data_6SEG
# 
_entry.id   6SEG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6SEG         
WWPDB D_1292103571 
EMDB  EMD-10155    
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'Class1: CENP-A nucleosome in complex with CENP-C central region' 
_pdbx_database_related.db_id          EMD-10155 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6SEG 
_pdbx_database_status.recvd_initial_deposition_date   2019-07-30 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Ali-Ahmad, A.' 1 0000-0002-9021-5405 
'Bilokapic, S.' 2 0000-0003-2199-2929 
'Schafer, I.B.' 3 ?                   
'Halic, M.'     4 0000-0002-0061-7372 
'Sekulic, N.'   5 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Embo Rep.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1469-3178 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            20 
_citation.language                  ? 
_citation.page_first                e48913 
_citation.page_last                 e48913 
_citation.title                     'CENP-C unwraps the human CENP-A nucleosome through the H2A C-terminal tail.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.15252/embr.201948913 
_citation.pdbx_database_id_PubMed   31475439 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ali-Ahmad, A.' 1 ?                   
primary 'Bilokapic, S.' 2 ?                   
primary 'Schafer, I.B.' 3 ?                   
primary 'Halic, M.'     4 0000-0002-0061-7372 
primary 'Sekulic, N.'   5 0000-0002-8027-9114 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6SEG 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.00 
_cell.length_a_esd                 ? 
_cell.length_b                     1.00 
_cell.length_b_esd                 ? 
_cell.length_c                     1.00 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6SEG 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Histone H3-like centromeric protein A' 16023.630 2 ? ? ? ? 
2 polymer man 'Histone H4'                            11394.426 2 ? ? ? ? 
3 polymer man 'Histone H2A type 2-A'                  14125.549 2 ? ? ? ? 
4 polymer man 'Histone H2B type 1-C/E/F/G/I'          13937.213 2 ? ? ? ? 
5 polymer man 'DNA (145-MER)'                         44520.383 1 ? ? ? ? 
6 polymer man 'DNA (145-MER)'                         44991.660 1 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Centromere autoantigen A,Centromere protein A,CENP-A'                                                                
3 'Histone H2A.2,Histone H2A/o'                                                                                         
4 'Histone H2B.1 A,Histone H2B.a,H2B/a,Histone H2B.g,H2B/g,Histone H2B.h,H2B/h,Histone H2B.k,H2B/k,Histone H2B.l,H2B/l' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTR
GVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG
;
;MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTR
GVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG
;
A,E ? 
2 'polypeptide(L)'        no no 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
;
;MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
;
C,G ? 
4 'polypeptide(L)'        no no 
;MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
;MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DG)(DA)(DA)(DT)(DC)(DC)(DC)(DG)(DG)(DT)(DG)(DC)(DC)(DG)(DA)(DG)
(DG)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DA)(DT)(DT)(DG)(DG)(DT)(DC)(DG)(DT)(DA)(DG)(DA)
(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DA)(DG)(DC)(DA)(DC)(DC)(DG)(DC)(DT)(DT)(DA)(DA)(DA)
(DC)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DG)(DC)(DT)(DG)(DT)(DC)(DC)(DC)(DC)
(DC)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DA)(DA)(DC)(DC)(DG)(DC)(DC)(DA)(DA)(DG)(DG)(DG)
(DG)(DA)(DT)(DT)(DA)(DC)(DT)(DC)(DC)(DC)(DT)(DA)(DG)(DT)(DC)(DT)(DC)(DC)(DA)(DG)
(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DT)(DC)(DA)(DG)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DC)(DA)
(DT)(DC)(DG)(DA)(DT)
;
;ATCAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCC
CGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCGAT
;
I   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DG)(DA)(DT)(DG)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DC)(DT)(DG)(DA)(DC)(DA)
(DC)(DG)(DT)(DG)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DC)(DT)(DA)(DG)(DG)(DG)(DA)(DG)
(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DT)(DT)(DG)(DG)(DC)(DG)(DG)(DT)(DT)(DA)(DA)(DA)
(DA)(DC)(DG)(DC)(DG)(DG)(DG)(DG)(DG)(DA)(DC)(DA)(DG)(DC)(DG)(DC)(DG)(DT)(DA)(DC)
(DG)(DT)(DG)(DC)(DG)(DT)(DT)(DT)(DA)(DA)(DG)(DC)(DG)(DG)(DT)(DG)(DC)(DT)(DA)(DG)
(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DT)(DA)(DC)(DG)(DA)(DC)(DC)(DA)(DA)(DT)(DT)(DG)(DA)
(DG)(DC)(DG)(DG)(DC)(DC)(DT)(DC)(DG)(DG)(DC)(DA)(DC)(DC)(DG)(DG)(DG)(DA)(DT)(DT)
(DC)(DT)(DG)(DA)(DT)
;
;ATCGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTAC
GTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTGAT
;
J   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   PRO n 
1 4   ARG n 
1 5   ARG n 
1 6   ARG n 
1 7   SER n 
1 8   ARG n 
1 9   LYS n 
1 10  PRO n 
1 11  GLU n 
1 12  ALA n 
1 13  PRO n 
1 14  ARG n 
1 15  ARG n 
1 16  ARG n 
1 17  SER n 
1 18  PRO n 
1 19  SER n 
1 20  PRO n 
1 21  THR n 
1 22  PRO n 
1 23  THR n 
1 24  PRO n 
1 25  GLY n 
1 26  PRO n 
1 27  SER n 
1 28  ARG n 
1 29  ARG n 
1 30  GLY n 
1 31  PRO n 
1 32  SER n 
1 33  LEU n 
1 34  GLY n 
1 35  ALA n 
1 36  SER n 
1 37  SER n 
1 38  HIS n 
1 39  GLN n 
1 40  HIS n 
1 41  SER n 
1 42  ARG n 
1 43  ARG n 
1 44  ARG n 
1 45  GLN n 
1 46  GLY n 
1 47  TRP n 
1 48  LEU n 
1 49  LYS n 
1 50  GLU n 
1 51  ILE n 
1 52  ARG n 
1 53  LYS n 
1 54  LEU n 
1 55  GLN n 
1 56  LYS n 
1 57  SER n 
1 58  THR n 
1 59  HIS n 
1 60  LEU n 
1 61  LEU n 
1 62  ILE n 
1 63  ARG n 
1 64  LYS n 
1 65  LEU n 
1 66  PRO n 
1 67  PHE n 
1 68  SER n 
1 69  ARG n 
1 70  LEU n 
1 71  ALA n 
1 72  ARG n 
1 73  GLU n 
1 74  ILE n 
1 75  CYS n 
1 76  VAL n 
1 77  LYS n 
1 78  PHE n 
1 79  THR n 
1 80  ARG n 
1 81  GLY n 
1 82  VAL n 
1 83  ASP n 
1 84  PHE n 
1 85  ASN n 
1 86  TRP n 
1 87  GLN n 
1 88  ALA n 
1 89  GLN n 
1 90  ALA n 
1 91  LEU n 
1 92  LEU n 
1 93  ALA n 
1 94  LEU n 
1 95  GLN n 
1 96  GLU n 
1 97  ALA n 
1 98  ALA n 
1 99  GLU n 
1 100 ALA n 
1 101 PHE n 
1 102 LEU n 
1 103 VAL n 
1 104 HIS n 
1 105 LEU n 
1 106 PHE n 
1 107 GLU n 
1 108 ASP n 
1 109 ALA n 
1 110 TYR n 
1 111 LEU n 
1 112 LEU n 
1 113 THR n 
1 114 LEU n 
1 115 HIS n 
1 116 ALA n 
1 117 GLY n 
1 118 ARG n 
1 119 VAL n 
1 120 THR n 
1 121 LEU n 
1 122 PHE n 
1 123 PRO n 
1 124 LYS n 
1 125 ASP n 
1 126 VAL n 
1 127 GLN n 
1 128 LEU n 
1 129 ALA n 
1 130 ARG n 
1 131 ARG n 
1 132 ILE n 
1 133 ARG n 
1 134 GLY n 
1 135 LEU n 
1 136 GLU n 
1 137 GLU n 
1 138 GLY n 
1 139 LEU n 
1 140 GLY n 
2 1   MET n 
2 2   SER n 
2 3   GLY n 
2 4   ARG n 
2 5   GLY n 
2 6   LYS n 
2 7   GLY n 
2 8   GLY n 
2 9   LYS n 
2 10  GLY n 
2 11  LEU n 
2 12  GLY n 
2 13  LYS n 
2 14  GLY n 
2 15  GLY n 
2 16  ALA n 
2 17  LYS n 
2 18  ARG n 
2 19  HIS n 
2 20  ARG n 
2 21  LYS n 
2 22  VAL n 
2 23  LEU n 
2 24  ARG n 
2 25  ASP n 
2 26  ASN n 
2 27  ILE n 
2 28  GLN n 
2 29  GLY n 
2 30  ILE n 
2 31  THR n 
2 32  LYS n 
2 33  PRO n 
2 34  ALA n 
2 35  ILE n 
2 36  ARG n 
2 37  ARG n 
2 38  LEU n 
2 39  ALA n 
2 40  ARG n 
2 41  ARG n 
2 42  GLY n 
2 43  GLY n 
2 44  VAL n 
2 45  LYS n 
2 46  ARG n 
2 47  ILE n 
2 48  SER n 
2 49  GLY n 
2 50  LEU n 
2 51  ILE n 
2 52  TYR n 
2 53  GLU n 
2 54  GLU n 
2 55  THR n 
2 56  ARG n 
2 57  GLY n 
2 58  VAL n 
2 59  LEU n 
2 60  LYS n 
2 61  VAL n 
2 62  PHE n 
2 63  LEU n 
2 64  GLU n 
2 65  ASN n 
2 66  VAL n 
2 67  ILE n 
2 68  ARG n 
2 69  ASP n 
2 70  ALA n 
2 71  VAL n 
2 72  THR n 
2 73  TYR n 
2 74  THR n 
2 75  GLU n 
2 76  HIS n 
2 77  ALA n 
2 78  LYS n 
2 79  ARG n 
2 80  LYS n 
2 81  THR n 
2 82  VAL n 
2 83  THR n 
2 84  ALA n 
2 85  MET n 
2 86  ASP n 
2 87  VAL n 
2 88  VAL n 
2 89  TYR n 
2 90  ALA n 
2 91  LEU n 
2 92  LYS n 
2 93  ARG n 
2 94  GLN n 
2 95  GLY n 
2 96  ARG n 
2 97  THR n 
2 98  LEU n 
2 99  TYR n 
2 100 GLY n 
2 101 PHE n 
2 102 GLY n 
2 103 GLY n 
3 1   MET n 
3 2   SER n 
3 3   GLY n 
3 4   ARG n 
3 5   GLY n 
3 6   LYS n 
3 7   GLN n 
3 8   GLY n 
3 9   GLY n 
3 10  LYS n 
3 11  ALA n 
3 12  ARG n 
3 13  ALA n 
3 14  LYS n 
3 15  ALA n 
3 16  LYS n 
3 17  SER n 
3 18  ARG n 
3 19  SER n 
3 20  SER n 
3 21  ARG n 
3 22  ALA n 
3 23  GLY n 
3 24  LEU n 
3 25  GLN n 
3 26  PHE n 
3 27  PRO n 
3 28  VAL n 
3 29  GLY n 
3 30  ARG n 
3 31  VAL n 
3 32  HIS n 
3 33  ARG n 
3 34  LEU n 
3 35  LEU n 
3 36  ARG n 
3 37  LYS n 
3 38  GLY n 
3 39  ASN n 
3 40  TYR n 
3 41  ALA n 
3 42  GLU n 
3 43  ARG n 
3 44  VAL n 
3 45  GLY n 
3 46  ALA n 
3 47  GLY n 
3 48  ALA n 
3 49  PRO n 
3 50  VAL n 
3 51  TYR n 
3 52  MET n 
3 53  ALA n 
3 54  ALA n 
3 55  VAL n 
3 56  LEU n 
3 57  GLU n 
3 58  TYR n 
3 59  LEU n 
3 60  THR n 
3 61  ALA n 
3 62  GLU n 
3 63  ILE n 
3 64  LEU n 
3 65  GLU n 
3 66  LEU n 
3 67  ALA n 
3 68  GLY n 
3 69  ASN n 
3 70  ALA n 
3 71  ALA n 
3 72  ARG n 
3 73  ASP n 
3 74  ASN n 
3 75  LYS n 
3 76  LYS n 
3 77  THR n 
3 78  ARG n 
3 79  ILE n 
3 80  ILE n 
3 81  PRO n 
3 82  ARG n 
3 83  HIS n 
3 84  LEU n 
3 85  GLN n 
3 86  LEU n 
3 87  ALA n 
3 88  ILE n 
3 89  ARG n 
3 90  ASN n 
3 91  ASP n 
3 92  GLU n 
3 93  GLU n 
3 94  LEU n 
3 95  ASN n 
3 96  LYS n 
3 97  LEU n 
3 98  LEU n 
3 99  GLY n 
3 100 LYS n 
3 101 VAL n 
3 102 THR n 
3 103 ILE n 
3 104 ALA n 
3 105 GLN n 
3 106 GLY n 
3 107 GLY n 
3 108 VAL n 
3 109 LEU n 
3 110 PRO n 
3 111 ASN n 
3 112 ILE n 
3 113 GLN n 
3 114 ALA n 
3 115 VAL n 
3 116 LEU n 
3 117 LEU n 
3 118 PRO n 
3 119 LYS n 
3 120 LYS n 
3 121 THR n 
3 122 GLU n 
3 123 SER n 
3 124 HIS n 
3 125 HIS n 
3 126 LYS n 
3 127 ALA n 
3 128 LYS n 
3 129 GLY n 
3 130 LYS n 
4 1   MET n 
4 2   PRO n 
4 3   GLU n 
4 4   PRO n 
4 5   ALA n 
4 6   LYS n 
4 7   SER n 
4 8   ALA n 
4 9   PRO n 
4 10  ALA n 
4 11  PRO n 
4 12  LYS n 
4 13  LYS n 
4 14  GLY n 
4 15  SER n 
4 16  LYS n 
4 17  LYS n 
4 18  ALA n 
4 19  VAL n 
4 20  THR n 
4 21  LYS n 
4 22  ALA n 
4 23  GLN n 
4 24  LYS n 
4 25  LYS n 
4 26  ASP n 
4 27  GLY n 
4 28  LYS n 
4 29  LYS n 
4 30  ARG n 
4 31  LYS n 
4 32  ARG n 
4 33  SER n 
4 34  ARG n 
4 35  LYS n 
4 36  GLU n 
4 37  SER n 
4 38  TYR n 
4 39  SER n 
4 40  VAL n 
4 41  TYR n 
4 42  VAL n 
4 43  TYR n 
4 44  LYS n 
4 45  VAL n 
4 46  LEU n 
4 47  LYS n 
4 48  GLN n 
4 49  VAL n 
4 50  HIS n 
4 51  PRO n 
4 52  ASP n 
4 53  THR n 
4 54  GLY n 
4 55  ILE n 
4 56  SER n 
4 57  SER n 
4 58  LYS n 
4 59  ALA n 
4 60  MET n 
4 61  GLY n 
4 62  ILE n 
4 63  MET n 
4 64  ASN n 
4 65  SER n 
4 66  PHE n 
4 67  VAL n 
4 68  ASN n 
4 69  ASP n 
4 70  ILE n 
4 71  PHE n 
4 72  GLU n 
4 73  ARG n 
4 74  ILE n 
4 75  ALA n 
4 76  GLY n 
4 77  GLU n 
4 78  ALA n 
4 79  SER n 
4 80  ARG n 
4 81  LEU n 
4 82  ALA n 
4 83  HIS n 
4 84  TYR n 
4 85  ASN n 
4 86  LYS n 
4 87  ARG n 
4 88  SER n 
4 89  THR n 
4 90  ILE n 
4 91  THR n 
4 92  SER n 
4 93  ARG n 
4 94  GLU n 
4 95  ILE n 
4 96  GLN n 
4 97  THR n 
4 98  ALA n 
4 99  VAL n 
4 100 ARG n 
4 101 LEU n 
4 102 LEU n 
4 103 LEU n 
4 104 PRO n 
4 105 GLY n 
4 106 GLU n 
4 107 LEU n 
4 108 ALA n 
4 109 LYS n 
4 110 HIS n 
4 111 ALA n 
4 112 VAL n 
4 113 SER n 
4 114 GLU n 
4 115 GLY n 
4 116 THR n 
4 117 LYS n 
4 118 ALA n 
4 119 VAL n 
4 120 THR n 
4 121 LYS n 
4 122 TYR n 
4 123 THR n 
4 124 SER n 
4 125 SER n 
4 126 LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DA  n 
5 5   DG  n 
5 6   DA  n 
5 7   DA  n 
5 8   DT  n 
5 9   DC  n 
5 10  DC  n 
5 11  DC  n 
5 12  DG  n 
5 13  DG  n 
5 14  DT  n 
5 15  DG  n 
5 16  DC  n 
5 17  DC  n 
5 18  DG  n 
5 19  DA  n 
5 20  DG  n 
5 21  DG  n 
5 22  DC  n 
5 23  DC  n 
5 24  DG  n 
5 25  DC  n 
5 26  DT  n 
5 27  DC  n 
5 28  DA  n 
5 29  DA  n 
5 30  DT  n 
5 31  DT  n 
5 32  DG  n 
5 33  DG  n 
5 34  DT  n 
5 35  DC  n 
5 36  DG  n 
5 37  DT  n 
5 38  DA  n 
5 39  DG  n 
5 40  DA  n 
5 41  DC  n 
5 42  DA  n 
5 43  DG  n 
5 44  DC  n 
5 45  DT  n 
5 46  DC  n 
5 47  DT  n 
5 48  DA  n 
5 49  DG  n 
5 50  DC  n 
5 51  DA  n 
5 52  DC  n 
5 53  DC  n 
5 54  DG  n 
5 55  DC  n 
5 56  DT  n 
5 57  DT  n 
5 58  DA  n 
5 59  DA  n 
5 60  DA  n 
5 61  DC  n 
5 62  DG  n 
5 63  DC  n 
5 64  DA  n 
5 65  DC  n 
5 66  DG  n 
5 67  DT  n 
5 68  DA  n 
5 69  DC  n 
5 70  DG  n 
5 71  DC  n 
5 72  DG  n 
5 73  DC  n 
5 74  DT  n 
5 75  DG  n 
5 76  DT  n 
5 77  DC  n 
5 78  DC  n 
5 79  DC  n 
5 80  DC  n 
5 81  DC  n 
5 82  DG  n 
5 83  DC  n 
5 84  DG  n 
5 85  DT  n 
5 86  DT  n 
5 87  DT  n 
5 88  DT  n 
5 89  DA  n 
5 90  DA  n 
5 91  DC  n 
5 92  DC  n 
5 93  DG  n 
5 94  DC  n 
5 95  DC  n 
5 96  DA  n 
5 97  DA  n 
5 98  DG  n 
5 99  DG  n 
5 100 DG  n 
5 101 DG  n 
5 102 DA  n 
5 103 DT  n 
5 104 DT  n 
5 105 DA  n 
5 106 DC  n 
5 107 DT  n 
5 108 DC  n 
5 109 DC  n 
5 110 DC  n 
5 111 DT  n 
5 112 DA  n 
5 113 DG  n 
5 114 DT  n 
5 115 DC  n 
5 116 DT  n 
5 117 DC  n 
5 118 DC  n 
5 119 DA  n 
5 120 DG  n 
5 121 DG  n 
5 122 DC  n 
5 123 DA  n 
5 124 DC  n 
5 125 DG  n 
5 126 DT  n 
5 127 DG  n 
5 128 DT  n 
5 129 DC  n 
5 130 DA  n 
5 131 DG  n 
5 132 DA  n 
5 133 DT  n 
5 134 DA  n 
5 135 DT  n 
5 136 DA  n 
5 137 DT  n 
5 138 DA  n 
5 139 DC  n 
5 140 DA  n 
5 141 DT  n 
5 142 DC  n 
5 143 DG  n 
5 144 DA  n 
5 145 DT  n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DG  n 
6 5   DA  n 
6 6   DT  n 
6 7   DG  n 
6 8   DT  n 
6 9   DA  n 
6 10  DT  n 
6 11  DA  n 
6 12  DT  n 
6 13  DA  n 
6 14  DT  n 
6 15  DC  n 
6 16  DT  n 
6 17  DG  n 
6 18  DA  n 
6 19  DC  n 
6 20  DA  n 
6 21  DC  n 
6 22  DG  n 
6 23  DT  n 
6 24  DG  n 
6 25  DC  n 
6 26  DC  n 
6 27  DT  n 
6 28  DG  n 
6 29  DG  n 
6 30  DA  n 
6 31  DG  n 
6 32  DA  n 
6 33  DC  n 
6 34  DT  n 
6 35  DA  n 
6 36  DG  n 
6 37  DG  n 
6 38  DG  n 
6 39  DA  n 
6 40  DG  n 
6 41  DT  n 
6 42  DA  n 
6 43  DA  n 
6 44  DT  n 
6 45  DC  n 
6 46  DC  n 
6 47  DC  n 
6 48  DC  n 
6 49  DT  n 
6 50  DT  n 
6 51  DG  n 
6 52  DG  n 
6 53  DC  n 
6 54  DG  n 
6 55  DG  n 
6 56  DT  n 
6 57  DT  n 
6 58  DA  n 
6 59  DA  n 
6 60  DA  n 
6 61  DA  n 
6 62  DC  n 
6 63  DG  n 
6 64  DC  n 
6 65  DG  n 
6 66  DG  n 
6 67  DG  n 
6 68  DG  n 
6 69  DG  n 
6 70  DA  n 
6 71  DC  n 
6 72  DA  n 
6 73  DG  n 
6 74  DC  n 
6 75  DG  n 
6 76  DC  n 
6 77  DG  n 
6 78  DT  n 
6 79  DA  n 
6 80  DC  n 
6 81  DG  n 
6 82  DT  n 
6 83  DG  n 
6 84  DC  n 
6 85  DG  n 
6 86  DT  n 
6 87  DT  n 
6 88  DT  n 
6 89  DA  n 
6 90  DA  n 
6 91  DG  n 
6 92  DC  n 
6 93  DG  n 
6 94  DG  n 
6 95  DT  n 
6 96  DG  n 
6 97  DC  n 
6 98  DT  n 
6 99  DA  n 
6 100 DG  n 
6 101 DA  n 
6 102 DG  n 
6 103 DC  n 
6 104 DT  n 
6 105 DG  n 
6 106 DT  n 
6 107 DC  n 
6 108 DT  n 
6 109 DA  n 
6 110 DC  n 
6 111 DG  n 
6 112 DA  n 
6 113 DC  n 
6 114 DC  n 
6 115 DA  n 
6 116 DA  n 
6 117 DT  n 
6 118 DT  n 
6 119 DG  n 
6 120 DA  n 
6 121 DG  n 
6 122 DC  n 
6 123 DG  n 
6 124 DG  n 
6 125 DC  n 
6 126 DC  n 
6 127 DT  n 
6 128 DC  n 
6 129 DG  n 
6 130 DG  n 
6 131 DC  n 
6 132 DA  n 
6 133 DC  n 
6 134 DC  n 
6 135 DG  n 
6 136 DG  n 
6 137 DG  n 
6 138 DA  n 
6 139 DT  n 
6 140 DT  n 
6 141 DC  n 
6 142 DT  n 
6 143 DG  n 
6 144 DA  n 
6 145 DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 140 Human ? CENPA ? ? ? ? ? ? 'Homo sapiens'        9606  ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 103 Human ? 
;HIST1H4A, H4/A, H4FA, HIST1H4B, H4/I, H4FI, HIST1H4C, H4/G, H4FG, HIST1H4D, H4/B, H4FB, HIST1H4E, H4/J, H4FJ, HIST1H4F, H4/C, H4FC, HIST1H4H, H4/H, H4FH, HIST1H4I, H4/M, H4FM, HIST1H4J, H4/E, H4FE, HIST1H4K, H4/D, H4FD, HIST1H4L, H4/K, H4FK, HIST2H4A, H4/N, H4F2, H4FN, HIST2H4, HIST2H4B, H4/O, H4FO, HIST4H4
;
? ? ? ? ? ? 'Homo sapiens'        9606  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 130 Human ? 'HIST2H2AA3, H2AFO, HIST2H2AA, HIST2H2AA4' ? ? ? ? ? ? 'Homo sapiens'        9606  
? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 126 Human ? 
'HIST1H2BC, H2BFL, HIST1H2BE, H2BFH, HIST1H2BF, H2BFG, HIST1H2BG, H2BFA, HIST1H2BI, H2BFK' ? ? ? ? ? ? 'Homo sapiens'        9606  
? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 145 ?     ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6 1 sample 'Biological sequence' 1 145 ?     ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP CENPA_HUMAN P49450 ? 1 
;MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTR
GVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG
;
1 
2 UNP H4_HUMAN    P62805 ? 2 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
1 
3 UNP H2A2A_HUMAN Q6FI13 ? 3 
;MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
;
1 
4 UNP H2B1C_HUMAN P62807 ? 4 
;MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
1 
5 PDB 6SEG        6SEG   ? 5 ? 1 
6 PDB 6SEG        6SEG   ? 6 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6SEG A 1 ? 140 ? P49450 1   ? 140 ? 1   140 
2  2 6SEG B 1 ? 103 ? P62805 1   ? 103 ? 0   102 
3  3 6SEG C 1 ? 130 ? Q6FI13 1   ? 130 ? 0   129 
4  4 6SEG D 1 ? 126 ? P62807 1   ? 126 ? 0   125 
5  1 6SEG E 1 ? 140 ? P49450 1   ? 140 ? 1   140 
6  2 6SEG F 1 ? 103 ? P62805 1   ? 103 ? 0   102 
7  3 6SEG G 1 ? 130 ? Q6FI13 1   ? 130 ? 0   129 
8  4 6SEG H 1 ? 126 ? P62807 1   ? 126 ? 0   125 
9  5 6SEG I 1 ? 145 ? 6SEG   -72 ? 72  ? -72 72  
10 6 6SEG J 1 ? 145 ? 6SEG   -72 ? 72  ? -72 72  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6SEG 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6SEG 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            . 
_refine.ls_d_res_low                             ? 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       'CDL v1.2' 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.0063  ? 12496 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 0.8490  ? 18125 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 0.0535  ? 2059  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.0365  ? 1410  ? f_plane_restr      ? ? 
'ELECTRON MICROSCOPY' ? 25.8523 ? 6452  ? f_dihedral_angle_d ? ? 
# 
_struct.entry_id                     6SEG 
_struct.title                        'Class1: CENP-A nucleosome in complex with CENP-C central region' 
_struct.pdbx_descriptor              
'Histone H3-like centromeric protein A, Histone H4, Histone H2A type 2-A, Histone H2B type 1-C/E/F/G/I/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6SEG 
_struct_keywords.text            'CENP-A, nucleosome, centromere, centromeric chromatin, NUCLEAR PROTEIN' 
_struct_keywords.pdbx_keywords   'NUCLEAR PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLN A 45  ? GLN A 55  ? GLN A 45  GLN A 55  1 ? 11 
HELX_P HELX_P2  AA2 ARG A 63  ? THR A 79  ? ARG A 63  THR A 79  1 ? 17 
HELX_P HELX_P3  AA3 GLN A 87  ? ALA A 116 ? GLN A 87  ALA A 116 1 ? 30 
HELX_P HELX_P4  AA4 PHE A 122 ? ARG A 133 ? PHE A 122 ARG A 133 1 ? 12 
HELX_P HELX_P5  AA5 ASN B 26  ? ILE B 30  ? ASN B 25  ILE B 29  5 ? 5  
HELX_P HELX_P6  AA6 THR B 31  ? GLY B 42  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  AA7 ILE B 51  ? ALA B 77  ? ILE B 50  ALA B 76  1 ? 27 
HELX_P HELX_P8  AA8 THR B 83  ? GLY B 95  ? THR B 82  GLY B 94  1 ? 13 
HELX_P HELX_P9  AA9 ARG C 18  ? ALA C 22  ? ARG C 17  ALA C 21  1 ? 5  
HELX_P HELX_P10 AB1 VAL C 28  ? LYS C 37  ? VAL C 27  LYS C 36  1 ? 10 
HELX_P HELX_P11 AB2 ALA C 46  ? ASN C 74  ? ALA C 45  ASN C 73  1 ? 29 
HELX_P HELX_P12 AB3 ILE C 80  ? ASP C 91  ? ILE C 79  ASP C 90  1 ? 12 
HELX_P HELX_P13 AB4 GLU C 93  ? LEU C 98  ? GLU C 92  LEU C 97  1 ? 6  
HELX_P HELX_P14 AB5 TYR D 38  ? HIS D 50  ? TYR D 37  HIS D 49  1 ? 13 
HELX_P HELX_P15 AB6 SER D 57  ? ASN D 85  ? SER D 56  ASN D 84  1 ? 29 
HELX_P HELX_P16 AB7 THR D 91  ? LEU D 103 ? THR D 90  LEU D 102 1 ? 13 
HELX_P HELX_P17 AB8 PRO D 104 ? SER D 124 ? PRO D 103 SER D 123 1 ? 21 
HELX_P HELX_P18 AB9 GLY E 46  ? SER E 57  ? GLY E 46  SER E 57  1 ? 12 
HELX_P HELX_P19 AC1 ARG E 63  ? THR E 79  ? ARG E 63  THR E 79  1 ? 17 
HELX_P HELX_P20 AC2 GLN E 87  ? ALA E 116 ? GLN E 87  ALA E 116 1 ? 30 
HELX_P HELX_P21 AC3 PHE E 122 ? GLY E 134 ? PHE E 122 GLY E 134 1 ? 13 
HELX_P HELX_P22 AC4 ASN F 26  ? ILE F 30  ? ASN F 25  ILE F 29  5 ? 5  
HELX_P HELX_P23 AC5 THR F 31  ? GLY F 42  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P24 AC6 ILE F 51  ? ALA F 77  ? ILE F 50  ALA F 76  1 ? 27 
HELX_P HELX_P25 AC7 THR F 83  ? GLN F 94  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P26 AC8 SER G 17  ? ALA G 22  ? SER G 16  ALA G 21  1 ? 6  
HELX_P HELX_P27 AC9 PRO G 27  ? LYS G 37  ? PRO G 26  LYS G 36  1 ? 11 
HELX_P HELX_P28 AD1 ALA G 46  ? ASN G 74  ? ALA G 45  ASN G 73  1 ? 29 
HELX_P HELX_P29 AD2 ILE G 80  ? ARG G 89  ? ILE G 79  ARG G 88  1 ? 10 
HELX_P HELX_P30 AD3 ASP G 91  ? LEU G 98  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P31 AD4 TYR H 38  ? HIS H 50  ? TYR H 37  HIS H 49  1 ? 13 
HELX_P HELX_P32 AD5 SER H 56  ? ASN H 85  ? SER H 55  ASN H 84  1 ? 30 
HELX_P HELX_P33 AD6 THR H 91  ? LEU H 103 ? THR H 90  LEU H 102 1 ? 13 
HELX_P HELX_P34 AD7 GLU H 106 ? THR H 123 ? GLU H 105 THR H 122 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? I DA 1   N1 ? ? ? 1_555 J DT 145 N3 ? ? I DA -72 J DT 72  1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? 
hydrog2   hydrog ? ? I DT 2   N3 ? ? ? 1_555 J DA 144 N1 ? ? I DT -71 J DA 71  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3   hydrog ? ? I DT 2   O4 ? ? ? 1_555 J DA 144 N6 ? ? I DT -71 J DA 71  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4   hydrog ? ? I DC 3   N3 ? ? ? 1_555 J DG 143 N1 ? ? I DC -70 J DG 70  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5   hydrog ? ? I DC 3   N4 ? ? ? 1_555 J DG 143 O6 ? ? I DC -70 J DG 70  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6   hydrog ? ? I DC 3   O2 ? ? ? 1_555 J DG 143 N2 ? ? I DC -70 J DG 70  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7   hydrog ? ? I DG 5   N1 ? ? ? 1_555 J DC 141 N3 ? ? I DG -68 J DC 68  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8   hydrog ? ? I DG 5   N2 ? ? ? 1_555 J DC 141 O2 ? ? I DG -68 J DC 68  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9   hydrog ? ? I DG 5   O6 ? ? ? 1_555 J DC 141 N4 ? ? I DG -68 J DC 68  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10  hydrog ? ? I DA 6   N1 ? ? ? 1_555 J DT 140 N3 ? ? I DA -67 J DT 67  1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? 
hydrog11  hydrog ? ? I DA 7   N1 ? ? ? 1_555 J DT 139 N3 ? ? I DA -66 J DT 66  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12  hydrog ? ? I DA 7   N6 ? ? ? 1_555 J DT 139 O4 ? ? I DA -66 J DT 66  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13  hydrog ? ? I DT 8   N3 ? ? ? 1_555 J DA 138 N1 ? ? I DT -65 J DA 65  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14  hydrog ? ? I DT 8   O4 ? ? ? 1_555 J DA 138 N6 ? ? I DT -65 J DA 65  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15  hydrog ? ? I DC 9   N3 ? ? ? 1_555 J DG 137 N1 ? ? I DC -64 J DG 64  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16  hydrog ? ? I DC 9   N4 ? ? ? 1_555 J DG 137 O6 ? ? I DC -64 J DG 64  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17  hydrog ? ? I DC 9   O2 ? ? ? 1_555 J DG 137 N2 ? ? I DC -64 J DG 64  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18  hydrog ? ? I DC 10  N3 ? ? ? 1_555 J DG 136 N1 ? ? I DC -63 J DG 63  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19  hydrog ? ? I DC 10  N4 ? ? ? 1_555 J DG 136 O6 ? ? I DC -63 J DG 63  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20  hydrog ? ? I DC 10  O2 ? ? ? 1_555 J DG 136 N2 ? ? I DC -63 J DG 63  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21  hydrog ? ? I DC 11  N3 ? ? ? 1_555 J DG 135 N1 ? ? I DC -62 J DG 62  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22  hydrog ? ? I DC 11  N4 ? ? ? 1_555 J DG 135 O6 ? ? I DC -62 J DG 62  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23  hydrog ? ? I DC 11  O2 ? ? ? 1_555 J DG 135 N2 ? ? I DC -62 J DG 62  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24  hydrog ? ? I DG 12  N1 ? ? ? 1_555 J DC 134 N3 ? ? I DG -61 J DC 61  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25  hydrog ? ? I DG 12  N2 ? ? ? 1_555 J DC 134 O2 ? ? I DG -61 J DC 61  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26  hydrog ? ? I DG 12  O6 ? ? ? 1_555 J DC 134 N4 ? ? I DG -61 J DC 61  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27  hydrog ? ? I DG 13  N1 ? ? ? 1_555 J DC 133 N3 ? ? I DG -60 J DC 60  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28  hydrog ? ? I DG 13  N2 ? ? ? 1_555 J DC 133 O2 ? ? I DG -60 J DC 60  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29  hydrog ? ? I DG 13  O6 ? ? ? 1_555 J DC 133 N4 ? ? I DG -60 J DC 60  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30  hydrog ? ? I DT 14  N3 ? ? ? 1_555 J DA 132 N1 ? ? I DT -59 J DA 59  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31  hydrog ? ? I DT 14  O4 ? ? ? 1_555 J DA 132 N6 ? ? I DT -59 J DA 59  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32  hydrog ? ? I DG 15  N1 ? ? ? 1_555 J DC 131 N3 ? ? I DG -58 J DC 58  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33  hydrog ? ? I DG 15  N2 ? ? ? 1_555 J DC 131 O2 ? ? I DG -58 J DC 58  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34  hydrog ? ? I DG 15  O6 ? ? ? 1_555 J DC 131 N4 ? ? I DG -58 J DC 58  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35  hydrog ? ? I DC 16  N3 ? ? ? 1_555 J DG 130 N1 ? ? I DC -57 J DG 57  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36  hydrog ? ? I DC 16  N4 ? ? ? 1_555 J DG 130 O6 ? ? I DC -57 J DG 57  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37  hydrog ? ? I DC 16  O2 ? ? ? 1_555 J DG 130 N2 ? ? I DC -57 J DG 57  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38  hydrog ? ? I DC 17  N3 ? ? ? 1_555 J DG 129 N1 ? ? I DC -56 J DG 56  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39  hydrog ? ? I DC 17  N4 ? ? ? 1_555 J DG 129 O6 ? ? I DC -56 J DG 56  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40  hydrog ? ? I DC 17  O2 ? ? ? 1_555 J DG 129 N2 ? ? I DC -56 J DG 56  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41  hydrog ? ? I DG 18  N1 ? ? ? 1_555 J DC 128 N3 ? ? I DG -55 J DC 55  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42  hydrog ? ? I DG 18  N2 ? ? ? 1_555 J DC 128 O2 ? ? I DG -55 J DC 55  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43  hydrog ? ? I DG 18  O6 ? ? ? 1_555 J DC 128 N4 ? ? I DG -55 J DC 55  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44  hydrog ? ? I DA 19  N1 ? ? ? 1_555 J DT 127 N3 ? ? I DA -54 J DT 54  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45  hydrog ? ? I DA 19  N6 ? ? ? 1_555 J DT 127 O4 ? ? I DA -54 J DT 54  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46  hydrog ? ? I DG 20  N1 ? ? ? 1_555 J DC 126 N3 ? ? I DG -53 J DC 53  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47  hydrog ? ? I DG 20  N2 ? ? ? 1_555 J DC 126 O2 ? ? I DG -53 J DC 53  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48  hydrog ? ? I DG 20  O6 ? ? ? 1_555 J DC 126 N4 ? ? I DG -53 J DC 53  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49  hydrog ? ? I DG 21  N1 ? ? ? 1_555 J DC 125 N3 ? ? I DG -52 J DC 52  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50  hydrog ? ? I DG 21  N2 ? ? ? 1_555 J DC 125 O2 ? ? I DG -52 J DC 52  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51  hydrog ? ? I DG 21  O6 ? ? ? 1_555 J DC 125 N4 ? ? I DG -52 J DC 52  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52  hydrog ? ? I DC 22  N3 ? ? ? 1_555 J DG 124 N1 ? ? I DC -51 J DG 51  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53  hydrog ? ? I DC 22  N4 ? ? ? 1_555 J DG 124 O6 ? ? I DC -51 J DG 51  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54  hydrog ? ? I DC 22  O2 ? ? ? 1_555 J DG 124 N2 ? ? I DC -51 J DG 51  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55  hydrog ? ? I DC 23  N3 ? ? ? 1_555 J DG 123 N1 ? ? I DC -50 J DG 50  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56  hydrog ? ? I DC 23  N4 ? ? ? 1_555 J DG 123 O6 ? ? I DC -50 J DG 50  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57  hydrog ? ? I DC 23  O2 ? ? ? 1_555 J DG 123 N2 ? ? I DC -50 J DG 50  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58  hydrog ? ? I DG 24  N1 ? ? ? 1_555 J DC 122 N3 ? ? I DG -49 J DC 49  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59  hydrog ? ? I DG 24  N2 ? ? ? 1_555 J DC 122 O2 ? ? I DG -49 J DC 49  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60  hydrog ? ? I DG 24  O6 ? ? ? 1_555 J DC 122 N4 ? ? I DG -49 J DC 49  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61  hydrog ? ? I DC 25  O2 ? ? ? 1_555 J DG 121 N2 ? ? I DC -48 J DG 48  1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
hydrog62  hydrog ? ? I DT 26  N3 ? ? ? 1_555 J DA 120 N1 ? ? I DT -47 J DA 47  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63  hydrog ? ? I DT 26  O4 ? ? ? 1_555 J DA 120 N6 ? ? I DT -47 J DA 47  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64  hydrog ? ? I DC 27  O2 ? ? ? 1_555 J DG 119 N2 ? ? I DC -46 J DG 46  1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
hydrog65  hydrog ? ? I DA 28  N1 ? ? ? 1_555 J DT 118 N3 ? ? I DA -45 J DT 45  1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? 
hydrog66  hydrog ? ? I DA 29  N1 ? ? ? 1_555 J DT 117 N3 ? ? I DA -44 J DT 44  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog67  hydrog ? ? I DA 29  N6 ? ? ? 1_555 J DT 117 O4 ? ? I DA -44 J DT 44  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog68  hydrog ? ? I DT 30  N3 ? ? ? 1_555 J DA 116 N1 ? ? I DT -43 J DA 43  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog69  hydrog ? ? I DT 30  O4 ? ? ? 1_555 J DA 116 N6 ? ? I DT -43 J DA 43  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog70  hydrog ? ? I DT 31  N3 ? ? ? 1_555 J DA 115 N1 ? ? I DT -42 J DA 42  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog71  hydrog ? ? I DT 31  O4 ? ? ? 1_555 J DA 115 N6 ? ? I DT -42 J DA 42  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog72  hydrog ? ? I DG 32  N1 ? ? ? 1_555 J DC 114 N3 ? ? I DG -41 J DC 41  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog73  hydrog ? ? I DG 32  N2 ? ? ? 1_555 J DC 114 O2 ? ? I DG -41 J DC 41  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog74  hydrog ? ? I DG 32  O6 ? ? ? 1_555 J DC 114 N4 ? ? I DG -41 J DC 41  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog75  hydrog ? ? I DG 33  N1 ? ? ? 1_555 J DC 113 N3 ? ? I DG -40 J DC 40  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog76  hydrog ? ? I DG 33  N2 ? ? ? 1_555 J DC 113 O2 ? ? I DG -40 J DC 40  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog77  hydrog ? ? I DG 33  O6 ? ? ? 1_555 J DC 113 N4 ? ? I DG -40 J DC 40  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog78  hydrog ? ? I DT 34  N3 ? ? ? 1_555 J DA 112 N1 ? ? I DT -39 J DA 39  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog79  hydrog ? ? I DT 34  O4 ? ? ? 1_555 J DA 112 N6 ? ? I DT -39 J DA 39  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog80  hydrog ? ? I DC 35  N3 ? ? ? 1_555 J DG 111 N1 ? ? I DC -38 J DG 38  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog81  hydrog ? ? I DC 35  N4 ? ? ? 1_555 J DG 111 O6 ? ? I DC -38 J DG 38  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog82  hydrog ? ? I DC 35  O2 ? ? ? 1_555 J DG 111 N2 ? ? I DC -38 J DG 38  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog83  hydrog ? ? I DG 36  N1 ? ? ? 1_555 J DC 110 N3 ? ? I DG -37 J DC 37  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog84  hydrog ? ? I DG 36  N2 ? ? ? 1_555 J DC 110 O2 ? ? I DG -37 J DC 37  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog85  hydrog ? ? I DG 36  O6 ? ? ? 1_555 J DC 110 N4 ? ? I DG -37 J DC 37  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog86  hydrog ? ? I DT 37  N3 ? ? ? 1_555 J DA 109 N1 ? ? I DT -36 J DA 36  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog87  hydrog ? ? I DT 37  O4 ? ? ? 1_555 J DA 109 N6 ? ? I DT -36 J DA 36  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog88  hydrog ? ? I DA 38  N1 ? ? ? 1_555 J DT 108 N3 ? ? I DA -35 J DT 35  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog89  hydrog ? ? I DA 38  N6 ? ? ? 1_555 J DT 108 O4 ? ? I DA -35 J DT 35  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog90  hydrog ? ? I DG 39  N1 ? ? ? 1_555 J DC 107 N3 ? ? I DG -34 J DC 34  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog91  hydrog ? ? I DG 39  N2 ? ? ? 1_555 J DC 107 O2 ? ? I DG -34 J DC 34  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog92  hydrog ? ? I DG 39  O6 ? ? ? 1_555 J DC 107 N4 ? ? I DG -34 J DC 34  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog93  hydrog ? ? I DA 40  N1 ? ? ? 1_555 J DT 106 N3 ? ? I DA -33 J DT 33  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog94  hydrog ? ? I DA 40  N6 ? ? ? 1_555 J DT 106 O4 ? ? I DA -33 J DT 33  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog95  hydrog ? ? I DC 41  N3 ? ? ? 1_555 J DG 105 N1 ? ? I DC -32 J DG 32  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog96  hydrog ? ? I DC 41  N4 ? ? ? 1_555 J DG 105 O6 ? ? I DC -32 J DG 32  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog97  hydrog ? ? I DC 41  O2 ? ? ? 1_555 J DG 105 N2 ? ? I DC -32 J DG 32  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog98  hydrog ? ? I DA 42  N1 ? ? ? 1_555 J DT 104 N3 ? ? I DA -31 J DT 31  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog99  hydrog ? ? I DA 42  N6 ? ? ? 1_555 J DT 104 O4 ? ? I DA -31 J DT 31  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog100 hydrog ? ? I DG 43  N1 ? ? ? 1_555 J DC 103 N3 ? ? I DG -30 J DC 30  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog101 hydrog ? ? I DG 43  N2 ? ? ? 1_555 J DC 103 O2 ? ? I DG -30 J DC 30  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog102 hydrog ? ? I DG 43  O6 ? ? ? 1_555 J DC 103 N4 ? ? I DG -30 J DC 30  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog103 hydrog ? ? I DC 44  N3 ? ? ? 1_555 J DG 102 N1 ? ? I DC -29 J DG 29  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog104 hydrog ? ? I DC 44  N4 ? ? ? 1_555 J DG 102 O6 ? ? I DC -29 J DG 29  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog105 hydrog ? ? I DC 44  O2 ? ? ? 1_555 J DG 102 N2 ? ? I DC -29 J DG 29  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog106 hydrog ? ? I DT 45  N3 ? ? ? 1_555 J DA 101 N1 ? ? I DT -28 J DA 28  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog107 hydrog ? ? I DT 45  O4 ? ? ? 1_555 J DA 101 N6 ? ? I DT -28 J DA 28  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog108 hydrog ? ? I DC 46  N3 ? ? ? 1_555 J DG 100 N1 ? ? I DC -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog109 hydrog ? ? I DC 46  N4 ? ? ? 1_555 J DG 100 O6 ? ? I DC -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog110 hydrog ? ? I DC 46  O2 ? ? ? 1_555 J DG 100 N2 ? ? I DC -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog111 hydrog ? ? I DT 47  N3 ? ? ? 1_555 J DA 99  N1 ? ? I DT -26 J DA 26  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog112 hydrog ? ? I DT 47  O4 ? ? ? 1_555 J DA 99  N6 ? ? I DT -26 J DA 26  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog113 hydrog ? ? I DA 48  N1 ? ? ? 1_555 J DT 98  N3 ? ? I DA -25 J DT 25  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog114 hydrog ? ? I DA 48  N6 ? ? ? 1_555 J DT 98  O4 ? ? I DA -25 J DT 25  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog115 hydrog ? ? I DG 49  N1 ? ? ? 1_555 J DC 97  N3 ? ? I DG -24 J DC 24  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog116 hydrog ? ? I DG 49  N2 ? ? ? 1_555 J DC 97  O2 ? ? I DG -24 J DC 24  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog117 hydrog ? ? I DG 49  O6 ? ? ? 1_555 J DC 97  N4 ? ? I DG -24 J DC 24  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog118 hydrog ? ? I DC 50  N3 ? ? ? 1_555 J DG 96  N1 ? ? I DC -23 J DG 23  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog119 hydrog ? ? I DC 50  N4 ? ? ? 1_555 J DG 96  O6 ? ? I DC -23 J DG 23  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog120 hydrog ? ? I DC 50  O2 ? ? ? 1_555 J DG 96  N2 ? ? I DC -23 J DG 23  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog121 hydrog ? ? I DA 51  N1 ? ? ? 1_555 J DT 95  N3 ? ? I DA -22 J DT 22  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog122 hydrog ? ? I DA 51  N6 ? ? ? 1_555 J DT 95  O4 ? ? I DA -22 J DT 22  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog123 hydrog ? ? I DC 52  N3 ? ? ? 1_555 J DG 94  N1 ? ? I DC -21 J DG 21  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog124 hydrog ? ? I DC 52  N4 ? ? ? 1_555 J DG 94  O6 ? ? I DC -21 J DG 21  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog125 hydrog ? ? I DC 52  O2 ? ? ? 1_555 J DG 94  N2 ? ? I DC -21 J DG 21  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog126 hydrog ? ? I DC 53  N3 ? ? ? 1_555 J DG 93  N1 ? ? I DC -20 J DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog127 hydrog ? ? I DC 53  N4 ? ? ? 1_555 J DG 93  O6 ? ? I DC -20 J DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog128 hydrog ? ? I DC 53  O2 ? ? ? 1_555 J DG 93  N2 ? ? I DC -20 J DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog129 hydrog ? ? I DG 54  N1 ? ? ? 1_555 J DC 92  N3 ? ? I DG -19 J DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog130 hydrog ? ? I DG 54  N2 ? ? ? 1_555 J DC 92  O2 ? ? I DG -19 J DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog131 hydrog ? ? I DG 54  O6 ? ? ? 1_555 J DC 92  N4 ? ? I DG -19 J DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog132 hydrog ? ? I DC 55  N3 ? ? ? 1_555 J DG 91  N1 ? ? I DC -18 J DG 18  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog133 hydrog ? ? I DC 55  N4 ? ? ? 1_555 J DG 91  O6 ? ? I DC -18 J DG 18  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog134 hydrog ? ? I DC 55  O2 ? ? ? 1_555 J DG 91  N2 ? ? I DC -18 J DG 18  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog135 hydrog ? ? I DT 56  N3 ? ? ? 1_555 J DA 90  N1 ? ? I DT -17 J DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog136 hydrog ? ? I DT 56  O4 ? ? ? 1_555 J DA 90  N6 ? ? I DT -17 J DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog137 hydrog ? ? I DT 57  N3 ? ? ? 1_555 J DA 89  N1 ? ? I DT -16 J DA 16  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog138 hydrog ? ? I DT 57  O4 ? ? ? 1_555 J DA 89  N6 ? ? I DT -16 J DA 16  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog139 hydrog ? ? I DA 58  N1 ? ? ? 1_555 J DT 88  N3 ? ? I DA -15 J DT 15  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog140 hydrog ? ? I DA 58  N6 ? ? ? 1_555 J DT 88  O4 ? ? I DA -15 J DT 15  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog141 hydrog ? ? I DA 59  N1 ? ? ? 1_555 J DT 87  N3 ? ? I DA -14 J DT 14  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog142 hydrog ? ? I DA 59  N6 ? ? ? 1_555 J DT 87  O4 ? ? I DA -14 J DT 14  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog143 hydrog ? ? I DA 60  N1 ? ? ? 1_555 J DT 86  N3 ? ? I DA -13 J DT 13  1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? 
hydrog144 hydrog ? ? I DC 61  N3 ? ? ? 1_555 J DG 85  N1 ? ? I DC -12 J DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog145 hydrog ? ? I DC 61  N4 ? ? ? 1_555 J DG 85  O6 ? ? I DC -12 J DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog146 hydrog ? ? I DC 61  O2 ? ? ? 1_555 J DG 85  N2 ? ? I DC -12 J DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog147 hydrog ? ? I DG 62  N1 ? ? ? 1_555 J DC 84  N3 ? ? I DG -11 J DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog148 hydrog ? ? I DG 62  N2 ? ? ? 1_555 J DC 84  O2 ? ? I DG -11 J DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog149 hydrog ? ? I DG 62  O6 ? ? ? 1_555 J DC 84  N4 ? ? I DG -11 J DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog150 hydrog ? ? I DC 63  N3 ? ? ? 1_555 J DG 83  N1 ? ? I DC -10 J DG 10  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog151 hydrog ? ? I DC 63  N4 ? ? ? 1_555 J DG 83  O6 ? ? I DC -10 J DG 10  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog152 hydrog ? ? I DC 63  O2 ? ? ? 1_555 J DG 83  N2 ? ? I DC -10 J DG 10  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog153 hydrog ? ? I DA 64  N1 ? ? ? 1_555 J DT 82  N3 ? ? I DA -9  J DT 9   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog154 hydrog ? ? I DA 64  N6 ? ? ? 1_555 J DT 82  O4 ? ? I DA -9  J DT 9   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog155 hydrog ? ? I DC 65  N3 ? ? ? 1_555 J DG 81  N1 ? ? I DC -8  J DG 8   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog156 hydrog ? ? I DC 65  N4 ? ? ? 1_555 J DG 81  O6 ? ? I DC -8  J DG 8   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog157 hydrog ? ? I DC 65  O2 ? ? ? 1_555 J DG 81  N2 ? ? I DC -8  J DG 8   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog158 hydrog ? ? I DG 66  N1 ? ? ? 1_555 J DC 80  N3 ? ? I DG -7  J DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog159 hydrog ? ? I DG 66  N2 ? ? ? 1_555 J DC 80  O2 ? ? I DG -7  J DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog160 hydrog ? ? I DG 66  O6 ? ? ? 1_555 J DC 80  N4 ? ? I DG -7  J DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog161 hydrog ? ? I DT 67  N3 ? ? ? 1_555 J DA 79  N1 ? ? I DT -6  J DA 6   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog162 hydrog ? ? I DT 67  O4 ? ? ? 1_555 J DA 79  N6 ? ? I DT -6  J DA 6   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog163 hydrog ? ? I DA 68  N1 ? ? ? 1_555 J DT 78  N3 ? ? I DA -5  J DT 5   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog164 hydrog ? ? I DA 68  N6 ? ? ? 1_555 J DT 78  O4 ? ? I DA -5  J DT 5   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog165 hydrog ? ? I DC 69  N3 ? ? ? 1_555 J DG 77  N1 ? ? I DC -4  J DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog166 hydrog ? ? I DC 69  N4 ? ? ? 1_555 J DG 77  O6 ? ? I DC -4  J DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog167 hydrog ? ? I DC 69  O2 ? ? ? 1_555 J DG 77  N2 ? ? I DC -4  J DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog168 hydrog ? ? I DG 70  N1 ? ? ? 1_555 J DC 76  N3 ? ? I DG -3  J DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog169 hydrog ? ? I DG 70  N2 ? ? ? 1_555 J DC 76  O2 ? ? I DG -3  J DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog170 hydrog ? ? I DG 70  O6 ? ? ? 1_555 J DC 76  N4 ? ? I DG -3  J DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog171 hydrog ? ? I DC 71  N3 ? ? ? 1_555 J DG 75  N1 ? ? I DC -2  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog172 hydrog ? ? I DC 71  N4 ? ? ? 1_555 J DG 75  O6 ? ? I DC -2  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog173 hydrog ? ? I DC 71  O2 ? ? ? 1_555 J DG 75  N2 ? ? I DC -2  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog174 hydrog ? ? I DG 72  N1 ? ? ? 1_555 J DC 74  N3 ? ? I DG -1  J DC 1   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog175 hydrog ? ? I DG 72  N2 ? ? ? 1_555 J DC 74  O2 ? ? I DG -1  J DC 1   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog176 hydrog ? ? I DG 72  O6 ? ? ? 1_555 J DC 74  N4 ? ? I DG -1  J DC 1   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog177 hydrog ? ? I DC 73  N3 ? ? ? 1_555 J DG 73  N1 ? ? I DC 0   J DG 0   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog178 hydrog ? ? I DC 73  N4 ? ? ? 1_555 J DG 73  O6 ? ? I DC 0   J DG 0   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog179 hydrog ? ? I DC 73  O2 ? ? ? 1_555 J DG 73  N2 ? ? I DC 0   J DG 0   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog180 hydrog ? ? I DT 74  N3 ? ? ? 1_555 J DA 72  N1 ? ? I DT 1   J DA -1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog181 hydrog ? ? I DT 74  O4 ? ? ? 1_555 J DA 72  N6 ? ? I DT 1   J DA -1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog182 hydrog ? ? I DG 75  N1 ? ? ? 1_555 J DC 71  N3 ? ? I DG 2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog183 hydrog ? ? I DG 75  N2 ? ? ? 1_555 J DC 71  O2 ? ? I DG 2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog184 hydrog ? ? I DG 75  O6 ? ? ? 1_555 J DC 71  N4 ? ? I DG 2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog185 hydrog ? ? I DT 76  N3 ? ? ? 1_555 J DA 70  N1 ? ? I DT 3   J DA -3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog186 hydrog ? ? I DT 76  O4 ? ? ? 1_555 J DA 70  N6 ? ? I DT 3   J DA -3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog187 hydrog ? ? I DC 77  N3 ? ? ? 1_555 J DG 69  N1 ? ? I DC 4   J DG -4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog188 hydrog ? ? I DC 77  N4 ? ? ? 1_555 J DG 69  O6 ? ? I DC 4   J DG -4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog189 hydrog ? ? I DC 77  O2 ? ? ? 1_555 J DG 69  N2 ? ? I DC 4   J DG -4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog190 hydrog ? ? I DC 78  N3 ? ? ? 1_555 J DG 68  N1 ? ? I DC 5   J DG -5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog191 hydrog ? ? I DC 78  N4 ? ? ? 1_555 J DG 68  O6 ? ? I DC 5   J DG -5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog192 hydrog ? ? I DC 78  O2 ? ? ? 1_555 J DG 68  N2 ? ? I DC 5   J DG -5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog193 hydrog ? ? I DC 79  N3 ? ? ? 1_555 J DG 67  N1 ? ? I DC 6   J DG -6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog194 hydrog ? ? I DC 79  N4 ? ? ? 1_555 J DG 67  O6 ? ? I DC 6   J DG -6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog195 hydrog ? ? I DC 79  O2 ? ? ? 1_555 J DG 67  N2 ? ? I DC 6   J DG -6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog196 hydrog ? ? I DC 80  N3 ? ? ? 1_555 J DG 66  N1 ? ? I DC 7   J DG -7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog197 hydrog ? ? I DC 80  N4 ? ? ? 1_555 J DG 66  O6 ? ? I DC 7   J DG -7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog198 hydrog ? ? I DC 80  O2 ? ? ? 1_555 J DG 66  N2 ? ? I DC 7   J DG -7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog199 hydrog ? ? I DC 81  N3 ? ? ? 1_555 J DG 65  N1 ? ? I DC 8   J DG -8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog200 hydrog ? ? I DC 81  N4 ? ? ? 1_555 J DG 65  O6 ? ? I DC 8   J DG -8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog201 hydrog ? ? I DC 81  O2 ? ? ? 1_555 J DG 65  N2 ? ? I DC 8   J DG -8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog202 hydrog ? ? I DG 82  N1 ? ? ? 1_555 J DC 64  N3 ? ? I DG 9   J DC -9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog203 hydrog ? ? I DG 82  N2 ? ? ? 1_555 J DC 64  O2 ? ? I DG 9   J DC -9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog204 hydrog ? ? I DG 82  O6 ? ? ? 1_555 J DC 64  N4 ? ? I DG 9   J DC -9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog205 hydrog ? ? I DC 83  N3 ? ? ? 1_555 J DG 63  N1 ? ? I DC 10  J DG -10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog206 hydrog ? ? I DC 83  N4 ? ? ? 1_555 J DG 63  O6 ? ? I DC 10  J DG -10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog207 hydrog ? ? I DC 83  O2 ? ? ? 1_555 J DG 63  N2 ? ? I DC 10  J DG -10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog208 hydrog ? ? I DG 84  N1 ? ? ? 1_555 J DC 62  N3 ? ? I DG 11  J DC -11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog209 hydrog ? ? I DG 84  N2 ? ? ? 1_555 J DC 62  O2 ? ? I DG 11  J DC -11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog210 hydrog ? ? I DG 84  O6 ? ? ? 1_555 J DC 62  N4 ? ? I DG 11  J DC -11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog211 hydrog ? ? I DT 85  N3 ? ? ? 1_555 J DA 61  N1 ? ? I DT 12  J DA -12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog212 hydrog ? ? I DT 85  O4 ? ? ? 1_555 J DA 61  N6 ? ? I DT 12  J DA -12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog213 hydrog ? ? I DT 86  N3 ? ? ? 1_555 J DA 60  N1 ? ? I DT 13  J DA -13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog214 hydrog ? ? I DT 86  O4 ? ? ? 1_555 J DA 60  N6 ? ? I DT 13  J DA -13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog215 hydrog ? ? I DT 87  N3 ? ? ? 1_555 J DA 59  N1 ? ? I DT 14  J DA -14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog216 hydrog ? ? I DT 87  O4 ? ? ? 1_555 J DA 59  N6 ? ? I DT 14  J DA -14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog217 hydrog ? ? I DT 88  N3 ? ? ? 1_555 J DA 58  N1 ? ? I DT 15  J DA -15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog218 hydrog ? ? I DT 88  O4 ? ? ? 1_555 J DA 58  N6 ? ? I DT 15  J DA -15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog219 hydrog ? ? I DA 89  N1 ? ? ? 1_555 J DT 57  N3 ? ? I DA 16  J DT -16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog220 hydrog ? ? I DA 89  N6 ? ? ? 1_555 J DT 57  O4 ? ? I DA 16  J DT -16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog221 hydrog ? ? I DA 90  N1 ? ? ? 1_555 J DT 56  N3 ? ? I DA 17  J DT -17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog222 hydrog ? ? I DA 90  N6 ? ? ? 1_555 J DT 56  O4 ? ? I DA 17  J DT -17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog223 hydrog ? ? I DC 91  N3 ? ? ? 1_555 J DG 55  N1 ? ? I DC 18  J DG -18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog224 hydrog ? ? I DC 91  N4 ? ? ? 1_555 J DG 55  O6 ? ? I DC 18  J DG -18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog225 hydrog ? ? I DC 91  O2 ? ? ? 1_555 J DG 55  N2 ? ? I DC 18  J DG -18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog226 hydrog ? ? I DC 92  N3 ? ? ? 1_555 J DG 54  N1 ? ? I DC 19  J DG -19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog227 hydrog ? ? I DC 92  N4 ? ? ? 1_555 J DG 54  O6 ? ? I DC 19  J DG -19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog228 hydrog ? ? I DC 92  O2 ? ? ? 1_555 J DG 54  N2 ? ? I DC 19  J DG -19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog229 hydrog ? ? I DG 93  N1 ? ? ? 1_555 J DC 53  N3 ? ? I DG 20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog230 hydrog ? ? I DG 93  N2 ? ? ? 1_555 J DC 53  O2 ? ? I DG 20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog231 hydrog ? ? I DG 93  O6 ? ? ? 1_555 J DC 53  N4 ? ? I DG 20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog232 hydrog ? ? I DC 94  N3 ? ? ? 1_555 J DG 52  N1 ? ? I DC 21  J DG -21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog233 hydrog ? ? I DC 94  N4 ? ? ? 1_555 J DG 52  O6 ? ? I DC 21  J DG -21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog234 hydrog ? ? I DC 94  O2 ? ? ? 1_555 J DG 52  N2 ? ? I DC 21  J DG -21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog235 hydrog ? ? I DC 95  N3 ? ? ? 1_555 J DG 51  N1 ? ? I DC 22  J DG -22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog236 hydrog ? ? I DC 95  N4 ? ? ? 1_555 J DG 51  O6 ? ? I DC 22  J DG -22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog237 hydrog ? ? I DC 95  O2 ? ? ? 1_555 J DG 51  N2 ? ? I DC 22  J DG -22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog238 hydrog ? ? I DA 96  N1 ? ? ? 1_555 J DT 50  N3 ? ? I DA 23  J DT -23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog239 hydrog ? ? I DA 96  N6 ? ? ? 1_555 J DT 50  O4 ? ? I DA 23  J DT -23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog240 hydrog ? ? I DA 97  N1 ? ? ? 1_555 J DT 49  N3 ? ? I DA 24  J DT -24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog241 hydrog ? ? I DA 97  N6 ? ? ? 1_555 J DT 49  O4 ? ? I DA 24  J DT -24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog242 hydrog ? ? I DG 98  N1 ? ? ? 1_555 J DC 48  N3 ? ? I DG 25  J DC -25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog243 hydrog ? ? I DG 98  N2 ? ? ? 1_555 J DC 48  O2 ? ? I DG 25  J DC -25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog244 hydrog ? ? I DG 98  O6 ? ? ? 1_555 J DC 48  N4 ? ? I DG 25  J DC -25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog245 hydrog ? ? I DG 99  N1 ? ? ? 1_555 J DC 47  N3 ? ? I DG 26  J DC -26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog246 hydrog ? ? I DG 99  N2 ? ? ? 1_555 J DC 47  O2 ? ? I DG 26  J DC -26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog247 hydrog ? ? I DG 99  O6 ? ? ? 1_555 J DC 47  N4 ? ? I DG 26  J DC -26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog248 hydrog ? ? I DG 100 N1 ? ? ? 1_555 J DC 46  N3 ? ? I DG 27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog249 hydrog ? ? I DG 100 N2 ? ? ? 1_555 J DC 46  O2 ? ? I DG 27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog250 hydrog ? ? I DG 100 O6 ? ? ? 1_555 J DC 46  N4 ? ? I DG 27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog251 hydrog ? ? I DG 101 N1 ? ? ? 1_555 J DC 45  N3 ? ? I DG 28  J DC -28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog252 hydrog ? ? I DG 101 N2 ? ? ? 1_555 J DC 45  O2 ? ? I DG 28  J DC -28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog253 hydrog ? ? I DG 101 O6 ? ? ? 1_555 J DC 45  N4 ? ? I DG 28  J DC -28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog254 hydrog ? ? I DA 102 N1 ? ? ? 1_555 J DT 44  N3 ? ? I DA 29  J DT -29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog255 hydrog ? ? I DA 102 N6 ? ? ? 1_555 J DT 44  O4 ? ? I DA 29  J DT -29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog256 hydrog ? ? I DT 103 N3 ? ? ? 1_555 J DA 43  N1 ? ? I DT 30  J DA -30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog257 hydrog ? ? I DT 103 O4 ? ? ? 1_555 J DA 43  N6 ? ? I DT 30  J DA -30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog258 hydrog ? ? I DT 104 N3 ? ? ? 1_555 J DA 42  N1 ? ? I DT 31  J DA -31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog259 hydrog ? ? I DT 104 O4 ? ? ? 1_555 J DA 42  N6 ? ? I DT 31  J DA -31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog260 hydrog ? ? I DA 105 N1 ? ? ? 1_555 J DT 41  N3 ? ? I DA 32  J DT -32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog261 hydrog ? ? I DA 105 N6 ? ? ? 1_555 J DT 41  O4 ? ? I DA 32  J DT -32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog262 hydrog ? ? I DC 106 N3 ? ? ? 1_555 J DG 40  N1 ? ? I DC 33  J DG -33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog263 hydrog ? ? I DC 106 N4 ? ? ? 1_555 J DG 40  O6 ? ? I DC 33  J DG -33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog264 hydrog ? ? I DC 106 O2 ? ? ? 1_555 J DG 40  N2 ? ? I DC 33  J DG -33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog265 hydrog ? ? I DT 107 N3 ? ? ? 1_555 J DA 39  N1 ? ? I DT 34  J DA -34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog266 hydrog ? ? I DT 107 O4 ? ? ? 1_555 J DA 39  N6 ? ? I DT 34  J DA -34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog267 hydrog ? ? I DC 108 N3 ? ? ? 1_555 J DG 38  N1 ? ? I DC 35  J DG -35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog268 hydrog ? ? I DC 108 N4 ? ? ? 1_555 J DG 38  O6 ? ? I DC 35  J DG -35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog269 hydrog ? ? I DC 108 O2 ? ? ? 1_555 J DG 38  N2 ? ? I DC 35  J DG -35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog270 hydrog ? ? I DC 109 N3 ? ? ? 1_555 J DG 37  N1 ? ? I DC 36  J DG -36 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog271 hydrog ? ? I DC 109 N4 ? ? ? 1_555 J DG 37  O6 ? ? I DC 36  J DG -36 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog272 hydrog ? ? I DC 109 O2 ? ? ? 1_555 J DG 37  N2 ? ? I DC 36  J DG -36 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog273 hydrog ? ? I DC 110 N3 ? ? ? 1_555 J DG 36  N1 ? ? I DC 37  J DG -37 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog274 hydrog ? ? I DC 110 N4 ? ? ? 1_555 J DG 36  O6 ? ? I DC 37  J DG -37 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog275 hydrog ? ? I DC 110 O2 ? ? ? 1_555 J DG 36  N2 ? ? I DC 37  J DG -37 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog276 hydrog ? ? I DT 111 N3 ? ? ? 1_555 J DA 35  N1 ? ? I DT 38  J DA -38 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog277 hydrog ? ? I DT 111 O4 ? ? ? 1_555 J DA 35  N6 ? ? I DT 38  J DA -38 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog278 hydrog ? ? I DA 112 N1 ? ? ? 1_555 J DT 34  N3 ? ? I DA 39  J DT -39 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog279 hydrog ? ? I DA 112 N6 ? ? ? 1_555 J DT 34  O4 ? ? I DA 39  J DT -39 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog280 hydrog ? ? I DG 113 N1 ? ? ? 1_555 J DC 33  N3 ? ? I DG 40  J DC -40 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog281 hydrog ? ? I DG 113 N2 ? ? ? 1_555 J DC 33  O2 ? ? I DG 40  J DC -40 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog282 hydrog ? ? I DG 113 O6 ? ? ? 1_555 J DC 33  N4 ? ? I DG 40  J DC -40 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog283 hydrog ? ? I DT 114 N3 ? ? ? 1_555 J DA 32  N1 ? ? I DT 41  J DA -41 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog284 hydrog ? ? I DT 114 O4 ? ? ? 1_555 J DA 32  N6 ? ? I DT 41  J DA -41 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog285 hydrog ? ? I DC 115 N3 ? ? ? 1_555 J DG 31  N1 ? ? I DC 42  J DG -42 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog286 hydrog ? ? I DC 115 N4 ? ? ? 1_555 J DG 31  O6 ? ? I DC 42  J DG -42 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog287 hydrog ? ? I DC 115 O2 ? ? ? 1_555 J DG 31  N2 ? ? I DC 42  J DG -42 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog288 hydrog ? ? I DT 116 N3 ? ? ? 1_555 J DA 30  N1 ? ? I DT 43  J DA -43 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog289 hydrog ? ? I DT 116 O4 ? ? ? 1_555 J DA 30  N6 ? ? I DT 43  J DA -43 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog290 hydrog ? ? I DC 117 N3 ? ? ? 1_555 J DG 29  N1 ? ? I DC 44  J DG -44 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog291 hydrog ? ? I DC 117 N4 ? ? ? 1_555 J DG 29  O6 ? ? I DC 44  J DG -44 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog292 hydrog ? ? I DC 117 O2 ? ? ? 1_555 J DG 29  N2 ? ? I DC 44  J DG -44 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog293 hydrog ? ? I DC 118 N3 ? ? ? 1_555 J DG 28  N1 ? ? I DC 45  J DG -45 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog294 hydrog ? ? I DC 118 N4 ? ? ? 1_555 J DG 28  O6 ? ? I DC 45  J DG -45 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog295 hydrog ? ? I DC 118 O2 ? ? ? 1_555 J DG 28  N2 ? ? I DC 45  J DG -45 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog296 hydrog ? ? I DA 119 N1 ? ? ? 1_555 J DT 27  N3 ? ? I DA 46  J DT -46 1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? 
hydrog297 hydrog ? ? I DG 120 N1 ? ? ? 1_555 J DC 26  N3 ? ? I DG 47  J DC -47 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog298 hydrog ? ? I DG 120 N2 ? ? ? 1_555 J DC 26  O2 ? ? I DG 47  J DC -47 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog299 hydrog ? ? I DG 120 O6 ? ? ? 1_555 J DC 26  N4 ? ? I DG 47  J DC -47 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog300 hydrog ? ? I DG 121 N1 ? ? ? 1_555 J DC 25  N3 ? ? I DG 48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog301 hydrog ? ? I DG 121 N2 ? ? ? 1_555 J DC 25  O2 ? ? I DG 48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog302 hydrog ? ? I DG 121 O6 ? ? ? 1_555 J DC 25  N4 ? ? I DG 48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog303 hydrog ? ? I DC 122 N3 ? ? ? 1_555 J DG 24  N1 ? ? I DC 49  J DG -49 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog304 hydrog ? ? I DC 122 N4 ? ? ? 1_555 J DG 24  O6 ? ? I DC 49  J DG -49 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog305 hydrog ? ? I DC 122 O2 ? ? ? 1_555 J DG 24  N2 ? ? I DC 49  J DG -49 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog306 hydrog ? ? I DA 123 N1 ? ? ? 1_555 J DT 23  N3 ? ? I DA 50  J DT -50 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog307 hydrog ? ? I DA 123 N6 ? ? ? 1_555 J DT 23  O4 ? ? I DA 50  J DT -50 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog308 hydrog ? ? I DC 124 N3 ? ? ? 1_555 J DG 22  N1 ? ? I DC 51  J DG -51 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog309 hydrog ? ? I DC 124 N4 ? ? ? 1_555 J DG 22  O6 ? ? I DC 51  J DG -51 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog310 hydrog ? ? I DC 124 O2 ? ? ? 1_555 J DG 22  N2 ? ? I DC 51  J DG -51 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog311 hydrog ? ? I DG 125 N1 ? ? ? 1_555 J DC 21  N3 ? ? I DG 52  J DC -52 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog312 hydrog ? ? I DG 125 N2 ? ? ? 1_555 J DC 21  O2 ? ? I DG 52  J DC -52 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog313 hydrog ? ? I DG 125 O6 ? ? ? 1_555 J DC 21  N4 ? ? I DG 52  J DC -52 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog314 hydrog ? ? I DT 126 N3 ? ? ? 1_555 J DA 20  N1 ? ? I DT 53  J DA -53 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog315 hydrog ? ? I DT 126 O4 ? ? ? 1_555 J DA 20  N6 ? ? I DT 53  J DA -53 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog316 hydrog ? ? I DG 127 N1 ? ? ? 1_555 J DC 19  N3 ? ? I DG 54  J DC -54 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog317 hydrog ? ? I DG 127 N2 ? ? ? 1_555 J DC 19  O2 ? ? I DG 54  J DC -54 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog318 hydrog ? ? I DG 127 O6 ? ? ? 1_555 J DC 19  N4 ? ? I DG 54  J DC -54 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog319 hydrog ? ? I DT 128 N3 ? ? ? 1_555 J DA 18  N1 ? ? I DT 55  J DA -55 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog320 hydrog ? ? I DT 128 O4 ? ? ? 1_555 J DA 18  N6 ? ? I DT 55  J DA -55 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog321 hydrog ? ? I DC 129 N3 ? ? ? 1_555 J DG 17  N1 ? ? I DC 56  J DG -56 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog322 hydrog ? ? I DC 129 N4 ? ? ? 1_555 J DG 17  O6 ? ? I DC 56  J DG -56 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog323 hydrog ? ? I DC 129 O2 ? ? ? 1_555 J DG 17  N2 ? ? I DC 56  J DG -56 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog324 hydrog ? ? I DA 130 N1 ? ? ? 1_555 J DT 16  N3 ? ? I DA 57  J DT -57 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog325 hydrog ? ? I DA 130 N6 ? ? ? 1_555 J DT 16  O4 ? ? I DA 57  J DT -57 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog326 hydrog ? ? I DG 131 N1 ? ? ? 1_555 J DC 15  N3 ? ? I DG 58  J DC -58 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog327 hydrog ? ? I DG 131 N2 ? ? ? 1_555 J DC 15  O2 ? ? I DG 58  J DC -58 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog328 hydrog ? ? I DG 131 O6 ? ? ? 1_555 J DC 15  N4 ? ? I DG 58  J DC -58 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog329 hydrog ? ? I DA 132 N1 ? ? ? 1_555 J DT 14  N3 ? ? I DA 59  J DT -59 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog330 hydrog ? ? I DA 132 N6 ? ? ? 1_555 J DT 14  O4 ? ? I DA 59  J DT -59 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog331 hydrog ? ? I DT 133 N3 ? ? ? 1_555 J DA 13  N1 ? ? I DT 60  J DA -60 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog332 hydrog ? ? I DT 133 O4 ? ? ? 1_555 J DA 13  N6 ? ? I DT 60  J DA -60 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog333 hydrog ? ? I DA 134 N1 ? ? ? 1_555 J DT 12  N3 ? ? I DA 61  J DT -61 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog334 hydrog ? ? I DA 134 N6 ? ? ? 1_555 J DT 12  O4 ? ? I DA 61  J DT -61 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog335 hydrog ? ? I DT 135 N3 ? ? ? 1_555 J DA 11  N1 ? ? I DT 62  J DA -62 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog336 hydrog ? ? I DT 135 O4 ? ? ? 1_555 J DA 11  N6 ? ? I DT 62  J DA -62 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog337 hydrog ? ? I DA 136 N1 ? ? ? 1_555 J DT 10  N3 ? ? I DA 63  J DT -63 1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? 
