.09900  85.16900  121.07000 1.000 142.77695 ? 46  LYS H C     1 
ATOM 5220  O O     . LYS H 4 47  ? 83.01400  84.71100  120.69900 1.000 142.77695 ? 46  LYS H O     1 
ATOM 5221  C CB    . LYS H 4 47  ? 85.55700  83.39500  122.07700 1.000 142.77695 ? 46  LYS H CB    1 
ATOM 5222  C CG    . LYS H 4 47  ? 86.24200  82.10200  121.67400 1.000 142.77695 ? 46  LYS H CG    1 
ATOM 5223  C CD    . LYS H 4 47  ? 85.53600  81.47200  120.47800 1.000 142.77695 ? 46  LYS H CD    1 
ATOM 5224  C CE    . LYS H 4 47  ? 86.33900  80.33300  119.88100 1.000 142.77695 ? 46  LYS H CE    1 
ATOM 5225  N NZ    . LYS H 4 47  ? 85.71500  79.81300  118.63100 1.000 142.77695 ? 46  LYS H NZ    1 
ATOM 5226  N N     . GLN H 4 48  ? 84.21300  86.37500  121.62500 1.000 137.69194 ? 47  GLN H N     1 
ATOM 5227  C CA    . GLN H 4 48  ? 83.04000  87.22900  121.75000 1.000 137.69194 ? 47  GLN H CA    1 
ATOM 5228  C C     . GLN H 4 48  ? 82.58900  87.74900  120.39100 1.000 137.69194 ? 47  GLN H C     1 
ATOM 5229  O O     . GLN H 4 48  ? 81.38800  87.78100  120.10100 1.000 137.69194 ? 47  GLN H O     1 
ATOM 5230  C CB    . GLN H 4 48  ? 83.33800  88.38800  122.69500 1.000 137.69194 ? 47  GLN H CB    1 
ATOM 5231  C CG    . GLN H 4 48  ? 82.17600  89.33000  122.90000 1.000 137.69194 ? 47  GLN H CG    1 
ATOM 5232  C CD    . GLN H 4 48  ? 82.46500  90.38500  123.94300 1.000 137.69194 ? 47  GLN H CD    1 
ATOM 5233  O OE1   . GLN H 4 48  ? 83.44900  90.29600  124.67400 1.000 137.69194 ? 47  GLN H OE1   1 
ATOM 5234  N NE2   . GLN H 4 48  ? 81.60800  91.39400  124.01700 1.000 137.69194 ? 47  GLN H NE2   1 
ATOM 5235  N N     . VAL H 4 49  ? 83.53400  88.14800  119.54100 1.000 141.93577 ? 48  VAL H N     1 
ATOM 5236  C CA    . VAL H 4 49  ? 83.15800  88.70900  118.24900 1.000 141.93577 ? 48  VAL H CA    1 
ATOM 5237  C C     . VAL H 4 49  ? 82.81800  87.60200  117.24400 1.000 141.93577 ? 48  VAL H C     1 
ATOM 5238  O O     . VAL H 4 49  ? 82.00700  87.81000  116.33500 1.000 141.93577 ? 48  VAL H O     1 
ATOM 5239  C CB    . VAL H 4 49  ? 84.26500  89.65500  117.73900 1.000 141.93577 ? 48  VAL H CB    1 
ATOM 5240  C CG1   . VAL H 4 49  ? 85.54700  88.91400  117.37800 1.000 141.93577 ? 48  VAL H CG1   1 
ATOM 5241  C CG2   . VAL H 4 49  ? 83.77400  90.52800  116.60600 1.000 141.93577 ? 48  VAL H CG2   1 
ATOM 5242  N N     . HIS H 4 50  ? 83.39500  86.41500  117.40100 1.000 140.06354 ? 49  HIS H N     1 
ATOM 5243  C CA    . HIS H 4 50  ? 83.19100  85.27500  116.52000 1.000 140.06354 ? 49  HIS H CA    1 
ATOM 5244  C C     . HIS H 4 50  ? 83.19400  84.00000  117.34200 1.000 140.06354 ? 49  HIS H C     1 
ATOM 5245  O O     . HIS H 4 50  ? 84.21900  83.64800  117.93000 1.000 140.06354 ? 49  HIS H O     1 
ATOM 5246  C CB    . HIS H 4 50  ? 84.29000  85.17200  115.46900 1.000 140.06354 ? 49  HIS H CB    1 
ATOM 5247  C CG    . HIS H 4 50  ? 84.26400  86.25000  114.44100 1.000 140.06354 ? 49  HIS H CG    1 
ATOM 5248  N ND1   . HIS H 4 50  ? 83.22300  86.40200  113.55400 1.000 140.06354 ? 49  HIS H ND1   1 
ATOM 5249  C CD2   . HIS H 4 50  ? 85.16500  87.21200  114.13500 1.000 140.06354 ? 49  HIS H CD2   1 
ATOM 5250  C CE1   . HIS H 4 50  ? 83.47900  87.41700  112.75000 1.000 140.06354 ? 49  HIS H CE1   1 
ATOM 5251  N NE2   . HIS H 4 50  ? 84.64900  87.93000  113.08500 1.000 140.06354 ? 49  HIS H NE2   1 
ATOM 5252  N N     . PRO H 4 51  ? 82.09900  83.24500  117.36100 1.000 143.12412 ? 50  PRO H N     1 
ATOM 5253  C CA    . PRO H 4 51  ? 82.03300  82.08800  118.25600 1.000 143.12412 ? 50  PRO H CA    1 
ATOM 5254  C C     . PRO H 4 51  ? 82.77000  80.87200  117.73600 1.000 143.12412 ? 50  PRO H C     1 
ATOM 5255  O O     . PRO H 4 51  ? 82.99400  79.93200  118.50900 1.000 143.12412 ? 50  PRO H O     1 
ATOM 5256  C CB    . PRO H 4 51  ? 80.52400  81.80700  118.35200 1.000 143.12412 ? 50  PRO H CB    1 
ATOM 5257  C CG    . PRO H 4 51  ? 79.83900  82.92200  117.58500 1.000 143.12412 ? 50  PRO H CG    1 
ATOM 5258  C CD    . PRO H 4 51  ? 80.84300  83.44400  116.62900 1.000 143.12412 ? 50  PRO H CD    1 
ATOM 5259  N N     . ASP H 4 52  ? 83.16900  80.86200  116.46800 1.000 141.94341 ? 51  ASP H N     1 
ATOM 5260  C CA    . ASP H 4 52  ? 83.71300  79.65800  115.86300 1.000 141.94341 ? 51  ASP H CA    1 
ATOM 5261  C C     . ASP H 4 52  ? 85.05200  79.84600  115.16400 1.000 141.94341 ? 51  ASP H C     1 
ATOM 5262  O O     . ASP H 4 52  ? 85.45800  78.96100  114.40400 1.000 141.94341 ? 51  ASP H O     1 
ATOM 5263  C CB    . ASP H 4 52  ? 82.69700  79.10300  114.86900 1.000 141.94341 ? 51  ASP H CB    1 
ATOM 5264  C CG    . ASP H 4 52  ? 82.19200  80.16600  113.92600 1.000 141.94341 ? 51  ASP H CG    1 
ATOM 5265  O OD1   . ASP H 4 52  ? 82.45000  81.35700  114.19800 1.000 141.94341 ? 51  ASP H OD1   1 
ATOM 5266  O OD2   . ASP H 4 52  ? 81.54100  79.81900  112.91900 1.000 141.94341 ? 51  ASP H OD2   1 
ATOM 5267  N N     . THR H 4 53  ? 85.75000  80.95300  115.38000 1.000 141.81724 ? 52  THR H N     1 
ATOM 5268  C CA    . THR H 4 53  ? 87.02400  81.19000  114.71300 1.000 141.81724 ? 52  THR H CA    1 
ATOM 5269  C C     . THR H 4 53  ? 88.17900  81.10100  115.69700 1.000 141.81724 ? 52  THR H C     1 
ATOM 5270  O O     . THR H 4 53  ? 88.13100  81.70200  116.77500 1.000 141.81724 ? 52  THR H O     1 
ATOM 5271  C CB    . THR H 4 53  ? 87.04100  82.55200  114.02400 1.000 141.81724 ? 52  THR H CB    1 
ATOM 5272  O OG1   . THR H 4 53  ? 87.09800  83.58400  115.01200 1.000 141.81724 ? 52  THR H OG1   1 
ATOM 5273  C CG2   . THR H 4 53  ? 85.79900  82.72900  113.17000 1.000 141.81724 ? 52  THR H CG2   1 
ATOM 5274  N N     . GLY H 4 54  ? 89.21200  80.34800  115.32200 1.000 145.58912 ? 53  GLY H N     1 
ATOM 5275  C CA    . GLY H 4 54  ? 90.42200  80.24400  116.10800 1.000 145.58912 ? 53  GLY H CA    1 
ATOM 5276  C C     . GLY H 4 54  ? 91.47300  81.22600  115.62700 1.000 145.58912 ? 53  GLY H C     1 
ATOM 5277  O O     . GLY H 4 54  ? 91.20700  82.13000  114.83600 1.000 145.58912 ? 53  GLY H O     1 
ATOM 5278  N N     . ILE H 4 55  ? 92.69900  81.01800  116.09700 1.000 137.72602 ? 54  ILE H N     1 
ATOM 5279  C CA    . ILE H 4 55  ? 93.80900  81.89900  115.75300 1.000 137.72602 ? 54  ILE H CA    1 
ATOM 5280  C C     . ILE H 4 55  ? 95.10600  81.12300  115.93800 1.000 137.72602 ? 54  ILE H C     1 
ATOM 5281  O O     . ILE H 4 55  ? 95.26100  80.37100  116.90300 1.000 137.72602 ? 54  ILE H O     1 
ATOM 5282  C CB    . ILE H 4 55  ? 93.76300  83.19500  116.60400 1.000 137.72602 ? 54  ILE H CB    1 
ATOM 5283  C CG1   . ILE H 4 55  ? 94.98000  84.08100  116.35700 1.000 137.72602 ? 54  ILE H CG1   1 
ATOM 5284  C CG2   . ILE H 4 55  ? 93.60200  82.88200  118.08400 1.000 137.72602 ? 54  ILE H CG2   1 
ATOM 5285  C CD1   . ILE H 4 55  ? 94.78500  85.51400  116.77900 1.000 137.72602 ? 54  ILE H CD1   1 
ATOM 5286  N N     . SER H 4 56  ? 96.02700  81.27900  114.98900 1.000 137.65488 ? 55  SER H N     1 
ATOM 5287  C CA    . SER H 4 56  ? 97.30900  80.60900  115.11600 1.000 137.65488 ? 55  SER H CA    1 
ATOM 5288  C C     . SER H 4 56  ? 98.16100  81.28900  116.18000 1.000 137.65488 ? 55  SER H C     1 
ATOM 5289  O O     . SER H 4 56  ? 97.86900  82.39400  116.64200 1.000 137.65488 ? 55  SER H O     1 
ATOM 5290  C CB    . SER H 4 56  ? 98.05700  80.60200  113.78900 1.000 137.65488 ? 55  SER H CB    1 
ATOM 5291  O OG    . SER H 4 56  ? 99.33800  80.02400  113.95000 1.000 137.65488 ? 55  SER H OG    1 
ATOM 5292  N N     . SER H 4 57  ? 99.24100  80.60700  116.56200 1.000 134.58172 ? 56  SER H N     1 
ATOM 5293  C CA    . SER H 4 57  ? 100.12600 81.14200  117.58700 1.000 134.58172 ? 56  SER H CA    1 
ATOM 5294  C C     . SER H 4 57  ? 100.90500 82.35000  117.09800 1.000 134.58172 ? 56  SER H C     1 
ATOM 5295  O O     . SER H 4 57  ? 101.19500 83.25400  117.88900 1.000 134.58172 ? 56  SER H O     1 
ATOM 5296  C CB    . SER H 4 57  ? 101.10300 80.07200  118.05300 1.000 134.58172 ? 56  SER H CB    1 
ATOM 5297  O OG    . SER H 4 57  ? 102.25900 80.08100  117.23500 1.000 134.58172 ? 56  SER H OG    1 
ATOM 5298  N N     . LYS H 4 58  ? 101.27400 82.37400  115.81900 1.000 123.82200 ? 57  LYS H N     1 
ATOM 5299  C CA    . LYS H 4 58  ? 102.00500 83.51800  115.29500 1.000 123.82200 ? 57  LYS H CA    1 
ATOM 5300  C C     . LYS H 4 58  ? 101.13100 84.76000  115.24200 1.000 123.82200 ? 57  LYS H C     1 
ATOM 5301  O O     . LYS H 4 58  ? 101.58800 85.85300  115.59300 1.000 123.82200 ? 57  LYS H O     1 
ATOM 5302  C CB    . LYS H 4 58  ? 102.57600 83.19300  113.92200 1.000 123.82200 ? 57  LYS H CB    1 
ATOM 5303  C CG    . LYS H 4 58  ? 103.31400 81.88400  113.89600 1.000 123.82200 ? 57  LYS H CG    1 
ATOM 5304  C CD    . LYS H 4 58  ? 104.56600 82.00300  113.05900 1.000 123.82200 ? 57  LYS H CD    1 
ATOM 5305  C CE    . LYS H 4 58  ? 105.50200 80.84400  113.31500 1.000 123.82200 ? 57  LYS H CE    1 
ATOM 5306  N NZ    . LYS H 4 58  ? 106.60600 80.81700  112.32200 1.000 123.82200 ? 57  LYS H NZ    1 
ATOM 5307  N N     . ALA H 4 59  ? 99.86900  84.60800  114.82900 1.000 124.61355 ? 58  ALA H N     1 
ATOM 5308  C CA    . ALA H 4 59  ? 98.94600  85.73800  114.80800 1.000 124.61355 ? 58  ALA H CA    1 
ATOM 5309  C C     . ALA H 4 59  ? 98.67300  86.26500  116.20700 1.000 124.61355 ? 58  ALA H C     1 
ATOM 5310  O O     . ALA H 4 59  ? 98.44300  87.46700  116.38600 1.000 124.61355 ? 58  ALA H O     1 
ATOM 5311  C CB    . ALA H 4 59  ? 97.64400  85.33500  114.12400 1.000 124.61355 ? 58  ALA H CB    1 
ATOM 5312  N N     . MET H 4 60  ? 98.70900  85.38000  117.20400 1.000 130.43951 ? 59  MET H N     1 
ATOM 5313  C CA    . MET H 4 60  ? 98.58100  85.79600  118.59400 1.000 130.43951 ? 59  MET H CA    1 
ATOM 5314  C C     . MET H 4 60  ? 99.73100  86.70500  119.00200 1.000 130.43951 ? 59  MET H C     1 
ATOM 5315  O O     . MET H 4 60  ? 99.52200  87.74200  119.64300 1.000 130.43951 ? 59  MET H O     1 
ATOM 5316  C CB    . MET H 4 60  ? 98.52200  84.56900  119.49300 1.000 130.43951 ? 59  MET H CB    1 
ATOM 5317  C CG    . MET H 4 60  ? 98.33800  84.90100  120.94200 1.000 130.43951 ? 59  MET H CG    1 
ATOM 5318  S SD    . MET H 4 60  ? 96.83800  85.83800  121.24000 1.000 130.43951 ? 59  MET H SD    1 
ATOM 5319  C CE    . MET H 4 60  ? 95.62800  84.52400  121.27400 1.000 130.43951 ? 59  MET H CE    1 
ATOM 5320  N N     . GLY H 4 61  ? 100.95700 86.32500  118.64200 1.000 126.31717 ? 60  GLY H N     1 
ATOM 5321  C CA    . GLY H 4 61  ? 102.09900 87.17900  118.91300 1.000 126.31717 ? 60  GLY H CA    1 
ATOM 5322  C C     . GLY H 4 61  ? 102.05200 88.48800  118.15100 1.000 126.31717 ? 60  GLY H C     1 
ATOM 5323  O O     . GLY H 4 61  ? 102.49000 89.52200  118.66500 1.000 126.31717 ? 60  GLY H O     1 
ATOM 5324  N N     . ILE H 4 62  ? 101.50900 88.46300  116.92900 1.000 122.62410 ? 61  ILE H N     1 
ATOM 5325  C CA    . ILE H 4 62  ? 101.33300 89.68300  116.14200 1.000 122.62410 ? 61  ILE H CA    1 
ATOM 5326  C C     . ILE H 4 62  ? 100.39200 90.64300  116.85100 1.000 122.62410 ? 61  ILE H C     1 
ATOM 5327  O O     . ILE H 4 62  ? 100.69700 91.82900  117.01400 1.000 122.62410 ? 61  ILE H O     1 
ATOM 5328  C CB    . ILE H 4 62  ? 100.82300 89.34300  114.73100 1.000 122.62410 ? 61  ILE H CB    1 
ATOM 5329  C CG1   . ILE H 4 62  ? 101.89700 88.60200  113.93500 1.000 122.62410 ? 61  ILE H CG1   1 
ATOM 5330  C CG2   . ILE H 4 62  ? 100.34700 90.58800  114.01400 1.000 122.62410 ? 61  ILE H CG2   1 
ATOM 5331  C CD1   . ILE H 4 62  ? 102.93400 89.47600  113.27200 1.000 122.62410 ? 61  ILE H CD1   1 
ATOM 5332  N N     . MET H 4 63  ? 99.25400  90.12700  117.32000 1.000 122.31085 ? 62  MET H N     1 
ATOM 5333  C CA    . MET H 4 63  ? 98.28200  90.95500  118.02700 1.000 122.31085 ? 62  MET H CA    1 
ATOM 5334  C C     . MET H 4 63  ? 98.84100  91.47300  119.34300 1.000 122.31085 ? 62  MET H C     1 
ATOM 5335  O O     . MET H 4 63  ? 98.57100  92.61600  119.73200 1.000 122.31085 ? 62  MET H O     1 
ATOM 5336  C CB    . MET H 4 63  ? 97.01100  90.15400  118.27500 1.000 122.31085 ? 62  MET H CB    1 
ATOM 5337  C CG    . MET H 4 63  ? 96.23400  89.86400  117.02400 1.000 122.31085 ? 62  MET H CG    1 
ATOM 5338  S SD    . MET H 4 63  ? 95.12400  91.22000  116.66300 1.000 122.31085 ? 62  MET H SD    1 
ATOM 5339  C CE    . MET H 4 63  ? 94.12900  91.21200  118.14800 1.000 122.31085 ? 62  MET H CE    1 
ATOM 5340  N N     . ASN H 4 64  ? 99.62700  90.64100  120.02800 1.000 125.57514 ? 63  ASN H N     1 
ATOM 5341  C CA    . ASN H 4 64  ? 100.26000 91.04300  121.27800 1.000 125.57514 ? 63  ASN H CA    1 
ATOM 5342  C C     . ASN H 4 64  ? 101.22500 92.20600  121.06400 1.000 125.57514 ? 63  ASN H C     1 
ATOM 5343  O O     . ASN H 4 64  ? 101.18200 93.21200  121.78800 1.000 125.57514 ? 63  ASN H O     1 
ATOM 5344  C CB    . ASN H 4 64  ? 100.99800 89.84900  121.86700 1.000 125.57514 ? 63  ASN H CB    1 
ATOM 5345  C CG    . ASN H 4 64  ? 101.72000 90.18900  123.13600 1.000 125.57514 ? 63  ASN H CG    1 
ATOM 5346  O OD1   . ASN H 4 64  ? 101.27700 91.02900  123.91900 1.000 125.57514 ? 63  ASN H OD1   1 
ATOM 5347  N ND2   . ASN H 4 64  ? 102.89300 89.60600  123.30400 1.000 125.57514 ? 63  ASN H ND2   1 
ATOM 5348  N N     . SER H 4 65  ? 102.10800 92.07900  120.06700 1.000 119.64249 ? 64  SER H N     1 
ATOM 5349  C CA    . SER H 4 65  ? 103.04700 93.15000  119.75000 1.000 119.64249 ? 64  SER H CA    1 
ATOM 5350  C C     . SER H 4 65  ? 102.32000 94.40100  119.28200 1.000 119.64249 ? 64  SER H C     1 
ATOM 5351  O O     . SER H 4 65  ? 102.74200 95.52400  119.58500 1.000 119.64249 ? 64  SER H O     1 
ATOM 5352  C CB    . SER H 4 65  ? 104.02700 92.67600  118.68700 1.000 119.64249 ? 64  SER H CB    1 
ATOM 5353  O OG    . SER H 4 65  ? 103.32000 92.16800  117.57500 1.000 119.64249 ? 64  SER H OG    1 
ATOM 5354  N N     . PHE H 4 66  ? 101.21300 94.21600  118.56000 1.000 113.48561 ? 65  PHE H N     1 
ATOM 5355  C CA    . PHE H 4 66  ? 100.43100 95.33600  118.05500 1.000 113.48561 ? 65  PHE H CA    1 
ATOM 5356  C C     . PHE H 4 66  ? 99.81900  96.14600  119.18800 1.000 113.48561 ? 65  PHE H C     1 
ATOM 5357  O O     . PHE H 4 66  ? 99.92300  97.38000  119.20500 1.000 113.48561 ? 65  PHE H O     1 
ATOM 5358  C CB    . PHE H 4 66  ? 99.35400  94.80500  117.11500 1.000 113.48561 ? 65  PHE H CB    1 
ATOM 5359  C CG    . PHE H 4 66  ? 98.21200  95.73300  116.91800 1.000 113.48561 ? 65  PHE H CG    1 
ATOM 5360  C CD1   . PHE H 4 66  ? 98.34200  96.83100  116.09700 1.000 113.48561 ? 65  PHE H CD1   1 
ATOM 5361  C CD2   . PHE H 4 66  ? 96.99200  95.48700  117.52000 1.000 113.48561 ? 65  PHE H CD2   1 
ATOM 5362  C CE1   . PHE H 4 66  ? 97.28500  97.68600  115.90300 1.000 113.48561 ? 65  PHE H CE1   1 
ATOM 5363  C CE2   . PHE H 4 66  ? 95.93400  96.33500  117.33400 1.000 113.48561 ? 65  PHE H CE2   1 
ATOM 5364  C CZ    . PHE H 4 66  ? 96.07800  97.43700  116.52200 1.000 113.48561 ? 65  PHE H CZ    1 
ATOM 5365  N N     . VAL H 4 67  ? 99.17600  95.47000  120.14200 1.000 107.18390 ? 66  VAL H N     1 
ATOM 5366  C CA    . VAL H 4 67  ? 98.57000  96.20100  121.25000 1.000 107.18390 ? 66  VAL H CA    1 
ATOM 5367  C C     . VAL H 4 67  ? 99.63300  96.81000  122.14700 1.000 107.18390 ? 66  VAL H C     1 
ATOM 5368  O O     . VAL H 4 67  ? 99.42100  97.89300  122.70800 1.000 107.18390 ? 66  VAL H O     1 
ATOM 5369  C CB    . VAL H 4 67  ? 97.57300  95.32300  122.02600 1.000 107.18390 ? 66  VAL H CB    1 
ATOM 5370  C CG1   . VAL H 4 67  ? 96.53700  94.84400  121.08500 1.000 107.18390 ? 66  VAL H CG1   1 
ATOM 5371  C CG2   . VAL H 4 67  ? 98.22500  94.15400  122.68500 1.000 107.18390 ? 66  VAL H CG2   1 
ATOM 5372  N N     . ASN H 4 68  ? 100.79600 96.15800  122.27500 1.000 108.09334 ? 67  ASN H N     1 
ATOM 5373  C CA    . ASN H 4 68  ? 101.88600 96.74000  123.04700 1.000 108.09334 ? 67  ASN H CA    1 
ATOM 5374  C C     . ASN H 4 68  ? 102.38400 98.03300  122.41100 1.000 108.09334 ? 67  ASN H C     1 
ATOM 5375  O O     . ASN H 4 68  ? 102.58500 99.03900  123.10700 1.000 108.09334 ? 67  ASN H O     1 
ATOM 5376  C CB    . ASN H 4 68  ? 103.01700 95.73000  123.18300 1.000 108.09334 ? 67  ASN H CB    1 
ATOM 5377  C CG    . ASN H 4 68  ? 103.56900 95.67500  124.58100 1.000 108.09334 ? 67  ASN H CG    1 
ATOM 5378  O OD1   . ASN H 4 68  ? 103.71600 96.70000  125.24000 1.000 108.09334 ? 67  ASN H OD1   1 
ATOM 5379  N ND2   . ASN H 4 68  ? 103.86400 94.47200  125.05300 1.000 108.09334 ? 67  ASN H ND2   1 
ATOM 5380  N N     . ASP H 4 69  ? 102.55100 98.03300  121.08600 1.000 115.46976 ? 68  ASP H N     1 
ATOM 5381  C CA    . ASP H 4 69  ? 103.01000 99.23000  120.38800 1.000 115.46976 ? 68  ASP H CA    1 
ATOM 5382  C C     . ASP H 4 69  ? 101.98200 100.35500 120.45200 1.000 115.46976 ? 68  ASP H C     1 
ATOM 5383  O O     . ASP H 4 69  ? 102.35100 101.52400 120.63000 1.000 115.46976 ? 68  ASP H O     1 
ATOM 5384  C CB    . ASP H 4 69  ? 103.33800 98.89000  118.93800 1.000 115.46976 ? 68  ASP H CB    1 
ATOM 5385  C CG    . ASP H 4 69  ? 104.34800 99.84100  118.33000 1.000 115.46976 ? 68  ASP H CG    1 
ATOM 5386  O OD1   . ASP H 4 69  ? 105.35100 99.35700  117.76800 1.000 115.46976 ? 68  ASP H OD1   1 
ATOM 5387  O OD2   . ASP H 4 69  ? 104.14600 101.06800 118.39600 1.000 115.46976 ? 68  ASP H OD2   1 
ATOM 5388  N N     . ILE H 4 70  ? 100.69700 100.02600 120.29700 1.000 109.14604 ? 69  ILE H N     1 
ATOM 5389  C CA    . ILE H 4 70  ? 99.64800  101.04300 120.36300 1.000 109.14604 ? 69  ILE H CA    1 
ATOM 5390  C C     . ILE H 4 70  ? 99.58100  101.65600 121.75500 1.000 109.14604 ? 69  ILE H C     1 
ATOM 5391  O O     . ILE H 4 70  ? 99.45100  102.88200 121.90600 1.000 109.14604 ? 69  ILE H O     1 
ATOM 5392  C CB    . ILE H 4 70  ? 98.30100  100.44500 119.92300 1.000 109.14604 ? 69  ILE H CB    1 
ATOM 5393  C CG1   . ILE H 4 70  ? 98.33700  100.13300 118.43100 1.000 109.14604 ? 69  ILE H CG1   1 
ATOM 5394  C CG2   . ILE H 4 70  ? 97.16200  101.39600 120.19100 1.000 109.14604 ? 69  ILE H CG2   1 
ATOM 5395  C CD1   . ILE H 4 70  ? 98.79800  101.29500 117.57400 1.000 109.14604 ? 69  ILE H CD1   1 
ATOM 5396  N N     . PHE H 4 71  ? 99.68300  100.81300 122.78900 1.000 110.98211 ? 70  PHE H N     1 
ATOM 5397  C CA    . PHE H 4 71  ? 99.68800  101.29200 124.16500 1.000 110.98211 ? 70  PHE H CA    1 
ATOM 5398  C C     . PHE H 4 71  ? 100.87100 102.21700 124.41700 1.000 110.98211 ? 70  PHE H C     1 
ATOM 5399  O O     . PHE H 4 71  ? 100.71500 103.27100 125.04900 1.000 110.98211 ? 70  PHE H O     1 
ATOM 5400  C CB    . PHE H 4 71  ? 99.71300  100.08700 125.10800 1.000 110.98211 ? 70  PHE H CB    1 
ATOM 5401  C CG    . PHE H 4 71  ? 100.43500 100.31900 126.40400 1.000 110.98211 ? 70  PHE H CG    1 
ATOM 5402  C CD1   . PHE H 4 71  ? 99.88100  101.09600 127.40200 1.000 110.98211 ? 70  PHE H CD1   1 
ATOM 5403  C CD2   . PHE H 4 71  ? 101.67100 99.74200  126.62500 1.000 110.98211 ? 70  PHE H CD2   1 
ATOM 5404  C CE1   . PHE H 4 71  ? 100.54000 101.30700 128.58300 1.000 110.98211 ? 70  PHE H CE1   1 
ATOM 5405  C CE2   . PHE H 4 71  ? 102.34000 99.94700  127.81200 1.000 110.98211 ? 70  PHE H CE2   1 
ATOM 5406  C CZ    . PHE H 4 71  ? 101.77200 100.73000 128.79200 1.000 110.98211 ? 70  PHE H CZ    1 
ATOM 5407  N N     . GLU H 4 72  ? 102.04900 101.85400 123.90000 1.000 116.01214 ? 71  GLU H N     1 
ATOM 5408  C CA    . GLU H 4 72  ? 103.22800 102.69600 124.07400 1.000 116.01214 ? 71  GLU H CA    1 
ATOM 5409  C C     . GLU H 4 72  ? 103.07100 104.04100 123.37200 1.000 116.01214 ? 71  GLU H C     1 
ATOM 5410  O O     . GLU H 4 72  ? 103.43600 105.08100 123.93200 1.000 116.01214 ? 71  GLU H O     1 
ATOM 5411  C CB    . GLU H 4 72  ? 104.46900 101.96500 123.56600 1.000 116.01214 ? 71  GLU H CB    1 
ATOM 5412  C CG    . GLU H 4 72  ? 105.77100 102.75500 123.67300 1.000 116.01214 ? 71  GLU H CG    1 
ATOM 5413  C CD    . GLU H 4 72  ? 106.16300 103.45300 122.38200 1.000 116.01214 ? 71  GLU H CD    1 
ATOM 5414  O OE1   . GLU H 4 72  ? 107.21700 104.12300 122.35900 1.000 116.01214 ? 71  GLU H OE1   1 
ATOM 5415  O OE2   . GLU H 4 72  ? 105.41100 103.33500 121.39400 1.000 116.01214 ? 71  GLU H OE2   1 
ATOM 5416  N N     . ARG H 4 73  ? 102.52800 104.03800 122.14900 1.000 109.01802 ? 72  ARG H N     1 
ATOM 5417  C CA    . ARG H 4 73  ? 102.35000 105.28300 121.40200 1.000 109.01802 ? 72  ARG H CA    1 
ATOM 5418  C C     . ARG H 4 73  ? 101.36900 106.22300 122.08600 1.000 109.01802 ? 72  ARG H C     1 
ATOM 5419  O O     . ARG H 4 73  ? 101.64300 107.42400 122.22900 1.000 109.01802 ? 72  ARG H O     1 
ATOM 5420  C CB    . ARG H 4 73  ? 101.87300 104.97900 119.98700 1.000 109.01802 ? 72  ARG H CB    1 
ATOM 5421  C CG    . ARG H 4 73  ? 102.94200 104.40800 119.10100 1.000 109.01802 ? 72  ARG H CG    1 
ATOM 5422  C CD    . ARG H 4 73  ? 102.34500 103.76800 117.87000 1.000 109.01802 ? 72  ARG H CD    1 
ATOM 5423  N NE    . ARG H 4 73  ? 101.51600 104.68300 117.10200 1.000 109.01802 ? 72  ARG H NE    1 
ATOM 5424  C CZ    . ARG H 4 73  ? 101.12000 104.44400 115.85800 1.000 109.01802 ? 72  ARG H CZ    1 
ATOM 5425  N NH1   . ARG H 4 73  ? 101.47900 103.32300 115.25200 1.000 109.01802 ? 72  ARG H NH1   1 
ATOM 5426  N NH2   . ARG H 4 73  ? 100.36900 105.32600 115.21900 1.000 109.01802 ? 72  ARG H NH2   1 
ATOM 5427  N N     . ILE H 4 74  ? 100.22300 105.69100 122.51900 1.000 104.47587 ? 73  ILE H N     1 
ATOM 5428  C CA    . ILE H 4 74  ? 99.21600  106.51900 123.17700 1.000 104.47587 ? 73  ILE H CA    1 
ATOM 5429  C C     . ILE H 4 74  ? 99.74600  107.05400 124.50000 1.000 104.47587 ? 73  ILE H C     1 
ATOM 5430  O O     . ILE H 4 74  ? 99.54400  108.22900 124.83500 1.000 104.47587 ? 73  ILE H O     1 
ATOM 5431  C CB    . ILE H 4 74  ? 97.91100  105.72700 123.34600 1.000 104.47587 ? 73  ILE H CB    1 
ATOM 5432  C CG1   . ILE H 4 74  ? 97.29000  105.48000 121.97800 1.000 104.47587 ? 73  ILE H CG1   1 
ATOM 5433  C CG2   . ILE H 4 74  ? 96.91700  106.49700 124.18900 1.000 104.47587 ? 73  ILE H CG2   1 
ATOM 5434  C CD1   . ILE H 4 74  ? 95.94400  104.81000 122.02800 1.000 104.47587 ? 73  ILE H CD1   1 
ATOM 5435  N N     . ALA H 4 75  ? 100.48000 106.22000 125.24300 1.000 114.17991 ? 74  ALA H N     1 
ATOM 5436  C CA    . ALA H 4 75  ? 101.02000 106.65500 126.52500 1.000 114.17991 ? 74  ALA H CA    1 
ATOM 5437  C C     . ALA H 4 75  ? 102.08000 107.73600 126.34900 1.000 114.17991 ? 74  ALA H C     1 
ATOM 5438  O O     . ALA H 4 75  ? 102.11300 108.70100 127.12000 1.000 114.17991 ? 74  ALA H O     1 
ATOM 5439  C CB    . ALA H 4 75  ? 101.59000 105.46300 127.28500 1.000 114.17991 ? 74  ALA H CB    1 
ATOM 5440  N N     . GLY H 4 76  ? 102.94800 107.59600 125.34300 1.000 117.32880 ? 75  GLY H N     1 
ATOM 5441  C CA    . GLY H 4 76  ? 103.94100 108.62800 125.08400 1.000 117.32880 ? 75  GLY H CA    1 
ATOM 5442  C C     . GLY H 4 76  ? 103.32100 109.94500 124.65500 1.000 117.32880 ? 75  GLY H C     1 
ATOM 5443  O O     . GLY H 4 76  ? 103.77200 111.02200 125.07200 1.000 117.32880 ? 75  GLY H O     1 
ATOM 5444  N N     . GLU H 4 77  ? 102.28400 109.87200 123.81300 1.000 114.00528 ? 76  GLU H N     1 
ATOM 5445  C CA    . GLU H 4 77  ? 101.54600 111.06400 123.41000 1.000 114.00528 ? 76  GLU H CA    1 
ATOM 5446  C C     . GLU H 4 77  ? 100.92300 111.76400 124.61100 1.000 114.00528 ? 76  GLU H C     1 
ATOM 5447  O O     . GLU H 4 77  ? 101.03000 112.98900 124.75600 1.000 114.00528 ? 76  GLU H O     1 
ATOM 5448  C CB    . GLU H 4 77  ? 100.47100 110.68500 122.39900 1.000 114.00528 ? 76  GLU H CB    1 
ATOM 5449  C CG    . GLU H 4 77  ? 100.01700 111.84600 121.57400 1.000 114.00528 ? 76  GLU H CG    1 
ATOM 5450  C CD    . GLU H 4 77  ? 101.16000 112.46800 120.81500 1.000 114.00528 ? 76  GLU H CD    1 
ATOM 5451  O OE1   . GLU H 4 77  ? 101.87200 111.72700 120.10900 1.000 114.00528 ? 76  GLU H OE1   1 
ATOM 5452  O OE2   . GLU H 4 77  ? 101.35800 113.69300 120.93300 1.000 114.00528 ? 76  GLU H OE2   1 
ATOM 5453  N N     . ALA H 4 78  ? 100.27300 110.99400 125.48700 1.000 114.48434 ? 77  ALA H N     1 
ATOM 5454  C CA    . ALA H 4 78  ? 99.67000  111.56600 126.68700 1.000 114.48434 ? 77  ALA H CA    1 
ATOM 5455  C C     . ALA H 4 78  ? 100.72100 112.14400 127.62200 1.000 114.48434 ? 77  ALA H C     1 
ATOM 5456  O O     . ALA H 4 78  ? 100.46900 113.15200 128.29300 1.000 114.48434 ? 77  ALA H O     1 
ATOM 5457  C CB    . ALA H 4 78  ? 98.84100  110.51100 127.41200 1.000 114.48434 ? 77  ALA H CB    1 
ATOM 5458  N N     . SER H 4 79  ? 101.90500 111.53000 127.66300 1.000 116.77684 ? 78  SER H N     1 
ATOM 5459  C CA    . SER H 4 79  ? 102.96200 112.00500 128.54500 1.000 116.77684 ? 78  SER H CA    1 
ATOM 5460  C C     . SER H 4 79  ? 103.48900 113.35600 128.09500 1.000 116.77684 ? 78  SER H C     1 
ATOM 5461  O O     . SER H 4 79  ? 103.63700 114.27300 128.91200 1.000 116.77684 ? 78  SER H O     1 
ATOM 5462  C CB    . SER H 4 79  ? 104.09900 110.99300 128.58500 1.000 116.77684 ? 78  SER H CB    1 
ATOM 5463  O OG    . SER H 4 79  ? 104.76800 110.96000 127.33900 1.000 116.77684 ? 78  SER H OG    1 
ATOM 5464  N N     . ARG H 4 80  ? 103.79200 113.49700 126.80000 1.000 121.93745 ? 79  ARG H N     1 
ATOM 5465  C CA    . ARG H 4 80  ? 104.20400 114.81200 126.31300 1.000 121.93745 ? 79  ARG H CA    1 
ATOM 5466  C C     . ARG H 4 80  ? 103.07800 115.84100 126.40200 1.000 121.93745 ? 79  ARG H C     1 
ATOM 5467  O O     . ARG H 4 80  ? 103.36200 117.02900 126.59600 1.000 121.93745 ? 79  ARG H O     1 
ATOM 5468  C CB    . ARG H 4 80  ? 104.77900 114.73300 124.90200 1.000 121.93745 ? 79  ARG H CB    1 
ATOM 5469  C CG    . ARG H 4 80  ? 103.85500 114.27200 123.81900 1.000 121.93745 ? 79  ARG H CG    1 
ATOM 5470  C CD    . ARG H 4 80  ? 104.58000 114.29200 122.48700 1.000 121.93745 ? 79  ARG H CD    1 
ATOM 5471  N NE    . ARG H 4 80  ? 106.00400 114.01100 122.64100 1.000 121.93745 ? 79  ARG H NE    1 
ATOM 5472  C CZ    . ARG H 4 80  ? 106.54800 112.81000 122.49300 1.000 121.93745 ? 79  ARG H CZ    1 
ATOM 5473  N NH1   . ARG H 4 80  ? 105.78600 111.77100 122.18500 1.000 121.93745 ? 79  ARG H NH1   1 
ATOM 5474  N NH2   . ARG H 4 80  ? 107.85400 112.64900 122.65400 1.000 121.93745 ? 79  ARG H NH2   1 
ATOM 5475  N N     . LEU H 4 81  ? 101.81300 115.41500 126.27900 1.000 117.61124 ? 80  LEU H N     1 
ATOM 5476  C CA    . LEU H 4 81  ? 100.69100 116.32900 126.51000 1.000 117.61124 ? 80  LEU H CA    1 
ATOM 5477  C C     . LEU H 4 81  ? 100.69600 116.88000 127.92700 1.000 117.61124 ? 80  LEU H C     1 
ATOM 5478  O O     . LEU H 4 81  ? 100.55100 118.09000 128.13200 1.000 117.61124 ? 80  LEU H O     1 
ATOM 5479  C CB    . LEU H 4 81  ? 99.36200  115.63900 126.22900 1.000 117.61124 ? 80  LEU H CB    1 
ATOM 5480  C CG    . LEU H 4 81  ? 98.95700  115.60300 124.77000 1.000 117.61124 ? 80  LEU H CG    1 
ATOM 5481  C CD1   . LEU H 4 81  ? 97.64700  114.88800 124.61700 1.000 117.61124 ? 80  LEU H CD1   1 
ATOM 5482  C CD2   . LEU H 4 81  ? 98.79800  117.03000 124.34700 1.000 117.61124 ? 80  LEU H CD2   1 
ATOM 5483  N N     . ALA H 4 82  ? 100.81700 115.99800 128.91800 1.000 118.08119 ? 81  ALA H N     1 
ATOM 5484  C CA    . ALA H 4 82  ? 100.83700 116.44700 130.30400 1.000 118.08119 ? 81  ALA H CA    1 
ATOM 5485  C C     . ALA H 4 82  ? 102.07500 117.27600 130.60200 1.000 118.08119 ? 81  ALA H C     1 
ATOM 5486  O O     . ALA H 4 82  ? 102.01600 118.20200 131.41700 1.000 118.08119 ? 81  ALA H O     1 
ATOM 5487  C CB    . ALA H 4 82  ? 100.76600 115.25200 131.24700 1.000 118.08119 ? 81  ALA H CB    1 
ATOM 5488  N N     . HIS H 4 83  ? 103.19400 116.97300 129.94600 1.000 119.99112 ? 82  HIS H N     1 
ATOM 5489  C CA    . HIS H 4 83  ? 104.41000 117.74200 130.17800 1.000 119.99112 ? 82  HIS H CA    1 
ATOM 5490  C C     . HIS H 4 83  ? 104.34200 119.12500 129.55100 1.000 119.99112 ? 82  HIS H C     1 
ATOM 5491  O O     . HIS H 4 83  ? 104.95400 120.06600 130.06500 1.000 119.99112 ? 82  HIS H O     1 
ATOM 5492  C CB    . HIS H 4 83  ? 105.61200 116.98100 129.63100 1.000 119.99112 ? 82  HIS H CB    1 
ATOM 5493  C CG    . HIS H 4 83  ? 106.91100 117.69400 129.81600 1.000 119.99112 ? 82  HIS H CG    1 
ATOM 5494  N ND1   . HIS H 4 83  ? 107.40800 118.58400 128.88900 1.000 119.99112 ? 82  HIS H ND1   1 
ATOM 5495  C CD2   . HIS H 4 83  ? 107.81200 117.66000 130.82500 1.000 119.99112 ? 82  HIS H CD2   1 
ATOM 5496  C CE1   . HIS H 4 83  ? 108.56200 119.06300 129.31600 1.000 119.99112 ? 82  HIS H CE1   1 
ATOM 5497  N NE2   . HIS H 4 83  ? 108.83000 118.51800 130.48800 1.000 119.99112 ? 82  HIS H NE2   1 
ATOM 5498  N N     . TYR H 4 84  ? 103.61300 119.26700 128.44600 1.000 123.10897 ? 83  TYR H N     1 
ATOM 5499  C CA    . TYR H 4 84  ? 103.51800 120.56100 127.78300 1.000 123.10897 ? 83  TYR H CA    1 
ATOM 5500  C C     . TYR H 4 84  ? 102.73600 121.57800 128.59900 1.000 123.10897 ? 83  TYR H C     1 
ATOM 5501  O O     . TYR H 4 84  ? 102.97800 122.78200 128.47500 1.000 123.10897 ? 83  TYR H O     1 
ATOM 5502  C CB    . TYR H 4 84  ? 102.87300 120.38900 126.41500 1.000 123.10897 ? 83  TYR H CB    1 
ATOM 5503  C CG    . TYR H 4 84  ? 103.84000 119.93900 125.35400 1.000 123.10897 ? 83  TYR H CG    1 
ATOM 5504  C CD1   . TYR H 4 84  ? 105.21000 120.07800 125.53200 1.000 123.10897 ? 83  TYR H CD1   1 
ATOM 5505  C CD2   . TYR H 4 84  ? 103.38600 119.35500 124.18200 1.000 123.10897 ? 83  TYR H CD2   1 
ATOM 5506  C CE1   . TYR H 4 84  ? 106.09900 119.66100 124.56300 1.000 123.10897 ? 83  TYR H CE1   1 
ATOM 5507  C CE2   . TYR H 4 84  ? 104.26600 118.93900 123.20600 1.000 123.10897 ? 83  TYR H CE2   1 
ATOM 5508  C CZ    . TYR H 4 84  ? 105.61900 119.09100 123.40400 1.000 123.10897 ? 83  TYR H CZ    1 
ATOM 5509  O OH    . TYR H 4 84  ? 106.49700 118.67300 122.43500 1.000 123.10897 ? 83  TYR H OH    1 
ATOM 5510  N N     . ASN H 4 85  ? 101.81100 121.12600 129.43900 1.000 124.24118 ? 84  ASN H N     1 
ATOM 5511  C CA    . ASN H 4 85  ? 100.93000 122.03200 130.15700 1.000 124.24118 ? 84  ASN H CA    1 
ATOM 5512  C C     . ASN H 4 85  ? 101.24900 122.11600 131.64000 1.000 124.24118 ? 84  ASN H C     1 
ATOM 5513  O O     . ASN H 4 85  ? 100.36800 122.47900 132.42600 1.000 124.24118 ? 84  ASN H O     1 
ATOM 5514  C CB    . ASN H 4 85  ? 99.48200  121.60200 129.96000 1.000 124.24118 ? 84  ASN H CB    1 
ATOM 5515  C CG    . ASN H 4 85  ? 99.02800  121.78600 128.54600 1.000 124.24118 ? 84  ASN H CG    1 
ATOM 5516  O OD1   . ASN H 4 85  ? 99.59500  122.58200 127.80400 1.000 124.24118 ? 84  ASN H OD1   1 
ATOM 5517  N ND2   . ASN H 4 85  ? 98.00800  121.04300 128.15300 1.000 124.24118 ? 84  ASN H ND2   1 
ATOM 5518  N N     . LYS H 4 86  ? 102.48600 121.77600 132.02300 1.000 118.26976 ? 85  LYS H N     1 
ATOM 5519  C CA    . LYS H 4 86  ? 102.97900 121.83600 133.40500 1.000 118.26976 ? 85  LYS H CA    1 
ATOM 5520  C C     . LYS H 4 86  ? 102.12600 120.98900 134.34600 1.000 118.26976 ? 85  LYS H C     1 
ATOM 5521  O O     . LYS H 4 86  ? 101.89300 121.35200 135.49900 1.000 118.26976 ? 85  LYS H O     1 
ATOM 5522  C CB    . LYS H 4 86  ? 103.06400 123.28000 133.90000 1.000 118.26976 ? 85  LYS H CB    1 
ATOM 5523  C CG    . LYS H 4 86  ? 104.16500 124.09000 133.26100 1.000 118.26976 ? 85  LYS H CG    1 
ATOM 5524  C CD    . LYS H 4 86  ? 104.30900 125.42900 133.95300 1.000 118.26976 ? 85  LYS H CD    1 
ATOM 5525  C CE    . LYS H 4 86  ? 105.48100 126.21500 133.40300 1.000 118.26976 ? 85  LYS H CE    1 
ATOM 5526  N NZ    . LYS H 4 86  ? 105.56800 127.56600 134.02100 1.000 118.26976 ? 85  LYS H NZ    1 
ATOM 5527  N N     . ARG H 4 87  ? 101.64300 119.86100 133.84600 1.000 136.10813 ? 86  ARG H N     1 
ATOM 5528  C CA    . ARG H 4 87  ? 100.80600 118.95700 134.61500 1.000 136.10813 ? 86  ARG H CA    1 
ATOM 5529  C C     . ARG H 4 87  ? 101.57900 117.69000 134.93700 1.000 136.10813 ? 86  ARG H C     1 
ATOM 5530  O O     . ARG H 4 87  ? 102.34900 117.19500 134.11000 1.000 136.10813 ? 86  ARG H O     1 
ATOM 5531  C CB    . ARG H 4 87  ? 99.53500  118.60700 133.84600 1.000 136.10813 ? 86  ARG H CB    1 
ATOM 5532  C CG    . ARG H 4 87  ? 98.47300  119.68000 133.90000 1.000 136.10813 ? 86  ARG H CG    1 
ATOM 5533  C CD    . ARG H 4 87  ? 98.18700  120.06700 135.32800 1.000 136.10813 ? 86  ARG H CD    1 
ATOM 5534  N NE    . ARG H 4 87  ? 97.14300  121.07500 135.43200 1.000 136.10813 ? 86  ARG H NE    1 
ATOM 5535  C CZ    . ARG H 4 87  ? 95.85000  120.79100 135.50900 1.000 136.10813 ? 86  ARG H CZ    1 
ATOM 5536  N NH1   . ARG H 4 87  ? 95.44900  119.52800 135.48900 1.000 136.10813 ? 86  ARG H NH1   1 
ATOM 5537  N NH2   . ARG H 4 87  ? 94.95800  121.76600 135.60800 1.000 136.10813 ? 86  ARG H NH2   1 
ATOM 5538  N N     . SER H 4 88  ? 101.38200 117.17200 136.14300 1.000 141.39430 ? 87  SER H N     1 
ATOM 5539  C CA    . SER H 4 88  ? 102.08100 115.96900 136.56000 1.000 141.39430 ? 87  SER H CA    1 
ATOM 5540  C C     . SER H 4 88  ? 101.20200 114.72900 136.55800 1.000 141.39430 ? 87  SER H C     1 
ATOM 5541  O O     . SER H 4 88  ? 101.73300 113.61500 136.59200 1.000 141.39430 ? 87  SER H O     1 
ATOM 5542  C CB    . SER H 4 88  ? 102.67000 116.16500 137.95500 1.000 141.39430 ? 87  SER H CB    1 
ATOM 5543  O OG    . SER H 4 88  ? 101.73900 116.82900 138.78400 1.000 141.39430 ? 87  SER H OG    1 
ATOM 5544  N N     . THR H 4 89  ? 99.88500  114.88800 136.53500 1.000 133.63729 ? 88  THR H N     1 
ATOM 5545  C CA    . THR H 4 89  ? 98.96200  113.76400 136.53200 1.000 133.63729 ? 88  THR H CA    1 
ATOM 5546  C C     . THR H 4 89  ? 98.36900  113.57000 135.14600 1.000 133.63729 ? 88  THR H C     1 
ATOM 5547  O O     . THR H 4 89  ? 98.06100  114.54000 134.45200 1.000 133.63729 ? 88  THR H O     1 
ATOM 5548  C CB    . THR H 4 89  ? 97.83700  113.97600 137.53900 1.000 133.63729 ? 88  THR H CB    1 
ATOM 5549  O OG1   . THR H 4 89  ? 96.84500  114.83300 136.96300 1.000 133.63729 ? 88  THR H OG1   1 
ATOM 5550  C CG2   . THR H 4 89  ? 98.37300  114.61100 138.81100 1.000 133.63729 ? 88  THR H CG2   1 
ATOM 5551  N N     . ILE H 4 90  ? 98.21100  112.31500 134.75000 1.000 119.74553 ? 89  ILE H N     1 
ATOM 5552  C CA    . ILE H 4 90  ? 97.61500  111.97000 133.46400 1.000 119.74553 ? 89  ILE H CA    1 
ATOM 5553  C C     . ILE H 4 90  ? 96.15200  111.63300 133.73400 1.000 119.74553 ? 89  ILE H C     1 
ATOM 5554  O O     . ILE H 4 90  ? 95.80100  110.50800 134.08800 1.000 119.74553 ? 89  ILE H O     1 
ATOM 5555  C CB    . ILE H 4 90  ? 98.35700  110.82700 132.78200 1.000 119.74553 ? 89  ILE H CB    1 
ATOM 5556  C CG1   . ILE H 4 90  ? 99.82000  111.20100 132.60100 1.000 119.74553 ? 89  ILE H CG1   1 
ATOM 5557  C CG2   . ILE H 4 90  ? 97.73300  110.51900 131.43900 1.000 119.74553 ? 89  ILE H CG2   1 
ATOM 5558  C CD1   . ILE H 4 90  ? 100.62000 110.17600 131.84400 1.000 119.74553 ? 89  ILE H CD1   1 
ATOM 5559  N N     . THR H 4 91  ? 95.28500  112.62900 133.58700 1.000 119.81620 ? 90  THR H N     1 
ATOM 5560  C CA    . THR H 4 91  ? 93.86300  112.41600 133.79100 1.000 119.81620 ? 90  THR H CA    1 
ATOM 5561  C C     . THR H 4 91  ? 93.23900  111.80400 132.54200 1.000 119.81620 ? 90  THR H C     1 
ATOM 5562  O O     . THR H 4 91  ? 93.91600  111.48000 131.56500 1.000 119.81620 ? 90  THR H O     1 
ATOM 5563  C CB    . THR H 4 91  ? 93.16200  113.72200 134.14400 1.000 119.81620 ? 90  THR H CB    1 
ATOM 5564  O OG1   . THR H 4 91  ? 93.34100  114.66400 133.08200 1.000 119.81620 ? 90  THR H OG1   1 
ATOM 5565  C CG2   . THR H 4 91  ? 93.73500  114.30000 135.42100 1.000 119.81620 ? 90  THR H CG2   1 
ATOM 5566  N N     . SER H 4 92  ? 91.91500  111.66000 132.57500 1.000 115.10572 ? 91  SER H N     1 
ATOM 5567  C CA    . SER H 4 92  ? 91.18800  111.08800 131.45000 1.000 115.10572 ? 91  SER H CA    1 
ATOM 5568  C C     . SER H 4 92  ? 91.14400  112.01500 130.24400 1.000 115.10572 ? 91  SER H C     1 
ATOM 5569  O O     . SER H 4 92  ? 90.88600  111.54900 129.13100 1.000 115.10572 ? 91  SER H O     1 
ATOM 5570  C CB    . SER H 4 92  ? 89.76800  110.73200 131.87700 1.000 115.10572 ? 91  SER H CB    1 
ATOM 5571  O OG    . SER H 4 92  ? 89.78300  109.76600 132.90900 1.000 115.10572 ? 91  SER H OG    1 
ATOM 5572  N N     . ARG H 4 93  ? 91.38000  113.30800 130.43100 1.000 123.67119 ? 92  ARG H N     1 
ATOM 5573  C CA    . ARG H 4 93  ? 91.34800  114.21600 129.29400 1.000 123.67119 ? 92  ARG H CA    1 
ATOM 5574  C C     . ARG H 4 93  ? 92.60200  114.08300 128.44800 1.000 123.67119 ? 92  ARG H C     1 
ATOM 5575  O O     . ARG H 4 93  ? 92.53700  114.20000 127.21700 1.000 123.67119 ? 92  ARG H O     1 
ATOM 5576  C CB    . ARG H 4 93  ? 91.19800  115.65300 129.77600 1.000 123.67119 ? 92  ARG H CB    1 
ATOM 5577  C CG    . ARG H 4 93  ? 89.97000  115.89600 130.61600 1.000 123.67119 ? 92  ARG H CG    1 
ATOM 5578  C CD    . ARG H 4 93  ? 89.99200  117.28600 131.21600 1.000 123.67119 ? 92  ARG H CD    1 
ATOM 5579  N NE    . ARG H 4 93  ? 89.77700  118.31500 130.20500 1.000 123.67119 ? 92  ARG H NE    1 
ATOM 5580  C CZ    . ARG H 4 93  ? 90.72600  119.12600 129.75300 1.000 123.67119 ? 92  ARG H CZ    1 
ATOM 5581  N NH1   . ARG H 4 93  ? 91.96000  119.02800 130.22400 1.000 123.67119 ? 92  ARG H NH1   1 
ATOM 5582  N NH2   . ARG H 4 93  ? 90.44300  120.03300 128.82800 1.000 123.67119 ? 92  ARG H NH2   1 
ATOM 5583  N N     . GLU H 4 94  ? 93.73800  113.83100 129.10200 1.000 123.01899 ? 93  GLU H N     1 
ATOM 5584  C CA    . GLU H 4 94  ? 95.01600  113.72100 128.40700 1.000 123.01899 ? 93  GLU H CA    1 
ATOM 5585  C C     . GLU H 4 94  ? 95.02700  112.54100 127.45500 1.000 123.01899 ? 93  GLU H C     1 
ATOM 5586  O O     . GLU H 4 94  ? 95.43600  112.66500 126.29800 1.000 123.01899 ? 93  GLU H O     1 
ATOM 5587  C CB    . GLU H 4 94  ? 96.14400  113.57900 129.42100 1.000 123.01899 ? 93  GLU H CB    1 
ATOM 5588  C CG    . GLU H 4 94  ? 96.71300  114.88500 129.89000 1.000 123.01899 ? 93  GLU H CG    1 
ATOM 5589  C CD    . GLU H 4 94  ? 95.83200  115.53900 130.92200 1.000 123.01899 ? 93  GLU H CD    1 
ATOM 5590  O OE1   . GLU H 4 94  ? 95.01400  114.82300 131.53500 1.000 123.01899 ? 93  GLU H OE1   1 
ATOM 5591  O OE2   . GLU H 4 94  ? 95.95500  116.76500 131.12200 1.000 123.01899 ? 93  GLU H OE2   1 
ATOM 5592  N N     . ILE H 4 95  ? 94.59000  111.38100 127.93700 1.000 115.89396 ? 94  ILE H N     1 
ATOM 5593  C CA    . ILE H 4 95  ? 94.55900  110.19300 127.10100 1.000 115.89396 ? 94  ILE H CA    1 
ATOM 5594  C C     . ILE H 4 95  ? 93.52800  110.32500 125.98400 1.000 115.89396 ? 94  ILE H C     1 
ATOM 5595  O O     . ILE H 4 95  ? 93.75200  109.83600 124.87000 1.000 115.89396 ? 94  ILE H O     1 
ATOM 5596  C CB    . ILE H 4 95  ? 94.34000  108.96200 127.99900 1.000 115.89396 ? 94  ILE H CB    1 
ATOM 5597  C CG1   . ILE H 4 95  ? 94.38300  107.67300 127.20100 1.000 115.89396 ? 94  ILE H CG1   1 
ATOM 5598  C CG2   . ILE H 4 95  ? 93.06900  109.07000 128.81700 1.000 115.89396 ? 94  ILE H CG2   1 
ATOM 5599  C CD1   . ILE H 4 95  ? 94.54900  106.50300 128.08200 1.000 115.89396 ? 94  ILE H CD1   1 
ATOM 5600  N N     . GLN H 4 96  ? 92.41400  111.01800 126.24000 1.000 111.16043 ? 95  GLN H N     1 
ATOM 5601  C CA    . GLN H 4 96  ? 91.41600  111.24700 125.20000 1.000 111.16043 ? 95  GLN H CA    1 
ATOM 5602  C C     . GLN H 4 96  ? 91.97400  112.12100 124.08500 1.000 111.16043 ? 95  GLN H C     1 
ATOM 5603  O O     . GLN H 4 96  ? 91.83800  111.80000 122.89900 1.000 111.16043 ? 95  GLN H O     1 
ATOM 5604  C CB    . GLN H 4 96  ? 90.16200  111.87000 125.80800 1.000 111.16043 ? 95  GLN H CB    1 
ATOM 5605  C CG    . GLN H 4 96  ? 89.24700  112.52100 124.80000 1.000 111.16043 ? 95  GLN H CG    1 
ATOM 5606  C CD    . GLN H 4 96  ? 87.83500  112.66600 125.31300 1.000 111.16043 ? 95  GLN H CD    1 
ATOM 5607  O OE1   . GLN H 4 96  ? 87.46800  112.07100 126.32200 1.000 111.16043 ? 95  GLN H OE1   1 
ATOM 5608  N NE2   . GLN H 4 96  ? 87.03600  113.46700 124.62600 1.000 111.16043 ? 95  GLN H NE2   1 
ATOM 5609  N N     . THR H 4 97  ? 92.63000  113.21900 124.44800 1.000 122.29809 ? 96  THR H N     1 
ATOM 5610  C CA    . THR H 4 97  ? 93.24600  114.06900 123.43700 1.000 122.29809 ? 96  THR H CA    1 
ATOM 5611  C C     . THR H 4 97  ? 94.40100  113.37200 122.72800 1.000 122.29809 ? 96  THR H C     1 
ATOM 5612  O O     . THR H 4 97  ? 94.61100  113.59000 121.52800 1.000 122.29809 ? 96  THR H O     1 
ATOM 5613  C CB    . THR H 4 97  ? 93.70400  115.36700 124.07600 1.000 122.29809 ? 96  THR H CB    1 
ATOM 5614  O OG1   . THR H 4 97  ? 94.42100  115.06800 125.27800 1.000 122.29809 ? 96  THR H OG1   1 
ATOM 5615  C CG2   . THR H 4 97  ? 92.49000  116.19200 124.42900 1.000 122.29809 ? 96  THR H CG2   1 
ATOM 5616  N N     . ALA H 4 98  ? 95.14700  112.53100 123.44500 1.000 118.90950 ? 97  ALA H N     1 
ATOM 5617  C CA    . ALA H 4 98  ? 96.23800  111.78400 122.83200 1.000 118.90950 ? 97  ALA H CA    1 
ATOM 5618  C C     . ALA H 4 98  ? 95.71900  110.80400 121.79000 1.000 118.90950 ? 97  ALA H C     1 
ATOM 5619  O O     . ALA H 4 98  ? 96.28300  110.69100 120.69500 1.000 118.90950 ? 97  ALA H O     1 
ATOM 5620  C CB    . ALA H 4 98  ? 97.03800  111.05500 123.90700 1.000 118.90950 ? 97  ALA H CB    1 
ATOM 5621  N N     . VAL H 4 99  ? 94.65100  110.07300 122.11900 1.000 121.33293 ? 98  VAL H N     1 
ATOM 5622  C CA    . VAL H 4 99  ? 94.10700  109.12600 121.15300 1.000 121.33293 ? 98  VAL H CA    1 
ATOM 5623  C C     . VAL H 4 99  ? 93.43000  109.86700 120.00400 1.000 121.33293 ? 98  VAL H C     1 
ATOM 5624  O O     . VAL H 4 99  ? 93.40800  109.37100 118.87000 1.000 121.33293 ? 98  VAL H O     1 
ATOM 5625  C CB    . VAL H 4 99  ? 93.18300  108.09400 121.83600 1.000 121.33293 ? 98  VAL H CB    1 
ATOM 5626  C CG1   . VAL H 4 99  ? 91.83900  108.66100 122.19900 1.000 121.33293 ? 98  VAL H CG1   1 
ATOM 5627  C CG2   . VAL H 4 99  ? 93.00400  106.87700 120.95300 1.000 121.33293 ? 98  VAL H CG2   1 
ATOM 5628  N N     . ARG H 4 100 ? 92.93000  111.08500 120.25400 1.000 125.64828 ? 99  ARG H N     1 
ATOM 5629  C CA    . ARG H 4 100 ? 92.37400  111.88800 119.17000 1.000 125.64828 ? 99  ARG H CA    1 
ATOM 5630  C C     . ARG H 4 100 ? 93.46600  112.33900 118.21400 1.000 125.64828 ? 99  ARG H C     1 
ATOM 5631  O O     . ARG H 4 100 ? 93.24300  112.42200 117.00200 1.000 125.64828 ? 99  ARG H O     1 
ATOM 5632  C CB    . ARG H 4 100 ? 91.64000  113.10200 119.73900 1.000 125.64828 ? 99  ARG H CB    1 
ATOM 5633  C CG    . ARG H 4 100 ? 90.24800  112.82100 120.25900 1.000 125.64828 ? 99  ARG H CG    1 
ATOM 5634  C CD    . ARG H 4 100 ? 89.19100  113.19500 119.24900 1.000 125.64828 ? 99  ARG H CD    1 
ATOM 5635  N NE    . ARG H 4 100 ? 88.99400  114.63700 119.21900 1.000 125.64828 ? 99  ARG H NE    1 
ATOM 5636  C CZ    . ARG H 4 100 ? 88.15000  115.28900 120.00900 1.000 125.64828 ? 99  ARG H CZ    1 
ATOM 5637  N NH1   . ARG H 4 100 ? 87.42100  114.62300 120.89300 1.000 125.64828 ? 99  ARG H NH1   1 
ATOM 5638  N NH2   . ARG H 4 100 ? 88.03600  116.60500 119.91500 1.000 125.64828 ? 99  ARG H NH2   1 
ATOM 5639  N N     . LEU H 4 101 ? 94.65100  112.64500 118.74400 1.000 121.96338 ? 100 LEU H N     1 
ATOM 5640  C CA    . LEU H 4 101 ? 95.76500  113.00100 117.87500 1.000 121.96338 ? 100 LEU H CA    1 
ATOM 5641  C C     . LEU H 4 101 ? 96.30900  111.79700 117.11600 1.000 121.96338 ? 100 LEU H C     1 
ATOM 5642  O O     . LEU H 4 101 ? 96.64200  111.90900 115.93100 1.000 121.96338 ? 100 LEU H O     1 
ATOM 5643  C CB    . LEU H 4 101 ? 96.88400  113.64400 118.68500 1.000 121.96338 ? 100 LEU H CB    1 
ATOM 5644  C CG    . LEU H 4 101 ? 96.75700  115.12600 118.99900 1.000 121.96338 ? 100 LEU H CG    1 
ATOM 5645  C CD1   . LEU H 4 101 ? 97.57600  115.46500 120.21700 1.000 121.96338 ? 100 LEU H CD1   1 
ATOM 5646  C CD2   . LEU H 4 101 ? 97.24200  115.91600 117.80900 1.000 121.96338 ? 100 LEU H CD2   1 
ATOM 5647  N N     . LEU H 4 102 ? 96.40600  110.63900 117.76900 1.000 126.40584 ? 101 LEU H N     1 
ATOM 5648  C CA    . LEU H 4 102 ? 97.07500  109.51400 117.12200 1.000 126.40584 ? 101 LEU H CA    1 
ATOM 5649  C C     . LEU H 4 102 ? 96.17300  108.77300 116.14800 1.000 126.40584 ? 101 LEU H C     1 
ATOM 5650  O O     . LEU H 4 102 ? 96.57200  108.50200 115.01200 1.000 126.40584 ? 101 LEU H O     1 
ATOM 5651  C CB    . LEU H 4 102 ? 97.61200  108.54900 118.17200 1.000 126.40584 ? 101 LEU H CB    1 
ATOM 5652  C CG    . LEU H 4 102 ? 98.75500  109.08300 119.02800 1.000 126.40584 ? 101 LEU H CG    1 
ATOM 5653  C CD1   . LEU H 4 102 ? 99.39200  107.93000 119.74500 1.000 126.40584 ? 101 LEU H CD1   1 
ATOM 5654  C CD2   . LEU H 4 102 ? 99.78600  109.83100 118.19800 1.000 126.40584 ? 101 LEU H CD2   1 
ATOM 5655  N N     . LEU H 4 103 ? 94.97700  108.42600 116.57100 1.000 137.83974 ? 102 LEU H N     1 
ATOM 5656  C CA    . LEU H 4 103 ? 94.09800  107.61700 115.74600 1.000 137.83974 ? 102 LEU H CA    1 
ATOM 5657  C C     . LEU H 4 103 ? 93.48300  108.50600 114.66400 1.000 137.83974 ? 102 LEU H C     1 
ATOM 5658  O O     . LEU H 4 103 ? 93.25600  109.69400 114.90200 1.000 137.83974 ? 102 LEU H O     1 
ATOM 5659  C CB    . LEU H 4 103 ? 93.02500  106.98000 116.62000 1.000 137.83974 ? 102 LEU H CB    1 
ATOM 5660  C CG    . LEU H 4 103 ? 92.14000  105.85400 116.10500 1.000 137.83974 ? 102 LEU H CG    1 
ATOM 5661  C CD1   . LEU H 4 103 ? 93.01600  104.68300 115.77600 1.000 137.83974 ? 102 LEU H CD1   1 
ATOM 5662  C CD2   . LEU H 4 103 ? 91.18900  105.42200 117.18300 1.000 137.83974 ? 102 LEU H CD2   1 
ATOM 5663  N N     . PRO H 4 104 ? 93.23800  107.97700 113.43700 1.000 147.05705 ? 103 PRO H N     1 
ATOM 5664  C CA    . PRO H 4 104 ? 92.57100  108.79900 112.41100 1.000 147.05705 ? 103 PRO H CA    1 
ATOM 5665  C C     . PRO H 4 104 ? 91.15300  109.23500 112.75200 1.000 147.05705 ? 103 PRO H C     1 
ATOM 5666  O O     . PRO H 4 104 ? 90.58800  108.81100 113.76200 1.000 147.05705 ? 103 PRO H O     1 
ATOM 5667  C CB    . PRO H 4 104 ? 92.59300  107.90200 111.16700 1.000 147.05705 ? 103 PRO H CB    1 
ATOM 5668  C CG    . PRO H 4 104 ? 92.91400  106.54900 111.65000 1.000 147.05705 ? 103 PRO H CG    1 
ATOM 5669  C CD    . PRO H 4 104 ? 93.74600  106.72100 112.87100 1.000 147.05705 ? 103 PRO H CD    1 
ATOM 5670  N N     . GLY H 4 105 ? 90.55800  110.02600 111.85700 1.000 156.14952 ? 104 GLY H N     1 
ATOM 5671  C CA    . GLY H 4 105 ? 89.34700  110.75600 112.20800 1.000 156.14952 ? 104 GLY H CA    1 
ATOM 5672  C C     . GLY H 4 105 ? 88.10100  109.92400 112.45500 1.000 156.14952 ? 104 GLY H C     1 
ATOM 5673  O O     . GLY H 4 105 ? 87.44200  110.09000 113.48500 1.000 156.14952 ? 104 GLY H O     1 
ATOM 5674  N N     . GLU H 4 106 ? 87.74400  109.04600 111.51300 1.000 166.28707 ? 105 GLU H N     1 
ATOM 5675  C CA    . GLU H 4 106 ? 86.47500  108.32700 111.63800 1.000 166.28707 ? 105 GLU H CA    1 
ATOM 5676  C C     . GLU H 4 106 ? 86.50500  107.33100 112.79800 1.000 166.28707 ? 105 GLU H C     1 
ATOM 5677  O O     . GLU H 4 106 ? 85.50900  107.17800 113.51700 1.000 166.28707 ? 105 GLU H O     1 
ATOM 5678  C CB    . GLU H 4 106 ? 86.09800  107.66900 110.30900 1.000 166.28707 ? 105 GLU H CB    1 
ATOM 5679  C CG    . GLU H 4 106 ? 85.10200  106.54100 110.42500 1.000 166.28707 ? 105 GLU H CG    1 
ATOM 5680  C CD    . GLU H 4 106 ? 83.71800  107.05600 110.78300 1.000 166.28707 ? 105 GLU H CD    1 
ATOM 5681  O OE1   . GLU H 4 106 ? 83.42800  108.24000 110.50700 1.000 166.28707 ? 105 GLU H OE1   1 
ATOM 5682  O OE2   . GLU H 4 106 ? 82.92400  106.29800 111.37300 1.000 166.28707 ? 105 GLU H OE2   1 
ATOM 5683  N N     . LEU H 4 107 ? 87.65700  106.69800 113.03600 1.000 154.05473 ? 106 LEU H N     1 
ATOM 5684  C CA    . LEU H 4 107 ? 87.75800  105.69500 114.09300 1.000 154.05473 ? 106 LEU H CA    1 
ATOM 5685  C C     . LEU H 4 107 ? 87.69000  106.34100 115.46500 1.000 154.05473 ? 106 LEU H C     1 
ATOM 5686  O O     . LEU H 4 107 ? 86.96300  105.85500 116.34300 1.000 154.05473 ? 106 LEU H O     1 
ATOM 5687  C CB    . LEU H 4 107 ? 89.04600  104.88500 113.97200 1.000 154.05473 ? 106 LEU H CB    1 
ATOM 5688  C CG    . LEU H 4 107 ? 89.12700  103.76000 112.95100 1.000 154.05473 ? 106 LEU H CG    1 
ATOM 5689  C CD1   . LEU H 4 107 ? 90.48700  103.10400 113.01000 1.000 154.05473 ? 106 LEU H CD1   1 
ATOM 5690  C CD2   . LEU H 4 107 ? 88.03000  102.74600 113.20100 1.000 154.05473 ? 106 LEU H CD2   1 
ATOM 5691  N N     . ALA H 4 108 ? 88.47300  107.41600 115.65700 1.000 158.70854 ? 107 ALA H N     1 
ATOM 5692  C CA    . ALA H 4 108 ? 88.68200  108.06900 116.95200 1.000 158.70854 ? 107 ALA H CA    1 
ATOM 5693  C C     . ALA H 4 108 ? 87.37600  108.39700 117.64700 1.000 158.70854 ? 107 ALA H C     1 
ATOM 5694  O O     . ALA H 4 108 ? 87.21300  108.09100 118.83600 1.000 158.70854 ? 107 ALA H O     1 
ATOM 5695  C CB    . ALA H 4 108 ? 89.50500  109.34200 116.77100 1.000 158.70854 ? 107 ALA H CB    1 
ATOM 5696  N N     . LYS H 4 109 ? 86.44800  109.01200 116.89900 1.000 157.75661 ? 108 LYS H N     1 
ATOM 5697  C CA    . LYS H 4 109 ? 85.08700  109.31100 117.34100 1.000 157.75661 ? 108 LYS H CA    1 
ATOM 5698  C C     . LYS H 4 109 ? 84.46000  108.10900 118.02600 1.000 157.75661 ? 108 LYS H C     1 
ATOM 5699  O O     . LYS H 4 109 ? 84.10700  108.17300 119.21300 1.000 157.75661 ? 108 LYS H O     1 
ATOM 5700  C CB    . LYS H 4 109 ? 84.24900  109.74100 116.14000 1.000 157.75661 ? 108 LYS H CB    1 
ATOM 5701  C CG    . LYS H 4 109 ? 84.70000  111.05000 115.52700 1.000 157.75661 ? 108 LYS H CG    1 
ATOM 5702  C CD    . LYS H 4 109 ? 83.75500  111.51500 114.43500 1.000 157.75661 ? 108 LYS H CD    1 
ATOM 5703  C CE    . LYS H 4 109 ? 82.33400  111.65200 114.94900 1.000 157.75661 ? 108 LYS H CE    1 
ATOM 5704  N NZ    . LYS H 4 109 ? 82.26700  112.48700 116.18100 1.000 157.75661 ? 108 LYS H NZ    1 
ATOM 5705  N N     . HIS H 4 110 ? 84.40500  106.98700 117.29100 1.000 157.00915 ? 109 HIS H N     1 
ATOM 5706  C CA    . HIS H 4 110 ? 83.96600  105.69200 117.80500 1.000 157.00915 ? 109 HIS H CA    1 
ATOM 5707  C C     . HIS H 4 110 ? 84.69000  105.34500 119.09500 1.000 157.00915 ? 109 HIS H C     1 
ATOM 5708  O O     . HIS H 4 110 ? 84.06200  105.12000 120.14000 1.000 157.00915 ? 109 HIS H O     1 
ATOM 5709  C CB    . HIS H 4 110 ? 84.24900  104.61800 116.76200 1.000 157.00915 ? 109 HIS H CB    1 
ATOM 5710  C CG    . HIS H 4 110 ? 83.24600  104.57200 115.66200 1.000 157.00915 ? 109 HIS H CG    1 
ATOM 5711  N ND1   . HIS H 4 110 ? 81.96800  104.09600 115.84000 1.000 157.00915 ? 109 HIS H ND1   1 
ATOM 5712  C CD2   . HIS H 4 110 ? 83.33500  104.94300 114.36400 1.000 157.00915 ? 109 HIS H CD2   1 
ATOM 5713  C CE1   . HIS H 4 110 ? 81.31000  104.17800 114.69900 1.000 157.00915 ? 109 HIS H CE1   1 
ATOM 5714  N NE2   . HIS H 4 110 ? 82.11700  104.68800 113.78700 1.000 157.00915 ? 109 HIS H NE2   1 
ATOM 5715  N N     . ALA H 4 111 ? 86.02700  105.36600 119.02400 1.000 148.22033 ? 110 ALA H N     1 
ATOM 5716  C CA    . ALA H 4 111 ? 86.88900  105.10000 120.16800 1.000 148.22033 ? 110 ALA H CA    1 
ATOM 5717  C C     . ALA H 4 111 ? 86.56800  106.02100 121.33500 1.000 148.22033 ? 110 ALA H C     1 
ATOM 5718  O O     . ALA H 4 111 ? 86.42500  105.55400 122.47400 1.000 148.22033 ? 110 ALA H O     1 
ATOM 5719  C CB    . ALA H 4 111 ? 88.35100  105.24400 119.75300 1.000 148.22033 ? 110 ALA H CB    1 
ATOM 5720  N N     . VAL H 4 112 ? 86.42200  107.32800 121.04600 1.000 146.56018 ? 111 VAL H N     1 
ATOM 5721  C CA    . VAL H 4 112 ? 86.05900  108.32000 122.06000 1.000 146.56018 ? 111 VAL H CA    1 
ATOM 5722  C C     . VAL H 4 112 ? 84.77300  107.91100 122.75200 1.000 146.56018 ? 111 VAL H C     1 
ATOM 5723  O O     . VAL H 4 112 ? 84.69500  107.89400 123.99000 1.000 146.56018 ? 111 VAL H O     1 
ATOM 5724  C CB    . VAL H 4 112 ? 85.95600  109.72500 121.44000 1.000 146.56018 ? 111 VAL H CB    1 
ATOM 5725  C CG1   . VAL H 4 112 ? 85.17000  110.66200 122.34000 1.000 146.56018 ? 111 VAL H CG1   1 
ATOM 5726  C CG2   . VAL H 4 112 ? 87.34000  110.29200 121.23700 1.000 146.56018 ? 111 VAL H CG2   1 
ATOM 5727  N N     . SER H 4 113 ? 83.77200  107.52700 121.94300 1.000 147.42761 ? 112 SER H N     1 
ATOM 5728  C CA    . SER H 4 113 ? 82.49900  107.02800 122.44800 1.000 147.42761 ? 112 SER H CA    1 
ATOM 5729  C C     . SER H 4 113 ? 82.71300  105.88000 123.41600 1.000 147.42761 ? 112 SER H C     1 
ATOM 5730  O O     . SER H 4 113 ? 82.21200  105.91700 124.54800 1.000 147.42761 ? 112 SER H O     1 
ATOM 5731  C CB    . SER H 4 113 ? 81.61000  106.59500 121.28700 1.000 147.42761 ? 112 SER H CB    1 
ATOM 5732  O OG    . SER H 4 113 ? 80.26100  106.50300 121.70500 1.000 147.42761 ? 112 SER H OG    1 
ATOM 5733  N N     . GLU H 4 114 ? 83.53200  104.90000 123.00000 1.000 140.81157 ? 113 GLU H N     1 
ATOM 5734  C CA    . GLU H 4 114 ? 83.88800  103.76200 123.84400 1.000 140.81157 ? 113 GLU H CA    1 
ATOM 5735  C C     . GLU H 4 114 ? 84.49100  104.21900 125.16000 1.000 140.81157 ? 113 GLU H C     1 
ATOM 5736  O O     . GLU H 4 114 ? 84.09400  103.74600 126.23400 1.000 140.81157 ? 113 GLU H O     1 
ATOM 5737  C CB    . GLU H 4 114 ? 84.86100  102.85400 123.10100 1.000 140.81157 ? 113 GLU H CB    1 
ATOM 5738  C CG    . GLU H 4 114 ? 84.23500  102.11900 121.94500 1.000 140.81157 ? 113 GLU H CG    1 
ATOM 5739  C CD    . GLU H 4 114 ? 83.39900  100.94400 122.39200 1.000 140.81157 ? 113 GLU H CD    1 