hydrog338 hydrog ? ? I DT 137 N3 ? ? ? 1_555 J DA 9   N1 ? ? I DT 64  J DA -64 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog339 hydrog ? ? I DT 137 O4 ? ? ? 1_555 J DA 9   N6 ? ? I DT 64  J DA -64 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog340 hydrog ? ? I DA 138 N1 ? ? ? 1_555 J DT 8   N3 ? ? I DA 65  J DT -65 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog341 hydrog ? ? I DA 138 N6 ? ? ? 1_555 J DT 8   O4 ? ? I DA 65  J DT -65 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog342 hydrog ? ? I DC 139 N3 ? ? ? 1_555 J DG 7   N1 ? ? I DC 66  J DG -66 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog343 hydrog ? ? I DC 139 N4 ? ? ? 1_555 J DG 7   O6 ? ? I DC 66  J DG -66 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog344 hydrog ? ? I DC 139 O2 ? ? ? 1_555 J DG 7   N2 ? ? I DC 66  J DG -66 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog345 hydrog ? ? I DA 140 N1 ? ? ? 1_555 J DT 6   N3 ? ? I DA 67  J DT -67 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog346 hydrog ? ? I DA 140 N6 ? ? ? 1_555 J DT 6   O4 ? ? I DA 67  J DT -67 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog347 hydrog ? ? I DT 141 N3 ? ? ? 1_555 J DA 5   N1 ? ? I DT 68  J DA -68 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog348 hydrog ? ? I DT 141 O4 ? ? ? 1_555 J DA 5   N6 ? ? I DT 68  J DA -68 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog349 hydrog ? ? I DC 142 N3 ? ? ? 1_555 J DG 4   N1 ? ? I DC 69  J DG -69 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog350 hydrog ? ? I DC 142 N4 ? ? ? 1_555 J DG 4   O6 ? ? I DC 69  J DG -69 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog351 hydrog ? ? I DC 142 O2 ? ? ? 1_555 J DG 4   N2 ? ? I DC 69  J DG -69 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA2 1 2 ? parallel 
AA3 1 2 ? parallel 
AA4 1 2 ? parallel 
AA5 1 2 ? parallel 
AA6 1 2 ? parallel 
AA7 1 2 ? parallel 
AA8 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ASN A 85  ? TRP A 86  ? ASN A 85  TRP A 86  
AA1 2 THR B 81  ? VAL B 82  ? THR B 80  VAL B 81  
AA2 1 THR A 120 ? LEU A 121 ? THR A 120 LEU A 121 
AA2 2 ARG B 46  ? ILE B 47  ? ARG B 45  ILE B 46  
AA3 1 THR B 97  ? TYR B 99  ? THR B 96  TYR B 98  
AA3 2 VAL G 101 ? ILE G 103 ? VAL G 100 ILE G 102 
AA4 1 ARG C 43  ? VAL C 44  ? ARG C 42  VAL C 43  
AA4 2 THR D 89  ? ILE D 90  ? THR D 88  ILE D 89  
AA5 1 VAL C 101 ? ILE C 103 ? VAL C 100 ILE C 102 
AA5 2 THR F 97  ? TYR F 99  ? THR F 96  TYR F 98  
AA6 1 ASN E 85  ? TRP E 86  ? ASN E 85  TRP E 86  
AA6 2 THR F 81  ? VAL F 82  ? THR F 80  VAL F 81  
AA7 1 THR E 120 ? LEU E 121 ? THR E 120 LEU E 121 
AA7 2 ARG F 46  ? ILE F 47  ? ARG F 45  ILE F 46  
AA8 1 ARG G 43  ? VAL G 44  ? ARG G 42  VAL G 43  
AA8 2 THR H 89  ? ILE H 90  ? THR H 88  ILE H 89  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ASN A 85  ? N ASN A 85  O VAL B 82  ? O VAL B 81  
AA2 1 2 N LEU A 121 ? N LEU A 121 O ARG B 46  ? O ARG B 45  
AA3 1 2 N THR B 97  ? N THR B 96  O THR G 102 ? O THR G 101 
AA4 1 2 N ARG C 43  ? N ARG C 42  O ILE D 90  ? O ILE D 89  
AA5 1 2 N THR C 102 ? N THR C 101 O TYR F 99  ? O TYR F 98  
AA6 1 2 N ASN E 85  ? N ASN E 85  O VAL F 82  ? O VAL F 81  
AA7 1 2 N LEU E 121 ? N LEU E 121 O ARG F 46  ? O ARG F 45  
AA8 1 2 N ARG G 43  ? N ARG G 42  O ILE H 90  ? O ILE H 89  
# 
_atom_sites.entry_id                    6SEG 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N     . GLN A 1 45  ? 102.38700 82.51400  76.76400  1.000 56.20340  ? 45  GLN A N     1 
ATOM 2     C CA    . GLN A 1 45  ? 101.77400 83.43700  77.71200  1.000 56.20340  ? 45  GLN A CA    1 
ATOM 3     C C     . GLN A 1 45  ? 101.98100 82.94500  79.14100  1.000 56.20340  ? 45  GLN A C     1 
ATOM 4     O O     . GLN A 1 45  ? 101.10400 83.08600  79.99100  1.000 56.20340  ? 45  GLN A O     1 
ATOM 5     C CB    . GLN A 1 45  ? 100.28100 83.60000  77.41700  1.000 56.20340  ? 45  GLN A CB    1 
ATOM 6     C CG    . GLN A 1 45  ? 99.73300  84.99100  77.69900  1.000 56.20340  ? 45  GLN A CG    1 
ATOM 7     C CD    . GLN A 1 45  ? 98.22000  85.03400  77.70900  1.000 56.20340  ? 45  GLN A CD    1 
ATOM 8     O OE1   . GLN A 1 45  ? 97.56300  84.06100  78.07400  1.000 56.20340  ? 45  GLN A OE1   1 
ATOM 9     N NE2   . GLN A 1 45  ? 97.65800  86.16700  77.30900  1.000 56.20340  ? 45  GLN A NE2   1 
ATOM 10    N N     . GLY A 1 46  ? 103.15500 82.37300  79.40500  1.000 53.76635  ? 46  GLY A N     1 
ATOM 11    C CA    . GLY A 1 46  ? 103.42700 81.81100  80.71500  1.000 53.76635  ? 46  GLY A CA    1 
ATOM 12    C C     . GLY A 1 46  ? 103.69600 82.83000  81.80100  1.000 53.76635  ? 46  GLY A C     1 
ATOM 13    O O     . GLY A 1 46  ? 103.68100 82.46300  82.98200  1.000 53.76635  ? 46  GLY A O     1 
ATOM 14    N N     . TRP A 1 47  ? 103.90700 84.09900  81.43900  1.000 49.57616  ? 47  TRP A N     1 
ATOM 15    C CA    . TRP A 1 47  ? 104.06600 85.12100  82.46400  1.000 49.57616  ? 47  TRP A CA    1 
ATOM 16    C C     . TRP A 1 47  ? 102.75300 85.38900  83.17500  1.000 49.57616  ? 47  TRP A C     1 
ATOM 17    O O     . TRP A 1 47  ? 102.75500 85.67000  84.37300  1.000 49.57616  ? 47  TRP A O     1 
ATOM 18    C CB    . TRP A 1 47  ? 104.61000 86.41800  81.86300  1.000 49.57616  ? 47  TRP A CB    1 
ATOM 19    C CG    . TRP A 1 47  ? 103.71100 87.04900  80.84800  1.000 49.57616  ? 47  TRP A CG    1 
ATOM 20    C CD1   . TRP A 1 47  ? 103.71900 86.83100  79.50600  1.000 49.57616  ? 47  TRP A CD1   1 
ATOM 21    C CD2   . TRP A 1 47  ? 102.67300 88.00800  81.09100  1.000 49.57616  ? 47  TRP A CD2   1 
ATOM 22    N NE1   . TRP A 1 47  ? 102.75000 87.58800  78.89500  1.000 49.57616  ? 47  TRP A NE1   1 
ATOM 23    C CE2   . TRP A 1 47  ? 102.09300 88.31900  79.84800  1.000 49.57616  ? 47  TRP A CE2   1 
ATOM 24    C CE3   . TRP A 1 47  ? 102.17300 88.62600  82.24000  1.000 49.57616  ? 47  TRP A CE3   1 
ATOM 25    C CZ2   . TRP A 1 47  ? 101.04200 89.22100  79.72100  1.000 49.57616  ? 47  TRP A CZ2   1 
ATOM 26    C CZ3   . TRP A 1 47  ? 101.13100 89.52100  82.11200  1.000 49.57616  ? 47  TRP A CZ3   1 
ATOM 27    C CH2   . TRP A 1 47  ? 100.57600 89.81000  80.86300  1.000 49.57616  ? 47  TRP A CH2   1 
ATOM 28    N N     . LEU A 1 48  ? 101.62600 85.26000  82.47400  1.000 50.71453  ? 48  LEU A N     1 
ATOM 29    C CA    . LEU A 1 48  ? 100.33600 85.51100  83.10500  1.000 50.71453  ? 48  LEU A CA    1 
ATOM 30    C C     . LEU A 1 48  ? 99.98800  84.40500  84.08900  1.000 50.71453  ? 48  LEU A C     1 
ATOM 31    O O     . LEU A 1 48  ? 99.53500  84.68300  85.20400  1.000 50.71453  ? 48  LEU A O     1 
ATOM 32    C CB    . LEU A 1 48  ? 99.25000  85.64900  82.04300  1.000 50.71453  ? 48  LEU A CB    1 
ATOM 33    C CG    . LEU A 1 48  ? 97.84800  85.91500  82.58100  1.000 50.71453  ? 48  LEU A CG    1 
ATOM 34    C CD1   . LEU A 1 48  ? 97.81900  87.19800  83.39200  1.000 50.71453  ? 48  LEU A CD1   1 
ATOM 35    C CD2   . LEU A 1 48  ? 96.85300  85.97700  81.43900  1.000 50.71453  ? 48  LEU A CD2   1 
ATOM 36    N N     . LYS A 1 49  ? 100.25100 83.15100  83.71300  1.000 54.06596  ? 49  LYS A N     1 
ATOM 37    C CA    . LYS A 1 49  ? 100.06400 82.03100  84.63000  1.000 54.06596  ? 49  LYS A CA    1 
ATOM 38    C C     . LYS A 1 49  ? 101.03100 82.10100  85.80400  1.000 54.06596  ? 49  LYS A C     1 
ATOM 39    O O     . LYS A 1 49  ? 100.65300 81.79900  86.94100  1.000 54.06596  ? 49  LYS A O     1 
ATOM 40    C CB    . LYS A 1 49  ? 100.24000 80.71200  83.87900  1.000 54.06596  ? 49  LYS A CB    1 
ATOM 41    C CG    . LYS A 1 49  ? 99.13800  80.40500  82.87800  1.000 54.06596  ? 49  LYS A CG    1 
ATOM 42    C CD    . LYS A 1 49  ? 99.53200  79.28300  81.92200  1.000 54.06596  ? 49  LYS A CD    1 
ATOM 43    C CE    . LYS A 1 49  ? 100.07200 78.06600  82.65600  1.000 54.06596  ? 49  LYS A CE    1 
ATOM 44    N NZ    . LYS A 1 49  ? 100.14200 76.87000  81.77500  1.000 54.06596  ? 49  LYS A NZ    1 
ATOM 45    N N     . GLU A 1 50  ? 102.26500 82.55000  85.56100  1.000 46.12885  ? 50  GLU A N     1 
ATOM 46    C CA    . GLU A 1 50  ? 103.25100 82.62200  86.63500  1.000 46.12885  ? 50  GLU A CA    1 
ATOM 47    C C     . GLU A 1 50  ? 102.92400 83.74000  87.62400  1.000 46.12885  ? 50  GLU A C     1 
ATOM 48    O O     . GLU A 1 50  ? 103.05700 83.55200  88.83700  1.000 46.12885  ? 50  GLU A O     1 
ATOM 49    C CB    . GLU A 1 50  ? 104.64900 82.77800  86.04400  1.000 46.12885  ? 50  GLU A CB    1 
ATOM 50    C CG    . GLU A 1 50  ? 105.77100 82.49300  87.01900  1.000 46.12885  ? 50  GLU A CG    1 
ATOM 51    C CD    . GLU A 1 50  ? 107.13800 82.57600  86.36700  1.000 46.12885  ? 50  GLU A CD    1 
ATOM 52    O OE1   . GLU A 1 50  ? 107.58100 83.69100  86.02900  1.000 46.12885  ? 50  GLU A OE1   1 
ATOM 53    O OE2   . GLU A 1 50  ? 107.76900 81.51400  86.17900  1.000 46.12885  ? 50  GLU A OE2   1 
ATOM 54    N N     . ILE A 1 51  ? 102.52100 84.91500  87.12800  1.000 41.77296  ? 51  ILE A N     1 
ATOM 55    C CA    . ILE A 1 51  ? 102.10100 86.00600  88.00300  1.000 41.77296  ? 51  ILE A CA    1 
ATOM 56    C C     . ILE A 1 51  ? 100.82900 85.63100  88.75500  1.000 41.77296  ? 51  ILE A C     1 
ATOM 57    O O     . ILE A 1 51  ? 100.70800 85.89000  89.95700  1.000 41.77296  ? 51  ILE A O     1 
ATOM 58    C CB    . ILE A 1 51  ? 101.92800 87.30300  87.18500  1.000 41.77296  ? 51  ILE A CB    1 
ATOM 59    C CG1   . ILE A 1 51  ? 103.27900 87.82300  86.71100  1.000 41.77296  ? 51  ILE A CG1   1 
ATOM 60    C CG2   . ILE A 1 51  ? 101.23000 88.38600  87.98000  1.000 41.77296  ? 51  ILE A CG2   1 
ATOM 61    C CD1   . ILE A 1 51  ? 103.19200 89.06900  85.87600  1.000 41.77296  ? 51  ILE A CD1   1 
ATOM 62    N N     . ARG A 1 52  ? 99.88600  84.96400  88.07900  1.000 46.86263  ? 52  ARG A N     1 
ATOM 63    C CA    . ARG A 1 52  ? 98.63700  84.55900  88.71700  1.000 46.86263  ? 52  ARG A CA    1 
ATOM 64    C C     . ARG A 1 52  ? 98.85800  83.47500  89.76700  1.000 46.86263  ? 52  ARG A C     1 
ATOM 65    O O     . ARG A 1 52  ? 98.07800  83.36600  90.71700  1.000 46.86263  ? 52  ARG A O     1 
ATOM 66    C CB    . ARG A 1 52  ? 97.65700  84.07500  87.64800  1.000 46.86263  ? 52  ARG A CB    1 
ATOM 67    C CG    . ARG A 1 52  ? 96.20500  84.03900  88.07300  1.000 46.86263  ? 52  ARG A CG    1 
ATOM 68    C CD    . ARG A 1 52  ? 95.52600  85.37700  87.85100  1.000 46.86263  ? 52  ARG A CD    1 
ATOM 69    N NE    . ARG A 1 52  ? 95.34300  85.67000  86.43300  1.000 46.86263  ? 52  ARG A NE    1 
ATOM 70    C CZ    . ARG A 1 52  ? 94.31500  85.24100  85.70500  1.000 46.86263  ? 52  ARG A CZ    1 
ATOM 71    N NH1   . ARG A 1 52  ? 94.23000  85.56000  84.42000  1.000 46.86263  ? 52  ARG A NH1   1 
ATOM 72    N NH2   . ARG A 1 52  ? 93.36900  84.49500  86.25900  1.000 46.86263  ? 52  ARG A NH2   1 
ATOM 73    N N     . LYS A 1 53  ? 99.91800  82.67900  89.62200  1.000 44.62247  ? 53  LYS A N     1 
ATOM 74    C CA    . LYS A 1 53  ? 100.23900 81.67400  90.62900  1.000 44.62247  ? 53  LYS A CA    1 
ATOM 75    C C     . LYS A 1 53  ? 101.03900 82.25900  91.78800  1.000 44.62247  ? 53  LYS A C     1 
ATOM 76    O O     . LYS A 1 53  ? 100.79200 81.91200  92.94700  1.000 44.62247  ? 53  LYS A O     1 
ATOM 77    C CB    . LYS A 1 53  ? 100.99700 80.52000  89.96900  1.000 44.62247  ? 53  LYS A CB    1 
ATOM 78    C CG    . LYS A 1 53  ? 101.35700 79.36000  90.88000  1.000 44.62247  ? 53  LYS A CG    1 
ATOM 79    C CD    . LYS A 1 53  ? 102.84200 79.35100  91.20400  1.000 44.62247  ? 53  LYS A CD    1 
ATOM 80    C CE    . LYS A 1 53  ? 103.66600 79.11200  89.95400  1.000 44.62247  ? 53  LYS A CE    1 
ATOM 81    N NZ    . LYS A 1 53  ? 105.12900 79.09900  90.23400  1.000 44.62247  ? 53  LYS A NZ    1 
ATOM 82    N N     . LEU A 1 54  ? 101.99900 83.14000  91.50600  1.000 40.68120  ? 54  LEU A N     1 
ATOM 83    C CA    . LEU A 1 54  ? 102.84500 83.68700  92.56000  1.000 40.68120  ? 54  LEU A CA    1 
ATOM 84    C C     . LEU A 1 54  ? 102.14900 84.74600  93.39700  1.000 40.68120  ? 54  LEU A C     1 
ATOM 85    O O     . LEU A 1 54  ? 102.62700 85.05700  94.49100  1.000 40.68120  ? 54  LEU A O     1 
ATOM 86    C CB    . LEU A 1 54  ? 104.12000 84.28000  91.96600  1.000 40.68120  ? 54  LEU A CB    1 
ATOM 87    C CG    . LEU A 1 54  ? 105.15800 83.26200  91.52100  1.000 40.68120  ? 54  LEU A CG    1 
ATOM 88    C CD1   . LEU A 1 54  ? 106.31200 83.96900  90.87900  1.000 40.68120  ? 54  LEU A CD1   1 
ATOM 89    C CD2   . LEU A 1 54  ? 105.63300 82.46900  92.70900  1.000 40.68120  ? 54  LEU A CD2   1 
ATOM 90    N N     . GLN A 1 55  ? 101.05100 85.31400  92.91500  1.000 41.33587  ? 55  GLN A N     1 
ATOM 91    C CA    . GLN A 1 55  ? 100.29800 86.28800  93.68700  1.000 41.33587  ? 55  GLN A CA    1 
ATOM 92    C C     . GLN A 1 55  ? 99.24000  85.64700  94.57200  1.000 41.33587  ? 55  GLN A C     1 
ATOM 93    O O     . GLN A 1 55  ? 98.51900  86.36500  95.26800  1.000 41.33587  ? 55  GLN A O     1 
ATOM 94    C CB    . GLN A 1 55  ? 99.65800  87.31400  92.75100  1.000 41.33587  ? 55  GLN A CB    1 
ATOM 95    C CG    . GLN A 1 55  ? 100.64800 88.32700  92.20000  1.000 41.33587  ? 55  GLN A CG    1 
ATOM 96    C CD    . GLN A 1 55  ? 99.98100  89.44400  91.43200  1.000 41.33587  ? 55  GLN A CD    1 
ATOM 97    O OE1   . GLN A 1 55  ? 98.75900  89.50100  91.33300  1.000 41.33587  ? 55  GLN A OE1   1 
ATOM 98    N NE2   . GLN A 1 55  ? 100.78300 90.34500  90.88700  1.000 41.33587  ? 55  GLN A NE2   1 
ATOM 99    N N     . LYS A 1 56  ? 99.13400  84.32000  94.56400  1.000 44.32720  ? 56  LYS A N     1 
ATOM 100   C CA    . LYS A 1 56  ? 98.28200  83.57700  95.48400  1.000 44.32720  ? 56  LYS A CA    1 
ATOM 101   C C     . LYS A 1 56  ? 99.05800  82.92000  96.61500  1.000 44.32720  ? 56  LYS A C     1 
ATOM 102   O O     . LYS A 1 56  ? 98.61400  82.95400  97.76500  1.000 44.32720  ? 56  LYS A O     1 
ATOM 103   C CB    . LYS A 1 56  ? 97.50000  82.49900  94.73300  1.000 44.32720  ? 56  LYS A CB    1 
ATOM 104   C CG    . LYS A 1 56  ? 96.37800  83.02000  93.86300  1.000 44.32720  ? 56  LYS A CG    1 
ATOM 105   C CD    . LYS A 1 56  ? 95.30000  81.96100  93.67500  1.000 44.32720  ? 56  LYS A CD    1 
ATOM 106   C CE    . LYS A 1 56  ? 95.88100  80.65300  93.15700  1.000 44.32720  ? 56  LYS A CE    1 
ATOM 107   N NZ    . LYS A 1 56  ? 94.90900  79.53300  93.25500  1.000 44.32720  ? 56  LYS A NZ    1 
ATOM 108   N N     . SER A 1 57  ? 100.19900 82.31300  96.30800  1.000 42.82371  ? 57  SER A N     1 
ATOM 109   C CA    . SER A 1 57  ? 100.98800 81.59900  97.29800  1.000 42.82371  ? 57  SER A CA    1 
ATOM 110   C C     . SER A 1 57  ? 101.64700 82.56900  98.27200  1.000 42.82371  ? 57  SER A C     1 
ATOM 111   O O     . SER A 1 57  ? 101.87200 83.74300  97.96900  1.000 42.82371  ? 57  SER A O     1 
ATOM 112   C CB    . SER A 1 57  ? 102.04600 80.73800  96.61300  1.000 42.82371  ? 57  SER A CB    1 
ATOM 113   O OG    . SER A 1 57  ? 102.97200 81.53700  95.89900  1.000 42.82371  ? 57  SER A OG    1 
ATOM 114   N N     . THR A 1 58  ? 101.94500 82.06300  99.46700  1.000 41.77952  ? 58  THR A N     1 
ATOM 115   C CA    . THR A 1 58  ? 102.53500 82.86700  100.52500 1.000 41.77952  ? 58  THR A CA    1 
ATOM 116   C C     . THR A 1 58  ? 103.94800 82.44500  100.89500 1.000 41.77952  ? 58  THR A C     1 
ATOM 117   O O     . THR A 1 58  ? 104.54100 83.05400  101.79100 1.000 41.77952  ? 58  THR A O     1 
ATOM 118   C CB    . THR A 1 58  ? 101.65700 82.79500  101.77700 1.000 41.77952  ? 58  THR A CB    1 
ATOM 119   O OG1   . THR A 1 58  ? 101.50600 81.42600  102.16500 1.000 41.77952  ? 58  THR A OG1   1 
ATOM 120   C CG2   . THR A 1 58  ? 100.28800 83.34300  101.48300 1.000 41.77952  ? 58  THR A CG2   1 
ATOM 121   N N     . HIS A 1 59  ? 104.50500 81.43400  100.23300 1.000 41.22923  ? 59  HIS A N     1 
ATOM 122   C CA    . HIS A 1 59  ? 105.82100 80.91900  100.58700 1.000 41.22923  ? 59  HIS A CA    1 
ATOM 123   C C     . HIS A 1 59  ? 106.93200 81.89400  100.20900 1.000 41.22923  ? 59  HIS A C     1 
ATOM 124   O O     . HIS A 1 59  ? 106.77100 82.76200  99.35000  1.000 41.22923  ? 59  HIS A O     1 
ATOM 125   C CB    . HIS A 1 59  ? 106.05800 79.55400  99.93500  1.000 41.22923  ? 59  HIS A CB    1 
ATOM 126   C CG    . HIS A 1 59  ? 105.96700 79.55700  98.43900  1.000 41.22923  ? 59  HIS A CG    1 
ATOM 127   N ND1   . HIS A 1 59  ? 104.95500 78.91500  97.76000  1.000 41.22923  ? 59  HIS A ND1   1 
ATOM 128   C CD2   . HIS A 1 59  ? 106.77600 80.08700  97.49100  1.000 41.22923  ? 59  HIS A CD2   1 
ATOM 129   C CE1   . HIS A 1 59  ? 105.13300 79.06600  96.46000  1.000 41.22923  ? 59  HIS A CE1   1 
ATOM 130   N NE2   . HIS A 1 59  ? 106.23000 79.77700  96.27000  1.000 41.22923  ? 59  HIS A NE2   1 
ATOM 131   N N     . LEU A 1 60  ? 108.05600 81.76500  100.90900 1.000 37.81016  ? 60  LEU A N     1 
ATOM 132   C CA    . LEU A 1 60  ? 109.23900 82.55800  100.60700 1.000 37.81016  ? 60  LEU A CA    1 
ATOM 133   C C     . LEU A 1 60  ? 109.80600 82.19600  99.24100  1.000 37.81016  ? 60  LEU A C     1 
ATOM 134   O O     . LEU A 1 60  ? 109.90500 81.02100  98.88000  1.000 37.81016  ? 60  LEU A O     1 
ATOM 135   C CB    . LEU A 1 60  ? 110.29900 82.35100  101.68200 1.000 37.81016  ? 60  LEU A CB    1 
ATOM 136   C CG    . LEU A 1 60  ? 109.90800 82.89000  103.05200 1.000 37.81016  ? 60  LEU A CG    1 
ATOM 137   C CD1   . LEU A 1 60  ? 110.92300 82.48600  104.10000 1.000 37.81016  ? 60  LEU A CD1   1 
ATOM 138   C CD2   . LEU A 1 60  ? 109.79900 84.39600  102.96500 1.000 37.81016  ? 60  LEU A CD2   1 
ATOM 139   N N     . LEU A 1 61  ? 110.20200 83.21900  98.48900  1.000 36.22666  ? 61  LEU A N     1 
ATOM 140   C CA    . LEU A 1 61  ? 110.66200 83.03400  97.12300  1.000 36.22666  ? 61  LEU A CA    1 
ATOM 141   C C     . LEU A 1 61  ? 112.16800 82.85500  97.03200  1.000 36.22666  ? 61  LEU A C     1 
ATOM 142   O O     . LEU A 1 61  ? 112.64100 82.09500  96.18200  1.000 36.22666  ? 61  LEU A O     1 
ATOM 143   C CB    . LEU A 1 61  ? 110.22500 84.22300  96.27000  1.000 36.22666  ? 61  LEU A CB    1 
ATOM 144   C CG    . LEU A 1 61  ? 108.70600 84.38400  96.21800  1.000 36.22666  ? 61  LEU A CG    1 
ATOM 145   C CD1   . LEU A 1 61  ? 108.32400 85.63800  95.47400  1.000 36.22666  ? 61  LEU A CD1   1 
ATOM 146   C CD2   . LEU A 1 61  ? 108.03700 83.16500  95.61300  1.000 36.22666  ? 61  LEU A CD2   1 
ATOM 147   N N     . ILE A 1 62  ? 112.92800 83.53100  97.88300  1.000 37.93238  ? 62  ILE A N     1 
ATOM 148   C CA    . ILE A 1 62  ? 114.36600 83.31800  97.96700  1.000 37.93238  ? 62  ILE A CA    1 
ATOM 149   C C     . ILE A 1 62  ? 114.60700 82.08400  98.82000  1.000 37.93238  ? 62  ILE A C     1 
ATOM 150   O O     . ILE A 1 62  ? 113.95700 81.89900  99.85400  1.000 37.93238  ? 62  ILE A O     1 
ATOM 151   C CB    . ILE A 1 62  ? 115.06000 84.55700  98.55700  1.000 37.93238  ? 62  ILE A CB    1 
ATOM 152   C CG1   . ILE A 1 62  ? 114.68700 85.80500  97.76100  1.000 37.93238  ? 62  ILE A CG1   1 
ATOM 153   C CG2   . ILE A 1 62  ? 116.55900 84.38900  98.56000  1.000 37.93238  ? 62  ILE A CG2   1 
ATOM 154   C CD1   . ILE A 1 62  ? 115.26000 87.08200  98.33600  1.000 37.93238  ? 62  ILE A CD1   1 
ATOM 155   N N     . ARG A 1 63  ? 115.51200 81.21600  98.37700  1.000 46.56771  ? 63  ARG A N     1 
ATOM 156   C CA    . ARG A 1 63  ? 115.77500 79.99500  99.12000  1.000 46.56771  ? 63  ARG A CA    1 
ATOM 157   C C     . ARG A 1 63  ? 116.49600 80.31000  100.42500 1.000 46.56771  ? 63  ARG A C     1 
ATOM 158   O O     . ARG A 1 63  ? 117.25900 81.27200  100.52300 1.000 46.56771  ? 63  ARG A O     1 
ATOM 159   C CB    . ARG A 1 63  ? 116.57500 79.00900  98.27300  1.000 46.56771  ? 63  ARG A CB    1 
ATOM 160   C CG    . ARG A 1 63  ? 115.82400 78.58900  97.02100  1.000 46.56771  ? 63  ARG A CG    1 
ATOM 161   C CD    . ARG A 1 63  ? 114.86000 77.44300  97.28000  1.000 46.56771  ? 63  ARG A CD    1 
ATOM 162   N NE    . ARG A 1 63  ? 115.41100 76.12900  96.97800  1.000 46.56771  ? 63  ARG A NE    1 
ATOM 163   C CZ    . ARG A 1 63  ? 114.74900 74.99200  97.16100  1.000 46.56771  ? 63  ARG A CZ    1 
ATOM 164   N NH1   . ARG A 1 63  ? 113.50900 75.01600  97.62700  1.000 46.56771  ? 63  ARG A NH1   1 
ATOM 165   N NH2   . ARG A 1 63  ? 115.31400 73.83100  96.86500  1.000 46.56771  ? 63  ARG A NH2   1 
ATOM 166   N N     . LYS A 1 64  ? 116.24200 79.47800  101.43600 1.000 44.29261  ? 64  LYS A N     1 
ATOM 167   C CA    . LYS A 1 64  ? 116.51300 79.85800  102.81800 1.000 44.29261  ? 64  LYS A CA    1 
ATOM 168   C C     . LYS A 1 64  ? 117.98700 79.76700  103.18800 1.000 44.29261  ? 64  LYS A C     1 
ATOM 169   O O     . LYS A 1 64  ? 118.47600 80.58200  103.98000 1.000 44.29261  ? 64  LYS A O     1 
ATOM 170   C CB    . LYS A 1 64  ? 115.69700 78.96400  103.74500 1.000 44.29261  ? 64  LYS A CB    1 
ATOM 171   C CG    . LYS A 1 64  ? 115.50800 79.47200  105.15100 1.000 44.29261  ? 64  LYS A CG    1 
ATOM 172   C CD    . LYS A 1 64  ? 114.61000 78.52200  105.92400 1.000 44.29261  ? 64  LYS A CD    1 
ATOM 173   C CE    . LYS A 1 64  ? 113.27300 78.33600  105.21900 1.000 44.29261  ? 64  LYS A CE    1 
ATOM 174   N NZ    . LYS A 1 64  ? 112.48800 77.20800  105.78600 1.000 44.29261  ? 64  LYS A NZ    1 
ATOM 175   N N     . LEU A 1 65  ? 118.71700 78.84600  102.58900 1.000 43.10197  ? 65  LEU A N     1 
ATOM 176   C CA    . LEU A 1 65  ? 120.12200 78.67200  102.93400 1.000 43.10197  ? 65  LEU A CA    1 
ATOM 177   C C     . LEU A 1 65  ? 121.04800 79.73200  102.32000 1.000 43.10197  ? 65  LEU A C     1 
ATOM 178   O O     . LEU A 1 65  ? 121.92500 80.22400  103.04600 1.000 43.10197  ? 65  LEU A O     1 
ATOM 179   C CB    . LEU A 1 65  ? 120.56900 77.25100  102.57800 1.000 43.10197  ? 65  LEU A CB    1 
ATOM 180   C CG    . LEU A 1 65  ? 122.01300 76.88500  102.89700 1.000 43.10197  ? 65  LEU A CG    1 
ATOM 181   C CD1   . LEU A 1 65  ? 122.23300 76.97400  104.38600 1.000 43.10197  ? 65  LEU A CD1   1 
ATOM 182   C CD2   . LEU A 1 65  ? 122.32000 75.48700  102.40100 1.000 43.10197  ? 65  LEU A CD2   1 
ATOM 183   N N     . PRO A 1 66  ? 120.94000 80.13500  101.03700 1.000 41.58835  ? 66  PRO A N     1 
ATOM 184   C CA    . PRO A 1 66  ? 121.81600 81.22700  100.58800 1.000 41.58835  ? 66  PRO A CA    1 
ATOM 185   C C     . PRO A 1 66  ? 121.42000 82.58300  101.13700 1.000 41.58835  ? 66  PRO A C     1 
ATOM 186   O O     . PRO A 1 66  ? 122.29400 83.44700  101.27500 1.000 41.58835  ? 66  PRO A O     1 
ATOM 187   C CB    . PRO A 1 66  ? 121.68200 81.18600  99.06300  1.000 41.58835  ? 66  PRO A CB    1 
ATOM 188   C CG    . PRO A 1 66  ? 120.36300 80.63800  98.83800  1.000 41.58835  ? 66  PRO A CG    1 
ATOM 189   C CD    . PRO A 1 66  ? 120.23300 79.57100  99.86800  1.000 41.58835  ? 66  PRO A CD    1 
ATOM 190   N N     . PHE A 1 67  ? 120.16900 82.76000  101.57200 1.000 36.10219  ? 67  PHE A N     1 
ATOM 191   C CA    . PHE A 1 67  ? 119.83200 83.96600  102.31600 1.000 36.10219  ? 67  PHE A CA    1 
ATOM 192   C C     . PHE A 1 67  ? 120.42400 83.92400  103.71200 1.000 36.10219  ? 67  PHE A C     1 
ATOM 193   O O     . PHE A 1 67  ? 120.82500 84.96800  104.23900 1.000 36.10219  ? 67  PHE A O     1 
ATOM 194   C CB    . PHE A 1 67  ? 118.32000 84.15500  102.40000 1.000 36.10219  ? 67  PHE A CB    1 
ATOM 195   C CG    . PHE A 1 67  ? 117.91200 85.49500  102.94600 1.000 36.10219  ? 67  PHE A CG    1 
ATOM 196   C CD1   . PHE A 1 67  ? 117.82400 86.59100  102.10900 1.000 36.10219  ? 67  PHE A CD1   1 
ATOM 197   C CD2   . PHE A 1 67  ? 117.62500 85.66300  104.29300 1.000 36.10219  ? 67  PHE A CD2   1 
ATOM 198   C CE1   . PHE A 1 67  ? 117.46000 87.82200  102.59900 1.000 36.10219  ? 67  PHE A CE1   1 
ATOM 199   C CE2   . PHE A 1 67  ? 117.26600 86.89200  104.78500 1.000 36.10219  ? 67  PHE A CE2   1 
ATOM 200   C CZ    . PHE A 1 67  ? 117.17900 87.97200  103.93500 1.000 36.10219  ? 67  PHE A CZ    1 
ATOM 201   N N     . SER A 1 68  ? 120.49700 82.73600  104.31800 1.000 37.40796  ? 68  SER A N     1 
ATOM 202   C CA    . SER A 1 68  ? 121.14700 82.62100  105.61700 1.000 37.40796  ? 68  SER A CA    1 
ATOM 203   C C     . SER A 1 68  ? 122.63500 82.92600  105.52100 1.000 37.40796  ? 68  SER A C     1 
ATOM 204   O O     . SER A 1 68  ? 123.17300 83.64700  106.36600 1.000 37.40796  ? 68  SER A O     1 
ATOM 205   C CB    . SER A 1 68  ? 120.91900 81.23000  106.20100 1.000 37.40796  ? 68  SER A CB    1 
ATOM 206   O OG    . SER A 1 68  ? 119.60500 81.11200  106.70900 1.000 37.40796  ? 68  SER A OG    1 
ATOM 207   N N     . ARG A 1 69  ? 123.30900 82.41800  104.48400 1.000 39.71008  ? 69  ARG A N     1 
ATOM 208   C CA    . ARG A 1 69  ? 124.73400 82.71900  104.33300 1.000 39.71008  ? 69  ARG A CA    1 
ATOM 209   C C     . ARG A 1 69  ? 124.97800 84.17300  103.95200 1.000 39.71008  ? 69  ARG A C     1 
ATOM 210   O O     . ARG A 1 69  ? 125.99600 84.74900  104.35100 1.000 39.71008  ? 69  ARG A O     1 
ATOM 211   C CB    . ARG A 1 69  ? 125.38100 81.81700  103.28900 1.000 39.71008  ? 69  ARG A CB    1 
ATOM 212   C CG    . ARG A 1 69  ? 125.44000 80.35900  103.65100 1.000 39.71008  ? 69  ARG A CG    1 
ATOM 213   C CD    . ARG A 1 69  ? 126.35600 79.64500  102.68200 1.000 39.71008  ? 69  ARG A CD    1 
ATOM 214   N NE    . ARG A 1 69  ? 125.95900 79.88300  101.30100 1.000 39.71008  ? 69  ARG A NE    1 
ATOM 215   C CZ    . ARG A 1 69  ? 125.19100 79.06400  100.59900 1.000 39.71008  ? 69  ARG A CZ    1 
ATOM 216   N NH1   . ARG A 1 69  ? 124.87600 79.36000  99.34900  1.000 39.71008  ? 69  ARG A NH1   1 
ATOM 217   N NH2   . ARG A 1 69  ? 124.74800 77.94200  101.14200 1.000 39.71008  ? 69  ARG A NH2   1 
ATOM 218   N N     . LEU A 1 70  ? 124.04600 84.79300  103.22300 1.000 37.77088  ? 70  LEU A N     1 
ATOM 219   C CA    . LEU A 1 70  ? 124.13500 86.22500  102.95700 1.000 37.77088  ? 70  LEU A CA    1 
ATOM 220   C C     . LEU A 1 70  ? 123.99600 87.04000  104.23700 1.000 37.77088  ? 70  LEU A C     1 
ATOM 221   O O     . LEU A 1 70  ? 124.73400 88.01100  104.44200 1.000 37.77088  ? 70  LEU A O     1 
ATOM 222   C CB    . LEU A 1 70  ? 123.07400 86.62700  101.93900 1.000 37.77088  ? 70  LEU A CB    1 
ATOM 223   C CG    . LEU A 1 70  ? 122.97300 88.11200  101.62500 1.000 37.77088  ? 70  LEU A CG    1 
ATOM 224   C CD1   . LEU A 1 70  ? 124.27300 88.59900  101.03600 1.000 37.77088  ? 70  LEU A CD1   1 
ATOM 225   C CD2   . LEU A 1 70  ? 121.83300 88.34400  100.66700 1.000 37.77088  ? 70  LEU A CD2   1 
ATOM 226   N N     . ALA A 1 71  ? 123.05600 86.66100  105.10600 1.000 36.38989  ? 71  ALA A N     1 
ATOM 227   C CA    . ALA A 1 71  ? 122.89200 87.36600  106.37200 1.000 36.38989  ? 71  ALA A CA    1 
ATOM 228   C C     . ALA A 1 71  ? 124.09300 87.16600  107.29500 1.000 36.38989  ? 71  ALA A C     1 
ATOM 229   O O     . ALA A 1 71  ? 124.48300 88.10000  107.99800 1.000 36.38989  ? 71  ALA A O     1 
ATOM 230   C CB    . ALA A 1 71  ? 121.60400 86.92500  107.05600 1.000 36.38989  ? 71  ALA A CB    1 
ATOM 231   N N     . ARG A 1 72  ? 124.69500 85.96700  107.30200 1.000 37.92527  ? 72  ARG A N     1 
ATOM 232   C CA    . ARG A 1 72  ? 125.94300 85.76000  108.04500 1.000 37.92527  ? 72  ARG A CA    1 
ATOM 233   C C     . ARG A 1 72  ? 127.06600 86.63800  107.50500 1.000 37.92527  ? 72  ARG A C     1 
ATOM 234   O O     . ARG A 1 72  ? 127.83100 87.23200  108.27800 1.000 37.92527  ? 72  ARG A O     1 
ATOM 235   C CB    . ARG A 1 72  ? 126.38800 84.29900  107.98300 1.000 37.92527  ? 72  ARG A CB    1 
ATOM 236   C CG    . ARG A 1 72  ? 125.45400 83.27600  108.57400 1.000 37.92527  ? 72  ARG A CG    1 
ATOM 237   C CD    . ARG A 1 72  ? 125.41000 83.26300  110.08500 1.000 37.92527  ? 72  ARG A CD    1 
ATOM 238   N NE    . ARG A 1 72  ? 124.92600 81.97500  110.57400 1.000 37.92527  ? 72  ARG A NE    1 
ATOM 239   C CZ    . ARG A 1 72  ? 123.64600 81.62400  110.62400 1.000 37.92527  ? 72  ARG A CZ    1 
ATOM 240   N NH1   . ARG A 1 72  ? 123.30400 80.43500  111.08700 1.000 37.92527  ? 72  ARG A NH1   1 
ATOM 241   N NH2   . ARG A 1 72  ? 122.70600 82.45900  110.22000 1.000 37.92527  ? 72  ARG A NH2   1 
ATOM 242   N N     . GLU A 1 73  ? 127.18300 86.71900  106.17500 1.000 40.25388  ? 73  GLU A N     1 
ATOM 243   C CA    . GLU A 1 73  ? 128.24400 87.49600  105.54300 1.000 40.25388  ? 73  GLU A CA    1 
ATOM 244   C C     . GLU A 1 73  ? 128.08600 88.98400  105.82200 1.000 40.25388  ? 73  GLU A C     1 
ATOM 245   O O     . GLU A 1 73  ? 129.07800 89.70000  105.98500 1.000 40.25388  ? 73  GLU A O     1 
ATOM 246   C CB    . GLU A 1 73  ? 128.23800 87.23500  104.03800 1.000 40.25388  ? 73  GLU A CB    1 
ATOM 247   C CG    . GLU A 1 73  ? 129.35200 87.91000  103.26700 1.000 40.25388  ? 73  GLU A CG    1 
ATOM 248   C CD    . GLU A 1 73  ? 128.94900 88.23600  101.84400 1.000 40.25388  ? 73  GLU A CD    1 
ATOM 249   O OE1   . GLU A 1 73  ? 128.12400 87.49300  101.27300 1.000 40.25388  ? 73  GLU A OE1   1 
ATOM 250   O OE2   . GLU A 1 73  ? 129.45000 89.24100  101.29700 1.000 40.25388  ? 73  GLU A OE2   1 
ATOM 251   N N     . ILE A 1 74  ? 126.85000 89.46800  105.88300 1.000 38.63486  ? 74  ILE A N     1 
ATOM 252   C CA    . ILE A 1 74  ? 126.65500 90.87500  106.20400 1.000 38.63486  ? 74  ILE A CA    1 
ATOM 253   C C     . ILE A 1 74  ? 126.81500 91.11600  107.70400 1.000 38.63486  ? 74  ILE A C     1 
ATOM 254   O O     . ILE A 1 74  ? 127.36700 92.14300  108.11800 1.000 38.63486  ? 74  ILE A O     1 
ATOM 255   C CB    . ILE A 1 74  ? 125.29100 91.32700  105.65900 1.000 38.63486  ? 74  ILE A CB    1 
ATOM 256   C CG1   . ILE A 1 74  ? 125.32900 91.26200  104.13200 1.000 38.63486  ? 74  ILE A CG1   1 
ATOM 257   C CG2   . ILE A 1 74  ? 124.93900 92.72700  106.10900 1.000 38.63486  ? 74  ILE A CG2   1 
ATOM 258   C CD1   . ILE A 1 74  ? 124.10600 91.78600  103.44600 1.000 38.63486  ? 74  ILE A CD1   1 
ATOM 259   N N     . CYS A 1 75  ? 126.41700 90.15100  108.53600 1.000 40.42340  ? 75  CYS A N     1 
ATOM 260   C CA    . CYS A 1 75  ? 126.46500 90.33100  109.98000 1.000 40.42340  ? 75  CYS A CA    1 
ATOM 261   C C     . CYS A 1 75  ? 127.88800 90.28500  110.51700 1.000 40.42340  ? 75  CYS A C     1 
ATOM 262   O O     . CYS A 1 75  ? 128.17500 90.90700  111.54300 1.000 40.42340  ? 75  CYS A O     1 
ATOM 263   C CB    . CYS A 1 75  ? 125.59400 89.26800  110.64700 1.000 40.42340  ? 75  CYS A CB    1 
ATOM 264   S SG    . CYS A 1 75  ? 125.50800 89.31800  112.43700 1.000 40.42340  ? 75  CYS A SG    1 
ATOM 265   N N     . VAL A 1 76  ? 128.79900 89.57600  109.84100 1.000 42.28510  ? 76  VAL A N     1 
ATOM 266   C CA    . VAL A 1 76  ? 130.16700 89.48400  110.35700 1.000 42.28510  ? 76  VAL A CA    1 
ATOM 267   C C     . VAL A 1 76  ? 130.95500 90.76900  110.12100 1.000 42.28510  ? 76  VAL A C     1 
ATOM 268   O O     . VAL A 1 76  ? 131.98900 90.98400  110.76500 1.000 42.28510  ? 76  VAL A O     1 
ATOM 269   C CB    . VAL A 1 76  ? 130.85000 88.24700  109.73300 1.000 42.28510  ? 76  VAL A CB    1 
ATOM 270   C CG1   . VAL A 1 76  ? 131.07700 88.43300  108.25200 1.000 42.28510  ? 76  VAL A CG1   1 
ATOM 271   C CG2   . VAL A 1 76  ? 132.12500 87.82000  110.46900 1.000 42.28510  ? 76  VAL A CG2   1 
ATOM 272   N N     . LYS A 1 77  ? 130.45800 91.67800  109.27800 1.000 43.92661  ? 77  LYS A N     1 
ATOM 273   C CA    . LYS A 1 77  ? 131.15500 92.94400  109.06800 1.000 43.92661  ? 77  LYS A CA    1 
ATOM 274   C C     . LYS A 1 77  ? 130.85500 93.95600  110.16600 1.000 43.92661  ? 77  LYS A C     1 
ATOM 275   O O     . LYS A 1 77  ? 131.74000 94.72000  110.56300 1.000 43.92661  ? 77  LYS A O     1 
ATOM 276   C CB    . LYS A 1 77  ? 130.76700 93.54100  107.71800 1.000 43.92661  ? 77  LYS A CB    1 
ATOM 277   C CG    . LYS A 1 77  ? 131.48300 92.94900  106.52700 1.000 43.92661  ? 77  LYS A CG    1 
ATOM 278   C CD    . LYS A 1 77  ? 131.11700 93.72000  105.27400 1.000 43.92661  ? 77  LYS A CD    1 
ATOM 279   C CE    . LYS A 1 77  ? 129.64900 93.53100  104.92900 1.000 43.92661  ? 77  LYS A CE    1 
ATOM 280   N NZ    . LYS A 1 77  ? 129.28300 94.23600  103.67400 1.000 43.92661  ? 77  LYS A NZ    1 
ATOM 281   N N     . PHE A 1 78  ? 129.62100 93.98600  110.66300 1.000 42.43134  ? 78  PHE A N     1 
ATOM 282   C CA    . PHE A 1 78  ? 129.24700 94.94700  111.69100 1.000 42.43134  ? 78  PHE A CA    1 
ATOM 283   C C     . PHE A 1 78  ? 129.61700 94.50200  113.09700 1.000 42.43134  ? 78  PHE A C     1 
ATOM 284   O O     . PHE A 1 78  ? 129.54900 95.31500  114.02300 1.000 42.43134  ? 78  PHE A O     1 
ATOM 285   C CB    . PHE A 1 78  ? 127.75100 95.24800  111.59700 1.000 42.43134  ? 78  PHE A CB    1 
ATOM 286   C CG    . PHE A 1 78  ? 127.35700 95.87100  110.29600 1.000 42.43134  ? 78  PHE A CG    1 
ATOM 287   C CD1   . PHE A 1 78  ? 126.65200 95.15100  109.35300 1.000 42.43134  ? 78  PHE A CD1   1 
ATOM 288   C CD2   . PHE A 1 78  ? 127.73600 97.16800  109.99700 1.000 42.43134  ? 78  PHE A CD2   1 
ATOM 289   C CE1   . PHE A 1 78  ? 126.30800 95.72400  108.14000 1.000 42.43134  ? 78  PHE A CE1   1 
ATOM 290   C CE2   . PHE A 1 78  ? 127.39800 97.74700  108.79200 1.000 42.43134  ? 78  PHE A CE2   1 
ATOM 291   C CZ    . PHE A 1 78  ? 126.68300 97.02400  107.86200 1.000 42.43134  ? 78  PHE A CZ    1 
ATOM 292   N N     . THR A 1 79  ? 130.00400 93.24600  113.28100 1.000 44.04758  ? 79  THR A N     1 
ATOM 293   C CA    . THR A 1 79  ? 130.41700 92.73800  114.58000 1.000 44.04758  ? 79  THR A CA    1 
ATOM 294   C C     . THR A 1 79  ? 131.92200 92.80900  114.78300 1.000 44.04758  ? 79  THR A C     1 
ATOM 295   O O     . THR A 1 79  ? 132.42900 92.15700  115.69600 1.000 44.04758  ? 79  THR A O     1 
ATOM 296   C CB    . THR A 1 79  ? 129.93900 91.30100  114.77100 1.000 44.04758  ? 79  THR A CB    1 
ATOM 297   O OG1   . THR A 1 79  ? 130.42100 90.48700  113.69700 1.000 44.04758  ? 79  THR A OG1   1 
ATOM 298   C CG2   . THR A 1 79  ? 128.43800 91.24900  114.80300 1.000 44.04758  ? 79  THR A CG2   1 
ATOM 299   N N     . ARG A 1 80  ? 132.63300 93.50200  113.88500 1.000 46.55546  ? 80  ARG A N     1 
ATOM 300   C CA    . ARG A 1 80  ? 134.09100 93.72200  113.90700 1.000 46.55546  ? 80  ARG A CA    1 
ATOM 301   C C     . ARG A 1 80  ? 134.87500 92.40200  113.88400 1.000 46.55546  ? 80  ARG A C     1 
ATOM 302   O O     . ARG A 1 80  ? 135.95500 92.27100  114.46300 1.000 46.55546  ? 80  ARG A O     1 
ATOM 303   C CB    . ARG A 1 80  ? 134.52600 94.68600  115.03900 1.000 46.55546  ? 80  ARG A CB    1 
ATOM 304   C CG    . ARG A 1 80  ? 134.61100 94.25500  116.51700 1.000 46.55546  ? 80  ARG A CG    1 
ATOM 305   C CD    . ARG A 1 80  ? 134.27500 95.40900  117.44900 1.000 46.55546  ? 80  ARG A CD    1 
ATOM 306   N NE    . ARG A 1 80  ? 132.93400 95.94200  117.22400 1.000 46.55546  ? 80  ARG A NE    1 
ATOM 307   C CZ    . ARG A 1 80  ? 131.83600 95.50700  117.83500 1.000 46.55546  ? 80  ARG A CZ    1 
ATOM 308   N NH1   . ARG A 1 80  ? 130.66400 96.06300  117.56300 1.000 46.55546  ? 80  ARG A NH1   1 
ATOM 309   N NH2   . ARG A 1 80  ? 131.90600 94.52000  118.71800 1.000 46.55546  ? 80  ARG A NH2   1 
ATOM 310   N N     . GLY A 1 81  ? 134.36700 91.44400  113.11000 1.000 47.10716  ? 81  GLY A N     1 
ATOM 311   C CA    . GLY A 1 81  ? 135.02900 90.18400  112.86600 1.000 47.10716  ? 81  GLY A CA    1 
ATOM 312   C C     . GLY A 1 81  ? 134.61300 89.02800  113.75500 1.000 47.10716  ? 81  GLY A C     1 
ATOM 313   O O     . GLY A 1 81  ? 134.87600 87.87600  113.39300 1.000 47.10716  ? 81  GLY A O     1 
ATOM 314   N N     . VAL A 1 82  ? 133.97200 89.28200  114.89000 1.000 47.12712  ? 82  VAL A N     1 
ATOM 315   C CA    . VAL A 1 82  ? 133.45700 88.17600  115.68900 1.000 47.12712  ? 82  VAL A CA    1 
ATOM 316   C C     . VAL A 1 82  ? 132.17100 87.67500  115.04300 1.000 47.12712  ? 82  VAL A C     1 
ATOM 317   O O     . VAL A 1 82  ? 131.47000 88.41600  114.34600 1.000 47.12712  ? 82  VAL A O     1 
ATOM 318   C CB    . VAL A 1 82  ? 133.25700 88.58200  117.16900 1.000 47.12712  ? 82  VAL A CB    1 
ATOM 319   C CG1   . VAL A 1 82  ? 131.99300 89.39700  117.38100 1.000 47.12712  ? 82  VAL A CG1   1 
ATOM 320   C CG2   . VAL A 1 82  ? 133.27700 87.36200  118.08100 1.000 47.12712  ? 82  VAL A CG2   1 
ATOM 321   N N     . ASP A 1 83  ? 131.89400 86.38800  115.19700 1.000 45.93190  ? 83  ASP A N     1 
ATOM 322   C CA    . ASP A 1 83  ? 130.70700 85.79200  114.60700 1.000 45.93190  ? 83  ASP A CA    1 
ATOM 323   C C     . ASP A 1 83  ? 129.60100 85.69300  115.64400 1.000 45.93190  ? 83  ASP A C     1 
ATOM 324   O O     . ASP A 1 83  ? 129.84500 85.32900  116.79700 1.000 45.93190  ? 83  ASP A O     1 
ATOM 325   C CB    . ASP A 1 83  ? 131.01200 84.40600  114.03600 1.000 45.93190  ? 83  ASP A CB    1 
ATOM 326   C CG    . ASP A 1 83  ? 131.88700 84.46500  112.80000 1.000 45.93190  ? 83  ASP A CG    1 
ATOM 327   O OD1   . ASP A 1 83  ? 131.33100 84.50400  111.68400 1.000 45.93190  ? 83  ASP A OD1   1 
ATOM 328   O OD2   . ASP A 1 83  ? 133.12800 84.46800  112.94300 1.000 45.93190  ? 83  ASP A OD2   1 
ATOM 329   N N     . PHE A 1 84  ? 128.38900 86.03300  115.23000 1.000 43.12153  ? 84  PHE A N     1 
ATOM 330   C CA    . PHE A 1 84  ? 127.21800 85.95900  116.08500 1.000 43.12153  ? 84  PHE A CA    1 
ATOM 331   C C     . PHE A 1 84  ? 126.37900 84.74800  115.70300 1.000 43.12153  ? 84  PHE A C     1 
ATOM 332   O O     . PHE A 1 84  ? 126.45400 84.23900  114.58500 1.000 43.12153  ? 84  PHE A O     1 
ATOM 333   C CB    . PHE A 1 84  ? 126.36300 87.22500  115.98400 1.000 43.12153  ? 84  PHE A CB    1 
ATOM 334   C CG    . PHE A 1 84  ? 126.79100 88.33300  116.90600 1.000 43.12153  ? 84  PHE A CG    1 
ATOM 335   C CD1   . PHE A 1 84  ? 127.84800 88.16500  117.78400 1.000 43.12153  ? 84  PHE A CD1   1 
ATOM 336   C CD2   . PHE A 1 84  ? 126.09100 89.52500  116.93000 1.000 43.12153  ? 84  PHE A CD2   1 
ATOM 337   C CE1   . PHE A 1 84  ? 128.22600 89.18600  118.63600 1.000 43.12153  ? 84  PHE A CE1   1 
ATOM 338   C CE2   . PHE A 1 84  ? 126.46100 90.54200  117.77900 1.000 43.12153  ? 84  PHE A CE2   1 
ATOM 339   C CZ    . PHE A 1 84  ? 127.52800 90.37200  118.63500 1.000 43.12153  ? 84  PHE A CZ    1 
ATOM 340   N N     . ASN A 1 85  ? 125.58100 84.28700  116.65500 1.000 42.04114  ? 85  ASN A N     1 
ATOM 341   C CA    . ASN A 1 85  ? 124.60100 83.25200  116.38500 1.000 42.04114  ? 85  ASN A CA    1 
ATOM 342   C C     . ASN A 1 85  ? 123.28600 83.90400  115.99400 1.000 42.04114  ? 85  ASN A C     1 
ATOM 343   O O     . ASN A 1 85  ? 122.99200 85.03200  116.38800 1.000 42.04114  ? 85  ASN A O     1 
ATOM 344   C CB    . ASN A 1 85  ? 124.39900 82.35500  117.60400 1.000 42.04114  ? 85  ASN A CB    1 
ATOM 345   C CG    . ASN A 1 85  ? 125.65200 81.61300  117.99200 1.000 42.04114  ? 85  ASN A CG    1 
ATOM 346   O OD1   . ASN A 1 85  ? 126.75200 81.97100  117.57900 1.000 42.04114  ? 85  ASN A OD1   1 
ATOM 347   N ND2   . ASN A 1 85  ? 125.49500 80.57000  118.79400 1.000 42.04114  ? 85  ASN A ND2   1 
ATOM 348   N N     . TRP A 1 86  ? 122.50600 83.20100  115.19000 1.000 39.00186  ? 86  TRP A N     1 
ATOM 349   C CA    . TRP A 1 86  ? 121.20500 83.68800  114.76700 1.000 39.00186  ? 86  TRP A CA    1 
ATOM 350   C C     . TRP A 1 86  ? 120.14300 82.69100  115.18500 1.000 39.00186  ? 86  TRP A C     1 
ATOM 351   O O     . TRP A 1 86  ? 120.31900 81.48600  115.00800 1.000 39.00186  ? 86  TRP A O     1 
ATOM 352   C CB    . TRP A 1 86  ? 121.14500 83.88700  113.25400 1.000 39.00186  ? 86  TRP A CB    1 
ATOM 353   C CG    . TRP A 1 86  ? 121.87400 85.09000  112.75500 1.000 39.00186  ? 86  TRP A CG    1 
ATOM 354   C CD1   . TRP A 1 86  ? 123.22000 85.23900  112.64000 1.000 39.00186  ? 86  TRP A CD1   1 
ATOM 355   C CD2   . TRP A 1 86  ? 121.29400 86.31000  112.29300 1.000 39.00186  ? 86  TRP A CD2   1 
ATOM 356   N NE1   . TRP A 1 86  ? 123.51700 86.47700  112.13700 1.000 39.00186  ? 86  TRP A NE1   1 
ATOM 357   C CE2   . TRP A 1 86  ? 122.34900 87.15400  111.91500 1.000 39.00186  ? 86  TRP A CE2   1 
ATOM 358   C CE3   . TRP A 1 86  ? 119.98300 86.77000  112.16200 1.000 39.00186  ? 86  TRP A CE3   1 
ATOM 359   C CZ2   . TRP A 1 86  ? 122.13600 88.43100  111.41600 1.000 39.00186  ? 86  TRP A CZ2   1 
ATOM 360   C CZ3   . TRP A 1 86  ? 119.77400 88.03600  111.66600 1.000 39.00186  ? 86  TRP A CZ3   1 
ATOM 361   C CH2   . TRP A 1 86  ? 120.84300 88.85300  111.30100 1.000 39.00186  ? 86  TRP A CH2   1 
ATOM 362   N N     . GLN A 1 87  ? 119.04500 83.19100  115.74100 1.000 40.06139  ? 87  GLN A N     1 
ATOM 363   C CA    . GLN A 1 87  ? 117.90600 82.32900  115.99800 1.000 40.06139  ? 87  GLN A CA    1 
ATOM 364   C C     . GLN A 1 87  ? 117.28200 81.88500  114.68000 1.000 40.06139  ? 87  GLN A C     1 
ATOM 365   O O     . GLN A 1 87  ? 117.44300 82.52800  113.64200 1.000 40.06139  ? 87  GLN A O     1 
ATOM 366   C CB    . GLN A 1 87  ? 116.87400 83.04300  116.86100 1.000 40.06139  ? 87  GLN A CB    1 
ATOM 367   C CG    . GLN A 1 87  ? 117.24800 83.12000  118.32100 1.000 40.06139  ? 87  GLN A CG    1 
ATOM 368   C CD    . GLN A 1 87  ? 116.03700 83.20000  119.21800 1.000 40.06139  ? 87  GLN A CD    1 
ATOM 369   O OE1   . GLN A 1 87  ? 114.91000 83.33400  118.74700 1.000 40.06139  ? 87  GLN A OE1   1 
ATOM 370   N NE2   . GLN A 1 87  ? 116.26300 83.13300  120.52200 1.000 40.06139  ? 87  GLN A NE2   1 
ATOM 371   N N     . ALA A 1 88  ? 116.57300 80.75600  114.72900 1.000 39.73662  ? 88  ALA A N     1 
ATOM 372   C CA    . ALA A 1 88  ? 115.95800 80.22600  113.51800 1.000 39.73662  ? 88  ALA A CA    1 
ATOM 373   C C     . ALA A 1 88  ? 114.81300 81.10200  113.03600 1.000 39.73662  ? 88  ALA A C     1 
ATOM 374   O O     . ALA A 1 88  ? 114.58000 81.19700  111.82800 1.000 39.73662  ? 88  ALA A O     1 
ATOM 375   C CB    . ALA A 1 88  ? 115.46600 78.80100  113.75400 1.000 39.73662  ? 88  ALA A CB    1 
ATOM 376   N N     . GLN A 1 89  ? 114.10100 81.75500  113.95200 1.000 37.35796  ? 89  GLN A N     1 
ATOM 377   C CA    . GLN A 1 89  ? 113.05200 82.67900  113.55500 1.000 37.35796  ? 89  GLN A CA    1 
ATOM 378   C C     . GLN A 1 89  ? 113.58500 84.05600  113.19800 1.000 37.35796  ? 89  GLN A C     1 
ATOM 379   O O     . GLN A 1 89  ? 112.87200 84.82300  112.54800 1.000 37.35796  ? 89  GLN A O     1 
ATOM 380   C CB    . GLN A 1 89  ? 112.02400 82.81700  114.67400 1.000 37.35796  ? 89  GLN A CB    1 
ATOM 381   C CG    . GLN A 1 89  ? 111.10400 81.62700  114.84900 1.000 37.35796  ? 89  GLN A CG    1 
ATOM 382   C CD    . GLN A 1 89  ? 110.10200 81.48800  113.72600 1.000 37.35796  ? 89  GLN A CD    1 
ATOM 383   O OE1   . GLN A 1 89  ? 109.09700 82.19500  113.68800 1.000 37.35796  ? 89  GLN A OE1   1 
ATOM 384   N NE2   . GLN A 1 89  ? 110.35600 80.55800  112.81600 1.000 37.35796  ? 89  GLN A NE2   1 
ATOM 385   N N     . ALA A 1 90  ? 114.83600 84.36300  113.54700 1.000 36.45461  ? 90  ALA A N     1 
ATOM 386   C CA    . ALA A 1 90  ? 115.41700 85.65100  113.18400 1.000 36.45461  ? 90  ALA A CA    1 
ATOM 387   C C     . ALA A 1 90  ? 115.68000 85.74000  111.69000 1.000 36.45461  ? 90  ALA A C     1 
ATOM 388   O O     . ALA A 1 90  ? 115.35600 86.75100  111.05500 1.000 36.45461  ? 90  ALA A O     1 
ATOM 389   C CB    . ALA A 1 90  ? 116.70900 85.87600  113.95900 1.000 36.45461  ? 90  ALA A CB    1 
ATOM 390   N N     . LEU A 1 91  ? 116.25000 84.68300  111.11200 1.000 34.91823  ? 91  LEU A N     1 
ATOM 391   C CA    . LEU A 1 91  ? 116.47500 84.64700  109.67500 1.000 34.91823  ? 91  LEU A CA    1 
ATOM 392   C C     . LEU A 1 91  ? 115.17000 84.59000  108.90200 1.000 34.91823  ? 91  LEU A C     1 
ATOM 393   O O     . LEU A 1 91  ? 115.07200 85.17500  107.82100 1.000 34.91823  ? 91  LEU A O     1 
ATOM 394   C CB    . LEU A 1 91  ? 117.35600 83.46000  109.32100 1.000 34.91823  ? 91  LEU A CB    1 
ATOM 395   C CG    . LEU A 1 91  ? 118.74800 83.59500  109.91200 1.000 34.91823  ? 91  LEU A CG    1 
ATOM 396   C CD1   . LEU A 1 91  ? 119.34000 82.22700  110.08800 1.000 34.91823  ? 91  LEU A CD1   1 
ATOM 397   C CD2   . LEU A 1 91  ? 119.60000 84.44500  109.00100 1.000 34.91823  ? 91  LEU A CD2   1 
ATOM 398   N N     . LEU A 1 92  ? 114.15000 83.93200  109.44900 1.000 35.62204  ? 92  LEU A N     1 
ATOM 399   C CA    . LEU A 1 92  ? 112.86200 83.90100  108.76900 1.000 35.62204  ? 92  LEU A CA    1 
ATOM 400   C C     . LEU A 1 92  ? 112.16500 85.25300  108.83500 1.000 35.62204  ? 92  LEU A C     1 
ATOM 401   O O     . LEU A 1 92  ? 111.53300 85.66600  107.86000 1.000 35.62204  ? 92  LEU A O     1 
ATOM 402   C CB    . LEU A 1 92  ? 111.98400 82.80200  109.35800 1.000 35.62204  ? 92  LEU A CB    1 
ATOM 403   C CG    . LEU A 1 92  ? 112.55500 81.41400  109.08200 1.000 35.62204  ? 92  LEU A CG    1 
ATOM 404   C CD1   . LEU A 1 92  ? 111.72300 80.34200  109.73800 1.000 35.62204  ? 92  LEU A CD1   1 
ATOM 405   C CD2   . LEU A 1 92  ? 112.62600 81.18200  107.59600 1.000 35.62204  ? 92  LEU A CD2   1 
ATOM 406   N N     . ALA A 1 93  ? 112.31700 85.98300  109.94600 1.000 34.37914  ? 93  ALA A N     1 
ATOM 407   C CA    . ALA A 1 93  ? 111.76300 87.33100  110.03400 1.000 34.37914  ? 93  ALA A CA    1 
ATOM 408   C C     . ALA A 1 93  ? 112.47100 88.28000  109.08100 1.000 34.37914  ? 93  ALA A C     1 
ATOM 409   O O     . ALA A 1 93  ? 111.82400 89.09000  108.40100 1.000 34.37914  ? 93  ALA A O     1 
ATOM 410   C CB    . ALA A 1 93  ? 111.86700 87.84400  111.46600 1.000 34.37914  ? 93  ALA A CB    1 
ATOM 411   N N     . LEU A 1 94  ? 113.79500 88.15800  108.99300 1.000 32.07974  ? 94  LEU A N     1 
ATOM 412   C CA    . LEU A 1 94  ? 114.56900 88.96500  108.06100 1.000 32.07974  ? 94  LEU A CA    1 
ATOM 413   C C     . LEU A 1 94  ? 114.21200 88.63200  106.61700 1.000 32.07974  ? 94  LEU A C     1 
ATOM 414   O O     . LEU A 1 94  ? 114.14500 89.52800  105.76900 1.000 32.07974  ? 94  LEU A O     1 
ATOM 415   C CB    . LEU A 1 94  ? 116.05600 88.74700  108.31900 1.000 32.07974  ? 94  LEU A CB    1 
ATOM 416   C CG    . LEU A 1 94  ? 117.01900 89.61100  107.52200 1.000 32.07974  ? 94  LEU A CG    1 
ATOM 417   C CD1   . LEU A 1 94  ? 116.89700 91.03100  107.99800 1.000 32.07974  ? 94  LEU A CD1   1 
ATOM 418   C CD2   . LEU A 1 94  ? 118.43400 89.12100  107.67300 1.000 32.07974  ? 94  LEU A CD2   1 
ATOM 419   N N     . GLN A 1 95  ? 113.94400 87.35700  106.32600 1.000 35.43419  ? 95  GLN A N     1 
ATOM 420   C CA    . GLN A 1 95  ? 113.62700 86.96500  104.96000 1.000 35.43419  ? 95  GLN A CA    1 
ATOM 421   C C     . GLN A 1 95  ? 112.23200 87.41800  104.55600 1.000 35.43419  ? 95  GLN A C     1 
ATOM 422   O O     . GLN A 1 95  ? 112.02600 87.83100  103.40900 1.000 35.43419  ? 95  GLN A O     1 
ATOM 423   C CB    . GLN A 1 95  ? 113.76400 85.45500  104.80500 1.000 35.43419  ? 95  GLN A CB    1 
ATOM 424   C CG    . GLN A 1 95  ? 113.76400 84.98500  103.37100 1.000 35.43419  ? 95  GLN A CG    1 
ATOM 425   C CD    . GLN A 1 95  ? 114.20400 83.55300  103.24900 1.000 35.43419  ? 95  GLN A CD    1 
ATOM 426   O OE1   . GLN A 1 95  ? 114.91400 83.03800  104.10600 1.000 35.43419  ? 95  GLN A OE1   1 
ATOM 427   N NE2   . GLN A 1 95  ? 113.78800 82.89900  102.18100 1.000 35.43419  ? 95  GLN A NE2   1 
ATOM 428   N N     . GLU A 1 96  ? 111.26900 87.36400  105.48600 1.000 35.25012  ? 96  GLU A N     1 
ATOM 429   C CA    . GLU A 1 96  ? 109.94400 87.91900  105.21600 1.000 35.25012  ? 96  GLU A CA    1 
ATOM 430   C C     . GLU A 1 96  ? 110.01500 89.41600  104.96000 1.000 35.25012  ? 96  GLU A C     1 
ATOM 431   O O     . GLU A 1 96  ? 109.39500 89.91500  104.01100 1.000 35.25012  ? 96  GLU A O     1 
ATOM 432   C CB    . GLU A 1 96  ? 108.98000 87.64300  106.37300 1.000 35.25012  ? 96  GLU A CB    1 
ATOM 433   C CG    . GLU A 1 96  ? 108.62500 86.18600  106.63600 1.000 35.25012  ? 96  GLU A CG    1 
ATOM 434   C CD    . GLU A 1 96  ? 107.73700 85.55400  105.58100 1.000 35.25012  ? 96  GLU A CD    1 
ATOM 435   O OE1   . GLU A 1 96  ? 107.60800 84.31200  105.59900 1.000 35.25012  ? 96  GLU A OE1   1 
ATOM 436   O OE2   . GLU A 1 96  ? 107.14800 86.28200  104.75300 1.000 35.25012  ? 96  GLU A OE2   1 
ATOM 437   N N     . ALA A 1 97  ? 110.78400 90.14300  105.78000 1.000 33.28510  ? 97  ALA A N     1 
ATOM 438   C CA    . ALA A 1 97  ? 110.90700 91.58700  105.59500 1.000 33.28510  ? 97  ALA A CA    1 
ATOM 439   C C     . ALA A 1 97  ? 111.59900 91.93400  104.28400 1.000 33.28510  ? 97  ALA A C     1 
ATOM 440   O O     . ALA A 1 97  ? 111.15300 92.83800  103.56700 1.000 33.28510  ? 97  ALA A O     1 
ATOM 441   C CB    . ALA A 1 97  ? 111.66300 92.20100  106.76300 1.000 33.28510  ? 97  ALA A CB    1 
ATOM 442   N N     . ALA A 1 98  ? 112.66100 91.20100  103.93600 1.000 32.70803  ? 98  ALA A N     1 
ATOM 443   C CA    . ALA A 1 98  ? 113.40500 91.49200  102.71700 1.000 32.70803  ? 98  ALA A CA    1 
ATOM 444   C C     . ALA A 1 98  ? 112.59300 91.16600  101.47600 1.000 32.70803  ? 98  ALA A C     1 
ATOM 445   O O     . ALA A 1 98  ? 112.59400 91.93800  100.51300 1.000 32.70803  ? 98  ALA A O     1 
ATOM 446   C CB    . ALA A 1 98  ? 114.72400 90.72700  102.71000 1.000 32.70803  ? 98  ALA A CB    1 
ATOM 447   N N     . GLU A 1 99  ? 111.85100 90.05800  101.49600 1.000 34.71748  ? 99  GLU A N     1 
ATOM 448   C CA    . GLU A 1 99  ? 111.04800 89.70400  100.33600 1.000 34.71748  ? 99  GLU A CA    1 
ATOM 449   C C     . GLU A 1 99  ? 109.83000 90.60500  100.18500 1.000 34.71748  ? 99  GLU A C     1 
ATOM 450   O O     . GLU A 1 99  ? 109.44200 90.92100  99.05600  1.000 34.71748  ? 99  GLU A O     1 
ATOM 451   C CB    . GLU A 1 99  ? 110.62300 88.24900  100.43500 1.000 34.71748  ? 99  GLU A CB    1 
ATOM 452   C CG    . GLU A 1 99  ? 111.70200 87.28700  100.02200 1.000 34.71748  ? 99  GLU A CG    1 
ATOM 453   C CD    . GLU A 1 99  ? 111.17600 85.88700  99.89200  1.000 34.71748  ? 99  GLU A CD    1 
ATOM 454   O OE1   . GLU A 1 99  ? 109.94400 85.73100  99.78000  1.000 34.71748  ? 99  GLU A OE1   1 
ATOM 455   O OE2   . GLU A 1 99  ? 111.98300 84.93700  99.89600  1.000 34.71748  ? 99  GLU A OE2   1 
ATOM 456   N N     . ALA A 1 100 ? 109.22800 91.05200  101.29100 1.000 32.25397  ? 100 ALA A N     1 
ATOM 457   C CA    . ALA A 1 100 ? 108.11300 91.98600  101.18000 1.000 32.25397  ? 100 ALA A CA    1 
ATOM 458   C C     . ALA A 1 100 ? 108.57600 93.35300  100.69900 1.000 32.25397  ? 100 ALA A C     1 
ATOM 459   O O     . ALA A 1 100 ? 107.89400 93.99200  99.88600  1.000 32.25397  ? 100 ALA A O     1 
ATOM 460   C CB    . ALA A 1 100 ? 107.39400 92.10700  102.51700 1.000 32.25397  ? 100 ALA A CB    1 
ATOM 461   N N     . PHE A 1 101 ? 109.74300 93.80500  101.16800 1.000 31.92538  ? 101 PHE A N     1 
ATOM 462   C CA    . PHE A 1 101 ? 110.32900 95.03600  100.64900 1.000 31.92538  ? 101 PHE A CA    1 
ATOM 463   C C     . PHE A 1 101 ? 110.65600 94.91200  99.17000  1.000 31.92538  ? 101 PHE A C     1 
ATOM 464   O O     . PHE A 1 101 ? 110.45000 95.86000  98.40400  1.000 31.92538  ? 101 PHE A O     1 
ATOM 465   C CB    . PHE A 1 101 ? 111.57800 95.39600  101.45000 1.000 31.92538  ? 101 PHE A CB    1 
ATOM 466   C CG    . PHE A 1 101 ? 112.36700 96.53200  100.87200 1.000 31.92538  ? 101 PHE A CG    1 
ATOM 467   C CD1   . PHE A 1 101 ? 111.93500 97.83600  101.02800 1.000 31.92538  ? 101 PHE A CD1   1 
ATOM 468   C CD2   . PHE A 1 101 ? 113.56000 96.30200  100.20500 1.000 31.92538  ? 101 PHE A CD2   1 
ATOM 469   C CE1   . PHE A 1 101 ? 112.66100 98.88600  100.50500 1.000 31.92538  ? 101 PHE A CE1   1 
ATOM 470   C CE2   . PHE A 1 101 ? 114.28800 97.34800  99.68300  1.000 31.92538  ? 101 PHE A CE2   1 
ATOM 471   C CZ    . PHE A 1 101 ? 113.84000 98.63900  99.83500  1.000 31.92538  ? 101 PHE A CZ    1 
ATOM 472   N N     . LEU A 1 102 ? 111.13800 93.74400  98.74300  1.000 31.16071  ? 102 LEU A N     1 
ATOM 473   C CA    . LEU A 1 102 ? 111.49600 93.57300  97.34200  1.000 31.16071  ? 102 LEU A CA    1 
ATOM 474   C C     . LEU A 1 102 ? 110.26700 93.52000  96.44300  1.000 31.16071  ? 102 LEU A C     1 
ATOM 475   O O     . LEU A 1 102 ? 110.27800 94.10100  95.35400  1.000 31.16071  ? 102 LEU A O     1 
ATOM 476   C CB    . LEU A 1 102 ? 112.35700 92.32700  97.17800  1.000 31.16071  ? 102 LEU A CB    1 
ATOM 477   C CG    . LEU A 1 102 ? 113.84000 92.63600  97.37800  1.000 31.16071  ? 102 LEU A CG    1 
ATOM 478   C CD1   . LEU A 1 102 ? 114.69300 91.40000  97.22700  1.000 31.16071  ? 102 LEU A CD1   1 
ATOM 479   C CD2   . LEU A 1 102 ? 114.29200 93.72500  96.42500  1.000 31.16071  ? 102 LEU A CD2   1 
ATOM 480   N N     . VAL A 1 103 ? 109.17900 92.89100  96.89100  1.000 32.27194  ? 103 VAL A N     1 
ATOM 481   C CA    . VAL A 1 103 ? 107.99700 92.87900  96.03000  1.000 32.27194  ? 103 VAL A CA    1 
ATOM 482   C C     . VAL A 1 103 ? 107.29000 94.23600  96.03100  1.000 32.27194  ? 103 VAL A C     1 
ATOM 483   O O     . VAL A 1 103 ? 106.70400 94.62700  95.01100  1.000 32.27194  ? 103 VAL A O     1 
ATOM 484   C CB    . VAL A 1 103 ? 107.03000 91.73300  96.39100  1.000 32.27194  ? 103 VAL A CB    1 
ATOM 485   C CG1   . VAL A 1 103 ? 107.72000 90.40000  96.26200  1.000 32.27194  ? 103 VAL A CG1   1 
ATOM 486   C CG2   . VAL A 1 103 ? 106.45600 91.88700  97.77500  1.000 32.27194  ? 103 VAL A CG2   1 
ATOM 487   N N     . HIS A 1 104 ? 107.37800 95.01000  97.12100  1.000 32.97632  ? 104 HIS A N     1 
ATOM 488   C CA    . HIS A 1 104 ? 106.77500 96.33900  97.09800  1.000 32.97632  ? 104 HIS A CA    1 
ATOM 489   C C     . HIS A 1 104 ? 107.59200 97.30300  96.24600  1.000 32.97632  ? 104 HIS A C     1 
ATOM 490   O O     . HIS A 1 104 ? 107.02700 98.12700  95.51100  1.000 32.97632  ? 104 HIS A O     1 
ATOM 491   C CB    . HIS A 1 104 ? 106.61200 96.87000  98.51700  1.000 32.97632  ? 104 HIS A CB    1 
ATOM 492   C CG    . HIS A 1 104 ? 105.45100 96.27600  99.25100  1.000 32.97632  ? 104 HIS A CG    1 
ATOM 493   N ND1   . HIS A 1 104 ? 105.30600 94.91900  99.44100  1.000 32.97632  ? 104 HIS A ND1   1 
ATOM 494   C CD2   . HIS A 1 104 ? 104.37900 96.85400  99.84200  1.000 32.97632  ? 104 HIS A CD2   1 
ATOM 495   C CE1   . HIS A 1 104 ? 104.19600 94.68600  100.11600 1.000 32.97632  ? 104 HIS A CE1   1 
ATOM 496   N NE2   . HIS A 1 104 ? 103.61500 95.84300  100.37200 1.000 32.97632  ? 104 HIS A NE2   1 
ATOM 497   N N     . LEU A 1 105 ? 108.92200 97.19000  96.29700  1.000 30.75126  ? 105 LEU A N     1 
ATOM 498   C CA    . LEU A 1 105 ? 109.75900 97.98000  95.40500  1.000 30.75126  ? 105 LEU A CA    1 
ATOM 499   C C     . LEU A 1 105 ? 109.56900 97.57100  93.95400  1.000 30.75126  ? 105 LEU A C     1 
ATOM 500   O O     . LEU A 1 105 ? 109.62400 98.42500  93.06500  1.000 30.75126  ? 105 LEU A O     1 
ATOM 501   C CB    . LEU A 1 105 ? 111.22400 97.85800  95.80800  1.000 30.75126  ? 105 LEU A CB    1 
ATOM 502   C CG    . LEU A 1 105 ? 112.23500 98.69500  95.02500  1.000 30.75126  ? 105 LEU A CG    1 
ATOM 503   C CD1   . LEU A 1 105 ? 111.82300 100.14500 94.98600  1.000 30.75126  ? 105 LEU A CD1   1 
ATOM 504   C CD2   . LEU A 1 105 ? 113.57300 98.57600  95.66300  1.000 30.75126  ? 105 LEU A CD2   1 
ATOM 505   N N     . PHE A 1 106 ? 109.28700 96.29500  93.69100  1.000 31.50960  ? 106 PHE A N     1 
ATOM 506   C CA    . PHE A 1 106 ? 109.08400 95.89600  92.30600  1.000 31.50960  ? 106 PHE A CA    1 
ATOM 507   C C     . PHE A 1 106 ? 107.73300 96.33400  91.76400  1.000 31.50960  ? 106 PHE A C     1 
ATOM 508   O O     . PHE A 1 106 ? 107.64800 96.69600  90.58800  1.000 31.50960  ? 106 PHE A O     1 
ATOM 509   C CB    . PHE A 1 106 ? 109.25500 94.38800  92.16000  1.000 31.50960  ? 106 PHE A CB    1 
ATOM 510   C CG    . PHE A 1 106 ? 110.67000 93.97200  91.92300  1.000 31.50960  ? 106 PHE A CG    1 
ATOM 511   C CD1   . PHE A 1 106 ? 111.49300 94.73400  91.11800  1.000 31.50960  ? 106 PHE A CD1   1 
ATOM 512   C CD2   . PHE A 1 106 ? 111.18000 92.82800  92.50100  1.000 31.50960  ? 106 PHE A CD2   1 
ATOM 513   C CE1   . PHE A 1 106 ? 112.79600 94.36100  90.89400  1.000 31.50960  ? 106 PHE A CE1   1 
ATOM 514   C CE2   . PHE A 1 106 ? 112.48400 92.44900  92.28000  1.000 31.50960  ? 106 PHE A CE2   1 
ATOM 515   C CZ    . PHE A 1 106 ? 113.29100 93.21700  91.47600  1.000 31.50960  ? 106 PHE A CZ    1 
ATOM 516   N N     . GLU A 1 107 ? 106.68200 96.37800  92.59000  1.000 33.19132  ? 107 GLU A N     1 
ATOM 517   C CA    . GLU A 1 107 ? 105.42600 96.91900  92.06900  1.000 33.19132  ? 107 GLU A CA    1 
ATOM 518   C C     . GLU A 1 107 ? 105.48400 98.43900  91.90600  1.000 33.19132  ? 107 GLU A C     1 
ATOM 519   O O     . GLU A 1 107 ? 104.90200 98.97400  90.94900  1.000 33.19132  ? 107 GLU A O     1 
ATOM 520   C CB    . GLU A 1 107 ? 104.23700 96.49100  92.93500  1.000 33.19132  ? 107 GLU A CB    1 
ATOM 521   C CG    . GLU A 1 107 ? 104.25000 96.92900  94.37500  1.000 33.19132  ? 107 GLU A CG    1 
ATOM 522   C CD    . GLU A 1 107 ? 103.22000 96.18900  95.20700  1.000 33.19132  ? 107 GLU A CD    1 
ATOM 523   O OE1   . GLU A 1 107 ? 102.70700 96.77100  96.18600  1.000 33.19132  ? 107 GLU A OE1   1 
ATOM 524   O OE2   . GLU A 1 107 ? 102.92500 95.02100  94.88100  1.000 33.19132  ? 107 GLU A OE2   1 
ATOM 525   N N     . ASP A 1 108 ? 106.22900 99.14400  92.77000  1.000 32.86558  ? 108 ASP A N     1 
ATOM 526   C CA    . ASP A 1 108 ? 106.43600 100.57900 92.56100  1.000 32.86558  ? 108 ASP A CA    1 
ATOM 527   C C     . ASP A 1 108 ? 107.25900 100.85500 91.30200  1.000 32.86558  ? 108 ASP A C     1 
ATOM 528   O O     . ASP A 1 108 ? 106.91500 101.73900 90.50200  1.000 32.86558  ? 108 ASP A O     1 
ATOM 529   C CB    . ASP A 1 108 ? 107.11300 101.19000 93.78600  1.000 32.86558  ? 108 ASP A CB    1 
ATOM 530   C CG    . ASP A 1 108 ? 106.17300 101.31300 94.96900  1.000 32.86558  ? 108 ASP A CG    1 
ATOM 531   O OD1   . ASP A 1 108 ? 104.97900 100.98700 94.81700  1.000 32.86558  ? 108 ASP A OD1   1 
ATOM 532   O OD2   . ASP A 1 108 ? 106.61900 101.74600 96.04900  1.000 32.86558  ? 108 ASP A OD2   1 
ATOM 533   N N     . ALA A 1 109 ? 108.33700 100.09400 91.09900  1.000 31.59824  ? 109 ALA A N     1 
ATOM 534   C CA    . ALA A 1 109 ? 109.16000 100.26900 89.91200  1.000 31.59824  ? 109 ALA A CA    1 
ATOM 535   C C     . ALA A 1 109 ? 108.43000 99.84500  88.64900  1.000 31.59824  ? 109 ALA A C     1 
ATOM 536   O O     . ALA A 1 109 ? 108.70900 100.37500 87.57000  1.000 31.59824  ? 109 ALA A O     1 
ATOM 537   C CB    . ALA A 1 109 ? 110.45900 99.48700  90.06000  1.000 31.59824  ? 109 ALA A CB    1 
ATOM 538   N N     . TYR A 1 110 ? 107.45700 98.94400  88.75500  1.000 32.88193  ? 110 TYR A N     1 
ATOM 539   C CA    . TYR A 1 110 ? 106.67600 98.62000  87.57300  1.000 32.88193  ? 110 TYR A CA    1 
ATOM 540   C C     . TYR A 1 110 ? 105.62200 99.67100  87.26600  1.000 32.88193  ? 110 TYR A C     1 
ATOM 541   O O     . TYR A 1 110 ? 105.27500 99.85700  86.09300  1.000 32.88193  ? 110 TYR A O     1 
ATOM 542   C CB    . TYR A 1 110 ? 106.01900 97.25900  87.72700  1.000 32.88193  ? 110 TYR A CB    1 
ATOM 543   C CG    . TYR A 1 110 ? 105.62300 96.70500  86.39900  1.000 32.88193  ? 110 TYR A CG    1 
ATOM 544   C CD1   . TYR A 1 110 ? 106.57800 96.43100  85.44300  1.000 32.88193  ? 110 TYR A CD1   1 
ATOM 545   C CD2   . TYR A 1 110 ? 104.29400 96.48300  86.08600  1.000 32.88193  ? 110 TYR A CD2   1 
ATOM 546   C CE1   . TYR A 1 110 ? 106.22800 95.94400  84.22700  1.000 32.88193  ? 110 TYR A CE1   1 
ATOM 547   C CE2   . TYR A 1 110 ? 103.93400 95.99000  84.86000  1.000 32.88193  ? 110 TYR A CE2   1 
ATOM 548   C CZ    . TYR A 1 110 ? 104.90900 95.72200  83.93500  1.000 32.88193  ? 110 TYR A CZ    1 
ATOM 549   O OH    . TYR A 1 110 ? 104.56400 95.22200  82.70700  1.000 32.88193  ? 110 TYR A OH    1 
ATOM 550   N N     . LEU A 1 111 ? 105.10500 100.36600 88.28700  1.000 31.79814  ? 111 LEU A N     1 
ATOM 551   C CA    . LEU A 1 111 ? 104.30700 101.56100 88.01700  1.000 31.79814  ? 111 LEU A CA    1 
ATOM 552   C C     . LEU A 1 111 ? 105.13300 102.61600 87.29500  1.000 31.79814  ? 111 LEU A C     1 
ATOM 553   O O     . LEU A 1 111 ? 104.64200 103.28100 86.37500  1.000 31.79814  ? 111 LEU A O     1 
ATOM 554   C CB    . LEU A 1 111 ? 103.73600 102.13200 89.30900  1.000 31.79814  ? 111 LEU A CB    1 
ATOM 555   C CG    . LEU A 1 111 ? 102.67500 101.28900 90.00200  1.000 31.79814  ? 111 LEU A CG    1 
ATOM 556   C CD1   . LEU A 1 111 ? 102.27200 101.94600 91.30400  1.000 31.79814  ? 111 LEU A CD1   1 
ATOM 557   C CD2   . LEU A 1 111 ? 101.48800 101.12100 89.09400  1.000 31.79814  ? 111 LEU A CD2   1 
ATOM 558   N N     . LEU A 1 112 ? 106.40200 102.75800 87.68100  1.000 31.71127  ? 112 LEU A N     1 
ATOM 559   C CA    . LEU A 1 112 ? 107.29400 103.67800 86.97500  1.000 31.71127  ? 112 LEU A CA    1 
ATOM 560   C C     . LEU A 1 112 ? 107.56600 103.23100 85.54100  1.000 31.71127  ? 112 LEU A C     1 
ATOM 561   O O     . LEU A 1 112 ? 107.65800 104.06500 84.62700  1.000 31.71127  ? 112 LEU A O     1 
ATOM 562   C CB    . LEU A 1 112 ? 108.60400 103.81100 87.74200  1.000 31.71127  ? 112 LEU A CB    1 
ATOM 563   C CG    . LEU A 1 112 ? 108.56500 104.96000 88.72800  1.000 31.71127  ? 112 LEU A CG    1 
ATOM 564   C CD1   . LEU A 1 112 ? 109.77600 104.96000 89.60700  1.000 31.71127  ? 112 LEU A CD1   1 
ATOM 565   C CD2   . LEU A 1 112 ? 108.54000 106.17400 87.88900  1.000 31.71127  ? 112 LEU A CD2   1 
ATOM 566   N N     . THR A 1 113 ? 107.68700 101.92000 85.33000  1.000 32.78487  ? 113 THR A N     1 
ATOM 567   C CA    . THR A 1 113 ? 107.91000 101.37700 83.99300  1.000 32.78487  ? 113 THR A CA    1 
ATOM 568   C C     . THR A 1 113 ? 106.71900 101.64100 83.08400  1.000 32.78487  ? 113 THR A C     1 
ATOM 569   O O     . THR A 1 113 ? 106.88300 102.11000 81.95200  1.000 32.78487  ? 113 THR A O     1 
ATOM 570   C CB    . THR A 1 113 ? 108.20600 99.88400  84.09400  1.000 32.78487  ? 113 THR A CB    1 
ATOM 571   O OG1   . THR A 1 113 ? 109.53800 99.70900  84.57700  1.000 32.78487  ? 113 THR A OG1   1 
ATOM 572   C CG2   . THR A 1 113 ? 108.07300 99.20300  82.76300  1.000 32.78487  ? 113 THR A CG2   1 
ATOM 573   N N     . LEU A 1 114 ? 105.50700 101.36800 83.56900  1.000 33.82218  ? 114 LEU A N     1 
ATOM 574   C CA    . LEU A 1 114 ? 104.32600 101.67600 82.77300  1.000 33.82218  ? 114 LEU A CA    1 
ATOM 575   C C     . LEU A 1 114 ? 104.09800 103.17400 82.62500  1.000 33.82218  ? 114 LEU A C     1 
ATOM 576   O O     . LEU A 1 114 ? 103.40300 103.58900 81.69300  1.000 33.82218  ? 114 LEU A O     1 
ATOM 577   C CB    . LEU A 1 114 ? 103.09300 101.02400 83.37600  1.000 33.82218  ? 114 LEU A CB    1 
ATOM 578   C CG    . LEU A 1 114 ? 103.15800 99.50600  83.40500  1.000 33.82218  ? 114 LEU A CG    1 
ATOM 579   C CD1   . LEU A 1 114 ? 101.97800 98.98800  84.17200  1.000 33.82218  ? 114 LEU A CD1   1 
ATOM 580   C CD2   . LEU A 1 114 ? 103.18900 98.93500  82.00500  1.000 33.82218  ? 114 LEU A CD2   1 
ATOM 581   N N     . HIS A 1 115 ? 104.66000 103.99200 83.52000  1.000 32.97750  ? 115 HIS A N     1 
ATOM 582   C CA    . HIS A 1 115 ? 104.66300 105.43100 83.29200  1.000 32.97750  ? 115 HIS A CA    1 
ATOM 583   C C     . HIS A 1 115 ? 105.55300 105.79800 82.11800  1.000 32.97750  ? 115 HIS A C     1 
ATOM 584   O O     . HIS A 1 115 ? 105.21500 106.68700 81.33100  1.000 32.97750  ? 115 HIS A O     1 
ATOM 585   C CB    . HIS A 1 115 ? 105.13500 106.16400 84.53700  1.000 32.97750  ? 115 HIS A CB    1 
ATOM 586   C CG    . HIS A 1 115 ? 104.85600 107.63100 84.51500  1.000 32.97750  ? 115 HIS A CG    1 
ATOM 587   N ND1   . HIS A 1 115 ? 105.85800 108.57400 84.54200  1.000 32.97750  ? 115 HIS A ND1   1 
ATOM 588   C CD2   . HIS A 1 115 ? 103.69100 108.31900 84.47800  1.000 32.97750  ? 115 HIS A CD2   1 
ATOM 589   C CE1   . HIS A 1 115 ? 105.32300 109.78100 84.51400  1.000 32.97750  ? 115 HIS A CE1   1 
ATOM 590   N NE2   . HIS A 1 115 ? 104.01000 109.65400 84.47900  1.000 32.97750  ? 115 HIS A NE2   1 
ATOM 591   N N     . ALA A 1 116 ? 106.68600 105.11600 81.97100  1.000 32.51172  ? 116 ALA A N     1 
ATOM 592   C CA    . ALA A 1 116 ? 107.61200 105.47100 80.90300  1.000 32.51172  ? 116 ALA A CA    1 
ATOM 593   C C     . ALA A 1 116 ? 107.18100 104.97200 79.52900  1.000 32.51172  ? 116 ALA A C     1 