ATOM 5740  O OE1   . GLU H 4 114 ? 83.56800  100.49500 123.54400 1.000 140.81157 ? 113 GLU H OE1   1 
ATOM 5741  O OE2   . GLU H 4 114 ? 82.56400  100.47200 121.59300 1.000 140.81157 ? 113 GLU H OE2   1 
ATOM 5742  N N     . GLY H 4 115 ? 85.41300  105.18800 125.08400 1.000 133.47506 ? 114 GLY H N     1 
ATOM 5743  C CA    . GLY H 4 115 ? 85.96700  105.78800 126.28600 1.000 133.47506 ? 114 GLY H CA    1 
ATOM 5744  C C     . GLY H 4 115 ? 84.89800  106.42300 127.14900 1.000 133.47506 ? 114 GLY H C     1 
ATOM 5745  O O     . GLY H 4 115 ? 84.76800  106.10600 128.33500 1.000 133.47506 ? 114 GLY H O     1 
ATOM 5746  N N     . THR H 4 116 ? 84.06000  107.26500 126.53900 1.000 137.51711 ? 115 THR H N     1 
ATOM 5747  C CA    . THR H 4 116 ? 82.96300  107.86600 127.28000 1.000 137.51711 ? 115 THR H CA    1 
ATOM 5748  C C     . THR H 4 116 ? 81.89400  106.85400 127.65900 1.000 137.51711 ? 115 THR H C     1 
ATOM 5749  O O     . THR H 4 116 ? 81.02400  107.18300 128.46700 1.000 137.51711 ? 115 THR H O     1 
ATOM 5750  C CB    . THR H 4 116 ? 82.33700  109.00800 126.48900 1.000 137.51711 ? 115 THR H CB    1 
ATOM 5751  O OG1   . THR H 4 116 ? 81.78000  108.49600 125.27700 1.000 137.51711 ? 115 THR H OG1   1 
ATOM 5752  C CG2   . THR H 4 116 ? 83.38300  110.05200 126.16000 1.000 137.51711 ? 115 THR H CG2   1 
ATOM 5753  N N     . LYS H 4 117 ? 81.92200  105.64900 127.09600 1.000 135.34115 ? 116 LYS H N     1 
ATOM 5754  C CA    . LYS H 4 117 ? 81.00200  104.62500 127.54700 1.000 135.34115 ? 116 LYS H CA    1 
ATOM 5755  C C     . LYS H 4 117 ? 81.60300  103.77600 128.65100 1.000 135.34115 ? 116 LYS H C     1 
ATOM 5756  O O     . LYS H 4 117 ? 80.86500  103.07100 129.34500 1.000 135.34115 ? 116 LYS H O     1 
ATOM 5757  C CB    . LYS H 4 117 ? 80.59700  103.72700 126.37700 1.000 135.34115 ? 116 LYS H CB    1 
ATOM 5758  C CG    . LYS H 4 117 ? 79.24600  103.06700 126.52600 1.000 135.34115 ? 116 LYS H CG    1 
ATOM 5759  C CD    . LYS H 4 117 ? 78.95000  102.18000 125.33800 1.000 135.34115 ? 116 LYS H CD    1 
ATOM 5760  C CE    . LYS H 4 117 ? 77.61700  101.48300 125.50700 1.000 135.34115 ? 116 LYS H CE    1 
ATOM 5761  N NZ    . LYS H 4 117 ? 77.56900  100.72600 126.78800 1.000 135.34115 ? 116 LYS H NZ    1 
ATOM 5762  N N     . ALA H 4 118 ? 82.91400  103.85400 128.85600 1.000 130.32232 ? 117 ALA H N     1 
ATOM 5763  C CA    . ALA H 4 118 ? 83.54400  103.00600 129.85800 1.000 130.32232 ? 117 ALA H CA    1 
ATOM 5764  C C     . ALA H 4 118 ? 83.58000  103.66900 131.22900 1.000 130.32232 ? 117 ALA H C     1 
ATOM 5765  O O     . ALA H 4 118 ? 83.06200  103.11200 132.20400 1.000 130.32232 ? 117 ALA H O     1 
ATOM 5766  C CB    . ALA H 4 118 ? 84.95900  102.63700 129.41100 1.000 130.32232 ? 117 ALA H CB    1 
ATOM 5767  N N     . VAL H 4 119 ? 84.18900  104.85800 131.29900 1.000 132.99994 ? 118 VAL H N     1 
ATOM 5768  C CA    . VAL H 4 119 ? 84.41400  105.55500 132.56400 1.000 132.99994 ? 118 VAL H CA    1 
ATOM 5769  C C     . VAL H 4 119 ? 83.09400  105.87000 133.26400 1.000 132.99994 ? 118 VAL H C     1 
ATOM 5770  O O     . VAL H 4 119 ? 82.97500  105.69800 134.48500 1.000 132.99994 ? 118 VAL H O     1 
ATOM 5771  C CB    . VAL H 4 119 ? 85.29500  106.80300 132.33400 1.000 132.99994 ? 118 VAL H CB    1 
ATOM 5772  C CG1   . VAL H 4 119 ? 84.71700  107.74100 131.27800 1.000 132.99994 ? 118 VAL H CG1   1 
ATOM 5773  C CG2   . VAL H 4 119 ? 85.54900  107.54100 133.63400 1.000 132.99994 ? 118 VAL H CG2   1 
ATOM 5774  N N     . THR H 4 120 ? 82.06800  106.27200 132.50000 1.000 135.03330 ? 119 THR H N     1 
ATOM 5775  C CA    . THR H 4 120 ? 80.75000  106.55800 133.06000 1.000 135.03330 ? 119 THR H CA    1 
ATOM 5776  C C     . THR H 4 120 ? 80.10700  105.33900 133.71300 1.000 135.03330 ? 119 THR H C     1 
ATOM 5777  O O     . THR H 4 120 ? 79.19000  105.50000 134.52200 1.000 135.03330 ? 119 THR H O     1 
ATOM 5778  C CB    . THR H 4 120 ? 79.81800  107.13500 131.98900 1.000 135.03330 ? 119 THR H CB    1 
ATOM 5779  O OG1   . THR H 4 120 ? 78.67300  107.71400 132.62300 1.000 135.03330 ? 119 THR H OG1   1 
ATOM 5780  C CG2   . THR H 4 120 ? 79.34300  106.06200 131.02200 1.000 135.03330 ? 119 THR H CG2   1 
ATOM 5781  N N     . LYS H 4 121 ? 80.56400  104.13000 133.38800 1.000 138.87912 ? 120 LYS H N     1 
ATOM 5782  C CA    . LYS H 4 121 ? 80.13000  102.95800 134.12600 1.000 138.87912 ? 120 LYS H CA    1 
ATOM 5783  C C     . LYS H 4 121 ? 81.07200  102.65200 135.27500 1.000 138.87912 ? 120 LYS H C     1 
ATOM 5784  O O     . LYS H 4 121 ? 80.62100  102.21100 136.33700 1.000 138.87912 ? 120 LYS H O     1 
ATOM 5785  C CB    . LYS H 4 121 ? 80.02500  101.75200 133.19800 1.000 138.87912 ? 120 LYS H CB    1 
ATOM 5786  C CG    . LYS H 4 121 ? 79.06000  100.70200 133.69400 1.000 138.87912 ? 120 LYS H CG    1 
ATOM 5787  C CD    . LYS H 4 121 ? 79.03000  99.50700  132.76800 1.000 138.87912 ? 120 LYS H CD    1 
ATOM 5788  C CE    . LYS H 4 121 ? 78.50300  99.89800  131.39800 1.000 138.87912 ? 120 LYS H CE    1 
ATOM 5789  N NZ    . LYS H 4 121 ? 78.38200  98.72700  130.48700 1.000 138.87912 ? 120 LYS H NZ    1 
ATOM 5790  N N     . TYR H 4 122 ? 82.37300  102.88200 135.06800 1.000 142.92394 ? 121 TYR H N     1 
ATOM 5791  C CA    . TYR H 4 122 ? 83.36400  102.60300 136.10300 1.000 142.92394 ? 121 TYR H CA    1 
ATOM 5792  C C     . TYR H 4 122 ? 83.16400  103.48600 137.32500 1.000 142.92394 ? 121 TYR H C     1 
ATOM 5793  O O     . TYR H 4 122 ? 83.34000  103.03400 138.46200 1.000 142.92394 ? 121 TYR H O     1 
ATOM 5794  C CB    . TYR H 4 122 ? 84.77000  102.78200 135.54100 1.000 142.92394 ? 121 TYR H CB    1 
ATOM 5795  C CG    . TYR H 4 122 ? 85.84100  102.70600 136.59500 1.000 142.92394 ? 121 TYR H CG    1 
ATOM 5796  C CD1   . TYR H 4 122 ? 86.16000  101.49700 137.19300 1.000 142.92394 ? 121 TYR H CD1   1 
ATOM 5797  C CD2   . TYR H 4 122 ? 86.54000  103.83900 136.98800 1.000 142.92394 ? 121 TYR H CD2   1 
ATOM 5798  C CE1   . TYR H 4 122 ? 87.13700  101.41500 138.15800 1.000 142.92394 ? 121 TYR H CE1   1 
ATOM 5799  C CE2   . TYR H 4 122 ? 87.51900  103.76700 137.95300 1.000 142.92394 ? 121 TYR H CE2   1 
ATOM 5800  C CZ    . TYR H 4 122 ? 87.81300  102.55100 138.53400 1.000 142.92394 ? 121 TYR H CZ    1 
ATOM 5801  O OH    . TYR H 4 122 ? 88.79000  102.46600 139.49700 1.000 142.92394 ? 121 TYR H OH    1 
ATOM 5802  N N     . THR H 4 123 ? 82.79200  104.74000 137.11800 1.000 143.63759 ? 122 THR H N     1 
ATOM 5803  C CA    . THR H 4 123 ? 82.44800  105.59600 138.23700 1.000 143.63759 ? 122 THR H CA    1 
ATOM 5804  C C     . THR H 4 123 ? 80.99600  105.44300 138.65400 1.000 143.63759 ? 122 THR H C     1 
ATOM 5805  O O     . THR H 4 123 ? 80.57800  106.07100 139.63000 1.000 143.63759 ? 122 THR H O     1 
ATOM 5806  C CB    . THR H 4 123 ? 82.72800  107.05600 137.88800 1.000 143.63759 ? 122 THR H CB    1 
ATOM 5807  O OG1   . THR H 4 123 ? 82.00300  107.40600 136.70500 1.000 143.63759 ? 122 THR H OG1   1 
ATOM 5808  C CG2   . THR H 4 123 ? 84.21100  107.26100 137.64900 1.000 143.63759 ? 122 THR H CG2   1 
ATOM 5809  N N     . SER H 4 124 ? 80.22200  104.61800 137.94900 1.000 147.09124 ? 123 SER H N     1 
ATOM 5810  C CA    . SER H 4 124 ? 78.83000  104.41400 138.32000 1.000 147.09124 ? 123 SER H CA    1 
ATOM 5811  C C     . SER H 4 124 ? 78.68700  103.49900 139.52200 1.000 147.09124 ? 123 SER H C     1 
ATOM 5812  O O     . SER H 4 124 ? 77.67700  103.57500 140.22800 1.000 147.09124 ? 123 SER H O     1 
ATOM 5813  C CB    . SER H 4 124 ? 78.04200  103.84000 137.14500 1.000 147.09124 ? 123 SER H CB    1 
ATOM 5814  O OG    . SER H 4 124 ? 76.70300  103.57600 137.52000 1.000 147.09124 ? 123 SER H OG    1 
ATOM 5815  N N     . SER H 4 125 ? 79.67000  102.64300 139.76600 1.000 147.06312 ? 124 SER H N     1 
ATOM 5816  C CA    . SER H 4 125 ? 79.63300  101.72300 140.89000 1.000 147.06312 ? 124 SER H CA    1 
ATOM 5817  C C     . SER H 4 125 ? 80.39700  102.28800 142.08000 1.000 147.06312 ? 124 SER H C     1 
ATOM 5818  O O     . SER H 4 125 ? 81.57600  101.99200 142.26500 1.000 147.06312 ? 124 SER H O     1 
ATOM 5819  C CB    . SER H 4 125 ? 80.21600  100.37100 140.48600 1.000 147.06312 ? 124 SER H CB    1 
ATOM 5820  O OG    . SER H 4 125 ? 81.59100  100.49400 140.17300 1.000 147.06312 ? 124 SER H OG    1 
ATOM 5821  O "O5'" . DA  I 5 1   ? 136.14800 132.41100 64.04400  1.000 400.94642 ? -72 DA  I "O5'" 1 
ATOM 5822  C "C5'" . DA  I 5 1   ? 136.25300 133.62500 64.77700  1.000 400.94642 ? -72 DA  I "C5'" 1 
ATOM 5823  C "C4'" . DA  I 5 1   ? 135.74400 134.79800 63.95700  1.000 400.94642 ? -72 DA  I "C4'" 1 
ATOM 5824  O "O4'" . DA  I 5 1   ? 134.38200 134.53500 63.52500  1.000 400.94642 ? -72 DA  I "O4'" 1 
ATOM 5825  C "C3'" . DA  I 5 1   ? 135.71200 136.14200 64.69700  1.000 400.94642 ? -72 DA  I "C3'" 1 
ATOM 5826  O "O3'" . DA  I 5 1   ? 136.43200 137.13900 63.96100  1.000 400.94642 ? -72 DA  I "O3'" 1 
ATOM 5827  C "C2'" . DA  I 5 1   ? 134.22200 136.47300 64.78700  1.000 400.94642 ? -72 DA  I "C2'" 1 
ATOM 5828  C "C1'" . DA  I 5 1   ? 133.64300 135.72500 63.60100  1.000 400.94642 ? -72 DA  I "C1'" 1 
ATOM 5829  N N9    . DA  I 5 1   ? 132.23300 135.39500 63.78500  1.000 400.94642 ? -72 DA  I N9    1 
ATOM 5830  C C8    . DA  I 5 1   ? 131.69700 134.16300 64.03900  1.000 400.94642 ? -72 DA  I C8    1 
ATOM 5831  N N7    . DA  I 5 1   ? 130.39200 134.17400 64.18600  1.000 400.94642 ? -72 DA  I N7    1 
ATOM 5832  C C5    . DA  I 5 1   ? 130.05100 135.50700 64.03500  1.000 400.94642 ? -72 DA  I C5    1 
ATOM 5833  C C6    . DA  I 5 1   ? 128.81500 136.18700 64.08200  1.000 400.94642 ? -72 DA  I C6    1 
ATOM 5834  N N6    . DA  I 5 1   ? 127.64700 135.57700 64.30500  1.000 400.94642 ? -72 DA  I N6    1 
ATOM 5835  N N1    . DA  I 5 1   ? 128.82600 137.52600 63.88900  1.000 400.94642 ? -72 DA  I N1    1 
ATOM 5836  C C2    . DA  I 5 1   ? 129.99600 138.13700 63.66600  1.000 400.94642 ? -72 DA  I C2    1 
ATOM 5837  N N3    . DA  I 5 1   ? 131.21700 137.60400 63.59600  1.000 400.94642 ? -72 DA  I N3    1 
ATOM 5838  C C4    . DA  I 5 1   ? 131.17400 136.27500 63.79200  1.000 400.94642 ? -72 DA  I C4    1 
ATOM 5839  P P     . DT  I 5 2   ? 137.03900 138.43400 64.70300  1.000 393.62826 ? -71 DT  I P     1 
ATOM 5840  O OP1   . DT  I 5 2   ? 137.86100 139.16900 63.71800  1.000 393.62826 ? -71 DT  I OP1   1 
ATOM 5841  O OP2   . DT  I 5 2   ? 137.64400 137.98300 65.97600  1.000 393.62826 ? -71 DT  I OP2   1 
ATOM 5842  O "O5'" . DT  I 5 2   ? 135.75100 139.32000 65.04800  1.000 393.62826 ? -71 DT  I "O5'" 1 
ATOM 5843  C "C5'" . DT  I 5 2   ? 135.03400 139.96600 64.00100  1.000 393.62826 ? -71 DT  I "C5'" 1 
ATOM 5844  C "C4'" . DT  I 5 2   ? 134.07300 141.01400 64.54000  1.000 393.62826 ? -71 DT  I "C4'" 1 
ATOM 5845  O "O4'" . DT  I 5 2   ? 132.76500 140.41200 64.73600  1.000 393.62826 ? -71 DT  I "O4'" 1 
ATOM 5846  C "C3'" . DT  I 5 2   ? 134.44000 141.65800 65.88100  1.000 393.62826 ? -71 DT  I "C3'" 1 
ATOM 5847  O "O3'" . DT  I 5 2   ? 134.13500 143.05000 65.79700  1.000 393.62826 ? -71 DT  I "O3'" 1 
ATOM 5848  C "C2'" . DT  I 5 2   ? 133.51600 140.93300 66.86400  1.000 393.62826 ? -71 DT  I "C2'" 1 
ATOM 5849  C "C1'" . DT  I 5 2   ? 132.27900 140.77500 66.00700  1.000 393.62826 ? -71 DT  I "C1'" 1 
ATOM 5850  N N1    . DT  I 5 2   ? 131.34000 139.71000 66.46500  1.000 393.62826 ? -71 DT  I N1    1 
ATOM 5851  C C2    . DT  I 5 2   ? 130.01500 140.02000 66.62900  1.000 393.62826 ? -71 DT  I C2    1 
ATOM 5852  O O2    . DT  I 5 2   ? 129.56400 141.13500 66.45200  1.000 393.62826 ? -71 DT  I O2    1 
ATOM 5853  N N3    . DT  I 5 2   ? 129.23000 138.97800 67.03100  1.000 393.62826 ? -71 DT  I N3    1 
ATOM 5854  C C4    . DT  I 5 2   ? 129.61900 137.67700 67.26900  1.000 393.62826 ? -71 DT  I C4    1 
ATOM 5855  O O4    . DT  I 5 2   ? 128.82600 136.81200 67.62500  1.000 393.62826 ? -71 DT  I O4    1 
ATOM 5856  C C5    . DT  I 5 2   ? 131.02000 137.40700 67.06800  1.000 393.62826 ? -71 DT  I C5    1 
ATOM 5857  C C7    . DT  I 5 2   ? 131.55800 136.02500 67.30000  1.000 393.62826 ? -71 DT  I C7    1 
ATOM 5858  C C6    . DT  I 5 2   ? 131.80900 138.42600 66.67900  1.000 393.62826 ? -71 DT  I C6    1 
ATOM 5859  P P     . DC  I 5 3   ? 134.52000 144.08700 66.96300  1.000 380.15340 ? -70 DC  I P     1 
ATOM 5860  O OP1   . DC  I 5 3   ? 135.11400 145.27300 66.30900  1.000 380.15340 ? -70 DC  I OP1   1 
ATOM 5861  O OP2   . DC  I 5 3   ? 135.27900 143.39300 68.02800  1.000 380.15340 ? -70 DC  I OP2   1 
ATOM 5862  O "O5'" . DC  I 5 3   ? 133.09100 144.50300 67.54400  1.000 380.15340 ? -70 DC  I "O5'" 1 
ATOM 5863  C "C5'" . DC  I 5 3   ? 132.13700 145.16800 66.70500  1.000 380.15340 ? -70 DC  I "C5'" 1 
ATOM 5864  C "C4'" . DC  I 5 3   ? 130.88400 145.52500 67.49000  1.000 380.15340 ? -70 DC  I "C4'" 1 
ATOM 5865  O "O4'" . DC  I 5 3   ? 130.15300 144.31700 67.80700  1.000 380.15340 ? -70 DC  I "O4'" 1 
ATOM 5866  C "C3'" . DC  I 5 3   ? 131.10000 146.24600 68.82200  1.000 380.15340 ? -70 DC  I "C3'" 1 
ATOM 5867  O "O3'" . DC  I 5 3   ? 130.11500 147.26900 68.95600  1.000 380.15340 ? -70 DC  I "O3'" 1 
ATOM 5868  C "C2'" . DC  I 5 3   ? 130.88900 145.13200 69.84800  1.000 380.15340 ? -70 DC  I "C2'" 1 
ATOM 5869  C "C1'" . DC  I 5 3   ? 129.79100 144.34400 69.16700  1.000 380.15340 ? -70 DC  I "C1'" 1 
ATOM 5870  N N1    . DC  I 5 3   ? 129.66900 142.94500 69.61600  1.000 380.15340 ? -70 DC  I N1    1 
ATOM 5871  C C2    . DC  I 5 3   ? 128.42400 142.46200 70.00600  1.000 380.15340 ? -70 DC  I C2    1 
ATOM 5872  O O2    . DC  I 5 3   ? 127.46300 143.23600 70.02400  1.000 380.15340 ? -70 DC  I O2    1 
ATOM 5873  N N3    . DC  I 5 3   ? 128.31400 141.16900 70.38700  1.000 380.15340 ? -70 DC  I N3    1 
ATOM 5874  C C4    . DC  I 5 3   ? 129.38000 140.36900 70.35700  1.000 380.15340 ? -70 DC  I C4    1 
ATOM 5875  N N4    . DC  I 5 3   ? 129.21900 139.09900 70.73600  1.000 380.15340 ? -70 DC  I N4    1 
ATOM 5876  C C5    . DC  I 5 3   ? 130.65800 140.83800 69.93500  1.000 380.15340 ? -70 DC  I C5    1 
ATOM 5877  C C6    . DC  I 5 3   ? 130.75300 142.12000 69.56700  1.000 380.15340 ? -70 DC  I C6    1 
ATOM 5878  P P     . DA  I 5 4   ? 130.48600 148.72100 69.53100  1.000 367.96481 ? -69 DA  I P     1 
ATOM 5879  O OP1   . DA  I 5 4   ? 130.67500 149.63200 68.38200  1.000 367.96481 ? -69 DA  I OP1   1 
ATOM 5880  O OP2   . DA  I 5 4   ? 131.56500 148.53800 70.52700  1.000 367.96481 ? -69 DA  I OP2   1 
ATOM 5881  O "O5'" . DA  I 5 4   ? 129.16100 149.15000 70.31800  1.000 367.96481 ? -69 DA  I "O5'" 1 
ATOM 5882  C "C5'" . DA  I 5 4   ? 128.02400 149.69100 69.62600  1.000 367.96481 ? -69 DA  I "C5'" 1 
ATOM 5883  C "C4'" . DA  I 5 4   ? 126.71100 149.49600 70.41000  1.000 367.96481 ? -69 DA  I "C4'" 1 
ATOM 5884  O "O4'" . DA  I 5 4   ? 126.59500 148.12900 70.87400  1.000 367.96481 ? -69 DA  I "O4'" 1 
ATOM 5885  C "C3'" . DA  I 5 4   ? 126.50200 150.32700 71.66900  1.000 367.96481 ? -69 DA  I "C3'" 1 
ATOM 5886  O "O3'" . DA  I 5 4   ? 125.11100 150.39200 71.92000  1.000 367.96481 ? -69 DA  I "O3'" 1 
ATOM 5887  C "C2'" . DA  I 5 4   ? 127.17100 149.46500 72.72900  1.000 367.96481 ? -69 DA  I "C2'" 1 
ATOM 5888  C "C1'" . DA  I 5 4   ? 126.69300 148.08600 72.29600  1.000 367.96481 ? -69 DA  I "C1'" 1 
ATOM 5889  N N9    . DA  I 5 4   ? 127.59000 146.99200 72.62000  1.000 367.96481 ? -69 DA  I N9    1 
ATOM 5890  C C8    . DA  I 5 4   ? 128.94800 146.95800 72.47600  1.000 367.96481 ? -69 DA  I C8    1 
ATOM 5891  N N7    . DA  I 5 4   ? 129.48300 145.80500 72.79300  1.000 367.96481 ? -69 DA  I N7    1 
ATOM 5892  C C5    . DA  I 5 4   ? 128.39600 145.01900 73.12500  1.000 367.96481 ? -69 DA  I C5    1 
ATOM 5893  C C6    . DA  I 5 4   ? 128.28200 143.68300 73.54500  1.000 367.96481 ? -69 DA  I C6    1 
ATOM 5894  N N6    . DA  I 5 4   ? 129.32800 142.86400 73.70200  1.000 367.96481 ? -69 DA  I N6    1 
ATOM 5895  N N1    . DA  I 5 4   ? 127.04300 143.21500 73.79700  1.000 367.96481 ? -69 DA  I N1    1 
ATOM 5896  C C2    . DA  I 5 4   ? 125.99600 144.03000 73.64100  1.000 367.96481 ? -69 DA  I C2    1 
ATOM 5897  N N3    . DA  I 5 4   ? 125.98000 145.29700 73.25100  1.000 367.96481 ? -69 DA  I N3    1 
ATOM 5898  C C4    . DA  I 5 4   ? 127.22300 145.73500 73.00800  1.000 367.96481 ? -69 DA  I C4    1 
ATOM 5899  P P     . DG  I 5 5   ? 124.42400 151.70100 72.54000  1.000 358.95229 ? -68 DG  I P     1 
ATOM 5900  O OP1   . DG  I 5 5   ? 123.65200 152.37000 71.47000  1.000 358.95229 ? -68 DG  I OP1   1 
ATOM 5901  O OP2   . DG  I 5 5   ? 125.46300 152.44500 73.28700  1.000 358.95229 ? -68 DG  I OP2   1 
ATOM 5902  O "O5'" . DG  I 5 5   ? 123.41300 151.08100 73.61300  1.000 358.95229 ? -68 DG  I "O5'" 1 
ATOM 5903  C "C5'" . DG  I 5 5   ? 122.27800 150.29600 73.19500  1.000 358.95229 ? -68 DG  I "C5'" 1 
ATOM 5904  C "C4'" . DG  I 5 5   ? 121.63500 149.48100 74.34200  1.000 358.95229 ? -68 DG  I "C4'" 1 
ATOM 5905  O "O4'" . DG  I 5 5   ? 122.50400 148.40700 74.78400  1.000 358.95229 ? -68 DG  I "O4'" 1 
ATOM 5906  C "C3'" . DG  I 5 5   ? 121.26900 150.22500 75.61800  1.000 358.95229 ? -68 DG  I "C3'" 1 
ATOM 5907  O "O3'" . DG  I 5 5   ? 120.21500 149.53000 76.27000  1.000 358.95229 ? -68 DG  I "O3'" 1 
ATOM 5908  C "C2'" . DG  I 5 5   ? 122.54800 150.09900 76.43500  1.000 358.95229 ? -68 DG  I "C2'" 1 
ATOM 5909  C "C1'" . DG  I 5 5   ? 122.97000 148.67000 76.10300  1.000 358.95229 ? -68 DG  I "C1'" 1 
ATOM 5910  N N9    . DG  I 5 5   ? 124.40400 148.43400 76.11600  1.000 358.95229 ? -68 DG  I N9    1 
ATOM 5911  C C8    . DG  I 5 5   ? 125.40000 149.33100 75.82900  1.000 358.95229 ? -68 DG  I C8    1 
ATOM 5912  N N7    . DG  I 5 5   ? 126.59400 148.81100 75.88800  1.000 358.95229 ? -68 DG  I N7    1 
ATOM 5913  C C5    . DG  I 5 5   ? 126.36900 147.47700 76.19000  1.000 358.95229 ? -68 DG  I C5    1 
ATOM 5914  C C6    . DG  I 5 5   ? 127.28500 146.41700 76.37000  1.000 358.95229 ? -68 DG  I C6    1 
ATOM 5915  O O6    . DG  I 5 5   ? 128.52100 146.44200 76.28900  1.000 358.95229 ? -68 DG  I O6    1 
ATOM 5916  N N1    . DG  I 5 5   ? 126.63500 145.22900 76.67500  1.000 358.95229 ? -68 DG  I N1    1 
ATOM 5917  C C2    . DG  I 5 5   ? 125.27500 145.08000 76.79000  1.000 358.95229 ? -68 DG  I C2    1 
ATOM 5918  N N2    . DG  I 5 5   ? 124.83500 143.85200 77.09600  1.000 358.95229 ? -68 DG  I N2    1 
ATOM 5919  N N3    . DG  I 5 5   ? 124.40900 146.06500 76.62600  1.000 358.95229 ? -68 DG  I N3    1 
ATOM 5920  C C4    . DG  I 5 5   ? 125.02600 147.23100 76.32800  1.000 358.95229 ? -68 DG  I C4    1 
ATOM 5921  P P     . DA  I 5 6   ? 118.77100 150.20400 76.43400  1.000 348.05175 ? -67 DA  I P     1 
ATOM 5922  O OP1   . DA  I 5 6   ? 118.08800 150.11900 75.12500  1.000 348.05175 ? -67 DA  I OP1   1 
ATOM 5923  O OP2   . DA  I 5 6   ? 118.97000 151.51700 77.08500  1.000 348.05175 ? -67 DA  I OP2   1 
ATOM 5924  O "O5'" . DA  I 5 6   ? 118.00100 149.25200 77.46700  1.000 348.05175 ? -67 DA  I "O5'" 1 
ATOM 5925  C "C5'" . DA  I 5 6   ? 118.47300 149.11600 78.81100  1.000 348.05175 ? -67 DA  I "C5'" 1 
ATOM 5926  C "C4'" . DA  I 5 6   ? 118.78300 147.66800 79.16500  1.000 348.05175 ? -67 DA  I "C4'" 1 
ATOM 5927  O "O4'" . DA  I 5 6   ? 120.16700 147.33900 78.87200  1.000 348.05175 ? -67 DA  I "O4'" 1 
ATOM 5928  C "C3'" . DA  I 5 6   ? 118.63900 147.35600 80.63800  1.000 348.05175 ? -67 DA  I "C3'" 1 
ATOM 5929  O "O3'" . DA  I 5 6   ? 118.47900 145.96300 80.82100  1.000 348.05175 ? -67 DA  I "O3'" 1 
ATOM 5930  C "C2'" . DA  I 5 6   ? 119.99000 147.79900 81.16200  1.000 348.05175 ? -67 DA  I "C2'" 1 
ATOM 5931  C "C1'" . DA  I 5 6   ? 120.88700 147.19700 80.09400  1.000 348.05175 ? -67 DA  I "C1'" 1 
ATOM 5932  N N9    . DA  I 5 6   ? 122.18600 147.82700 79.94200  1.000 348.05175 ? -67 DA  I N9    1 
ATOM 5933  C C8    . DA  I 5 6   ? 122.43200 149.13200 79.66200  1.000 348.05175 ? -67 DA  I C8    1 
ATOM 5934  N N7    . DA  I 5 6   ? 123.70400 149.41100 79.51200  1.000 348.05175 ? -67 DA  I N7    1 
ATOM 5935  C C5    . DA  I 5 6   ? 124.33200 148.19500 79.68600  1.000 348.05175 ? -67 DA  I C5    1 
ATOM 5936  C C6    . DA  I 5 6   ? 125.68400 147.81700 79.65500  1.000 348.05175 ? -67 DA  I C6    1 
ATOM 5937  N N6    . DA  I 5 6   ? 126.67300 148.67900 79.42500  1.000 348.05175 ? -67 DA  I N6    1 
ATOM 5938  N N1    . DA  I 5 6   ? 125.98000 146.51900 79.88000  1.000 348.05175 ? -67 DA  I N1    1 
ATOM 5939  C C2    . DA  I 5 6   ? 124.98000 145.66000 80.11600  1.000 348.05175 ? -67 DA  I C2    1 
ATOM 5940  N N3    . DA  I 5 6   ? 123.66900 145.90100 80.16500  1.000 348.05175 ? -67 DA  I N3    1 
ATOM 5941  C C4    . DA  I 5 6   ? 123.41200 147.20100 79.93800  1.000 348.05175 ? -67 DA  I C4    1 
ATOM 5942  P P     . DA  I 5 7   ? 117.86400 145.40900 82.19300  1.000 323.57573 ? -66 DA  I P     1 
ATOM 5943  O OP1   . DA  I 5 7   ? 116.78200 144.48700 81.80300  1.000 323.57573 ? -66 DA  I OP1   1 
ATOM 5944  O OP2   . DA  I 5 7   ? 117.58400 146.54900 83.09400  1.000 323.57573 ? -66 DA  I OP2   1 
ATOM 5945  O "O5'" . DA  I 5 7   ? 119.03200 144.52000 82.83100  1.000 323.57573 ? -66 DA  I "O5'" 1 
ATOM 5946  C "C5'" . DA  I 5 7   ? 119.56800 143.39800 82.12700  1.000 323.57573 ? -66 DA  I "C5'" 1 
ATOM 5947  C "C4'" . DA  I 5 7   ? 120.63100 142.65200 82.94800  1.000 323.57573 ? -66 DA  I "C4'" 1 
ATOM 5948  O "O4'" . DA  I 5 7   ? 121.95300 143.22100 82.77500  1.000 323.57573 ? -66 DA  I "O4'" 1 
ATOM 5949  C "C3'" . DA  I 5 7   ? 120.38000 142.59600 84.45000  1.000 323.57573 ? -66 DA  I "C3'" 1 
ATOM 5950  O "O3'" . DA  I 5 7   ? 120.83600 141.34900 84.96900  1.000 323.57573 ? -66 DA  I "O3'" 1 
ATOM 5951  C "C2'" . DA  I 5 7   ? 121.23500 143.76900 84.97300  1.000 323.57573 ? -66 DA  I "C2'" 1 
ATOM 5952  C "C1'" . DA  I 5 7   ? 122.39100 143.83400 83.97400  1.000 323.57573 ? -66 DA  I "C1'" 1 
ATOM 5953  N N9    . DA  I 5 7   ? 122.83000 145.18400 83.65400  1.000 323.57573 ? -66 DA  I N9    1 
ATOM 5954  C C8    . DA  I 5 7   ? 122.04200 146.26500 83.42200  1.000 323.57573 ? -66 DA  I C8    1 
ATOM 5955  N N7    . DA  I 5 7   ? 122.70700 147.35900 83.14100  1.000 323.57573 ? -66 DA  I N7    1 
ATOM 5956  C C5    . DA  I 5 7   ? 124.02500 146.95900 83.17600  1.000 323.57573 ? -66 DA  I C5    1 
ATOM 5957  C C6    . DA  I 5 7   ? 125.22800 147.64700 82.95300  1.000 323.57573 ? -66 DA  I C6    1 
ATOM 5958  N N6    . DA  I 5 7   ? 125.28600 148.94500 82.64500  1.000 323.57573 ? -66 DA  I N6    1 
ATOM 5959  N N1    . DA  I 5 7   ? 126.37400 146.94900 83.05900  1.000 323.57573 ? -66 DA  I N1    1 
ATOM 5960  C C2    . DA  I 5 7   ? 126.31200 145.65100 83.36700  1.000 323.57573 ? -66 DA  I C2    1 
ATOM 5961  N N3    . DA  I 5 7   ? 125.24300 144.89700 83.59800  1.000 323.57573 ? -66 DA  I N3    1 
ATOM 5962  C C4    . DA  I 5 7   ? 124.12100 145.61800 83.48300  1.000 323.57573 ? -66 DA  I C4    1 
ATOM 5963  P P     . DT  I 5 8   ? 120.92200 141.09400 86.55500  1.000 311.93242 ? -65 DT  I P     1 
ATOM 5964  O OP1   . DT  I 5 8   ? 120.79500 139.63000 86.70900  1.000 311.93242 ? -65 DT  I OP1   1 
ATOM 5965  O OP2   . DT  I 5 8   ? 119.97700 141.96200 87.29500  1.000 311.93242 ? -65 DT  I OP2   1 
ATOM 5966  O "O5'" . DT  I 5 8   ? 122.42600 141.46600 86.93500  1.000 311.93242 ? -65 DT  I "O5'" 1 
ATOM 5967  C "C5'" . DT  I 5 8   ? 123.48800 140.90800 86.19200  1.000 311.93242 ? -65 DT  I "C5'" 1 
ATOM 5968  C "C4'" . DT  I 5 8   ? 124.82900 141.33700 86.75400  1.000 311.93242 ? -65 DT  I "C4'" 1 
ATOM 5969  O "O4'" . DT  I 5 8   ? 125.19200 142.65500 86.27500  1.000 311.93242 ? -65 DT  I "O4'" 1 
ATOM 5970  C "C3'" . DT  I 5 8   ? 124.89100 141.38600 88.27800  1.000 311.93242 ? -65 DT  I "C3'" 1 
ATOM 5971  O "O3'" . DT  I 5 8   ? 126.08500 140.76800 88.72100  1.000 311.93242 ? -65 DT  I "O3'" 1 
ATOM 5972  C "C2'" . DT  I 5 8   ? 124.88600 142.89700 88.57500  1.000 311.93242 ? -65 DT  I "C2'" 1 
ATOM 5973  C "C1'" . DT  I 5 8   ? 125.59600 143.46200 87.35500  1.000 311.93242 ? -65 DT  I "C1'" 1 
ATOM 5974  N N1    . DT  I 5 8   ? 125.25600 144.87500 87.03400  1.000 311.93242 ? -65 DT  I N1    1 
ATOM 5975  C C2    . DT  I 5 8   ? 126.27400 145.75700 86.76500  1.000 311.93242 ? -65 DT  I C2    1 
ATOM 5976  O O2    . DT  I 5 8   ? 127.44700 145.43500 86.75000  1.000 311.93242 ? -65 DT  I O2    1 
ATOM 5977  N N3    . DT  I 5 8   ? 125.86900 147.02900 86.46700  1.000 311.93242 ? -65 DT  I N3    1 
ATOM 5978  C C4    . DT  I 5 8   ? 124.57600 147.50400 86.44200  1.000 311.93242 ? -65 DT  I C4    1 
ATOM 5979  O O4    . DT  I 5 8   ? 124.31400 148.67000 86.17300  1.000 311.93242 ? -65 DT  I O4    1 
ATOM 5980  C C5    . DT  I 5 8   ? 123.55500 146.53200 86.75300  1.000 311.93242 ? -65 DT  I C5    1 
ATOM 5981  C C7    . DT  I 5 8   ? 122.11100 146.93600 86.77200  1.000 311.93242 ? -65 DT  I C7    1 
ATOM 5982  C C6    . DT  I 5 8   ? 123.94000 145.27800 87.03400  1.000 311.93242 ? -65 DT  I C6    1 
ATOM 5983  P P     . DC  I 5 9   ? 126.42200 140.65200 90.28700  1.000 302.98414 ? -64 DC  I P     1 
ATOM 5984  O OP1   . DC  I 5 9   ? 127.09000 139.34600 90.46400  1.000 302.98414 ? -64 DC  I OP1   1 
ATOM 5985  O OP2   . DC  I 5 9   ? 125.23100 140.95500 91.11300  1.000 302.98414 ? -64 DC  I OP2   1 
ATOM 5986  O "O5'" . DC  I 5 9   ? 127.51600 141.78700 90.50500  1.000 302.98414 ? -64 DC  I "O5'" 1 
ATOM 5987  C "C5'" . DC  I 5 9   ? 128.40500 142.11500 89.44600  1.000 302.98414 ? -64 DC  I "C5'" 1 
ATOM 5988  C "C4'" . DC  I 5 9   ? 129.67400 142.77900 89.95700  1.000 302.98414 ? -64 DC  I "C4'" 1 
ATOM 5989  O "O4'" . DC  I 5 9   ? 129.67600 144.18400 89.62400  1.000 302.98414 ? -64 DC  I "O4'" 1 
ATOM 5990  C "C3'" . DC  I 5 9   ? 129.89400 142.71500 91.45900  1.000 302.98414 ? -64 DC  I "C3'" 1 
ATOM 5991  O "O3'" . DC  I 5 9   ? 131.28200 142.70100 91.72700  1.000 302.98414 ? -64 DC  I "O3'" 1 
ATOM 5992  C "C2'" . DC  I 5 9   ? 129.24100 144.01200 91.95800  1.000 302.98414 ? -64 DC  I "C2'" 1 
ATOM 5993  C "C1'" . DC  I 5 9   ? 129.41100 144.96200 90.77500  1.000 302.98414 ? -64 DC  I "C1'" 1 
ATOM 5994  N N1    . DC  I 5 9   ? 128.22700 145.81900 90.50800  1.000 302.98414 ? -64 DC  I N1    1 
ATOM 5995  C C2    . DC  I 5 9   ? 128.42800 147.15000 90.16600  1.000 302.98414 ? -64 DC  I C2    1 
ATOM 5996  O O2    . DC  I 5 9   ? 129.57800 147.57100 90.09300  1.000 302.98414 ? -64 DC  I O2    1 
ATOM 5997  N N3    . DC  I 5 9   ? 127.35900 147.94000 89.91700  1.000 302.98414 ? -64 DC  I N3    1 
ATOM 5998  C C4    . DC  I 5 9   ? 126.13100 147.43500 90.00400  1.000 302.98414 ? -64 DC  I C4    1 
ATOM 5999  N N4    . DC  I 5 9   ? 125.10400 148.25000 89.75100  1.000 302.98414 ? -64 DC  I N4    1 
ATOM 6000  C C5    . DC  I 5 9   ? 125.90100 146.07200 90.35600  1.000 302.98414 ? -64 DC  I C5    1 
ATOM 6001  C C6    . DC  I 5 9   ? 126.97000 145.30600 90.59800  1.000 302.98414 ? -64 DC  I C6    1 
ATOM 6002  P P     . DC  I 5 10  ? 131.82400 142.64000 93.23700  1.000 288.66712 ? -63 DC  I P     1 
ATOM 6003  O OP1   . DC  I 5 10  ? 133.11400 141.91900 93.19100  1.000 288.66712 ? -63 DC  I OP1   1 
ATOM 6004  O OP2   . DC  I 5 10  ? 130.75600 142.14100 94.13000  1.000 288.66712 ? -63 DC  I OP2   1 
ATOM 6005  O "O5'" . DC  I 5 10  ? 132.13400 144.16600 93.58600  1.000 288.66712 ? -63 DC  I "O5'" 1 
ATOM 6006  C "C5'" . DC  I 5 10  ? 132.92500 144.92900 92.69400  1.000 288.66712 ? -63 DC  I "C5'" 1 
ATOM 6007  C "C4'" . DC  I 5 10  ? 132.93500 146.39700 93.07300  1.000 288.66712 ? -63 DC  I "C4'" 1 
ATOM 6008  O "O4'" . DC  I 5 10  ? 131.71700 147.05100 92.64400  1.000 288.66712 ? -63 DC  I "O4'" 1 
ATOM 6009  C "C3'" . DC  I 5 10  ? 133.08100 146.66200 94.57300  1.000 288.66712 ? -63 DC  I "C3'" 1 
ATOM 6010  O "O3'" . DC  I 5 10  ? 134.20400 147.50400 94.79000  1.000 288.66712 ? -63 DC  I "O3'" 1 
ATOM 6011  C "C2'" . DC  I 5 10  ? 131.75500 147.35100 94.95100  1.000 288.66712 ? -63 DC  I "C2'" 1 
ATOM 6012  C "C1'" . DC  I 5 10  ? 131.32000 147.96400 93.63300  1.000 288.66712 ? -63 DC  I "C1'" 1 
ATOM 6013  N N1    . DC  I 5 10  ? 129.85500 148.19000 93.51200  1.000 288.66712 ? -63 DC  I N1    1 
ATOM 6014  C C2    . DC  I 5 10  ? 129.38400 149.46600 93.20600  1.000 288.66712 ? -63 DC  I C2    1 
ATOM 6015  O O2    . DC  I 5 10  ? 130.19900 150.37900 93.05800  1.000 288.66712 ? -63 DC  I O2    1 
ATOM 6016  N N3    . DC  I 5 10  ? 128.05000 149.66300 93.08700  1.000 288.66712 ? -63 DC  I N3    1 
ATOM 6017  C C4    . DC  I 5 10  ? 127.20900 148.64400 93.25800  1.000 288.66712 ? -63 DC  I C4    1 
ATOM 6018  N N4    . DC  I 5 10  ? 125.90000 148.88100 93.13100  1.000 288.66712 ? -63 DC  I N4    1 
ATOM 6019  C C5    . DC  I 5 10  ? 127.67300 147.33300 93.56800  1.000 288.66712 ? -63 DC  I C5    1 
ATOM 6020  C C6    . DC  I 5 10  ? 128.99100 147.15400 93.68400  1.000 288.66712 ? -63 DC  I C6    1 
ATOM 6021  P P     . DC  I 5 11  ? 134.55800 148.07400 96.25000  1.000 271.03282 ? -62 DC  I P     1 
ATOM 6022  O OP1   . DC  I 5 11  ? 136.02600 148.24000 96.27100  1.000 271.03282 ? -62 DC  I OP1   1 
ATOM 6023  O OP2   . DC  I 5 11  ? 133.92500 147.26000 97.31200  1.000 271.03282 ? -62 DC  I OP2   1 
ATOM 6024  O "O5'" . DC  I 5 11  ? 133.91100 149.52700 96.23600  1.000 271.03282 ? -62 DC  I "O5'" 1 
ATOM 6025  C "C5'" . DC  I 5 11  ? 134.22600 150.42200 95.17900  1.000 271.03282 ? -62 DC  I "C5'" 1 
ATOM 6026  C "C4'" . DC  I 5 11  ? 133.88100 151.86100 95.53400  1.000 271.03282 ? -62 DC  I "C4'" 1 
ATOM 6027  O "O4'" . DC  I 5 11  ? 132.49600 152.13200 95.21100  1.000 271.03282 ? -62 DC  I "O4'" 1 
ATOM 6028  C "C3'" . DC  I 5 11  ? 134.05600 152.23600 97.00200  1.000 271.03282 ? -62 DC  I "C3'" 1 
ATOM 6029  O "O3'" . DC  I 5 11  ? 134.53800 153.55600 97.09900  1.000 271.03282 ? -62 DC  I "O3'" 1 
ATOM 6030  C "C2'" . DC  I 5 11  ? 132.64000 152.12000 97.56700  1.000 271.03282 ? -62 DC  I "C2'" 1 
ATOM 6031  C "C1'" . DC  I 5 11  ? 131.78400 152.50500 96.37200  1.000 271.03282 ? -62 DC  I "C1'" 1 
ATOM 6032  N N1    . DC  I 5 11  ? 130.46400 151.83300 96.34300  1.000 271.03282 ? -62 DC  I N1    1 
ATOM 6033  C C2    . DC  I 5 11  ? 129.32700 152.59300 96.09700  1.000 271.03282 ? -62 DC  I C2    1 
ATOM 6034  O O2    . DC  I 5 11  ? 129.45400 153.80700 95.92300  1.000 271.03282 ? -62 DC  I O2    1 
ATOM 6035  N N3    . DC  I 5 11  ? 128.12200 151.98200 96.07300  1.000 271.03282 ? -62 DC  I N3    1 
ATOM 6036  C C4    . DC  I 5 11  ? 128.03900 150.66900 96.27500  1.000 271.03282 ? -62 DC  I C4    1 
ATOM 6037  N N4    . DC  I 5 11  ? 126.82900 150.10800 96.23800  1.000 271.03282 ? -62 DC  I N4    1 
ATOM 6038  C C5    . DC  I 5 11  ? 129.19300 149.87300 96.53100  1.000 271.03282 ? -62 DC  I C5    1 
ATOM 6039  C C6    . DC  I 5 11  ? 130.37500 150.49100 96.55000  1.000 271.03282 ? -62 DC  I C6    1 
ATOM 6040  P P     . DG  I 5 12  ? 135.09100 154.11100 98.50000  1.000 255.03519 ? -61 DG  I P     1 
ATOM 6041  O OP1   . DG  I 5 12  ? 136.32400 154.87400 98.20600  1.000 255.03519 ? -61 DG  I OP1   1 
ATOM 6042  O OP2   . DG  I 5 12  ? 135.14100 152.99700 99.47200  1.000 255.03519 ? -61 DG  I OP2   1 
ATOM 6043  O "O5'" . DG  I 5 12  ? 133.96400 155.14000 98.97000  1.000 255.03519 ? -61 DG  I "O5'" 1 
ATOM 6044  C "C5'" . DG  I 5 12  ? 133.60600 156.21000 98.11600  1.000 255.03519 ? -61 DG  I "C5'" 1 
ATOM 6045  C "C4'" . DG  I 5 12  ? 132.24000 156.76300 98.46700  1.000 255.03519 ? -61 DG  I "C4'" 1 
ATOM 6046  O "O4'" . DG  I 5 12  ? 131.21800 155.79700 98.15400  1.000 255.03519 ? -61 DG  I "O4'" 1 
ATOM 6047  C "C3'" . DG  I 5 12  ? 132.05600 157.12300 99.94100  1.000 255.03519 ? -61 DG  I "C3'" 1 
ATOM 6048  O "O3'" . DG  I 5 12  ? 131.85400 158.52200 100.05700 1.000 255.03519 ? -61 DG  I "O3'" 1 
ATOM 6049  C "C2'" . DG  I 5 12  ? 130.81900 156.32000 100.38700 1.000 255.03519 ? -61 DG  I "C2'" 1 
ATOM 6050  C "C1'" . DG  I 5 12  ? 130.16700 155.94600 99.06900  1.000 255.03519 ? -61 DG  I "C1'" 1 
ATOM 6051  N N9    . DG  I 5 12  ? 129.42900 154.69600 99.11300  1.000 255.03519 ? -61 DG  I N9    1 
ATOM 6052  C C8    . DG  I 5 12  ? 129.94300 153.43900 99.28700  1.000 255.03519 ? -61 DG  I C8    1 
ATOM 6053  N N7    . DG  I 5 12  ? 129.04300 152.50200 99.26100  1.000 255.03519 ? -61 DG  I N7    1 
ATOM 6054  C C5    . DG  I 5 12  ? 127.85700 153.18500 99.05300  1.000 255.03519 ? -61 DG  I C5    1 
ATOM 6055  C C6    . DG  I 5 12  ? 126.54500 152.69800 98.93100  1.000 255.03519 ? -61 DG  I C6    1 
ATOM 6056  O O6    . DG  I 5 12  ? 126.15700 151.53000 98.99200  1.000 255.03519 ? -61 DG  I O6    1 
ATOM 6057  N N1    . DG  I 5 12  ? 125.63400 153.72300 98.73000  1.000 255.03519 ? -61 DG  I N1    1 
ATOM 6058  C C2    . DG  I 5 12  ? 125.95600 155.05200 98.64300  1.000 255.03519 ? -61 DG  I C2    1 
ATOM 6059  N N2    . DG  I 5 12  ? 124.94300 155.90200 98.44600  1.000 255.03519 ? -61 DG  I N2    1 
ATOM 6060  N N3    . DG  I 5 12  ? 127.18600 155.52200 98.75500  1.000 255.03519 ? -61 DG  I N3    1 
ATOM 6061  C C4    . DG  I 5 12  ? 128.08100 154.53400 98.95100  1.000 255.03519 ? -61 DG  I C4    1 
ATOM 6062  P P     . DG  I 5 13  ? 131.66300 159.21200 101.49300 1.000 245.17274 ? -60 DG  I P     1 
ATOM 6063  O OP1   . DG  I 5 13  ? 132.14900 160.60400 101.38100 1.000 245.17274 ? -60 DG  I OP1   1 
ATOM 6064  O OP2   . DG  I 5 13  ? 132.22700 158.33000 102.53800 1.000 245.17274 ? -60 DG  I OP2   1 
ATOM 6065  O "O5'" . DG  I 5 13  ? 130.08300 159.25400 101.66000 1.000 245.17274 ? -60 DG  I "O5'" 1 
ATOM 6066  C "C5'" . DG  I 5 13  ? 129.28900 159.75700 100.60400 1.000 245.17274 ? -60 DG  I "C5'" 1 
ATOM 6067  C "C4'" . DG  I 5 13  ? 127.83700 159.73500 100.99700 1.000 245.17274 ? -60 DG  I "C4'" 1 
ATOM 6068  O "O4'" . DG  I 5 13  ? 127.30100 158.41600 100.76000 1.000 245.17274 ? -60 DG  I "O4'" 1 
ATOM 6069  C "C3'" . DG  I 5 13  ? 127.58800 160.05200 102.46600 1.000 245.17274 ? -60 DG  I "C3'" 1 
ATOM 6070  O "O3'" . DG  I 5 13  ? 126.64900 161.09800 102.58400 1.000 245.17274 ? -60 DG  I "O3'" 1 
ATOM 6071  C "C2'" . DG  I 5 13  ? 127.06800 158.74200 103.05400 1.000 245.17274 ? -60 DG  I "C2'" 1 
ATOM 6072  C "C1'" . DG  I 5 13  ? 126.50000 158.03000 101.84300 1.000 245.17274 ? -60 DG  I "C1'" 1 
ATOM 6073  N N9    . DG  I 5 13  ? 126.56400 156.57800 101.93200 1.000 245.17274 ? -60 DG  I N9    1 
ATOM 6074  C C8    . DG  I 5 13  ? 127.69200 155.80600 102.04600 1.000 245.17274 ? -60 DG  I C8    1 
ATOM 6075  N N7    . DG  I 5 13  ? 127.44200 154.52800 102.08000 1.000 245.17274 ? -60 DG  I N7    1 
ATOM 6076  C C5    . DG  I 5 13  ? 126.06300 154.45100 101.96200 1.000 245.17274 ? -60 DG  I C5    1 
ATOM 6077  C C6    . DG  I 5 13  ? 125.21300 153.32300 101.93400 1.000 245.17274 ? -60 DG  I C6    1 
ATOM 6078  O O6    . DG  I 5 13  ? 125.52200 152.12800 102.00700 1.000 245.17274 ? -60 DG  I O6    1 
ATOM 6079  N N1    . DG  I 5 13  ? 123.87800 153.68900 101.80300 1.000 245.17274 ? -60 DG  I N1    1 
ATOM 6080  C C2    . DG  I 5 13  ? 123.42900 154.97800 101.71400 1.000 245.17274 ? -60 DG  I C2    1 
ATOM 6081  N N2    . DG  I 5 13  ? 122.11100 155.13300 101.59400 1.000 245.17274 ? -60 DG  I N2    1 
ATOM 6082  N N3    . DG  I 5 13  ? 124.21200 156.04200 101.74000 1.000 245.17274 ? -60 DG  I N3    1 
ATOM 6083  C C4    . DG  I 5 13  ? 125.51100 155.70400 101.86900 1.000 245.17274 ? -60 DG  I C4    1 
ATOM 6084  P P     . DT  I 5 14  ? 126.47400 161.86700 103.98200 1.000 230.94749 ? -59 DT  I P     1 
ATOM 6085  O OP1   . DT  I 5 14  ? 126.29200 163.30400 103.68500 1.000 230.94749 ? -59 DT  I OP1   1 
ATOM 6086  O OP2   . DT  I 5 14  ? 127.56300 161.43800 104.88800 1.000 230.94749 ? -59 DT  I OP2   1 
ATOM 6087  O "O5'" . DT  I 5 14  ? 125.10200 161.28200 104.54200 1.000 230.94749 ? -59 DT  I "O5'" 1 
ATOM 6088  C "C5'" . DT  I 5 14  ? 123.97600 161.23600 103.69000 1.000 230.94749 ? -59 DT  I "C5'" 1 
ATOM 6089  C "C4'" . DT  I 5 14  ? 122.89300 160.36800 104.28500 1.000 230.94749 ? -59 DT  I "C4'" 1 
ATOM 6090  O "O4'" . DT  I 5 14  ? 123.20300 158.97900 104.04600 1.000 230.94749 ? -59 DT  I "O4'" 1 
ATOM 6091  C "C3'" . DT  I 5 14  ? 122.71200 160.52200 105.79400 1.000 230.94749 ? -59 DT  I "C3'" 1 
ATOM 6092  O "O3'" . DT  I 5 14  ? 121.38700 160.96900 106.07200 1.000 230.94749 ? -59 DT  I "O3'" 1 
ATOM 6093  C "C2'" . DT  I 5 14  ? 122.97700 159.11700 106.35100 1.000 230.94749 ? -59 DT  I "C2'" 1 
ATOM 6094  C "C1'" . DT  I 5 14  ? 122.77600 158.22000 105.14000 1.000 230.94749 ? -59 DT  I "C1'" 1 
ATOM 6095  N N1    . DT  I 5 14  ? 123.58000 156.96400 105.17700 1.000 230.94749 ? -59 DT  I N1    1 
ATOM 6096  C C2    . DT  I 5 14  ? 122.94000 155.75300 105.07800 1.000 230.94749 ? -59 DT  I C2    1 
ATOM 6097  O O2    . DT  I 5 14  ? 121.73700 155.64500 104.94100 1.000 230.94749 ? -59 DT  I O2    1 
ATOM 6098  N N3    . DT  I 5 14  ? 123.76900 154.66600 105.11500 1.000 230.94749 ? -59 DT  I N3    1 
ATOM 6099  C C4    . DT  I 5 14  ? 125.13800 154.66900 105.25800 1.000 230.94749 ? -59 DT  I C4    1 
ATOM 6100  O O4    . DT  I 5 14  ? 125.79900 153.64200 105.29100 1.000 230.94749 ? -59 DT  I O4    1 
ATOM 6101  C C5    . DT  I 5 14  ? 125.74200 155.96400 105.37000 1.000 230.94749 ? -59 DT  I C5    1 
ATOM 6102  C C7    . DT  I 5 14  ? 127.22400 156.07900 105.53700 1.000 230.94749 ? -59 DT  I C7    1 
ATOM 6103  C C6    . DT  I 5 14  ? 124.94400 157.03900 105.33100 1.000 230.94749 ? -59 DT  I C6    1 
ATOM 6104  P P     . DG  I 5 15  ? 120.89800 161.22400 107.58300 1.000 208.16408 ? -58 DG  I P     1 
ATOM 6105  O OP1   . DG  I 5 15  ? 119.86600 162.28000 107.52300 1.000 208.16408 ? -58 DG  I OP1   1 
ATOM 6106  O OP2   . DG  I 5 15  ? 122.07200 161.41800 108.46100 1.000 208.16408 ? -58 DG  I OP2   1 
ATOM 6107  O "O5'" . DG  I 5 15  ? 120.17400 159.85900 107.97700 1.000 208.16408 ? -58 DG  I "O5'" 1 
ATOM 6108  C "C5'" . DG  I 5 15  ? 119.24900 159.27100 107.07600 1.000 208.16408 ? -58 DG  I "C5'" 1 
ATOM 6109  C "C4'" . DG  I 5 15  ? 118.90200 157.85500 107.49300 1.000 208.16408 ? -58 DG  I "C4'" 1 
ATOM 6110  O "O4'" . DG  I 5 15  ? 120.01800 156.96700 107.22700 1.000 208.16408 ? -58 DG  I "O4'" 1 
ATOM 6111  C "C3'" . DG  I 5 15  ? 118.56300 157.66500 108.97300 1.000 208.16408 ? -58 DG  I "C3'" 1 
ATOM 6112  O "O3'" . DG  I 5 15  ? 117.44700 156.80000 109.09600 1.000 208.16408 ? -58 DG  I "O3'" 1 
ATOM 6113  C "C2'" . DG  I 5 15  ? 119.81700 157.01100 109.52600 1.000 208.16408 ? -58 DG  I "C2'" 1 
ATOM 6114  C "C1'" . DG  I 5 15  ? 120.21500 156.14800 108.35500 1.000 208.16408 ? -58 DG  I "C1'" 1 
ATOM 6115  N N9    . DG  I 5 15  ? 121.59500 155.69900 108.38200 1.000 208.16408 ? -58 DG  I N9    1 
ATOM 6116  C C8    . DG  I 5 15  ? 122.72200 156.46700 108.47900 1.000 208.16408 ? -58 DG  I C8    1 
ATOM 6117  N N7    . DG  I 5 15  ? 123.82300 155.77800 108.43900 1.000 208.16408 ? -58 DG  I N7    1 
ATOM 6118  C C5    . DG  I 5 15  ? 123.39200 154.47100 108.29900 1.000 208.16408 ? -58 DG  I C5    1 
ATOM 6119  C C6    . DG  I 5 15  ? 124.12900 153.27800 108.19700 1.000 208.16408 ? -58 DG  I C6    1 
ATOM 6120  O O6    . DG  I 5 15  ? 125.35400 153.13500 108.21600 1.000 208.16408 ? -58 DG  I O6    1 
ATOM 6121  N N1    . DG  I 5 15  ? 123.30000 152.17000 108.06400 1.000 208.16408 ? -58 DG  I N1    1 
ATOM 6122  C C2    . DG  I 5 15  ? 121.93400 152.21900 108.03000 1.000 208.16408 ? -58 DG  I C2    1 
ATOM 6123  N N2    . DG  I 5 15  ? 121.30400 151.05500 107.89400 1.000 208.16408 ? -58 DG  I N2    1 
ATOM 6124  N N3    . DG  I 5 15  ? 121.23200 153.33000 108.12300 1.000 208.16408 ? -58 DG  I N3    1 
ATOM 6125  C C4    . DG  I 5 15  ? 122.02500 154.41200 108.25400 1.000 208.16408 ? -58 DG  I C4    1 
ATOM 6126  P P     . DC  I 5 16  ? 116.20700 157.19100 110.03600 1.000 192.49259 ? -57 DC  I P     1 
ATOM 6127  O OP1   . DC  I 5 16  ? 115.33200 158.10600 109.27300 1.000 192.49259 ? -57 DC  I OP1   1 
ATOM 6128  O OP2   . DC  I 5 16  ? 116.75400 157.61100 111.34400 1.000 192.49259 ? -57 DC  I OP2   1 
ATOM 6129  O "O5'" . DC  I 5 16  ? 115.43800 155.80300 110.24000 1.000 192.49259 ? -57 DC  I "O5'" 1 
ATOM 6130  C "C5'" . DC  I 5 16  ? 115.99700 154.59100 109.73200 1.000 192.49259 ? -57 DC  I "C5'" 1 
ATOM 6131  C "C4'" . DC  I 5 16  ? 116.26800 153.61000 110.85500 1.000 192.49259 ? -57 DC  I "C4'" 1 
ATOM 6132  O "O4'" . DC  I 5 16  ? 117.69000 153.32500 110.93300 1.000 192.49259 ? -57 DC  I "O4'" 1 
ATOM 6133  C "C3'" . DC  I 5 16  ? 115.86800 154.10500 112.24200 1.000 192.49259 ? -57 DC  I "C3'" 1 
ATOM 6134  O "O3'" . DC  I 5 16  ? 115.39200 153.03000 113.02600 1.000 192.49259 ? -57 DC  I "O3'" 1 
ATOM 6135  C "C2'" . DC  I 5 16  ? 117.19500 154.60700 112.78100 1.000 192.49259 ? -57 DC  I "C2'" 1 
ATOM 6136  C "C1'" . DC  I 5 16  ? 118.10900 153.51700 112.25800 1.000 192.49259 ? -57 DC  I "C1'" 1 
ATOM 6137  N N1    . DC  I 5 16  ? 119.54800 153.87100 112.25500 1.000 192.49259 ? -57 DC  I N1    1 
ATOM 6138  C C2    . DC  I 5 16  ? 120.49800 152.86900 112.07300 1.000 192.49259 ? -57 DC  I C2    1 
ATOM 6139  O O2    . DC  I 5 16  ? 120.11600 151.70700 111.90200 1.000 192.49259 ? -57 DC  I O2    1 
ATOM 6140  N N3    . DC  I 5 16  ? 121.80900 153.20100 112.07600 1.000 192.49259 ? -57 DC  I N3    1 
ATOM 6141  C C4    . DC  I 5 16  ? 122.17300 154.46800 112.25700 1.000 192.49259 ? -57 DC  I C4    1 
ATOM 6142  N N4    . DC  I 5 16  ? 123.47800 154.75100 112.25900 1.000 192.49259 ? -57 DC  I N4    1 
ATOM 6143  C C5    . DC  I 5 16  ? 121.21800 155.49900 112.46100 1.000 192.49259 ? -57 DC  I C5    1 
ATOM 6144  C C6    . DC  I 5 16  ? 119.93100 155.15500 112.46300 1.000 192.49259 ? -57 DC  I C6    1 
ATOM 6145  P P     . DC  I 5 17  ? 113.83900 152.62100 113.01700 1.000 179.97298 ? -56 DC  I P     1 
ATOM 6146  O OP1   . DC  I 5 17  ? 113.21300 152.96800 111.72300 1.000 179.97298 ? -56 DC  I OP1   1 
ATOM 6147  O OP2   . DC  I 5 17  ? 113.25800 153.15500 114.26500 1.000 179.97298 ? -56 DC  I OP2   1 
ATOM 6148  O "O5'" . DC  I 5 17  ? 113.88100 151.03500 113.16100 1.000 179.97298 ? -56 DC  I "O5'" 1 
ATOM 6149  C "C5'" . DC  I 5 17  ? 114.85700 150.29000 112.45200 1.000 179.97298 ? -56 DC  I "C5'" 1 
ATOM 6150  C "C4'" . DC  I 5 17  ? 115.68200 149.41300 113.38900 1.000 179.97298 ? -56 DC  I "C4'" 1 
ATOM 6151  O "O4'" . DC  I 5 17  ? 116.95800 150.03400 113.69500 1.000 179.97298 ? -56 DC  I "O4'" 1 
ATOM 6152  C "C3'" . DC  I 5 17  ? 115.04600 149.10100 114.73800 1.000 179.97298 ? -56 DC  I "C3'" 1 
ATOM 6153  O "O3'" . DC  I 5 17  ? 115.42400 147.80200 115.11200 1.000 179.97298 ? -56 DC  I "O3'" 1 
ATOM 6154  C "C2'" . DC  I 5 17  ? 115.71000 150.12900 115.64600 1.000 179.97298 ? -56 DC  I "C2'" 1 
ATOM 6155  C "C1'" . DC  I 5 17  ? 117.12000 150.07900 115.09600 1.000 179.97298 ? -56 DC  I "C1'" 1 
ATOM 6156  N N1    . DC  I 5 17  ? 117.95200 151.24800 115.42200 1.000 179.97298 ? -56 DC  I N1    1 
ATOM 6157  C C2    . DC  I 5 17  ? 119.33800 151.11400 115.41700 1.000 179.97298 ? -56 DC  I C2    1 
ATOM 6158  O O2    . DC  I 5 17  ? 119.82800 150.01700 115.16200 1.000 179.97298 ? -56 DC  I O2    1 
ATOM 6159  N N3    . DC  I 5 17  ? 120.10200 152.18600 115.70000 1.000 179.97298 ? -56 DC  I N3    1 
ATOM 6160  C C4    . DC  I 5 17  ? 119.52900 153.35600 115.97100 1.000 179.97298 ? -56 DC  I C4    1 
ATOM 6161  N N4    . DC  I 5 17  ? 120.32300 154.39400 116.23900 1.000 179.97298 ? -56 DC  I N4    1 
ATOM 6162  C C5    . DC  I 5 17  ? 118.11600 153.51400 115.98500 1.000 179.97298 ? -56 DC  I C5    1 
ATOM 6163  C C6    . DC  I 5 17  ? 117.37200 152.44500 115.69600 1.000 179.97298 ? -56 DC  I C6    1 
ATOM 6164  P P     . DG  I 5 18  ? 114.34000 146.62500 115.16500 1.000 174.85686 ? -55 DG  I P     1 
ATOM 6165  O OP1   . DG  I 5 18  ? 113.78000 146.46700 113.80600 1.000 174.85686 ? -55 DG  I OP1   1 
ATOM 6166  O OP2   . DG  I 5 18  ? 113.45000 146.88900 116.31400 1.000 174.85686 ? -55 DG  I OP2   1 
ATOM 6167  O "O5'" . DG  I 5 18  ? 115.21300 145.33800 115.50500 1.000 174.85686 ? -55 DG  I "O5'" 1 
ATOM 6168  C "C5'" . DG  I 5 18  ? 116.13000 144.82900 114.54100 1.000 174.85686 ? -55 DG  I "C5'" 1 
ATOM 6169  C "C4'" . DG  I 5 18  ? 117.53100 144.59600 115.11700 1.000 174.85686 ? -55 DG  I "C4'" 1 
ATOM 6170  O "O4'" . DG  I 5 18  ? 118.12600 145.84400 115.54900 1.000 174.85686 ? -55 DG  I "O4'" 1 
ATOM 6171  C "C3'" . DG  I 5 18  ? 117.62900 143.67700 116.32700 1.000 174.85686 ? -55 DG  I "C3'" 1 
ATOM 6172  O "O3'" . DG  I 5 18  ? 118.88200 143.04900 116.30300 1.000 174.85686 ? -55 DG  I "O3'" 1 
ATOM 6173  C "C2'" . DG  I 5 18  ? 117.57000 144.66200 117.48300 1.000 174.85686 ? -55 DG  I "C2'" 1 
ATOM 6174  C "C1'" . DG  I 5 18  ? 118.45100 145.75700 116.92600 1.000 174.85686 ? -55 DG  I "C1'" 1 
ATOM 6175  N N9    . DG  I 5 18  ? 118.24600 147.06700 117.51000 1.000 174.85686 ? -55 DG  I N9    1 
ATOM 6176  C C8    . DG  I 5 18  ? 117.05500 147.65300 117.84300 1.000 174.85686 ? -55 DG  I C8    1 
ATOM 6177  N N7    . DG  I 5 18  ? 117.19100 148.85700 118.31800 1.000 174.85686 ? -55 DG  I N7    1 
ATOM 6178  C C5    . DG  I 5 18  ? 118.55400 149.08700 118.26900 1.000 174.85686 ? -55 DG  I C5    1 
ATOM 6179  C C6    . DG  I 5 18  ? 119.29700 150.21700 118.65300 1.000 174.85686 ? -55 DG  I C6    1 
ATOM 6180  O O6    . DG  I 5 18  ? 118.88500 151.28300 119.11600 1.000 174.85686 ? -55 DG  I O6    1 
ATOM 6181  N N1    . DG  I 5 18  ? 120.65200 150.03000 118.44700 1.000 174.85686 ? -55 DG  I N1    1 
ATOM 6182  C C2    . DG  I 5 18  ? 121.21900 148.89600 117.93500 1.000 174.85686 ? -55 DG  I C2    1 
ATOM 6183  N N2    . DG  I 5 18  ? 122.54900 148.89800 117.81100 1.000 174.85686 ? -55 DG  I N2    1 
ATOM 6184  N N3    . DG  I 5 18  ? 120.53500 147.82800 117.57900 1.000 174.85686 ? -55 DG  I N3    1 
ATOM 6185  C C4    . DG  I 5 18  ? 119.21300 147.99500 117.77100 1.000 174.85686 ? -55 DG  I C4    1 
ATOM 6186  P P     . DA  I 5 19  ? 119.04600 141.54700 116.82600 1.000 165.17868 ? -54 DA  I P     1 
ATOM 6187  O OP1   . DA  I 5 19  ? 118.84600 140.62200 115.69100 1.000 165.17868 ? -54 DA  I OP1   1 
ATOM 6188  O OP2   . DA  I 5 19  ? 118.21600 141.44800 118.04400 1.000 165.17868 ? -54 DA  I OP2   1 
ATOM 6189  O "O5'" . DA  I 5 19  ? 120.56400 141.48300 117.30300 1.000 165.17868 ? -54 DA  I "O5'" 1 
ATOM 6190  C "C5'" . DA  I 5 19  ? 121.60200 141.97700 116.46800 1.000 165.17868 ? -54 DA  I "C5'" 1 
ATOM 6191  C "C4'" . DA  I 5 19  ? 122.83800 142.42200 117.26200 1.000 165.17868 ? -54 DA  I "C4'" 1 
ATOM 6192  O "O4'" . DA  I 5 19  ? 122.65400 143.74900 117.81300 1.000 165.17868 ? -54 DA  I "O4'" 1 
ATOM 6193  C "C3'" . DA  I 5 19  ? 123.24100 141.56200 118.44600 1.000 165.17868 ? -54 DA  I "C3'" 1 
ATOM 6194  O "O3'" . DA  I 5 19  ? 124.62100 141.65100 118.61100 1.000 165.17868 ? -54 DA  I "O3'" 1 
ATOM 6195  C "C2'" . DA  I 5 19  ? 122.53600 142.24000 119.60900 1.000 165.17868 ? -54 DA  I "C2'" 1 
ATOM 6196  C "C1'" . DA  I 5 19  ? 122.67600 143.70100 119.23100 1.000 165.17868 ? -54 DA  I "C1'" 1 
ATOM 6197  N N9    . DA  I 5 19  ? 121.59000 144.53300 119.69600 1.000 165.17868 ? -54 DA  I N9    1 
ATOM 6198  C C8    . DA  I 5 19  ? 120.26400 144.23400 119.67300 1.000 165.17868 ? -54 DA  I C8    1 
ATOM 6199  N N7    . DA  I 5 19  ? 119.50000 145.19700 120.12000 1.000 165.17868 ? -54 DA  I N7    1 
ATOM 6200  C C5    . DA  I 5 19  ? 120.38500 146.20400 120.42700 1.000 165.17868 ? -54 DA  I C5    1 
ATOM 6201  C C6    . DA  I 5 19  ? 120.20200 147.49100 120.94100 1.000 165.17868 ? -54 DA  I C6    1 
ATOM 6202  N N6    . DA  I 5 19  ? 119.00500 147.99400 121.24000 1.000 165.17868 ? -54 DA  I N6    1 
ATOM 6203  N N1    . DA  I 5 19  ? 121.29900 148.24700 121.13800 1.000 165.17868 ? -54 DA  I N1    1 
ATOM 6204  C C2    . DA  I 5 19  ? 122.49900 147.73400 120.84700 1.000 165.17868 ? -54 DA  I C2    1 
ATOM 6205  N N3    . DA  I 5 19  ? 122.79300 146.53600 120.35000 1.000 165.17868 ? -54 DA  I N3    1 
ATOM 6206  C C4    . DA  I 5 19  ? 121.68000 145.81400 120.16600 1.000 165.17868 ? -54 DA  I C4    1 
ATOM 6207  P P     . DG  I 5 20  ? 125.43700 140.43200 119.24700 1.000 170.51049 ? -53 DG  I P     1 
ATOM 6208  O OP1   . DG  I 5 20  ? 126.34600 139.92900 118.20400 1.000 170.51049 ? -53 DG  I OP1   1 
ATOM 6209  O OP2   . DG  I 5 20  ? 124.48000 139.51700 119.89900 1.000 170.51049 ? -53 DG  I OP2   1 
ATOM 6210  O "O5'" . DG  I 5 20  ? 126.30300 141.14000 120.37500 1.000 170.51049 ? -53 DG  I "O5'" 1 
ATOM 6211  C "C5'" . DG  I 5 20  ? 126.99200 142.33200 120.06600 1.000 170.51049 ? -53 DG  I "C5'" 1 
ATOM 6212  C "C4'" . DG  I 5 20  ? 127.17800 143.21000 121.29300 1.000 170.51049 ? -53 DG  I "C4'" 1 
ATOM 6213  O "O4'" . DG  I 5 20  ? 125.96600 143.95800 121.58200 1.000 170.51049 ? -53 DG  I "O4'" 1 
ATOM 6214  C "C3'" . DG  I 5 20  ? 127.52500 142.47200 122.58200 1.000 170.51049 ? -53 DG  I "C3'" 1 
ATOM 6215  O "O3'" . DG  I 5 20  ? 128.46500 143.21500 123.29100 1.000 170.51049 ? -53 DG  I "O3'" 1 
ATOM 6216  C "C2'" . DG  I 5 20  ? 126.19700 142.44600 123.32800 1.000 170.51049 ? -53 DG  I "C2'" 1 
ATOM 6217  C "C1'" . DG  I 5 20  ? 125.64700 143.80200 122.94600 1.000 170.51049 ? -53 DG  I "C1'" 1 
ATOM 6218  N N9    . DG  I 5 20  ? 124.21100 143.93400 123.11100 1.000 170.51049 ? -53 DG  I N9    1 
ATOM 6219  C C8    . DG  I 5 20  ? 123.25800 143.00300 122.82500 1.000 170.51049 ? -53 DG  I C8    1 
ATOM 6220  N N7    . DG  I 5 20  ? 122.04300 143.41600 123.04300 1.000 170.51049 ? -53 DG  I N7    1 
ATOM 6221  C C5    . DG  I 5 20  ? 122.20900 144.70600 123.50800 1.000 170.51049 ? -53 DG  I C5    1 
ATOM 6222  C C6    . DG  I 5 20  ? 121.25200 145.65300 123.91700 1.000 170.51049 ? -53 DG  I C6    1 
ATOM 6223  O O6    . DG  I 5 20  ? 120.02100 145.53800 123.95200 1.000 170.51049 ? -53 DG  I O6    1 
ATOM 6224  N N1    . DG  I 5 20  ? 121.84900 146.83800 124.31900 1.000 170.51049 ? -53 DG  I N1    1 
ATOM 6225  C C2    . DG  I 5 20  ? 123.20300 147.07300 124.32400 1.000 170.51049 ? -53 DG  I C2    1 
ATOM 6226  N N2    . DG  I 5 20  ? 123.60100 148.27900 124.74100 1.000 170.51049 ? -53 DG  I N2    1 
ATOM 6227  N N3    . DG  I 5 20  ? 124.10600 146.19200 123.94200 1.000 170.51049 ? -53 DG  I N3    1 
ATOM 6228  C C4    . DG  I 5 20  ? 123.54000 145.03800 123.55000 1.000 170.51049 ? -53 DG  I C4    1 
ATOM 6229  P P     . DG  I 5 21  ? 129.60300 142.47800 124.14200 1.000 178.47328 ? -52 DG  I P     1 
ATOM 6230  O OP1   . DG  I 5 21  ? 130.80500 142.35800 123.29000 1.000 178.47328 ? -52 DG  I OP1   1 
ATOM 6231  O OP2   . DG  I 5 21  ? 129.00300 141.26900 124.74700 1.000 178.47328 ? -52 DG  I OP2   1 
ATOM 6232  O "O5'" . DG  I 5 21  ? 129.89100 143.52000 125.30700 1.000 178.47328 ? -52 DG  I "O5'" 1 
ATOM 6233  C "C5'" . DG  I 5 21  ? 129.93600 144.89500 125.00400 1.000 178.47328 ? -52 DG  I "C5'" 1 
ATOM 6234  C "C4'" . DG  I 5 21  ? 129.22000 145.69700 126.06500 1.000 178.47328 ? -52 DG  I "C4'" 1 
ATOM 6235  O "O4'" . DG  I 5 21  ? 127.78600 145.64400 125.86000 1.000 178.47328 ? -52 DG  I "O4'" 1 
ATOM 6236  C "C3'" . DG  I 5 21  ? 129.46400 145.21300 127.49200 1.000 178.47328 ? -52 DG  I "C3'" 1 
ATOM 6237  O "O3'" . DG  I 5 21  ? 129.97000 146.27400 128.26200 1.000 178.47328 ? -52 DG  I "O3'" 1 
ATOM 6238  C "C2'" . DG  I 5 21  ? 128.08300 144.75700 127.97700 1.000 178.47328 ? -52 DG  I "C2'" 1 
ATOM 6239  C "C1'" . DG  I 5 21  ? 127.16000 145.58900 127.11600 1.000 178.47328 ? -52 DG  I "C1'" 1 
ATOM 6240  N N9    . DG  I 5 21  ? 125.81600 145.03800 126.96000 1.000 178.47328 ? -52 DG  I N9    1 
ATOM 6241  C C8    . DG  I 5 21  ? 125.47500 143.83100 126.41900 1.000 178.47328 ? -52 DG  I C8    1 
ATOM 6242  N N7    . DG  I 5 21  ? 124.19100 143.61700 126.39100 1.000 178.47328 ? -52 DG  I N7    1 
ATOM 6243  C C5    . DG  I 5 21  ? 123.64700 144.75700 126.95600 1.000 178.47328 ? -52 DG  I C5    1 
ATOM 6244  C C6    . DG  I 5 21  ? 122.30000 145.09900 127.19900 1.000 178.47328 ? -52 DG  I C6    1 
ATOM 6245  O O6    . DG  I 5 21  ? 121.28600 144.43900 126.95400 1.000 178.47328 ? -52 DG  I O6    1 
ATOM 6246  N N1    . DG  I 5 21  ? 122.18400 146.35000 127.78900 1.000 178.47328 ? -52 DG  I N1    1 
ATOM 6247  C C2    . DG  I 5 21  ? 123.24100 147.16500 128.10500 1.000 178.47328 ? -52 DG  I C2    1 
ATOM 6248  N N2    . DG  I 5 21  ? 122.94400 148.34100 128.66800 1.000 178.47328 ? -52 DG  I N2    1 
ATOM 6249  N N3    . DG  I 5 21  ? 124.50700 146.85500 127.88100 1.000 178.47328 ? -52 DG  I N3    1 
ATOM 6250  C C4    . DG  I 5 21  ? 124.63400 145.64500 127.30200 1.000 178.47328 ? -52 DG  I C4    1 
ATOM 6251  P P     . DC  I 5 22  ? 130.65800 145.98800 129.68200 1.000 174.14358 ? -51 DC  I P     1 
ATOM 6252  O OP1   . DC  I 5 22  ? 131.91100 146.77000 129.73900 1.000 174.14358 ? -51 DC  I OP1   1 
ATOM 6253  O OP2   . DC  I 5 22  ? 130.69100 144.52900 129.91500 1.000 174.14358 ? -51 DC  I OP2   1 
ATOM 6254  O "O5'" . DC  I 5 22  ? 129.62800 146.61400 130.71500 1.000 174.14358 ? -51 DC  I "O5'" 1 
ATOM 6255  C "C5'" . DC  I 5 22  ? 129.14800 147.92500 130.50500 1.000 174.14358 ? -51 DC  I "C5'" 1 
ATOM 6256  C "C4'" . DC  I 5 22  ? 127.94900 148.17800 131.37700 1.000 174.14358 ? -51 DC  I "C4'" 1 
ATOM 6257  O "O4'" . DC  I 5 22  ? 126.78100 147.55300 130.80400 1.000 174.14358 ? -51 DC  I "O4'" 1 
ATOM 6258  C "C3'" . DC  I 5 22  ? 128.08700 147.62400 132.78800 1.000 174.14358 ? -51 DC  I "C3'" 1 
ATOM 6259  O "O3'" . DC  I 5 22  ? 127.91500 148.66200 133.72700 1.000 174.14358 ? -51 DC  I "O3'" 1 
ATOM 6260  C "C2'" . DC  I 5 22  ? 126.98200 146.57200 132.88800 1.000 174.14358 ? -51 DC  I "C2'" 1 
ATOM 6261  C "C1'" . DC  I 5 22  ? 125.99100 147.03200 131.83800 1.000 174.14358 ? -51 DC  I "C1'" 1 
ATOM 6262  N N1    . DC  I 5 22  ? 125.17200 145.94000 131.27900 1.000 174.14358 ? -51 DC  I N1    1 
ATOM 6263  C C2    . DC  I 5 22  ? 123.78400 145.97700 131.40800 1.000 174.14358 ? -51 DC  I C2    1 
ATOM 6264  O O2    . DC  I 5 22  ? 123.26400 146.93300 131.98400 1.000 174.14358 ? -51 DC  I O2    1 
ATOM 6265  N N3    . DC  I 5 22  ? 123.05400 144.97300 130.87700 1.000 174.14358 ? -51 DC  I N3    1 
ATOM 6266  C C4    . DC  I 5 22  ? 123.66200 143.96500 130.25800 1.000 174.14358 ? -51 DC  I C4    1 
ATOM 6267  N N4    . DC  I 5 22  ? 122.90500 142.99000 129.75200 1.000 174.14358 ? -51 DC  I N4    1 
ATOM 6268  C C5    . DC  I 5 22  ? 125.07500 143.90500 130.13200 1.000 174.14358 ? -51 DC  I C5    1 
ATOM 6269  C C6    . DC  I 5 22  ? 125.78100 144.90500 130.65300 1.000 174.14358 ? -51 DC  I C6    1 
ATOM 6270  P P     . DC  I 5 23  ? 128.30600 148.43800 135.26700 1.000 171.50506 ? -50 DC  I P     1 
ATOM 6271  O OP1   . DC  I 5 23  ? 128.99500 149.66500 135.72000 1.000 171.50506 ? -50 DC  I OP1   1 
ATOM 6272  O OP2   . DC  I 5 23  ? 128.98200 147.13000 135.41300 1.000 171.50506 ? -50 DC  I OP2   1 
ATOM 6273  O "O5'" . DC  I 5 23  ? 126.89000 148.35400 135.99500 1.000 171.50506 ? -50 DC  I "O5'" 1 
ATOM 6274  C "C5'" . DC  I 5 23  ? 125.93100 149.36400 135.76000 1.000 171.50506 ? -50 DC  I "C5'" 1 
ATOM 6275  C "C4'" . DC  I 5 23  ? 124.59600 148.99500 136.36700 1.000 171.50506 ? -50 DC  I "C4'" 1 
ATOM 6276  O "O4'" . DC  I 5 23  ? 123.91700 148.04000 135.52000 1.000 171.50506 ? -50 DC  I "O4'" 1 
ATOM 6277  C "C3'" . DC  I 5 23  ? 124.68000 148.36400 137.75200 1.000 171.50506 ? -50 DC  I "C3'" 1 
ATOM 6278  O "O3'" . DC  I 5 23  ? 123.73900 148.98200 138.60500 1.000 171.50506 ? -50 DC  I "O3'" 1 
ATOM 6279  C "C2'" . DC  I 5 23  ? 124.33900 146.89700 137.49500 1.000 171.50506 ? -50 DC  I "C2'" 1 
ATOM 6280  C "C1'" . DC  I 5 23  ? 123.40700 146.99300 136.30300 1.000 171.50506 ? -50 DC  I "C1'" 1 
ATOM 6281  N N1    . DC  I 5 23  ? 123.40300 145.77600 135.46700 1.000 171.50506 ? -50 DC  I N1    1 
ATOM 6282  C C2    . DC  I 5 23  ? 122.19700 145.15600 135.14300 1.000 171.50506 ? -50 DC  I C2    1 
ATOM 6283  O O2    . DC  I 5 23  ? 121.14300 145.64400 135.55600 1.000 171.50506 ? -50 DC  I O2    1 
ATOM 6284  N N3    . DC  I 5 23  ? 122.22300 144.04700 134.36700 1.000 171.50506 ? -50 DC  I N3    1 
ATOM 6285  C C4    . DC  I 5 23  ? 123.38500 143.56200 133.94100 1.000 171.50506 ? -50 DC  I C4    1 
ATOM 6286  N N4    . DC  I 5 23  ? 123.36800 142.46600 133.18600 1.000 171.50506 ? -50 DC  I N4    1 
ATOM 6287  C C5    . DC  I 5 23  ? 124.61900 144.17700 134.27000 1.000 171.50506 ? -50 DC  I C5    1 
ATOM 6288  C C6    . DC  I 5 23  ? 124.57800 145.26400 135.03600 1.000 171.50506 ? -50 DC  I C6    1 
ATOM 6289  P P     . DG  I 5 24  ? 123.84600 148.81600 140.19800 1.000 169.21992 ? -49 DG  I P     1 
ATOM 6290  O OP1   . DG  I 5 24  ? 123.75800 150.16800 140.78500 1.000 169.21992 ? -49 DG  I OP1   1 
ATOM 6291  O OP2   . DG  I 5 24  ? 125.00300 147.95500 140.52100 1.000 169.21992 ? -49 DG  I OP2   1 
ATOM 6292  O "O5'" . DG  I 5 24  ? 122.51900 148.02700 140.57800 1.000 169.21992 ? -49 DG  I "O5'" 1 
ATOM 6293  C "C5'" . DG  I 5 24  ? 121.26700 148.52300 140.14500 1.000 169.21992 ? -49 DG  I "C5'" 1 
ATOM 6294  C "C4'" . DG  I 5 24  ? 120.19900 147.46100 140.27200 1.000 169.21992 ? -49 DG  I "C4'" 1 
ATOM 6295  O "O4'" . DG  I 5 24  ? 120.38400 146.45200 139.24500 1.000 169.21992 ? -49 DG  I "O4'" 1 
ATOM 6296  C "C3'" . DG  I 5 24  ? 120.18900 146.72200 141.60600 1.000 169.21992 ? -49 DG  I "C3'" 1 
ATOM 6297  O "O3'" . DG  I 5 24  ? 118.86200 146.62800 142.08800 1.000 169.21992 ? -49 DG  I "O3'" 1 
ATOM 6298  C "C2'" . DG  I 5 24  ? 120.75700 145.35500 141.25600 1.000 169.21992 ? -49 DG  I "C2'" 1 
ATOM 6299  C "C1'" . DG  I 5 24  ? 120.30900 145.17100 139.82000 1.000 169.21992 ? -49 DG  I "C1'" 1 
ATOM 6300  N N9    . DG  I 5 24  ? 121.17900 144.27800 139.07400 1.000 169.21992 ? -49 DG  I N9    1 
ATOM 6301  C C8    . DG  I 5 24  ? 122.53700 144.36100 138.97800 1.000 169.21992 ? -49 DG  I C8    1 
ATOM 6302  N N7    . DG  I 5 24  ? 123.06400 143.44000 138.23100 1.000 169.21992 ? -49 DG  I N7    1 
ATOM 6303  C C5    . DG  I 5 24  ? 121.98100 142.70300 137.79300 1.000 169.21992 ? -49 DG  I C5    1 
ATOM 6304  C C6    . DG  I 5 24  ? 121.94100 141.57900 136.95100 1.000 169.21992 ? -49 DG  I C6    1 
ATOM 6305  O O6    . DG  I 5 24  ? 122.88800 140.99900 136.41300 1.000 169.21992 ? -49 DG  I O6    1 
ATOM 6306  N N1    . DG  I 5 24  ? 120.64500 141.13100 136.75100 1.000 169.21992 ? -49 DG  I N1    1 
ATOM 6307  C C2    . DG  I 5 24  ? 119.52600 141.70200 137.29900 1.000 169.21992 ? -49 DG  I C2    1 
ATOM 6308  N N2    . DG  I 5 24  ? 118.35600 141.12900 136.99300 1.000 169.21992 ? -49 DG  I N2    1 
ATOM 6309  N N3    . DG  I 5 24  ? 119.55100 142.76100 138.09600 1.000 169.21992 ? -49 DG  I N3    1 
ATOM 6310  C C4    . DG  I 5 24  ? 120.81000 143.20600 138.29700 1.000 169.21992 ? -49 DG  I C4    1 
ATOM 6311  P P     . DC  I 5 25  ? 118.54800 146.04400 143.55400 1.000 169.19636 ? -48 DC  I P     1 
ATOM 6312  O OP1   . DC  I 5 25  ? 117.54900 146.94900 144.15800 1.000 169.19636 ? -48 DC  I OP1   1 
ATOM 6313  O OP2   . DC  I 5 25  ? 119.79800 145.76400 144.29600 1.000 169.19636 ? -48 DC  I OP2   1 
ATOM 6314  O "O5'" . DC  I 5 25  ? 117.81200 144.66300 143.24100 1.000 169.19636 ? -48 DC  I "O5'" 1 
ATOM 6315  C "C5'" . DC  I 5 25  ? 116.71400 144.64900 142.34200 1.000 169.19636 ? -48 DC  I "C5'" 1 
ATOM 6316  C "C4'" . DC  I 5 25  ? 116.34200 143.23600 141.92900 1.000 169.19636 ? -48 DC  I "C4'" 1 
ATOM 6317  O "O4'" . DC  I 5 25  ? 117.37200 142.67000 141.07700 1.000 169.19636 ? -48 DC  I "O4'" 1 
ATOM 6318  C "C3'" . DC  I 5 25  ? 116.14600 142.24900 143.07400 1.000 169.19636 ? -48 DC  I "C3'" 1 
ATOM 6319  O "O3'" . DC  I 5 25  ? 115.02800 141.44400 142.78800 1.000 169.19636 ? -48 DC  I "O3'" 1 
ATOM 6320  C "C2'" . DC  I 5 25  ? 117.43700 141.43500 143.04000 1.000 169.19636 ? -48 DC  I "C2'" 1 
ATOM 6321  C "C1'" . DC  I 5 25  ? 117.72400 141.39100 141.55500 1.000 169.19636 ? -48 DC  I "C1'" 1 
ATOM 6322  N N1    . DC  I 5 25  ? 119.15500 141.14700 141.21300 1.000 169.19636 ? -48 DC  I N1    1 
ATOM 6323  C C2    . DC  I 5 25  ? 119.50100 140.09000 140.37000 1.000 169.19636 ? -48 DC  I C2    1 
ATOM 6324  O O2    . DC  I 5 25  ? 118.61200 139.35400 139.93600 1.000 169.19636 ? -48 DC  I O2    1 
ATOM 6325  N N3    . DC  I 5 25  ? 120.80500 139.90100 140.05900 1.000 169.19636 ? -48 DC  I N3    1 
ATOM 6326  C C4    . DC  I 5 25  ? 121.72900 140.72000 140.54900 1.000 169.19636 ? -48 DC  I C4    1 
ATOM 6327  N N4    . DC  I 5 25  ? 123.00100 140.50000 140.22100 1.000 169.19636 ? -48 DC  I N4    1 
ATOM 6328  C C5    . DC  I 5 25  ? 121.39200 141.80000 141.40300 1.000 169.19636 ? -48 DC  I C5    1 
ATOM 6329  C C6    . DC  I 5 25  ? 120.10700 141.96800 141.70700 1.000 169.19636 ? -48 DC  I C6    1 
ATOM 6330  P P     . DT  I 5 26  ? 114.24900 140.65700 143.95100 1.000 160.59482 ? -47 DT  I P     1 
ATOM 6331  O OP1   . DT  I 5 26  ? 113.02200 141.42700 144.24100 1.000 160.59482 ? -47 DT  I OP1   1 
ATOM 6332  O OP2   . DT  I 5 26  ? 115.17200 140.32700 145.05900 1.000 160.59482 ? -47 DT  I OP2   1 
ATOM 6333  O "O5'" . DT  I 5 26  ? 113.84100 139.29300 143.23900 1.000 160.59482 ? -47 DT  I "O5'" 1 
ATOM 6334  C "C5'" . DT  I 5 26  ? 114.53000 138.88500 142.06700 1.000 160.59482 ? -47 DT  I "C5'" 1 
ATOM 6335  C "C4'" . DT  I 5 26  ? 114.89900 137.42100 142.14700 1.000 160.59482 ? -47 DT  I "C4'" 1 
ATOM 6336  O "O4'" . DT  I 5 26  ? 116.31700 137.24600 141.89200 1.000 160.59482 ? -47 DT  I "O4'" 1 
ATOM 6337  C "C3'" . DT  I 5 26  ? 114.65300 136.77500 143.49800 1.000 160.59482 ? -47 DT  I "C3'" 1 
ATOM 6338  O "O3'" . DT  I 5 26  ? 114.38100 135.41500 143.29600 1.000 160.59482 ? -47 DT  I "O3'" 1 
ATOM 6339  C "C2'" . DT  I 5 26  ? 116.00800 136.96000 144.16600 1.000 160.59482 ? -47 DT  I "C2'" 1 
ATOM 6340  C "C1'" . DT  I 5 26  ? 116.90400 136.60300 143.00000 1.000 160.59482 ? -47 DT  I "C1'" 1 
ATOM 6341  N N1    . DT  I 5 26  ? 118.30300 137.06500 143.11800 1.000 160.59482 ? -47 DT  I N1    1 
ATOM 6342  C C2    . DT  I 5 26  ? 119.27600 136.37100 142.45300 1.000 160.59482 ? -47 DT  I C2    1 
ATOM 6343  O O2    . DT  I 5 26  ? 119.04300 135.39500 141.76900 1.000 160.59482 ? -47 DT  I O2    1 
ATOM 6344  N N3    . DT  I 5 26  ? 120.53800 136.86600 142.60000 1.000 160.59482 ? -47 DT  I N3    1 
ATOM 6345  C C4    . DT  I 5 26  ? 120.91800 137.96700 143.34000 1.000 160.59482 ? -47 DT  I C4    1 
ATOM 6346  O O4    . DT  I 5 26  ? 122.08200 138.33000 143.42200 1.000 160.59482 ? -47 DT  I O4    1 
ATOM 6347  C C5    . DT  I 5 26  ? 119.85400 138.64800 144.02300 1.000 160.59482 ? -47 DT  I C5    1 
ATOM 6348  C C7    . DT  I 5 26  ? 120.15900 139.85000 144.86300 1.000 160.59482 ? -47 DT  I C7    1 
ATOM 6349  C C6    . DT  I 5 26  ? 118.60600 138.17000 143.88300 1.000 160.59482 ? -47 DT  I C6    1 
ATOM 6350  P P     . DC  I 5 27  ? 112.87900 134.86400 143.38800 1.000 153.49554 ? -46 DC  I P     1 
ATOM 6351  O OP1   . DC  I 5 27  ? 112.06200 135.61100 142.41200 1.000 153.49554 ? -46 DC  I OP1   1 
ATOM 6352  O OP2   . DC  I 5 27  ? 112.48100 134.84200 144.80900 1.000 153.49554 ? -46 DC  I OP2   1 
ATOM 6353  O "O5'" . DC  I 5 27  ? 113.01700 133.35900 142.88800 1.000 153.49554 ? -46 DC  I "O5'" 1 
ATOM 6354  C "C5'" . DC  I 5 27  ? 113.53600 133.09000 141.58900 1.000 153.49554 ? -46 DC  I "C5'" 1 
ATOM 6355  C "C4'" . DC  I 5 27  ? 114.53300 131.92300 141.56100 1.000 153.49554 ? -46 DC  I "C4'" 1 
ATOM 6356  O "O4'" . DC  I 5 27  ? 115.83800 132.33200 142.04100 1.000 153.49554 ? -46 DC  I "O4'" 1 
ATOM 6357  C "C3'" . DC  I 5 27  ? 114.16700 130.69800 142.38800 1.000 153.49554 ? -46 DC  I "C3'" 1 
ATOM 6358  O "O3'" . DC  I 5 27  ? 114.72000 129.55700 141.78000 1.000 153.49554 ? -46 DC  I "O3'" 1 
ATOM 6359  C "C2'" . DC  I 5 27  ? 114.89200 130.97700 143.70500 1.000 153.49554 ? -46 DC  I "C2'" 1 
ATOM 6360  C "C1'" . DC  I 5 27  ? 116.18900 131.56900 143.18200 1.000 153.49554 ? -46 DC  I "C1'" 1 
ATOM 6361  N N1    . DC  I 5 27  ? 116.88700 132.46200 144.11800 1.000 153.49554 ? -46 DC  I N1    1 
ATOM 6362  C C2    . DC  I 5 27  ? 118.27000 132.58300 144.02700 1.000 153.49554 ? -46 DC  I C2    1 
ATOM 6363  O O2    . DC  I 5 27  ? 118.87200 131.91800 143.18500 1.000 153.49554 ? -46 DC  I O2    1 
ATOM 6364  N N3    . DC  I 5 27  ? 118.91100 133.41900 144.86600 1.000 153.49554 ? -46 DC  I N3    1 
ATOM 6365  C C4    . DC  I 5 27  ? 118.22300 134.11800 145.75900 1.000 153.49554 ? -46 DC  I C4    1 
ATOM 6366  N N4    . DC  I 5 27  ? 118.90600 134.93400 146.56400 1.000 153.49554 ? -46 DC  I N4    1 
ATOM 6367  C C5    . DC  I 5 27  ? 116.80800 134.00700 145.87000 1.000 153.49554 ? -46 DC  I C5    1 
ATOM 6368  C C6    . DC  I 5 27  ? 116.18500 133.18400 145.02600 1.000 153.49554 ? -46 DC  I C6    1 
ATOM 6369  P P     . DA  I 5 28  ? 113.84100 128.63400 140.80900 1.000 152.08422 ? -45 DA  I P     1 
ATOM 6370  O OP1   . DA  I 5 28  ? 113.25300 129.48300 139.75100 1.000 152.08422 ? -45 DA  I OP1   1 
ATOM 6371  O OP2   . DA  I 5 28  ? 112.97000 127.78500 141.64600 1.000 152.08422 ? -45 DA  I OP2   1 
ATOM 6372  O "O5'" . DA  I 5 28  ? 114.92300 127.69700 140.11600 1.000 152.08422 ? -45 DA  I "O5'" 1 
ATOM 6373  C "C5'" . DA  I 5 28  ? 115.73100 128.20000 139.07200 1.000 152.08422 ? -45 DA  I "C5'" 1 
ATOM 6374  C "C4'" . DA  I 5 28  ? 117.21400 127.94300 139.31700 1.000 152.08422 ? -45 DA  I "C4'" 1 
ATOM 6375  O "O4'" . DA  I 5 28  ? 117.66500 128.62300 140.51600 1.000 152.08422 ? -45 DA  I "O4'" 1 
ATOM 6376  C "C3'" . DA  I 5 28  ? 117.60200 126.47900 139.50200 1.000 152.08422 ? -45 DA  I "C3'" 1 
ATOM 6377  O "O3'" . DA  I 5 28  ? 118.86500 126.25700 138.93200 1.000 152.08422 ? -45 DA  I "O3'" 1 
ATOM 6378  C "C2'" . DA  I 5 28  ? 117.66900 126.34500 141.01900 1.000 152.08422 ? -45 DA  I "C2'" 1 
ATOM 6379  C "C1'" . DA  I 5 28  ? 118.25800 127.68700 141.39200 1.000 152.08422 ? -45 DA  I "C1'" 1 
ATOM 6380  N N9    . DA  I 5 28  ? 117.99300 128.09100 142.75900 1.000 152.08422 ? -45 DA  I N9    1 
ATOM 6381  C C8    . DA  I 5 28  ? 116.81100 128.00800 143.42900 1.000 152.08422 ? -45 DA  I C8    1 
ATOM 6382  N N7    . DA  I 5 28  ? 116.86700 128.47100 144.65200 1.000 152.08422 ? -45 DA  I N7    1 
ATOM 6383  C C5    . DA  I 5 28  ? 118.17100 128.90200 144.78000 1.000 152.08422 ? -45 DA  I C5    1 
ATOM 6384  C C6    . DA  I 5 28  ? 118.86800 129.49900 145.83800 1.000 152.08422 ? -45 DA  I C6    1 
ATOM 6385  N N6    . DA  I 5 28  ? 118.31100 129.77300 147.01700 1.000 152.08422 ? -45 DA  I N6    1 
ATOM 6386  N N1    . DA  I 5 28  ? 120.16500 129.79800 145.64100 1.000 152.08422 ? -45 DA  I N1    1 
ATOM 6387  C C2    . DA  I 5 28  ? 120.71900 129.52600 144.45900 1.000 152.08422 ? -45 DA  I C2    1 
ATOM 6388  N N3    . DA  I 5 28  ? 120.16300 128.96700 143.39200 1.000 152.08422 ? -45 DA  I N3    1 
ATOM 6389  C C4    . DA  I 5 28  ? 118.87700 128.67800 143.62200 1.000 152.08422 ? -45 DA  I C4    1 
ATOM 6390  P P     . DA  I 5 29  ? 119.31400 124.77600 138.51200 1.000 146.48067 ? -44 DA  I P     1 
ATOM 6391  O OP1   . DA  I 5 29  ? 119.30200 124.74500 137.03700 1.000 146.48067 ? -44 DA  I OP1   1 
ATOM 6392  O OP2   . DA  I 5 29  ? 118.54600 123.77200 139.27400 1.000 146.48067 ? -44 DA  I OP2   1 
ATOM 6393  O "O5'" . DA  I 5 29  ? 120.82300 124.69300 139.00100 1.000 146.48067 ? -44 DA  I "O5'" 1 
ATOM 6394  C "C5'" . DA  I 5 29  ? 121.77200 125.56400 138.44700 1.000 146.48067 ? -44 DA  I "C5'" 1 
ATOM 6395  C "C4'" . DA  I 5 29  ? 122.98300 125.71800 139.34700 1.000 146.48067 ? -44 DA  I "C4'" 1 
ATOM 6396  O "O4'" . DA  I 5 29  ? 122.59000 126.36900 140.58500 1.000 146.48067 ? -44 DA  I "O4'" 1 
ATOM 6397  C "C3'" . DA  I 5 29  ? 123.66900 124.41500 139.74800 1.000 146.48067 ? -44 DA  I "C3'" 1 
ATOM 6398  O "O3'" . DA  I 5 29  ? 125.07000 124.59500 139.72200 1.000 146.48067 ? -44 DA  I "O3'" 1 
ATOM 6399  C "C2'" . DA  I 5 29  ? 123.15800 124.17000 141.16500 1.000 146.48067 ? -44 DA  I "C2'" 1 
ATOM 6400  C "C1'" . DA  I 5 29  ? 122.96000 125.57900 141.69200 1.000 146.48067 ? -44 DA  I "C1'" 1 
ATOM 6401  N N9    . DA  I 5 29  ? 121.90600 125.67300 142.69500 1.000 146.48067 ? -44 DA  I N9    1 
ATOM 6402  C C8    . DA  I 5 29  ? 120.60700 125.29600 142.54900 1.000 146.48067 ? -44 DA  I C8    1 
ATOM 6403  N N7    . DA  I 5 29  ? 119.87400 125.49200 143.61900 1.000 146.48067 ? -44 DA  I N7    1 
ATOM 6404  C C5    . DA  I 5 29  ? 120.75400 126.04400 144.52700 1.000 146.48067 ? -44 DA  I C5    1 
ATOM 6405  C C6    . DA  I 5 29  ? 120.59600 126.48300 145.85300 1.000 146.48067 ? -44 DA  I C6    1 
ATOM 6406  N N6    . DA  I 5 29  ? 119.43800 126.43000 146.51000 1.000 146.48067 ? -44 DA  I N6    1 
ATOM 6407  N N1    . DA  I 5 29  ? 121.67500 126.99300 146.47600 1.000 146.48067 ? -44 DA  I N1    1 
ATOM 6408  C C2    . DA  I 5 29  ? 122.83400 127.04900 145.81400 1.000 146.48067 ? -44 DA  I C2    1 
ATOM 6409  N N3    . DA  I 5 29  ? 123.10500 126.66300 144.57000 1.000 146.48067 ? -44 DA  I N3    1 
ATOM 6410  C C4    . DA  I 5 29  ? 122.01100 126.17000 143.97400 1.000 146.48067 ? -44 DA  I C4    1 
ATOM 6411  P P     . DT  I 5 30  ? 126.06800 123.38500 140.06700 1.000 152.86437 ? -43 DT  I P     1 
ATOM 6412  O OP1   . DT  I 5 30  ? 127.28800 123.57100 139.25800 1.000 152.86437 ? -43 DT  I OP1   1 
ATOM 6413  O OP2   . DT  I 5 30  ? 125.34700 122.09600 139.99100 1.000 152.86437 ? -43 DT  I OP2   1 
ATOM 6414  O "O5'" . DT  I 5 30  ? 126.44200 123.66900 141.58400 1.000 152.86437 ? -43 DT  I "O5'" 1 
ATOM 6415  C "C5'" . DT  I 5 30  ? 126.98100 124.93000 141.92500 1.000 152.86437 ? -43 DT  I "C5'" 1 
ATOM 6416  C "C4'" . DT  I 5 30  ? 127.40400 124.96800 143.37400 1.000 152.86437 ? -43 DT  I "C4'" 1 
ATOM 6417  O "O4'" . DT  I 5 30  ? 126.24400 125.17100 144.21600 1.000 152.86437 ? -43 DT  I "O4'" 1 
ATOM 6418  C "C3'" . DT  I 5 30  ? 128.08900 123.70000 143.86700 1.000 152.86437 ? -43 DT  I "C3'" 1 
ATOM 6419  O "O3'" . DT  I 5 30  ? 129.26200 124.04900 144.55700 1.000 152.86437 ? -43 DT  I "O3'" 1 
ATOM 6420  C "C2'" . DT  I 5 30  ? 127.05100 123.07000 144.79400 1.000 152.86437 ? -43 DT  I "C2'" 1 
ATOM 6421  C "C1'" . DT  I 5 30  ? 126.28900 124.28100 145.29600 1.000 152.86437 ? -43 DT  I "C1'" 1 
ATOM 6422  N N1    . DT  I 5 30  ? 124.88900 123.98800 145.71300 1.000 152.86437 ? -43 DT  I N1    1 
ATOM 6423  C C2    . DT  I 5 30  ? 124.48200 124.32200 146.98000 1.000 152.86437 ? -43 DT  I C2    1 
ATOM 6424  O O2    . DT  I 5 30  ? 125.21300 124.83700 147.79900 1.000 152.86437 ? -43 DT  I O2    1 
ATOM 6425  N N3    . DT  I 5 30  ? 123.18000 124.02400 147.25900 1.000 152.86437 ? -43 DT  I N3    1 
ATOM 6426  C C4    . DT  I 5 30  ? 122.26300 123.44600 146.41800 1.000 152.86437 ? -43 DT  I C4    1 
ATOM 6427  O O4    . DT  I 5 30  ? 121.11300 123.21200 146.76200 1.000 152.86437 ? -43 DT  I O4    1 
ATOM 6428  C C5    . DT  I 5 30  ? 122.74900 123.12400 145.10900 1.000 152.86437 ? -43 DT  I C5    1 
ATOM 6429  C C7    . DT  I 5 30  ? 121.83500 122.47800 144.12200 1.000 152.86437 ? -43 DT  I C7    1 
ATOM 6430  C C6    . DT  I 5 30  ? 124.02100 123.41800 144.81300 1.000 152.86437 ? -43 DT  I C6    1 
ATOM 6431  P P     . DT  I 5 31  ? 130.28400 122.91800 145.05200 1.000 160.10265 ? -42 DT  I P     1 
ATOM 6432  O OP1   . DT  I 5 31  ? 131.64600 123.48100 144.94500 1.000 160.10265 ? -42 DT  I OP1   1 
ATOM 6433  O OP2   . DT  I 5 31  ? 129.96400 121.65000 144.36900 1.000 160.10265 ? -42 DT  I OP2   1 
ATOM 6434  O "O5'" . DT  I 5 31  ? 129.93100 122.77000 146.59300 1.000 160.10265 ? -42 DT  I "O5'" 1 
ATOM 6435  C "C5'" . DT  I 5 31  ? 129.89000 123.92200 147.40700 1.000 160.10265 ? -42 DT  I "C5'" 1 
ATOM 6436  C "C4'" . DT  I 5 31  ? 129.59400 123.56300 148.84900 1.000 160.10265 ? -42 DT  I "C4'" 1 
ATOM 6437  O "O4'" . DT  I 5 31  ? 128.16500 123.41100 149.04400 1.000 160.10265 ? -42 DT  I "O4'" 1 
ATOM 6438  C "C3'" . DT  I 5 31  ? 130.23300 122.26700 149.33300 1.000 160.10265 ? -42 DT  I "C3'" 1 
ATOM 6439  O "O3'" . DT  I 5 31  ? 130.73600 122.45000 150.63100 1.000 160.10265 ? -42 DT  I "O3'" 1 
ATOM 6440  C "C2'" . DT  I 5 31  ? 129.06700 121.28500 149.33500 1.000 160.10265 ? -42 DT  I "C2'" 1 
ATOM 6441  C "C1'" . DT  I 5 31  ? 127.90800 122.19400 149.69900 1.000 160.10265 ? -42 DT  I "C1'" 1 
ATOM 6442  N N1    . DT  I 5 31  ? 126.58500 121.69500 149.26000 1.000 160.10265 ? -42 DT  I N1    1 
ATOM 6443  C C2    . DT  I 5 31  ? 125.54200 121.69700 150.14800 1.000 160.10265 ? -42 DT  I C2    1 
ATOM 6444  O O2    . DT  I 5 31  ? 125.64500 122.08200 151.29200 1.000 160.10265 ? -42 DT  I O2    1 
ATOM 6445  N N3    . DT  I 5 31  ? 124.36700 121.22500 149.65000 1.000 160.10265 ? -42 DT  I N3    1 
ATOM 6446  C C4    . DT  I 5 31  ? 124.13200 120.75900 148.38100 1.000 160.10265 ? -42 DT  I C4    1 
ATOM 6447  O O4    . DT  I 5 31  ? 123.03600 120.35100 148.02300 1.000 160.10265 ? -42 DT  I O4    1 
ATOM 6448  C C5    . DT  I 5 31  ? 125.26300 120.78300 147.49800 1.000 160.10265 ? -42 DT  I C5    1 
ATOM 6449  C C7    . DT  I 5 31  ? 125.11700 120.28600 146.09400 1.000 160.10265 ? -42 DT  I C7    1 
ATOM 6450  C C6    . DT  I 5 31  ? 126.42500 121.24600 147.97300 1.000 160.10265 ? -42 DT  I C6    1 
ATOM 6451  P P     . DG  I 5 32  ? 131.89800 121.49700 151.18800 1.000 165.23306 ? -41 DG  I P     1 
ATOM 6452  O OP1   . DG  I 5 32  ? 132.94100 122.36400 151.77400 1.000 165.23306 ? -41 DG  I OP1   1 
ATOM 6453  O OP2   . DG  I 5 32  ? 132.25100 120.53800 150.12100 1.000 165.23306 ? -41 DG  I OP2   1 
ATOM 6454  O "O5'" . DG  I 5 32  ? 131.17400 120.69800 152.36100 1.000 165.23306 ? -41 DG  I "O5'" 1 
ATOM 6455  C "C5'" . DG  I 5 32  ? 130.45300 121.41200 153.34500 1.000 165.23306 ? -41 DG  I "C5'" 1 
ATOM 6456  C "C4'" . DG  I 5 32  ? 129.34900 120.55500 153.93000 1.000 165.23306 ? -41 DG  I "C4'" 1 
ATOM 6457  O "O4'" . DG  I 5 32  ? 128.23000 120.50100 153.02700 1.000 165.23306 ? -41 DG  I "O4'" 1 
ATOM 6458  C "C3'" . DG  I 5 32  ? 129.74100 119.10700 154.18000 1.000 165.23306 ? -41 DG  I "C3'" 1 
ATOM 6459  O "O3'" . DG  I 5 32  ? 130.00100 118.91400 155.56300 1.000 165.23306 ? -41 DG  I "O3'" 1 
ATOM 6460  C "C2'" . DG  I 5 32  ? 128.53000 118.28900 153.71100 1.000 165.23306 ? -41 DG  I "C2'" 1 
ATOM 6461  C "C1'" . DG  I 5 32  ? 127.50400 119.33600 153.30700 1.000 165.23306 ? -41 DG  I "C1'" 1 
ATOM 6462  N N9    . DG  I 5 32  ? 126.72000 118.96400 152.13700 1.000 165.23306 ? -41 DG  I N9    1 
ATOM 6463  C C8    . DG  I 5 32  ? 127.15700 118.87100 150.84800 1.000 165.23306 ? -41 DG  I C8    1 
ATOM 6464  N N7    . DG  I 5 32  ? 126.22800 118.53100 150.00600 1.000 165.23306 ? -41 DG  I N7    1 
ATOM 6465  C C5    . DG  I 5 32  ? 125.10100 118.37700 150.79100 1.000 165.23306 ? -41 DG  I C5    1 
ATOM 6466  C C6    . DG  I 5 32  ? 123.78500 118.02300 150.43000 1.000 165.23306 ? -41 DG  I C6    1 
ATOM 6467  O O6    . DG  I 5 32  ? 123.34500 117.74500 149.31100 1.000 165.23306 ? -41 DG  I O6    1 
ATOM 6468  N N1    . DG  I 5 32  ? 122.94200 117.98600 151.52800 1.000 165.23306 ? -41 DG  I N1    1 
ATOM 6469  C C2    . DG  I 5 32  ? 123.32100 118.26500 152.81200 1.000 165.23306 ? -41 DG  I C2    1 
ATOM 6470  N N2    . DG  I 5 32  ? 122.36100 118.18300 153.74000 1.000 165.23306 ? -41 DG  I N2    1 
ATOM 6471  N N3    . DG  I 5 32  ? 124.55100 118.60900 153.16500 1.000 165.23306 ? -41 DG  I N3    1 
ATOM 6472  C C4    . DG  I 5 32  ? 125.38400 118.64600 152.10400 1.000 165.23306 ? -41 DG  I C4    1 
ATOM 6473  P P     . DG  I 5 33  ? 130.62700 117.53000 156.08700 1.000 171.79350 ? -40 DG  I P     1 
ATOM 6474  O OP1   . DG  I 5 33  ? 131.32400 117.80300 157.36200 1.000 171.79350 ? -40 DG  I OP1   1 
ATOM 6475  O OP2   . DG  I 5 33  ? 131.35700 116.91600 154.95800 1.000 171.79350 ? -40 DG  I OP2   1 
ATOM 6476  O "O5'" . DG  I 5 33  ? 129.35200 116.61900 156.39100 1.000 171.79350 ? -40 DG  I "O5'" 1 
ATOM 6477  C "C5'" . DG  I 5 33  ? 128.30400 117.13000 157.19500 1.000 171.79350 ? -40 DG  I "C5'" 1 
ATOM 6478  C "C4'" . DG  I 5 33  ? 127.03700 116.33200 156.98400 1.000 171.79350 ? -40 DG  I "C4'" 1 
ATOM 6479  O "O4'" . DG  I 5 33  ? 126.53300 116.54600 155.65500 1.000 171.79350 ? -40 DG  I "O4'" 1 
ATOM 6480  C "C3'" . DG  I 5 33  ? 127.20000 114.82400 157.12000 1.000 171.79350 ? -40 DG  I "C3'" 1 
ATOM 6481  O "O3'" . DG  I 5 33  ? 126.70500 114.40200 158.38200 1.000 171.79350 ? -40 DG  I "O3'" 1 
ATOM 6482  C "C2'" . DG  I 5 33  ? 126.37800 114.24000 155.96300 1.000 171.79350 ? -40 DG  I "C2'" 1 
ATOM 6483  C "C1'" . DG  I 5 33  ? 125.72400 115.45400 155.32400 1.000 171.79350 ? -40 DG  I "C1'" 1 
ATOM 6484  N N9    . DG  I 5 33  ? 125.62000 115.35300 153.87700 1.000 171.79350 ? -40 DG  I N9    1 
ATOM 6485  C C8    . DG  I 5 33  ? 126.61900 115.53100 152.96000 1.000 171.79350 ? -40 DG  I C8    1 
ATOM 6486  N N7    . DG  I 5 33  ? 126.22900 115.37400 151.73200 1.000 171.79350 ? -40 DG  I N7    1 
ATOM 6487  C C5    . DG  I 5 33  ? 124.88600 115.06300 151.84400 1.000 171.79350 ? -40 DG  I C5    1 
ATOM 6488  C C6    . DG  I 5 33  ? 123.93500 114.77600 150.84500 1.000 171.79350 ? -40 DG  I C6    1 
ATOM 6489  O O6    . DG  I 5 33  ? 124.09400 114.75200 149.62300 1.000 171.79350 ? -40 DG  I O6    1 
ATOM 6490  N N1    . DG  I 5 33  ? 122.68600 114.51600 151.38500 1.000 171.79350 ? -40 DG  I N1    1 
ATOM 6491  C C2    . DG  I 5 33  ? 122.39300 114.52400 152.72200 1.000 171.79350 ? -40 DG  I C2    1 
ATOM 6492  N N2    . DG  I 5 33  ? 121.12700 114.24500 153.05300 1.000 171.79350 ? -40 DG  I N2    1 
ATOM 6493  N N3    . DG  I 5 33  ? 123.27800 114.78500 153.67100 1.000 171.79350 ? -40 DG  I N3    1 
ATOM 6494  C C4    . DG  I 5 33  ? 124.49900 115.04400 153.15800 1.000 171.79350 ? -40 DG  I C4    1 
ATOM 6495  P P     . DT  I 5 34  ? 126.85000 112.87200 158.84700 1.000 174.67165 ? -39 DT  I P     1 
ATOM 6496  O OP1   . DT  I 5 34  ? 126.82300 112.85400 160.32500 1.000 174.67165 ? -39 DT  I OP1   1 
ATOM 6497  O OP2   . DT  I 5 34  ? 127.99200 112.28300 158.11700 1.000 174.67165 ? -39 DT  I OP2   1 
ATOM 6498  O "O5'" . DT  I 5 34  ? 125.52000 112.17700 158.29700 1.000 174.67165 ? -39 DT  I "O5'" 1 
ATOM 6499  C "C5'" . DT  I 5 34  ? 124.26200 112.76300 158.57300 1.000 174.67165 ? -39 DT  I "C5'" 1 
ATOM 6500  C "C4'" . DT  I 5 34  ? 123.16300 112.05100 157.81800 1.000 174.67165 ? -39 DT  I "C4'" 1 
ATOM 6501  O "O4'" . DT  I 5 34  ? 123.23700 112.37500 156.41500 1.000 174.67165 ? -39 DT  I "O4'" 1 
ATOM 6502  C "C3'" . DT  I 5 34  ? 123.21300 110.53000 157.91000 1.000 174.67165 ? -39 DT  I "C3'" 1 
ATOM 6503  O "O3'" . DT  I 5 34  ? 122.02500 110.06400 158.48100 1.000 174.67165 ? -39 DT  I "O3'" 1 
ATOM 6504  C "C2'" . DT  I 5 34  ? 123.36400 110.05700 156.46100 1.000 174.67165 ? -39 DT  I "C2'" 1 
ATOM 6505  C "C1'" . DT  I 5 34  ? 122.86500 111.24800 155.67000 1.000 174.67165 ? -39 DT  I "C1'" 1 
ATOM 6506  N N1    . DT  I 5 34  ? 123.47200 111.35900 154.33400 1.000 174.67165 ? -39 DT  I N1    1 
ATOM 6507  C C2    . DT  I 5 34  ? 122.68500 111.20800 153.22700 1.000 174.67165 ? -39 DT  I C2    1 
ATOM 6508  O O2    . DT  I 5 34  ? 121.49300 110.98900 153.28300 1.000 174.67165 ? -39 DT  I O2    1 
ATOM 6509  N N3    . DT  I 5 34  ? 123.34400 111.33700 152.04000 1.000 174.67165 ? -39 DT  I N3    1 
ATOM 6510  C C4    . DT  I 5 34  ? 124.68500 111.58800 151.86000 1.000 174.67165 ? -39 DT  I C4    1 
ATOM 6511  O O4    . DT  I 5 34  ? 125.18900 111.68300 150.75300 1.000 174.67165 ? -39 DT  I O4    1 
ATOM 6512  C C5    . DT  I 5 34  ? 125.45100 111.73000 153.06500 1.000 174.67165 ? -39 DT  I C5    1 
ATOM 6513  C C7    . DT  I 5 34  ? 126.92000 112.00100 152.99400 1.000 174.67165 ? -39 DT  I C7    1 
ATOM 6514  C C6    . DT  I 5 34  ? 124.81400 111.60400 154.22900 1.000 174.67165 ? -39 DT  I C6    1 
ATOM 6515  P P     . DC  I 5 35  ? 121.92400 108.55200 158.99800 1.000 167.25386 ? -38 DC  I P     1 
ATOM 6516  O OP1   . DC  I 5 35  ? 121.09600 108.56600 160.22300 1.000 167.25386 ? -38 DC  I OP1   1 
ATOM 6517  O OP2   . DC  I 5 35  ? 123.29100 107.98500 159.02900 1.000 167.25386 ? -38 DC  I OP2   1 
ATOM 6518  O "O5'" . DC  I 5 35  ? 121.11100 107.81700 157.84200 1.000 167.25386 ? -38 DC  I "O5'" 1 
ATOM 6519  C "C5'" . DC  I 5 35  ? 119.85800 108.33300 157.43500 1.000 167.25386 ? -38 DC  I "C5'" 1 
ATOM 6520  C "C4'" . DC  I 5 35  ? 119.33600 107.60400 156.21200 1.000 167.25386 ? -38 DC  I "C4'" 1 
ATOM 6521  O "O4'" . DC  I 5 35  ? 120.13300 107.93400 155.04700 1.000 167.25386 ? -38 DC  I "O4'" 1 
ATOM 6522  C "C3'" . DC  I 5 35  ? 119.35100 106.08400 156.32600 1.000 167.25386 ? -38 DC  I "C3'" 1 
ATOM 6523  O "O3'" . DC  I 5 35  ? 118.14000 105.56900 155.82400 1.000 167.25386 ? -38 DC  I "O3'" 1 
ATOM 6524  C "C2'" . DC  I 5 35  ? 120.53500 105.68400 155.44800 1.000 167.25386 ? -38 DC  I "C2'" 1 
ATOM 6525  C "C1'" . DC  I 5 35  ? 120.49500 106.75200 154.37400 1.000 167.25386 ? -38 DC  I "C1'" 1 
ATOM 6526  N N1    . DC  I 5 35  ? 121.80100 106.98000 153.72300 1.000 167.25386 ? -38 DC  I N1    1 
ATOM 6527  C C2    . DC  I 5 35  ? 121.87800 107.05900 152.33300 1.000 167.25386 ? -38 DC  I C2    1 
ATOM 6528  O O2    . DC  I 5 35  ? 120.84800 106.96200 151.66300 1.000 167.25386 ? -38 DC  I O2    1 
ATOM 6529  N N3    . DC  I 5 35  ? 123.07900 107.27800 151.75700 1.000 167.25386 ? -38 DC  I N3    1 
ATOM 6530  C C4    . DC  I 5 35  ? 124.16700 107.38900 152.51200 1.000 167.25386 ? -38 DC  I C4    1 
ATOM 6531  N N4    . DC  I 5 35  ? 125.33100 107.60000 151.89800 1.000 167.25386 ? -38 DC  I N4    1 
ATOM 6532  C C5    . DC  I 5 35  ? 124.11100 107.29600 153.92900 1.000 167.25386 ? -38 DC  I C5    1 
ATOM 6533  C C6    . DC  I 5 35  ? 122.91900 107.08700 154.48500 1.000 167.25386 ? -38 DC  I C6    1 
ATOM 6534  P P     . DG  I 5 36  ? 117.63900 104.10100 156.23900 1.000 163.52875 ? -37 DG  I P     1 
ATOM 6535  O OP1   . DG  I 5 36  ? 116.44100 104.28900 157.08300 1.000 163.52875 ? -37 DG  I OP1   1 
ATOM 6536  O OP2   . DG  I 5 36  ? 118.77100 103.30200 156.75400 1.000 163.52875 ? -37 DG  I OP2   1 
ATOM 6537  O "O5'" . DG  I 5 36  ? 117.17100 103.48100 154.85000 1.000 163.52875 ? -37 DG  I "O5'" 1 
ATOM 6538  C "C5'" . DG  I 5 36  ? 116.35500 104.25200 153.99800 1.000 163.52875 ? -37 DG  I "C5'" 1 
ATOM 6539  C "C4'" . DG  I 5 36  ? 116.56100 103.86300 152.55200 1.000 163.52875 ? -37 DG  I "C4'" 1 
ATOM 6540  O "O4'" . DG  I 5 36  ? 117.86800 104.29700 152.10500 1.000 163.52875 ? -37 DG  I "O4'" 1 
ATOM 6541  C "C3'" . DG  I 5 36  ? 116.47900 102.37100 152.27100 1.000 163.52875 ? -37 DG  I "C3'" 1 
ATOM 6542  O "O3'" . DG  I 5 36  ? 115.65500 102.16300 151.15300 1.000 163.52875 ? -37 DG  I "O3'" 1 
ATOM 6543  C "C2'" . DG  I 5 36  ? 117.92900 101.97300 151.99400 1.000 163.52875 ? -37 DG  I "C2'" 1 
ATOM 6544  C "C1'" . DG  I 5 36  ? 118.52400 103.24800 151.43200 1.000 163.52875 ? -37 DG  I "C1'" 1 
ATOM 6545  N N9    . DG  I 5 36  ? 119.95500 103.39400 151.68400 1.000 163.52875 ? -37 DG  I N9    1 
ATOM 6546  C C8    . DG  I 5 36  ? 120.57400 103.38200 152.90100 1.000 163.52875 ? -37 DG  I C8    1 
ATOM 6547  N N7    . DG  I 5 36  ? 121.85700 103.57900 152.83700 1.000 163.52875 ? -37 DG  I N7    1 
ATOM 6548  C C5    . DG  I 5 36  ? 122.10600 103.75100 151.48800 1.000 163.52875 ? -37 DG  I C5    1 
ATOM 6549  C C6    . DG  I 5 36  ? 123.31800 104.00000 150.81700 1.000 163.52875 ? -37 DG  I C6    1 
ATOM 6550  O O6    . DG  I 5 36  ? 124.44600 104.11800 151.29900 1.000 163.52875 ? -37 DG  I O6    1 
ATOM 6551  N N1    . DG  I 5 36  ? 123.13900 104.11100 149.44600 1.000 163.52875 ? -37 DG  I N1    1 
ATOM 6552  C C2    . DG  I 5 36  ? 121.93500 103.99900 148.80500 1.000 163.52875 ? -37 DG  I C2    1 
ATOM 6553  N N2    . DG  I 5 36  ? 121.95600 104.13500 147.47200 1.000 163.52875 ? -37 DG  I N2    1 
ATOM 6554  N N3    . DG  I 5 36  ? 120.78400 103.76400 149.42400 1.000 163.52875 ? -37 DG  I N3    1 
ATOM 6555  C C4    . DG  I 5 36  ? 120.94600 103.65300 150.76200 1.000 163.52875 ? -37 DG  I C4    1 
ATOM 6556  P P     . DT  I 5 37  ? 115.14300 100.69400 150.77000 1.000 155.68067 ? -36 DT  I P     1 
ATOM 6557  O OP1   . DT  I 5 37  ? 113.70900 100.80300 150.43500 1.000 155.68067 ? -36 DT  I OP1   1 
ATOM 6558  O OP2   . DT  I 5 37  ? 115.58700 99.73100  151.79900 1.000 155.68067 ? -36 DT  I OP2   1 
ATOM 6559  O "O5'" . DT  I 5 37  ? 115.94900 100.39200 149.43700 1.000 155.68067 ? -36 DT  I "O5'" 1 
ATOM 6560  C "C5'" . DT  I 5 37  ? 116.08300 101.41700 148.47200 1.000 155.68067 ? -36 DT  I "C5'" 1 
ATOM 6561  C "C4'" . DT  I 5 37  ? 117.11200 101.07200 147.41000 1.000 155.68067 ? -36 DT  I "C4'" 1 
ATOM 6562  O "O4'" . DT  I 5 37  ? 118.46100 101.33800 147.88700 1.000 155.68067 ? -36 DT  I "O4'" 1 
ATOM 6563  C "C3'" . DT  I 5 37  ? 117.11800 99.62200  146.94400 1.000 155.68067 ? -36 DT  I "C3'" 1 
ATOM 6564  O "O3'" . DT  I 5 37  ? 117.42400 99.59600  145.56700 1.000 155.68067 ? -36 DT  I "O3'" 1 
ATOM 6565  C "C2'" . DT  I 5 37  ? 118.27600 99.03200  147.75800 1.000 155.68067 ? -36 DT  I "C2'" 1 
ATOM 6566  C "C1'" . DT  I 5 37  ? 119.25100 100.18700 147.68000 1.000 155.68067 ? -36 DT  I "C1'" 1 
ATOM 6567  N N1    . DT  I 5 37  ? 120.35300 100.17300 148.67400 1.000 155.68067 ? -36 DT  I N1    1 
ATOM 6568  C C2    . DT  I 5 37  ? 121.63000 100.43400 148.24700 1.000 155.68067 ? -36 DT  I C2    1 
ATOM 6569  O O2    . DT  I 5 37  ? 121.91000 100.65200 147.08800 1.000 155.68067 ? -36 DT  I O2    1 
ATOM 6570  N N3    . DT  I 5 37  ? 122.57500 100.41900 149.23100 1.000 155.68067 ? -36 DT  I N3    1 
ATOM 6571  C C4    . DT  I 5 37  ? 122.37700 100.19100 150.56900 1.000 155.68067 ? -36 DT  I C4    1 
ATOM 6572  O O4    . DT  I 5 37  ? 123.29400 100.20000 151.37700 1.000 155.68067 ? -36 DT  I O4    1 
ATOM 6573  C C5    . DT  I 5 37  ? 121.01900 99.93400  150.95600 1.000 155.68067 ? -36 DT  I C5    1 
ATOM 6574  C C7    . DT  I 5 37  ? 120.69600 99.66000  152.39200 1.000 155.68067 ? -36 DT  I C7    1 
ATOM 6575  C C6    . DT  I 5 37  ? 120.07700 99.94000  150.00000 1.000 155.68067 ? -36 DT  I C6    1 
ATOM 6576  P P     . DA  I 5 38  ? 116.27600 99.52100  144.44600 1.000 150.03253 ? -35 DA  I P     1 
ATOM 6577  O OP1   . DA  I 5 38  ? 115.34700 100.65000 144.65100 1.000 150.03253 ? -35 DA  I OP1   1 
ATOM 6578  O OP2   . DA  I 5 38  ? 115.74500 98.14300  144.42900 1.000 150.03253 ? -35 DA  I OP2   1 
ATOM 6579  O "O5'" . DA  I 5 38  ? 117.07300 99.76300  143.07700 1.000 150.03253 ? -35 DA  I "O5'" 1 
ATOM 6580  C "C5'" . DA  I 5 38  ? 117.84800 100.94900 142.90000 1.000 150.03253 ? -35 DA  I "C5'" 1 
ATOM 6581  C "C4'" . DA  I 5 38  ? 118.88100 100.84500 141.76500 1.000 150.03253 ? -35 DA  I "C4'" 1 
ATOM 6582  O "O4'" . DA  I 5 38  ? 120.18400 100.49900 142.26900 1.000 150.03253 ? -35 DA  I "O4'" 1 
ATOM 6583  C "C3'" . DA  I 5 38  ? 118.61300 99.84500  140.65400 1.000 150.03253 ? -35 DA  I "C3'" 1 
ATOM 6584  O "O3'" . DA  I 5 38  ? 119.21800 100.34400 139.42900 1.000 150.03253 ? -35 DA  I "O3'" 1 
ATOM 6585  C "C2'" . DA  I 5 38  ? 119.31500 98.57900  141.17600 1.000 150.03253 ? -35 DA  I "C2'" 1 
ATOM 6586  C "C1'" . DA  I 5 38  ? 120.42200 99.12100  142.08500 1.000 150.03253 ? -35 DA  I "C1'" 1 
ATOM 6587  N N9    . DA  I 5 38  ? 120.43900 98.50600  143.39100 1.000 150.03253 ? -35 DA  I N9    1 
ATOM 6588  C C8    . DA  I 5 38  ? 119.39000 97.93100  144.02000 1.000 150.03253 ? -35 DA  I C8    1 
ATOM 6589  N N7    . DA  I 5 38  ? 119.66600 97.48900  145.21400 1.000 150.03253 ? -35 DA  I N7    1 
ATOM 6590  C C5    . DA  I 5 38  ? 120.99200 97.80700  145.38600 1.000 150.03253 ? -35 DA  I C5    1 
ATOM 6591  C C6    . DA  I 5 38  ? 121.87700 97.59700  146.44700 1.000 150.03253 ? -35 DA  I C6    1 
ATOM 6592  N N6    . DA  I 5 38  ? 121.52300 97.00000  147.58300 1.000 150.03253 ? -35 DA  I N6    1 
ATOM 6593  N N1    . DA  I 5 38  ? 123.14100 98.02700  146.30100 1.000 150.03253 ? -35 DA  I N1    1 
ATOM 6594  C C2    . DA  I 5 38  ? 123.49300 98.62600  145.15800 1.000 150.03253 ? -35 DA  I C2    1 
ATOM 6595  N N3    . DA  I 5 38  ? 122.74300 98.87800  144.08800 1.000 150.03253 ? -35 DA  I N3    1 
ATOM 6596  C C4    . DA  I 5 38  ? 121.49000 98.44000  144.27200 1.000 150.03253 ? -35 DA  I C4    1 
ATOM 6597  P P     . DG  I 5 39  ? 119.61300 99.39300  138.18700 1.000 152.45950 ? -34 DG  I P     1 
ATOM 6598  O OP1   . DG  I 5 39  ? 119.76000 100.30500 137.03600 1.000 152.45950 ? -34 DG  I OP1   1 
ATOM 6599  O OP2   . DG  I 5 39  ? 118.65700 98.27600  138.04900 1.000 152.45950 ? -34 DG  I OP2   1 
ATOM 6600  O "O5'" . DG  I 5 39  ? 121.07000 98.83700  138.55400 1.000 152.45950 ? -34 DG  I "O5'" 1 
ATOM 6601  C "C5'" . DG  I 5 39  ? 122.12700 99.74200  138.83300 1.000 152.45950 ? -34 DG  I "C5'" 1 
ATOM 6602  C "C4'" . DG  I 5 39  ? 123.43600 99.03300  139.19900 1.000 152.45950 ? -34 DG  I "C4'" 1 
ATOM 6603  O "O4'" . DG  I 5 39  ? 123.36400 98.45100  140.53000 1.000 152.45950 ? -34 DG  I "O4'" 1 
ATOM 6604  C "C3'" . DG  I 5 39  ? 123.88000 97.89000  138.29100 1.000 152.45950 ? -34 DG  I "C3'" 1 
ATOM 6605  O "O3'" . DG  I 5 39  ? 125.27900 97.85900  138.28000 1.000 152.45950 ? -34 DG  I "O3'" 1 
ATOM 6606  C "C2'" . DG  I 5 39  ? 123.35700 96.67300  139.04100 1.000 152.45950 ? -34 DG  I "C2'" 1 
ATOM 6607  C "C1'" . DG  I 5 39  ? 123.71600 97.08300  140.45400 1.000 152.45950 ? -34 DG  I "C1'" 1 
ATOM 6608  N N9    . DG  I 5 39  ? 123.01800 96.35900  141.50800 1.000 152.45950 ? -34 DG  I N9    1 
ATOM 6609  C C8    . DG  I 5 39  ? 121.69700 96.00600  141.53600 1.000 152.45950 ? -34 DG  I C8    1 
ATOM 6610  N N7    . DG  I 5 39  ? 121.33800 95.41800  142.63900 1.000 152.45950 ? -34 DG  I N7    1 
ATOM 6611  C C5    . DG  I 5 39  ? 122.49600 95.38100  143.39400 1.000 152.45950 ? -34 DG  I C5    1 
ATOM 6612  C C6    . DG  I 5 39  ? 122.71800 94.85700  144.68000 1.000 152.45950 ? -34 DG  I C6    1 
ATOM 6613  O O6    . DG  I 5 39  ? 121.90900 94.30000  145.43200 1.000 152.45950 ? -34 DG  I O6    1 
ATOM 6614  N N1    . DG  I 5 39  ? 124.03200 95.02700  145.08200 1.000 152.45950 ? -34 DG  I N1    1 
ATOM 6615  C C2    . DG  I 5 39  ? 125.01300 95.63000  144.33200 1.000 152.45950 ? -34 DG  I C2    1 
ATOM 6616  N N2    . DG  I 5 39  ? 126.22700 95.69500  144.89000 1.000 152.45950 ? -34 DG  I N2    1 
ATOM 6617  N N3    . DG  I 5 39  ? 124.81700 96.12800  143.12200 1.000 152.45950 ? -34 DG  I N3    1 
ATOM 6618  C C4    . DG  I 5 39  ? 123.53700 95.96800  142.71800 1.000 152.45950 ? -34 DG  I C4    1 
ATOM 6619  P P     . DA  I 5 40  ? 126.09500 97.71500  136.90900 1.000 158.16263 ? -33 DA  I P     1 
ATOM 6620  O OP1   . DA  I 5 40  ? 126.12400 99.04200  136.26000 1.000 158.16263 ? -33 DA  I OP1   1 
ATOM 6621  O OP2   . DA  I 5 40  ? 125.55700 96.54400  136.18400 1.000 158.16263 ? -33 DA  I OP2   1 
ATOM 6622  O "O5'" . DA  I 5 40  ? 127.56700 97.35800  137.40900 1.000 158.16263 ? -33 DA  I "O5'" 1 
ATOM 6623  C "C5'" . DA  I 5 40  ? 128.14400 98.09500  138.48300 1.000 158.16263 ? -33 DA  I "C5'" 1 
ATOM 6624  C "C4'" . DA  I 5 40  ? 129.14800 97.27000  139.28900 1.000 158.16263 ? -33 DA  I "C4'" 1 
ATOM 6625  O "O4'" . DA  I 5 40  ? 128.49700 96.55500  140.37000 1.000 158.16263 ? -33 DA  I "O4'" 1 
ATOM 6626  C "C3'" . DA  I 5 40  ? 129.92900 96.22700  138.51300 1.000 158.16263 ? -33 DA  I "C3'" 1 
ATOM 6627  O "O3'" . DA  I 5 40  ? 131.21900 96.13600  139.05400 1.000 158.16263 ? -33 DA  I "O3'" 1 
ATOM 6628  C "C2'" . DA  I 5 40  ? 129.13400 94.94300  138.76900 1.000 158.16263 ? -33 DA  I "C2'" 1 
ATOM 6629  C "C1'" . DA  I 5 40  ? 128.61400 95.15500  140.18500 1.000 158.16263 ? -33 DA  I "C1'" 1 
ATOM 6630  N N9    . DA  I 5 40  ? 127.29900 94.57600  140.43000 1.000 158.16263 ? -33 DA  I N9    1 
ATOM 6631  C C8    . DA  I 5 40  ? 126.20300 94.68800  139.63600 1.000 158.16263 ? -33 DA  I C8    1 
ATOM 6632  N N7    . DA  I 5 40  ? 125.14100 94.08900  140.11200 1.000 158.16263 ? -33 DA  I N7    1 
ATOM 6633  C C5    . DA  I 5 40  ? 125.55700 93.57600  141.31400 1.000 158.16263 ? -33 DA  I C5    1 
ATOM 6634  C C6    . DA  I 5 40  ? 124.89300 92.83400  142.29800 1.000 158.16263 ? -33 DA  I C6    1 
ATOM 6635  N N6    . DA  I 5 40  ? 123.60900 92.48700  142.20700 1.000 158.16263 ? -33 DA  I N6    1 
ATOM 6636  N N1    . DA  I 5 40  ? 125.59900 92.45800  143.38000 1.000 158.16263 ? -33 DA  I N1    1 
ATOM 6637  C C2    . DA  I 5 40  ? 126.88800 92.81000  143.46200 1.000 158.16263 ? -33 DA  I C2    1 
ATOM 6638  N N3    . DA  I 5 40  ? 127.62100 93.50800  142.59700 1.000 158.16263 ? -33 DA  I N3    1 
ATOM 6639  C C4    . DA  I 5 40  ? 126.88700 93.86900  141.53700 1.000 158.16263 ? -33 DA  I C4    1 
ATOM 6640  P P     . DC  I 5 41  ? 132.34800 95.27300  138.31300 1.000 171.31414 ? -32 DC  I P     1 
ATOM 6641  O OP1   . DC  I 5 41  ? 133.62700 95.99300  138.49700 1.000 171.31414 ? -32 DC  I OP1   1 
ATOM 6642  O OP2   . DC  I 5 41  ? 131.87700 94.94300  136.95100 1.000 171.31414 ? -32 DC  I OP2   1 
ATOM 6643  O "O5'" . DC  I 5 41  ? 132.39600 93.93100  139.16900 1.000 171.31414 ? -32 DC  I "O5'" 1 
ATOM 6644  C "C5'" . DC  I 5 41  ? 132.39400 94.00400  140.57900 1.000 171.31414 ? -32 DC  I "C5'" 1 
ATOM 6645  C "C4'" . DC  I 5 41  ? 132.26400 92.62300  141.18100 1.000 171.31414 ? -32 DC  I "C4'" 1 
ATOM 6646  O "O4'" . DC  I 5 41  ? 130.87200 92.30600  141.42300 1.000 171.31414 ? -32 DC  I "O4'" 1 
ATOM 6647  C "C3'" . DC  I 5 41  ? 132.81600 91.49800  140.30900 1.000 171.31414 ? -32 DC  I "C3'" 1 
ATOM 6648  O "O3'" . DC  I 5 41  ? 133.64700 90.67200  141.08900 1.000 171.31414 ? -32 DC  I "O3'" 1 
ATOM 6649  C "C2'" . DC  I 5 41  ? 131.56000 90.75900  139.84000 1.000 171.31414 ? -32 DC  I "C2'" 1 
ATOM 6650  C "C1'" . DC  I 5 41  ? 130.62400 90.98500  141.00700 1.000 171.31414 ? -32 DC  I "C1'" 1 
ATOM 6651  N N1    . DC  I 5 41  ? 129.18800 90.86400  140.67000 1.000 171.31414 ? -32 DC  I N1    1 
ATOM 6652  C C2    . DC  I 5 41  ? 128.37300 90.06000  141.45700 1.000 171.31414 ? -32 DC  I C2    1 
ATOM 6653  O O2    . DC  I 5 41  ? 128.87200 89.47300  142.41900 1.000 171.31414 ? -32 DC  I O2    1 
ATOM 6654  N N3    . DC  I 5 41  ? 127.06000 89.96200  141.15300 1.000 171.31414 ? -32 DC  I N3    1 
ATOM 6655  C C4    . DC  I 5 41  ? 126.57000 90.61900  140.10600 1.000 171.31414 ? -32 DC  I C4    1 
ATOM 6656  N N4    . DC  I 5 41  ? 125.26900 90.49100  139.84000 1.000 171.31414 ? -32 DC  I N4    1 
ATOM 6657  C C5    . DC  I 5 41  ? 127.39200 91.43500  139.28200 1.000 171.31414 ? -32 DC  I C5    1 
ATOM 6658  C C6    . DC  I 5 41  ? 128.68300 91.52700  139.60000 1.000 171.31414 ? -32 DC  I C6    1 
ATOM 6659  P P     . DA  I 5 42  ? 134.66800 89.64900  140.39300 1.000 177.83566 ? -31 DA  I P     1 
ATOM 6660  O OP1   . DA  I 5 42  ? 135.99600 89.88700  140.99500 1.000 177.83566 ? -31 DA  I OP1   1 
ATOM 6661  O OP2   . DA  I 5 42  ? 134.51100 89.71400  138.92400 1.000 177.83566 ? -31 DA  I OP2   1 
ATOM 6662  O "O5'" . DA  I 5 42  ? 134.14500 88.23100  140.89100 1.000 177.83566 ? -31 DA  I "O5'" 1 
ATOM 6663  C "C5'" . DA  I 5 42  ? 133.91000 88.03400  142.26900 1.000 177.83566 ? -31 DA  I "C5'" 1 
ATOM 6664  C "C4'" . DA  I 5 42  ? 132.96800 86.87500  142.50000 1.000 177.83566 ? -31 DA  I "C4'" 1 
ATOM 6665  O "O4'" . DA  I 5 42  ? 131.60900 87.24100  142.15100 1.000 177.83566 ? -31 DA  I "O4'" 1 
ATOM 6666  C "C3'" . DA  I 5 42  ? 133.29500 85.61700  141.70000 1.000 177.83566 ? -31 DA  I "C3'" 1 
ATOM 6667  O "O3'" . DA  I 5 42  ? 133.22900 84.51100  142.55600 1.000 177.83566 ? -31 DA  I "O3'" 1 
ATOM 6668  C "C2'" . DA  I 5 42  ? 132.17700 85.57500  140.65400 1.000 177.83566 ? -31 DA  I "C2'" 1 
ATOM 6669  C "C1'" . DA  I 5 42  ? 131.03100 86.18100  141.43500 1.000 177.83566 ? -31 DA  I "C1'" 1 
ATOM 6670  N N9    . DA  I 5 42  ? 129.95200 86.70400  140.61300 1.000 177.83566 ? -31 DA  I N9    1 
ATOM 6671  C C8    . DA  I 5 42  ? 130.04300 87.65100  139.64200 1.000 177.83566 ? -31 DA  I C8    1 
ATOM 6672  N N7    . DA  I 5 42  ? 128.90000 87.94000  139.07500 1.000 177.83566 ? -31 DA  I N7    1 
ATOM 6673  C C5    . DA  I 5 42  ? 127.99700 87.12300  139.72300 1.000 177.83566 ? -31 DA  I C5    1 
ATOM 6674  C C6    . DA  I 5 42  ? 126.61300 86.94900  139.58600 1.000 177.83566 ? -31 DA  I C6    1 
ATOM 6675  N N6    . DA  I 5 42  ? 125.87500 87.62300  138.70600 1.000 177.83566 ? -31 DA  I N6    1 
ATOM 6676  N N1    . DA  I 5 42  ? 126.01300 86.05100  140.38800 1.000 177.83566 ? -31 DA  I N1    1 
ATOM 6677  C C2    . DA  I 5 42  ? 126.75500 85.37200  141.26700 1.000 177.83566 ? -31 DA  I C2    1 
ATOM 6678  N N3    . DA  I 5 42  ? 128.06300 85.45700  141.49100 1.000 177.83566 ? -31 DA  I N3    1 
ATOM 6679  C C4    . DA  I 5 42  ? 128.62800 86.35700  140.67600 1.000 177.83566 ? -31 DA  I C4    1 
ATOM 6680  P P     . DG  I 5 43  ? 134.02300 83.16100  142.22000 1.000 183.67262 ? -30 DG  I P     1 
ATOM 6681  O OP1   . DG  I 5 43  ? 135.37700 83.30800  142.79200 1.000 183.67262 ? -30 DG  I OP1   1 
ATOM 6682  O OP2   . DG  I 5 43  ? 133.87000 82.82600  140.78800 1.000 183.67262 ? -30 DG  I OP2   1 
ATOM 6683  O "O5'" . DG  I 5 43  ? 133.22900 82.06800  143.07000 1.000 183.67262 ? -30 DG  I "O5'" 1 
ATOM 6684  C "C5'" . DG  I 5 43  ? 131.88400 82.33000  143.46300 1.000 183.67262 ? -30 DG  I "C5'" 1 
ATOM 6685  C "C4'" . DG  I 5 43  ? 130.90100 81.52400  142.63500 1.000 183.67262 ? -30 DG  I "C4'" 1 
ATOM 6686  O "O4'" . DG  I 5 43  ? 130.03600 82.40800  141.90000 1.000 183.67262 ? -30 DG  I "O4'" 1 
ATOM 6687  C "C3'" . DG  I 5 43  ? 131.52400 80.60800  141.58800 1.000 183.67262 ? -30 DG  I "C3'" 1 
ATOM 6688  O "O3'" . DG  I 5 43  ? 131.61000 79.23000  142.10100 1.000 183.67262 ? -30 DG  I "O3'" 1 
ATOM 6689  C "C2'" . DG  I 5 43  ? 130.65200 80.78900  140.33700 1.000 183.67262 ? -30 DG  I "C2'" 1 
ATOM 6690  C "C1'" . DG  I 5 43  ? 129.51800 81.69000  140.81700 1.000 183.67262 ? -30 DG  I "C1'" 1 
ATOM 6691  N N9    . DG  I 5 43  ? 129.02500 82.60700  139.80000 1.000 183.67262 ? -30 DG  I N9    1 
ATOM 6692  C C8    . DG  I 5 43  ? 129.75300 83.51000  139.06900 1.000 183.67262 ? -30 DG  I C8    1 
ATOM 6693  N N7    . DG  I 5 43  ? 129.03100 84.19600  138.22900 1.000 183.67262 ? -30 DG  I N7    1 
ATOM 6694  C C5    . DG  I 5 43  ? 127.74300 83.72100  138.42200 1.000 183.67262 ? -30 DG  I C5    1 
ATOM 6695  C C6    . DG  I 5 43  ? 126.53200 84.09000  137.79700 1.000 183.67262 ? -30 DG  I C6    1 
ATOM 6696  O O6    . DG  I 5 43  ? 126.35500 84.93900  136.91700 1.000 183.67262 ? -30 DG  I O6    1 
ATOM 6697  N N1    . DG  I 5 43  ? 125.45300 83.36400  138.28900 1.000 183.67262 ? -30 DG  I N1    1 
ATOM 6698  C C2    . DG  I 5 43  ? 125.53700 82.40200  139.26400 1.000 183.67262 ? -30 DG  I C2    1 
ATOM 6699  N N2    . DG  I 5 43  ? 124.39000 81.80100  139.61500 1.000 183.67262 ? -30 DG  I N2    1 
ATOM 6700  N N3    . DG  I 5 43  ? 126.66700 82.04500  139.85600 1.000 183.67262 ? -30 DG  I N3    1 
ATOM 6701  C C4    . DG  I 5 43  ? 127.72500 82.74300  139.38500 1.000 183.67262 ? -30 DG  I C4    1 
ATOM 6702  P P     . DC  I 5 44  ? 130.61900 78.02100  141.68400 1.000 185.06034 ? -29 DC  I P     1 
ATOM 6703  O OP1   . DC  I 5 44  ? 130.88800 76.97800  142.69100 1.000 185.06034 ? -29 DC  I OP1   1 
ATOM 6704  O OP2   . DC  I 5 44  ? 130.74900 77.62400  140.26400 1.000 185.06034 ? -29 DC  I OP2   1 
ATOM 6705  O "O5'" . DC  I 5 44  ? 129.14700 78.55500  142.00400 1.000 185.06034 ? -29 DC  I "O5'" 1 
ATOM 6706  C "C5'" . DC  I 5 44  ? 128.16300 77.66100  142.48500 1.000 185.06034 ? -29 DC  I "C5'" 1 
ATOM 6707  C "C4'" . DC  I 5 44  ? 127.19200 77.27900  141.38700 1.000 185.06034 ? -29 DC  I "C4'" 1 
ATOM 6708  O "O4'" . DC  I 5 44  ? 127.00700 78.39200  140.49400 1.000 185.06034 ? -29 DC  I "O4'" 1 
ATOM 6709  C "C3'" . DC  I 5 44  ? 127.62500 76.10000  140.52200 1.000 185.06034 ? -29 DC  I "C3'" 1 
ATOM 6710  O "O3'" . DC  I 5 44  ? 126.73900 74.99700  140.77700 1.000 185.06034 ? -29 DC  I "O3'" 1 
ATOM 6711  C "C2'" . DC  I 5 44  ? 127.52600 76.63200  139.07600 1.000 185.06034 ? -29 DC  I "C2'" 1 
ATOM 6712  C "C1'" . DC  I 5 44  ? 126.71500 77.90800  139.21300 1.000 185.06034 ? -29 DC  I "C1'" 1 
ATOM 6713  N N1    . DC  I 5 44  ? 127.10100 78.96200  138.24100 1.000 185.06034 ? -29 DC  I N1    1 
ATOM 6714  C C2    . DC  I 5 44  ? 126.12700 79.58400  137.46100 1.000 185.06034 ? -29 DC  I C2    1 
ATOM 6715  O O2    . DC  I 5 44  ? 124.95000 79.24600  137.59100 1.000 185.06034 ? -29 DC  I O2    1 
ATOM 6716  N N3    . DC  I 5 44  ? 126.50500 80.55500  136.59500 1.000 185.06034 ? -29 DC  I N3    1 
ATOM 6717  C C4    . DC  I 5 44  ? 127.78700 80.89100  136.49400 1.000 185.06034 ? -29 DC  I C4    1 
ATOM 6718  N N4    . DC  I 5 44  ? 128.12000 81.84700  135.62700 1.000 185.06034 ? -29 DC  I N4    1 
ATOM 6719  C C5    . DC  I 5 44  ? 128.78900 80.26100  137.27500 1.000 185.06034 ? -29 DC  I C5    1 
ATOM 6720  C C6    . DC  I 5 44  ? 128.40200 79.31000  138.12200 1.000 185.06034 ? -29 DC  I C6    1 
ATOM 6721  P P     . DT  I 5 45  ? 126.64400 73.71600  139.80800 1.000 179.57783 ? -28 DT  I P     1 
ATOM 6722  O OP1   . DT  I 5 45  ? 126.05200 72.64100  140.63000 1.000 179.57783 ? -28 DT  I OP1   1 
ATOM 6723  O OP2   . DT  I 5 45  ? 127.93100 73.45200  139.12600 1.000 179.57783 ? -28 DT  I OP2   1 
ATOM 6724  O "O5'" . DT  I 5 45  ? 125.53500 74.14600  138.75000 1.000 179.57783 ? -28 DT  I "O5'" 1 
ATOM 6725  C "C5'" . DT  I 5 45  ? 124.30800 74.67700  139.21500 1.000 179.57783 ? -28 DT  I "C5'" 1 
ATOM 6726  C "C4'" . DT  I 5 45  ? 123.29000 74.81000  138.09600 1.000 179.57783 ? -28 DT  I "C4'" 1 
ATOM 6727  O "O4'" . DT  I 5 45  ? 123.55500 76.00700  137.32200 1.000 179.57783 ? -28 DT  I "O4'" 1 
ATOM 6728  C "C3'" . DT  I 5 45  ? 123.25500 73.65600  137.10100 1.000 179.57783 ? -28 DT  I "C3'" 1 
ATOM 6729  O "O3'" . DT  I 5 45  ? 121.92700 73.40600  136.73000 1.000 179.57783 ? -28 DT  I "O3'" 1 
ATOM 6730  C "C2'" . DT  I 5 45  ? 124.05300 74.20600  135.92000 1.000 179.57783 ? -28 DT  I "C2'" 1 
ATOM 6731  C "C1'" . DT  I 5 45  ? 123.69000 75.67900  135.95800 1.000 179.57783 ? -28 DT  I "C1'" 1 
ATOM 6732  N N1    . DT  I 5 45  ? 124.72600 76.56100  135.37300 1.000 179.57783 ? -28 DT  I N1    1 
ATOM 6733  C C2    . DT  I 5 45  ? 124.34700 77.57700  134.53600 1.000 179.57783 ? -28 DT  I C2    1 
ATOM 6734  O O2    . DT  I 5 45  ? 123.19000 77.80500  134.25000 1.000 179.57783 ? -28 DT  I O2    1 
ATOM 6735  N N3    . DT  I 5 45  ? 125.37500 78.33400  134.05400 1.000 179.57783 ? -28 DT  I N3    1 
ATOM 6736  C C4    . DT  I 5 45  ? 126.71800 78.16900  134.31400 1.000 179.57783 ? -28 DT  I C4    1 
ATOM 6737  O O4    . DT  I 5 45  ? 127.57300 78.89600  133.83200 1.000 179.57783 ? -28 DT  I O4    1 
ATOM 6738  C C5    . DT  I 5 45  ? 127.04600 77.08100  135.19100 1.000 179.57783 ? -28 DT  I C5    1 
ATOM 6739  C C7    . DT  I 5 45  ? 128.47500 76.80700  135.53400 1.000 179.57783 ? -28 DT  I C7    1 
ATOM 6740  C C6    . DT  I 5 45  ? 126.04800 76.33700  135.67200 1.000 179.57783 ? -28 DT  I C6    1 
ATOM 6741  P P     . DC  I 5 46  ? 121.51800 72.00600  136.06100 1.000 172.46094 ? -27 DC  I P     1 
ATOM 6742  O OP1   . DC  I 5 46  ? 120.42100 71.42800  136.86700 1.000 172.46094 ? -27 DC  I OP1   1 
ATOM 6743  O OP2   . DC  I 5 46  ? 122.73900 71.21000  135.81500 1.000 172.46094 ? -27 DC  I OP2   1 
ATOM 6744  O "O5'" . DC  I 5 46  ? 120.91800 72.45100  134.65900 1.000 172.46094 ? -27 DC  I "O5'" 1 
ATOM 6745  C "C5'" . DC  I 5 46  ? 119.89000 73.41300  134.62500 1.000 172.46094 ? -27 DC  I "C5'" 1 
ATOM 6746  C "C4'" . DC  I 5 46  ? 119.80600 74.10500  133.27600 1.000 172.46094 ? -27 DC  I "C4'" 1 
ATOM 6747  O "O4'" . DC  I 5 46  ? 121.03300 74.83000  132.99600 1.000 172.46094 ? -27 DC  I "O4'" 1 
ATOM 6748  C "C3'" . DC  I 5 46  ? 119.59200 73.18500  132.08500 1.000 172.46094 ? -27 DC  I "C3'" 1 
ATOM 6749  O "O3'" . DC  I 5 46  ? 118.75400 73.83000  131.18000 1.000 172.46094 ? -27 DC  I "O3'" 1 
ATOM 6750  C "C2'" . DC  I 5 46  ? 121.00000 73.04300  131.51000 1.000 172.46094 ? -27 DC  I "C2'" 1 
ATOM 6751  C "C1'" . DC  I 5 46  ? 121.54000 74.43600  131.73800 1.000 172.46094 ? -27 DC  I "C1'" 1 
ATOM 6752  N N1    . DC  I 5 46  ? 123.02900 74.54600  131.78200 1.000 172.46094 ? -27 DC  I N1    1 
ATOM 6753  C C2    . DC  I 5 46  ? 123.64700 75.63000  131.15700 1.000 172.46094 ? -27 DC  I C2    1 
ATOM 6754  O O2    . DC  I 5 46  ? 122.94300 76.46000  130.57600 1.000 172.46094 ? -27 DC  I O2    1 
ATOM 6755  N N3    . DC  I 5 46  ? 124.99400 75.74800  131.21600 1.000 172.46094 ? -27 DC  I N3    1 
ATOM 6756  C C4    . DC  I 5 46  ? 125.71300 74.83500  131.85700 1.000 172.46094 ? -27 DC  I C4    1 
ATOM 6757  N N4    . DC  I 5 46  ? 127.03900 74.99400  131.88400 1.000 172.46094 ? -27 DC  I N4    1 
ATOM 6758  C C5    . DC  I 5 46  ? 125.10400 73.71800  132.50000 1.000 172.46094 ? -27 DC  I C5    1 
ATOM 6759  C C6    . DC  I 5 46  ? 123.77000 73.61400  132.43600 1.000 172.46094 ? -27 DC  I C6    1 
ATOM 6760  P P     . DT  I 5 47  ? 117.84400 72.98800  130.16800 1.000 170.08148 ? -26 DT  I P     1 
ATOM 6761  O OP1   . DT  I 5 47  ? 116.46400 73.01300  130.69100 1.000 170.08148 ? -26 DT  I OP1   1 
ATOM 6762  O OP2   . DT  I 5 47  ? 118.50200 71.69800  129.88000 1.000 170.08148 ? -26 DT  I OP2   1 
ATOM 6763  O "O5'" . DT  I 5 47  ? 117.89600 73.86200  128.84800 1.000 170.08148 ? -26 DT  I "O5'" 1 
ATOM 6764  C "C5'" . DT  I 5 47  ? 117.88200 75.27900  128.93600 1.000 170.08148 ? -26 DT  I "C5'" 1 
ATOM 6765  C "C4'" . DT  I 5 47  ? 118.64000 75.91900  127.78000 1.000 170.08148 ? -26 DT  I "C4'" 1 
ATOM 6766  O "O4'" . DT  I 5 47  ? 120.06800 75.96900  128.04800 1.000 170.08148 ? -26 DT  I "O4'" 1 
ATOM 6767  C "C3'" . DT  I 5 47  ? 118.50000 75.20100  126.44300 1.000 170.08148 ? -26 DT  I "C3'" 1 
ATOM 6768  O "O3'" . DT  I 5 47  ? 118.46800 76.14400  125.41000 1.000 170.08148 ? -26 DT  I "O3'" 1 
ATOM 6769  C "C2'" . DT  I 5 47  ? 119.79800 74.40300  126.37900 1.000 170.08148 ? -26 DT  I "C2'" 1 
ATOM 6770  C "C1'" . DT  I 5 47  ? 120.74800 75.42800  126.93700 1.000 170.08148 ? -26 DT  I "C1'" 1 
ATOM 6771  N N1    . DT  I 5 47  ? 122.04400 74.89500  127.37500 1.000 170.08148 ? -26 DT  I N1    1 
ATOM 6772  C C2    . DT  I 5 47  ? 123.16400 75.64100  127.14100 1.000 170.08148 ? -26 DT  I C2    1 
ATOM 6773  O O2    . DT  I 5 47  ? 123.13800 76.73000  126.60900 1.000 170.08148 ? -26 DT  I O2    1 
ATOM 6774  N N3    . DT  I 5 47  ? 124.32000 75.08400  127.58000 1.000 170.08148 ? -26 DT  I N3    1 
ATOM 6775  C C4    . DT  I 5 47  ? 124.47600 73.86900  128.20000 1.000 170.08148 ? -26 DT  I C4    1 
ATOM 6776  O O4    . DT  I 5 47  ? 125.56800 73.45400  128.55400 1.000 170.08148 ? -26 DT  I O4    1 
ATOM 6777  C C5    . DT  I 5 47  ? 123.26800 73.12200  128.40400 1.000 170.08148 ? -26 DT  I C5    1 
ATOM 6778  C C7    . DT  I 5 47  ? 123.33000 71.77900  129.06400 1.000 170.08148 ? -26 DT  I C7    1 
ATOM 6779  C C6    . DT  I 5 47  ? 122.11500 73.66200  127.98200 1.000 170.08148 ? -26 DT  I C6    1 