ATOM 594   O O     . ALA A 1 116 ? 107.89200 105.22500 78.55300  1.000 32.51172  ? 116 ALA A O     1 
ATOM 595   C CB    . ALA A 1 116 ? 109.00900 104.94300 81.22300  1.000 32.51172  ? 116 ALA A CB    1 
ATOM 596   N N     . GLY A 1 117 ? 106.04700 104.29000 79.41900  1.000 35.23267  ? 117 GLY A N     1 
ATOM 597   C CA    . GLY A 1 117 ? 105.60800 103.75500 78.14400  1.000 35.23267  ? 117 GLY A CA    1 
ATOM 598   C C     . GLY A 1 117 ? 106.32300 102.49600 77.71400  1.000 35.23267  ? 117 GLY A C     1 
ATOM 599   O O     . GLY A 1 117 ? 106.68500 102.36300 76.54000  1.000 35.23267  ? 117 GLY A O     1 
ATOM 600   N N     . ARG A 1 118 ? 106.53700 101.56100 78.63500  1.000 36.23680  ? 118 ARG A N     1 
ATOM 601   C CA    . ARG A 1 118 ? 107.17500 100.29400 78.31700  1.000 36.23680  ? 118 ARG A CA    1 
ATOM 602   C C     . ARG A 1 118 ? 106.70600 99.24500  79.31100  1.000 36.23680  ? 118 ARG A C     1 
ATOM 603   O O     . ARG A 1 118 ? 105.96500 99.54000  80.24900  1.000 36.23680  ? 118 ARG A O     1 
ATOM 604   C CB    . ARG A 1 118 ? 108.69900 100.41600 78.32100  1.000 36.23680  ? 118 ARG A CB    1 
ATOM 605   C CG    . ARG A 1 118 ? 109.27700 101.25500 79.41900  1.000 36.23680  ? 118 ARG A CG    1 
ATOM 606   C CD    . ARG A 1 118 ? 110.78700 101.22000 79.37100  1.000 36.23680  ? 118 ARG A CD    1 
ATOM 607   N NE    . ARG A 1 118 ? 111.36900 102.29900 80.15700  1.000 36.23680  ? 118 ARG A NE    1 
ATOM 608   C CZ    . ARG A 1 118 ? 111.62500 102.22700 81.45600  1.000 36.23680  ? 118 ARG A CZ    1 
ATOM 609   N NH1   . ARG A 1 118 ? 111.36000 101.12000 82.12700  1.000 36.23680  ? 118 ARG A NH1   1 
ATOM 610   N NH2   . ARG A 1 118 ? 112.15500 103.26300 82.08300  1.000 36.23680  ? 118 ARG A NH2   1 
ATOM 611   N N     . VAL A 1 119 ? 107.10700 97.99900  79.06700  1.000 37.37639  ? 119 VAL A N     1 
ATOM 612   C CA    . VAL A 1 119 ? 106.77800 96.90100  79.96500  1.000 37.37639  ? 119 VAL A CA    1 
ATOM 613   C C     . VAL A 1 119 ? 108.00100 96.24800  80.59800  1.000 37.37639  ? 119 VAL A C     1 
ATOM 614   O O     . VAL A 1 119 ? 107.85600 95.56600  81.62000  1.000 37.37639  ? 119 VAL A O     1 
ATOM 615   C CB    . VAL A 1 119 ? 105.91600 95.83600  79.25800  1.000 37.37639  ? 119 VAL A CB    1 
ATOM 616   C CG1   . VAL A 1 119 ? 104.60100 96.43200  78.81300  1.000 37.37639  ? 119 VAL A CG1   1 
ATOM 617   C CG2   . VAL A 1 119 ? 106.64500 95.26500  78.07400  1.000 37.37639  ? 119 VAL A CG2   1 
ATOM 618   N N     . THR A 1 120 ? 109.19300 96.38300  80.03100  1.000 37.40228  ? 120 THR A N     1 
ATOM 619   C CA    . THR A 1 120 ? 110.39300 95.83500  80.64900  1.000 37.40228  ? 120 THR A CA    1 
ATOM 620   C C     . THR A 1 120 ? 110.86400 96.73800  81.78600  1.000 37.40228  ? 120 THR A C     1 
ATOM 621   O O     . THR A 1 120 ? 110.89800 97.95900  81.63800  1.000 37.40228  ? 120 THR A O     1 
ATOM 622   C CB    . THR A 1 120 ? 111.48500 95.68500  79.58600  1.000 37.40228  ? 120 THR A CB    1 
ATOM 623   O OG1   . THR A 1 120 ? 111.01400 94.82000  78.54800  1.000 37.40228  ? 120 THR A OG1   1 
ATOM 624   C CG2   . THR A 1 120 ? 112.74600 95.08100  80.15800  1.000 37.40228  ? 120 THR A CG2   1 
ATOM 625   N N     . LEU A 1 121 ? 111.26000 96.14100  82.91500  1.000 34.24506  ? 121 LEU A N     1 
ATOM 626   C CA    . LEU A 1 121 ? 111.88800 96.92700  83.97300  1.000 34.24506  ? 121 LEU A CA    1 
ATOM 627   C C     . LEU A 1 121 ? 113.35100 97.17200  83.67400  1.000 34.24506  ? 121 LEU A C     1 
ATOM 628   O O     . LEU A 1 121 ? 114.11200 96.23700  83.43000  1.000 34.24506  ? 121 LEU A O     1 
ATOM 629   C CB    . LEU A 1 121 ? 111.83500 96.26000  85.34400  1.000 34.24506  ? 121 LEU A CB    1 
ATOM 630   C CG    . LEU A 1 121 ? 110.68600 96.11900  86.31000  1.000 34.24506  ? 121 LEU A CG    1 
ATOM 631   C CD1   . LEU A 1 121 ? 111.17000 95.23800  87.43000  1.000 34.24506  ? 121 LEU A CD1   1 
ATOM 632   C CD2   . LEU A 1 121 ? 110.36500 97.46600  86.85800  1.000 34.24506  ? 121 LEU A CD2   1 
ATOM 633   N N     . PHE A 1 122 ? 113.73400 98.38700  83.75600  1.000 37.35598  ? 122 PHE A N     1 
ATOM 634   C CA    . PHE A 1 122 ? 115.08100 98.86700  83.64400  1.000 37.35598  ? 122 PHE A CA    1 
ATOM 635   C C     . PHE A 1 122 ? 115.49100 99.38200  85.00700  1.000 37.35598  ? 122 PHE A C     1 
ATOM 636   O O     . PHE A 1 122 ? 114.65100 99.95500  85.70700  1.000 37.35598  ? 122 PHE A O     1 
ATOM 637   C CB    . PHE A 1 122 ? 115.20200 99.98900  82.61100  1.000 37.35598  ? 122 PHE A CB    1 
ATOM 638   C CG    . PHE A 1 122 ? 115.02300 99.53500  81.20100  1.000 37.35598  ? 122 PHE A CG    1 
ATOM 639   C CD1   . PHE A 1 122 ? 115.24900 98.21800  80.84900  1.000 37.35598  ? 122 PHE A CD1   1 
ATOM 640   C CD2   . PHE A 1 122 ? 114.60500 100.42100 80.23000  1.000 37.35598  ? 122 PHE A CD2   1 
ATOM 641   C CE1   . PHE A 1 122 ? 115.08000 97.79900  79.55500  1.000 37.35598  ? 122 PHE A CE1   1 
ATOM 642   C CE2   . PHE A 1 122 ? 114.42900 100.00500 78.93600  1.000 37.35598  ? 122 PHE A CE2   1 
ATOM 643   C CZ    . PHE A 1 122 ? 114.66800 98.69000  78.60000  1.000 37.35598  ? 122 PHE A CZ    1 
ATOM 644   N N     . PRO A 1 123 ? 116.73000 99.12800  85.44500  1.000 35.59604  ? 123 PRO A N     1 
ATOM 645   C CA    . PRO A 1 123 ? 117.14600 99.54100  86.79800  1.000 35.59604  ? 123 PRO A CA    1 
ATOM 646   C C     . PRO A 1 123 ? 117.05500 101.04000 87.08300  1.000 35.59604  ? 123 PRO A C     1 
ATOM 647   O O     . PRO A 1 123 ? 117.10700 101.41500 88.25800  1.000 35.59604  ? 123 PRO A O     1 
ATOM 648   C CB    . PRO A 1 123 ? 118.59400 99.04700  86.87800  1.000 35.59604  ? 123 PRO A CB    1 
ATOM 649   C CG    . PRO A 1 123 ? 119.03300 98.93900  85.46800  1.000 35.59604  ? 123 PRO A CG    1 
ATOM 650   C CD    . PRO A 1 123 ? 117.83400 98.49500  84.70900  1.000 35.59604  ? 123 PRO A CD    1 
ATOM 651   N N     . LYS A 1 124 ? 116.89400 101.89500 86.06600  1.000 35.55092  ? 124 LYS A N     1 
ATOM 652   C CA    . LYS A 1 124 ? 116.57200 103.29700 86.30800  1.000 35.55092  ? 124 LYS A CA    1 
ATOM 653   C C     . LYS A 1 124 ? 115.21700 103.46600 86.98500  1.000 35.55092  ? 124 LYS A C     1 
ATOM 654   O O     . LYS A 1 124 ? 115.02600 104.42000 87.74100  1.000 35.55092  ? 124 LYS A O     1 
ATOM 655   C CB    . LYS A 1 124 ? 116.60100 104.07600 84.99500  1.000 35.55092  ? 124 LYS A CB    1 
ATOM 656   C CG    . LYS A 1 124 ? 115.77100 103.45300 83.89700  1.000 35.55092  ? 124 LYS A CG    1 
ATOM 657   C CD    . LYS A 1 124 ? 115.84700 104.23900 82.60500  1.000 35.55092  ? 124 LYS A CD    1 
ATOM 658   C CE    . LYS A 1 124 ? 115.21800 105.60800 82.76200  1.000 35.55092  ? 124 LYS A CE    1 
ATOM 659   N NZ    . LYS A 1 124 ? 115.25900 106.38700 81.49800  1.000 35.55092  ? 124 LYS A NZ    1 
ATOM 660   N N     . ASP A 1 125 ? 114.29200 102.52100 86.78800  1.000 34.92683  ? 125 ASP A N     1 
ATOM 661   C CA    . ASP A 1 125 ? 112.99700 102.60200 87.45900  1.000 34.92683  ? 125 ASP A CA    1 
ATOM 662   C C     . ASP A 1 125 ? 113.10600 102.25400 88.93700  1.000 34.92683  ? 125 ASP A C     1 
ATOM 663   O O     . ASP A 1 125 ? 112.46800 102.89700 89.77500  1.000 34.92683  ? 125 ASP A O     1 
ATOM 664   C CB    . ASP A 1 125 ? 111.99100 101.69200 86.76600  1.000 34.92683  ? 125 ASP A CB    1 
ATOM 665   C CG    . ASP A 1 125 ? 111.96300 101.90500 85.27900  1.000 34.92683  ? 125 ASP A CG    1 
ATOM 666   O OD1   . ASP A 1 125 ? 112.53900 102.91000 84.82200  1.000 34.92683  ? 125 ASP A OD1   1 
ATOM 667   O OD2   . ASP A 1 125 ? 111.36000 101.08700 84.56300  1.000 34.92683  ? 125 ASP A OD2   1 
ATOM 668   N N     . VAL A 1 126 ? 113.91800 101.25200 89.27800  1.000 34.80345  ? 126 VAL A N     1 
ATOM 669   C CA    . VAL A 1 126 ? 114.14900 100.93500 90.68300  1.000 34.80345  ? 126 VAL A CA    1 
ATOM 670   C C     . VAL A 1 126 ? 114.94000 102.04900 91.35700  1.000 34.80345  ? 126 VAL A C     1 
ATOM 671   O O     . VAL A 1 126 ? 114.63500 102.44800 92.48900  1.000 34.80345  ? 126 VAL A O     1 
ATOM 672   C CB    . VAL A 1 126 ? 114.86000 99.57600  90.80200  1.000 34.80345  ? 126 VAL A CB    1 
ATOM 673   C CG1   . VAL A 1 126 ? 114.96500 99.15800  92.24600  1.000 34.80345  ? 126 VAL A CG1   1 
ATOM 674   C CG2   . VAL A 1 126 ? 114.11900 98.52500  90.00400  1.000 34.80345  ? 126 VAL A CG2   1 
ATOM 675   N N     . GLN A 1 127 ? 115.93800 102.59600 90.65600  1.000 36.01602  ? 127 GLN A N     1 
ATOM 676   C CA    . GLN A 1 127 ? 116.71200 103.71600 91.18200  1.000 36.01602  ? 127 GLN A CA    1 
ATOM 677   C C     . GLN A 1 127 ? 115.86400 104.96800 91.35100  1.000 36.01602  ? 127 GLN A C     1 
ATOM 678   O O     . GLN A 1 127 ? 116.12700 105.77100 92.25100  1.000 36.01602  ? 127 GLN A O     1 
ATOM 679   C CB    . GLN A 1 127 ? 117.90800 103.99700 90.27600  1.000 36.01602  ? 127 GLN A CB    1 
ATOM 680   C CG    . GLN A 1 127 ? 119.01100 102.96200 90.37800  1.000 36.01602  ? 127 GLN A CG    1 
ATOM 681   C CD    . GLN A 1 127 ? 119.96300 103.01400 89.20200  1.000 36.01602  ? 127 GLN A CD    1 
ATOM 682   O OE1   . GLN A 1 127 ? 119.96600 103.97300 88.43300  1.000 36.01602  ? 127 GLN A OE1   1 
ATOM 683   N NE2   . GLN A 1 127 ? 120.76600 101.97000 89.04600  1.000 36.01602  ? 127 GLN A NE2   1 
ATOM 684   N N     . LEU A 1 128 ? 114.84700 105.15400 90.50800  1.000 35.16922  ? 128 LEU A N     1 
ATOM 685   C CA    . LEU A 1 128 ? 113.97200 106.30800 90.65400  1.000 35.16922  ? 128 LEU A CA    1 
ATOM 686   C C     . LEU A 1 128 ? 112.95400 106.09800 91.76200  1.000 35.16922  ? 128 LEU A C     1 
ATOM 687   O O     . LEU A 1 128 ? 112.64000 107.03800 92.49700  1.000 35.16922  ? 128 LEU A O     1 
ATOM 688   C CB    . LEU A 1 128 ? 113.25200 106.60200 89.34400  1.000 35.16922  ? 128 LEU A CB    1 
ATOM 689   C CG    . LEU A 1 128 ? 112.49200 107.92600 89.36000  1.000 35.16922  ? 128 LEU A CG    1 
ATOM 690   C CD1   . LEU A 1 128 ? 113.43400 109.07800 89.63000  1.000 35.16922  ? 128 LEU A CD1   1 
ATOM 691   C CD2   . LEU A 1 128 ? 111.73900 108.13500 88.09000  1.000 35.16922  ? 128 LEU A CD2   1 
ATOM 692   N N     . ALA A 1 129 ? 112.42800 104.87900 91.89800  1.000 35.60837  ? 129 ALA A N     1 
ATOM 693   C CA    . ALA A 1 129 ? 111.48000 104.60800 92.97000  1.000 35.60837  ? 129 ALA A CA    1 
ATOM 694   C C     . ALA A 1 129 ? 112.14800 104.66800 94.33400  1.000 35.60837  ? 129 ALA A C     1 
ATOM 695   O O     . ALA A 1 129 ? 111.50400 105.06000 95.31000  1.000 35.60837  ? 129 ALA A O     1 
ATOM 696   C CB    . ALA A 1 129 ? 110.82700 103.24500 92.76500  1.000 35.60837  ? 129 ALA A CB    1 
ATOM 697   N N     . ARG A 1 130 ? 113.45100 104.38100 94.40600  1.000 38.00487  ? 130 ARG A N     1 
ATOM 698   C CA    . ARG A 1 130 ? 114.15500 104.51500 95.67600  1.000 38.00487  ? 130 ARG A CA    1 
ATOM 699   C C     . ARG A 1 130 ? 114.28500 105.96300 96.12600  1.000 38.00487  ? 130 ARG A C     1 
ATOM 700   O O     . ARG A 1 130 ? 114.42900 106.20600 97.32800  1.000 38.00487  ? 130 ARG A O     1 
ATOM 701   C CB    . ARG A 1 130 ? 115.54200 103.88300 95.59500  1.000 38.00487  ? 130 ARG A CB    1 
ATOM 702   C CG    . ARG A 1 130 ? 115.53700 102.37400 95.62100  1.000 38.00487  ? 130 ARG A CG    1 
ATOM 703   C CD    . ARG A 1 130 ? 116.93800 101.82800 95.47700  1.000 38.00487  ? 130 ARG A CD    1 
ATOM 704   N NE    . ARG A 1 130 ? 117.66200 101.82500 96.74200  1.000 38.00487  ? 130 ARG A NE    1 
ATOM 705   C CZ    . ARG A 1 130 ? 118.93800 101.47600 96.86300  1.000 38.00487  ? 130 ARG A CZ    1 
ATOM 706   N NH1   . ARG A 1 130 ? 119.52500 101.49300 98.04900  1.000 38.00487  ? 130 ARG A NH1   1 
ATOM 707   N NH2   . ARG A 1 130 ? 119.62900 101.12100 95.79200  1.000 38.00487  ? 130 ARG A NH2   1 
ATOM 708   N N     . ARG A 1 131 ? 114.23900 106.92900 95.20900  1.000 37.59255  ? 131 ARG A N     1 
ATOM 709   C CA    . ARG A 1 131 ? 114.33800 108.32300 95.60500  1.000 37.59255  ? 131 ARG A CA    1 
ATOM 710   C C     . ARG A 1 131 ? 113.02100 109.07900 95.52600  1.000 37.59255  ? 131 ARG A C     1 
ATOM 711   O O     . ARG A 1 131 ? 112.95200 110.20900 96.01900  1.000 37.59255  ? 131 ARG A O     1 
ATOM 712   C CB    . ARG A 1 131 ? 115.40200 109.05300 94.77700  1.000 37.59255  ? 131 ARG A CB    1 
ATOM 713   C CG    . ARG A 1 131 ? 115.12300 109.18400 93.31500  1.000 37.59255  ? 131 ARG A CG    1 
ATOM 714   C CD    . ARG A 1 131 ? 116.32600 109.82100 92.64800  1.000 37.59255  ? 131 ARG A CD    1 
ATOM 715   N NE    . ARG A 1 131 ? 116.54100 111.19000 93.10700  1.000 37.59255  ? 131 ARG A NE    1 
ATOM 716   C CZ    . ARG A 1 131 ? 116.77700 112.22000 92.30200  1.000 37.59255  ? 131 ARG A CZ    1 
ATOM 717   N NH1   . ARG A 1 131 ? 116.95500 113.43200 92.80700  1.000 37.59255  ? 131 ARG A NH1   1 
ATOM 718   N NH2   . ARG A 1 131 ? 116.84300 112.03900 90.99100  1.000 37.59255  ? 131 ARG A NH2   1 
ATOM 719   N N     . ILE A 1 132 ? 111.98000 108.50600 94.92200  1.000 35.53002  ? 132 ILE A N     1 
ATOM 720   C CA    . ILE A 1 132 ? 110.64600 109.06300 95.13500  1.000 35.53002  ? 132 ILE A CA    1 
ATOM 721   C C     . ILE A 1 132 ? 110.07400 108.58100 96.46600  1.000 35.53002  ? 132 ILE A C     1 
ATOM 722   O O     . ILE A 1 132 ? 109.39400 109.33900 97.16600  1.000 35.53002  ? 132 ILE A O     1 
ATOM 723   C CB    . ILE A 1 132 ? 109.70900 108.74300 93.95200  1.000 35.53002  ? 132 ILE A CB    1 
ATOM 724   C CG1   . ILE A 1 132 ? 110.29900 109.24300 92.63900  1.000 35.53002  ? 132 ILE A CG1   1 
ATOM 725   C CG2   . ILE A 1 132 ? 108.36400 109.41000 94.11800  1.000 35.53002  ? 132 ILE A CG2   1 
ATOM 726   C CD1   . ILE A 1 132 ? 110.49600 110.72500 92.58500  1.000 35.53002  ? 132 ILE A CD1   1 
ATOM 727   N N     . ARG A 1 133 ? 110.36900 107.33500 96.86400  1.000 39.27362  ? 133 ARG A N     1 
ATOM 728   C CA    . ARG A 1 133 ? 109.88500 106.85300 98.15800  1.000 39.27362  ? 133 ARG A CA    1 
ATOM 729   C C     . ARG A 1 133 ? 110.57600 107.55300 99.32000  1.000 39.27362  ? 133 ARG A C     1 
ATOM 730   O O     . ARG A 1 133 ? 109.99300 107.67000 100.40200 1.000 39.27362  ? 133 ARG A O     1 
ATOM 731   C CB    . ARG A 1 133 ? 110.03900 105.33600 98.26800  1.000 39.27362  ? 133 ARG A CB    1 
ATOM 732   C CG    . ARG A 1 133 ? 109.11500 104.56700 97.33900  1.000 39.27362  ? 133 ARG A CG    1 
ATOM 733   C CD    . ARG A 1 133 ? 109.36900 103.07200 97.33700  1.000 39.27362  ? 133 ARG A CD    1 
ATOM 734   N NE    . ARG A 1 133 ? 109.03500 102.44400 98.60700  1.000 39.27362  ? 133 ARG A NE    1 
ATOM 735   C CZ    . ARG A 1 133 ? 109.27100 101.16900 98.88900  1.000 39.27362  ? 133 ARG A CZ    1 
ATOM 736   N NH1   . ARG A 1 133 ? 108.93500 100.67500 100.07000 1.000 39.27362  ? 133 ARG A NH1   1 
ATOM 737   N NH2   . ARG A 1 133 ? 109.84900 100.38800 97.99200  1.000 39.27362  ? 133 ARG A NH2   1 
ATOM 738   N N     . GLY A 1 134 ? 111.79800 108.03500 99.12300  1.000 43.37253  ? 134 GLY A N     1 
ATOM 739   C CA    . GLY A 1 134 ? 112.42200 108.88000 100.12000 1.000 43.37253  ? 134 GLY A CA    1 
ATOM 740   C C     . GLY A 1 134 ? 113.85100 108.51200 100.45000 1.000 43.37253  ? 134 GLY A C     1 
ATOM 741   O O     . GLY A 1 134 ? 114.57600 107.98200 99.60600  1.000 43.37253  ? 134 GLY A O     1 
ATOM 742   N N     . LEU A 1 135 ? 114.27200 108.79900 101.68000 1.000 46.64688  ? 135 LEU A N     1 
ATOM 743   C CA    . LEU A 1 135 ? 115.61500 108.47400 102.13100 1.000 46.64688  ? 135 LEU A CA    1 
ATOM 744   C C     . LEU A 1 135 ? 115.64600 107.31800 103.11600 1.000 46.64688  ? 135 LEU A C     1 
ATOM 745   O O     . LEU A 1 135 ? 116.72900 106.78500 103.38100 1.000 46.64688  ? 135 LEU A O     1 
ATOM 746   C CB    . LEU A 1 135 ? 116.28400 109.70000 102.77000 1.000 46.64688  ? 135 LEU A CB    1 
ATOM 747   C CG    . LEU A 1 135 ? 116.83400 110.78000 101.83400 1.000 46.64688  ? 135 LEU A CG    1 
ATOM 748   C CD1   . LEU A 1 135 ? 115.78200 111.83300 101.50200 1.000 46.64688  ? 135 LEU A CD1   1 
ATOM 749   C CD2   . LEU A 1 135 ? 118.06900 111.42500 102.44100 1.000 46.64688  ? 135 LEU A CD2   1 
ATOM 750   N N     . GLU A 1 136 ? 114.49800 106.92000 103.66900 1.000 47.19106  ? 136 GLU A N     1 
ATOM 751   C CA    . GLU A 1 136 ? 114.41800 105.73400 104.50800 1.000 47.19106  ? 136 GLU A CA    1 
ATOM 752   C C     . GLU A 1 136 ? 113.25900 104.81600 104.14800 1.000 47.19106  ? 136 GLU A C     1 
ATOM 753   O O     . GLU A 1 136 ? 113.20900 103.69200 104.65800 1.000 47.19106  ? 136 GLU A O     1 
ATOM 754   C CB    . GLU A 1 136 ? 114.31200 106.13400 105.99100 1.000 47.19106  ? 136 GLU A CB    1 
ATOM 755   C CG    . GLU A 1 136 ? 114.93100 105.14800 106.99700 1.000 47.19106  ? 136 GLU A CG    1 
ATOM 756   C CD    . GLU A 1 136 ? 116.44300 105.00300 106.87900 1.000 47.19106  ? 136 GLU A CD    1 
ATOM 757   O OE1   . GLU A 1 136 ? 117.11000 105.92800 106.36500 1.000 47.19106  ? 136 GLU A OE1   1 
ATOM 758   O OE2   . GLU A 1 136 ? 116.96700 103.95500 107.31400 1.000 47.19106  ? 136 GLU A OE2   1 
ATOM 759   N N     . GLU A 1 137 ? 112.34100 105.24200 103.28300 1.000 45.01093  ? 137 GLU A N     1 
ATOM 760   C CA    . GLU A 1 137 ? 111.30300 104.35100 102.78100 1.000 45.01093  ? 137 GLU A CA    1 
ATOM 761   C C     . GLU A 1 137 ? 111.73600 103.62500 101.51600 1.000 45.01093  ? 137 GLU A C     1 
ATOM 762   O O     . GLU A 1 137 ? 111.27200 102.50900 101.25600 1.000 45.01093  ? 137 GLU A O     1 
ATOM 763   C CB    . GLU A 1 137 ? 110.00900 105.13200 102.52500 1.000 45.01093  ? 137 GLU A CB    1 
ATOM 764   C CG    . GLU A 1 137 ? 108.76300 104.26700 102.40000 1.000 45.01093  ? 137 GLU A CG    1 
ATOM 765   C CD    . GLU A 1 137 ? 107.54000 105.05300 101.97000 1.000 45.01093  ? 137 GLU A CD    1 
ATOM 766   O OE1   . GLU A 1 137 ? 107.68200 105.99200 101.16200 1.000 45.01093  ? 137 GLU A OE1   1 
ATOM 767   O OE2   . GLU A 1 137 ? 106.43000 104.72900 102.43700 1.000 45.01093  ? 137 GLU A OE2   1 
ATOM 768   N N     . GLY A 1 138 ? 112.63200 104.22100 100.73700 1.000 43.31277  ? 138 GLY A N     1 
ATOM 769   C CA    . GLY A 1 138 ? 113.10300 103.59500 99.52200  1.000 43.31277  ? 138 GLY A CA    1 
ATOM 770   C C     . GLY A 1 138 ? 114.50100 103.04200 99.67600  1.000 43.31277  ? 138 GLY A C     1 
ATOM 771   O O     . GLY A 1 138 ? 114.95000 102.23100 98.86200  1.000 43.31277  ? 138 GLY A O     1 
ATOM 772   N N     . LEU A 1 139 ? 115.19800 103.46900 100.72300 1.000 44.95587  ? 139 LEU A N     1 
ATOM 773   C CA    . LEU A 1 139 ? 116.53700 102.96800 101.00700 1.000 44.95587  ? 139 LEU A CA    1 
ATOM 774   C C     . LEU A 1 139 ? 116.48500 101.84000 102.03300 1.000 44.95587  ? 139 LEU A C     1 
ATOM 775   O O     . LEU A 1 139 ? 117.46200 101.12000 102.23000 1.000 44.95587  ? 139 LEU A O     1 
ATOM 776   C CB    . LEU A 1 139 ? 117.43600 104.09700 101.50900 1.000 44.95587  ? 139 LEU A CB    1 
ATOM 777   C CG    . LEU A 1 139 ? 118.43200 104.72300 100.53500 1.000 44.95587  ? 139 LEU A CG    1 
ATOM 778   C CD1   . LEU A 1 139 ? 117.73600 105.32000 99.32800  1.000 44.95587  ? 139 LEU A CD1   1 
ATOM 779   C CD2   . LEU A 1 139 ? 119.24800 105.78100 101.25600 1.000 44.95587  ? 139 LEU A CD2   1 
ATOM 780   N N     . ASN B 2 26  ? 128.46700 85.57600  98.46800  1.000 44.31015  ? 25  ASN B N     1 
ATOM 781   C CA    . ASN B 2 26  ? 127.22200 84.84900  98.66300  1.000 44.31015  ? 25  ASN B CA    1 
ATOM 782   C C     . ASN B 2 26  ? 126.03500 85.63600  98.13200  1.000 44.31015  ? 25  ASN B C     1 
ATOM 783   O O     . ASN B 2 26  ? 124.90400 85.15300  98.15400  1.000 44.31015  ? 25  ASN B O     1 
ATOM 784   C CB    . ASN B 2 26  ? 127.01300 84.52400  100.13800 1.000 44.31015  ? 25  ASN B CB    1 
ATOM 785   C CG    . ASN B 2 26  ? 128.22400 83.88100  100.76500 1.000 44.31015  ? 25  ASN B CG    1 
ATOM 786   O OD1   . ASN B 2 26  ? 129.18200 84.55900  101.12900 1.000 44.31015  ? 25  ASN B OD1   1 
ATOM 787   N ND2   . ASN B 2 26  ? 128.19100 82.56200  100.89600 1.000 44.31015  ? 25  ASN B ND2   1 
ATOM 788   N N     . ILE B 2 27  ? 126.29600 86.85900  97.66300  1.000 42.21784  ? 26  ILE B N     1 
ATOM 789   C CA    . ILE B 2 27  ? 125.23400 87.67900  97.09500  1.000 42.21784  ? 26  ILE B CA    1 
ATOM 790   C C     . ILE B 2 27  ? 124.77700 87.12700  95.74900  1.000 42.21784  ? 26  ILE B C     1 
ATOM 791   O O     . ILE B 2 27  ? 123.63900 87.36800  95.33400  1.000 42.21784  ? 26  ILE B O     1 
ATOM 792   C CB    . ILE B 2 27  ? 125.70800 89.14700  97.01200  1.000 42.21784  ? 26  ILE B CB    1 
ATOM 793   C CG1   . ILE B 2 27  ? 124.55100 90.10400  96.71200  1.000 42.21784  ? 26  ILE B CG1   1 
ATOM 794   C CG2   . ILE B 2 27  ? 126.83200 89.31000  96.00000  1.000 42.21784  ? 26  ILE B CG2   1 
ATOM 795   C CD1   . ILE B 2 27  ? 123.39300 89.98600  97.66100  1.000 42.21784  ? 26  ILE B CD1   1 
ATOM 796   N N     . GLN B 2 28  ? 125.60900 86.32700  95.07900  1.000 43.67958  ? 27  GLN B N     1 
ATOM 797   C CA    . GLN B 2 28  ? 125.16900 85.62100  93.88500  1.000 43.67958  ? 27  GLN B CA    1 
ATOM 798   C C     . GLN B 2 28  ? 124.32900 84.39500  94.20800  1.000 43.67958  ? 27  GLN B C     1 
ATOM 799   O O     . GLN B 2 28  ? 123.78500 83.78100  93.28700  1.000 43.67958  ? 27  GLN B O     1 
ATOM 800   C CB    . GLN B 2 28  ? 126.37200 85.20900  93.03700  1.000 43.67958  ? 27  GLN B CB    1 
ATOM 801   C CG    . GLN B 2 28  ? 127.35300 86.33400  92.77500  1.000 43.67958  ? 27  GLN B CG    1 
ATOM 802   C CD    . GLN B 2 28  ? 126.71300 87.52700  92.10700  1.000 43.67958  ? 27  GLN B CD    1 
ATOM 803   O OE1   . GLN B 2 28  ? 125.93900 87.38200  91.16400  1.000 43.67958  ? 27  GLN B OE1   1 
ATOM 804   N NE2   . GLN B 2 28  ? 127.03500 88.71900  92.58900  1.000 43.67958  ? 27  GLN B NE2   1 
ATOM 805   N N     . GLY B 2 29  ? 124.21300 84.02700  95.48600  1.000 43.64285  ? 28  GLY B N     1 
ATOM 806   C CA    . GLY B 2 29  ? 123.26100 83.01300  95.89600  1.000 43.64285  ? 28  GLY B CA    1 
ATOM 807   C C     . GLY B 2 29  ? 121.81900 83.45700  95.79300  1.000 43.64285  ? 28  GLY B C     1 
ATOM 808   O O     . GLY B 2 29  ? 120.92100 82.61100  95.75600  1.000 43.64285  ? 28  GLY B O     1 
ATOM 809   N N     . ILE B 2 30  ? 121.57700 84.76500  95.74500  1.000 41.15305  ? 29  ILE B N     1 
ATOM 810   C CA    . ILE B 2 30  ? 120.26000 85.27900  95.40500  1.000 41.15305  ? 29  ILE B CA    1 
ATOM 811   C C     . ILE B 2 30  ? 120.16500 85.17400  93.89500  1.000 41.15305  ? 29  ILE B C     1 
ATOM 812   O O     . ILE B 2 30  ? 120.53000 86.10700  93.17100  1.000 41.15305  ? 29  ILE B O     1 
ATOM 813   C CB    . ILE B 2 30  ? 120.05900 86.72700  95.88300  1.000 41.15305  ? 29  ILE B CB    1 
ATOM 814   C CG1   . ILE B 2 30  ? 120.60100 86.90200  97.29900  1.000 41.15305  ? 29  ILE B CG1   1 
ATOM 815   C CG2   . ILE B 2 30  ? 118.59400 87.10700  95.81800  1.000 41.15305  ? 29  ILE B CG2   1 
ATOM 816   C CD1   . ILE B 2 30  ? 119.85800 86.11400  98.34500  1.000 41.15305  ? 29  ILE B CD1   1 
ATOM 817   N N     . THR B 2 31  ? 119.67900 84.03400  93.41500  1.000 42.84498  ? 30  THR B N     1 
ATOM 818   C CA    . THR B 2 31  ? 119.81000 83.67300  92.01500  1.000 42.84498  ? 30  THR B CA    1 
ATOM 819   C C     . THR B 2 31  ? 118.86100 84.49300  91.14800  1.000 42.84498  ? 30  THR B C     1 
ATOM 820   O O     . THR B 2 31  ? 117.94700 85.16200  91.63300  1.000 42.84498  ? 30  THR B O     1 
ATOM 821   C CB    . THR B 2 31  ? 119.54400 82.18300  91.83400  1.000 42.84498  ? 30  THR B CB    1 
ATOM 822   O OG1   . THR B 2 31  ? 118.33200 81.83500  92.51000  1.000 42.84498  ? 30  THR B OG1   1 
ATOM 823   C CG2   . THR B 2 31  ? 120.68000 81.37400  92.41500  1.000 42.84498  ? 30  THR B CG2   1 
ATOM 824   N N     . LYS B 2 32  ? 119.11600 84.45500  89.84400  1.000 38.98345  ? 31  LYS B N     1 
ATOM 825   C CA    . LYS B 2 32  ? 118.21900 85.10300  88.89200  1.000 38.98345  ? 31  LYS B CA    1 
ATOM 826   C C     . LYS B 2 32  ? 116.80400 84.52300  88.85200  1.000 38.98345  ? 31  LYS B C     1 
ATOM 827   O O     . LYS B 2 32  ? 115.87400 85.30800  88.61000  1.000 38.98345  ? 31  LYS B O     1 
ATOM 828   C CB    . LYS B 2 32  ? 118.85400 85.10100  87.49600  1.000 38.98345  ? 31  LYS B CB    1 
ATOM 829   C CG    . LYS B 2 32  ? 120.21600 85.76000  87.44600  1.000 38.98345  ? 31  LYS B CG    1 
ATOM 830   C CD    . LYS B 2 32  ? 120.82000 85.69100  86.06100  1.000 38.98345  ? 31  LYS B CD    1 
ATOM 831   C CE    . LYS B 2 32  ? 122.25100 86.18700  86.07800  1.000 38.98345  ? 31  LYS B CE    1 
ATOM 832   N NZ    . LYS B 2 32  ? 123.07800 85.41300  87.04100  1.000 38.98345  ? 31  LYS B NZ    1 
ATOM 833   N N     . PRO B 2 33  ? 116.55300 83.21300  89.02900  1.000 39.58746  ? 32  PRO B N     1 
ATOM 834   C CA    . PRO B 2 33  ? 115.15400 82.79200  89.20800  1.000 39.58746  ? 32  PRO B CA    1 
ATOM 835   C C     . PRO B 2 33  ? 114.48300 83.31700  90.46800  1.000 39.58746  ? 32  PRO B C     1 
ATOM 836   O O     . PRO B 2 33  ? 113.26300 83.50400  90.45900  1.000 39.58746  ? 32  PRO B O     1 
ATOM 837   C CB    . PRO B 2 33  ? 115.25700 81.26500  89.22100  1.000 39.58746  ? 32  PRO B CB    1 
ATOM 838   C CG    . PRO B 2 33  ? 116.35800 80.99400  88.32100  1.000 39.58746  ? 32  PRO B CG    1 
ATOM 839   C CD    . PRO B 2 33  ? 117.37200 82.04000  88.65100  1.000 39.58746  ? 32  PRO B CD    1 
ATOM 840   N N     . ALA B 2 34  ? 115.22600 83.56100  91.54900  1.000 37.86516  ? 33  ALA B N     1 
ATOM 841   C CA    . ALA B 2 34  ? 114.60600 84.08700  92.76300  1.000 37.86516  ? 33  ALA B CA    1 
ATOM 842   C C     . ALA B 2 34  ? 114.20200 85.54800  92.60200  1.000 37.86516  ? 33  ALA B C     1 
ATOM 843   O O     . ALA B 2 34  ? 113.11400 85.95000  93.03800  1.000 37.86516  ? 33  ALA B O     1 
ATOM 844   C CB    . ALA B 2 34  ? 115.55400 83.92600  93.94500  1.000 37.86516  ? 33  ALA B CB    1 
ATOM 845   N N     . ILE B 2 35  ? 115.06500 86.35200  91.97700  1.000 35.63518  ? 34  ILE B N     1 
ATOM 846   C CA    . ILE B 2 35  ? 114.74600 87.75100  91.70600  1.000 35.63518  ? 34  ILE B CA    1 
ATOM 847   C C     . ILE B 2 35  ? 113.59000 87.84800  90.72400  1.000 35.63518  ? 34  ILE B C     1 
ATOM 848   O O     . ILE B 2 35  ? 112.69400 88.69100  90.87100  1.000 35.63518  ? 34  ILE B O     1 
ATOM 849   C CB    . ILE B 2 35  ? 116.00200 88.47400  91.18900  1.000 35.63518  ? 34  ILE B CB    1 
ATOM 850   C CG1   . ILE B 2 35  ? 117.10800 88.38900  92.23200  1.000 35.63518  ? 34  ILE B CG1   1 
ATOM 851   C CG2   . ILE B 2 35  ? 115.70700 89.91900  90.87900  1.000 35.63518  ? 34  ILE B CG2   1 
ATOM 852   C CD1   . ILE B 2 35  ? 118.38000 89.04300  91.81400  1.000 35.63518  ? 34  ILE B CD1   1 
ATOM 853   N N     . ARG B 2 36  ? 113.57400 86.96200  89.72900  1.000 38.00827  ? 35  ARG B N     1 
ATOM 854   C CA    . ARG B 2 36  ? 112.47300 86.91100  88.77800  1.000 38.00827  ? 35  ARG B CA    1 
ATOM 855   C C     . ARG B 2 36  ? 111.17600 86.48400  89.45100  1.000 38.00827  ? 35  ARG B C     1 
ATOM 856   O O     . ARG B 2 36  ? 110.11300 87.00500  89.11900  1.000 38.00827  ? 35  ARG B O     1 
ATOM 857   C CB    . ARG B 2 36  ? 112.82900 85.98100  87.62500  1.000 38.00827  ? 35  ARG B CB    1 
ATOM 858   C CG    . ARG B 2 36  ? 111.77900 85.85600  86.56100  1.000 38.00827  ? 35  ARG B CG    1 
ATOM 859   C CD    . ARG B 2 36  ? 112.25700 84.93500  85.47200  1.000 38.00827  ? 35  ARG B CD    1 
ATOM 860   N NE    . ARG B 2 36  ? 113.37000 85.52500  84.74300  1.000 38.00827  ? 35  ARG B NE    1 
ATOM 861   C CZ    . ARG B 2 36  ? 114.04700 84.89700  83.79200  1.000 38.00827  ? 35  ARG B CZ    1 
ATOM 862   N NH1   . ARG B 2 36  ? 115.04900 85.50600  83.17300  1.000 38.00827  ? 35  ARG B NH1   1 
ATOM 863   N NH2   . ARG B 2 36  ? 113.72600 83.65400  83.46400  1.000 38.00827  ? 35  ARG B NH2   1 
ATOM 864   N N     . ARG B 2 37  ? 111.24300 85.57300  90.42500  1.000 36.67307  ? 36  ARG B N     1 
ATOM 865   C CA    . ARG B 2 37  ? 110.03900 85.19200  91.16400  1.000 36.67307  ? 36  ARG B CA    1 
ATOM 866   C C     . ARG B 2 37  ? 109.51600 86.33800  92.02400  1.000 36.67307  ? 36  ARG B C     1 
ATOM 867   O O     . ARG B 2 37  ? 108.29900 86.53300  92.12600  1.000 36.67307  ? 36  ARG B O     1 
ATOM 868   C CB    . ARG B 2 37  ? 110.31000 83.97300  92.03800  1.000 36.67307  ? 36  ARG B CB    1 
ATOM 869   C CG    . ARG B 2 37  ? 110.14700 82.64800  91.34000  1.000 36.67307  ? 36  ARG B CG    1 
ATOM 870   C CD    . ARG B 2 37  ? 110.02300 81.53400  92.35800  1.000 36.67307  ? 36  ARG B CD    1 
ATOM 871   N NE    . ARG B 2 37  ? 111.21200 81.42200  93.19200  1.000 36.67307  ? 36  ARG B NE    1 
ATOM 872   C CZ    . ARG B 2 37  ? 112.26900 80.68100  92.88400  1.000 36.67307  ? 36  ARG B CZ    1 
ATOM 873   N NH1   . ARG B 2 37  ? 112.28300 79.98100  91.76100  1.000 36.67307  ? 36  ARG B NH1   1 
ATOM 874   N NH2   . ARG B 2 37  ? 113.31100 80.63900  93.70100  1.000 36.67307  ? 36  ARG B NH2   1 
ATOM 875   N N     . LEU B 2 38  ? 110.41600 87.11000  92.64100  1.000 33.75698  ? 37  LEU B N     1 
ATOM 876   C CA    . LEU B 2 38  ? 109.99100 88.29100  93.39200  1.000 33.75698  ? 37  LEU B CA    1 
ATOM 877   C C     . LEU B 2 38  ? 109.35300 89.33700  92.48400  1.000 33.75698  ? 37  LEU B C     1 
ATOM 878   O O     . LEU B 2 38  ? 108.34500 89.95800  92.84900  1.000 33.75698  ? 37  LEU B O     1 
ATOM 879   C CB    . LEU B 2 38  ? 111.17500 88.89900  94.13400  1.000 33.75698  ? 37  LEU B CB    1 
ATOM 880   C CG    . LEU B 2 38  ? 111.69700 88.08200  95.30200  1.000 33.75698  ? 37  LEU B CG    1 
ATOM 881   C CD1   . LEU B 2 38  ? 113.12500 88.45600  95.57200  1.000 33.75698  ? 37  LEU B CD1   1 
ATOM 882   C CD2   . LEU B 2 38  ? 110.84400 88.32000  96.51700  1.000 33.75698  ? 37  LEU B CD2   1 
ATOM 883   N N     . ALA B 2 39  ? 109.90200 89.51800  91.28300  1.000 35.31328  ? 38  ALA B N     1 
ATOM 884   C CA    . ALA B 2 39  ? 109.32900 90.49300  90.36200  1.000 35.31328  ? 38  ALA B CA    1 
ATOM 885   C C     . ALA B 2 39  ? 107.99600 90.01500  89.80200  1.000 35.31328  ? 38  ALA B C     1 
ATOM 886   O O     . ALA B 2 39  ? 107.07700 90.81800  89.62000  1.000 35.31328  ? 38  ALA B O     1 
ATOM 887   C CB    . ALA B 2 39  ? 110.31300 90.79600  89.23800  1.000 35.31328  ? 38  ALA B CB    1 
ATOM 888   N N     . ARG B 2 40  ? 107.85800 88.71300  89.54300  1.000 38.03394  ? 39  ARG B N     1 
ATOM 889   C CA    . ARG B 2 40  ? 106.58500 88.20300  89.05000  1.000 38.03394  ? 39  ARG B CA    1 
ATOM 890   C C     . ARG B 2 40  ? 105.52500 88.22100  90.13900  1.000 38.03394  ? 39  ARG B C     1 
ATOM 891   O O     . ARG B 2 40  ? 104.33300 88.32000  89.83500  1.000 38.03394  ? 39  ARG B O     1 
ATOM 892   C CB    . ARG B 2 40  ? 106.75500 86.79500  88.49100  1.000 38.03394  ? 39  ARG B CB    1 
ATOM 893   C CG    . ARG B 2 40  ? 107.56900 86.72000  87.21800  1.000 38.03394  ? 39  ARG B CG    1 
ATOM 894   C CD    . ARG B 2 40  ? 106.80800 87.16800  86.00900  1.000 38.03394  ? 39  ARG B CD    1 
ATOM 895   N NE    . ARG B 2 40  ? 107.68400 87.40600  84.87000  1.000 38.03394  ? 39  ARG B NE    1 
ATOM 896   C CZ    . ARG B 2 40  ? 108.07700 86.46700  84.01900  1.000 38.03394  ? 39  ARG B CZ    1 
ATOM 897   N NH1   . ARG B 2 40  ? 107.67300 85.21600  84.17500  1.000 38.03394  ? 39  ARG B NH1   1 
ATOM 898   N NH2   . ARG B 2 40  ? 108.87600 86.78000  83.00900  1.000 38.03394  ? 39  ARG B NH2   1 
ATOM 899   N N     . ARG B 2 41  ? 105.93100 88.12400  91.40700  1.000 35.19532  ? 40  ARG B N     1 
ATOM 900   C CA    . ARG B 2 41  ? 104.98100 88.36700  92.48400  1.000 35.19532  ? 40  ARG B CA    1 
ATOM 901   C C     . ARG B 2 41  ? 104.59300 89.83800  92.52500  1.000 35.19532  ? 40  ARG B C     1 
ATOM 902   O O     . ARG B 2 41  ? 103.43200 90.17700  92.78200  1.000 35.19532  ? 40  ARG B O     1 
ATOM 903   C CB    . ARG B 2 41  ? 105.57000 87.92300  93.82100  1.000 35.19532  ? 40  ARG B CB    1 
ATOM 904   C CG    . ARG B 2 41  ? 104.67600 88.19700  95.00400  1.000 35.19532  ? 40  ARG B CG    1 
ATOM 905   C CD    . ARG B 2 41  ? 105.14700 87.50600  96.25000  1.000 35.19532  ? 40  ARG B CD    1 
ATOM 906   N NE    . ARG B 2 41  ? 104.82600 86.08900  96.23500  1.000 35.19532  ? 40  ARG B NE    1 
ATOM 907   C CZ    . ARG B 2 41  ? 104.95900 85.29200  97.28600  1.000 35.19532  ? 40  ARG B CZ    1 
ATOM 908   N NH1   . ARG B 2 41  ? 105.40800 85.77900  98.43100  1.000 35.19532  ? 40  ARG B NH1   1 
ATOM 909   N NH2   . ARG B 2 41  ? 104.64400 84.01000  97.19300  1.000 35.19532  ? 40  ARG B NH2   1 
ATOM 910   N N     . GLY B 2 42  ? 105.54000 90.72500  92.21600  1.000 33.61746  ? 41  GLY B N     1 
ATOM 911   C CA    . GLY B 2 42  ? 105.24600 92.14800  92.15600  1.000 33.61746  ? 41  GLY B CA    1 
ATOM 912   C C     . GLY B 2 42  ? 104.41300 92.58500  90.96400  1.000 33.61746  ? 41  GLY B C     1 
ATOM 913   O O     . GLY B 2 42  ? 104.04900 93.76300  90.89200  1.000 33.61746  ? 41  GLY B O     1 
ATOM 914   N N     . GLY B 2 43  ? 104.11800 91.68700  90.03100  1.000 35.08358  ? 42  GLY B N     1 
ATOM 915   C CA    . GLY B 2 43  ? 103.31200 92.01300  88.87600  1.000 35.08358  ? 42  GLY B CA    1 
ATOM 916   C C     . GLY B 2 43  ? 104.08400 92.35300  87.62500  1.000 35.08358  ? 42  GLY B C     1 
ATOM 917   O O     . GLY B 2 43  ? 103.47600 92.79600  86.64700  1.000 35.08358  ? 42  GLY B O     1 
ATOM 918   N N     . VAL B 2 44  ? 105.39400 92.16000  87.62600  1.000 35.18215  ? 43  VAL B N     1 
ATOM 919   C CA    . VAL B 2 44  ? 106.25300 92.58900  86.53000  1.000 35.18215  ? 43  VAL B CA    1 
ATOM 920   C C     . VAL B 2 44  ? 106.16100 91.60900  85.37100  1.000 35.18215  ? 43  VAL B C     1 
ATOM 921   O O     . VAL B 2 44  ? 106.34300 90.40100  85.54800  1.000 35.18215  ? 43  VAL B O     1 
ATOM 922   C CB    . VAL B 2 44  ? 107.69800 92.73500  87.01300  1.000 35.18215  ? 43  VAL B CB    1 
ATOM 923   C CG1   . VAL B 2 44  ? 108.56000 93.16100  85.87900  1.000 35.18215  ? 43  VAL B CG1   1 
ATOM 924   C CG2   . VAL B 2 44  ? 107.76800 93.73500  88.14400  1.000 35.18215  ? 43  VAL B CG2   1 
ATOM 925   N N     . LYS B 2 45  ? 105.88100 92.12700  84.17600  1.000 41.34405  ? 44  LYS B N     1 
ATOM 926   C CA    . LYS B 2 45  ? 105.71400 91.26600  83.01300  1.000 41.34405  ? 44  LYS B CA    1 
ATOM 927   C C     . LYS B 2 45  ? 107.06000 90.88000  82.40600  1.000 41.34405  ? 44  LYS B C     1 
ATOM 928   O O     . LYS B 2 45  ? 107.34500 89.69200  82.23000  1.000 41.34405  ? 44  LYS B O     1 
ATOM 929   C CB    . LYS B 2 45  ? 104.82300 91.96300  81.98500  1.000 41.34405  ? 44  LYS B CB    1 
ATOM 930   C CG    . LYS B 2 45  ? 104.71100 91.25200  80.65400  1.000 41.34405  ? 44  LYS B CG    1 
ATOM 931   C CD    . LYS B 2 45  ? 103.90900 92.08800  79.66900  1.000 41.34405  ? 44  LYS B CD    1 
ATOM 932   C CE    . LYS B 2 45  ? 103.71900 91.36400  78.35000  1.000 41.34405  ? 44  LYS B CE    1 
ATOM 933   N NZ    . LYS B 2 45  ? 102.81600 92.11000  77.43500  1.000 41.34405  ? 44  LYS B NZ    1 
ATOM 934   N N     . ARG B 2 46  ? 107.90300 91.86100  82.08400  1.000 41.54501  ? 45  ARG B N     1 
ATOM 935   C CA    . ARG B 2 46  ? 109.23900 91.60500  81.56200  1.000 41.54501  ? 45  ARG B CA    1 
ATOM 936   C C     . ARG B 2 46  ? 110.30100 92.27200  82.42000  1.000 41.54501  ? 45  ARG B C     1 
ATOM 937   O O     . ARG B 2 46  ? 110.08800 93.34900  82.97600  1.000 41.54501  ? 45  ARG B O     1 
ATOM 938   C CB    . ARG B 2 46  ? 109.39500 92.08500  80.12900  1.000 41.54501  ? 45  ARG B CB    1 
ATOM 939   C CG    . ARG B 2 46  ? 108.42100 91.47500  79.17500  1.000 41.54501  ? 45  ARG B CG    1 
ATOM 940   C CD    . ARG B 2 46  ? 108.63900 92.03100  77.80100  1.000 41.54501  ? 45  ARG B CD    1 
ATOM 941   N NE    . ARG B 2 46  ? 109.89800 91.60800  77.19900  1.000 41.54501  ? 45  ARG B NE    1 
ATOM 942   C CZ    . ARG B 2 46  ? 110.02400 90.54000  76.41900  1.000 41.54501  ? 45  ARG B CZ    1 
ATOM 943   N NH1   . ARG B 2 46  ? 108.96800 89.78500  76.15700  1.000 41.54501  ? 45  ARG B NH1   1 
ATOM 944   N NH2   . ARG B 2 46  ? 111.20200 90.22600  75.90000  1.000 41.54501  ? 45  ARG B NH2   1 
ATOM 945   N N     . ILE B 2 47  ? 111.46000 91.62400  82.50100  1.000 40.32283  ? 46  ILE B N     1 
ATOM 946   C CA    . ILE B 2 47  ? 112.56100 92.03000  83.36700  1.000 40.32283  ? 46  ILE B CA    1 
ATOM 947   C C     . ILE B 2 47  ? 113.82200 92.09900  82.51600  1.000 40.32283  ? 46  ILE B C     1 
ATOM 948   O O     . ILE B 2 47  ? 114.14800 91.13100  81.82300  1.000 40.32283  ? 46  ILE B O     1 
ATOM 949   C CB    . ILE B 2 47  ? 112.75000 91.02300  84.51800  1.000 40.32283  ? 46  ILE B CB    1 
ATOM 950   C CG1   . ILE B 2 47  ? 111.50300 90.94600  85.39200  1.000 40.32283  ? 46  ILE B CG1   1 
ATOM 951   C CG2   . ILE B 2 47  ? 113.91900 91.39700  85.37600  1.000 40.32283  ? 46  ILE B CG2   1 
ATOM 952   C CD1   . ILE B 2 47  ? 111.18300 89.55000  85.84400  1.000 40.32283  ? 46  ILE B CD1   1 
ATOM 953   N N     . SER B 2 48  ? 114.53500 93.22300  82.56300  1.000 37.15257  ? 47  SER B N     1 
ATOM 954   C CA    . SER B 2 48  ? 115.80400 93.27500  81.85000  1.000 37.15257  ? 47  SER B CA    1 
ATOM 955   C C     . SER B 2 48  ? 116.88000 92.49500  82.59800  1.000 37.15257  ? 47  SER B C     1 
ATOM 956   O O     . SER B 2 48  ? 116.72700 92.12600  83.76100  1.000 37.15257  ? 47  SER B O     1 
ATOM 957   C CB    . SER B 2 48  ? 116.27200 94.71000  81.64200  1.000 37.15257  ? 47  SER B CB    1 
ATOM 958   O OG    . SER B 2 48  ? 116.45200 95.36700  82.87800  1.000 37.15257  ? 47  SER B OG    1 
ATOM 959   N N     . GLY B 2 49  ? 117.99600 92.26000  81.91300  1.000 37.26862  ? 48  GLY B N     1 
ATOM 960   C CA    . GLY B 2 49  ? 119.10400 91.55500  82.52700  1.000 37.26862  ? 48  GLY B CA    1 
ATOM 961   C C     . GLY B 2 49  ? 119.89600 92.37200  83.52400  1.000 37.26862  ? 48  GLY B C     1 
ATOM 962   O O     . GLY B 2 49  ? 120.70400 91.79700  84.26000  1.000 37.26862  ? 48  GLY B O     1 
ATOM 963   N N     . LEU B 2 50  ? 119.69500 93.68600  83.56500  1.000 35.19777  ? 49  LEU B N     1 
ATOM 964   C CA    . LEU B 2 50  ? 120.40100 94.54000  84.50700  1.000 35.19777  ? 49  LEU B CA    1 
ATOM 965   C C     . LEU B 2 50  ? 119.65000 94.72300  85.81700  1.000 35.19777  ? 49  LEU B C     1 
ATOM 966   O O     . LEU B 2 50  ? 120.12600 95.45500  86.68800  1.000 35.19777  ? 49  LEU B O     1 
ATOM 967   C CB    . LEU B 2 50  ? 120.67400 95.90800  83.87600  1.000 35.19777  ? 49  LEU B CB    1 
ATOM 968   C CG    . LEU B 2 50  ? 121.13600 95.92300  82.42000  1.000 35.19777  ? 49  LEU B CG    1 
ATOM 969   C CD1   . LEU B 2 50  ? 121.24100 97.34700  81.92100  1.000 35.19777  ? 49  LEU B CD1   1 
ATOM 970   C CD2   . LEU B 2 50  ? 122.46200 95.20900  82.26300  1.000 35.19777  ? 49  LEU B CD2   1 
ATOM 971   N N     . ILE B 2 51  ? 118.49900 94.07200  85.98100  1.000 34.53456  ? 50  ILE B N     1 
ATOM 972   C CA    . ILE B 2 51  ? 117.77200 94.13500  87.24500  1.000 34.53456  ? 50  ILE B CA    1 
ATOM 973   C C     . ILE B 2 51  ? 118.46400 93.28500  88.30000  1.000 34.53456  ? 50  ILE B C     1 
ATOM 974   O O     . ILE B 2 51  ? 118.53400 93.66600  89.47500  1.000 34.53456  ? 50  ILE B O     1 
ATOM 975   C CB    . ILE B 2 51  ? 116.30800 93.71300  87.02400  1.000 34.53456  ? 50  ILE B CB    1 
ATOM 976   C CG1   . ILE B 2 51  ? 115.60400 94.72600  86.13800  1.000 34.53456  ? 50  ILE B CG1   1 
ATOM 977   C CG2   . ILE B 2 51  ? 115.53400 93.59100  88.31100  1.000 34.53456  ? 50  ILE B CG2   1 
ATOM 978   C CD1   . ILE B 2 51  ? 115.55400 96.10200  86.75600  1.000 34.53456  ? 50  ILE B CD1   1 
ATOM 979   N N     . TYR B 2 52  ? 119.02200 92.14400  87.88700  1.000 36.12939  ? 51  TYR B N     1 
ATOM 980   C CA    . TYR B 2 52  ? 119.56600 91.16800  88.82600  1.000 36.12939  ? 51  TYR B CA    1 
ATOM 981   C C     . TYR B 2 52  ? 120.79700 91.69300  89.55700  1.000 36.12939  ? 51  TYR B C     1 
ATOM 982   O O     . TYR B 2 52  ? 120.97100 91.42400  90.74800  1.000 36.12939  ? 51  TYR B O     1 
ATOM 983   C CB    . TYR B 2 52  ? 119.88800 89.87600  88.08300  1.000 36.12939  ? 51  TYR B CB    1 
ATOM 984   C CG    . TYR B 2 52  ? 118.74600 89.36100  87.23900  1.000 36.12939  ? 51  TYR B CG    1 
ATOM 985   C CD1   . TYR B 2 52  ? 117.46300 89.28100  87.75200  1.000 36.12939  ? 51  TYR B CD1   1 
ATOM 986   C CD2   . TYR B 2 52  ? 118.94900 88.96500  85.92900  1.000 36.12939  ? 51  TYR B CD2   1 
ATOM 987   C CE1   . TYR B 2 52  ? 116.41600 88.81000  86.99000  1.000 36.12939  ? 51  TYR B CE1   1 
ATOM 988   C CE2   . TYR B 2 52  ? 117.90600 88.49500  85.15900  1.000 36.12939  ? 51  TYR B CE2   1 
ATOM 989   C CZ    . TYR B 2 52  ? 116.64400 88.42000  85.69600  1.000 36.12939  ? 51  TYR B CZ    1 
ATOM 990   O OH    . TYR B 2 52  ? 115.60400 87.95500  84.93200  1.000 36.12939  ? 51  TYR B OH    1 
ATOM 991   N N     . GLU B 2 53  ? 121.64800 92.45800  88.88100  1.000 37.46993  ? 52  GLU B N     1 
ATOM 992   C CA    . GLU B 2 53  ? 122.76500 93.08500  89.57600  1.000 37.46993  ? 52  GLU B CA    1 
ATOM 993   C C     . GLU B 2 53  ? 122.38200 94.36000  90.30700  1.000 37.46993  ? 52  GLU B C     1 
ATOM 994   O O     . GLU B 2 53  ? 123.20200 94.88300  91.06500  1.000 37.46993  ? 52  GLU B O     1 
ATOM 995   C CB    . GLU B 2 53  ? 123.91200 93.36700  88.61000  1.000 37.46993  ? 52  GLU B CB    1 
ATOM 996   C CG    . GLU B 2 53  ? 124.68300 92.12600  88.18900  1.000 37.46993  ? 52  GLU B CG    1 
ATOM 997   C CD    . GLU B 2 53  ? 125.75900 91.73100  89.20000  1.000 37.46993  ? 52  GLU B CD    1 
ATOM 998   O OE1   . GLU B 2 53  ? 126.95700 91.87000  88.87400  1.000 37.46993  ? 52  GLU B OE1   1 
ATOM 999   O OE2   . GLU B 2 53  ? 125.42000 91.27300  90.31200  1.000 37.46993  ? 52  GLU B OE2   1 
ATOM 1000  N N     . GLU B 2 54  ? 121.18200 94.88600  90.08600  1.000 37.52285  ? 53  GLU B N     1 
ATOM 1001  C CA    . GLU B 2 54  ? 120.70500 96.02800  90.85100  1.000 37.52285  ? 53  GLU B CA    1 
ATOM 1002  C C     . GLU B 2 54  ? 119.82500 95.62600  92.02500  1.000 37.52285  ? 53  GLU B C     1 
ATOM 1003  O O     . GLU B 2 54  ? 119.89900 96.25500  93.08600  1.000 37.52285  ? 53  GLU B O     1 
ATOM 1004  C CB    . GLU B 2 54  ? 119.93300 96.98500  89.93800  1.000 37.52285  ? 53  GLU B CB    1 
ATOM 1005  C CG    . GLU B 2 54  ? 120.08400 98.45000  90.30100  1.000 37.52285  ? 53  GLU B CG    1 
ATOM 1006  C CD    . GLU B 2 54  ? 119.08900 98.89600  91.34300  1.000 37.52285  ? 53  GLU B CD    1 
ATOM 1007  O OE1   . GLU B 2 54  ? 118.05600 98.21600  91.49000  1.000 37.52285  ? 53  GLU B OE1   1 
ATOM 1008  O OE2   . GLU B 2 54  ? 119.34100 99.91900  92.01400  1.000 37.52285  ? 53  GLU B OE2   1 
ATOM 1009  N N     . THR B 2 55  ? 119.05200 94.54500  91.88200  1.000 35.09764  ? 54  THR B N     1 
ATOM 1010  C CA    . THR B 2 55  ? 118.28900 94.00700  93.00400  1.000 35.09764  ? 54  THR B CA    1 
ATOM 1011  C C     . THR B 2 55  ? 119.19900 93.40600  94.06500  1.000 35.09764  ? 54  THR B C     1 
ATOM 1012  O O     . THR B 2 55  ? 118.89100 93.49000  95.25800  1.000 35.09764  ? 54  THR B O     1 
ATOM 1013  C CB    . THR B 2 55  ? 117.29400 92.96700  92.48900  1.000 35.09764  ? 54  THR B CB    1 
ATOM 1014  O OG1   . THR B 2 55  ? 116.51100 93.55100  91.44800  1.000 35.09764  ? 54  THR B OG1   1 
ATOM 1015  C CG2   . THR B 2 55  ? 116.36000 92.48900  93.57400  1.000 35.09764  ? 54  THR B CG2   1 
ATOM 1016  N N     . ARG B 2 56  ? 120.33800 92.84100  93.66400  1.000 36.94426  ? 55  ARG B N     1 
ATOM 1017  C CA    . ARG B 2 56  ? 121.29100 92.34700  94.65000  1.000 36.94426  ? 55  ARG B CA    1 
ATOM 1018  C C     . ARG B 2 56  ? 121.91600 93.48900  95.44200  1.000 36.94426  ? 55  ARG B C     1 
ATOM 1019  O O     . ARG B 2 56  ? 122.13100 93.36100  96.65000  1.000 36.94426  ? 55  ARG B O     1 
ATOM 1020  C CB    . ARG B 2 56  ? 122.36500 91.50900  93.96700  1.000 36.94426  ? 55  ARG B CB    1 
ATOM 1021  C CG    . ARG B 2 56  ? 121.89100 90.12600  93.61200  1.000 36.94426  ? 55  ARG B CG    1 
ATOM 1022  C CD    . ARG B 2 56  ? 122.84200 89.44100  92.67000  1.000 36.94426  ? 55  ARG B CD    1 
ATOM 1023  N NE    . ARG B 2 56  ? 122.16600 88.37900  91.94200  1.000 36.94426  ? 55  ARG B NE    1 
ATOM 1024  C CZ    . ARG B 2 56  ? 122.58800 87.87800  90.79200  1.000 36.94426  ? 55  ARG B CZ    1 
ATOM 1025  N NH1   . ARG B 2 56  ? 123.69400 88.34000  90.23000  1.000 36.94426  ? 55  ARG B NH1   1 
ATOM 1026  N NH2   . ARG B 2 56  ? 121.90400 86.91300  90.20500  1.000 36.94426  ? 55  ARG B NH2   1 
ATOM 1027  N N     . GLY B 2 57  ? 122.14700 94.63600  94.80100  1.000 34.79435  ? 56  GLY B N     1 
ATOM 1028  C CA    . GLY B 2 57  ? 122.63300 95.79300  95.53600  1.000 34.79435  ? 56  GLY B CA    1 
ATOM 1029  C C     . GLY B 2 57  ? 121.58400 96.39200  96.45500  1.000 34.79435  ? 56  GLY B C     1 
ATOM 1030  O O     . GLY B 2 57  ? 121.89900 96.83800  97.56300  1.000 34.79435  ? 56  GLY B O     1 
ATOM 1031  N N     . VAL B 2 58  ? 120.32300 96.39600  96.01400  1.000 33.72395  ? 57  VAL B N     1 
ATOM 1032  C CA    . VAL B 2 58  ? 119.23100 96.87200  96.86400  1.000 33.72395  ? 57  VAL B CA    1 
ATOM 1033  C C     . VAL B 2 58  ? 119.04800 95.95900  98.07400  1.000 33.72395  ? 57  VAL B C     1 
ATOM 1034  O O     . VAL B 2 58  ? 118.84800 96.43200  99.20200  1.000 33.72395  ? 57  VAL B O     1 
ATOM 1035  C CB    . VAL B 2 58  ? 117.93800 96.99800  96.03500  1.000 33.72395  ? 57  VAL B CB    1 
ATOM 1036  C CG1   . VAL B 2 58  ? 116.76000 97.28000  96.91900  1.000 33.72395  ? 57  VAL B CG1   1 
ATOM 1037  C CG2   . VAL B 2 58  ? 118.07200 98.12000  95.03900  1.000 33.72395  ? 57  VAL B CG2   1 
ATOM 1038  N N     . LEU B 2 59  ? 119.17400 94.64500  97.87200  1.000 34.21765  ? 58  LEU B N     1 
ATOM 1039  C CA    . LEU B 2 59  ? 119.08300 93.70300  98.98100  1.000 34.21765  ? 58  LEU B CA    1 
ATOM 1040  C C     . LEU B 2 59  ? 120.27300 93.83500  99.92100  1.000 34.21765  ? 58  LEU B C     1 
ATOM 1041  O O     . LEU B 2 59  ? 120.11600 93.69900  101.13700 1.000 34.21765  ? 58  LEU B O     1 
ATOM 1042  C CB    . LEU B 2 59  ? 118.98300 92.27700  98.44800  1.000 34.21765  ? 58  LEU B CB    1 
ATOM 1043  C CG    . LEU B 2 59  ? 118.73200 91.18800  99.48600  1.000 34.21765  ? 58  LEU B CG    1 
ATOM 1044  C CD1   . LEU B 2 59  ? 117.40400 91.42500  100.16100 1.000 34.21765  ? 58  LEU B CD1   1 
ATOM 1045  C CD2   . LEU B 2 59  ? 118.77300 89.81900  98.84700  1.000 34.21765  ? 58  LEU B CD2   1 
ATOM 1046  N N     . LYS B 2 60  ? 121.46300 94.11500  99.37500  1.000 34.86632  ? 59  LYS B N     1 
ATOM 1047  C CA    . LYS B 2 60  ? 122.63800 94.39000  100.19900 1.000 34.86632  ? 59  LYS B CA    1 
ATOM 1048  C C     . LYS B 2 60  ? 122.42000 95.60300  101.09000 1.000 34.86632  ? 59  LYS B C     1 
ATOM 1049  O O     . LYS B 2 60  ? 122.71100 95.56100  102.28700 1.000 34.86632  ? 59  LYS B O     1 
ATOM 1050  C CB    . LYS B 2 60  ? 123.86500 94.61200  99.31600  1.000 34.86632  ? 59  LYS B CB    1 
ATOM 1051  C CG    . LYS B 2 60  ? 124.57800 93.35600  98.87000  1.000 34.86632  ? 59  LYS B CG    1 
ATOM 1052  C CD    . LYS B 2 60  ? 125.56700 92.90700  99.91300  1.000 34.86632  ? 59  LYS B CD    1 
ATOM 1053  C CE    . LYS B 2 60  ? 126.65300 93.94700  100.11400 1.000 34.86632  ? 59  LYS B CE    1 
ATOM 1054  N NZ    . LYS B 2 60  ? 127.65500 93.50300  101.12000 1.000 34.86632  ? 59  LYS B NZ    1 
ATOM 1055  N N     . VAL B 2 61  ? 121.87000 96.68100  100.52500 1.000 34.35954  ? 60  VAL B N     1 
ATOM 1056  C CA    . VAL B 2 61  ? 121.66300 97.90700  101.29500 1.000 34.35954  ? 60  VAL B CA    1 
ATOM 1057  C C     . VAL B 2 61  ? 120.57900 97.71300  102.35400 1.000 34.35954  ? 60  VAL B C     1 
ATOM 1058  O O     . VAL B 2 61  ? 120.74300 98.13800  103.50800 1.000 34.35954  ? 60  VAL B O     1 
ATOM 1059  C CB    . VAL B 2 61  ? 121.34300 99.07100  100.34000 1.000 34.35954  ? 60  VAL B CB    1 
ATOM 1060  C CG1   . VAL B 2 61  ? 120.83300 100.28000 101.09200 1.000 34.35954  ? 60  VAL B CG1   1 
ATOM 1061  C CG2   . VAL B 2 61  ? 122.58000 99.43900  99.55300  1.000 34.35954  ? 60  VAL B CG2   1 
ATOM 1062  N N     . PHE B 2 62  ? 119.48900 97.02000  102.00100 1.000 31.74452  ? 61  PHE B N     1 
ATOM 1063  C CA    . PHE B 2 62  ? 118.42400 96.75100  102.96700 1.000 31.74452  ? 61  PHE B CA    1 
ATOM 1064  C C     . PHE B 2 62  ? 118.90500 95.85500  104.10100 1.000 31.74452  ? 61  PHE B C     1 
ATOM 1065  O O     . PHE B 2 62  ? 118.61300 96.12100  105.27200 1.000 31.74452  ? 61  PHE B O     1 
ATOM 1066  C CB    . PHE B 2 62  ? 117.21800 96.11000  102.27900 1.000 31.74452  ? 61  PHE B CB    1 
ATOM 1067  C CG    . PHE B 2 62  ? 116.09200 95.77300  103.22000 1.000 31.74452  ? 61  PHE B CG    1 
ATOM 1068  C CD1   . PHE B 2 62  ? 115.22700 96.76000  103.65700 1.000 31.74452  ? 61  PHE B CD1   1 
ATOM 1069  C CD2   . PHE B 2 62  ? 115.89600 94.47700  103.67000 1.000 31.74452  ? 61  PHE B CD2   1 
ATOM 1070  C CE1   . PHE B 2 62  ? 114.19400 96.46400  104.52200 1.000 31.74452  ? 61  PHE B CE1   1 
ATOM 1071  C CE2   . PHE B 2 62  ? 114.87300 94.18400  104.54500 1.000 31.74452  ? 61  PHE B CE2   1 
ATOM 1072  C CZ    . PHE B 2 62  ? 114.01600 95.17500  104.96000 1.000 31.74452  ? 61  PHE B CZ    1 
ATOM 1073  N N     . LEU B 2 63  ? 119.63700 94.78700  103.77700 1.000 31.80920  ? 62  LEU B N     1 
ATOM 1074  C CA    . LEU B 2 63  ? 120.09700 93.88900  104.82400 1.000 31.80920  ? 62  LEU B CA    1 
ATOM 1075  C C     . LEU B 2 63  ? 121.18800 94.52000  105.66700 1.000 31.80920  ? 62  LEU B C     1 
ATOM 1076  O O     . LEU B 2 63  ? 121.28000 94.21200  106.85300 1.000 31.80920  ? 62  LEU B O     1 
ATOM 1077  C CB    . LEU B 2 63  ? 120.59200 92.57600  104.23300 1.000 31.80920  ? 62  LEU B CB    1 
ATOM 1078  C CG    . LEU B 2 63  ? 119.55900 91.61000  103.67500 1.000 31.80920  ? 62  LEU B CG    1 
ATOM 1079  C CD1   . LEU B 2 63  ? 120.21100 90.27400  103.44600 1.000 31.80920  ? 62  LEU B CD1   1 
ATOM 1080  C CD2   . LEU B 2 63  ? 118.38900 91.48400  104.60100 1.000 31.80920  ? 62  LEU B CD2   1 
ATOM 1081  N N     . GLU B 2 64  ? 121.99700 95.41800  105.09800 1.000 35.53832  ? 63  GLU B N     1 
ATOM 1082  C CA    . GLU B 2 64  ? 122.94500 96.16400  105.91700 1.000 35.53832  ? 63  GLU B CA    1 
ATOM 1083  C C     . GLU B 2 64  ? 122.21700 97.06700  106.89800 1.000 35.53832  ? 63  GLU B C     1 
ATOM 1084  O O     . GLU B 2 64  ? 122.55500 97.09500  108.08600 1.000 35.53832  ? 63  GLU B O     1 
ATOM 1085  C CB    . GLU B 2 64  ? 123.88600 96.98400  105.03800 1.000 35.53832  ? 63  GLU B CB    1 
ATOM 1086  C CG    . GLU B 2 64  ? 125.04600 96.19900  104.45400 1.000 35.53832  ? 63  GLU B CG    1 
ATOM 1087  C CD    . GLU B 2 64  ? 125.73700 96.94300  103.33300 1.000 35.53832  ? 63  GLU B CD    1 
ATOM 1088  O OE1   . GLU B 2 64  ? 125.37800 98.11100  103.08200 1.000 35.53832  ? 63  GLU B OE1   1 
ATOM 1089  O OE2   . GLU B 2 64  ? 126.63300 96.35900  102.69000 1.000 35.53832  ? 63  GLU B OE2   1 
ATOM 1090  N N     . ASN B 2 65  ? 121.17100 97.75500  106.43200 1.000 33.98085  ? 64  ASN B N     1 
ATOM 1091  C CA    . ASN B 2 65  ? 120.42700 98.66200  107.30000 1.000 33.98085  ? 64  ASN B CA    1 
ATOM 1092  C C     . ASN B 2 65  ? 119.64300 97.93000  108.38500 1.000 33.98085  ? 64  ASN B C     1 
ATOM 1093  O O     . ASN B 2 65  ? 119.47900 98.46700  109.48400 1.000 33.98085  ? 64  ASN B O     1 
ATOM 1094  C CB    . ASN B 2 65  ? 119.48200 99.52300  106.46700 1.000 33.98085  ? 64  ASN B CB    1 
ATOM 1095  C CG    . ASN B 2 65  ? 120.20700 100.59500 105.69300 1.000 33.98085  ? 64  ASN B CG    1 
ATOM 1096  O OD1   . ASN B 2 65  ? 121.42700 100.55700 105.55200 1.000 33.98085  ? 64  ASN B OD1   1 
ATOM 1097  N ND2   . ASN B 2 65  ? 119.45900 101.56400 105.18400 1.000 33.98085  ? 64  ASN B ND2   1 
ATOM 1098  N N     . VAL B 2 66  ? 119.15300 96.72000  108.11400 1.000 31.72065  ? 65  VAL B N     1 
ATOM 1099  C CA    . VAL B 2 66  ? 118.40800 96.00600  109.15000 1.000 31.72065  ? 65  VAL B CA    1 
ATOM 1100  C C     . VAL B 2 66  ? 119.35100 95.25000  110.08000 1.000 31.72065  ? 65  VAL B C     1 
ATOM 1101  O O     . VAL B 2 66  ? 119.15500 95.23200  111.30000 1.000 31.72065  ? 65  VAL B O     1 
ATOM 1102  C CB    . VAL B 2 66  ? 117.35700 95.07200  108.52300 1.000 31.72065  ? 65  VAL B CB    1 
ATOM 1103  C CG1   . VAL B 2 66  ? 116.55900 94.36700  109.59100 1.000 31.72065  ? 65  VAL B CG1   1 
ATOM 1104  C CG2   . VAL B 2 66  ? 116.40800 95.86000  107.66700 1.000 31.72065  ? 65  VAL B CG2   1 
ATOM 1105  N N     . ILE B 2 67  ? 120.41000 94.65100  109.53600 1.000 32.96384  ? 66  ILE B N     1 
ATOM 1106  C CA    . ILE B 2 67  ? 121.31900 93.84900  110.33800 1.000 32.96384  ? 66  ILE B CA    1 
ATOM 1107  C C     . ILE B 2 67  ? 122.19500 94.73100  111.22300 1.000 32.96384  ? 66  ILE B C     1 
ATOM 1108  O O     . ILE B 2 67  ? 122.53100 94.33600  112.34300 1.000 32.96384  ? 66  ILE B O     1 
ATOM 1109  C CB    . ILE B 2 67  ? 122.11100 92.92700  109.38700 1.000 32.96384  ? 66  ILE B CB    1 
ATOM 1110  C CG1   . ILE B 2 67  ? 121.24400 91.73500  108.98900 1.000 32.96384  ? 66  ILE B CG1   1 
ATOM 1111  C CG2   . ILE B 2 67  ? 123.39900 92.42100  109.98200 1.000 32.96384  ? 66  ILE B CG2   1 
ATOM 1112  C CD1   . ILE B 2 67  ? 121.83700 90.88800  107.90600 1.000 32.96384  ? 66  ILE B CD1   1 
ATOM 1113  N N     . ARG B 2 68  ? 122.49600 95.96500  110.79900 1.000 35.19948  ? 67  ARG B N     1 
ATOM 1114  C CA    . ARG B 2 68  ? 123.22800 96.88500  111.66700 1.000 35.19948  ? 67  ARG B CA    1 
ATOM 1115  C C     . ARG B 2 68  ? 122.41200 97.27400  112.89500 1.000 35.19948  ? 67  ARG B C     1 
ATOM 1116  O O     . ARG B 2 68  ? 122.93500 97.28100  114.01500 1.000 35.19948  ? 67  ARG B O     1 
ATOM 1117  C CB    . ARG B 2 68  ? 123.63800 98.12800  110.88300 1.000 35.19948  ? 67  ARG B CB    1 
ATOM 1118  C CG    . ARG B 2 68  ? 124.42500 99.13800  111.69500 1.000 35.19948  ? 67  ARG B CG    1 
ATOM 1119  C CD    . ARG B 2 68  ? 125.04000 100.22000 110.82400 1.000 35.19948  ? 67  ARG B CD    1 
ATOM 1120  N NE    . ARG B 2 68  ? 124.03000 101.11100 110.26600 1.000 35.19948  ? 67  ARG B NE    1 
ATOM 1121  C CZ    . ARG B 2 68  ? 123.67100 101.11900 108.98800 1.000 35.19948  ? 67  ARG B CZ    1 
ATOM 1122  N NH1   . ARG B 2 68  ? 124.24600 100.28900 108.13300 1.000 35.19948  ? 67  ARG B NH1   1 
ATOM 1123  N NH2   . ARG B 2 68  ? 122.73800 101.96100 108.56600 1.000 35.19948  ? 67  ARG B NH2   1 
ATOM 1124  N N     . ASP B 2 69  ? 121.11300 97.52200  112.72200 1.000 33.31941  ? 68  ASP B N     1 
ATOM 1125  C CA    . ASP B 2 69  ? 120.27000 97.83500  113.87200 1.000 33.31941  ? 68  ASP B CA    1 
ATOM 1126  C C     . ASP B 2 69  ? 120.01500 96.60700  114.74000 1.000 33.31941  ? 68  ASP B C     1 
ATOM 1127  O O     . ASP B 2 69  ? 119.94500 96.71900  115.96900 1.000 33.31941  ? 68  ASP B O     1 
ATOM 1128  C CB    . ASP B 2 69  ? 118.94600 98.43600  113.40700 1.000 33.31941  ? 68  ASP B CB    1 
ATOM 1129  C CG    . ASP B 2 69  ? 119.12100 99.73500  112.66200 1.000 33.31941  ? 68  ASP B CG    1 
ATOM 1130  O OD1   . ASP B 2 69  ? 120.13400 100.42300 112.89700 1.000 33.31941  ? 68  ASP B OD1   1 
ATOM 1131  O OD2   . ASP B 2 69  ? 118.24300 100.07000 111.84300 1.000 33.31941  ? 68  ASP B OD2   1 
ATOM 1132  N N     . ALA B 2 70  ? 119.89100 95.42500  114.12900 1.000 32.28729  ? 69  ALA B N     1 
ATOM 1133  C CA    . ALA B 2 70  ? 119.65300 94.21900  114.91800 1.000 32.28729  ? 69  ALA B CA    1 
ATOM 1134  C C     . ALA B 2 70  ? 120.88700 93.83200  115.72000 1.000 32.28729  ? 69  ALA B C     1 
ATOM 1135  O O     . ALA B 2 70  ? 120.77600 93.41000  116.87400 1.000 32.28729  ? 69  ALA B O     1 
ATOM 1136  C CB    . ALA B 2 70  ? 119.22200 93.07200  114.01000 1.000 32.28729  ? 69  ALA B CB    1 
ATOM 1137  N N     . VAL B 2 71  ? 122.07200 94.02100  115.14200 1.000 31.72940  ? 70  VAL B N     1 
ATOM 1138  C CA    . VAL B 2 71  ? 123.32100 93.77900  115.85000 1.000 31.72940  ? 70  VAL B CA    1 
ATOM 1139  C C     . VAL B 2 71  ? 123.55100 94.84800  116.91000 1.000 31.72940  ? 70  VAL B C     1 
ATOM 1140  O O     . VAL B 2 71  ? 124.10200 94.55900  117.97400 1.000 31.72940  ? 70  VAL B O     1 
ATOM 1141  C CB    . VAL B 2 71  ? 124.45600 93.67900  114.81100 1.000 31.72940  ? 70  VAL B CB    1 
ATOM 1142  C CG1   . VAL B 2 71  ? 125.83300 93.87800  115.40800 1.000 31.72940  ? 70  VAL B CG1   1 
ATOM 1143  C CG2   . VAL B 2 71  ? 124.39800 92.33100  114.15100 1.000 31.72940  ? 70  VAL B CG2   1 
ATOM 1144  N N     . THR B 2 72  ? 123.06100 96.07200  116.68600 1.000 31.78180  ? 71  THR B N     1 
ATOM 1145  C CA    . THR B 2 72  ? 123.12800 97.09900  117.72300 1.000 31.78180  ? 71  THR B CA    1 
ATOM 1146  C C     . THR B 2 72  ? 122.24000 96.76500  118.92100 1.000 31.78180  ? 71  THR B C     1 
ATOM 1147  O O     . THR B 2 72  ? 122.67100 96.90800  120.07000 1.000 31.78180  ? 71  THR B O     1 
ATOM 1148  C CB    . THR B 2 72  ? 122.75000 98.45000  117.12100 1.000 31.78180  ? 71  THR B CB    1 
ATOM 1149  O OG1   . THR B 2 72  ? 123.53100 98.67600  115.94400 1.000 31.78180  ? 71  THR B OG1   1 
ATOM 1150  C CG2   . THR B 2 72  ? 123.01100 99.55900  118.09300 1.000 31.78180  ? 71  THR B CG2   1 
ATOM 1151  N N     . TYR B 2 73  ? 121.01900 96.27900  118.67500 1.000 32.42772  ? 72  TYR B N     1 
ATOM 1152  C CA    . TYR B 2 73  ? 120.14600 95.83900  119.76500 1.000 32.42772  ? 72  TYR B CA    1 
ATOM 1153  C C     . TYR B 2 73  ? 120.71400 94.61800  120.48900 1.000 32.42772  ? 72  TYR B C     1 
ATOM 1154  O O     . TYR B 2 73  ? 120.69100 94.54700  121.73200 1.000 32.42772  ? 72  TYR B O     1 
ATOM 1155  C CB    . TYR B 2 73  ? 118.76200 95.50100  119.21200 1.000 32.42772  ? 72  TYR B CB    1 
ATOM 1156  C CG    . TYR B 2 73  ? 117.81800 96.66300  119.04000 1.000 32.42772  ? 72  TYR B CG    1 
ATOM 1157  C CD1   . TYR B 2 73  ? 117.38400 97.39700  120.12600 1.000 32.42772  ? 72  TYR B CD1   1 
ATOM 1158  C CD2   . TYR B 2 73  ? 117.34900 97.01300  117.78400 1.000 32.42772  ? 72  TYR B CD2   1 
ATOM 1159  C CE1   . TYR B 2 73  ? 116.51300 98.45500  119.96600 1.000 32.42772  ? 72  TYR B CE1   1 
ATOM 1160  C CE2   . TYR B 2 73  ? 116.48300 98.06600  117.61300 1.000 32.42772  ? 72  TYR B CE2   1 
ATOM 1161  C CZ    . TYR B 2 73  ? 116.06800 98.78300  118.70800 1.000 32.42772  ? 72  TYR B CZ    1 
ATOM 1162  O OH    . TYR B 2 73  ? 115.20200 99.83700  118.54100 1.000 32.42772  ? 72  TYR B OH    1 
ATOM 1163  N N     . THR B 2 74  ? 121.29000 93.68600  119.72200 1.000 34.19896  ? 73  THR B N     1 
ATOM 1164  C CA    . THR B 2 74  ? 121.87300 92.47400  120.28500 1.000 34.19896  ? 73  THR B CA    1 
ATOM 1165  C C     . THR B 2 74  ? 123.08800 92.79900  121.13800 1.000 34.19896  ? 73  THR B C     1 
ATOM 1166  O O     . THR B 2 74  ? 123.24400 92.24500  122.22500 1.000 34.19896  ? 73  THR B O     1 
ATOM 1167  C CB    . THR B 2 74  ? 122.22700 91.50900  119.15200 1.000 34.19896  ? 73  THR B CB    1 
ATOM 1168  O OG1   . THR B 2 74  ? 121.02100 90.99900  118.57800 1.000 34.19896  ? 73  THR B OG1   1 
ATOM 1169  C CG2   . THR B 2 74  ? 123.05100 90.34000  119.64400 1.000 34.19896  ? 73  THR B CG2   1 
ATOM 1170  N N     . GLU B 2 75  ? 123.95900 93.68700  120.65700 1.000 34.67867  ? 74  GLU B N     1 
ATOM 1171  C CA    . GLU B 2 75  ? 125.11700 94.11400  121.43000 1.000 34.67867  ? 74  GLU B CA    1 
ATOM 1172  C C     . GLU B 2 75  ? 124.71500 94.93800  122.64400 1.000 34.67867  ? 74  GLU B C     1 
ATOM 1173  O O     . GLU B 2 75  ? 125.45600 94.95800  123.63200 1.000 34.67867  ? 74  GLU B O     1 
ATOM 1174  C CB    . GLU B 2 75  ? 126.07000 94.90900  120.54600 1.000 34.67867  ? 74  GLU B CB    1 
ATOM 1175  C CG    . GLU B 2 75  ? 126.93300 94.05500  119.64800 1.000 34.67867  ? 74  GLU B CG    1 
ATOM 1176  C CD    . GLU B 2 75  ? 128.00000 94.86100  118.95000 1.000 34.67867  ? 74  GLU B CD    1 
ATOM 1177  O OE1   . GLU B 2 75  ? 128.90700 94.25300  118.34400 1.000 34.67867  ? 74  GLU B OE1   1 
ATOM 1178  O OE2   . GLU B 2 75  ? 127.93200 96.10600  119.00400 1.000 34.67867  ? 74  GLU B OE2   1 
ATOM 1179  N N     . HIS B 2 76  ? 123.61400 95.70000  122.55700 1.000 33.42594  ? 75  HIS B N     1 
ATOM 1180  C CA    . HIS B 2 76  ? 123.13800 96.43100  123.73000 1.000 33.42594  ? 75  HIS B CA    1 
ATOM 1181  C C     . HIS B 2 76  ? 122.74500 95.47900  124.84100 1.000 33.42594  ? 75  HIS B C     1 
ATOM 1182  O O     . HIS B 2 76  ? 123.03200 95.73200  126.01500 1.000 33.42594  ? 75  HIS B O     1 
ATOM 1183  C CB    . HIS B 2 76  ? 121.95500 97.32900  123.41100 1.000 33.42594  ? 75  HIS B CB    1 
ATOM 1184  C CG    . HIS B 2 76  ? 121.45000 98.06600  124.61100 1.000 33.42594  ? 75  HIS B CG    1 
ATOM 1185  N ND1   . HIS B 2 76  ? 120.34600 97.66400  125.32900 1.000 33.42594  ? 75  HIS B ND1   1 
ATOM 1186  C CD2   . HIS B 2 76  ? 121.93800 99.15200  125.25200 1.000 33.42594  ? 75  HIS B CD2   1 
ATOM 1187  C CE1   . HIS B 2 76  ? 120.15900 98.49000  126.34200 1.000 33.42594  ? 75  HIS B CE1   1 
ATOM 1188  N NE2   . HIS B 2 76  ? 121.11100 99.40100  126.31800 1.000 33.42594  ? 75  HIS B NE2   1 
ATOM 1189  N N     . ALA B 2 77  ? 122.07800 94.38300  124.49600 1.000 35.01432  ? 76  ALA B N     1 
ATOM 1190  C CA    . ALA B 2 77  ? 121.93600 93.38100  125.53700 1.000 35.01432  ? 76  ALA B CA    1 
ATOM 1191  C C     . ALA B 2 77  ? 123.24300 92.60000  125.64200 1.000 35.01432  ? 76  ALA B C     1 
ATOM 1192  O O     . ALA B 2 77  ? 124.11900 92.69900  124.78900 1.000 35.01432  ? 76  ALA B O     1 
ATOM 1193  C CB    . ALA B 2 77  ? 120.76200 92.44900  125.25100 1.000 35.01432  ? 76  ALA B CB    1 
ATOM 1194  N N     . LYS B 2 78  ? 123.43400 91.88700  126.74100 1.000 40.25219  ? 77  LYS B N     1 
ATOM 1195  C CA    . LYS B 2 78  ? 124.68600 91.14300  126.85900 1.000 40.25219  ? 77  LYS B CA    1 
ATOM 1196  C C     . LYS B 2 78  ? 124.49600 89.74300  126.27300 1.000 40.25219  ? 77  LYS B C     1 
ATOM 1197  O O     . LYS B 2 78  ? 124.52900 88.72400  126.96500 1.000 40.25219  ? 77  LYS B O     1 
ATOM 1198  C CB    . LYS B 2 78  ? 125.16100 91.11200  128.30600 1.000 40.25219  ? 77  LYS B CB    1 
ATOM 1199  C CG    . LYS B 2 78  ? 125.38000 92.49600  128.93100 1.000 40.25219  ? 77  LYS B CG    1 
ATOM 1200  C CD    . LYS B 2 78  ? 126.12200 93.45500  128.00500 1.000 40.25219  ? 77  LYS B CD    1 
ATOM 1201  C CE    . LYS B 2 78  ? 127.60800 93.14600  127.94900 1.000 40.25219  ? 77  LYS B CE    1 
ATOM 1202  N NZ    . LYS B 2 78  ? 128.36100 94.17300  127.17900 1.000 40.25219  ? 77  LYS B NZ    1 
ATOM 1203  N N     . ARG B 2 79  ? 124.31200 89.71200  124.95100 1.000 40.96467  ? 78  ARG B N     1 
ATOM 1204  C CA    . ARG B 2 79  ? 124.04700 88.48300  124.21900 1.000 40.96467  ? 78  ARG B CA    1 
ATOM 1205  C C     . ARG B 2 79  ? 124.89800 88.42500  122.96200 1.000 40.96467  ? 78  ARG B C     1 
ATOM 1206  O O     . ARG B 2 79  ? 125.27400 89.45200  122.39400 1.000 40.96467  ? 78  ARG B O     1 
ATOM 1207  C CB    . ARG B 2 79  ? 122.56500 88.33300  123.82300 1.000 40.96467  ? 78  ARG B CB    1 
ATOM 1208  C CG    . ARG B 2 79  ? 121.56700 88.39800  124.96500 1.000 40.96467  ? 78  ARG B CG    1 
ATOM 1209  C CD    . ARG B 2 79  ? 120.19700 87.94700  124.51300 1.000 40.96467  ? 78  ARG B CD    1 
ATOM 1210  N NE    . ARG B 2 79  ? 119.90800 88.39000  123.15700 1.000 40.96467  ? 78  ARG B NE    1 
ATOM 1211  C CZ    . ARG B 2 79  ? 119.17600 89.45800  122.86300 1.000 40.96467  ? 78  ARG B CZ    1 
ATOM 1212  N NH1   . ARG B 2 79  ? 118.64700 90.18700  123.83100 1.000 40.96467  ? 78  ARG B NH1   1 
ATOM 1213  N NH2   . ARG B 2 79  ? 118.96800 89.79100  121.60000 1.000 40.96467  ? 78  ARG B NH2   1 
ATOM 1214  N N     . LYS B 2 80  ? 125.20200 87.20100  122.54200 1.000 45.70760  ? 79  LYS B N     1 
ATOM 1215  C CA    . LYS B 2 80  ? 125.93500 86.93300  121.31400 1.000 45.70760  ? 79  LYS B CA    1 
ATOM 1216  C C     . LYS B 2 80  ? 125.05700 86.24800  120.27800 1.000 45.70760  ? 79  LYS B C     1 
ATOM 1217  O O     . LYS B 2 80  ? 125.56800 85.77500  119.26000 1.000 45.70760  ? 79  LYS B O     1 
ATOM 1218  C CB    . LYS B 2 80  ? 127.17200 86.08400  121.60900 1.000 45.70760  ? 79  LYS B CB    1 
ATOM 1219  C CG    . LYS B 2 80  ? 128.35200 86.88200  122.12500 1.000 45.70760  ? 79  LYS B CG    1 
ATOM 1220  C CD    . LYS B 2 80  ? 129.20800 86.07100  123.07700 1.000 45.70760  ? 79  LYS B CD    1 
ATOM 1221  C CE    . LYS B 2 80  ? 128.52600 85.90100  124.42300 1.000 45.70760  ? 79  LYS B CE    1 
ATOM 1222  N NZ    . LYS B 2 80  ? 129.44200 85.31700  125.44300 1.000 45.70760  ? 79  LYS B NZ    1 
ATOM 1223  N N     . THR B 2 81  ? 123.75100 86.17000  120.52400 1.000 42.29913  ? 80  THR B N     1 
ATOM 1224  C CA    . THR B 2 81  ? 122.79400 85.55000  119.61800 1.000 42.29913  ? 80  THR B CA    1 
ATOM 1225  C C     . THR B 2 81  ? 121.76600 86.58100  119.18200 1.000 42.29913  ? 80  THR B C     1 
ATOM 1226  O O     . THR B 2 81  ? 121.03300 87.11900  120.01600 1.000 42.29913  ? 80  THR B O     1 
ATOM 1227  C CB    . THR B 2 81  ? 122.09900 84.36500  120.28400 1.000 42.29913  ? 80  THR B CB    1 
ATOM 1228  O OG1   . THR B 2 81  ? 123.08100 83.40000  120.67400 1.000 42.29913  ? 80  THR B OG1   1 
ATOM 1229  C CG2   . THR B 2 81  ? 121.11400 83.72200  119.33200 1.000 42.29913  ? 80  THR B CG2   1 
ATOM 1230  N N     . VAL B 2 82  ? 121.70300 86.84100  117.87900 1.000 37.83612  ? 81  VAL B N     1 
ATOM 1231  C CA    . VAL B 2 82  ? 120.71700 87.75500  117.31300 1.000 37.83612  ? 81  VAL B CA    1 
ATOM 1232  C C     . VAL B 2 82  ? 119.37000 87.04400  117.30500 1.000 37.83612  ? 81  VAL B C     1 
ATOM 1233  O O     . VAL B 2 82  ? 119.14300 86.13700  116.50400 1.000 37.83612  ? 81  VAL B O     1 
ATOM 1234  C CB    . VAL B 2 82  ? 121.11300 88.20400  115.90500 1.000 37.83612  ? 81  VAL B CB    1 
ATOM 1235  C CG1   . VAL B 2 82  ? 120.24400 89.35400  115.45500 1.000 37.83612  ? 81  VAL B CG1   1 
ATOM 1236  C CG2   . VAL B 2 82  ? 122.57300 88.59100  115.87700 1.000 37.83612  ? 81  VAL B CG2   1 
ATOM 1237  N N     . THR B 2 83  ? 118.46700 87.46500  118.18400 1.000 37.18854  ? 82  THR B N     1 
ATOM 1238  C CA    . THR B 2 83  ? 117.19100 86.78400  118.31100 1.000 37.18854  ? 82  THR B CA    1 
ATOM 1239  C C     . THR B 2 83  ? 116.19800 87.28100  117.26600 1.000 37.18854  ? 82  THR B C     1 
ATOM 1240  O O     . THR B 2 83  ? 116.50100 88.12900  116.42700 1.000 37.18854  ? 82  THR B O     1 
ATOM 1241  C CB    . THR B 2 83  ? 116.62700 86.97600  119.71500 1.000 37.18854  ? 82  THR B CB    1 
ATOM 1242  O OG1   . THR B 2 83  ? 116.35300 88.36300  119.93000 1.000 37.18854  ? 82  THR B OG1   1 
ATOM 1243  C CG2   . THR B 2 83  ? 117.62500 86.50500  120.75400 1.000 37.18854  ? 82  THR B CG2   1 
ATOM 1244  N N     . ALA B 2 84  ? 114.97900 86.74800  117.33800 1.000 35.91319  ? 83  ALA B N     1 
ATOM 1245  C CA    . ALA B 2 84  ? 113.92700 87.12000  116.40300 1.000 35.91319  ? 83  ALA B CA    1 
ATOM 1246  C C     . ALA B 2 84  ? 113.35600 88.48700  116.72800 1.000 35.91319  ? 83  ALA B C     1 
ATOM 1247  O O     . ALA B 2 84  ? 113.00300 89.24700  115.82100 1.000 35.91319  ? 83  ALA B O     1 
ATOM 1248  C CB    . ALA B 2 84  ? 112.81700 86.07300  116.41200 1.000 35.91319  ? 83  ALA B CB    1 
ATOM 1249  N N     . MET B 2 85  ? 113.20600 88.78200  118.02100 1.000 36.86988  ? 84  MET B N     1 
ATOM 1250  C CA    . MET B 2 85  ? 112.70000 90.07700  118.46000 1.000 36.86988  ? 84  MET B CA    1 
ATOM 1251  C C     . MET B 2 85  ? 113.62900 91.22100  118.08000 1.000 36.86988  ? 84  MET B C     1 
ATOM 1252  O O     . MET B 2 85  ? 113.15700 92.33300  117.83600 1.000 36.86988  ? 84  MET B O     1 
ATOM 1253  C CB    . MET B 2 85  ? 112.47400 90.07000  119.97000 1.000 36.86988  ? 84  MET B CB    1 
ATOM 1254  C CG    . MET B 2 85  ? 111.08600 89.63000  120.38800 1.000 36.86988  ? 84  MET B CG    1 
ATOM 1255  S SD    . MET B 2 85  ? 110.68100 87.96700  119.82800 1.000 36.86988  ? 84  MET B SD    1 
ATOM 1256  C CE    . MET B 2 85  ? 111.91400 87.00400  120.70100 1.000 36.86988  ? 84  MET B CE    1 
ATOM 1257  N N     . ASP B 2 86  ? 114.94500 90.98100  118.05000 1.000 35.33918  ? 85  ASP B N     1 
ATOM 1258  C CA    . ASP B 2 86  ? 115.88700 92.01600  117.62600 1.000 35.33918  ? 85  ASP B CA    1 
ATOM 1259  C C     . ASP B 2 86  ? 115.68700 92.43800  116.18000 1.000 35.33918  ? 85  ASP B C     1 
ATOM 1260  O O     . ASP B 2 86  ? 115.81100 93.62500  115.86800 1.000 35.33918  ? 85  ASP B O     1 
ATOM 1261  C CB    . ASP B 2 86  ? 117.31800 91.52600  117.80900 1.000 35.33918  ? 85  ASP B CB    1 
ATOM 1262  C CG    . ASP B 2 86  ? 117.75700 91.56400  119.24100 1.000 35.33918  ? 85  ASP B CG    1 
ATOM 1263  O OD1   . ASP B 2 86  ? 116.99100 92.07900  120.07900 1.000 35.33918  ? 85  ASP B OD1   1 
ATOM 1264  O OD2   . ASP B 2 86  ? 118.86100 91.06500  119.53700 1.000 35.33918  ? 85  ASP B OD2   1 
ATOM 1265  N N     . VAL B 2 87  ? 115.25700 91.52100  115.31600 1.000 32.76797  ? 86  VAL B N     1 
ATOM 1266  C CA    . VAL B 2 87  ? 114.96000 91.88800  113.93700 1.000 32.76797  ? 86  VAL B CA    1 
ATOM 1267  C C     . VAL B 2 87  ? 113.67000 92.69500  113.87200 1.000 32.76797  ? 86  VAL B C     1 
ATOM 1268  O O     . VAL B 2 87  ? 113.58200 93.69000  113.14200 1.000 32.76797  ? 86  VAL B O     1 
ATOM 1269  C CB    . VAL B 2 87  ? 114.90800 90.62300  113.06300 1.000 32.76797  ? 86  VAL B CB    1 
ATOM 1270  C CG1   . VAL B 2 87  ? 114.45300 90.94100  111.66400 1.000 32.76797  ? 86  VAL B CG1   1 
ATOM 1271  C CG2   . VAL B 2 87  ? 116.26900 89.96800  113.02300 1.000 32.76797  ? 86  VAL B CG2   1 
ATOM 1272  N N     . VAL B 2 88  ? 112.66300 92.29800  114.65400 1.000 32.77064  ? 87  VAL B N     1 
ATOM 1273  C CA    . VAL B 2 88  ? 111.37000 92.97500  114.64600 1.000 32.77064  ? 87  VAL B CA    1 
ATOM 1274  C C     . VAL B 2 88  ? 111.50500 94.39500  115.18600 1.000 32.77064  ? 87  VAL B C     1 
ATOM 1275  O O     . VAL B 2 88  ? 110.96500 95.34800  114.61100 1.000 32.77064  ? 87  VAL B O     1 
ATOM 1276  C CB    . VAL B 2 88  ? 110.35100 92.14200  115.44500 1.000 32.77064  ? 87  VAL B CB    1 
ATOM 1277  C CG1   . VAL B 2 88  ? 109.12100 92.95100  115.79400 1.000 32.77064  ? 87  VAL B CG1   1 
ATOM 1278  C CG2   . VAL B 2 88  ? 109.97200 90.90200  114.66600 1.000 32.77064  ? 87  VAL B CG2   1 
ATOM 1279  N N     . TYR B 2 89  ? 112.25600 94.56100  116.27700 1.000 33.79447  ? 88  TYR B N     1 
ATOM 1280  C CA    . TYR B 2 89  ? 112.55300 95.89000  116.80400 1.000 33.79447  ? 88  TYR B CA    1 
ATOM 1281  C C     . TYR B 2 89  ? 113.41500 96.70200  115.84700 1.000 33.79447  ? 88  TYR B C     1 
ATOM 1282  O O     . TYR B 2 89  ? 113.21200 97.91100  115.70900 1.000 33.79447  ? 88  TYR B O     1 
ATOM 1283  C CB    . TYR B 2 89  ? 113.22500 95.78500  118.17200 1.000 33.79447  ? 88  TYR B CB    1 
ATOM 1284  C CG    . TYR B 2 89  ? 112.39100 95.08500  119.21800 1.000 33.79447  ? 88  TYR B CG    1 
ATOM 1285  C CD1   . TYR B 2 89  ? 111.00500 95.15900  119.19000 1.000 33.79447  ? 88  TYR B CD1   1 
ATOM 1286  C CD2   . TYR B 2 89  ? 112.98800 94.37300  120.24700 1.000 33.79447  ? 88  TYR B CD2   1 
ATOM 1287  C CE1   . TYR B 2 89  ? 110.23600 94.52500  120.14100 1.000 33.79447  ? 88  TYR B CE1   1 
ATOM 1288  C CE2   . TYR B 2 89  ? 112.22600 93.73100  121.20400 1.000 33.79447  ? 88  TYR B CE2   1 
ATOM 1289  C CZ    . TYR B 2 89  ? 110.85100 93.81300  121.14400 1.000 33.79447  ? 88  TYR B CZ    1 
ATOM 1290  O OH    . TYR B 2 89  ? 110.08000 93.18800  122.09200 1.000 33.79447  ? 88  TYR B OH    1 
ATOM 1291  N N     . ALA B 2 90  ? 114.38100 96.06500  115.17800 1.000 31.53742  ? 89  ALA B N     1 
ATOM 1292  C CA    . ALA B 2 90  ? 115.21000 96.77100  114.21100 1.000 31.53742  ? 89  ALA B CA    1 
ATOM 1293  C C     . ALA B 2 90  ? 114.44000 97.21500  112.97800 1.000 31.53742  ? 89  ALA B C     1 
ATOM 1294  O O     . ALA B 2 90  ? 114.86400 98.15700  112.30700 1.000 31.53742  ? 89  ALA B O     1 
ATOM 1295  C CB    . ALA B 2 90  ? 116.36800 95.87600  113.78400 1.000 31.53742  ? 89  ALA B CB    1 
ATOM 1296  N N     . LEU B 2 91  ? 113.33000 96.55800  112.66600 1.000 31.70173  ? 90  LEU B N     1 
ATOM 1297  C CA    . LEU B 2 91  ? 112.45900 96.98900  111.58200 1.000 31.70173  ? 90  LEU B CA    1 
ATOM 1298  C C     . LEU B 2 91  ? 111.46000 98.05200  112.03100 1.000 31.70173  ? 90  LEU B C     1 
ATOM 1299  O O     . LEU B 2 91  ? 111.16500 98.99300  111.27700 1.000 31.70173  ? 90  LEU B O     1 
ATOM 1300  C CB    . LEU B 2 91  ? 111.74300 95.77500  111.00100 1.000 31.70173  ? 90  LEU B CB    1 
ATOM 1301  C CG    . LEU B 2 91  ? 112.63600 94.85100  110.18500 1.000 31.70173  ? 90  LEU B CG    1 
ATOM 1302  C CD1   . LEU B 2 91  ? 112.05500 93.46800  110.19000 1.000 31.70173  ? 90  LEU B CD1   1 
ATOM 1303  C CD2   . LEU B 2 91  ? 112.75800 95.37100  108.78000 1.000 31.70173  ? 90  LEU B CD2   1 
ATOM 1304  N N     . LYS B 2 92  ? 110.96000 97.94300  113.26700 1.000 32.27828  ? 91  LYS B N     1 
ATOM 1305  C CA    . LYS B 2 92  ? 110.08000 98.97500  113.80100 1.000 32.27828  ? 91  LYS B CA    1 
ATOM 1306  C C     . LYS B 2 92  ? 110.84400 100.26600 114.05200 1.000 32.27828  ? 91  LYS B C     1 
ATOM 1307  O O     . LYS B 2 92  ? 110.23500 101.34000 114.08900 1.000 32.27828  ? 91  LYS B O     1 
ATOM 1308  C CB    . LYS B 2 92  ? 109.41500 98.48700  115.08400 1.000 32.27828  ? 91  LYS B CB    1 
ATOM 1309  C CG    . LYS B 2 92  ? 108.10500 99.17700  115.40700 1.000 32.27828  ? 91  LYS B CG    1 
ATOM 1310  C CD    . LYS B 2 92  ? 107.43200 98.54000  116.60500 1.000 32.27828  ? 91  LYS B CD    1 
ATOM 1311  C CE    . LYS B 2 92  ? 108.29500 98.65700  117.84800 1.000 32.27828  ? 91  LYS B CE    1 
ATOM 1312  N NZ    . LYS B 2 92  ? 108.64800 100.07100 118.15200 1.000 32.27828  ? 91  LYS B NZ    1 
ATOM 1313  N N     . ARG B 2 93  ? 112.16500 100.16600 114.23200 1.000 32.78313  ? 92  ARG B N     1 
ATOM 1314  C CA    . ARG B 2 93  ? 113.04400 101.32600 114.16500 1.000 32.78313  ? 92  ARG B CA    1 
ATOM 1315  C C     . ARG B 2 93  ? 112.93100 102.01200 112.81300 1.000 32.78313  ? 92  ARG B C     1 
ATOM 1316  O O     . ARG B 2 93  ? 112.70500 103.22400 112.73800 1.000 32.78313  ? 92  ARG B O     1 
ATOM 1317  C CB    . ARG B 2 93  ? 114.48300 100.88500 114.44600 1.000 32.78313  ? 92  ARG B CB    1 
ATOM 1318  C CG    . ARG B 2 93  ? 115.55700 101.93300 114.25200 1.000 32.78313  ? 92  ARG B CG    1 
ATOM 1319  C CD    . ARG B 2 93  ? 115.55800 103.04600 115.26100 1.000 32.78313  ? 92  ARG B CD    1 
ATOM 1320  N NE    . ARG B 2 93  ? 115.87300 104.28900 114.56400 1.000 32.78313  ? 92  ARG B NE    1 
ATOM 1321  C CZ    . ARG B 2 93  ? 114.95900 105.12300 114.07900 1.000 32.78313  ? 92  ARG B CZ    1 
ATOM 1322  N NH1   . ARG B 2 93  ? 113.67000 104.85600 114.23500 1.000 32.78313  ? 92  ARG B NH1   1 
ATOM 1323  N NH2   . ARG B 2 93  ? 115.33000 106.22500 113.43800 1.000 32.78313  ? 92  ARG B NH2   1 
ATOM 1324  N N     . GLN B 2 94  ? 113.05200 101.24500 111.72600 1.000 34.54536  ? 93  GLN B N     1 
ATOM 1325  C CA    . GLN B 2 94  ? 113.01800 101.83400 110.39200 1.000 34.54536  ? 93  GLN B CA    1 
ATOM 1326  C C     . GLN B 2 94  ? 111.62300 102.24300 109.95500 1.000 34.54536  ? 93  GLN B C     1 
ATOM 1327  O O     . GLN B 2 94  ? 111.48400 102.84300 108.88500 1.000 34.54536  ? 93  GLN B O     1 
ATOM 1328  C CB    . GLN B 2 94  ? 113.59000 100.86800 109.37100 1.000 34.54536  ? 93  GLN B CB    1 
ATOM 1329  C CG    . GLN B 2 94  ? 114.89300 100.27500 109.78500 1.000 34.54536  ? 93  GLN B CG    1 
ATOM 1330  C CD    . GLN B 2 94  ? 115.62700 99.68800  108.62200 1.000 34.54536  ? 93  GLN B CD    1 
ATOM 1331  O OE1   . GLN B 2 94  ? 115.21800 99.83800  107.47200 1.000 34.54536  ? 93  GLN B OE1   1 
ATOM 1332  N NE2   . GLN B 2 94  ? 116.72200 99.01600  108.90700 1.000 34.54536  ? 93  GLN B NE2   1 
ATOM 1333  N N     . GLY B 2 95  ? 110.59400 101.91900 110.73200 1.000 34.26829  ? 94  GLY B N     1 
ATOM 1334  C CA    . GLY B 2 95  ? 109.23900 102.28500 110.38700 1.000 34.26829  ? 94  GLY B CA    1 
ATOM 1335  C C     . GLY B 2 95  ? 108.45100 101.22200 109.66800 1.000 34.26829  ? 94  GLY B C     1 
ATOM 1336  O O     . GLY B 2 95  ? 107.24000 101.38700 109.49400 1.000 34.26829  ? 94  GLY B O     1 
ATOM 1337  N N     . ARG B 2 96  ? 109.08800 100.13800 109.26400 1.000 33.75056  ? 95  ARG B N     1 
ATOM 1338  C CA    . ARG B 2 96  ? 108.40800 99.02500  108.61800 1.000 33.75056  ? 95  ARG B CA    1 
ATOM 1339  C C     . ARG B 2 96  ? 108.15900 97.96400  109.68800 1.000 33.75056  ? 95  ARG B C     1 
ATOM 1340  O O     . ARG B 2 96  ? 109.04800 97.19500  110.04200 1.000 33.75056  ? 95  ARG B O     1 
ATOM 1341  C CB    . ARG B 2 96  ? 109.22800 98.53500  107.42600 1.000 33.75056  ? 95  ARG B CB    1 
ATOM 1342  C CG    . ARG B 2 96  ? 110.73400 98.41100  107.66800 1.000 33.75056  ? 95  ARG B CG    1 
ATOM 1343  C CD    . ARG B 2 96  ? 111.48900 98.03500  106.41700 1.000 33.75056  ? 95  ARG B CD    1 
ATOM 1344  N NE    . ARG B 2 96  ? 111.32700 99.01600  105.35500 1.000 33.75056  ? 95  ARG B NE    1 
ATOM 1345  C CZ    . ARG B 2 96  ? 112.26300 99.89200  105.01400 1.000 33.75056  ? 95  ARG B CZ    1 
ATOM 1346  N NH1   . ARG B 2 96  ? 113.42200 99.90000  105.65600 1.000 33.75056  ? 95  ARG B NH1   1 
ATOM 1347  N NH2   . ARG B 2 96  ? 112.04600 100.75600 104.03400 1.000 33.75056  ? 95  ARG B NH2   1 
ATOM 1348  N N     . THR B 2 97  ? 106.94500 97.93600  110.22100 1.000 33.96795  ? 96  THR B N     1 
ATOM 1349  C CA    . THR B 2 97  ? 106.61500 96.98900  111.27300 1.000 33.96795  ? 96  THR B CA    1 
ATOM 1350  C C     . THR B 2 97  ? 106.45200 95.60600  110.64900 1.000 33.96795  ? 96  THR B C     1 
ATOM 1351  O O     . THR B 2 97  ? 106.06500 95.47500  109.48700 1.000 33.96795  ? 96  THR B O     1 
ATOM 1352  C CB    . THR B 2 97  ? 105.33700 97.44500  111.98800 1.000 33.96795  ? 96  THR B CB    1 
ATOM 1353  O OG1   . THR B 2 97  ? 105.49400 98.81000  112.38700 1.000 33.96795  ? 96  THR B OG1   1 
ATOM 1354  C CG2   . THR B 2 97  ? 105.08700 96.66600  113.26100 1.000 33.96795  ? 96  THR B CG2   1 
ATOM 1355  N N     . LEU B 2 98  ? 106.76600 94.56800  111.42200 1.000 32.37695  ? 97  LEU B N     1 
ATOM 1356  C CA    . LEU B 2 98  ? 106.63700 93.18500  110.97600 1.000 32.37695  ? 97  LEU B CA    1 
ATOM 1357  C C     . LEU B 2 98  ? 105.87300 92.40700  112.03400 1.000 32.37695  ? 97  LEU B C     1 
ATOM 1358  O O     . LEU B 2 98  ? 106.39700 92.16000  113.12400 1.000 32.37695  ? 97  LEU B O     1 
ATOM 1359  C CB    . LEU B 2 98  ? 108.01200 92.56900  110.72800 1.000 32.37695  ? 97  LEU B CB    1 
ATOM 1360  C CG    . LEU B 2 98  ? 108.11300 91.08400  110.38900 1.000 32.37695  ? 97  LEU B CG    1 
ATOM 1361  C CD1   . LEU B 2 98  ? 107.52000 90.79000  109.03900 1.000 32.37695  ? 97  LEU B CD1   1 
ATOM 1362  C CD2   . LEU B 2 98  ? 109.55800 90.65600  110.42900 1.000 32.37695  ? 97  LEU B CD2   1 
ATOM 1363  N N     . TYR B 2 99  ? 104.63600 92.03500  111.72000 1.000 33.50112  ? 98  TYR B N     1 
ATOM 1364  C CA    . TYR B 2 99  ? 103.80200 91.26700  112.63300 1.000 33.50112  ? 98  TYR B CA    1 
ATOM 1365  C C     . TYR B 2 99  ? 104.09300 89.78700  112.45700 1.000 33.50112  ? 98  TYR B C     1 
ATOM 1366  O O     . TYR B 2 99  ? 104.31300 89.32200  111.34000 1.000 33.50112  ? 98  TYR B O     1 
ATOM 1367  C CB    . TYR B 2 99  ? 102.31600 91.50500  112.36300 1.000 33.50112  ? 98  TYR B CB    1 
ATOM 1368  C CG    . TYR B 2 99  ? 101.75400 92.84600  112.76200 1.000 33.50112  ? 98  TYR B CG    1 
ATOM 1369  C CD1   . TYR B 2 99  ? 102.50700 93.76600  113.46700 1.000 33.50112  ? 98  TYR B CD1   1 
ATOM 1370  C CD2   . TYR B 2 99  ? 100.44400 93.17400  112.45100 1.000 33.50112  ? 98  TYR B CD2   1 
ATOM 1371  C CE1   . TYR B 2 99  ? 101.97700 94.98300  113.83400 1.000 33.50112  ? 98  TYR B CE1   1 
ATOM 1372  C CE2   . TYR B 2 99  ? 99.90900  94.38600  112.80900 1.000 33.50112  ? 98  TYR B CE2   1 
ATOM 1373  C CZ    . TYR B 2 99  ? 100.68000 95.28800  113.49800 1.000 33.50112  ? 98  TYR B CZ    1 
ATOM 1374  O OH    . TYR B 2 99  ? 100.14800 96.50000  113.86200 1.000 33.50112  ? 98  TYR B OH    1 
ATOM 1375  N N     . GLY B 2 100 ? 104.07400 89.04400  113.55600 1.000 37.11598  ? 99  GLY B N     1 
ATOM 1376  C CA    . GLY B 2 100 ? 104.15200 87.59700  113.49100 1.000 37.11598  ? 99  GLY B CA    1 
ATOM 1377  C C     . GLY B 2 100 ? 105.31200 86.96300  114.22000 1.000 37.11598  ? 99  GLY B C     1 
ATOM 1378  O O     . GLY B 2 100 ? 105.35400 85.72900  114.31100 1.000 37.11598  ? 99  GLY B O     1 
ATOM 1379  N N     . PHE B 2 101 ? 106.26200 87.72700  114.74500 1.000 37.92798  ? 100 PHE B N     1 
ATOM 1380  C CA    . PHE B 2 101 ? 107.37600 87.14300  115.47800 1.000 37.92798  ? 100 PHE B CA    1 
ATOM 1381  C C     . PHE B 2 101 ? 107.57700 87.72400  116.86400 1.000 37.92798  ? 100 PHE B C     1 
ATOM 1382  O O     . PHE B 2 101 ? 108.24500 87.08400  117.68200 1.000 37.92798  ? 100 PHE B O     1 
ATOM 1383  C CB    . PHE B 2 101 ? 108.68200 87.30100  114.68800 1.000 37.92798  ? 100 PHE B CB    1 
ATOM 1384  C CG    . PHE B 2 101 ? 108.62100 86.73600  113.30100 1.000 37.92798  ? 100 PHE B CG    1 
ATOM 1385  C CD1   . PHE B 2 101 ? 108.85600 85.39200  113.07400 1.000 37.92798  ? 100 PHE B CD1   1 
ATOM 1386  C CD2   . PHE B 2 101 ? 108.33600 87.55300  112.22200 1.000 37.92798  ? 100 PHE B CD2   1 
ATOM 1387  C CE1   . PHE B 2 101 ? 108.80100 84.87200  111.79300 1.000 37.92798  ? 100 PHE B CE1   1 
ATOM 1388  C CE2   . PHE B 2 101 ? 108.28200 87.04000  110.94500 1.000 37.92798  ? 100 PHE B CE2   1 
ATOM 1389  C CZ    . PHE B 2 101 ? 108.51500 85.70000  110.72800 1.000 37.92798  ? 100 PHE B CZ    1 
ATOM 1390  N N     . GLY B 2 102 ? 107.02000 88.89200  117.16400 1.000 41.77765  ? 101 GLY B N     1 
ATOM 1391  C CA    . GLY B 2 102 ? 107.32100 89.57800  118.40200 1.000 41.77765  ? 101 GLY B CA    1 
ATOM 1392  C C     . GLY B 2 102 ? 106.14400 89.61000  119.34900 1.000 41.77765  ? 101 GLY B C     1 
ATOM 1393  O O     . GLY B 2 102 ? 105.95900 90.57800  120.09100 1.000 41.77765  ? 101 GLY B O     1 
ATOM 1394  N N     . GLY B 2 103 ? 105.33700 88.55700  119.32300 1.000 42.28161  ? 102 GLY B N     1 
ATOM 1395  C CA    . GLY B 2 103 ? 104.19400 88.44400  120.20800 1.000 42.28161  ? 102 GLY B CA    1 
ATOM 1396  C C     . GLY B 2 103 ? 103.68200 87.02300  120.32000 1.000 42.28161  ? 102 GLY B C     1 
ATOM 1397  O O     . GLY B 2 103 ? 104.46300 86.07200  120.32200 1.000 42.28161  ? 102 GLY B O     1 
ATOM 1398  N N     . SER C 3 17  ? 129.27900 123.54500 139.13200 1.000 48.36819  ? 16  SER C N     1 
ATOM 1399  C CA    . SER C 3 17  ? 128.47600 123.36000 137.93000 1.000 48.36819  ? 16  SER C CA    1 
ATOM 1400  C C     . SER C 3 17  ? 128.75300 122.00400 137.31700 1.000 48.36819  ? 16  SER C C     1 
ATOM 1401  O O     . SER C 3 17  ? 129.88500 121.72300 136.94100 1.000 48.36819  ? 16  SER C O     1 
ATOM 1402  C CB    . SER C 3 17  ? 128.75900 124.46000 136.91300 1.000 48.36819  ? 16  SER C CB    1 
ATOM 1403  O OG    . SER C 3 17  ? 128.00000 124.26400 135.73500 1.000 48.36819  ? 16  SER C OG    1 
ATOM 1404  N N     . ARG C 3 18  ? 127.71300 121.16600 137.25100 1.000 46.24807  ? 17  ARG C N     1 
ATOM 1405  C CA    . ARG C 3 18  ? 127.85000 119.81800 136.70200 1.000 46.24807  ? 17  ARG C CA    1 
ATOM 1406  C C     . ARG C 3 18  ? 128.24600 119.85600 135.22900 1.000 46.24807  ? 17  ARG C C     1 
ATOM 1407  O O     . ARG C 3 18  ? 129.04000 119.02500 134.77100 1.000 46.24807  ? 17  ARG C O     1 
ATOM 1408  C CB    . ARG C 3 18  ? 126.55600 119.03100 136.92200 1.000 46.24807  ? 17  ARG C CB    1 
ATOM 1409  C CG    . ARG C 3 18  ? 126.54500 117.66500 136.27500 1.000 46.24807  ? 17  ARG C CG    1 
ATOM 1410  C CD    . ARG C 3 18  ? 125.62000 116.69300 136.96800 1.000 46.24807  ? 17  ARG C CD    1 
ATOM 1411  N NE    . ARG C 3 18  ? 124.27400 117.20900 137.15900 1.000 46.24807  ? 17  ARG C NE    1 
ATOM 1412  C CZ    . ARG C 3 18  ? 123.20100 116.43300 137.23200 1.000 46.24807  ? 17  ARG C CZ    1 
ATOM 1413  N NH1   . ARG C 3 18  ? 122.00100 116.96300 137.41400 1.000 46.24807  ? 17  ARG C NH1   1 
ATOM 1414  N NH2   . ARG C 3 18  ? 123.33400 115.12100 137.11500 1.000 46.24807  ? 17  ARG C NH2   1 
ATOM 1415  N N     . SER C 3 19  ? 127.68000 120.80100 134.47100 1.000 43.78246  ? 18  SER C N     1 
ATOM 1416  C CA    . SER C 3 19  ? 128.00000 120.94400 133.05200 1.000 43.78246  ? 18  SER C CA    1 
ATOM 1417  C C     . SER C 3 19  ? 129.47300 121.27500 132.84300 1.000 43.78246  ? 18  SER C C     1 
ATOM 1418  O O     . SER C 3 19  ? 130.09500 120.78600 131.89400 1.000 43.78246  ? 18  SER C O     1 
ATOM 1419  C CB    . SER C 3 19  ? 127.11700 122.01200 132.41900 1.000 43.78246  ? 18  SER C CB    1 
ATOM 1420  O OG    . SER C 3 19  ? 127.71900 122.51600 131.24400 1.000 43.78246  ? 18  SER C OG    1 
ATOM 1421  N N     . SER C 3 20  ? 130.02700 122.14800 133.68900 1.000 43.81856  ? 19  SER C N     1 
ATOM 1422  C CA    . SER C 3 20  ? 131.44200 122.49800 133.60400 1.000 43.81856  ? 19  SER C CA    1 
ATOM 1423  C C     . SER C 3 20  ? 132.32900 121.29400 133.89900 1.000 43.81856  ? 19  SER C C     1 
ATOM 1424  O O     . SER C 3 20  ? 133.43500 121.19100 133.35700 1.000 43.81856  ? 19  SER C O     1 
ATOM 1425  C CB    . SER C 3 20  ? 131.76000 123.64200 134.56000 1.000 43.81856  ? 19  SER C CB    1 
ATOM 1426  O OG    . SER C 3 20  ? 133.13000 123.98800 134.49400 1.000 43.81856  ? 19  SER C OG    1 
ATOM 1427  N N     . ARG C 3 21  ? 131.88700 120.41700 134.81100 1.000 43.64120  ? 20  ARG C N     1 
ATOM 1428  C CA    . ARG C 3 21  ? 132.65500 119.22400 135.17500 1.000 43.64120  ? 20  ARG C CA    1 
ATOM 1429  C C     . ARG C 3 21  ? 132.87800 118.30400 133.98000 1.000 43.64120  ? 20  ARG C C     1 
ATOM 1430  O O     . ARG C 3 21  ? 133.97300 117.76000 133.80400 1.000 43.64120  ? 20  ARG C O     1 
ATOM 1431  C CB    . ARG C 3 21  ? 131.93300 118.46300 136.28600 1.000 43.64120  ? 20  ARG C CB    1 
ATOM 1432  C CG    . ARG C 3 21  ? 131.84700 119.18300 137.61200 1.000 43.64120  ? 20  ARG C CG    1 
ATOM 1433  C CD    . ARG C 3 21  ? 130.99600 118.39900 138.59500 1.000 43.64120  ? 20  ARG C CD    1 
ATOM 1434  N NE    . ARG C 3 21  ? 131.55500 117.09600 138.92400 1.000 43.64120  ? 20  ARG C NE    1 
ATOM 1435  C CZ    . ARG C 3 21  ? 130.92800 116.19200 139.66700 1.000 43.64120  ? 20  ARG C CZ    1 
ATOM 1436  N NH1   . ARG C 3 21  ? 131.49800 115.02300 139.92200 1.000 43.64120  ? 20  ARG C NH1   1 
ATOM 1437  N NH2   . ARG C 3 21  ? 129.72800 116.45800 140.15700 1.000 43.64120  ? 20  ARG C NH2   1 
ATOM 1438  N N     . ALA C 3 22  ? 131.85900 118.12500 133.14400 1.000 40.55209  ? 21  ALA C N     1 
ATOM 1439  C CA    . ALA C 3 22  ? 131.98300 117.28700 131.96000 1.000 40.55209  ? 21  ALA C CA    1 
ATOM 1440  C C     . ALA C 3 22  ? 132.65000 117.99300 130.79100 1.000 40.55209  ? 21  ALA C C     1 
ATOM 1441  O O     . ALA C 3 22  ? 132.78500 117.38600 129.72600 1.000 40.55209  ? 21  ALA C O     1 
ATOM 1442  C CB    . ALA C 3 22  ? 130.60900 116.78100 131.52500 1.000 40.55209  ? 21  ALA C CB    1 
ATOM 1443  N N     . GLY C 3 23  ? 133.07900 119.24000 130.96300 1.000 39.40417  ? 22  GLY C N     1 
ATOM 1444  C CA    . GLY C 3 23  ? 133.71000 119.98400 129.89100 1.000 39.40417  ? 22  GLY C CA    1 
ATOM 1445  C C     . GLY C 3 23  ? 132.79000 120.32000 128.74400 1.000 39.40417  ? 22  GLY C C     1 
ATOM 1446  O O     . GLY C 3 23  ? 133.24900 120.42800 127.60500 1.000 39.40417  ? 22  GLY C O     1 
ATOM 1447  N N     . LEU C 3 24  ? 131.50000 120.48300 129.01000 1.000 39.04903  ? 23  LEU C N     1 
ATOM 1448  C CA    . LEU C 3 24  ? 130.51400 120.77100 127.98200 1.000 39.04903  ? 23  LEU C CA    1 
ATOM 1449  C C     . LEU C 3 24  ? 130.06700 122.22100 128.06700 1.000 39.04903  ? 23  LEU C C     1 
ATOM 1450  O O     . LEU C 3 24  ? 130.44100 122.96700 128.97400 1.000 39.04903  ? 23  LEU C O     1 
ATOM 1451  C CB    . LEU C 3 24  ? 129.29500 119.85300 128.11000 1.000 39.04903  ? 23  LEU C CB    1 
ATOM 1452  C CG    . LEU C 3 24  ? 129.52100 118.35500 128.00000 1.000 39.04903  ? 23  LEU C CG    1 
ATOM 1453  C CD1   . LEU C 3 24  ? 128.20400 117.65100 128.12400 1.000 39.04903  ? 23  LEU C CD1   1 
ATOM 1454  C CD2   . LEU C 3 24  ? 130.17200 118.03000 126.67900 1.000 39.04903  ? 23  LEU C CD2   1 
ATOM 1455  N N     . GLN C 3 25  ? 129.25000 122.61200 127.09000 1.000 40.82265  ? 24  GLN C N     1 
ATOM 1456  C CA    . GLN C 3 25  ? 128.55800 123.88700 127.12300 1.000 40.82265  ? 24  GLN C CA    1 
ATOM 1457  C C     . GLN C 3 25  ? 127.04800 123.74400 127.19400 1.000 40.82265  ? 24  GLN C C     1 
ATOM 1458  O O     . GLN C 3 25  ? 126.37600 124.70100 127.59300 1.000 40.82265  ? 24  GLN C O     1 
ATOM 1459  C CB    . GLN C 3 25  ? 128.92900 124.73300 125.89700 1.000 40.82265  ? 24  GLN C CB    1 
ATOM 1460  C CG    . GLN C 3 25  ? 130.42200 124.97200 125.75100 1.000 40.82265  ? 24  GLN C CG    1 
ATOM 1461  C CD    . GLN C 3 25  ? 130.92300 126.13900 126.58000 1.000 40.82265  ? 24  GLN C CD    1 
ATOM 1462  O OE1   . GLN C 3 25  ? 130.16200 126.77900 127.30200 1.000 40.82265  ? 24  GLN C OE1   1 
ATOM 1463  N NE2   . GLN C 3 25  ? 132.21900 126.41500 126.48600 1.000 40.82265  ? 24  GLN C NE2   1 
ATOM 1464  N N     . PHE C 3 26  ? 126.49800 122.59000 126.82900 1.000 38.34134  ? 25  PHE C N     1 
ATOM 1465  C CA    . PHE C 3 26  ? 125.08800 122.31000 127.03000 1.000 38.34134  ? 25  PHE C CA    1 
ATOM 1466  C C     . PHE C 3 26  ? 124.84100 121.87700 128.47400 1.000 38.34134  ? 25  PHE C C     1 
ATOM 1467  O O     . PHE C 3 26  ? 125.71300 121.26800 129.09600 1.000 38.34134  ? 25  PHE C O     1 
ATOM 1468  C CB    . PHE C 3 26  ? 124.62500 121.22500 126.06400 1.000 38.34134  ? 25  PHE C CB    1 
ATOM 1469  C CG    . PHE C 3 26  ? 124.03000 121.76800 124.81000 1.000 38.34134  ? 25  PHE C CG    1 
ATOM 1470  C CD1   . PHE C 3 26  ? 124.80500 122.48900 123.92100 1.000 38.34134  ? 25  PHE C CD1   1 
ATOM 1471  C CD2   . PHE C 3 26  ? 122.68900 121.59700 124.53700 1.000 38.34134  ? 25  PHE C CD2   1 
ATOM 1472  C CE1   . PHE C 3 26  ? 124.25500 123.00400 122.77000 1.000 38.34134  ? 25  PHE C CE1   1 
ATOM 1473  C CE2   . PHE C 3 26  ? 122.13800 122.11300 123.39000 1.000 38.34134  ? 25  PHE C CE2   1 
ATOM 1474  C CZ    . PHE C 3 26  ? 122.91900 122.81700 122.50700 1.000 38.34134  ? 25  PHE C CZ    1 
ATOM 1475  N N     . PRO C 3 27  ? 123.67300 122.18900 129.04000 1.000 40.40179  ? 26  PRO C N     1 
ATOM 1476  C CA    . PRO C 3 27  ? 123.46800 121.93000 130.46700 1.000 40.40179  ? 26  PRO C CA    1 
ATOM 1477  C C     . PRO C 3 27  ? 123.21700 120.46200 130.75100 1.000 40.40179  ? 26  PRO C C     1 
ATOM 1478  O O     . PRO C 3 27  ? 122.54000 119.76300 129.99600 1.000 40.40179  ? 26  PRO C O     1 
ATOM 1479  C CB    . PRO C 3 27  ? 122.23700 122.77700 130.80400 1.000 40.40179  ? 26  PRO C CB    1 
ATOM 1480  C CG    . PRO C 3 27  ? 121.48400 122.82600 129.55300 1.000 40.40179  ? 26  PRO C CG    1 
ATOM 1481  C CD    . PRO C 3 27  ? 122.49500 122.84600 128.44600 1.000 40.40179  ? 26  PRO C CD    1 
ATOM 1482  N N     . VAL C 3 28  ? 123.79800 119.99000 131.84800 1.000 40.59939  ? 27  VAL C N     1 
ATOM 1483  C CA    . VAL C 3 28  ? 123.54400 118.63200 132.30000 1.000 40.59939  ? 27  VAL C CA    1 
ATOM 1484  C C     . VAL C 3 28  ? 122.42500 118.58800 133.33300 1.000 40.59939  ? 27  VAL C C     1 
ATOM 1485  O O     . VAL C 3 28  ? 121.70900 117.58300 133.41500 1.000 40.59939  ? 27  VAL C O     1 
ATOM 1486  C CB    . VAL C 3 28  ? 124.85500 118.02400 132.83000 1.000 40.59939  ? 27  VAL C CB    1 
ATOM 1487  C CG1   . VAL C 3 28  ? 124.71200 116.56100 133.11900 1.000 40.59939  ? 27  VAL C CG1   1 
ATOM 1488  C CG2   . VAL C 3 28  ? 125.92700 118.18300 131.78800 1.000 40.59939  ? 27  VAL C CG2   1 
ATOM 1489  N N     . GLY C 3 29  ? 122.18100 119.68200 134.04500 1.000 43.83545  ? 28  GLY C N     1 
ATOM 1490  C CA    . GLY C 3 29  ? 121.10600 119.70600 135.01100 1.000 43.83545  ? 28  GLY C CA    1 
ATOM 1491  C C     . GLY C 3 29  ? 119.74600 119.82100 134.36200 1.000 43.83545  ? 28  GLY C C     1 
ATOM 1492  O O     . GLY C 3 29  ? 118.80200 119.13700 134.76700 1.000 43.83545  ? 28  GLY C O     1 
ATOM 1493  N N     . ARG C 3 30  ? 119.63900 120.67200 133.34200 1.000 44.33670  ? 29  ARG C N     1 
ATOM 1494  C CA    . ARG C 3 30  ? 118.38100 120.80900 132.61700 1.000 44.33670  ? 29  ARG C CA    1 
ATOM 1495  C C     . ARG C 3 30  ? 118.07000 119.55900 131.80600 1.000 44.33670  ? 29  ARG C C     1 
ATOM 1496  O O     . ARG C 3 30  ? 116.90800 119.15500 131.70500 1.000 44.33670  ? 29  ARG C O     1 
ATOM 1497  C CB    . ARG C 3 30  ? 118.43200 122.04900 131.72700 1.000 44.33670  ? 29  ARG C CB    1 
ATOM 1498  C CG    . ARG C 3 30  ? 118.60200 123.33400 132.53000 1.000 44.33670  ? 29  ARG C CG    1 
ATOM 1499  C CD    . ARG C 3 30  ? 118.71400 124.57000 131.66500 1.000 44.33670  ? 29  ARG C CD    1 
ATOM 1500  N NE    . ARG C 3 30  ? 117.47800 124.93200 130.98700 1.000 44.33670  ? 29  ARG C NE    1 
ATOM 1501  C CZ    . ARG C 3 30  ? 117.29500 124.80800 129.68000 1.000 44.33670  ? 29  ARG C CZ    1 
ATOM 1502  N NH1   . ARG C 3 30  ? 118.24900 124.30200 128.92200 1.000 44.33670  ? 29  ARG C NH1   1 
ATOM 1503  N NH2   . ARG C 3 30  ? 116.15500 125.17000 129.12900 1.000 44.33670  ? 29  ARG C NH2   1 
ATOM 1504  N N     . VAL C 3 31  ? 119.09700 118.92000 131.24200 1.000 38.73769  ? 30  VAL C N     1 
ATOM 1505  C CA    . VAL C 3 31  ? 118.89400 117.67700 130.50400 1.000 38.73769  ? 30  VAL C CA    1 
ATOM 1506  C C     . VAL C 3 31  ? 118.49400 116.54500 131.45200 1.000 38.73769  ? 30  VAL C C     1 
ATOM 1507  O O     . VAL C 3 31  ? 117.60700 115.74400 131.13400 1.000 38.73769  ? 30  VAL C O     1 
ATOM 1508  C CB    . VAL C 3 31  ? 120.15600 117.35300 129.67800 1.000 38.73769  ? 30  VAL C CB    1 
ATOM 1509  C CG1   . VAL C 3 31  ? 120.25100 115.89100 129.33200 1.000 38.73769  ? 30  VAL C CG1   1 
ATOM 1510  C CG2   . VAL C 3 31  ? 120.15200 118.16000 128.39900 1.000 38.73769  ? 30  VAL C CG2   1 
ATOM 1511  N N     . HIS C 3 32  ? 119.08500 116.50200 132.65200 1.000 40.80832  ? 31  HIS C N     1 
ATOM 1512  C CA    . HIS C 3 32  ? 118.68700 115.51400 133.65600 1.000 40.80832  ? 31  HIS C CA    1 
ATOM 1513  C C     . HIS C 3 32  ? 117.26700 115.75600 134.15200 1.000 40.80832  ? 31  HIS C C     1 
ATOM 1514  O O     . HIS C 3 32  ? 116.51900 114.80300 134.39400 1.000 40.80832  ? 31  HIS C O     1 
ATOM 1515  C CB    . HIS C 3 32  ? 119.66200 115.53300 134.82900 1.000 40.80832  ? 31  HIS C CB    1 
ATOM 1516  C CG    . HIS C 3 32  ? 119.64800 114.28800 135.65700 1.000 40.80832  ? 31  HIS C CG    1 
ATOM 1517  N ND1   . HIS C 3 32  ? 120.46700 114.11800 136.75100 1.000 40.80832  ? 31  HIS C ND1   1 
ATOM 1518  C CD2   . HIS C 3 32  ? 118.92200 113.15200 135.55200 1.000 40.80832  ? 31  HIS C CD2   1 
ATOM 1519  C CE1   . HIS C 3 32  ? 120.24700 112.93000 137.28400 1.000 40.80832  ? 31  HIS C CE1   1 
ATOM 1520  N NE2   . HIS C 3 32  ? 119.30900 112.32600 136.57900 1.000 40.80832  ? 31  HIS C NE2   1 
ATOM 1521  N N     . ARG C 3 33  ? 116.86000 117.02100 134.26600 1.000 44.38616  ? 32  ARG C N     1 
ATOM 1522  C CA    . ARG C 3 33  ? 115.49400 117.30100 134.69300 1.000 44.38616  ? 32  ARG C CA    1 
ATOM 1523  C C     . ARG C 3 33  ? 114.49300 116.97000 133.59500 1.000 44.38616  ? 32  ARG C C     1 
ATOM 1524  O O     . ARG C 3 33  ? 113.38900 116.50000 133.88700 1.000 44.38616  ? 32  ARG C O     1 
ATOM 1525  C CB    . ARG C 3 33  ? 115.36400 118.76400 135.11200 1.000 44.38616  ? 32  ARG C CB    1 
ATOM 1526  C CG    . ARG C 3 33  ? 114.03300 119.12800 135.74500 1.000 44.38616  ? 32  ARG C CG    1 
ATOM 1527  C CD    . ARG C 3 33  ? 113.23700 120.06400 134.86100 1.000 44.38616  ? 32  ARG C CD    1 
ATOM 1528  N NE    . ARG C 3 33  ? 114.01100 121.23800 134.47400 1.000 44.38616  ? 32  ARG C NE    1 
ATOM 1529  C CZ    . ARG C 3 33  ? 113.60900 122.13200 133.57800 1.000 44.38616  ? 32  ARG C CZ    1 
ATOM 1530  N NH1   . ARG C 3 33  ? 112.43600 121.98900 132.97900 1.000 44.38616  ? 32  ARG C NH1   1 
ATOM 1531  N NH2   . ARG C 3 33  ? 114.37600 123.16900 133.28300 1.000 44.38616  ? 32  ARG C NH2   1 
ATOM 1532  N N     . LEU C 3 34  ? 114.86500 117.17700 132.33200 1.000 38.53215  ? 33  LEU C N     1 
ATOM 1533  C CA    . LEU C 3 34  ? 113.97300 116.81100 131.24000 1.000 38.53215  ? 33  LEU C CA    1 
ATOM 1534  C C     . LEU C 3 34  ? 113.90800 115.30200 131.05700 1.000 38.53215  ? 33  LEU C C     1 
ATOM 1535  O O     . LEU C 3 34  ? 112.89600 114.78300 130.57900 1.000 38.53215  ? 33  LEU C O     1 
ATOM 1536  C CB    . LEU C 3 34  ? 114.41600 117.48800 129.94700 1.000 38.53215  ? 33  LEU C CB    1 
ATOM 1537  C CG    . LEU C 3 34  ? 114.14300 118.98600 129.85100 1.000 38.53215  ? 33  LEU C CG    1 
ATOM 1538  C CD1   . LEU C 3 34  ? 114.59100 119.50400 128.50800 1.000 38.53215  ? 33  LEU C CD1   1 
ATOM 1539  C CD2   . LEU C 3 34  ? 112.67700 119.27300 130.07300 1.000 38.53215  ? 33  LEU C CD2   1 
ATOM 1540  N N     . LEU C 3 35  ? 114.97800 114.58800 131.40500 1.000 37.48534  ? 34  LEU C N     1 
ATOM 1541  C CA    . LEU C 3 35  ? 114.94600 113.13200 131.37300 1.000 37.48534  ? 34  LEU C CA    1 
ATOM 1542  C C     . LEU C 3 35  ? 114.16300 112.55200 132.54000 1.000 37.48534  ? 34  LEU C C     1 
ATOM 1543  O O     . LEU C 3 35  ? 113.58600 111.46900 132.41300 1.000 37.48534  ? 34  LEU C O     1 
ATOM 1544  C CB    . LEU C 3 35  ? 116.36400 112.56900 131.38400 1.000 37.48534  ? 34  LEU C CB    1 
ATOM 1545  C CG    . LEU C 3 35  ? 117.16600 112.59300 130.09100 1.000 37.48534  ? 34  LEU C CG    1 
ATOM 1546  C CD1   . LEU C 3 35  ? 118.61700 112.33700 130.40200 1.000 37.48534  ? 34  LEU C CD1   1 
ATOM 1547  C CD2   . LEU C 3 35  ? 116.64700 111.55300 129.13200 1.000 37.48534  ? 34  LEU C CD2   1 
ATOM 1548  N N     . ARG C 3 36  ? 114.14000 113.23700 133.68300 1.000 42.60372  ? 35  ARG C N     1 
ATOM 1549  C CA    . ARG C 3 36  ? 113.41300 112.69600 134.82200 1.000 42.60372  ? 35  ARG C CA    1 
ATOM 1550  C C     . ARG C 3 36  ? 111.93200 113.04000 134.75600 1.000 42.60372  ? 35  ARG C C     1 
ATOM 1551  O O     . ARG C 3 36  ? 111.08600 112.20400 135.08800 1.000 42.60372  ? 35  ARG C O     1 
ATOM 1552  C CB    . ARG C 3 36  ? 114.00800 113.20800 136.13000 1.000 42.60372  ? 35  ARG C CB    1 
ATOM 1553  C CG    . ARG C 3 36  ? 115.29900 112.53600 136.54100 1.000 42.60372  ? 35  ARG C CG    1 
ATOM 1554  C CD    . ARG C 3 36  ? 115.54100 112.74400 138.02100 1.000 42.60372  ? 35  ARG C CD    1 
ATOM 1555  N NE    . ARG C 3 36  ? 115.49300 114.15800 138.37300 1.000 42.60372  ? 35  ARG C NE    1 
ATOM 1556  C CZ    . ARG C 3 36  ? 116.55700 114.88500 138.68700 1.000 42.60372  ? 35  ARG C CZ    1 
ATOM 1557  N NH1   . ARG C 3 36  ? 117.75700 114.32900 138.70200 1.000 42.60372  ? 35  ARG C NH1   1 
ATOM 1558  N NH2   . ARG C 3 36  ? 116.42000 116.16800 138.99000 1.000 42.60372  ? 35  ARG C NH2   1 
ATOM 1559  N N     . LYS C 3 37  ? 111.59700 114.26100 134.34500 1.000 40.63658  ? 36  LYS C N     1 
ATOM 1560  C CA    . LYS C 3 37  ? 110.21400 114.70600 134.26800 1.000 40.63658  ? 36  LYS C CA    1 
ATOM 1561  C C     . LYS C 3 37  ? 109.59300 114.44100 132.90800 1.000 40.63658  ? 36  LYS C C     1 
ATOM 1562  O O     . LYS C 3 37  ? 108.46600 114.87500 132.65900 1.000 40.63658  ? 36  LYS C O     1 
ATOM 1563  C CB    . LYS C 3 37  ? 110.11900 116.19800 134.58800 1.000 40.63658  ? 36  LYS C CB    1 
ATOM 1564  C CG    . LYS C 3 37  ? 110.05800 116.51500 136.06700 1.000 40.63658  ? 36  LYS C CG    1 
ATOM 1565  C CD    . LYS C 3 37  ? 110.00200 118.01600 136.30800 1.000 40.63658  ? 36  LYS C CD    1 
ATOM 1566  C CE    . LYS C 3 37  ? 108.82200 118.65600 135.59200 1.000 40.63658  ? 36  LYS C CE    1 
ATOM 1567  N NZ    . LYS C 3 37  ? 108.68600 120.10100 135.91900 1.000 40.63658  ? 36  LYS C NZ    1 
ATOM 1568  N N     . GLY C 3 38  ? 110.30100 113.75100 132.02800 1.000 38.41523  ? 37  GLY C N     1 
ATOM 1569  C CA    . GLY C 3 38  ? 109.81800 113.43100 130.70700 1.000 38.41523  ? 37  GLY C CA    1 
ATOM 1570  C C     . GLY C 3 38  ? 109.17800 112.07400 130.56700 1.000 38.41523  ? 37  GLY C C     1 
ATOM 1571  O O     . GLY C 3 38  ? 108.80100 111.71100 129.44800 1.000 38.41523  ? 37  GLY C O     1 
ATOM 1572  N N     . ASN C 3 39  ? 109.13700 111.28600 131.65100 1.000 38.44387  ? 38  ASN C N     1 
ATOM 1573  C CA    . ASN C 3 39  ? 108.48300 109.97900 131.75200 1.000 38.44387  ? 38  ASN C CA    1 
ATOM 1574  C C     . ASN C 3 39  ? 109.17400 108.90400 130.92800 1.000 38.44387  ? 38  ASN C C     1 
ATOM 1575  O O     . ASN C 3 39  ? 108.54200 107.90500 130.58300 1.000 38.44387  ? 38  ASN C O     1 
ATOM 1576  C CB    . ASN C 3 39  ? 106.99100 110.02900 131.39200 1.000 38.44387  ? 38  ASN C CB    1 
ATOM 1577  C CG    . ASN C 3 39  ? 106.20800 110.95400 132.28700 1.000 38.44387  ? 38  ASN C CG    1 
ATOM 1578  O OD1   . ASN C 3 39  ? 106.49900 111.08000 133.47600 1.000 38.44387  ? 38  ASN C OD1   1 
ATOM 1579  N ND2   . ASN C 3 39  ? 105.20300 111.61100 131.72200 1.000 38.44387  ? 38  ASN C ND2   1 
ATOM 1580  N N     . TYR C 3 40  ? 110.43900 109.11200 130.54800 1.000 35.71321  ? 39  TYR C N     1 
ATOM 1581  C CA    . TYR C 3 40  ? 111.13000 108.14700 129.69500 1.000 35.71321  ? 39  TYR C CA    1 
ATOM 1582  C C     . TYR C 3 40  ? 111.34900 106.81700 130.40600 1.000 35.71321  ? 39  TYR C C     1 
ATOM 1583  O O     . TYR C 3 40  ? 111.12400 105.75500 129.81700 1.000 35.71321  ? 39  TYR C O     1 
ATOM 1584  C CB    . TYR C 3 40  ? 112.44400 108.73300 129.18500 1.000 35.71321  ? 39  TYR C CB    1 
ATOM 1585  C CG    . TYR C 3 40  ? 112.21000 109.97700 128.36900 1.000 35.71321  ? 39  TYR C CG    1 
ATOM 1586  C CD1   . TYR C 3 40  ? 111.83100 109.88900 127.03800 1.000 35.71321  ? 39  TYR C CD1   1 
ATOM 1587  C CD2   . TYR C 3 40  ? 112.38700 111.23500 128.91800 1.000 35.71321  ? 39  TYR C CD2   1 
ATOM 1588  C CE1   . TYR C 3 40  ? 111.59600 111.02000 126.28600 1.000 35.71321  ? 39  TYR C CE1   1 
ATOM 1589  C CE2   . TYR C 3 40  ? 112.17100 112.37300 128.16900 1.000 35.71321  ? 39  TYR C CE2   1 
ATOM 1590  C CZ    . TYR C 3 40  ? 111.78100 112.25900 126.85300 1.000 35.71321  ? 39  TYR C CZ    1 
ATOM 1591  O OH    . TYR C 3 40  ? 111.56500 113.39200 126.10600 1.000 35.71321  ? 39  TYR C OH    1 
ATOM 1592  N N     . ALA C 3 41  ? 111.75100 106.84800 131.67000 1.000 41.83206  ? 40  ALA C N     1 
ATOM 1593  C CA    . ALA C 3 41  ? 111.94700 105.61900 132.42400 1.000 41.83206  ? 40  ALA C CA    1 
ATOM 1594  C C     . ALA C 3 41  ? 111.80100 105.93100 133.90100 1.000 41.83206  ? 40  ALA C C     1 
ATOM 1595  O O     . ALA C 3 41  ? 111.74700 107.09400 134.30800 1.000 41.83206  ? 40  ALA C O     1 
ATOM 1596  C CB    . ALA C 3 41  ? 113.30100 104.97700 132.13700 1.000 41.83206  ? 40  ALA C CB    1 
ATOM 1597  N N     . GLU C 3 42  ? 111.69000 104.86100 134.69300 1.000 46.97533  ? 41  GLU C N     1 
ATOM 1598  C CA    . GLU C 3 42  ? 111.52100 104.99100 136.13600 1.000 46.97533  ? 41  GLU C CA    1 
ATOM 1599  C C     . GLU C 3 42  ? 112.72200 105.66600 136.78700 1.000 46.97533  ? 41  GLU C C     1 
ATOM 1600  O O     . GLU C 3 42  ? 112.56100 106.50700 137.67700 1.000 46.97533  ? 41  GLU C O     1 
ATOM 1601  C CB    . GLU C 3 42  ? 111.27600 103.61800 136.75500 1.000 46.97533  ? 41  GLU C CB    1 
ATOM 1602  C CG    . GLU C 3 42  ? 110.80600 103.66800 138.19500 1.000 46.97533  ? 41  GLU C CG    1 
ATOM 1603  C CD    . GLU C 3 42  ? 110.73100 102.29900 138.83200 1.000 46.97533  ? 41  GLU C CD    1 
ATOM 1604  O OE1   . GLU C 3 42  ? 109.96000 102.13400 139.79800 1.000 46.97533  ? 41  GLU C OE1   1 
ATOM 1605  O OE2   . GLU C 3 42  ? 111.44400 101.38600 138.36800 1.000 46.97533  ? 41  GLU C OE2   1 
ATOM 1606  N N     . ARG C 3 43  ? 113.93100 105.31300 136.36300 1.000 49.47353  ? 42  ARG C N     1 
ATOM 1607  C CA    . ARG C 3 43  ? 115.13800 105.92100 136.89900 1.000 49.47353  ? 42  ARG C CA    1 
ATOM 1608  C C     . ARG C 3 43  ? 116.04900 106.36300 135.76200 1.000 49.47353  ? 42  ARG C C     1 
ATOM 1609  O O     . ARG C 3 43  ? 116.03400 105.78600 134.67500 1.000 49.47353  ? 42  ARG C O     1 
ATOM 1610  C CB    . ARG C 3 43  ? 115.87400 104.95100 137.83400 1.000 49.47353  ? 42  ARG C CB    1 
ATOM 1611  C CG    . ARG C 3 43  ? 115.12100 104.71700 139.13000 1.000 49.47353  ? 42  ARG C CG    1 
ATOM 1612  C CD    . ARG C 3 43  ? 115.61400 103.55800 139.96700 1.000 49.47353  ? 42  ARG C CD    1 
ATOM 1613  N NE    . ARG C 3 43  ? 117.04900 103.62700 140.20200 1.000 49.47353  ? 42  ARG C NE    1 
ATOM 1614  C CZ    . ARG C 3 43  ? 117.71900 102.77100 140.96300 1.000 49.47353  ? 42  ARG C CZ    1 
ATOM 1615  N NH1   . ARG C 3 43  ? 119.02800 102.89300 141.11600 1.000 49.47353  ? 42  ARG C NH1   1 
ATOM 1616  N NH2   . ARG C 3 43  ? 117.06800 101.83800 141.63200 1.000 49.47353  ? 42  ARG C NH2   1 
ATOM 1617  N N     . VAL C 3 44  ? 116.81400 107.42300 136.00900 1.000 44.36373  ? 43  VAL C N     1 
ATOM 1618  C CA    . VAL C 3 44  ? 117.78000 107.95700 135.05400 1.000 44.36373  ? 43  VAL C CA    1 
ATOM 1619  C C     . VAL C 3 44  ? 119.13700 108.00500 135.73800 1.000 44.36373  ? 43  VAL C C     1 
ATOM 1620  O O     . VAL C 3 44  ? 119.26800 108.59900 136.81100 1.000 44.36373  ? 43  VAL C O     1 
ATOM 1621  C CB    . VAL C 3 44  ? 117.37400 109.35600 134.55600 1.000 44.36373  ? 43  VAL C CB    1 
ATOM 1622  C CG1   . VAL C 3 44  ? 118.45400 109.95100 133.68400 1.000 44.36373  ? 43  VAL C CG1   1 
ATOM 1623  C CG2   . VAL C 3 44  ? 116.07500 109.28600 133.78700 1.000 44.36373  ? 43  VAL C CG2   1 
ATOM 1624  N N     . GLY C 3 45  ? 120.14900 107.42300 135.10200 1.000 43.76323  ? 44  GLY C N     1 
ATOM 1625  C CA    . GLY C 3 45  ? 121.47500 107.36600 135.68000 1.000 43.76323  ? 44  GLY C CA    1 
ATOM 1626  C C     . GLY C 3 45  ? 122.16400 108.72000 135.74400 1.000 43.76323  ? 44  GLY C C     1 
ATOM 1627  O O     . GLY C 3 45  ? 121.61600 109.76500 135.39400 1.000 43.76323  ? 44  GLY C O     1 
ATOM 1628  N N     . ALA C 3 46  ? 123.40800 108.69300 136.21800 1.000 41.75198  ? 45  ALA C N     1 
ATOM 1629  C CA    . ALA C 3 46  ? 124.14800 109.93900 136.37700 1.000 41.75198  ? 45  ALA C CA    1 
ATOM 1630  C C     . ALA C 3 46  ? 124.83200 110.35300 135.08400 1.000 41.75198  ? 45  ALA C C     1 
ATOM 1631  O O     . ALA C 3 46  ? 124.81300 111.53200 134.71900 1.000 41.75198  ? 45  ALA C O     1 
ATOM 1632  C CB    . ALA C 3 46  ? 125.17600 109.80600 137.49700 1.000 41.75198  ? 45  ALA C CB    1 
ATOM 1633  N N     . GLY C 3 47  ? 125.44500 109.40100 134.38400 1.000 37.26170  ? 46  GLY C N     1 
ATOM 1634  C CA    . GLY C 3 47  ? 126.13400 109.70000 133.14700 1.000 37.26170  ? 46  GLY C CA    1 
ATOM 1635  C C     . GLY C 3 47  ? 125.25400 109.79800 131.92800 1.000 37.26170  ? 46  GLY C C     1 
ATOM 1636  O O     . GLY C 3 47  ? 125.75400 110.13500 130.85200 1.000 37.26170  ? 46  GLY C O     1 
ATOM 1637  N N     . ALA C 3 48  ? 123.96800 109.49800 132.05600 1.000 34.97587  ? 47  ALA C N     1 
ATOM 1638  C CA    . ALA C 3 48  ? 123.06900 109.63500 130.91800 1.000 34.97587  ? 47  ALA C CA    1 
ATOM 1639  C C     . ALA C 3 48  ? 122.80200 111.09400 130.54200 1.000 34.97587  ? 47  ALA C C     1 
ATOM 1640  O O     . ALA C 3 48  ? 122.81300 111.38600 129.34200 1.000 34.97587  ? 47  ALA C O     1 
ATOM 1641  C CB    . ALA C 3 48  ? 121.75700 108.88500 131.16000 1.000 34.97587  ? 47  ALA C CB    1 
ATOM 1642  N N     . PRO C 3 49  ? 122.58300 112.05000 131.46800 1.000 35.91147  ? 48  PRO C N     1 
ATOM 1643  C CA    . PRO C 3 49  ? 122.52700 113.44400 131.01000 1.000 35.91147  ? 48  PRO C CA    1 
ATOM 1644  C C     . PRO C 3 49  ? 123.85900 113.99100 130.53600 1.000 35.91147  ? 48  PRO C C     1 
ATOM 1645  O O     . PRO C 3 49  ? 123.85600 114.86400 129.66300 1.000 35.91147  ? 48  PRO C O     1 
ATOM 1646  C CB    . PRO C 3 49  ? 122.00900 114.20000 132.23800 1.000 35.91147  ? 48  PRO C CB    1 
ATOM 1647  C CG    . PRO C 3 49  ? 122.36700 113.36400 133.35600 1.000 35.91147  ? 48  PRO C CG    1 
ATOM 1648  C CD    . PRO C 3 49  ? 122.10300 111.99500 132.86400 1.000 35.91147  ? 48  PRO C CD    1 
ATOM 1649  N N     . VAL C 3 50  ? 124.98800 113.49400 131.05000 1.000 34.07859  ? 49  VAL C N     1 
ATOM 1650  C CA    . VAL C 3 50  ? 126.29200 113.92700 130.54500 1.000 34.07859  ? 49  VAL C CA    1 
ATOM 1651  C C     . VAL C 3 50  ? 126.47800 113.47400 129.10300 1.000 34.07859  ? 49  VAL C C     1 
ATOM 1652  O O     . VAL C 3 50  ? 126.83300 114.27200 128.22700 1.000 34.07859  ? 49  VAL C O     1 
ATOM 1653  C CB    . VAL C 3 50  ? 127.42200 113.39800 131.44500 1.000 34.07859  ? 49  VAL C CB    1 
ATOM 1654  C CG1   . VAL C 3 50  ? 128.75700 113.56900 130.77200 1.000 34.07859  ? 49  VAL C CG1   1 
ATOM 1655  C CG2   . VAL C 3 50  ? 127.42500 114.10900 132.76800 1.000 34.07859  ? 49  VAL C CG2   1 
ATOM 1656  N N     . TYR C 3 51  ? 126.18600 112.19900 128.83400 1.000 33.33895  ? 50  TYR C N     1 
ATOM 1657  C CA    . TYR C 3 51  ? 126.28100 111.65000 127.48400 1.000 33.33895  ? 50  TYR C CA    1 
ATOM 1658  C C     . TYR C 3 51  ? 125.29300 112.32400 126.54200 1.000 33.33895  ? 50  TYR C C     1 
ATOM 1659  O O     . TYR C 3 51  ? 125.63200 112.63900 125.39200 1.000 33.33895  ? 50  TYR C O     1 
ATOM 1660  C CB    . TYR C 3 51  ? 126.02000 110.14800 127.53300 1.000 33.33895  ? 50  TYR C CB    1 
ATOM 1661  C CG    . TYR C 3 51  ? 126.71100 109.33700 126.47000 1.000 33.33895  ? 50  TYR C CG    1 
ATOM 1662  C CD1   . TYR C 3 51  ? 127.81900 108.57300 126.78000 1.000 33.33895  ? 50  TYR C CD1   1 
ATOM 1663  C CD2   . TYR C 3 51  ? 126.26700 109.33900 125.16000 1.000 33.33895  ? 50  TYR C CD2   1 
ATOM 1664  C CE1   . TYR C 3 51  ? 128.45400 107.82500 125.83100 1.000 33.33895  ? 50  TYR C CE1   1 
ATOM 1665  C CE2   . TYR C 3 51  ? 126.89800 108.59600 124.19700 1.000 33.33895  ? 50  TYR C CE2   1 
ATOM 1666  C CZ    . TYR C 3 51  ? 127.99400 107.84600 124.54400 1.000 33.33895  ? 50  TYR C CZ    1 
ATOM 1667  O OH    . TYR C 3 51  ? 128.63900 107.09600 123.59900 1.000 33.33895  ? 50  TYR C OH    1 
ATOM 1668  N N     . MET C 3 52  ? 124.07100 112.57100 127.02600 1.000 30.45994  ? 51  MET C N     1 
ATOM 1669  C CA    . MET C 3 52  ? 123.02900 113.20000 126.22600 1.000 30.45994  ? 51  MET C CA    1 
ATOM 1670  C C     . MET C 3 52  ? 123.39300 114.63000 125.85500 1.000 30.45994  ? 51  MET C C     1 
ATOM 1671  O O     . MET C 3 52  ? 123.25100 115.02900 124.69300 1.000 30.45994  ? 51  MET C O     1 
ATOM 1672  C CB    . MET C 3 52  ? 121.72000 113.16600 127.00800 1.000 30.45994  ? 51  MET C CB    1 
ATOM 1673  C CG    . MET C 3 52  ? 120.53600 113.75300 126.30300 1.000 30.45994  ? 51  MET C CG    1 
ATOM 1674  S SD    . MET C 3 52  ? 119.75400 112.60200 125.19000 1.000 30.45994  ? 51  MET C SD    1 
ATOM 1675  C CE    . MET C 3 52  ? 120.00800 113.49600 123.67700 1.000 30.45994  ? 51  MET C CE    1 
ATOM 1676  N N     . ALA C 3 53  ? 123.89300 115.40600 126.82100 1.000 32.47442  ? 52  ALA C N     1 
ATOM 1677  C CA    . ALA C 3 53  ? 124.27600 116.78000 126.54000 1.000 32.47442  ? 52  ALA C CA    1 
ATOM 1678  C C     . ALA C 3 53  ? 125.52300 116.84500 125.67400 1.000 32.47442  ? 52  ALA C C     1 
ATOM 1679  O O     . ALA C 3 53  ? 125.66600 117.77700 124.88100 1.000 32.47442  ? 52  ALA C O     1 
ATOM 1680  C CB    . ALA C 3 53  ? 124.48200 117.54500 127.84300 1.000 32.47442  ? 52  ALA C CB    1 
ATOM 1681  N N     . ALA C 3 54  ? 126.40300 115.84600 125.76700 1.000 31.48095  ? 53  ALA C N     1 
ATOM 1682  C CA    . ALA C 3 54  ? 127.57600 115.82200 124.90000 1.000 31.48095  ? 53  ALA C CA    1 
ATOM 1683  C C     . ALA C 3 54  ? 127.19500 115.53600 123.45700 1.000 31.48095  ? 53  ALA C C     1 
ATOM 1684  O O     . ALA C 3 54  ? 127.74700 116.14500 122.53200 1.000 31.48095  ? 53  ALA C O     1 
ATOM 1685  C CB    . ALA C 3 54  ? 128.56200 114.77800 125.39200 1.000 31.48095  ? 53  ALA C CB    1 
ATOM 1686  N N     . VAL C 3 55  ? 126.24800 114.62000 123.24700 1.000 30.53210  ? 54  VAL C N     1 
ATOM 1687  C CA    . VAL C 3 55  ? 125.79000 114.31900 121.89400 1.000 30.53210  ? 54  VAL C CA    1 
ATOM 1688  C C     . VAL C 3 55  ? 125.03600 115.50500 121.30100 1.000 30.53210  ? 54  VAL C C     1 
ATOM 1689  O O     . VAL C 3 55  ? 125.23700 115.86000 120.12900 1.000 30.53210  ? 54  VAL C O     1 
ATOM 1690  C CB    . VAL C 3 55  ? 124.94900 113.03300 121.91100 1.000 30.53210  ? 54  VAL C CB    1 
ATOM 1691  C CG1   . VAL C 3 55  ? 124.17000 112.86400 120.62700 1.000 30.53210  ? 54  VAL C CG1   1 
ATOM 1692  C CG2   . VAL C 3 55  ? 125.85700 111.84800 122.13600 1.000 30.53210  ? 54  VAL C CG2   1 
ATOM 1693  N N     . LEU C 3 56  ? 124.19100 116.16200 122.10800 1.000 31.31396  ? 55  LEU C N     1 
ATOM 1694  C CA    . LEU C 3 56  ? 123.47900 117.35000 121.63900 1.000 31.31396  ? 55  LEU C CA    1 
ATOM 1695  C C     . LEU C 3 56  ? 124.43700 118.49200 121.32600 1.000 31.31396  ? 55  LEU C C     1 
ATOM 1696  O O     . LEU C 3 56  ? 124.26100 119.19900 120.32700 1.000 31.31396  ? 55  LEU C O     1 
ATOM 1697  C CB    . LEU C 3 56  ? 122.45900 117.79900 122.67900 1.000 31.31396  ? 55  LEU C CB    1 
ATOM 1698  C CG    . LEU C 3 56  ? 121.22700 116.93200 122.89700 1.000 31.31396  ? 55  LEU C CG    1 
ATOM 1699  C CD1   . LEU C 3 56  ? 120.33100 117.58200 123.92700 1.000 31.31396  ? 55  LEU C CD1   1 
ATOM 1700  C CD2   . LEU C 3 56  ? 120.48600 116.69500 121.60300 1.000 31.31396  ? 55  LEU C CD2   1 
ATOM 1701  N N     . GLU C 3 57  ? 125.47400 118.66500 122.14900 1.000 33.62642  ? 56  GLU C N     1 
ATOM 1702  C CA    . GLU C 3 57  ? 126.46600 119.70600 121.91100 1.000 33.62642  ? 56  GLU C CA    1 
ATOM 1703  C C     . GLU C 3 57  ? 127.28700 119.42900 120.66000 1.000 33.62642  ? 56  GLU C C     1 
ATOM 1704  O O     . GLU C 3 57  ? 127.59400 120.35700 119.90500 1.000 33.62642  ? 56  GLU C O     1 
ATOM 1705  C CB    . GLU C 3 57  ? 127.38000 119.83100 123.12500 1.000 33.62642  ? 56  GLU C CB    1 
ATOM 1706  C CG    . GLU C 3 57  ? 128.36800 120.96200 123.05100 1.000 33.62642  ? 56  GLU C CG    1 
ATOM 1707  C CD    . GLU C 3 57  ? 129.79400 120.47000 122.99000 1.000 33.62642  ? 56  GLU C CD    1 
ATOM 1708  O OE1   . GLU C 3 57  ? 130.00000 119.24000 123.00400 1.000 33.62642  ? 56  GLU C OE1   1 
ATOM 1709  O OE2   . GLU C 3 57  ? 130.71400 121.31100 122.93900 1.000 33.62642  ? 56  GLU C OE2   1 
ATOM 1710  N N     . TYR C 3 58  ? 127.63000 118.16200 120.40700 1.000 35.46935  ? 57  TYR C N     1 
ATOM 1711  C CA    . TYR C 3 58  ? 128.36700 117.83800 119.18900 1.000 35.46935  ? 57  TYR C CA    1 
ATOM 1712  C C     . TYR C 3 58  ? 127.51700 118.05300 117.94600 1.000 35.46935  ? 57  TYR C C     1 
ATOM 1713  O O     . TYR C 3 58  ? 128.01200 118.57100 116.93800 1.000 35.46935  ? 57  TYR C O     1 
ATOM 1714  C CB    . TYR C 3 58  ? 128.87900 116.40200 119.22500 1.000 35.46935  ? 57  TYR C CB    1 
ATOM 1715  C CG    . TYR C 3 58  ? 129.39900 115.96100 117.88100 1.000 35.46935  ? 57  TYR C CG    1 
ATOM 1716  C CD1   . TYR C 3 58  ? 130.55200 116.52400 117.35000 1.000 35.46935  ? 57  TYR C CD1   1 
ATOM 1717  C CD2   . TYR C 3 58  ? 128.72300 115.01500 117.12400 1.000 35.46935  ? 57  TYR C CD2   1 
ATOM 1718  C CE1   . TYR C 3 58  ? 131.02500 116.14400 116.11600 1.000 35.46935  ? 57  TYR C CE1   1 
ATOM 1719  C CE2   . TYR C 3 58  ? 129.18900 114.63300 115.88900 1.000 35.46935  ? 57  TYR C CE2   1 
ATOM 1720  C CZ    . TYR C 3 58  ? 130.34000 115.20000 115.39200 1.000 35.46935  ? 57  TYR C CZ    1 
ATOM 1721  O OH    . TYR C 3 58  ? 130.80600 114.81800 114.16000 1.000 35.46935  ? 57  TYR C OH    1 
ATOM 1722  N N     . LEU C 3 59  ? 126.24300 117.65200 117.98900 1.000 33.17279  ? 58  LEU C N     1 
ATOM 1723  C CA    . LEU C 3 59  ? 125.38100 117.82400 116.82300 1.000 33.17279  ? 58  LEU C CA    1 
ATOM 1724  C C     . LEU C 3 59  ? 125.10900 119.29700 116.55500 1.000 33.17279  ? 58  LEU C C     1 
ATOM 1725  O O     . LEU C 3 59  ? 125.09600 119.73300 115.39500 1.000 33.17279  ? 58  LEU C O     1 
ATOM 1726  C CB    . LEU C 3 59  ? 124.07600 117.06200 117.02200 1.000 33.17279  ? 58  LEU C CB    1 
ATOM 1727  C CG    . LEU C 3 59  ? 124.15100 115.55100 116.82500 1.000 33.17279  ? 58  LEU C CG    1 
ATOM 1728  C CD1   . LEU C 3 59  ? 122.76500 114.97700 116.87800 1.000 33.17279  ? 58  LEU C CD1   1 
ATOM 1729  C CD2   . LEU C 3 59  ? 124.80800 115.20800 115.50500 1.000 33.17279  ? 58  LEU C CD2   1 
ATOM 1730  N N     . THR C 3 60  ? 124.95600 120.08700 117.62300 1.000 32.19158  ? 59  THR C N     1 
ATOM 1731  C CA    . THR C 3 60  ? 124.77800 121.52400 117.48300 1.000 32.19158  ? 59  THR C CA    1 
ATOM 1732  C C     . THR C 3 60  ? 126.04800 122.19200 116.96600 1.000 32.19158  ? 59  THR C C     1 
ATOM 1733  O O     . THR C 3 60  ? 125.96700 123.09100 116.12400 1.000 32.19158  ? 59  THR C O     1 
ATOM 1734  C CB    . THR C 3 60  ? 124.34400 122.09300 118.83700 1.000 32.19158  ? 59  THR C CB    1 
ATOM 1735  O OG1   . THR C 3 60  ? 123.00900 121.66300 119.11600 1.000 32.19158  ? 59  THR C OG1   1 
ATOM 1736  C CG2   . THR C 3 60  ? 124.38100 123.60000 118.87300 1.000 32.19158  ? 59  THR C CG2   1 
ATOM 1737  N N     . ALA C 3 61  ? 127.22200 121.69000 117.35900 1.000 33.79203  ? 60  ALA C N     1 
ATOM 1738  C CA    . ALA C 3 61  ? 128.47600 122.21800 116.83100 1.000 33.79203  ? 60  ALA C CA    1 
ATOM 1739  C C     . ALA C 3 61  ? 128.65200 121.88700 115.35900 1.000 33.79203  ? 60  ALA C C     1 
ATOM 1740  O O     . ALA C 3 61  ? 129.13000 122.72500 114.58900 1.000 33.79203  ? 60  ALA C O     1 
ATOM 1741  C CB    . ALA C 3 61  ? 129.65100 121.68000 117.64200 1.000 33.79203  ? 60  ALA C CB    1 
ATOM 1742  N N     . GLU C 3 62  ? 128.24000 120.68800 114.94600 1.000 35.42663  ? 61  GLU C N     1 
ATOM 1743  C CA    . GLU C 3 62  ? 128.36200 120.29200 113.54500 1.000 35.42663  ? 61  GLU C CA    1 
ATOM 1744  C C     . GLU C 3 62  ? 127.45700 121.12900 112.64900 1.000 35.42663  ? 61  GLU C C     1 
ATOM 1745  O O     . GLU C 3 62  ? 127.91000 121.69100 111.63800 1.000 35.42663  ? 61  GLU C O     1 
ATOM 1746  C CB    . GLU C 3 62  ? 128.03500 118.81000 113.39600 1.000 35.42663  ? 61  GLU C CB    1 
ATOM 1747  C CG    . GLU C 3 62  ? 128.44300 118.22700 112.07200 1.000 35.42663  ? 61  GLU C CG    1 
ATOM 1748  C CD    . GLU C 3 62  ? 129.88800 117.78500 112.06800 1.000 35.42663  ? 61  GLU C CD    1 
ATOM 1749  O OE1   . GLU C 3 62  ? 130.49200 117.74100 113.15700 1.000 35.42663  ? 61  GLU C OE1   1 
ATOM 1750  O OE2   . GLU C 3 62  ? 130.42000 117.47600 110.98200 1.000 35.42663  ? 61  GLU C OE2   1 
ATOM 1751  N N     . ILE C 3 63  ? 126.17700 121.24600 113.01700 1.000 32.30701  ? 62  ILE C N     1 
ATOM 1752  C CA    . ILE C 3 63  ? 125.26300 121.99500 112.16100 1.000 32.30701  ? 62  ILE C CA    1 
ATOM 1753  C C     . ILE C 3 63  ? 125.52900 123.50000 112.24300 1.000 32.30701  ? 62  ILE C C     1 
ATOM 1754  O O     . ILE C 3 63  ? 125.36900 124.20900 111.24300 1.000 32.30701  ? 62  ILE C O     1 
ATOM 1755  C CB    . ILE C 3 63  ? 123.79900 121.62200 112.47300 1.000 32.30701  ? 62  ILE C CB    1 
ATOM 1756  C CG1   . ILE C 3 63  ? 122.84900 122.20500 111.42400 1.000 32.30701  ? 62  ILE C CG1   1 
ATOM 1757  C CG2   . ILE C 3 63  ? 123.39700 122.05900 113.85400 1.000 32.30701  ? 62  ILE C CG2   1 
ATOM 1758  C CD1   . ILE C 3 63  ? 121.38800 121.97300 111.72600 1.000 32.30701  ? 62  ILE C CD1   1 
ATOM 1759  N N     . LEU C 3 64  ? 126.04000 124.00900 113.37200 1.000 35.16760  ? 63  LEU C N     1 
ATOM 1760  C CA    . LEU C 3 64  ? 126.38500 125.42500 113.42600 1.000 35.16760  ? 63  LEU C CA    1 
ATOM 1761  C C     . LEU C 3 64  ? 127.68000 125.73900 112.69400 1.000 35.16760  ? 63  LEU C C     1 
ATOM 1762  O O     . LEU C 3 64  ? 127.81000 126.83200 112.14400 1.000 35.16760  ? 63  LEU C O     1 
ATOM 1763  C CB    . LEU C 3 64  ? 126.48400 125.90300 114.87200 1.000 35.16760  ? 63  LEU C CB    1 
ATOM 1764  C CG    . LEU C 3 64  ? 125.16400 126.32400 115.50600 1.000 35.16760  ? 63  LEU C CG    1 
ATOM 1765  C CD1   . LEU C 3 64  ? 125.37500 126.67900 116.95200 1.000 35.16760  ? 63  LEU C CD1   1 
ATOM 1766  C CD2   . LEU C 3 64  ? 124.58200 127.49400 114.75600 1.000 35.16760  ? 63  LEU C CD2   1 
ATOM 1767  N N     . GLU C 3 65  ? 128.62500 124.79900 112.63200 1.000 37.60390  ? 64  GLU C N     1 
ATOM 1768  C CA    . GLU C 3 65  ? 129.82300 125.02500 111.83300 1.000 37.60390  ? 64  GLU C CA    1 
ATOM 1769  C C     . GLU C 3 65  ? 129.50300 125.01300 110.34500 1.000 37.60390  ? 64  GLU C C     1 
ATOM 1770  O O     . GLU C 3 65  ? 130.01200 125.85200 109.58600 1.000 37.60390  ? 64  GLU C O     1 
ATOM 1771  C CB    . GLU C 3 65  ? 130.87400 123.97000 112.15800 1.000 37.60390  ? 64  GLU C CB    1 
ATOM 1772  C CG    . GLU C 3 65  ? 132.23100 124.26400 111.56900 1.000 37.60390  ? 64  GLU C CG    1 
ATOM 1773  C CD    . GLU C 3 65  ? 133.23400 123.18200 111.87800 1.000 37.60390  ? 64  GLU C CD    1 
ATOM 1774  O OE1   . GLU C 3 65  ? 132.81500 122.02200 112.06200 1.000 37.60390  ? 64  GLU C OE1   1 
ATOM 1775  O OE2   . GLU C 3 65  ? 134.44000 123.49300 111.94800 1.000 37.60390  ? 64  GLU C OE2   1 
ATOM 1776  N N     . LEU C 3 66  ? 128.64000 124.08800 109.91200 1.000 36.54170  ? 65  LEU C N     1 
ATOM 1777  C CA    . LEU C 3 66  ? 128.25200 124.07100 108.50600 1.000 36.54170  ? 65  LEU C CA    1 
ATOM 1778  C C     . LEU C 3 66  ? 127.40000 125.28600 108.14000 1.000 36.54170  ? 65  LEU C C     1 
ATOM 1779  O O     . LEU C 3 66  ? 127.55500 125.85000 107.04900 1.000 36.54170  ? 65  LEU C O     1 
ATOM 1780  C CB    . LEU C 3 66  ? 127.51800 122.77600 108.18200 1.000 36.54170  ? 65  LEU C CB    1 
ATOM 1781  C CG    . LEU C 3 66  ? 128.38200 121.52200 108.19300 1.000 36.54170  ? 65  LEU C CG    1 
ATOM 1782  C CD1   . LEU C 3 66  ? 127.52000 120.30500 107.96200 1.000 36.54170  ? 65  LEU C CD1   1 
ATOM 1783  C CD2   . LEU C 3 66  ? 129.46100 121.62400 107.14400 1.000 36.54170  ? 65  LEU C CD2   1 
ATOM 1784  N N     . ALA C 3 67  ? 126.52600 125.73200 109.05100 1.000 36.92676  ? 66  ALA C N     1 
ATOM 1785  C CA    . ALA C 3 67  ? 125.74000 126.93400 108.80100 1.000 36.92676  ? 66  ALA C CA    1 
ATOM 1786  C C     . ALA C 3 67  ? 126.60100 128.18700 108.81500 1.000 36.92676  ? 66  ALA C C     1 
ATOM 1787  O O     . ALA C 3 67  ? 126.32900 129.12700 108.06400 1.000 36.92676  ? 66  ALA C O     1 
ATOM 1788  C CB    . ALA C 3 67  ? 124.62700 127.05600 109.83300 1.000 36.92676  ? 66  ALA C CB    1 
ATOM 1789  N N     . GLY C 3 68  ? 127.64600 128.21900 109.64100 1.000 40.40704  ? 67  GLY C N     1 
ATOM 1790  C CA    . GLY C 3 68  ? 128.54100 129.36000 109.63500 1.000 40.40704  ? 67  GLY C CA    1 
ATOM 1791  C C     . GLY C 3 68  ? 129.37000 129.43600 108.37000 1.000 40.40704  ? 67  GLY C C     1 
ATOM 1792  O O     . GLY C 3 68  ? 129.60900 130.52500 107.84400 1.000 40.40704  ? 67  GLY C O     1 
ATOM 1793  N N     . ASN C 3 69  ? 129.80100 128.28200 107.85200 1.000 41.99430  ? 68  ASN C N     1 
ATOM 1794  C CA    . ASN C 3 69  ? 130.48400 128.27300 106.56100 1.000 41.99430  ? 68  ASN C CA    1 
ATOM 1795  C C     . ASN C 3 69  ? 129.54600 128.67200 105.42500 1.000 41.99430  ? 68  ASN C C     1 
ATOM 1796  O O     . ASN C 3 69  ? 129.94800 129.40500 104.51500 1.000 41.99430  ? 68  ASN C O     1 
ATOM 1797  C CB    . ASN C 3 69  ? 131.09800 126.90300 106.29800 1.000 41.99430  ? 68  ASN C CB    1 
ATOM 1798  C CG    . ASN C 3 69  ? 132.41900 126.72000 107.00500 1.000 41.99430  ? 68  ASN C CG    1 
ATOM 1799  O OD1   . ASN C 3 69  ? 133.18500 127.66900 107.16600 1.000 41.99430  ? 68  ASN C OD1   1 
ATOM 1800  N ND2   . ASN C 3 69  ? 132.69400 125.49700 107.43900 1.000 41.99430  ? 68  ASN C ND2   1 
ATOM 1801  N N     . ALA C 3 70  ? 128.29100 128.21100 105.46400 1.000 43.28647  ? 69  ALA C N     1 
ATOM 1802  C CA    . ALA C 3 70  ? 127.33500 128.58900 104.42600 1.000 43.28647  ? 69  ALA C CA    1 
ATOM 1803  C C     . ALA C 3 70  ? 126.93500 130.05700 104.51400 1.000 43.28647  ? 69  ALA C C     1 
ATOM 1804  O O     . ALA C 3 70  ? 126.57800 130.65900 103.49700 1.000 43.28647  ? 69  ALA C O     1 
ATOM 1805  C CB    . ALA C 3 70  ? 126.09500 127.70400 104.50300 1.000 43.28647  ? 69  ALA C CB    1 
ATOM 1806  N N     . ALA C 3 71  ? 126.98800 130.65000 105.70500 1.000 44.88792  ? 70  ALA C N     1 
ATOM 1807  C CA    . ALA C 3 71  ? 126.73500 132.07900 105.83500 1.000 44.88792  ? 70  ALA C CA    1 
ATOM 1808  C C     . ALA C 3 71  ? 127.94000 132.91300 105.43500 1.000 44.88792  ? 70  ALA C C     1 
ATOM 1809  O O     . ALA C 3 71  ? 127.77500 134.01600 104.90900 1.000 44.88792  ? 70  ALA C O     1 
ATOM 1810  C CB    . ALA C 3 71  ? 126.34500 132.41800 107.27000 1.000 44.88792  ? 70  ALA C CB    1 
ATOM 1811  N N     . ARG C 3 72  ? 129.15000 132.41100 105.68300 1.000 47.99564  ? 71  ARG C N     1 
ATOM 1812  C CA    . ARG C 3 72  ? 130.35100 133.12200 105.26400 1.000 47.99564  ? 71  ARG C CA    1 
ATOM 1813  C C     . ARG C 3 72  ? 130.58300 133.01700 103.76300 1.000 47.99564  ? 71  ARG C C     1 
ATOM 1814  O O     . ARG C 3 72  ? 131.23100 133.89100 103.18000 1.000 47.99564  ? 71  ARG C O     1 
ATOM 1815  C CB    . ARG C 3 72  ? 131.55400 132.58400 106.03400 1.000 47.99564  ? 71  ARG C CB    1 
ATOM 1816  C CG    . ARG C 3 72  ? 132.67000 133.58100 106.23000 1.000 47.99564  ? 71  ARG C CG    1 
ATOM 1817  C CD    . ARG C 3 72  ? 133.73800 133.00900 107.14100 1.000 47.99564  ? 71  ARG C CD    1 
ATOM 1818  N NE    . ARG C 3 72  ? 134.12500 131.65700 106.74700 1.000 47.99564  ? 71  ARG C NE    1 
ATOM 1819  C CZ    . ARG C 3 72  ? 135.05200 131.37800 105.83900 1.000 47.99564  ? 71  ARG C CZ    1 
ATOM 1820  N NH1   . ARG C 3 72  ? 135.69500 132.35700 105.22000 1.000 47.99564  ? 71  ARG C NH1   1 
ATOM 1821  N NH2   . ARG C 3 72  ? 135.33600 130.11800 105.54800 1.000 47.99564  ? 71  ARG C NH2   1 
ATOM 1822  N N     . ASP C 3 73  ? 130.07000 131.96200 103.12200 1.000 48.95871  ? 72  ASP C N     1 
ATOM 1823  C CA    . ASP C 3 73  ? 130.17900 131.86100 101.66900 1.000 48.95871  ? 72  ASP C CA    1 
ATOM 1824  C C     . ASP C 3 73  ? 129.25500 132.85000 100.97100 1.000 48.95871  ? 72  ASP C C     1 
ATOM 1825  O O     . ASP C 3 73  ? 129.52500 133.25400 99.83600  1.000 48.95871  ? 72  ASP C O     1 
ATOM 1826  C CB    . ASP C 3 73  ? 129.87800 130.43600 101.21000 1.000 48.95871  ? 72  ASP C CB    1 
ATOM 1827  C CG    . ASP C 3 73  ? 130.72100 130.02000 100.01900 1.000 48.95871  ? 72  ASP C CG    1 
ATOM 1828  O OD1   . ASP C 3 73  ? 130.40300 128.98900 99.39200  1.000 48.95871  ? 72  ASP C OD1   1 
ATOM 1829  O OD2   . ASP C 3 73  ? 131.69900 130.72900 99.70500  1.000 48.95871  ? 72  ASP C OD2   1 
ATOM 1830  N N     . ASN C 3 74  ? 128.16400 133.23600 101.62400 1.000 48.78234  ? 73  ASN C N     1 
ATOM 1831  C CA    . ASN C 3 74  ? 127.25300 134.25500 101.12500 1.000 48.78234  ? 73  ASN C CA    1 
ATOM 1832  C C     . ASN C 3 74  ? 127.68300 135.65800 101.54100 1.000 48.78234  ? 73  ASN C C     1 
ATOM 1833  O O     . ASN C 3 74  ? 126.96400 136.62200 101.25800 1.000 48.78234  ? 73  ASN C O     1 
ATOM 1834  C CB    . ASN C 3 74  ? 125.83700 133.96600 101.62600 1.000 48.78234  ? 73  ASN C CB    1 
ATOM 1835  C CG    . ASN C 3 74  ? 124.76600 134.50600 100.70900 1.000 48.78234  ? 73  ASN C CG    1 
ATOM 1836  O OD1   . ASN C 3 74  ? 125.05900 135.07300 99.65800  1.000 48.78234  ? 73  ASN C OD1   1 
ATOM 1837  N ND2   . ASN C 3 74  ? 123.51100 134.33800 101.10700 1.000 48.78234  ? 73  ASN C ND2   1 
ATOM 1838  N N     . LYS C 3 75  ? 128.85200 135.77200 102.18800 1.000 53.20729  ? 74  LYS C N     1 
ATOM 1839  C CA    . LYS C 3 75  ? 129.42100 137.01800 102.72000 1.000 53.20729  ? 74  LYS C CA    1 
ATOM 1840  C C     . LYS C 3 75  ? 128.45800 137.72700 103.67400 1.000 53.20729  ? 74  LYS C C     1 
ATOM 1841  O O     . LYS C 3 75  ? 128.21800 138.93200 103.57700 1.000 53.20729  ? 74  LYS C O     1 
ATOM 1842  C CB    . LYS C 3 75  ? 129.88000 137.94500 101.58900 1.000 53.20729  ? 74  LYS C CB    1 
ATOM 1843  C CG    . LYS C 3 75  ? 130.84000 137.27300 100.60600 1.000 53.20729  ? 74  LYS C CG    1 
ATOM 1844  C CD    . LYS C 3 75  ? 131.74600 138.27200 99.90000  1.000 53.20729  ? 74  LYS C CD    1 
ATOM 1845  C CE    . LYS C 3 75  ? 130.95700 139.21700 99.01100  1.000 53.20729  ? 74  LYS C CE    1 
ATOM 1846  N NZ    . LYS C 3 75  ? 131.84000 140.20800 98.33900  1.000 53.20729  ? 74  LYS C NZ    1 