ATOM 6780  P P     . DA  I 5 48  ? 117.07000 76.65700  124.81900 1.000 168.96717 ? -25 DA  I P     1 
ATOM 6781  O OP1   . DA  I 5 48  ? 116.41900 77.49300  125.84800 1.000 168.96717 ? -25 DA  I OP1   1 
ATOM 6782  O OP2   . DA  I 5 48  ? 116.35900 75.49000  124.26100 1.000 168.96717 ? -25 DA  I OP2   1 
ATOM 6783  O "O5'" . DA  I 5 48  ? 117.52100 77.59400  123.61600 1.000 168.96717 ? -25 DA  I "O5'" 1 
ATOM 6784  C "C5'" . DA  I 5 48  ? 118.42200 78.64600  123.86600 1.000 168.96717 ? -25 DA  I "C5'" 1 
ATOM 6785  C "C4'" . DA  I 5 48  ? 119.63000 78.59700  122.93900 1.000 168.96717 ? -25 DA  I "C4'" 1 
ATOM 6786  O "O4'" . DA  I 5 48  ? 120.57400 77.58700  123.38800 1.000 168.96717 ? -25 DA  I "O4'" 1 
ATOM 6787  C "C3'" . DA  I 5 48  ? 119.34100 78.25900  121.47700 1.000 168.96717 ? -25 DA  I "C3'" 1 
ATOM 6788  O "O3'" . DA  I 5 48  ? 120.20600 78.99900  120.65700 1.000 168.96717 ? -25 DA  I "O3'" 1 
ATOM 6789  C "C2'" . DA  I 5 48  ? 119.68700 76.77700  121.40200 1.000 168.96717 ? -25 DA  I "C2'" 1 
ATOM 6790  C "C1'" . DA  I 5 48  ? 120.90200 76.74600  122.30200 1.000 168.96717 ? -25 DA  I "C1'" 1 
ATOM 6791  N N9    . DA  I 5 48  ? 121.24300 75.42700  122.80600 1.000 168.96717 ? -25 DA  I N9    1 
ATOM 6792  C C8    . DA  I 5 48  ? 120.40100 74.37900  123.02000 1.000 168.96717 ? -25 DA  I C8    1 
ATOM 6793  N N7    . DA  I 5 48  ? 120.99700 73.31800  123.51200 1.000 168.96717 ? -25 DA  I N7    1 
ATOM 6794  C C5    . DA  I 5 48  ? 122.31200 73.71400  123.65500 1.000 168.96717 ? -25 DA  I C5    1 
ATOM 6795  C C6    . DA  I 5 48  ? 123.46000 73.05300  124.12900 1.000 168.96717 ? -25 DA  I C6    1 
ATOM 6796  N N6    . DA  I 5 48  ? 123.45300 71.79700  124.57400 1.000 168.96717 ? -25 DA  I N6    1 
ATOM 6797  N N1    . DA  I 5 48  ? 124.62300 73.73700  124.12800 1.000 168.96717 ? -25 DA  I N1    1 
ATOM 6798  C C2    . DA  I 5 48  ? 124.63000 74.99400  123.68200 1.000 168.96717 ? -25 DA  I C2    1 
ATOM 6799  N N3    . DA  I 5 48  ? 123.61800 75.71600  123.21200 1.000 168.96717 ? -25 DA  I N3    1 
ATOM 6800  C C4    . DA  I 5 48  ? 122.47900 75.01100  123.22800 1.000 168.96717 ? -25 DA  I C4    1 
ATOM 6801  P P     . DG  I 5 49  ? 119.64300 79.74100  119.35700 1.000 164.57051 ? -24 DG  I P     1 
ATOM 6802  O OP1   . DG  I 5 49  ? 118.92900 80.95100  119.81300 1.000 164.57051 ? -24 DG  I OP1   1 
ATOM 6803  O OP2   . DG  I 5 49  ? 118.94700 78.73100  118.53500 1.000 164.57051 ? -24 DG  I OP2   1 
ATOM 6804  O "O5'" . DG  I 5 49  ? 120.96300 80.18800  118.58200 1.000 164.57051 ? -24 DG  I "O5'" 1 
ATOM 6805  C "C5'" . DG  I 5 49  ? 121.93400 80.96400  119.25400 1.000 164.57051 ? -24 DG  I "C5'" 1 
ATOM 6806  C "C4'" . DG  I 5 49  ? 123.33400 80.44600  118.99100 1.000 164.57051 ? -24 DG  I "C4'" 1 
ATOM 6807  O "O4'" . DG  I 5 49  ? 123.51600 79.17900  119.66300 1.000 164.57051 ? -24 DG  I "O4'" 1 
ATOM 6808  C "C3'" . DG  I 5 49  ? 123.67400 80.20900  117.52100 1.000 164.57051 ? -24 DG  I "C3'" 1 
ATOM 6809  O "O3'" . DG  I 5 49  ? 124.95300 80.75000  117.23400 1.000 164.57051 ? -24 DG  I "O3'" 1 
ATOM 6810  C "C2'" . DG  I 5 49  ? 123.65800 78.69000  117.39100 1.000 164.57051 ? -24 DG  I "C2'" 1 
ATOM 6811  C "C1'" . DG  I 5 49  ? 124.07500 78.24200  118.77700 1.000 164.57051 ? -24 DG  I "C1'" 1 
ATOM 6812  N N9    . DG  I 5 49  ? 123.56100 76.93000  119.13500 1.000 164.57051 ? -24 DG  I N9    1 
ATOM 6813  C C8    . DG  I 5 49  ? 122.25900 76.52000  119.08400 1.000 164.57051 ? -24 DG  I C8    1 
ATOM 6814  N N7    . DG  I 5 49  ? 122.08200 75.29600  119.49100 1.000 164.57051 ? -24 DG  I N7    1 
ATOM 6815  C C5    . DG  I 5 49  ? 123.34600 74.87700  119.85100 1.000 164.57051 ? -24 DG  I C5    1 
ATOM 6816  C C6    . DG  I 5 49  ? 123.77400 73.64000  120.36400 1.000 164.57051 ? -24 DG  I C6    1 
ATOM 6817  O O6    . DG  I 5 49  ? 123.09600 72.63700  120.61200 1.000 164.57051 ? -24 DG  I O6    1 
ATOM 6818  N N1    . DG  I 5 49  ? 125.14200 73.62700  120.59300 1.000 164.57051 ? -24 DG  I N1    1 
ATOM 6819  C C2    . DG  I 5 49  ? 125.98800 74.68000  120.35100 1.000 164.57051 ? -24 DG  I C2    1 
ATOM 6820  N N2    . DG  I 5 49  ? 127.28000 74.48500  120.63300 1.000 164.57051 ? -24 DG  I N2    1 
ATOM 6821  N N3    . DG  I 5 49  ? 125.59600 75.84600  119.86900 1.000 164.57051 ? -24 DG  I N3    1 
ATOM 6822  C C4    . DG  I 5 49  ? 124.26700 75.87500  119.65300 1.000 164.57051 ? -24 DG  I C4    1 
ATOM 6823  P P     . DC  I 5 50  ? 125.50700 80.80100  115.72700 1.000 169.02125 ? -23 DC  I P     1 
ATOM 6824  O OP1   . DC  I 5 50  ? 126.21200 82.08400  115.55300 1.000 169.02125 ? -23 DC  I OP1   1 
ATOM 6825  O OP2   . DC  I 5 50  ? 124.42900 80.45000  114.78300 1.000 169.02125 ? -23 DC  I OP2   1 
ATOM 6826  O "O5'" . DC  I 5 50  ? 126.60000 79.64900  115.70100 1.000 169.02125 ? -23 DC  I "O5'" 1 
ATOM 6827  C "C5'" . DC  I 5 50  ? 127.58600 79.61000  116.71600 1.000 169.02125 ? -23 DC  I "C5'" 1 
ATOM 6828  C "C4'" . DC  I 5 50  ? 128.38200 78.32800  116.63900 1.000 169.02125 ? -23 DC  I "C4'" 1 
ATOM 6829  O "O4'" . DC  I 5 50  ? 127.60200 77.23800  117.18000 1.000 169.02125 ? -23 DC  I "O4'" 1 
ATOM 6830  C "C3'" . DC  I 5 50  ? 128.78500 77.90700  115.22900 1.000 169.02125 ? -23 DC  I "C3'" 1 
ATOM 6831  O "O3'" . DC  I 5 50  ? 130.15100 77.57700  115.21500 1.000 169.02125 ? -23 DC  I "O3'" 1 
ATOM 6832  C "C2'" . DC  I 5 50  ? 127.91700 76.68100  114.95700 1.000 169.02125 ? -23 DC  I "C2'" 1 
ATOM 6833  C "C1'" . DC  I 5 50  ? 127.75200 76.11800  116.35200 1.000 169.02125 ? -23 DC  I "C1'" 1 
ATOM 6834  N N1    . DC  I 5 50  ? 126.56300 75.27000  116.51900 1.000 169.02125 ? -23 DC  I N1    1 
ATOM 6835  C C2    . DC  I 5 50  ? 126.72000 73.95400  116.93000 1.000 169.02125 ? -23 DC  I C2    1 
ATOM 6836  O O2    . DC  I 5 50  ? 127.85800 73.53200  117.13500 1.000 169.02125 ? -23 DC  I O2    1 
ATOM 6837  N N3    . DC  I 5 50  ? 125.62300 73.18400  117.09300 1.000 169.02125 ? -23 DC  I N3    1 
ATOM 6838  C C4    . DC  I 5 50  ? 124.41500 73.69200  116.86100 1.000 169.02125 ? -23 DC  I C4    1 
ATOM 6839  N N4    . DC  I 5 50  ? 123.35800 72.89600  117.03300 1.000 169.02125 ? -23 DC  I N4    1 
ATOM 6840  C C5    . DC  I 5 50  ? 124.23700 75.03500  116.43200 1.000 169.02125 ? -23 DC  I C5    1 
ATOM 6841  C C6    . DC  I 5 50  ? 125.32900 75.78200  116.28400 1.000 169.02125 ? -23 DC  I C6    1 
ATOM 6842  P P     . DA  I 5 51  ? 131.02500 77.83500  113.89900 1.000 180.51962 ? -22 DA  I P     1 
ATOM 6843  O OP1   . DA  I 5 51  ? 132.18600 78.65800  114.29300 1.000 180.51962 ? -22 DA  I OP1   1 
ATOM 6844  O OP2   . DA  I 5 51  ? 130.11000 78.30200  112.83800 1.000 180.51962 ? -22 DA  I OP2   1 
ATOM 6845  O "O5'" . DA  I 5 51  ? 131.53900 76.37800  113.50800 1.000 180.51962 ? -22 DA  I "O5'" 1 
ATOM 6846  C "C5'" . DA  I 5 51  ? 132.14900 75.57000  114.49100 1.000 180.51962 ? -22 DA  I "C5'" 1 
ATOM 6847  C "C4'" . DA  I 5 51  ? 131.93600 74.10100  114.19000 1.000 180.51962 ? -22 DA  I "C4'" 1 
ATOM 6848  O "O4'" . DA  I 5 51  ? 130.63200 73.69400  114.62900 1.000 180.51962 ? -22 DA  I "O4'" 1 
ATOM 6849  C "C3'" . DA  I 5 51  ? 132.00100 73.73700  112.71300 1.000 180.51962 ? -22 DA  I "C3'" 1 
ATOM 6850  O "O3'" . DA  I 5 51  ? 133.25900 73.13800  112.42900 1.000 180.51962 ? -22 DA  I "O3'" 1 
ATOM 6851  C "C2'" . DA  I 5 51  ? 130.83400 72.75700  112.50200 1.000 180.51962 ? -22 DA  I "C2'" 1 
ATOM 6852  C "C1'" . DA  I 5 51  ? 130.26100 72.56100  113.89700 1.000 180.51962 ? -22 DA  I "C1'" 1 
ATOM 6853  N N9    . DA  I 5 51  ? 128.81200 72.43600  113.92200 1.000 180.51962 ? -22 DA  I N9    1 
ATOM 6854  C C8    . DA  I 5 51  ? 127.89700 73.42400  113.71800 1.000 180.51962 ? -22 DA  I C8    1 
ATOM 6855  N N7    . DA  I 5 51  ? 126.65500 73.02300  113.81400 1.000 180.51962 ? -22 DA  I N7    1 
ATOM 6856  C C5    . DA  I 5 51  ? 126.76700 71.67800  114.10900 1.000 180.51962 ? -22 DA  I C5    1 
ATOM 6857  C C6    . DA  I 5 51  ? 125.80900 70.67500  114.33500 1.000 180.51962 ? -22 DA  I C6    1 
ATOM 6858  N N6    . DA  I 5 51  ? 124.49500 70.89600  114.29600 1.000 180.51962 ? -22 DA  I N6    1 
ATOM 6859  N N1    . DA  I 5 51  ? 126.25500 69.43000  114.60600 1.000 180.51962 ? -22 DA  I N1    1 
ATOM 6860  C C2    . DA  I 5 51  ? 127.57300 69.21200  114.64000 1.000 180.51962 ? -22 DA  I C2    1 
ATOM 6861  N N3    . DA  I 5 51  ? 128.56600 70.07700  114.44800 1.000 180.51962 ? -22 DA  I N3    1 
ATOM 6862  C C4    . DA  I 5 51  ? 128.08900 71.30200  114.18500 1.000 180.51962 ? -22 DA  I C4    1 
ATOM 6863  P P     . DC  I 5 52  ? 133.65900 72.74700  110.92300 1.000 189.54628 ? -21 DC  I P     1 
ATOM 6864  O OP1   . DC  I 5 52  ? 135.13600 72.73000  110.84500 1.000 189.54628 ? -21 DC  I OP1   1 
ATOM 6865  O OP2   . DC  I 5 52  ? 132.88100 73.61700  110.01600 1.000 189.54628 ? -21 DC  I OP2   1 
ATOM 6866  O "O5'" . DC  I 5 52  ? 133.12000 71.25300  110.75200 1.000 189.54628 ? -21 DC  I "O5'" 1 
ATOM 6867  C "C5'" . DC  I 5 52  ? 133.42800 70.28000  111.73700 1.000 189.54628 ? -21 DC  I "C5'" 1 
ATOM 6868  C "C4'" . DC  I 5 52  ? 132.56900 69.04700  111.55900 1.000 189.54628 ? -21 DC  I "C4'" 1 
ATOM 6869  O "O4'" . DC  I 5 52  ? 131.21000 69.33400  111.93200 1.000 189.54628 ? -21 DC  I "O4'" 1 
ATOM 6870  C "C3'" . DC  I 5 52  ? 132.49700 68.52900  110.13000 1.000 189.54628 ? -21 DC  I "C3'" 1 
ATOM 6871  O "O3'" . DC  I 5 52  ? 133.33300 67.39300  109.99700 1.000 189.54628 ? -21 DC  I "O3'" 1 
ATOM 6872  C "C2'" . DC  I 5 52  ? 131.01400 68.17700  109.92000 1.000 189.54628 ? -21 DC  I "C2'" 1 
ATOM 6873  C "C1'" . DC  I 5 52  ? 130.38000 68.41200  111.28400 1.000 189.54628 ? -21 DC  I "C1'" 1 
ATOM 6874  N N1    . DC  I 5 52  ? 129.01300 68.97300  111.20400 1.000 189.54628 ? -21 DC  I N1    1 
ATOM 6875  C C2    . DC  I 5 52  ? 127.91000 68.13800  111.38300 1.000 189.54628 ? -21 DC  I C2    1 
ATOM 6876  O O2    . DC  I 5 52  ? 128.09300 66.94600  111.63000 1.000 189.54628 ? -21 DC  I O2    1 
ATOM 6877  N N3    . DC  I 5 52  ? 126.67100 68.66800  111.30300 1.000 189.54628 ? -21 DC  I N3    1 
ATOM 6878  C C4    . DC  I 5 52  ? 126.51900 69.96100  111.04000 1.000 189.54628 ? -21 DC  I C4    1 
ATOM 6879  N N4    . DC  I 5 52  ? 125.28100 70.44300  110.96300 1.000 189.54628 ? -21 DC  I N4    1 
ATOM 6880  C C5    . DC  I 5 52  ? 127.62900 70.82100  110.84000 1.000 189.54628 ? -21 DC  I C5    1 
ATOM 6881  C C6    . DC  I 5 52  ? 128.84500 70.28700  110.92500 1.000 189.54628 ? -21 DC  I C6    1 
ATOM 6882  P P     . DC  I 5 53  ? 133.61000 66.74700  108.55300 1.000 195.24923 ? -20 DC  I P     1 
ATOM 6883  O OP1   . DC  I 5 53  ? 134.88900 66.01000  108.62400 1.000 195.24923 ? -20 DC  I OP1   1 
ATOM 6884  O OP2   . DC  I 5 53  ? 133.43100 67.81800  107.55000 1.000 195.24923 ? -20 DC  I OP2   1 
ATOM 6885  O "O5'" . DC  I 5 53  ? 132.42300 65.69400  108.36800 1.000 195.24923 ? -20 DC  I "O5'" 1 
ATOM 6886  C "C5'" . DC  I 5 53  ? 132.16500 64.73700  109.38200 1.000 195.24923 ? -20 DC  I "C5'" 1 
ATOM 6887  C "C4'" . DC  I 5 53  ? 130.94600 63.91700  109.02800 1.000 195.24923 ? -20 DC  I "C4'" 1 
ATOM 6888  O "O4'" . DC  I 5 53  ? 129.74900 64.69000  109.28200 1.000 195.24923 ? -20 DC  I "O4'" 1 
ATOM 6889  C "C3'" . DC  I 5 53  ? 130.88500 63.49300  107.56400 1.000 195.24923 ? -20 DC  I "C3'" 1 
ATOM 6890  O "O3'" . DC  I 5 53  ? 130.82600 62.09000  107.46000 1.000 195.24923 ? -20 DC  I "O3'" 1 
ATOM 6891  C "C2'" . DC  I 5 53  ? 129.60900 64.13600  107.03100 1.000 195.24923 ? -20 DC  I "C2'" 1 
ATOM 6892  C "C1'" . DC  I 5 53  ? 128.80200 64.41100  108.28700 1.000 195.24923 ? -20 DC  I "C1'" 1 
ATOM 6893  N N1    . DC  I 5 53  ? 127.91600 65.58000  108.14300 1.000 195.24923 ? -20 DC  I N1    1 
ATOM 6894  C C2    . DC  I 5 53  ? 126.52900 65.42000  108.20000 1.000 195.24923 ? -20 DC  I C2    1 
ATOM 6895  O O2    . DC  I 5 53  ? 126.05400 64.30300  108.41300 1.000 195.24923 ? -20 DC  I O2    1 
ATOM 6896  N N3    . DC  I 5 53  ? 125.74100 66.50800  108.04900 1.000 195.24923 ? -20 DC  I N3    1 
ATOM 6897  C C4    . DC  I 5 53  ? 126.29000 67.70000  107.83200 1.000 195.24923 ? -20 DC  I C4    1 
ATOM 6898  N N4    . DC  I 5 53  ? 125.47700 68.74600  107.68300 1.000 195.24923 ? -20 DC  I N4    1 
ATOM 6899  C C5    . DC  I 5 53  ? 127.69700 67.87500  107.75300 1.000 195.24923 ? -20 DC  I C5    1 
ATOM 6900  C C6    . DC  I 5 53  ? 128.46100 66.79600  107.90100 1.000 195.24923 ? -20 DC  I C6    1 
ATOM 6901  P P     . DG  I 5 54  ? 131.23700 61.37400  106.08400 1.000 197.29799 ? -19 DG  I P     1 
ATOM 6902  O OP1   . DG  I 5 54  ? 132.01200 60.16300  106.42500 1.000 197.29799 ? -19 DG  I OP1   1 
ATOM 6903  O OP2   . DG  I 5 54  ? 131.81600 62.40200  105.19300 1.000 197.29799 ? -19 DG  I OP2   1 
ATOM 6904  O "O5'" . DG  I 5 54  ? 129.83700 60.93500  105.45700 1.000 197.29799 ? -19 DG  I "O5'" 1 
ATOM 6905  C "C5'" . DG  I 5 54  ? 128.92900 60.17700  106.22600 1.000 197.29799 ? -19 DG  I "C5'" 1 
ATOM 6906  C "C4'" . DG  I 5 54  ? 127.52200 60.33900  105.69300 1.000 197.29799 ? -19 DG  I "C4'" 1 
ATOM 6907  O "O4'" . DG  I 5 54  ? 127.02400 61.65200  106.01500 1.000 197.29799 ? -19 DG  I "O4'" 1 
ATOM 6908  C "C3'" . DG  I 5 54  ? 127.38400 60.21300  104.17900 1.000 197.29799 ? -19 DG  I "C3'" 1 
ATOM 6909  O "O3'" . DG  I 5 54  ? 126.80700 58.94700  103.85400 1.000 197.29799 ? -19 DG  I "O3'" 1 
ATOM 6910  C "C2'" . DG  I 5 54  ? 126.47300 61.37500  103.76900 1.000 197.29799 ? -19 DG  I "C2'" 1 
ATOM 6911  C "C1'" . DG  I 5 54  ? 126.02600 61.98400  105.08500 1.000 197.29799 ? -19 DG  I "C1'" 1 
ATOM 6912  N N9    . DG  I 5 54  ? 125.87500 63.43000  105.03400 1.000 197.29799 ? -19 DG  I N9    1 
ATOM 6913  C C8    . DG  I 5 54  ? 126.87200 64.36300  105.00400 1.000 197.29799 ? -19 DG  I C8    1 
ATOM 6914  N N7    . DG  I 5 54  ? 126.44200 65.58800  104.99100 1.000 197.29799 ? -19 DG  I N7    1 
ATOM 6915  C C5    . DG  I 5 54  ? 125.06600 65.45900  105.03400 1.000 197.29799 ? -19 DG  I C5    1 
ATOM 6916  C C6    . DG  I 5 54  ? 124.06900 66.44900  105.04400 1.000 197.29799 ? -19 DG  I C6    1 
ATOM 6917  O O6    . DG  I 5 54  ? 124.21200 67.67300  105.02000 1.000 197.29799 ? -19 DG  I O6    1 
ATOM 6918  N N1    . DG  I 5 54  ? 122.79700 65.89800  105.08700 1.000 197.29799 ? -19 DG  I N1    1 
ATOM 6919  C C2    . DG  I 5 54  ? 122.52400 64.55400  105.12100 1.000 197.29799 ? -19 DG  I C2    1 
ATOM 6920  N N2    . DG  I 5 54  ? 121.23100 64.21200  105.16300 1.000 197.29799 ? -19 DG  I N2    1 
ATOM 6921  N N3    . DG  I 5 54  ? 123.45500 63.61000  105.11200 1.000 197.29799 ? -19 DG  I N3    1 
ATOM 6922  C C4    . DG  I 5 54  ? 124.69900 64.13700  105.06700 1.000 197.29799 ? -19 DG  I C4    1 
ATOM 6923  P P     . DC  I 5 55  ? 126.70200 58.45000  102.32800 1.000 188.68717 ? -18 DC  I P     1 
ATOM 6924  O OP1   . DC  I 5 55  ? 126.56900 56.97900  102.34900 1.000 188.68717 ? -18 DC  I OP1   1 
ATOM 6925  O OP2   . DC  I 5 55  ? 127.80400 59.08800  101.57600 1.000 188.68717 ? -18 DC  I OP2   1 
ATOM 6926  O "O5'" . DC  I 5 55  ? 125.32800 59.08500  101.80700 1.000 188.68717 ? -18 DC  I "O5'" 1 
ATOM 6927  C "C5'" . DC  I 5 55  ? 124.13100 58.86600  102.54400 1.000 188.68717 ? -18 DC  I "C5'" 1 
ATOM 6928  C "C4'" . DC  I 5 55  ? 123.04200 59.82900  102.11400 1.000 188.68717 ? -18 DC  I "C4'" 1 
ATOM 6929  O "O4'" . DC  I 5 55  ? 123.39100 61.17900  102.49000 1.000 188.68717 ? -18 DC  I "O4'" 1 
ATOM 6930  C "C3'" . DC  I 5 55  ? 122.78100 59.87300  100.61600 1.000 188.68717 ? -18 DC  I "C3'" 1 
ATOM 6931  O "O3'" . DC  I 5 55  ? 121.55900 59.18900  100.34000 1.000 188.68717 ? -18 DC  I "O3'" 1 
ATOM 6932  C "C2'" . DC  I 5 55  ? 122.69700 61.37200  100.27700 1.000 188.68717 ? -18 DC  I "C2'" 1 
ATOM 6933  C "C1'" . DC  I 5 55  ? 122.71800 62.06300  101.63200 1.000 188.68717 ? -18 DC  I "C1'" 1 
ATOM 6934  N N1    . DC  I 5 55  ? 123.43000 63.38200  101.62700 1.000 188.68717 ? -18 DC  I N1    1 
ATOM 6935  C C2    . DC  I 5 55  ? 122.70100 64.57500  101.69200 1.000 188.68717 ? -18 DC  I C2    1 
ATOM 6936  O O2    . DC  I 5 55  ? 121.47300 64.53000  101.77400 1.000 188.68717 ? -18 DC  I O2    1 
ATOM 6937  N N3    . DC  I 5 55  ? 123.37100 65.75000  101.68700 1.000 188.68717 ? -18 DC  I N3    1 
ATOM 6938  C C4    . DC  I 5 55  ? 124.69900 65.75900  101.60700 1.000 188.68717 ? -18 DC  I C4    1 
ATOM 6939  N N4    . DC  I 5 55  ? 125.32000 66.93900  101.59900 1.000 188.68717 ? -18 DC  I N4    1 
ATOM 6940  C C5    . DC  I 5 55  ? 125.45200 64.55900  101.52600 1.000 188.68717 ? -18 DC  I C5    1 
ATOM 6941  C C6    . DC  I 5 55  ? 124.78200 63.41000  101.52900 1.000 188.68717 ? -18 DC  I C6    1 
ATOM 6942  P P     . DT  I 5 56  ? 120.98300 59.07800  98.84300  1.000 181.60872 ? -17 DT  I P     1 
ATOM 6943  O OP1   . DT  I 5 56  ? 120.10600 57.88800  98.79900  1.000 181.60872 ? -17 DT  I OP1   1 
ATOM 6944  O OP2   . DT  I 5 56  ? 122.10600 59.20800  97.88900  1.000 181.60872 ? -17 DT  I OP2   1 
ATOM 6945  O "O5'" . DT  I 5 56  ? 120.06300 60.37000  98.69700  1.000 181.60872 ? -17 DT  I "O5'" 1 
ATOM 6946  C "C5'" . DT  I 5 56  ? 119.15900 60.70600  99.73700  1.000 181.60872 ? -17 DT  I "C5'" 1 
ATOM 6947  C "C4'" . DT  I 5 56  ? 118.38700 61.95600  99.38600  1.000 181.60872 ? -17 DT  I "C4'" 1 
ATOM 6948  O "O4'" . DT  I 5 56  ? 119.20000 63.12900  99.63600  1.000 181.60872 ? -17 DT  I "O4'" 1 
ATOM 6949  C "C3'" . DT  I 5 56  ? 117.95700 62.03900  97.93200  1.000 181.60872 ? -17 DT  I "C3'" 1 
ATOM 6950  O "O3'" . DT  I 5 56  ? 116.61800 62.42300  97.87300  1.000 181.60872 ? -17 DT  I "O3'" 1 
ATOM 6951  C "C2'" . DT  I 5 56  ? 118.87500 63.10600  97.33800  1.000 181.60872 ? -17 DT  I "C2'" 1 
ATOM 6952  C "C1'" . DT  I 5 56  ? 119.13000 63.99900  98.53100  1.000 181.60872 ? -17 DT  I "C1'" 1 
ATOM 6953  N N1    . DT  I 5 56  ? 120.40700 64.76400  98.47000  1.000 181.60872 ? -17 DT  I N1    1 
ATOM 6954  C C2    . DT  I 5 56  ? 120.37300 66.12900  98.59200  1.000 181.60872 ? -17 DT  I C2    1 
ATOM 6955  O O2    . DT  I 5 56  ? 119.34500 66.75700  98.74600  1.000 181.60872 ? -17 DT  I O2    1 
ATOM 6956  N N3    . DT  I 5 56  ? 121.59600 66.73800  98.54700  1.000 181.60872 ? -17 DT  I N3    1 
ATOM 6957  C C4    . DT  I 5 56  ? 122.82000 66.13100  98.38400  1.000 181.60872 ? -17 DT  I C4    1 
ATOM 6958  O O4    . DT  I 5 56  ? 123.86700 66.76200  98.34900  1.000 181.60872 ? -17 DT  I O4    1 
ATOM 6959  C C5    . DT  I 5 56  ? 122.78500 64.70300  98.25500  1.000 181.60872 ? -17 DT  I C5    1 
ATOM 6960  C C7    . DT  I 5 56  ? 124.06100 63.94400  98.06500  1.000 181.60872 ? -17 DT  I C7    1 
ATOM 6961  C C6    . DT  I 5 56  ? 121.59300 64.09300  98.29900  1.000 181.60872 ? -17 DT  I C6    1 
ATOM 6962  P P     . DT  I 5 57  ? 115.76200 62.12000  96.55600  1.000 178.90200 ? -16 DT  I P     1 
ATOM 6963  O OP1   . DT  I 5 57  ? 114.45800 61.56800  96.98600  1.000 178.90200 ? -16 DT  I OP1   1 
ATOM 6964  O OP2   . DT  I 5 57  ? 116.61500 61.36200  95.61300  1.000 178.90200 ? -16 DT  I OP2   1 
ATOM 6965  O "O5'" . DT  I 5 57  ? 115.53300 63.57300  95.95400  1.000 178.90200 ? -16 DT  I "O5'" 1 
ATOM 6966  C "C5'" . DT  I 5 57  ? 115.26400 64.65600  96.82800  1.000 178.90200 ? -16 DT  I "C5'" 1 
ATOM 6967  C "C4'" . DT  I 5 57  ? 115.44500 65.99100  96.12900  1.000 178.90200 ? -16 DT  I "C4'" 1 
ATOM 6968  O "O4'" . DT  I 5 57  ? 116.81100 66.47100  96.26100  1.000 178.90200 ? -16 DT  I "O4'" 1 
ATOM 6969  C "C3'" . DT  I 5 57  ? 115.14900 65.97200  94.63400  1.000 178.90200 ? -16 DT  I "C3'" 1 
ATOM 6970  O "O3'" . DT  I 5 57  ? 114.51300 67.16200  94.28400  1.000 178.90200 ? -16 DT  I "O3'" 1 
ATOM 6971  C "C2'" . DT  I 5 57  ? 116.55000 65.91500  94.02700  1.000 178.90200 ? -16 DT  I "C2'" 1 
ATOM 6972  C "C1'" . DT  I 5 57  ? 117.29500 66.82100  94.98700  1.000 178.90200 ? -16 DT  I "C1'" 1 
ATOM 6973  N N1    . DT  I 5 57  ? 118.76300 66.65600  94.97200  1.000 178.90200 ? -16 DT  I N1    1 
ATOM 6974  C C2    . DT  I 5 57  ? 119.56200 67.75800  95.15600  1.000 178.90200 ? -16 DT  I C2    1 
ATOM 6975  O O2    . DT  I 5 57  ? 119.12200 68.87400  95.34500  1.000 178.90200 ? -16 DT  I O2    1 
ATOM 6976  N N3    . DT  I 5 57  ? 120.90500 67.49800  95.12700  1.000 178.90200 ? -16 DT  I N3    1 
ATOM 6977  C C4    . DT  I 5 57  ? 121.50900 66.27500  94.92800  1.000 178.90200 ? -16 DT  I C4    1 
ATOM 6978  O O4    . DT  I 5 57  ? 122.72200 66.13600  94.91300  1.000 178.90200 ? -16 DT  I O4    1 
ATOM 6979  C C5    . DT  I 5 57  ? 120.61100 65.17000  94.73300  1.000 178.90200 ? -16 DT  I C5    1 
ATOM 6980  C C7    . DT  I 5 57  ? 121.15700 63.79500  94.50300  1.000 178.90200 ? -16 DT  I C7    1 
ATOM 6981  C C6    . DT  I 5 57  ? 119.29800 65.41500  94.75300  1.000 178.90200 ? -16 DT  I C6    1 
ATOM 6982  P P     . DA  I 5 58  ? 112.93700 67.17800  93.99600  1.000 170.50461 ? -15 DA  I P     1 
ATOM 6983  O OP1   . DA  I 5 58  ? 112.26300 66.49700  95.12200  1.000 170.50461 ? -15 DA  I OP1   1 
ATOM 6984  O OP2   . DA  I 5 58  ? 112.71700 66.70900  92.61300  1.000 170.50461 ? -15 DA  I OP2   1 
ATOM 6985  O "O5'" . DA  I 5 58  ? 112.58900 68.72900  94.05100  1.000 170.50461 ? -15 DA  I "O5'" 1 
ATOM 6986  C "C5'" . DA  I 5 58  ? 112.87200 69.45900  95.23200  1.000 170.50461 ? -15 DA  I "C5'" 1 
ATOM 6987  C "C4'" . DA  I 5 58  ? 113.67600 70.73300  94.96100  1.000 170.50461 ? -15 DA  I "C4'" 1 
ATOM 6988  O "O4'" . DA  I 5 58  ? 115.07300 70.42700  94.69400  1.000 170.50461 ? -15 DA  I "O4'" 1 
ATOM 6989  C "C3'" . DA  I 5 58  ? 113.21900 71.59200  93.78800  1.000 170.50461 ? -15 DA  I "C3'" 1 
ATOM 6990  O "O3'" . DA  I 5 58  ? 113.49700 72.93500  94.09700  1.000 170.50461 ? -15 DA  I "O3'" 1 
ATOM 6991  C "C2'" . DA  I 5 58  ? 114.13500 71.11300  92.66400  1.000 170.50461 ? -15 DA  I "C2'" 1 
ATOM 6992  C "C1'" . DA  I 5 58  ? 115.43600 70.94800  93.42800  1.000 170.50461 ? -15 DA  I "C1'" 1 
ATOM 6993  N N9    . DA  I 5 58  ? 116.39400 70.04400  92.81500  1.000 170.50461 ? -15 DA  I N9    1 
ATOM 6994  C C8    . DA  I 5 58  ? 116.13100 68.85700  92.20800  1.000 170.50461 ? -15 DA  I C8    1 
ATOM 6995  N N7    . DA  I 5 58  ? 117.19900 68.24200  91.76800  1.000 170.50461 ? -15 DA  I N7    1 
ATOM 6996  C C5    . DA  I 5 58  ? 118.23400 69.07800  92.12700  1.000 170.50461 ? -15 DA  I C5    1 
ATOM 6997  C C6    . DA  I 5 58  ? 119.62300 68.99300  91.94800  1.000 170.50461 ? -15 DA  I C6    1 
ATOM 6998  N N6    . DA  I 5 58  ? 120.21800 67.96900  91.33800  1.000 170.50461 ? -15 DA  I N6    1 
ATOM 6999  N N1    . DA  I 5 58  ? 120.38000 70.00300  92.42000  1.000 170.50461 ? -15 DA  I N1    1 
ATOM 7000  C C2    . DA  I 5 58  ? 119.77900 71.02700  93.03800  1.000 170.50461 ? -15 DA  I C2    1 
ATOM 7001  N N3    . DA  I 5 58  ? 118.47900 71.21800  93.25700  1.000 170.50461 ? -15 DA  I N3    1 
ATOM 7002  C C4    . DA  I 5 58  ? 117.75700 70.19500  92.77500  1.000 170.50461 ? -15 DA  I C4    1 
ATOM 7003  P P     . DA  I 5 59  ? 112.66500 74.13200  93.43200  1.000 164.06784 ? -14 DA  I P     1 
ATOM 7004  O OP1   . DA  I 5 59  ? 111.62400 74.52600  94.40500  1.000 164.06784 ? -14 DA  I OP1   1 
ATOM 7005  O OP2   . DA  I 5 59  ? 112.29100 73.76300  92.05000  1.000 164.06784 ? -14 DA  I OP2   1 
ATOM 7006  O "O5'" . DA  I 5 59  ? 113.74000 75.30300  93.34400  1.000 164.06784 ? -14 DA  I "O5'" 1 
ATOM 7007  C "C5'" . DA  I 5 59  ? 114.63900 75.51800  94.42200  1.000 164.06784 ? -14 DA  I "C5'" 1 
ATOM 7008  C "C4'" . DA  I 5 59  ? 116.02500 75.94900  93.94300  1.000 164.06784 ? -14 DA  I "C4'" 1 
ATOM 7009  O "O4'" . DA  I 5 59  ? 116.76200 74.84200  93.35500  1.000 164.06784 ? -14 DA  I "O4'" 1 
ATOM 7010  C "C3'" . DA  I 5 59  ? 116.05200 77.05700  92.90100  1.000 164.06784 ? -14 DA  I "C3'" 1 
ATOM 7011  O "O3'" . DA  I 5 59  ? 117.17600 77.85500  93.13300  1.000 164.06784 ? -14 DA  I "O3'" 1 
ATOM 7012  C "C2'" . DA  I 5 59  ? 116.21600 76.27600  91.59900  1.000 164.06784 ? -14 DA  I "C2'" 1 
ATOM 7013  C "C1'" . DA  I 5 59  ? 117.18200 75.19800  92.04800  1.000 164.06784 ? -14 DA  I "C1'" 1 
ATOM 7014  N N9    . DA  I 5 59  ? 117.19000 73.99700  91.23100  1.000 164.06784 ? -14 DA  I N9    1 
ATOM 7015  C C8    . DA  I 5 59  ? 116.11300 73.26100  90.86000  1.000 164.06784 ? -14 DA  I C8    1 
ATOM 7016  N N7    . DA  I 5 59  ? 116.41100 72.19700  90.16100  1.000 164.06784 ? -14 DA  I N7    1 
ATOM 7017  C C5    . DA  I 5 59  ? 117.78600 72.24200  90.06300  1.000 164.06784 ? -14 DA  I C5    1 
ATOM 7018  C C6    . DA  I 5 59  ? 118.71400 71.39700  89.43600  1.000 164.06784 ? -14 DA  I C6    1 
ATOM 7019  N N6    . DA  I 5 59  ? 118.36300 70.30200  88.76400  1.000 164.06784 ? -14 DA  I N6    1 
ATOM 7020  N N1    . DA  I 5 59  ? 120.01700 71.72200  89.52400  1.000 164.06784 ? -14 DA  I N1    1 
ATOM 7021  C C2    . DA  I 5 59  ? 120.36300 72.82600  90.19500  1.000 164.06784 ? -14 DA  I C2    1 
ATOM 7022  N N3    . DA  I 5 59  ? 119.57700 73.69500  90.83200  1.000 164.06784 ? -14 DA  I N3    1 
ATOM 7023  C C4    . DA  I 5 59  ? 118.28800 73.34000  90.72400  1.000 164.06784 ? -14 DA  I C4    1 
ATOM 7024  P P     . DA  I 5 60  ? 117.21700 79.37200  92.62700  1.000 159.65739 ? -13 DA  I P     1 
ATOM 7025  O OP1   . DA  I 5 60  ? 117.14200 80.22200  93.83200  1.000 159.65739 ? -13 DA  I OP1   1 
ATOM 7026  O OP2   . DA  I 5 60  ? 116.22600 79.54300  91.54500  1.000 159.65739 ? -13 DA  I OP2   1 
ATOM 7027  O "O5'" . DA  I 5 60  ? 118.67700 79.50300  92.00100  1.000 159.65739 ? -13 DA  I "O5'" 1 
ATOM 7028  C "C5'" . DA  I 5 60  ? 119.77800 78.90600  92.66200  1.000 159.65739 ? -13 DA  I "C5'" 1 
ATOM 7029  C "C4'" . DA  I 5 60  ? 120.91900 78.58700  91.70300  1.000 159.65739 ? -13 DA  I "C4'" 1 
ATOM 7030  O "O4'" . DA  I 5 60  ? 120.69100 77.33600  91.00300  1.000 159.65739 ? -13 DA  I "O4'" 1 
ATOM 7031  C "C3'" . DA  I 5 60  ? 121.18300 79.62300  90.62600  1.000 159.65739 ? -13 DA  I "C3'" 1 
ATOM 7032  O "O3'" . DA  I 5 60  ? 122.56100 79.70600  90.42500  1.000 159.65739 ? -13 DA  I "O3'" 1 
ATOM 7033  C "C2'" . DA  I 5 60  ? 120.49100 79.01700  89.40300  1.000 159.65739 ? -13 DA  I "C2'" 1 
ATOM 7034  C "C1'" . DA  I 5 60  ? 120.78700 77.54500  89.60700  1.000 159.65739 ? -13 DA  I "C1'" 1 
ATOM 7035  N N9    . DA  I 5 60  ? 119.85700 76.62700  88.95700  1.000 159.65739 ? -13 DA  I N9    1 
ATOM 7036  C C8    . DA  I 5 60  ? 118.50700 76.61100  89.08000  1.000 159.65739 ? -13 DA  I C8    1 
ATOM 7037  N N7    . DA  I 5 60  ? 117.92100 75.64000  88.42500  1.000 159.65739 ? -13 DA  I N7    1 
ATOM 7038  C C5    . DA  I 5 60  ? 118.96500 74.96500  87.83500  1.000 159.65739 ? -13 DA  I C5    1 
ATOM 7039  C C6    . DA  I 5 60  ? 119.01200 73.83300  86.99900  1.000 159.65739 ? -13 DA  I C6    1 
ATOM 7040  N N6    . DA  I 5 60  ? 117.92700 73.16500  86.60000  1.000 159.65739 ? -13 DA  I N6    1 
ATOM 7041  N N1    . DA  I 5 60  ? 120.22200 73.41600  86.58300  1.000 159.65739 ? -13 DA  I N1    1 
ATOM 7042  C C2    . DA  I 5 60  ? 121.30300 74.09200  86.97900  1.000 159.65739 ? -13 DA  I C2    1 
ATOM 7043  N N3    . DA  I 5 60  ? 121.38500 75.16100  87.76500  1.000 159.65739 ? -13 DA  I N3    1 
ATOM 7044  C C4    . DA  I 5 60  ? 120.17000 75.54700  88.16700  1.000 159.65739 ? -13 DA  I C4    1 
ATOM 7045  P P     . DC  I 5 61  ? 123.21900 81.04300  89.84200  1.000 167.17738 ? -12 DC  I P     1 
ATOM 7046  O OP1   . DC  I 5 61  ? 124.07500 81.59800  90.91100  1.000 167.17738 ? -12 DC  I OP1   1 
ATOM 7047  O OP2   . DC  I 5 61  ? 122.15500 81.87200  89.24100  1.000 167.17738 ? -12 DC  I OP2   1 
ATOM 7048  O "O5'" . DC  I 5 61  ? 124.15200 80.49500  88.67700  1.000 167.17738 ? -12 DC  I "O5'" 1 
ATOM 7049  C "C5'" . DC  I 5 61  ? 124.67500 79.18500  88.77400  1.000 167.17738 ? -12 DC  I "C5'" 1 
ATOM 7050  C "C4'" . DC  I 5 61  ? 125.13500 78.67900  87.42200  1.000 167.17738 ? -12 DC  I "C4'" 1 
ATOM 7051  O "O4'" . DC  I 5 61  ? 124.18400 77.72400  86.89200  1.000 167.17738 ? -12 DC  I "O4'" 1 
ATOM 7052  C "C3'" . DC  I 5 61  ? 125.30200 79.75200  86.35700  1.000 167.17738 ? -12 DC  I "C3'" 1 
ATOM 7053  O "O3'" . DC  I 5 61  ? 126.46400 79.48000  85.61700  1.000 167.17738 ? -12 DC  I "O3'" 1 
ATOM 7054  C "C2'" . DC  I 5 61  ? 124.03800 79.59600  85.50800  1.000 167.17738 ? -12 DC  I "C2'" 1 
ATOM 7055  C "C1'" . DC  I 5 61  ? 123.80000 78.09900  85.58800  1.000 167.17738 ? -12 DC  I "C1'" 1 
ATOM 7056  N N1    . DC  I 5 61  ? 122.38700 77.68800  85.39600  1.000 167.17738 ? -12 DC  I N1    1 
ATOM 7057  C C2    . DC  I 5 61  ? 122.09100 76.63800  84.53100  1.000 167.17738 ? -12 DC  I C2    1 
ATOM 7058  O O2    . DC  I 5 61  ? 123.01400 76.06900  83.94500  1.000 167.17738 ? -12 DC  I O2    1 
ATOM 7059  N N3    . DC  I 5 61  ? 120.80300 76.25700  84.37600  1.000 167.17738 ? -12 DC  I N3    1 
ATOM 7060  C C4    . DC  I 5 61  ? 119.84100 76.89400  85.03500  1.000 167.17738 ? -12 DC  I C4    1 
ATOM 7061  N N4    . DC  I 5 61  ? 118.58200 76.49200  84.84700  1.000 167.17738 ? -12 DC  I N4    1 
ATOM 7062  C C5    . DC  I 5 61  ? 120.12300 77.98100  85.90500  1.000 167.17738 ? -12 DC  I C5    1 
ATOM 7063  C C6    . DC  I 5 61  ? 121.39900 78.33500  86.05700  1.000 167.17738 ? -12 DC  I C6    1 
ATOM 7064  P P     . DG  I 5 62  ? 127.17400 80.63200  84.75800  1.000 181.11991 ? -11 DG  I P     1 
ATOM 7065  O OP1   . DG  I 5 62  ? 128.57400 80.71400  85.22300  1.000 181.11991 ? -11 DG  I OP1   1 
ATOM 7066  O OP2   . DG  I 5 62  ? 126.32100 81.83700  84.78500  1.000 181.11991 ? -11 DG  I OP2   1 
ATOM 7067  O "O5'" . DG  I 5 62  ? 127.15800 80.04700  83.27600  1.000 181.11991 ? -11 DG  I "O5'" 1 
ATOM 7068  C "C5'" . DG  I 5 62  ? 127.27800 78.65200  83.08300  1.000 181.11991 ? -11 DG  I "C5'" 1 
ATOM 7069  C "C4'" . DG  I 5 62  ? 126.67800 78.22600  81.75700  1.000 181.11991 ? -11 DG  I "C4'" 1 
ATOM 7070  O "O4'" . DG  I 5 62  ? 125.28600 77.84600  81.92400  1.000 181.11991 ? -11 DG  I "O4'" 1 
ATOM 7071  C "C3'" . DG  I 5 62  ? 126.69400 79.28900  80.66000  1.000 181.11991 ? -11 DG  I "C3'" 1 
ATOM 7072  O "O3'" . DG  I 5 62  ? 127.07500 78.68200  79.45400  1.000 181.11991 ? -11 DG  I "O3'" 1 
ATOM 7073  C "C2'" . DG  I 5 62  ? 125.24100 79.74200  80.60800  1.000 181.11991 ? -11 DG  I "C2'" 1 
ATOM 7074  C "C1'" . DG  I 5 62  ? 124.54000 78.43500  80.89000  1.000 181.11991 ? -11 DG  I "C1'" 1 
ATOM 7075  N N9    . DG  I 5 62  ? 123.16500 78.58500  81.32400  1.000 181.11991 ? -11 DG  I N9    1 
ATOM 7076  C C8    . DG  I 5 62  ? 122.69100 79.41700  82.29900  1.000 181.11991 ? -11 DG  I C8    1 
ATOM 7077  N N7    . DG  I 5 62  ? 121.40500 79.32800  82.47300  1.000 181.11991 ? -11 DG  I N7    1 
ATOM 7078  C C5    . DG  I 5 62  ? 121.00800 78.36900  81.55800  1.000 181.11991 ? -11 DG  I C5    1 
ATOM 7079  C C6    . DG  I 5 62  ? 119.72700 77.85000  81.28400  1.000 181.11991 ? -11 DG  I C6    1 
ATOM 7080  O O6    . DG  I 5 62  ? 118.65200 78.14400  81.81600  1.000 181.11991 ? -11 DG  I O6    1 
ATOM 7081  N N1    . DG  I 5 62  ? 119.76500 76.89400  80.27800  1.000 181.11991 ? -11 DG  I N1    1 
ATOM 7082  C C2    . DG  I 5 62  ? 120.89900 76.49100  79.62200  1.000 181.11991 ? -11 DG  I C2    1 
ATOM 7083  N N2    . DG  I 5 62  ? 120.74300 75.55500  78.68000  1.000 181.11991 ? -11 DG  I N2    1 
ATOM 7084  N N3    . DG  I 5 62  ? 122.10600 76.97200  79.87100  1.000 181.11991 ? -11 DG  I N3    1 
ATOM 7085  C C4    . DG  I 5 62  ? 122.08300 77.90300  80.84700  1.000 181.11991 ? -11 DG  I C4    1 
ATOM 7086  P P     . DC  I 5 63  ? 127.75200 79.53200  78.27400  1.000 177.66708 ? -10 DC  I P     1 
ATOM 7087  O OP1   . DC  I 5 63  ? 129.19800 79.63900  78.55900  1.000 177.66708 ? -10 DC  I OP1   1 
ATOM 7088  O OP2   . DC  I 5 63  ? 126.95100 80.74900  78.02500  1.000 177.66708 ? -10 DC  I OP2   1 
ATOM 7089  O "O5'" . DC  I 5 63  ? 127.53900 78.59400  77.01100  1.000 177.66708 ? -10 DC  I "O5'" 1 
ATOM 7090  C "C5'" . DC  I 5 63  ? 126.79800 77.39800  77.15400  1.000 177.66708 ? -10 DC  I "C5'" 1 
ATOM 7091  C "C4'" . DC  I 5 63  ? 125.61200 77.41000  76.21900  1.000 177.66708 ? -10 DC  I "C4'" 1 
ATOM 7092  O "O4'" . DC  I 5 63  ? 124.38400 77.61500  76.95600  1.000 177.66708 ? -10 DC  I "O4'" 1 
ATOM 7093  C "C3'" . DC  I 5 63  ? 125.66200 78.50200  75.15000  1.000 177.66708 ? -10 DC  I "C3'" 1 
ATOM 7094  O "O3'" . DC  I 5 63  ? 125.61000 77.91300  73.87100  1.000 177.66708 ? -10 DC  I "O3'" 1 
ATOM 7095  C "C2'" . DC  I 5 63  ? 124.42300 79.35300  75.42900  1.000 177.66708 ? -10 DC  I "C2'" 1 
ATOM 7096  C "C1'" . DC  I 5 63  ? 123.52100 78.38400  76.16300  1.000 177.66708 ? -10 DC  I "C1'" 1 
ATOM 7097  N N1    . DC  I 5 63  ? 122.52900 79.04300  77.03200  1.000 177.66708 ? -10 DC  I N1    1 
ATOM 7098  C C2    . DC  I 5 63  ? 121.17800 78.70800  76.91900  1.000 177.66708 ? -10 DC  I C2    1 
ATOM 7099  O O2    . DC  I 5 63  ? 120.83600 77.85200  76.10100  1.000 177.66708 ? -10 DC  I O2    1 
ATOM 7100  N N3    . DC  I 5 63  ? 120.28500 79.32600  77.72000  1.000 177.66708 ? -10 DC  I N3    1 
ATOM 7101  C C4    . DC  I 5 63  ? 120.69700 80.24100  78.59000  1.000 177.66708 ? -10 DC  I C4    1 
ATOM 7102  N N4    . DC  I 5 63  ? 119.78200 80.82900  79.36000  1.000 177.66708 ? -10 DC  I N4    1 
ATOM 7103  C C5    . DC  I 5 63  ? 122.06800 80.60100  78.71100  1.000 177.66708 ? -10 DC  I C5    1 
ATOM 7104  C C6    . DC  I 5 63  ? 122.93800 79.98500  77.91500  1.000 177.66708 ? -10 DC  I C6    1 
ATOM 7105  P P     . DA  I 5 64  ? 126.06500 78.73200  72.56700  1.000 174.11542 ? -9  DA  I P     1 
ATOM 7106  O OP1   . DA  I 5 64  ? 127.09800 77.92300  71.88700  1.000 174.11542 ? -9  DA  I OP1   1 
ATOM 7107  O OP2   . DA  I 5 64  ? 126.37300 80.12900  72.94600  1.000 174.11542 ? -9  DA  I OP2   1 
ATOM 7108  O "O5'" . DA  I 5 64  ? 124.74900 78.73700  71.66800  1.000 174.11542 ? -9  DA  I "O5'" 1 
ATOM 7109  C "C5'" . DA  I 5 64  ? 124.01700 77.53800  71.50500  1.000 174.11542 ? -9  DA  I "C5'" 1 
ATOM 7110  C "C4'" . DA  I 5 64  ? 122.54700 77.83200  71.31200  1.000 174.11542 ? -9  DA  I "C4'" 1 
ATOM 7111  O "O4'" . DA  I 5 64  ? 121.98500 78.34500  72.53500  1.000 174.11542 ? -9  DA  I "O4'" 1 
ATOM 7112  C "C3'" . DA  I 5 64  ? 122.23800 78.87200  70.24100  1.000 174.11542 ? -9  DA  I "C3'" 1 
ATOM 7113  O "O3'" . DA  I 5 64  ? 121.61000 78.23700  69.13500  1.000 174.11542 ? -9  DA  I "O3'" 1 
ATOM 7114  C "C2'" . DA  I 5 64  ? 121.31300 79.88600  70.92400  1.000 174.11542 ? -9  DA  I "C2'" 1 
ATOM 7115  C "C1'" . DA  I 5 64  ? 120.91900 79.19700  72.21600  1.000 174.11542 ? -9  DA  I "C1'" 1 
ATOM 7116  N N9    . DA  I 5 64  ? 120.70900 80.11700  73.32000  1.000 174.11542 ? -9  DA  I N9    1 
ATOM 7117  C C8    . DA  I 5 64  ? 121.65900 80.81000  74.00000  1.000 174.11542 ? -9  DA  I C8    1 
ATOM 7118  N N7    . DA  I 5 64  ? 121.18400 81.55100  74.96600  1.000 174.11542 ? -9  DA  I N7    1 
ATOM 7119  C C5    . DA  I 5 64  ? 119.82700 81.32000  74.91800  1.000 174.11542 ? -9  DA  I C5    1 
ATOM 7120  C C6    . DA  I 5 64  ? 118.76100 81.80800  75.68200  1.000 174.11542 ? -9  DA  I C6    1 
ATOM 7121  N N6    . DA  I 5 64  ? 118.92300 82.66800  76.68100  1.000 174.11542 ? -9  DA  I N6    1 
ATOM 7122  N N1    . DA  I 5 64  ? 117.52000 81.37800  75.37800  1.000 174.11542 ? -9  DA  I N1    1 
ATOM 7123  C C2    . DA  I 5 64  ? 117.37000 80.51400  74.37200  1.000 174.11542 ? -9  DA  I C2    1 
ATOM 7124  N N3    . DA  I 5 64  ? 118.30000 79.98400  73.58200  1.000 174.11542 ? -9  DA  I N3    1 
ATOM 7125  C C4    . DA  I 5 64  ? 119.51700 80.43400  73.91200  1.000 174.11542 ? -9  DA  I C4    1 
ATOM 7126  P P     . DC  I 5 65  ? 121.27800 79.05900  67.79500  1.000 170.31183 ? -8  DC  I P     1 
ATOM 7127  O OP1   . DC  I 5 65  ? 121.23500 78.09600  66.67500  1.000 170.31183 ? -8  DC  I OP1   1 
ATOM 7128  O OP2   . DC  I 5 65  ? 122.19200 80.22100  67.73600  1.000 170.31183 ? -8  DC  I OP2   1 
ATOM 7129  O "O5'" . DC  I 5 65  ? 119.80000 79.61000  68.05000  1.000 170.31183 ? -8  DC  I "O5'" 1 
ATOM 7130  C "C5'" . DC  I 5 65  ? 118.79700 78.73500  68.56000  1.000 170.31183 ? -8  DC  I "C5'" 1 
ATOM 7131  C "C4'" . DC  I 5 65  ? 117.49500 79.47600  68.77200  1.000 170.31183 ? -8  DC  I "C4'" 1 
ATOM 7132  O "O4'" . DC  I 5 65  ? 117.51300 80.15500  70.05500  1.000 170.31183 ? -8  DC  I "O4'" 1 
ATOM 7133  C "C3'" . DC  I 5 65  ? 117.19000 80.54400  67.72800  1.000 170.31183 ? -8  DC  I "C3'" 1 
ATOM 7134  O "O3'" . DC  I 5 65  ? 115.83800 80.43000  67.32300  1.000 170.31183 ? -8  DC  I "O3'" 1 
ATOM 7135  C "C2'" . DC  I 5 65  ? 117.45000 81.84900  68.47900  1.000 170.31183 ? -8  DC  I "C2'" 1 
ATOM 7136  C "C1'" . DC  I 5 65  ? 117.04700 81.47200  69.88900  1.000 170.31183 ? -8  DC  I "C1'" 1 
ATOM 7137  N N1    . DC  I 5 65  ? 117.66100 82.32500  70.94100  1.000 170.31183 ? -8  DC  I N1    1 
ATOM 7138  C C2    . DC  I 5 65  ? 116.85500 82.91100  71.92000  1.000 170.31183 ? -8  DC  I C2    1 
ATOM 7139  O O2    . DC  I 5 65  ? 115.64100 82.69900  71.91000  1.000 170.31183 ? -8  DC  I O2    1 
ATOM 7140  N N3    . DC  I 5 65  ? 117.43500 83.67400  72.87500  1.000 170.31183 ? -8  DC  I N3    1 
ATOM 7141  C C4    . DC  I 5 65  ? 118.74900 83.87200  72.85900  1.000 170.31183 ? -8  DC  I C4    1 
ATOM 7142  N N4    . DC  I 5 65  ? 119.27700 84.64000  73.81400  1.000 170.31183 ? -8  DC  I N4    1 
ATOM 7143  C C5    . DC  I 5 65  ? 119.58200 83.29500  71.86400  1.000 170.31183 ? -8  DC  I C5    1 
ATOM 7144  C C6    . DC  I 5 65  ? 118.99900 82.54300  70.93100  1.000 170.31183 ? -8  DC  I C6    1 
ATOM 7145  P P     . DG  I 5 66  ? 115.34300 81.03900  65.92200  1.000 162.96488 ? -7  DG  I P     1 
ATOM 7146  O OP1   . DG  I 5 66  ? 114.85700 79.91400  65.09800  1.000 162.96488 ? -7  DG  I OP1   1 
ATOM 7147  O OP2   . DG  I 5 66  ? 116.38300 81.94400  65.39200  1.000 162.96488 ? -7  DG  I OP2   1 
ATOM 7148  O "O5'" . DG  I 5 66  ? 114.08200 81.91500  66.33400  1.000 162.96488 ? -7  DG  I "O5'" 1 
ATOM 7149  C "C5'" . DG  I 5 66  ? 113.09900 81.35300  67.18400  1.000 162.96488 ? -7  DG  I "C5'" 1 
ATOM 7150  C "C4'" . DG  I 5 66  ? 112.31900 82.42400  67.92700  1.000 162.96488 ? -7  DG  I "C4'" 1 
ATOM 7151  O "O4'" . DG  I 5 66  ? 113.14000 83.01600  68.97000  1.000 162.96488 ? -7  DG  I "O4'" 1 
ATOM 7152  C "C3'" . DG  I 5 66  ? 111.82500 83.58100  67.07200  1.000 162.96488 ? -7  DG  I "C3'" 1 
ATOM 7153  O "O3'" . DG  I 5 66  ? 110.53700 83.94100  67.48300  1.000 162.96488 ? -7  DG  I "O3'" 1 
ATOM 7154  C "C2'" . DG  I 5 66  ? 112.82300 84.69200  67.38100  1.000 162.96488 ? -7  DG  I "C2'" 1 
ATOM 7155  C "C1'" . DG  I 5 66  ? 113.14700 84.42100  68.83700  1.000 162.96488 ? -7  DG  I "C1'" 1 
ATOM 7156  N N9    . DG  I 5 66  ? 114.45600 84.91000  69.24300  1.000 162.96488 ? -7  DG  I N9    1 
ATOM 7157  C C8    . DG  I 5 66  ? 115.63500 84.72500  68.58400  1.000 162.96488 ? -7  DG  I C8    1 
ATOM 7158  N N7    . DG  I 5 66  ? 116.65800 85.24900  69.19000  1.000 162.96488 ? -7  DG  I N7    1 
ATOM 7159  C C5    . DG  I 5 66  ? 116.12100 85.82000  70.32900  1.000 162.96488 ? -7  DG  I C5    1 
ATOM 7160  C C6    . DG  I 5 66  ? 116.75100 86.53500  71.36900  1.000 162.96488 ? -7  DG  I C6    1 
ATOM 7161  O O6    . DG  I 5 66  ? 117.94800 86.81300  71.49000  1.000 162.96488 ? -7  DG  I O6    1 
ATOM 7162  N N1    . DG  I 5 66  ? 115.84600 86.94300  72.33600  1.000 162.96488 ? -7  DG  I N1    1 
ATOM 7163  C C2    . DG  I 5 66  ? 114.49900 86.68800  72.30300  1.000 162.96488 ? -7  DG  I C2    1 
ATOM 7164  N N2    . DG  I 5 66  ? 113.77900 87.16000  73.32700  1.000 162.96488 ? -7  DG  I N2    1 
ATOM 7165  N N3    . DG  I 5 66  ? 113.89500 86.01900  71.33100  1.000 162.96488 ? -7  DG  I N3    1 
ATOM 7166  C C4    . DG  I 5 66  ? 114.76600 85.61600  70.38200  1.000 162.96488 ? -7  DG  I C4    1 
ATOM 7167  P P     . DT  I 5 67  ? 109.51700 84.61000  66.44500  1.000 158.26161 ? -6  DT  I P     1 
ATOM 7168  O OP1   . DT  I 5 67  ? 108.40000 83.66500  66.24500  1.000 158.26161 ? -6  DT  I OP1   1 
ATOM 7169  O OP2   . DT  I 5 67  ? 110.29000 85.10000  65.28500  1.000 158.26161 ? -6  DT  I OP2   1 
ATOM 7170  O "O5'" . DT  I 5 67  ? 108.98100 85.87900  67.24100  1.000 158.26161 ? -6  DT  I "O5'" 1 
ATOM 7171  C "C5'" . DT  I 5 67  ? 108.88100 85.82800  68.65700  1.000 158.26161 ? -6  DT  I "C5'" 1 
ATOM 7172  C "C4'" . DT  I 5 67  ? 109.07200 87.19900  69.29000  1.000 158.26161 ? -6  DT  I "C4'" 1 
ATOM 7173  O "O4'" . DT  I 5 67  ? 110.47800 87.45300  69.57200  1.000 158.26161 ? -6  DT  I "O4'" 1 
ATOM 7174  C "C3'" . DT  I 5 67  ? 108.59800 88.38400  68.44600  1.000 158.26161 ? -6  DT  I "C3'" 1 
ATOM 7175  O "O3'" . DT  I 5 67  ? 108.06300 89.37600  69.29500  1.000 158.26161 ? -6  DT  I "O3'" 1 
ATOM 7176  C "C2'" . DT  I 5 67  ? 109.90900 88.87300  67.83700  1.000 158.26161 ? -6  DT  I "C2'" 1 
ATOM 7177  C "C1'" . DT  I 5 67  ? 110.81300 88.71200  69.04000  1.000 158.26161 ? -6  DT  I "C1'" 1 
ATOM 7178  N N1    . DT  I 5 67  ? 112.27100 88.76600  68.75100  1.000 158.26161 ? -6  DT  I N1    1 
ATOM 7179  C C2    . DT  I 5 67  ? 113.10700 89.36200  69.66100  1.000 158.26161 ? -6  DT  I C2    1 
ATOM 7180  O O2    . DT  I 5 67  ? 112.71400 89.86100  70.69600  1.000 158.26161 ? -6  DT  I O2    1 
ATOM 7181  N N3    . DT  I 5 67  ? 114.42600 89.36500  69.31000  1.000 158.26161 ? -6  DT  I N3    1 
ATOM 7182  C C4    . DT  I 5 67  ? 114.98100 88.83700  68.16900  1.000 158.26161 ? -6  DT  I C4    1 
ATOM 7183  O O4    . DT  I 5 67  ? 116.18100 88.88600  67.94100  1.000 158.26161 ? -6  DT  I O4    1 
ATOM 7184  C C5    . DT  I 5 67  ? 114.05200 88.22500  67.26000  1.000 158.26161 ? -6  DT  I C5    1 
ATOM 7185  C C7    . DT  I 5 67  ? 114.54500 87.62200  65.98200  1.000 158.26161 ? -6  DT  I C7    1 
ATOM 7186  C C6    . DT  I 5 67  ? 112.75400 88.22500  67.58800  1.000 158.26161 ? -6  DT  I C6    1 
ATOM 7187  P P     . DA  I 5 68  ? 106.48800 89.45000  69.60600  1.000 160.36490 ? -5  DA  I P     1 
ATOM 7188  O OP1   . DA  I 5 68  ? 105.98500 88.10300  69.94700  1.000 160.36490 ? -5  DA  I OP1   1 
ATOM 7189  O OP2   . DA  I 5 68  ? 105.86100 90.20900  68.50500  1.000 160.36490 ? -5  DA  I OP2   1 
ATOM 7190  O "O5'" . DA  I 5 68  ? 106.42300 90.36100  70.91600  1.000 160.36490 ? -5  DA  I "O5'" 1 
ATOM 7191  C "C5'" . DA  I 5 68  ? 107.14200 89.96500  72.08700  1.000 160.36490 ? -5  DA  I "C5'" 1 
ATOM 7192  C "C4'" . DA  I 5 68  ? 107.69400 91.14800  72.89600  1.000 160.36490 ? -5  DA  I "C4'" 1 
ATOM 7193  O "O4'" . DA  I 5 68  ? 109.06200 91.45700  72.51800  1.000 160.36490 ? -5  DA  I "O4'" 1 
ATOM 7194  C "C3'" . DA  I 5 68  ? 106.95800 92.47100  72.79900  1.000 160.36490 ? -5  DA  I "C3'" 1 
ATOM 7195  O "O3'" . DA  I 5 68  ? 107.19500 93.17800  73.99700  1.000 160.36490 ? -5  DA  I "O3'" 1 
ATOM 7196  C "C2'" . DA  I 5 68  ? 107.67600 93.14800  71.63200  1.000 160.36490 ? -5  DA  I "C2'" 1 
ATOM 7197  C "C1'" . DA  I 5 68  ? 109.11700 92.72400  71.87600  1.000 160.36490 ? -5  DA  I "C1'" 1 
ATOM 7198  N N9    . DA  I 5 68  ? 109.91400 92.56700  70.67200  1.000 160.36490 ? -5  DA  I N9    1 
ATOM 7199  C C8    . DA  I 5 68  ? 109.48700 92.11900  69.46200  1.000 160.36490 ? -5  DA  I C8    1 
ATOM 7200  N N7    . DA  I 5 68  ? 110.43400 92.04700  68.56300  1.000 160.36490 ? -5  DA  I N7    1 
ATOM 7201  C C5    . DA  I 5 68  ? 111.56300 92.45800  69.23500  1.000 160.36490 ? -5  DA  I C5    1 
ATOM 7202  C C6    . DA  I 5 68  ? 112.89800 92.60500  68.83200  1.000 160.36490 ? -5  DA  I C6    1 
ATOM 7203  N N6    . DA  I 5 68  ? 113.32300 92.32400  67.60100  1.000 160.36490 ? -5  DA  I N6    1 
ATOM 7204  N N1    . DA  I 5 68  ? 113.78300 93.05000  69.74500  1.000 160.36490 ? -5  DA  I N1    1 
ATOM 7205  C C2    . DA  I 5 68  ? 113.35200 93.33100  70.98000  1.000 160.36490 ? -5  DA  I C2    1 
ATOM 7206  N N3    . DA  I 5 68  ? 112.11700 93.23200  71.47400  1.000 160.36490 ? -5  DA  I N3    1 
ATOM 7207  C C4    . DA  I 5 68  ? 111.26400 92.78500  70.53900  1.000 160.36490 ? -5  DA  I C4    1 
ATOM 7208  P P     . DC  I 5 69  ? 106.36900 94.49900  74.37400  1.000 157.18348 ? -4  DC  I P     1 
ATOM 7209  O OP1   . DC  I 5 69  ? 105.74400 94.23100  75.68400  1.000 157.18348 ? -4  DC  I OP1   1 
ATOM 7210  O OP2   . DC  I 5 69  ? 105.52200 94.92800  73.24300  1.000 157.18348 ? -4  DC  I OP2   1 
ATOM 7211  O "O5'" . DC  I 5 69  ? 107.50900 95.59100  74.60000  1.000 157.18348 ? -4  DC  I "O5'" 1 
ATOM 7212  C "C5'" . DC  I 5 69  ? 108.66700 95.27800  75.36700  1.000 157.18348 ? -4  DC  I "C5'" 1 
ATOM 7213  C "C4'" . DC  I 5 69  ? 109.84000 96.20000  75.04000  1.000 157.18348 ? -4  DC  I "C4'" 1 
ATOM 7214  O "O4'" . DC  I 5 69  ? 110.48700 95.81600  73.79300  1.000 157.18348 ? -4  DC  I "O4'" 1 
ATOM 7215  C "C3'" . DC  I 5 69  ? 109.48200 97.67300  74.88100  1.000 157.18348 ? -4  DC  I "C3'" 1 
ATOM 7216  O "O3'" . DC  I 5 69  ? 110.51800 98.47000  75.38400  1.000 157.18348 ? -4  DC  I "O3'" 1 
ATOM 7217  C "C2'" . DC  I 5 69  ? 109.40100 97.81900  73.36400  1.000 157.18348 ? -4  DC  I "C2'" 1 
ATOM 7218  C "C1'" . DC  I 5 69  ? 110.56700 96.94700  72.94500  1.000 157.18348 ? -4  DC  I "C1'" 1 
ATOM 7219  N N1    . DC  I 5 69  ? 110.52100 96.48600  71.53000  1.000 157.18348 ? -4  DC  I N1    1 
ATOM 7220  C C2    . DC  I 5 69  ? 111.70000 96.40200  70.78500  1.000 157.18348 ? -4  DC  I C2    1 
ATOM 7221  O O2    . DC  I 5 69  ? 112.76800 96.71300  71.30500  1.000 157.18348 ? -4  DC  I O2    1 
ATOM 7222  N N3    . DC  I 5 69  ? 111.63800 95.96900  69.50500  1.000 157.18348 ? -4  DC  I N3    1 
ATOM 7223  C C4    . DC  I 5 69  ? 110.46700 95.64500  68.96900  1.000 157.18348 ? -4  DC  I C4    1 
ATOM 7224  N N4    . DC  I 5 69  ? 110.45300 95.22400  67.70100  1.000 157.18348 ? -4  DC  I N4    1 
ATOM 7225  C C5    . DC  I 5 69  ? 109.25700 95.73200  69.70800  1.000 157.18348 ? -4  DC  I C5    1 
ATOM 7226  C C6    . DC  I 5 69  ? 109.33100 96.16800  70.96800  1.000 157.18348 ? -4  DC  I C6    1 
ATOM 7227  P P     . DG  I 5 70  ? 110.25700 99.43000  76.63800  1.000 153.58882 ? -3  DG  I P     1 
ATOM 7228  O OP1   . DG  I 5 70  ? 110.19100 98.59400  77.85000  1.000 153.58882 ? -3  DG  I OP1   1 
ATOM 7229  O OP2   . DG  I 5 70  ? 109.12700 100.31700 76.30400  1.000 153.58882 ? -3  DG  I OP2   1 
ATOM 7230  O "O5'" . DG  I 5 70  ? 111.57200 100.31700 76.69900  1.000 153.58882 ? -3  DG  I "O5'" 1 
ATOM 7231  C "C5'" . DG  I 5 70  ? 112.79400 99.73600  77.08500  1.000 153.58882 ? -3  DG  I "C5'" 1 
ATOM 7232  C "C4'" . DG  I 5 70  ? 113.99800 100.43200 76.45300  1.000 153.58882 ? -3  DG  I "C4'" 1 
ATOM 7233  O "O4'" . DG  I 5 70  ? 114.08000 100.13200 75.04000  1.000 153.58882 ? -3  DG  I "O4'" 1 
ATOM 7234  C "C3'" . DG  I 5 70  ? 114.03300 101.94900 76.55200  1.000 153.58882 ? -3  DG  I "C3'" 1 
ATOM 7235  O "O3'" . DG  I 5 70  ? 115.38100 102.36600 76.65500  1.000 153.58882 ? -3  DG  I "O3'" 1 
ATOM 7236  C "C2'" . DG  I 5 70  ? 113.41800 102.39400 75.22100  1.000 153.58882 ? -3  DG  I "C2'" 1 
ATOM 7237  C "C1'" . DG  I 5 70  ? 113.88400 101.30300 74.26800  1.000 153.58882 ? -3  DG  I "C1'" 1 
ATOM 7238  N N9    . DG  I 5 70  ? 112.92500 100.97900 73.22900  1.000 153.58882 ? -3  DG  I N9    1 
ATOM 7239  C C8    . DG  I 5 70  ? 111.59100 100.75100 73.39300  1.000 153.58882 ? -3  DG  I C8    1 
ATOM 7240  N N7    . DG  I 5 70  ? 110.98000 100.45600 72.28600  1.000 153.58882 ? -3  DG  I N7    1 
ATOM 7241  C C5    . DG  I 5 70  ? 111.97600 100.44300 71.33700  1.000 153.58882 ? -3  DG  I C5    1 
ATOM 7242  C C6    . DG  I 5 70  ? 111.90100 100.18300 69.95900  1.000 153.58882 ? -3  DG  I C6    1 
ATOM 7243  O O6    . DG  I 5 70  ? 110.90600 99.88300  69.29100  1.000 153.58882 ? -3  DG  I O6    1 
ATOM 7244  N N1    . DG  I 5 70  ? 113.13900 100.29200 69.35000  1.000 153.58882 ? -3  DG  I N1    1 
ATOM 7245  C C2    . DG  I 5 70  ? 114.30300 100.62900 69.99800  1.000 153.58882 ? -3  DG  I C2    1 
ATOM 7246  N N2    . DG  I 5 70  ? 115.41000 100.67900 69.24800  1.000 153.58882 ? -3  DG  I N2    1 
ATOM 7247  N N3    . DG  I 5 70  ? 114.38300 100.87100 71.29600  1.000 153.58882 ? -3  DG  I N3    1 
ATOM 7248  C C4    . DG  I 5 70  ? 113.18400 100.76300 71.89800  1.000 153.58882 ? -3  DG  I C4    1 
ATOM 7249  P P     . DC  I 5 71  ? 115.75800 103.92400 76.73300  1.000 168.48074 ? -2  DC  I P     1 
ATOM 7250  O OP1   . DC  I 5 71  ? 117.05200 104.02300 77.43900  1.000 168.48074 ? -2  DC  I OP1   1 
ATOM 7251  O OP2   . DC  I 5 71  ? 114.58900 104.67300 77.24100  1.000 168.48074 ? -2  DC  I OP2   1 
ATOM 7252  O "O5'" . DC  I 5 71  ? 116.01700 104.31100 75.21200  1.000 168.48074 ? -2  DC  I "O5'" 1 
ATOM 7253  C "C5'" . DC  I 5 71  ? 116.92400 103.54700 74.45200  1.000 168.48074 ? -2  DC  I "C5'" 1 
ATOM 7254  C "C4'" . DC  I 5 71  ? 117.12800 104.14100 73.07200  1.000 168.48074 ? -2  DC  I "C4'" 1 
ATOM 7255  O "O4'" . DC  I 5 71  ? 116.13900 103.61500 72.15100  1.000 168.48074 ? -2  DC  I "O4'" 1 
ATOM 7256  C "C3'" . DC  I 5 71  ? 117.01500 105.66200 72.99000  1.000 168.48074 ? -2  DC  I "C3'" 1 
ATOM 7257  O "O3'" . DC  I 5 71  ? 118.02000 106.15500 72.12900  1.000 168.48074 ? -2  DC  I "O3'" 1 
ATOM 7258  C "C2'" . DC  I 5 71  ? 115.62300 105.87200 72.40400  1.000 168.48074 ? -2  DC  I "C2'" 1 
ATOM 7259  C "C1'" . DC  I 5 71  ? 115.51700 104.67900 71.47600  1.000 168.48074 ? -2  DC  I "C1'" 1 
ATOM 7260  N N1    . DC  I 5 71  ? 114.13300 104.28700 71.14600  1.000 168.48074 ? -2  DC  I N1    1 
ATOM 7261  C C2    . DC  I 5 71  ? 113.81500 103.99000 69.82700  1.000 168.48074 ? -2  DC  I C2    1 
ATOM 7262  O O2    . DC  I 5 71  ? 114.70800 104.04600 68.97800  1.000 168.48074 ? -2  DC  I O2    1 
ATOM 7263  N N3    . DC  I 5 71  ? 112.55000 103.63000 69.52200  1.000 168.48074 ? -2  DC  I N3    1 
ATOM 7264  C C4    . DC  I 5 71  ? 111.62700 103.58500 70.47700  1.000 168.48074 ? -2  DC  I C4    1 
ATOM 7265  N N4    . DC  I 5 71  ? 110.39000 103.22500 70.13200  1.000 168.48074 ? -2  DC  I N4    1 
ATOM 7266  C C5    . DC  I 5 71  ? 111.93000 103.89500 71.83100  1.000 168.48074 ? -2  DC  I C5    1 
ATOM 7267  C C6    . DC  I 5 71  ? 113.18600 104.24000 72.11700  1.000 168.48074 ? -2  DC  I C6    1 
ATOM 7268  P P     . DG  I 5 72  ? 118.66100 107.60400 72.37400  1.000 176.63831 ? -1  DG  I P     1 
ATOM 7269  O OP1   . DG  I 5 72  ? 120.06300 107.41400 72.80000  1.000 176.63831 ? -1  DG  I OP1   1 
ATOM 7270  O OP2   . DG  I 5 72  ? 117.72700 108.36900 73.22600  1.000 176.63831 ? -1  DG  I OP2   1 
ATOM 7271  O "O5'" . DG  I 5 72  ? 118.64700 108.27800 70.92700  1.000 176.63831 ? -1  DG  I "O5'" 1 
ATOM 7272  C "C5'" . DG  I 5 72  ? 119.19400 107.57600 69.81400  1.000 176.63831 ? -1  DG  I "C5'" 1 
ATOM 7273  C "C4'" . DG  I 5 72  ? 118.39200 107.85800 68.55900  1.000 176.63831 ? -1  DG  I "C4'" 1 
ATOM 7274  O "O4'" . DG  I 5 72  ? 117.09800 107.24200 68.66100  1.000 176.63831 ? -1  DG  I "O4'" 1 
ATOM 7275  C "C3'" . DG  I 5 72  ? 118.13900 109.34000 68.30300  1.000 176.63831 ? -1  DG  I "C3'" 1 
ATOM 7276  O "O3'" . DG  I 5 72  ? 118.87700 109.77100 67.17200  1.000 176.63831 ? -1  DG  I "O3'" 1 
ATOM 7277  C "C2'" . DG  I 5 72  ? 116.62700 109.44500 68.06900  1.000 176.63831 ? -1  DG  I "C2'" 1 
ATOM 7278  C "C1'" . DG  I 5 72  ? 116.18200 108.00000 67.92700  1.000 176.63831 ? -1  DG  I "C1'" 1 
ATOM 7279  N N9    . DG  I 5 72  ? 114.86100 107.75600 68.47700  1.000 176.63831 ? -1  DG  I N9    1 
ATOM 7280  C C8    . DG  I 5 72  ? 114.49300 107.82800 69.79100  1.000 176.63831 ? -1  DG  I C8    1 
ATOM 7281  N N7    . DG  I 5 72  ? 113.24100 107.55000 69.99600  1.000 176.63831 ? -1  DG  I N7    1 
ATOM 7282  C C5    . DG  I 5 72  ? 112.74500 107.28600 68.73400  1.000 176.63831 ? -1  DG  I C5    1 
ATOM 7283  C C6    . DG  I 5 72  ? 111.44700 106.93300 68.32700  1.000 176.63831 ? -1  DG  I C6    1 
ATOM 7284  O O6    . DG  I 5 72  ? 110.44300 106.77600 69.02700  1.000 176.63831 ? -1  DG  I O6    1 
ATOM 7285  N N1    . DG  I 5 72  ? 111.37000 106.75700 66.95500  1.000 176.63831 ? -1  DG  I N1    1 
ATOM 7286  C C2    . DG  I 5 72  ? 112.42000 106.90000 66.08700  1.000 176.63831 ? -1  DG  I C2    1 
ATOM 7287  N N2    . DG  I 5 72  ? 112.15700 106.69000 64.79400  1.000 176.63831 ? -1  DG  I N2    1 
ATOM 7288  N N3    . DG  I 5 72  ? 113.64300 107.23300 66.45600  1.000 176.63831 ? -1  DG  I N3    1 
ATOM 7289  C C4    . DG  I 5 72  ? 113.73300 107.40300 67.78900  1.000 176.63831 ? -1  DG  I C4    1 
ATOM 7290  P P     . DC  I 5 73  ? 118.88400 111.32100 66.75200  1.000 177.02618 ? 0   DC  I P     1 
ATOM 7291  O OP1   . DC  I 5 73  ? 120.16300 111.57400 66.05700  1.000 177.02618 ? 0   DC  I OP1   1 
ATOM 7292  O OP2   . DC  I 5 73  ? 118.52800 112.12900 67.93900  1.000 177.02618 ? 0   DC  I OP2   1 
ATOM 7293  O "O5'" . DC  I 5 73  ? 117.70000 111.43400 65.68900  1.000 177.02618 ? 0   DC  I "O5'" 1 
ATOM 7294  C "C5'" . DC  I 5 73  ? 117.64500 110.52500 64.61300  1.000 177.02618 ? 0   DC  I "C5'" 1 
ATOM 7295  C "C4'" . DC  I 5 73  ? 116.33100 110.64900 63.87600  1.000 177.02618 ? 0   DC  I "C4'" 1 
ATOM 7296  O "O4'" . DC  I 5 73  ? 115.27800 110.06900 64.66400  1.000 177.02618 ? 0   DC  I "O4'" 1 
ATOM 7297  C "C3'" . DC  I 5 73  ? 115.89600 112.08300 63.58300  1.000 177.02618 ? 0   DC  I "C3'" 1 
ATOM 7298  O "O3'" . DC  I 5 73  ? 115.96700 112.32600 62.19100  1.000 177.02618 ? 0   DC  I "O3'" 1 
ATOM 7299  C "C2'" . DC  I 5 73  ? 114.45500 112.17100 64.10300  1.000 177.02618 ? 0   DC  I "C2'" 1 