ATOM 1847  N N     . LYS C 3 76  ? 127.91300 136.96000 104.61400 1.000 57.00780  ? 75  LYS C N     1 
ATOM 1848  C CA    . LYS C 3 76  ? 127.10000 137.47400 105.70500 1.000 57.00780  ? 75  LYS C CA    1 
ATOM 1849  C C     . LYS C 3 76  ? 127.72700 137.05100 107.02700 1.000 57.00780  ? 75  LYS C C     1 
ATOM 1850  O O     . LYS C 3 76  ? 128.24400 135.93700 107.14800 1.000 57.00780  ? 75  LYS C O     1 
ATOM 1851  C CB    . LYS C 3 76  ? 125.66100 136.96000 105.62600 1.000 57.00780  ? 75  LYS C CB    1 
ATOM 1852  C CG    . LYS C 3 76  ? 124.96900 137.20300 104.30200 1.000 57.00780  ? 75  LYS C CG    1 
ATOM 1853  C CD    . LYS C 3 76  ? 124.66000 138.67000 104.10000 1.000 57.00780  ? 75  LYS C CD    1 
ATOM 1854  C CE    . LYS C 3 76  ? 123.26500 138.87000 103.53400 1.000 57.00780  ? 75  LYS C CE    1 
ATOM 1855  N NZ    . LYS C 3 76  ? 123.07300 138.14000 102.25700 1.000 57.00780  ? 75  LYS C NZ    1 
ATOM 1856  N N     . THR C 3 77  ? 127.68300 137.94000 108.01900 1.000 59.97034  ? 76  THR C N     1 
ATOM 1857  C CA    . THR C 3 77  ? 128.18700 137.64200 109.35400 1.000 59.97034  ? 76  THR C CA    1 
ATOM 1858  C C     . THR C 3 77  ? 127.07600 137.27200 110.32700 1.000 59.97034  ? 76  THR C C     1 
ATOM 1859  O O     . THR C 3 77  ? 127.18600 137.55100 111.52400 1.000 59.97034  ? 76  THR C O     1 
ATOM 1860  C CB    . THR C 3 77  ? 128.98400 138.82300 109.90300 1.000 59.97034  ? 76  THR C CB    1 
ATOM 1861  O OG1   . THR C 3 77  ? 128.07900 139.82000 110.39000 1.000 59.97034  ? 76  THR C OG1   1 
ATOM 1862  C CG2   . THR C 3 77  ? 129.86000 139.42600 108.81800 1.000 59.97034  ? 76  THR C CG2   1 
ATOM 1863  N N     . ARG C 3 78  ? 126.00800 136.64900 109.83800 1.000 55.41489  ? 77  ARG C N     1 
ATOM 1864  C CA    . ARG C 3 78  ? 124.86200 136.32000 110.67100 1.000 55.41489  ? 77  ARG C CA    1 
ATOM 1865  C C     . ARG C 3 78  ? 124.10300 135.19000 109.99800 1.000 55.41489  ? 77  ARG C C     1 
ATOM 1866  O O     . ARG C 3 78  ? 123.96000 135.17700 108.77400 1.000 55.41489  ? 77  ARG C O     1 
ATOM 1867  C CB    . ARG C 3 78  ? 123.94900 137.53300 110.88100 1.000 55.41489  ? 77  ARG C CB    1 
ATOM 1868  C CG    . ARG C 3 78  ? 122.83200 137.31600 111.87800 1.000 55.41489  ? 77  ARG C CG    1 
ATOM 1869  C CD    . ARG C 3 78  ? 122.06600 138.59700 112.12900 1.000 55.41489  ? 77  ARG C CD    1 
ATOM 1870  N NE    . ARG C 3 78  ? 122.89800 139.59700 112.78400 1.000 55.41489  ? 77  ARG C NE    1 
ATOM 1871  C CZ    . ARG C 3 78  ? 122.53600 140.85900 112.97800 1.000 55.41489  ? 77  ARG C CZ    1 
ATOM 1872  N NH1   . ARG C 3 78  ? 121.34800 141.28000 112.57500 1.000 55.41489  ? 77  ARG C NH1   1 
ATOM 1873  N NH2   . ARG C 3 78  ? 123.35900 141.69800 113.58400 1.000 55.41489  ? 77  ARG C NH2   1 
ATOM 1874  N N     . ILE C 3 79  ? 123.63300 134.24200 110.80000 1.000 41.58816  ? 78  ILE C N     1 
ATOM 1875  C CA    . ILE C 3 79  ? 123.00700 133.02300 110.30900 1.000 41.58816  ? 78  ILE C CA    1 
ATOM 1876  C C     . ILE C 3 79  ? 121.49900 133.22300 110.29300 1.000 41.58816  ? 78  ILE C C     1 
ATOM 1877  O O     . ILE C 3 79  ? 120.88700 133.48300 111.33400 1.000 41.58816  ? 78  ILE C O     1 
ATOM 1878  C CB    . ILE C 3 79  ? 123.39900 131.81700 111.17600 1.000 41.58816  ? 78  ILE C CB    1 
ATOM 1879  C CG1   . ILE C 3 79  ? 124.91500 131.64600 111.17600 1.000 41.58816  ? 78  ILE C CG1   1 
ATOM 1880  C CG2   . ILE C 3 79  ? 122.72000 130.56000 110.68100 1.000 41.58816  ? 78  ILE C CG2   1 
ATOM 1881  C CD1   . ILE C 3 79  ? 125.38900 130.49900 112.01500 1.000 41.58816  ? 78  ILE C CD1   1 
ATOM 1882  N N     . ILE C 3 80  ? 120.90000 133.09700 109.11400 1.000 36.49598  ? 79  ILE C N     1 
ATOM 1883  C CA    . ILE C 3 80  ? 119.45100 133.11700 108.94700 1.000 36.49598  ? 79  ILE C CA    1 
ATOM 1884  C C     . ILE C 3 80  ? 119.08900 131.67100 108.61800 1.000 36.49598  ? 79  ILE C C     1 
ATOM 1885  O O     . ILE C 3 80  ? 120.00600 130.88900 108.33400 1.000 36.49598  ? 79  ILE C O     1 
ATOM 1886  C CB    . ILE C 3 80  ? 119.03900 134.12300 107.85800 1.000 36.49598  ? 79  ILE C CB    1 
ATOM 1887  C CG1   . ILE C 3 80  ? 119.53300 133.66900 106.49000 1.000 36.49598  ? 79  ILE C CG1   1 
ATOM 1888  C CG2   . ILE C 3 80  ? 119.57200 135.50000 108.18400 1.000 36.49598  ? 79  ILE C CG2   1 
ATOM 1889  C CD1   . ILE C 3 80  ? 118.98300 134.48100 105.35200 1.000 36.49598  ? 79  ILE C CD1   1 
ATOM 1890  N N     . PRO C 3 81  ? 117.82100 131.23500 108.67500 1.000 34.91648  ? 80  PRO C N     1 
ATOM 1891  C CA    . PRO C 3 81  ? 117.53500 129.81400 108.40700 1.000 34.91648  ? 80  PRO C CA    1 
ATOM 1892  C C     . PRO C 3 81  ? 117.75900 129.35500 106.96800 1.000 34.91648  ? 80  PRO C C     1 
ATOM 1893  O O     . PRO C 3 81  ? 117.67700 128.14700 106.72300 1.000 34.91648  ? 80  PRO C O     1 
ATOM 1894  C CB    . PRO C 3 81  ? 116.06100 129.67300 108.80600 1.000 34.91648  ? 80  PRO C CB    1 
ATOM 1895  C CG    . PRO C 3 81  ? 115.52700 131.02900 108.80100 1.000 34.91648  ? 80  PRO C CG    1 
ATOM 1896  C CD    . PRO C 3 81  ? 116.63700 131.89200 109.25700 1.000 34.91648  ? 80  PRO C CD    1 
ATOM 1897  N N     . ARG C 3 82  ? 118.00100 130.25700 106.01200 1.000 35.69002  ? 81  ARG C N     1 
ATOM 1898  C CA    . ARG C 3 82  ? 118.49200 129.83400 104.70200 1.000 35.69002  ? 81  ARG C CA    1 
ATOM 1899  C C     . ARG C 3 82  ? 119.83900 129.13200 104.81300 1.000 35.69002  ? 81  ARG C C     1 
ATOM 1900  O O     . ARG C 3 82  ? 120.07200 128.10900 104.15800 1.000 35.69002  ? 81  ARG C O     1 
ATOM 1901  C CB    . ARG C 3 82  ? 118.60600 131.03700 103.76600 1.000 35.69002  ? 81  ARG C CB    1 
ATOM 1902  C CG    . ARG C 3 82  ? 119.31100 130.74800 102.44400 1.000 35.69002  ? 81  ARG C CG    1 
ATOM 1903  C CD    . ARG C 3 82  ? 118.33500 130.47000 101.33000 1.000 35.69002  ? 81  ARG C CD    1 
ATOM 1904  N NE    . ARG C 3 82  ? 118.98000 130.08500 100.08200 1.000 35.69002  ? 81  ARG C NE    1 
ATOM 1905  C CZ    . ARG C 3 82  ? 118.95400 128.85800 99.58200  1.000 35.69002  ? 81  ARG C CZ    1 
ATOM 1906  N NH1   . ARG C 3 82  ? 118.30400 127.89900 100.21900 1.000 35.69002  ? 81  ARG C NH1   1 
ATOM 1907  N NH2   . ARG C 3 82  ? 119.56300 128.59300 98.43800  1.000 35.69002  ? 81  ARG C NH2   1 
ATOM 1908  N N     . HIS C 3 83  ? 120.72600 129.64700 105.66600 1.000 37.39779  ? 82  HIS C N     1 
ATOM 1909  C CA    . HIS C 3 83  ? 122.03500 129.03400 105.84300 1.000 37.39779  ? 82  HIS C CA    1 
ATOM 1910  C C     . HIS C 3 83  ? 121.94600 127.69300 106.55300 1.000 37.39779  ? 82  HIS C C     1 
ATOM 1911  O O     . HIS C 3 83  ? 122.74500 126.79700 106.27100 1.000 37.39779  ? 82  HIS C O     1 
ATOM 1912  C CB    . HIS C 3 83  ? 122.94900 129.97900 106.60900 1.000 37.39779  ? 82  HIS C CB    1 
ATOM 1913  C CG    . HIS C 3 83  ? 122.95200 131.37300 106.07500 1.000 37.39779  ? 82  HIS C CG    1 
ATOM 1914  N ND1   . HIS C 3 83  ? 122.96700 132.48200 106.89000 1.000 37.39779  ? 82  HIS C ND1   1 
ATOM 1915  C CD2   . HIS C 3 83  ? 122.93400 131.84000 104.80600 1.000 37.39779  ? 82  HIS C CD2   1 
ATOM 1916  C CE1   . HIS C 3 83  ? 122.97500 133.57200 106.14700 1.000 37.39779  ? 82  HIS C CE1   1 
ATOM 1917  N NE2   . HIS C 3 83  ? 122.94500 133.21000 104.87800 1.000 37.39779  ? 82  HIS C NE2   1 
ATOM 1918  N N     . LEU C 3 84  ? 120.97100 127.52200 107.44600 1.000 36.19996  ? 83  LEU C N     1 
ATOM 1919  C CA    . LEU C 3 84  ? 120.77600 126.22900 108.09300 1.000 36.19996  ? 83  LEU C CA    1 
ATOM 1920  C C     . LEU C 3 84  ? 120.27100 125.18500 107.10600 1.000 36.19996  ? 83  LEU C C     1 
ATOM 1921  O O     . LEU C 3 84  ? 120.67300 124.01900 107.17000 1.000 36.19996  ? 83  LEU C O     1 
ATOM 1922  C CB    . LEU C 3 84  ? 119.80800 126.37900 109.25900 1.000 36.19996  ? 83  LEU C CB    1 
ATOM 1923  C CG    . LEU C 3 84  ? 120.39300 127.07200 110.48000 1.000 36.19996  ? 83  LEU C CG    1 
ATOM 1924  C CD1   . LEU C 3 84  ? 119.28900 127.54200 111.37100 1.000 36.19996  ? 83  LEU C CD1   1 
ATOM 1925  C CD2   . LEU C 3 84  ? 121.29100 126.12800 111.23400 1.000 36.19996  ? 83  LEU C CD2   1 
ATOM 1926  N N     . GLN C 3 85  ? 119.41700 125.59100 106.16400 1.000 36.07255  ? 84  GLN C N     1 
ATOM 1927  C CA    . GLN C 3 85  ? 118.95800 124.66900 105.13100 1.000 36.07255  ? 84  GLN C CA    1 
ATOM 1928  C C     . GLN C 3 85  ? 120.07300 124.34400 104.14400 1.000 36.07255  ? 84  GLN C C     1 
ATOM 1929  O O     . GLN C 3 85  ? 120.20600 123.19600 103.70500 1.000 36.07255  ? 84  GLN C O     1 
ATOM 1930  C CB    . GLN C 3 85  ? 117.74700 125.26100 104.41500 1.000 36.07255  ? 84  GLN C CB    1 
ATOM 1931  C CG    . GLN C 3 85  ? 117.23400 124.47000 103.22900 1.000 36.07255  ? 84  GLN C CG    1 
ATOM 1932  C CD    . GLN C 3 85  ? 116.30500 123.33300 103.60800 1.000 36.07255  ? 84  GLN C CD    1 
ATOM 1933  O OE1   . GLN C 3 85  ? 116.20800 122.94500 104.76800 1.000 36.07255  ? 84  GLN C OE1   1 
ATOM 1934  N NE2   . GLN C 3 85  ? 115.59900 122.80200 102.61800 1.000 36.07255  ? 84  GLN C NE2   1 
ATOM 1935  N N     . LEU C 3 86  ? 120.90600 125.33200 103.80500 1.000 35.94888  ? 85  LEU C N     1 
ATOM 1936  C CA    . LEU C 3 86  ? 122.07000 125.05400 102.97300 1.000 35.94888  ? 85  LEU C CA    1 
ATOM 1937  C C     . LEU C 3 86  ? 123.11500 124.22500 103.70600 1.000 35.94888  ? 85  LEU C C     1 
ATOM 1938  O O     . LEU C 3 86  ? 123.95900 123.60200 103.05900 1.000 35.94888  ? 85  LEU C O     1 
ATOM 1939  C CB    . LEU C 3 86  ? 122.71200 126.35300 102.49000 1.000 35.94888  ? 85  LEU C CB    1 
ATOM 1940  C CG    . LEU C 3 86  ? 121.93800 127.22400 101.50700 1.000 35.94888  ? 85  LEU C CG    1 
ATOM 1941  C CD1   . LEU C 3 86  ? 122.76400 128.44400 101.13700 1.000 35.94888  ? 85  LEU C CD1   1 
ATOM 1942  C CD2   . LEU C 3 86  ? 121.55300 126.43600 100.28000 1.000 35.94888  ? 85  LEU C CD2   1 
ATOM 1943  N N     . ALA C 3 87  ? 123.09600 124.22600 105.03600 1.000 36.96369  ? 86  ALA C N     1 
ATOM 1944  C CA    . ALA C 3 87  ? 124.00500 123.38500 105.79800 1.000 36.96369  ? 86  ALA C CA    1 
ATOM 1945  C C     . ALA C 3 87  ? 123.49700 121.95500 105.87300 1.000 36.96369  ? 86  ALA C C     1 
ATOM 1946  O O     . ALA C 3 87  ? 124.28200 121.00800 105.78200 1.000 36.96369  ? 86  ALA C O     1 
ATOM 1947  C CB    . ALA C 3 87  ? 124.17500 123.95000 107.20200 1.000 36.96369  ? 86  ALA C CB    1 
ATOM 1948  N N     . ILE C 3 88  ? 122.18700 121.78900 106.04800 1.000 34.71740  ? 87  ILE C N     1 
ATOM 1949  C CA    . ILE C 3 88  ? 121.61000 120.45800 106.19000 1.000 34.71740  ? 87  ILE C CA    1 
ATOM 1950  C C     . ILE C 3 88  ? 121.57800 119.74000 104.84600 1.000 34.71740  ? 87  ILE C C     1 
ATOM 1951  O O     . ILE C 3 88  ? 122.05100 118.60500 104.72200 1.000 34.71740  ? 87  ILE C O     1 
ATOM 1952  C CB    . ILE C 3 88  ? 120.20700 120.55800 106.81100 1.000 34.71740  ? 87  ILE C CB    1 
ATOM 1953  C CG1   . ILE C 3 88  ? 120.30800 120.94600 108.28100 1.000 34.71740  ? 87  ILE C CG1   1 
ATOM 1954  C CG2   . ILE C 3 88  ? 119.45500 119.25500 106.66700 1.000 34.71740  ? 87  ILE C CG2   1 
ATOM 1955  C CD1   . ILE C 3 88  ? 119.04100 121.55400 108.82200 1.000 34.71740  ? 87  ILE C CD1   1 
ATOM 1956  N N     . ARG C 3 89  ? 121.03200 120.39100 103.81400 1.000 37.08558  ? 88  ARG C N     1 
ATOM 1957  C CA    . ARG C 3 89  ? 120.81000 119.69700 102.55000 1.000 37.08558  ? 88  ARG C CA    1 
ATOM 1958  C C     . ARG C 3 89  ? 122.09100 119.47400 101.75800 1.000 37.08558  ? 88  ARG C C     1 
ATOM 1959  O O     . ARG C 3 89  ? 122.11900 118.58700 100.90100 1.000 37.08558  ? 88  ARG C O     1 
ATOM 1960  C CB    . ARG C 3 89  ? 119.79600 120.45400 101.69200 1.000 37.08558  ? 88  ARG C CB    1 
ATOM 1961  C CG    . ARG C 3 89  ? 118.47300 120.74500 102.38400 1.000 37.08558  ? 88  ARG C CG    1 
ATOM 1962  C CD    . ARG C 3 89  ? 117.87100 119.51000 103.02500 1.000 37.08558  ? 88  ARG C CD    1 
ATOM 1963  N NE    . ARG C 3 89  ? 116.72400 119.85000 103.85600 1.000 37.08558  ? 88  ARG C NE    1 
ATOM 1964  C CZ    . ARG C 3 89  ? 116.20900 119.04900 104.77900 1.000 37.08558  ? 88  ARG C CZ    1 
ATOM 1965  N NH1   . ARG C 3 89  ? 116.74300 117.85800 104.99500 1.000 37.08558  ? 88  ARG C NH1   1 
ATOM 1966  N NH2   . ARG C 3 89  ? 115.16300 119.44500 105.48900 1.000 37.08558  ? 88  ARG C NH2   1 
ATOM 1967  N N     . ASN C 3 90  ? 123.15000 120.24200 102.01600 1.000 39.30292  ? 89  ASN C N     1 
ATOM 1968  C CA    . ASN C 3 90  ? 124.39900 119.98800 101.30900 1.000 39.30292  ? 89  ASN C CA    1 
ATOM 1969  C C     . ASN C 3 90  ? 125.19000 118.86300 101.95000 1.000 39.30292  ? 89  ASN C C     1 
ATOM 1970  O O     . ASN C 3 90  ? 125.89000 118.12700 101.24600 1.000 39.30292  ? 89  ASN C O     1 
ATOM 1971  C CB    . ASN C 3 90  ? 125.26600 121.24200 101.25600 1.000 39.30292  ? 89  ASN C CB    1 
ATOM 1972  C CG    . ASN C 3 90  ? 124.99000 122.08400 100.04200 1.000 39.30292  ? 89  ASN C CG    1 
ATOM 1973  O OD1   . ASN C 3 90  ? 124.63500 121.56500 98.98700  1.000 39.30292  ? 89  ASN C OD1   1 
ATOM 1974  N ND2   . ASN C 3 90  ? 125.16700 123.39100 100.17400 1.000 39.30292  ? 89  ASN C ND2   1 
ATOM 1975  N N     . ASP C 3 91  ? 125.10000 118.71000 103.26500 1.000 40.14436  ? 90  ASP C N     1 
ATOM 1976  C CA    . ASP C 3 91  ? 125.81000 117.63200 103.92900 1.000 40.14436  ? 90  ASP C CA    1 
ATOM 1977  C C     . ASP C 3 91  ? 125.01700 116.34600 103.76900 1.000 40.14436  ? 90  ASP C C     1 
ATOM 1978  O O     . ASP C 3 91  ? 123.78600 116.35200 103.80800 1.000 40.14436  ? 90  ASP C O     1 
ATOM 1979  C CB    . ASP C 3 91  ? 126.02500 117.95500 105.40400 1.000 40.14436  ? 90  ASP C CB    1 
ATOM 1980  C CG    . ASP C 3 91  ? 127.25900 117.29100 105.96500 1.000 40.14436  ? 90  ASP C CG    1 
ATOM 1981  O OD1   . ASP C 3 91  ? 128.34400 117.46200 105.36800 1.000 40.14436  ? 90  ASP C OD1   1 
ATOM 1982  O OD2   . ASP C 3 91  ? 127.15100 116.60300 107.00100 1.000 40.14436  ? 90  ASP C OD2   1 
ATOM 1983  N N     . GLU C 3 92  ? 125.73100 115.24000 103.58400 1.000 40.19491  ? 91  GLU C N     1 
ATOM 1984  C CA    . GLU C 3 92  ? 125.08500 113.98800 103.20900 1.000 40.19491  ? 91  GLU C CA    1 
ATOM 1985  C C     . GLU C 3 92  ? 124.36900 113.34500 104.38800 1.000 40.19491  ? 91  GLU C C     1 
ATOM 1986  O O     . GLU C 3 92  ? 123.26000 112.82300 104.23600 1.000 40.19491  ? 91  GLU C O     1 
ATOM 1987  C CB    . GLU C 3 92  ? 126.10800 113.01900 102.60400 1.000 40.19491  ? 91  GLU C CB    1 
ATOM 1988  C CG    . GLU C 3 92  ? 126.67900 113.41500 101.22600 1.000 40.19491  ? 91  GLU C CG    1 
ATOM 1989  C CD    . GLU C 3 92  ? 127.67800 114.56800 101.26200 1.000 40.19491  ? 91  GLU C CD    1 
ATOM 1990  O OE1   . GLU C 3 92  ? 128.00000 115.10900 100.18400 1.000 40.19491  ? 91  GLU C OE1   1 
ATOM 1991  O OE2   . GLU C 3 92  ? 128.14700 114.92500 102.36300 1.000 40.19491  ? 91  GLU C OE2   1 
ATOM 1992  N N     . GLU C 3 93  ? 124.99700 113.36100 105.55900 1.000 39.69732  ? 92  GLU C N     1 
ATOM 1993  C CA    . GLU C 3 93  ? 124.51400 112.65600 106.73800 1.000 39.69732  ? 92  GLU C CA    1 
ATOM 1994  C C     . GLU C 3 93  ? 123.52100 113.46200 107.56000 1.000 39.69732  ? 92  GLU C C     1 
ATOM 1995  O O     . GLU C 3 93  ? 122.58400 112.88700 108.13200 1.000 39.69732  ? 92  GLU C O     1 
ATOM 1996  C CB    . GLU C 3 93  ? 125.70700 112.23600 107.57500 1.000 39.69732  ? 92  GLU C CB    1 
ATOM 1997  C CG    . GLU C 3 93  ? 126.46200 111.16500 106.85900 1.000 39.69732  ? 92  GLU C CG    1 
ATOM 1998  C CD    . GLU C 3 93  ? 127.73900 110.83700 107.52500 1.000 39.69732  ? 92  GLU C CD    1 
ATOM 1999  O OE1   . GLU C 3 93  ? 128.26200 111.72100 108.23100 1.000 39.69732  ? 92  GLU C OE1   1 
ATOM 2000  O OE2   . GLU C 3 93  ? 128.20000 109.69200 107.35400 1.000 39.69732  ? 92  GLU C OE2   1 
ATOM 2001  N N     . LEU C 3 94  ? 123.69800 114.78200 107.63800 1.000 36.24027  ? 93  LEU C N     1 
ATOM 2002  C CA    . LEU C 3 94  ? 122.69700 115.60200 108.30600 1.000 36.24027  ? 93  LEU C CA    1 
ATOM 2003  C C     . LEU C 3 94  ? 121.41300 115.66800 107.49300 1.000 36.24027  ? 93  LEU C C     1 
ATOM 2004  O O     . LEU C 3 94  ? 120.35000 115.94500 108.05300 1.000 36.24027  ? 93  LEU C O     1 
ATOM 2005  C CB    . LEU C 3 94  ? 123.23500 117.00800 108.55800 1.000 36.24027  ? 93  LEU C CB    1 
ATOM 2006  C CG    . LEU C 3 94  ? 124.13200 117.18900 109.77900 1.000 36.24027  ? 93  LEU C CG    1 
ATOM 2007  C CD1   . LEU C 3 94  ? 124.72400 118.57500 109.78400 1.000 36.24027  ? 93  LEU C CD1   1 
ATOM 2008  C CD2   . LEU C 3 94  ? 123.34600 116.94800 111.05100 1.000 36.24027  ? 93  LEU C CD2   1 
ATOM 2009  N N     . ASN C 3 95  ? 121.48700 115.38100 106.19500 1.000 37.29770  ? 94  ASN C N     1 
ATOM 2010  C CA    . ASN C 3 95  ? 120.29600 115.22200 105.38200 1.000 37.29770  ? 94  ASN C CA    1 
ATOM 2011  C C     . ASN C 3 95  ? 119.60400 113.89500 105.64300 1.000 37.29770  ? 94  ASN C C     1 
ATOM 2012  O O     . ASN C 3 95  ? 118.41200 113.76700 105.35800 1.000 37.29770  ? 94  ASN C O     1 
ATOM 2013  C CB    . ASN C 3 95  ? 120.65200 115.33300 103.90400 1.000 37.29770  ? 94  ASN C CB    1 
ATOM 2014  C CG    . ASN C 3 95  ? 119.44500 115.54700 103.03500 1.000 37.29770  ? 94  ASN C CG    1 
ATOM 2015  O OD1   . ASN C 3 95  ? 118.41300 116.02600 103.49700 1.000 37.29770  ? 94  ASN C OD1   1 
ATOM 2016  N ND2   . ASN C 3 95  ? 119.56500 115.19600 101.76300 1.000 37.29770  ? 94  ASN C ND2   1 
ATOM 2017  N N     . LYS C 3 96  ? 120.32000 112.89900 106.16500 1.000 36.84943  ? 95  LYS C N     1 
ATOM 2018  C CA    . LYS C 3 96  ? 119.65400 111.67100 106.57200 1.000 36.84943  ? 95  LYS C CA    1 
ATOM 2019  C C     . LYS C 3 96  ? 119.08800 111.79200 107.97500 1.000 36.84943  ? 95  LYS C C     1 
ATOM 2020  O O     . LYS C 3 96  ? 118.07700 111.15600 108.28900 1.000 36.84943  ? 95  LYS C O     1 
ATOM 2021  C CB    . LYS C 3 96  ? 120.61600 110.48800 106.50300 1.000 36.84943  ? 95  LYS C CB    1 
ATOM 2022  C CG    . LYS C 3 96  ? 120.94000 110.02000 105.10100 1.000 36.84943  ? 95  LYS C CG    1 
ATOM 2023  C CD    . LYS C 3 96  ? 121.64900 108.67900 105.13200 1.000 36.84943  ? 95  LYS C CD    1 
ATOM 2024  C CE    . LYS C 3 96  ? 123.02500 108.80000 105.76000 1.000 36.84943  ? 95  LYS C CE    1 
ATOM 2025  N NZ    . LYS C 3 96  ? 123.70600 107.48200 105.87200 1.000 36.84943  ? 95  LYS C NZ    1 
ATOM 2026  N N     . LEU C 3 97  ? 119.72400 112.59300 108.82900 1.000 33.68687  ? 96  LEU C N     1 
ATOM 2027  C CA    . LEU C 3 97  ? 119.18300 112.80100 110.16700 1.000 33.68687  ? 96  LEU C CA    1 
ATOM 2028  C C     . LEU C 3 97  ? 117.97600 113.73200 110.13300 1.000 33.68687  ? 96  LEU C C     1 
ATOM 2029  O O     . LEU C 3 97  ? 116.99200 113.50700 110.84400 1.000 33.68687  ? 96  LEU C O     1 
ATOM 2030  C CB    . LEU C 3 97  ? 120.26900 113.35800 111.08700 1.000 33.68687  ? 96  LEU C CB    1 
ATOM 2031  C CG    . LEU C 3 97  ? 119.86500 113.82600 112.48300 1.000 33.68687  ? 96  LEU C CG    1 
ATOM 2032  C CD1   . LEU C 3 97  ? 119.24700 112.69100 113.26900 1.000 33.68687  ? 96  LEU C CD1   1 
ATOM 2033  C CD2   . LEU C 3 97  ? 121.06100 114.39500 113.20800 1.000 33.68687  ? 96  LEU C CD2   1 
ATOM 2034  N N     . LEU C 3 98  ? 118.01500 114.74900 109.27800 1.000 32.28668  ? 97  LEU C N     1 
ATOM 2035  C CA    . LEU C 3 98  ? 116.96200 115.75100 109.20500 1.000 32.28668  ? 97  LEU C CA    1 
ATOM 2036  C C     . LEU C 3 98  ? 116.26800 115.68300 107.85500 1.000 32.28668  ? 97  LEU C C     1 
ATOM 2037  O O     . LEU C 3 98  ? 116.04800 116.71200 107.21200 1.000 32.28668  ? 97  LEU C O     1 
ATOM 2038  C CB    . LEU C 3 98  ? 117.52700 117.15000 109.44400 1.000 32.28668  ? 97  LEU C CB    1 
ATOM 2039  C CG    . LEU C 3 98  ? 117.98400 117.51600 110.85400 1.000 32.28668  ? 97  LEU C CG    1 
ATOM 2040  C CD1   . LEU C 3 98  ? 119.46800 117.31000 111.02500 1.000 32.28668  ? 97  LEU C CD1   1 
ATOM 2041  C CD2   . LEU C 3 98  ? 117.62300 118.94900 111.14600 1.000 32.28668  ? 97  LEU C CD2   1 
ATOM 2042  N N     . GLY C 3 99  ? 115.94100 114.47500 107.41100 1.000 34.62834  ? 98  GLY C N     1 
ATOM 2043  C CA    . GLY C 3 99  ? 115.29500 114.28700 106.12900 1.000 34.62834  ? 98  GLY C CA    1 
ATOM 2044  C C     . GLY C 3 99  ? 113.82200 114.61800 106.12600 1.000 34.62834  ? 98  GLY C C     1 
ATOM 2045  O O     . GLY C 3 99  ? 113.31700 115.20500 105.16600 1.000 34.62834  ? 98  GLY C O     1 
ATOM 2046  N N     . LYS C 3 100 ? 113.11300 114.23500 107.18700 1.000 32.35303  ? 99  LYS C N     1 
ATOM 2047  C CA    . LYS C 3 100 ? 111.68300 114.48100 107.29700 1.000 32.35303  ? 99  LYS C CA    1 
ATOM 2048  C C     . LYS C 3 100 ? 111.36000 115.72200 108.12000 1.000 32.35303  ? 99  LYS C C     1 
ATOM 2049  O O     . LYS C 3 100 ? 110.30400 115.77900 108.75600 1.000 32.35303  ? 99  LYS C O     1 
ATOM 2050  C CB    . LYS C 3 100 ? 110.97600 113.25800 107.87700 1.000 32.35303  ? 99  LYS C CB    1 
ATOM 2051  C CG    . LYS C 3 100 ? 110.97800 112.05900 106.94900 1.000 32.35303  ? 99  LYS C CG    1 
ATOM 2052  C CD    . LYS C 3 100 ? 110.30000 110.85600 107.57700 1.000 32.35303  ? 99  LYS C CD    1 
ATOM 2053  C CE    . LYS C 3 100 ? 111.02400 110.40300 108.83100 1.000 32.35303  ? 99  LYS C CE    1 
ATOM 2054  N NZ    . LYS C 3 100 ? 112.44200 110.05700 108.55100 1.000 32.35303  ? 99  LYS C NZ    1 
ATOM 2055  N N     . VAL C 3 101 ? 112.24700 116.71300 108.13400 1.000 32.07838  ? 100 VAL C N     1 
ATOM 2056  C CA    . VAL C 3 101 ? 111.96000 117.98200 108.78600 1.000 32.07838  ? 100 VAL C CA    1 
ATOM 2057  C C     . VAL C 3 101 ? 111.91600 119.07800 107.73200 1.000 32.07838  ? 100 VAL C C     1 
ATOM 2058  O O     . VAL C 3 101 ? 112.36900 118.91300 106.59600 1.000 32.07838  ? 100 VAL C O     1 
ATOM 2059  C CB    . VAL C 3 101 ? 112.96700 118.34500 109.89600 1.000 32.07838  ? 100 VAL C CB    1 
ATOM 2060  C CG1   . VAL C 3 101 ? 113.18600 117.17400 110.82900 1.000 32.07838  ? 100 VAL C CG1   1 
ATOM 2061  C CG2   . VAL C 3 101 ? 114.26100 118.83200 109.30300 1.000 32.07838  ? 100 VAL C CG2   1 
ATOM 2062  N N     . THR C 3 102 ? 111.33700 120.21000 108.12100 1.000 31.50762  ? 101 THR C N     1 
ATOM 2063  C CA    . THR C 3 102 ? 111.17800 121.36200 107.24600 1.000 31.50762  ? 101 THR C CA    1 
ATOM 2064  C C     . THR C 3 102 ? 111.70200 122.59200 107.96400 1.000 31.50762  ? 101 THR C C     1 
ATOM 2065  O O     . THR C 3 102 ? 111.20000 122.94600 109.03400 1.000 31.50762  ? 101 THR C O     1 
ATOM 2066  C CB    . THR C 3 102 ? 109.71500 121.56000 106.85600 1.000 31.50762  ? 101 THR C CB    1 
ATOM 2067  O OG1   . THR C 3 102 ? 109.27600 120.45100 106.06600 1.000 31.50762  ? 101 THR C OG1   1 
ATOM 2068  C CG2   . THR C 3 102 ? 109.55700 122.83200 106.06200 1.000 31.50762  ? 101 THR C CG2   1 
ATOM 2069  N N     . ILE C 3 103 ? 112.71200 123.23100 107.39100 1.000 32.85145  ? 102 ILE C N     1 
ATOM 2070  C CA    . ILE C 3 103 ? 113.26400 124.45100 107.96700 1.000 32.85145  ? 102 ILE C CA    1 
ATOM 2071  C C     . ILE C 3 103 ? 112.41800 125.62100 107.48800 1.000 32.85145  ? 102 ILE C C     1 
ATOM 2072  O O     . ILE C 3 103 ? 112.27700 125.83400 106.28000 1.000 32.85145  ? 102 ILE C O     1 
ATOM 2073  C CB    . ILE C 3 103 ? 114.73200 124.63700 107.56200 1.000 32.85145  ? 102 ILE C CB    1 
ATOM 2074  C CG1   . ILE C 3 103 ? 115.56200 123.42400 107.96600 1.000 32.85145  ? 102 ILE C CG1   1 
ATOM 2075  C CG2   . ILE C 3 103 ? 115.29300 125.88100 108.19400 1.000 32.85145  ? 102 ILE C CG2   1 
ATOM 2076  C CD1   . ILE C 3 103 ? 115.56600 123.15700 109.42400 1.000 32.85145  ? 102 ILE C CD1   1 
ATOM 2077  N N     . ALA C 3 104 ? 111.81900 126.35000 108.42700 1.000 33.83909  ? 103 ALA C N     1 
ATOM 2078  C CA    . ALA C 3 104 ? 111.00900 127.50600 108.06800 1.000 33.83909  ? 103 ALA C CA    1 
ATOM 2079  C C     . ALA C 3 104 ? 111.88400 128.60000 107.48200 1.000 33.83909  ? 103 ALA C C     1 
ATOM 2080  O O     . ALA C 3 104 ? 113.00400 128.82400 107.94500 1.000 33.83909  ? 103 ALA C O     1 
ATOM 2081  C CB    . ALA C 3 104 ? 110.26500 128.04500 109.28000 1.000 33.83909  ? 103 ALA C CB    1 
ATOM 2082  N N     . GLN C 3 105 ? 111.35900 129.26600 106.44800 1.000 36.68490  ? 104 GLN C N     1 
ATOM 2083  C CA    . GLN C 3 105 ? 112.03200 130.33900 105.70800 1.000 36.68490  ? 104 GLN C CA    1 
ATOM 2084  C C     . GLN C 3 105 ? 113.36000 129.87500 105.12100 1.000 36.68490  ? 104 GLN C C     1 
ATOM 2085  O O     . GLN C 3 105 ? 114.30800 130.65200 105.01000 1.000 36.68490  ? 104 GLN C O     1 
ATOM 2086  C CB    . GLN C 3 105 ? 112.23400 131.59100 106.57100 1.000 36.68490  ? 104 GLN C CB    1 
ATOM 2087  C CG    . GLN C 3 105 ? 110.98600 132.10900 107.27400 1.000 36.68490  ? 104 GLN C CG    1 
ATOM 2088  C CD    . GLN C 3 105 ? 110.10200 132.99100 106.40500 1.000 36.68490  ? 104 GLN C CD    1 
ATOM 2089  O OE1   . GLN C 3 105 ? 110.09300 132.89000 105.17900 1.000 36.68490  ? 104 GLN C OE1   1 
ATOM 2090  N NE2   . GLN C 3 105 ? 109.34900 133.87200 107.05100 1.000 36.68490  ? 104 GLN C NE2   1 
ATOM 2091  N N     . GLY C 3 106 ? 113.43800 128.60200 104.75400 1.000 36.32503  ? 105 GLY C N     1 
ATOM 2092  C CA    . GLY C 3 106 ? 114.61100 128.07000 104.10100 1.000 36.32503  ? 105 GLY C CA    1 
ATOM 2093  C C     . GLY C 3 106 ? 114.26500 127.61700 102.70300 1.000 36.32503  ? 105 GLY C C     1 
ATOM 2094  O O     . GLY C 3 106 ? 113.45700 126.70300 102.52300 1.000 36.32503  ? 105 GLY C O     1 
ATOM 2095  N N     . GLY C 3 107 ? 114.86300 128.25100 101.70600 1.000 38.70836  ? 106 GLY C N     1 
ATOM 2096  C CA    . GLY C 3 107 ? 114.58300 127.89100 100.33700 1.000 38.70836  ? 106 GLY C CA    1 
ATOM 2097  C C     . GLY C 3 107 ? 115.21800 126.56800 99.97500  1.000 38.70836  ? 106 GLY C C     1 
ATOM 2098  O O     . GLY C 3 107 ? 116.17500 126.12100 100.60200 1.000 38.70836  ? 106 GLY C O     1 
ATOM 2099  N N     . VAL C 3 108 ? 114.63000 125.91200 98.97400  1.000 37.49431  ? 107 VAL C N     1 
ATOM 2100  C CA    . VAL C 3 108 ? 115.16000 124.64300 98.49800  1.000 37.49431  ? 107 VAL C CA    1 
ATOM 2101  C C     . VAL C 3 108 ? 116.55100 124.82900 97.90700  1.000 37.49431  ? 107 VAL C C     1 
ATOM 2102  O O     . VAL C 3 108 ? 116.87600 125.88400 97.34500  1.000 37.49431  ? 107 VAL C O     1 
ATOM 2103  C CB    . VAL C 3 108 ? 114.19100 124.00400 97.49100  1.000 37.49431  ? 107 VAL C CB    1 
ATOM 2104  C CG1   . VAL C 3 108 ? 112.89300 123.66600 98.18600  1.000 37.49431  ? 107 VAL C CG1   1 
ATOM 2105  C CG2   . VAL C 3 108 ? 113.93700 124.93000 96.33000  1.000 37.49431  ? 107 VAL C CG2   1 
ATOM 2106  N N     . LEU C 3 109 ? 117.41100 123.84500 98.16100  1.000 40.01563  ? 108 LEU C N     1 
ATOM 2107  C CA    . LEU C 3 109 ? 118.77800 123.85100 97.65700  1.000 40.01563  ? 108 LEU C CA    1 
ATOM 2108  C C     . LEU C 3 109 ? 118.75700 123.90300 96.13100  1.000 40.01563  ? 108 LEU C C     1 
ATOM 2109  O O     . LEU C 3 109 ? 117.96300 123.18200 95.51100  1.000 40.01563  ? 108 LEU C O     1 
ATOM 2110  C CB    . LEU C 3 109 ? 119.49000 122.59100 98.14600  1.000 40.01563  ? 108 LEU C CB    1 
ATOM 2111  C CG    . LEU C 3 109 ? 120.92200 122.26700 97.74100  1.000 40.01563  ? 108 LEU C CG    1 
ATOM 2112  C CD1   . LEU C 3 109 ? 121.88100 123.26100 98.34800  1.000 40.01563  ? 108 LEU C CD1   1 
ATOM 2113  C CD2   . LEU C 3 109 ? 121.27200 120.86000 98.16200  1.000 40.01563  ? 108 LEU C CD2   1 
ATOM 2114  N N     . PRO C 3 110 ? 119.54600 124.77900 95.50100  1.000 41.33905  ? 109 PRO C N     1 
ATOM 2115  C CA    . PRO C 3 110 ? 119.47500 124.94100 94.04000  1.000 41.33905  ? 109 PRO C CA    1 
ATOM 2116  C C     . PRO C 3 110 ? 119.85300 123.68800 93.26000  1.000 41.33905  ? 109 PRO C C     1 
ATOM 2117  O O     . PRO C 3 110 ? 120.93300 123.12200 93.43900  1.000 41.33905  ? 109 PRO C O     1 
ATOM 2118  C CB    . PRO C 3 110 ? 120.45600 126.08700 93.76800  1.000 41.33905  ? 109 PRO C CB    1 
ATOM 2119  C CG    . PRO C 3 110 ? 120.53200 126.82700 95.03800  1.000 41.33905  ? 109 PRO C CG    1 
ATOM 2120  C CD    . PRO C 3 110 ? 120.40800 125.80000 96.11500  1.000 41.33905  ? 109 PRO C CD    1 
ATOM 2121  N N     . ASN C 3 111 ? 118.95200 123.28900 92.36300  1.000 42.91960  ? 110 ASN C N     1 
ATOM 2122  C CA    . ASN C 3 111 ? 119.12800 122.15500 91.46700  1.000 42.91960  ? 110 ASN C CA    1 
ATOM 2123  C C     . ASN C 3 111 ? 118.15300 122.28500 90.30300  1.000 42.91960  ? 110 ASN C C     1 
ATOM 2124  O O     . ASN C 3 111 ? 117.11700 122.94800 90.41500  1.000 42.91960  ? 110 ASN C O     1 
ATOM 2125  C CB    . ASN C 3 111 ? 119.02500 120.80500 92.21900  1.000 42.91960  ? 110 ASN C CB    1 
ATOM 2126  C CG    . ASN C 3 111 ? 117.60000 120.42900 92.69600  1.000 42.91960  ? 110 ASN C CG    1 
ATOM 2127  O OD1   . ASN C 3 111 ? 116.63300 121.18400 92.59700  1.000 42.91960  ? 110 ASN C OD1   1 
ATOM 2128  N ND2   . ASN C 3 111 ? 117.49500 119.22300 93.24000  1.000 42.91960  ? 110 ASN C ND2   1 
ATOM 2129  N N     . ILE C 3 112 ? 118.48200 121.58600 89.21100  1.000 44.37308  ? 111 ILE C N     1 
ATOM 2130  C CA    . ILE C 3 112 ? 117.74100 121.54500 87.93900  1.000 44.37308  ? 111 ILE C CA    1 
ATOM 2131  C C     . ILE C 3 112 ? 118.51900 120.66000 86.97600  1.000 44.37308  ? 111 ILE C C     1 
ATOM 2132  O O     . ILE C 3 112 ? 118.18800 119.49000 86.78700  1.000 44.37308  ? 111 ILE C O     1 
ATOM 2133  C CB    . ILE C 3 112 ? 117.53400 122.94500 87.28300  1.000 44.37308  ? 111 ILE C CB    1 
ATOM 2134  C CG1   . ILE C 3 112 ? 116.89300 122.80300 85.90100  1.000 44.37308  ? 111 ILE C CG1   1 
ATOM 2135  C CG2   . ILE C 3 112 ? 118.85300 123.69200 87.16200  1.000 44.37308  ? 111 ILE C CG2   1 
ATOM 2136  C CD1   . ILE C 3 112 ? 115.47300 122.28000 85.93000  1.000 44.37308  ? 111 ILE C CD1   1 
ATOM 2137  N N     . ARG D 4 34  ? 108.43900 132.56300 133.12600 1.000 66.51049  ? 33  ARG D N     1 
ATOM 2138  C CA    . ARG D 4 34  ? 109.73000 132.13600 132.60200 1.000 66.51049  ? 33  ARG D CA    1 
ATOM 2139  C C     . ARG D 4 34  ? 109.58000 130.90900 131.71300 1.000 66.51049  ? 33  ARG D C     1 
ATOM 2140  O O     . ARG D 4 34  ? 109.05100 129.88200 132.13500 1.000 66.51049  ? 33  ARG D O     1 
ATOM 2141  C CB    . ARG D 4 34  ? 110.71200 131.85700 133.73800 1.000 66.51049  ? 33  ARG D CB    1 
ATOM 2142  C CG    . ARG D 4 34  ? 111.18100 133.11300 134.45200 1.000 66.51049  ? 33  ARG D CG    1 
ATOM 2143  C CD    . ARG D 4 34  ? 112.02600 132.78400 135.66500 1.000 66.51049  ? 33  ARG D CD    1 
ATOM 2144  N NE    . ARG D 4 34  ? 113.12500 131.89300 135.31900 1.000 66.51049  ? 33  ARG D NE    1 
ATOM 2145  C CZ    . ARG D 4 34  ? 114.19300 131.69300 136.07900 1.000 66.51049  ? 33  ARG D CZ    1 
ATOM 2146  N NH1   . ARG D 4 34  ? 114.31600 132.33200 137.23400 1.000 66.51049  ? 33  ARG D NH1   1 
ATOM 2147  N NH2   . ARG D 4 34  ? 115.14300 130.85900 135.68000 1.000 66.51049  ? 33  ARG D NH2   1 
ATOM 2148  N N     . LYS D 4 35  ? 110.04300 131.03300 130.47300 1.000 61.39959  ? 34  LYS D N     1 
ATOM 2149  C CA    . LYS D 4 35  ? 109.97200 129.96600 129.48300 1.000 61.39959  ? 34  LYS D CA    1 
ATOM 2150  C C     . LYS D 4 35  ? 111.39100 129.54800 129.12500 1.000 61.39959  ? 34  LYS D C     1 
ATOM 2151  O O     . LYS D 4 35  ? 112.12300 130.30700 128.48300 1.000 61.39959  ? 34  LYS D O     1 
ATOM 2152  C CB    . LYS D 4 35  ? 109.21000 130.43200 128.24700 1.000 61.39959  ? 34  LYS D CB    1 
ATOM 2153  C CG    . LYS D 4 35  ? 108.93700 129.33800 127.23100 1.000 61.39959  ? 34  LYS D CG    1 
ATOM 2154  C CD    . LYS D 4 35  ? 108.05000 129.84200 126.10500 1.000 61.39959  ? 34  LYS D CD    1 
ATOM 2155  C CE    . LYS D 4 35  ? 108.66800 131.03400 125.38700 1.000 61.39959  ? 34  LYS D CE    1 
ATOM 2156  N NZ    . LYS D 4 35  ? 110.10800 130.82200 125.05500 1.000 61.39959  ? 34  LYS D NZ    1 
ATOM 2157  N N     . GLU D 4 36  ? 111.77300 128.34400 129.54000 1.000 54.23085  ? 35  GLU D N     1 
ATOM 2158  C CA    . GLU D 4 36  ? 113.13800 127.87300 129.35200 1.000 54.23085  ? 35  GLU D CA    1 
ATOM 2159  C C     . GLU D 4 36  ? 113.39800 127.49700 127.89600 1.000 54.23085  ? 35  GLU D C     1 
ATOM 2160  O O     . GLU D 4 36  ? 112.54500 126.91200 127.22300 1.000 54.23085  ? 35  GLU D O     1 
ATOM 2161  C CB    . GLU D 4 36  ? 113.41000 126.68300 130.27600 1.000 54.23085  ? 35  GLU D CB    1 
ATOM 2162  C CG    . GLU D 4 36  ? 112.36800 125.57000 130.21500 1.000 54.23085  ? 35  GLU D CG    1 
ATOM 2163  C CD    . GLU D 4 36  ? 112.74200 124.44600 129.26500 1.000 54.23085  ? 35  GLU D CD    1 
ATOM 2164  O OE1   . GLU D 4 36  ? 113.93800 124.29400 128.95800 1.000 54.23085  ? 35  GLU D OE1   1 
ATOM 2165  O OE2   . GLU D 4 36  ? 111.83900 123.70800 128.82300 1.000 54.23085  ? 35  GLU D OE2   1 
ATOM 2166  N N     . SER D 4 37  ? 114.58200 127.85800 127.40300 1.000 48.65051  ? 36  SER D N     1 
ATOM 2167  C CA    . SER D 4 37  ? 114.98700 127.54300 126.04200 1.000 48.65051  ? 36  SER D CA    1 
ATOM 2168  C C     . SER D 4 37  ? 116.46300 127.17000 126.01900 1.000 48.65051  ? 36  SER D C     1 
ATOM 2169  O O     . SER D 4 37  ? 117.16600 127.26300 127.02700 1.000 48.65051  ? 36  SER D O     1 
ATOM 2170  C CB    . SER D 4 37  ? 114.71600 128.71800 125.09700 1.000 48.65051  ? 36  SER D CB    1 
ATOM 2171  O OG    . SER D 4 37  ? 115.25100 129.92100 125.61100 1.000 48.65051  ? 36  SER D OG    1 
ATOM 2172  N N     . TYR D 4 38  ? 116.92500 126.73000 124.84700 1.000 42.23711  ? 37  TYR D N     1 
ATOM 2173  C CA    . TYR D 4 38  ? 118.31700 126.36500 124.61200 1.000 42.23711  ? 37  TYR D CA    1 
ATOM 2174  C C     . TYR D 4 38  ? 119.06900 127.44900 123.85300 1.000 42.23711  ? 37  TYR D C     1 
ATOM 2175  O O     . TYR D 4 38  ? 120.03800 127.14800 123.15000 1.000 42.23711  ? 37  TYR D O     1 
ATOM 2176  C CB    . TYR D 4 38  ? 118.40900 125.05700 123.82500 1.000 42.23711  ? 37  TYR D CB    1 
ATOM 2177  C CG    . TYR D 4 38  ? 118.08300 123.80800 124.59200 1.000 42.23711  ? 37  TYR D CG    1 
ATOM 2178  C CD1   . TYR D 4 38  ? 119.01800 123.23300 125.43900 1.000 42.23711  ? 37  TYR D CD1   1 
ATOM 2179  C CD2   . TYR D 4 38  ? 116.86000 123.17600 124.43600 1.000 42.23711  ? 37  TYR D CD2   1 
ATOM 2180  C CE1   . TYR D 4 38  ? 118.73200 122.08100 126.13600 1.000 42.23711  ? 37  TYR D CE1   1 
ATOM 2181  C CE2   . TYR D 4 38  ? 116.56500 122.02300 125.12700 1.000 42.23711  ? 37  TYR D CE2   1 
ATOM 2182  C CZ    . TYR D 4 38  ? 117.50700 121.48200 125.97400 1.000 42.23711  ? 37  TYR D CZ    1 
ATOM 2183  O OH    . TYR D 4 38  ? 117.22500 120.33100 126.66600 1.000 42.23711  ? 37  TYR D OH    1 
ATOM 2184  N N     . SER D 4 39  ? 118.63300 128.70300 123.96300 1.000 43.39338  ? 38  SER D N     1 
ATOM 2185  C CA    . SER D 4 39  ? 119.19000 129.75400 123.11800 1.000 43.39338  ? 38  SER D CA    1 
ATOM 2186  C C     . SER D 4 39  ? 120.58500 130.16100 123.57100 1.000 43.39338  ? 38  SER D C     1 
ATOM 2187  O O     . SER D 4 39  ? 121.43000 130.51400 122.74100 1.000 43.39338  ? 38  SER D O     1 
ATOM 2188  C CB    . SER D 4 39  ? 118.25800 130.96100 123.10600 1.000 43.39338  ? 38  SER D CB    1 
ATOM 2189  O OG    . SER D 4 39  ? 118.54400 131.82800 124.18500 1.000 43.39338  ? 38  SER D OG    1 
ATOM 2190  N N     . VAL D 4 40  ? 120.82400 130.17300 124.88400 1.000 44.94312  ? 39  VAL D N     1 
ATOM 2191  C CA    . VAL D 4 40  ? 122.12500 130.56000 125.42400 1.000 44.94312  ? 39  VAL D CA    1 
ATOM 2192  C C     . VAL D 4 40  ? 123.21300 129.55500 125.04100 1.000 44.94312  ? 39  VAL D C     1 
ATOM 2193  O O     . VAL D 4 40  ? 124.32500 129.94300 124.66200 1.000 44.94312  ? 39  VAL D O     1 
ATOM 2194  C CB    . VAL D 4 40  ? 122.00800 130.77700 126.94600 1.000 44.94312  ? 39  VAL D CB    1 
ATOM 2195  C CG1   . VAL D 4 40  ? 121.27900 129.63400 127.61400 1.000 44.94312  ? 39  VAL D CG1   1 
ATOM 2196  C CG2   . VAL D 4 40  ? 123.37100 130.97100 127.58200 1.000 44.94312  ? 39  VAL D CG2   1 
ATOM 2197  N N     . TYR D 4 41  ? 122.90300 128.25700 125.07100 1.000 44.94210  ? 40  TYR D N     1 
ATOM 2198  C CA    . TYR D 4 41  ? 123.92500 127.25100 124.79500 1.000 44.94210  ? 40  TYR D CA    1 
ATOM 2199  C C     . TYR D 4 41  ? 124.20900 127.09800 123.31500 1.000 44.94210  ? 40  TYR D C     1 
ATOM 2200  O O     . TYR D 4 41  ? 125.35000 126.80900 122.93900 1.000 44.94210  ? 40  TYR D O     1 
ATOM 2201  C CB    . TYR D 4 41  ? 123.50300 125.90900 125.37300 1.000 44.94210  ? 40  TYR D CB    1 
ATOM 2202  C CG    . TYR D 4 41  ? 122.82100 126.07000 126.68800 1.000 44.94210  ? 40  TYR D CG    1 
ATOM 2203  C CD1   . TYR D 4 41  ? 123.53800 126.46900 127.80000 1.000 44.94210  ? 40  TYR D CD1   1 
ATOM 2204  C CD2   . TYR D 4 41  ? 121.45700 125.87000 126.81400 1.000 44.94210  ? 40  TYR D CD2   1 
ATOM 2205  C CE1   . TYR D 4 41  ? 122.92600 126.63700 129.00100 1.000 44.94210  ? 40  TYR D CE1   1 
ATOM 2206  C CE2   . TYR D 4 41  ? 120.83600 126.04000 128.01800 1.000 44.94210  ? 40  TYR D CE2   1 
ATOM 2207  C CZ    . TYR D 4 41  ? 121.57700 126.42000 129.10800 1.000 44.94210  ? 40  TYR D CZ    1 
ATOM 2208  O OH    . TYR D 4 41  ? 120.96100 126.58800 130.31100 1.000 44.94210  ? 40  TYR D OH    1 
ATOM 2209  N N     . VAL D 4 42  ? 123.20200 127.31300 122.47000 1.000 42.73786  ? 41  VAL D N     1 
ATOM 2210  C CA    . VAL D 4 42  ? 123.43200 127.37500 121.03200 1.000 42.73786  ? 41  VAL D CA    1 
ATOM 2211  C C     . VAL D 4 42  ? 124.33600 128.55600 120.70200 1.000 42.73786  ? 41  VAL D C     1 
ATOM 2212  O O     . VAL D 4 42  ? 125.24000 128.44900 119.86700 1.000 42.73786  ? 41  VAL D O     1 
ATOM 2213  C CB    . VAL D 4 42  ? 122.07800 127.43000 120.30000 1.000 42.73786  ? 41  VAL D CB    1 
ATOM 2214  C CG1   . VAL D 4 42  ? 122.22200 127.90600 118.88200 1.000 42.73786  ? 41  VAL D CG1   1 
ATOM 2215  C CG2   . VAL D 4 42  ? 121.42900 126.06500 120.32400 1.000 42.73786  ? 41  VAL D CG2   1 
ATOM 2216  N N     . TYR D 4 43  ? 124.17900 129.66200 121.43400 1.000 48.09889  ? 42  TYR D N     1 
ATOM 2217  C CA    . TYR D 4 43  ? 125.05400 130.81400 121.23900 1.000 48.09889  ? 42  TYR D CA    1 
ATOM 2218  C C     . TYR D 4 43  ? 126.47300 130.54800 121.73100 1.000 48.09889  ? 42  TYR D C     1 
ATOM 2219  O O     . TYR D 4 43  ? 127.43900 130.98900 121.09800 1.000 48.09889  ? 42  TYR D O     1 
ATOM 2220  C CB    . TYR D 4 43  ? 124.47400 132.04000 121.93200 1.000 48.09889  ? 42  TYR D CB    1 
ATOM 2221  C CG    . TYR D 4 43  ? 124.95500 133.32100 121.31900 1.000 48.09889  ? 42  TYR D CG    1 
ATOM 2222  C CD1   . TYR D 4 43  ? 124.35300 133.83800 120.18500 1.000 48.09889  ? 42  TYR D CD1   1 
ATOM 2223  C CD2   . TYR D 4 43  ? 126.02900 134.00700 121.86700 1.000 48.09889  ? 42  TYR D CD2   1 
ATOM 2224  C CE1   . TYR D 4 43  ? 124.80100 135.00800 119.61800 1.000 48.09889  ? 42  TYR D CE1   1 
ATOM 2225  C CE2   . TYR D 4 43  ? 126.48300 135.17800 121.31100 1.000 48.09889  ? 42  TYR D CE2   1 
ATOM 2226  C CZ    . TYR D 4 43  ? 125.86700 135.67400 120.18600 1.000 48.09889  ? 42  TYR D CZ    1 
ATOM 2227  O OH    . TYR D 4 43  ? 126.31900 136.84600 119.62500 1.000 48.09889  ? 42  TYR D OH    1 
ATOM 2228  N N     . LYS D 4 44  ? 126.62000 129.84900 122.86300 1.000 45.62734  ? 43  LYS D N     1 
ATOM 2229  C CA    . LYS D 4 44  ? 127.95200 129.50900 123.36700 1.000 45.62734  ? 43  LYS D CA    1 
ATOM 2230  C C     . LYS D 4 44  ? 128.69300 128.58500 122.40800 1.000 45.62734  ? 43  LYS D C     1 
ATOM 2231  O O     . LYS D 4 44  ? 129.87800 128.80200 122.11200 1.000 45.62734  ? 43  LYS D O     1 
ATOM 2232  C CB    . LYS D 4 44  ? 127.84200 128.85800 124.74300 1.000 45.62734  ? 43  LYS D CB    1 
ATOM 2233  C CG    . LYS D 4 44  ? 127.67500 129.83600 125.88200 1.000 45.62734  ? 43  LYS D CG    1 
ATOM 2234  C CD    . LYS D 4 44  ? 127.76400 129.12700 127.21300 1.000 45.62734  ? 43  LYS D CD    1 
ATOM 2235  C CE    . LYS D 4 44  ? 127.43700 130.05900 128.35500 1.000 45.62734  ? 43  LYS D CE    1 
ATOM 2236  N NZ    . LYS D 4 44  ? 127.10100 129.28100 129.57600 1.000 45.62734  ? 43  LYS D NZ    1 
ATOM 2237  N N     . VAL D 4 45  ? 128.00000 127.56500 121.89600 1.000 42.11949  ? 44  VAL D N     1 
ATOM 2238  C CA    . VAL D 4 45  ? 128.59900 126.64600 120.93500 1.000 42.11949  ? 44  VAL D CA    1 
ATOM 2239  C C     . VAL D 4 45  ? 128.92900 127.37400 119.63500 1.000 42.11949  ? 44  VAL D C     1 
ATOM 2240  O O     . VAL D 4 45  ? 129.98000 127.12900 119.02700 1.000 42.11949  ? 44  VAL D O     1 
ATOM 2241  C CB    . VAL D 4 45  ? 127.67100 125.43700 120.72600 1.000 42.11949  ? 44  VAL D CB    1 
ATOM 2242  C CG1   . VAL D 4 45  ? 128.18300 124.54700 119.65300 1.000 42.11949  ? 44  VAL D CG1   1 
ATOM 2243  C CG2   . VAL D 4 45  ? 127.59000 124.63400 121.99900 1.000 42.11949  ? 44  VAL D CG2   1 
ATOM 2244  N N     . LEU D 4 46  ? 128.04700 128.28900 119.20200 1.000 43.16516  ? 45  LEU D N     1 
ATOM 2245  C CA    . LEU D 4 46  ? 128.28200 129.07700 117.99400 1.000 43.16516  ? 45  LEU D CA    1 
ATOM 2246  C C     . LEU D 4 46  ? 129.52700 129.93800 118.12900 1.000 43.16516  ? 45  LEU D C     1 
ATOM 2247  O O     . LEU D 4 46  ? 130.34200 130.01300 117.20700 1.000 43.16516  ? 45  LEU D O     1 
ATOM 2248  C CB    . LEU D 4 46  ? 127.09400 129.99200 117.72300 1.000 43.16516  ? 45  LEU D CB    1 
ATOM 2249  C CG    . LEU D 4 46  ? 127.36800 130.92000 116.53600 1.000 43.16516  ? 45  LEU D CG    1 
ATOM 2250  C CD1   . LEU D 4 46  ? 127.47200 130.19900 115.19300 1.000 43.16516  ? 45  LEU D CD1   1 
ATOM 2251  C CD2   . LEU D 4 46  ? 126.51600 132.13200 116.51500 1.000 43.16516  ? 45  LEU D CD2   1 
ATOM 2252  N N     . LYS D 4 47  ? 129.68600 130.59100 119.28000 1.000 45.17733  ? 46  LYS D N     1 
ATOM 2253  C CA    . LYS D 4 47  ? 130.86500 131.41200 119.52000 1.000 45.17733  ? 46  LYS D CA    1 
ATOM 2254  C C     . LYS D 4 47  ? 132.12200 130.56000 119.54400 1.000 45.17733  ? 46  LYS D C     1 
ATOM 2255  O O     . LYS D 4 47  ? 133.19100 131.01200 119.12200 1.000 45.17733  ? 46  LYS D O     1 
ATOM 2256  C CB    . LYS D 4 47  ? 130.70500 132.21900 120.80700 1.000 45.17733  ? 46  LYS D CB    1 
ATOM 2257  C CG    . LYS D 4 47  ? 129.82500 133.45700 120.63500 1.000 45.17733  ? 46  LYS D CG    1 
ATOM 2258  C CD    . LYS D 4 47  ? 130.17800 134.21600 119.35400 1.000 45.17733  ? 46  LYS D CD    1 
ATOM 2259  C CE    . LYS D 4 47  ? 129.31400 135.44200 119.15200 1.000 45.17733  ? 46  LYS D CE    1 
ATOM 2260  N NZ    . LYS D 4 47  ? 129.63600 136.14400 117.88400 1.000 45.17733  ? 46  LYS D NZ    1 
ATOM 2261  N N     . GLN D 4 48  ? 132.03200 129.35300 120.10200 1.000 44.40125  ? 47  GLN D N     1 
ATOM 2262  C CA    . GLN D 4 48  ? 133.19900 128.47700 120.12300 1.000 44.40125  ? 47  GLN D CA    1 
ATOM 2263  C C     . GLN D 4 48  ? 133.60600 128.03200 118.71000 1.000 44.40125  ? 47  GLN D C     1 
ATOM 2264  O O     . GLN D 4 48  ? 134.78900 128.08200 118.35900 1.000 44.40125  ? 47  GLN D O     1 
ATOM 2265  C CB    . GLN D 4 48  ? 132.92100 127.27500 121.02200 1.000 44.40125  ? 47  GLN D CB    1 
ATOM 2266  C CG    . GLN D 4 48  ? 133.97000 126.19500 120.98300 1.000 44.40125  ? 47  GLN D CG    1 
ATOM 2267  C CD    . GLN D 4 48  ? 133.52300 124.94800 121.70100 1.000 44.40125  ? 47  GLN D CD    1 
ATOM 2268  O OE1   . GLN D 4 48  ? 132.61000 124.98800 122.52700 1.000 44.40125  ? 47  GLN D OE1   1 
ATOM 2269  N NE2   . GLN D 4 48  ? 134.19800 123.83600 121.43100 1.000 44.40125  ? 47  GLN D NE2   1 
ATOM 2270  N N     . VAL D 4 49  ? 132.64800 127.58300 117.88500 1.000 42.62881  ? 48  VAL D N     1 
ATOM 2271  C CA    . VAL D 4 49  ? 132.99400 127.14300 116.52400 1.000 42.62881  ? 48  VAL D CA    1 
ATOM 2272  C C     . VAL D 4 49  ? 133.35400 128.31700 115.60400 1.000 42.62881  ? 48  VAL D C     1 
ATOM 2273  O O     . VAL D 4 49  ? 134.31500 128.23400 114.83100 1.000 42.62881  ? 48  VAL D O     1 
ATOM 2274  C CB    . VAL D 4 49  ? 131.89500 126.24100 115.91100 1.000 42.62881  ? 48  VAL D CB    1 
ATOM 2275  C CG1   . VAL D 4 49  ? 131.79200 124.94200 116.67600 1.000 42.62881  ? 48  VAL D CG1   1 
ATOM 2276  C CG2   . VAL D 4 49  ? 130.53300 126.90300 115.84100 1.000 42.62881  ? 48  VAL D CG2   1 
ATOM 2277  N N     . HIS D 4 50  ? 132.60300 129.41500 115.66300 1.000 43.37397  ? 49  HIS D N     1 
ATOM 2278  C CA    . HIS D 4 50  ? 132.79800 130.57800 114.79700 1.000 43.37397  ? 49  HIS D CA    1 
ATOM 2279  C C     . HIS D 4 50  ? 132.70300 131.84400 115.63600 1.000 43.37397  ? 49  HIS D C     1 
ATOM 2280  O O     . HIS D 4 50  ? 131.59400 132.33800 115.89300 1.000 43.37397  ? 49  HIS D O     1 
ATOM 2281  C CB    . HIS D 4 50  ? 131.76000 130.63100 113.67900 1.000 43.37397  ? 49  HIS D CB    1 
ATOM 2282  C CG    . HIS D 4 50  ? 132.07500 129.77200 112.49900 1.000 43.37397  ? 49  HIS D CG    1 
ATOM 2283  N ND1   . HIS D 4 50  ? 131.46400 128.55800 112.28000 1.000 43.37397  ? 49  HIS D ND1   1 
ATOM 2284  C CD2   . HIS D 4 50  ? 132.91800 129.96300 111.45800 1.000 43.37397  ? 49  HIS D CD2   1 
ATOM 2285  C CE1   . HIS D 4 50  ? 131.92600 128.03200 111.16000 1.000 43.37397  ? 49  HIS D CE1   1 
ATOM 2286  N NE2   . HIS D 4 50  ? 132.81000 128.86400 110.64200 1.000 43.37397  ? 49  HIS D NE2   1 
ATOM 2287  N N     . PRO D 4 51  ? 133.83200 132.40100 116.08000 1.000 46.29043  ? 50  PRO D N     1 
ATOM 2288  C CA    . PRO D 4 51  ? 133.77800 133.50600 117.04900 1.000 46.29043  ? 50  PRO D CA    1 
ATOM 2289  C C     . PRO D 4 51  ? 133.33200 134.84600 116.47800 1.000 46.29043  ? 50  PRO D C     1 
ATOM 2290  O O     . PRO D 4 51  ? 133.16900 135.79500 117.25200 1.000 46.29043  ? 50  PRO D O     1 
ATOM 2291  C CB    . PRO D 4 51  ? 135.22400 133.58700 117.55600 1.000 46.29043  ? 50  PRO D CB    1 
ATOM 2292  C CG    . PRO D 4 51  ? 136.04100 133.02700 116.43900 1.000 46.29043  ? 50  PRO D CG    1 
ATOM 2293  C CD    . PRO D 4 51  ? 135.20900 131.95100 115.82000 1.000 46.29043  ? 50  PRO D CD    1 
ATOM 2294  N N     . ASP D 4 52  ? 133.12000 134.97800 115.16600 1.000 46.83136  ? 51  ASP D N     1 
ATOM 2295  C CA    . ASP D 4 52  ? 132.69400 136.25200 114.60200 1.000 46.83136  ? 51  ASP D CA    1 
ATOM 2296  C C     . ASP D 4 52  ? 131.25800 136.29000 114.09600 1.000 46.83136  ? 51  ASP D C     1 
ATOM 2297  O O     . ASP D 4 52  ? 130.72600 137.38800 113.91400 1.000 46.83136  ? 51  ASP D O     1 
ATOM 2298  C CB    . ASP D 4 52  ? 133.61900 136.65900 113.44400 1.000 46.83136  ? 51  ASP D CB    1 
ATOM 2299  C CG    . ASP D 4 52  ? 134.94700 137.21700 113.92100 1.000 46.83136  ? 51  ASP D CG    1 
ATOM 2300  O OD1   . ASP D 4 52  ? 136.00100 136.70700 113.48800 1.000 46.83136  ? 51  ASP D OD1   1 
ATOM 2301  O OD2   . ASP D 4 52  ? 134.93500 138.17000 114.72800 1.000 46.83136  ? 51  ASP D OD2   1 
ATOM 2302  N N     . THR D 4 53  ? 130.61300 135.14800 113.87900 1.000 47.95115  ? 52  THR D N     1 
ATOM 2303  C CA    . THR D 4 53  ? 129.24800 135.16100 113.37100 1.000 47.95115  ? 52  THR D CA    1 
ATOM 2304  C C     . THR D 4 53  ? 128.22300 135.26000 114.49800 1.000 47.95115  ? 52  THR D C     1 
ATOM 2305  O O     . THR D 4 53  ? 128.54900 135.22500 115.68600 1.000 47.95115  ? 52  THR D O     1 
ATOM 2306  C CB    . THR D 4 53  ? 128.97300 133.91500 112.53000 1.000 47.95115  ? 52  THR D CB    1 
ATOM 2307  O OG1   . THR D 4 53  ? 129.25300 132.74700 113.30700 1.000 47.95115  ? 52  THR D OG1   1 
ATOM 2308  C CG2   . THR D 4 53  ? 129.83600 133.90600 111.28100 1.000 47.95115  ? 52  THR D CG2   1 
ATOM 2309  N N     . GLY D 4 54  ? 126.95600 135.38700 114.09900 1.000 47.17037  ? 53  GLY D N     1 
ATOM 2310  C CA    . GLY D 4 54  ? 125.84300 135.39100 115.02400 1.000 47.17037  ? 53  GLY D CA    1 
ATOM 2311  C C     . GLY D 4 54  ? 124.65300 134.67200 114.42000 1.000 47.17037  ? 53  GLY D C     1 
ATOM 2312  O O     . GLY D 4 54  ? 124.71600 134.17800 113.29700 1.000 47.17037  ? 53  GLY D O     1 
ATOM 2313  N N     . ILE D 4 55  ? 123.56200 134.63300 115.17800 1.000 44.94509  ? 54  ILE D N     1 
ATOM 2314  C CA    . ILE D 4 55  ? 122.33600 133.97200 114.75000 1.000 44.94509  ? 54  ILE D CA    1 
ATOM 2315  C C     . ILE D 4 55  ? 121.20200 134.98500 114.82900 1.000 44.94509  ? 54  ILE D C     1 
ATOM 2316  O O     . ILE D 4 55  ? 121.19300 135.86100 115.69700 1.000 44.94509  ? 54  ILE D O     1 
ATOM 2317  C CB    . ILE D 4 55  ? 122.05600 132.71800 115.62100 1.000 44.94509  ? 54  ILE D CB    1 
ATOM 2318  C CG1   . ILE D 4 55  ? 123.14100 131.68000 115.43400 1.000 44.94509  ? 54  ILE D CG1   1 
ATOM 2319  C CG2   . ILE D 4 55  ? 120.84600 131.96800 115.20000 1.000 44.94509  ? 54  ILE D CG2   1 
ATOM 2320  C CD1   . ILE D 4 55  ? 123.09200 130.56100 116.43600 1.000 44.94509  ? 54  ILE D CD1   1 
ATOM 2321  N N     . SER D 4 56  ? 120.23400 134.85800 113.92300 1.000 43.40880  ? 55  SER D N     1 
ATOM 2322  C CA    . SER D 4 56  ? 119.02000 135.65000 113.97000 1.000 43.40880  ? 55  SER D CA    1 
ATOM 2323  C C     . SER D 4 56  ? 118.07000 135.08200 115.02500 1.000 43.40880  ? 55  SER D C     1 
ATOM 2324  O O     . SER D 4 56  ? 118.36500 134.09600 115.70000 1.000 43.40880  ? 55  SER D O     1 
ATOM 2325  C CB    . SER D 4 56  ? 118.36500 135.68300 112.59600 1.000 43.40880  ? 55  SER D CB    1 
ATOM 2326  O OG    . SER D 4 56  ? 117.74100 134.44700 112.31900 1.000 43.40880  ? 55  SER D OG    1 
ATOM 2327  N N     . SER D 4 57  ? 116.91100 135.72000 115.19200 1.000 44.90172  ? 56  SER D N     1 
ATOM 2328  C CA    . SER D 4 57  ? 115.91400 135.17300 116.10500 1.000 44.90172  ? 56  SER D CA    1 
ATOM 2329  C C     . SER D 4 57  ? 115.25600 133.92900 115.53300 1.000 44.90172  ? 56  SER D C     1 
ATOM 2330  O O     . SER D 4 57  ? 114.95700 132.98600 116.27300 1.000 44.90172  ? 56  SER D O     1 
ATOM 2331  C CB    . SER D 4 57  ? 114.85400 136.22100 116.42800 1.000 44.90172  ? 56  SER D CB    1 
ATOM 2332  O OG    . SER D 4 57  ? 113.78100 135.64800 117.15100 1.000 44.90172  ? 56  SER D OG    1 
ATOM 2333  N N     . LYS D 4 58  ? 115.00400 133.91100 114.22500 1.000 41.17059  ? 57  LYS D N     1 
ATOM 2334  C CA    . LYS D 4 58  ? 114.30200 132.77800 113.63800 1.000 41.17059  ? 57  LYS D CA    1 
ATOM 2335  C C     . LYS D 4 58  ? 115.20700 131.56400 113.51800 1.000 41.17059  ? 57  LYS D C     1 
ATOM 2336  O O     . LYS D 4 58  ? 114.76500 130.43300 113.75200 1.000 41.17059  ? 57  LYS D O     1 
ATOM 2337  C CB    . LYS D 4 58  ? 113.76200 133.16500 112.26600 1.000 41.17059  ? 57  LYS D CB    1 
ATOM 2338  C CG    . LYS D 4 58  ? 112.71000 134.24700 112.30100 1.000 41.17059  ? 57  LYS D CG    1 
ATOM 2339  C CD    . LYS D 4 58  ? 112.29500 134.62600 110.89400 1.000 41.17059  ? 57  LYS D CD    1 
ATOM 2340  C CE    . LYS D 4 58  ? 111.24500 135.72200 110.89900 1.000 41.17059  ? 57  LYS D CE    1 
ATOM 2341  N NZ    . LYS D 4 58  ? 110.87900 136.12600 109.51500 1.000 41.17059  ? 57  LYS D NZ    1 
ATOM 2342  N N     . ALA D 4 59  ? 116.49200 131.78400 113.25800 1.000 38.66444  ? 58  ALA D N     1 
ATOM 2343  C CA    . ALA D 4 59  ? 117.43400 130.68200 113.16400 1.000 38.66444  ? 58  ALA D CA    1 
ATOM 2344  C C     . ALA D 4 59  ? 117.93600 130.24400 114.52100 1.000 38.66444  ? 58  ALA D C     1 
ATOM 2345  O O     . ALA D 4 59  ? 118.63600 129.23300 114.60900 1.000 38.66444  ? 58  ALA D O     1 
ATOM 2346  C CB    . ALA D 4 59  ? 118.62200 131.07700 112.29200 1.000 38.66444  ? 58  ALA D CB    1 
ATOM 2347  N N     . MET D 4 60  ? 117.61600 130.99300 115.57100 1.000 39.59946  ? 59  MET D N     1 
ATOM 2348  C CA    . MET D 4 60  ? 117.77600 130.47600 116.91700 1.000 39.59946  ? 59  MET D CA    1 
ATOM 2349  C C     . MET D 4 60  ? 116.57800 129.63100 117.29800 1.000 39.59946  ? 59  MET D C     1 
ATOM 2350  O O     . MET D 4 60  ? 116.72100 128.66800 118.05200 1.000 39.59946  ? 59  MET D O     1 
ATOM 2351  C CB    . MET D 4 60  ? 117.95600 131.62000 117.91100 1.000 39.59946  ? 59  MET D CB    1 
ATOM 2352  C CG    . MET D 4 60  ? 118.43900 131.17800 119.27200 1.000 39.59946  ? 59  MET D CG    1 
ATOM 2353  S SD    . MET D 4 60  ? 120.22100 130.97700 119.32200 1.000 39.59946  ? 59  MET D SD    1 
ATOM 2354  C CE    . MET D 4 60  ? 120.72000 132.68100 119.54700 1.000 39.59946  ? 59  MET D CE    1 
ATOM 2355  N N     . GLY D 4 61  ? 115.40300 129.96400 116.76500 1.000 38.14455  ? 60  GLY D N     1 
ATOM 2356  C CA    . GLY D 4 61  ? 114.24900 129.10200 116.94000 1.000 38.14455  ? 60  GLY D CA    1 
ATOM 2357  C C     . GLY D 4 61  ? 114.40800 127.77100 116.23400 1.000 38.14455  ? 60  GLY D C     1 
ATOM 2358  O O     . GLY D 4 61  ? 113.97100 126.73700 116.74800 1.000 38.14455  ? 60  GLY D O     1 
ATOM 2359  N N     . ILE D 4 62  ? 115.07100 127.77400 115.06900 1.000 36.07105  ? 61  ILE D N     1 
ATOM 2360  C CA    . ILE D 4 62  ? 115.35900 126.52300 114.36300 1.000 36.07105  ? 61  ILE D CA    1 
ATOM 2361  C C     . ILE D 4 62  ? 116.27700 125.63500 115.19500 1.000 36.07105  ? 61  ILE D C     1 
ATOM 2362  O O     . ILE D 4 62  ? 116.02800 124.43700 115.34900 1.000 36.07105  ? 61  ILE D O     1 
ATOM 2363  C CB    . ILE D 4 62  ? 115.97400 126.79900 112.97800 1.000 36.07105  ? 61  ILE D CB    1 
ATOM 2364  C CG1   . ILE D 4 62  ? 115.05800 127.66000 112.11200 1.000 36.07105  ? 61  ILE D CG1   1 
ATOM 2365  C CG2   . ILE D 4 62  ? 116.31200 125.49600 112.27500 1.000 36.07105  ? 61  ILE D CG2   1 
ATOM 2366  C CD1   . ILE D 4 62  ? 113.89900 126.93400 111.50700 1.000 36.07105  ? 61  ILE D CD1   1 
ATOM 2367  N N     . MET D 4 63  ? 117.32300 126.21300 115.78400 1.000 35.15360  ? 62  MET D N     1 
ATOM 2368  C CA    . MET D 4 63  ? 118.27100 125.41100 116.55000 1.000 35.15360  ? 62  MET D CA    1 
ATOM 2369  C C     . MET D 4 63  ? 117.69200 124.98300 117.89400 1.000 35.15360  ? 62  MET D C     1 
ATOM 2370  O O     . MET D 4 63  ? 117.94200 123.86300 118.35800 1.000 35.15360  ? 62  MET D O     1 
ATOM 2371  C CB    . MET D 4 63  ? 119.56400 126.19400 116.75000 1.000 35.15360  ? 62  MET D CB    1 
ATOM 2372  C CG    . MET D 4 63  ? 120.30200 126.48900 115.46600 1.000 35.15360  ? 62  MET D CG    1 
ATOM 2373  S SD    . MET D 4 63  ? 120.98600 124.97700 114.79200 1.000 35.15360  ? 62  MET D SD    1 
ATOM 2374  C CE    . MET D 4 63  ? 121.86500 124.40100 116.23100 1.000 35.15360  ? 62  MET D CE    1 
ATOM 2375  N N     . ASN D 4 64  ? 116.90400 125.85400 118.52200 1.000 36.79595  ? 63  ASN D N     1 
ATOM 2376  C CA    . ASN D 4 64  ? 116.23100 125.51700 119.76500 1.000 36.79595  ? 63  ASN D CA    1 
ATOM 2377  C C     . ASN D 4 64  ? 115.16700 124.45000 119.56300 1.000 36.79595  ? 63  ASN D C     1 
ATOM 2378  O O     . ASN D 4 64  ? 114.87600 123.68900 120.49100 1.000 36.79595  ? 63  ASN D O     1 
ATOM 2379  C CB    . ASN D 4 64  ? 115.61600 126.78500 120.35000 1.000 36.79595  ? 63  ASN D CB    1 
ATOM 2380  C CG    . ASN D 4 64  ? 115.00200 126.56500 121.69900 1.000 36.79595  ? 63  ASN D CG    1 
ATOM 2381  O OD1   . ASN D 4 64  ? 115.67800 126.63400 122.71300 1.000 36.79595  ? 63  ASN D OD1   1 
ATOM 2382  N ND2   . ASN D 4 64  ? 113.70800 126.30700 121.72500 1.000 36.79595  ? 63  ASN D ND2   1 
ATOM 2383  N N     . SER D 4 65  ? 114.57700 124.37000 118.36800 1.000 32.94410  ? 64  SER D N     1 
ATOM 2384  C CA    . SER D 4 65  ? 113.65400 123.27900 118.09500 1.000 32.94410  ? 64  SER D CA    1 
ATOM 2385  C C     . SER D 4 65  ? 114.38900 122.02200 117.65700 1.000 32.94410  ? 64  SER D C     1 
ATOM 2386  O O     . SER D 4 65  ? 113.90500 120.91200 117.89800 1.000 32.94410  ? 64  SER D O     1 
ATOM 2387  C CB    . SER D 4 65  ? 112.64000 123.69900 117.04000 1.000 32.94410  ? 64  SER D CB    1 
ATOM 2388  O OG    . SER D 4 65  ? 111.78400 122.61800 116.74000 1.000 32.94410  ? 64  SER D OG    1 
ATOM 2389  N N     . PHE D 4 66  ? 115.55900 122.18100 117.03600 1.000 31.05952  ? 65  PHE D N     1 
ATOM 2390  C CA    . PHE D 4 66  ? 116.35800 121.04000 116.60300 1.000 31.05952  ? 65  PHE D CA    1 
ATOM 2391  C C     . PHE D 4 66  ? 116.90000 120.26200 117.79000 1.000 31.05952  ? 65  PHE D C     1 
ATOM 2392  O O     . PHE D 4 66  ? 116.87100 119.02500 117.78800 1.000 31.05952  ? 65  PHE D O     1 
ATOM 2393  C CB    . PHE D 4 66  ? 117.50700 121.52900 115.72200 1.000 31.05952  ? 65  PHE D CB    1 
ATOM 2394  C CG    . PHE D 4 66  ? 118.59700 120.52100 115.52400 1.000 31.05952  ? 65  PHE D CG    1 
ATOM 2395  C CD1   . PHE D 4 66  ? 118.42200 119.45100 114.67500 1.000 31.05952  ? 65  PHE D CD1   1 
ATOM 2396  C CD2   . PHE D 4 66  ? 119.81100 120.65800 116.18000 1.000 31.05952  ? 65  PHE D CD2   1 
ATOM 2397  C CE1   . PHE D 4 66  ? 119.43200 118.53300 114.48400 1.000 31.05952  ? 65  PHE D CE1   1 
ATOM 2398  C CE2   . PHE D 4 66  ? 120.81500 119.73800 116.00100 1.000 31.05952  ? 65  PHE D CE2   1 
ATOM 2399  C CZ    . PHE D 4 66  ? 120.62500 118.67500 115.15400 1.000 31.05952  ? 65  PHE D CZ    1 
ATOM 2400  N N     . VAL D 4 67  ? 117.42100 120.97200 118.79600 1.000 31.09055  ? 66  VAL D N     1 
ATOM 2401  C CA    . VAL D 4 67  ? 117.94000 120.32100 119.99800 1.000 31.09055  ? 66  VAL D CA    1 
ATOM 2402  C C     . VAL D 4 67  ? 116.82500 119.58800 120.72800 1.000 31.09055  ? 66  VAL D C     1 
ATOM 2403  O O     . VAL D 4 67  ? 117.00600 118.45700 121.18900 1.000 31.09055  ? 66  VAL D O     1 
ATOM 2404  C CB    . VAL D 4 67  ? 118.63500 121.35200 120.90400 1.000 31.09055  ? 66  VAL D CB    1 
ATOM 2405  C CG1   . VAL D 4 67  ? 119.05500 120.72000 122.20600 1.000 31.09055  ? 66  VAL D CG1   1 
ATOM 2406  C CG2   . VAL D 4 67  ? 119.84400 121.91600 120.21100 1.000 31.09055  ? 66  VAL D CG2   1 
ATOM 2407  N N     . ASN D 4 68  ? 115.64100 120.19900 120.79300 1.000 31.05432  ? 67  ASN D N     1 
ATOM 2408  C CA    . ASN D 4 68  ? 114.50500 119.57800 121.46300 1.000 31.05432  ? 67  ASN D CA    1 
ATOM 2409  C C     . ASN D 4 68  ? 114.01600 118.34800 120.70500 1.000 31.05432  ? 67  ASN D C     1 
ATOM 2410  O O     . ASN D 4 68  ? 113.65800 117.33800 121.32000 1.000 31.05432  ? 67  ASN D O     1 
ATOM 2411  C CB    . ASN D 4 68  ? 113.38600 120.60200 121.61100 1.000 31.05432  ? 67  ASN D CB    1 
ATOM 2412  C CG    . ASN D 4 68  ? 112.48300 120.31100 122.78300 1.000 31.05432  ? 67  ASN D CG    1 
ATOM 2413  O OD1   . ASN D 4 68  ? 112.03300 119.18400 122.97600 1.000 31.05432  ? 67  ASN D OD1   1 
ATOM 2414  N ND2   . ASN D 4 68  ? 112.21500 121.33400 123.58400 1.000 31.05432  ? 67  ASN D ND2   1 
ATOM 2415  N N     . ASP D 4 69  ? 114.05700 118.39300 119.37100 1.000 31.14294  ? 68  ASP D N     1 
ATOM 2416  C CA    . ASP D 4 69  ? 113.62700 117.25800 118.55900 1.000 31.14294  ? 68  ASP D CA    1 
ATOM 2417  C C     . ASP D 4 69  ? 114.59800 116.08900 118.69300 1.000 31.14294  ? 68  ASP D C     1 
ATOM 2418  O O     . ASP D 4 69  ? 114.17700 114.93900 118.87000 1.000 31.14294  ? 68  ASP D O     1 
ATOM 2419  C CB    . ASP D 4 69  ? 113.50200 117.69900 117.10000 1.000 31.14294  ? 68  ASP D CB    1 
ATOM 2420  C CG    . ASP D 4 69  ? 112.91500 116.62700 116.19000 1.000 31.14294  ? 68  ASP D CG    1 
ATOM 2421  O OD1   . ASP D 4 69  ? 112.92600 116.84700 114.96200 1.000 31.14294  ? 68  ASP D OD1   1 
ATOM 2422  O OD2   . ASP D 4 69  ? 112.37900 115.61000 116.67500 1.000 31.14294  ? 68  ASP D OD2   1 
ATOM 2423  N N     . ILE D 4 70  ? 115.90300 116.36200 118.60600 1.000 29.38652  ? 69  ILE D N     1 
ATOM 2424  C CA    . ILE D 4 70  ? 116.90300 115.30400 118.75500 1.000 29.38652  ? 69  ILE D CA    1 
ATOM 2425  C C     . ILE D 4 70  ? 116.93300 114.75500 120.17900 1.000 29.38652  ? 69  ILE D C     1 
ATOM 2426  O O     . ILE D 4 70  ? 117.12000 113.54700 120.37600 1.000 29.38652  ? 69  ILE D O     1 
ATOM 2427  C CB    . ILE D 4 70  ? 118.27400 115.83400 118.29600 1.000 29.38652  ? 69  ILE D CB    1 
ATOM 2428  C CG1   . ILE D 4 70  ? 118.21100 116.17400 116.81500 1.000 29.38652  ? 69  ILE D CG1   1 
ATOM 2429  C CG2   . ILE D 4 70  ? 119.38100 114.82800 118.50700 1.000 29.38652  ? 69  ILE D CG2   1 
ATOM 2430  C CD1   . ILE D 4 70  ? 117.76800 115.02900 115.94200 1.000 29.38652  ? 69  ILE D CD1   1 
ATOM 2431  N N     . PHE D 4 71  ? 116.68600 115.60200 121.18300 1.000 31.34744  ? 70  PHE D N     1 
ATOM 2432  C CA    . PHE D 4 71  ? 116.57700 115.12600 122.55800 1.000 31.34744  ? 70  PHE D CA    1 
ATOM 2433  C C     . PHE D 4 71  ? 115.38200 114.20400 122.73000 1.000 31.34744  ? 70  PHE D C     1 
ATOM 2434  O O     . PHE D 4 71  ? 115.49200 113.15500 123.37500 1.000 31.34744  ? 70  PHE D O     1 
ATOM 2435  C CB    . PHE D 4 71  ? 116.48100 116.31000 123.51600 1.000 31.34744  ? 70  PHE D CB    1 
ATOM 2436  C CG    . PHE D 4 71  ? 116.29600 115.91200 124.94500 1.000 31.34744  ? 70  PHE D CG    1 
ATOM 2437  C CD1   . PHE D 4 71  ? 117.35800 115.44300 125.68700 1.000 31.34744  ? 70  PHE D CD1   1 
ATOM 2438  C CD2   . PHE D 4 71  ? 115.05500 116.01100 125.55000 1.000 31.34744  ? 70  PHE D CD2   1 
ATOM 2439  C CE1   . PHE D 4 71  ? 117.18700 115.07400 126.99800 1.000 31.34744  ? 70  PHE D CE1   1 
ATOM 2440  C CE2   . PHE D 4 71  ? 114.88000 115.63700 126.85800 1.000 31.34744  ? 70  PHE D CE2   1 
ATOM 2441  C CZ    . PHE D 4 71  ? 115.94700 115.17300 127.58300 1.000 31.34744  ? 70  PHE D CZ    1 
ATOM 2442  N N     . GLU D 4 72  ? 114.24000 114.56800 122.13800 1.000 30.55241  ? 71  GLU D N     1 
ATOM 2443  C CA    . GLU D 4 72  ? 113.05400 113.72300 122.20800 1.000 30.55241  ? 71  GLU D CA    1 
ATOM 2444  C C     . GLU D 4 72  ? 113.27100 112.39200 121.50200 1.000 30.55241  ? 71  GLU D C     1 
ATOM 2445  O O     . GLU D 4 72  ? 112.88100 111.34300 122.02300 1.000 30.55241  ? 71  GLU D O     1 
ATOM 2446  C CB    . GLU D 4 72  ? 111.86300 114.46000 121.60200 1.000 30.55241  ? 71  GLU D CB    1 
ATOM 2447  C CG    . GLU D 4 72  ? 110.57500 113.67000 121.60700 1.000 30.55241  ? 71  GLU D CG    1 
ATOM 2448  C CD    . GLU D 4 72  ? 110.24000 113.11200 122.97200 1.000 30.55241  ? 71  GLU D CD    1 
ATOM 2449  O OE1   . GLU D 4 72  ? 110.06500 113.91000 123.91600 1.000 30.55241  ? 71  GLU D OE1   1 
ATOM 2450  O OE2   . GLU D 4 72  ? 110.14600 111.87400 123.10000 1.000 30.55241  ? 71  GLU D OE2   1 
ATOM 2451  N N     . ARG D 4 73  ? 113.95900 112.40700 120.35600 1.000 28.85271  ? 72  ARG D N     1 
ATOM 2452  C CA    . ARG D 4 73  ? 114.19600 111.17000 119.61200 1.000 28.85271  ? 72  ARG D CA    1 
ATOM 2453  C C     . ARG D 4 73  ? 115.15800 110.24300 120.34600 1.000 28.85271  ? 72  ARG D C     1 
ATOM 2454  O O     . ARG D 4 73  ? 114.88600 109.04400 120.48400 1.000 28.85271  ? 72  ARG D O     1 
ATOM 2455  C CB    . ARG D 4 73  ? 114.71400 111.48800 118.21100 1.000 28.85271  ? 72  ARG D CB    1 
ATOM 2456  C CG    . ARG D 4 73  ? 113.62400 111.93400 117.26400 1.000 28.85271  ? 72  ARG D CG    1 
ATOM 2457  C CD    . ARG D 4 73  ? 114.15900 112.83000 116.16900 1.000 28.85271  ? 72  ARG D CD    1 
ATOM 2458  N NE    . ARG D 4 73  ? 114.87800 112.09600 115.13900 1.000 28.85271  ? 72  ARG D NE    1 
ATOM 2459  C CZ    . ARG D 4 73  ? 115.24300 112.62100 113.97600 1.000 28.85271  ? 72  ARG D CZ    1 
ATOM 2460  N NH1   . ARG D 4 73  ? 114.96400 113.88600 113.70200 1.000 28.85271  ? 72  ARG D NH1   1 
ATOM 2461  N NH2   . ARG D 4 73  ? 115.89000 111.88200 113.09100 1.000 28.85271  ? 72  ARG D NH2   1 
ATOM 2462  N N     . ILE D 4 74  ? 116.27700 110.78300 120.83900 1.000 28.60834  ? 73  ILE D N     1 
ATOM 2463  C CA    . ILE D 4 74  ? 117.27300 109.95700 121.51700 1.000 28.60834  ? 73  ILE D CA    1 
ATOM 2464  C C     . ILE D 4 74  ? 116.73500 109.43800 122.84200 1.000 28.60834  ? 73  ILE D C     1 
ATOM 2465  O O     . ILE D 4 74  ? 116.91100 108.26000 123.17600 1.000 28.60834  ? 73  ILE D O     1 
ATOM 2466  C CB    . ILE D 4 74  ? 118.59000 110.73400 121.68700 1.000 28.60834  ? 73  ILE D CB    1 
ATOM 2467  C CG1   . ILE D 4 74  ? 119.22300 111.01800 120.32600 1.000 28.60834  ? 73  ILE D CG1   1 
ATOM 2468  C CG2   . ILE D 4 74  ? 119.57600 109.96000 122.53700 1.000 28.60834  ? 73  ILE D CG2   1 
ATOM 2469  C CD1   . ILE D 4 74  ? 120.53500 111.74400 120.39300 1.000 28.60834  ? 73  ILE D CD1   1 
ATOM 2470  N N     . ALA D 4 75  ? 116.01300 110.27600 123.58900 1.000 29.93312  ? 74  ALA D N     1 
ATOM 2471  C CA    . ALA D 4 75  ? 115.48800 109.82400 124.86700 1.000 29.93312  ? 74  ALA D CA    1 
ATOM 2472  C C     . ALA D 4 75  ? 114.32200 108.85700 124.69600 1.000 29.93312  ? 74  ALA D C     1 
ATOM 2473  O O     . ALA D 4 75  ? 114.19300 107.92400 125.48800 1.000 29.93312  ? 74  ALA D O     1 
ATOM 2474  C CB    . ALA D 4 75  ? 115.09200 111.02500 125.71700 1.000 29.93312  ? 74  ALA D CB    1 
ATOM 2475  N N     . GLY D 4 76  ? 113.48400 109.02700 123.66900 1.000 30.88592  ? 75  GLY D N     1 
ATOM 2476  C CA    . GLY D 4 76  ? 112.42700 108.05700 123.42800 1.000 30.88592  ? 75  GLY D CA    1 
ATOM 2477  C C     . GLY D 4 76  ? 112.95500 106.72200 122.93800 1.000 30.88592  ? 75  GLY D C     1 
ATOM 2478  O O     . GLY D 4 76  ? 112.43200 105.66300 123.30900 1.000 30.88592  ? 75  GLY D O     1 
ATOM 2479  N N     . GLU D 4 77  ? 114.01300 106.74900 122.11800 1.000 32.37906  ? 76  GLU D N     1 
ATOM 2480  C CA    . GLU D 4 77  ? 114.64500 105.50900 121.68400 1.000 32.37906  ? 76  GLU D CA    1 
ATOM 2481  C C     . GLU D 4 77  ? 115.32000 104.79600 122.84700 1.000 32.37906  ? 76  GLU D C     1 
ATOM 2482  O O     . GLU D 4 77  ? 115.20200 103.57400 122.97700 1.000 32.37906  ? 76  GLU D O     1 
ATOM 2483  C CB    . GLU D 4 77  ? 115.64900 105.79400 120.57300 1.000 32.37906  ? 76  GLU D CB    1 
ATOM 2484  C CG    . GLU D 4 77  ? 116.34600 104.56000 120.04200 1.000 32.37906  ? 76  GLU D CG    1 
ATOM 2485  C CD    . GLU D 4 77  ? 115.37600 103.50300 119.55500 1.000 32.37906  ? 76  GLU D CD    1 
ATOM 2486  O OE1   . GLU D 4 77  ? 114.43900 103.84500 118.80300 1.000 32.37906  ? 76  GLU D OE1   1 
ATOM 2487  O OE2   . GLU D 4 77  ? 115.54400 102.32700 119.93500 1.000 32.37906  ? 76  GLU D OE2   1 
ATOM 2488  N N     . ALA D 4 78  ? 115.99300 105.54500 123.72600 1.000 31.55510  ? 77  ALA D N     1 
ATOM 2489  C CA    . ALA D 4 78  ? 116.57300 104.94600 124.92400 1.000 31.55510  ? 77  ALA D CA    1 
ATOM 2490  C C     . ALA D 4 78  ? 115.49900 104.45700 125.88700 1.000 31.55510  ? 77  ALA D C     1 
ATOM 2491  O O     . ALA D 4 78  ? 115.70800 103.46400 126.58900 1.000 31.55510  ? 77  ALA D O     1 
ATOM 2492  C CB    . ALA D 4 78  ? 117.49500 105.94400 125.61800 1.000 31.55510  ? 77  ALA D CB    1 
ATOM 2493  N N     . SER D 4 79  ? 114.33800 105.11400 125.90000 1.000 31.28226  ? 78  SER D N     1 
ATOM 2494  C CA    . SER D 4 79  ? 113.23300 104.69600 126.75300 1.000 31.28226  ? 78  SER D CA    1 
ATOM 2495  C C     . SER D 4 79  ? 112.68000 103.35000 126.32100 1.000 31.28226  ? 78  SER D C     1 
ATOM 2496  O O     . SER D 4 79  ? 112.53800 102.43500 127.14000 1.000 31.28226  ? 78  SER D O     1 
ATOM 2497  C CB    . SER D 4 79  ? 112.13100 105.74700 126.72000 1.000 31.28226  ? 78  SER D CB    1 
ATOM 2498  O OG    . SER D 4 79  ? 110.95000 105.24500 127.31300 1.000 31.28226  ? 78  SER D OG    1 
ATOM 2499  N N     . ARG D 4 80  ? 112.37700 103.20200 125.02800 1.000 31.91180  ? 79  ARG D N     1 
ATOM 2500  C CA    . ARG D 4 80  ? 111.89600 101.90700 124.55700 1.000 31.91180  ? 79  ARG D CA    1 
ATOM 2501  C C     . ARG D 4 80  ? 113.00100 100.85700 124.55300 1.000 31.91180  ? 79  ARG D C     1 
ATOM 2502  O O     . ARG D 4 80  ? 112.70900 99.66600  124.69500 1.000 31.91180  ? 79  ARG D O     1 
ATOM 2503  C CB    . ARG D 4 80  ? 111.26000 102.03800 123.17400 1.000 31.91180  ? 79  ARG D CB    1 
ATOM 2504  C CG    . ARG D 4 80  ? 112.20300 102.37000 122.05000 1.000 31.91180  ? 79  ARG D CG    1 
ATOM 2505  C CD    . ARG D 4 80  ? 111.46100 102.35500 120.72900 1.000 31.91180  ? 79  ARG D CD    1 
ATOM 2506  N NE    . ARG D 4 80  ? 110.27200 103.20000 120.76200 1.000 31.91180  ? 79  ARG D NE    1 
ATOM 2507  C CZ    . ARG D 4 80  ? 110.23800 104.45400 120.32800 1.000 31.91180  ? 79  ARG D CZ    1 
ATOM 2508  N NH1   . ARG D 4 80  ? 111.32800 105.01100 119.82200 1.000 31.91180  ? 79  ARG D NH1   1 
ATOM 2509  N NH2   . ARG D 4 80  ? 109.11300 105.15100 120.39500 1.000 31.91180  ? 79  ARG D NH2   1 
ATOM 2510  N N     . LEU D 4 81  ? 114.26300 101.28000 124.48800 1.000 33.10173  ? 80  LEU D N     1 
ATOM 2511  C CA    . LEU D 4 81  ? 115.38100 100.35100 124.58700 1.000 33.10173  ? 80  LEU D CA    1 
ATOM 2512  C C     . LEU D 4 81  ? 115.52900 99.79500  125.99700 1.000 33.10173  ? 80  LEU D C     1 
ATOM 2513  O O     . LEU D 4 81  ? 115.86300 98.62000  126.17200 1.000 33.10173  ? 80  LEU D O     1 
ATOM 2514  C CB    . LEU D 4 81  ? 116.65100 101.06800 124.15600 1.000 33.10173  ? 80  LEU D CB    1 
ATOM 2515  C CG    . LEU D 4 81  ? 117.95700 100.30900 124.11800 1.000 33.10173  ? 80  LEU D CG    1 
ATOM 2516  C CD1   . LEU D 4 81  ? 117.80600 99.05600  123.31300 1.000 33.10173  ? 80  LEU D CD1   1 
ATOM 2517  C CD2   . LEU D 4 81  ? 118.94600 101.22000 123.47800 1.000 33.10173  ? 80  LEU D CD2   1 
ATOM 2518  N N     . ALA D 4 82  ? 115.29400 100.61900 127.01400 1.000 34.45608  ? 81  ALA D N     1 
ATOM 2519  C CA    . ALA D 4 82  ? 115.26600 100.11300 128.37700 1.000 34.45608  ? 81  ALA D CA    1 
ATOM 2520  C C     . ALA D 4 82  ? 113.98300 99.36300  128.69100 1.000 34.45608  ? 81  ALA D C     1 
ATOM 2521  O O     . ALA D 4 82  ? 113.97400 98.53400  129.60300 1.000 34.45608  ? 81  ALA D O     1 
ATOM 2522  C CB    . ALA D 4 82  ? 115.44000 101.25400 129.37400 1.000 34.45608  ? 81  ALA D CB    1 
ATOM 2523  N N     . HIS D 4 83  ? 112.90000 99.63900  127.96500 1.000 36.75082  ? 82  HIS D N     1 
ATOM 2524  C CA    . HIS D 4 83  ? 111.68900 98.84600  128.13800 1.000 36.75082  ? 82  HIS D CA    1 
ATOM 2525  C C     . HIS D 4 83  ? 111.82800 97.46000  127.52700 1.000 36.75082  ? 82  HIS D C     1 
ATOM 2526  O O     . HIS D 4 83  ? 111.18800 96.51600  128.00000 1.000 36.75082  ? 82  HIS D O     1 
ATOM 2527  C CB    . HIS D 4 83  ? 110.49500 99.57300  127.52300 1.000 36.75082  ? 82  HIS D CB    1 
ATOM 2528  C CG    . HIS D 4 83  ? 109.17200 98.97100  127.87800 1.000 36.75082  ? 82  HIS D CG    1 
ATOM 2529  N ND1   . HIS D 4 83  ? 108.65700 97.87000  127.22900 1.000 36.75082  ? 82  HIS D ND1   1 
ATOM 2530  C CD2   . HIS D 4 83  ? 108.25500 99.32100  128.80900 1.000 36.75082  ? 82  HIS D CD2   1 
ATOM 2531  C CE1   . HIS D 4 83  ? 107.48300 97.56400  127.74900 1.000 36.75082  ? 82  HIS D CE1   1 
ATOM 2532  N NE2   . HIS D 4 83  ? 107.21400 98.43100  128.70800 1.000 36.75082  ? 82  HIS D NE2   1 
ATOM 2533  N N     . TYR D 4 84  ? 112.63900 97.31900  126.47500 1.000 34.98191  ? 83  TYR D N     1 
ATOM 2534  C CA    . TYR D 4 84  ? 112.81200 96.01000  125.84800 1.000 34.98191  ? 83  TYR D CA    1 
ATOM 2535  C C     . TYR D 4 84  ? 113.59700 95.06200  126.74000 1.000 34.98191  ? 83  TYR D C     1 
ATOM 2536  O O     . TYR D 4 84  ? 113.25900 93.87900  126.84600 1.000 34.98191  ? 83  TYR D O     1 
ATOM 2537  C CB    . TYR D 4 84  ? 113.52900 96.14000  124.50700 1.000 34.98191  ? 83  TYR D CB    1 
ATOM 2538  C CG    . TYR D 4 84  ? 112.74400 96.82000  123.41900 1.000 34.98191  ? 83  TYR D CG    1 
ATOM 2539  C CD1   . TYR D 4 84  ? 111.36000 96.86000  123.45500 1.000 34.98191  ? 83  TYR D CD1   1 
ATOM 2540  C CD2   . TYR D 4 84  ? 113.39200 97.41300  122.34900 1.000 34.98191  ? 83  TYR D CD2   1 
ATOM 2541  C CE1   . TYR D 4 84  ? 110.64400 97.47900  122.46000 1.000 34.98191  ? 83  TYR D CE1   1 
ATOM 2542  C CE2   . TYR D 4 84  ? 112.68700 98.03500  121.35000 1.000 34.98191  ? 83  TYR D CE2   1 
ATOM 2543  C CZ    . TYR D 4 84  ? 111.31400 98.06500  121.40900 1.000 34.98191  ? 83  TYR D CZ    1 
ATOM 2544  O OH    . TYR D 4 84  ? 110.60500 98.68500  120.40800 1.000 34.98191  ? 83  TYR D OH    1 
ATOM 2545  N N     . ASN D 4 85  ? 114.65000 95.55900  127.38300 1.000 35.85927  ? 84  ASN D N     1 
ATOM 2546  C CA    . ASN D 4 85  ? 115.58500 94.71700  128.11000 1.000 35.85927  ? 84  ASN D CA    1 
ATOM 2547  C C     . ASN D 4 85  ? 115.21100 94.53000  129.57100 1.000 35.85927  ? 84  ASN D C     1 
ATOM 2548  O O     . ASN D 4 85  ? 116.06000 94.08200  130.35000 1.000 35.85927  ? 84  ASN D O     1 
ATOM 2549  C CB    . ASN D 4 85  ? 116.99200 95.29400  128.00100 1.000 35.85927  ? 84  ASN D CB    1 
ATOM 2550  C CG    . ASN D 4 85  ? 117.53600 95.21300  126.59900 1.000 35.85927  ? 84  ASN D CG    1 
ATOM 2551  O OD1   . ASN D 4 85  ? 118.42100 95.96900  126.22500 1.000 35.85927  ? 84  ASN D OD1   1 
ATOM 2552  N ND2   . ASN D 4 85  ? 117.00400 94.29100  125.81000 1.000 35.85927  ? 84  ASN D ND2   1 
ATOM 2553  N N     . LYS D 4 86  ? 113.96100 94.84100  129.93900 1.000 38.91616  ? 85  LYS D N     1 
ATOM 2554  C CA    . LYS D 4 86  ? 113.43000 94.72500  131.30400 1.000 38.91616  ? 85  LYS D CA    1 
ATOM 2555  C C     . LYS D 4 86  ? 114.27000 95.50000  132.31700 1.000 38.91616  ? 85  LYS D C     1 
ATOM 2556  O O     . LYS D 4 86  ? 114.50100 95.04300  133.43700 1.000 38.91616  ? 85  LYS D O     1 
ATOM 2557  C CB    . LYS D 4 86  ? 113.28200 93.26200  131.73400 1.000 38.91616  ? 85  LYS D CB    1 
ATOM 2558  C CG    . LYS D 4 86  ? 112.56100 92.37700  130.73600 1.000 38.91616  ? 85  LYS D CG    1 
ATOM 2559  C CD    . LYS D 4 86  ? 112.30600 91.00000  131.32900 1.000 38.91616  ? 85  LYS D CD    1 
ATOM 2560  C CE    . LYS D 4 86  ? 111.56000 90.10600  130.35500 1.000 38.91616  ? 85  LYS D CE    1 
ATOM 2561  N NZ    . LYS D 4 86  ? 111.25500 88.77500  130.94700 1.000 38.91616  ? 85  LYS D NZ    1 
ATOM 2562  N N     . ARG D 4 87  ? 114.73400 96.68000  131.92200 1.000 43.81598  ? 86  ARG D N     1 
ATOM 2563  C CA    . ARG D 4 87  ? 115.48200 97.55900  132.80400 1.000 43.81598  ? 86  ARG D CA    1 
ATOM 2564  C C     . ARG D 4 87  ? 114.64300 98.78100  133.14100 1.000 43.81598  ? 86  ARG D C     1 
ATOM 2565  O O     . ARG D 4 87  ? 113.69900 99.13100  132.43000 1.000 43.81598  ? 86  ARG D O     1 
ATOM 2566  C CB    . ARG D 4 87  ? 116.80400 98.00100  132.17300 1.000 43.81598  ? 86  ARG D CB    1 
ATOM 2567  C CG    . ARG D 4 87  ? 117.67500 96.87600  131.66700 1.000 43.81598  ? 86  ARG D CG    1 
ATOM 2568  C CD    . ARG D 4 87  ? 118.17300 96.01200  132.80200 1.000 43.81598  ? 86  ARG D CD    1 
ATOM 2569  N NE    . ARG D 4 87  ? 119.04000 94.93900  132.33200 1.000 43.81598  ? 86  ARG D NE    1 
ATOM 2570  C CZ    . ARG D 4 87  ? 119.55200 94.00100  133.12000 1.000 43.81598  ? 86  ARG D CZ    1 
ATOM 2571  N NH1   . ARG D 4 87  ? 119.27100 93.99700  134.41500 1.000 43.81598  ? 86  ARG D NH1   1 
ATOM 2572  N NH2   . ARG D 4 87  ? 120.33300 93.05800  132.61300 1.000 43.81598  ? 86  ARG D NH2   1 
ATOM 2573  N N     . SER D 4 88  ? 114.99400 99.43000  134.24800 1.000 46.97024  ? 87  SER D N     1 
ATOM 2574  C CA    . SER D 4 88  ? 114.32000 100.64800 134.65900 1.000 46.97024  ? 87  SER D CA    1 
ATOM 2575  C C     . SER D 4 88  ? 115.20100 101.88200 134.59300 1.000 46.97024  ? 87  SER D C     1 
ATOM 2576  O O     . SER D 4 88  ? 114.68700 102.99300 134.73400 1.000 46.97024  ? 87  SER D O     1 
ATOM 2577  C CB    . SER D 4 88  ? 113.78400 100.49800 136.08600 1.000 46.97024  ? 87  SER D CB    1 
ATOM 2578  O OG    . SER D 4 88  ? 113.01100 99.32000  136.20900 1.000 46.97024  ? 87  SER D OG    1 
ATOM 2579  N N     . THR D 4 89  ? 116.49900 101.72700 134.36800 1.000 44.70194  ? 88  THR D N     1 
ATOM 2580  C CA    . THR D 4 89  ? 117.43600 102.83800 134.40200 1.000 44.70194  ? 88  THR D CA    1 
ATOM 2581  C C     . THR D 4 89  ? 117.91400 103.16000 132.99500 1.000 44.70194  ? 88  THR D C     1 
ATOM 2582  O O     . THR D 4 89  ? 118.36500 102.26900 132.27000 1.000 44.70194  ? 88  THR D O     1 
ATOM 2583  C CB    . THR D 4 89  ? 118.62700 102.51500 135.30600 1.000 44.70194  ? 88  THR D CB    1 
ATOM 2584  O OG1   . THR D 4 89  ? 118.15600 102.16800 136.61200 1.000 44.70194  ? 88  THR D OG1   1 
ATOM 2585  C CG2   . THR D 4 89  ? 119.55000 103.70800 135.42300 1.000 44.70194  ? 88  THR D CG2   1 
ATOM 2586  N N     . ILE D 4 90  ? 117.80200 104.43100 132.61200 1.000 38.95960  ? 89  ILE D N     1 
ATOM 2587  C CA    . ILE D 4 90  ? 118.52500 104.95900 131.46300 1.000 38.95960  ? 89  ILE D CA    1 
ATOM 2588  C C     . ILE D 4 90  ? 119.94500 105.26700 131.90500 1.000 38.95960  ? 89  ILE D C     1 
ATOM 2589  O O     . ILE D 4 90  ? 120.20400 106.33300 132.46700 1.000 38.95960  ? 89  ILE D O     1 
ATOM 2590  C CB    . ILE D 4 90  ? 117.86400 106.23000 130.89800 1.000 38.95960  ? 89  ILE D CB    1 
ATOM 2591  C CG1   . ILE D 4 90  ? 116.41600 105.97400 130.53300 1.000 38.95960  ? 89  ILE D CG1   1 
ATOM 2592  C CG2   . ILE D 4 90  ? 118.59100 106.70900 129.66200 1.000 38.95960  ? 89  ILE D CG2   1 
ATOM 2593  C CD1   . ILE D 4 90  ? 116.24000 104.89900 129.52800 1.000 38.95960  ? 89  ILE D CD1   1 
ATOM 2594  N N     . THR D 4 91  ? 120.86300 104.33400 131.72100 1.000 37.20771  ? 90  THR D N     1 
ATOM 2595  C CA    . THR D 4 91  ? 122.24700 104.65100 132.02100 1.000 37.20771  ? 90  THR D CA    1 
ATOM 2596  C C     . THR D 4 91  ? 122.89900 105.10200 130.71600 1.000 37.20771  ? 90  THR D C     1 
ATOM 2597  O O     . THR D 4 91  ? 122.21300 105.36500 129.72700 1.000 37.20771  ? 90  THR D O     1 
ATOM 2598  C CB    . THR D 4 91  ? 122.94500 103.48000 132.71800 1.000 37.20771  ? 90  THR D CB    1 
ATOM 2599  O OG1   . THR D 4 91  ? 124.25400 103.88600 133.13900 1.000 37.20771  ? 90  THR D OG1   1 
ATOM 2600  C CG2   . THR D 4 91  ? 123.05500 102.26400 131.82700 1.000 37.20771  ? 90  THR D CG2   1 
ATOM 2601  N N     . SER D 4 92  ? 124.22600 105.21700 130.69300 1.000 36.10134  ? 91  SER D N     1 
ATOM 2602  C CA    . SER D 4 92  ? 124.89800 105.68700 129.48900 1.000 36.10134  ? 91  SER D CA    1 
ATOM 2603  C C     . SER D 4 92  ? 124.88000 104.66300 128.36500 1.000 36.10134  ? 91  SER D C     1 
ATOM 2604  O O     . SER D 4 92  ? 125.09400 105.04000 127.21100 1.000 36.10134  ? 91  SER D O     1 
ATOM 2605  C CB    . SER D 4 92  ? 126.33700 106.07400 129.80600 1.000 36.10134  ? 91  SER D CB    1 
ATOM 2606  O OG    . SER D 4 92  ? 126.37700 107.07400 130.80200 1.000 36.10134  ? 91  SER D OG    1 
ATOM 2607  N N     . ARG D 4 93  ? 124.64300 103.38500 128.66800 1.000 36.91303  ? 92  ARG D N     1 
ATOM 2608  C CA    . ARG D 4 93  ? 124.57900 102.38100 127.61200 1.000 36.91303  ? 92  ARG D CA    1 
ATOM 2609  C C     . ARG D 4 93  ? 123.35200 102.56700 126.72500 1.000 36.91303  ? 92  ARG D C     1 
ATOM 2610  O O     . ARG D 4 93  ? 123.44500 102.41500 125.50300 1.000 36.91303  ? 92  ARG D O     1 
ATOM 2611  C CB    . ARG D 4 93  ? 124.60800 100.98000 128.21200 1.000 36.91303  ? 92  ARG D CB    1 
ATOM 2612  C CG    . ARG D 4 93  ? 125.85700 100.70900 129.03600 1.000 36.91303  ? 92  ARG D CG    1 
ATOM 2613  C CD    . ARG D 4 93  ? 125.99900 99.26700  129.55200 1.000 36.91303  ? 92  ARG D CD    1 
ATOM 2614  N NE    . ARG D 4 93  ? 126.15100 98.26000  128.49800 1.000 36.91303  ? 92  ARG D NE    1 
ATOM 2615  C CZ    . ARG D 4 93  ? 125.16300 97.56300  127.94500 1.000 36.91303  ? 92  ARG D CZ    1 
ATOM 2616  N NH1   . ARG D 4 93  ? 123.91100 97.72800  128.34100 1.000 36.91303  ? 92  ARG D NH1   1 
ATOM 2617  N NH2   . ARG D 4 93  ? 125.43600 96.68200  126.99600 1.000 36.91303  ? 92  ARG D NH2   1 
ATOM 2618  N N     . GLU D 4 94  ? 122.19300 102.88200 127.31400 1.000 35.87322  ? 93  GLU D N     1 
ATOM 2619  C CA    . GLU D 4 94  ? 121.01600 103.14800 126.49100 1.000 35.87322  ? 93  GLU D CA    1 
ATOM 2620  C C     . GLU D 4 94  ? 121.14300 104.43800 125.69500 1.000 35.87322  ? 93  GLU D C     1 
ATOM 2621  O O     . GLU D 4 94  ? 120.67400 104.49400 124.55500 1.000 35.87322  ? 93  GLU D O     1 
ATOM 2622  C CB    . GLU D 4 94  ? 119.74200 103.18200 127.33300 1.000 35.87322  ? 93  GLU D CB    1 
ATOM 2623  C CG    . GLU D 4 94  ? 119.24200 101.82400 127.78500 1.000 35.87322  ? 93  GLU D CG    1 
ATOM 2624  C CD    . GLU D 4 94  ? 119.87000 101.34500 129.06100 1.000 35.87322  ? 93  GLU D CD    1 
ATOM 2625  O OE1   . GLU D 4 94  ? 120.73100 102.06200 129.59100 1.000 35.87322  ? 93  GLU D OE1   1 
ATOM 2626  O OE2   . GLU D 4 94  ? 119.50500 100.24900 129.53200 1.000 35.87322  ? 93  GLU D OE2   1 
ATOM 2627  N N     . ILE D 4 95  ? 121.79400 105.46500 126.24700 1.000 32.99470  ? 94  ILE D N     1 
ATOM 2628  C CA    . ILE D 4 95  ? 122.00000 106.69600 125.48700 1.000 32.99470  ? 94  ILE D CA    1 
ATOM 2629  C C     . ILE D 4 95  ? 122.97900 106.46800 124.33900 1.000 32.99470  ? 94  ILE D C     1 
ATOM 2630  O O     . ILE D 4 95  ? 122.74000 106.91400 123.20900 1.000 32.99470  ? 94  ILE D O     1 
ATOM 2631  C CB    . ILE D 4 95  ? 122.46200 107.82600 126.42000 1.000 32.99470  ? 94  ILE D CB    1 
ATOM 2632  C CG1   . ILE D 4 95  ? 121.38700 108.12000 127.46000 1.000 32.99470  ? 94  ILE D CG1   1 
ATOM 2633  C CG2   . ILE D 4 95  ? 122.73900 109.08100 125.63200 1.000 32.99470  ? 94  ILE D CG2   1 
ATOM 2634  C CD1   . ILE D 4 95  ? 120.13300 108.72100 126.88400 1.000 32.99470  ? 94  ILE D CD1   1 
ATOM 2635  N N     . GLN D 4 96  ? 124.06600 105.73400 124.59400 1.000 32.53792  ? 95  GLN D N     1 
ATOM 2636  C CA    . GLN D 4 96  ? 125.04200 105.44600 123.54500 1.000 32.53792  ? 95  GLN D CA    1 
ATOM 2637  C C     . GLN D 4 96  ? 124.45200 104.55800 122.45900 1.000 32.53792  ? 95  GLN D C     1 
ATOM 2638  O O     . GLN D 4 96  ? 124.67700 104.79200 121.26500 1.000 32.53792  ? 95  GLN D O     1 
ATOM 2639  C CB    . GLN D 4 96  ? 126.28100 104.79800 124.15800 1.000 32.53792  ? 95  GLN D CB    1 
ATOM 2640  C CG    . GLN D 4 96  ? 127.22200 104.14800 123.16500 1.000 32.53792  ? 95  GLN D CG    1 
ATOM 2641  C CD    . GLN D 4 96  ? 128.51400 103.70100 123.80200 1.000 32.53792  ? 95  GLN D CD    1 
ATOM 2642  O OE1   . GLN D 4 96  ? 129.29900 104.52200 124.26800 1.000 32.53792  ? 95  GLN D OE1   1 
ATOM 2643  N NE2   . GLN D 4 96  ? 128.74700 102.39800 123.82400 1.000 32.53792  ? 95  GLN D NE2   1 
ATOM 2644  N N     . THR D 4 97  ? 123.65600 103.56800 122.84600 1.000 32.16203  ? 96  THR D N     1 
ATOM 2645  C CA    . THR D 4 97  ? 123.02200 102.71000 121.85700 1.000 32.16203  ? 96  THR D CA    1 
ATOM 2646  C C     . THR D 4 97  ? 121.91400 103.43300 121.09800 1.000 32.16203  ? 96  THR D C     1 
ATOM 2647  O O     . THR D 4 97  ? 121.71600 103.17100 119.90800 1.000 32.16203  ? 96  THR D O     1 
ATOM 2648  C CB    . THR D 4 97  ? 122.51400 101.45500 122.54800 1.000 32.16203  ? 96  THR D CB    1 
ATOM 2649  O OG1   . THR D 4 97  ? 123.58900 100.88400 123.30000 1.000 32.16203  ? 96  THR D OG1   1 
ATOM 2650  C CG2   . THR D 4 97  ? 122.02700 100.44500 121.54800 1.000 32.16203  ? 96  THR D CG2   1 
ATOM 2651  N N     . ALA D 4 98  ? 121.22400 104.38400 121.73200 1.000 31.67792  ? 97  ALA D N     1 
ATOM 2652  C CA    . ALA D 4 98  ? 120.25000 105.18200 120.99900 1.000 31.67792  ? 97  ALA D CA    1 
ATOM 2653  C C     . ALA D 4 98  ? 120.93000 106.10700 120.00300 1.000 31.67792  ? 97  ALA D C     1 
ATOM 2654  O O     . ALA D 4 98  ? 120.40400 106.32700 118.90900 1.000 31.67792  ? 97  ALA D O     1 
ATOM 2655  C CB    . ALA D 4 98  ? 119.39100 105.98700 121.96700 1.000 31.67792  ? 97  ALA D CB    1 
ATOM 2656  N N     . VAL D 4 99  ? 122.10900 106.62100 120.35200 1.000 30.87943  ? 98  VAL D N     1 
ATOM 2657  C CA    . VAL D 4 99  ? 122.88300 107.43900 119.42500 1.000 30.87943  ? 98  VAL D CA    1 
ATOM 2658  C C     . VAL D 4 99  ? 123.37700 106.60200 118.25000 1.000 30.87943  ? 98  VAL D C     1 
ATOM 2659  O O     . VAL D 4 99  ? 123.28900 107.02300 117.08700 1.000 30.87943  ? 98  VAL D O     1 
ATOM 2660  C CB    . VAL D 4 99  ? 124.03700 108.10000 120.19800 1.000 30.87943  ? 98  VAL D CB    1 
ATOM 2661  C CG1   . VAL D 4 99  ? 125.12100 108.59400 119.27900 1.000 30.87943  ? 98  VAL D CG1   1 
ATOM 2662  C CG2   . VAL D 4 99  ? 123.49600 109.23100 121.01300 1.000 30.87943  ? 98  VAL D CG2   1 
ATOM 2663  N N     . ARG D 4 100 ? 123.80800 105.36800 118.52800 1.000 33.27430  ? 99  ARG D N     1 
ATOM 2664  C CA    . ARG D 4 100 ? 124.26800 104.46600 117.47700 1.000 33.27430  ? 99  ARG D CA    1 
ATOM 2665  C C     . ARG D 4 100 ? 123.12400 104.00900 116.58600 1.000 33.27430  ? 99  ARG D C     1 
ATOM 2666  O O     . ARG D 4 100 ? 123.33000 103.74600 115.39800 1.000 33.27430  ? 99  ARG D O     1 
ATOM 2667  C CB    . ARG D 4 100 ? 124.97300 103.26200 118.09500 1.000 33.27430  ? 99  ARG D CB    1 
ATOM 2668  C CG    . ARG D 4 100 ? 126.44600 103.48100 118.34500 1.000 33.27430  ? 99  ARG D CG    1 
ATOM 2669  C CD    . ARG D 4 100 ? 127.02600 102.38300 119.20500 1.000 33.27430  ? 99  ARG D CD    1 
ATOM 2670  N NE    . ARG D 4 100 ? 126.64200 101.05400 118.74400 1.000 33.27430  ? 99  ARG D NE    1 
ATOM 2671  C CZ    . ARG D 4 100 ? 126.72000 99.95800  119.49100 1.000 33.27430  ? 99  ARG D CZ    1 
ATOM 2672  N NH1   . ARG D 4 100 ? 127.16200 100.03500 120.73800 1.000 33.27430  ? 99  ARG D NH1   1 
ATOM 2673  N NH2   . ARG D 4 100 ? 126.35200 98.78500  118.99600 1.000 33.27430  ? 99  ARG D NH2   1 
ATOM 2674  N N     . LEU D 4 101 ? 121.92400 103.88700 117.14300 1.000 31.62314  ? 100 LEU D N     1 
ATOM 2675  C CA    . LEU D 4 101 ? 120.77400 103.48900 116.34600 1.000 31.62314  ? 100 LEU D CA    1 
ATOM 2676  C C     . LEU D 4 101 ? 120.29900 104.63800 115.46700 1.000 31.62314  ? 100 LEU D C     1 
ATOM 2677  O O     . LEU D 4 101 ? 120.11100 104.46900 114.25800 1.000 31.62314  ? 100 LEU D O     1 
ATOM 2678  C CB    . LEU D 4 101 ? 119.65000 103.00800 117.26000 1.000 31.62314  ? 100 LEU D CB    1 
ATOM 2679  C CG    . LEU D 4 101 ? 119.72300 101.54900 117.69500 1.000 31.62314  ? 100 LEU D CG    1 
ATOM 2680  C CD1   . LEU D 4 101 ? 118.64300 101.24600 118.70100 1.000 31.62314  ? 100 LEU D CD1   1 
ATOM 2681  C CD2   . LEU D 4 101 ? 119.58700 100.65500 116.49100 1.000 31.62314  ? 100 LEU D CD2   1 
ATOM 2682  N N     . LEU D 4 102 ? 120.08200 105.81300 116.06300 1.000 32.80698  ? 101 LEU D N     1 
ATOM 2683  C CA    . LEU D 4 102 ? 119.47500 106.91800 115.33000 1.000 32.80698  ? 101 LEU D CA    1 
ATOM 2684  C C     . LEU D 4 102 ? 120.42500 107.54700 114.32200 1.000 32.80698  ? 101 LEU D C     1 
ATOM 2685  O O     . LEU D 4 102 ? 120.02000 107.82900 113.18900 1.000 32.80698  ? 101 LEU D O     1 
ATOM 2686  C CB    . LEU D 4 102 ? 118.96600 107.97700 116.29600 1.000 32.80698  ? 101 LEU D CB    1 
ATOM 2687  C CG    . LEU D 4 102 ? 117.82500 107.51800 117.19100 1.000 32.80698  ? 101 LEU D CG    1 
ATOM 2688  C CD1   . LEU D 4 102 ? 117.53400 108.59600 118.14400 1.000 32.80698  ? 101 LEU D CD1   1 
ATOM 2689  C CD2   . LEU D 4 102 ? 116.60300 107.23300 116.38500 1.000 32.80698  ? 101 LEU D CD2   1 
ATOM 2690  N N     . LEU D 4 103 ? 121.67800 107.79700 114.70000 1.000 33.61632  ? 102 LEU D N     1 
ATOM 2691  C CA    . LEU D 4 103 ? 122.49000 108.63700 113.83500 1.000 33.61632  ? 102 LEU D CA    1 
ATOM 2692  C C     . LEU D 4 103 ? 123.08400 107.85100 112.66400 1.000 33.61632  ? 102 LEU D C     1 
ATOM 2693  O O     . LEU D 4 103 ? 123.20000 106.62500 112.71800 1.000 33.61632  ? 102 LEU D O     1 
ATOM 2694  C CB    . LEU D 4 103 ? 123.58800 109.30900 114.65600 1.000 33.61632  ? 102 LEU D CB    1 
ATOM 2695  C CG    . LEU D 4 103 ? 123.05100 110.27000 115.71600 1.000 33.61632  ? 102 LEU D CG    1 
ATOM 2696  C CD1   . LEU D 4 103 ? 124.17100 110.84800 116.54600 1.000 33.61632  ? 102 LEU D CD1   1 
ATOM 2697  C CD2   . LEU D 4 103 ? 122.24000 111.36800 115.09000 1.000 33.61632  ? 102 LEU D CD2   1 
ATOM 2698  N N     . PRO D 4 104 ? 123.45900 108.53700 111.58100 1.000 36.98462  ? 103 PRO D N     1 
ATOM 2699  C CA    . PRO D 4 104 ? 124.18600 107.87100 110.49200 1.000 36.98462  ? 103 PRO D CA    1 
ATOM 2700  C C     . PRO D 4 104 ? 125.64100 107.59100 110.84800 1.000 36.98462  ? 103 PRO D C     1 
ATOM 2701  O O     . PRO D 4 104 ? 126.13900 107.98400 111.90300 1.000 36.98462  ? 103 PRO D O     1 
ATOM 2702  C CB    . PRO D 4 104 ? 124.05300 108.84900 109.32600 1.000 36.98462  ? 103 PRO D CB    1 
ATOM 2703  C CG    . PRO D 4 104 ? 123.77200 110.14800 109.93800 1.000 36.98462  ? 103 PRO D CG    1 
ATOM 2704  C CD    . PRO D 4 104 ? 122.98800 109.87300 111.17300 1.000 36.98462  ? 103 PRO D CD    1 
ATOM 2705  N N     . GLY D 4 105 ? 126.30700 106.89600 109.91300 1.000 37.61767  ? 104 GLY D N     1 
ATOM 2706  C CA    . GLY D 4 105 ? 127.56700 106.20700 110.19700 1.000 37.61767  ? 104 GLY D CA    1 
ATOM 2707  C C     . GLY D 4 105 ? 128.70700 107.06500 110.72000 1.000 37.61767  ? 104 GLY D C     1 
ATOM 2708  O O     . GLY D 4 105 ? 129.36300 106.70100 111.69700 1.000 37.61767  ? 104 GLY D O     1 
ATOM 2709  N N     . GLU D 4 106 ? 128.97300 108.20600 110.08200 1.000 38.93849  ? 105 GLU D N     1 
ATOM 2710  C CA    . GLU D 4 106 ? 130.08300 109.02400 110.57200 1.000 38.93849  ? 105 GLU D CA    1 
ATOM 2711  C C     . GLU D 4 106 ? 129.69000 109.83500 111.79900 1.000 38.93849  ? 105 GLU D C     1 
ATOM 2712  O O     . GLU D 4 106 ? 130.52000 110.04000 112.69200 1.000 38.93849  ? 105 GLU D O     1 
ATOM 2713  C CB    . GLU D 4 106 ? 130.62900 109.93900 109.47700 1.000 38.93849  ? 105 GLU D CB    1 
ATOM 2714  C CG    . GLU D 4 106 ? 131.34800 109.22300 108.34100 1.000 38.93849  ? 105 GLU D CG    1 
ATOM 2715  C CD    . GLU D 4 106 ? 131.38600 110.04100 107.05800 1.000 38.93849  ? 105 GLU D CD    1 
ATOM 2716  O OE1   . GLU D 4 106 ? 132.05800 111.09400 107.04100 1.000 38.93849  ? 105 GLU D OE1   1 
ATOM 2717  O OE2   . GLU D 4 106 ? 130.76100 109.62600 106.06000 1.000 38.93849  ? 105 GLU D OE2   1 
ATOM 2718  N N     . LEU D 4 107 ? 128.46000 110.35600 111.83300 1.000 37.30209  ? 106 LEU D N     1 
ATOM 2719  C CA    . LEU D 4 107 ? 128.01800 111.14400 112.98100 1.000 37.30209  ? 106 LEU D CA    1 
ATOM 2720  C C     . LEU D 4 107 ? 127.91800 110.30200 114.24500 1.000 37.30209  ? 106 LEU D C     1 
ATOM 2721  O O     . LEU D 4 107 ? 128.15000 110.81500 115.34400 1.000 37.30209  ? 106 LEU D O     1 
ATOM 2722  C CB    . LEU D 4 107 ? 126.67200 111.80500 112.70100 1.000 37.30209  ? 106 LEU D CB    1 
ATOM 2723  C CG    . LEU D 4 107 ? 126.60400 112.87900 111.62500 1.000 37.30209  ? 106 LEU D CG    1 
ATOM 2724  C CD1   . LEU D 4 107 ? 125.16800 113.30300 111.42600 1.000 37.30209  ? 106 LEU D CD1   1 
ATOM 2725  C CD2   . LEU D 4 107 ? 127.45700 114.06300 112.02200 1.000 37.30209  ? 106 LEU D CD2   1 
ATOM 2726  N N     . ALA D 4 108 ? 127.56100 109.02200 114.11400 1.000 35.60638  ? 107 ALA D N     1 
ATOM 2727  C CA    . ALA D 4 108 ? 127.51900 108.13600 115.27300 1.000 35.60638  ? 107 ALA D CA    1 
ATOM 2728  C C     . ALA D 4 108 ? 128.90900 107.88200 115.84100 1.000 35.60638  ? 107 ALA D C     1 
ATOM 2729  O O     . ALA D 4 108 ? 129.09700 107.92400 117.06000 1.000 35.60638  ? 107 ALA D O     1 
ATOM 2730  C CB    . ALA D 4 108 ? 126.84900 106.81500 114.90600 1.000 35.60638  ? 107 ALA D CB    1 
ATOM 2731  N N     . LYS D 4 109 ? 129.89900 107.65700 114.97300 1.000 36.29470  ? 108 LYS D N     1 
ATOM 2732  C CA    . LYS D 4 109 ? 131.25400 107.35200 115.42500 1.000 36.29470  ? 108 LYS D CA    1 
ATOM 2733  C C     . LYS D 4 109 ? 131.93400 108.54000 116.08700 1.000 36.29470  ? 108 LYS D C     1 
ATOM 2734  O O     . LYS D 4 109 ? 132.84200 108.35200 116.90200 1.000 36.29470  ? 108 LYS D O     1 
ATOM 2735  C CB    . LYS D 4 109 ? 132.09700 106.87300 114.24700 1.000 36.29470  ? 108 LYS D CB    1 
ATOM 2736  C CG    . LYS D 4 109 ? 131.77800 105.47000 113.76400 1.000 36.29470  ? 108 LYS D CG    1 
ATOM 2737  C CD    . LYS D 4 109 ? 132.70400 105.06300 112.62300 1.000 36.29470  ? 108 LYS D CD    1 
ATOM 2738  C CE    . LYS D 4 109 ? 134.16900 105.02900 113.05300 1.000 36.29470  ? 108 LYS D CE    1 
ATOM 2739  N NZ    . LYS D 4 109 ? 134.38400 104.39100 114.38300 1.000 36.29470  ? 108 LYS D NZ    1 
ATOM 2740  N N     . HIS D 4 110 ? 131.53700 109.75900 115.74400 1.000 38.13144  ? 109 HIS D N     1 
ATOM 2741  C CA    . HIS D 4 110 ? 132.05900 110.93200 116.42800 1.000 38.13144  ? 109 HIS D CA    1 
ATOM 2742  C C     . HIS D 4 110 ? 131.23600 111.31000 117.64700 1.000 38.13144  ? 109 HIS D C     1 
ATOM 2743  O O     . HIS D 4 110 ? 131.79400 111.78500 118.64300 1.000 38.13144  ? 109 HIS D O     1 
ATOM 2744  C CB    . HIS D 4 110 ? 132.11700 112.10700 115.45900 1.000 38.13144  ? 109 HIS D CB    1 
ATOM 2745  C CG    . HIS D 4 110 ? 133.16500 111.95800 114.40400 1.000 38.13144  ? 109 HIS D CG    1 
ATOM 2746  N ND1   . HIS D 4 110 ? 133.03700 112.50400 113.14600 1.000 38.13144  ? 109 HIS D ND1   1 
ATOM 2747  C CD2   . HIS D 4 110 ? 134.35300 111.31000 114.41500 1.000 38.13144  ? 109 HIS D CD2   1 
ATOM 2748  C CE1   . HIS D 4 110 ? 134.10200 112.20000 112.42700 1.000 38.13144  ? 109 HIS D CE1   1 
ATOM 2749  N NE2   . HIS D 4 110 ? 134.91700 111.47700 113.17400 1.000 38.13144  ? 109 HIS D NE2   1 
ATOM 2750  N N     . ALA D 4 111 ? 129.92300 111.08800 117.59900 1.000 36.11150  ? 110 ALA D N     1 
ATOM 2751  C CA    . ALA D 4 111 ? 129.07400 111.44900 118.72300 1.000 36.11150  ? 110 ALA D CA    1 
ATOM 2752  C C     . ALA D 4 111 ? 129.26700 110.51300 119.90300 1.000 36.11150  ? 110 ALA D C     1 
ATOM 2753  O O     . ALA D 4 111 ? 129.21600 110.96600 121.05100 1.000 36.11150  ? 110 ALA D O     1 
ATOM 2754  C CB    . ALA D 4 111 ? 127.61100 111.46000 118.29100 1.000 36.11150  ? 110 ALA D CB    1 
ATOM 2755  N N     . VAL D 4 112 ? 129.52500 109.22300 119.65900 1.000 36.05485  ? 111 VAL D N     1 
ATOM 2756  C CA    . VAL D 4 112 ? 129.81100 108.34800 120.79100 1.000 36.05485  ? 111 VAL D CA    1 
ATOM 2757  C C     . VAL D 4 112 ? 131.19700 108.63100 121.35400 1.000 36.05485  ? 111 VAL D C     1 
ATOM 2758  O O     . VAL D 4 112 ? 131.42800 108.43900 122.55300 1.000 36.05485  ? 111 VAL D O     1 
ATOM 2759  C CB    . VAL D 4 112 ? 129.63300 106.85400 120.44100 1.000 36.05485  ? 111 VAL D CB    1 
ATOM 2760  C CG1   . VAL D 4 112 ? 128.23200 106.58100 119.92600 1.000 36.05485  ? 111 VAL D CG1   1 
ATOM 2761  C CG2   . VAL D 4 112 ? 130.69100 106.36000 119.47200 1.000 36.05485  ? 111 VAL D CG2   1 
ATOM 2762  N N     . SER D 4 113 ? 132.11600 109.15500 120.53600 1.000 36.44809  ? 112 SER D N     1 
ATOM 2763  C CA    . SER D 4 113 ? 133.41600 109.56100 121.05800 1.000 36.44809  ? 112 SER D CA    1 
ATOM 2764  C C     . SER D 4 113 ? 133.29300 110.80100 121.93200 1.000 36.44809  ? 112 SER D C     1 
ATOM 2765  O O     . SER D 4 113 ? 133.91500 110.87700 122.99900 1.000 36.44809  ? 112 SER D O     1 
ATOM 2766  C CB    . SER D 4 113 ? 134.38900 109.81000 119.91200 1.000 36.44809  ? 112 SER D CB    1 
ATOM 2767  O OG    . SER D 4 113 ? 135.69300 110.05300 120.40500 1.000 36.44809  ? 112 SER D OG    1 
ATOM 2768  N N     . GLU D 4 114 ? 132.46200 111.76100 121.51000 1.000 38.16609  ? 113 GLU D N     1 
ATOM 2769  C CA    . GLU D 4 114 ? 132.19600 112.94700 122.32200 1.000 38.16609  ? 113 GLU D CA    1 
ATOM 2770  C C     . GLU D 4 114 ? 131.50100 112.58000 123.62700 1.000 38.16609  ? 113 GLU D C     1 
ATOM 2771  O O     . GLU D 4 114 ? 131.86400 113.08500 124.69700 1.000 38.16609  ? 113 GLU D O     1 
ATOM 2772  C CB    . GLU D 4 114 ? 131.35200 113.94500 121.53400 1.000 38.16609  ? 113 GLU D CB    1 
ATOM 2773  C CG    . GLU D 4 114 ? 132.08100 114.59300 120.37200 1.000 38.16609  ? 113 GLU D CG    1 
ATOM 2774  C CD    . GLU D 4 114 ? 133.26800 115.42200 120.81400 1.000 38.16609  ? 113 GLU D CD    1 
ATOM 2775  O OE1   . GLU D 4 114 ? 133.11600 116.24100 121.74300 1.000 38.16609  ? 113 GLU D OE1   1 
ATOM 2776  O OE2   . GLU D 4 114 ? 134.36000 115.24800 120.23700 1.000 38.16609  ? 113 GLU D OE2   1 
ATOM 2777  N N     . GLY D 4 115 ? 130.51800 111.68000 123.55700 1.000 36.56375  ? 114 GLY D N     1 
ATOM 2778  C CA    . GLY D 4 115 ? 129.80300 111.27600 124.75500 1.000 36.56375  ? 114 GLY D CA    1 
ATOM 2779  C C     . GLY D 4 115 ? 130.66200 110.49300 125.73000 1.000 36.56375  ? 114 GLY D C     1 
ATOM 2780  O O     . GLY D 4 115 ? 130.59300 110.71800 126.94100 1.000 36.56375  ? 114 GLY D O     1 
ATOM 2781  N N     . THR D 4 116 ? 131.49300 109.57600 125.22300 1.000 35.22968  ? 115 THR D N     1 
ATOM 2782  C CA    . THR D 4 116 ? 132.35900 108.80800 126.10800 1.000 35.22968  ? 115 THR D CA    1 
ATOM 2783  C C     . THR D 4 116 ? 133.46400 109.67200 126.69600 1.000 35.22968  ? 115 THR D C     1 
ATOM 2784  O O     . THR D 4 116 ? 133.83600 109.48200 127.86100 1.000 35.22968  ? 115 THR D O     1 
ATOM 2785  C CB    . THR D 4 116 ? 132.95800 107.62300 125.35900 1.000 35.22968  ? 115 THR D CB    1 
ATOM 2786  O OG1   . THR D 4 116 ? 131.95500 107.04100 124.52200 1.000 35.22968  ? 115 THR D OG1   1 
ATOM 2787  C CG2   . THR D 4 116 ? 133.43800 106.57200 126.33700 1.000 35.22968  ? 115 THR D CG2   1 
ATOM 2788  N N     . LYS D 4 117 ? 133.96400 110.64800 125.93000 1.000 37.31185  ? 116 LYS D N     1 
ATOM 2789  C CA    . LYS D 4 117 ? 134.94200 111.58900 126.46400 1.000 37.31185  ? 116 LYS D CA    1 
ATOM 2790  C C     . LYS D 4 117 ? 134.33900 112.45500 127.56100 1.000 37.31185  ? 116 LYS D C     1 
ATOM 2791  O O     . LYS D 4 117 ? 134.97900 112.68900 128.59200 1.000 37.31185  ? 116 LYS D O     1 
ATOM 2792  C CB    . LYS D 4 117 ? 135.49000 112.45100 125.32800 1.000 37.31185  ? 116 LYS D CB    1 
ATOM 2793  C CG    . LYS D 4 117 ? 136.38500 113.59300 125.75700 1.000 37.31185  ? 116 LYS D CG    1 
ATOM 2794  C CD    . LYS D 4 117 ? 137.05600 114.24000 124.55400 1.000 37.31185  ? 116 LYS D CD    1 
ATOM 2795  C CE    . LYS D 4 117 ? 136.04500 114.68300 123.51100 1.000 37.31185  ? 116 LYS D CE    1 
ATOM 2796  N NZ    . LYS D 4 117 ? 135.10900 115.69900 124.05000 1.000 37.31185  ? 116 LYS D NZ    1 
ATOM 2797  N N     . ALA D 4 118 ? 133.08200 112.87700 127.39300 1.000 36.75391  ? 117 ALA D N     1 
ATOM 2798  C CA    . ALA D 4 118 ? 132.45300 113.70200 128.42000 1.000 36.75391  ? 117 ALA D CA    1 
ATOM 2799  C C     . ALA D 4 118 ? 132.10600 112.89200 129.66100 1.000 36.75391  ? 117 ALA D C     1 
ATOM 2800  O O     . ALA D 4 118 ? 132.21400 113.40100 130.77900 1.000 36.75391  ? 117 ALA D O     1 
ATOM 2801  C CB    . ALA D 4 118 ? 131.20800 114.37900 127.87100 1.000 36.75391  ? 117 ALA D CB    1 
ATOM 2802  N N     . VAL D 4 119 ? 131.69200 111.63500 129.49200 1.000 36.37858  ? 118 VAL D N     1 
ATOM 2803  C CA    . VAL D 4 119 ? 131.37500 110.80200 130.64900 1.000 36.37858  ? 118 VAL D CA    1 
ATOM 2804  C C     . VAL D 4 119 ? 132.64400 110.44900 131.42100 1.000 36.37858  ? 118 VAL D C     1 
ATOM 2805  O O     . VAL D 4 119 ? 132.65600 110.47000 132.65900 1.000 36.37858  ? 118 VAL D O     1 
ATOM 2806  C CB    . VAL D 4 119 ? 130.58500 109.55700 130.20000 1.000 36.37858  ? 118 VAL D CB    1 
ATOM 2807  C CG1   . VAL D 4 119 ? 130.54500 108.49500 131.27100 1.000 36.37858  ? 118 VAL D CG1   1 
ATOM 2808  C CG2   . VAL D 4 119 ? 129.17500 109.95000 129.85100 1.000 36.37858  ? 118 VAL D CG2   1 
ATOM 2809  N N     . THR D 4 120 ? 133.75100 110.20200 130.71000 1.000 38.18418  ? 119 THR D N     1 
ATOM 2810  C CA    . THR D 4 120 ? 135.01800 109.93300 131.38400 1.000 38.18418  ? 119 THR D CA    1 
ATOM 2811  C C     . THR D 4 120 ? 135.54300 111.17500 132.09600 1.000 38.18418  ? 119 THR D C     1 
ATOM 2812  O O     . THR D 4 120 ? 136.01900 111.08700 133.23700 1.000 38.18418  ? 119 THR D O     1 
ATOM 2813  C CB    . THR D 4 120 ? 136.04100 109.42200 130.37400 1.000 38.18418  ? 119 THR D CB    1 
ATOM 2814  O OG1   . THR D 4 120 ? 135.50100 108.28700 129.69100 1.000 38.18418  ? 119 THR D OG1   1 
ATOM 2815  C CG2   . THR D 4 120 ? 137.32500 109.01000 131.06700 1.000 38.18418  ? 119 THR D CG2   1 
ATOM 2816  N N     . LYS D 4 121 ? 135.40100 112.34800 131.46900 1.000 40.61217  ? 120 LYS D N     1 
ATOM 2817  C CA    . LYS D 4 121 ? 135.81800 113.58700 132.11300 1.000 40.61217  ? 120 LYS D CA    1 
ATOM 2818  C C     . LYS D 4 121 ? 134.92500 113.93600 133.29600 1.000 40.61217  ? 120 LYS D C     1 
ATOM 2819  O O     . LYS D 4 121 ? 135.39800 114.52900 134.27200 1.000 40.61217  ? 120 LYS D O     1 
ATOM 2820  C CB    . LYS D 4 121 ? 135.81900 114.72300 131.09300 1.000 40.61217  ? 120 LYS D CB    1 
ATOM 2821  C CG    . LYS D 4 121 ? 136.52800 115.98200 131.55600 1.000 40.61217  ? 120 LYS D CG    1 
ATOM 2822  C CD    . LYS D 4 121 ? 136.65200 116.98900 130.43000 1.000 40.61217  ? 120 LYS D CD    1 
ATOM 2823  C CE    . LYS D 4 121 ? 137.55900 118.13800 130.82400 1.000 40.61217  ? 120 LYS D CE    1 
ATOM 2824  N NZ    . LYS D 4 121 ? 137.74200 119.11000 129.71300 1.000 40.61217  ? 120 LYS D NZ    1 
ATOM 2825  N N     . TYR D 4 122 ? 133.65100 113.54900 133.25000 1.000 41.04121  ? 121 TYR D N     1 
ATOM 2826  C CA    . TYR D 4 122 ? 132.74800 113.87200 134.34500 1.000 41.04121  ? 121 TYR D CA    1 
ATOM 2827  C C     . TYR D 4 122 ? 132.97000 112.95000 135.53300 1.000 41.04121  ? 121 TYR D C     1 
ATOM 2828  O O     . TYR D 4 122 ? 132.93300 113.40100 136.68300 1.000 41.04121  ? 121 TYR D O     1 
ATOM 2829  C CB    . TYR D 4 122 ? 131.30000 113.79300 133.86000 1.000 41.04121  ? 121 TYR D CB    1 
ATOM 2830  C CG    . TYR D 4 122 ? 130.26700 113.82200 134.95700 1.000 41.04121  ? 121 TYR D CG    1 
ATOM 2831  C CD1   . TYR D 4 122 ? 129.95800 115.00500 135.60700 1.000 41.04121  ? 121 TYR D CD1   1 
ATOM 2832  C CD2   . TYR D 4 122 ? 129.58400 112.67100 135.32900 1.000 41.04121  ? 121 TYR D CD2   1 
ATOM 2833  C CE1   . TYR D 4 122 ? 129.01300 115.04100 136.60700 1.000 41.04121  ? 121 TYR D CE1   1 
ATOM 2834  C CE2   . TYR D 4 122 ? 128.63700 112.69900 136.32700 1.000 41.04121  ? 121 TYR D CE2   1 
ATOM 2835  C CZ    . TYR D 4 122 ? 128.35400 113.88900 136.96000 1.000 41.04121  ? 121 TYR D CZ    1 
ATOM 2836  O OH    . TYR D 4 122 ? 127.41100 113.92400 137.95700 1.000 41.04121  ? 121 TYR D OH    1 
ATOM 2837  N N     . THR D 4 123 ? 133.22200 111.66300 135.28100 1.000 40.19833  ? 122 THR D N     1 
ATOM 2838  C CA    . THR D 4 123 ? 133.44500 110.73500 136.38100 1.000 40.19833  ? 122 THR D CA    1 
ATOM 2839  C C     . THR D 4 123 ? 134.87700 110.75900 136.88600 1.000 40.19833  ? 122 THR D C     1 
ATOM 2840  O O     . THR D 4 123 ? 135.14600 110.19000 137.94900 1.000 40.19833  ? 122 THR D O     1 
ATOM 2841  C CB    . THR D 4 123 ? 133.07900 109.30400 135.97800 1.000 40.19833  ? 122 THR D CB    1 
ATOM 2842  O OG1   . THR D 4 123 ? 133.95200 108.85400 134.93700 1.000 40.19833  ? 122 THR D OG1   1 
ATOM 2843  C CG2   . THR D 4 123 ? 131.63300 109.21800 135.52700 1.000 40.19833  ? 122 THR D CG2   1 
ATOM 2844  N N     . SER D 4 124 ? 135.79900 111.40200 136.16700 1.000 42.83658  ? 123 SER D N     1 
ATOM 2845  C CA    . SER D 4 124 ? 137.14700 111.55500 136.69400 1.000 42.83658  ? 123 SER D CA    1 
ATOM 2846  C C     . SER D 4 124 ? 137.26000 112.68400 137.70800 1.000 42.83658  ? 123 SER D C     1 
ATOM 2847  O O     . SER D 4 124 ? 138.28600 112.78200 138.38700 1.000 42.83658  ? 123 SER D O     1 
ATOM 2848  C CB    . SER D 4 124 ? 138.13100 111.80400 135.55200 1.000 42.83658  ? 123 SER D CB    1 
ATOM 2849  O OG    . SER D 4 124 ? 137.99900 113.12400 135.05500 1.000 42.83658  ? 123 SER D OG    1 
ATOM 2850  N N     . SER D 4 125 ? 136.24100 113.53100 137.82500 1.000 44.94748  ? 124 SER D N     1 
ATOM 2851  C CA    . SER D 4 125 ? 136.22600 114.61700 138.80000 1.000 44.94748  ? 124 SER D CA    1 
ATOM 2852  C C     . SER D 4 125 ? 136.02000 114.08800 140.21200 1.000 44.94748  ? 124 SER D C     1 
ATOM 2853  O O     . SER D 4 125 ? 134.88400 113.92800 140.66100 1.000 44.94748  ? 124 SER D O     1 
ATOM 2854  C CB    . SER D 4 125 ? 135.13400 115.62800 138.45900 1.000 44.94748  ? 124 SER D CB    1 
ATOM 2855  O OG    . SER D 4 125 ? 133.88100 115.19900 138.95400 1.000 44.94748  ? 124 SER D OG    1 
ATOM 2856  N N     . GLN E 1 45  ? 114.81300 133.00900 77.55400  1.000 61.36099  ? 45  GLN E N     1 
ATOM 2857  C CA    . GLN E 1 45  ? 114.51800 131.82100 78.34300  1.000 61.36099  ? 45  GLN E CA    1 
ATOM 2858  C C     . GLN E 1 45  ? 114.09700 132.22400 79.74700  1.000 61.36099  ? 45  GLN E C     1 
ATOM 2859  O O     . GLN E 1 45  ? 114.81600 131.97000 80.71100  1.000 61.36099  ? 45  GLN E O     1 
ATOM 2860  C CB    . GLN E 1 45  ? 115.73200 130.88900 78.40500  1.000 61.36099  ? 45  GLN E CB    1 
ATOM 2861  C CG    . GLN E 1 45  ? 116.12200 130.21600 77.08200  1.000 61.36099  ? 45  GLN E CG    1 
ATOM 2862  C CD    . GLN E 1 45  ? 115.02600 129.37500 76.43700  1.000 61.36099  ? 45  GLN E CD    1 
ATOM 2863  O OE1   . GLN E 1 45  ? 114.12600 128.86000 77.10300  1.000 61.36099  ? 45  GLN E OE1   1 
ATOM 2864  N NE2   . GLN E 1 45  ? 115.10600 129.23400 75.12100  1.000 61.36099  ? 45  GLN E NE2   1 
ATOM 2865  N N     . GLY E 1 46  ? 112.92800 132.86300 79.84800  1.000 56.09122  ? 46  GLY E N     1 
ATOM 2866  C CA    . GLY E 1 46  ? 112.43800 133.38100 81.11500  1.000 56.09122  ? 46  GLY E CA    1 
ATOM 2867  C C     . GLY E 1 46  ? 112.14500 132.33700 82.17500  1.000 56.09122  ? 46  GLY E C     1 
ATOM 2868  O O     . GLY E 1 46  ? 112.10700 132.67700 83.36400  1.000 56.09122  ? 46  GLY E O     1 
ATOM 2869  N N     . TRP E 1 47  ? 111.95300 131.07200 81.78100  1.000 52.01230  ? 47  TRP E N     1 
ATOM 2870  C CA    . TRP E 1 47  ? 111.70300 130.03200 82.77400  1.000 52.01230  ? 47  TRP E CA    1 
ATOM 2871  C C     . TRP E 1 47  ? 112.94700 129.73900 83.59700  1.000 52.01230  ? 47  TRP E C     1 
ATOM 2872  O O     . TRP E 1 47  ? 112.83800 129.43100 84.78500  1.000 52.01230  ? 47  TRP E O     1 
ATOM 2873  C CB    . TRP E 1 47  ? 111.21400 128.74800 82.10000  1.000 52.01230  ? 47  TRP E CB    1 
ATOM 2874  C CG    . TRP E 1 47  ? 112.22900 128.12000 81.19500  1.000 52.01230  ? 47  TRP E CG    1 
ATOM 2875  C CD1   . TRP E 1 47  ? 112.40800 128.37200 79.87100  1.000 52.01230  ? 47  TRP E CD1   1 
ATOM 2876  C CD2   . TRP E 1 47  ? 113.21500 127.14300 81.55500  1.000 52.01230  ? 47  TRP E CD2   1 
ATOM 2877  N NE1   . TRP E 1 47  ? 113.44200 127.61400 79.38100  1.000 52.01230  ? 47  TRP E NE1   1 
ATOM 2878  C CE2   . TRP E 1 47  ? 113.95400 126.85200 80.39700  1.000 52.01230  ? 47  TRP E CE2   1 
ATOM 2879  C CE3   . TRP E 1 47  ? 113.54500 126.49000 82.74500  1.000 52.01230  ? 47  TRP E CE3   1 
ATOM 2880  C CZ2   . TRP E 1 47  ? 115.00000 125.93700 80.39200  1.000 52.01230  ? 47  TRP E CZ2   1 
ATOM 2881  C CZ3   . TRP E 1 47  ? 114.58200 125.58100 82.73800  1.000 52.01230  ? 47  TRP E CZ3   1 
ATOM 2882  C CH2   . TRP E 1 47  ? 115.29800 125.31200 81.57000  1.000 52.01230  ? 47  TRP E CH2   1 
ATOM 2883  N N     . LEU E 1 48  ? 114.13300 129.89800 83.01000  1.000 51.94038  ? 48  LEU E N     1 
ATOM 2884  C CA    . LEU E 1 48  ? 115.36300 129.61700 83.74000  1.000 51.94038  ? 48  LEU E CA    1 
ATOM 2885  C C     . LEU E 1 48  ? 115.65800 130.72300 84.74100  1.000 51.94038  ? 48  LEU E C     1 
ATOM 2886  O O     . LEU E 1 48  ? 116.05200 130.45100 85.88400  1.000 51.94038  ? 48  LEU E O     1 
ATOM 2887  C CB    . LEU E 1 48  ? 116.52300 129.44400 82.76500  1.000 51.94038  ? 48  LEU E CB    1 
ATOM 2888  C CG    . LEU E 1 48  ? 117.86500 129.08200 83.38900  1.000 51.94038  ? 48  LEU E CG    1 
ATOM 2889  C CD1   . LEU E 1 48  ? 117.76100 127.77500 84.14500  1.000 51.94038  ? 48  LEU E CD1   1 
ATOM 2890  C CD2   . LEU E 1 48  ? 118.93200 129.00000 82.32200  1.000 51.94038  ? 48  LEU E CD2   1 
ATOM 2891  N N     . LYS E 1 49  ? 115.46700 131.97500 84.32200  1.000 55.47816  ? 49  LYS E N     1 
ATOM 2892  C CA    . LYS E 1 49  ? 115.63300 133.10700 85.22400  1.000 55.47816  ? 49  LYS E CA    1 
ATOM 2893  C C     . LYS E 1 49  ? 114.59700 133.06800 86.33800  1.000 55.47816  ? 49  LYS E C     1 
ATOM 2894  O O     . LYS E 1 49  ? 114.90900 133.37300 87.49500  1.000 55.47816  ? 49  LYS E O     1 
ATOM 2895  C CB    . LYS E 1 49  ? 115.51600 134.40600 84.43200  1.000 55.47816  ? 49  LYS E CB    1 
ATOM 2896  C CG    . LYS E 1 49  ? 116.61600 134.59600 83.41200  1.000 55.47816  ? 49  LYS E CG    1 
ATOM 2897  C CD    . LYS E 1 49  ? 116.53500 135.96000 82.75500  1.000 55.47816  ? 49  LYS E CD    1 
ATOM 2898  C CE    . LYS E 1 49  ? 116.79000 135.85000 81.25900  1.000 55.47816  ? 49  LYS E CE    1 
ATOM 2899  N NZ    . LYS E 1 49  ? 116.82600 137.18100 80.60200  1.000 55.47816  ? 49  LYS E NZ    1 
ATOM 2900  N N     . GLU E 1 50  ? 113.37600 132.62200 86.02100  1.000 48.39713  ? 50  GLU E N     1 
ATOM 2901  C CA    . GLU E 1 50  ? 112.34500 132.50100 87.04400  1.000 48.39713  ? 50  GLU E CA    1 
ATOM 2902  C C     . GLU E 1 50  ? 112.65800 131.37500 88.02200  1.000 48.39713  ? 50  GLU E C     1 
ATOM 2903  O O     . GLU E 1 50  ? 112.46000 131.53600 89.23200  1.000 48.39713  ? 50  GLU E O     1 
ATOM 2904  C CB    . GLU E 1 50  ? 110.98200 132.28600 86.39200  1.000 48.39713  ? 50  GLU E CB    1 
ATOM 2905  C CG    . GLU E 1 50  ? 109.81600 132.36200 87.36100  1.000 48.39713  ? 50  GLU E CG    1 
ATOM 2906  C CD    . GLU E 1 50  ? 108.48200 132.51800 86.65900  1.000 48.39713  ? 50  GLU E CD    1 
ATOM 2907  O OE1   . GLU E 1 50  ? 108.38200 133.36200 85.74400  1.000 48.39713  ? 50  GLU E OE1   1 
ATOM 2908  O OE2   . GLU E 1 50  ? 107.52900 131.79900 87.02600  1.000 48.39713  ? 50  GLU E OE2   1 
ATOM 2909  N N     . ILE E 1 51  ? 113.18100 130.24700 87.52600  1.000 42.90964  ? 51  ILE E N     1 
ATOM 2910  C CA    . ILE E 1 51  ? 113.54100 129.12700 88.39400  1.000 42.90964  ? 51  ILE E CA    1 
ATOM 2911  C C     . ILE E 1 51  ? 114.68500 129.50800 89.32700  1.000 42.90964  ? 51  ILE E C     1 
ATOM 2912  O O     . ILE E 1 51  ? 114.62900 129.23800 90.53200  1.000 42.90964  ? 51  ILE E O     1 
ATOM 2913  C CB    . ILE E 1 51  ? 113.88000 127.88600 87.54500  1.000 42.90964  ? 51  ILE E CB    1 
ATOM 2914  C CG1   . ILE E 1 51  ? 112.60300 127.16100 87.13500  1.000 42.90964  ? 51  ILE E CG1   1 
ATOM 2915  C CG2   . ILE E 1 51  ? 114.78400 126.91900 88.29100  1.000 42.90964  ? 51  ILE E CG2   1 
ATOM 2916  C CD1   . ILE E 1 51  ? 112.84100 125.93900 86.29900  1.000 42.90964  ? 51  ILE E CD1   1 
ATOM 2917  N N     . ARG E 1 52  ? 115.70500 130.19800 88.80700  1.000 44.49444  ? 52  ARG E N     1 
ATOM 2918  C CA    . ARG E 1 52  ? 116.83200 130.56000 89.66200  1.000 44.49444  ? 52  ARG E CA    1 
ATOM 2919  C C     . ARG E 1 52  ? 116.47200 131.67000 90.64300  1.000 44.49444  ? 52  ARG E C     1 
ATOM 2920  O O     . ARG E 1 52  ? 116.92300 131.64200 91.79800  1.000 44.49444  ? 52  ARG E O     1 
ATOM 2921  C CB    . ARG E 1 52  ? 118.03400 130.95700 88.81400  1.000 44.49444  ? 52  ARG E CB    1 
ATOM 2922  C CG    . ARG E 1 52  ? 118.70100 129.77100 88.16500  1.000 44.49444  ? 52  ARG E CG    1 
ATOM 2923  C CD    . ARG E 1 52  ? 120.04800 130.11700 87.57800  1.000 44.49444  ? 52  ARG E CD    1 
ATOM 2924  N NE    . ARG E 1 52  ? 120.78400 128.90800 87.22200  1.000 44.49444  ? 52  ARG E NE    1 
ATOM 2925  C CZ    . ARG E 1 52  ? 121.95600 128.90100 86.59900  1.000 44.49444  ? 52  ARG E CZ    1 
ATOM 2926  N NH1   . ARG E 1 52  ? 122.54900 127.74800 86.31900  1.000 44.49444  ? 52  ARG E NH1   1 
ATOM 2927  N NH2   . ARG E 1 52  ? 122.53600 130.04400 86.25700  1.000 44.49444  ? 52  ARG E NH2   1 
ATOM 2928  N N     . LYS E 1 53  ? 115.62100 132.61600 90.23200  1.000 43.73619  ? 53  LYS E N     1 
ATOM 2929  C CA    . LYS E 1 53  ? 115.20000 133.66700 91.14900  1.000 43.73619  ? 53  LYS E CA    1 
ATOM 2930  C C     . LYS E 1 53  ? 114.28500 133.12100 92.23600  1.000 43.73619  ? 53  LYS E C     1 
ATOM 2931  O O     . LYS E 1 53  ? 114.34000 133.58600 93.37800  1.000 43.73619  ? 53  LYS E O     1 
ATOM 2932  C CB    . LYS E 1 53  ? 114.50200 134.78600 90.38000  1.000 43.73619  ? 53  LYS E CB    1 
ATOM 2933  C CG    . LYS E 1 53  ? 114.27100 136.04500 91.18900  1.000 43.73619  ? 53  LYS E CG    1 
ATOM 2934  C CD    . LYS E 1 53  ? 113.06700 136.80900 90.68700  1.000 43.73619  ? 53  LYS E CD    1 
ATOM 2935  C CE    . LYS E 1 53  ? 111.79300 136.00900 90.87800  1.000 43.73619  ? 53  LYS E CE    1 
ATOM 2936  N NZ    . LYS E 1 53  ? 110.58600 136.80800 90.54000  1.000 43.73619  ? 53  LYS E NZ    1 
ATOM 2937  N N     . LEU E 1 54  ? 113.45600 132.12700 91.91100  1.000 40.61262  ? 54  LEU E N     1 
ATOM 2938  C CA    . LEU E 1 54  ? 112.59700 131.53600 92.92500  1.000 40.61262  ? 54  LEU E CA    1 
ATOM 2939  C C     . LEU E 1 54  ? 113.35400 130.58200 93.83700  1.000 40.61262  ? 54  LEU E C     1 
ATOM 2940  O O     . LEU E 1 54  ? 112.98200 130.43000 95.00300  1.000 40.61262  ? 54  LEU E O     1 
ATOM 2941  C CB    . LEU E 1 54  ? 111.41600 130.83400 92.26400  1.000 40.61262  ? 54  LEU E CB    1 
ATOM 2942  C CG    . LEU E 1 54  ? 110.35400 131.84100 91.82100  1.000 40.61262  ? 54  LEU E CG    1 
ATOM 2943  C CD1   . LEU E 1 54  ? 109.22400 131.15800 91.10300  1.000 40.61262  ? 54  LEU E CD1   1 
ATOM 2944  C CD2   . LEU E 1 54  ? 109.83000 132.61800 93.00500  1.000 40.61262  ? 54  LEU E CD2   1 
ATOM 2945  N N     . GLN E 1 55  ? 114.41400 129.94300 93.34400  1.000 39.98550  ? 55  GLN E N     1 
ATOM 2946  C CA    . GLN E 1 55  ? 115.19900 129.06500 94.19900  1.000 39.98550  ? 55  GLN E CA    1 
ATOM 2947  C C     . GLN E 1 55  ? 116.18100 129.81900 95.08200  1.000 39.98550  ? 55  GLN E C     1 
ATOM 2948  O O     . GLN E 1 55  ? 116.60200 129.28000 96.10900  1.000 39.98550  ? 55  GLN E O     1 
ATOM 2949  C CB    . GLN E 1 55  ? 115.94800 128.04100 93.35400  1.000 39.98550  ? 55  GLN E CB    1 
ATOM 2950  C CG    . GLN E 1 55  ? 115.07500 126.91500 92.86900  1.000 39.98550  ? 55  GLN E CG    1 
ATOM 2951  C CD    . GLN E 1 55  ? 115.84600 125.87100 92.11100  1.000 39.98550  ? 55  GLN E CD    1 
ATOM 2952  O OE1   . GLN E 1 55  ? 117.06800 125.92900 92.02900  1.000 39.98550  ? 55  GLN E OE1   1 
ATOM 2953  N NE2   . GLN E 1 55  ? 115.13800 124.90500 91.55000  1.000 39.98550  ? 55  GLN E NE2   1 
ATOM 2954  N N     . LYS E 1 56  ? 116.56600 131.04200 94.71000  1.000 41.27913  ? 56  LYS E N     1 
ATOM 2955  C CA    . LYS E 1 56  ? 117.40000 131.83600 95.60800  1.000 41.27913  ? 56  LYS E CA    1 
ATOM 2956  C C     . LYS E 1 56  ? 116.61700 132.32600 96.82700  1.000 41.27913  ? 56  LYS E C     1 
ATOM 2957  O O     . LYS E 1 56  ? 117.12400 132.27900 97.95300  1.000 41.27913  ? 56  LYS E O     1 
ATOM 2958  C CB    . LYS E 1 56  ? 118.00800 133.01600 94.85100  1.000 41.27913  ? 56  LYS E CB    1 
ATOM 2959  C CG    . LYS E 1 56  ? 119.31400 132.68900 94.14200  1.000 41.27913  ? 56  LYS E CG    1 
ATOM 2960  C CD    . LYS E 1 56  ? 120.13000 133.94200 93.85900  1.000 41.27913  ? 56  LYS E CD    1 
ATOM 2961  C CE    . LYS E 1 56  ? 120.42900 134.72100 95.13000  1.000 41.27913  ? 56  LYS E CE    1 
ATOM 2962  N NZ    . LYS E 1 56  ? 121.25700 135.93100 94.86300  1.000 41.27913  ? 56  LYS E NZ    1 
ATOM 2963  N N     . SER E 1 57  ? 115.38500 132.78800 96.62600  1.000 40.54919  ? 57  SER E N     1 
ATOM 2964  C CA    . SER E 1 57  ? 114.58300 133.41900 97.66600  1.000 40.54919  ? 57  SER E CA    1 
ATOM 2965  C C     . SER E 1 57  ? 113.93600 132.38800 98.59100  1.000 40.54919  ? 57  SER E C     1 
ATOM 2966  O O     . SER E 1 57  ? 113.90200 131.18900 98.31000  1.000 40.54919  ? 57  SER E O     1 
ATOM 2967  C CB    . SER E 1 57  ? 113.51200 134.30900 97.03900  1.000 40.54919  ? 57  SER E CB    1 
ATOM 2968  O OG    . SER E 1 57  ? 112.63500 133.55800 96.21600  1.000 40.54919  ? 57  SER E OG    1 
ATOM 2969  N N     . THR E 1 58  ? 113.43300 132.87600 99.73300  1.000 40.08889  ? 58  THR E N     1 
ATOM 2970  C CA    . THR E 1 58  ? 112.76600 132.04000 100.72500 1.000 40.08889  ? 58  THR E CA    1 
ATOM 2971  C C     . THR E 1 58  ? 111.34400 132.47500 101.04700 1.000 40.08889  ? 58  THR E C     1 
ATOM 2972  O O     . THR E 1 58  ? 110.69600 131.82100 101.87100 1.000 40.08889  ? 58  THR E O     1 
ATOM 2973  C CB    . THR E 1 58  ? 113.53700 132.04000 102.05000 1.000 40.08889  ? 58  THR E CB    1 
ATOM 2974  O OG1   . THR E 1 58  ? 113.54000 133.36500 102.59100 1.000 40.08889  ? 58  THR E OG1   1 
ATOM 2975  C CG2   . THR E 1 58  ? 114.94500 131.62400 101.84400 1.000 40.08889  ? 58  THR E CG2   1 
ATOM 2976  N N     . HIS E 1 59  ? 110.85100 133.55400 100.44400 1.000 41.95624  ? 59  HIS E N     1 
ATOM 2977  C CA    . HIS E 1 59  ? 109.53600 134.08600 100.77600 1.000 41.95624  ? 59  HIS E CA    1 
ATOM 2978  C C     . HIS E 1 59  ? 108.41900 133.13400 100.37100 1.000 41.95624  ? 59  HIS E C     1 
ATOM 2979  O O     . HIS E 1 59  ? 108.56800 132.32400 99.45400  1.000 41.95624  ? 59  HIS E O     1 
ATOM 2980  C CB    . HIS E 1 59  ? 109.33400 135.45200 100.11800 1.000 41.95624  ? 59  HIS E CB    1 
ATOM 2981  C CG    . HIS E 1 59  ? 109.53200 135.45800 98.63300  1.000 41.95624  ? 59  HIS E CG    1 
ATOM 2982  N ND1   . HIS E 1 59  ? 108.65300 134.86100 97.75500  1.000 41.95624  ? 59  HIS E ND1   1 
ATOM 2983  C CD2   . HIS E 1 59  ? 110.50800 136.00500 97.87100  1.000 41.95624  ? 59  HIS E CD2   1 
ATOM 2984  C CE1   . HIS E 1 59  ? 109.08300 135.03300 96.51800  1.000 41.95624  ? 59  HIS E CE1   1 
ATOM 2985  N NE2   . HIS E 1 59  ? 110.20800 135.72200 96.56100  1.000 41.95624  ? 59  HIS E NE2   1 
ATOM 2986  N N     . LEU E 1 60  ? 107.31400 133.20600 101.11300 1.000 39.08745  ? 60  LEU E N     1 
ATOM 2987  C CA    . LEU E 1 60  ? 106.13200 132.40900 100.81600 1.000 39.08745  ? 60  LEU E CA    1 
ATOM 2988  C C     . LEU E 1 60  ? 105.57100 132.77600 99.45000  1.000 39.08745  ? 60  LEU E C     1 
ATOM 2989  O O     . LEU E 1 60  ? 105.32300 133.95000 99.16200  1.000 39.08745  ? 60  LEU E O     1 
ATOM 2990  C CB    . LEU E 1 60  ? 105.07200 132.62700 101.89400 1.000 39.08745  ? 60  LEU E CB    1 
ATOM 2991  C CG    . LEU E 1 60  ? 105.23500 131.81600 103.17400 1.000 39.08745  ? 60  LEU E CG    1 
ATOM 2992  C CD1   . LEU E 1 60  ? 104.20100 132.22800 104.20400 1.000 39.08745  ? 60  LEU E CD1   1 
ATOM 2993  C CD2   . LEU E 1 60  ? 105.10300 130.34700 102.85100 1.000 39.08745  ? 60  LEU E CD2   1 
ATOM 2994  N N     . LEU E 1 61  ? 105.36700 131.76500 98.60800  1.000 37.31846  ? 61  LEU E N     1 
ATOM 2995  C CA    . LEU E 1 61  ? 104.92000 132.02700 97.24700  1.000 37.31846  ? 61  LEU E CA    1 
ATOM 2996  C C     . LEU E 1 61  ? 103.41500 132.21700 97.17000  1.000 37.31846  ? 61  LEU E C     1 
ATOM 2997  O O     . LEU E 1 61  ? 102.93100 133.02000 96.36700  1.000 37.31846  ? 61  LEU E O     1 
ATOM 2998  C CB    . LEU E 1 61  ? 105.35800 130.89600 96.32900  1.000 37.31846  ? 61  LEU E CB    1 
ATOM 2999  C CG    . LEU E 1 61  ? 106.84700 130.60700 96.39600  1.000 37.31846  ? 61  LEU E CG    1 
ATOM 3000  C CD1   . LEU E 1 61  ? 107.15000 129.42800 95.53200  1.000 37.31846  ? 61  LEU E CD1   1 
ATOM 3001  C CD2   . LEU E 1 61  ? 107.60700 131.81900 95.93000  1.000 37.31846  ? 61  LEU E CD2   1 
ATOM 3002  N N     . ILE E 1 62  ? 102.66400 131.49200 97.97900  1.000 39.40550  ? 62  ILE E N     1 
ATOM 3003  C CA    . ILE E 1 62  ? 101.22500 131.69700 98.05800  1.000 39.40550  ? 62  ILE E CA    1 
ATOM 3004  C C     . ILE E 1 62  ? 100.96800 132.95100 98.87800  1.000 39.40550  ? 62  ILE E C     1 
ATOM 3005  O O     . ILE E 1 62  ? 101.64700 133.20200 99.88100  1.000 39.40550  ? 62  ILE E O     1 
ATOM 3006  C CB    . ILE E 1 62  ? 100.54000 130.46700 98.67300  1.000 39.40550  ? 62  ILE E CB    1 
ATOM 3007  C CG1   . ILE E 1 62  ? 100.99600 129.19800 97.96100  1.000 39.40550  ? 62  ILE E CG1   1 
ATOM 3008  C CG2   . ILE E 1 62  ? 99.04100  130.58000 98.55800  1.000 39.40550  ? 62  ILE E CG2   1 
ATOM 3009  C CD1   . ILE E 1 62  ? 100.44100 127.93400 98.56500  1.000 39.40550  ? 62  ILE E CD1   1 
ATOM 3010  N N     . ARG E 1 63  ? 100.01400 133.76300 98.43500  1.000 46.12807  ? 63  ARG E N     1 
ATOM 3011  C CA    . ARG E 1 63  ? 99.65500  134.96700 99.16400  1.000 46.12807  ? 63  ARG E CA    1 
ATOM 3012  C C     . ARG E 1 63  ? 98.97800  134.60300 100.48000 1.000 46.12807  ? 63  ARG E C     1 
ATOM 3013  O O     . ARG E 1 63  ? 98.31400  133.57200 100.59400 1.000 46.12807  ? 63  ARG E O     1 
ATOM 3014  C CB    . ARG E 1 63  ? 98.74800  135.84500 98.30800  1.000 46.12807  ? 63  ARG E CB    1 
ATOM 3015  C CG    . ARG E 1 63  ? 99.48800  136.54200 97.17800  1.000 46.12807  ? 63  ARG E CG    1 
ATOM 3016  C CD    . ARG E 1 63  ? 100.41700 137.61600 97.70500  1.000 46.12807  ? 63  ARG E CD    1 
ATOM 3017  N NE    . ARG E 1 63  ? 101.51400 137.89500 96.78800  1.000 46.12807  ? 63  ARG E NE    1 
ATOM 3018  C CZ    . ARG E 1 63  ? 102.72200 137.34700 96.88200  1.000 46.12807  ? 63  ARG E CZ    1 
ATOM 3019  N NH1   . ARG E 1 63  ? 102.99200 136.50100 97.86500  1.000 46.12807  ? 63  ARG E NH1   1 
ATOM 3020  N NH2   . ARG E 1 63  ? 103.66600 137.65600 96.00100  1.000 46.12807  ? 63  ARG E NH2   1 
ATOM 3021  N N     . LYS E 1 64  ? 99.17100  135.45700 101.48800 1.000 45.34557  ? 64  LYS E N     1 
ATOM 3022  C CA    . LYS E 1 64  ? 98.79600  135.09400 102.85100 1.000 45.34557  ? 64  LYS E CA    1 
ATOM 3023  C C     . LYS E 1 64  ? 97.28800  135.14200 103.06300 1.000 45.34557  ? 64  LYS E C     1 
ATOM 3024  O O     . LYS E 1 64  ? 96.73000  134.30100 103.77700 1.000 45.34557  ? 64  LYS E O     1 
ATOM 3025  C CB    . LYS E 1 64  ? 99.49300  136.02000 103.84300 1.000 45.34557  ? 64  LYS E CB    1 
ATOM 3026  C CG    . LYS E 1 64  ? 100.98300 135.80300 103.96500 1.000 45.34557  ? 64  LYS E CG    1 
ATOM 3027  C CD    . LYS E 1 64  ? 101.61500 136.90500 104.79600 1.000 45.34557  ? 64  LYS E CD    1 
ATOM 3028  C CE    . LYS E 1 64  ? 101.09300 136.89700 106.21500 1.000 45.34557  ? 64  LYS E CE    1 
ATOM 3029  N NZ    . LYS E 1 64  ? 101.79400 137.90200 107.05400 1.000 45.34557  ? 64  LYS E NZ    1 
ATOM 3030  N N     . LEU E 1 65  ? 96.60900  136.09100 102.43900 1.000 46.61815  ? 65  LEU E N     1 
ATOM 3031  C CA    . LEU E 1 65  ? 95.17900  136.26300 102.67200 1.000 46.61815  ? 65  LEU E CA    1 
ATOM 3032  C C     . LEU E 1 65  ? 94.28800  135.22500 101.97200 1.000 46.61815  ? 65  LEU E C     1 
ATOM 3033  O O     . LEU E 1 65  ? 93.36000  134.72800 102.62600 1.000 46.61815  ? 65  LEU E O     1 
ATOM 3034  C CB    . LEU E 1 65  ? 94.76600  137.69400 102.30300 1.000 46.61815  ? 65  LEU E CB    1 
ATOM 3035  C CG    . LEU E 1 65  ? 93.43300  138.21600 102.82600 1.000 46.61815  ? 65  LEU E CG    1 
ATOM 3036  C CD1   . LEU E 1 65  ? 93.37600  138.07400 104.33000 1.000 46.61815  ? 65  LEU E CD1   1 
ATOM 3037  C CD2   . LEU E 1 65  ? 93.25200  139.66600 102.42400 1.000 46.61815  ? 65  LEU E CD2   1 
ATOM 3038  N N     . PRO E 1 66  ? 94.48800  134.84800 100.69200 1.000 43.88092  ? 66  PRO E N     1 
ATOM 3039  C CA    . PRO E 1 66  ? 93.65100  133.76000 100.15700 1.000 43.88092  ? 66  PRO E CA    1 
ATOM 3040  C C     . PRO E 1 66  ? 93.96400  132.39900 100.75400 1.000 43.88092  ? 66  PRO E C     1 
ATOM 3041  O O     . PRO E 1 66  ? 93.04600  131.58200 100.90000 1.000 43.88092  ? 66  PRO E O     1 
ATOM 3042  C CB    . PRO E 1 66  ? 93.94200  133.79700 98.65300  1.000 43.88092  ? 66  PRO E CB    1 
ATOM 3043  C CG    . PRO E 1 66  ? 95.25900  134.39100 98.55600  1.000 43.88092  ? 66  PRO E CG    1 
ATOM 3044  C CD    . PRO E 1 66  ? 95.26200  135.44900 99.58800  1.000 43.88092  ? 66  PRO E CD    1 
ATOM 3045  N N     . PHE E 1 67  ? 95.21600  132.14200 101.14200 1.000 38.15162  ? 67  PHE E N     1 
ATOM 3046  C CA    . PHE E 1 67  ? 95.51000  130.90900 101.86300 1.000 38.15162  ? 67  PHE E CA    1 
ATOM 3047  C C     . PHE E 1 67  ? 94.88500  130.92300 103.25000 1.000 38.15162  ? 67  PHE E C     1 
ATOM 3048  O O     . PHE E 1 67  ? 94.46500  129.87600 103.75000 1.000 38.15162  ? 67  PHE E O     1 
ATOM 3049  C CB    . PHE E 1 67  ? 97.01400  130.68000 101.96800 1.000 38.15162  ? 67  PHE E CB    1 
ATOM 3050  C CG    . PHE E 1 67  ? 97.37600  129.33400 102.52900 1.000 38.15162  ? 67  PHE E CG    1 
ATOM 3051  C CD1   . PHE E 1 67  ? 97.42300  128.22300 101.70700 1.000 38.15162  ? 67  PHE E CD1   1 
ATOM 3052  C CD2   . PHE E 1 67  ? 97.66200  129.17600 103.87700 1.000 38.15162  ? 67  PHE E CD2   1 
ATOM 3053  C CE1   . PHE E 1 67  ? 97.74800  126.98500 102.21500 1.000 38.15162  ? 67  PHE E CE1   1 
ATOM 3054  C CE2   . PHE E 1 67  ? 97.98000  127.94100 104.38900 1.000 38.15162  ? 67  PHE E CE2   1 
ATOM 3055  C CZ    . PHE E 1 67  ? 98.02900  126.84500 103.55600 1.000 38.15162  ? 67  PHE E CZ    1 
ATOM 3056  N N     . SER E 1 68  ? 94.83400  132.09300 103.89300 1.000 39.04079  ? 68  SER E N     1 
ATOM 3057  C CA    . SER E 1 68  ? 94.17400  132.19200 105.18800 1.000 39.04079  ? 68  SER E CA    1 
ATOM 3058  C C     . SER E 1 68  ? 92.67900  131.94200 105.06800 1.000 39.04079  ? 68  SER E C     1 
ATOM 3059  O O     . SER E 1 68  ? 92.08900  131.26900 105.92100 1.000 39.04079  ? 68  SER E O     1 
ATOM 3060  C CB    . SER E 1 68  ? 94.43500  133.55900 105.80500 1.000 39.04079  ? 68  SER E CB    1 
ATOM 3061  O OG    . SER E 1 68  ? 93.43400  133.87000 106.75500 1.000 39.04079  ? 68  SER E OG    1 
ATOM 3062  N N     . ARG E 1 69  ? 92.05300  132.46100 104.00800 1.000 41.66381  ? 69  ARG E N     1 
ATOM 3063  C CA    . ARG E 1 69  ? 90.63100  132.20000 103.80300 1.000 41.66381  ? 69  ARG E CA    1 
ATOM 3064  C C     . ARG E 1 69  ? 90.37500  130.73400 103.48000 1.000 41.66381  ? 69  ARG E C     1 
ATOM 3065  O O     . ARG E 1 69  ? 89.36800  130.16900 103.92000 1.000 41.66381  ? 69  ARG E O     1 
ATOM 3066  C CB    . ARG E 1 69  ? 90.07400  133.08900 102.69800 1.000 41.66381  ? 69  ARG E CB    1 
ATOM 3067  C CG    . ARG E 1 69  ? 89.54600  134.40700 103.19100 1.000 41.66381  ? 69  ARG E CG    1 
ATOM 3068  C CD    . ARG E 1 69  ? 89.83900  135.49400 102.19600 1.000 41.66381  ? 69  ARG E CD    1 
ATOM 3069  N NE    . ARG E 1 69  ? 89.59900  135.02800 100.83800 1.000 41.66381  ? 69  ARG E NE    1 
ATOM 3070  C CZ    . ARG E 1 69  ? 89.98200  135.68000 99.74800  1.000 41.66381  ? 69  ARG E CZ    1 
ATOM 3071  N NH1   . ARG E 1 69  ? 89.72300  135.18100 98.54900  1.000 41.66381  ? 69  ARG E NH1   1 
ATOM 3072  N NH2   . ARG E 1 69  ? 90.61600  136.83800 99.86100  1.000 41.66381  ? 69  ARG E NH2   1 
ATOM 3073  N N     . LEU E 1 70  ? 91.29000  130.09600 102.74300 1.000 37.97459  ? 70  LEU E N     1 
ATOM 3074  C CA    . LEU E 1 70  ? 91.16400  128.66800 102.46500 1.000 37.97459  ? 70  LEU E CA    1 
ATOM 3075  C C     . LEU E 1 70  ? 91.31500  127.83700 103.73300 1.000 37.97459  ? 70  LEU E C     1 
ATOM 3076  O O     . LEU E 1 70  ? 90.55800  126.88100 103.94800 1.000 37.97459  ? 70  LEU E O     1 
ATOM 3077  C CB    . LEU E 1 70  ? 92.20000  128.25000 101.42700 1.000 37.97459  ? 70  LEU E CB    1 
ATOM 3078  C CG    . LEU E 1 70  ? 92.36600  126.75900 101.15600 1.000 37.97459  ? 70  LEU E CG    1 
ATOM 3079  C CD1   . LEU E 1 70  ? 91.07000  126.17300 100.63500 1.000 37.97459  ? 70  LEU E CD1   1 
ATOM 3080  C CD2   . LEU E 1 70  ? 93.49800  126.53700 100.18000 1.000 37.97459  ? 70  LEU E CD2   1 
ATOM 3081  N N     . ALA E 1 71  ? 92.27800  128.19600 104.58700 1.000 37.12914  ? 71  ALA E N     1 
ATOM 3082  C CA    . ALA E 1 71  ? 92.48900  127.47800 105.83900 1.000 37.12914  ? 71  ALA E CA    1 
ATOM 3083  C C     . ALA E 1 71  ? 91.30500  127.64100 106.78200 1.000 37.12914  ? 71  ALA E C     1 
ATOM 3084  O O     . ALA E 1 71  ? 90.90100  126.67900 107.43800 1.000 37.12914  ? 71  ALA E O     1 
ATOM 3085  C CB    . ALA E 1 71  ? 93.77500  127.95400 106.50800 1.000 37.12914  ? 71  ALA E CB    1 
ATOM 3086  N N     . ARG E 1 72  ? 90.70500  128.83300 106.82900 1.000 39.32341  ? 72  ARG E N     1 
ATOM 3087  C CA    . ARG E 1 72  ? 89.53100  129.01700 107.67900 1.000 39.32341  ? 72  ARG E CA    1 
ATOM 3088  C C     . ARG E 1 72  ? 88.30300  128.31000 107.11100 1.000 39.32341  ? 72  ARG E C     1 
ATOM 3089  O O     . ARG E 1 72  ? 87.48400  127.78100 107.87400 1.000 39.32341  ? 72  ARG E O     1 
ATOM 3090  C CB    . ARG E 1 72  ? 89.24500  130.50100 107.87700 1.000 39.32341  ? 72  ARG E CB    1 
ATOM 3091  C CG    . ARG E 1 72  ? 90.29400  131.23000 108.68000 1.000 39.32341  ? 72  ARG E CG    1 
ATOM 3092  C CD    . ARG E 1 72  ? 90.03000  132.71800 108.68100 1.000 39.32341  ? 72  ARG E CD    1 
ATOM 3093  N NE    . ARG E 1 72  ? 91.21300  133.47400 109.06700 1.000 39.32341  ? 72  ARG E NE    1 
ATOM 3094  C CZ    . ARG E 1 72  ? 91.56800  133.72200 110.32100 1.000 39.32341  ? 72  ARG E CZ    1 
ATOM 3095  N NH1   . ARG E 1 72  ? 90.83000  133.27600 111.32400 1.000 39.32341  ? 72  ARG E NH1   1 
ATOM 3096  N NH2   . ARG E 1 72  ? 92.66400  134.42100 110.57000 1.000 39.32341  ? 72  ARG E NH2   1 
ATOM 3097  N N     . GLU E 1 73  ? 88.16100  128.28300 105.77900 1.000 40.23951  ? 73  GLU E N     1 
ATOM 3098  C CA    . GLU E 1 73  ? 87.03500  127.58700 105.15800 1.000 40.23951  ? 73  GLU E CA    1 
ATOM 3099  C C     . GLU E 1 73  ? 87.12900  126.08400 105.37700 1.000 40.23951  ? 73  GLU E C     1 
ATOM 3100  O O     . GLU E 1 73  ? 86.11200  125.41000 105.56600 1.000 40.23951  ? 73  GLU E O     1 