ATOM 7300  C "C1'" . DC  I 5 73  ? 114.07900 110.72100 64.36100  1.000 177.02618 ? 0   DC  I "C1'" 1 
ATOM 7301  N N1    . DC  I 5 73  ? 113.17500 110.55400 65.50900  1.000 177.02618 ? 0   DC  I N1    1 
ATOM 7302  C C2    . DC  I 5 73  ? 111.84400 110.19100 65.30200  1.000 177.02618 ? 0   DC  I C2    1 
ATOM 7303  O O2    . DC  I 5 73  ? 111.44700 109.99500 64.15400  1.000 177.02618 ? 0   DC  I O2    1 
ATOM 7304  N N3    . DC  I 5 73  ? 111.03600 110.04200 66.37500  1.000 177.02618 ? 0   DC  I N3    1 
ATOM 7305  C C4    . DC  I 5 73  ? 111.50900 110.25600 67.59800  1.000 177.02618 ? 0   DC  I C4    1 
ATOM 7306  N N4    . DC  I 5 73  ? 110.67700 110.10600 68.62700  1.000 177.02618 ? 0   DC  I N4    1 
ATOM 7307  C C5    . DC  I 5 73  ? 112.85500 110.64800 67.82300  1.000 177.02618 ? 0   DC  I C5    1 
ATOM 7308  C C6    . DC  I 5 73  ? 113.64300 110.78200 66.75900  1.000 177.02618 ? 0   DC  I C6    1 
ATOM 7309  P P     . DT  I 5 74  ? 115.77800 113.81400 61.62000  1.000 182.75853 ? 1   DT  I P     1 
ATOM 7310  O OP1   . DT  I 5 74  ? 116.51100 113.90800 60.33800  1.000 182.75853 ? 1   DT  I OP1   1 
ATOM 7311  O OP2   . DT  I 5 74  ? 116.06900 114.75700 62.72100  1.000 182.75853 ? 1   DT  I OP2   1 
ATOM 7312  O "O5'" . DT  I 5 74  ? 114.21800 113.89700 61.31700  1.000 182.75853 ? 1   DT  I "O5'" 1 
ATOM 7313  C "C5'" . DT  I 5 74  ? 113.60700 112.87400 60.56500  1.000 182.75853 ? 1   DT  I "C5'" 1 
ATOM 7314  C "C4'" . DT  I 5 74  ? 112.11400 113.07800 60.51100  1.000 182.75853 ? 1   DT  I "C4'" 1 
ATOM 7315  O "O4'" . DT  I 5 74  ? 111.51700 112.64000 61.75200  1.000 182.75853 ? 1   DT  I "O4'" 1 
ATOM 7316  C "C3'" . DT  I 5 74  ? 111.68000 114.52900 60.31200  1.000 182.75853 ? 1   DT  I "C3'" 1 
ATOM 7317  O "O3'" . DT  I 5 74  ? 110.85900 114.63000 59.17100  1.000 182.75853 ? 1   DT  I "O3'" 1 
ATOM 7318  C "C2'" . DT  I 5 74  ? 110.91600 114.87500 61.58600  1.000 182.75853 ? 1   DT  I "C2'" 1 
ATOM 7319  C "C1'" . DT  I 5 74  ? 110.47500 113.51500 62.08800  1.000 182.75853 ? 1   DT  I "C1'" 1 
ATOM 7320  N N1    . DT  I 5 74  ? 110.28200 113.47500 63.54800  1.000 182.75853 ? 1   DT  I N1    1 
ATOM 7321  C C2    . DT  I 5 74  ? 109.05700 113.12900 64.05600  1.000 182.75853 ? 1   DT  I C2    1 
ATOM 7322  O O2    . DT  I 5 74  ? 108.10600 112.83200 63.35900  1.000 182.75853 ? 1   DT  I O2    1 
ATOM 7323  N N3    . DT  I 5 74  ? 108.98500 113.13100 65.41800  1.000 182.75853 ? 1   DT  I N3    1 
ATOM 7324  C C4    . DT  I 5 74  ? 109.99500 113.44600 66.30000  1.000 182.75853 ? 1   DT  I C4    1 
ATOM 7325  O O4    . DT  I 5 74  ? 109.83900 113.42100 67.51000  1.000 182.75853 ? 1   DT  I O4    1 
ATOM 7326  C C5    . DT  I 5 74  ? 111.24800 113.80800 65.70000  1.000 182.75853 ? 1   DT  I C5    1 
ATOM 7327  C C7    . DT  I 5 74  ? 112.41500 114.17200 66.56000  1.000 182.75853 ? 1   DT  I C7    1 
ATOM 7328  C C6    . DT  I 5 74  ? 111.32700 113.81300 64.36900  1.000 182.75853 ? 1   DT  I C6    1 
ATOM 7329  P P     . DG  I 5 75  ? 110.58200 116.05800 58.49400  1.000 179.34639 ? 2   DG  I P     1 
ATOM 7330  O OP1   . DG  I 5 75  ? 110.67300 115.88800 57.03000  1.000 179.34639 ? 2   DG  I OP1   1 
ATOM 7331  O OP2   . DG  I 5 75  ? 111.41500 117.06900 59.18100  1.000 179.34639 ? 2   DG  I OP2   1 
ATOM 7332  O "O5'" . DG  I 5 75  ? 109.06600 116.35600 58.87500  1.000 179.34639 ? 2   DG  I "O5'" 1 
ATOM 7333  C "C5'" . DG  I 5 75  ? 108.07700 115.38800 58.58700  1.000 179.34639 ? 2   DG  I "C5'" 1 
ATOM 7334  C "C4'" . DG  I 5 75  ? 106.88600 115.56800 59.49800  1.000 179.34639 ? 2   DG  I "C4'" 1 
ATOM 7335  O "O4'" . DG  I 5 75  ? 107.27100 115.29700 60.85300  1.000 179.34639 ? 2   DG  I "O4'" 1 
ATOM 7336  C "C3'" . DG  I 5 75  ? 106.32300 116.98000 59.51200  1.000 179.34639 ? 2   DG  I "C3'" 1 
ATOM 7337  O "O3'" . DG  I 5 75  ? 105.14800 117.03200 58.70500  1.000 179.34639 ? 2   DG  I "O3'" 1 
ATOM 7338  C "C2'" . DG  I 5 75  ? 106.02500 117.27200 60.99100  1.000 179.34639 ? 2   DG  I "C2'" 1 
ATOM 7339  C "C1'" . DG  I 5 75  ? 106.40300 115.98600 61.71100  1.000 179.34639 ? 2   DG  I "C1'" 1 
ATOM 7340  N N9    . DG  I 5 75  ? 107.09500 116.20700 62.96900  1.000 179.34639 ? 2   DG  I N9    1 
ATOM 7341  C C8    . DG  I 5 75  ? 108.39200 116.60800 63.13200  1.000 179.34639 ? 2   DG  I C8    1 
ATOM 7342  N N7    . DG  I 5 75  ? 108.75600 116.70000 64.37400  1.000 179.34639 ? 2   DG  I N7    1 
ATOM 7343  C C5    . DG  I 5 75  ? 107.62700 116.33900 65.08200  1.000 179.34639 ? 2   DG  I C5    1 
ATOM 7344  C C6    . DG  I 5 75  ? 107.42100 116.25700 66.46700  1.000 179.34639 ? 2   DG  I C6    1 
ATOM 7345  O O6    . DG  I 5 75  ? 108.22300 116.49300 67.37400  1.000 179.34639 ? 2   DG  I O6    1 
ATOM 7346  N N1    . DG  I 5 75  ? 106.13300 115.85000 66.77200  1.000 179.34639 ? 2   DG  I N1    1 
ATOM 7347  C C2    . DG  I 5 75  ? 105.16500 115.55800 65.84900  1.000 179.34639 ? 2   DG  I C2    1 
ATOM 7348  N N2    . DG  I 5 75  ? 103.97900 115.18000 66.33700  1.000 179.34639 ? 2   DG  I N2    1 
ATOM 7349  N N3    . DG  I 5 75  ? 105.34300 115.63200 64.54200  1.000 179.34639 ? 2   DG  I N3    1 
ATOM 7350  C C4    . DG  I 5 75  ? 106.59600 116.02800 64.23200  1.000 179.34639 ? 2   DG  I C4    1 
ATOM 7351  P P     . DT  I 5 76  ? 104.41200 118.43100 58.42300  1.000 185.65488 ? 3   DT  I P     1 
ATOM 7352  O OP1   . DT  I 5 76  ? 103.67900 118.29900 57.14500  1.000 185.65488 ? 3   DT  I OP1   1 
ATOM 7353  O OP2   . DT  I 5 76  ? 105.41100 119.50800 58.60000  1.000 185.65488 ? 3   DT  I OP2   1 
ATOM 7354  O "O5'" . DT  I 5 76  ? 103.34900 118.55100 59.60600  1.000 185.65488 ? 3   DT  I "O5'" 1 
ATOM 7355  C "C5'" . DT  I 5 76  ? 102.54200 117.43900 59.94100  1.000 185.65488 ? 3   DT  I "C5'" 1 
ATOM 7356  C "C4'" . DT  I 5 76  ? 101.76500 117.72000 61.20400  1.000 185.65488 ? 3   DT  I "C4'" 1 
ATOM 7357  O "O4'" . DT  I 5 76  ? 102.62500 117.58400 62.36300  1.000 185.65488 ? 3   DT  I "O4'" 1 
ATOM 7358  C "C3'" . DT  I 5 76  ? 101.15500 119.11500 61.27700  1.000 185.65488 ? 3   DT  I "C3'" 1 
ATOM 7359  O "O3'" . DT  I 5 76  ? 99.78600  119.00300 61.56800  1.000 185.65488 ? 3   DT  I "O3'" 1 
ATOM 7360  C "C2'" . DT  I 5 76  ? 101.91400 119.78300 62.42200  1.000 185.65488 ? 3   DT  I "C2'" 1 
ATOM 7361  C "C1'" . DT  I 5 76  ? 102.31500 118.60100 63.27900  1.000 185.65488 ? 3   DT  I "C1'" 1 
ATOM 7362  N N1    . DT  I 5 76  ? 103.50100 118.86600 64.12200  1.000 185.65488 ? 3   DT  I N1    1 
ATOM 7363  C C2    . DT  I 5 76  ? 103.40900 118.72700 65.48600  1.000 185.65488 ? 3   DT  I C2    1 
ATOM 7364  O O2    . DT  I 5 76  ? 102.39400 118.37000 66.05000  1.000 185.65488 ? 3   DT  I O2    1 
ATOM 7365  N N3    . DT  I 5 76  ? 104.56400 119.00700 66.16600  1.000 185.65488 ? 3   DT  I N3    1 
ATOM 7366  C C4    . DT  I 5 76  ? 105.76600 119.41200 65.62400  1.000 185.65488 ? 3   DT  I C4    1 
ATOM 7367  O O4    . DT  I 5 76  ? 106.75100 119.64500 66.30800  1.000 185.65488 ? 3   DT  I O4    1 
ATOM 7368  C C5    . DT  I 5 76  ? 105.78400 119.54800 64.19500  1.000 185.65488 ? 3   DT  I C5    1 
ATOM 7369  C C7    . DT  I 5 76  ? 107.03500 119.98500 63.49900  1.000 185.65488 ? 3   DT  I C7    1 
ATOM 7370  C C6    . DT  I 5 76  ? 104.66100 119.28400 63.52600  1.000 185.65488 ? 3   DT  I C6    1 
ATOM 7371  P P     . DC  I 5 77  ? 98.81700  120.28100 61.51100  1.000 179.42221 ? 4   DC  I P     1 
ATOM 7372  O OP1   . DC  I 5 77  ? 97.58100  119.84900 60.82500  1.000 179.42221 ? 4   DC  I OP1   1 
ATOM 7373  O OP2   . DC  I 5 77  ? 99.54100  121.47200 61.01500  1.000 179.42221 ? 4   DC  I OP2   1 
ATOM 7374  O "O5'" . DC  I 5 77  ? 98.45600  120.49700 63.04300  1.000 179.42221 ? 4   DC  I "O5'" 1 
ATOM 7375  C "C5'" . DC  I 5 77  ? 98.09400  119.37700 63.81600  1.000 179.42221 ? 4   DC  I "C5'" 1 
ATOM 7376  C "C4'" . DC  I 5 77  ? 98.08200  119.70200 65.29600  1.000 179.42221 ? 4   DC  I "C4'" 1 
ATOM 7377  O "O4'" . DC  I 5 77  ? 99.42900  119.89500 65.80000  1.000 179.42221 ? 4   DC  I "O4'" 1 
ATOM 7378  C "C3'" . DC  I 5 77  ? 97.29500  120.94800 65.66500  1.000 179.42221 ? 4   DC  I "C3'" 1 
ATOM 7379  O "O3'" . DC  I 5 77  ? 96.50600  120.65400 66.80200  1.000 179.42221 ? 4   DC  I "O3'" 1 
ATOM 7380  C "C2'" . DC  I 5 77  ? 98.39700  121.98200 65.96300  1.000 179.42221 ? 4   DC  I "C2'" 1 
ATOM 7381  C "C1'" . DC  I 5 77  ? 99.50700  121.10800 66.51800  1.000 179.42221 ? 4   DC  I "C1'" 1 
ATOM 7382  N N1    . DC  I 5 77  ? 100.88100 121.65400 66.34100  1.000 179.42221 ? 4   DC  I N1    1 
ATOM 7383  C C2    . DC  I 5 77  ? 101.72000 121.82600 67.45300  1.000 179.42221 ? 4   DC  I C2    1 
ATOM 7384  O O2    . DC  I 5 77  ? 101.30300 121.54500 68.57700  1.000 179.42221 ? 4   DC  I O2    1 
ATOM 7385  N N3    . DC  I 5 77  ? 102.96900 122.30200 67.26100  1.000 179.42221 ? 4   DC  I N3    1 
ATOM 7386  C C4    . DC  I 5 77  ? 103.38600 122.59400 66.03100  1.000 179.42221 ? 4   DC  I C4    1 
ATOM 7387  N N4    . DC  I 5 77  ? 104.62400 123.06400 65.88300  1.000 179.42221 ? 4   DC  I N4    1 
ATOM 7388  C C5    . DC  I 5 77  ? 102.55100 122.42100 64.89500  1.000 179.42221 ? 4   DC  I C5    1 
ATOM 7389  C C6    . DC  I 5 77  ? 101.31800 121.95800 65.09800  1.000 179.42221 ? 4   DC  I C6    1 
ATOM 7390  P P     . DC  I 5 78  ? 95.62000  121.78400 67.50900  1.000 174.07334 ? 5   DC  I P     1 
ATOM 7391  O OP1   . DC  I 5 78  ? 94.51800  121.09500 68.21300  1.000 174.07334 ? 5   DC  I OP1   1 
ATOM 7392  O OP2   . DC  I 5 78  ? 95.30400  122.83900 66.52300  1.000 174.07334 ? 5   DC  I OP2   1 
ATOM 7393  O "O5'" . DC  I 5 78  ? 96.60900  122.37600 68.59800  1.000 174.07334 ? 5   DC  I "O5'" 1 
ATOM 7394  C "C5'" . DC  I 5 78  ? 97.07900  121.56000 69.66100  1.000 174.07334 ? 5   DC  I "C5'" 1 
ATOM 7395  C "C4'" . DC  I 5 78  ? 97.71200  122.37300 70.79500  1.000 174.07334 ? 5   DC  I "C4'" 1 
ATOM 7396  O "O4'" . DC  I 5 78  ? 99.06700  122.77300 70.45300  1.000 174.07334 ? 5   DC  I "O4'" 1 
ATOM 7397  C "C3'" . DC  I 5 78  ? 96.99600  123.66800 71.17600  1.000 174.07334 ? 5   DC  I "C3'" 1 
ATOM 7398  O "O3'" . DC  I 5 78  ? 97.23400  123.95500 72.53600  1.000 174.07334 ? 5   DC  I "O3'" 1 
ATOM 7399  C "C2'" . DC  I 5 78  ? 97.73500  124.68400 70.31100  1.000 174.07334 ? 5   DC  I "C2'" 1 
ATOM 7400  C "C1'" . DC  I 5 78  ? 99.15500  124.18300 70.46800  1.000 174.07334 ? 5   DC  I "C1'" 1 
ATOM 7401  N N1    . DC  I 5 78  ? 100.08000 124.60300 69.40300  1.000 174.07334 ? 5   DC  I N1    1 
ATOM 7402  C C2    . DC  I 5 78  ? 101.37900 124.97300 69.74100  1.000 174.07334 ? 5   DC  I C2    1 
ATOM 7403  O O2    . DC  I 5 78  ? 101.71000 124.96900 70.92400  1.000 174.07334 ? 5   DC  I O2    1 
ATOM 7404  N N3    . DC  I 5 78  ? 102.23200 125.34100 68.76500  1.000 174.07334 ? 5   DC  I N3    1 
ATOM 7405  C C4    . DC  I 5 78  ? 101.82900 125.33600 67.49500  1.000 174.07334 ? 5   DC  I C4    1 
ATOM 7406  N N4    . DC  I 5 78  ? 102.70600 125.70900 66.55900  1.000 174.07334 ? 5   DC  I N4    1 
ATOM 7407  C C5    . DC  I 5 78  ? 100.50600 124.95400 67.12800  1.000 174.07334 ? 5   DC  I C5    1 
ATOM 7408  C C6    . DC  I 5 78  ? 99.67500  124.59100 68.10800  1.000 174.07334 ? 5   DC  I C6    1 
ATOM 7409  P P     . DC  I 5 79  ? 96.30300  123.36500 73.70600  1.000 163.56681 ? 6   DC  I P     1 
ATOM 7410  O OP1   . DC  I 5 79  ? 95.88400  121.97400 73.43700  1.000 163.56681 ? 6   DC  I OP1   1 
ATOM 7411  O OP2   . DC  I 5 79  ? 95.27800  124.38600 73.99900  1.000 163.56681 ? 6   DC  I OP2   1 
ATOM 7412  O "O5'" . DC  I 5 79  ? 97.30100  123.34300 74.94100  1.000 163.56681 ? 6   DC  I "O5'" 1 
ATOM 7413  C "C5'" . DC  I 5 79  ? 98.70200  123.34100 74.69800  1.000 163.56681 ? 6   DC  I "C5'" 1 
ATOM 7414  C "C4'" . DC  I 5 79  ? 99.39500  124.43500 75.48900  1.000 163.56681 ? 6   DC  I "C4'" 1 
ATOM 7415  O "O4'" . DC  I 5 79  ? 100.07200 125.36300 74.60200  1.000 163.56681 ? 6   DC  I "O4'" 1 
ATOM 7416  C "C3'" . DC  I 5 79  ? 98.47000  125.29300 76.33600  1.000 163.56681 ? 6   DC  I "C3'" 1 
ATOM 7417  O "O3'" . DC  I 5 79  ? 99.16500  125.77000 77.46600  1.000 163.56681 ? 6   DC  I "O3'" 1 
ATOM 7418  C "C2'" . DC  I 5 79  ? 98.13100  126.43400 75.38100  1.000 163.56681 ? 6   DC  I "C2'" 1 
ATOM 7419  C "C1'" . DC  I 5 79  ? 99.46900  126.64200 74.68600  1.000 163.56681 ? 6   DC  I "C1'" 1 
ATOM 7420  N N1    . DC  I 5 79  ? 99.37600  127.21200 73.32200  1.000 163.56681 ? 6   DC  I N1    1 
ATOM 7421  C C2    . DC  I 5 79  ? 100.54100 127.60000 72.66600  1.000 163.56681 ? 6   DC  I C2    1 
ATOM 7422  O O2    . DC  I 5 79  ? 101.62700 127.46100 73.22600  1.000 163.56681 ? 6   DC  I O2    1 
ATOM 7423  N N3    . DC  I 5 79  ? 100.45300 128.11100 71.42200  1.000 163.56681 ? 6   DC  I N3    1 
ATOM 7424  C C4    . DC  I 5 79  ? 99.27200  128.25400 70.84100  1.000 163.56681 ? 6   DC  I C4    1 
ATOM 7425  N N4    . DC  I 5 79  ? 99.24800  128.76500 69.60800  1.000 163.56681 ? 6   DC  I N4    1 
ATOM 7426  C C5    . DC  I 5 79  ? 98.06500  127.89400 71.50000  1.000 163.56681 ? 6   DC  I C5    1 
ATOM 7427  C C6    . DC  I 5 79  ? 98.16300  127.36700 72.72400  1.000 163.56681 ? 6   DC  I C6    1 
ATOM 7428  P P     . DC  I 5 80  ? 99.26100  124.88100 78.80000  1.000 155.60417 ? 7   DC  I P     1 
ATOM 7429  O OP1   . DC  I 5 80  ? 99.12500  123.43500 78.53600  1.000 155.60417 ? 7   DC  I OP1   1 
ATOM 7430  O OP2   . DC  I 5 80  ? 98.33600  125.51300 79.75800  1.000 155.60417 ? 7   DC  I OP2   1 
ATOM 7431  O "O5'" . DC  I 5 80  ? 100.72300 125.18400 79.33400  1.000 155.60417 ? 7   DC  I "O5'" 1 
ATOM 7432  C "C5'" . DC  I 5 80  ? 100.99500 126.43400 79.89900  1.000 155.60417 ? 7   DC  I "C5'" 1 
ATOM 7433  C "C4'" . DC  I 5 80  ? 102.42300 126.84900 79.64800  1.000 155.60417 ? 7   DC  I "C4'" 1 
ATOM 7434  O "O4'" . DC  I 5 80  ? 102.56300 127.34300 78.29400  1.000 155.60417 ? 7   DC  I "O4'" 1 
ATOM 7435  C "C3'" . DC  I 5 80  ? 102.87700 127.99900 80.50100  1.000 155.60417 ? 7   DC  I "C3'" 1 
ATOM 7436  O "O3'" . DC  I 5 80  ? 104.27100 128.04200 80.51400  1.000 155.60417 ? 7   DC  I "O3'" 1 
ATOM 7437  C "C2'" . DC  I 5 80  ? 102.30000 129.17200 79.74600  1.000 155.60417 ? 7   DC  I "C2'" 1 
ATOM 7438  C "C1'" . DC  I 5 80  ? 102.56600 128.76400 78.30100  1.000 155.60417 ? 7   DC  I "C1'" 1 
ATOM 7439  N N1    . DC  I 5 80  ? 101.53400 129.23100 77.33600  1.000 155.60417 ? 7   DC  I N1    1 
ATOM 7440  C C2    . DC  I 5 80  ? 101.91600 129.85100 76.14100  1.000 155.60417 ? 7   DC  I C2    1 
ATOM 7441  O O2    . DC  I 5 80  ? 103.11200 130.01300 75.89200  1.000 155.60417 ? 7   DC  I O2    1 
ATOM 7442  N N3    . DC  I 5 80  ? 100.95400 130.25000 75.27700  1.000 155.60417 ? 7   DC  I N3    1 
ATOM 7443  C C4    . DC  I 5 80  ? 99.67500  130.06500 75.57600  1.000 155.60417 ? 7   DC  I C4    1 
ATOM 7444  N N4    . DC  I 5 80  ? 98.75800  130.47600 74.69700  1.000 155.60417 ? 7   DC  I N4    1 
ATOM 7445  C C5    . DC  I 5 80  ? 99.27000  129.46100 76.79500  1.000 155.60417 ? 7   DC  I C5    1 
ATOM 7446  C C6    . DC  I 5 80  ? 100.22200 129.05300 77.62800  1.000 155.60417 ? 7   DC  I C6    1 
ATOM 7447  P P     . DC  I 5 81  ? 105.04000 128.87000 81.64900  1.000 157.40207 ? 8   DC  I P     1 
ATOM 7448  O OP1   . DC  I 5 81  ? 106.14400 128.03700 82.15900  1.000 157.40207 ? 8   DC  I OP1   1 
ATOM 7449  O OP2   . DC  I 5 81  ? 104.02900 129.40200 82.58500  1.000 157.40207 ? 8   DC  I OP2   1 
ATOM 7450  O "O5'" . DC  I 5 81  ? 105.66400 130.08100 80.83100  1.000 157.40207 ? 8   DC  I "O5'" 1 
ATOM 7451  C "C5'" . DC  I 5 81  ? 106.37100 129.81900 79.63400  1.000 157.40207 ? 8   DC  I "C5'" 1 
ATOM 7452  C "C4'" . DC  I 5 81  ? 106.88400 131.09200 78.97600  1.000 157.40207 ? 8   DC  I "C4'" 1 
ATOM 7453  O "O4'" . DC  I 5 81  ? 105.95700 131.54600 77.95400  1.000 157.40207 ? 8   DC  I "O4'" 1 
ATOM 7454  C "C3'" . DC  I 5 81  ? 107.09600 132.28200 79.89400  1.000 157.40207 ? 8   DC  I "C3'" 1 
ATOM 7455  O "O3'" . DC  I 5 81  ? 108.18300 133.03500 79.40000  1.000 157.40207 ? 8   DC  I "O3'" 1 
ATOM 7456  C "C2'" . DC  I 5 81  ? 105.78600 133.05000 79.73600  1.000 157.40207 ? 8   DC  I "C2'" 1 
ATOM 7457  C "C1'" . DC  I 5 81  ? 105.49800 132.84800 78.25800  1.000 157.40207 ? 8   DC  I "C1'" 1 
ATOM 7458  N N1    . DC  I 5 81  ? 104.06500 132.92200 77.89600  1.000 157.40207 ? 8   DC  I N1    1 
ATOM 7459  C C2    . DC  I 5 81  ? 103.68100 133.54900 76.71400  1.000 157.40207 ? 8   DC  I C2    1 
ATOM 7460  O O2    . DC  I 5 81  ? 104.54700 134.03300 75.98700  1.000 157.40207 ? 8   DC  I O2    1 
ATOM 7461  N N3    . DC  I 5 81  ? 102.36700 133.58700 76.38900  1.000 157.40207 ? 8   DC  I N3    1 
ATOM 7462  C C4    . DC  I 5 81  ? 101.46800 133.04500 77.19800  1.000 157.40207 ? 8   DC  I C4    1 
ATOM 7463  N N4    . DC  I 5 81  ? 100.18300 133.11000 76.84800  1.000 157.40207 ? 8   DC  I N4    1 
ATOM 7464  C C5    . DC  I 5 81  ? 101.84300 132.41600 78.40900  1.000 157.40207 ? 8   DC  I C5    1 
ATOM 7465  C C6    . DC  I 5 81  ? 103.14000 132.38200 78.71400  1.000 157.40207 ? 8   DC  I C6    1 
ATOM 7466  P P     . DG  I 5 82  ? 108.97700 134.05900 80.34400  1.000 171.22305 ? 9   DG  I P     1 
ATOM 7467  O OP1   . DG  I 5 82  ? 110.37800 133.59100 80.39800  1.000 171.22305 ? 9   DG  I OP1   1 
ATOM 7468  O OP2   . DG  I 5 82  ? 108.21400 134.24100 81.59600  1.000 171.22305 ? 9   DG  I OP2   1 
ATOM 7469  O "O5'" . DG  I 5 82  ? 108.94400 135.42600 79.51600  1.000 171.22305 ? 9   DG  I "O5'" 1 
ATOM 7470  C "C5'" . DG  I 5 82  ? 109.32800 135.43200 78.15200  1.000 171.22305 ? 9   DG  I "C5'" 1 
ATOM 7471  C "C4'" . DG  I 5 82  ? 108.71000 136.60300 77.40800  1.000 171.22305 ? 9   DG  I "C4'" 1 
ATOM 7472  O "O4'" . DG  I 5 82  ? 107.29900 136.37400 77.17600  1.000 171.22305 ? 9   DG  I "O4'" 1 
ATOM 7473  C "C3'" . DG  I 5 82  ? 108.81500 137.94700 78.11600  1.000 171.22305 ? 9   DG  I "C3'" 1 
ATOM 7474  O "O3'" . DG  I 5 82  ? 109.21500 138.92700 77.18800  1.000 171.22305 ? 9   DG  I "O3'" 1 
ATOM 7475  C "C2'" . DG  I 5 82  ? 107.39700 138.20300 78.62400  1.000 171.22305 ? 9   DG  I "C2'" 1 
ATOM 7476  C "C1'" . DG  I 5 82  ? 106.56200 137.51000 77.56800  1.000 171.22305 ? 9   DG  I "C1'" 1 
ATOM 7477  N N9    . DG  I 5 82  ? 105.26100 137.06200 78.03600  1.000 171.22305 ? 9   DG  I N9    1 
ATOM 7478  C C8    . DG  I 5 82  ? 105.00300 136.29700 79.13300  1.000 171.22305 ? 9   DG  I C8    1 
ATOM 7479  N N7    . DG  I 5 82  ? 103.74200 136.02000 79.29400  1.000 171.22305 ? 9   DG  I N7    1 
ATOM 7480  C C5    . DG  I 5 82  ? 103.12300 136.65400 78.23600  1.000 171.22305 ? 9   DG  I C5    1 
ATOM 7481  C C6    . DG  I 5 82  ? 101.76100 136.72000 77.89000  1.000 171.22305 ? 9   DG  I C6    1 
ATOM 7482  O O6    . DG  I 5 82  ? 100.79800 136.21000 78.46800  1.000 171.22305 ? 9   DG  I O6    1 
ATOM 7483  N N1    . DG  I 5 82  ? 101.56100 137.46900 76.74200  1.000 171.22305 ? 9   DG  I N1    1 
ATOM 7484  C C2    . DG  I 5 82  ? 102.55500 138.07500 76.01800  1.000 171.22305 ? 9   DG  I C2    1 
ATOM 7485  N N2    . DG  I 5 82  ? 102.17100 138.75800 74.93700  1.000 171.22305 ? 9   DG  I N2    1 
ATOM 7486  N N3    . DG  I 5 82  ? 103.83700 138.02200 76.33300  1.000 171.22305 ? 9   DG  I N3    1 
ATOM 7487  C C4    . DG  I 5 82  ? 104.04600 137.29700 77.44800  1.000 171.22305 ? 9   DG  I C4    1 
ATOM 7488  P P     . DC  I 5 83  ? 109.72200 140.35900 77.69700  1.000 175.51745 ? 10  DC  I P     1 
ATOM 7489  O OP1   . DC  I 5 83  ? 110.85000 140.72100 76.82000  1.000 175.51745 ? 10  DC  I OP1   1 
ATOM 7490  O OP2   . DC  I 5 83  ? 109.85700 140.34600 79.16900  1.000 175.51745 ? 10  DC  I OP2   1 
ATOM 7491  O "O5'" . DC  I 5 83  ? 108.55700 141.35300 77.28300  1.000 175.51745 ? 10  DC  I "O5'" 1 
ATOM 7492  C "C5'" . DC  I 5 83  ? 108.12400 141.37800 75.94600  1.000 175.51745 ? 10  DC  I "C5'" 1 
ATOM 7493  C "C4'" . DC  I 5 83  ? 106.83300 142.14000 75.82600  1.000 175.51745 ? 10  DC  I "C4'" 1 
ATOM 7494  O "O4'" . DC  I 5 83  ? 105.73400 141.30900 76.26700  1.000 175.51745 ? 10  DC  I "O4'" 1 
ATOM 7495  C "C3'" . DC  I 5 83  ? 106.78900 143.41300 76.67400  1.000 175.51745 ? 10  DC  I "C3'" 1 
ATOM 7496  O "O3'" . DC  I 5 83  ? 106.48900 144.54100 75.86600  1.000 175.51745 ? 10  DC  I "O3'" 1 
ATOM 7497  C "C2'" . DC  I 5 83  ? 105.68200 143.13400 77.68900  1.000 175.51745 ? 10  DC  I "C2'" 1 
ATOM 7498  C "C1'" . DC  I 5 83  ? 104.82600 142.10500 76.97000  1.000 175.51745 ? 10  DC  I "C1'" 1 
ATOM 7499  N N1    . DC  I 5 83  ? 104.05100 141.25200 77.89500  1.000 175.51745 ? 10  DC  I N1    1 
ATOM 7500  C C2    . DC  I 5 83  ? 102.66200 141.18400 77.77600  1.000 175.51745 ? 10  DC  I C2    1 
ATOM 7501  O O2    . DC  I 5 83  ? 102.10500 141.79700 76.86800  1.000 175.51745 ? 10  DC  I O2    1 
ATOM 7502  N N3    . DC  I 5 83  ? 101.96700 140.41500 78.64000  1.000 175.51745 ? 10  DC  I N3    1 
ATOM 7503  C C4    . DC  I 5 83  ? 102.60300 139.75900 79.60300  1.000 175.51745 ? 10  DC  I C4    1 
ATOM 7504  N N4    . DC  I 5 83  ? 101.87500 139.01800 80.43800  1.000 175.51745 ? 10  DC  I N4    1 
ATOM 7505  C C5    . DC  I 5 83  ? 104.01500 139.83400 79.75700  1.000 175.51745 ? 10  DC  I C5    1 
ATOM 7506  C C6    . DC  I 5 83  ? 104.69200 140.59100 78.89200  1.000 175.51745 ? 10  DC  I C6    1 
ATOM 7507  P P     . DG  I 5 84  ? 106.79500 146.02600 76.40600  1.000 176.15546 ? 11  DG  I P     1 
ATOM 7508  O OP1   . DG  I 5 84  ? 107.52700 146.74400 75.34400  1.000 176.15546 ? 11  DG  I OP1   1 
ATOM 7509  O OP2   . DG  I 5 84  ? 107.39100 145.92400 77.75500  1.000 176.15546 ? 11  DG  I OP2   1 
ATOM 7510  O "O5'" . DG  I 5 84  ? 105.34800 146.68000 76.55900  1.000 176.15546 ? 11  DG  I "O5'" 1 
ATOM 7511  C "C5'" . DG  I 5 84  ? 104.50300 146.75200 75.42700  1.000 176.15546 ? 11  DG  I "C5'" 1 
ATOM 7512  C "C4'" . DG  I 5 84  ? 103.05000 146.81800 75.84000  1.000 176.15546 ? 11  DG  I "C4'" 1 
ATOM 7513  O "O4'" . DG  I 5 84  ? 102.69700 145.60300 76.52700  1.000 176.15546 ? 11  DG  I "O4'" 1 
ATOM 7514  C "C3'" . DG  I 5 84  ? 102.70300 147.95000 76.80000  1.000 176.15546 ? 11  DG  I "C3'" 1 
ATOM 7515  O "O3'" . DG  I 5 84  ? 101.90000 148.90200 76.13900  1.000 176.15546 ? 11  DG  I "O3'" 1 
ATOM 7516  C "C2'" . DG  I 5 84  ? 101.95100 147.27800 77.95000  1.000 176.15546 ? 11  DG  I "C2'" 1 
ATOM 7517  C "C1'" . DG  I 5 84  ? 101.67100 145.88200 77.43600  1.000 176.15546 ? 11  DG  I "C1'" 1 
ATOM 7518  N N9    . DG  I 5 84  ? 101.70900 144.87100 78.48000  1.000 176.15546 ? 11  DG  I N9    1 
ATOM 7519  C C8    . DG  I 5 84  ? 102.82000 144.38300 79.11200  1.000 176.15546 ? 11  DG  I C8    1 
ATOM 7520  N N7    . DG  I 5 84  ? 102.55800 143.46600 79.99400  1.000 176.15546 ? 11  DG  I N7    1 
ATOM 7521  C C5    . DG  I 5 84  ? 101.18300 143.33000 79.93700  1.000 176.15546 ? 11  DG  I C5    1 
ATOM 7522  C C6    . DG  I 5 84  ? 100.32500 142.48300 80.66500  1.000 176.15546 ? 11  DG  I C6    1 
ATOM 7523  O O6    . DG  I 5 84  ? 100.62000 141.65500 81.53100  1.000 176.15546 ? 11  DG  I O6    1 
ATOM 7524  N N1    . DG  I 5 84  ? 98.99600  142.66200 80.30300  1.000 176.15546 ? 11  DG  I N1    1 
ATOM 7525  C C2    . DG  I 5 84  ? 98.55600  143.54800 79.35500  1.000 176.15546 ? 11  DG  I C2    1 
ATOM 7526  N N2    . DG  I 5 84  ? 97.23500  143.58500 79.13900  1.000 176.15546 ? 11  DG  I N2    1 
ATOM 7527  N N3    . DG  I 5 84  ? 99.35200  144.35000 78.66500  1.000 176.15546 ? 11  DG  I N3    1 
ATOM 7528  C C4    . DG  I 5 84  ? 100.64700 144.18600 79.00700  1.000 176.15546 ? 11  DG  I C4    1 
ATOM 7529  P P     . DT  I 5 85  ? 101.52100 150.28700 76.85600  1.000 173.90010 ? 12  DT  I P     1 
ATOM 7530  O OP1   . DT  I 5 85  ? 101.28100 151.29500 75.80300  1.000 173.90010 ? 12  DT  I OP1   1 
ATOM 7531  O OP2   . DT  I 5 85  ? 102.52800 150.54500 77.90700  1.000 173.90010 ? 12  DT  I OP2   1 
ATOM 7532  O "O5'" . DT  I 5 85  ? 100.13500 149.95600 77.57700  1.000 173.90010 ? 12  DT  I "O5'" 1 
ATOM 7533  C "C5'" . DT  I 5 85  ? 99.03600  149.51800 76.79200  1.000 173.90010 ? 12  DT  I "C5'" 1 
ATOM 7534  C "C4'" . DT  I 5 85  ? 97.85700  149.14400 77.66200  1.000 173.90010 ? 12  DT  I "C4'" 1 
ATOM 7535  O "O4'" . DT  I 5 85  ? 98.16700  147.94900 78.42200  1.000 173.90010 ? 12  DT  I "O4'" 1 
ATOM 7536  C "C3'" . DT  I 5 85  ? 97.44500  150.20600 78.67800  1.000 173.90010 ? 12  DT  I "C3'" 1 
ATOM 7537  O "O3'" . DT  I 5 85  ? 96.07100  150.48000 78.53800  1.000 173.90010 ? 12  DT  I "O3'" 1 
ATOM 7538  C "C2'" . DT  I 5 85  ? 97.74800  149.55800 80.02900  1.000 173.90010 ? 12  DT  I "C2'" 1 
ATOM 7539  C "C1'" . DT  I 5 85  ? 97.64700  148.08100 79.71900  1.000 173.90010 ? 12  DT  I "C1'" 1 
ATOM 7540  N N1    . DT  I 5 85  ? 98.45100  147.22800 80.63600  1.000 173.90010 ? 12  DT  I N1    1 
ATOM 7541  C C2    . DT  I 5 85  ? 97.83000  146.25000 81.37200  1.000 173.90010 ? 12  DT  I C2    1 
ATOM 7542  O O2    . DT  I 5 85  ? 96.63800  146.02900 81.31800  1.000 173.90010 ? 12  DT  I O2    1 
ATOM 7543  N N3    . DT  I 5 85  ? 98.66600  145.52500 82.17200  1.000 173.90010 ? 12  DT  I N3    1 
ATOM 7544  C C4    . DT  I 5 85  ? 100.02700 145.68100 82.31000  1.000 173.90010 ? 12  DT  I C4    1 
ATOM 7545  O O4    . DT  I 5 85  ? 100.69700 144.98200 83.05700  1.000 173.90010 ? 12  DT  I O4    1 
ATOM 7546  C C5    . DT  I 5 85  ? 100.61000 146.72500 81.52000  1.000 173.90010 ? 12  DT  I C5    1 
ATOM 7547  C C7    . DT  I 5 85  ? 102.08200 146.98500 81.59900  1.000 173.90010 ? 12  DT  I C7    1 
ATOM 7548  C C6    . DT  I 5 85  ? 99.80300  147.44300 80.73400  1.000 173.90010 ? 12  DT  I C6    1 
ATOM 7549  P P     . DT  I 5 86  ? 95.36200  151.60900 79.43300  1.000 171.67858 ? 13  DT  I P     1 
ATOM 7550  O OP1   . DT  I 5 86  ? 94.33200  152.24000 78.58200  1.000 171.67858 ? 13  DT  I OP1   1 
ATOM 7551  O OP2   . DT  I 5 86  ? 96.37700  152.46900 80.07900  1.000 171.67858 ? 13  DT  I OP2   1 
ATOM 7552  O "O5'" . DT  I 5 86  ? 94.61100  150.75100 80.54600  1.000 171.67858 ? 13  DT  I "O5'" 1 
ATOM 7553  C "C5'" . DT  I 5 86  ? 93.67900  149.76800 80.14000  1.000 171.67858 ? 13  DT  I "C5'" 1 
ATOM 7554  C "C4'" . DT  I 5 86  ? 93.11300  149.01900 81.32700  1.000 171.67858 ? 13  DT  I "C4'" 1 
ATOM 7555  O "O4'" . DT  I 5 86  ? 94.13800  148.18900 81.93000  1.000 171.67858 ? 13  DT  I "O4'" 1 
ATOM 7556  C "C3'" . DT  I 5 86  ? 92.55800  149.89600 82.44300  1.000 171.67858 ? 13  DT  I "C3'" 1 
ATOM 7557  O "O3'" . DT  I 5 86  ? 91.32800  149.35400 82.87600  1.000 171.67858 ? 13  DT  I "O3'" 1 
ATOM 7558  C "C2'" . DT  I 5 86  ? 93.63500  149.79500 83.52600  1.000 171.67858 ? 13  DT  I "C2'" 1 
ATOM 7559  C "C1'" . DT  I 5 86  ? 94.14000  148.38500 83.32200  1.000 171.67858 ? 13  DT  I "C1'" 1 
ATOM 7560  N N1    . DT  I 5 86  ? 95.52000  148.13300 83.82800  1.000 171.67858 ? 13  DT  I N1    1 
ATOM 7561  C C2    . DT  I 5 86  ? 95.73400  147.05500 84.64500  1.000 171.67858 ? 13  DT  I C2    1 
ATOM 7562  O O2    . DT  I 5 86  ? 94.85100  146.29900 84.99100  1.000 171.67858 ? 13  DT  I O2    1 
ATOM 7563  N N3    . DT  I 5 86  ? 97.02400  146.88500 85.04100  1.000 171.67858 ? 13  DT  I N3    1 
ATOM 7564  C C4    . DT  I 5 86  ? 98.10200  147.67000 84.71500  1.000 171.67858 ? 13  DT  I C4    1 
ATOM 7565  O O4    . DT  I 5 86  ? 99.22900  147.43900 85.12700  1.000 171.67858 ? 13  DT  I O4    1 
ATOM 7566  C C5    . DT  I 5 86  ? 97.81900  148.78200 83.85700  1.000 171.67858 ? 13  DT  I C5    1 
ATOM 7567  C C7    . DT  I 5 86  ? 98.92700  149.70100 83.45100  1.000 171.67858 ? 13  DT  I C7    1 
ATOM 7568  C C6    . DT  I 5 86  ? 96.55400  148.96100 83.45100  1.000 171.67858 ? 13  DT  I C6    1 
ATOM 7569  P P     . DT  I 5 87  ? 90.45000  150.07800 84.00800  1.000 168.39201 ? 14  DT  I P     1 
ATOM 7570  O OP1   . DT  I 5 87  ? 89.04700  149.94800 83.56800  1.000 168.39201 ? 14  DT  I OP1   1 
ATOM 7571  O OP2   . DT  I 5 87  ? 90.98200  151.41900 84.32800  1.000 168.39201 ? 14  DT  I OP2   1 
ATOM 7572  O "O5'" . DT  I 5 87  ? 90.63600  149.12900 85.27000  1.000 168.39201 ? 14  DT  I "O5'" 1 
ATOM 7573  C "C5'" . DT  I 5 87  ? 90.37100  147.74500 85.14000  1.000 168.39201 ? 14  DT  I "C5'" 1 
ATOM 7574  C "C4'" . DT  I 5 87  ? 90.66900  146.98400 86.42200  1.000 168.39201 ? 14  DT  I "C4'" 1 
ATOM 7575  O "O4'" . DT  I 5 87  ? 92.09700  146.83300 86.60800  1.000 168.39201 ? 14  DT  I "O4'" 1 
ATOM 7576  C "C3'" . DT  I 5 87  ? 90.14900  147.62600 87.70000  1.000 168.39201 ? 14  DT  I "C3'" 1 
ATOM 7577  O "O3'" . DT  I 5 87  ? 89.70000  146.61900 88.55500  1.000 168.39201 ? 14  DT  I "O3'" 1 
ATOM 7578  C "C2'" . DT  I 5 87  ? 91.39800  148.29700 88.27000  1.000 168.39201 ? 14  DT  I "C2'" 1 
ATOM 7579  C "C1'" . DT  I 5 87  ? 92.45700  147.28300 87.89600  1.000 168.39201 ? 14  DT  I "C1'" 1 
ATOM 7580  N N1    . DT  I 5 87  ? 93.84400  147.80400 87.82000  1.000 168.39201 ? 14  DT  I N1    1 
ATOM 7581  C C2    . DT  I 5 87  ? 94.85500  147.05100 88.35900  1.000 168.39201 ? 14  DT  I C2    1 
ATOM 7582  O O2    . DT  I 5 87  ? 94.66800  145.98500 88.90900  1.000 168.39201 ? 14  DT  I O2    1 
ATOM 7583  N N3    . DT  I 5 87  ? 96.10100  147.57900 88.21700  1.000 168.39201 ? 14  DT  I N3    1 
ATOM 7584  C C4    . DT  I 5 87  ? 96.43800  148.76500 87.61100  1.000 168.39201 ? 14  DT  I C4    1 
ATOM 7585  O O4    . DT  I 5 87  ? 97.59400  149.15600 87.53900  1.000 168.39201 ? 14  DT  I O4    1 
ATOM 7586  C C5    . DT  I 5 87  ? 95.33900  149.51200 87.06500  1.000 168.39201 ? 14  DT  I C5    1 
ATOM 7587  C C7    . DT  I 5 87  ? 95.59800  150.82400 86.39300  1.000 168.39201 ? 14  DT  I C7    1 
ATOM 7588  C C6    . DT  I 5 87  ? 94.10200  149.00200 87.18900  1.000 168.39201 ? 14  DT  I C6    1 
ATOM 7589  P P     . DT  I 5 88  ? 88.55900  146.92100 89.63600  1.000 162.92590 ? 15  DT  I P     1 
ATOM 7590  O OP1   . DT  I 5 88  ? 87.35600  146.17300 89.21100  1.000 162.92590 ? 15  DT  I OP1   1 
ATOM 7591  O OP2   . DT  I 5 88  ? 88.47900  148.38300 89.84100  1.000 162.92590 ? 15  DT  I OP2   1 
ATOM 7592  O "O5'" . DT  I 5 88  ? 89.14700  146.24900 90.95700  1.000 162.92590 ? 15  DT  I "O5'" 1 
ATOM 7593  C "C5'" . DT  I 5 88  ? 89.80000  145.00000 90.86400  1.000 162.92590 ? 15  DT  I "C5'" 1 
ATOM 7594  C "C4'" . DT  I 5 88  ? 90.84700  144.84300 91.94800  1.000 162.92590 ? 15  DT  I "C4'" 1 
ATOM 7595  O "O4'" . DT  I 5 88  ? 92.09800  145.45500 91.54400  1.000 162.92590 ? 15  DT  I "O4'" 1 
ATOM 7596  C "C3'" . DT  I 5 88  ? 90.48500  145.46300 93.29100  1.000 162.92590 ? 15  DT  I "C3'" 1 
ATOM 7597  O "O3'" . DT  I 5 88  ? 90.79300  144.55500 94.34100  1.000 162.92590 ? 15  DT  I "O3'" 1 
ATOM 7598  C "C2'" . DT  I 5 88  ? 91.37000  146.70800 93.34800  1.000 162.92590 ? 15  DT  I "C2'" 1 
ATOM 7599  C "C1'" . DT  I 5 88  ? 92.59700  146.23100 92.60700  1.000 162.92590 ? 15  DT  I "C1'" 1 
ATOM 7600  N N1    . DT  I 5 88  ? 93.44700  147.31300 92.05700  1.000 162.92590 ? 15  DT  I N1    1 
ATOM 7601  C C2    . DT  I 5 88  ? 94.80900  147.16100 92.09500  1.000 162.92590 ? 15  DT  I C2    1 
ATOM 7602  O O2    . DT  I 5 88  ? 95.35400  146.16800 92.52900  1.000 162.92590 ? 15  DT  I O2    1 
ATOM 7603  N N3    . DT  I 5 88  ? 95.51500  148.19600 91.56700  1.000 162.92590 ? 15  DT  I N3    1 
ATOM 7604  C C4    . DT  I 5 88  ? 95.01000  149.36000 91.03700  1.000 162.92590 ? 15  DT  I C4    1 
ATOM 7605  O O4    . DT  I 5 88  ? 95.73000  150.24000 90.59200  1.000 162.92590 ? 15  DT  I O4    1 
ATOM 7606  C C5    . DT  I 5 88  ? 93.57800  149.47200 91.04700  1.000 162.92590 ? 15  DT  I C5    1 
ATOM 7607  C C7    . DT  I 5 88  ? 92.92600  150.70500 90.50300  1.000 162.92590 ? 15  DT  I C7    1 
ATOM 7608  C C6    . DT  I 5 88  ? 92.86900  148.45600 91.55800  1.000 162.92590 ? 15  DT  I C6    1 
ATOM 7609  P P     . DA  I 5 89  ? 89.68300  143.50700 94.84100  1.000 160.30510 ? 16  DA  I P     1 
ATOM 7610  O OP1   . DA  I 5 89  ? 89.44100  142.50900 93.78000  1.000 160.30510 ? 16  DA  I OP1   1 
ATOM 7611  O OP2   . DA  I 5 89  ? 88.55900  144.29700 95.37900  1.000 160.30510 ? 16  DA  I OP2   1 
ATOM 7612  O "O5'" . DA  I 5 89  ? 90.37300  142.75000 96.06100  1.000 160.30510 ? 16  DA  I "O5'" 1 
ATOM 7613  C "C5'" . DA  I 5 89  ? 91.58000  142.03500 95.86800  1.000 160.30510 ? 16  DA  I "C5'" 1 
ATOM 7614  C "C4'" . DA  I 5 89  ? 92.71500  142.61500 96.70000  1.000 160.30510 ? 16  DA  I "C4'" 1 
ATOM 7615  O "O4'" . DA  I 5 89  ? 93.09100  143.92300 96.19400  1.000 160.30510 ? 16  DA  I "O4'" 1 
ATOM 7616  C "C3'" . DA  I 5 89  ? 92.40100  142.82200 98.19300  1.000 160.30510 ? 16  DA  I "C3'" 1 
ATOM 7617  O "O3'" . DA  I 5 89  ? 93.53500  142.51800 98.98000  1.000 160.30510 ? 16  DA  I "O3'" 1 
ATOM 7618  C "C2'" . DA  I 5 89  ? 92.12600  144.31400 98.25800  1.000 160.30510 ? 16  DA  I "C2'" 1 
ATOM 7619  C "C1'" . DA  I 5 89  ? 93.17900  144.79800 97.28700  1.000 160.30510 ? 16  DA  I "C1'" 1 
ATOM 7620  N N9    . DA  I 5 89  ? 92.99700  146.16500 96.84600  1.000 160.30510 ? 16  DA  I N9    1 
ATOM 7621  C C8    . DA  I 5 89  ? 91.82700  146.85500 96.75400  1.000 160.30510 ? 16  DA  I C8    1 
ATOM 7622  N N7    . DA  I 5 89  ? 91.97500  148.08400 96.32300  1.000 160.30510 ? 16  DA  I N7    1 
ATOM 7623  C C5    . DA  I 5 89  ? 93.33600  148.19700 96.11800  1.000 160.30510 ? 16  DA  I C5    1 
ATOM 7624  C C6    . DA  I 5 89  ? 94.14100  149.25200 95.66400  1.000 160.30510 ? 16  DA  I C6    1 
ATOM 7625  N N6    . DA  I 5 89  ? 93.65700  150.44400 95.31700  1.000 160.30510 ? 16  DA  I N6    1 
ATOM 7626  N N1    . DA  I 5 89  ? 95.46800  149.03500 95.58100  1.000 160.30510 ? 16  DA  I N1    1 
ATOM 7627  C C2    . DA  I 5 89  ? 95.94900  147.84000 95.93000  1.000 160.30510 ? 16  DA  I C2    1 
ATOM 7628  N N3    . DA  I 5 89  ? 95.28900  146.77500 96.37100  1.000 160.30510 ? 16  DA  I N3    1 
ATOM 7629  C C4    . DA  I 5 89  ? 93.97700  147.02400 96.44100  1.000 160.30510 ? 16  DA  I C4    1 
ATOM 7630  P P     . DA  I 5 90  ? 93.72800  141.06700 99.63200  1.000 157.27539 ? 17  DA  I P     1 
ATOM 7631  O OP1   . DA  I 5 90  ? 93.39700  140.03500 98.63000  1.000 157.27539 ? 17  DA  I OP1   1 
ATOM 7632  O OP2   . DA  I 5 90  ? 93.02900  141.08500 100.93200 1.000 157.27539 ? 17  DA  I OP2   1 
ATOM 7633  O "O5'" . DA  I 5 90  ? 95.29300  141.01000 99.92100  1.000 157.27539 ? 17  DA  I "O5'" 1 
ATOM 7634  C "C5'" . DA  I 5 90  ? 96.19800  141.34400 98.88900  1.000 157.27539 ? 17  DA  I "C5'" 1 
ATOM 7635  C "C4'" . DA  I 5 90  ? 97.49600  141.91200 99.44000  1.000 157.27539 ? 17  DA  I "C4'" 1 
ATOM 7636  O "O4'" . DA  I 5 90  ? 97.56400  143.33300 99.17600  1.000 157.27539 ? 17  DA  I "O4'" 1 
ATOM 7637  C "C3'" . DA  I 5 90  ? 97.71300  141.75500 100.93300 1.000 157.27539 ? 17  DA  I "C3'" 1 
ATOM 7638  O "O3'" . DA  I 5 90  ? 99.10400  141.58100 101.17800 1.000 157.27539 ? 17  DA  I "O3'" 1 
ATOM 7639  C "C2'" . DA  I 5 90  ? 97.19300  143.08100 101.49500 1.000 157.27539 ? 17  DA  I "C2'" 1 
ATOM 7640  C "C1'" . DA  I 5 90  ? 97.49800  144.07100 100.37900 1.000 157.27539 ? 17  DA  I "C1'" 1 
ATOM 7641  N N9    . DA  I 5 90  ? 96.46600  145.08400 100.21300 1.000 157.27539 ? 17  DA  I N9    1 
ATOM 7642  C C8    . DA  I 5 90  ? 95.12200  144.89600 100.30400 1.000 157.27539 ? 17  DA  I C8    1 
ATOM 7643  N N7    . DA  I 5 90  ? 94.42300  145.98000 100.10100 1.000 157.27539 ? 17  DA  I N7    1 
ATOM 7644  C C5    . DA  I 5 90  ? 95.36800  146.93800 99.82300  1.000 157.27539 ? 17  DA  I C5    1 
ATOM 7645  C C6    . DA  I 5 90  ? 95.26100  148.29900 99.52000  1.000 157.27539 ? 17  DA  I C6    1 
ATOM 7646  N N6    . DA  I 5 90  ? 94.09300  148.93100 99.42400  1.000 157.27539 ? 17  DA  I N6    1 
ATOM 7647  N N1    . DA  I 5 90  ? 96.40000  148.98900 99.31500  1.000 157.27539 ? 17  DA  I N1    1 
ATOM 7648  C C2    . DA  I 5 90  ? 97.56900  148.34500 99.41200  1.000 157.27539 ? 17  DA  I C2    1 
ATOM 7649  N N3    . DA  I 5 90  ? 97.79200  147.06300 99.69700  1.000 157.27539 ? 17  DA  I N3    1 
ATOM 7650  C C4    . DA  I 5 90  ? 96.63800  146.41000 99.89100  1.000 157.27539 ? 17  DA  I C4    1 
ATOM 7651  P P     . DC  I 5 91  ? 99.68800  141.52600 102.67200 1.000 164.92534 ? 18  DC  I P     1 
ATOM 7652  O OP1   . DC  I 5 91  ? 100.92600 140.72500 102.59400 1.000 164.92534 ? 18  DC  I OP1   1 
ATOM 7653  O OP2   . DC  I 5 91  ? 98.63700  141.12200 103.62700 1.000 164.92534 ? 18  DC  I OP2   1 
ATOM 7654  O "O5'" . DC  I 5 91  ? 100.11700 143.03200 102.95500 1.000 164.92534 ? 18  DC  I "O5'" 1 
ATOM 7655  C "C5'" . DC  I 5 91  ? 100.88000 143.71800 101.99300 1.000 164.92534 ? 18  DC  I "C5'" 1 
ATOM 7656  C "C4'" . DC  I 5 91  ? 101.14500 145.14400 102.42100 1.000 164.92534 ? 18  DC  I "C4'" 1 
ATOM 7657  O "O4'" . DC  I 5 91  ? 100.02500 145.99500 102.06900 1.000 164.92534 ? 18  DC  I "O4'" 1 
ATOM 7658  C "C3'" . DC  I 5 91  ? 101.37800 145.32700 103.91600 1.000 164.92534 ? 18  DC  I "C3'" 1 
ATOM 7659  O "O3'" . DC  I 5 91  ? 102.50600 146.14100 104.11000 1.000 164.92534 ? 18  DC  I "O3'" 1 
ATOM 7660  C "C2'" . DC  I 5 91  ? 100.09800 146.01800 104.38300 1.000 164.92534 ? 18  DC  I "C2'" 1 
ATOM 7661  C "C1'" . DC  I 5 91  ? 99.72100  146.82800 103.15800 1.000 164.92534 ? 18  DC  I "C1'" 1 
ATOM 7662  N N1    . DC  I 5 91  ? 98.28200  147.18400 103.09200 1.000 164.92534 ? 18  DC  I N1    1 
ATOM 7663  C C2    . DC  I 5 91  ? 97.90600  148.50900 102.86700 1.000 164.92534 ? 18  DC  I C2    1 
ATOM 7664  O O2    . DC  I 5 91  ? 98.78100  149.36300 102.71700 1.000 164.92534 ? 18  DC  I O2    1 
ATOM 7665  N N3    . DC  I 5 91  ? 96.59100  148.81400 102.81100 1.000 164.92534 ? 18  DC  I N3    1 
ATOM 7666  C C4    . DC  I 5 91  ? 95.68200  147.85900 102.98200 1.000 164.92534 ? 18  DC  I C4    1 
ATOM 7667  N N4    . DC  I 5 91  ? 94.39500  148.19900 102.91700 1.000 164.92534 ? 18  DC  I N4    1 
ATOM 7668  C C5    . DC  I 5 91  ? 96.04800  146.50900 103.22100 1.000 164.92534 ? 18  DC  I C5    1 
ATOM 7669  C C6    . DC  I 5 91  ? 97.34500  146.22100 103.27200 1.000 164.92534 ? 18  DC  I C6    1 
ATOM 7670  P P     . DC  I 5 92  ? 103.23000 146.22000 105.54000 1.000 179.13700 ? 19  DC  I P     1 
ATOM 7671  O OP1   . DC  I 5 92  ? 104.64900 145.87100 105.32900 1.000 179.13700 ? 19  DC  I OP1   1 
ATOM 7672  O OP2   . DC  I 5 92  ? 102.44500 145.47600 106.54700 1.000 179.13700 ? 19  DC  I OP2   1 
ATOM 7673  O "O5'" . DC  I 5 92  ? 103.15400 147.76900 105.89100 1.000 179.13700 ? 19  DC  I "O5'" 1 
ATOM 7674  C "C5'" . DC  I 5 92  ? 103.51800 148.72300 104.90500 1.000 179.13700 ? 19  DC  I "C5'" 1 
ATOM 7675  C "C4'" . DC  I 5 92  ? 103.04400 150.10600 105.29300 1.000 179.13700 ? 19  DC  I "C4'" 1 
ATOM 7676  O "O4'" . DC  I 5 92  ? 101.63300 150.25000 104.99900 1.000 179.13700 ? 19  DC  I "O4'" 1 
ATOM 7677  C "C3'" . DC  I 5 92  ? 103.21800 150.43100 106.76800 1.000 179.13700 ? 19  DC  I "C3'" 1 
ATOM 7678  O "O3'" . DC  I 5 92  ? 103.78800 151.69800 106.91000 1.000 179.13700 ? 19  DC  I "O3'" 1 
ATOM 7679  C "C2'" . DC  I 5 92  ? 101.79300 150.39600 107.31800 1.000 179.13700 ? 19  DC  I "C2'" 1 
ATOM 7680  C "C1'" . DC  I 5 92  ? 100.97200 150.80600 106.10700 1.000 179.13700 ? 19  DC  I "C1'" 1 
ATOM 7681  N N1    . DC  I 5 92  ? 99.58400  150.27700 106.11600 1.000 179.13700 ? 19  DC  I N1    1 
ATOM 7682  C C2    . DC  I 5 92  ? 98.50600  151.15300 106.00600 1.000 179.13700 ? 19  DC  I C2    1 
ATOM 7683  O O2    . DC  I 5 92  ? 98.72500  152.36200 105.91700 1.000 179.13700 ? 19  DC  I O2    1 
ATOM 7684  N N3    . DC  I 5 92  ? 97.25100  150.64700 106.00600 1.000 179.13700 ? 19  DC  I N3    1 
ATOM 7685  C C4    . DC  I 5 92  ? 97.06300  149.33500 106.10800 1.000 179.13700 ? 19  DC  I C4    1 
ATOM 7686  N N4    . DC  I 5 92  ? 95.81200  148.87700 106.10300 1.000 179.13700 ? 19  DC  I N4    1 
ATOM 7687  C C5    . DC  I 5 92  ? 98.14900  148.43100 106.22400 1.000 179.13700 ? 19  DC  I C5    1 
ATOM 7688  C C6    . DC  I 5 92  ? 99.37900  148.94200 106.22100 1.000 179.13700 ? 19  DC  I C6    1 
ATOM 7689  P P     . DG  I 5 93  ? 104.57700 152.06400 108.25400 1.000 185.72663 ? 20  DG  I P     1 
ATOM 7690  O OP1   . DG  I 5 93  ? 105.81200 152.78700 107.88400 1.000 185.72663 ? 20  DG  I OP1   1 
ATOM 7691  O OP2   . DG  I 5 93  ? 104.65200 150.83300 109.06900 1.000 185.72663 ? 20  DG  I OP2   1 
ATOM 7692  O "O5'" . DG  I 5 93  ? 103.58700 153.06800 108.98500 1.000 185.72663 ? 20  DG  I "O5'" 1 
ATOM 7693  C "C5'" . DG  I 5 93  ? 102.99400 154.11200 108.25300 1.000 185.72663 ? 20  DG  I "C5'" 1 
ATOM 7694  C "C4'" . DG  I 5 93  ? 101.70200 154.52700 108.90900 1.000 185.72663 ? 20  DG  I "C4'" 1 
ATOM 7695  O "O4'" . DG  I 5 93  ? 100.63100 153.67300 108.47800 1.000 185.72663 ? 20  DG  I "O4'" 1 
ATOM 7696  C "C3'" . DG  I 5 93  ? 101.70500 154.42300 110.42700 1.000 185.72663 ? 20  DG  I "C3'" 1 
ATOM 7697  O "O3'" . DG  I 5 93  ? 101.92600 155.71300 110.99900 1.000 185.72663 ? 20  DG  I "O3'" 1 
ATOM 7698  C "C2'" . DG  I 5 93  ? 100.32200 153.86900 110.77400 1.000 185.72663 ? 20  DG  I "C2'" 1 
ATOM 7699  C "C1'" . DG  I 5 93  ? 99.61400  153.76100 109.43600 1.000 185.72663 ? 20  DG  I "C1'" 1 
ATOM 7700  N N9    . DG  I 5 93  ? 98.73200  152.60800 109.32900 1.000 185.72663 ? 20  DG  I N9    1 
ATOM 7701  C C8    . DG  I 5 93  ? 99.09200  151.29200 109.26100 1.000 185.72663 ? 20  DG  I C8    1 
ATOM 7702  N N7    . DG  I 5 93  ? 98.08000  150.48200 109.14500 1.000 185.72663 ? 20  DG  I N7    1 
ATOM 7703  C C5    . DG  I 5 93  ? 96.97800  151.32100 109.13200 1.000 185.72663 ? 20  DG  I C5    1 
ATOM 7704  C C6    . DG  I 5 93  ? 95.60600  151.01500 109.02800 1.000 185.72663 ? 20  DG  I C6    1 
ATOM 7705  O O6    . DG  I 5 93  ? 95.08000  149.90600 108.92500 1.000 185.72663 ? 20  DG  I O6    1 
ATOM 7706  N N1    . DG  I 5 93  ? 94.81900  152.15800 109.05500 1.000 185.72663 ? 20  DG  I N1    1 
ATOM 7707  C C2    . DG  I 5 93  ? 95.30000  153.43600 109.16600 1.000 185.72663 ? 20  DG  I C2    1 
ATOM 7708  N N2    . DG  I 5 93  ? 94.39100  154.41800 109.17600 1.000 185.72663 ? 20  DG  I N2    1 
ATOM 7709  N N3    . DG  I 5 93  ? 96.58700  153.73600 109.26500 1.000 185.72663 ? 20  DG  I N3    1 
ATOM 7710  C C4    . DG  I 5 93  ? 97.36400  152.63100 109.24100 1.000 185.72663 ? 20  DG  I C4    1 
ATOM 7711  P P     . DC  I 5 94  ? 102.13700 155.88500 112.58400 1.000 192.21217 ? 21  DC  I P     1 
ATOM 7712  O OP1   . DC  I 5 94  ? 102.82900 157.16900 112.80900 1.000 192.21217 ? 21  DC  I OP1   1 
ATOM 7713  O OP2   . DC  I 5 94  ? 102.73000 154.62600 113.08200 1.000 192.21217 ? 21  DC  I OP2   1 
ATOM 7714  O "O5'" . DC  I 5 94  ? 100.64900 155.97500 113.17000 1.000 192.21217 ? 21  DC  I "O5'" 1 
ATOM 7715  C "C5'" . DC  I 5 94  ? 99.74700  156.93900 112.65000 1.000 192.21217 ? 21  DC  I "C5'" 1 
ATOM 7716  C "C4'" . DC  I 5 94  ? 98.31600  156.59300 113.01300 1.000 192.21217 ? 21  DC  I "C4'" 1 
ATOM 7717  O "O4'" . DC  I 5 94  ? 97.89200  155.41600 112.30400 1.000 192.21217 ? 21  DC  I "O4'" 1 
ATOM 7718  C "C3'" . DC  I 5 94  ? 98.07700  156.25100 114.47100 1.000 192.21217 ? 21  DC  I "C3'" 1 
ATOM 7719  O "O3'" . DC  I 5 94  ? 97.76700  157.44000 115.20600 1.000 192.21217 ? 21  DC  I "O3'" 1 
ATOM 7720  C "C2'" . DC  I 5 94  ? 96.88100  155.29900 114.41600 1.000 192.21217 ? 21  DC  I "C2'" 1 
ATOM 7721  C "C1'" . DC  I 5 94  ? 96.74300  154.92700 112.94700 1.000 192.21217 ? 21  DC  I "C1'" 1 
ATOM 7722  N N1    . DC  I 5 94  ? 96.61100  153.46900 112.73300 1.000 192.21217 ? 21  DC  I N1    1 
ATOM 7723  C C2    . DC  I 5 94  ? 95.34000  152.91100 112.61500 1.000 192.21217 ? 21  DC  I C2    1 
ATOM 7724  O O2    . DC  I 5 94  ? 94.35500  153.65400 112.64800 1.000 192.21217 ? 21  DC  I O2    1 
ATOM 7725  N N3    . DC  I 5 94  ? 95.22800  151.57700 112.43600 1.000 192.21217 ? 21  DC  I N3    1 
ATOM 7726  C C4    . DC  I 5 94  ? 96.32000  150.81800 112.40500 1.000 192.21217 ? 21  DC  I C4    1 
ATOM 7727  N N4    . DC  I 5 94  ? 96.16600  149.50700 112.23100 1.000 192.21217 ? 21  DC  I N4    1 
ATOM 7728  C C5    . DC  I 5 94  ? 97.62000  151.36900 112.54800 1.000 192.21217 ? 21  DC  I C5    1 
ATOM 7729  C C6    . DC  I 5 94  ? 97.71200  152.68300 112.72800 1.000 192.21217 ? 21  DC  I C6    1 
ATOM 7730  P P     . DC  I 5 95  ? 97.65800  157.41400 116.81200 1.000 193.44629 ? 22  DC  I P     1 
ATOM 7731  O OP1   . DC  I 5 95  ? 97.77000  158.80600 117.29700 1.000 193.44629 ? 22  DC  I OP1   1 
ATOM 7732  O OP2   . DC  I 5 95  ? 98.60300  156.38400 117.29200 1.000 193.44629 ? 22  DC  I OP2   1 
ATOM 7733  O "O5'" . DC  I 5 95  ? 96.17500  156.88800 117.11500 1.000 193.44629 ? 22  DC  I "O5'" 1 
ATOM 7734  C "C5'" . DC  I 5 95  ? 95.04600  157.55200 116.55300 1.000 193.44629 ? 22  DC  I "C5'" 1 
ATOM 7735  C "C4'" . DC  I 5 95  ? 93.81400  156.67500 116.65600 1.000 193.44629 ? 22  DC  I "C4'" 1 
ATOM 7736  O "O4'" . DC  I 5 95  ? 94.04500  155.43400 115.96400 1.000 193.44629 ? 22  DC  I "O4'" 1 
ATOM 7737  C "C3'" . DC  I 5 95  ? 93.44200  156.27800 118.07500 1.000 193.44629 ? 22  DC  I "C3'" 1 
ATOM 7738  O "O3'" . DC  I 5 95  ? 92.35700  157.06900 118.52700 1.000 193.44629 ? 22  DC  I "O3'" 1 
ATOM 7739  C "C2'" . DC  I 5 95  ? 93.04900  154.79700 117.97100 1.000 193.44629 ? 22  DC  I "C2'" 1 
ATOM 7740  C "C1'" . DC  I 5 95  ? 93.18700  154.46400 116.49300 1.000 193.44629 ? 22  DC  I "C1'" 1 
ATOM 7741  N N1    . DC  I 5 95  ? 93.77400  153.11400 116.25900 1.000 193.44629 ? 22  DC  I N1    1 
ATOM 7742  C C2    . DC  I 5 95  ? 92.93300  152.02100 116.05100 1.000 193.44629 ? 22  DC  I C2    1 
ATOM 7743  O O2    . DC  I 5 95  ? 91.71300  152.19800 116.02300 1.000 193.44629 ? 22  DC  I O2    1 
ATOM 7744  N N3    . DC  I 5 95  ? 93.48300  150.79800 115.85400 1.000 193.44629 ? 22  DC  I N3    1 
ATOM 7745  C C4    . DC  I 5 95  ? 94.80700  150.65100 115.88300 1.000 193.44629 ? 22  DC  I C4    1 
ATOM 7746  N N4    . DC  I 5 95  ? 95.30800  149.43000 115.69000 1.000 193.44629 ? 22  DC  I N4    1 
ATOM 7747  C C5    . DC  I 5 95  ? 95.67700  151.75100 116.11500 1.000 193.44629 ? 22  DC  I C5    1 
ATOM 7748  C C6    . DC  I 5 95  ? 95.12100  152.94700 116.31100 1.000 193.44629 ? 22  DC  I C6    1 
ATOM 7749  P P     . DA  I 5 96  ? 91.92000  157.04200 120.07300 1.000 187.03524 ? 23  DA  I P     1 
ATOM 7750  O OP1   . DA  I 5 96  ? 91.17300  158.28700 120.34600 1.000 187.03524 ? 23  DA  I OP1   1 
ATOM 7751  O OP2   . DA  I 5 96  ? 93.11900  156.70600 120.86700 1.000 187.03524 ? 23  DA  I OP2   1 
ATOM 7752  O "O5'" . DA  I 5 96  ? 90.91200  155.80900 120.17300 1.000 187.03524 ? 23  DA  I "O5'" 1 
ATOM 7753  C "C5'" . DA  I 5 96  ? 89.78400  155.75600 119.32600 1.000 187.03524 ? 23  DA  I "C5'" 1 
ATOM 7754  C "C4'" . DA  I 5 96  ? 89.03500  154.45900 119.52300 1.000 187.03524 ? 23  DA  I "C4'" 1 
ATOM 7755  O "O4'" . DA  I 5 96  ? 89.75900  153.36700 118.90800 1.000 187.03524 ? 23  DA  I "O4'" 1 
ATOM 7756  C "C3'" . DA  I 5 96  ? 88.81400  154.06700 120.97800 1.000 187.03524 ? 23  DA  I "C3'" 1 
ATOM 7757  O "O3'" . DA  I 5 96  ? 87.44300  153.85200 121.19500 1.000 187.03524 ? 23  DA  I "O3'" 1 
ATOM 7758  C "C2'" . DA  I 5 96  ? 89.62700  152.78400 121.15800 1.000 187.03524 ? 23  DA  I "C2'" 1 
ATOM 7759  C "C1'" . DA  I 5 96  ? 89.70900  152.23900 119.74700 1.000 187.03524 ? 23  DA  I "C1'" 1 
ATOM 7760  N N9    . DA  I 5 96  ? 90.89900  151.43400 119.50400 1.000 187.03524 ? 23  DA  I N9    1 
ATOM 7761  C C8    . DA  I 5 96  ? 92.18900  151.86400 119.50300 1.000 187.03524 ? 23  DA  I C8    1 
ATOM 7762  N N7    . DA  I 5 96  ? 93.06000  150.93400 119.22300 1.000 187.03524 ? 23  DA  I N7    1 
ATOM 7763  C C5    . DA  I 5 96  ? 92.28600  149.81800 119.00900 1.000 187.03524 ? 23  DA  I C5    1 
ATOM 7764  C C6    . DA  I 5 96  ? 92.61300  148.50600 118.67100 1.000 187.03524 ? 23  DA  I C6    1 
ATOM 7765  N N6    . DA  I 5 96  ? 93.86500  148.09800 118.49500 1.000 187.03524 ? 23  DA  I N6    1 
ATOM 7766  N N1    . DA  I 5 96  ? 91.60600  147.62100 118.53300 1.000 187.03524 ? 23  DA  I N1    1 
ATOM 7767  C C2    . DA  I 5 96  ? 90.34900  148.03900 118.71200 1.000 187.03524 ? 23  DA  I C2    1 
ATOM 7768  N N3    . DA  I 5 96  ? 89.91800  149.25600 119.03600 1.000 187.03524 ? 23  DA  I N3    1 
ATOM 7769  C C4    . DA  I 5 96  ? 90.94800  150.10500 119.16900 1.000 187.03524 ? 23  DA  I C4    1 
ATOM 7770  P P     . DA  I 5 97  ? 86.87300  153.65700 122.68000 1.000 181.34051 ? 24  DA  I P     1 
ATOM 7771  O OP1   . DA  I 5 97  ? 85.56900  154.35000 122.74100 1.000 181.34051 ? 24  DA  I OP1   1 
ATOM 7772  O OP2   . DA  I 5 97  ? 87.92700  154.00600 123.65700 1.000 181.34051 ? 24  DA  I OP2   1 
ATOM 7773  O "O5'" . DA  I 5 97  ? 86.61800  152.08800 122.75600 1.000 181.34051 ? 24  DA  I "O5'" 1 
ATOM 7774  C "C5'" . DA  I 5 97  ? 85.82400  151.46400 121.76000 1.000 181.34051 ? 24  DA  I "C5'" 1 
ATOM 7775  C "C4'" . DA  I 5 97  ? 85.76500  149.96400 121.96900 1.000 181.34051 ? 24  DA  I "C4'" 1 
ATOM 7776  O "O4'" . DA  I 5 97  ? 86.99100  149.34500 121.50500 1.000 181.34051 ? 24  DA  I "O4'" 1 
ATOM 7777  C "C3'" . DA  I 5 97  ? 85.58400  149.53400 123.41600 1.000 181.34051 ? 24  DA  I "C3'" 1 
ATOM 7778  O "O3'" . DA  I 5 97  ? 84.63800  148.50900 123.48000 1.000 181.34051 ? 24  DA  I "O3'" 1 
ATOM 7779  C "C2'" . DA  I 5 97  ? 86.97500  149.03800 123.81400 1.000 181.34051 ? 24  DA  I "C2'" 1 
ATOM 7780  C "C1'" . DA  I 5 97  ? 87.51200  148.49900 122.50200 1.000 181.34051 ? 24  DA  I "C1'" 1 
ATOM 7781  N N9    . DA  I 5 97  ? 88.96400  148.55900 122.40300 1.000 181.34051 ? 24  DA  I N9    1 
ATOM 7782  C C8    . DA  I 5 97  ? 89.75000  149.65500 122.58700 1.000 181.34051 ? 24  DA  I C8    1 
ATOM 7783  N N7    . DA  I 5 97  ? 91.02600  149.43300 122.40600 1.000 181.34051 ? 24  DA  I N7    1 
ATOM 7784  C C5    . DA  I 5 97  ? 91.08000  148.09800 122.07200 1.000 181.34051 ? 24  DA  I C5    1 
ATOM 7785  C C6    . DA  I 5 97  ? 92.14800  147.24800 121.75100 1.000 181.34051 ? 24  DA  I C6    1 
ATOM 7786  N N6    . DA  I 5 97  ? 93.41700  147.65000 121.73200 1.000 181.34051 ? 24  DA  I N6    1 
ATOM 7787  N N1    . DA  I 5 97  ? 91.86200  145.96200 121.46200 1.000 181.34051 ? 24  DA  I N1    1 
ATOM 7788  C C2    . DA  I 5 97  ? 90.58700  145.56600 121.48500 1.000 181.34051 ? 24  DA  I C2    1 
ATOM 7789  N N3    . DA  I 5 97  ? 89.49700  146.27600 121.77100 1.000 181.34051 ? 24  DA  I N3    1 
ATOM 7790  C C4    . DA  I 5 97  ? 89.81600  147.54300 122.05700 1.000 181.34051 ? 24  DA  I C4    1 
ATOM 7791  P P     . DG  I 5 98  ? 83.95600  148.12200 124.87700 1.000 175.14055 ? 25  DG  I P     1 
ATOM 7792  O OP1   . DG  I 5 98  ? 82.49500  148.10000 124.65900 1.000 175.14055 ? 25  DG  I OP1   1 
ATOM 7793  O OP2   . DG  I 5 98  ? 84.51700  148.97400 125.94700 1.000 175.14055 ? 25  DG  I OP2   1 
ATOM 7794  O "O5'" . DG  I 5 98  ? 84.46300  146.63300 125.10500 1.000 175.14055 ? 25  DG  I "O5'" 1 
ATOM 7795  C "C5'" . DG  I 5 98  ? 84.39000  145.71600 124.03700 1.000 175.14055 ? 25  DG  I "C5'" 1 
ATOM 7796  C "C4'" . DG  I 5 98  ? 85.36200  144.56400 124.21400 1.000 175.14055 ? 25  DG  I "C4'" 1 
ATOM 7797  O "O4'" . DG  I 5 98  ? 86.72300  145.01200 123.96200 1.000 175.14055 ? 25  DG  I "O4'" 1 
ATOM 7798  C "C3'" . DG  I 5 98  ? 85.39000  143.93300 125.61100 1.000 175.14055 ? 25  DG  I "C3'" 1 
ATOM 7799  O "O3'" . DG  I 5 98  ? 85.55800  142.53400 125.48400 1.000 175.14055 ? 25  DG  I "O3'" 1 
ATOM 7800  C "C2'" . DG  I 5 98  ? 86.64300  144.55700 126.21300 1.000 175.14055 ? 25  DG  I "C2'" 1 
ATOM 7801  C "C1'" . DG  I 5 98  ? 87.53800  144.52800 124.99600 1.000 175.14055 ? 25  DG  I "C1'" 1 
ATOM 7802  N N9    . DG  I 5 98  ? 88.73800  145.34700 125.09700 1.000 175.14055 ? 25  DG  I N9    1 
ATOM 7803  C C8    . DG  I 5 98  ? 88.82600  146.66000 125.46900 1.000 175.14055 ? 25  DG  I C8    1 
ATOM 7804  N N7    . DG  I 5 98  ? 90.04400  147.12800 125.43900 1.000 175.14055 ? 25  DG  I N7    1 
ATOM 7805  C C5    . DG  I 5 98  ? 90.80500  146.05600 125.00300 1.000 175.14055 ? 25  DG  I C5    1 
ATOM 7806  C C6    . DG  I 5 98  ? 92.19700  145.95400 124.77900 1.000 175.14055 ? 25  DG  I C6    1 
ATOM 7807  O O6    . DG  I 5 98  ? 93.06400  146.82300 124.91100 1.000 175.14055 ? 25  DG  I O6    1 
ATOM 7808  N N1    . DG  I 5 98  ? 92.55500  144.68700 124.33600 1.000 175.14055 ? 25  DG  I N1    1 
ATOM 7809  C C2    . DG  I 5 98  ? 91.68100  143.65100 124.14400 1.000 175.14055 ? 25  DG  I C2    1 
ATOM 7810  N N2    . DG  I 5 98  ? 92.20200  142.50100 123.70700 1.000 175.14055 ? 25  DG  I N2    1 
ATOM 7811  N N3    . DG  I 5 98  ? 90.37800  143.73300 124.35600 1.000 175.14055 ? 25  DG  I N3    1 
ATOM 7812  C C4    . DG  I 5 98  ? 90.01400  144.95700 124.78700 1.000 175.14055 ? 25  DG  I C4    1 
ATOM 7813  P P     . DG  I 5 99  ? 84.30900  141.53800 125.28600 1.000 169.48852 ? 26  DG  I P     1 
ATOM 7814  O OP1   . DG  I 5 99  ? 83.29900  142.09100 124.36000 1.000 169.48852 ? 26  DG  I OP1   1 
ATOM 7815  O OP2   . DG  I 5 99  ? 83.88400  141.12700 126.64000 1.000 169.48852 ? 26  DG  I OP2   1 
ATOM 7816  O "O5'" . DG  I 5 99  ? 84.99000  140.26900 124.60000 1.000 169.48852 ? 26  DG  I "O5'" 1 
ATOM 7817  C "C5'" . DG  I 5 99  ? 86.25900  140.42700 123.96300 1.000 169.48852 ? 26  DG  I "C5'" 1 
ATOM 7818  C "C4'" . DG  I 5 99  ? 87.02000  139.11600 123.90200 1.000 169.48852 ? 26  DG  I "C4'" 1 
ATOM 7819  O "O4'" . DG  I 5 99  ? 88.40000  139.31700 124.27700 1.000 169.48852 ? 26  DG  I "O4'" 1 