ATOM 3101  C CB    . GLU E 1 73  ? 86.98000  127.90000 103.66300 1.000 40.23951  ? 73  GLU E CB    1 
ATOM 3102  C CG    . GLU E 1 73  ? 85.72600  127.37700 102.97500 1.000 40.23951  ? 73  GLU E CG    1 
ATOM 3103  C CD    . GLU E 1 73  ? 85.92300  127.11600 101.49700 1.000 40.23951  ? 73  GLU E CD    1 
ATOM 3104  O OE1   . GLU E 1 73  ? 87.04000  126.72300 101.10500 1.000 40.23951  ? 73  GLU E OE1   1 
ATOM 3105  O OE2   . GLU E 1 73  ? 84.95800  127.30300 100.72700 1.000 40.23951  ? 73  GLU E OE2   1 
ATOM 3106  N N     . ILE E 1 74  ? 88.34400  125.54100 105.35000 1.000 38.13427  ? 74  ILE E N     1 
ATOM 3107  C CA    . ILE E 1 74  ? 88.52600  124.12800 105.65100 1.000 38.13427  ? 74  ILE E CA    1 
ATOM 3108  C C     . ILE E 1 74  ? 88.35800  123.86400 107.14500 1.000 38.13427  ? 74  ILE E C     1 
ATOM 3109  O O     . ILE E 1 74  ? 87.79300  122.83600 107.54300 1.000 38.13427  ? 74  ILE E O     1 
ATOM 3110  C CB    . ILE E 1 74  ? 89.89400  123.67900 105.10100 1.000 38.13427  ? 74  ILE E CB    1 
ATOM 3111  C CG1   . ILE E 1 74  ? 89.84100  123.64400 103.57500 1.000 38.13427  ? 74  ILE E CG1   1 
ATOM 3112  C CG2   . ILE E 1 74  ? 90.34100  122.35400 105.66700 1.000 38.13427  ? 74  ILE E CG2   1 
ATOM 3113  C CD1   . ILE E 1 74  ? 91.10100  123.17100 102.92800 1.000 38.13427  ? 74  ILE E CD1   1 
ATOM 3114  N N     . CYS E 1 75  ? 88.77900  124.80600 107.99300 1.000 40.61140  ? 75  CYS E N     1 
ATOM 3115  C CA    . CYS E 1 75  ? 88.70800  124.61200 109.43600 1.000 40.61140  ? 75  CYS E CA    1 
ATOM 3116  C C     . CYS E 1 75  ? 87.28300  124.66400 109.96400 1.000 40.61140  ? 75  CYS E C     1 
ATOM 3117  O O     . CYS E 1 75  ? 86.96700  123.96000 110.92600 1.000 40.61140  ? 75  CYS E O     1 
ATOM 3118  C CB    . CYS E 1 75  ? 89.56500  125.66700 110.13400 1.000 40.61140  ? 75  CYS E CB    1 
ATOM 3119  S SG    . CYS E 1 75  ? 89.59600  125.58400 111.92700 1.000 40.61140  ? 75  CYS E SG    1 
ATOM 3120  N N     . VAL E 1 76  ? 86.40400  125.45500 109.34100 1.000 41.89738  ? 76  VAL E N     1 
ATOM 3121  C CA    . VAL E 1 76  ? 85.04300  125.58700 109.85800 1.000 41.89738  ? 76  VAL E CA    1 
ATOM 3122  C C     . VAL E 1 76  ? 84.22000  124.31200 109.65700 1.000 41.89738  ? 76  VAL E C     1 
ATOM 3123  O O     . VAL E 1 76  ? 83.19000  124.13300 110.31500 1.000 41.89738  ? 76  VAL E O     1 
ATOM 3124  C CB    . VAL E 1 76  ? 84.36300  126.81700 109.21500 1.000 41.89738  ? 76  VAL E CB    1 
ATOM 3125  C CG1   . VAL E 1 76  ? 83.94000  126.53700 107.78500 1.000 41.89738  ? 76  VAL E CG1   1 
ATOM 3126  C CG2   . VAL E 1 76  ? 83.20400  127.34600 110.06200 1.000 41.89738  ? 76  VAL E CG2   1 
ATOM 3127  N N     . LYS E 1 77  ? 84.66700  123.38900 108.79900 1.000 42.30572  ? 77  LYS E N     1 
ATOM 3128  C CA    . LYS E 1 77  ? 83.95800  122.12500 108.64100 1.000 42.30572  ? 77  LYS E CA    1 
ATOM 3129  C C     . LYS E 1 77  ? 84.27500  121.12900 109.74700 1.000 42.30572  ? 77  LYS E C     1 
ATOM 3130  O O     . LYS E 1 77  ? 83.44300  120.26800 110.05100 1.000 42.30572  ? 77  LYS E O     1 
ATOM 3131  C CB    . LYS E 1 77  ? 84.27700  121.49300 107.28900 1.000 42.30572  ? 77  LYS E CB    1 
ATOM 3132  C CG    . LYS E 1 77  ? 83.73800  122.24900 106.09700 1.000 42.30572  ? 77  LYS E CG    1 
ATOM 3133  C CD    . LYS E 1 77  ? 84.06300  121.50000 104.82100 1.000 42.30572  ? 77  LYS E CD    1 
ATOM 3134  C CE    . LYS E 1 77  ? 83.39100  120.13500 104.80800 1.000 42.30572  ? 77  LYS E CE    1 
ATOM 3135  N NZ    . LYS E 1 77  ? 83.02900  119.69200 103.43700 1.000 42.30572  ? 77  LYS E NZ    1 
ATOM 3136  N N     . PHE E 1 78  ? 85.45700  121.21500 110.34800 1.000 41.83039  ? 78  PHE E N     1 
ATOM 3137  C CA    . PHE E 1 78  ? 85.85800  120.25200 111.36300 1.000 41.83039  ? 78  PHE E CA    1 
ATOM 3138  C C     . PHE E 1 78  ? 85.51100  120.68500 112.77700 1.000 41.83039  ? 78  PHE E C     1 
ATOM 3139  O O     . PHE E 1 78  ? 85.51500  119.84700 113.68300 1.000 41.83039  ? 78  PHE E O     1 
ATOM 3140  C CB    . PHE E 1 78  ? 87.36100  119.99600 111.27100 1.000 41.83039  ? 78  PHE E CB    1 
ATOM 3141  C CG    . PHE E 1 78  ? 87.75300  119.19100 110.08000 1.000 41.83039  ? 78  PHE E CG    1 
ATOM 3142  C CD1   . PHE E 1 78  ? 87.04000  118.05900 109.73500 1.000 41.83039  ? 78  PHE E CD1   1 
ATOM 3143  C CD2   . PHE E 1 78  ? 88.80200  119.59200 109.27500 1.000 41.83039  ? 78  PHE E CD2   1 
ATOM 3144  C CE1   . PHE E 1 78  ? 87.39000  117.31600 108.62500 1.000 41.83039  ? 78  PHE E CE1   1 
ATOM 3145  C CE2   . PHE E 1 78  ? 89.15300  118.86100 108.16200 1.000 41.83039  ? 78  PHE E CE2   1 
ATOM 3146  C CZ    . PHE E 1 78  ? 88.44700  117.71900 107.83700 1.000 41.83039  ? 78  PHE E CZ    1 
ATOM 3147  N N     . THR E 1 79  ? 85.20300  121.96100 112.99000 1.000 45.15075  ? 79  THR E N     1 
ATOM 3148  C CA    . THR E 1 79  ? 84.93500  122.46400 114.32600 1.000 45.15075  ? 79  THR E CA    1 
ATOM 3149  C C     . THR E 1 79  ? 83.45500  122.46700 114.66800 1.000 45.15075  ? 79  THR E C     1 
ATOM 3150  O O     . THR E 1 79  ? 83.04600  123.24200 115.53900 1.000 45.15075  ? 79  THR E O     1 
ATOM 3151  C CB    . THR E 1 79  ? 85.50200  123.87300 114.49400 1.000 45.15075  ? 79  THR E CB    1 
ATOM 3152  O OG1   . THR E 1 79  ? 84.81200  124.77400 113.62500 1.000 45.15075  ? 79  THR E OG1   1 
ATOM 3153  C CG2   . THR E 1 79  ? 86.97100  123.89600 114.18700 1.000 45.15075  ? 79  THR E CG2   1 
ATOM 3154  N N     . ARG E 1 80  ? 82.66200  121.60800 114.01100 1.000 50.02233  ? 80  ARG E N     1 
ATOM 3155  C CA    . ARG E 1 80  ? 81.24800  121.36000 114.33000 1.000 50.02233  ? 80  ARG E CA    1 
ATOM 3156  C C     . ARG E 1 80  ? 80.41200  122.63600 114.25000 1.000 50.02233  ? 80  ARG E C     1 
ATOM 3157  O O     . ARG E 1 80  ? 79.55700  122.89700 115.09800 1.000 50.02233  ? 80  ARG E O     1 
ATOM 3158  C CB    . ARG E 1 80  ? 81.09900  120.68300 115.69600 1.000 50.02233  ? 80  ARG E CB    1 
ATOM 3159  C CG    . ARG E 1 80  ? 82.06500  119.52400 115.88600 1.000 50.02233  ? 80  ARG E CG    1 
ATOM 3160  C CD    . ARG E 1 80  ? 81.53200  118.43000 116.77800 1.000 50.02233  ? 80  ARG E CD    1 
ATOM 3161  N NE    . ARG E 1 80  ? 82.35400  117.23100 116.65000 1.000 50.02233  ? 80  ARG E NE    1 
ATOM 3162  C CZ    . ARG E 1 80  ? 83.48300  117.01500 117.31900 1.000 50.02233  ? 80  ARG E CZ    1 
ATOM 3163  N NH1   . ARG E 1 80  ? 84.16400  115.89400 117.12100 1.000 50.02233  ? 80  ARG E NH1   1 
ATOM 3164  N NH2   . ARG E 1 80  ? 83.93000  117.91000 118.18900 1.000 50.02233  ? 80  ARG E NH2   1 
ATOM 3165  N N     . GLY E 1 81  ? 80.67200  123.43800 113.22500 1.000 49.23175  ? 81  GLY E N     1 
ATOM 3166  C CA    . GLY E 1 81  ? 79.94000  124.66000 112.93900 1.000 49.23175  ? 81  GLY E CA    1 
ATOM 3167  C C     . GLY E 1 81  ? 80.40700  125.93700 113.61400 1.000 49.23175  ? 81  GLY E C     1 
ATOM 3168  O O     . GLY E 1 81  ? 80.34800  127.00500 113.00200 1.000 49.23175  ? 81  GLY E O     1 
ATOM 3169  N N     . VAL E 1 82  ? 80.87400  125.85600 114.85700 1.000 47.79075  ? 82  VAL E N     1 
ATOM 3170  C CA    . VAL E 1 82  ? 81.34500  127.04800 115.55700 1.000 47.79075  ? 82  VAL E CA    1 
ATOM 3171  C C     . VAL E 1 82  ? 82.72800  127.42100 115.03000 1.000 47.79075  ? 82  VAL E C     1 
ATOM 3172  O O     . VAL E 1 82  ? 83.61100  126.56800 114.89100 1.000 47.79075  ? 82  VAL E O     1 
ATOM 3173  C CB    . VAL E 1 82  ? 81.31600  126.84700 117.08700 1.000 47.79075  ? 82  VAL E CB    1 
ATOM 3174  C CG1   . VAL E 1 82  ? 82.06400  125.60400 117.53700 1.000 47.79075  ? 82  VAL E CG1   1 
ATOM 3175  C CG2   . VAL E 1 82  ? 81.86000  128.07700 117.80900 1.000 47.79075  ? 82  VAL E CG2   1 
ATOM 3176  N N     . ASP E 1 83  ? 82.89500  128.69000 114.66900 1.000 45.63131  ? 83  ASP E N     1 
ATOM 3177  C CA    . ASP E 1 83  ? 84.15300  129.15100 114.10200 1.000 45.63131  ? 83  ASP E CA    1 
ATOM 3178  C C     . ASP E 1 83  ? 85.25100  129.22200 115.15600 1.000 45.63131  ? 83  ASP E C     1 
ATOM 3179  O O     . ASP E 1 83  ? 85.00600  129.52400 116.32700 1.000 45.63131  ? 83  ASP E O     1 
ATOM 3180  C CB    . ASP E 1 83  ? 83.97100  130.52200 113.45600 1.000 45.63131  ? 83  ASP E CB    1 
ATOM 3181  C CG    . ASP E 1 83  ? 85.03900  130.82600 112.43200 1.000 45.63131  ? 83  ASP E CG    1 
ATOM 3182  O OD1   . ASP E 1 83  ? 85.58400  129.87200 111.84000 1.000 45.63131  ? 83  ASP E OD1   1 
ATOM 3183  O OD2   . ASP E 1 83  ? 85.33300  132.02000 112.21800 1.000 45.63131  ? 83  ASP E OD2   1 
ATOM 3184  N N     . PHE E 1 84  ? 86.47600  128.94500 114.72000 1.000 43.31651  ? 84  PHE E N     1 
ATOM 3185  C CA    . PHE E 1 84  ? 87.65100  128.97300 115.57400 1.000 43.31651  ? 84  PHE E CA    1 
ATOM 3186  C C     . PHE E 1 84  ? 88.54800  130.13100 115.17000 1.000 43.31651  ? 84  PHE E C     1 
ATOM 3187  O O     . PHE E 1 84  ? 88.54900  130.56000 114.01400 1.000 43.31651  ? 84  PHE E O     1 
ATOM 3188  C CB    . PHE E 1 84  ? 88.45100  127.67000 115.48600 1.000 43.31651  ? 84  PHE E CB    1 
ATOM 3189  C CG    . PHE E 1 84  ? 88.03900  126.62700 116.47900 1.000 43.31651  ? 84  PHE E CG    1 
ATOM 3190  C CD1   . PHE E 1 84  ? 86.83500  126.72500 117.15600 1.000 43.31651  ? 84  PHE E CD1   1 
ATOM 3191  C CD2   . PHE E 1 84  ? 88.87100  125.55900 116.76000 1.000 43.31651  ? 84  PHE E CD2   1 
ATOM 3192  C CE1   . PHE E 1 84  ? 86.46000  125.76500 118.06900 1.000 43.31651  ? 84  PHE E CE1   1 
ATOM 3193  C CE2   . PHE E 1 84  ? 88.50300  124.59900 117.67500 1.000 43.31651  ? 84  PHE E CE2   1 
ATOM 3194  C CZ    . PHE E 1 84  ? 87.29600  124.70300 118.33100 1.000 43.31651  ? 84  PHE E CZ    1 
ATOM 3195  N N     . ASN E 1 85  ? 89.31700  130.62500 116.12900 1.000 43.10650  ? 85  ASN E N     1 
ATOM 3196  C CA    . ASN E 1 85  ? 90.31900  131.63600 115.85300 1.000 43.10650  ? 85  ASN E CA    1 
ATOM 3197  C C     . ASN E 1 85  ? 91.63200  130.96500 115.49000 1.000 43.10650  ? 85  ASN E C     1 
ATOM 3198  O O     . ASN E 1 85  ? 91.93100  129.86100 115.94400 1.000 43.10650  ? 85  ASN E O     1 
ATOM 3199  C CB    . ASN E 1 85  ? 90.51800  132.54500 117.06300 1.000 43.10650  ? 85  ASN E CB    1 
ATOM 3200  C CG    . ASN E 1 85  ? 89.27200  133.31600 117.42000 1.000 43.10650  ? 85  ASN E CG    1 
ATOM 3201  O OD1   . ASN E 1 85  ? 88.17300  132.97100 116.99300 1.000 43.10650  ? 85  ASN E OD1   1 
ATOM 3202  N ND2   . ASN E 1 85  ? 89.43400  134.36400 118.21500 1.000 43.10650  ? 85  ASN E ND2   1 
ATOM 3203  N N     . TRP E 1 86  ? 92.41800  131.64000 114.66300 1.000 38.67241  ? 86  TRP E N     1 
ATOM 3204  C CA    . TRP E 1 86  ? 93.73900  131.16600 114.28600 1.000 38.67241  ? 86  TRP E CA    1 
ATOM 3205  C C     . TRP E 1 86  ? 94.76700  132.18800 114.73000 1.000 38.67241  ? 86  TRP E C     1 
ATOM 3206  O O     . TRP E 1 86  ? 94.57800  133.39000 114.52300 1.000 38.67241  ? 86  TRP E O     1 
ATOM 3207  C CB    . TRP E 1 86  ? 93.84400  130.94000 112.77900 1.000 38.67241  ? 86  TRP E CB    1 
ATOM 3208  C CG    . TRP E 1 86  ? 93.16700  129.70600 112.30100 1.000 38.67241  ? 86  TRP E CG    1 
ATOM 3209  C CD1   . TRP E 1 86  ? 91.83100  129.50500 112.17200 1.000 38.67241  ? 86  TRP E CD1   1 
ATOM 3210  C CD2   . TRP E 1 86  ? 93.79700  128.49100 111.89400 1.000 38.67241  ? 86  TRP E CD2   1 
ATOM 3211  N NE1   . TRP E 1 86  ? 91.58700  128.24100 111.70300 1.000 38.67241  ? 86  TRP E NE1   1 
ATOM 3212  C CE2   . TRP E 1 86  ? 92.78100  127.59800 111.52600 1.000 38.67241  ? 86  TRP E CE2   1 
ATOM 3213  C CE3   . TRP E 1 86  ? 95.12500  128.07200 111.80400 1.000 38.67241  ? 86  TRP E CE3   1 
ATOM 3214  C CZ2   . TRP E 1 86  ? 93.04800  126.31400 111.08000 1.000 38.67241  ? 86  TRP E CZ2   1 
ATOM 3215  C CZ3   . TRP E 1 86  ? 95.38700  126.79900 111.35900 1.000 38.67241  ? 86  TRP E CZ3   1 
ATOM 3216  C CH2   . TRP E 1 86  ? 94.35700  125.93400 111.00400 1.000 38.67241  ? 86  TRP E CH2   1 
ATOM 3217  N N     . GLN E 1 87  ? 95.84900  131.71200 115.33300 1.000 39.61488  ? 87  GLN E N     1 
ATOM 3218  C CA    . GLN E 1 87  ? 96.95400  132.58000 115.69400 1.000 39.61488  ? 87  GLN E CA    1 
ATOM 3219  C C     . GLN E 1 87  ? 97.66400  133.09800 114.44800 1.000 39.61488  ? 87  GLN E C     1 
ATOM 3220  O O     . GLN E 1 87  ? 97.55500  132.53600 113.35700 1.000 39.61488  ? 87  GLN E O     1 
ATOM 3221  C CB    . GLN E 1 87  ? 97.94500  131.84000 116.58600 1.000 39.61488  ? 87  GLN E CB    1 
ATOM 3222  C CG    . GLN E 1 87  ? 97.55300  131.80000 118.03800 1.000 39.61488  ? 87  GLN E CG    1 
ATOM 3223  C CD    . GLN E 1 87  ? 98.75400  131.69600 118.95000 1.000 39.61488  ? 87  GLN E CD    1 
ATOM 3224  O OE1   . GLN E 1 87  ? 99.87900  131.50900 118.49300 1.000 39.61488  ? 87  GLN E OE1   1 
ATOM 3225  N NE2   . GLN E 1 87  ? 98.52300  131.82300 120.24900 1.000 39.61488  ? 87  GLN E NE2   1 
ATOM 3226  N N     . ALA E 1 88  ? 98.39100  134.20100 114.62400 1.000 40.80762  ? 88  ALA E N     1 
ATOM 3227  C CA    . ALA E 1 88  ? 99.14300  134.77500 113.51600 1.000 40.80762  ? 88  ALA E CA    1 
ATOM 3228  C C     . ALA E 1 88  ? 100.29900 133.88100 113.09500 1.000 40.80762  ? 88  ALA E C     1 
ATOM 3229  O O     . ALA E 1 88  ? 100.67400 133.87000 111.91800 1.000 40.80762  ? 88  ALA E O     1 
ATOM 3230  C CB    . ALA E 1 88  ? 99.65700  136.16100 113.89400 1.000 40.80762  ? 88  ALA E CB    1 
ATOM 3231  N N     . GLN E 1 89  ? 100.87900 133.13400 114.03100 1.000 38.33710  ? 89  GLN E N     1 
ATOM 3232  C CA    . GLN E 1 89  ? 101.93100 132.19300 113.68500 1.000 38.33710  ? 89  GLN E CA    1 
ATOM 3233  C C     . GLN E 1 89  ? 101.40100 130.84000 113.24300 1.000 38.33710  ? 89  GLN E C     1 
ATOM 3234  O O     . GLN E 1 89  ? 102.13500 130.09500 112.59000 1.000 38.33710  ? 89  GLN E O     1 
ATOM 3235  C CB    . GLN E 1 89  ? 102.87700 131.99700 114.87100 1.000 38.33710  ? 89  GLN E CB    1 
ATOM 3236  C CG    . GLN E 1 89  ? 103.74800 133.19700 115.16600 1.000 38.33710  ? 89  GLN E CG    1 
ATOM 3237  C CD    . GLN E 1 89  ? 104.84000 133.38100 114.13600 1.000 38.33710  ? 89  GLN E CD    1 
ATOM 3238  O OE1   . GLN E 1 89  ? 105.88100 132.73000 114.20000 1.000 38.33710  ? 89  GLN E OE1   1 
ATOM 3239  N NE2   . GLN E 1 89  ? 104.61200 134.27600 113.18100 1.000 38.33710  ? 89  GLN E NE2   1 
ATOM 3240  N N     . ALA E 1 90  ? 100.12800 130.53900 113.50600 1.000 35.55721  ? 90  ALA E N     1 
ATOM 3241  C CA    . ALA E 1 90  ? 99.56800  129.26700 113.06400 1.000 35.55721  ? 90  ALA E CA    1 
ATOM 3242  C C     . ALA E 1 90  ? 99.35400  129.24400 111.56100 1.000 35.55721  ? 90  ALA E C     1 
ATOM 3243  O O     . ALA E 1 90  ? 99.67800  128.25100 110.90000 1.000 35.55721  ? 90  ALA E O     1 
ATOM 3244  C CB    . ALA E 1 90  ? 98.25200  128.99500 113.78100 1.000 35.55721  ? 90  ALA E CB    1 
ATOM 3245  N N     . LEU E 1 91  ? 98.80500  130.32700 111.00800 1.000 35.18356  ? 91  LEU E N     1 
ATOM 3246  C CA    . LEU E 1 91  ? 98.59900  130.41800 109.56900 1.000 35.18356  ? 91  LEU E CA    1 
ATOM 3247  C C     . LEU E 1 91  ? 99.92000  130.46200 108.81500 1.000 35.18356  ? 91  LEU E C     1 
ATOM 3248  O O     . LEU E 1 91  ? 100.03600 129.86200 107.74300 1.000 35.18356  ? 91  LEU E O     1 
ATOM 3249  C CB    . LEU E 1 91  ? 97.75000  131.64200 109.24900 1.000 35.18356  ? 91  LEU E CB    1 
ATOM 3250  C CG    . LEU E 1 91  ? 96.31200  131.48200 109.73500 1.000 35.18356  ? 91  LEU E CG    1 
ATOM 3251  C CD1   . LEU E 1 91  ? 95.63100  132.83000 109.85200 1.000 35.18356  ? 91  LEU E CD1   1 
ATOM 3252  C CD2   . LEU E 1 91  ? 95.54600  130.56300 108.80400 1.000 35.18356  ? 91  LEU E CD2   1 
ATOM 3253  N N     . LEU E 1 92  ? 100.94500 131.09100 109.39100 1.000 34.79875  ? 92  LEU E N     1 
ATOM 3254  C CA    . LEU E 1 92  ? 102.25900 131.07800 108.75600 1.000 34.79875  ? 92  LEU E CA    1 
ATOM 3255  C C     . LEU E 1 92  ? 102.92300 129.71100 108.85600 1.000 34.79875  ? 92  LEU E C     1 
ATOM 3256  O O     . LEU E 1 92  ? 103.60600 129.29400 107.91800 1.000 34.79875  ? 92  LEU E O     1 
ATOM 3257  C CB    . LEU E 1 92  ? 103.16400 132.14700 109.36000 1.000 34.79875  ? 92  LEU E CB    1 
ATOM 3258  C CG    . LEU E 1 92  ? 103.25000 133.47200 108.60000 1.000 34.79875  ? 92  LEU E CG    1 
ATOM 3259  C CD1   . LEU E 1 92  ? 101.97600 134.28000 108.74900 1.000 34.79875  ? 92  LEU E CD1   1 
ATOM 3260  C CD2   . LEU E 1 92  ? 104.45600 134.26500 109.06100 1.000 34.79875  ? 92  LEU E CD2   1 
ATOM 3261  N N     . ALA E 1 93  ? 102.72600 128.99000 109.96600 1.000 33.66588  ? 93  ALA E N     1 
ATOM 3262  C CA    . ALA E 1 93  ? 103.29600 127.65000 110.08400 1.000 33.66588  ? 93  ALA E CA    1 
ATOM 3263  C C     . ALA E 1 93  ? 102.64700 126.69300 109.09700 1.000 33.66588  ? 93  ALA E C     1 
ATOM 3264  O O     . ALA E 1 93  ? 103.34000 125.91800 108.42200 1.000 33.66588  ? 93  ALA E O     1 
ATOM 3265  C CB    . ALA E 1 93  ? 103.13400 127.13100 111.51100 1.000 33.66588  ? 93  ALA E CB    1 
ATOM 3266  N N     . LEU E 1 94  ? 101.32400 126.77000 108.97400 1.000 31.62609  ? 94  LEU E N     1 
ATOM 3267  C CA    . LEU E 1 94  ? 100.61200 125.95100 108.00500 1.000 31.62609  ? 94  LEU E CA    1 
ATOM 3268  C C     . LEU E 1 94  ? 100.97900 126.32800 106.57600 1.000 31.62609  ? 94  LEU E C     1 
ATOM 3269  O O     . LEU E 1 94  ? 101.08400 125.45400 105.71000 1.000 31.62609  ? 94  LEU E O     1 
ATOM 3270  C CB    . LEU E 1 94  ? 99.11200  126.08300 108.23400 1.000 31.62609  ? 94  LEU E CB    1 
ATOM 3271  C CG    . LEU E 1 94  ? 98.21800  125.16200 107.42200 1.000 31.62609  ? 94  LEU E CG    1 
ATOM 3272  C CD1   . LEU E 1 94  ? 98.36600  123.74700 107.90600 1.000 31.62609  ? 94  LEU E CD1   1 
ATOM 3273  C CD2   . LEU E 1 94  ? 96.78800  125.62000 107.52500 1.000 31.62609  ? 94  LEU E CD2   1 
ATOM 3274  N N     . GLN E 1 95  ? 101.21500 127.61500 106.31000 1.000 35.86055  ? 95  GLN E N     1 
ATOM 3275  C CA    . GLN E 1 95  ? 101.54600 128.01700 104.94800 1.000 35.86055  ? 95  GLN E CA    1 
ATOM 3276  C C     . GLN E 1 95  ? 102.96700 127.62400 104.56900 1.000 35.86055  ? 95  GLN E C     1 
ATOM 3277  O O     . GLN E 1 95  ? 103.21200 127.23200 103.42400 1.000 35.86055  ? 95  GLN E O     1 
ATOM 3278  C CB    . GLN E 1 95  ? 101.33500 129.51600 104.78200 1.000 35.86055  ? 95  GLN E CB    1 
ATOM 3279  C CG    . GLN E 1 95  ? 101.34100 129.96200 103.34600 1.000 35.86055  ? 95  GLN E CG    1 
ATOM 3280  C CD    . GLN E 1 95  ? 100.84400 131.36700 103.18600 1.000 35.86055  ? 95  GLN E CD    1 
ATOM 3281  O OE1   . GLN E 1 95  ? 100.03400 131.84400 103.97900 1.000 35.86055  ? 95  GLN E OE1   1 
ATOM 3282  N NE2   . GLN E 1 95  ? 101.33500 132.05100 102.16600 1.000 35.86055  ? 95  GLN E NE2   1 
ATOM 3283  N N     . GLU E 1 96  ? 103.90900 127.68900 105.51500 1.000 35.34747  ? 96  GLU E N     1 
ATOM 3284  C CA    . GLU E 1 96  ? 105.25200 127.17500 105.26100 1.000 35.34747  ? 96  GLU E CA    1 
ATOM 3285  C C     . GLU E 1 96  ? 105.23800 125.67000 105.02900 1.000 35.34747  ? 96  GLU E C     1 
ATOM 3286  O O     . GLU E 1 96  ? 105.93100 125.17200 104.13400 1.000 35.34747  ? 96  GLU E O     1 
ATOM 3287  C CB    . GLU E 1 96  ? 106.19700 127.52900 106.41100 1.000 35.34747  ? 96  GLU E CB    1 
ATOM 3288  C CG    . GLU E 1 96  ? 106.51700 129.01600 106.57700 1.000 35.34747  ? 96  GLU E CG    1 
ATOM 3289  C CD    . GLU E 1 96  ? 107.56500 129.55800 105.62000 1.000 35.34747  ? 96  GLU E CD    1 
ATOM 3290  O OE1   . GLU E 1 96  ? 107.95000 128.87200 104.65100 1.000 35.34747  ? 96  GLU E OE1   1 
ATOM 3291  O OE2   . GLU E 1 96  ? 108.00800 130.70300 105.85000 1.000 35.34747  ? 96  GLU E OE2   1 
ATOM 3292  N N     . ALA E 1 97  ? 104.44700 124.93000 105.81500 1.000 33.38681  ? 97  ALA E N     1 
ATOM 3293  C CA    . ALA E 1 97  ? 104.35600 123.48600 105.61500 1.000 33.38681  ? 97  ALA E CA    1 
ATOM 3294  C C     . ALA E 1 97  ? 103.72400 123.12700 104.27400 1.000 33.38681  ? 97  ALA E C     1 
ATOM 3295  O O     . ALA E 1 97  ? 104.22100 122.23700 103.57500 1.000 33.38681  ? 97  ALA E O     1 
ATOM 3296  C CB    . ALA E 1 97  ? 103.56500 122.85300 106.74800 1.000 33.38681  ? 97  ALA E CB    1 
ATOM 3297  N N     . ALA E 1 98  ? 102.64700 123.82000 103.88700 1.000 33.01006  ? 98  ALA E N     1 
ATOM 3298  C CA    . ALA E 1 98  ? 101.98900 123.52700 102.61500 1.000 33.01006  ? 98  ALA E CA    1 
ATOM 3299  C C     . ALA E 1 98  ? 102.85900 123.92400 101.43100 1.000 33.01006  ? 98  ALA E C     1 
ATOM 3300  O O     . ALA E 1 98  ? 102.89900 123.21300 100.42000 1.000 33.01006  ? 98  ALA E O     1 
ATOM 3301  C CB    . ALA E 1 98  ? 100.64000 124.23400 102.54700 1.000 33.01006  ? 98  ALA E CB    1 
ATOM 3302  N N     . GLU E 1 99  ? 103.58300 125.04000 101.55200 1.000 34.71388  ? 99  GLU E N     1 
ATOM 3303  C CA    . GLU E 1 99  ? 104.50700 125.46900 100.51100 1.000 34.71388  ? 99  GLU E CA    1 
ATOM 3304  C C     . GLU E 1 99  ? 105.66200 124.48800 100.34800 1.000 34.71388  ? 99  GLU E C     1 
ATOM 3305  O O     . GLU E 1 99  ? 106.01200 124.12800 99.21800  1.000 34.71388  ? 99  GLU E O     1 
ATOM 3306  C CB    . GLU E 1 99  ? 105.01000 126.87900 100.83400 1.000 34.71388  ? 99  GLU E CB    1 
ATOM 3307  C CG    . GLU E 1 99  ? 106.03100 127.45400 99.86200  1.000 34.71388  ? 99  GLU E CG    1 
ATOM 3308  C CD    . GLU E 1 99  ? 107.41600 127.54400 100.47500 1.000 34.71388  ? 99  GLU E CD    1 
ATOM 3309  O OE1   . GLU E 1 99  ? 107.50300 127.72800 101.70600 1.000 34.71388  ? 99  GLU E OE1   1 
ATOM 3310  O OE2   . GLU E 1 99  ? 108.41800 127.41400 99.74400  1.000 34.71388  ? 99  GLU E OE2   1 
ATOM 3311  N N     . ALA E 1 100 ? 106.22700 123.99500 101.45500 1.000 33.16186  ? 100 ALA E N     1 
ATOM 3312  C CA    . ALA E 1 100 ? 107.32500 123.03700 101.35400 1.000 33.16186  ? 100 ALA E CA    1 
ATOM 3313  C C     . ALA E 1 100 ? 106.84700 121.69100 100.82500 1.000 33.16186  ? 100 ALA E C     1 
ATOM 3314  O O     . ALA E 1 100 ? 107.55500 121.04400 100.04000 1.000 33.16186  ? 100 ALA E O     1 
ATOM 3315  C CB    . ALA E 1 100 ? 107.99800 122.86900 102.71000 1.000 33.16186  ? 100 ALA E CB    1 
ATOM 3316  N N     . PHE E 1 101 ? 105.62700 121.28800 101.19600 1.000 31.79887  ? 101 PHE E N     1 
ATOM 3317  C CA    . PHE E 1 101 ? 105.04300 120.05500 100.67700 1.000 31.79887  ? 101 PHE E CA    1 
ATOM 3318  C C     . PHE E 1 101 ? 104.80000 120.14100 99.17800  1.000 31.79887  ? 101 PHE E C     1 
ATOM 3319  O O     . PHE E 1 101 ? 105.09000 119.19000 98.44400  1.000 31.79887  ? 101 PHE E O     1 
ATOM 3320  C CB    . PHE E 1 101 ? 103.74000 119.75400 101.41400 1.000 31.79887  ? 101 PHE E CB    1 
ATOM 3321  C CG    . PHE E 1 101 ? 102.96600 118.59800 100.84800 1.000 31.79887  ? 101 PHE E CG    1 
ATOM 3322  C CD1   . PHE E 1 101 ? 103.35000 117.29800 101.11800 1.000 31.79887  ? 101 PHE E CD1   1 
ATOM 3323  C CD2   . PHE E 1 101 ? 101.83500 118.81200 100.07200 1.000 31.79887  ? 101 PHE E CD2   1 
ATOM 3324  C CE1   . PHE E 1 101 ? 102.63600 116.23500 100.60900 1.000 31.79887  ? 101 PHE E CE1   1 
ATOM 3325  C CE2   . PHE E 1 101 ? 101.12300 117.75400 99.55900  1.000 31.79887  ? 101 PHE E CE2   1 
ATOM 3326  C CZ    . PHE E 1 101 ? 101.52200 116.46500 99.82900  1.000 31.79887  ? 101 PHE E CZ    1 
ATOM 3327  N N     . LEU E 1 102 ? 104.28600 121.27600 98.70200  1.000 31.94048  ? 102 LEU E N     1 
ATOM 3328  C CA    . LEU E 1 102 ? 104.01800 121.40500 97.27700  1.000 31.94048  ? 102 LEU E CA    1 
ATOM 3329  C C     . LEU E 1 102 ? 105.29900 121.50500 96.45900  1.000 31.94048  ? 102 LEU E C     1 
ATOM 3330  O O     . LEU E 1 102 ? 105.36000 120.95200 95.35500  1.000 31.94048  ? 102 LEU E O     1 
ATOM 3331  C CB    . LEU E 1 102 ? 103.11800 122.60500 97.02200  1.000 31.94048  ? 102 LEU E CB    1 
ATOM 3332  C CG    . LEU E 1 102 ? 101.64700 122.23900 97.16600  1.000 31.94048  ? 102 LEU E CG    1 
ATOM 3333  C CD1   . LEU E 1 102 ? 100.78600 123.46700 97.01800  1.000 31.94048  ? 102 LEU E CD1   1 
ATOM 3334  C CD2   . LEU E 1 102 ? 101.27200 121.19500 96.13300  1.000 31.94048  ? 102 LEU E CD2   1 
ATOM 3335  N N     . VAL E 1 103 ? 106.34400 122.14800 96.98800  1.000 31.42938  ? 103 VAL E N     1 
ATOM 3336  C CA    . VAL E 1 103 ? 107.60200 122.20100 96.24600  1.000 31.42938  ? 103 VAL E CA    1 
ATOM 3337  C C     . VAL E 1 103 ? 108.26000 120.82300 96.19200  1.000 31.42938  ? 103 VAL E C     1 
ATOM 3338  O O     . VAL E 1 103 ? 108.77900 120.41500 95.14400  1.000 31.42938  ? 103 VAL E O     1 
ATOM 3339  C CB    . VAL E 1 103 ? 108.53900 123.27000 96.83800  1.000 31.42938  ? 103 VAL E CB    1 
ATOM 3340  C CG1   . VAL E 1 103 ? 109.85600 123.28500 96.11000  1.000 31.42938  ? 103 VAL E CG1   1 
ATOM 3341  C CG2   . VAL E 1 103 ? 107.92300 124.63600 96.67900  1.000 31.42938  ? 103 VAL E CG2   1 
ATOM 3342  N N     . HIS E 1 104 ? 108.20900 120.06100 97.29300  1.000 34.55694  ? 104 HIS E N     1 
ATOM 3343  C CA    . HIS E 1 104 ? 108.80100 118.72200 97.27500  1.000 34.55694  ? 104 HIS E CA    1 
ATOM 3344  C C     . HIS E 1 104 ? 108.02100 117.77400 96.36600  1.000 34.55694  ? 104 HIS E C     1 
ATOM 3345  O O     . HIS E 1 104 ? 108.62000 116.95600 95.64700  1.000 34.55694  ? 104 HIS E O     1 
ATOM 3346  C CB    . HIS E 1 104 ? 108.88900 118.16600 98.69300  1.000 34.55694  ? 104 HIS E CB    1 
ATOM 3347  C CG    . HIS E 1 104 ? 109.96000 117.13400 98.86800  1.000 34.55694  ? 104 HIS E CG    1 
ATOM 3348  N ND1   . HIS E 1 104 ? 109.96900 115.94400 98.17200  1.000 34.55694  ? 104 HIS E ND1   1 
ATOM 3349  C CD2   . HIS E 1 104 ? 111.06700 117.12100 99.64700  1.000 34.55694  ? 104 HIS E CD2   1 
ATOM 3350  C CE1   . HIS E 1 104 ? 111.02800 115.23800 98.52200  1.000 34.55694  ? 104 HIS E CE1   1 
ATOM 3351  N NE2   . HIS E 1 104 ? 111.71200 115.93000 99.41500  1.000 34.55694  ? 104 HIS E NE2   1 
ATOM 3352  N N     . LEU E 1 105 ? 106.69000 117.89200 96.35800  1.000 31.50116  ? 105 LEU E N     1 
ATOM 3353  C CA    . LEU E 1 105 ? 105.88200 117.09400 95.44700  1.000 31.50116  ? 105 LEU E CA    1 
ATOM 3354  C C     . LEU E 1 105 ? 106.13500 117.47000 93.99400  1.000 31.50116  ? 105 LEU E C     1 
ATOM 3355  O O     . LEU E 1 105 ? 106.13600 116.59300 93.12600  1.000 31.50116  ? 105 LEU E O     1 
ATOM 3356  C CB    . LEU E 1 105 ? 104.40400 117.25700 95.78000  1.000 31.50116  ? 105 LEU E CB    1 
ATOM 3357  C CG    . LEU E 1 105 ? 103.41600 116.45100 94.94400  1.000 31.50116  ? 105 LEU E CG    1 
ATOM 3358  C CD1   . LEU E 1 105 ? 103.76500 114.98500 94.98500  1.000 31.50116  ? 105 LEU E CD1   1 
ATOM 3359  C CD2   . LEU E 1 105 ? 102.02400 116.66800 95.44800  1.000 31.50116  ? 105 LEU E CD2   1 
ATOM 3360  N N     . PHE E 1 106 ? 106.39500 118.74600 93.71100  1.000 32.17968  ? 106 PHE E N     1 
ATOM 3361  C CA    . PHE E 1 106 ? 106.66500 119.12400 92.33100  1.000 32.17968  ? 106 PHE E CA    1 
ATOM 3362  C C     . PHE E 1 106 ? 108.05500 118.68700 91.88600  1.000 32.17968  ? 106 PHE E C     1 
ATOM 3363  O O     . PHE E 1 106 ? 108.24700 118.37200 90.70700  1.000 32.17968  ? 106 PHE E O     1 
ATOM 3364  C CB    . PHE E 1 106 ? 106.47800 120.62400 92.16000  1.000 32.17968  ? 106 PHE E CB    1 
ATOM 3365  C CG    . PHE E 1 106 ? 105.05200 121.02200 91.94200  1.000 32.17968  ? 106 PHE E CG    1 
ATOM 3366  C CD1   . PHE E 1 106 ? 104.21700 120.23200 91.17800  1.000 32.17968  ? 106 PHE E CD1   1 
ATOM 3367  C CD2   . PHE E 1 106 ? 104.54600 122.17900 92.50100  1.000 32.17968  ? 106 PHE E CD2   1 
ATOM 3368  C CE1   . PHE E 1 106 ? 102.90600 120.59000 90.97200  1.000 32.17968  ? 106 PHE E CE1   1 
ATOM 3369  C CE2   . PHE E 1 106 ? 103.23700 122.54100 92.30000  1.000 32.17968  ? 106 PHE E CE2   1 
ATOM 3370  C CZ    . PHE E 1 106 ? 102.41500 121.74500 91.53600  1.000 32.17968  ? 106 PHE E CZ    1 
ATOM 3371  N N     . GLU E 1 107 ? 109.01400 118.60000 92.81300  1.000 33.42704  ? 107 GLU E N     1 
ATOM 3372  C CA    . GLU E 1 107 ? 110.30700 117.99200 92.49400  1.000 33.42704  ? 107 GLU E CA    1 
ATOM 3373  C C     . GLU E 1 107 ? 110.16000 116.51400 92.14100  1.000 33.42704  ? 107 GLU E C     1 
ATOM 3374  O O     . GLU E 1 107 ? 110.72300 116.04300 91.14100  1.000 33.42704  ? 107 GLU E O     1 
ATOM 3375  C CB    . GLU E 1 107 ? 111.27600 118.15200 93.66400  1.000 33.42704  ? 107 GLU E CB    1 
ATOM 3376  C CG    . GLU E 1 107 ? 111.71400 119.57200 93.94000  1.000 33.42704  ? 107 GLU E CG    1 
ATOM 3377  C CD    . GLU E 1 107 ? 112.52600 119.68800 95.21400  1.000 33.42704  ? 107 GLU E CD    1 
ATOM 3378  O OE1   . GLU E 1 107 ? 113.00500 120.79900 95.52100  1.000 33.42704  ? 107 GLU E OE1   1 
ATOM 3379  O OE2   . GLU E 1 107 ? 112.68500 118.66500 95.91100  1.000 33.42704  ? 107 GLU E OE2   1 
ATOM 3380  N N     . ASP E 1 108 ? 109.40100 115.76600 92.95200  1.000 33.73859  ? 108 ASP E N     1 
ATOM 3381  C CA    . ASP E 1 108 ? 109.20400 114.34000 92.68100  1.000 33.73859  ? 108 ASP E CA    1 
ATOM 3382  C C     . ASP E 1 108 ? 108.43000 114.10700 91.38600  1.000 33.73859  ? 108 ASP E C     1 
ATOM 3383  O O     . ASP E 1 108 ? 108.79100 113.23500 90.57700  1.000 33.73859  ? 108 ASP E O     1 
ATOM 3384  C CB    . ASP E 1 108 ? 108.48100 113.68800 93.85200  1.000 33.73859  ? 108 ASP E CB    1 
ATOM 3385  C CG    . ASP E 1 108 ? 109.34200 113.60300 95.08700  1.000 33.73859  ? 108 ASP E CG    1 
ATOM 3386  O OD1   . ASP E 1 108 ? 110.55500 113.88000 94.98700  1.000 33.73859  ? 108 ASP E OD1   1 
ATOM 3387  O OD2   . ASP E 1 108 ? 108.81100 113.25400 96.15800  1.000 33.73859  ? 108 ASP E OD2   1 
ATOM 3388  N N     . ALA E 1 109 ? 107.38800 114.90500 91.15500  1.000 32.12844  ? 109 ALA E N     1 
ATOM 3389  C CA    . ALA E 1 109 ? 106.60900 114.77200 89.93600  1.000 32.12844  ? 109 ALA E CA    1 
ATOM 3390  C C     . ALA E 1 109 ? 107.40200 115.20000 88.71200  1.000 32.12844  ? 109 ALA E C     1 
ATOM 3391  O O     . ALA E 1 109 ? 107.19300 114.65400 87.62500  1.000 32.12844  ? 109 ALA E O     1 
ATOM 3392  C CB    . ALA E 1 109 ? 105.32500 115.58300 90.05600  1.000 32.12844  ? 109 ALA E CB    1 
ATOM 3393  N N     . TYR E 1 110 ? 108.36300 116.11000 88.86700  1.000 32.56438  ? 110 TYR E N     1 
ATOM 3394  C CA    . TYR E 1 110 ? 109.17200 116.44400 87.70800  1.000 32.56438  ? 110 TYR E CA    1 
ATOM 3395  C C     . TYR E 1 110 ? 110.23800 115.39800 87.43500  1.000 32.56438  ? 110 TYR E C     1 
ATOM 3396  O O     . TYR E 1 110 ? 110.63800 115.23000 86.27800  1.000 32.56438  ? 110 TYR E O     1 
ATOM 3397  C CB    . TYR E 1 110 ? 109.81800 117.81100 87.86200  1.000 32.56438  ? 110 TYR E CB    1 
ATOM 3398  C CG    . TYR E 1 110 ? 110.08100 118.39600 86.51400  1.000 32.56438  ? 110 TYR E CG    1 
ATOM 3399  C CD1   . TYR E 1 110 ? 109.03400 118.63600 85.64900  1.000 32.56438  ? 110 TYR E CD1   1 
ATOM 3400  C CD2   . TYR E 1 110 ? 111.36700 118.66900 86.08600  1.000 32.56438  ? 110 TYR E CD2   1 
ATOM 3401  C CE1   . TYR E 1 110 ? 109.24800 119.14400 84.41000  1.000 32.56438  ? 110 TYR E CE1   1 
ATOM 3402  C CE2   . TYR E 1 110 ? 111.59300 119.18500 84.83300  1.000 32.56438  ? 110 TYR E CE2   1 
ATOM 3403  C CZ    . TYR E 1 110 ? 110.52400 119.42100 84.00300  1.000 32.56438  ? 110 TYR E CZ    1 
ATOM 3404  O OH    . TYR E 1 110 ? 110.72700 119.93800 82.75200  1.000 32.56438  ? 110 TYR E OH    1 
ATOM 3405  N N     . LEU E 1 111 ? 110.69500 114.68200 88.46700  1.000 30.96456  ? 111 LEU E N     1 
ATOM 3406  C CA    . LEU E 1 111 ? 111.53700 113.51500 88.21300  1.000 30.96456  ? 111 LEU E CA    1 
ATOM 3407  C C     . LEU E 1 111 ? 110.77900 112.45700 87.42800  1.000 30.96456  ? 111 LEU E C     1 
ATOM 3408  O O     . LEU E 1 111 ? 111.33300 111.84600 86.50600  1.000 30.96456  ? 111 LEU E O     1 
ATOM 3409  C CB    . LEU E 1 111 ? 112.05400 112.91500 89.51600  1.000 30.96456  ? 111 LEU E CB    1 
ATOM 3410  C CG    . LEU E 1 111 ? 113.02600 113.73300 90.34700  1.000 30.96456  ? 111 LEU E CG    1 
ATOM 3411  C CD1   . LEU E 1 111 ? 113.34800 112.98100 91.61200  1.000 30.96456  ? 111 LEU E CD1   1 
ATOM 3412  C CD2   . LEU E 1 111 ? 114.27600 113.98700 89.54800  1.000 30.96456  ? 111 LEU E CD2   1 
ATOM 3413  N N     . LEU E 1 112 ? 109.50400 112.24200 87.76400  1.000 31.54178  ? 112 LEU E N     1 
ATOM 3414  C CA    . LEU E 1 112 ? 108.71000 111.28100 86.99600  1.000 31.54178  ? 112 LEU E CA    1 
ATOM 3415  C C     . LEU E 1 112 ? 108.46000 111.77300 85.57000  1.000 31.54178  ? 112 LEU E C     1 
ATOM 3416  O O     . LEU E 1 112 ? 108.40800 110.97100 84.62700  1.000 31.54178  ? 112 LEU E O     1 
ATOM 3417  C CB    . LEU E 1 112 ? 107.38200 110.99600 87.68200  1.000 31.54178  ? 112 LEU E CB    1 
ATOM 3418  C CG    . LEU E 1 112 ? 107.43400 110.53200 89.13100  1.000 31.54178  ? 112 LEU E CG    1 
ATOM 3419  C CD1   . LEU E 1 112 ? 106.04900 110.19500 89.60000  1.000 31.54178  ? 112 LEU E CD1   1 
ATOM 3420  C CD2   . LEU E 1 112 ? 108.40500 109.44000 89.40900  1.000 31.54178  ? 112 LEU E CD2   1 
ATOM 3421  N N     . THR E 1 113 ? 108.27400 113.08700 85.40600  1.000 33.01865  ? 113 THR E N     1 
ATOM 3422  C CA    . THR E 1 113 ? 108.07700 113.67900 84.08500  1.000 33.01865  ? 113 THR E CA    1 
ATOM 3423  C C     . THR E 1 113 ? 109.29800 113.46800 83.20000  1.000 33.01865  ? 113 THR E C     1 
ATOM 3424  O O     . THR E 1 113 ? 109.17800 113.02900 82.05200  1.000 33.01865  ? 113 THR E O     1 
ATOM 3425  C CB    . THR E 1 113 ? 107.76500 115.16700 84.23100  1.000 33.01865  ? 113 THR E CB    1 
ATOM 3426  O OG1   . THR E 1 113 ? 106.42600 115.31600 84.70100  1.000 33.01865  ? 113 THR E OG1   1 
ATOM 3427  C CG2   . THR E 1 113 ? 107.89900 115.89200 82.91600  1.000 33.01865  ? 113 THR E CG2   1 
ATOM 3428  N N     . LEU E 1 114 ? 110.48800 113.75600 83.72800  1.000 32.55105  ? 114 LEU E N     1 
ATOM 3429  C CA    . LEU E 1 114 ? 111.71200 113.50200 82.97900  1.000 32.55105  ? 114 LEU E CA    1 
ATOM 3430  C C     . LEU E 1 114 ? 111.98100 112.01100 82.79000  1.000 32.55105  ? 114 LEU E C     1 
ATOM 3431  O O     . LEU E 1 114 ? 112.70900 111.64000 81.86400  1.000 32.55105  ? 114 LEU E O     1 
ATOM 3432  C CB    . LEU E 1 114 ? 112.89100 114.16700 83.67900  1.000 32.55105  ? 114 LEU E CB    1 
ATOM 3433  C CG    . LEU E 1 114 ? 112.76700 115.68300 83.79500  1.000 32.55105  ? 114 LEU E CG    1 
ATOM 3434  C CD1   . LEU E 1 114 ? 113.81600 116.22300 84.73900  1.000 32.55105  ? 114 LEU E CD1   1 
ATOM 3435  C CD2   . LEU E 1 114 ? 112.87700 116.33500 82.44100  1.000 32.55105  ? 114 LEU E CD2   1 
ATOM 3436  N N     . HIS E 1 115 ? 111.41500 111.15300 83.64600  1.000 33.34920  ? 115 HIS E N     1 
ATOM 3437  C CA    . HIS E 1 115 ? 111.45900 109.71400 83.40000  1.000 33.34920  ? 115 HIS E CA    1 
ATOM 3438  C C     . HIS E 1 115 ? 110.61000 109.32400 82.20300  1.000 33.34920  ? 115 HIS E C     1 
ATOM 3439  O O     . HIS E 1 115 ? 110.98600 108.43300 81.43400  1.000 33.34920  ? 115 HIS E O     1 
ATOM 3440  C CB    . HIS E 1 115 ? 110.97500 108.95500 84.62600  1.000 33.34920  ? 115 HIS E CB    1 
ATOM 3441  C CG    . HIS E 1 115 ? 111.19200 107.47900 84.55200  1.000 33.34920  ? 115 HIS E CG    1 
ATOM 3442  N ND1   . HIS E 1 115 ? 110.14800 106.58000 84.53500  1.000 33.34920  ? 115 HIS E ND1   1 
ATOM 3443  C CD2   . HIS E 1 115 ? 112.32400 106.74000 84.52000  1.000 33.34920  ? 115 HIS E CD2   1 
ATOM 3444  C CE1   . HIS E 1 115 ? 110.62800 105.35200 84.48000  1.000 33.34920  ? 115 HIS E CE1   1 
ATOM 3445  N NE2   . HIS E 1 115 ? 111.94600 105.42100 84.47500  1.000 33.34920  ? 115 HIS E NE2   1 
ATOM 3446  N N     . ALA E 1 116 ? 109.46500 109.97600 82.02300  1.000 32.13697  ? 116 ALA E N     1 
ATOM 3447  C CA    . ALA E 1 116 ? 108.56000 109.59300 80.94600  1.000 32.13697  ? 116 ALA E CA    1 
ATOM 3448  C C     . ALA E 1 116 ? 108.99000 110.11100 79.58000  1.000 32.13697  ? 116 ALA E C     1 
ATOM 3449  O O     . ALA E 1 116 ? 108.27500 109.88200 78.60200  1.000 32.13697  ? 116 ALA E O     1 
ATOM 3450  C CB    . ALA E 1 116 ? 107.14500 110.08000 81.25000  1.000 32.13697  ? 116 ALA E CB    1 
ATOM 3451  N N     . GLY E 1 117 ? 110.12200 110.79900 79.48600  1.000 34.44788  ? 117 GLY E N     1 
ATOM 3452  C CA    . GLY E 1 117 ? 110.54200 111.40400 78.23900  1.000 34.44788  ? 117 GLY E CA    1 
ATOM 3453  C C     . GLY E 1 117 ? 109.78700 112.67000 77.92200  1.000 34.44788  ? 117 GLY E C     1 
ATOM 3454  O O     . GLY E 1 117 ? 109.40700 112.89300 76.76700  1.000 34.44788  ? 117 GLY E O     1 
ATOM 3455  N N     . ARG E 1 118 ? 109.55400 113.51100 78.92400  1.000 36.45678  ? 118 ARG E N     1 
ATOM 3456  C CA    . ARG E 1 118 ? 108.79000 114.73400 78.76100  1.000 36.45678  ? 118 ARG E CA    1 
ATOM 3457  C C     . ARG E 1 118 ? 109.48600 115.85800 79.50500  1.000 36.45678  ? 118 ARG E C     1 
ATOM 3458  O O     . ARG E 1 118 ? 110.33900 115.62600 80.36100  1.000 36.45678  ? 118 ARG E O     1 
ATOM 3459  C CB    . ARG E 1 118 ? 107.36700 114.57400 79.29700  1.000 36.45678  ? 118 ARG E CB    1 
ATOM 3460  C CG    . ARG E 1 118 ? 106.45300 113.74700 78.43300  1.000 36.45678  ? 118 ARG E CG    1 
ATOM 3461  C CD    . ARG E 1 118 ? 105.04500 113.85600 78.94700  1.000 36.45678  ? 118 ARG E CD    1 
ATOM 3462  N NE    . ARG E 1 118 ? 104.72700 112.80200 79.90300  1.000 36.45678  ? 118 ARG E NE    1 
ATOM 3463  C CZ    . ARG E 1 118 ? 104.69200 112.97100 81.21900  1.000 36.45678  ? 118 ARG E CZ    1 
ATOM 3464  N NH1   . ARG E 1 118 ? 104.95900 114.15400 81.74500  1.000 36.45678  ? 118 ARG E NH1   1 
ATOM 3465  N NH2   . ARG E 1 118 ? 104.38600 111.95800 82.01000  1.000 36.45678  ? 118 ARG E NH2   1 
ATOM 3466  N N     . VAL E 1 119 ? 109.10900 117.08900 79.17100  1.000 39.56402  ? 119 VAL E N     1 
ATOM 3467  C CA    . VAL E 1 119 ? 109.44200 118.24700 79.99100  1.000 39.56402  ? 119 VAL E CA    1 
ATOM 3468  C C     . VAL E 1 119 ? 108.20800 118.94400 80.53800  1.000 39.56402  ? 119 VAL E C     1 
ATOM 3469  O O     . VAL E 1 119 ? 108.33900 119.77300 81.44800  1.000 39.56402  ? 119 VAL E O     1 
ATOM 3470  C CB    . VAL E 1 119 ? 110.32500 119.26000 79.23200  1.000 39.56402  ? 119 VAL E CB    1 
ATOM 3471  C CG1   . VAL E 1 119 ? 111.57600 118.58900 78.70800  1.000 39.56402  ? 119 VAL E CG1   1 
ATOM 3472  C CG2   . VAL E 1 119 ? 109.55800 119.89200 78.10500  1.000 39.56402  ? 119 VAL E CG2   1 
ATOM 3473  N N     . THR E 1 120 ? 107.02300 118.64500 80.01800  1.000 39.30624  ? 120 THR E N     1 
ATOM 3474  C CA    . THR E 1 120 ? 105.78500 119.24300 80.49500  1.000 39.30624  ? 120 THR E CA    1 
ATOM 3475  C C     . THR E 1 120 ? 105.24700 118.40900 81.64700  1.000 39.30624  ? 120 THR E C     1 
ATOM 3476  O O     . THR E 1 120 ? 105.02600 117.20600 81.49400  1.000 39.30624  ? 120 THR E O     1 
ATOM 3477  C CB    . THR E 1 120 ? 104.76200 119.33400 79.36500  1.000 39.30624  ? 120 THR E CB    1 
ATOM 3478  O OG1   . THR E 1 120 ? 105.25200 120.21700 78.35200  1.000 39.30624  ? 120 THR E OG1   1 
ATOM 3479  C CG2   . THR E 1 120 ? 103.44000 119.85300 79.87100  1.000 39.30624  ? 120 THR E CG2   1 
ATOM 3480  N N     . LEU E 1 121 ? 105.05800 119.04000 82.80100  1.000 35.10314  ? 121 LEU E N     1 
ATOM 3481  C CA    . LEU E 1 121 ? 104.50300 118.33900 83.94800  1.000 35.10314  ? 121 LEU E CA    1 
ATOM 3482  C C     . LEU E 1 121 ? 103.02300 118.05800 83.72300  1.000 35.10314  ? 121 LEU E C     1 
ATOM 3483  O O     . LEU E 1 121 ? 102.25100 118.96600 83.41600  1.000 35.10314  ? 121 LEU E O     1 
ATOM 3484  C CB    . LEU E 1 121 ? 104.71000 119.17100 85.20600  1.000 35.10314  ? 121 LEU E CB    1 
ATOM 3485  C CG    . LEU E 1 121 ? 104.21600 118.61100 86.52900  1.000 35.10314  ? 121 LEU E CG    1 
ATOM 3486  C CD1   . LEU E 1 121 ? 104.95900 117.35900 86.83300  1.000 35.10314  ? 121 LEU E CD1   1 
ATOM 3487  C CD2   . LEU E 1 121 ? 104.44700 119.62100 87.62000  1.000 35.10314  ? 121 LEU E CD2   1 
ATOM 3488  N N     . PHE E 1 122 ? 102.62200 116.80700 83.91400  1.000 36.78377  ? 122 PHE E N     1 
ATOM 3489  C CA    . PHE E 1 122 ? 101.27000 116.33300 83.69000  1.000 36.78377  ? 122 PHE E CA    1 
ATOM 3490  C C     . PHE E 1 122 ? 100.67000 115.80700 84.98600  1.000 36.78377  ? 122 PHE E C     1 
ATOM 3491  O O     . PHE E 1 122 ? 101.39900 115.25600 85.81200  1.000 36.78377  ? 122 PHE E O     1 
ATOM 3492  C CB    . PHE E 1 122 ? 101.24100 115.22700 82.62500  1.000 36.78377  ? 122 PHE E CB    1 
ATOM 3493  C CG    . PHE E 1 122 ? 101.19900 115.74200 81.22300  1.000 36.78377  ? 122 PHE E CG    1 
ATOM 3494  C CD1   . PHE E 1 122 ? 100.05200 116.32400 80.72500  1.000 36.78377  ? 122 PHE E CD1   1 
ATOM 3495  C CD2   . PHE E 1 122 ? 102.30400 115.64900 80.40700  1.000 36.78377  ? 122 PHE E CD2   1 
ATOM 3496  C CE1   . PHE E 1 122 ? 100.01000 116.79900 79.43800  1.000 36.78377  ? 122 PHE E CE1   1 
ATOM 3497  C CE2   . PHE E 1 122 ? 102.26800 116.12400 79.12400  1.000 36.78377  ? 122 PHE E CE2   1 
ATOM 3498  C CZ    . PHE E 1 122 ? 101.12100 116.69900 78.63900  1.000 36.78377  ? 122 PHE E CZ    1 
ATOM 3499  N N     . PRO E 1 123 ? 99.37000  116.02900 85.22400  1.000 34.57325  ? 123 PRO E N     1 
ATOM 3500  C CA    . PRO E 1 123 ? 98.75000  115.57900 86.48400  1.000 34.57325  ? 123 PRO E CA    1 
ATOM 3501  C C     . PRO E 1 123 ? 98.82400  114.08300 86.75600  1.000 34.57325  ? 123 PRO E C     1 
ATOM 3502  O O     . PRO E 1 123 ? 98.71800  113.68400 87.92300  1.000 34.57325  ? 123 PRO E O     1 
ATOM 3503  C CB    . PRO E 1 123 ? 97.29800  116.03700 86.32800  1.000 34.57325  ? 123 PRO E CB    1 
ATOM 3504  C CG    . PRO E 1 123 ? 97.09000  116.16300 84.87700  1.000 34.57325  ? 123 PRO E CG    1 
ATOM 3505  C CD    . PRO E 1 123 ? 98.38000  116.64800 84.32900  1.000 34.57325  ? 123 PRO E CD    1 
ATOM 3506  N N     . LYS E 1 124 ? 99.04400  113.25000 85.73500  1.000 34.36217  ? 124 LYS E N     1 
ATOM 3507  C CA    . LYS E 1 124 ? 99.36100  111.84500 85.96900  1.000 34.36217  ? 124 LYS E CA    1 
ATOM 3508  C C     . LYS E 1 124 ? 100.69800 111.66800 86.67800  1.000 34.36217  ? 124 LYS E C     1 
ATOM 3509  O O     . LYS E 1 124 ? 100.85700 110.72500 87.46000  1.000 34.36217  ? 124 LYS E O     1 
ATOM 3510  C CB    . LYS E 1 124 ? 99.34100  111.08400 84.64500  1.000 34.36217  ? 124 LYS E CB    1 
ATOM 3511  C CG    . LYS E 1 124 ? 100.15100 111.73800 83.54500  1.000 34.36217  ? 124 LYS E CG    1 
ATOM 3512  C CD    . LYS E 1 124 ? 100.04200 110.98600 82.23100  1.000 34.36217  ? 124 LYS E CD    1 
ATOM 3513  C CE    . LYS E 1 124 ? 100.67100 109.61200 82.32900  1.000 34.36217  ? 124 LYS E CE    1 
ATOM 3514  N NZ    . LYS E 1 124 ? 100.56600 108.86900 81.04800  1.000 34.36217  ? 124 LYS E NZ    1 
ATOM 3515  N N     . ASP E 1 125 ? 101.64000 112.59600 86.48700  1.000 33.60028  ? 125 ASP E N     1 
ATOM 3516  C CA    . ASP E 1 125 ? 102.91300 112.50200 87.19400  1.000 33.60028  ? 125 ASP E CA    1 
ATOM 3517  C C     . ASP E 1 125 ? 102.76700 112.86600 88.66600  1.000 33.60028  ? 125 ASP E C     1 
ATOM 3518  O O     . ASP E 1 125 ? 103.38800 112.23400 89.52500  1.000 33.60028  ? 125 ASP E O     1 
ATOM 3519  C CB    . ASP E 1 125 ? 103.95300 113.38300 86.51600  1.000 33.60028  ? 125 ASP E CB    1 
ATOM 3520  C CG    . ASP E 1 125 ? 103.99800 113.16100 85.02400  1.000 33.60028  ? 125 ASP E CG    1 
ATOM 3521  O OD1   . ASP E 1 125 ? 103.38500 112.18100 84.56100  1.000 33.60028  ? 125 ASP E OD1   1 
ATOM 3522  O OD2   . ASP E 1 125 ? 104.64100 113.94900 84.30600  1.000 33.60028  ? 125 ASP E OD2   1 
ATOM 3523  N N     . VAL E 1 126 ? 101.94900 113.87200 88.98000  1.000 33.69105  ? 126 VAL E N     1 
ATOM 3524  C CA    . VAL E 1 126 ? 101.69600 114.21100 90.37800  1.000 33.69105  ? 126 VAL E CA    1 
ATOM 3525  C C     . VAL E 1 126 ? 100.89600 113.10700 91.06300  1.000 33.69105  ? 126 VAL E C     1 
ATOM 3526  O O     . VAL E 1 126 ? 101.14800 112.77300 92.23100  1.000 33.69105  ? 126 VAL E O     1 
ATOM 3527  C CB    . VAL E 1 126 ? 100.98800 115.57300 90.47300  1.000 33.69105  ? 126 VAL E CB    1 
ATOM 3528  C CG1   . VAL E 1 126 ? 100.94400 116.05200 91.90100  1.000 33.69105  ? 126 VAL E CG1   1 
ATOM 3529  C CG2   . VAL E 1 126 ? 101.68800 116.58700 89.60600  1.000 33.69105  ? 126 VAL E CG2   1 
ATOM 3530  N N     . GLN E 1 127 ? 99.94400  112.50000 90.33900  1.000 33.80820  ? 127 GLN E N     1 
ATOM 3531  C CA    . GLN E 1 127 ? 99.20600  111.36000 90.88000  1.000 33.80820  ? 127 GLN E CA    1 
ATOM 3532  C C     . GLN E 1 127 ? 100.12300 110.17300 91.15000  1.000 33.80820  ? 127 GLN E C     1 
ATOM 3533  O O     . GLN E 1 127 ? 99.99700  109.50900 92.18400  1.000 33.80820  ? 127 GLN E O     1 
ATOM 3534  C CB    . GLN E 1 127 ? 98.07700  110.95000 89.93500  1.000 33.80820  ? 127 GLN E CB    1 
ATOM 3535  C CG    . GLN E 1 127 ? 96.88600  111.89000 89.91400  1.000 33.80820  ? 127 GLN E CG    1 
ATOM 3536  C CD    . GLN E 1 127 ? 96.01700  111.69900 88.68400  1.000 33.80820  ? 127 GLN E CD    1 
ATOM 3537  O OE1   . GLN E 1 127 ? 96.16100  110.71900 87.95800  1.000 33.80820  ? 127 GLN E OE1   1 
ATOM 3538  N NE2   . GLN E 1 127 ? 95.11500  112.64100 88.44300  1.000 33.80820  ? 127 GLN E NE2   1 
ATOM 3539  N N     . LEU E 1 128 ? 101.07300 109.90500 90.25200  1.000 32.61426  ? 128 LEU E N     1 
ATOM 3540  C CA    . LEU E 1 128 ? 101.96200 108.77000 90.47200  1.000 32.61426  ? 128 LEU E CA    1 
ATOM 3541  C C     . LEU E 1 128 ? 102.99400 109.06000 91.55100  1.000 32.61426  ? 128 LEU E C     1 
ATOM 3542  O O     . LEU E 1 128 ? 103.42200 108.13900 92.25700  1.000 32.61426  ? 128 LEU E O     1 
ATOM 3543  C CB    . LEU E 1 128 ? 102.65700 108.37500 89.17600  1.000 32.61426  ? 128 LEU E CB    1 
ATOM 3544  C CG    . LEU E 1 128 ? 103.29200 106.98800 89.20700  1.000 32.61426  ? 128 LEU E CG    1 
ATOM 3545  C CD1   . LEU E 1 128 ? 102.32900 105.94800 89.74200  1.000 32.61426  ? 128 LEU E CD1   1 
ATOM 3546  C CD2   . LEU E 1 128 ? 103.74400 106.61600 87.84800  1.000 32.61426  ? 128 LEU E CD2   1 
ATOM 3547  N N     . ALA E 1 129 ? 103.38900 110.32500 91.70900  1.000 33.73477  ? 129 ALA E N     1 
ATOM 3548  C CA    . ALA E 1 129 ? 104.27800 110.67900 92.80700  1.000 33.73477  ? 129 ALA E CA    1 
ATOM 3549  C C     . ALA E 1 129 ? 103.57800 110.50200 94.14100  1.000 33.73477  ? 129 ALA E C     1 
ATOM 3550  O O     . ALA E 1 129 ? 104.18100 110.01200 95.09500  1.000 33.73477  ? 129 ALA E O     1 
ATOM 3551  C CB    . ALA E 1 129 ? 104.78400 112.10900 92.64200  1.000 33.73477  ? 129 ALA E CB    1 
ATOM 3552  N N     . ARG E 1 130 ? 102.28900 110.83900 94.20900  1.000 35.39545  ? 130 ARG E N     1 
ATOM 3553  C CA    . ARG E 1 130 ? 101.53500 110.56600 95.42800  1.000 35.39545  ? 130 ARG E CA    1 
ATOM 3554  C C     . ARG E 1 130 ? 101.26700 109.07900 95.62700  1.000 35.39545  ? 130 ARG E C     1 
ATOM 3555  O O     . ARG E 1 130 ? 101.12100 108.63200 96.76900  1.000 35.39545  ? 130 ARG E O     1 
ATOM 3556  C CB    . ARG E 1 130 ? 100.21600 111.32300 95.41900  1.000 35.39545  ? 130 ARG E CB    1 
ATOM 3557  C CG    . ARG E 1 130 ? 100.33500 112.74900 95.85000  1.000 35.39545  ? 130 ARG E CG    1 
ATOM 3558  C CD    . ARG E 1 130 ? 99.04200  113.18700 96.47200  1.000 35.39545  ? 130 ARG E CD    1 
ATOM 3559  N NE    . ARG E 1 130 ? 97.90500  112.87400 95.62200  1.000 35.39545  ? 130 ARG E NE    1 
ATOM 3560  C CZ    . ARG E 1 130 ? 96.65000  113.17100 95.92900  1.000 35.39545  ? 130 ARG E CZ    1 
ATOM 3561  N NH1   . ARG E 1 130 ? 96.37500  113.78700 97.06800  1.000 35.39545  ? 130 ARG E NH1   1 
ATOM 3562  N NH2   . ARG E 1 130 ? 95.67000  112.85100 95.09900  1.000 35.39545  ? 130 ARG E NH2   1 
ATOM 3563  N N     . ARG E 1 131 ? 101.18200 108.30200 94.54700  1.000 35.01061  ? 131 ARG E N     1 
ATOM 3564  C CA    . ARG E 1 131 ? 100.87300 106.88300 94.70100  1.000 35.01061  ? 131 ARG E CA    1 
ATOM 3565  C C     . ARG E 1 131 ? 102.09000 106.08800 95.15700  1.000 35.01061  ? 131 ARG E C     1 
ATOM 3566  O O     . ARG E 1 131 ? 101.99200 105.27300 96.08100  1.000 35.01061  ? 131 ARG E O     1 
ATOM 3567  C CB    . ARG E 1 131 ? 100.31900 106.31600 93.39500  1.000 35.01061  ? 131 ARG E CB    1 
ATOM 3568  C CG    . ARG E 1 131 ? 100.08800 104.81900 93.42800  1.000 35.01061  ? 131 ARG E CG    1 
ATOM 3569  C CD    . ARG E 1 131 ? 99.15000  104.37900 92.32200  1.000 35.01061  ? 131 ARG E CD    1 
ATOM 3570  N NE    . ARG E 1 131 ? 99.08500  102.92400 92.21300  1.000 35.01061  ? 131 ARG E NE    1 
ATOM 3571  C CZ    . ARG E 1 131 ? 98.57700  102.27500 91.16900  1.000 35.01061  ? 131 ARG E CZ    1 
ATOM 3572  N NH1   . ARG E 1 131 ? 98.56000  100.95000 91.15500  1.000 35.01061  ? 131 ARG E NH1   1 
ATOM 3573  N NH2   . ARG E 1 131 ? 98.09800  102.95000 90.13400  1.000 35.01061  ? 131 ARG E NH2   1 
ATOM 3574  N N     . ILE E 1 132 ? 103.25100 106.30700 94.53100  1.000 35.83364  ? 132 ILE E N     1 
ATOM 3575  C CA    . ILE E 1 132 ? 104.45500 105.59000 94.94100  1.000 35.83364  ? 132 ILE E CA    1 
ATOM 3576  C C     . ILE E 1 132 ? 105.20500 106.32500 96.04000  1.000 35.83364  ? 132 ILE E C     1 
ATOM 3577  O O     . ILE E 1 132 ? 106.22200 105.82200 96.53200  1.000 35.83364  ? 132 ILE E O     1 
ATOM 3578  C CB    . ILE E 1 132 ? 105.39400 105.30700 93.75000  1.000 35.83364  ? 132 ILE E CB    1 
ATOM 3579  C CG1   . ILE E 1 132 ? 106.15700 106.55500 93.34700  1.000 35.83364  ? 132 ILE E CG1   1 
ATOM 3580  C CG2   . ILE E 1 132 ? 104.61300 104.78100 92.56800  1.000 35.83364  ? 132 ILE E CG2   1 
ATOM 3581  C CD1   . ILE E 1 132 ? 107.15800 106.31000 92.26100  1.000 35.83364  ? 132 ILE E CD1   1 
ATOM 3582  N N     . ARG E 1 133 ? 104.72300 107.49300 96.45300  1.000 39.55302  ? 133 ARG E N     1 
ATOM 3583  C CA    . ARG E 1 133 ? 105.23500 108.18500 97.62400  1.000 39.55302  ? 133 ARG E CA    1 
ATOM 3584  C C     . ARG E 1 133 ? 104.71100 107.56800 98.91200  1.000 39.55302  ? 133 ARG E C     1 
ATOM 3585  O O     . ARG E 1 133 ? 105.33800 107.72800 99.96400  1.000 39.55302  ? 133 ARG E O     1 
ATOM 3586  C CB    . ARG E 1 133 ? 104.84400 109.65900 97.50800  1.000 39.55302  ? 133 ARG E CB    1 
ATOM 3587  C CG    . ARG E 1 133 ? 105.36400 110.67200 98.49700  1.000 39.55302  ? 133 ARG E CG    1 
ATOM 3588  C CD    . ARG E 1 133 ? 104.83600 112.02300 98.00500  1.000 39.55302  ? 133 ARG E CD    1 
ATOM 3589  N NE    . ARG E 1 133 ? 105.15700 113.17100 98.84200  1.000 39.55302  ? 133 ARG E NE    1 
ATOM 3590  C CZ    . ARG E 1 133 ? 106.29500 113.84600 98.77300  1.000 39.55302  ? 133 ARG E CZ    1 
ATOM 3591  N NH1   . ARG E 1 133 ? 107.22600 113.48100 97.90800  1.000 39.55302  ? 133 ARG E NH1   1 
ATOM 3592  N NH2   . ARG E 1 133 ? 106.50100 114.88600 99.56900  1.000 39.55302  ? 133 ARG E NH2   1 
ATOM 3593  N N     . GLY E 1 134 ? 103.60100 106.84300 98.84200  1.000 43.62424  ? 134 GLY E N     1 
ATOM 3594  C CA    . GLY E 1 134 ? 103.05500 106.11400 99.96800  1.000 43.62424  ? 134 GLY E CA    1 
ATOM 3595  C C     . GLY E 1 134 ? 101.67700 106.60800 100.36300 1.000 43.62424  ? 134 GLY E C     1 
ATOM 3596  O O     . GLY E 1 134 ? 101.13500 107.55600 99.79800  1.000 43.62424  ? 134 GLY E O     1 
ATOM 3597  N N     . LEU E 1 135 ? 101.10600 105.91700 101.35400 1.000 45.47626  ? 135 LEU E N     1 
ATOM 3598  C CA    . LEU E 1 135 ? 99.85000  106.33400 101.96700 1.000 45.47626  ? 135 LEU E CA    1 
ATOM 3599  C C     . LEU E 1 135 ? 100.04900 107.36000 103.07200 1.000 45.47626  ? 135 LEU E C     1 
ATOM 3600  O O     . LEU E 1 135 ? 99.08400  108.02300 103.46800 1.000 45.47626  ? 135 LEU E O     1 
ATOM 3601  C CB    . LEU E 1 135 ? 99.10900  105.12200 102.53500 1.000 45.47626  ? 135 LEU E CB    1 
ATOM 3602  C CG    . LEU E 1 135 ? 98.55600  104.11000 101.53700 1.000 45.47626  ? 135 LEU E CG    1 
ATOM 3603  C CD1   . LEU E 1 135 ? 98.12500  102.84900 102.25700 1.000 45.47626  ? 135 LEU E CD1   1 
ATOM 3604  C CD2   . LEU E 1 135 ? 97.38900  104.71500 100.78000 1.000 45.47626  ? 135 LEU E CD2   1 
ATOM 3605  N N     . GLU E 1 136 ? 101.27000 107.49200 103.58400 1.000 47.19294  ? 136 GLU E N     1 
ATOM 3606  C CA    . GLU E 1 136 ? 101.59000 108.38900 104.68700 1.000 47.19294  ? 136 GLU E CA    1 
ATOM 3607  C C     . GLU E 1 136 ? 102.31300 109.64400 104.21800 1.000 47.19294  ? 136 GLU E C     1 
ATOM 3608  O O     . GLU E 1 136 ? 101.96800 110.75100 104.63900 1.000 47.19294  ? 136 GLU E O     1 
ATOM 3609  C CB    . GLU E 1 136 ? 102.43100 107.64900 105.73300 1.000 47.19294  ? 136 GLU E CB    1 
ATOM 3610  C CG    . GLU E 1 136 ? 101.63500 106.67100 106.58500 1.000 47.19294  ? 136 GLU E CG    1 
ATOM 3611  C CD    . GLU E 1 136 ? 101.46400 105.31700 105.92400 1.000 47.19294  ? 136 GLU E CD    1 
ATOM 3612  O OE1   . GLU E 1 136 ? 100.52300 104.58700 106.29700 1.000 47.19294  ? 136 GLU E OE1   1 
ATOM 3613  O OE2   . GLU E 1 136 ? 102.25900 104.99000 105.01900 1.000 47.19294  ? 136 GLU E OE2   1 
ATOM 3614  N N     . GLU E 1 137 ? 103.32000 109.49300 103.35300 1.000 45.14981  ? 137 GLU E N     1 
ATOM 3615  C CA    . GLU E 1 137 ? 104.09700 110.64800 102.92100 1.000 45.14981  ? 137 GLU E CA    1 
ATOM 3616  C C     . GLU E 1 137 ? 103.41400 111.38900 101.77900 1.000 45.14981  ? 137 GLU E C     1 
ATOM 3617  O O     . GLU E 1 137 ? 103.59300 112.60400 101.64100 1.000 45.14981  ? 137 GLU E O     1 
ATOM 3618  C CB    . GLU E 1 137 ? 105.50200 110.20500 102.50700 1.000 45.14981  ? 137 GLU E CB    1 
ATOM 3619  C CG    . GLU E 1 137 ? 106.51400 111.33400 102.37700 1.000 45.14981  ? 137 GLU E CG    1 
ATOM 3620  C CD    . GLU E 1 137 ? 107.92500 110.82800 102.15600 1.000 45.14981  ? 137 GLU E CD    1 
ATOM 3621  O OE1   . GLU E 1 137 ? 108.87400 111.61100 102.36600 1.000 45.14981  ? 137 GLU E OE1   1 
ATOM 3622  O OE2   . GLU E 1 137 ? 108.08600 109.64600 101.78700 1.000 45.14981  ? 137 GLU E OE2   1 
ATOM 3623  N N     . GLY E 1 138 ? 102.61700 110.69300 100.97200 1.000 44.10236  ? 138 GLY E N     1 
ATOM 3624  C CA    . GLY E 1 138 ? 101.76800 111.34400 100.00100 1.000 44.10236  ? 138 GLY E CA    1 
ATOM 3625  C C     . GLY E 1 138 ? 100.45900 111.78700 100.62200 1.000 44.10236  ? 138 GLY E C     1 
ATOM 3626  O O     . GLY E 1 138 ? 100.27000 111.76500 101.83900 1.000 44.10236  ? 138 GLY E O     1 
ATOM 3627  N N     . LEU E 1 139 ? 99.52600  112.16100 99.74300  1.000 43.37420  ? 139 LEU E N     1 
ATOM 3628  C CA    . LEU E 1 139 ? 98.19500  112.68900 100.08800 1.000 43.37420  ? 139 LEU E CA    1 
ATOM 3629  C C     . LEU E 1 139 ? 98.24900  113.87500 101.05700 1.000 43.37420  ? 139 LEU E C     1 
ATOM 3630  O O     . LEU E 1 139 ? 98.56000  114.99900 100.66300 1.000 43.37420  ? 139 LEU E O     1 
ATOM 3631  C CB    . LEU E 1 139 ? 97.28000  111.58800 100.66400 1.000 43.37420  ? 139 LEU E CB    1 
ATOM 3632  C CG    . LEU E 1 139 ? 96.89300  110.32400 99.87800  1.000 43.37420  ? 139 LEU E CG    1 
ATOM 3633  C CD1   . LEU E 1 139 ? 97.98100  109.25200 99.81300  1.000 43.37420  ? 139 LEU E CD1   1 
ATOM 3634  C CD2   . LEU E 1 139 ? 95.60900  109.73800 100.45100 1.000 43.37420  ? 139 LEU E CD2   1 
ATOM 3635  N N     . ASN F 2 26  ? 86.49400  128.87300 98.29000  1.000 41.12044  ? 25  ASN F N     1 
ATOM 3636  C CA    . ASN F 2 26  ? 87.42000  129.89600 97.82800  1.000 41.12044  ? 25  ASN F CA    1 
ATOM 3637  C C     . ASN F 2 26  ? 88.84100  129.35700 97.71900  1.000 41.12044  ? 25  ASN F C     1 
ATOM 3638  O O     . ASN F 2 26  ? 89.78500  129.96400 98.21700  1.000 41.12044  ? 25  ASN F O     1 
ATOM 3639  C CB    . ASN F 2 26  ? 87.38200  131.11100 98.75800  1.000 41.12044  ? 25  ASN F CB    1 
ATOM 3640  C CG    . ASN F 2 26  ? 87.41000  130.73000 100.22500 1.000 41.12044  ? 25  ASN F CG    1 
ATOM 3641  O OD1   . ASN F 2 26  ? 87.67000  129.58400 100.58000 1.000 41.12044  ? 25  ASN F OD1   1 
ATOM 3642  N ND2   . ASN F 2 26  ? 87.13300  131.69800 101.08800 1.000 41.12044  ? 25  ASN F ND2   1 
ATOM 3643  N N     . ILE F 2 27  ? 88.98200  128.20000 97.06600  1.000 41.23948  ? 26  ILE F N     1 
ATOM 3644  C CA    . ILE F 2 27  ? 90.30200  127.66600 96.74600  1.000 41.23948  ? 26  ILE F CA    1 
ATOM 3645  C C     . ILE F 2 27  ? 90.83300  128.23900 95.44100  1.000 41.23948  ? 26  ILE F C     1 
ATOM 3646  O O     . ILE F 2 27  ? 92.01200  128.04000 95.11300  1.000 41.23948  ? 26  ILE F O     1 
ATOM 3647  C CB    . ILE F 2 27  ? 90.25400  126.12400 96.71900  1.000 41.23948  ? 26  ILE F CB    1 
ATOM 3648  C CG1   . ILE F 2 27  ? 91.62600  125.53000 97.04700  1.000 41.23948  ? 26  ILE F CG1   1 
ATOM 3649  C CG2   . ILE F 2 27  ? 89.74500  125.61900 95.38400  1.000 41.23948  ? 26  ILE F CG2   1 
ATOM 3650  C CD1   . ILE F 2 27  ? 91.58300  124.10100 97.42500  1.000 41.23948  ? 26  ILE F CD1   1 
ATOM 3651  N N     . GLN F 2 28  ? 90.01900  128.99900 94.70800  1.000 42.18074  ? 27  GLN F N     1 
ATOM 3652  C CA    . GLN F 2 28  ? 90.51000  129.68700 93.52300  1.000 42.18074  ? 27  GLN F CA    1 
ATOM 3653  C C     . GLN F 2 28  ? 91.40200  130.87300 93.86400  1.000 42.18074  ? 27  GLN F C     1 
ATOM 3654  O O     . GLN F 2 28  ? 91.99500  131.45800 92.95300  1.000 42.18074  ? 27  GLN F O     1 
ATOM 3655  C CB    . GLN F 2 28  ? 89.33500  130.15100 92.66800  1.000 42.18074  ? 27  GLN F CB    1 
ATOM 3656  C CG    . GLN F 2 28  ? 88.32100  129.05900 92.37700  1.000 42.18074  ? 27  GLN F CG    1 
ATOM 3657  C CD    . GLN F 2 28  ? 88.92700  127.87700 91.65400  1.000 42.18074  ? 27  GLN F CD    1 
ATOM 3658  O OE1   . GLN F 2 28  ? 89.66500  128.04000 90.68300  1.000 42.18074  ? 27  GLN F OE1   1 
ATOM 3659  N NE2   . GLN F 2 28  ? 88.60900  126.67500 92.11900  1.000 42.18074  ? 27  GLN F NE2   1 
ATOM 3660  N N     . GLY F 2 29  ? 91.50300  131.24400 95.14400  1.000 42.51228  ? 28  GLY F N     1 
ATOM 3661  C CA    . GLY F 2 29  ? 92.50700  132.18500 95.60200  1.000 42.51228  ? 28  GLY F CA    1 
ATOM 3662  C C     . GLY F 2 29  ? 93.91800  131.63900 95.56600  1.000 42.51228  ? 28  GLY F C     1 
ATOM 3663  O O     . GLY F 2 29  ? 94.87500  132.41900 95.61300  1.000 42.51228  ? 28  GLY F O     1 
ATOM 3664  N N     . ILE F 2 30  ? 94.07100  130.31800 95.49200  1.000 39.73304  ? 29  ILE F N     1 
ATOM 3665  C CA    . ILE F 2 30  ? 95.35700  129.72600 95.15400  1.000 39.73304  ? 29  ILE F CA    1 
ATOM 3666  C C     . ILE F 2 30  ? 95.46900  129.85100 93.64500  1.000 39.73304  ? 29  ILE F C     1 
ATOM 3667  O O     . ILE F 2 30  ? 95.05000  128.95900 92.90200  1.000 39.73304  ? 29  ILE F O     1 
ATOM 3668  C CB    . ILE F 2 30  ? 95.46000  128.26000 95.60700  1.000 39.73304  ? 29  ILE F CB    1 
ATOM 3669  C CG1   . ILE F 2 30  ? 94.96300  128.10500 97.04200  1.000 39.73304  ? 29  ILE F CG1   1 
ATOM 3670  C CG2   . ILE F 2 30  ? 96.88400  127.76800 95.49100  1.000 39.73304  ? 29  ILE F CG2   1 
ATOM 3671  C CD1   . ILE F 2 30  ? 95.77300  128.85700 98.05800  1.000 39.73304  ? 29  ILE F CD1   1 
ATOM 3672  N N     . THR F 2 31  ? 96.03100  130.96300 93.18800  1.000 41.91095  ? 30  THR F N     1 
ATOM 3673  C CA    . THR F 2 31  ? 95.90800  131.37600 91.80300  1.000 41.91095  ? 30  THR F CA    1 
ATOM 3674  C C     . THR F 2 31  ? 96.82300  130.56000 90.89900  1.000 41.91095  ? 30  THR F C     1 
ATOM 3675  O O     . THR F 2 31  ? 97.66000  129.77800 91.35200  1.000 41.91095  ? 30  THR F O     1 
ATOM 3676  C CB    . THR F 2 31  ? 96.21700  132.86400 91.66800  1.000 41.91095  ? 30  THR F CB    1 
ATOM 3677  O OG1   . THR F 2 31  ? 97.41700  133.17000 92.38500  1.000 41.91095  ? 30  THR F OG1   1 
ATOM 3678  C CG2   . THR F 2 31  ? 95.07900  133.68900 92.23300  1.000 41.91095  ? 30  THR F CG2   1 
ATOM 3679  N N     . LYS F 2 32  ? 96.62300  130.73200 89.59600  1.000 37.96832  ? 31  LYS F N     1 
ATOM 3680  C CA    . LYS F 2 32  ? 97.48600  130.07700 88.61700  1.000 37.96832  ? 31  LYS F CA    1 
ATOM 3681  C C     . LYS F 2 32  ? 98.94300  130.55100 88.65400  1.000 37.96832  ? 31  LYS F C     1 
ATOM 3682  O O     . LYS F 2 32  ? 99.82900  129.68300 88.56600  1.000 37.96832  ? 31  LYS F O     1 
ATOM 3683  C CB    . LYS F 2 32  ? 96.86200  130.20900 87.21700  1.000 37.96832  ? 31  LYS F CB    1 
ATOM 3684  C CG    . LYS F 2 32  ? 97.84600  130.11400 86.06700  1.000 37.96832  ? 31  LYS F CG    1 
ATOM 3685  C CD    . LYS F 2 32  ? 97.25400  130.60400 84.76800  1.000 37.96832  ? 31  LYS F CD    1 
ATOM 3686  C CE    . LYS F 2 32  ? 98.27700  130.51000 83.65400  1.000 37.96832  ? 31  LYS F CE    1 
ATOM 3687  N NZ    . LYS F 2 32  ? 99.57200  131.12300 84.06200  1.000 37.96832  ? 31  LYS F NZ    1 
ATOM 3688  N N     . PRO F 2 33  ? 99.28300  131.84900 88.79100  1.000 39.44590  ? 32  PRO F N     1 
ATOM 3689  C CA    . PRO F 2 33  ? 100.70600 132.18300 88.96700  1.000 39.44590  ? 32  PRO F CA    1 
ATOM 3690  C C     . PRO F 2 33  ? 101.30800 131.73200 90.28700  1.000 39.44590  ? 32  PRO F C     1 
ATOM 3691  O O     . PRO F 2 33  ? 102.52900 131.57300 90.34600  1.000 39.44590  ? 32  PRO F O     1 
ATOM 3692  C CB    . PRO F 2 33  ? 100.73600 133.71300 88.84100  1.000 39.44590  ? 32  PRO F CB    1 
ATOM 3693  C CG    . PRO F 2 33  ? 99.38100  134.14000 89.08000  1.000 39.44590  ? 32  PRO F CG    1 
ATOM 3694  C CD    . PRO F 2 33  ? 98.53400  133.08400 88.48600  1.000 39.44590  ? 32  PRO F CD    1 
ATOM 3695  N N     . ALA F 2 34  ? 100.51700 131.50900 91.33800  1.000 36.59692  ? 33  ALA F N     1 
ATOM 3696  C CA    . ALA F 2 34  ? 101.08600 130.98600 92.57900  1.000 36.59692  ? 33  ALA F CA    1 
ATOM 3697  C C     . ALA F 2 34  ? 101.47100 129.51800 92.44600  1.000 36.59692  ? 33  ALA F C     1 
ATOM 3698  O O     . ALA F 2 34  ? 102.52300 129.09600 92.94400  1.000 36.59692  ? 33  ALA F O     1 
ATOM 3699  C CB    . ALA F 2 34  ? 100.10200 131.17500 93.72900  1.000 36.59692  ? 33  ALA F CB    1 
ATOM 3700  N N     . ILE F 2 35  ? 100.63200 128.72500 91.77700  1.000 35.06617  ? 34  ILE F N     1 
ATOM 3701  C CA    . ILE F 2 35  ? 100.96300 127.32900 91.50900  1.000 35.06617  ? 34  ILE F CA    1 
ATOM 3702  C C     . ILE F 2 35  ? 102.14800 127.24300 90.55800  1.000 35.06617  ? 34  ILE F C     1 
ATOM 3703  O O     . ILE F 2 35  ? 103.02700 126.38300 90.71000  1.000 35.06617  ? 34  ILE F O     1 
ATOM 3704  C CB    . ILE F 2 35  ? 99.72300  126.60600 90.95500  1.000 35.06617  ? 34  ILE F CB    1 
ATOM 3705  C CG1   . ILE F 2 35  ? 98.59100  126.65900 91.97900  1.000 35.06617  ? 34  ILE F CG1   1 
ATOM 3706  C CG2   . ILE F 2 35  ? 100.03500 125.17200 90.60500  1.000 35.06617  ? 34  ILE F CG2   1 
ATOM 3707  C CD1   . ILE F 2 35  ? 97.31800  126.01900 91.50900  1.000 35.06617  ? 34  ILE F CD1   1 
ATOM 3708  N N     . ARG F 2 36  ? 102.21600 128.17100 89.60000  1.000 38.84466  ? 35  ARG F N     1 
ATOM 3709  C CA    . ARG F 2 36  ? 103.37700 128.27300 88.72600  1.000 38.84466  ? 35  ARG F CA    1 
ATOM 3710  C C     . ARG F 2 36  ? 104.63100 128.62600 89.50700  1.000 38.84466  ? 35  ARG F C     1 
ATOM 3711  O O     . ARG F 2 36  ? 105.70000 128.09200 89.22300  1.000 38.84466  ? 35  ARG F O     1 
ATOM 3712  C CB    . ARG F 2 36  ? 103.12700 129.31000 87.63500  1.000 38.84466  ? 35  ARG F CB    1 
ATOM 3713  C CG    . ARG F 2 36  ? 102.58800 128.72600 86.35200  1.000 38.84466  ? 35  ARG F CG    1 
ATOM 3714  C CD    . ARG F 2 36  ? 102.56500 129.75100 85.24100  1.000 38.84466  ? 35  ARG F CD    1 
ATOM 3715  N NE    . ARG F 2 36  ? 103.90800 130.19300 84.89300  1.000 38.84466  ? 35  ARG F NE    1 
ATOM 3716  C CZ    . ARG F 2 36  ? 104.19400 130.95500 83.84400  1.000 38.84466  ? 35  ARG F CZ    1 
ATOM 3717  N NH1   . ARG F 2 36  ? 103.22700 131.35700 83.02900  1.000 38.84466  ? 35  ARG F NH1   1 
ATOM 3718  N NH2   . ARG F 2 36  ? 105.44900 131.31300 83.60400  1.000 38.84466  ? 35  ARG F NH2   1 
ATOM 3719  N N     . ARG F 2 37  ? 104.51600 129.50200 90.51000  1.000 37.02983  ? 36  ARG F N     1 
ATOM 3720  C CA    . ARG F 2 37  ? 105.67600 129.86800 91.31800  1.000 37.02983  ? 36  ARG F CA    1 
ATOM 3721  C C     . ARG F 2 37  ? 106.16100 128.70000 92.16500  1.000 37.02983  ? 36  ARG F C     1 
ATOM 3722  O O     . ARG F 2 37  ? 107.37100 128.49600 92.30900  1.000 37.02983  ? 36  ARG F O     1 
ATOM 3723  C CB    . ARG F 2 37  ? 105.34800 131.06200 92.20900  1.000 37.02983  ? 36  ARG F CB    1 
ATOM 3724  C CG    . ARG F 2 37  ? 105.47900 132.40600 91.53000  1.000 37.02983  ? 36  ARG F CG    1 
ATOM 3725  C CD    . ARG F 2 37  ? 105.60200 133.51900 92.55000  1.000 37.02983  ? 36  ARG F CD    1 
ATOM 3726  N NE    . ARG F 2 37  ? 104.42200 133.62000 93.39800  1.000 37.02983  ? 36  ARG F NE    1 