ATOM 7820  C "C3'" . DG  I 5 99  ? 86.55700  138.05500 124.85500 1.000 169.48852 ? 26  DG  I "C3'" 1 
ATOM 7821  O "O3'" . DG  I 5 99  ? 87.08900  136.82300 124.42200 1.000 169.48852 ? 26  DG  I "O3'" 1 
ATOM 7822  C "C2'" . DG  I 5 99  ? 87.21300  138.51400 126.15400 1.000 169.48852 ? 26  DG  I "C2'" 1 
ATOM 7823  C "C1'" . DG  I 5 99  ? 88.55300  139.06400 125.66600 1.000 169.48852 ? 26  DG  I "C1'" 1 
ATOM 7824  N N9    . DG  I 5 99  ? 88.95500  140.30900 126.29100 1.000 169.48852 ? 26  DG  I N9    1 
ATOM 7825  C C8    . DG  I 5 99  ? 88.13800  141.28300 126.78500 1.000 169.48852 ? 26  DG  I C8    1 
ATOM 7826  N N7    . DG  I 5 99  ? 88.78400  142.30700 127.25100 1.000 169.48852 ? 26  DG  I N7    1 
ATOM 7827  C C5    . DG  I 5 99  ? 90.10900  142.00900 127.02400 1.000 169.48852 ? 26  DG  I C5    1 
ATOM 7828  C C6    . DG  I 5 99  ? 91.26400  142.75600 127.31700 1.000 169.48852 ? 26  DG  I C6    1 
ATOM 7829  O O6    . DG  I 5 99  ? 91.34600  143.87200 127.84200 1.000 169.48852 ? 26  DG  I O6    1 
ATOM 7830  N N1    . DG  I 5 99  ? 92.41100  142.09200 126.92900 1.000 169.48852 ? 26  DG  I N1    1 
ATOM 7831  C C2    . DG  I 5 99  ? 92.44400  140.86100 126.33200 1.000 169.48852 ? 26  DG  I C2    1 
ATOM 7832  N N2    . DG  I 5 99  ? 93.65800  140.38300 126.03700 1.000 169.48852 ? 26  DG  I N2    1 
ATOM 7833  N N3    . DG  I 5 99  ? 91.36600  140.14500 126.05600 1.000 169.48852 ? 26  DG  I N3    1 
ATOM 7834  C C4    . DG  I 5 99  ? 90.23600  140.78400 126.42700 1.000 169.48852 ? 26  DG  I C4    1 
ATOM 7835  P P     . DG  I 5 100 ? 86.67000  135.44000 125.11600 1.000 166.53042 ? 27  DG  I P     1 
ATOM 7836  O OP1   . DG  I 5 100 ? 86.35900  134.51100 124.01000 1.000 166.53042 ? 27  DG  I OP1   1 
ATOM 7837  O OP2   . DG  I 5 100 ? 85.65600  135.67600 126.16600 1.000 166.53042 ? 27  DG  I OP2   1 
ATOM 7838  O "O5'" . DG  I 5 100 ? 88.02800  134.95100 125.79800 1.000 166.53042 ? 27  DG  I "O5'" 1 
ATOM 7839  C "C5'" . DG  I 5 100 ? 89.22800  134.92100 125.04000 1.000 166.53042 ? 27  DG  I "C5'" 1 
ATOM 7840  C "C4'" . DG  I 5 100 ? 90.47600  135.04400 125.91100 1.000 166.53042 ? 27  DG  I "C4'" 1 
ATOM 7841  O "O4'" . DG  I 5 100 ? 90.56400  136.36500 126.51700 1.000 166.53042 ? 27  DG  I "O4'" 1 
ATOM 7842  C "C3'" . DG  I 5 100 ? 90.57000  134.05300 127.08000 1.000 166.53042 ? 27  DG  I "C3'" 1 
ATOM 7843  O "O3'" . DG  I 5 100 ? 91.92300  133.68200 127.29900 1.000 166.53042 ? 27  DG  I "O3'" 1 
ATOM 7844  C "C2'" . DG  I 5 100 ? 90.07200  134.89200 128.25000 1.000 166.53042 ? 27  DG  I "C2'" 1 
ATOM 7845  C "C1'" . DG  I 5 100 ? 90.73000  136.21300 127.91300 1.000 166.53042 ? 27  DG  I "C1'" 1 
ATOM 7846  N N9    . DG  I 5 100 ? 90.17900  137.37000 128.60200 1.000 166.53042 ? 27  DG  I N9    1 
ATOM 7847  C C8    . DG  I 5 100 ? 88.87700  137.58600 128.95400 1.000 166.53042 ? 27  DG  I C8    1 
ATOM 7848  N N7    . DG  I 5 100 ? 88.68100  138.73200 129.53700 1.000 166.53042 ? 27  DG  I N7    1 
ATOM 7849  C C5    . DG  I 5 100 ? 89.93900  139.30200 129.58800 1.000 166.53042 ? 27  DG  I C5    1 
ATOM 7850  C C6    . DG  I 5 100 ? 90.35400  140.53800 130.11900 1.000 166.53042 ? 27  DG  I C6    1 
ATOM 7851  O O6    . DG  I 5 100 ? 89.66800  141.40700 130.67000 1.000 166.53042 ? 27  DG  I O6    1 
ATOM 7852  N N1    . DG  I 5 100 ? 91.71900  140.72700 129.96600 1.000 166.53042 ? 27  DG  I N1    1 
ATOM 7853  C C2    . DG  I 5 100 ? 92.57500  139.82700 129.38500 1.000 166.53042 ? 27  DG  I C2    1 
ATOM 7854  N N2    . DG  I 5 100 ? 93.86200  140.18600 129.31400 1.000 166.53042 ? 27  DG  I N2    1 
ATOM 7855  N N3    . DG  I 5 100 ? 92.19400  138.67400 128.87200 1.000 166.53042 ? 27  DG  I N3    1 
ATOM 7856  C C4    . DG  I 5 100 ? 90.87000  138.47600 129.01600 1.000 166.53042 ? 27  DG  I C4    1 
ATOM 7857  P P     . DG  I 5 101 ? 92.61400  132.47800 126.49300 1.000 160.39793 ? 28  DG  I P     1 
ATOM 7858  O OP1   . DG  I 5 101 ? 92.12500  132.37700 125.11100 1.000 160.39793 ? 28  DG  I OP1   1 
ATOM 7859  O OP2   . DG  I 5 101 ? 92.46800  131.29400 127.35800 1.000 160.39793 ? 28  DG  I OP2   1 
ATOM 7860  O "O5'" . DG  I 5 101 ? 94.16000  132.86100 126.53500 1.000 160.39793 ? 28  DG  I "O5'" 1 
ATOM 7861  C "C5'" . DG  I 5 101 ? 94.55200  134.22700 126.43000 1.000 160.39793 ? 28  DG  I "C5'" 1 
ATOM 7862  C "C4'" . DG  I 5 101 ? 95.99800  134.42900 126.86900 1.000 160.39793 ? 28  DG  I "C4'" 1 
ATOM 7863  O "O4'" . DG  I 5 101 ? 96.07000  135.44300 127.89300 1.000 160.39793 ? 28  DG  I "O4'" 1 
ATOM 7864  C "C3'" . DG  I 5 101 ? 96.66500  133.23100 127.50500 1.000 160.39793 ? 28  DG  I "C3'" 1 
ATOM 7865  O "O3'" . DG  I 5 101 ? 98.08500  133.38100 127.40300 1.000 160.39793 ? 28  DG  I "O3'" 1 
ATOM 7866  C "C2'" . DG  I 5 101 ? 96.18600  133.32800 128.95900 1.000 160.39793 ? 28  DG  I "C2'" 1 
ATOM 7867  C "C1'" . DG  I 5 101 ? 96.02700  134.83300 129.17300 1.000 160.39793 ? 28  DG  I "C1'" 1 
ATOM 7868  N N9    . DG  I 5 101 ? 94.77600  135.21100 129.81500 1.000 160.39793 ? 28  DG  I N9    1 
ATOM 7869  C C8    . DG  I 5 101 ? 93.58500  134.54800 129.75300 1.000 160.39793 ? 28  DG  I C8    1 
ATOM 7870  N N7    . DG  I 5 101 ? 92.63000  135.13600 130.40600 1.000 160.39793 ? 28  DG  I N7    1 
ATOM 7871  C C5    . DG  I 5 101 ? 93.21700  136.27400 130.91400 1.000 160.39793 ? 28  DG  I C5    1 
ATOM 7872  C C6    . DG  I 5 101 ? 92.66400  137.30100 131.70100 1.000 160.39793 ? 28  DG  I C6    1 
ATOM 7873  O O6    . DG  I 5 101 ? 91.50500  137.40900 132.11200 1.000 160.39793 ? 28  DG  I O6    1 
ATOM 7874  N N1    . DG  I 5 101 ? 93.60600  138.26500 132.01800 1.000 160.39793 ? 28  DG  I N1    1 
ATOM 7875  C C2    . DG  I 5 101 ? 94.91800  138.23800 131.61800 1.000 160.39793 ? 28  DG  I C2    1 
ATOM 7876  N N2    . DG  I 5 101 ? 95.68400  139.26100 132.01600 1.000 160.39793 ? 28  DG  I N2    1 
ATOM 7877  N N3    . DG  I 5 101 ? 95.44600  137.28100 130.87600 1.000 160.39793 ? 28  DG  I N3    1 
ATOM 7878  C C4    . DG  I 5 101 ? 94.54000  136.33600 130.56300 1.000 160.39793 ? 28  DG  I C4    1 
ATOM 7879  P P     . DA  I 5 102 ? 99.09300  132.41000 128.19600 1.000 165.01463 ? 29  DA  I P     1 
ATOM 7880  O OP1   . DA  I 5 102 ? 100.36300 132.48500 127.44800 1.000 165.01463 ? 29  DA  I OP1   1 
ATOM 7881  O OP2   . DA  I 5 102 ? 98.45900  131.09100 128.41400 1.000 165.01463 ? 29  DA  I OP2   1 
ATOM 7882  O "O5'" . DA  I 5 102 ? 99.33000  133.12800 129.60700 1.000 165.01463 ? 29  DA  I "O5'" 1 
ATOM 7883  C "C5'" . DA  I 5 102 ? 99.73700  134.48100 129.64200 1.000 165.01463 ? 29  DA  I "C5'" 1 
ATOM 7884  C "C4'" . DA  I 5 102 ? 99.85100  135.00200 131.06700 1.000 165.01463 ? 29  DA  I "C4'" 1 
ATOM 7885  O "O4'" . DA  I 5 102 ? 98.55200  135.41500 131.56600 1.000 165.01463 ? 29  DA  I "O4'" 1 
ATOM 7886  C "C3'" . DA  I 5 102 ? 100.40900 134.01900 132.09300 1.000 165.01463 ? 29  DA  I "C3'" 1 
ATOM 7887  O "O3'" . DA  I 5 102 ? 101.31100 134.69900 132.92800 1.000 165.01463 ? 29  DA  I "O3'" 1 
ATOM 7888  C "C2'" . DA  I 5 102 ? 99.16500  133.57600 132.86300 1.000 165.01463 ? 29  DA  I "C2'" 1 
ATOM 7889  C "C1'" . DA  I 5 102 ? 98.31900  134.83300 132.82800 1.000 165.01463 ? 29  DA  I "C1'" 1 
ATOM 7890  N N9    . DA  I 5 102 ? 96.89100  134.58700 132.96400 1.000 165.01463 ? 29  DA  I N9    1 
ATOM 7891  C C8    . DA  I 5 102 ? 96.17200  133.57800 132.40400 1.000 165.01463 ? 29  DA  I C8    1 
ATOM 7892  N N7    . DA  I 5 102 ? 94.89600  133.61600 132.68500 1.000 165.01463 ? 29  DA  I N7    1 
ATOM 7893  C C5    . DA  I 5 102 ? 94.77000  134.73200 133.48000 1.000 165.01463 ? 29  DA  I C5    1 
ATOM 7894  C C6    . DA  I 5 102 ? 93.66800  135.32100 134.11200 1.000 165.01463 ? 29  DA  I C6    1 
ATOM 7895  N N6    . DA  I 5 102 ? 92.42800  134.84000 134.02200 1.000 165.01463 ? 29  DA  I N6    1 
ATOM 7896  N N1    . DA  I 5 102 ? 93.88300  136.44100 134.82800 1.000 165.01463 ? 29  DA  I N1    1 
ATOM 7897  C C2    . DA  I 5 102 ? 95.12400  136.92600 134.91200 1.000 165.01463 ? 29  DA  I C2    1 
ATOM 7898  N N3    . DA  I 5 102 ? 96.23900  136.45400 134.36800 1.000 165.01463 ? 29  DA  I N3    1 
ATOM 7899  C C4    . DA  I 5 102 ? 95.98900  135.34700 133.65700 1.000 165.01463 ? 29  DA  I C4    1 
ATOM 7900  P P     . DT  I 5 103 ? 102.38200 133.89800 133.81400 1.000 168.35916 ? 30  DT  I P     1 
ATOM 7901  O OP1   . DT  I 5 103 ? 103.72000 134.41000 133.45200 1.000 168.35916 ? 30  DT  I OP1   1 
ATOM 7902  O OP2   . DT  I 5 103 ? 102.10900 132.44900 133.72000 1.000 168.35916 ? 30  DT  I OP2   1 
ATOM 7903  O "O5'" . DT  I 5 103 ? 102.03600 134.37100 135.29700 1.000 168.35916 ? 30  DT  I "O5'" 1 
ATOM 7904  C "C5'" . DT  I 5 103 ? 101.84200 135.75100 135.55000 1.000 168.35916 ? 30  DT  I "C5'" 1 
ATOM 7905  C "C4'" . DT  I 5 103 ? 100.95300 135.96400 136.75500 1.000 168.35916 ? 30  DT  I "C4'" 1 
ATOM 7906  O "O4'" . DT  I 5 103 ? 99.58100  135.67800 136.41500 1.000 168.35916 ? 30  DT  I "O4'" 1 
ATOM 7907  C "C3'" . DT  I 5 103 ? 101.28100 135.07900 137.95500 1.000 168.35916 ? 30  DT  I "C3'" 1 
ATOM 7908  O "O3'" . DT  I 5 103 ? 101.81000 135.87400 138.99500 1.000 168.35916 ? 30  DT  I "O3'" 1 
ATOM 7909  C "C2'" . DT  I 5 103 ? 99.93600  134.44700 138.34800 1.000 168.35916 ? 30  DT  I "C2'" 1 
ATOM 7910  C "C1'" . DT  I 5 103 ? 98.92800  135.28400 137.58500 1.000 168.35916 ? 30  DT  I "C1'" 1 
ATOM 7911  N N1    . DT  I 5 103 ? 97.70600  134.54300 137.22800 1.000 168.35916 ? 30  DT  I N1    1 
ATOM 7912  C C2    . DT  I 5 103 ? 96.51300  134.93900 137.76100 1.000 168.35916 ? 30  DT  I C2    1 
ATOM 7913  O O2    . DT  I 5 103 ? 96.40400  135.88400 138.51300 1.000 168.35916 ? 30  DT  I O2    1 
ATOM 7914  N N3    . DT  I 5 103 ? 95.44200  134.19100 137.38300 1.000 168.35916 ? 30  DT  I N3    1 
ATOM 7915  C C4    . DT  I 5 103 ? 95.44200  133.10700 136.54300 1.000 168.35916 ? 30  DT  I C4    1 
ATOM 7916  O O4    . DT  I 5 103 ? 94.41700  132.49800 136.26400 1.000 168.35916 ? 30  DT  I O4    1 
ATOM 7917  C C5    . DT  I 5 103 ? 96.73000  132.73800 136.01900 1.000 168.35916 ? 30  DT  I C5    1 
ATOM 7918  C C7    . DT  I 5 103 ? 96.85900  131.56500 135.10200 1.000 168.35916 ? 30  DT  I C7    1 
ATOM 7919  C C6    . DT  I 5 103 ? 97.78900  133.47000 136.38000 1.000 168.35916 ? 30  DT  I C6    1 
ATOM 7920  P P     . DT  I 5 104 ? 102.32400 135.20200 140.35900 1.000 173.30451 ? 31  DT  I P     1 
ATOM 7921  O OP1   . DT  I 5 104 ? 103.37300 136.08500 140.91200 1.000 173.30451 ? 31  DT  I OP1   1 
ATOM 7922  O OP2   . DT  I 5 104 ? 102.62100 133.77600 140.11300 1.000 173.30451 ? 31  DT  I OP2   1 
ATOM 7923  O "O5'" . DT  I 5 104 ? 101.05200 135.27300 141.31500 1.000 173.30451 ? 31  DT  I "O5'" 1 
ATOM 7924  C "C5'" . DT  I 5 104 ? 100.36100 136.49600 141.46300 1.000 173.30451 ? 31  DT  I "C5'" 1 
ATOM 7925  C "C4'" . DT  I 5 104 ? 99.20300  136.33100 142.41800 1.000 173.30451 ? 31  DT  I "C4'" 1 
ATOM 7926  O "O4'" . DT  I 5 104 ? 98.09500  135.69000 141.74900 1.000 173.30451 ? 31  DT  I "O4'" 1 
ATOM 7927  C "C3'" . DT  I 5 104 ? 99.51600  135.48200 143.64400 1.000 173.30451 ? 31  DT  I "C3'" 1 
ATOM 7928  O "O3'" . DT  I 5 104 ? 99.09300  136.15600 144.80000 1.000 173.30451 ? 31  DT  I "O3'" 1 
ATOM 7929  C "C2'" . DT  I 5 104 ? 98.72000  134.20100 143.41800 1.000 173.30451 ? 31  DT  I "C2'" 1 
ATOM 7930  C "C1'" . DT  I 5 104 ? 97.55800  134.70500 142.59200 1.000 173.30451 ? 31  DT  I "C1'" 1 
ATOM 7931  N N1    . DT  I 5 104 ? 96.93600  133.67400 141.75100 1.000 173.30451 ? 31  DT  I N1    1 
ATOM 7932  C C2    . DT  I 5 104 ? 95.58900  133.46200 141.84900 1.000 173.30451 ? 31  DT  I C2    1 
ATOM 7933  O O2    . DT  I 5 104 ? 94.87000  134.08200 142.60800 1.000 173.30451 ? 31  DT  I O2    1 
ATOM 7934  N N3    . DT  I 5 104 ? 95.10300  132.49600 141.02500 1.000 173.30451 ? 31  DT  I N3    1 
ATOM 7935  C C4    . DT  I 5 104 ? 95.81800  131.73600 140.12900 1.000 173.30451 ? 31  DT  I C4    1 
ATOM 7936  O O4    . DT  I 5 104 ? 95.29100  130.88600 139.42700 1.000 173.30451 ? 31  DT  I O4    1 
ATOM 7937  C C5    . DT  I 5 104 ? 97.22800  132.01100 140.07500 1.000 173.30451 ? 31  DT  I C5    1 
ATOM 7938  C C7    . DT  I 5 104 ? 98.10600  131.24200 139.14300 1.000 173.30451 ? 31  DT  I C7    1 
ATOM 7939  C C6    . DT  I 5 104 ? 97.71300  132.95800 140.87800 1.000 173.30451 ? 31  DT  I C6    1 
ATOM 7940  P P     . DA  I 5 105 ? 99.64300  135.70600 146.23700 1.000 170.52931 ? 32  DA  I P     1 
ATOM 7941  O OP1   . DA  I 5 105 ? 99.99200  136.93700 146.97600 1.000 170.52931 ? 32  DA  I OP1   1 
ATOM 7942  O OP2   . DA  I 5 105 ? 100.67000 134.66100 146.03700 1.000 170.52931 ? 32  DA  I OP2   1 
ATOM 7943  O "O5'" . DA  I 5 105 ? 98.37000  135.03700 146.92500 1.000 170.52931 ? 32  DA  I "O5'" 1 
ATOM 7944  C "C5'" . DA  I 5 105 ? 97.14700  135.74500 146.97500 1.000 170.52931 ? 32  DA  I "C5'" 1 
ATOM 7945  C "C4'" . DA  I 5 105 ? 95.99800  134.80200 147.25500 1.000 170.52931 ? 32  DA  I "C4'" 1 
ATOM 7946  O "O4'" . DA  I 5 105 ? 95.68700  134.03000 146.07900 1.000 170.52931 ? 32  DA  I "O4'" 1 
ATOM 7947  C "C3'" . DA  I 5 105 ? 96.25900  133.80000 148.37700 1.000 170.52931 ? 32  DA  I "C3'" 1 
ATOM 7948  O "O3'" . DA  I 5 105 ? 95.25400  133.92700 149.36100 1.000 170.52931 ? 32  DA  I "O3'" 1 
ATOM 7949  C "C2'" . DA  I 5 105 ? 96.20700  132.43600 147.67700 1.000 170.52931 ? 32  DA  I "C2'" 1 
ATOM 7950  C "C1'" . DA  I 5 105 ? 95.34400  132.72800 146.46800 1.000 170.52931 ? 32  DA  I "C1'" 1 
ATOM 7951  N N9    . DA  I 5 105 ? 95.58600  131.84800 145.33700 1.000 170.52931 ? 32  DA  I N9    1 
ATOM 7952  C C8    . DA  I 5 105 ? 96.77200  131.63300 144.70200 1.000 170.52931 ? 32  DA  I C8    1 
ATOM 7953  N N7    . DA  I 5 105 ? 96.68900  130.80800 143.69100 1.000 170.52931 ? 32  DA  I N7    1 
ATOM 7954  C C5    . DA  I 5 105 ? 95.35400  130.46700 143.65500 1.000 170.52931 ? 32  DA  I C5    1 
ATOM 7955  C C6    . DA  I 5 105 ? 94.61700  129.62200 142.81300 1.000 170.52931 ? 32  DA  I C6    1 
ATOM 7956  N N6    . DA  I 5 105 ? 95.15900  128.94200 141.80300 1.000 170.52931 ? 32  DA  I N6    1 
ATOM 7957  N N1    . DA  I 5 105 ? 93.29600  129.50100 143.04900 1.000 170.52931 ? 32  DA  I N1    1 
ATOM 7958  C C2    . DA  I 5 105 ? 92.75400  130.18400 144.06200 1.000 170.52931 ? 32  DA  I C2    1 
ATOM 7959  N N3    . DA  I 5 105 ? 93.34700  131.00800 144.92100 1.000 170.52931 ? 32  DA  I N3    1 
ATOM 7960  C C4    . DA  I 5 105 ? 94.65800  131.10700 144.65800 1.000 170.52931 ? 32  DA  I C4    1 
ATOM 7961  P P     . DC  I 5 106 ? 95.45500  133.29400 150.82300 1.000 171.26137 ? 33  DC  I P     1 
ATOM 7962  O OP1   . DC  I 5 106 ? 95.12700  134.35400 151.79900 1.000 171.26137 ? 33  DC  I OP1   1 
ATOM 7963  O OP2   . DC  I 5 106 ? 96.77300  132.62700 150.88500 1.000 171.26137 ? 33  DC  I OP2   1 
ATOM 7964  O "O5'" . DC  I 5 106 ? 94.32400  132.17600 150.89700 1.000 171.26137 ? 33  DC  I "O5'" 1 
ATOM 7965  C "C5'" . DC  I 5 106 ? 92.99500  132.51600 150.56100 1.000 171.26137 ? 33  DC  I "C5'" 1 
ATOM 7966  C "C4'" . DC  I 5 106 ? 92.22400  131.28800 150.14600 1.000 171.26137 ? 33  DC  I "C4'" 1 
ATOM 7967  O "O4'" . DC  I 5 106 ? 92.71200  130.82300 148.87800 1.000 171.26137 ? 33  DC  I "O4'" 1 
ATOM 7968  C "C3'" . DC  I 5 106 ? 92.35300  130.10600 151.10100 1.000 171.26137 ? 33  DC  I "C3'" 1 
ATOM 7969  O "O3'" . DC  I 5 106 ? 91.12500  129.92100 151.79600 1.000 171.26137 ? 33  DC  I "O3'" 1 
ATOM 7970  C "C2'" . DC  I 5 106 ? 92.69000  128.91000 150.19900 1.000 171.26137 ? 33  DC  I "C2'" 1 
ATOM 7971  C "C1'" . DC  I 5 106 ? 92.48400  129.44700 148.79300 1.000 171.26137 ? 33  DC  I "C1'" 1 
ATOM 7972  N N1    . DC  I 5 106 ? 93.41300  128.87600 147.79300 1.000 171.26137 ? 33  DC  I N1    1 
ATOM 7973  C C2    . DC  I 5 106 ? 92.93200  127.97300 146.85000 1.000 171.26137 ? 33  DC  I C2    1 
ATOM 7974  O O2    . DC  I 5 106 ? 91.73600  127.67700 146.86300 1.000 171.26137 ? 33  DC  I O2    1 
ATOM 7975  N N3    . DC  I 5 106 ? 93.78600  127.46400 145.93500 1.000 171.26137 ? 33  DC  I N3    1 
ATOM 7976  C C4    . DC  I 5 106 ? 95.06700  127.81800 145.95700 1.000 171.26137 ? 33  DC  I C4    1 
ATOM 7977  N N4    . DC  I 5 106 ? 95.87700  127.28900 145.03900 1.000 171.26137 ? 33  DC  I N4    1 
ATOM 7978  C C5    . DC  I 5 106 ? 95.57800  128.72800 146.92200 1.000 171.26137 ? 33  DC  I C5    1 
ATOM 7979  C C6    . DC  I 5 106 ? 94.72300  129.22400 147.81400 1.000 171.26137 ? 33  DC  I C6    1 
ATOM 7980  P P     . DT  I 5 107 ? 90.99600  128.81700 152.95700 1.000 168.99292 ? 34  DT  I P     1 
ATOM 7981  O OP1   . DT  I 5 107 ? 89.88900  129.22900 153.84200 1.000 168.99292 ? 34  DT  I OP1   1 
ATOM 7982  O OP2   . DT  I 5 107 ? 92.34500  128.58700 153.51300 1.000 168.99292 ? 34  DT  I OP2   1 
ATOM 7983  O "O5'" . DT  I 5 107 ? 90.54300  127.49300 152.19000 1.000 168.99292 ? 34  DT  I "O5'" 1 
ATOM 7984  C "C5'" . DT  I 5 107 ? 89.44100  127.54600 151.30500 1.000 168.99292 ? 34  DT  I "C5'" 1 
ATOM 7985  C "C4'" . DT  I 5 107 ? 89.27500  126.24200 150.54900 1.000 168.99292 ? 34  DT  I "C4'" 1 
ATOM 7986  O "O4'" . DT  I 5 107 ? 90.34600  126.06700 149.58400 1.000 168.99292 ? 34  DT  I "O4'" 1 
ATOM 7987  C "C3'" . DT  I 5 107 ? 89.27700  124.98200 151.40900 1.000 168.99292 ? 34  DT  I "C3'" 1 
ATOM 7988  O "O3'" . DT  I 5 107 ? 88.27300  124.12300 150.93000 1.000 168.99292 ? 34  DT  I "O3'" 1 
ATOM 7989  C "C2'" . DT  I 5 107 ? 90.66600  124.40700 151.14800 1.000 168.99292 ? 34  DT  I "C2'" 1 
ATOM 7990  C "C1'" . DT  I 5 107 ? 90.83200  124.75100 149.69000 1.000 168.99292 ? 34  DT  I "C1'" 1 
ATOM 7991  N N1    . DT  I 5 107 ? 92.21900  124.72700 149.21900 1.000 168.99292 ? 34  DT  I N1    1 
ATOM 7992  C C2    . DT  I 5 107 ? 92.53700  123.96400 148.13100 1.000 168.99292 ? 34  DT  I C2    1 
ATOM 7993  O O2    . DT  I 5 107 ? 91.72100  123.30400 147.52000 1.000 168.99292 ? 34  DT  I O2    1 
ATOM 7994  N N3    . DT  I 5 107 ? 93.84400  124.02000 147.75800 1.000 168.99292 ? 34  DT  I N3    1 
ATOM 7995  C C4    . DT  I 5 107 ? 94.84800  124.73600 148.37100 1.000 168.99292 ? 34  DT  I C4    1 
ATOM 7996  O O4    . DT  I 5 107 ? 95.99900  124.72500 147.96800 1.000 168.99292 ? 34  DT  I O4    1 
ATOM 7997  C C5    . DT  I 5 107 ? 94.44600  125.50600 149.51200 1.000 168.99292 ? 34  DT  I C5    1 
ATOM 7998  C C7    . DT  I 5 107 ? 95.45200  126.32600 150.25700 1.000 168.99292 ? 34  DT  I C7    1 
ATOM 7999  C C6    . DT  I 5 107 ? 93.16600  125.45600 149.88100 1.000 168.99292 ? 34  DT  I C6    1 
ATOM 8000  P P     . DC  I 5 108 ? 87.69700  122.91700 151.81800 1.000 168.04717 ? 35  DC  I P     1 
ATOM 8001  O OP1   . DC  I 5 108 ? 86.62600  123.48400 152.66200 1.000 168.04717 ? 35  DC  I OP1   1 
ATOM 8002  O OP2   . DC  I 5 108 ? 88.78800  122.14300 152.44600 1.000 168.04717 ? 35  DC  I OP2   1 
ATOM 8003  O "O5'" . DC  I 5 108 ? 87.03600  121.97500 150.71900 1.000 168.04717 ? 35  DC  I "O5'" 1 
ATOM 8004  C "C5'" . DC  I 5 108 ? 87.44900  122.09300 149.35900 1.000 168.04717 ? 35  DC  I "C5'" 1 
ATOM 8005  C "C4'" . DC  I 5 108 ? 87.86500  120.74700 148.80500 1.000 168.04717 ? 35  DC  I "C4'" 1 
ATOM 8006  O "O4'" . DC  I 5 108 ? 89.26000  120.77400 148.40200 1.000 168.04717 ? 35  DC  I "O4'" 1 
ATOM 8007  C "C3'" . DC  I 5 108 ? 87.74300  119.59700 149.78500 1.000 168.04717 ? 35  DC  I "C3'" 1 
ATOM 8008  O "O3'" . DC  I 5 108 ? 87.42200  118.42400 149.08300 1.000 168.04717 ? 35  DC  I "O3'" 1 
ATOM 8009  C "C2'" . DC  I 5 108 ? 89.15300  119.52500 150.35600 1.000 168.04717 ? 35  DC  I "C2'" 1 
ATOM 8010  C "C1'" . DC  I 5 108 ? 89.97000  119.77500 149.10400 1.000 168.04717 ? 35  DC  I "C1'" 1 
ATOM 8011  N N1    . DC  I 5 108 ? 91.33700  120.27200 149.35900 1.000 168.04717 ? 35  DC  I N1    1 
ATOM 8012  C C2    . DC  I 5 108 ? 92.37500  119.90700 148.50100 1.000 168.04717 ? 35  DC  I C2    1 
ATOM 8013  O O2    . DC  I 5 108 ? 92.13400  119.18800 147.53100 1.000 168.04717 ? 35  DC  I O2    1 
ATOM 8014  N N3    . DC  I 5 108 ? 93.61600  120.37800 148.73800 1.000 168.04717 ? 35  DC  I N3    1 
ATOM 8015  C C4    . DC  I 5 108 ? 93.83900  121.16200 149.78800 1.000 168.04717 ? 35  DC  I C4    1 
ATOM 8016  N N4    . DC  I 5 108 ? 95.08400  121.59800 149.98300 1.000 168.04717 ? 35  DC  I N4    1 
ATOM 8017  C C5    . DC  I 5 108 ? 92.79800  121.53600 150.68000 1.000 168.04717 ? 35  DC  I C5    1 
ATOM 8018  C C6    . DC  I 5 108 ? 91.57600  121.06600 150.43200 1.000 168.04717 ? 35  DC  I C6    1 
ATOM 8019  P P     . DC  I 5 109 ? 85.91000  117.89200 149.04300 1.000 167.39662 ? 36  DC  I P     1 
ATOM 8020  O OP1   . DC  I 5 109 ? 85.02200  119.04300 148.78400 1.000 167.39662 ? 36  DC  I OP1   1 
ATOM 8021  O OP2   . DC  I 5 109 ? 85.70800  117.05500 150.24300 1.000 167.39662 ? 36  DC  I OP2   1 
ATOM 8022  O "O5'" . DC  I 5 109 ? 85.88400  116.93200 147.76800 1.000 167.39662 ? 36  DC  I "O5'" 1 
ATOM 8023  C "C5'" . DC  I 5 109 ? 86.26700  117.43300 146.49200 1.000 167.39662 ? 36  DC  I "C5'" 1 
ATOM 8024  C "C4'" . DC  I 5 109 ? 87.41000  116.62800 145.86700 1.000 167.39662 ? 36  DC  I "C4'" 1 
ATOM 8025  O "O4'" . DC  I 5 109 ? 88.66900  116.91000 146.53800 1.000 167.39662 ? 36  DC  I "O4'" 1 
ATOM 8026  C "C3'" . DC  I 5 109 ? 87.26400  115.11000 145.90200 1.000 167.39662 ? 36  DC  I "C3'" 1 
ATOM 8027  O "O3'" . DC  I 5 109 ? 87.84600  114.57100 144.74500 1.000 167.39662 ? 36  DC  I "O3'" 1 
ATOM 8028  C "C2'" . DC  I 5 109 ? 88.09300  114.73900 147.12400 1.000 167.39662 ? 36  DC  I "C2'" 1 
ATOM 8029  C "C1'" . DC  I 5 109 ? 89.25600  115.69800 146.96800 1.000 167.39662 ? 36  DC  I "C1'" 1 
ATOM 8030  N N1    . DC  I 5 109 ? 89.98300  115.96700 148.22500 1.000 167.39662 ? 36  DC  I N1    1 
ATOM 8031  C C2    . DC  I 5 109 ? 91.34300  116.26600 148.18300 1.000 167.39662 ? 36  DC  I C2    1 
ATOM 8032  O O2    . DC  I 5 109 ? 91.91600  116.31200 147.09700 1.000 167.39662 ? 36  DC  I O2    1 
ATOM 8033  N N3    . DC  I 5 109 ? 91.99000  116.53000 149.33700 1.000 167.39662 ? 36  DC  I N3    1 
ATOM 8034  C C4    . DC  I 5 109 ? 91.33900  116.47800 150.49000 1.000 167.39662 ? 36  DC  I C4    1 
ATOM 8035  N N4    . DC  I 5 109 ? 92.02200  116.73500 151.60600 1.000 167.39662 ? 36  DC  I N4    1 
ATOM 8036  C C5    . DC  I 5 109 ? 89.95800  116.14600 150.55700 1.000 167.39662 ? 36  DC  I C5    1 
ATOM 8037  C C6    . DC  I 5 109 ? 89.32500  115.90700 149.41100 1.000 167.39662 ? 36  DC  I C6    1 
ATOM 8038  P P     . DC  I 5 110 ? 87.43000  113.11700 144.21000 1.000 170.31156 ? 37  DC  I P     1 
ATOM 8039  O OP1   . DC  I 5 110 ? 86.41100  113.32500 143.16300 1.000 170.31156 ? 37  DC  I OP1   1 
ATOM 8040  O OP2   . DC  I 5 110 ? 87.14900  112.20700 145.34000 1.000 170.31156 ? 37  DC  I OP2   1 
ATOM 8041  O "O5'" . DC  I 5 110 ? 88.75900  112.61200 143.50100 1.000 170.31156 ? 37  DC  I "O5'" 1 
ATOM 8042  C "C5'" . DC  I 5 110 ? 89.44800  113.48200 142.63700 1.000 170.31156 ? 37  DC  I "C5'" 1 
ATOM 8043  C "C4'" . DC  I 5 110 ? 90.94100  113.18700 142.58400 1.000 170.31156 ? 37  DC  I "C4'" 1 
ATOM 8044  O "O4'" . DC  I 5 110 ? 91.60400  113.61800 143.80300 1.000 170.31156 ? 37  DC  I "O4'" 1 
ATOM 8045  C "C3'" . DC  I 5 110 ? 91.31000  111.72800 142.40000 1.000 170.31156 ? 37  DC  I "C3'" 1 
ATOM 8046  O "O3'" . DC  I 5 110 ? 92.43400  111.65300 141.58200 1.000 170.31156 ? 37  DC  I "O3'" 1 
ATOM 8047  C "C2'" . DC  I 5 110 ? 91.64100  111.27600 143.82400 1.000 170.31156 ? 37  DC  I "C2'" 1 
ATOM 8048  C "C1'" . DC  I 5 110 ? 92.26300  112.52700 144.41900 1.000 170.31156 ? 37  DC  I "C1'" 1 
ATOM 8049  N N1    . DC  I 5 110 ? 92.08200  112.65800 145.89200 1.000 170.31156 ? 37  DC  I N1    1 
ATOM 8050  C C2    . DC  I 5 110 ? 93.15300  113.06300 146.69600 1.000 170.31156 ? 37  DC  I C2    1 
ATOM 8051  O O2    . DC  I 5 110 ? 94.24100  113.30700 146.17500 1.000 170.31156 ? 37  DC  I O2    1 
ATOM 8052  N N3    . DC  I 5 110 ? 92.95900  113.19400 148.02900 1.000 170.31156 ? 37  DC  I N3    1 
ATOM 8053  C C4    . DC  I 5 110 ? 91.77300  112.92600 148.55700 1.000 170.31156 ? 37  DC  I C4    1 
ATOM 8054  N N4    . DC  I 5 110 ? 91.62500  113.06200 149.87500 1.000 170.31156 ? 37  DC  I N4    1 
ATOM 8055  C C5    . DC  I 5 110 ? 90.68300  112.49400 147.76100 1.000 170.31156 ? 37  DC  I C5    1 
ATOM 8056  C C6    . DC  I 5 110 ? 90.87400  112.38800 146.44600 1.000 170.31156 ? 37  DC  I C6    1 
ATOM 8057  P P     . DT  I 5 111 ? 92.80500  110.28300 140.84400 1.000 158.09233 ? 38  DT  I P     1 
ATOM 8058  O OP1   . DT  I 5 111 ? 92.91800  110.57900 139.40300 1.000 158.09233 ? 38  DT  I OP1   1 
ATOM 8059  O OP2   . DT  I 5 111 ? 91.88500  109.22700 141.31100 1.000 158.09233 ? 38  DT  I OP2   1 
ATOM 8060  O "O5'" . DT  I 5 111 ? 94.24200  109.94900 141.42200 1.000 158.09233 ? 38  DT  I "O5'" 1 
ATOM 8061  C "C5'" . DT  I 5 111 ? 95.17100  110.99000 141.62000 1.000 158.09233 ? 38  DT  I "C5'" 1 
ATOM 8062  C "C4'" . DT  I 5 111 ? 96.26300  110.56100 142.57700 1.000 158.09233 ? 38  DT  I "C4'" 1 
ATOM 8063  O "O4'" . DT  I 5 111 ? 95.87800  110.83800 143.95100 1.000 158.09233 ? 38  DT  I "O4'" 1 
ATOM 8064  C "C3'" . DT  I 5 111 ? 96.61200  109.07600 142.53000 1.000 158.09233 ? 38  DT  I "C3'" 1 
ATOM 8065  O "O3'" . DT  I 5 111 ? 98.00800  108.91300 142.66000 1.000 158.09233 ? 38  DT  I "O3'" 1 
ATOM 8066  C "C2'" . DT  I 5 111 ? 95.89300  108.53500 143.75600 1.000 158.09233 ? 38  DT  I "C2'" 1 
ATOM 8067  C "C1'" . DT  I 5 111 ? 96.10400  109.68400 144.72000 1.000 158.09233 ? 38  DT  I "C1'" 1 
ATOM 8068  N N1    . DT  I 5 111 ? 95.19300  109.67700 145.88700 1.000 158.09233 ? 38  DT  I N1    1 
ATOM 8069  C C2    . DT  I 5 111 ? 95.67500  110.04500 147.11900 1.000 158.09233 ? 38  DT  I C2    1 
ATOM 8070  O O2    . DT  I 5 111 ? 96.81800  110.40600 147.30600 1.000 158.09233 ? 38  DT  I O2    1 
ATOM 8071  N N3    . DT  I 5 111 ? 94.75600  110.00000 148.12500 1.000 158.09233 ? 38  DT  I N3    1 
ATOM 8072  C C4    . DT  I 5 111 ? 93.44000  109.61500 148.02900 1.000 158.09233 ? 38  DT  I C4    1 
ATOM 8073  O O4    . DT  I 5 111 ? 92.68800  109.60200 148.99000 1.000 158.09233 ? 38  DT  I O4    1 
ATOM 8074  C C5    . DT  I 5 111 ? 93.00500  109.22700 146.71800 1.000 158.09233 ? 38  DT  I C5    1 
ATOM 8075  C C7    . DT  I 5 111 ? 91.59000  108.78500 146.50200 1.000 158.09233 ? 38  DT  I C7    1 
ATOM 8076  C C6    . DT  I 5 111 ? 93.89500  109.26800 145.72200 1.000 158.09233 ? 38  DT  I C6    1 
ATOM 8077  P P     . DA  I 5 112 ? 98.74900  107.66200 141.98200 1.000 164.03427 ? 39  DA  I P     1 
ATOM 8078  O OP1   . DA  I 5 112 ? 99.15000  108.07300 140.62200 1.000 164.03427 ? 39  DA  I OP1   1 
ATOM 8079  O OP2   . DA  I 5 112 ? 97.90300  106.46500 142.15700 1.000 164.03427 ? 39  DA  I OP2   1 
ATOM 8080  O "O5'" . DA  I 5 112 ? 100.05500 107.47100 142.88000 1.000 164.03427 ? 39  DA  I "O5'" 1 
ATOM 8081  C "C5'" . DA  I 5 112 ? 100.96100 108.54900 143.05100 1.000 164.03427 ? 39  DA  I "C5'" 1 
ATOM 8082  C "C4'" . DA  I 5 112 ? 101.71500 108.47800 144.38100 1.000 164.03427 ? 39  DA  I "C4'" 1 
ATOM 8083  O "O4'" . DA  I 5 112 ? 100.81900 108.69700 145.49700 1.000 164.03427 ? 39  DA  I "O4'" 1 
ATOM 8084  C "C3'" . DA  I 5 112 ? 102.43000 107.17100 144.67200 1.000 164.03427 ? 39  DA  I "C3'" 1 
ATOM 8085  O "O3'" . DA  I 5 112 ? 103.62800 107.43700 145.36500 1.000 164.03427 ? 39  DA  I "O3'" 1 
ATOM 8086  C "C2'" . DA  I 5 112 ? 101.43700 106.42000 145.56100 1.000 164.03427 ? 39  DA  I "C2'" 1 
ATOM 8087  C "C1'" . DA  I 5 112 ? 100.75800 107.55100 146.32400 1.000 164.03427 ? 39  DA  I "C1'" 1 
ATOM 8088  N N9    . DA  I 5 112 ? 99.35500  107.30400 146.61000 1.000 164.03427 ? 39  DA  I N9    1 
ATOM 8089  C C8    . DA  I 5 112 ? 98.38300  107.03000 145.70400 1.000 164.03427 ? 39  DA  I C8    1 
ATOM 8090  N N7    . DA  I 5 112 ? 97.19800  106.87100 146.23300 1.000 164.03427 ? 39  DA  I N7    1 
ATOM 8091  C C5    . DA  I 5 112 ? 97.39700  107.08800 147.57000 1.000 164.03427 ? 39  DA  I C5    1 
ATOM 8092  C C6    . DA  I 5 112 ? 96.52200  107.06900 148.65900 1.000 164.03427 ? 39  DA  I C6    1 
ATOM 8093  N N6    . DA  I 5 112 ? 95.21800  106.82100 148.54100 1.000 164.03427 ? 39  DA  I N6    1 
ATOM 8094  N N1    . DA  I 5 112 ? 97.03700  107.31300 149.87700 1.000 164.03427 ? 39  DA  I N1    1 
ATOM 8095  C C2    . DA  I 5 112 ? 98.34900  107.56200 149.98600 1.000 164.03427 ? 39  DA  I C2    1 
ATOM 8096  N N3    . DA  I 5 112 ? 99.27300  107.60600 149.02600 1.000 164.03427 ? 39  DA  I N3    1 
ATOM 8097  C C4    . DA  I 5 112 ? 98.72300  107.36400 147.83000 1.000 164.03427 ? 39  DA  I C4    1 
ATOM 8098  P P     . DG  I 5 113 ? 104.69400 106.26300 145.60000 1.000 171.06690 ? 40  DG  I P     1 
ATOM 8099  O OP1   . DG  I 5 113 ? 106.03000 106.88600 145.66100 1.000 171.06690 ? 40  DG  I OP1   1 
ATOM 8100  O OP2   . DG  I 5 113 ? 104.42900 105.19200 144.62100 1.000 171.06690 ? 40  DG  I OP2   1 
ATOM 8101  O "O5'" . DG  I 5 113 ? 104.31800 105.71000 147.04200 1.000 171.06690 ? 40  DG  I "O5'" 1 
ATOM 8102  C "C5'" . DG  I 5 113 ? 104.25200 106.59900 148.12700 1.000 171.06690 ? 40  DG  I "C5'" 1 
ATOM 8103  C "C4'" . DG  I 5 113 ? 103.73000 105.89500 149.35800 1.000 171.06690 ? 40  DG  I "C4'" 1 
ATOM 8104  O "O4'" . DG  I 5 113 ? 102.28500 105.89600 149.35000 1.000 171.06690 ? 40  DG  I "O4'" 1 
ATOM 8105  C "C3'" . DG  I 5 113 ? 104.16000 104.43600 149.47800 1.000 171.06690 ? 40  DG  I "C3'" 1 
ATOM 8106  O "O3'" . DG  I 5 113 ? 104.84500 104.24800 150.68800 1.000 171.06690 ? 40  DG  I "O3'" 1 
ATOM 8107  C "C2'" . DG  I 5 113 ? 102.84400 103.65000 149.44200 1.000 171.06690 ? 40  DG  I "C2'" 1 
ATOM 8108  C "C1'" . DG  I 5 113 ? 101.82900 104.68800 149.88600 1.000 171.06690 ? 40  DG  I "C1'" 1 
ATOM 8109  N N9    . DG  I 5 113 ? 100.48500 104.44700 149.37800 1.000 171.06690 ? 40  DG  I N9    1 
ATOM 8110  C C8    . DG  I 5 113 ? 100.10000 104.37600 148.06700 1.000 171.06690 ? 40  DG  I C8    1 
ATOM 8111  N N7    . DG  I 5 113 ? 98.82600  104.16600 147.91100 1.000 171.06690 ? 40  DG  I N7    1 
ATOM 8112  C C5    . DG  I 5 113 ? 98.33300  104.10700 149.20200 1.000 171.06690 ? 40  DG  I C5    1 
ATOM 8113  C C6    . DG  I 5 113 ? 97.01400  103.90200 149.66300 1.000 171.06690 ? 40  DG  I C6    1 
ATOM 8114  O O6    . DG  I 5 113 ? 95.98800  103.72800 148.99800 1.000 171.06690 ? 40  DG  I O6    1 
ATOM 8115  N N1    . DG  I 5 113 ? 96.94600  103.91300 151.04800 1.000 171.06690 ? 40  DG  I N1    1 
ATOM 8116  C C2    . DG  I 5 113 ? 98.02000  104.09800 151.88100 1.000 171.06690 ? 40  DG  I C2    1 
ATOM 8117  N N2    . DG  I 5 113 ? 97.76800  104.08000 153.19400 1.000 171.06690 ? 40  DG  I N2    1 
ATOM 8118  N N3    . DG  I 5 113 ? 99.26100  104.29100 151.46000 1.000 171.06690 ? 40  DG  I N3    1 
ATOM 8119  C C4    . DG  I 5 113 ? 99.34200  104.28100 150.11500 1.000 171.06690 ? 40  DG  I C4    1 
ATOM 8120  P P     . DT  I 5 114 ? 105.81200 102.98500 150.88100 1.000 175.56233 ? 41  DT  I P     1 
ATOM 8121  O OP1   . DT  I 5 114 ? 107.04300 103.44100 151.55900 1.000 175.56233 ? 41  DT  I OP1   1 
ATOM 8122  O OP2   . DT  I 5 114 ? 105.90000 102.28500 149.58400 1.000 175.56233 ? 41  DT  I OP2   1 
ATOM 8123  O "O5'" . DT  I 5 114 ? 104.98700 102.05100 151.86300 1.000 175.56233 ? 41  DT  I "O5'" 1 
ATOM 8124  C "C5'" . DT  I 5 114 ? 104.51200 102.58000 153.08100 1.000 175.56233 ? 41  DT  I "C5'" 1 
ATOM 8125  C "C4'" . DT  I 5 114 ? 103.41400 101.70400 153.62500 1.000 175.56233 ? 41  DT  I "C4'" 1 
ATOM 8126  O "O4'" . DT  I 5 114 ? 102.20600 101.91600 152.87400 1.000 175.56233 ? 41  DT  I "O4'" 1 
ATOM 8127  C "C3'" . DT  I 5 114 ? 103.70000 100.21700 153.51600 1.000 175.56233 ? 41  DT  I "C3'" 1 
ATOM 8128  O "O3'" . DT  I 5 114 ? 104.17300 99.71500  154.77100 1.000 175.56233 ? 41  DT  I "O3'" 1 
ATOM 8129  C "C2'" . DT  I 5 114 ? 102.35300 99.60400  153.13700 1.000 175.56233 ? 41  DT  I "C2'" 1 
ATOM 8130  C "C1'" . DT  I 5 114 ? 101.40200 100.78600 153.04200 1.000 175.56233 ? 41  DT  I "C1'" 1 
ATOM 8131  N N1    . DT  I 5 114 ? 100.46300 100.67600 151.91100 1.000 175.56233 ? 41  DT  I N1    1 
ATOM 8132  C C2    . DT  I 5 114 ? 99.14400  100.40200 152.16300 1.000 175.56233 ? 41  DT  I C2    1 
ATOM 8133  O O2    . DT  I 5 114 ? 98.69600  100.25600 153.28200 1.000 175.56233 ? 41  DT  I O2    1 
ATOM 8134  N N3    . DT  I 5 114 ? 98.36000  100.30700 151.05100 1.000 175.56233 ? 41  DT  I N3    1 
ATOM 8135  C C4    . DT  I 5 114 ? 98.75800  100.45400 149.74100 1.000 175.56233 ? 41  DT  I C4    1 
ATOM 8136  O O4    . DT  I 5 114 ? 97.98200  100.35300 148.80300 1.000 175.56233 ? 41  DT  I O4    1 
ATOM 8137  C C5    . DT  I 5 114 ? 100.15200 100.73100 149.54800 1.000 175.56233 ? 41  DT  I C5    1 
ATOM 8138  C C7    . DT  I 5 114 ? 100.69400 100.90300 148.16500 1.000 175.56233 ? 41  DT  I C7    1 
ATOM 8139  C C6    . DT  I 5 114 ? 100.93200 100.82300 150.63000 1.000 175.56233 ? 41  DT  I C6    1 
ATOM 8140  P P     . DC  I 5 115 ? 104.64800 98.18400  154.91800 1.000 176.10880 ? 42  DC  I P     1 
ATOM 8141  O OP1   . DC  I 5 115 ? 105.53400 98.10900  156.09700 1.000 176.10880 ? 42  DC  I OP1   1 
ATOM 8142  O OP2   . DC  I 5 115 ? 105.13800 97.73600  153.59800 1.000 176.10880 ? 42  DC  I OP2   1 
ATOM 8143  O "O5'" . DC  I 5 115 ? 103.30700 97.37200  155.23200 1.000 176.10880 ? 42  DC  I "O5'" 1 
ATOM 8144  C "C5'" . DC  I 5 115 ? 102.47100 97.77500  156.29200 1.000 176.10880 ? 42  DC  I "C5'" 1 
ATOM 8145  C "C4'" . DC  I 5 115 ? 101.10400 97.13100  156.16900 1.000 176.10880 ? 42  DC  I "C4'" 1 
ATOM 8146  O "O4'" . DC  I 5 115 ? 100.44700 97.55900  154.95800 1.000 176.10880 ? 42  DC  I "O4'" 1 
ATOM 8147  C "C3'" . DC  I 5 115 ? 101.10800 95.60700  156.13300 1.000 176.10880 ? 42  DC  I "C3'" 1 
ATOM 8148  O "O3'" . DC  I 5 115 ? 100.57600 95.11900  157.37900 1.000 176.10880 ? 42  DC  I "O3'" 1 
ATOM 8149  C "C2'" . DC  I 5 115 ? 100.23300 95.25000  154.91700 1.000 176.10880 ? 42  DC  I "C2'" 1 
ATOM 8150  C "C1'" . DC  I 5 115 ? 99.54900  96.55300  154.56600 1.000 176.10880 ? 42  DC  I "C1'" 1 
ATOM 8151  N N1    . DC  I 5 115 ? 99.24600  96.70200  153.11400 1.000 176.10880 ? 42  DC  I N1    1 
ATOM 8152  C C2    . DC  I 5 115 ? 97.94600  96.49100  152.64500 1.000 176.10880 ? 42  DC  I C2    1 
ATOM 8153  O O2    . DC  I 5 115 ? 97.05200  96.20400  153.44400 1.000 176.10880 ? 42  DC  I O2    1 
ATOM 8154  N N3    . DC  I 5 115 ? 97.69700  96.64200  151.32300 1.000 176.10880 ? 42  DC  I N3    1 
ATOM 8155  C C4    . DC  I 5 115 ? 98.68600  96.96500  150.49300 1.000 176.10880 ? 42  DC  I C4    1 
ATOM 8156  N N4    . DC  I 5 115 ? 98.40200  97.09800  149.19800 1.000 176.10880 ? 42  DC  I N4    1 
ATOM 8157  C C5    . DC  I 5 115 ? 100.01300 97.16600  150.95300 1.000 176.10880 ? 42  DC  I C5    1 
ATOM 8158  C C6    . DC  I 5 115 ? 100.24300 97.00900  152.25300 1.000 176.10880 ? 42  DC  I C6    1 
ATOM 8159  P P     . DT  I 5 116 ? 100.00800 93.62400  157.56100 1.000 172.19607 ? 43  DT  I P     1 
ATOM 8160  O OP1   . DT  I 5 116 ? 99.97100  93.39000  159.01800 1.000 172.19607 ? 43  DT  I OP1   1 
ATOM 8161  O OP2   . DT  I 5 116 ? 100.75200 92.66100  156.71700 1.000 172.19607 ? 43  DT  I OP2   1 
ATOM 8162  O "O5'" . DT  I 5 116 ? 98.49600  93.74500  157.06300 1.000 172.19607 ? 43  DT  I "O5'" 1 
ATOM 8163  C "C5'" . DT  I 5 116 ? 97.51500  92.89500  157.55500 1.000 172.19607 ? 43  DT  I "C5'" 1 
ATOM 8164  C "C4'" . DT  I 5 116 ? 96.77600  92.23600  156.41300 1.000 172.19607 ? 43  DT  I "C4'" 1 
ATOM 8165  O "O4'" . DT  I 5 116 ? 97.01400  92.94800  155.18500 1.000 172.19607 ? 43  DT  I "O4'" 1 
ATOM 8166  C "C3'" . DT  I 5 116 ? 97.19400  90.80500  156.13200 1.000 172.19607 ? 43  DT  I "C3'" 1 
ATOM 8167  O "O3'" . DT  I 5 116 ? 96.25500  89.92400  156.74700 1.000 172.19607 ? 43  DT  I "O3'" 1 
ATOM 8168  C "C2'" . DT  I 5 116 ? 97.17400  90.69900  154.60000 1.000 172.19607 ? 43  DT  I "C2'" 1 
ATOM 8169  C "C1'" . DT  I 5 116 ? 96.71300  92.07200  154.13500 1.000 172.19607 ? 43  DT  I "C1'" 1 
ATOM 8170  N N1    . DT  I 5 116 ? 97.37300  92.52700  152.88000 1.000 172.19607 ? 43  DT  I N1    1 
ATOM 8171  C C2    . DT  I 5 116 ? 96.61800  92.65600  151.74500 1.000 172.19607 ? 43  DT  I C2    1 
ATOM 8172  O O2    . DT  I 5 116 ? 95.42300  92.44300  151.71400 1.000 172.19607 ? 43  DT  I O2    1 
ATOM 8173  N N3    . DT  I 5 116 ? 97.30800  93.06800  150.64500 1.000 172.19607 ? 43  DT  I N3    1 
ATOM 8174  C C4    . DT  I 5 116 ? 98.65000  93.34200  150.56100 1.000 172.19607 ? 43  DT  I C4    1 
ATOM 8175  O O4    . DT  I 5 116 ? 99.17900  93.70400  149.52200 1.000 172.19607 ? 43  DT  I O4    1 
ATOM 8176  C C5    . DT  I 5 116 ? 99.39000  93.17100  151.77600 1.000 172.19607 ? 43  DT  I C5    1 
ATOM 8177  C C7    . DT  I 5 116 ? 100.86300 93.43800  151.79300 1.000 172.19607 ? 43  DT  I C7    1 
ATOM 8178  C C6    . DT  I 5 116 ? 98.72600  92.76600  152.86600 1.000 172.19607 ? 43  DT  I C6    1 
ATOM 8179  P P     . DC  I 5 117 ? 96.34900  88.33100  156.56200 1.000 166.97015 ? 44  DC  I P     1 
ATOM 8180  O OP1   . DC  I 5 117 ? 95.65200  87.72900  157.71900 1.000 166.97015 ? 44  DC  I OP1   1 
ATOM 8181  O OP2   . DC  I 5 117 ? 97.75400  87.96800  156.27500 1.000 166.97015 ? 44  DC  I OP2   1 
ATOM 8182  O "O5'" . DC  I 5 117 ? 95.47900  88.04600  155.25700 1.000 166.97015 ? 44  DC  I "O5'" 1 
ATOM 8183  C "C5'" . DC  I 5 117 ? 94.20900  88.65200  155.12500 1.000 166.97015 ? 44  DC  I "C5'" 1 
ATOM 8184  C "C4'" . DC  I 5 117 ? 93.67800  88.47000  153.72200 1.000 166.97015 ? 44  DC  I "C4'" 1 
ATOM 8185  O "O4'" . DC  I 5 117 ? 94.50100  89.19700  152.77600 1.000 166.97015 ? 44  DC  I "O4'" 1 
ATOM 8186  C "C3'" . DC  I 5 117 ? 93.64300  87.02600  153.24300 1.000 166.97015 ? 44  DC  I "C3'" 1 
ATOM 8187  O "O3'" . DC  I 5 117 ? 92.35600  86.73600  152.75000 1.000 166.97015 ? 44  DC  I "O3'" 1 
ATOM 8188  C "C2'" . DC  I 5 117 ? 94.70000  86.98400  152.13500 1.000 166.97015 ? 44  DC  I "C2'" 1 
ATOM 8189  C "C1'" . DC  I 5 117 ? 94.68300  88.41100  151.62800 1.000 166.97015 ? 44  DC  I "C1'" 1 
ATOM 8190  N N1    . DC  I 5 117 ? 95.94100  88.84200  150.96000 1.000 166.97015 ? 44  DC  I N1    1 
ATOM 8191  C C2    . DC  I 5 117 ? 95.91600  89.23800  149.62200 1.000 166.97015 ? 44  DC  I C2    1 
ATOM 8192  O O2    . DC  I 5 117 ? 94.84700  89.22900  149.00900 1.000 166.97015 ? 44  DC  I O2    1 
ATOM 8193  N N3    . DC  I 5 117 ? 97.06600  89.64200  149.03600 1.000 166.97015 ? 44  DC  I N3    1 
ATOM 8194  C C4    . DC  I 5 117 ? 98.19800  89.64500  149.73100 1.000 166.97015 ? 44  DC  I C4    1 
ATOM 8195  N N4    . DC  I 5 117 ? 99.30800  90.04300  149.11300 1.000 166.97015 ? 44  DC  I N4    1 
ATOM 8196  C C5    . DC  I 5 117 ? 98.24400  89.24100  151.09100 1.000 166.97015 ? 44  DC  I C5    1 
ATOM 8197  C C6    . DC  I 5 117 ? 97.10400  88.84200  151.65300 1.000 166.97015 ? 44  DC  I C6    1 
ATOM 8198  P P     . DC  I 5 118 ? 91.91400  85.22000  152.47400 1.000 161.32854 ? 45  DC  I P     1 
ATOM 8199  O OP1   . DC  I 5 118 ? 90.52800  85.06900  152.96300 1.000 161.32854 ? 45  DC  I OP1   1 
ATOM 8200  O OP2   . DC  I 5 118 ? 92.97400  84.31900  152.97400 1.000 161.32854 ? 45  DC  I OP2   1 
ATOM 8201  O "O5'" . DC  I 5 118 ? 91.89700  85.12300  150.89000 1.000 161.32854 ? 45  DC  I "O5'" 1 
ATOM 8202  C "C5'" . DC  I 5 118 ? 91.16500  86.06900  150.13400 1.000 161.32854 ? 45  DC  I "C5'" 1 
ATOM 8203  C "C4'" . DC  I 5 118 ? 91.47200  85.97000  148.64600 1.000 161.32854 ? 45  DC  I "C4'" 1 
ATOM 8204  O "O4'" . DC  I 5 118 ? 92.78500  86.52300  148.35300 1.000 161.32854 ? 45  DC  I "O4'" 1 
ATOM 8205  C "C3'" . DC  I 5 118 ? 91.48700  84.55800  148.06700 1.000 161.32854 ? 45  DC  I "C3'" 1 
ATOM 8206  O "O3'" . DC  I 5 118 ? 90.99800  84.61400  146.75100 1.000 161.32854 ? 45  DC  I "O3'" 1 
ATOM 8207  C "C2'" . DC  I 5 118 ? 92.97700  84.24200  148.06000 1.000 161.32854 ? 45  DC  I "C2'" 1 
ATOM 8208  C "C1'" . DC  I 5 118 ? 93.51000  85.58000  147.59600 1.000 161.32854 ? 45  DC  I "C1'" 1 
ATOM 8209  N N1    . DC  I 5 118 ? 94.95000  85.79100  147.83500 1.000 161.32854 ? 45  DC  I N1    1 
ATOM 8210  C C2    . DC  I 5 118 ? 95.75100  86.28000  146.80700 1.000 161.32854 ? 45  DC  I C2    1 
ATOM 8211  O O2    . DC  I 5 118 ? 95.24500  86.53400  145.71300 1.000 161.32854 ? 45  DC  I O2    1 
ATOM 8212  N N3    . DC  I 5 118 ? 97.06300  86.49300  147.04400 1.000 161.32854 ? 45  DC  I N3    1 
ATOM 8213  C C4    . DC  I 5 118 ? 97.57300  86.22000  148.24100 1.000 161.32854 ? 45  DC  I C4    1 
ATOM 8214  N N4    . DC  I 5 118 ? 98.87600  86.43700  148.42200 1.000 161.32854 ? 45  DC  I N4    1 
ATOM 8215  C C5    . DC  I 5 118 ? 96.77400  85.71400  149.29900 1.000 161.32854 ? 45  DC  I C5    1 
ATOM 8216  C C6    . DC  I 5 118 ? 95.48000  85.51300  149.05000 1.000 161.32854 ? 45  DC  I C6    1 
ATOM 8217  P P     . DA  I 5 119 ? 89.48100  84.21400  146.42800 1.000 156.24793 ? 46  DA  I P     1 
ATOM 8218  O OP1   . DA  I 5 119 ? 88.60500  85.19500  147.10100 1.000 156.24793 ? 46  DA  I OP1   1 
ATOM 8219  O OP2   . DA  I 5 119 ? 89.33600  82.77300  146.71600 1.000 156.24793 ? 46  DA  I OP2   1 
ATOM 8220  O "O5'" . DA  I 5 119 ? 89.37100  84.41600  144.84800 1.000 156.24793 ? 46  DA  I "O5'" 1 
ATOM 8221  C "C5'" . DA  I 5 119 ? 89.63900  85.69600  144.26800 1.000 156.24793 ? 46  DA  I "C5'" 1 
ATOM 8222  C "C4'" . DA  I 5 119 ? 90.30300  85.61100  142.88200 1.000 156.24793 ? 46  DA  I "C4'" 1 
ATOM 8223  O "O4'" . DA  I 5 119 ? 91.74400  85.54800  142.99900 1.000 156.24793 ? 46  DA  I "O4'" 1 
ATOM 8224  C "C3'" . DA  I 5 119 ? 89.93100  84.43100  141.99700 1.000 156.24793 ? 46  DA  I "C3'" 1 
ATOM 8225  O "O3'" . DA  I 5 119 ? 90.10900  84.79600  140.64600 1.000 156.24793 ? 46  DA  I "O3'" 1 
ATOM 8226  C "C2'" . DA  I 5 119 ? 90.99600  83.40600  142.38100 1.000 156.24793 ? 46  DA  I "C2'" 1 
ATOM 8227  C "C1'" . DA  I 5 119 ? 92.22000  84.30000  142.52200 1.000 156.24793 ? 46  DA  I "C1'" 1 
ATOM 8228  N N9    . DA  I 5 119 ? 93.19100  83.82800  143.48100 1.000 156.24793 ? 46  DA  I N9    1 
ATOM 8229  C C8    . DA  I 5 119 ? 92.94300  83.14600  144.63000 1.000 156.24793 ? 46  DA  I C8    1 
ATOM 8230  N N7    . DA  I 5 119 ? 94.01900  82.88300  145.32200 1.000 156.24793 ? 46  DA  I N7    1 
ATOM 8231  C C5    . DA  I 5 119 ? 95.02600  83.48600  144.61200 1.000 156.24793 ? 46  DA  I C5    1 
ATOM 8232  C C6    . DA  I 5 119 ? 96.40500  83.58100  144.82900 1.000 156.24793 ? 46  DA  I C6    1 
ATOM 8233  N N6    . DA  I 5 119 ? 97.01700  83.05200  145.88900 1.000 156.24793 ? 46  DA  I N6    1 
ATOM 8234  N N1    . DA  I 5 119 ? 97.13600  84.24600  143.91700 1.000 156.24793 ? 46  DA  I N1    1 
ATOM 8235  C C2    . DA  I 5 119 ? 96.52100  84.77100  142.85500 1.000 156.24793 ? 46  DA  I C2    1 
ATOM 8236  N N3    . DA  I 5 119 ? 95.22900  84.74200  142.54400 1.000 156.24793 ? 46  DA  I N3    1 
ATOM 8237  C C4    . DA  I 5 119 ? 94.53400  84.07900  143.47400 1.000 156.24793 ? 46  DA  I C4    1 
ATOM 8238  P P     . DG  I 5 120 ? 88.91200  85.38000  139.75400 1.000 157.56426 ? 47  DG  I P     1 
ATOM 8239  O OP1   . DG  I 5 120 ? 88.29600  86.52900  140.44600 1.000 157.56426 ? 47  DG  I OP1   1 
ATOM 8240  O OP2   . DG  I 5 120 ? 88.07000  84.23700  139.35300 1.000 157.56426 ? 47  DG  I OP2   1 
ATOM 8241  O "O5'" . DG  I 5 120 ? 89.66300  85.92500  138.45000 1.000 157.56426 ? 47  DG  I "O5'" 1 
ATOM 8242  C "C5'" . DG  I 5 120 ? 90.26400  87.21700  138.44800 1.000 157.56426 ? 47  DG  I "C5'" 1 
ATOM 8243  C "C4'" . DG  I 5 120 ? 91.69500  87.20400  137.90400 1.000 157.56426 ? 47  DG  I "C4'" 1 
ATOM 8244  O "O4'" . DG  I 5 120 ? 92.55100  86.34300  138.69500 1.000 157.56426 ? 47  DG  I "O4'" 1 
ATOM 8245  C "C3'" . DG  I 5 120 ? 91.85600  86.73200  136.46500 1.000 157.56426 ? 47  DG  I "C3'" 1 
ATOM 8246  O "O3'" . DG  I 5 120 ? 92.91600  87.44400  135.86400 1.000 157.56426 ? 47  DG  I "O3'" 1 
ATOM 8247  C "C2'" . DG  I 5 120 ? 92.22900  85.26300  136.64700 1.000 157.56426 ? 47  DG  I "C2'" 1 
ATOM 8248  C "C1'" . DG  I 5 120 ? 93.12500  85.34900  137.86600 1.000 157.56426 ? 47  DG  I "C1'" 1 
ATOM 8249  N N9    . DG  I 5 120 ? 93.21600  84.12400  138.64300 1.000 157.56426 ? 47  DG  I N9    1 
ATOM 8250  C C8    . DG  I 5 120 ? 92.18800  83.30200  139.00800 1.000 157.56426 ? 47  DG  I C8    1 
ATOM 8251  N N7    . DG  I 5 120 ? 92.56400  82.29100  139.73000 1.000 157.56426 ? 47  DG  I N7    1 
ATOM 8252  C C5    . DG  I 5 120 ? 93.92600  82.46200  139.86900 1.000 157.56426 ? 47  DG  I C5    1 
ATOM 8253  C C6    . DG  I 5 120 ? 94.87100  81.67500  140.55400 1.000 157.56426 ? 47  DG  I C6    1 
ATOM 8254  O O6    . DG  I 5 120 ? 94.68700  80.63900  141.20100 1.000 157.56426 ? 47  DG  I O6    1 
ATOM 8255  N N1    . DG  I 5 120 ? 96.14700  82.19200  140.43500 1.000 157.56426 ? 47  DG  I N1    1 
ATOM 8256  C C2    . DG  I 5 120 ? 96.47000  83.32600  139.74300 1.000 157.56426 ? 47  DG  I C2    1 
ATOM 8257  N N2    . DG  I 5 120 ? 97.75900  83.66700  139.75400 1.000 157.56426 ? 47  DG  I N2    1 
ATOM 8258  N N3    . DG  I 5 120 ? 95.59500  84.07800  139.10000 1.000 157.56426 ? 47  DG  I N3    1 
ATOM 8259  C C4    . DG  I 5 120 ? 94.34500  83.58700  139.20700 1.000 157.56426 ? 47  DG  I C4    1 
ATOM 8260  P P     . DG  I 5 121 ? 93.08300  87.46700  134.26900 1.000 154.13737 ? 48  DG  I P     1 
ATOM 8261  O OP1   . DG  I 5 121 ? 93.08700  88.89100  133.87900 1.000 154.13737 ? 48  DG  I OP1   1 
ATOM 8262  O OP2   . DG  I 5 121 ? 92.10600  86.54100  133.65800 1.000 154.13737 ? 48  DG  I OP2   1 
ATOM 8263  O "O5'" . DG  I 5 121 ? 94.55200  86.89300  134.02400 1.000 154.13737 ? 48  DG  I "O5'" 1 
ATOM 8264  C "C5'" . DG  I 5 121 ? 95.66900  87.57100  134.57000 1.000 154.13737 ? 48  DG  I "C5'" 1 
ATOM 8265  C "C4'" . DG  I 5 121 ? 96.89600  86.67800  134.63300 1.000 154.13737 ? 48  DG  I "C4'" 1 
ATOM 8266  O "O4'" . DG  I 5 121 ? 96.69100  85.61800  135.60100 1.000 154.13737 ? 48  DG  I "O4'" 1 
ATOM 8267  C "C3'" . DG  I 5 121 ? 97.27900  85.99200  133.32100 1.000 154.13737 ? 48  DG  I "C3'" 1 
ATOM 8268  O "O3'" . DG  I 5 121 ? 98.68500  86.03300  133.16700 1.000 154.13737 ? 48  DG  I "O3'" 1 
ATOM 8269  C "C2'" . DG  I 5 121 ? 96.78100  84.56400  133.53100 1.000 154.13737 ? 48  DG  I "C2'" 1 
ATOM 8270  C "C1'" . DG  I 5 121 ? 97.01500  84.38200  135.01700 1.000 154.13737 ? 48  DG  I "C1'" 1 
ATOM 8271  N N9    . DG  I 5 121 ? 96.17900  83.35600  135.62100 1.000 154.13737 ? 48  DG  I N9    1 
ATOM 8272  C C8    . DG  I 5 121 ? 94.82100  83.23700  135.52300 1.000 154.13737 ? 48  DG  I C8    1 
ATOM 8273  N N7    . DG  I 5 121 ? 94.34100  82.22500  136.18000 1.000 154.13737 ? 48  DG  I N7    1 
ATOM 8274  C C5    . DG  I 5 121 ? 95.45400  81.63800  136.74900 1.000 154.13737 ? 48  DG  I C5    1 
ATOM 8275  C C6    . DG  I 5 121 ? 95.55600  80.50200  137.56700 1.000 154.13737 ? 48  DG  I C6    1 
ATOM 8276  O O6    . DG  I 5 121 ? 94.65000  79.76800  137.97200 1.000 154.13737 ? 48  DG  I O6    1 
ATOM 8277  N N1    . DG  I 5 121 ? 96.86700  80.25000  137.93400 1.000 154.13737 ? 48  DG  I N1    1 
ATOM 8278  C C2    . DG  I 5 121 ? 97.94400  81.00100  137.55000 1.000 154.13737 ? 48  DG  I C2    1 
ATOM 8279  N N2    . DG  I 5 121 ? 99.13700  80.60000  137.99700 1.000 154.13737 ? 48  DG  I N2    1 
ATOM 8280  N N3    . DG  I 5 121 ? 97.86300  82.06600  136.77700 1.000 154.13737 ? 48  DG  I N3    1 
ATOM 8281  C C4    . DG  I 5 121 ? 96.59000  82.32900  136.42400 1.000 154.13737 ? 48  DG  I C4    1 
ATOM 8282  P P     . DC  I 5 122 ? 99.37600  85.72600  131.74900 1.000 155.45808 ? 49  DC  I P     1 
ATOM 8283  O OP1   . DC  I 5 122 ? 100.16000 86.92000  131.37400 1.000 155.45808 ? 49  DC  I OP1   1 
ATOM 8284  O OP2   . DC  I 5 122 ? 98.37900  85.20100  130.79400 1.000 155.45808 ? 49  DC  I OP2   1 
ATOM 8285  O "O5'" . DC  I 5 122 ? 100.40000 84.55600  132.09100 1.000 155.45808 ? 49  DC  I "O5'" 1 
ATOM 8286  C "C5'" . DC  I 5 122 ? 101.42000 84.77400  133.05600 1.000 155.45808 ? 49  DC  I "C5'" 1 
ATOM 8287  C "C4'" . DC  I 5 122 ? 102.05700 83.46700  133.49400 1.000 155.45808 ? 49  DC  I "C4'" 1 
ATOM 8288  O "O4'" . DC  I 5 122 ? 101.10300 82.67600  134.25100 1.000 155.45808 ? 49  DC  I "O4'" 1 
ATOM 8289  C "C3'" . DC  I 5 122 ? 102.54500 82.57600  132.35900 1.000 155.45808 ? 49  DC  I "C3'" 1 
ATOM 8290  O "O3'" . DC  I 5 122 ? 103.78700 82.01300  132.69700 1.000 155.45808 ? 49  DC  I "O3'" 1 
ATOM 8291  C "C2'" . DC  I 5 122 ? 101.46200 81.51000  132.27100 1.000 155.45808 ? 49  DC  I "C2'" 1 
ATOM 8292  C "C1'" . DC  I 5 122 ? 101.05300 81.37300  133.72300 1.000 155.45808 ? 49  DC  I "C1'" 1 
ATOM 8293  N N1    . DC  I 5 122 ? 99.68300  80.85000  133.89600 1.000 155.45808 ? 49  DC  I N1    1 
ATOM 8294  C C2    . DC  I 5 122 ? 99.46700  79.71500  134.67500 1.000 155.45808 ? 49  DC  I C2    1 
ATOM 8295  O O2    . DC  I 5 122 ? 100.43000 79.16600  135.21200 1.000 155.45808 ? 49  DC  I O2    1 
ATOM 8296  N N3    . DC  I 5 122 ? 98.20600  79.25000  134.81600 1.000 155.45808 ? 49  DC  I N3    1 
ATOM 8297  C C4    . DC  I 5 122 ? 97.19700  79.87500  134.21700 1.000 155.45808 ? 49  DC  I C4    1 
ATOM 8298  N N4    . DC  I 5 122 ? 95.96800  79.38600  134.38200 1.000 155.45808 ? 49  DC  I N4    1 
ATOM 8299  C C5    . DC  I 5 122 ? 97.40100  81.02800  133.41400 1.000 155.45808 ? 49  DC  I C5    1 
ATOM 8300  C C6    . DC  I 5 122 ? 98.64700  81.47800  133.28500 1.000 155.45808 ? 49  DC  I C6    1 
ATOM 8301  P P     . DA  I 5 123 ? 104.75700 81.44100  131.55500 1.000 159.02202 ? 50  DA  I P     1 
ATOM 8302  O OP1   . DA  I 5 123 ? 106.05300 82.13500  131.68100 1.000 159.02202 ? 50  DA  I OP1   1 
ATOM 8303  O OP2   . DA  I 5 123 ? 104.04200 81.44800  130.26400 1.000 159.02202 ? 50  DA  I OP2   1 
ATOM 8304  O "O5'" . DA  I 5 123 ? 104.99400 79.93200  131.99500 1.000 159.02202 ? 50  DA  I "O5'" 1 
ATOM 8305  C "C5'" . DA  I 5 123 ? 105.59800 79.66900  133.24100 1.000 159.02202 ? 50  DA  I "C5'" 1 
ATOM 8306  C "C4'" . DA  I 5 123 ? 105.48100 78.20700  133.61100 1.000 159.02202 ? 50  DA  I "C4'" 1 
ATOM 8307  O "O4'" . DA  I 5 123 ? 104.11300 77.89800  133.97100 1.000 159.02202 ? 50  DA  I "O4'" 1 
ATOM 8308  C "C3'" . DA  I 5 123 ? 105.87500 77.23700  132.50600 1.000 159.02202 ? 50  DA  I "C3'" 1 
ATOM 8309  O "O3'" . DA  I 5 123 ? 106.68300 76.21000  133.04100 1.000 159.02202 ? 50  DA  I "O3'" 1 
ATOM 8310  C "C2'" . DA  I 5 123 ? 104.54200 76.69800  131.99800 1.000 159.02202 ? 50  DA  I "C2'" 1 
ATOM 8311  C "C1'" . DA  I 5 123 ? 103.64500 76.80400  133.22000 1.000 159.02202 ? 50  DA  I "C1'" 1 
ATOM 8312  N N9    . DA  I 5 123 ? 102.26200 77.05800  132.87600 1.000 159.02202 ? 50  DA  I N9    1 
ATOM 8313  C C8    . DA  I 5 123 ? 101.79400 78.09400  132.14000 1.000 159.02202 ? 50  DA  I C8    1 
ATOM 8314  N N7    . DA  I 5 123 ? 100.50000 78.08900  131.97800 1.000 159.02202 ? 50  DA  I N7    1 
ATOM 8315  C C5    . DA  I 5 123 ? 100.09200 76.96100  132.65000 1.000 159.02202 ? 50  DA  I C5    1 
ATOM 8316  C C6    . DA  I 5 123 ? 98.83200  76.39300  132.85000 1.000 159.02202 ? 50  DA  I C6    1 
ATOM 8317  N N6    . DA  I 5 123 ? 97.71400  76.92300  132.35900 1.000 159.02202 ? 50  DA  I N6    1 
ATOM 8318  N N1    . DA  I 5 123 ? 98.76000  75.25800  133.57100 1.000 159.02202 ? 50  DA  I N1    1 
ATOM 8319  C C2    . DA  I 5 123 ? 99.88700  74.73500  134.06300 1.000 159.02202 ? 50  DA  I C2    1 
ATOM 8320  N N3    . DA  I 5 123 ? 101.13500 75.18200  133.93500 1.000 159.02202 ? 50  DA  I N3    1 
ATOM 8321  C C4    . DA  I 5 123 ? 101.16500 76.31300  133.21700 1.000 159.02202 ? 50  DA  I C4    1 
ATOM 8322  P P     . DC  I 5 124 ? 107.34800 75.11200  132.07700 1.000 165.92906 ? 51  DC  I P     1 
ATOM 8323  O OP1   . DC  I 5 124 ? 108.61600 74.68700  132.70500 1.000 165.92906 ? 51  DC  I OP1   1 
ATOM 8324  O OP2   . DC  I 5 124 ? 107.35600 75.62500  130.69100 1.000 165.92906 ? 51  DC  I OP2   1 
ATOM 8325  O "O5'" . DC  I 5 124 ? 106.31700 73.90100  132.14300 1.000 165.92906 ? 51  DC  I "O5'" 1 
ATOM 8326  C "C5'" . DC  I 5 124 ? 105.90500 73.40100  133.40100 1.000 165.92906 ? 51  DC  I "C5'" 1 
ATOM 8327  C "C4'" . DC  I 5 124 ? 104.81500 72.37300  133.22000 1.000 165.92906 ? 51  DC  I "C4'" 1 
ATOM 8328  O "O4'" . DC  I 5 124 ? 103.55500 73.02800  132.95800 1.000 165.92906 ? 51  DC  I "O4'" 1 
ATOM 8329  C "C3'" . DC  I 5 124 ? 105.05100 71.41100  132.06200 1.000 165.92906 ? 51  DC  I "C3'" 1 
ATOM 8330  O "O3'" . DC  I 5 124 ? 105.12700 70.09700  132.55200 1.000 165.92906 ? 51  DC  I "O3'" 1 
ATOM 8331  C "C2'" . DC  I 5 124 ? 103.83600 71.60300  131.14600 1.000 165.92906 ? 51  DC  I "C2'" 1 
ATOM 8332  C "C1'" . DC  I 5 124 ? 102.81500 72.24000  132.06700 1.000 165.92906 ? 51  DC  I "C1'" 1 
ATOM 8333  N N1    . DC  I 5 124 ? 101.85200 73.10900  131.36400 1.000 165.92906 ? 51  DC  I N1    1 
ATOM 8334  C C2    . DC  I 5 124 ? 100.50200 72.77300  131.35100 1.000 165.92906 ? 51  DC  I C2    1 
ATOM 8335  O O2    . DC  I 5 124 ? 100.13100 71.75000  131.92800 1.000 165.92906 ? 51  DC  I O2    1 
ATOM 8336  N N3    . DC  I 5 124 ? 99.63300  73.58100  130.71000 1.000 165.92906 ? 51  DC  I N3    1 
ATOM 8337  C C4    . DC  I 5 124 ? 100.07300 74.67800  130.10300 1.000 165.92906 ? 51  DC  I C4    1 
ATOM 8338  N N4    . DC  I 5 124 ? 99.18000  75.44700  129.48000 1.000 165.92906 ? 51  DC  I N4    1 
ATOM 8339  C C5    . DC  I 5 124 ? 101.44700 75.03500  130.10200 1.000 165.92906 ? 51  DC  I C5    1 
ATOM 8340  C C6    . DC  I 5 124 ? 102.29200 74.22900  130.74000 1.000 165.92906 ? 51  DC  I C6    1 
ATOM 8341  P P     . DG  I 5 125 ? 105.58300 68.89700  131.59100 1.000 179.45918 ? 52  DG  I P     1 
ATOM 8342  O OP1   . DG  I 5 125 ? 106.38800 67.96600  132.41000 1.000 179.45918 ? 52  DG  I OP1   1 
ATOM 8343  O OP2   . DG  I 5 125 ? 106.15600 69.45300  130.34600 1.000 179.45918 ? 52  DG  I OP2   1 
ATOM 8344  O "O5'" . DG  I 5 125 ? 104.20400 68.18700  131.24400 1.000 179.45918 ? 52  DG  I "O5'" 1 
ATOM 8345  C "C5'" . DG  I 5 125 ? 103.30900 67.88400  132.28900 1.000 179.45918 ? 52  DG  I "C5'" 1 
ATOM 8346  C "C4'" . DG  I 5 125 ? 101.93500 67.57800  131.74400 1.000 179.45918 ? 52  DG  I "C4'" 1 
ATOM 8347  O "O4'" . DG  I 5 125 ? 101.30500 68.79000  131.27700 1.000 179.45918 ? 52  DG  I "O4'" 1 
ATOM 8348  C "C3'" . DG  I 5 125 ? 101.93800 66.61400  130.56400 1.000 179.45918 ? 52  DG  I "C3'" 1 
ATOM 8349  O "O3'" . DG  I 5 125 ? 101.21100 65.46400  130.90000 1.000 179.45918 ? 52  DG  I "O3'" 1 
ATOM 8350  C "C2'" . DG  I 5 125 ? 101.27400 67.39000  129.41800 1.000 179.45918 ? 52  DG  I "C2'" 1 
ATOM 8351  C "C1'" . DG  I 5 125 ? 100.53100 68.49100  130.14700 1.000 179.45918 ? 52  DG  I "C1'" 1 
ATOM 8352  N N9    . DG  I 5 125 ? 100.36900 69.70600  129.36500 1.000 179.45918 ? 52  DG  I N9    1 
ATOM 8353  C C8    . DG  I 5 125 ? 101.35300 70.57400  128.96800 1.000 179.45918 ? 52  DG  I C8    1 
ATOM 8354  N N7    . DG  I 5 125 ? 100.90700 71.58900  128.28900 1.000 179.45918 ? 52  DG  I N7    1 
ATOM 8355  C C5    . DG  I 5 125 ? 99.53900  71.37900  128.23300 1.000 179.45918 ? 52  DG  I C5    1 
ATOM 8356  C C6    . DG  I 5 125 ? 98.52700  72.14800  127.62600 1.000 179.45918 ? 52  DG  I C6    1 
ATOM 8357  O O6    . DG  I 5 125 ? 98.64100  73.20200  126.99400 1.000 179.45918 ? 52  DG  I O6    1 
ATOM 8358  N N1    . DG  I 5 125 ? 97.27400  71.58000  127.80300 1.000 179.45918 ? 52  DG  I N1    1 
ATOM 8359  C C2    . DG  I 5 125 ? 97.02900  70.41700  128.48500 1.000 179.45918 ? 52  DG  I C2    1 
ATOM 8360  N N2    . DG  I 5 125 ? 95.75300  70.02600  128.55300 1.000 179.45918 ? 52  DG  I N2    1 
ATOM 8361  N N3    . DG  I 5 125 ? 97.96800  69.68500  129.05900 1.000 179.45918 ? 52  DG  I N3    1 
ATOM 8362  C C4    . DG  I 5 125 ? 99.19400  70.22600  128.89300 1.000 179.45918 ? 52  DG  I C4    1 
ATOM 8363  P P     . DT  I 5 126 ? 101.37100 64.13800  130.01700 1.000 186.63624 ? 53  DT  I P     1 
ATOM 8364  O OP1   . DT  I 5 126 ? 101.26800 62.97600  130.92600 1.000 186.63624 ? 53  DT  I OP1   1 
ATOM 8365  O OP2   . DT  I 5 126 ? 102.56300 64.31200  129.15800 1.000 186.63624 ? 53  DT  I OP2   1 
ATOM 8366  O "O5'" . DT  I 5 126 ? 100.08900 64.18000  129.08000 1.000 186.63624 ? 53  DT  I "O5'" 1 
ATOM 8367  C "C5'" . DT  I 5 126 ? 98.82400  64.41600  129.65700 1.000 186.63624 ? 53  DT  I "C5'" 1 
ATOM 8368  C "C4'" . DT  I 5 126 ? 97.78100  64.62000  128.58600 1.000 186.63624 ? 53  DT  I "C4'" 1 
ATOM 8369  O "O4'" . DT  I 5 126 ? 97.82100  65.98200  128.08600 1.000 186.63624 ? 53  DT  I "O4'" 1 
ATOM 8370  C "C3'" . DT  I 5 126 ? 97.93400  63.71300  127.36600 1.000 186.63624 ? 53  DT  I "C3'" 1 
ATOM 8371  O "O3'" . DT  I 5 126 ? 96.67900  63.17200  127.04300 1.000 186.63624 ? 53  DT  I "O3'" 1 
ATOM 8372  C "C2'" . DT  I 5 126 ? 98.42300  64.67200  126.28300 1.000 186.63624 ? 53  DT  I "C2'" 1 
ATOM 8373  C "C1'" . DT  I 5 126 ? 97.70400  65.93900  126.68800 1.000 186.63624 ? 53  DT  I "C1'" 1 
ATOM 8374  N N1    . DT  I 5 126 ? 98.27300  67.16900  126.10800 1.000 186.63624 ? 53  DT  I N1    1 
ATOM 8375  C C2    . DT  I 5 126 ? 97.43500  68.05500  125.48400 1.000 186.63624 ? 53  DT  I C2    1 
ATOM 8376  O O2    . DT  I 5 126 ? 96.23600  67.88300  125.39200 1.000 186.63624 ? 53  DT  I O2    1 
ATOM 8377  N N3    . DT  I 5 126 ? 98.04800  69.16100  124.97600 1.000 186.63624 ? 53  DT  I N3    1 
ATOM 8378  C C4    . DT  I 5 126 ? 99.39300  69.45600  125.02200 1.000 186.63624 ? 53  DT  I C4    1 
ATOM 8379  O O4    . DT  I 5 126 ? 99.85500  70.47600  124.53600 1.000 186.63624 ? 53  DT  I O4    1 
ATOM 8380  C C5    . DT  I 5 126 ? 100.21700 68.48200  125.68600 1.000 186.63624 ? 53  DT  I C5    1 
ATOM 8381  C C7    . DT  I 5 126 ? 101.69400 68.69900  125.79600 1.000 186.63624 ? 53  DT  I C7    1 
ATOM 8382  C C6    . DT  I 5 126 ? 99.62500  67.39500  126.18900 1.000 186.63624 ? 53  DT  I C6    1 
ATOM 8383  P P     . DG  I 5 127 ? 96.54900  61.78800  126.23900 1.000 190.04315 ? 54  DG  I P     1 
ATOM 8384  O OP1   . DG  I 5 127 ? 96.36500  60.71400  127.23700 1.000 190.04315 ? 54  DG  I OP1   1 
ATOM 8385  O OP2   . DG  I 5 127 ? 97.63400  61.68800  125.24000 1.000 190.04315 ? 54  DG  I OP2   1 
ATOM 8386  O "O5'" . DG  I 5 127 ? 95.18400  61.98300  125.44700 1.000 190.04315 ? 54  DG  I "O5'" 1 
ATOM 8387  C "C5'" . DG  I 5 127 ? 94.02700  62.37800  126.16300 1.000 190.04315 ? 54  DG  I "C5'" 1 
ATOM 8388  C "C4'" . DG  I 5 127 ? 93.10900  63.25300  125.32400 1.000 190.04315 ? 54  DG  I "C4'" 1 
ATOM 8389  O "O4'" . DG  I 5 127 ? 93.78400  64.48100  124.96300 1.000 190.04315 ? 54  DG  I "O4'" 1 
ATOM 8390  C "C3'" . DG  I 5 127 ? 92.62100  62.64400  124.01800 1.000 190.04315 ? 54  DG  I "C3'" 1 
ATOM 8391  O "O3'" . DG  I 5 127 ? 91.29100  63.05900  123.79900 1.000 190.04315 ? 54  DG  I "O3'" 1 
ATOM 8392  C "C2'" . DG  I 5 127 ? 93.57600  63.23500  122.97800 1.000 190.04315 ? 54  DG  I "C2'" 1 
ATOM 8393  C "C1'" . DG  I 5 127 ? 93.84300  64.61200  123.55700 1.000 190.04315 ? 54  DG  I "C1'" 1 
ATOM 8394  N N9    . DG  I 5 127 ? 95.15000  65.16300  123.23300 1.000 190.04315 ? 54  DG  I N9    1 
ATOM 8395  C C8    . DG  I 5 127 ? 96.37300  64.60300  123.49300 1.000 190.04315 ? 54  DG  I C8    1 
ATOM 8396  N N7    . DG  I 5 127 ? 97.37500  65.34800  123.11700 1.000 190.04315 ? 54  DG  I N7    1 
ATOM 8397  C C5    . DG  I 5 127 ? 96.77300  66.47100  122.57500 1.000 190.04315 ? 54  DG  I C5    1 
ATOM 8398  C C6    . DG  I 5 127 ? 97.34700  67.62400  122.00000 1.000 190.04315 ? 54  DG  I C6    1 
ATOM 8399  O O6    . DG  I 5 127 ? 98.54100  67.89600  121.85500 1.000 190.04315 ? 54  DG  I O6    1 
ATOM 8400  N N1    . DG  I 5 127 ? 96.37600  68.52500  121.57400 1.000 190.04315 ? 54  DG  I N1    1 
ATOM 8401  C C2    . DG  I 5 127 ? 95.02100  68.33200  121.69300 1.000 190.04315 ? 54  DG  I C2    1 
ATOM 8402  N N2    . DG  I 5 127 ? 94.22900  69.30700  121.22300 1.000 190.04315 ? 54  DG  I N2    1 
ATOM 8403  N N3    . DG  I 5 127 ? 94.47400  67.25300  122.22800 1.000 190.04315 ? 54  DG  I N3    1 
ATOM 8404  C C4    . DG  I 5 127 ? 95.40500  66.37100  122.64600 1.000 190.04315 ? 54  DG  I C4    1 
ATOM 8405  P P     . DT  I 5 128 ? 90.42700  62.43700  122.60300 1.000 183.70141 ? 55  DT  I P     1 
ATOM 8406  O OP1   . DT  I 5 128 ? 89.02700  62.35300  123.06900 1.000 183.70141 ? 55  DT  I OP1   1 
ATOM 8407  O OP2   . DT  I 5 128 ? 91.11600  61.23200  122.09600 1.000 183.70141 ? 55  DT  I OP2   1 
ATOM 8408  O "O5'" . DT  I 5 128 ? 90.51400  63.55100  121.47500 1.000 183.70141 ? 55  DT  I "O5'" 1 
ATOM 8409  C "C5'" . DT  I 5 128 ? 90.27300  64.91100  121.79800 1.000 183.70141 ? 55  DT  I "C5'" 1 
ATOM 8410  C "C4'" . DT  I 5 128 ? 90.41000  65.80100  120.57200 1.000 183.70141 ? 55  DT  I "C4'" 1 
ATOM 8411  O "O4'" . DT  I 5 128 ? 91.78100  66.25700  120.42100 1.000 183.70141 ? 55  DT  I "O4'" 1 
ATOM 8412  C "C3'" . DT  I 5 128 ? 90.04400  65.14200  119.24900 1.000 183.70141 ? 55  DT  I "C3'" 1 
ATOM 8413  O "O3'" . DT  I 5 128 ? 89.40800  66.08700  118.42100 1.000 183.70141 ? 55  DT  I "O3'" 1 
ATOM 8414  C "C2'" . DT  I 5 128 ? 91.40700  64.75200  118.68900 1.000 183.70141 ? 55  DT  I "C2'" 1 
ATOM 8415  C "C1'" . DT  I 5 128 ? 92.23400  65.94100  119.12200 1.000 183.70141 ? 55  DT  I "C1'" 1 
ATOM 8416  N N1    . DT  I 5 128 ? 93.69400  65.69700  119.18000 1.000 183.70141 ? 55  DT  I N1    1 
ATOM 8417  C C2    . DT  I 5 128 ? 94.54700  66.70500  118.81400 1.000 183.70141 ? 55  DT  I C2    1 
ATOM 8418  O O2    . DT  I 5 128 ? 94.16500  67.79000  118.42500 1.000 183.70141 ? 55  DT  I O2    1 
ATOM 8419  N N3    . DT  I 5 128 ? 95.86800  66.40300  118.91600 1.000 183.70141 ? 55  DT  I N3    1 
ATOM 8420  C C4    . DT  I 5 128 ? 96.41800  65.21900  119.34400 1.000 183.70141 ? 55  DT  I C4    1 
ATOM 8421  O O4    . DT  I 5 128 ? 97.62600  65.04600  119.39800 1.000 183.70141 ? 55  DT  I O4    1 
ATOM 8422  C C5    . DT  I 5 128 ? 95.47300  64.20000  119.71900 1.000 183.70141 ? 55  DT  I C5    1 
ATOM 8423  C C7    . DT  I 5 128 ? 95.96000  62.86700  120.19700 1.000 183.70141 ? 55  DT  I C7    1 
ATOM 8424  C C6    . DT  I 5 128 ? 94.16800  64.48500  119.62400 1.000 183.70141 ? 55  DT  I C6    1 
ATOM 8425  P P     . DC  I 5 129 ? 88.18600  65.64200  117.48300 1.000 179.83813 ? 56  DC  I P     1 
ATOM 8426  O OP1   . DC  I 5 129 ? 86.95200  65.70300  118.29600 1.000 179.83813 ? 56  DC  I OP1   1 
ATOM 8427  O OP2   . DC  I 5 129 ? 88.57600  64.37400  116.83000 1.000 179.83813 ? 56  DC  I OP2   1 
ATOM 8428  O "O5'" . DC  I 5 129 ? 88.14000  66.76700  116.35000 1.000 179.83813 ? 56  DC  I "O5'" 1 
ATOM 8429  C "C5'" . DC  I 5 129 ? 88.34500  68.13600  116.68700 1.000 179.83813 ? 56  DC  I "C5'" 1 
ATOM 8430  C "C4'" . DC  I 5 129 ? 89.33900  68.81600  115.74500 1.000 179.83813 ? 56  DC  I "C4'" 1 
ATOM 8431  O "O4'" . DC  I 5 129 ? 90.68700  68.29500  115.93000 1.000 179.83813 ? 56  DC  I "O4'" 1 
ATOM 8432  C "C3'" . DC  I 5 129 ? 89.06000  68.67700  114.25300 1.000 179.83813 ? 56  DC  I "C3'" 1 
ATOM 8433  O "O3'" . DC  I 5 129 ? 89.48700  69.87700  113.61900 1.000 179.83813 ? 56  DC  I "O3'" 1 
ATOM 8434  C "C2'" . DC  I 5 129 ? 89.97000  67.50800  113.87500 1.000 179.83813 ? 56  DC  I "C2'" 1 
ATOM 8435  C "C1'" . DC  I 5 129 ? 91.19700  67.88900  114.67000 1.000 179.83813 ? 56  DC  I "C1'" 1 
ATOM 8436  N N1    . DC  I 5 129 ? 92.16700  66.80000  114.89400 1.000 179.83813 ? 56  DC  I N1    1 
ATOM 8437  C C2    . DC  I 5 129 ? 93.53300  67.07300  114.83100 1.000 179.83813 ? 56  DC  I C2    1 
ATOM 8438  O O2    . DC  I 5 129 ? 93.90900  68.20800  114.53900 1.000 179.83813 ? 56  DC  I O2    1 
ATOM 8439  N N3    . DC  I 5 129 ? 94.40700  66.07600  115.06400 1.000 179.83813 ? 56  DC  I N3    1 
ATOM 8440  C C4    . DC  I 5 129 ? 93.96800  64.86700  115.37300 1.000 179.83813 ? 56  DC  I C4    1 
ATOM 8441  N N4    . DC  I 5 129 ? 94.87100  63.91900  115.60600 1.000 179.83813 ? 56  DC  I N4    1 
ATOM 8442  C C5    . DC  I 5 129 ? 92.58500  64.56900  115.44400 1.000 179.83813 ? 56  DC  I C5    1 
ATOM 8443  C C6    . DC  I 5 129 ? 91.72600  65.56200  115.21800 1.000 179.83813 ? 56  DC  I C6    1 
ATOM 8444  P P     . DA  I 5 130 ? 88.42700  70.96400  113.09900 1.000 182.57494 ? 57  DA  I P     1 
ATOM 8445  O OP1   . DA  I 5 130 ? 87.77400  71.54700  114.28900 1.000 182.57494 ? 57  DA  I OP1   1 
ATOM 8446  O OP2   . DA  I 5 130 ? 87.61300  70.33700  112.03800 1.000 182.57494 ? 57  DA  I OP2   1 
ATOM 8447  O "O5'" . DA  I 5 130 ? 89.34000  72.07800  112.40300 1.000 182.57494 ? 57  DA  I "O5'" 1 
ATOM 8448  C "C5'" . DA  I 5 130 ? 90.49400  72.57800  113.08700 1.000 182.57494 ? 57  DA  I "C5'" 1 
ATOM 8449  C "C4'" . DA  I 5 130 ? 91.44600  73.37300  112.18000 1.000 182.57494 ? 57  DA  I "C4'" 1 
ATOM 8450  O "O4'" . DA  I 5 130 ? 92.59200  72.58900  111.81800 1.000 182.57494 ? 57  DA  I "O4'" 1 
ATOM 8451  C "C3'" . DA  I 5 130 ? 90.90000  73.88200  110.85900 1.000 182.57494 ? 57  DA  I "C3'" 1 
ATOM 8452  O "O3'" . DA  I 5 130 ? 91.64600  75.07200  110.48700 1.000 182.57494 ? 57  DA  I "O3'" 1 
ATOM 8453  C "C2'" . DA  I 5 130 ? 91.17800  72.70000  109.91300 1.000 182.57494 ? 57  DA  I "C2'" 1 
ATOM 8454  C "C1'" . DA  I 5 130 ? 92.36400  71.98300  110.56900 1.000 182.57494 ? 57  DA  I "C1'" 1 
ATOM 8455  N N9    . DA  I 5 130 ? 92.13800  70.57000  110.79600 1.000 182.57494 ? 57  DA  I N9    1 
ATOM 8456  C C8    . DA  I 5 130 ? 90.94200  69.92600  110.81700 1.000 182.57494 ? 57  DA  I C8    1 
ATOM 8457  N N7    . DA  I 5 130 ? 91.03900  68.65100  111.06300 1.000 182.57494 ? 57  DA  I N7    1 
ATOM 8458  C C5    . DA  I 5 130 ? 92.38700  68.44800  111.24900 1.000 182.57494 ? 57  DA  I C5    1 
ATOM 8459  C C6    . DA  I 5 130 ? 93.14100  67.30300  111.54600 1.000 182.57494 ? 57  DA  I C6    1 
ATOM 8460  N N6    . DA  I 5 130 ? 92.60300  66.09800  111.73600 1.000 182.57494 ? 57  DA  I N6    1 
ATOM 8461  N N1    . DA  I 5 130 ? 94.47700  67.44200  111.64200 1.000 182.57494 ? 57  DA  I N1    1 
ATOM 8462  C C2    . DA  I 5 130 ? 95.01400  68.65000  111.45200 1.000 182.57494 ? 57  DA  I C2    1 
ATOM 8463  N N3    . DA  I 5 130 ? 94.40600  69.79500  111.16700 1.000 182.57494 ? 57  DA  I N3    1 
ATOM 8464  C C4    . DA  I 5 130 ? 93.08200  69.62100  111.08100 1.000 182.57494 ? 57  DA  I C4    1 
ATOM 8465  P P     . DG  I 5 131 ? 91.74200  75.61500  108.97100 1.000 189.59116 ? 58  DG  I P     1 
ATOM 8466  O OP1   . DG  I 5 131 ? 92.19700  77.01500  109.08600 1.000 189.59116 ? 58  DG  I OP1   1 
ATOM 8467  O OP2   . DG  I 5 131 ? 90.48100  75.35200  108.24600 1.000 189.59116 ? 58  DG  I OP2   1 
ATOM 8468  O "O5'" . DG  I 5 131 ? 92.93500  74.78000  108.30400 1.000 189.59116 ? 58  DG  I "O5'" 1 
ATOM 8469  C "C5'" . DG  I 5 131 ? 94.23300  74.77300  108.88700 1.000 189.59116 ? 58  DG  I "C5'" 1 
ATOM 8470  C "C4'" . DG  I 5 131 ? 95.18400  73.82300  108.15700 1.000 189.59116 ? 58  DG  I "C4'" 1 
ATOM 8471  O "O4'" . DG  I 5 131 ? 94.88400  72.43700  108.48500 1.000 189.59116 ? 58  DG  I "O4'" 1 
ATOM 8472  C "C3'" . DG  I 5 131 ? 95.16000  73.89100  106.62900 1.000 189.59116 ? 58  DG  I "C3'" 1 
ATOM 8473  O "O3'" . DG  I 5 131 ? 96.45100  73.64200  106.13300 1.000 189.59116 ? 58  DG  I "O3'" 1 
ATOM 8474  C "C2'" . DG  I 5 131 ? 94.25000  72.72200  106.27500 1.000 189.59116 ? 58  DG  I "C2'" 1 
ATOM 8475  C "C1'" . DG  I 5 131 ? 94.74900  71.70900  107.28500 1.000 189.59116 ? 58  DG  I "C1'" 1 
ATOM 8476  N N9    . DG  I 5 131 ? 93.86500  70.56900  107.49600 1.000 189.59116 ? 58  DG  I N9    1 
ATOM 8477  C C8    . DG  I 5 131 ? 92.49600  70.56100  107.46900 1.000 189.59116 ? 58  DG  I C8    1 
ATOM 8478  N N7    . DG  I 5 131 ? 91.97800  69.39700  107.73200 1.000 189.59116 ? 58  DG  I N7    1 
ATOM 8479  C C5    . DG  I 5 131 ? 93.07500  68.57700  107.93100 1.000 189.59116 ? 58  DG  I C5    1 
ATOM 8480  C C6    . DG  I 5 131 ? 93.13600  67.20100  108.23400 1.000 189.59116 ? 58  DG  I C6    1 
ATOM 8481  O O6    . DG  I 5 131 ? 92.20000  66.41200  108.39800 1.000 189.59116 ? 58  DG  I O6    1 
ATOM 8482  N N1    . DG  I 5 131 ? 94.44600  66.75900  108.35800 1.000 189.59116 ? 58  DG  I N1    1 
ATOM 8483  C C2    . DG  I 5 131 ? 95.55800  67.54800  108.20000 1.000 189.59116 ? 58  DG  I C2    1 
ATOM 8484  N N2    . DG  I 5 131 ? 96.74400  66.94300  108.35200 1.000 189.59116 ? 58  DG  I N2    1 
ATOM 8485  N N3    . DG  I 5 131 ? 95.51400  68.84000  107.91300 1.000 189.59116 ? 58  DG  I N3    1 
ATOM 8486  C C4    . DG  I 5 131 ? 94.24300  69.28500  107.79500 1.000 189.59116 ? 58  DG  I C4    1 
ATOM 8487  P P     . DA  I 5 132 ? 97.26200  74.78200  105.35500 1.000 207.02901 ? 59  DA  I P     1 
ATOM 8488  O OP1   . DA  I 5 132 ? 97.66200  75.79000  106.35700 1.000 207.02901 ? 59  DA  I OP1   1 
ATOM 8489  O OP2   . DA  I 5 132 ? 96.46500  75.18600  104.17900 1.000 207.02901 ? 59  DA  I OP2   1 
ATOM 8490  O "O5'" . DA  I 5 132 ? 98.56900  74.02300  104.83700 1.000 207.02901 ? 59  DA  I "O5'" 1 
ATOM 8491  C "C5'" . DA  I 5 132 ? 99.44800  73.41300  105.76900 1.000 207.02901 ? 59  DA  I "C5'" 1 
ATOM 8492  C "C4'" . DA  I 5 132 ? 100.03500 72.10900  105.23600 1.000 207.02901 ? 59  DA  I "C4'" 1 
ATOM 8493  O "O4'" . DA  I 5 132 ? 99.14700  70.99500  105.51900 1.000 207.02901 ? 59  DA  I "O4'" 1 
ATOM 8494  C "C3'" . DA  I 5 132 ? 100.30600 72.06900  103.73700 1.000 207.02901 ? 59  DA  I "C3'" 1 
ATOM 8495  O "O3'" . DA  I 5 132 ? 101.53000 71.39200  103.49700 1.000 207.02901 ? 59  DA  I "O3'" 1 
ATOM 8496  C "C2'" . DA  I 5 132 ? 99.11300  71.28000  103.19000 1.000 207.02901 ? 59  DA  I "C2'" 1 
ATOM 8497  C "C1'" . DA  I 5 132 ? 98.81700  70.31400  104.32500 1.000 207.02901 ? 59  DA  I "C1'" 1 
ATOM 8498  N N9    . DA  I 5 132 ? 97.41700  69.93100  104.39700 1.000 207.02901 ? 59  DA  I N9    1 
ATOM 8499  C C8    . DA  I 5 132 ? 96.34600  70.75700  104.29100 1.000 207.02901 ? 59  DA  I C8    1 
ATOM 8500  N N7    . DA  I 5 132 ? 95.19200  70.14500  104.39200 1.000 207.02901 ? 59  DA  I N7    1 
ATOM 8501  C C5    . DA  I 5 132 ? 95.53200  68.83700  104.63200 1.000 207.02901 ? 59  DA  I C5    1 
ATOM 8502  C C6    . DA  I 5 132 ? 94.75900  67.68800  104.84900 1.000 207.02901 ? 59  DA  I C6    1 
ATOM 8503  N N6    . DA  I 5 132 ? 93.42500  67.69700  104.86600 1.000 207.02901 ? 59  DA  I N6    1 
ATOM 8504  N N1    . DA  I 5 132 ? 95.40800  66.52500  105.04400 1.000 207.02901 ? 59  DA  I N1    1 
ATOM 8505  C C2    . DA  I 5 132 ? 96.74700  66.52300  105.02400 1.000 207.02901 ? 59  DA  I C2    1 
ATOM 8506  N N3    . DA  I 5 132 ? 97.58200  67.54200  104.82800 1.000 207.02901 ? 59  DA  I N3    1 
ATOM 8507  C C4    . DA  I 5 132 ? 96.90300  68.68000  104.63700 1.000 207.02901 ? 59  DA  I C4    1 
ATOM 8508  P P     . DT  I 5 133 ? 102.08000 71.19500  102.00000 1.000 225.45539 ? 60  DT  I P     1 
ATOM 8509  O OP1   . DT  I 5 133 ? 103.55300 71.11700  102.08800 1.000 225.45539 ? 60  DT  I OP1   1 
ATOM 8510  O OP2   . DT  I 5 133 ? 101.45800 72.20800  101.11900 1.000 225.45539 ? 60  DT  I OP2   1 
ATOM 8511  O "O5'" . DT  I 5 133 ? 101.52700 69.75700  101.58500 1.000 225.45539 ? 60  DT  I "O5'" 1 
ATOM 8512  C "C5'" . DT  I 5 133 ? 101.74600 68.65100  102.44300 1.000 225.45539 ? 60  DT  I "C5'" 1 
ATOM 8513  C "C4'" . DT  I 5 133 ? 101.19500 67.38100  101.83000 1.000 225.45539 ? 60  DT  I "C4'" 1 
ATOM 8514  O "O4'" . DT  I 5 133 ? 99.79000  67.23200  102.15200 1.000 225.45539 ? 60  DT  I "O4'" 1 
ATOM 8515  C "C3'" . DT  I 5 133 ? 101.29800 67.30600  100.30400 1.000 225.45539 ? 60  DT  I "C3'" 1 
ATOM 8516  O "O3'" . DT  I 5 133 ? 101.81500 66.05100  99.92600  1.000 225.45539 ? 60  DT  I "O3'" 1 
ATOM 8517  C "C2'" . DT  I 5 133 ? 99.84900  67.45300  99.85100  1.000 225.45539 ? 60  DT  I "C2'" 1 
ATOM 8518  C "C1'" . DT  I 5 133 ? 99.12000  66.79300  101.00100 1.000 225.45539 ? 60  DT  I "C1'" 1 
ATOM 8519  N N1    . DT  I 5 133 ? 97.70200  67.15400  101.09000 1.000 225.45539 ? 60  DT  I N1    1 
ATOM 8520  C C2    . DT  I 5 133 ? 96.77800  66.15400  101.21100 1.000 225.45539 ? 60  DT  I C2    1 
ATOM 8521  O O2    . DT  I 5 133 ? 97.07500  64.97900  101.27900 1.000 225.45539 ? 60  DT  I O2    1 
ATOM 8522  N N3    . DT  I 5 133 ? 95.49000  66.57200  101.27300 1.000 225.45539 ? 60  DT  I N3    1 
ATOM 8523  C C4    . DT  I 5 133 ? 95.03600  67.86900  101.21000 1.000 225.45539 ? 60  DT  I C4    1 
ATOM 8524  O O4    . DT  I 5 133 ? 93.84900  68.14400  101.27100 1.000 225.45539 ? 60  DT  I O4    1 
ATOM 8525  C C5    . DT  I 5 133 ? 96.05500  68.87500  101.06600 1.000 225.45539 ? 60  DT  I C5    1 
ATOM 8526  C C7    . DT  I 5 133 ? 95.67700  70.31900  100.97300 1.000 225.45539 ? 60  DT  I C7    1 
ATOM 8527  C C6    . DT  I 5 133 ? 97.32800  68.47300  101.00800 1.000 225.45539 ? 60  DT  I C6    1 
ATOM 8528  P P     . DA  I 5 134 ? 102.43200 65.82900  98.46100  1.000 257.15597 ? 61  DA  I P     1 
ATOM 8529  O OP1   . DA  I 5 134 ? 103.82000 65.35800  98.64900  1.000 257.15597 ? 61  DA  I OP1   1 
ATOM 8530  O OP2   . DA  I 5 134 ? 102.17600 67.02400  97.62900  1.000 257.15597 ? 61  DA  I OP2   1 
ATOM 8531  O "O5'" . DA  I 5 134 ? 101.57200 64.62200  97.86900  1.000 257.15597 ? 61  DA  I "O5'" 1 
ATOM 8532  C "C5'" . DA  I 5 134 ? 101.44500 63.42000  98.60500  1.000 257.15597 ? 61  DA  I "C5'" 1 
ATOM 8533  C "C4'" . DA  I 5 134 ? 100.21800 62.64300  98.16500  1.000 257.15597 ? 61  DA  I "C4'" 1 
ATOM 8534  O "O4'" . DA  I 5 134 ? 99.01600  63.31500  98.61100  1.000 257.15597 ? 61  DA  I "O4'" 1 
ATOM 8535  C "C3'" . DA  I 5 134 ? 100.08000 62.46700  96.65200  1.000 257.15597 ? 61  DA  I "C3'" 1 
ATOM 8536  O "O3'" . DA  I 5 134 ? 99.89900  61.10000  96.35100  1.000 257.15597 ? 61  DA  I "O3'" 1 
ATOM 8537  C "C2'" . DA  I 5 134 ? 98.84400  63.29500  96.28400  1.000 257.15597 ? 61  DA  I "C2'" 1 
ATOM 8538  C "C1'" . DA  I 5 134 ? 98.05900  63.29000  97.58100  1.000 257.15597 ? 61  DA  I "C1'" 1 
ATOM 8539  N N9    . DA  I 5 134 ? 97.19400  64.44600  97.74100  1.000 257.15597 ? 61  DA  I N9    1 
ATOM 8540  C C8    . DA  I 5 134 ? 97.57600  65.75100  97.83300  1.000 257.15597 ? 61  DA  I C8    1 
ATOM 8541  N N7    . DA  I 5 134 ? 96.57900  66.58400  97.99300  1.000 257.15597 ? 61  DA  I N7    1 
ATOM 8542  C C5    . DA  I 5 134 ? 95.46800  65.76300  98.01500  1.000 257.15597 ? 61  DA  I C5    1 
ATOM 8543  C C6    . DA  I 5 134 ? 94.09700  66.02800  98.15600  1.000 257.15597 ? 61  DA  I C6    1 
ATOM 8544  N N6    . DA  I 5 134 ? 93.60000  67.25600  98.30800  1.000 257.15597 ? 61  DA  I N6    1 
ATOM 8545  N N1    . DA  I 5 134 ? 93.25300  64.97900  98.13300  1.000 257.15597 ? 61  DA  I N1    1 
ATOM 8546  C C2    . DA  I 5 134 ? 93.75100  63.75000  97.97700  1.000 257.15597 ? 61  DA  I C2    1 
ATOM 8547  N N3    . DA  I 5 134 ? 95.01800  63.37700  97.83800  1.000 257.15597 ? 61  DA  I N3    1 
ATOM 8548  C C4    . DA  I 5 134 ? 95.83200  64.44200  97.86400  1.000 257.15597 ? 61  DA  I C4    1 
ATOM 8549  P P     . DT  I 5 135 ? 100.02900 60.58000  94.83900  1.000 278.80353 ? 62  DT  I P     1 
ATOM 8550  O OP1   . DT  I 5 135 ? 100.60700 59.21900  94.88300  1.000 278.80353 ? 62  DT  I OP1   1 
ATOM 8551  O OP2   . DT  I 5 135 ? 100.69300 61.64100  94.04900  1.000 278.80353 ? 62  DT  I OP2   1 
ATOM 8552  O "O5'" . DT  I 5 135 ? 98.51300  60.47200  94.35200  1.000 278.80353 ? 62  DT  I "O5'" 1 
ATOM 8553  C "C5'" . DT  I 5 135 ? 97.59900  59.67700  95.08900  1.000 278.80353 ? 62  DT  I "C5'" 1 
ATOM 8554  C "C4'" . DT  I 5 135 ? 96.18400  59.89300  94.59600  1.000 278.80353 ? 62  DT  I "C4'" 1 
ATOM 8555  O "O4'" . DT  I 5 135 ? 95.69900  61.17900  95.04100  1.000 278.80353 ? 62  DT  I "O4'" 1 
ATOM 8556  C "C3'" . DT  I 5 135 ? 96.02400  59.88100  93.07000  1.000 278.80353 ? 62  DT  I "C3'" 1 
ATOM 8557  O "O3'" . DT  I 5 135 ? 95.14400  58.83000  92.69300  1.000 278.80353 ? 62  DT  I "O3'" 1 
ATOM 8558  C "C2'" . DT  I 5 135 ? 95.44200  61.26200  92.73900  1.000 278.80353 ? 62  DT  I "C2'" 1 
ATOM 8559  C "C1'" . DT  I 5 135 ? 94.83400  61.68100  94.06100  1.000 278.80353 ? 62  DT  I "C1'" 1 
ATOM 8560  N N1    . DT  I 5 135 ? 94.72000  63.14800  94.22200  1.000 278.80353 ? 62  DT  I N1    1 
ATOM 8561  C C2    . DT  I 5 135 ? 93.48000  63.69800  94.38200  1.000 278.80353 ? 62  DT  I C2    1 
ATOM 8562  O O2    . DT  I 5 135 ? 92.45800  63.04000  94.39900  1.000 278.80353 ? 62  DT  I O2    1 
ATOM 8563  N N3    . DT  I 5 135 ? 93.46900  65.05400  94.52100  1.000 278.80353 ? 62  DT  I N3    1 
ATOM 8564  C C4    . DT  I 5 135 ? 94.55300  65.90300  94.51700  1.000 278.80353 ? 62  DT  I C4    1 
ATOM 8565  O O4    . DT  I 5 135 ? 94.43300  67.11500  94.65200  1.000 278.80353 ? 62  DT  I O4    1 
ATOM 8566  C C5    . DT  I 5 135 ? 95.83400  65.26300  94.34500  1.000 278.80353 ? 62  DT  I C5    1 
ATOM 8567  C C7    . DT  I 5 135 ? 97.08900  66.08100  94.32200  1.000 278.80353 ? 62  DT  I C7    1 
ATOM 8568  C C6    . DT  I 5 135 ? 95.85600  63.92900  94.20700  1.000 278.80353 ? 62  DT  I C6    1 
ATOM 8569  P P     . DA  I 5 136 ? 94.84000  58.51000  91.14600  1.000 284.57022 ? 63  DA  I P     1 
ATOM 8570  O OP1   . DA  I 5 136 ? 94.68900  57.04200  91.04800  1.000 284.57022 ? 63  DA  I OP1   1 
ATOM 8571  O OP2   . DA  I 5 136 ? 95.82600  59.19300  90.27700  1.000 284.57022 ? 63  DA  I OP2   1 
ATOM 8572  O "O5'" . DA  I 5 136 ? 93.40500  59.16700  90.90700  1.000 284.57022 ? 63  DA  I "O5'" 1 
ATOM 8573  C "C5'" . DA  I 5 136 ? 92.32000  58.77800  91.73600  1.000 284.57022 ? 63  DA  I "C5'" 1 
ATOM 8574  C "C4'" . DA  I 5 136 ? 91.11000  59.66000  91.50900  1.000 284.57022 ? 63  DA  I "C4'" 1 
ATOM 8575  O "O4'" . DA  I 5 136 ? 91.39100  61.00300  91.97700  1.000 284.57022 ? 63  DA  I "O4'" 1 
ATOM 8576  C "C3'" . DA  I 5 136 ? 90.67400  59.79400  90.05100  1.000 284.57022 ? 63  DA  I "C3'" 1 
ATOM 8577  O "O3'" . DA  I 5 136 ? 89.27300  59.60400  89.96200  1.000 284.57022 ? 63  DA  I "O3'" 1 
ATOM 8578  C "C2'" . DA  I 5 136 ? 91.07600  61.22400  89.68700  1.000 284.57022 ? 63  DA  I "C2'" 1 
ATOM 8579  C "C1'" . DA  I 5 136 ? 90.94200  61.92900  91.02100  1.000 284.57022 ? 63  DA  I "C1'" 1 
ATOM 8580  N N9    . DA  I 5 136 ? 91.75800  63.13100  91.13600  1.000 284.57022 ? 63  DA  I N9    1 
ATOM 8581  C C8    . DA  I 5 136 ? 93.11400  63.22700  91.00200  1.000 284.57022 ? 63  DA  I C8    1 
ATOM 8582  N N7    . DA  I 5 136 ? 93.57900  64.44000  91.17700  1.000 284.57022 ? 63  DA  I N7    1 
ATOM 8583  C C5    . DA  I 5 136 ? 92.45000  65.18500  91.45400  1.000 284.57022 ? 63  DA  I C5    1 
ATOM 8584  C C6    . DA  I 5 136 ? 92.25800  66.54900  91.73900  1.000 284.57022 ? 63  DA  I C6    1 
ATOM 8585  N N6    . DA  I 5 136 ? 93.25100  67.44100  91.79100  1.000 284.57022 ? 63  DA  I N6    1 
ATOM 8586  N N1    . DA  I 5 136 ? 90.99900  66.96300  91.96800  1.000 284.57022 ? 63  DA  I N1    1 
ATOM 8587  C C2    . DA  I 5 136 ? 90.00300  66.07400  91.91500  1.000 284.57022 ? 63  DA  I C2    1 
ATOM 8588  N N3    . DA  I 5 136 ? 90.06000  64.77300  91.66100  1.000 284.57022 ? 63  DA  I N3    1 
ATOM 8589  C C4    . DA  I 5 136 ? 91.32100  64.39000  91.43700  1.000 284.57022 ? 63  DA  I C4    1 
ATOM 8590  P P     . DT  I 5 137 ? 88.55800  59.40400  88.53700  1.000 300.15894 ? 64  DT  I P     1 
ATOM 8591  O OP1   . DT  I 5 137 ? 87.60100  58.28600  88.67900  1.000 300.15894 ? 64  DT  I OP1   1 
ATOM 8592  O OP2   . DT  I 5 137 ? 89.58800  59.34700  87.47500  1.000 300.15894 ? 64  DT  I OP2   1 
ATOM 8593  O "O5'" . DT  I 5 137 ? 87.72600  60.75200  88.36200  1.000 300.15894 ? 64  DT  I "O5'" 1 
ATOM 8594  C "C5'" . DT  I 5 137 ? 86.83100  61.15800  89.38600  1.000 300.15894 ? 64  DT  I "C5'" 1 
ATOM 8595  C "C4'" . DT  I 5 137 ? 86.25200  62.52800  89.08900  1.000 300.15894 ? 64  DT  I "C4'" 1 
ATOM 8596  O "O4'" . DT  I 5 137 ? 87.22200  63.56600  89.40300  1.000 300.15894 ? 64  DT  I "O4'" 1 
ATOM 8597  C "C3'" . DT  I 5 137 ? 85.83900  62.76300  87.63600  1.000 300.15894 ? 64  DT  I "C3'" 1 
ATOM 8598  O "O3'" . DT  I 5 137 ? 84.58200  63.41000  87.60900  1.000 300.15894 ? 64  DT  I "O3'" 1 
ATOM 8599  C "C2'" . DT  I 5 137 ? 86.94600  63.66600  87.10500  1.000 300.15894 ? 64  DT  I "C2'" 1 
ATOM 8600  C "C1'" . DT  I 5 137 ? 87.26000  64.48400  88.33700  1.000 300.15894 ? 64  DT  I "C1'" 1 
ATOM 8601  N N1    . DT  I 5 137 ? 88.58400  65.13700  88.30100  1.000 300.15894 ? 64  DT  I N1    1 
ATOM 8602  C C2    . DT  I 5 137 ? 88.66500  66.47900  88.55600  1.000 300.15894 ? 64  DT  I C2    1 
ATOM 8603  O O2    . DT  I 5 137 ? 87.69800  67.16800  88.81500  1.000 300.15894 ? 64  DT  I O2    1 
ATOM 8604  N N3    . DT  I 5 137 ? 89.92300  66.99600  88.49400  1.000 300.15894 ? 64  DT  I N3    1 
ATOM 8605  C C4    . DT  I 5 137 ? 91.08800  66.32200  88.21100  1.000 300.15894 ? 64  DT  I C4    1 
ATOM 8606  O O4    . DT  I 5 137 ? 92.17500  66.88200  88.18400  1.000 300.15894 ? 64  DT  I O4    1 
ATOM 8607  C C5    . DT  I 5 137 ? 90.93700  64.91400  87.95100  1.000 300.15894 ? 64  DT  I C5    1 
ATOM 8608  C C7    . DT  I 5 137 ? 92.13700  64.07800  87.62700  1.000 300.15894 ? 64  DT  I C7    1 
ATOM 8609  C C6    . DT  I 5 137 ? 89.70400  64.39300  88.00600  1.000 300.15894 ? 64  DT  I C6    1 
ATOM 8610  P P     . DA  I 5 138 ? 83.64700  63.35400  86.30400  1.000 314.60982 ? 65  DA  I P     1 
ATOM 8611  O OP1   . DA  I 5 138 ? 82.41900  62.62300  86.67500  1.000 314.60982 ? 65  DA  I OP1   1 
ATOM 8612  O OP2   . DA  I 5 138 ? 84.44900  62.89200  85.15100  1.000 314.60982 ? 65  DA  I OP2   1 
ATOM 8613  O "O5'" . DA  I 5 138 ? 83.28000  64.89000  86.05800  1.000 314.60982 ? 65  DA  I "O5'" 1 
ATOM 8614  C "C5'" . DA  I 5 138 ? 82.65500  65.63500  87.09900  1.000 314.60982 ? 65  DA  I "C5'" 1 
ATOM 8615  C "C4'" . DA  I 5 138 ? 82.91800  67.12300  86.94800  1.000 314.60982 ? 65  DA  I "C4'" 1 
ATOM 8616  O "O4'" . DA  I 5 138 ? 84.33000  67.39100  87.12200  1.000 314.60982 ? 65  DA  I "O4'" 1 
ATOM 8617  C "C3'" . DA  I 5 138 ? 82.52900  67.71000  85.59000  1.000 314.60982 ? 65  DA  I "C3'" 1 
ATOM 8618  O "O3'" . DA  I 5 138 ? 81.81100  68.92600  85.78000  1.000 314.60982 ? 65  DA  I "O3'" 1 
ATOM 8619  C "C2'" . DA  I 5 138 ? 83.87900  67.94200  84.90500  1.000 314.60982 ? 65  DA  I "C2'" 1 
ATOM 8620  C "C1'" . DA  I 5 138 ? 84.77900  68.23400  86.09000  1.000 314.60982 ? 65  DA  I "C1'" 1 
ATOM 8621  N N9    . DA  I 5 138 ? 86.17900  67.92300  85.84500  1.000 314.60982 ? 65  DA  I N9    1 
ATOM 8622  C C8    . DA  I 5 138 ? 86.70500  66.70400  85.54500  1.000 314.60982 ? 65  DA  I C8    1 
ATOM 8623  N N7    . DA  I 5 138 ? 88.00400  66.70800  85.38900  1.000 314.60982 ? 65  DA  I N7    1 
ATOM 8624  C C5    . DA  I 5 138 ? 88.35200  68.02700  85.59500  1.000 314.60982 ? 65  DA  I C5    1 
ATOM 8625  C C6    . DA  I 5 138 ? 89.58500  68.69400  85.56900  1.000 314.60982 ? 65  DA  I C6    1 
ATOM 8626  N N6    . DA  I 5 138 ? 90.74300  68.08400  85.30900  1.000 314.60982 ? 65  DA  I N6    1 
ATOM 8627  N N1    . DA  I 5 138 ? 89.58100  70.01900  85.81900  1.000 314.60982 ? 65  DA  I N1    1 
ATOM 8628  C C2    . DA  I 5 138 ? 88.42000  70.62800  86.07900  1.000 314.60982 ? 65  DA  I C2    1 
ATOM 8629  N N3    . DA  I 5 138 ? 87.20100  70.10500  86.13500  1.000 314.60982 ? 65  DA  I N3    1 
ATOM 8630  C C4    . DA  I 5 138 ? 87.23800  68.78900  85.88500  1.000 314.60982 ? 65  DA  I C4    1 
ATOM 8631  P P     . DC  I 5 139 ? 81.17000  69.70300  84.52800  1.000 325.00516 ? 66  DC  I P     1 
ATOM 8632  O OP1   . DC  I 5 139 ? 79.91400  70.31100  85.01300  1.000 325.00516 ? 66  DC  I OP1   1 
ATOM 8633  O OP2   . DC  I 5 139 ? 81.14100  68.80400  83.35300  1.000 325.00516 ? 66  DC  I OP2   1 
ATOM 8634  O "O5'" . DC  I 5 139 ? 82.20300  70.88000  84.23000  1.000 325.00516 ? 66  DC  I "O5'" 1 
ATOM 8635  C "C5'" . DC  I 5 139 ? 82.49100  71.83800  85.23200  1.000 325.00516 ? 66  DC  I "C5'" 1 
ATOM 8636  C "C4'" . DC  I 5 139 ? 83.50800  72.84200  84.73000  1.000 325.00516 ? 66  DC  I "C4'" 1 
ATOM 8637  O "O4'" . DC  I 5 139 ? 84.80700  72.21000  84.65000  1.000 325.00516 ? 66  DC  I "O4'" 1 
ATOM 8638  C "C3'" . DC  I 5 139 ? 83.23100  73.41500  83.33400  1.000 325.00516 ? 66  DC  I "C3'" 1 
ATOM 8639  O "O3'" . DC  I 5 139 ? 83.42000  74.82000  83.35700  1.000 325.00516 ? 66  DC  I "O3'" 1 
ATOM 8640  C "C2'" . DC  I 5 139 ? 84.28200  72.72500  82.46000  1.000 325.00516 ? 66  DC  I "C2'" 1 
ATOM 8641  C "C1'" . DC  I 5 139 ? 85.41800  72.59100  83.44700  1.000 325.00516 ? 66  DC  I "C1'" 1 
ATOM 8642  N N1    . DC  I 5 139 ? 86.40800  71.56300  83.08300  1.000 325.00516 ? 66  DC  I N1    1 
ATOM 8643  C C2    . DC  I 5 139 ? 87.73800  71.93600  82.93100  1.000 325.00516 ? 66  DC  I C2    1 
ATOM 8644  O O2    . DC  I 5 139 ? 88.04400  73.11800  83.10800  1.000 325.00516 ? 66  DC  I O2    1 
ATOM 8645  N N3    . DC  I 5 139 ? 88.64900  70.99500  82.60500  1.000 325.00516 ? 66  DC  I N3    1 
ATOM 8646  C C4    . DC  I 5 139 ? 88.26600  69.72900  82.43000  1.000 325.00516 ? 66  DC  I C4    1 
ATOM 8647  N N4    . DC  I 5 139 ? 89.20200  68.83500  82.10800  1.000 325.00516 ? 66  DC  I N4    1 
ATOM 8648  C C5    . DC  I 5 139 ? 86.90600  69.32800  82.57400  1.000 325.00516 ? 66  DC  I C5    1 
ATOM 8649  C C6    . DC  I 5 139 ? 86.01800  70.27000  82.90300  1.000 325.00516 ? 66  DC  I C6    1 
ATOM 8650  P P     . DA  I 5 140 ? 82.72700  75.76700  82.25900  1.000 342.77351 ? 67  DA  I P     1 
ATOM 8651  O OP1   . DA  I 5 140 ? 81.61500  76.46900  82.93400  1.000 342.77351 ? 67  DA  I OP1   1 
ATOM 8652  O OP2   . DA  I 5 140 ? 82.46100  75.00200  81.02100  1.000 342.77351 ? 67  DA  I OP2   1 
ATOM 8653  O "O5'" . DA  I 5 140 ? 83.86500  76.83300  81.92900  1.000 342.77351 ? 67  DA  I "O5'" 1 
ATOM 8654  C "C5'" . DA  I 5 140 ? 84.42700  77.62100  82.96900  1.000 342.77351 ? 67  DA  I "C5'" 1 
ATOM 8655  C "C4'" . DA  I 5 140 ? 85.79900  78.15000  82.57700  1.000 342.77351 ? 67  DA  I "C4'" 1 
ATOM 8656  O "O4'" . DA  I 5 140 ? 86.73900  77.05000  82.45100  1.000 342.77351 ? 67  DA  I "O4'" 1 
ATOM 8657  C "C3'" . DA  I 5 140 ? 85.84900  78.91500  81.25500  1.000 342.77351 ? 67  DA  I "C3'" 1 
ATOM 8658  O "O3'" . DA  I 5 140 ? 86.67200  80.06700  81.39700  1.000 342.77351 ? 67  DA  I "O3'" 1 
ATOM 8659  C "C2'" . DA  I 5 140 ? 86.45100  77.89500  80.28800  1.000 342.77351 ? 67  DA  I "C2'" 1 
ATOM 8660  C "C1'" . DA  I 5 140 ? 87.37600  77.10400  81.19400  1.000 342.77351 ? 67  DA  I "C1'" 1 
ATOM 8661  N N9    . DA  I 5 140 ? 87.59600  75.73400  80.74900  1.000 342.77351 ? 67  DA  I N9    1 
ATOM 8662  C C8    . DA  I 5 140 ? 86.63700  74.80700  80.45100  1.000 342.77351 ? 67  DA  I C8    1 
ATOM 8663  N N7    . DA  I 5 140 ? 87.12000  73.64600  80.08400  1.000 342.77351 ? 67  DA  I N7    1 
ATOM 8664  C C5    . DA  I 5 140 ? 88.49000  73.82700  80.13200  1.000 342.77351 ? 67  DA  I C5    1 
ATOM 8665  C C6    . DA  I 5 140 ? 89.56700  72.96900  79.85900  1.000 342.77351 ? 67  DA  I C6    1 
ATOM 8666  N N6    . DA  I 5 140 ? 89.40900  71.70700  79.45800  1.000 342.77351 ? 67  DA  I N6    1 
ATOM 8667  N N1    . DA  I 5 140 ? 90.81600  73.45800  80.01100  1.000 342.77351 ? 67  DA  I N1    1 
ATOM 8668  C C2    . DA  I 5 140 ? 90.97100  74.72600  80.40800  1.000 342.77351 ? 67  DA  I C2    1 
ATOM 8669  N N3    . DA  I 5 140 ? 90.03300  75.62400  80.70700  1.000 342.77351 ? 67  DA  I N3    1 
ATOM 8670  C C4    . DA  I 5 140 ? 88.80300  75.10700  80.54400  1.000 342.77351 ? 67  DA  I C4    1 
ATOM 8671  P P     . DT  I 5 141 ? 86.95400  81.04100  80.14800  1.000 351.25715 ? 68  DT  I P     1 
ATOM 8672  O OP1   . DT  I 5 141 ? 87.15800  82.38800  80.72000  1.000 351.25715 ? 68  DT  I OP1   1 
ATOM 8673  O OP2   . DT  I 5 141 ? 85.91800  80.85700  79.10700  1.000 351.25715 ? 68  DT  I OP2   1 
ATOM 8674  O "O5'" . DT  I 5 141 ? 88.35900  80.53400  79.58000  1.000 351.25715 ? 68  DT  I "O5'" 1 
ATOM 8675  C "C5'" . DT  I 5 141 ? 89.45600  80.36700  80.47400  1.000 351.25715 ? 68  DT  I "C5'" 1 
ATOM 8676  C "C4'" . DT  I 5 141 ? 90.61000  79.64600  79.80500  1.000 351.25715 ? 68  DT  I "C4'" 1 
ATOM 8677  O "O4'" . DT  I 5 141 ? 90.20500  78.30200  79.46200  1.000 351.25715 ? 68  DT  I "O4'" 1 
ATOM 8678  C "C3'" . DT  I 5 141 ? 91.08000  80.29700  78.50300  1.000 351.25715 ? 68  DT  I "C3'" 1 
ATOM 8679  O "O3'" . DT  I 5 141 ? 92.46400  80.59300  78.56400  1.000 351.25715 ? 68  DT  I "O3'" 1 
ATOM 8680  C "C2'" . DT  I 5 141 ? 90.76200  79.25400  77.43000  1.000 351.25715 ? 68  DT  I "C2'" 1 
ATOM 8681  C "C1'" . DT  I 5 141 ? 90.73800  77.96300  78.21000  1.000 351.25715 ? 68  DT  I "C1'" 1 
ATOM 8682  N N1    . DT  I 5 141 ? 89.85200  76.93100  77.60800  1.000 351.25715 ? 68  DT  I N1    1 
ATOM 8683  C C2    . DT  I 5 141 ? 90.39000  75.73700  77.20700  1.000 351.25715 ? 68  DT  I C2    1 
ATOM 8684  O O2    . DT  I 5 141 ? 91.57100  75.46900  77.31700  1.000 351.25715 ? 68  DT  I O2    1 
ATOM 8685  N N3    . DT  I 5 141 ? 89.48800  74.85300  76.68300  1.000 351.25715 ? 68  DT  I N3    1 
ATOM 8686  C C4    . DT  I 5 141 ? 88.13300  75.03900  76.51300  1.000 351.25715 ? 68  DT  I C4    1 
ATOM 8687  O O4    . DT  I 5 141 ? 87.40800  74.17900  76.02600  1.000 351.25715 ? 68  DT  I O4    1 
ATOM 8688  C C5    . DT  I 5 141 ? 87.63200  76.31700  76.94900  1.000 351.25715 ? 68  DT  I C5    1 
ATOM 8689  C C7    . DT  I 5 141 ? 86.17400  76.63700  76.81400  1.000 351.25715 ? 68  DT  I C7    1 
ATOM 8690  C C6    . DT  I 5 141 ? 88.50700  77.19300  77.46700  1.000 351.25715 ? 68  DT  I C6    1 
ATOM 8691  P P     . DC  I 5 142 ? 92.90600  82.13200  78.70100  1.000 364.71637 ? 69  DC  I P     1 
ATOM 8692  O OP1   . DC  I 5 142 ? 93.40300  82.31800  80.08300  1.000 364.71637 ? 69  DC  I OP1   1 
ATOM 8693  O OP2   . DC  I 5 142 ? 91.77800  82.95100  78.20400  1.000 364.71637 ? 69  DC  I OP2   1 
ATOM 8694  O "O5'" . DC  I 5 142 ? 94.12200  82.32300  77.67900  1.000 364.71637 ? 69  DC  I "O5'" 1 
ATOM 8695  C "C5'" . DC  I 5 142 ? 95.25400  81.47700  77.75400  1.000 364.71637 ? 69  DC  I "C5'" 1 
ATOM 8696  C "C4'" . DC  I 5 142 ? 95.62400  80.90500  76.39400  1.000 364.71637 ? 69  DC  I "C4'" 1 
ATOM 8697  O "O4'" . DC  I 5 142 ? 94.56600  80.07000  75.87400  1.000 364.71637 ? 69  DC  I "O4'" 1 
ATOM 8698  C "C3'" . DC  I 5 142 ? 95.93000  81.92500  75.30100  1.000 364.71637 ? 69  DC  I "C3'" 1 
ATOM 8699  O "O3'" . DC  I 5 142 ? 97.01900  81.43400  74.55700  1.000 364.71637 ? 69  DC  I "O3'" 1 
ATOM 8700  C "C2'" . DC  I 5 142 ? 94.64600  81.93500  74.45900  1.000 364.71637 ? 69  DC  I "C2'" 1 
ATOM 8701  C "C1'" . DC  I 5 142 ? 94.23600  80.47700  74.55900  1.000 364.71637 ? 69  DC  I "C1'" 1 
ATOM 8702  N N1    . DC  I 5 142 ? 92.80000  80.18400  74.35100  1.000 364.71637 ? 69  DC  I N1    1 
ATOM 8703  C C2    . DC  I 5 142 ? 92.46300  78.89900  73.96900  1.000 364.71637 ? 69  DC  I C2    1 
ATOM 8704  O O2    . DC  I 5 142 ? 93.37300  78.07700  73.82900  1.000 364.71637 ? 69  DC  I O2    1 
ATOM 8705  N N3    . DC  I 5 142 ? 91.16500  78.57800  73.79800  1.000 364.71637 ? 69  DC  I N3    1 
ATOM 8706  C C4    . DC  I 5 142 ? 90.22000  79.50100  73.97500  1.000 364.71637 ? 69  DC  I C4    1 
ATOM 8707  N N4    . DC  I 5 142 ? 88.95000  79.12600  73.79100  1.000 364.71637 ? 69  DC  I N4    1 
ATOM 8708  C C5    . DC  I 5 142 ? 90.54200  80.84400  74.35100  1.000 364.71637 ? 69  DC  I C5    1 
ATOM 8709  C C6    . DC  I 5 142 ? 91.84000  81.13700  74.53900  1.000 364.71637 ? 69  DC  I C6    1 
ATOM 8710  P P     . DG  I 5 143 ? 98.12300  82.41100  73.93000  1.000 379.32353 ? 70  DG  I P     1 
ATOM 8711  O OP1   . DG  I 5 143 ? 99.21800  82.55700  74.91500  1.000 379.32353 ? 70  DG  I OP1   1 
ATOM 8712  O OP2   . DG  I 5 143 ? 97.42400  83.60900  73.41700  1.000 379.32353 ? 70  DG  I OP2   1 
ATOM 8713  O "O5'" . DG  I 5 143 ? 98.65300  81.56600  72.68300  1.000 379.32353 ? 70  DG  I "O5'" 1 
ATOM 8714  C "C5'" . DG  I 5 143 ? 99.35000  80.34800  72.91200  1.000 379.32353 ? 70  DG  I "C5'" 1 
ATOM 8715  C "C4'" . DG  I 5 143 ? 99.02800  79.31000  71.84400  1.000 379.32353 ? 70  DG  I "C4'" 1 
ATOM 8716  O "O4'" . DG  I 5 143 ? 97.60500  79.00300  71.87700  1.000 379.32353 ? 70  DG  I "O4'" 1 
ATOM 8717  C "C3'" . DG  I 5 143 ? 99.33700  79.73000  70.40500  1.000 379.32353 ? 70  DG  I "C3'" 1 
ATOM 8718  O "O3'" . DG  I 5 143 ? 99.87600  78.61400  69.70100  1.000 379.32353 ? 70  DG  I "O3'" 1 
ATOM 8719  C "C2'" . DG  I 5 143 ? 97.95700  80.12200  69.86600  1.000 379.32353 ? 70  DG  I "C2'" 1 
ATOM 8720  C "C1'" . DG  I 5 143 ? 97.06800  79.11900  70.57800  1.000 379.32353 ? 70  DG  I "C1'" 1 
ATOM 8721  N N9    . DG  I 5 143 ? 95.67600  79.55200  70.70200  1.000 379.32353 ? 70  DG  I N9    1 
ATOM 8722  C C8    . DG  I 5 143 ? 95.23300  80.79300  71.09400  1.000 379.32353 ? 70  DG  I C8    1 
ATOM 8723  N N7    . DG  I 5 143 ? 93.93400  80.90000  71.11200  1.000 379.32353 ? 70  DG  I N7    1 
ATOM 8724  C C5    . DG  I 5 143 ? 93.48200  79.65800  70.68700  1.000 379.32353 ? 70  DG  I C5    1 
ATOM 8725  C C6    . DG  I 5 143 ? 92.16100  79.18500  70.50300  1.000 379.32353 ? 70  DG  I C6    1 
ATOM 8726  O O6    . DG  I 5 143 ? 91.09800  79.79100  70.68500  1.000 379.32353 ? 70  DG  I O6    1 
ATOM 8727  N N1    . DG  I 5 143 ? 92.14300  77.86600  70.06000  1.000 379.32353 ? 70  DG  I N1    1 
ATOM 8728  C C2    . DG  I 5 143 ? 93.25900  77.10100  69.82000  1.000 379.32353 ? 70  DG  I C2    1 
ATOM 8729  N N2    . DG  I 5 143 ? 93.04400  75.84600  69.40000  1.000 379.32353 ? 70  DG  I N2    1 
ATOM 8730  N N3    . DG  I 5 143 ? 94.50500  77.53200  69.99400  1.000 379.32353 ? 70  DG  I N3    1 
ATOM 8731  C C4    . DG  I 5 143 ? 94.54100  78.81600  70.42500  1.000 379.32353 ? 70  DG  I C4    1 
ATOM 8732  P P     . DA  I 5 144 ? 100.75000 78.81500  68.36600  1.000 409.18656 ? 71  DA  I P     1 
ATOM 8733  O OP1   . DA  I 5 144 ? 102.14900 78.48600  68.71800  1.000 409.18656 ? 71  DA  I OP1   1 
ATOM 8734  O OP2   . DA  I 5 144 ? 100.44500 80.13100  67.76400  1.000 409.18656 ? 71  DA  I OP2   1 
ATOM 8735  O "O5'" . DA  I 5 144 ? 100.19800 77.68500  67.38100  1.000 409.18656 ? 71  DA  I "O5'" 1 
ATOM 8736  C "C5'" . DA  I 5 144 ? 100.25100 76.30800  67.75800  1.000 409.18656 ? 71  DA  I "C5'" 1 
ATOM 8737  C "C4'" . DA  I 5 144 ? 99.19600  75.49900  67.01600  1.000 409.18656 ? 71  DA  I "C4'" 1 
ATOM 8738  O "O4'" . DA  I 5 144 ? 97.86600  75.92900  67.41400  1.000 409.18656 ? 71  DA  I "O4'" 1 
ATOM 8739  C "C3'" . DA  I 5 144 ? 99.23700  75.60500  65.49400  1.000 409.18656 ? 71  DA  I "C3'" 1 
ATOM 8740  O "O3'" . DA  I 5 144 ? 98.97400  74.34400  64.90800  1.000 409.18656 ? 71  DA  I "O3'" 1 
ATOM 8741  C "C2'" . DA  I 5 144 ? 98.11000  76.58200  65.18600  1.000 409.18656 ? 71  DA  I "C2'" 1 
ATOM 8742  C "C1'" . DA  I 5 144 ? 97.10300  76.23100  66.26500  1.000 409.18656 ? 71  DA  I "C1'" 1 
ATOM 8743  N N9    . DA  I 5 144 ? 96.17500  77.31300  66.59300  1.000 409.18656 ? 71  DA  I N9    1 
ATOM 8744  C C8    . DA  I 5 144 ? 96.49300  78.55700  67.06100  1.000 409.18656 ? 71  DA  I C8    1 
ATOM 8745  N N7    . DA  I 5 144 ? 95.45000  79.32300  67.28000  1.000 409.18656 ? 71  DA  I N7    1 
ATOM 8746  C C5    . DA  I 5 144 ? 94.37400  78.52800  66.92700  1.000 409.18656 ? 71  DA  I C5    1 
ATOM 8747  C C6    . DA  I 5 144 ? 92.98300  78.75600  66.92500  1.000 409.18656 ? 71  DA  I C6    1 
ATOM 8748  N N6    . DA  I 5 144 ? 92.42700  79.90900  67.31200  1.000 409.18656 ? 71  DA  I N6    1 
ATOM 8749  N N1    . DA  I 5 144 ? 92.18200  77.74900  66.51400  1.000 409.18656 ? 71  DA  I N1    1 
ATOM 8750  C C2    . DA  I 5 144 ? 92.74000  76.59500  66.13100  1.000 409.18656 ? 71  DA  I C2    1 
ATOM 8751  N N3    . DA  I 5 144 ? 94.03100  76.26500  66.08800  1.000 409.18656 ? 71  DA  I N3    1 
ATOM 8752  C C4    . DA  I 5 144 ? 94.80100  77.28400  66.50200  1.000 409.18656 ? 71  DA  I C4    1 
ATOM 8753  P P     . DT  I 5 145 ? 99.18100  74.14100  63.32800  1.000 424.55852 ? 72  DT  I P     1 
ATOM 8754  O OP1   . DT  I 5 145 ? 99.51900  72.71900  63.09900  1.000 424.55852 ? 72  DT  I OP1   1 
ATOM 8755  O OP2   . DT  I 5 145 ? 100.08500 75.20700  62.84200  1.000 424.55852 ? 72  DT  I OP2   1 
ATOM 8756  O "O5'" . DT  I 5 145 ? 97.72200  74.41200  62.72800  1.000 424.55852 ? 72  DT  I "O5'" 1 
ATOM 8757  C "C5'" . DT  I 5 145 ? 96.62900  73.60300  63.12100  1.000 424.55852 ? 72  DT  I "C5'" 1 
ATOM 8758  C "C4'" . DT  I 5 145 ? 95.34000  74.09700  62.48800  1.000 424.55852 ? 72  DT  I "C4'" 1 
ATOM 8759  O "O4'" . DT  I 5 145 ? 94.88100  75.28300  63.18600  1.000 424.55852 ? 72  DT  I "O4'" 1 
ATOM 8760  C "C3'" . DT  I 5 145 ? 95.44700  74.48500  61.00900  1.000 424.55852 ? 72  DT  I "C3'" 1 
ATOM 8761  O "O3'" . DT  I 5 145 ? 94.40800  73.86200  60.26900  1.000 424.55852 ? 72  DT  I "O3'" 1 
ATOM 8762  C "C2'" . DT  I 5 145 ? 95.29000  76.01000  61.02100  1.000 424.55852 ? 72  DT  I "C2'" 1 
ATOM 8763  C "C1'" . DT  I 5 145 ? 94.41500  76.21700  62.24500  1.000 424.55852 ? 72  DT  I "C1'" 1 
ATOM 8764  N N1    . DT  I 5 145 ? 94.52400  77.58300  62.84100  1.000 424.55852 ? 72  DT  I N1    1 
ATOM 8765  C C2    . DT  I 5 145 ? 93.37900  78.27800  63.14200  1.000 424.55852 ? 72  DT  I C2    1 
ATOM 8766  O O2    . DT  I 5 145 ? 92.26000  77.83200  62.96400  1.000 424.55852 ? 72  DT  I O2    1 
ATOM 8767  N N3    . DT  I 5 145 ? 93.58900  79.51700  63.68400  1.000 424.55852 ? 72  DT  I N3    1 
ATOM 8768  C C4    . DT  I 5 145 ? 94.80300  80.12600  63.93700  1.000 424.55852 ? 72  DT  I C4    1 
ATOM 8769  O O4    . DT  I 5 145 ? 94.88700  81.24900  64.42400  1.000 424.55852 ? 72  DT  I O4    1 
ATOM 8770  C C5    . DT  I 5 145 ? 95.96400  79.35000  63.58900  1.000 424.55852 ? 72  DT  I C5    1 
ATOM 8771  C C7    . DT  I 5 145 ? 97.33600  79.91100  63.81600  1.000 424.55852 ? 72  DT  I C7    1 
ATOM 8772  C C6    . DT  I 5 145 ? 95.77000  78.13300  63.05600  1.000 424.55852 ? 72  DT  I C6    1 
ATOM 8773  O "O5'" . DA  J 6 1   ? 85.49000  85.83500  64.71400  1.000 426.55941 ? -72 DA  J "O5'" 1 
ATOM 8774  C "C5'" . DA  J 6 1   ? 84.51400  85.26200  63.84500  1.000 426.55941 ? -72 DA  J "C5'" 1 
ATOM 8775  C "C4'" . DA  J 6 1   ? 84.61200  83.73900  63.79300  1.000 426.55941 ? -72 DA  J "C4'" 1 
ATOM 8776  O "O4'" . DA  J 6 1   ? 85.98400  83.34700  63.52100  1.000 426.55941 ? -72 DA  J "O4'" 1 
ATOM 8777  C "C3'" . DA  J 6 1   ? 84.22600  83.00300  65.07600  1.000 426.55941 ? -72 DA  J "C3'" 1 
ATOM 8778  O "O3'" . DA  J 6 1   ? 83.64400  81.75100  64.74600  1.000 426.55941 ? -72 DA  J "O3'" 1 
ATOM 8779  C "C2'" . DA  J 6 1   ? 85.57400  82.81100  65.75800  1.000 426.55941 ? -72 DA  J "C2'" 1 
ATOM 8780  C "C1'" . DA  J 6 1   ? 86.46400  82.52200  64.56600  1.000 426.55941 ? -72 DA  J "C1'" 1 
ATOM 8781  N N9    . DA  J 6 1   ? 87.86600  82.85500  64.79700  1.000 426.55941 ? -72 DA  J N9    1 
ATOM 8782  C C8    . DA  J 6 1   ? 88.36200  84.01000  65.33900  1.000 426.55941 ? -72 DA  J C8    1 
ATOM 8783  N N7    . DA  J 6 1   ? 89.67100  84.04300  65.40600  1.000 426.55941 ? -72 DA  J N7    1 
ATOM 8784  C C5    . DA  J 6 1   ? 90.06000  82.83400  64.85600  1.000 426.55941 ? -72 DA  J C5    1 
ATOM 8785  C C6    . DA  J 6 1   ? 91.32100  82.25600  64.63200  1.000 426.55941 ? -72 DA  J C6    1 
ATOM 8786  N N6    . DA  J 6 1   ? 92.47100  82.85600  64.95300  1.000 426.55941 ? -72 DA  J N6    1 
ATOM 8787  N N1    . DA  J 6 1   ? 91.35700  81.03200  64.06100  1.000 426.55941 ? -72 DA  J N1    1 
ATOM 8788  C C2    . DA  J 6 1   ? 90.20700  80.43200  63.73900  1.000 426.55941 ? -72 DA  J C2    1 
ATOM 8789  N N3    . DA  J 6 1   ? 88.96300  80.87500  63.90100  1.000 426.55941 ? -72 DA  J N3    1 
ATOM 8790  C C4    . DA  J 6 1   ? 88.95900  82.09300  64.47000  1.000 426.55941 ? -72 DA  J C4    1 
ATOM 8791  P P     . DT  J 6 2   ? 82.62200  81.03000  65.75600  1.000 410.06515 ? -71 DT  J P     1 
ATOM 8792  O OP1   . DT  J 6 2   ? 81.26000  81.45400  65.36700  1.000 410.06515 ? -71 DT  J OP1   1 
ATOM 8793  O OP2   . DT  J 6 2   ? 83.07800  81.22700  67.14900  1.000 410.06515 ? -71 DT  J OP2   1 
ATOM 8794  O "O5'" . DT  J 6 2   ? 82.79500  79.48000  65.41200  1.000 410.06515 ? -71 DT  J "O5'" 1 
ATOM 8795  C "C5'" . DT  J 6 2   ? 82.53300  78.49400  66.40000  1.000 410.06515 ? -71 DT  J "C5'" 1 
ATOM 8796  C "C4'" . DT  J 6 2   ? 83.27600  77.21600  66.06900  1.000 410.06515 ? -71 DT  J "C4'" 1 
ATOM 8797  O "O4'" . DT  J 6 2   ? 84.68100  77.51400  65.88900  1.000 410.06515 ? -71 DT  J "O4'" 1 
ATOM 8798  C "C3'" . DT  J 6 2   ? 83.24800  76.15100  67.14700  1.000 410.06515 ? -71 DT  J "C3'" 1 
ATOM 8799  O "O3'" . DT  J 6 2   ? 83.51900  74.88800  66.55800  1.000 410.06515 ? -71 DT  J "O3'" 1 
ATOM 8800  C "C2'" . DT  J 6 2   ? 84.39400  76.60000  68.04600  1.000 410.06515 ? -71 DT  J "C2'" 1 
ATOM 8801  C "C1'" . DT  J 6 2   ? 85.42000  77.07000  67.01500  1.000 410.06515 ? -71 DT  J "C1'" 1 
ATOM 8802  N N1    . DT  J 6 2   ? 86.27700  78.19700  67.48000  1.000 410.06515 ? -71 DT  J N1    1 
ATOM 8803  C C2    . DT  J 6 2   ? 87.63900  78.10700  67.32700  1.000 410.06515 ? -71 DT  J C2    1 
ATOM 8804  O O2    . DT  J 6 2   ? 88.19000  77.15400  66.80600  1.000 410.06515 ? -71 DT  J O2    1 
ATOM 8805  N N3    . DT  J 6 2   ? 88.34000  79.19200  67.78000  1.000 410.06515 ? -71 DT  J N3    1 
ATOM 8806  C C4    . DT  J 6 2   ? 87.82700  80.32800  68.37500  1.000 410.06515 ? -71 DT  J C4    1 
ATOM 8807  O O4    . DT  J 6 2   ? 88.54200  81.24800  68.75800  1.000 410.06515 ? -71 DT  J O4    1 
ATOM 8808  C C5    . DT  J 6 2   ? 86.39100  80.35300  68.52300  1.000 410.06515 ? -71 DT  J C5    1 
ATOM 8809  C C7    . DT  J 6 2   ? 85.72200  81.53200  69.16600  1.000 410.06515 ? -71 DT  J C7    1 
ATOM 8810  C C6    . DT  J 6 2   ? 85.69300  79.29700  68.07600  1.000 410.06515 ? -71 DT  J C6    1 
ATOM 8811  P P     . DC  J 6 3   ? 83.18000  73.52800  67.34100  1.000 392.09224 ? -70 DC  J P     1 
ATOM 8812  O OP1   . DC  J 6 3   ? 82.63000  72.57200  66.35500  1.000 392.09224 ? -70 DC  J OP1   1 
ATOM 8813  O OP2   . DC  J 6 3   ? 82.39200  73.87900  68.54300  1.000 392.09224 ? -70 DC  J OP2   1 
ATOM 8814  O "O5'" . DC  J 6 3   ? 84.61300  72.99700  67.81500  1.000 392.09224 ? -70 DC  J "O5'" 1 
ATOM 8815  C "C5'" . DC  J 6 3   ? 85.60000  72.66400  66.84100  1.000 392.09224 ? -70 DC  J "C5'" 1 
ATOM 8816  C "C4'" . DC  J 6 3   ? 86.89300  72.14600  67.47200  1.000 392.09224 ? -70 DC  J "C4'" 1 
ATOM 8817  O "O4'" . DC  J 6 3   ? 87.77500  73.26100  67.78200  1.000 392.09224 ? -70 DC  J "O4'" 1 
ATOM 8818  C "C3'" . DC  J 6 3   ? 86.73600  71.36800  68.77800  1.000 392.09224 ? -70 DC  J "C3'" 1 
ATOM 8819  O "O3'" . DC  J 6 3   ? 87.70600  70.32900  68.82000  1.000 392.09224 ? -70 DC  J "O3'" 1 
ATOM 8820  C "C2'" . DC  J 6 3   ? 87.03000  72.44000  69.82800  1.000 392.09224 ? -70 DC  J "C2'" 1 
ATOM 8821  C "C1'" . DC  J 6 3   ? 88.14000  73.22400  69.14700  1.000 392.09224 ? -70 DC  J "C1'" 1 
ATOM 8822  N N1    . DC  J 6 3   ? 88.24200  74.63700  69.61700  1.000 392.09224 ? -70 DC  J N1    1 
ATOM 8823  C C2    . DC  J 6 3   ? 89.49500  75.26700  69.68500  1.000 392.09224 ? -70 DC  J C2    1 
ATOM 8824  O O2    . DC  J 6 3   ? 90.50500  74.64300  69.34200  1.000 392.09224 ? -70 DC  J O2    1 
ATOM 8825  N N3    . DC  J 6 3   ? 89.55400  76.55800  70.10200  1.000 392.09224 ? -70 DC  J N3    1 
ATOM 8826  C C4    . DC  J 6 3   ? 88.43700  77.19700  70.45500  1.000 392.09224 ? -70 DC  J C4    1 
ATOM 8827  N N4    . DC  J 6 3   ? 88.53900  78.46400  70.86300  1.000 392.09224 ? -70 DC  J N4    1 
ATOM 8828  C C5    . DC  J 6 3   ? 87.16200  76.56700  70.40200  1.000 392.09224 ? -70 DC  J C5    1 
ATOM 8829  C C6    . DC  J 6 3   ? 87.11300  75.30200  69.98500  1.000 392.09224 ? -70 DC  J C6    1 
ATOM 8830  P P     . DG  J 6 4   ? 87.48600  69.02100  69.73100  1.000 372.51472 ? -69 DG  J P     1 
ATOM 8831  O OP1   . DG  J 6 4   ? 87.25200  67.88100  68.81600  1.000 372.51472 ? -69 DG  J OP1   1 
ATOM 8832  O OP2   . DG  J 6 4   ? 86.49000  69.33400  70.78100  1.000 372.51472 ? -69 DG  J OP2   1 
ATOM 8833  O "O5'" . DG  J 6 4   ? 88.90800  68.82800  70.43400  1.000 372.51472 ? -69 DG  J "O5'" 1 
ATOM 8834  C "C5'" . DG  J 6 4   ? 90.07800  68.77600  69.63000  1.000 372.51472 ? -69 DG  J "C5'" 1 
ATOM 8835  C "C4'" . DG  J 6 4   ? 91.29300  69.30800  70.37300  1.000 372.51472 ? -69 DG  J "C4'" 1 
ATOM 8836  O "O4'" . DG  J 6 4   ? 91.09700  70.72000  70.64200  1.000 372.51472 ? -69 DG  J "O4'" 1 
ATOM 8837  C "C3'" . DG  J 6 4   ? 91.59700  68.66800  71.73000  1.000 372.51472 ? -69 DG  J "C3'" 1 
ATOM 8838  O "O3'" . DG  J 6 4   ? 93.00200  68.55900  71.88300  1.000 372.51472 ? -69 DG  J "O3'" 1 
ATOM 8839  C "C2'" . DG  J 6 4   ? 91.01300  69.66300  72.72600  1.000 372.51472 ? -69 DG  J "C2'" 1 
ATOM 8840  C "C1'" . DG  J 6 4   ? 91.27300  70.97900  72.01800  1.000 372.51472 ? -69 DG  J "C1'" 1 
ATOM 8841  N N9    . DG  J 6 4   ? 90.34600  72.03300  72.40500  1.000 372.51472 ? -69 DG  J N9    1 
ATOM 8842  C C8    . DG  J 6 4   ? 88.99200  71.93000  72.58700  1.000 372.51472 ? -69 DG  J C8    1 
ATOM 8843  N N7    . DG  J 6 4   ? 88.42300  73.06200  72.90900  1.000 372.51472 ? -69 DG  J N7    1 
ATOM 8844  C C5    . DG  J 6 4   ? 89.46800  73.97400  72.90900  1.000 372.51472 ? -69 DG  J C5    1 
ATOM 8845  C C6    . DG  J 6 4   ? 89.47700  75.36500  73.17500  1.000 372.51472 ? -69 DG  J C6    1 
ATOM 8846  O O6    . DG  J 6 4   ? 88.53000  76.10900  73.47600  1.000 372.51472 ? -69 DG  J O6    1 
ATOM 8847  N N1    . DG  J 6 4   ? 90.75600  75.89300  73.05900  1.000 372.51472 ? -69 DG  J N1    1 
ATOM 8848  C C2    . DG  J 6 4   ? 91.88000  75.17200  72.73400  1.000 372.51472 ? -69 DG  J C2    1 
ATOM 8849  N N2    . DG  J 6 4   ? 93.02600  75.84500  72.67300  1.000 372.51472 ? -69 DG  J N2    1 
ATOM 8850  N N3    . DG  J 6 4   ? 91.88300  73.88100  72.48500  1.000 372.51472 ? -69 DG  J N3    1 
ATOM 8851  C C4    . DG  J 6 4   ? 90.65200  73.34900  72.59000  1.000 372.51472 ? -69 DG  J C4    1 
ATOM 8852  P P     . DA  J 6 5   ? 93.72700  67.12700  71.83400  1.000 356.13075 ? -68 DA  J P     1 
ATOM 8853  O OP1   . DA  J 6 5   ? 94.11700  66.86400  70.43200  1.000 356.13075 ? -68 DA  J OP1   1 
ATOM 8854  O OP2   . DA  J 6 5   ? 92.86400  66.16300  72.55000  1.000 356.13075 ? -68 DA  J OP2   1 
ATOM 8855  O "O5'" . DA  J 6 5   ? 95.04200  67.35200  72.71400  1.000 356.13075 ? -68 DA  J "O5'" 1 
ATOM 8856  C "C5'" . DA  J 6 5   ? 95.88100  68.47300  72.44300  1.000 356.13075 ? -68 DA  J "C5'" 1 
ATOM 8857  C "C4'" . DA  J 6 5   ? 96.10100  69.32800  73.68500  1.000 356.13075 ? -68 DA  J "C4'" 1 
ATOM 8858  O "O4'" . DA  J 6 5   ? 94.83900  69.88100  74.13800  1.000 356.13075 ? -68 DA  J "O4'" 1 
ATOM 8859  C "C3'" . DA  J 6 5   ? 96.69500  68.60600  74.89700  1.000 356.13075 ? -68 DA  J "C3'" 1 
ATOM 8860  O "O3'" . DA  J 6 5   ? 97.57100  69.48100  75.56900  1.000 356.13075 ? -68 DA  J "O3'" 1 
ATOM 8861  C "C2'" . DA  J 6 5   ? 95.47200  68.31800  75.75300  1.000 356.13075 ? -68 DA  J "C2'" 1 
ATOM 8862  C "C1'" . DA  J 6 5   ? 94.65800  69.57100  75.50300  1.000 356.13075 ? -68 DA  J "C1'" 1 
ATOM 8863  N N9    . DA  J 6 5   ? 93.23600  69.41200  75.76300  1.000 356.13075 ? -68 DA  J N9    1 
ATOM 8864  C C8    . DA  J 6 5   ? 92.51700  68.24900  75.77700  1.000 356.13075 ? -68 DA  J C8    1 
ATOM 8865  N N7    . DA  J 6 5   ? 91.24400  68.42200  76.04500  1.000 356.13075 ? -68 DA  J N7    1 
ATOM 8866  C C5    . DA  J 6 5   ? 91.12600  69.79000  76.21900  1.000 356.13075 ? -68 DA  J C5    1 
ATOM 8867  C C6    . DA  J 6 5   ? 90.03000  70.62400  76.51600  1.000 356.13075 ? -68 DA  J C6    1 
ATOM 8868  N N6    . DA  J 6 5   ? 88.78900  70.16900  76.71100  1.000 356.13075 ? -68 DA  J N6    1 
ATOM 8869  N N1    . DA  J 6 5   ? 90.26400  71.95000  76.61600  1.000 356.13075 ? -68 DA  J N1    1 
ATOM 8870  C C2    . DA  J 6 5   ? 91.51000  72.40300  76.42200  1.000 356.13075 ? -68 DA  J C2    1 
ATOM 8871  N N3    . DA  J 6 5   ? 92.60900  71.72200  76.13400  1.000 356.13075 ? -68 DA  J N3    1 
ATOM 8872  C C4    . DA  J 6 5   ? 92.34700  70.41100  76.04500  1.000 356.13075 ? -68 DA  J C4    1 
ATOM 8873  P P     . DT  J 6 6   ? 99.03400  69.00800  76.02500  1.000 338.70230 ? -67 DT  J P     1 
ATOM 8874  O OP1   . DT  J 6 6   ? 99.91500  69.00300  74.83700  1.000 338.70230 ? -67 DT  J OP1   1 
ATOM 8875  O OP2   . DT  J 6 6   ? 98.88300  67.77700  76.83100  1.000 338.70230 ? -67 DT  J OP2   1 
ATOM 8876  O "O5'" . DT  J 6 6   ? 99.48400  70.18000  77.00900  1.000 338.70230 ? -67 DT  J "O5'" 1 
ATOM 8877  C "C5'" . DT  J 6 6   ? 99.30500  71.53900  76.61500  1.000 338.70230 ? -67 DT  J "C5'" 1 
ATOM 8878  C "C4'" . DT  J 6 6   ? 98.64600  72.32900  77.73000  1.000 338.70230 ? -67 DT  J "C4'" 1 
ATOM 8879  O "O4'" . DT  J 6 6   ? 97.21200  72.14800  77.70000  1.000 338.70230 ? -67 DT  J "O4'" 1 
ATOM 8880  C "C3'" . DT  J 6 6   ? 99.08700  71.92900  79.13800  1.000 338.70230 ? -67 DT  J "C3'" 1 
ATOM 8881  O "O3'" . DT  J 6 6   ? 99.97200  72.92100  79.67700  1.000 338.70230 ? -67 DT  J "O3'" 1 
ATOM 8882  C "C2'" . DT  J 6 6   ? 97.77900  71.83200  79.93600  1.000 338.70230 ? -67 DT  J "C2'" 1 
ATOM 8883  C "C1'" . DT  J 6 6   ? 96.72700  72.39300  78.99300  1.000 338.70230 ? -67 DT  J "C1'" 1 
ATOM 8884  N N1    . DT  J 6 6   ? 95.37700  71.77200  79.16500  1.000 338.70230 ? -67 DT  J N1    1 
ATOM 8885  C C2    . DT  J 6 6   ? 94.29900  72.58100  79.44000  1.000 338.70230 ? -67 DT  J C2    1 
ATOM 8886  O O2    . DT  J 6 6   ? 94.37900  73.79200  79.53400  1.000 338.70230 ? -67 DT  J O2    1 
ATOM 8887  N N3    . DT  J 6 6   ? 93.11300  71.91800  79.59400  1.000 338.70230 ? -67 DT  J N3    1 
ATOM 8888  C C4    . DT  J 6 6   ? 92.89900  70.56100  79.51000  1.000 338.70230 ? -67 DT  J C4    1 
ATOM 8889  O O4    . DT  J 6 6   ? 91.79300  70.06300  79.66300  1.000 338.70230 ? -67 DT  J O4    1 
ATOM 8890  C C5    . DT  J 6 6   ? 94.06700  69.76900  79.23100  1.000 338.70230 ? -67 DT  J C5    1 
ATOM 8891  C C7    . DT  J 6 6   ? 93.95000  68.28000  79.12200  1.000 338.70230 ? -67 DT  J C7    1 
ATOM 8892  C C6    . DT  J 6 6   ? 95.23900  70.40300  79.07800  1.000 338.70230 ? -67 DT  J C6    1 
ATOM 8893  P P     . DG  J 6 7   ? 100.51500 72.81300  81.19000  1.000 313.47198 ? -66 DG  J P     1 
ATOM 8894  O OP1   . DG  J 6 7   ? 101.77800 73.58000  81.22900  1.000 313.47198 ? -66 DG  J OP1   1 
ATOM 8895  O OP2   . DG  J 6 7   ? 100.52300 71.39200  81.60600  1.000 313.47198 ? -66 DG  J OP2   1 
ATOM 8896  O "O5'" . DG  J 6 7   ? 99.42600  73.60700  82.05800  1.000 313.47198 ? -66 DG  J "O5'" 1 
ATOM 8897  C "C5'" . DG  J 6 7   ? 99.01700  74.90600  81.65400  1.000 313.47198 ? -66 DG  J "C5'" 1 
ATOM 8898  C "C4'" . DG  J 6 7   ? 97.66400  75.27200  82.24200  1.000 313.47198 ? -66 DG  J "C4'" 1 
ATOM 8899  O "O4'" . DG  J 6 7   ? 96.66900  74.28300  81.88000  1.000 313.47198 ? -66 DG  J "O4'" 1 
ATOM 8900  C "C3'" . DG  J 6 7   ? 97.62100  75.39000  83.77000  1.000 313.47198 ? -66 DG  J "C3'" 1 
ATOM 8901  O "O3'" . DG  J 6 7   ? 97.16300  76.68700  84.13200  1.000 313.47198 ? -66 DG  J "O3'" 1 
ATOM 8902  C "C2'" . DG  J 6 7   ? 96.62400  74.30300  84.19400  1.000 313.47198 ? -66 DG  J "C2'" 1 
ATOM 8903  C "C1'" . DG  J 6 7   ? 95.77100  74.15300  82.94800  1.000 313.47198 ? -66 DG  J "C1'" 1 
ATOM 8904  N N9    . DG  J 6 7   ? 95.08300  72.86700  82.84300  1.000 313.47198 ? -66 DG  J N9    1 
ATOM 8905  C C8    . DG  J 6 7   ? 95.64400  71.64200  82.59300  1.000 313.47198 ? -66 DG  J C8    1 
ATOM 8906  N N7    . DG  J 6 7   ? 94.77900  70.67200  82.54200  1.000 313.47198 ? -66 DG  J N7    1 
ATOM 8907  C C5    . DG  J 6 7   ? 93.56600  71.29300  82.77100  1.000 313.47198 ? -66 DG  J C5    1 
ATOM 8908  C C6    . DG  J 6 7   ? 92.27000  70.75100  82.83400  1.000 313.47198 ? -66 DG  J C6    1 
ATOM 8909  O O6    . DG  J 6 7   ? 91.92600  69.57300  82.69400  1.000 313.47198 ? -66 DG  J O6    1 
ATOM 8910  N N1    . DG  J 6 7   ? 91.31900  71.72700  83.08800  1.000 313.47198 ? -66 DG  J N1    1 
ATOM 8911  C C2    . DG  J 6 7   ? 91.58800  73.06100  83.25400  1.000 313.47198 ? -66 DG  J C2    1 
ATOM 8912  N N2    . DG  J 6 7   ? 90.54300  73.85500  83.49900  1.000 313.47198 ? -66 DG  J N2    1 
ATOM 8913  N N3    . DG  J 6 7   ? 92.80000  73.58300  83.20100  1.000 313.47198 ? -66 DG  J N3    1 
ATOM 8914  C C4    . DG  J 6 7   ? 93.73600  72.64500  82.95500  1.000 313.47198 ? -66 DG  J C4    1 
ATOM 8915  P P     . DT  J 6 8   ? 97.09100  77.13500  85.67400  1.000 297.14107 ? -65 DT  J P     1 
ATOM 8916  O OP1   . DT  J 6 8   ? 97.30400  78.59700  85.71700  1.000 297.14107 ? -65 DT  J OP1   1 
ATOM 8917  O OP2   . DT  J 6 8   ? 97.95700  76.24300  86.47500  1.000 297.14107 ? -65 DT  J OP2   1 
ATOM 8918  O "O5'" . DT  J 6 8   ? 95.57600  76.83500  86.07200  1.000 297.14107 ? -65 DT  J "O5'" 1 
ATOM 8919  C "C5'" . DT  J 6 8   ? 94.51700  77.43300  85.33900  1.000 297.14107 ? -65 DT  J "C5'" 1 
ATOM 8920  C "C4'" . DT  J 6 8   ? 93.17400  77.15400  85.99300  1.000 297.14107 ? -65 DT  J "C4'" 1 
ATOM 8921  O "O4'" . DT  J 6 8   ? 92.71500  75.82400  85.62600  1.000 297.14107 ? -65 DT  J "O4'" 1 
ATOM 8922  C "C3'" . DT  J 6 8   ? 93.15800  77.19500  87.52300  1.000 297.14107 ? -65 DT  J "C3'" 1 
ATOM 8923  O "O3'" . DT  J 6 8   ? 91.97600  77.85000  87.95800  1.000 297.14107 ? -65 DT  J "O3'" 1 
ATOM 8924  C "C2'" . DT  J 6 8   ? 93.15600  75.71900  87.91100  1.000 297.14107 ? -65 DT  J "C2'" 1 
ATOM 8925  C "C1'" . DT  J 6 8   ? 92.32500  75.13300  86.79100  1.000 297.14107 ? -65 DT  J "C1'" 1 
ATOM 8926  N N1    . DT  J 6 8   ? 92.53400  73.68300  86.57500  1.000 297.14107 ? -65 DT  J N1    1 
ATOM 8927  C C2    . DT  J 6 8   ? 91.43800  72.86600  86.50900  1.000 297.14107 ? -65 DT  J C2    1 
ATOM 8928  O O2    . DT  J 6 8   ? 90.29700  73.27200  86.62200  1.000 297.14107 ? -65 DT  J O2    1 
ATOM 8929  N N3    . DT  J 6 8   ? 91.72000  71.55000  86.29200  1.000 297.14107 ? -65 DT  J N3    1 
ATOM 8930  C C4    . DT  J 6 8   ? 92.96200  70.97400  86.14400  1.000 297.14107 ? -65 DT  J C4    1 
ATOM 8931  O O4    . DT  J 6 8   ? 93.10800  69.77300  85.95700  1.000 297.14107 ? -65 DT  J O4    1 
ATOM 8932  C C5    . DT  J 6 8   ? 94.07500  71.88300  86.22500  1.000 297.14107 ? -65 DT  J C5    1 
ATOM 8933  C C7    . DT  J 6 8   ? 95.47300  71.36500  86.08400  1.000 297.14107 ? -65 DT  J C7    1 
ATOM 8934  C C6    . DT  J 6 8   ? 93.81300  73.18500  86.43200  1.000 297.14107 ? -65 DT  J C6    1 
ATOM 8935  P P     . DA  J 6 9   ? 91.86100  78.44000  89.44700  1.000 290.02093 ? -64 DA  J P     1 
ATOM 8936  O OP1   . DA  J 6 9   ? 91.51500  79.87400  89.33100  1.000 290.02093 ? -64 DA  J OP1   1 
ATOM 8937  O OP2   . DA  J 6 9   ? 93.05700  78.03700  90.21800  1.000 290.02093 ? -64 DA  J OP2   1 
ATOM 8938  O "O5'" . DA  J 6 9   ? 90.60300  77.66800  90.05300  1.000 290.02093 ? -64 DA  J "O5'" 1 
ATOM 8939  C "C5'" . DA  J 6 9   ? 89.34000  77.75400  89.40300  1.000 290.02093 ? -64 DA  J "C5'" 1 
ATOM 8940  C "C4'" . DA  J 6 9   ? 88.42200  76.62600  89.84100  1.000 290.02093 ? -64 DA  J "C4'" 1 
ATOM 8941  O "O4'" . DA  J 6 9   ? 88.90900  75.36400  89.32100  1.000 290.02093 ? -64 DA  J "O4'" 1 
ATOM 8942  C "C3'" . DA  J 6 9   ? 88.28200  76.45200  91.35400  1.000 290.02093 ? -64 DA  J "C3'" 1 
ATOM 8943  O "O3'" . DA  J 6 9   ? 86.91100  76.25400  91.68300  1.000 290.02093 ? -64 DA  J "O3'" 1 
ATOM 8944  C "C2'" . DA  J 6 9   ? 89.11700  75.20000  91.63800  1.000 290.02093 ? -64 DA  J "C2'" 1 
ATOM 8945  C "C1'" . DA  J 6 9   ? 88.92600  74.41300  90.35600  1.000 290.02093 ? -64 DA  J "C1'" 1 
ATOM 8946  N N9    . DA  J 6 9   ? 89.99300  73.46100  90.07900  1.000 290.02093 ? -64 DA  J N9    1 
ATOM 8947  C C8    . DA  J 6 9   ? 91.33400  73.71200  90.04700  1.000 290.02093 ? -64 DA  J C8    1 
ATOM 8948  N N7    . DA  J 6 9   ? 92.06500  72.65800  89.77800  1.000 290.02093 ? -64 DA  J N7    1 
ATOM 8949  C C5    . DA  J 6 9   ? 91.13800  71.64200  89.64400  1.000 290.02093 ? -64 DA  J C5    1 
ATOM 8950  C C6    . DA  J 6 9   ? 91.26500  70.27000  89.36000  1.000 290.02093 ? -64 DA  J C6    1 
ATOM 8951  N N6    . DA  J 6 9   ? 92.43800  69.66800  89.15500  1.000 290.02093 ? -64 DA  J N6    1 
ATOM 8952  N N1    . DA  J 6 9   ? 90.13200  69.53700  89.29500  1.000 290.02093 ? -64 DA  J N1    1 
ATOM 8953  C C2    . DA  J 6 9   ? 88.95700  70.14000  89.50000  1.000 290.02093 ? -64 DA  J C2    1 
ATOM 8954  N N3    . DA  J 6 9   ? 88.71200  71.41800  89.77300  1.000 290.02093 ? -64 DA  J N3    1 
ATOM 8955  C C4    . DA  J 6 9   ? 89.85500  72.12100  89.83100  1.000 290.02093 ? -64 DA  J C4    1 
ATOM 8956  P P     . DT  J 6 10  ? 86.43100  76.18800  93.21700  1.000 278.43533 ? -63 DT  J P     1 
ATOM 8957  O OP1   . DT  J 6 10  ? 85.14100  76.90700  93.29100  1.000 278.43533 ? -63 DT  J OP1   1 
ATOM 8958  O OP2   . DT  J 6 10  ? 87.54300  76.62300  94.09200  1.000 278.43533 ? -63 DT  J OP2   1 
ATOM 8959  O "O5'" . DT  J 6 10  ? 86.13700  74.63700  93.47500  1.000 278.43533 ? -63 DT  J "O5'" 1 
ATOM 8960  C "C5'" . DT  J 6 10  ? 85.23100  73.93600  92.63300  1.000 278.43533 ? -63 DT  J "C5'" 1 
ATOM 8961  C "C4'" . DT  J 6 10  ? 85.26100  72.44400  92.92000  1.000 278.43533 ? -63 DT  J "C4'" 1 
ATOM 8962  O "O4'" . DT  J 6 10  ? 86.49800  71.86200  92.41900  1.000 278.43533 ? -63 DT  J "O4'" 1 
ATOM 8963  C "C3'" . DT  J 6 10  ? 85.18100  72.05100  94.40600  1.000 278.43533 ? -63 DT  J "C3'" 1 
ATOM 8964  O "O3'" . DT  J 6 10  ? 84.24300  70.97700  94.56300  1.000 278.43533 ? -63 DT  J "O3'" 1 
ATOM 8965  C "C2'" . DT  J 6 10  ? 86.60800  71.60900  94.71500  1.000 278.43533 ? -63 DT  J "C2'" 1 
ATOM 8966  C "C1'" . DT  J 6 10  ? 86.98100  70.97700  93.39600  1.000 278.43533 ? -63 DT  J "C1'" 1 
ATOM 8967  N N1    . DT  J 6 10  ? 88.42900  70.76900  93.21600  1.000 278.43533 ? -63 DT  J N1    1 
ATOM 8968  C C2    . DT  J 6 10  ? 88.86900  69.53000  92.85800  1.000 278.43533 ? -63 DT  J C2    1 
ATOM 8969  O O2    . DT  J 6 10  ? 88.12700  68.57600  92.72800  1.000 278.43533 ? -63 DT  J O2    1 
ATOM 8970  N N3    . DT  J 6 10  ? 90.21800  69.41600  92.72600  1.000 278.43533 ? -63 DT  J N3    1 
ATOM 8971  C C4    . DT  J 6 10  ? 91.15500  70.41300  92.86700  1.000 278.43533 ? -63 DT  J C4    1 
ATOM 8972  O O4    . DT  J 6 10  ? 92.35200  70.20900  92.70500  1.000 278.43533 ? -63 DT  J O4    1 
ATOM 8973  C C5    . DT  J 6 10  ? 90.62700  71.70900  93.21800  1.000 278.43533 ? -63 DT  J C5    1 
ATOM 8974  C C7    . DT  J 6 10  ? 91.54900  72.87400  93.40700  1.000 278.43533 ? -63 DT  J C7    1 
ATOM 8975  C C6    . DT  J 6 10  ? 89.29900  71.82500  93.37000  1.000 278.43533 ? -63 DT  J C6    1 
ATOM 8976  P P     . DA  J 6 11  ? 83.58800  70.62900  95.99300  1.000 268.05857 ? -62 DA  J P     1 
ATOM 8977  O OP1   . DA  J 6 11  ? 82.37900  71.46900  96.11500  1.000 268.05857 ? -62 DA  J OP1   1 
ATOM 8978  O OP2   . DA  J 6 11  ? 84.61300  70.66900  97.05800  1.000 268.05857 ? -62 DA  J OP2   1 
ATOM 8979  O "O5'" . DA  J 6 11  ? 83.13800  69.10000  95.84100  1.000 268.05857 ? -62 DA  J "O5'" 1 
ATOM 8980  C "C5'" . DA  J 6 11  ? 83.57500  68.35400  94.72000  1.000 268.05857 ? -62 DA  J "C5'" 1 
ATOM 8981  C "C4'" . DA  J 6 11  ? 83.93700  66.92200  95.08400  1.000 268.05857 ? -62 DA  J "C4'" 1 
ATOM 8982  O "O4'" . DA  J 6 11  ? 85.33000  66.69400  94.76300  1.000 268.05857 ? -62 DA  J "O4'" 1 
ATOM 8983  C "C3'" . DA  J 6 11  ? 83.79400  66.54500  96.55400  1.000 268.05857 ? -62 DA  J "C3'" 1 
ATOM 8984  O "O3'" . DA  J 6 11  ? 83.46000  65.16100  96.67600  1.000 268.05857 ? -62 DA  J "O3'" 1 
ATOM 8985  C "C2'" . DA  J 6 11  ? 85.18300  66.82200  97.09200  1.000 268.05857 ? -62 DA  J "C2'" 1 
ATOM 8986  C "C1'" . DA  J 6 11  ? 86.05600  66.38200  95.93300  1.000 268.05857 ? -62 DA  J "C1'" 1 
ATOM 8987  N N9    . DA  J 6 11  ? 87.31400  67.10200  95.88500  1.000 268.05857 ? -62 DA  J N9    1 
ATOM 8988  C C8    . DA  J 6 11  ? 87.49400  68.45200  95.95300  1.000 268.05857 ? -62 DA  J C8    1 
ATOM 8989  N N7    . DA  J 6 11  ? 88.74600  68.82200  95.85800  1.000 268.05857 ? -62 DA  J N7    1 
ATOM 8990  C C5    . DA  J 6 11  ? 89.42000  67.63700  95.63600  1.000 268.05857 ? -62 DA  J C5    1 
ATOM 8991  C C6    . DA  J 6 11  ? 90.77700  67.33900  95.42700  1.000 268.05857 ? -62 DA  J C6    1 
ATOM 8992  N N6    . DA  J 6 11  ? 91.73800  68.26500  95.39400  1.000 268.05857 ? -62 DA  J N6    1 
ATOM 8993  N N1    . DA  J 6 11  ? 91.11000  66.04500  95.25000  1.000 268.05857 ? -62 DA  J N1    1 
ATOM 8994  C C2    . DA  J 6 11  ? 90.14900  65.11900  95.27900  1.000 268.05857 ? -62 DA  J C2    1 
ATOM 8995  N N3    . DA  J 6 11  ? 88.84700  65.27700  95.46900  1.000 268.05857 ? -62 DA  J N3    1 
ATOM 8996  C C4    . DA  J 6 11  ? 88.54700  66.57000  95.64200  1.000 268.05857 ? -62 DA  J C4    1 
ATOM 8997  P P     . DT  J 6 12  ? 83.10100  64.52600  98.11200  1.000 248.77697 ? -61 DT  J P     1 
ATOM 8998  O OP1   . DT  J 6 12  ? 81.95300  63.62000  97.89700  1.000 248.77697 ? -61 DT  J OP1   1 
ATOM 8999  O OP2   . DT  J 6 12  ? 82.98900  65.58800  99.13500  1.000 248.77697 ? -61 DT  J OP2   1 
ATOM 9000  O "O5'" . DT  J 6 12  ? 84.37800  63.62500  98.44800  1.000 248.77697 ? -61 DT  J "O5'" 1 
ATOM 9001  C "C5'" . DT  J 6 12  ? 84.62900  62.45600  97.68100  1.000 248.77697 ? -61 DT  J "C5'" 1 
ATOM 9002  C "C4'" . DT  J 6 12  ? 85.90800  61.76100  98.11800  1.000 248.77697 ? -61 DT  J "C4'" 1 
ATOM 9003  O "O4'" . DT  J 6 12  ? 87.04800  62.58000  97.75500  1.000 248.77697 ? -61 DT  J "O4'" 1 
ATOM 9004  C "C3'" . DT  J 6 12  ? 86.02600  61.49900  99.62300  1.000 248.77697 ? -61 DT  J "C3'" 1 
ATOM 9005  O "O3'" . DT  J 6 12  ? 86.51700  60.18500  99.86800  1.000 248.77697 ? -61 DT  J "O3'" 1 
ATOM 9006  C "C2'" . DT  J 6 12  ? 87.04200  62.55200  100.06300 1.000 248.77697 ? -61 DT  J "C2'" 1 
ATOM 9007  C "C1'" . DT  J 6 12  ? 87.93200  62.63900  98.83800  1.000 248.77697 ? -61 DT  J "C1'" 1 
ATOM 9008  N N1    . DT  J 6 12  ? 88.67500  63.90300  98.76300  1.000 248.77697 ? -61 DT  J N1    1 
ATOM 9009  C C2    . DT  J 6 12  ? 90.01600  63.86400  98.50800  1.000 248.77697 ? -61 DT  J C2    1 
ATOM 9010  O O2    . DT  J 6 12  ? 90.61500  62.83900  98.25800  1.000 248.77697 ? -61 DT  J O2    1 
ATOM 9011  N N3    . DT  J 6 12  ? 90.62500  65.07700  98.48300  1.000 248.77697 ? -61 DT  J N3    1 
ATOM 9012  C C4    . DT  J 6 12  ? 90.05000  66.30200  98.71900  1.000 248.77697 ? -61 DT  J C4    1 
ATOM 9013  O O4    . DT  J 6 12  ? 90.69400  67.34200  98.69200  1.000 248.77697 ? -61 DT  J O4    1 
ATOM 9014  C C5    . DT  J 6 12  ? 88.65000  66.27400  99.03500  1.000 248.77697 ? -61 DT  J C5    1 
ATOM 9015  C C7    . DT  J 6 12  ? 87.93000  67.54900  99.33400  1.000 248.77697 ? -61 DT  J C7    1 
ATOM 9016  C C6    . DT  J 6 12  ? 88.03400  65.08600  99.05100  1.000 248.77697 ? -61 DT  J C6    1 
ATOM 9017  P P     . DA  J 6 13  ? 86.39400  59.54300  101.34000 1.000 232.72502 ? -60 DA  J P     1 
ATOM 9018  O OP1   . DA  J 6 13  ? 85.69300  58.25300  101.16000 1.000 232.72502 ? -60 DA  J OP1   1 
ATOM 9019  O OP2   . DA  J 6 13  ? 85.83800  60.53400  102.28500 1.000 232.72502 ? -60 DA  J OP2   1 
ATOM 9020  O "O5'" . DA  J 6 13  ? 87.90100  59.22900  101.77400 1.000 232.72502 ? -60 DA  J "O5'" 1 
ATOM 9021  C "C5'" . DA  J 6 13  ? 88.61900  58.18400  101.13800 1.000 232.72502 ? -60 DA  J "C5'" 1 
ATOM 9022  C "C4'" . DA  J 6 13  ? 90.11000  58.23900  101.45000 1.000 232.72502 ? -60 DA  J "C4'" 1 
ATOM 9023  O "O4'" . DA  J 6 13  ? 90.67200  59.49600  101.00100 1.000 232.72502 ? -60 DA  J "O4'" 1 
ATOM 9024  C "C3'" . DA  J 6 13  ? 90.49900  58.11800  102.92300 1.000 232.72502 ? -60 DA  J "C3'" 1 
ATOM 9025  O "O3'" . DA  J 6 13  ? 91.71600  57.40800  103.00400 1.000 232.72502 ? -60 DA  J "O3'" 1 
ATOM 9026  C "C2'" . DA  J 6 13  ? 90.69700  59.57400  103.33200 1.000 232.72502 ? -60 DA  J "C2'" 1 
ATOM 9027  C "C1'" . DA  J 6 13  ? 91.33800  60.12500  102.07600 1.000 232.72502 ? -60 DA  J "C1'" 1 
ATOM 9028  N N9    . DA  J 6 13  ? 91.19400  61.55700  101.90400 1.000 232.72502 ? -60 DA  J N9    1 
ATOM 9029  C C8    . DA  J 6 13  ? 90.03400  62.26800  101.86100 1.000 232.72502 ? -60 DA  J C8    1 
ATOM 9030  N N7    . DA  J 6 13  ? 90.20700  63.54900  101.65800 1.000 232.72502 ? -60 DA  J N7    1 
ATOM 9031  C C5    . DA  J 6 13  ? 91.57600  63.67700  101.53700 1.000 232.72502 ? -60 DA  J C5    1 
ATOM 9032  C C6    . DA  J 6 13  ? 92.40500  64.78200  101.30400 1.000 232.72502 ? -60 DA  J C6    1 
ATOM 9033  N N6    . DA  J 6 13  ? 91.94600  66.02100  101.15800 1.000 232.72502 ? -60 DA  J N6    1 
ATOM 9034  N N1    . DA  J 6 13  ? 93.72900  64.56800  101.24600 1.000 232.72502 ? -60 DA  J N1    1 
ATOM 9035  C C2    . DA  J 6 13  ? 94.19600  63.32600  101.40400 1.000 232.72502 ? -60 DA  J C2    1 
ATOM 9036  N N3    . DA  J 6 13  ? 93.51500  62.20800  101.62500 1.000 232.72502 ? -60 DA  J N3    1 
ATOM 9037  C C4    . DA  J 6 13  ? 92.19800  62.45700  101.68000 1.000 232.72502 ? -60 DA  J C4    1 
ATOM 9038  P P     . DT  J 6 14  ? 92.15100  56.64200  104.34700 1.000 219.89141 ? -59 DT  J P     1 
ATOM 9039  O OP1   . DT  J 6 14  ? 91.97300  55.19700  104.09800 1.000 219.89141 ? -59 DT  J OP1   1 
ATOM 9040  O OP2   . DT  J 6 14  ? 91.49400  57.27200  105.51200 1.000 219.89141 ? -59 DT  J OP2   1 
ATOM 9041  O "O5'" . DT  J 6 14  ? 93.71300  56.95900  104.43900 1.000 219.89141 ? -59 DT  J "O5'" 1 
ATOM 9042  C "C5'" . DT  J 6 14  ? 94.19700  58.19500  103.93100 1.000 219.89141 ? -59 DT  J "C5'" 1 
ATOM 9043  C "C4'" . DT  J 6 14  ? 95.45600  58.62400  104.65000 1.000 219.89141 ? -59 DT  J "C4'" 1 
ATOM 9044  O "O4'" . DT  J 6 14  ? 95.64400  60.05100  104.48000 1.000 219.89141 ? -59 DT  J "O4'" 1 
ATOM 9045  C "C3'" . DT  J 6 14  ? 95.41800  58.44900  106.14800 1.000 219.89141 ? -59 DT  J "C3'" 1 
ATOM 9046  O "O3'" . DT  J 6 14  ? 96.73400  58.57900  106.64800 1.000 219.89141 ? -59 DT  J "O3'" 1 
ATOM 9047  C "C2'" . DT  J 6 14  ? 94.58300  59.65000  106.53200 1.000 219.89141 ? -59 DT  J "C2'" 1 
ATOM 9048  C "C1'" . DT  J 6 14  ? 95.26700  60.71000  105.67800 1.000 219.89141 ? -59 DT  J "C1'" 1 
ATOM 9049  N N1    . DT  J 6 14  ? 94.42700  61.87100  105.32800 1.000 219.89141 ? -59 DT  J N1    1 
ATOM 9050  C C2    . DT  J 6 14  ? 95.04600  62.99800  104.87000 1.000 219.89141 ? -59 DT  J C2    1 
ATOM 9051  O O2    . DT  J 6 14  ? 96.25100  63.08500  104.74400 1.000 219.89141 ? -59 DT  J O2    1 
ATOM 9052  N N3    . DT  J 6 14  ? 94.21400  64.03000  104.57100 1.000 219.89141 ? -59 DT  J N3    1 
ATOM 9053  C C4    . DT  J 6 14  ? 92.83900  64.04000  104.66500 1.000 219.89141 ? -59 DT  J C4    1 
ATOM 9054  O O4    . DT  J 6 14  ? 92.17500  65.02300  104.37100 1.000 219.89141 ? -59 DT  J O4    1 
ATOM 9055  C C5    . DT  J 6 14  ? 92.24500  62.82400  105.15700 1.000 219.89141 ? -59 DT  J C5    1 
ATOM 9056  C C7    . DT  J 6 14  ? 90.75900  62.72500  105.31500 1.000 219.89141 ? -59 DT  J C7    1 
ATOM 9057  C C6    . DT  J 6 14  ? 93.05800  61.80500  105.46300 1.000 219.89141 ? -59 DT  J C6    1 
ATOM 9058  P P     . DC  J 6 15  ? 97.39200  57.43600  107.55900 1.000 205.97578 ? -58 DC  J P     1 
ATOM 9059  O OP1   . DC  J 6 15  ? 97.45100  56.19700  106.75600 1.000 205.97578 ? -58 DC  J OP1   1 
ATOM 9060  O OP2   . DC  J 6 15  ? 96.69600  57.44300  108.86300 1.000 205.97578 ? -58 DC  J OP2   1 
ATOM 9061  O "O5'" . DC  J 6 15  ? 98.88200  57.97000  107.80300 1.000 205.97578 ? -58 DC  J "O5'" 1 
ATOM 9062  C "C5'" . DC  J 6 15  ? 99.30800  59.21300  107.22500 1.000 205.97578 ? -58 DC  J "C5'" 1 
ATOM 9063  C "C4'" . DC  J 6 15  ? 99.26200  60.34200  108.24600 1.000 205.97578 ? -58 DC  J "C4'" 1 
ATOM 9064  O "O4'" . DC  J 6 15  ? 98.19500  61.25200  107.93200 1.000 205.97578 ? -58 DC  J "O4'" 1 
ATOM 9065  C "C3'" . DC  J 6 15  ? 99.02000  59.90400  109.68500 1.000 205.97578 ? -58 DC  J "C3'" 1 
ATOM 9066  O "O3'" . DC  J 6 15  ? 100.29300 59.78800  110.42200 1.000 205.97578 ? -58 DC  J "O3'" 1 
ATOM 9067  C "C2'" . DC  J 6 15  ? 98.04700  60.95000  110.26300 1.000 205.97578 ? -58 DC  J "C2'" 1 
ATOM 9068  C "C1'" . DC  J 6 15  ? 97.80600  61.92300  109.10500 1.000 205.97578 ? -58 DC  J "C1'" 1 
ATOM 9069  N N1    . DC  J 6 15  ? 96.39400  62.34100  108.94900 1.000 205.97578 ? -58 DC  J N1    1 
ATOM 9070  C C2    . DC  J 6 15  ? 96.10400  63.56200  108.34300 1.000 205.97578 ? -58 DC  J C2    1 
ATOM 9071  O O2    . DC  J 6 15  ? 97.02100  64.28800  107.96800 1.000 205.97578 ? -58 DC  J O2    1 
ATOM 9072  N N3    . DC  J 6 15  ? 94.81900  63.93600  108.20200 1.000 205.97578 ? -58 DC  J N3    1 
ATOM 9073  C C4    . DC  J 6 15  ? 93.84500  63.13800  108.62600 1.000 205.97578 ? -58 DC  J C4    1 
ATOM 9074  N N4    . DC  J 6 15  ? 92.58900  63.55100  108.46000 1.000 205.97578 ? -58 DC  J N4    1 
ATOM 9075  C C5    . DC  J 6 15  ? 94.11500  61.89000  109.25000 1.000 205.97578 ? -58 DC  J C5    1 
ATOM 9076  C C6    . DC  J 6 15  ? 95.39400  61.53600  109.39300 1.000 205.97578 ? -58 DC  J C6    1 
ATOM 9077  P P     . DT  J 6 16  ? 101.02900 61.01100  111.18700 1.000 193.57053 ? -57 DT  J P     1 
ATOM 9078  O OP1   . DT  J 6 16  ? 102.45900 60.64100  111.21800 1.000 193.57053 ? -57 DT  J OP1   1 
ATOM 9079  O OP2   . DT  J 6 16  ? 100.34400 61.24100  112.47800 1.000 193.57053 ? -57 DT  J OP2   1 
ATOM 9080  O "O5'" . DT  J 6 16  ? 100.92100 62.28600  110.22100 1.000 193.57053 ? -57 DT  J "O5'" 1 
ATOM 9081  C "C5'" . DT  J 6 16  ? 102.03800 63.13200  110.01200 1.000 193.57053 ? -57 DT  J "C5'" 1 
ATOM 9082  C "C4'" . DT  J 6 16  ? 101.85300 64.45400  110.73400 1.000 193.57053 ? -57 DT  J "C4'" 1 
ATOM 9083  O "O4'" . DT  J 6 16  ? 100.46300 64.85600  110.63400 1.000 193.57053 ? -57 DT  J "O4'" 1 
ATOM 9084  C "C3'" . DT  J 6 16  ? 102.18500 64.43100  112.22700 1.000 193.57053 ? -57 DT  J "C3'" 1 
ATOM 9085  O "O3'" . DT  J 6 16  ? 102.89000 65.59000  112.57700 1.000 193.57053 ? -57 DT  J "O3'" 1 
ATOM 9086  C "C2'" . DT  J 6 16  ? 100.81700 64.40600  112.89400 1.000 193.57053 ? -57 DT  J "C2'" 1 
ATOM 9087  C "C1'" . DT  J 6 16  ? 99.97600  65.19200  111.90700 1.000 193.57053 ? -57 DT  J "C1'" 1 
ATOM 9088  N N1    . DT  J 6 16  ? 98.52800  64.85700  111.96400 1.000 193.57053 ? -57 DT  J N1    1 
ATOM 9089  C C2    . DT  J 6 16  ? 97.62300  65.73100  111.43100 1.000 193.57053 ? -57 DT  J C2    1 
ATOM 9090  O O2    . DT  J 6 16  ? 97.94200  66.77000  110.89200 1.000 193.57053 ? -57 DT  J O2    1 
ATOM 9091  N N3    . DT  J 6 16  ? 96.32000  65.34300  111.53700 1.000 193.57053 ? -57 DT  J N3    1 
ATOM 9092  C C4    . DT  J 6 16  ? 95.83900  64.19200  112.12200 1.000 193.57053 ? -57 DT  J C4    1 
ATOM 9093  O O4    . DT  J 6 16  ? 94.64300  63.93400  112.17200 1.000 193.57053 ? -57 DT  J O4    1 
ATOM 9094  C C5    . DT  J 6 16  ? 96.84200  63.31800  112.67300 1.000 193.57053 ? -57 DT  J C5    1 
ATOM 9095  C C7    . DT  J 6 16  ? 96.44100  62.03600  113.33800 1.000 193.57053 ? -57 DT  J C7    1 
ATOM 9096  C C6    . DT  J 6 16  ? 98.12300  63.69000  112.57200 1.000 193.57053 ? -57 DT  J C6    1 
ATOM 9097  P P     . DG  J 6 17  ? 104.44800 65.50100  112.93600 1.000 178.23846 ? -56 DG  J P     1 
ATOM 9098  O OP1   . DG  J 6 17  ? 105.15800 65.08600  111.70900 1.000 178.23846 ? -56 DG  J OP1   1 
ATOM 9099  O OP2   . DG  J 6 17  ? 104.57400 64.69500  114.16700 1.000 178.23846 ? -56 DG  J OP2   1 
ATOM 9100  O "O5'" . DG  J 6 17  ? 104.84500 67.00900  113.27100 1.000 178.23846 ? -56 DG  J "O5'" 1 
ATOM 9101  C "C5'" . DG  J 6 17  ? 104.38400 68.05300  112.43600 1.000 178.23846 ? -56 DG  J "C5'" 1 
ATOM 9102  C "C4'" . DG  J 6 17  ? 103.40900 68.95800  113.17200 1.000 178.23846 ? -56 DG  J "C4'" 1 
ATOM 9103  O "O4'" . DG  J 6 17  ? 102.16800 68.26000  113.45800 1.000 178.23846 ? -56 DG  J "O4'" 1 
ATOM 9104  C "C3'" . DG  J 6 17  ? 103.90200 69.50100  114.51400 1.000 178.23846 ? -56 DG  J "C3'" 1 
ATOM 9105  O "O3'" . DG  J 6 17  ? 103.57700 70.87000  114.59800 1.000 178.23846 ? -56 DG  J "O3'" 1 
ATOM 9106  C "C2'" . DG  J 6 17  ? 103.11200 68.68700  115.53000 1.000 178.23846 ? -56 DG  J "C2'" 1 
ATOM 9107  C "C1'" . DG  J 6 17  ? 101.80700 68.51900  114.79200 1.000 178.23846 ? -56 DG  J "C1'" 1 
ATOM 9108  N N9    . DG  J 6 17  ? 100.98700 67.43500  115.28800 1.000 178.23846 ? -56 DG  J N9    1 
ATOM 9109  C C8    . DG  J 6 17  ? 101.41000 66.29200  115.90900 1.000 178.23846 ? -56 DG  J C8    1 
ATOM 9110  N N7    . DG  J 6 17  ? 100.43500 65.50400  116.25800 1.000 178.23846 ? -56 DG  J N7    1 
ATOM 9111  C C5    . DG  J 6 17  ? 99.29600  66.17400  115.84200 1.000 178.23846 ? -56 DG  J C5    1 
ATOM 9112  C C6    . DG  J 6 17  ? 97.93800  65.81300  115.94700 1.000 178.23846 ? -56 DG  J C6    1 
ATOM 9113  O O6    . DG  J 6 17  ? 97.44900  64.79400  116.43600 1.000 178.23846 ? -56 DG  J O6    1 
ATOM 9114  N N1    . DG  J 6 17  ? 97.10800  66.77800  115.39800 1.000 178.23846 ? -56 DG  J N1    1 
ATOM 9115  C C2    . DG  J 6 17  ? 97.53400  67.94400  114.82100 1.000 178.23846 ? -56 DG  J C2    1 
ATOM 9116  N N2    . DG  J 6 17  ? 96.58100  68.75600  114.34400 1.000 178.23846 ? -56 DG  J N2    1 
ATOM 9117  N N3    . DG  J 6 17  ? 98.80400  68.29500  114.71800 1.000 178.23846 ? -56 DG  J N3    1 
ATOM 9118  C C4    . DG  J 6 17  ? 99.62400  67.36500  115.24900 1.000 178.23846 ? -56 DG  J C4    1 
ATOM 9119  P P     . DA  J 6 18  ? 104.45000 71.87100  115.49600 1.000 176.97121 ? -55 DA  J P     1 
ATOM 9120  O OP1   . DA  J 6 18  ? 105.60700 72.30400  114.68400 1.000 176.97121 ? -55 DA  J OP1   1 
ATOM 9121  O OP2   . DA  J 6 18  ? 104.66400 71.26100  116.82500 1.000 176.97121 ? -55 DA  J OP2   1 
ATOM 9122  O "O5'" . DA  J 6 18  ? 103.47500 73.11300  115.70000 1.000 176.97121 ? -55 DA  J "O5'" 1 
ATOM 9123  C "C5'" . DA  J 6 18  ? 102.74300 73.61500  114.59600 1.000 176.97121 ? -55 DA  J "C5'" 1 
ATOM 9124  C "C4'" . DA  J 6 18  ? 101.26100 73.71300  114.91400 1.000 176.97121 ? -55 DA  J "C4'" 1 
ATOM 9125  O "O4'" . DA  J 6 18  ? 100.73600 72.41600  115.30400 1.000 176.97121 ? -55 DA  J "O4'" 1 
ATOM 9126  C "C3'" . DA  J 6 18  ? 100.91600 74.67500  116.04700 1.000 176.97121 ? -55 DA  J "C3'" 1 
ATOM 9127  O "O3'" . DA  J 6 18  ? 99.77300  75.41900  115.70300 1.000 176.97121 ? -55 DA  J "O3'" 1 
ATOM 9128  C "C2'" . DA  J 6 18  ? 100.63600 73.73600  117.21700 1.000 176.97121 ? -55 DA  J "C2'" 1 
ATOM 9129  C "C1'" . DA  J 6 18  ? 100.02400 72.54600  116.51200 1.000 176.97121 ? -55 DA  J "C1'" 1 
ATOM 9130  N N9    . DA  J 6 18  ? 100.14900 71.30400  117.25900 1.000 176.97121 ? -55 DA  J N9    1 
ATOM 9131  C C8    . DA  J 6 18  ? 101.29900 70.74200  117.72100 1.000 176.97121 ? -55 DA  J C8    1 
ATOM 9132  N N7    . DA  J 6 18  ? 101.11500 69.62000  118.36900 1.000 176.97121 ? -55 DA  J N7    1 
ATOM 9133  C C5    . DA  J 6 18  ? 99.74700  69.44000  118.33600 1.000 176.97121 ? -55 DA  J C5    1 
ATOM 9134  C C6    . DA  J 6 18  ? 98.91500  68.43400  118.84700 1.000 176.97121 ? -55 DA  J C6    1 
ATOM 9135  N N6    . DA  J 6 18  ? 99.37400  67.38100  119.52600 1.000 176.97121 ? -55 DA  J N6    1 
ATOM 9136  N N1    . DA  J 6 18  ? 97.58900  68.55200  118.64400 1.000 176.97121 ? -55 DA  J N1    1 
ATOM 9137  C C2    . DA  J 6 18  ? 97.13200  69.60600  117.96600 1.000 176.97121 ? -55 DA  J C2    1 
ATOM 9138  N N3    . DA  J 6 18  ? 97.81900  70.61500  117.43500 1.000 176.97121 ? -55 DA  J N3    1 
ATOM 9139  C C4    . DA  J 6 18  ? 99.13400  70.46800  117.65700 1.000 176.97121 ? -55 DA  J C4    1 
ATOM 9140  P P     . DC  J 6 19  ? 99.37200  76.73400  116.53200 1.000 168.04484 ? -54 DC  J P     1 
ATOM 9141  O OP1   . DC  J 6 19  ? 99.22100  77.83100  115.55500 1.000 168.04484 ? -54 DC  J OP1   1 
ATOM 9142  O OP2   . DC  J 6 19  ? 100.29500 76.90500  117.67200 1.000 168.04484 ? -54 DC  J OP2   1 
ATOM 9143  O "O5'" . DC  J 6 19  ? 97.94600  76.37000  117.13200 1.000 168.04484 ? -54 DC  J "O5'" 1 
ATOM 9144  C "C5'" . DC  J 6 19  ? 96.94700  75.81600  116.29300 1.000 168.04484 ? -54 DC  J "C5'" 1 
ATOM 9145  C "C4'" . DC  J 6 19  ? 95.77300  75.29500  117.10500 1.000 168.04484 ? -54 DC  J "C4'" 1 
ATOM 9146  O "O4'" . DC  J 6 19  ? 96.10800  74.01400  117.70000 1.000 168.04484 ? -54 DC  J "O4'" 1 
ATOM 9147  C "C3'" . DC  J 6 19  ? 95.32500  76.18900  118.25400 1.000 168.04484 ? -54 DC  J "C3'" 1 
ATOM 9148  O "O3'" . DC  J 6 19  ? 93.91000  76.19800  118.31200 1.000 168.04484 ? -54 DC  J "O3'" 1 
ATOM 9149  C "C2'" . DC  J 6 19  ? 95.93300  75.50400  119.47400 1.000 168.04484 ? -54 DC  J "C2'" 1 
ATOM 9150  C "C1'" . DC  J 6 19  ? 95.82800  74.04500  119.08000 1.000 168.04484 ? -54 DC  J "C1'" 1 
ATOM 9151  N N1    . DC  J 6 19  ? 96.80100  73.15600  119.76700 1.000 168.04484 ? -54 DC  J N1    1 
ATOM 9152  C C2    . DC  J 6 19  ? 96.34600  72.02400  120.43900 1.000 168.04484 ? -54 DC  J C2    1 
ATOM 9153  O O2    . DC  J 6 19  ? 95.14000  71.78200  120.45700 1.000 168.04484 ? -54 DC  J O2    1 
ATOM 9154  N N3    . DC  J 6 19  ? 97.24400  71.21600  121.04600 1.000 168.04484 ? -54 DC  J N3    1 
ATOM 9155  C C4    . DC  J 6 19  ? 98.53800  71.50800  120.99900 1.000 168.04484 ? -54 DC  J C4    1 
ATOM 9156  N N4    . DC  J 6 19  ? 99.38500  70.68100  121.61400 1.000 168.04484 ? -54 DC  J N4    1 
ATOM 9157  C C5    . DC  J 6 19  ? 99.02300  72.65900  120.32100 1.000 168.04484 ? -54 DC  J C5    1 
ATOM 9158  C C6    . DC  J 6 19  ? 98.12600  73.44800  119.72500 1.000 168.04484 ? -54 DC  J C6    1 
ATOM 9159  P P     . DA  J 6 20  ? 93.13400  77.38400  119.06400 1.000 173.32235 ? -53 DA  J P     1 
ATOM 9160  O OP1   . DA  J 6 20  ? 92.16800  77.95300  118.10200 1.000 173.32235 ? -53 DA  J OP1   1 
ATOM 9161  O OP2   . DA  J 6 20  ? 94.13700  78.25300  119.71100 1.000 173.32235 ? -53 DA  J OP2   1 
ATOM 9162  O "O5'" . DA  J 6 20  ? 92.31200  76.64000  120.20900 1.000 173.32235 ? -53 DA  J "O5'" 1 
ATOM 9163  C "C5'" . DA  J 6 20  ? 91.41700  75.60200  119.86600 1.000 173.32235 ? -53 DA  J "C5'" 1 
ATOM 9164  C "C4'" . DA  J 6 20  ? 91.07300  74.73900  121.06900 1.000 173.32235 ? -53 DA  J "C4'" 1 
ATOM 9165  O "O4'" . DA  J 6 20  ? 92.21300  73.93200  121.46000 1.000 173.32235 ? -53 DA  J "O4'" 1 
ATOM 9166  C "C3'" . DA  J 6 20  ? 90.64300  75.50000  122.31600 1.000 173.32235 ? -53 DA  J "C3'" 1 
ATOM 9167  O "O3'" . DA  J 6 20  ? 89.57400  74.82800  122.91900 1.000 173.32235 ? -53 DA  J "O3'" 1 
ATOM 9168  C "C2'" . DA  J 6 20  ? 91.88300  75.45200  123.20000 1.000 173.32235 ? -53 DA  J "C2'" 1 
ATOM 9169  C "C1'" . DA  J 6 20  ? 92.47100  74.10300  122.83700 1.000 173.32235 ? -53 DA  J "C1'" 1 
ATOM 9170  N N9    . DA  J 6 20  ? 93.90400  74.02500  123.05000 1.000 173.32235 ? -53 DA  J N9    1 
ATOM 9171  C C8    . DA  J 6 20  ? 94.83400  74.91500  122.62300 1.000 173.32235 ? -53 DA  J C8    1 
ATOM 9172  N N7    . DA  J 6 20  ? 96.06200  74.59200  122.93100 1.000 173.32235 ? -53 DA  J N7    1 
ATOM 9173  C C5    . DA  J 6 20  ? 95.92600  73.40500  123.61600 1.000 173.32235 ? -53 DA  J C5    1 
ATOM 9174  C C6    . DA  J 6 20  ? 96.86200  72.55300  124.21500 1.000 173.32235 ? -53 DA  J C6    1 
ATOM 9175  N N6    . DA  J 6 20  ? 98.17200  72.79600  124.21200 1.000 173.32235 ? -53 DA  J N6    1 
ATOM 9176  N N1    . DA  J 6 20  ? 96.40000  71.44000  124.82100 1.000 173.32235 ? -53 DA  J N1    1 
ATOM 9177  C C2    . DA  J 6 20  ? 95.08200  71.20600  124.82200 1.000 173.32235 ? -53 DA  J C2    1 
ATOM 9178  N N3    . DA  J 6 20  ? 94.10500  71.93800  124.29100 1.000 173.32235 ? -53 DA  J N3    1 
ATOM 9179  C C4    . DA  J 6 20  ? 94.60200  73.03100  123.69300 1.000 173.32235 ? -53 DA  J C4    1 
ATOM 9180  P P     . DC  J 6 21  ? 88.66500  75.56200  124.01600 1.000 179.43948 ? -52 DC  J P     1 
ATOM 9181  O OP1   . DC  J 6 21  ? 87.26500  75.39400  123.57600 1.000 179.43948 ? -52 DC  J OP1   1 
ATOM 9182  O OP2   . DC  J 6 21  ? 89.19200  76.92200  124.26200 1.000 179.43948 ? -52 DC  J OP2   1 
ATOM 9183  O "O5'" . DC  J 6 21  ? 88.88900  74.68300  125.33000 1.000 179.43948 ? -52 DC  J "O5'" 1 
ATOM 9184  C "C5'" . DC  J 6 21  ? 88.65400  73.28700  125.28300 1.000 179.43948 ? -52 DC  J "C5'" 1 
ATOM 9185  C "C4'" . DC  J 6 21  ? 89.36600  72.56800  126.41300 1.000 179.43948 ? -52 DC  J "C4'" 1 
ATOM 9186  O "O4'" . DC  J 6 21  ? 90.80400  72.57700  126.19700 1.000 179.43948 ? -52 DC  J "O4'" 1 
ATOM 9187  C "C3'" . DC  J 6 21  ? 89.14600  73.16300  127.80600 1.000 179.43948 ? -52 DC  J "C3'" 1 
ATOM 9188  O "O3'" . DC  J 6 21  ? 88.89700  72.11000  128.72600 1.000 179.43948 ? -52 DC  J "O3'" 1 
ATOM 9189  C "C2'" . DC  J 6 21  ? 90.47600  73.84800  128.08800 1.000 179.43948 ? -52 DC  J "C2'" 1 
ATOM 9190  C "C1'" . DC  J 6 21  ? 91.42700  72.88700  127.41800 1.000 179.43948 ? -52 DC  J "C1'" 1 
ATOM 9191  N N1    . DC  J 6 21  ? 92.76700  73.45500  127.16600 1.000 179.43948 ? -52 DC  J N1    1 
ATOM 9192  C C2    . DC  J 6 21  ? 93.88900  72.80300  127.66900 1.000 179.43948 ? -52 DC  J C2    1 
ATOM 9193  O O2    . DC  J 6 21  ? 93.74000  71.75500  128.29800 1.000 179.43948 ? -52 DC  J O2    1 
ATOM 9194  N N3    . DC  J 6 21  ? 95.10700  73.33600  127.45000 1.000 179.43948 ? -52 DC  J N3    1 
ATOM 9195  C C4    . DC  J 6 21  ? 95.22100  74.46900  126.76700 1.000 179.43948 ? -52 DC  J C4    1 
ATOM 9196  N N4    . DC  J 6 21  ? 96.44600  74.95900  126.57100 1.000 179.43948 ? -52 DC  J N4    1 
ATOM 9197  C C5    . DC  J 6 21  ? 94.08500  75.15700  126.25800 1.000 179.43948 ? -52 DC  J C5    1 
ATOM 9198  C C6    . DC  J 6 21  ? 92.88900  74.61900  126.48500 1.000 179.43948 ? -52 DC  J C6    1 
ATOM 9199  P P     . DG  J 6 22  ? 88.34100  72.40600  130.20600 1.000 175.63553 ? -51 DG  J P     1 
ATOM 9200  O OP1   . DG  J 6 22  ? 86.94600  72.85900  130.04300 1.000 175.63553 ? -51 DG  J OP1   1 
ATOM 9201  O OP2   . DG  J 6 22  ? 89.28900  73.23200  130.98400 1.000 175.63553 ? -51 DG  J OP2   1 
ATOM 9202  O "O5'" . DG  J 6 22  ? 88.34300  70.96100  130.88900 1.000 175.63553 ? -51 DG  J "O5'" 1 
ATOM 9203  C "C5'" . DG  J 6 22  ? 89.32300  70.00400  130.51500 1.000 175.63553 ? -51 DG  J "C5'" 1 
ATOM 9204  C "C4'" . DG  J 6 22  ? 90.49200  70.01300  131.48000 1.000 175.63553 ? -51 DG  J "C4'" 1 
ATOM 9205  O "O4'" . DG  J 6 22  ? 91.58300  70.75900  130.91800 1.000 175.63553 ? -51 DG  J "O4'" 1 
ATOM 9206  C "C3'" . DG  J 6 22  ? 90.20700  70.64000  132.84500 1.000 175.63553 ? -51 DG  J "C3'" 1 
ATOM 9207  O "O3'" . DG  J 6 22  ? 90.18600  69.61700  133.84100 1.000 175.63553 ? -51 DG  J "O3'" 1 
ATOM 9208  C "C2'" . DG  J 6 22  ? 91.36000  71.63900  133.05600 1.000 175.63553 ? -51 DG  J "C2'" 1 
ATOM 9209  C "C1'" . DG  J 6 22  ? 92.34900  71.26700  131.96900 1.000 175.63553 ? -51 DG  J "C1'" 1 
ATOM 9210  N N9    . DG  J 6 22  ? 93.12100  72.38700  131.46400 1.000 175.63553 ? -51 DG  J N9    1 
ATOM 9211  C C8    . DG  J 6 22  ? 92.65000  73.46000  130.76100 1.000 175.63553 ? -51 DG  J C8    1 
ATOM 9212  N N7    . DG  J 6 22  ? 93.57600  74.31200  130.43600 1.000 175.63553 ? -51 DG  J N7    1 
ATOM 9213  C C5    . DG  J 6 22  ? 94.73400  73.76500  130.95900 1.000 175.63553 ? -51 DG  J C5    1 
ATOM 9214  C C6    . DG  J 6 22  ? 96.05700  74.24200  130.92400 1.000 175.63553 ? -51 DG  J C6    1 
ATOM 9215  O O6    . DG  J 6 22  ? 96.48500  75.27300  130.40200 1.000 175.63553 ? -51 DG  J O6    1 
ATOM 9216  N N1    . DG  J 6 22  ? 96.92900  73.38500  131.57800 1.000 175.63553 ? -51 DG  J N1    1 
ATOM 9217  C C2    . DG  J 6 22  ? 96.56600  72.21400  132.18700 1.000 175.63553 ? -51 DG  J C2    1 
ATOM 9218  N N2    . DG  J 6 22  ? 97.55100  71.52000  132.76700 1.000 175.63553 ? -51 DG  J N2    1 
ATOM 9219  N N3    . DG  J 6 22  ? 95.32700  71.75600  132.23100 1.000 175.63553 ? -51 DG  J N3    1 
ATOM 9220  C C4    . DG  J 6 22  ? 94.46800  72.58000  131.59600 1.000 175.63553 ? -51 DG  J C4    1 
ATOM 9221  P P     . DT  J 6 23  ? 90.03300  69.97300  135.40100 1.000 176.74919 ? -50 DT  J P     1 
ATOM 9222  O OP1   . DT  J 6 23  ? 89.47200  68.76600  136.04400 1.000 176.74919 ? -50 DT  J OP1   1 
ATOM 9223  O OP2   . DT  J 6 23  ? 89.33500  71.26800  135.56000 1.000 176.74919 ? -50 DT  J OP2   1 
ATOM 9224  O "O5'" . DT  J 6 23  ? 91.53700  70.12500  135.90900 1.000 176.74919 ? -50 DT  J "O5'" 1 
ATOM 9225  C "C5'" . DT  J 6 23  ? 92.48700  69.12400  135.58900 1.000 176.74919 ? -50 DT  J "C5'" 1 
ATOM 9226  C "C4'" . DT  J 6 23  ? 93.81300  69.40800  136.25900 1.000 176.74919 ? -50 DT  J "C4'" 1 
ATOM 9227  O "O4'" . DT  J 6 23  ? 94.57100  70.36900  135.48100 1.000 176.74919 ? -50 DT  J "O4'" 1 
ATOM 9228  C "C3'" . DT  J 6 23  ? 93.71100  69.98200  137.67000 1.000 176.74919 ? -50 DT  J "C3'" 1 
ATOM 9229  O "O3'" . DT  J 6 23  ? 94.62200  69.32400  138.51800 1.000 176.74919 ? -50 DT  J "O3'" 1 
ATOM 9230  C "C2'" . DT  J 6 23  ? 94.08600  71.44600  137.48500 1.000 176.74919 ? -50 DT  J "C2'" 1 
ATOM 9231  C "C1'" . DT  J 6 23  ? 95.06500  71.37700  136.33100 1.000 176.74919 ? -50 DT  J "C1'" 1 
ATOM 9232  N N1    . DT  J 6 23  ? 95.15200  72.63500  135.56400 1.000 176.74919 ? -50 DT  J N1    1 
ATOM 9233  C C2    . DT  J 6 23  ? 96.37900  73.21600  135.36400 1.000 176.74919 ? -50 DT  J C2    1 
ATOM 9234  O O2    . DT  J 6 23  ? 97.41900  72.73100  135.76500 1.000 176.74919 ? -50 DT  J O2    1 
ATOM 9235  N N3    . DT  J 6 23  ? 96.34900  74.37600  134.64700 1.000 176.74919 ? -50 DT  J N3    1 
ATOM 9236  C C4    . DT  J 6 23  ? 95.23600  75.00900  134.13800 1.000 176.74919 ? -50 DT  J C4    1 
ATOM 9237  O O4    . DT  J 6 23  ? 95.30700  76.05400  133.51200 1.000 176.74919 ? -50 DT  J O4    1 
ATOM 9238  C C5    . DT  J 6 23  ? 93.98200  74.35800  134.39800 1.000 176.74919 ? -50 DT  J C5    1 
ATOM 9239  C C7    . DT  J 6 23  ? 92.70800  74.96500  133.90000 1.000 176.74919 ? -50 DT  J C7    1 
ATOM 9240  C C6    . DT  J 6 23  ? 93.99800  73.21700  135.09400 1.000 176.74919 ? -50 DT  J C6    1 
ATOM 9241  P P     . DG  J 6 24  ? 94.48600  69.44700  140.11200 1.000 175.61460 ? -49 DG  J P     1 
ATOM 9242  O OP1   . DG  J 6 24  ? 94.60900  68.08200  140.66600 1.000 175.61460 ? -49 DG  J OP1   1 
ATOM 9243  O OP2   . DG  J 6 24  ? 93.29800  70.26800  140.43100 1.000 175.61460 ? -49 DG  J OP2   1 
ATOM 9244  O "O5'" . DG  J 6 24  ? 95.79400  70.26400  140.51900 1.000 175.61460 ? -49 DG  J "O5'" 1 
ATOM 9245  C "C5'" . DG  J 6 24  ? 97.05400  69.80100  140.07900 1.000 175.61460 ? -49 DG  J "C5'" 1 
ATOM 9246  C "C4'" . DG  J 6 24  ? 98.11400  70.87100  140.22100 1.000 175.61460 ? -49 DG  J "C4'" 1 
ATOM 9247  O "O4'" . DG  J 6 24  ? 97.92700  71.89400  139.21200 1.000 175.61460 ? -49 DG  J "O4'" 1 
ATOM 9248  C "C3'" . DG  J 6 24  ? 98.12900  71.58500  141.56800 1.000 175.61460 ? -49 DG  J "C3'" 1 
ATOM 9249  O "O3'" . DG  J 6 24  ? 99.45000  71.62200  142.06300 1.000 175.61460 ? -49 DG  J "O3'" 1 
ATOM 9250  C "C2'" . DG  J 6 24  ? 97.61200  72.98700  141.24600 1.000 175.61460 ? -49 DG  J "C2'" 1 
ATOM 9251  C "C1'" . DG  J 6 24  ? 98.03500  73.16700  139.80100 1.000 175.61460 ? -49 DG  J "C1'" 1 
ATOM 9252  N N9    . DG  J 6 24  ? 97.18200  74.08400  139.06100 1.000 175.61460 ? -49 DG  J N9    1 
ATOM 9253  C C8    . DG  J 6 24  ? 95.82400  74.01900  138.93900 1.000 175.61460 ? -49 DG  J C8    1 
ATOM 9254  N N7    . DG  J 6 24  ? 95.32200  74.96000  138.19900 1.000 175.61460 ? -49 DG  J N7    1 
ATOM 9255  C C5    . DG  J 6 24  ? 96.42100  75.69600  137.80100 1.000 175.61460 ? -49 DG  J C5    1 
ATOM 9256  C C6    . DG  J 6 24  ? 96.49300  76.83900  136.98700 1.000 175.61460 ? -49 DG  J C6    1 
ATOM 9257  O O6    . DG  J 6 24  ? 95.56600  77.44400  136.44200 1.000 175.61460 ? -49 DG  J O6    1 
ATOM 9258  N N1    . DG  J 6 24  ? 97.79900  77.27700  136.83100 1.000 175.61460 ? -49 DG  J N1    1 
ATOM 9259  C C2    . DG  J 6 24  ? 98.89800  76.67900  137.39000 1.000 175.61460 ? -49 DG  J C2    1 
ATOM 9260  N N2    . DG  J 6 24  ? 100.08100 77.24300  137.12800 1.000 175.61460 ? -49 DG  J N2    1 
ATOM 9261  N N3    . DG  J 6 24  ? 98.84400  75.60400  138.15800 1.000 175.61460 ? -49 DG  J N3    1 
ATOM 9262  C C4    . DG  J 6 24  ? 97.57600  75.16900  138.32000 1.000 175.61460 ? -49 DG  J C4    1 
ATOM 9263  P P     . DC  J 6 25  ? 99.74900  72.13000  143.55600 1.000 173.93689 ? -48 DC  J P     1 
ATOM 9264  O OP1   . DC  J 6 25  ? 100.83900 71.28700  144.09400 1.000 173.93689 ? -48 DC  J OP1   1 
ATOM 9265  O OP2   . DC  J 6 25  ? 98.47500  72.23600  144.30000 1.000 173.93689 ? -48 DC  J OP2   1 
ATOM 9266  O "O5'" . DC  J 6 25  ? 100.33500 73.59200  143.32600 1.000 173.93689 ? -48 DC  J "O5'" 1 
ATOM 9267  C "C5'" . DC  J 6 25  ? 101.38000 73.77400  142.39200 1.000 173.93689 ? -48 DC  J "C5'" 1 
ATOM 9268  C "C4'" . DC  J 6 25  ? 101.63300 75.24300  142.12900 1.000 173.93689 ? -48 DC  J "C4'" 1 
ATOM 9269  O "O4'" . DC  J 6 25  ? 100.57300 75.79900  141.31300 1.000 173.93689 ? -48 DC  J "O4'" 1 
ATOM 9270  C "C3'" . DC  J 6 25  ? 101.71200 76.11500  143.37700 1.000 173.93689 ? -48 DC  J "C3'" 1 
ATOM 9271  O "O3'" . DC  J 6 25  ? 102.80900 76.99300  143.25900 1.000 173.93689 ? -48 DC  J "O3'" 1 
ATOM 9272  C "C2'" . DC  J 6 25  ? 100.38400 76.87300  143.35900 1.000 173.93689 ? -48 DC  J "C2'" 1 
ATOM 9273  C "C1'" . DC  J 6 25  ? 100.16200 77.02200  141.86900 1.000 173.93689 ? -48 DC  J "C1'" 1 
ATOM 9274  N N1    . DC  J 6 25  ? 98.76100  77.26900  141.47200 1.000 173.93689 ? -48 DC  J N1    1 
ATOM 9275  C C2    . DC  J 6 25  ? 98.47700  78.32900  140.61700 1.000 173.93689 ? -48 DC  J C2    1 
ATOM 9276  O O2    . DC  J 6 25  ? 99.40500  79.03900  140.22300 1.000 173.93689 ? -48 DC  J O2    1 
ATOM 9277  N N3    . DC  J 6 25  ? 97.19800  78.54600  140.24000 1.000 173.93689 ? -48 DC  J N3    1 
ATOM 9278  C C4    . DC  J 6 25  ? 96.23100  77.75200  140.69100 1.000 173.93689 ? -48 DC  J C4    1 
ATOM 9279  N N4    . DC  J 6 25  ? 94.98100  78.00400  140.29600 1.000 173.93689 ? -48 DC  J N4    1 
ATOM 9280  C C5    . DC  J 6 25  ? 96.50200  76.66300  141.56600 1.000 173.93689 ? -48 DC  J C5    1 
ATOM 9281  C C6    . DC  J 6 25  ? 97.77100  76.46300  141.92900 1.000 173.93689 ? -48 DC  J C6    1 
ATOM 9282  P P     . DC  J 6 26  ? 103.53900 77.54900  144.57200 1.000 165.95429 ? -47 DC  J P     1 
ATOM 9283  O OP1   . DC  J 6 26  ? 104.92200 77.02900  144.55200 1.000 165.95429 ? -47 DC  J OP1   1 
ATOM 9284  O OP2   . DC  J 6 26  ? 102.66900 77.28300  145.73600 1.000 165.95429 ? -47 DC  J OP2   1 
ATOM 9285  O "O5'" . DC  J 6 26  ? 103.58500 79.12400  144.33900 1.000 165.95429 ? -47 DC  J "O5'" 1 
ATOM 9286  C "C5'" . DC  J 6 26  ? 104.11800 79.64400  143.13800 1.000 165.95429 ? -47 DC  J "C5'" 1 
ATOM 9287  C "C4'" . DC  J 6 26  ? 103.58800 81.03900  142.86600 1.000 165.95429 ? -47 DC  J "C4'" 1 
ATOM 9288  O "O4'" . DC  J 6 26  ? 102.20600 80.97400  142.44500 1.000 165.95429 ? -47 DC  J "O4'" 1 
ATOM 9289  C "C3'" . DC  J 6 26  ? 103.62300 81.98800  144.06300 1.000 165.95429 ? -47 DC  J "C3'" 1 
ATOM 9290  O "O3'" . DC  J 6 26  ? 104.07500 83.25100  143.65300 1.000 165.95429 ? -47 DC  J "O3'" 1 
ATOM 9291  C "C2'" . DC  J 6 26  ? 102.16500 82.04600  144.50800 1.000 165.95429 ? -47 DC  J "C2'" 1 
ATOM 9292  C "C1'" . DC  J 6 26  ? 101.45200 81.90300  143.18300 1.000 165.95429 ? -47 DC  J "C1'" 1 
ATOM 9293  N N1    . DC  J 6 26  ? 100.08700 81.39600  143.30100 1.000 165.95429 ? -47 DC  J N1    1 
ATOM 9294  C C2    . DC  J 6 26  ? 99.07200  82.03100  142.60300 1.000 165.95429 ? -47 DC  J C2    1 
ATOM 9295  O O2    . DC  J 6 26  ? 99.35300  82.99700  141.88900 1.000 165.95429 ? -47 DC  J O2    1 
ATOM 9296  N N3    . DC  J 6 26  ? 97.81200  81.55800  142.70000 1.000 165.95429 ? -47 DC  J N3    1 
ATOM 9297  C C4    . DC  J 6 26  ? 97.55500  80.51400  143.48400 1.000 165.95429 ? -47 DC  J C4    1 
ATOM 9298  N N4    . DC  J 6 26  ? 96.29300  80.08700  143.55200 1.000 165.95429 ? -47 DC  J N4    1 
ATOM 9299  C C5    . DC  J 6 26  ? 98.58200  79.85600  144.21700 1.000 165.95429 ? -47 DC  J C5    1 
ATOM 9300  C C6    . DC  J 6 26  ? 99.82400  80.33100  144.09900 1.000 165.95429 ? -47 DC  J C6    1 
ATOM 9301  P P     . DT  J 6 27  ? 105.60100 83.66800  143.90800 1.000 164.35989 ? -46 DT  J P     1 
ATOM 9302  O OP1   . DT  J 6 27  ? 106.46800 82.59100  143.37900 1.000 164.35989 ? -46 DT  J OP1   1 
ATOM 9303  O OP2   . DT  J 6 27  ? 105.70600 84.09500  145.31800 1.000 164.35989 ? -46 DT  J OP2   1 
ATOM 9304  O "O5'" . DT  J 6 27  ? 105.79600 84.95600  142.99900 1.000 164.35989 ? -46 DT  J "O5'" 1 
ATOM 9305  C "C5'" . DT  J 6 27  ? 105.48800 84.89400  141.62800 1.000 164.35989 ? -46 DT  J "C5'" 1 
ATOM 9306  C "C4'" . DT  J 6 27  ? 104.36900 85.85600  141.27400 1.000 164.35989 ? -46 DT  J "C4'" 1 
ATOM 9307  O "O4'" . DT  J 6 27  ? 103.11400 85.40000  141.84000 1.000 164.35989 ? -46 DT  J "O4'" 1 
ATOM 9308  C "C3'" . DT  J 6 27  ? 104.56200 87.28800  141.77200 1.000 164.35989 ? -46 DT  J "C3'" 1 
ATOM 9309  O "O3'" . DT  J 6 27  ? 104.14600 88.19100  140.77300 1.000 164.35989 ? -46 DT  J "O3'" 1 
ATOM 9310  C "C2'" . DT  J 6 27  ? 103.63900 87.35300  142.98500 1.000 164.35989 ? -46 DT  J "C2'" 1 
ATOM 9311  C "C1'" . DT  J 6 27  ? 102.50300 86.46700  142.52400 1.000 164.35989 ? -46 DT  J "C1'" 1 
ATOM 9312  N N1    . DT  J 6 27  ? 101.68600 85.92200  143.61700 1.000 164.35989 ? -46 DT  J N1    1 
ATOM 9313  C C2    . DT  J 6 27  ? 100.35800 85.68900  143.39300 1.000 164.35989 ? -46 DT  J C2    1 
ATOM 9314  O O2    . DT  J 6 27  ? 99.81900  85.89500  142.32500 1.000 164.35989 ? -46 DT  J O2    1 
ATOM 9315  N N3    . DT  J 6 27  ? 99.67900  85.18700  144.46000 1.000 164.35989 ? -46 DT  J N3    1 
ATOM 9316  C C4    . DT  J 6 27  ? 100.18400 84.91300  145.71000 1.000 164.35989 ? -46 DT  J C4    1 
ATOM 9317  O O4    . DT  J 6 27  ? 99.49000  84.46000  146.60600 1.000 164.35989 ? -46 DT  J O4    1 
ATOM 9318  C C5    . DT  J 6 27  ? 101.58400 85.19300  145.88500 1.000 164.35989 ? -46 DT  J C5    1 
ATOM 9319  C C7    . DT  J 6 27  ? 102.24400 84.92900  147.20100 1.000 164.35989 ? -46 DT  J C7    1 
ATOM 9320  C C6    . DT  J 6 27  ? 102.26200 85.67900  144.84100 1.000 164.35989 ? -46 DT  J C6    1 
ATOM 9321  P P     . DG  J 6 28  ? 104.78900 89.65700  140.68600 1.000 160.53110 ? -45 DG  J P     1 
ATOM 9322  O OP1   . DG  J 6 28  ? 105.83500 89.61500  139.64400 1.000 160.53110 ? -45 DG  J OP1   1 
ATOM 9323  O OP2   . DG  J 6 28  ? 105.12600 90.11300  142.05100 1.000 160.53110 ? -45 DG  J OP2   1 
ATOM 9324  O "O5'" . DG  J 6 28  ? 103.59100 90.56100  140.15600 1.000 160.53110 ? -45 DG  J "O5'" 1 
ATOM 9325  C "C5'" . DG  J 6 28  ? 102.89100 90.18400  138.98700 1.000 160.53110 ? -45 DG  J "C5'" 1 
ATOM 9326  C "C4'" . DG  J 6 28  ? 101.39600 90.32100  139.18600 1.000 160.53110 ? -45 DG  J "C4'" 1 
ATOM 9327  O "O4'" . DG  J 6 28  ? 100.99300 89.61500  140.38600 1.000 160.53110 ? -45 DG  J "O4'" 1 
ATOM 9328  C "C3'" . DG  J 6 28  ? 100.90800 91.75600  139.35400 1.000 160.53110 ? -45 DG  J "C3'" 1 
ATOM 9329  O "O3'" . DG  J 6 28  ? 99.70500  91.94000  138.63900 1.000 160.53110 ? -45 DG  J "O3'" 1 
ATOM 9330  C "C2'" . DG  J 6 28  ? 100.68500 91.87000  140.85700 1.000 160.53110 ? -45 DG  J "C2'" 1 
ATOM 9331  C "C1'" . DG  J 6 28  ? 100.22700 90.46900  141.20100 1.000 160.53110 ? -45 DG  J "C1'" 1 
ATOM 9332  N N9    . DG  J 6 28  ? 100.45500 90.10700  142.59200 1.000 160.53110 ? -45 DG  J N9    1 
ATOM 9333  C C8    . DG  J 6 28  ? 101.63900 90.17100  143.27300 1.000 160.53110 ? -45 DG  J C8    1 
ATOM 9334  N N7    . DG  J 6 28  ? 101.55100 89.76500  144.50500 1.000 160.53110 ? -45 DG  J N7    1 
ATOM 9335  C C5    . DG  J 6 28  ? 100.22200 89.40700  144.64900 1.000 160.53110 ? -45 DG  J C5    1 
ATOM 9336  C C6    . DG  J 6 28  ? 99.53600  88.89600  145.77000 1.000 160.53110 ? -45 DG  J C6    1 
ATOM 9337  O O6    . DG  J 6 28  ? 99.97900  88.64600  146.89300 1.000 160.53110 ? -45 DG  J O6    1 
ATOM 9338  N N1    . DG  J 6 28  ? 98.20000  88.66100  145.49200 1.000 160.53110 ? -45 DG  J N1    1 
ATOM 9339  C C2    . DG  J 6 28  ? 97.60000  88.89500  144.28500 1.000 160.53110 ? -45 DG  J C2    1 
ATOM 9340  N N2    . DG  J 6 28  ? 96.29700  88.60300  144.21100 1.000 160.53110 ? -45 DG  J N2    1 
ATOM 9341  N N3    . DG  J 6 28  ? 98.23000  89.37600  143.22500 1.000 160.53110 ? -45 DG  J N3    1 
ATOM 9342  C C4    . DG  J 6 28  ? 99.53500  89.60500  143.48000 1.000 160.53110 ? -45 DG  J C4    1 
ATOM 9343  P P     . DG  J 6 29  ? 99.18700  93.41800  138.28800 1.000 154.69924 ? -44 DG  J P     1 
ATOM 9344  O OP1   . DG  J 6 29  ? 99.01500  93.46900  136.82300 1.000 154.69924 ? -44 DG  J OP1   1 
ATOM 9345  O OP2   . DG  J 6 29  ? 100.04700 94.41700  138.95200 1.000 154.69924 ? -44 DG  J OP2   1 
ATOM 9346  O "O5'" . DG  J 6 29  ? 97.74500  93.47500  138.96200 1.000 154.69924 ? -44 DG  J "O5'" 1 
ATOM 9347  C "C5'" . DG  J 6 29  ? 96.75500  92.55300  138.55600 1.000 154.69924 ? -44 DG  J "C5'" 1 
ATOM 9348  C "C4'" . DG  J 6 29  ? 95.66800  92.43500  139.60200 1.000 154.69924 ? -44 DG  J "C4'" 1 
ATOM 9349  O "O4'" . DG  J 6 29  ? 96.22200  91.87400  140.81800 1.000 154.69924 ? -44 DG  J "O4'" 1 
ATOM 9350  C "C3'" . DG  J 6 29  ? 95.00600  93.75100  139.99900 1.000 154.69924 ? -44 DG  J "C3'" 1 
ATOM 9351  O "O3'" . DG  J 6 29  ? 93.59300  93.60200  139.99200 1.000 154.69924 ? -44 DG  J "O3'" 1 
ATOM 9352  C "C2'" . DG  J 6 29  ? 95.53700  94.00700  141.40200 1.000 154.69924 ? -44 DG  J "C2'" 1 
ATOM 9353  C "C1'" . DG  J 6 29  ? 95.75400  92.60000  141.92400 1.000 154.69924 ? -44 DG  J "C1'" 1 
ATOM 9354  N N9    . DG  J 6 29  ? 96.75400  92.53100  142.97800 1.000 154.69924 ? -44 DG  J N9    1 
ATOM 9355  C C8    . DG  J 6 29  ? 98.07700  92.84200  142.86900 1.000 154.69924 ? -44 DG  J C8    1 
ATOM 9356  N N7    . DG  J 6 29  ? 98.74700  92.66700  143.96800 1.000 154.69924 ? -44 DG  J N7    1 
ATOM 9357  C C5    . DG  J 6 29  ? 97.80900  92.18700  144.86000 1.000 154.69924 ? -44 DG  J C5    1 
ATOM 9358  C C6    . DG  J 6 29  ? 97.95400  91.81300  146.20600 1.000 154.69924 ? -44 DG  J C6    1 
ATOM 9359  O O6    . DG  J 6 29  ? 98.97300  91.83200  146.89800 1.000 154.69924 ? -44 DG  J O6    1 
ATOM 9360  N N1    . DG  J 6 29  ? 96.75800  91.37700  146.75100 1.000 154.69924 ? -44 DG  J N1    1 
ATOM 9361  C C2    . DG  J 6 29  ? 95.57000  91.30700  146.07400 1.000 154.69924 ? -44 DG  J C2    1 
ATOM 9362  N N2    . DG  J 6 29  ? 94.51800  90.86400  146.77200 1.000 154.69924 ? -44 DG  J N2    1 
ATOM 9363  N N3    . DG  J 6 29  ? 95.41600  91.66300  144.80700 1.000 154.69924 ? -44 DG  J N3    1 
ATOM 9364  C C4    . DG  J 6 29  ? 96.57800  92.08300  144.26300 1.000 154.69924 ? -44 DG  J C4    1 
ATOM 9365  P P     . DA  J 6 30  ? 92.63100  94.88500  140.08900 1.000 154.22642 ? -43 DA  J P     1 
ATOM 9366  O OP1   . DA  J 6 30  ? 91.55100  94.69900  139.10100 1.000 154.22642 ? -43 DA  J OP1   1 
ATOM 9367  O OP2   . DA  J 6 30  ? 93.45000  96.11400  140.05600 1.000 154.22642 ? -43 DA  J OP2   1 
ATOM 9368  O "O5'" . DA  J 6 30  ? 91.97800  94.74600  141.53300 1.000 154.22642 ? -43 DA  J "O5'" 1 
ATOM 9369  C "C5'" . DA  J 6 30  ? 91.11500  93.65800  141.79200 1.000 154.22642 ? -43 DA  J "C5'" 1 
ATOM 9370  C "C4'" . DA  J 6 30  ? 90.78400  93.54700  143.26500 1.000 154.22642 ? -43 DA  J "C4'" 1 
ATOM 9371  O "O4'" . DA  J 6 30  ? 91.99200  93.27700  144.01500 1.000 154.22642 ? -43 DA  J "O4'" 1 
ATOM 9372  C "C3'" . DA  J 6 30  ? 90.16100  94.78900  143.89300 1.000 154.22642 ? -43 DA  J "C3'" 1 
ATOM 9373  O "O3'" . DA  J 6 30  ? 89.11100  94.40500  144.74900 1.000 154.22642 ? -43 DA  J "O3'" 1 
ATOM 9374  C "C2'" . DA  J 6 30  ? 91.31300  95.39200  144.68200 1.000 154.22642 ? -43 DA  J "C2'" 1 
ATOM 9375  C "C1'" . DA  J 6 30  ? 92.07200  94.15300  145.10700 1.000 154.22642 ? -43 DA  J "C1'" 1 
ATOM 9376  N N9    . DA  J 6 30  ? 93.47000  94.41100  145.37800 1.000 154.22642 ? -43 DA  J N9    1 
ATOM 9377  C C8    . DA  J 6 30  ? 94.40700  94.82700  144.49300 1.000 154.22642 ? -43 DA  J C8    1 
ATOM 9378  N N7    . DA  J 6 30  ? 95.59800  94.97000  145.00700 1.000 154.22642 ? -43 DA  J N7    1 
ATOM 9379  C C5    . DA  J 6 30  ? 95.42600  94.60400  146.32200 1.000 154.22642 ? -43 DA  J C5    1 
ATOM 9380  C C6    . DA  J 6 30  ? 96.31100  94.52900  147.40400 1.000 154.22642 ? -43 DA  J C6