ATOM 3727  C CZ    . ARG F 2 37  ? 103.35200 134.34600 93.09800  1.000 37.02983  ? 36  ARG F CZ    1 
ATOM 3728  N NH1   . ARG F 2 37  ? 103.31200 135.03400 91.96800  1.000 37.02983  ? 36  ARG F NH1   1 
ATOM 3729  N NH2   . ARG F 2 37  ? 102.32200 134.38300 93.92700  1.000 37.02983  ? 36  ARG F NH2   1 
ATOM 3730  N N     . LEU F 2 38  ? 105.23000 127.91900 92.72100  1.000 34.24312  ? 37  LEU F N     1 
ATOM 3731  C CA    . LEU F 2 38  ? 105.60700 126.71900 93.46700  1.000 34.24312  ? 37  LEU F CA    1 
ATOM 3732  C C     . LEU F 2 38  ? 106.27900 125.68700 92.57000  1.000 34.24312  ? 37  LEU F C     1 
ATOM 3733  O O     . LEU F 2 38  ? 107.26900 125.05700 92.96700  1.000 34.24312  ? 37  LEU F O     1 
ATOM 3734  C CB    . LEU F 2 38  ? 104.38000 126.11100 94.13800  1.000 34.24312  ? 37  LEU F CB    1 
ATOM 3735  C CG    . LEU F 2 38  ? 103.78400 126.92700 95.27300  1.000 34.24312  ? 37  LEU F CG    1 
ATOM 3736  C CD1   . LEU F 2 38  ? 102.34600 126.53300 95.51800  1.000 34.24312  ? 37  LEU F CD1   1 
ATOM 3737  C CD2   . LEU F 2 38  ? 104.61300 126.71800 96.50800  1.000 34.24312  ? 37  LEU F CD2   1 
ATOM 3738  N N     . ALA F 2 39  ? 105.77600 125.52500 91.34600  1.000 35.74345  ? 38  ALA F N     1 
ATOM 3739  C CA    . ALA F 2 39  ? 106.38500 124.57700 90.42200  1.000 35.74345  ? 38  ALA F CA    1 
ATOM 3740  C C     . ALA F 2 39  ? 107.74900 125.05800 89.93700  1.000 35.74345  ? 38  ALA F C     1 
ATOM 3741  O O     . ALA F 2 39  ? 108.66700 124.25100 89.77200  1.000 35.74345  ? 38  ALA F O     1 
ATOM 3742  C CB    . ALA F 2 39  ? 105.45200 124.31700 89.24800  1.000 35.74345  ? 38  ALA F CB    1 
ATOM 3743  N N     . ARG F 2 40  ? 107.91300 126.36400 89.71600  1.000 37.95982  ? 39  ARG F N     1 
ATOM 3744  C CA    . ARG F 2 40  ? 109.22400 126.86900 89.32300  1.000 37.95982  ? 39  ARG F CA    1 
ATOM 3745  C C     . ARG F 2 40  ? 110.21800 126.82300 90.47700  1.000 37.95982  ? 39  ARG F C     1 
ATOM 3746  O O     . ARG F 2 40  ? 111.42400 126.72100 90.23800  1.000 37.95982  ? 39  ARG F O     1 
ATOM 3747  C CB    . ARG F 2 40  ? 109.12000 128.29300 88.77700  1.000 37.95982  ? 39  ARG F CB    1 
ATOM 3748  C CG    . ARG F 2 40  ? 108.33300 128.45500 87.48500  1.000 37.95982  ? 39  ARG F CG    1 
ATOM 3749  C CD    . ARG F 2 40  ? 109.08200 127.99800 86.26400  1.000 37.95982  ? 39  ARG F CD    1 
ATOM 3750  N NE    . ARG F 2 40  ? 108.17900 127.78600 85.13700  1.000 37.95982  ? 39  ARG F NE    1 
ATOM 3751  C CZ    . ARG F 2 40  ? 107.77900 128.74200 84.30500  1.000 37.95982  ? 39  ARG F CZ    1 
ATOM 3752  N NH1   . ARG F 2 40  ? 106.95800 128.45100 83.30700  1.000 37.95982  ? 39  ARG F NH1   1 
ATOM 3753  N NH2   . ARG F 2 40  ? 108.20000 129.98700 84.46700  1.000 37.95982  ? 39  ARG F NH2   1 
ATOM 3754  N N     . ARG F 2 41  ? 109.75100 126.90500 91.72600  1.000 36.68960  ? 40  ARG F N     1 
ATOM 3755  C CA    . ARG F 2 41  ? 110.67100 126.66500 92.83400  1.000 36.68960  ? 40  ARG F CA    1 
ATOM 3756  C C     . ARG F 2 41  ? 111.03900 125.19000 92.90300  1.000 36.68960  ? 40  ARG F C     1 
ATOM 3757  O O     . ARG F 2 41  ? 112.17600 124.84500 93.24000  1.000 36.68960  ? 40  ARG F O     1 
ATOM 3758  C CB    . ARG F 2 41  ? 110.07800 127.13000 94.16800  1.000 36.68960  ? 40  ARG F CB    1 
ATOM 3759  C CG    . ARG F 2 41  ? 111.06700 127.03300 95.33000  1.000 36.68960  ? 40  ARG F CG    1 
ATOM 3760  C CD    . ARG F 2 41  ? 110.48500 127.36000 96.69800  1.000 36.68960  ? 40  ARG F CD    1 
ATOM 3761  N NE    . ARG F 2 41  ? 110.11500 128.75600 96.88200  1.000 36.68960  ? 40  ARG F NE    1 
ATOM 3762  C CZ    . ARG F 2 41  ? 110.95300 129.70300 97.28000  1.000 36.68960  ? 40  ARG F CZ    1 
ATOM 3763  N NH1   . ARG F 2 41  ? 112.21400 129.40300 97.54000  1.000 36.68960  ? 40  ARG F NH1   1 
ATOM 3764  N NH2   . ARG F 2 41  ? 110.53100 130.94700 97.42300  1.000 36.68960  ? 40  ARG F NH2   1 
ATOM 3765  N N     . GLY F 2 42  ? 110.11400 124.31000 92.52100  1.000 35.60431  ? 41  GLY F N     1 
ATOM 3766  C CA    . GLY F 2 42  ? 110.44500 122.90100 92.43500  1.000 35.60431  ? 41  GLY F CA    1 
ATOM 3767  C C     . GLY F 2 42  ? 111.29500 122.50700 91.24600  1.000 35.60431  ? 41  GLY F C     1 
ATOM 3768  O O     . GLY F 2 42  ? 111.68300 121.34100 91.14400  1.000 35.60431  ? 41  GLY F O     1 
ATOM 3769  N N     . GLY F 2 43  ? 111.60000 123.43600 90.34700  1.000 36.24021  ? 42  GLY F N     1 
ATOM 3770  C CA    . GLY F 2 43  ? 112.41200 123.14800 89.18700  1.000 36.24021  ? 42  GLY F CA    1 
ATOM 3771  C C     . GLY F 2 43  ? 111.65500 122.75600 87.94200  1.000 36.24021  ? 42  GLY F C     1 
ATOM 3772  O O     . GLY F 2 43  ? 112.28400 122.31700 86.97500  1.000 36.24021  ? 42  GLY F O     1 
ATOM 3773  N N     . VAL F 2 44  ? 110.33400 122.90500 87.92700  1.000 35.68843  ? 43  VAL F N     1 
ATOM 3774  C CA    . VAL F 2 44  ? 109.52100 122.46100 86.79900  1.000 35.68843  ? 43  VAL F CA    1 
ATOM 3775  C C     . VAL F 2 44  ? 109.65800 123.45500 85.65300  1.000 35.68843  ? 43  VAL F C     1 
ATOM 3776  O O     . VAL F 2 44  ? 109.38800 124.64800 85.81300  1.000 35.68843  ? 43  VAL F O     1 
ATOM 3777  C CB    . VAL F 2 44  ? 108.05300 122.29000 87.20900  1.000 35.68843  ? 43  VAL F CB    1 
ATOM 3778  C CG1   . VAL F 2 44  ? 107.24500 121.80100 86.04600  1.000 35.68843  ? 43  VAL F CG1   1 
ATOM 3779  C CG2   . VAL F 2 44  ? 107.94000 121.32500 88.36300  1.000 35.68843  ? 43  VAL F CG2   1 
ATOM 3780  N N     . LYS F 2 45  ? 110.07800 122.96100 84.49000  1.000 41.74106  ? 44  LYS F N     1 
ATOM 3781  C CA    . LYS F 2 45  ? 110.30700 123.82500 83.33800  1.000 41.74106  ? 44  LYS F CA    1 
ATOM 3782  C C     . LYS F 2 45  ? 109.00000 124.19000 82.64100  1.000 41.74106  ? 44  LYS F C     1 
ATOM 3783  O O     . LYS F 2 45  ? 108.76700 125.36100 82.32700  1.000 41.74106  ? 44  LYS F O     1 
ATOM 3784  C CB    . LYS F 2 45  ? 111.27400 123.14300 82.37200  1.000 41.74106  ? 44  LYS F CB    1 
ATOM 3785  C CG    . LYS F 2 45  ? 111.45300 123.83200 81.03600  1.000 41.74106  ? 44  LYS F CG    1 
ATOM 3786  C CD    . LYS F 2 45  ? 112.32800 122.98800 80.12300  1.000 41.74106  ? 44  LYS F CD    1 
ATOM 3787  C CE    . LYS F 2 45  ? 112.63500 123.70100 78.82100  1.000 41.74106  ? 44  LYS F CE    1 
ATOM 3788  N NZ    . LYS F 2 45  ? 113.60200 122.92900 77.99600  1.000 41.74106  ? 44  LYS F NZ    1 
ATOM 3789  N N     . ARG F 2 46  ? 108.14200 123.20700 82.37300  1.000 41.76099  ? 45  ARG F N     1 
ATOM 3790  C CA    . ARG F 2 46  ? 106.86000 123.44400 81.72400  1.000 41.76099  ? 45  ARG F CA    1 
ATOM 3791  C C     . ARG F 2 46  ? 105.74100 122.76400 82.49400  1.000 41.76099  ? 45  ARG F C     1 
ATOM 3792  O O     . ARG F 2 46  ? 105.91800 121.66700 83.02500  1.000 41.76099  ? 45  ARG F O     1 
ATOM 3793  C CB    . ARG F 2 46  ? 106.86400 122.95700 80.28600  1.000 41.76099  ? 45  ARG F CB    1 
ATOM 3794  C CG    . ARG F 2 46  ? 107.71300 123.80700 79.38300  1.000 41.76099  ? 45  ARG F CG    1 
ATOM 3795  C CD    . ARG F 2 46  ? 107.79300 123.20200 78.01500  1.000 41.76099  ? 45  ARG F CD    1 
ATOM 3796  N NE    . ARG F 2 46  ? 106.52200 123.18000 77.30100  1.000 41.76099  ? 45  ARG F NE    1 
ATOM 3797  C CZ    . ARG F 2 46  ? 106.07900 124.17600 76.54500  1.000 41.76099  ? 45  ARG F CZ    1 
ATOM 3798  N NH1   . ARG F 2 46  ? 106.81000 125.27100 76.39600  1.000 41.76099  ? 45  ARG F NH1   1 
ATOM 3799  N NH2   . ARG F 2 46  ? 104.91400 124.07200 75.92400  1.000 41.76099  ? 45  ARG F NH2   1 
ATOM 3800  N N     . ILE F 2 47  ? 104.58400 123.41800 82.53100  1.000 39.43836  ? 46  ILE F N     1 
ATOM 3801  C CA    . ILE F 2 47  ? 103.44900 123.01100 83.34900  1.000 39.43836  ? 46  ILE F CA    1 
ATOM 3802  C C     . ILE F 2 47  ? 102.22800 122.90300 82.44900  1.000 39.43836  ? 46  ILE F C     1 
ATOM 3803  O O     . ILE F 2 47  ? 101.89100 123.86500 81.75600  1.000 39.43836  ? 46  ILE F O     1 
ATOM 3804  C CB    . ILE F 2 47  ? 103.19100 124.04000 84.46600  1.000 39.43836  ? 46  ILE F CB    1 
ATOM 3805  C CG1   . ILE F 2 47  ? 104.38800 124.16000 85.40000  1.000 39.43836  ? 46  ILE F CG1   1 
ATOM 3806  C CG2   . ILE F 2 47  ? 101.98300 123.68200 85.25600  1.000 39.43836  ? 46  ILE F CG2   1 
ATOM 3807  C CD1   . ILE F 2 47  ? 104.60400 125.55900 85.87600  1.000 39.43836  ? 46  ILE F CD1   1 
ATOM 3808  N N     . SER F 2 48  ? 101.54900 121.75900 82.47300  1.000 37.30812  ? 47  SER F N     1 
ATOM 3809  C CA    . SER F 2 48  ? 100.33000 121.64500 81.68600  1.000 37.30812  ? 47  SER F CA    1 
ATOM 3810  C C     . SER F 2 48  ? 99.19900  122.44800 82.32400  1.000 37.30812  ? 47  SER F C     1 
ATOM 3811  O O     . SER F 2 48  ? 99.27600  122.88500 83.47200  1.000 37.30812  ? 47  SER F O     1 
ATOM 3812  C CB    . SER F 2 48  ? 99.90400  120.18900 81.53100  1.000 37.30812  ? 47  SER F CB    1 
ATOM 3813  O OG    . SER F 2 48  ? 99.86000  119.53900 82.78400  1.000 37.30812  ? 47  SER F OG    1 
ATOM 3814  N N     . GLY F 2 49  ? 98.13000  122.63700 81.55900  1.000 37.20226  ? 48  GLY F N     1 
ATOM 3815  C CA    . GLY F 2 49  ? 96.99100  123.38000 82.05600  1.000 37.20226  ? 48  GLY F CA    1 
ATOM 3816  C C     . GLY F 2 49  ? 96.09900  122.62200 83.00700  1.000 37.20226  ? 48  GLY F C     1 
ATOM 3817  O O     . GLY F 2 49  ? 95.26400  123.23800 83.67200  1.000 37.20226  ? 48  GLY F O     1 
ATOM 3818  N N     . LEU F 2 50  ? 96.24800  121.30600 83.08600  1.000 35.56026  ? 49  LEU F N     1 
ATOM 3819  C CA    . LEU F 2 50  ? 95.49100  120.49900 84.02800  1.000 35.56026  ? 49  LEU F CA    1 
ATOM 3820  C C     . LEU F 2 50  ? 96.20800  120.31400 85.35500  1.000 35.56026  ? 49  LEU F C     1 
ATOM 3821  O O     . LEU F 2 50  ? 95.71200  119.57700 86.20700  1.000 35.56026  ? 49  LEU F O     1 
ATOM 3822  C CB    . LEU F 2 50  ? 95.18500  119.12700 83.42600  1.000 35.56026  ? 49  LEU F CB    1 
ATOM 3823  C CG    . LEU F 2 50  ? 94.71700  119.08400 81.97500  1.000 35.56026  ? 49  LEU F CG    1 
ATOM 3824  C CD1   . LEU F 2 50  ? 94.53800  117.64700 81.54000  1.000 35.56026  ? 49  LEU F CD1   1 
ATOM 3825  C CD2   . LEU F 2 50  ? 93.42300  119.85400 81.80900  1.000 35.56026  ? 49  LEU F CD2   1 
ATOM 3826  N N     . ILE F 2 51  ? 97.36600  120.94500 85.54400  1.000 33.74044  ? 50  ILE F N     1 
ATOM 3827  C CA    . ILE F 2 51  ? 98.05900  120.86700 86.82400  1.000 33.74044  ? 50  ILE F CA    1 
ATOM 3828  C C     . ILE F 2 51  ? 97.34000  121.70900 87.86700  1.000 33.74044  ? 50  ILE F C     1 
ATOM 3829  O O     . ILE F 2 51  ? 97.20100  121.30200 89.02800  1.000 33.74044  ? 50  ILE F O     1 
ATOM 3830  C CB    . ILE F 2 51  ? 99.52800  121.29300 86.63700  1.000 33.74044  ? 50  ILE F CB    1 
ATOM 3831  C CG1   . ILE F 2 51  ? 100.34400 120.13800 86.07700  1.000 33.74044  ? 50  ILE F CG1   1 
ATOM 3832  C CG2   . ILE F 2 51  ? 100.17200 121.76200 87.92500  1.000 33.74044  ? 50  ILE F CG2   1 
ATOM 3833  C CD1   . ILE F 2 51  ? 100.36800 118.93900 86.97600  1.000 33.74044  ? 50  ILE F CD1   1 
ATOM 3834  N N     . TYR F 2 52  ? 96.81100  122.86300 87.44900  1.000 35.26576  ? 51  TYR F N     1 
ATOM 3835  C CA    . TYR F 2 52  ? 96.24200  123.82800 88.38200  1.000 35.26576  ? 51  TYR F CA    1 
ATOM 3836  C C     . TYR F 2 52  ? 94.96700  123.32500 89.04500  1.000 35.26576  ? 51  TYR F C     1 
ATOM 3837  O O     . TYR F 2 52  ? 94.65800  123.74400 90.16400  1.000 35.26576  ? 51  TYR F O     1 
ATOM 3838  C CB    . TYR F 2 52  ? 95.97100  125.15000 87.67100  1.000 35.26576  ? 51  TYR F CB    1 
ATOM 3839  C CG    . TYR F 2 52  ? 97.13200  125.66600 86.86000  1.000 35.26576  ? 51  TYR F CG    1 
ATOM 3840  C CD1   . TYR F 2 52  ? 98.40900  125.72500 87.39500  1.000 35.26576  ? 51  TYR F CD1   1 
ATOM 3841  C CD2   . TYR F 2 52  ? 96.94600  126.10900 85.56100  1.000 35.26576  ? 51  TYR F CD2   1 
ATOM 3842  C CE1   . TYR F 2 52  ? 99.46900  126.20000 86.65600  1.000 35.26576  ? 51  TYR F CE1   1 
ATOM 3843  C CE2   . TYR F 2 52  ? 97.99900  126.58600 84.81700  1.000 35.26576  ? 51  TYR F CE2   1 
ATOM 3844  C CZ    . TYR F 2 52  ? 99.25500  126.62900 85.36900  1.000 35.26576  ? 51  TYR F CZ    1 
ATOM 3845  O OH    . TYR F 2 52  ? 100.30000 127.10300 84.61800  1.000 35.26576  ? 51  TYR F OH    1 
ATOM 3846  N N     . GLU F 2 53  ? 94.21900  122.43500 88.40100  1.000 37.39423  ? 52  GLU F N     1 
ATOM 3847  C CA    . GLU F 2 53  ? 93.04500  121.89400 89.06700  1.000 37.39423  ? 52  GLU F CA    1 
ATOM 3848  C C     . GLU F 2 53  ? 93.35700  120.70300 89.96200  1.000 37.39423  ? 52  GLU F C     1 
ATOM 3849  O O     . GLU F 2 53  ? 92.51900  120.33900 90.79300  1.000 37.39423  ? 52  GLU F O     1 
ATOM 3850  C CB    . GLU F 2 53  ? 91.97600  121.49800 88.04300  1.000 37.39423  ? 52  GLU F CB    1 
ATOM 3851  C CG    . GLU F 2 53  ? 91.47700  122.64900 87.17800  1.000 37.39423  ? 52  GLU F CG    1 
ATOM 3852  C CD    . GLU F 2 53  ? 92.15300  122.71100 85.82300  1.000 37.39423  ? 52  GLU F CD    1 
ATOM 3853  O OE1   . GLU F 2 53  ? 92.36500  121.63900 85.22100  1.000 37.39423  ? 52  GLU F OE1   1 
ATOM 3854  O OE2   . GLU F 2 53  ? 92.46700  123.82800 85.36000  1.000 37.39423  ? 52  GLU F OE2   1 
ATOM 3855  N N     . GLU F 2 54  ? 94.53000  120.09100 89.81900  1.000 36.86754  ? 53  GLU F N     1 
ATOM 3856  C CA    . GLU F 2 54  ? 94.96200  119.01800 90.70800  1.000 36.86754  ? 53  GLU F CA    1 
ATOM 3857  C C     . GLU F 2 54  ? 95.87200  119.48900 91.83100  1.000 36.86754  ? 53  GLU F C     1 
ATOM 3858  O O     . GLU F 2 54  ? 95.92000  118.84200 92.88300  1.000 36.86754  ? 53  GLU F O     1 
ATOM 3859  C CB    . GLU F 2 54  ? 95.65100  117.90700 89.91500  1.000 36.86754  ? 53  GLU F CB    1 
ATOM 3860  C CG    . GLU F 2 54  ? 94.94300  117.53700 88.61700  1.000 36.86754  ? 53  GLU F CG    1 
ATOM 3861  C CD    . GLU F 2 54  ? 93.47700  117.15300 88.75900  1.000 36.86754  ? 53  GLU F CD    1 
ATOM 3862  O OE1   . GLU F 2 54  ? 92.72300  117.38600 87.79100  1.000 36.86754  ? 53  GLU F OE1   1 
ATOM 3863  O OE2   . GLU F 2 54  ? 93.08400  116.55400 89.78500  1.000 36.86754  ? 53  GLU F OE2   1 
ATOM 3864  N N     . THR F 2 55  ? 96.61500  120.58000 91.62900  1.000 34.85317  ? 54  THR F N     1 
ATOM 3865  C CA    . THR F 2 55  ? 97.37000  121.15400 92.73600  1.000 34.85317  ? 54  THR F CA    1 
ATOM 3866  C C     . THR F 2 55  ? 96.43000  121.74200 93.77900  1.000 34.85317  ? 54  THR F C     1 
ATOM 3867  O O     . THR F 2 55  ? 96.67400  121.60700 94.98400  1.000 34.85317  ? 54  THR F O     1 
ATOM 3868  C CB    . THR F 2 55  ? 98.34900  122.20200 92.21300  1.000 34.85317  ? 54  THR F CB    1 
ATOM 3869  O OG1   . THR F 2 55  ? 99.19300  121.60000 91.22800  1.000 34.85317  ? 54  THR F OG1   1 
ATOM 3870  C CG2   . THR F 2 55  ? 99.22400  122.73800 93.32800  1.000 34.85317  ? 54  THR F CG2   1 
ATOM 3871  N N     . ARG F 2 56  ? 95.29500  122.27700 93.34000  1.000 34.74079  ? 55  ARG F N     1 
ATOM 3872  C CA    . ARG F 2 56  ? 94.21900  122.69000 94.22700  1.000 34.74079  ? 55  ARG F CA    1 
ATOM 3873  C C     . ARG F 2 56  ? 93.36900  121.52000 94.71000  1.000 34.74079  ? 55  ARG F C     1 
ATOM 3874  O O     . ARG F 2 56  ? 92.30400  121.74700 95.28100  1.000 34.74079  ? 55  ARG F O     1 
ATOM 3875  C CB    . ARG F 2 56  ? 93.31400  123.70100 93.52400  1.000 34.74079  ? 55  ARG F CB    1 
ATOM 3876  C CG    . ARG F 2 56  ? 93.96300  125.01600 93.18800  1.000 34.74079  ? 55  ARG F CG    1 
ATOM 3877  C CD    . ARG F 2 56  ? 93.07100  125.81300 92.26500  1.000 34.74079  ? 55  ARG F CD    1 
ATOM 3878  N NE    . ARG F 2 56  ? 93.80600  126.82300 91.52000  1.000 34.74079  ? 55  ARG F NE    1 
ATOM 3879  C CZ    . ARG F 2 56  ? 93.44000  127.27800 90.32900  1.000 34.74079  ? 55  ARG F CZ    1 
ATOM 3880  N NH1   . ARG F 2 56  ? 94.16400  128.20000 89.71500  1.000 34.74079  ? 55  ARG F NH1   1 
ATOM 3881  N NH2   . ARG F 2 56  ? 92.34400  126.81300 89.75200  1.000 34.74079  ? 55  ARG F NH2   1 
ATOM 3882  N N     . GLY F 2 57  ? 93.77100  120.28400 94.45000  1.000 35.05840  ? 56  GLY F N     1 
ATOM 3883  C CA    . GLY F 2 57  ? 93.15000  119.15100 95.09500  1.000 35.05840  ? 56  GLY F CA    1 
ATOM 3884  C C     . GLY F 2 57  ? 94.09400  118.53200 96.09900  1.000 35.05840  ? 56  GLY F C     1 
ATOM 3885  O O     . GLY F 2 57  ? 93.68500  118.16800 97.20500  1.000 35.05840  ? 56  GLY F O     1 
ATOM 3886  N N     . VAL F 2 58  ? 95.37800  118.45400 95.74100  1.000 33.73515  ? 57  VAL F N     1 
ATOM 3887  C CA    . VAL F 2 58  ? 96.36500  117.91200 96.67200  1.000 33.73515  ? 57  VAL F CA    1 
ATOM 3888  C C     . VAL F 2 58  ? 96.60400  118.88500 97.82600  1.000 33.73515  ? 57  VAL F C     1 
ATOM 3889  O O     . VAL F 2 58  ? 96.80200  118.46400 98.97400  1.000 33.73515  ? 57  VAL F O     1 
ATOM 3890  C CB    . VAL F 2 58  ? 97.66300  117.50800 95.93900  1.000 33.73515  ? 57  VAL F CB    1 
ATOM 3891  C CG1   . VAL F 2 58  ? 98.34900  118.66600 95.25900  1.000 33.73515  ? 57  VAL F CG1   1 
ATOM 3892  C CG2   . VAL F 2 58  ? 98.61900  116.81800 96.88400  1.000 33.73515  ? 57  VAL F CG2   1 
ATOM 3893  N N     . LEU F 2 59  ? 96.55400  120.19700 97.55600  1.000 34.53567  ? 58  LEU F N     1 
ATOM 3894  C CA    . LEU F 2 59  ? 96.67300  121.18000 98.62700  1.000 34.53567  ? 58  LEU F CA    1 
ATOM 3895  C C     . LEU F 2 59  ? 95.47200  121.11900 99.56400  1.000 34.53567  ? 58  LEU F C     1 
ATOM 3896  O O     . LEU F 2 59  ? 95.62200  121.24700 100.78500 1.000 34.53567  ? 58  LEU F O     1 
ATOM 3897  C CB    . LEU F 2 59  ? 96.83100  122.57600 98.03000  1.000 34.53567  ? 58  LEU F CB    1 
ATOM 3898  C CG    . LEU F 2 59  ? 96.80400  123.77300 98.97300  1.000 34.53567  ? 58  LEU F CG    1 
ATOM 3899  C CD1   . LEU F 2 59  ? 97.98000  123.71700 99.91300  1.000 34.53567  ? 58  LEU F CD1   1 
ATOM 3900  C CD2   . LEU F 2 59  ? 96.82800  125.05600 98.18500  1.000 34.53567  ? 58  LEU F CD2   1 
ATOM 3901  N N     . LYS F 2 60  ? 94.28100  120.87400 99.01200  1.000 35.18026  ? 59  LYS F N     1 
ATOM 3902  C CA    . LYS F 2 60  ? 93.08900  120.72800 99.84000  1.000 35.18026  ? 59  LYS F CA    1 
ATOM 3903  C C     . LYS F 2 60  ? 93.14100  119.46100 100.68400 1.000 35.18026  ? 59  LYS F C     1 
ATOM 3904  O O     . LYS F 2 60  ? 92.70000  119.47000 101.83500 1.000 35.18026  ? 59  LYS F O     1 
ATOM 3905  C CB    . LYS F 2 60  ? 91.84100  120.72700 98.96300  1.000 35.18026  ? 59  LYS F CB    1 
ATOM 3906  C CG    . LYS F 2 60  ? 90.57800  121.13700 99.68200  1.000 35.18026  ? 59  LYS F CG    1 
ATOM 3907  C CD    . LYS F 2 60  ? 89.42800  121.29400 98.70500  1.000 35.18026  ? 59  LYS F CD    1 
ATOM 3908  C CE    . LYS F 2 60  ? 88.30000  122.11400 99.30600  1.000 35.18026  ? 59  LYS F CE    1 
ATOM 3909  N NZ    . LYS F 2 60  ? 87.85200  121.57700 100.61700 1.000 35.18026  ? 59  LYS F NZ    1 
ATOM 3910  N N     . VAL F 2 61  ? 93.69000  118.37000 100.14100 1.000 34.08193  ? 60  VAL F N     1 
ATOM 3911  C CA    . VAL F 2 61  ? 93.82000  117.13200 100.91300 1.000 34.08193  ? 60  VAL F CA    1 
ATOM 3912  C C     . VAL F 2 61  ? 94.84000  117.29500 102.04000 1.000 34.08193  ? 60  VAL F C     1 
ATOM 3913  O O     . VAL F 2 61  ? 94.60100  116.86200 103.18100 1.000 34.08193  ? 60  VAL F O     1 
ATOM 3914  C CB    . VAL F 2 61  ? 94.17200  115.96100 99.97400  1.000 34.08193  ? 60  VAL F CB    1 
ATOM 3915  C CG1   . VAL F 2 61  ? 94.58600  114.72500 100.75500 1.000 34.08193  ? 60  VAL F CG1   1 
ATOM 3916  C CG2   . VAL F 2 61  ? 92.98100  115.61700 99.10500  1.000 34.08193  ? 60  VAL F CG2   1 
ATOM 3917  N N     . PHE F 2 62  ? 95.96900  117.95600 101.75200 1.000 32.45955  ? 61  PHE F N     1 
ATOM 3918  C CA    . PHE F 2 62  ? 96.96600  118.23400 102.78400 1.000 32.45955  ? 61  PHE F CA    1 
ATOM 3919  C C     . PHE F 2 62  ? 96.39800  119.11300 103.89100 1.000 32.45955  ? 61  PHE F C     1 
ATOM 3920  O O     . PHE F 2 62  ? 96.62000  118.84700 105.08200 1.000 32.45955  ? 61  PHE F O     1 
ATOM 3921  C CB    . PHE F 2 62  ? 98.19700  118.89200 102.16300 1.000 32.45955  ? 61  PHE F CB    1 
ATOM 3922  C CG    . PHE F 2 62  ? 99.24300  119.28100 103.16300 1.000 32.45955  ? 61  PHE F CG    1 
ATOM 3923  C CD1   . PHE F 2 62  ? 100.08700 118.33100 103.69300 1.000 32.45955  ? 61  PHE F CD1   1 
ATOM 3924  C CD2   . PHE F 2 62  ? 99.39000  120.59700 103.56400 1.000 32.45955  ? 61  PHE F CD2   1 
ATOM 3925  C CE1   . PHE F 2 62  ? 101.04500 118.68200 104.61000 1.000 32.45955  ? 61  PHE F CE1   1 
ATOM 3926  C CE2   . PHE F 2 62  ? 100.34200 120.94600 104.48600 1.000 32.45955  ? 61  PHE F CE2   1 
ATOM 3927  C CZ    . PHE F 2 62  ? 101.17300 119.98900 105.00300 1.000 32.45955  ? 61  PHE F CZ    1 
ATOM 3928  N N     . LEU F 2 63  ? 95.65700  120.16000 103.52200 1.000 33.23566  ? 62  LEU F N     1 
ATOM 3929  C CA    . LEU F 2 63  ? 95.08500  121.02800 104.54000 1.000 33.23566  ? 62  LEU F CA    1 
ATOM 3930  C C     . LEU F 2 63  ? 93.97600  120.32700 105.31000 1.000 33.23566  ? 62  LEU F C     1 
ATOM 3931  O O     . LEU F 2 63  ? 93.86200  120.51600 106.52000 1.000 33.23566  ? 62  LEU F O     1 
ATOM 3932  C CB    . LEU F 2 63  ? 94.57100  122.31600 103.90800 1.000 33.23566  ? 62  LEU F CB    1 
ATOM 3933  C CG    . LEU F 2 63  ? 95.62300  123.30100 103.40800 1.000 33.23566  ? 62  LEU F CG    1 
ATOM 3934  C CD1   . LEU F 2 63  ? 94.98300  124.63800 103.13500 1.000 33.23566  ? 62  LEU F CD1   1 
ATOM 3935  C CD2   . LEU F 2 63  ? 96.75400  123.44700 104.39200 1.000 33.23566  ? 62  LEU F CD2   1 
ATOM 3936  N N     . GLU F 2 64  ? 93.19900  119.46500 104.65800 1.000 35.55923  ? 63  GLU F N     1 
ATOM 3937  C CA    . GLU F 2 64  ? 92.13200  118.76400 105.35200 1.000 35.55923  ? 63  GLU F CA    1 
ATOM 3938  C C     . GLU F 2 64  ? 92.64700  117.62500 106.21300 1.000 35.55923  ? 63  GLU F C     1 
ATOM 3939  O O     . GLU F 2 64  ? 91.87200  117.06700 106.99200 1.000 35.55923  ? 63  GLU F O     1 
ATOM 3940  C CB    . GLU F 2 64  ? 91.12900  118.20600 104.34100 1.000 35.55923  ? 63  GLU F CB    1 
ATOM 3941  C CG    . GLU F 2 64  ? 89.88200  119.04000 104.14400 1.000 35.55923  ? 63  GLU F CG    1 
ATOM 3942  C CD    . GLU F 2 64  ? 88.85000  118.36000 103.26400 1.000 35.55923  ? 63  GLU F CD    1 
ATOM 3943  O OE1   . GLU F 2 64  ? 89.17900  117.32700 102.64400 1.000 35.55923  ? 63  GLU F OE1   1 
ATOM 3944  O OE2   . GLU F 2 64  ? 87.70900  118.86300 103.18900 1.000 35.55923  ? 63  GLU F OE2   1 
ATOM 3945  N N     . ASN F 2 65  ? 93.92200  117.26200 106.08800 1.000 33.71068  ? 64  ASN F N     1 
ATOM 3946  C CA    . ASN F 2 65  ? 94.54000  116.40900 107.09900 1.000 33.71068  ? 64  ASN F CA    1 
ATOM 3947  C C     . ASN F 2 65  ? 95.12700  117.20900 108.25900 1.000 33.71068  ? 64  ASN F C     1 
ATOM 3948  O O     . ASN F 2 65  ? 94.83600  116.92000 109.42900 1.000 33.71068  ? 64  ASN F O     1 
ATOM 3949  C CB    . ASN F 2 65  ? 95.62800  115.54200 106.46700 1.000 33.71068  ? 64  ASN F CB    1 
ATOM 3950  C CG    . ASN F 2 65  ? 95.06400  114.41500 105.64800 1.000 33.71068  ? 64  ASN F CG    1 
ATOM 3951  O OD1   . ASN F 2 65  ? 93.87400  114.11900 105.71800 1.000 33.71068  ? 64  ASN F OD1   1 
ATOM 3952  N ND2   . ASN F 2 65  ? 95.91900  113.76900 104.86600 1.000 33.71068  ? 64  ASN F ND2   1 
ATOM 3953  N N     . VAL F 2 66  ? 95.95600  118.21100 107.94900 1.000 31.83918  ? 65  VAL F N     1 
ATOM 3954  C CA    . VAL F 2 66  ? 96.70400  118.90000 108.99900 1.000 31.83918  ? 65  VAL F CA    1 
ATOM 3955  C C     . VAL F 2 66  ? 95.78200  119.76800 109.84900 1.000 31.83918  ? 65  VAL F C     1 
ATOM 3956  O O     . VAL F 2 66  ? 95.92900  119.82900 111.07500 1.000 31.83918  ? 65  VAL F O     1 
ATOM 3957  C CB    . VAL F 2 66  ? 97.85800  119.71200 108.38400 1.000 31.83918  ? 65  VAL F CB    1 
ATOM 3958  C CG1   . VAL F 2 66  ? 98.67900  120.37700 109.46000 1.000 31.83918  ? 65  VAL F CG1   1 
ATOM 3959  C CG2   . VAL F 2 66  ? 98.74700  118.80700 107.57100 1.000 31.83918  ? 65  VAL F CG2   1 
ATOM 3960  N N     . ILE F 2 67  ? 94.79300  120.41500 109.23000 1.000 32.34650  ? 66  ILE F N     1 
ATOM 3961  C CA    . ILE F 2 67  ? 93.85200  121.24600 109.96700 1.000 32.34650  ? 66  ILE F CA    1 
ATOM 3962  C C     . ILE F 2 67  ? 92.91400  120.38800 110.80700 1.000 32.34650  ? 66  ILE F C     1 
ATOM 3963  O O     . ILE F 2 67  ? 92.54000  120.77700 111.91700 1.000 32.34650  ? 66  ILE F O     1 
ATOM 3964  C CB    . ILE F 2 67  ? 93.10200  122.14500 108.96500 1.000 32.34650  ? 66  ILE F CB    1 
ATOM 3965  C CG1   . ILE F 2 67  ? 94.03100  123.22100 108.42000 1.000 32.34650  ? 66  ILE F CG1   1 
ATOM 3966  C CG2   . ILE F 2 67  ? 91.93000  122.83500 109.58800 1.000 32.34650  ? 66  ILE F CG2   1 
ATOM 3967  C CD1   . ILE F 2 67  ? 93.40900  124.04000 107.31900 1.000 32.34650  ? 66  ILE F CD1   1 
ATOM 3968  N N     . ARG F 2 68  ? 92.57800  119.18400 110.33600 1.000 34.28318  ? 67  ARG F N     1 
ATOM 3969  C CA    . ARG F 2 68  ? 91.78500  118.25600 111.14000 1.000 34.28318  ? 67  ARG F CA    1 
ATOM 3970  C C     . ARG F 2 68  ? 92.53600  117.80100 112.38300 1.000 34.28318  ? 67  ARG F C     1 
ATOM 3971  O O     . ARG F 2 68  ? 91.97200  117.78400 113.48500 1.000 34.28318  ? 67  ARG F O     1 
ATOM 3972  C CB    . ARG F 2 68  ? 91.38600  117.04700 110.30300 1.000 34.28318  ? 67  ARG F CB    1 
ATOM 3973  C CG    . ARG F 2 68  ? 90.64900  115.97100 111.07600 1.000 34.28318  ? 67  ARG F CG    1 
ATOM 3974  C CD    . ARG F 2 68  ? 90.86500  114.61900 110.43200 1.000 34.28318  ? 67  ARG F CD    1 
ATOM 3975  N NE    . ARG F 2 68  ? 90.65400  114.68000 108.99200 1.000 34.28318  ? 67  ARG F NE    1 
ATOM 3976  C CZ    . ARG F 2 68  ? 91.12200  113.78500 108.13200 1.000 34.28318  ? 67  ARG F CZ    1 
ATOM 3977  N NH1   . ARG F 2 68  ? 91.84100  112.76200 108.56500 1.000 34.28318  ? 67  ARG F NH1   1 
ATOM 3978  N NH2   . ARG F 2 68  ? 90.88000  113.92000 106.83700 1.000 34.28318  ? 67  ARG F NH2   1 
ATOM 3979  N N     . ASP F 2 69  ? 93.82200  117.47300 112.23800 1.000 30.94365  ? 68  ASP F N     1 
ATOM 3980  C CA    . ASP F 2 69  ? 94.58800  117.08700 113.41800 1.000 30.94365  ? 68  ASP F CA    1 
ATOM 3981  C C     . ASP F 2 69  ? 94.84700  118.26900 114.34900 1.000 30.94365  ? 68  ASP F C     1 
ATOM 3982  O O     . ASP F 2 69  ? 94.85500  118.09500 115.57200 1.000 30.94365  ? 68  ASP F O     1 
ATOM 3983  C CB    . ASP F 2 69  ? 95.89400  116.41900 113.00800 1.000 30.94365  ? 68  ASP F CB    1 
ATOM 3984  C CG    . ASP F 2 69  ? 95.68400  115.02800 112.46300 1.000 30.94365  ? 68  ASP F CG    1 
ATOM 3985  O OD1   . ASP F 2 69  ? 94.55500  114.51200 112.57900 1.000 30.94365  ? 68  ASP F OD1   1 
ATOM 3986  O OD2   . ASP F 2 69  ? 96.64600  114.44400 111.92600 1.000 30.94365  ? 68  ASP F OD2   1 
ATOM 3987  N N     . ALA F 2 70  ? 95.02300  119.47700 113.80500 1.000 30.46914  ? 69  ALA F N     1 
ATOM 3988  C CA    . ALA F 2 70  ? 95.23600  120.64400 114.65400 1.000 30.46914  ? 69  ALA F CA    1 
ATOM 3989  C C     . ALA F 2 70  ? 93.96500  121.04700 115.38700 1.000 30.46914  ? 69  ALA F C     1 
ATOM 3990  O O     . ALA F 2 70  ? 94.02900  121.49900 116.53300 1.000 30.46914  ? 69  ALA F O     1 
ATOM 3991  C CB    . ALA F 2 70  ? 95.75500  121.81300 113.82600 1.000 30.46914  ? 69  ALA F CB    1 
ATOM 3992  N N     . VAL F 2 71  ? 92.80500  120.85000 114.76400 1.000 31.48405  ? 70  VAL F N     1 
ATOM 3993  C CA    . VAL F 2 71  ? 91.53700  121.08900 115.43700 1.000 31.48405  ? 70  VAL F CA    1 
ATOM 3994  C C     . VAL F 2 71  ? 91.28900  120.03000 116.50300 1.000 31.48405  ? 70  VAL F C     1 
ATOM 3995  O O     . VAL F 2 71  ? 90.74000  120.33300 117.56600 1.000 31.48405  ? 70  VAL F O     1 
ATOM 3996  C CB    . VAL F 2 71  ? 90.42100  121.16300 114.37500 1.000 31.48405  ? 70  VAL F CB    1 
ATOM 3997  C CG1   . VAL F 2 71  ? 89.04200  120.87700 114.94100 1.000 31.48405  ? 70  VAL F CG1   1 
ATOM 3998  C CG2   . VAL F 2 71  ? 90.43200  122.52700 113.74200 1.000 31.48405  ? 70  VAL F CG2   1 
ATOM 3999  N N     . THR F 2 72  ? 91.74700  118.79500 116.27700 1.000 31.44930  ? 71  THR F N     1 
ATOM 4000  C CA    . THR F 2 72  ? 91.63800  117.77400 117.31800 1.000 31.44930  ? 71  THR F CA    1 
ATOM 4001  C C     . THR F 2 72  ? 92.53000  118.09800 118.51400 1.000 31.44930  ? 71  THR F C     1 
ATOM 4002  O O     . THR F 2 72  ? 92.09500  117.98400 119.66800 1.000 31.44930  ? 71  THR F O     1 
ATOM 4003  C CB    . THR F 2 72  ? 91.98100  116.40500 116.74100 1.000 31.44930  ? 71  THR F CB    1 
ATOM 4004  O OG1   . THR F 2 72  ? 91.16300  116.15300 115.59500 1.000 31.44930  ? 71  THR F OG1   1 
ATOM 4005  C CG2   . THR F 2 72  ? 91.70500  115.33100 117.75900 1.000 31.44930  ? 71  THR F CG2   1 
ATOM 4006  N N     . TYR F 2 73  ? 93.76600  118.54400 118.25300 1.000 30.30215  ? 72  TYR F N     1 
ATOM 4007  C CA    . TYR F 2 73  ? 94.65900  118.97400 119.32800 1.000 30.30215  ? 72  TYR F CA    1 
ATOM 4008  C C     . TYR F 2 73  ? 94.12900  120.20200 120.05400 1.000 30.30215  ? 72  TYR F C     1 
ATOM 4009  O O     . TYR F 2 73  ? 94.34600  120.35100 121.25900 1.000 30.30215  ? 72  TYR F O     1 
ATOM 4010  C CB    . TYR F 2 73  ? 96.04700  119.29000 118.78100 1.000 30.30215  ? 72  TYR F CB    1 
ATOM 4011  C CG    . TYR F 2 73  ? 96.97800  118.11800 118.63100 1.000 30.30215  ? 72  TYR F CG    1 
ATOM 4012  C CD1   . TYR F 2 73  ? 97.40400  117.40400 119.73100 1.000 30.30215  ? 72  TYR F CD1   1 
ATOM 4013  C CD2   . TYR F 2 73  ? 97.47000  117.76000 117.39100 1.000 30.30215  ? 72  TYR F CD2   1 
ATOM 4014  C CE1   . TYR F 2 73  ? 98.26900  116.34400 119.59800 1.000 30.30215  ? 72  TYR F CE1   1 
ATOM 4015  C CE2   . TYR F 2 73  ? 98.33500  116.70300 117.24800 1.000 30.30215  ? 72  TYR F CE2   1 
ATOM 4016  C CZ    . TYR F 2 73  ? 98.73100  116.00000 118.35500 1.000 30.30215  ? 72  TYR F CZ    1 
ATOM 4017  O OH    . TYR F 2 73  ? 99.59800  114.94300 118.22300 1.000 30.30215  ? 72  TYR F OH    1 
ATOM 4018  N N     . THR F 2 74  ? 93.43700  121.08900 119.34000 1.000 33.81515  ? 73  THR F N     1 
ATOM 4019  C CA    . THR F 2 74  ? 92.88400  122.28700 119.96100 1.000 33.81515  ? 73  THR F CA    1 
ATOM 4020  C C     . THR F 2 74  ? 91.67700  121.95000 120.82300 1.000 33.81515  ? 73  THR F C     1 
ATOM 4021  O O     . THR F 2 74  ? 91.57500  122.40600 121.96400 1.000 33.81515  ? 73  THR F O     1 
ATOM 4022  C CB    . THR F 2 74  ? 92.51200  123.29700 118.87800 1.000 33.81515  ? 73  THR F CB    1 
ATOM 4023  O OG1   . THR F 2 74  ? 93.70000  123.73400 118.21200 1.000 33.81515  ? 73  THR F OG1   1 
ATOM 4024  C CG2   . THR F 2 74  ? 91.80500  124.49400 119.46300 1.000 33.81515  ? 73  THR F CG2   1 
ATOM 4025  N N     . GLU F 2 75  ? 90.76400  121.12900 120.30300 1.000 35.78215  ? 74  GLU F N     1 
ATOM 4026  C CA    . GLU F 2 75  ? 89.57800  120.73500 121.05000 1.000 35.78215  ? 74  GLU F CA    1 
ATOM 4027  C C     . GLU F 2 75  ? 89.88400  119.78600 122.19600 1.000 35.78215  ? 74  GLU F C     1 
ATOM 4028  O O     . GLU F 2 75  ? 89.03800  119.63000 123.08100 1.000 35.78215  ? 74  GLU F O     1 
ATOM 4029  C CB    . GLU F 2 75  ? 88.55600  120.07800 120.12600 1.000 35.78215  ? 74  GLU F CB    1 
ATOM 4030  C CG    . GLU F 2 75  ? 87.89000  121.02000 119.14800 1.000 35.78215  ? 74  GLU F CG    1 
ATOM 4031  C CD    . GLU F 2 75  ? 86.85300  120.32100 118.28900 1.000 35.78215  ? 74  GLU F CD    1 
ATOM 4032  O OE1   . GLU F 2 75  ? 85.96300  121.01200 117.75200 1.000 35.78215  ? 74  GLU F OE1   1 
ATOM 4033  O OE2   . GLU F 2 75  ? 86.92600  119.08200 118.15300 1.000 35.78215  ? 74  GLU F OE2   1 
ATOM 4034  N N     . HIS F 2 76  ? 91.04800  119.13000 122.19800 1.000 34.19820  ? 75  HIS F N     1 
ATOM 4035  C CA    . HIS F 2 76  ? 91.40400  118.32500 123.36200 1.000 34.19820  ? 75  HIS F CA    1 
ATOM 4036  C C     . HIS F 2 76  ? 91.68700  119.20300 124.57000 1.000 34.19820  ? 75  HIS F C     1 
ATOM 4037  O O     . HIS F 2 76  ? 91.21900  118.92000 125.67800 1.000 34.19820  ? 75  HIS F O     1 
ATOM 4038  C CB    . HIS F 2 76  ? 92.60900  117.44800 123.07000 1.000 34.19820  ? 75  HIS F CB    1 
ATOM 4039  C CG    . HIS F 2 76  ? 93.11400  116.72900 124.27600 1.000 34.19820  ? 75  HIS F CG    1 
ATOM 4040  N ND1   . HIS F 2 76  ? 94.34900  116.97700 124.82800 1.000 34.19820  ? 75  HIS F ND1   1 
ATOM 4041  C CD2   . HIS F 2 76  ? 92.53000  115.79800 125.06300 1.000 34.19820  ? 75  HIS F CD2   1 
ATOM 4042  C CE1   . HIS F 2 76  ? 94.51500  116.20900 125.88900 1.000 34.19820  ? 75  HIS F CE1   1 
ATOM 4043  N NE2   . HIS F 2 76  ? 93.42500  115.48400 126.05300 1.000 34.19820  ? 75  HIS F NE2   1 
ATOM 4044  N N     . ALA F 2 77  ? 92.44900  120.27300 124.37900 1.000 37.63619  ? 76  ALA F N     1 
ATOM 4045  C CA    . ALA F 2 77  ? 92.50200  121.31300 125.38800 1.000 37.63619  ? 76  ALA F CA    1 
ATOM 4046  C C     . ALA F 2 77  ? 91.19000  122.09300 125.38300 1.000 37.63619  ? 76  ALA F C     1 
ATOM 4047  O O     . ALA F 2 77  ? 90.35400  121.96100 124.48600 1.000 37.63619  ? 76  ALA F O     1 
ATOM 4048  C CB    . ALA F 2 77  ? 93.68700  122.24200 125.14300 1.000 37.63619  ? 76  ALA F CB    1 
ATOM 4049  N N     . LYS F 2 78  ? 90.98900  122.90600 126.41000 1.000 45.00985  ? 77  LYS F N     1 
ATOM 4050  C CA    . LYS F 2 78  ? 89.76500  123.69700 126.48200 1.000 45.00985  ? 77  LYS F CA    1 
ATOM 4051  C C     . LYS F 2 78  ? 90.00600  125.05100 125.81200 1.000 45.00985  ? 77  LYS F C     1 
ATOM 4052  O O     . LYS F 2 78  ? 90.01700  126.10900 126.44000 1.000 45.00985  ? 77  LYS F O     1 
ATOM 4053  C CB    . LYS F 2 78  ? 89.31300  123.83500 127.92700 1.000 45.00985  ? 77  LYS F CB    1 
ATOM 4054  C CG    . LYS F 2 78  ? 88.98700  122.50000 128.58100 1.000 45.00985  ? 77  LYS F CG    1 
ATOM 4055  C CD    . LYS F 2 78  ? 87.76300  121.86500 127.94300 1.000 45.00985  ? 77  LYS F CD    1 
ATOM 4056  C CE    . LYS F 2 78  ? 87.28800  120.66200 128.73100 1.000 45.00985  ? 77  LYS F CE    1 
ATOM 4057  N NZ    . LYS F 2 78  ? 86.76400  119.60300 127.83300 1.000 45.00985  ? 77  LYS F NZ    1 
ATOM 4058  N N     . ARG F 2 79  ? 90.20400  124.99300 124.49400 1.000 42.29449  ? 78  ARG F N     1 
ATOM 4059  C CA    . ARG F 2 79  ? 90.55300  126.16400 123.70500 1.000 42.29449  ? 78  ARG F CA    1 
ATOM 4060  C C     . ARG F 2 79  ? 89.60800  126.33400 122.52400 1.000 42.29449  ? 78  ARG F C     1 
ATOM 4061  O O     . ARG F 2 79  ? 88.92800  125.40000 122.09700 1.000 42.29449  ? 78  ARG F O     1 
ATOM 4062  C CB    . ARG F 2 79  ? 91.99200  126.08600 123.19000 1.000 42.29449  ? 78  ARG F CB    1 
ATOM 4063  C CG    . ARG F 2 79  ? 93.02300  126.60400 124.16300 1.000 42.29449  ? 78  ARG F CG    1 
ATOM 4064  C CD    . ARG F 2 79  ? 94.21800  127.15600 123.41900 1.000 42.29449  ? 78  ARG F CD    1 
ATOM 4065  N NE    . ARG F 2 79  ? 94.75700  126.18100 122.48700 1.000 42.29449  ? 78  ARG F NE    1 
ATOM 4066  C CZ    . ARG F 2 79  ? 95.86600  125.48900 122.70300 1.000 42.29449  ? 78  ARG F CZ    1 
ATOM 4067  N NH1   . ARG F 2 79  ? 96.55800  125.67700 123.81600 1.000 42.29449  ? 78  ARG F NH1   1 
ATOM 4068  N NH2   . ARG F 2 79  ? 96.28600  124.61300 121.80600 1.000 42.29449  ? 78  ARG F NH2   1 
ATOM 4069  N N     . LYS F 2 80  ? 89.58600  127.56100 122.00400 1.000 46.78162  ? 79  LYS F N     1 
ATOM 4070  C CA    . LYS F 2 80  ? 88.91600  127.89700 120.75500 1.000 46.78162  ? 79  LYS F CA    1 
ATOM 4071  C C     . LYS F 2 80  ? 89.86900  128.56000 119.77100 1.000 46.78162  ? 79  LYS F C     1 
ATOM 4072  O O     . LYS F 2 80  ? 89.41600  129.13800 118.77800 1.000 46.78162  ? 79  LYS F O     1 
ATOM 4073  C CB    . LYS F 2 80  ? 87.71400  128.81500 121.00200 1.000 46.78162  ? 79  LYS F CB    1 
ATOM 4074  C CG    . LYS F 2 80  ? 86.42300  128.09900 121.36500 1.000 46.78162  ? 79  LYS F CG    1 
ATOM 4075  C CD    . LYS F 2 80  ? 86.30700  127.84800 122.85900 1.000 46.78162  ? 79  LYS F CD    1 
ATOM 4076  C CE    . LYS F 2 80  ? 86.30100  129.14800 123.64200 1.000 46.78162  ? 79  LYS F CE    1 
ATOM 4077  N NZ    . LYS F 2 80  ? 86.27400  128.91000 125.11100 1.000 46.78162  ? 79  LYS F NZ    1 
ATOM 4078  N N     . THR F 2 81  ? 91.17300  128.49900 120.02500 1.000 42.61270  ? 80  THR F N     1 
ATOM 4079  C CA    . THR F 2 81  ? 92.18300  129.13100 119.18700 1.000 42.61270  ? 80  THR F CA    1 
ATOM 4080  C C     . THR F 2 81  ? 93.16600  128.07200 118.71900 1.000 42.61270  ? 80  THR F C     1 
ATOM 4081  O O     . THR F 2 81  ? 93.79800  127.40700 119.54400 1.000 42.61270  ? 80  THR F O     1 
ATOM 4082  C CB    . THR F 2 81  ? 92.92100  130.23100 119.94800 1.000 42.61270  ? 80  THR F CB    1 
ATOM 4083  O OG1   . THR F 2 81  ? 92.00200  131.26500 120.31000 1.000 42.61270  ? 80  THR F OG1   1 
ATOM 4084  C CG2   . THR F 2 81  ? 94.01200  130.82200 119.08900 1.000 42.61270  ? 80  THR F CG2   1 
ATOM 4085  N N     . VAL F 2 82  ? 93.29100  127.91200 117.40600 1.000 37.58586  ? 81  VAL F N     1 
ATOM 4086  C CA    . VAL F 2 82  ? 94.28500  127.00800 116.83900 1.000 37.58586  ? 81  VAL F CA    1 
ATOM 4087  C C     . VAL F 2 82  ? 95.62900  127.72200 116.88500 1.000 37.58586  ? 81  VAL F C     1 
ATOM 4088  O O     . VAL F 2 82  ? 95.88900  128.62000 116.08400 1.000 37.58586  ? 81  VAL F O     1 
ATOM 4089  C CB    . VAL F 2 82  ? 93.92300  126.60100 115.40900 1.000 37.58586  ? 81  VAL F CB    1 
ATOM 4090  C CG1   . VAL F 2 82  ? 94.77700  125.44000 114.96800 1.000 37.58586  ? 81  VAL F CG1   1 
ATOM 4091  C CG2   . VAL F 2 82  ? 92.45800  126.25000 115.31800 1.000 37.58586  ? 81  VAL F CG2   1 
ATOM 4092  N N     . THR F 2 83  ? 96.49200  127.31800 117.80900 1.000 36.11211  ? 82  THR F N     1 
ATOM 4093  C CA    . THR F 2 83  ? 97.76200  128.00000 117.98700 1.000 36.11211  ? 82  THR F CA    1 
ATOM 4094  C C     . THR F 2 83  ? 98.79500  127.48300 116.99300 1.000 36.11211  ? 82  THR F C     1 
ATOM 4095  O O     . THR F 2 83  ? 98.52100  126.62400 116.15400 1.000 36.11211  ? 82  THR F O     1 
ATOM 4096  C CB    . THR F 2 83  ? 98.26700  127.82500 119.41400 1.000 36.11211  ? 82  THR F CB    1 
ATOM 4097  O OG1   . THR F 2 83  ? 98.43900  126.43200 119.69000 1.000 36.11211  ? 82  THR F OG1   1 
ATOM 4098  C CG2   . THR F 2 83  ? 97.28000  128.40700 120.39700 1.000 36.11211  ? 82  THR F CG2   1 
ATOM 4099  N N     . ALA F 2 84  ? 100.00700 128.03200 117.08200 1.000 34.66463  ? 83  ALA F N     1 
ATOM 4100  C CA    . ALA F 2 84  ? 101.10000 127.53900 116.25500 1.000 34.66463  ? 83  ALA F CA    1 
ATOM 4101  C C     . ALA F 2 84  ? 101.60200 126.19700 116.75000 1.000 34.66463  ? 83  ALA F C     1 
ATOM 4102  O O     . ALA F 2 84  ? 102.15900 125.41800 115.97100 1.000 34.66463  ? 83  ALA F O     1 
ATOM 4103  C CB    . ALA F 2 84  ? 102.24300 128.54900 116.22600 1.000 34.66463  ? 83  ALA F CB    1 
ATOM 4104  N N     . MET F 2 85  ? 101.44500 125.92700 118.04500 1.000 35.09205  ? 84  MET F N     1 
ATOM 4105  C CA    . MET F 2 85  ? 101.82300 124.63300 118.59200 1.000 35.09205  ? 84  MET F CA    1 
ATOM 4106  C C     . MET F 2 85  ? 100.92300 123.51100 118.09800 1.000 35.09205  ? 84  MET F C     1 
ATOM 4107  O O     . MET F 2 85  ? 101.40100 122.39400 117.89900 1.000 35.09205  ? 84  MET F O     1 
ATOM 4108  C CB    . MET F 2 85  ? 101.79700 124.68200 120.11800 1.000 35.09205  ? 84  MET F CB    1 
ATOM 4109  C CG    . MET F 2 85  ? 103.04600 125.25700 120.74700 1.000 35.09205  ? 84  MET F CG    1 
ATOM 4110  S SD    . MET F 2 85  ? 104.48800 124.23900 120.40400 1.000 35.09205  ? 84  MET F SD    1 
ATOM 4111  C CE    . MET F 2 85  ? 105.68000 125.00400 121.49300 1.000 35.09205  ? 84  MET F CE    1 
ATOM 4112  N N     . ASP F 2 86  ? 99.63000  123.77900 117.89500 1.000 33.02841  ? 85  ASP F N     1 
ATOM 4113  C CA    . ASP F 2 86  ? 98.72300  122.74100 117.40800 1.000 33.02841  ? 85  ASP F CA    1 
ATOM 4114  C C     . ASP F 2 86  ? 99.05600  122.32400 115.98300 1.000 33.02841  ? 85  ASP F C     1 
ATOM 4115  O O     . ASP F 2 86  ? 99.01200  121.13400 115.65600 1.000 33.02841  ? 85  ASP F O     1 
ATOM 4116  C CB    . ASP F 2 86  ? 97.28000  123.22200 117.49100 1.000 33.02841  ? 85  ASP F CB    1 
ATOM 4117  C CG    . ASP F 2 86  ? 96.80900  123.38500 118.91200 1.000 33.02841  ? 85  ASP F CG    1 
ATOM 4118  O OD1   . ASP F 2 86  ? 97.45400  122.81700 119.81600 1.000 33.02841  ? 85  ASP F OD1   1 
ATOM 4119  O OD2   . ASP F 2 86  ? 95.80100  124.08700 119.13300 1.000 33.02841  ? 85  ASP F OD2   1 
ATOM 4120  N N     . VAL F 2 87  ? 99.45000  123.27900 115.14200 1.000 30.96250  ? 86  VAL F N     1 
ATOM 4121  C CA    . VAL F 2 87  ? 99.84300  122.95600 113.77700 1.000 30.96250  ? 86  VAL F CA    1 
ATOM 4122  C C     . VAL F 2 87  ? 101.16800 122.20500 113.76300 1.000 30.96250  ? 86  VAL F C     1 
ATOM 4123  O O     . VAL F 2 87  ? 101.32900 121.22700 113.02600 1.000 30.96250  ? 86  VAL F O     1 
ATOM 4124  C CB    . VAL F 2 87  ? 99.90500  124.24000 112.93400 1.000 30.96250  ? 86  VAL F CB    1 
ATOM 4125  C CG1   . VAL F 2 87  ? 100.21600 123.92000 111.49600 1.000 30.96250  ? 86  VAL F CG1   1 
ATOM 4126  C CG2   . VAL F 2 87  ? 98.60000  124.99700 113.04000 1.000 30.96250  ? 86  VAL F CG2   1 
ATOM 4127  N N     . VAL F 2 88  ? 102.12000 122.62700 114.60000 1.000 30.81142  ? 87  VAL F N     1 
ATOM 4128  C CA    . VAL F 2 88  ? 103.42600 121.97600 114.67600 1.000 30.81142  ? 87  VAL F CA    1 
ATOM 4129  C C     . VAL F 2 88  ? 103.29100 120.54900 115.20000 1.000 30.81142  ? 87  VAL F C     1 
ATOM 4130  O O     . VAL F 2 88  ? 103.92400 119.62200 114.68100 1.000 30.81142  ? 87  VAL F O     1 
ATOM 4131  C CB    . VAL F 2 88  ? 104.37900 122.83200 115.53600 1.000 30.81142  ? 87  VAL F CB    1 
ATOM 4132  C CG1   . VAL F 2 88  ? 105.53500 122.02300 116.08600 1.000 30.81142  ? 87  VAL F CG1   1 
ATOM 4133  C CG2   . VAL F 2 88  ? 104.91600 123.98900 114.72000 1.000 30.81142  ? 87  VAL F CG2   1 
ATOM 4134  N N     . TYR F 2 89  ? 102.40000 120.33300 116.16800 1.000 32.90451  ? 88  TYR F N     1 
ATOM 4135  C CA    . TYR F 2 89  ? 102.19500 118.98700 116.69100 1.000 32.90451  ? 88  TYR F CA    1 
ATOM 4136  C C     . TYR F 2 89  ? 101.41000 118.10900 115.72600 1.000 32.90451  ? 88  TYR F C     1 
ATOM 4137  O O     . TYR F 2 89  ? 101.66600 116.90400 115.65800 1.000 32.90451  ? 88  TYR F O     1 
ATOM 4138  C CB    . TYR F 2 89  ? 101.47700 119.04000 118.03800 1.000 32.90451  ? 88  TYR F CB    1 
ATOM 4139  C CG    . TYR F 2 89  ? 102.26900 119.68300 119.14700 1.000 32.90451  ? 88  TYR F CG    1 
ATOM 4140  C CD1   . TYR F 2 89  ? 103.65600 119.67900 119.13200 1.000 32.90451  ? 88  TYR F CD1   1 
ATOM 4141  C CD2   . TYR F 2 89  ? 101.62700 120.28200 120.22200 1.000 32.90451  ? 88  TYR F CD2   1 
ATOM 4142  C CE1   . TYR F 2 89  ? 104.38100 120.26600 120.15000 1.000 32.90451  ? 88  TYR F CE1   1 
ATOM 4143  C CE2   . TYR F 2 89  ? 102.34300 120.86900 121.24300 1.000 32.90451  ? 88  TYR F CE2   1 
ATOM 4144  C CZ    . TYR F 2 89  ? 103.71900 120.85600 121.20000 1.000 32.90451  ? 88  TYR F CZ    1 
ATOM 4145  O OH    . TYR F 2 89  ? 104.43700 121.43700 122.21600 1.000 32.90451  ? 88  TYR F OH    1 
ATOM 4146  N N     . ALA F 2 90  ? 100.47400 118.68500 114.96300 1.000 31.58428  ? 89  ALA F N     1 
ATOM 4147  C CA    . ALA F 2 90  ? 99.79000  117.92500 113.92000 1.000 31.58428  ? 89  ALA F CA    1 
ATOM 4148  C C     . ALA F 2 90  ? 100.75400 117.48500 112.83000 1.000 31.58428  ? 89  ALA F C     1 
ATOM 4149  O O     . ALA F 2 90  ? 100.72000 116.32900 112.38100 1.000 31.58428  ? 89  ALA F O     1 
ATOM 4150  C CB    . ALA F 2 90  ? 98.67300  118.76900 113.32100 1.000 31.58428  ? 89  ALA F CB    1 
ATOM 4151  N N     . LEU F 2 91  ? 101.65700 118.38000 112.43100 1.000 31.14439  ? 90  LEU F N     1 
ATOM 4152  C CA    . LEU F 2 91  ? 102.63500 118.04500 111.40800 1.000 31.14439  ? 90  LEU F CA    1 
ATOM 4153  C C     . LEU F 2 91  ? 103.66500 117.05200 111.92600 1.000 31.14439  ? 90  LEU F C     1 
ATOM 4154  O O     . LEU F 2 91  ? 104.12800 116.19800 111.16600 1.000 31.14439  ? 90  LEU F O     1 
ATOM 4155  C CB    . LEU F 2 91  ? 103.30800 119.31800 110.91000 1.000 31.14439  ? 90  LEU F CB    1 
ATOM 4156  C CG    . LEU F 2 91  ? 102.42900 120.24400 110.08000 1.000 31.14439  ? 90  LEU F CG    1 
ATOM 4157  C CD1   . LEU F 2 91  ? 102.97000 121.64300 110.15700 1.000 31.14439  ? 90  LEU F CD1   1 
ATOM 4158  C CD2   . LEU F 2 91  ? 102.37600 119.77500 108.65600 1.000 31.14439  ? 90  LEU F CD2   1 
ATOM 4159  N N     . LYS F 2 92  ? 104.03100 117.14100 113.20600 1.000 33.17796  ? 91  LYS F N     1 
ATOM 4160  C CA    . LYS F 2 92  ? 104.96000 116.16900 113.77000 1.000 33.17796  ? 91  LYS F CA    1 
ATOM 4161  C C     . LYS F 2 92  ? 104.29500 114.81300 113.94400 1.000 33.17796  ? 91  LYS F C     1 
ATOM 4162  O O     . LYS F 2 92  ? 104.96900 113.78100 113.88400 1.000 33.17796  ? 91  LYS F O     1 
ATOM 4163  C CB    . LYS F 2 92  ? 105.49000 116.67300 115.10900 1.000 33.17796  ? 91  LYS F CB    1 
ATOM 4164  C CG    . LYS F 2 92  ? 106.72600 115.96300 115.61500 1.000 33.17796  ? 91  LYS F CG    1 
ATOM 4165  C CD    . LYS F 2 92  ? 107.13000 116.51500 116.96700 1.000 33.17796  ? 91  LYS F CD    1 
ATOM 4166  C CE    . LYS F 2 92  ? 107.39800 118.01400 116.89200 1.000 33.17796  ? 91  LYS F CE    1 
ATOM 4167  N NZ    . LYS F 2 92  ? 107.50200 118.64300 118.23700 1.000 33.17796  ? 91  LYS F NZ    1 
ATOM 4168  N N     . ARG F 2 93  ? 102.97900 114.80000 114.17300 1.000 32.48417  ? 92  ARG F N     1 
ATOM 4169  C CA    . ARG F 2 93  ? 102.24000 113.54500 114.21500 1.000 32.48417  ? 92  ARG F CA    1 
ATOM 4170  C C     . ARG F 2 93  ? 102.21400 112.89400 112.83900 1.000 32.48417  ? 92  ARG F C     1 
ATOM 4171  O O     . ARG F 2 93  ? 102.33800 111.67000 112.72500 1.000 32.48417  ? 92  ARG F O     1 
ATOM 4172  C CB    . ARG F 2 93  ? 100.83000 113.79200 114.78700 1.000 32.48417  ? 92  ARG F CB    1 
ATOM 4173  C CG    . ARG F 2 93  ? 99.83600  112.61000 114.81900 1.000 32.48417  ? 92  ARG F CG    1 
ATOM 4174  C CD    . ARG F 2 93  ? 98.95200  112.54700 113.58000 1.000 32.48417  ? 92  ARG F CD    1 
ATOM 4175  N NE    . ARG F 2 93  ? 98.39100  111.22900 113.33700 1.000 32.48417  ? 92  ARG F NE    1 
ATOM 4176  C CZ    . ARG F 2 93  ? 97.49600  110.97900 112.38900 1.000 32.48417  ? 92  ARG F CZ    1 
ATOM 4177  N NH1   . ARG F 2 93  ? 97.06700  111.96100 111.61300 1.000 32.48417  ? 92  ARG F NH1   1 
ATOM 4178  N NH2   . ARG F 2 93  ? 97.02900  109.75200 112.21300 1.000 32.48417  ? 92  ARG F NH2   1 
ATOM 4179  N N     . GLN F 2 94  ? 102.06200 113.68900 111.78100 1.000 33.66366  ? 93  GLN F N     1 
ATOM 4180  C CA    . GLN F 2 94  ? 101.99200 113.10000 110.44700 1.000 33.66366  ? 93  GLN F CA    1 
ATOM 4181  C C     . GLN F 2 94  ? 103.35700 112.82600 109.82500 1.000 33.66366  ? 93  GLN F C     1 
ATOM 4182  O O     . GLN F 2 94  ? 103.41800 112.51800 108.63200 1.000 33.66366  ? 93  GLN F O     1 
ATOM 4183  C CB    . GLN F 2 94  ? 101.17300 113.98600 109.51600 1.000 33.66366  ? 93  GLN F CB    1 
ATOM 4184  C CG    . GLN F 2 94  ? 99.77800  114.20800 110.01100 1.000 33.66366  ? 93  GLN F CG    1 
ATOM 4185  C CD    . GLN F 2 94  ? 99.05700  115.24400 109.21400 1.000 33.66366  ? 93  GLN F CD    1 
ATOM 4186  O OE1   . GLN F 2 94  ? 99.45500  115.57000 108.09900 1.000 33.66366  ? 93  GLN F OE1   1 
ATOM 4187  N NE2   . GLN F 2 94  ? 97.98400  115.77900 109.77900 1.000 33.66366  ? 93  GLN F NE2   1 
ATOM 4188  N N     . GLY F 2 95  ? 104.44300 112.92900 110.58500 1.000 33.41257  ? 94  GLY F N     1 
ATOM 4189  C CA    . GLY F 2 95  ? 105.75800 112.58200 110.09700 1.000 33.41257  ? 94  GLY F CA    1 
ATOM 4190  C C     . GLY F 2 95  ? 106.56700 113.71300 109.50400 1.000 33.41257  ? 94  GLY F C     1 
ATOM 4191  O O     . GLY F 2 95  ? 107.77600 113.54800 109.31000 1.000 33.41257  ? 94  GLY F O     1 
ATOM 4192  N N     . ARG F 2 96  ? 105.95900 114.85400 109.22200 1.000 32.33440  ? 95  ARG F N     1 
ATOM 4193  C CA    . ARG F 2 96  ? 106.65100 115.97400 108.59400 1.000 32.33440  ? 95  ARG F CA    1 
ATOM 4194  C C     . ARG F 2 96  ? 106.87800 117.04900 109.65600 1.000 32.33440  ? 95  ARG F C     1 
ATOM 4195  O O     . ARG F 2 96  ? 106.05400 117.94100 109.84600 1.000 32.33440  ? 95  ARG F O     1 
ATOM 4196  C CB    . ARG F 2 96  ? 105.86200 116.47900 107.38300 1.000 32.33440  ? 95  ARG F CB    1 
ATOM 4197  C CG    . ARG F 2 96  ? 104.35300 116.45900 107.54600 1.000 32.33440  ? 95  ARG F CG    1 
ATOM 4198  C CD    . ARG F 2 96  ? 103.65800 116.86700 106.26900 1.000 32.33440  ? 95  ARG F CD    1 
ATOM 4199  N NE    . ARG F 2 96  ? 103.51400 115.73400 105.36300 1.000 32.33440  ? 95  ARG F NE    1 
ATOM 4200  C CZ    . ARG F 2 96  ? 102.41600 114.99400 105.27100 1.000 32.33440  ? 95  ARG F CZ    1 
ATOM 4201  N NH1   . ARG F 2 96  ? 102.36800 113.97500 104.42600 1.000 32.33440  ? 95  ARG F NH1   1 
ATOM 4202  N NH2   . ARG F 2 96  ? 101.36500 115.27100 106.02700 1.000 32.33440  ? 95  ARG F NH2   1 
ATOM 4203  N N     . THR F 2 97  ? 108.01600 116.95500 110.34100 1.000 32.52990  ? 96  THR F N     1 
ATOM 4204  C CA    . THR F 2 97  ? 108.35200 117.89100 111.40600 1.000 32.52990  ? 96  THR F CA    1 
ATOM 4205  C C     . THR F 2 97  ? 108.59600 119.28200 110.82900 1.000 32.52990  ? 96  THR F C     1 
ATOM 4206  O O     . THR F 2 97  ? 109.15600 119.43100 109.74300 1.000 32.52990  ? 96  THR F O     1 
ATOM 4207  C CB    . THR F 2 97  ? 109.59500 117.39300 112.15400 1.000 32.52990  ? 96  THR F CB    1 
ATOM 4208  O OG1   . THR F 2 97  ? 109.38700 116.04200 112.57800 1.000 32.52990  ? 96  THR F OG1   1 
ATOM 4209  C CG2   . THR F 2 97  ? 109.86700 118.21300 113.39600 1.000 32.52990  ? 96  THR F CG2   1 
ATOM 4210  N N     . LEU F 2 98  ? 108.12500 120.30300 111.53500 1.000 30.73620  ? 97  LEU F N     1 
ATOM 4211  C CA    . LEU F 2 98  ? 108.35300 121.69000 111.16600 1.000 30.73620  ? 97  LEU F CA    1 
ATOM 4212  C C     . LEU F 2 98  ? 109.16000 122.36500 112.26400 1.000 30.73620  ? 97  LEU F C     1 
ATOM 4213  O O     . LEU F 2 98  ? 108.88100 122.17600 113.45100 1.000 30.73620  ? 97  LEU F O     1 
ATOM 4214  C CB    . LEU F 2 98  ? 107.02400 122.41500 110.95900 1.000 30.73620  ? 97  LEU F CB    1 
ATOM 4215  C CG    . LEU F 2 98  ? 107.00500 123.85400 110.44900 1.000 30.73620  ? 97  LEU F CG    1 
ATOM 4216  C CD1   . LEU F 2 98  ? 107.61200 123.94700 109.07200 1.000 30.73620  ? 97  LEU F CD1   1 
ATOM 4217  C CD2   . LEU F 2 98  ? 105.58600 124.37200 110.43600 1.000 30.73620  ? 97  LEU F CD2   1 
ATOM 4218  N N     . TYR F 2 99  ? 110.14600 123.16800 111.87400 1.000 30.92535  ? 98  TYR F N     1 
ATOM 4219  C CA    . TYR F 2 99  ? 111.01500 123.83400 112.82900 1.000 30.92535  ? 98  TYR F CA    1 
ATOM 4220  C C     . TYR F 2 99  ? 110.83300 125.34000 112.72900 1.000 30.92535  ? 98  TYR F C     1 
ATOM 4221  O O     . TYR F 2 99  ? 110.42600 125.86700 111.69600 1.000 30.92535  ? 98  TYR F O     1 
ATOM 4222  C CB    . TYR F 2 99  ? 112.50100 123.53200 112.59600 1.000 30.92535  ? 98  TYR F CB    1 
ATOM 4223  C CG    . TYR F 2 99  ? 112.97800 122.14600 112.94000 1.000 30.92535  ? 98  TYR F CG    1 
ATOM 4224  C CD1   . TYR F 2 99  ? 112.35200 121.39000 113.91000 1.000 30.92535  ? 98  TYR F CD1   1 
ATOM 4225  C CD2   . TYR F 2 99  ? 114.11500 121.62900 112.34400 1.000 30.92535  ? 98  TYR F CD2   1 
ATOM 4226  C CE1   . TYR F 2 99  ? 112.80900 120.13300 114.23400 1.000 30.92535  ? 98  TYR F CE1   1 
ATOM 4227  C CE2   . TYR F 2 99  ? 114.58100 120.37900 112.66100 1.000 30.92535  ? 98  TYR F CE2   1 
ATOM 4228  C CZ    . TYR F 2 99  ? 113.92500 119.63500 113.60900 1.000 30.92535  ? 98  TYR F CZ    1 
ATOM 4229  O OH    . TYR F 2 99  ? 114.39100 118.38600 113.92900 1.000 30.92535  ? 98  TYR F OH    1 
ATOM 4230  N N     . GLY F 2 100 ? 111.14000 126.02700 113.82500 1.000 36.90031  ? 99  GLY F N     1 
ATOM 4231  C CA    . GLY F 2 100 ? 111.13200 127.47200 113.86100 1.000 36.90031  ? 99  GLY F CA    1 
ATOM 4232  C C     . GLY F 2 100 ? 109.85100 128.13900 114.30400 1.000 36.90031  ? 99  GLY F C     1 
ATOM 4233  O O     . GLY F 2 100 ? 109.85000 129.36000 114.49800 1.000 36.90031  ? 99  GLY F O     1 
ATOM 4234  N N     . PHE F 2 101 ? 108.75800 127.40200 114.46600 1.000 34.26682  ? 100 PHE F N     1 
ATOM 4235  C CA    . PHE F 2 101 ? 107.53400 127.99100 114.98600 1.000 34.26682  ? 100 PHE F CA    1 
ATOM 4236  C C     . PHE F 2 101 ? 107.25400 127.59400 116.42500 1.000 34.26682  ? 100 PHE F C     1 
ATOM 4237  O O     . PHE F 2 101 ? 106.94200 128.44900 117.25700 1.000 34.26682  ? 100 PHE F O     1 
ATOM 4238  C CB    . PHE F 2 101 ? 106.34700 127.61200 114.09700 1.000 34.26682  ? 100 PHE F CB    1 
ATOM 4239  C CG    . PHE F 2 101 ? 106.36200 128.29600 112.77100 1.000 34.26682  ? 100 PHE F CG    1 
ATOM 4240  C CD1   . PHE F 2 101 ? 105.86400 129.57700 112.63600 1.000 34.26682  ? 100 PHE F CD1   1 
ATOM 4241  C CD2   . PHE F 2 101 ? 106.88000 127.66200 111.66000 1.000 34.26682  ? 100 PHE F CD2   1 
ATOM 4242  C CE1   . PHE F 2 101 ? 105.88400 130.21300 111.41700 1.000 34.26682  ? 100 PHE F CE1   1 
ATOM 4243  C CE2   . PHE F 2 101 ? 106.89500 128.29100 110.44100 1.000 34.26682  ? 100 PHE F CE2   1 
ATOM 4244  C CZ    . PHE F 2 101 ? 106.40000 129.56900 110.32000 1.000 34.26682  ? 100 PHE F CZ    1 
ATOM 4245  N N     . GLY F 2 102 ? 107.35700 126.30900 116.73700 1.000 36.04030  ? 101 GLY F N     1 
ATOM 4246  C CA    . GLY F 2 102 ? 107.10500 125.82900 118.07700 1.000 36.04030  ? 101 GLY F CA    1 
ATOM 4247  C C     . GLY F 2 102 ? 108.26000 125.04300 118.65300 1.000 36.04030  ? 101 GLY F C     1 
ATOM 4248  O O     . GLY F 2 102 ? 108.79700 124.14200 118.00300 1.000 36.04030  ? 101 GLY F O     1 
ATOM 4249  N N     . GLY F 2 103 ? 108.65300 125.37900 119.87300 1.000 39.41540  ? 102 GLY F N     1 
ATOM 4250  C CA    . GLY F 2 103 ? 109.74400 124.69500 120.53600 1.000 39.41540  ? 102 GLY F CA    1 
ATOM 4251  C C     . GLY F 2 103 ? 110.66100 125.67000 121.23600 1.000 39.41540  ? 102 GLY F C     1 
ATOM 4252  O O     . GLY F 2 103 ? 111.29200 126.51200 120.59500 1.000 39.41540  ? 102 GLY F O     1 
ATOM 4253  N N     . ARG G 3 12  ? 83.80200  89.54000  152.00200 1.000 73.14633  ? 11  ARG G N     1 
ATOM 4254  C CA    . ARG G 3 12  ? 84.10000  90.33100  150.81700 1.000 73.14633  ? 11  ARG G CA    1 
ATOM 4255  C C     . ARG G 3 12  ? 83.18200  89.90600  149.67200 1.000 73.14633  ? 11  ARG G C     1 
ATOM 4256  O O     . ARG G 3 12  ? 82.89600  88.72100  149.51200 1.000 73.14633  ? 11  ARG G O     1 
ATOM 4257  C CB    . ARG G 3 12  ? 85.57300  90.17400  150.42900 1.000 73.14633  ? 11  ARG G CB    1 
ATOM 4258  C CG    . ARG G 3 12  ? 86.01200  90.95600  149.19500 1.000 73.14633  ? 11  ARG G CG    1 
ATOM 4259  C CD    . ARG G 3 12  ? 87.50900  90.85800  148.94700 1.000 73.14633  ? 11  ARG G CD    1 
ATOM 4260  N NE    . ARG G 3 12  ? 87.94900  89.47400  148.81200 1.000 73.14633  ? 11  ARG G NE    1 
ATOM 4261  C CZ    . ARG G 3 12  ? 88.70300  88.84200  149.70400 1.000 73.14633  ? 11  ARG G CZ    1 
ATOM 4262  N NH1   . ARG G 3 12  ? 89.04900  87.57900  149.50700 1.000 73.14633  ? 11  ARG G NH1   1 
ATOM 4263  N NH2   . ARG G 3 12  ? 89.10500  89.47500  150.79900 1.000 73.14633  ? 11  ARG G NH2   1 
ATOM 4264  N N     . ALA G 3 13  ? 82.71200  90.88300  148.89700 1.000 74.11263  ? 12  ALA G N     1 
ATOM 4265  C CA    . ALA G 3 13  ? 81.84300  90.62900  147.75800 1.000 74.11263  ? 12  ALA G CA    1 
ATOM 4266  C C     . ALA G 3 13  ? 82.58100  89.86300  146.66100 1.000 74.11263  ? 12  ALA G C     1 
ATOM 4267  O O     . ALA G 3 13  ? 83.81300  89.82900  146.60500 1.000 74.11263  ? 12  ALA G O     1 
ATOM 4268  C CB    . ALA G 3 13  ? 81.29100  91.94300  147.20500 1.000 74.11263  ? 12  ALA G CB    1 
ATOM 4269  N N     . LYS G 3 14  ? 81.79700  89.22500  145.79100 1.000 73.27455  ? 13  LYS G N     1 
ATOM 4270  C CA    . LYS G 3 14  ? 82.34600  88.37900  144.73800 1.000 73.27455  ? 13  LYS G CA    1 
ATOM 4271  C C     . LYS G 3 14  ? 83.06800  89.21900  143.69200 1.000 73.27455  ? 13  LYS G C     1 
ATOM 4272  O O     . LYS G 3 14  ? 82.55900  90.25100  143.24900 1.000 73.27455  ? 13  LYS G O     1 
ATOM 4273  C CB    . LYS G 3 14  ? 81.22800  87.56600  144.08900 1.000 73.27455  ? 13  LYS G CB    1 
ATOM 4274  C CG    . LYS G 3 14  ? 81.69100  86.33300  143.33400 1.000 73.27455  ? 13  LYS G CG    1 
ATOM 4275  C CD    . LYS G 3 14  ? 82.60600  85.46200  144.17500 1.000 73.27455  ? 13  LYS G CD    1 
ATOM 4276  C CE    . LYS G 3 14  ? 82.80000  84.10200  143.52800 1.000 73.27455  ? 13  LYS G CE    1 
ATOM 4277  N NZ    . LYS G 3 14  ? 83.33200  84.21100  142.14600 1.000 73.27455  ? 13  LYS G NZ    1 
ATOM 4278  N N     . ALA G 3 15  ? 84.25800  88.76800  143.30000 1.000 68.74653  ? 14  ALA G N     1 
ATOM 4279  C CA    . ALA G 3 15  ? 85.16600  89.57300  142.49500 1.000 68.74653  ? 14  ALA G CA    1 
ATOM 4280  C C     . ALA G 3 15  ? 84.71600  89.66600  141.04300 1.000 68.74653  ? 14  ALA G C     1 
ATOM 4281  O O     . ALA G 3 15  ? 85.03100  88.79400  140.22800 1.000 68.74653  ? 14  ALA G O     1 
ATOM 4282  C CB    . ALA G 3 15  ? 86.58400  89.00700  142.57100 1.000 68.74653  ? 14  ALA G CB    1 
ATOM 4283  N N     . LYS G 3 16  ? 83.97800  90.72200  140.71800 1.000 63.83747  ? 15  LYS G N     1 
ATOM 4284  C CA    . LYS G 3 16  ? 83.58100  91.00100  139.34400 1.000 63.83747  ? 15  LYS G CA    1 
ATOM 4285  C C     . LYS G 3 16  ? 84.74000  91.66700  138.61700 1.000 63.83747  ? 15  LYS G C     1 
ATOM 4286  O O     . LYS G 3 16  ? 85.25300  92.69300  139.07600 1.000 63.83747  ? 15  LYS G O     1 
ATOM 4287  C CB    . LYS G 3 16  ? 82.34600  91.89700  139.33000 1.000 63.83747  ? 15  LYS G CB    1 
ATOM 4288  C CG    . LYS G 3 16  ? 81.36700  91.57700  140.44200 1.000 63.83747  ? 15  LYS G CG    1 
ATOM 4289  C CD    . LYS G 3 16  ? 80.01400  92.22600  140.22800 1.000 63.83747  ? 15  LYS G CD    1 
ATOM 4290  C CE    . LYS G 3 16  ? 79.93600  93.55800  140.94700 1.000 63.83747  ? 15  LYS G CE    1 
ATOM 4291  N NZ    . LYS G 3 16  ? 78.53100  93.97500  141.18300 1.000 63.83747  ? 15  LYS G NZ    1 
ATOM 4292  N N     . SER G 3 17  ? 85.16700  91.08300  137.50100 1.000 55.78291  ? 16  SER G N     1 
ATOM 4293  C CA    . SER G 3 17  ? 86.25200  91.67400  136.73300 1.000 55.78291  ? 16  SER G CA    1 
ATOM 4294  C C     . SER G 3 17  ? 85.78000  92.94200  136.03700 1.000 55.78291  ? 16  SER G C     1 
ATOM 4295  O O     . SER G 3 17  ? 84.61100  93.07900  135.67100 1.000 55.78291  ? 16  SER G O     1 
ATOM 4296  C CB    . SER G 3 17  ? 86.79400  90.68200  135.70600 1.000 55.78291  ? 16  SER G CB    1 
ATOM 4297  O OG    . SER G 3 17  ? 85.81100  90.34700  134.74800 1.000 55.78291  ? 16  SER G OG    1 
ATOM 4298  N N     . ARG G 3 18  ? 86.71100  93.88200  135.86400 1.000 49.19314  ? 17  ARG G N     1 
ATOM 4299  C CA    . ARG G 3 18  ? 86.37000  95.18400  135.30600 1.000 49.19314  ? 17  ARG G CA    1 
ATOM 4300  C C     . ARG G 3 18  ? 86.04000  95.12400  133.82200 1.000 49.19314  ? 17  ARG G C     1 
ATOM 4301  O O     . ARG G 3 18  ? 85.34500  96.01100  133.32100 1.000 49.19314  ? 17  ARG G O     1 
ATOM 4302  C CB    . ARG G 3 18  ? 87.50200  96.17000  135.56600 1.000 49.19314  ? 17  ARG G CB    1 
ATOM 4303  C CG    . ARG G 3 18  ? 87.67800  96.48100  137.03100 1.000 49.19314  ? 17  ARG G CG    1 
ATOM 4304  C CD    . ARG G 3 18  ? 89.04100  97.05100  137.32700 1.000 49.19314  ? 17  ARG G CD    1 
ATOM 4305  N NE    . ARG G 3 18  ? 89.30800  98.25200  136.55300 1.000 49.19314  ? 17  ARG G NE    1 
ATOM 4306  C CZ    . ARG G 3 18  ? 90.50600  98.81100  136.45000 1.000 49.19314  ? 17  ARG G CZ    1 
ATOM 4307  N NH1   . ARG G 3 18  ? 91.54100  98.27000  137.07500 1.000 49.19314  ? 17  ARG G NH1   1 
ATOM 4308  N NH2   . ARG G 3 18  ? 90.66600  99.90700  135.72400 1.000 49.19314  ? 17  ARG G NH2   1 
ATOM 4309  N N     . SER G 3 19  ? 86.52000  94.11200  133.10800 1.000 46.47783  ? 18  SER G N     1 
ATOM 4310  C CA    . SER G 3 19  ? 86.09800  93.92300  131.73000 1.000 46.47783  ? 18  SER G CA    1 
ATOM 4311  C C     . SER G 3 19  ? 84.74300  93.24500  131.61700 1.000 46.47783  ? 18  SER G C     1 
ATOM 4312  O O     . SER G 3 19  ? 84.21400  93.14500  130.50700 1.000 46.47783  ? 18  SER G O     1 
ATOM 4313  C CB    . SER G 3 19  ? 87.13800  93.11100  130.96500 1.000 46.47783  ? 18  SER G CB    1 
ATOM 4314  O OG    . SER G 3 19  ? 87.21000  91.78600  131.45200 1.000 46.47783  ? 18  SER G OG    1 
ATOM 4315  N N     . SER G 3 20  ? 84.17700  92.77000  132.72500 1.000 48.46636  ? 19  SER G N     1 
ATOM 4316  C CA    . SER G 3 20  ? 82.84800  92.17800  132.70900 1.000 48.46636  ? 19  SER G CA    1 
ATOM 4317  C C     . SER G 3 20  ? 81.76500  93.21800  132.93900 1.000 48.46636  ? 19  SER G C     1 
ATOM 4318  O O     . SER G 3 20  ? 80.68500  93.12900  132.34900 1.000 48.46636  ? 19  SER G O     1 
ATOM 4319  C CB    . SER G 3 20  ? 82.74200  91.08200  133.77100 1.000 48.46636  ? 19  SER G CB    1 
ATOM 4320  O OG    . SER G 3 20  ? 81.39600  90.68800  133.96900 1.000 48.46636  ? 19  SER G OG    1 
ATOM 4321  N N     . ARG G 3 21  ? 82.03800  94.21300  133.78000 1.000 50.79578  ? 20  ARG G N     1 
ATOM 4322  C CA    . ARG G 3 21  ? 81.06400  95.26300  134.03100 1.000 50.79578  ? 20  ARG G CA    1 
ATOM 4323  C C     . ARG G 3 21  ? 81.01200  96.28000  132.90200 1.000 50.79578  ? 20  ARG G C     1 
ATOM 4324  O O     . ARG G 3 21  ? 79.98200  96.93800  132.72700 1.000 50.79578  ? 20  ARG G O     1 
ATOM 4325  C CB    . ARG G 3 21  ? 81.38300  95.96200  135.35300 1.000 50.79578  ? 20  ARG G CB    1 
ATOM 4326  C CG    . ARG G 3 21  ? 82.77300  96.54500  135.41300 1.000 50.79578  ? 20  ARG G CG    1 
ATOM 4327  C CD    . ARG G 3 21  ? 83.03200  97.25100  136.72300 1.000 50.79578  ? 20  ARG G CD    1 
ATOM 4328  N NE    . ARG G 3 21  ? 82.97100  96.34900  137.86300 1.000 50.79578  ? 20  ARG G NE    1 
ATOM 4329  C CZ    . ARG G 3 21  ? 83.20000  96.72800  139.11200 1.000 50.79578  ? 20  ARG G CZ    1 
ATOM 4330  N NH1   . ARG G 3 21  ? 83.49600  97.99400  139.37100 1.000 50.79578  ? 20  ARG G NH1   1 
ATOM 4331  N NH2   . ARG G 3 21  ? 83.12800  95.84900  140.10100 1.000 50.79578  ? 20  ARG G NH2   1 
ATOM 4332  N N     . ALA G 3 22  ? 82.08700  96.41000  132.12700 1.000 45.32705  ? 21  ALA G N     1 
ATOM 4333  C CA    . ALA G 3 22  ? 82.09600  97.28000  130.96100 1.000 45.32705  ? 21  ALA G CA    1 
ATOM 4334  C C     . ALA G 3 22  ? 81.47300  96.63200  129.73800 1.000 45.32705  ? 21  ALA G C     1 
ATOM 4335  O O     . ALA G 3 22  ? 81.31400  97.30700  128.71800 1.000 45.32705  ? 21  ALA G O     1 
ATOM 4336  C CB    . ALA G 3 22  ? 83.52600  97.70400  130.63200 1.000 45.32705  ? 21  ALA G CB    1 
ATOM 4337  N N     . GLY G 3 23  ? 81.10900  95.35600  129.81700 1.000 46.38493  ? 22  GLY G N     1 
ATOM 4338  C CA    . GLY G 3 23  ? 80.58400  94.65500  128.66400 1.000 46.38493  ? 22  GLY G CA    1 
ATOM 4339  C C     . GLY G 3 23  ? 81.62100  94.38200  127.60200 1.000 46.38493  ? 22  GLY G C     1 
ATOM 4340  O O     . GLY G 3 23  ? 81.30000  94.40600  126.41200 1.000 46.38493  ? 22  GLY G O     1 
ATOM 4341  N N     . LEU G 3 24  ? 82.86000  94.12400  128.00000 1.000 41.28624  ? 23  LEU G N     1 
ATOM 4342  C CA    . LEU G 3 24  ? 83.97000  93.94500  127.08000 1.000 41.28624  ? 23  LEU G CA    1 
ATOM 4343  C C     . LEU G 3 24  ? 84.48200  92.51300  127.13700 1.000 41.28624  ? 23  LEU G C     1 
ATOM 4344  O O     . LEU G 3 24  ? 84.03000  91.69000  127.93700 1.000 41.28624  ? 23  LEU G O     1 
ATOM 4345  C CB    . LEU G 3 24  ? 85.09600  94.92400  127.39900 1.000 41.28624  ? 23  LEU G CB    1 
ATOM 4346  C CG    . LEU G 3 24  ? 84.77300  96.40200  127.25500 1.000 41.28624  ? 23  LEU G CG    1 
ATOM 4347  C CD1   . LEU G 3 24  ? 86.00800  97.22600  127.55200 1.000 41.28624  ? 23  LEU G CD1   1 
ATOM 4348  C CD2   . LEU G 3 24  ? 84.25500  96.67900  125.86000 1.000 41.28624  ? 23  LEU G CD2   1 
ATOM 4349  N N     . GLN G 3 25  ? 85.44600  92.22400  126.26400 1.000 39.85362  ? 24  GLN G N     1 
ATOM 4350  C CA    . GLN G 3 25  ? 86.15200  90.95500  126.26200 1.000 39.85362  ? 24  GLN G CA    1 
ATOM 4351  C C     . GLN G 3 25  ? 87.65300  91.09800  126.43800 1.000 39.85362  ? 24  GLN G C     1 
ATOM 4352  O O     . GLN G 3 25  ? 88.29500  90.14300  126.88500 1.000 39.85362  ? 24  GLN G O     1 
ATOM 4353  C CB    . GLN G 3 25  ? 85.87500  90.18900  124.96100 1.000 39.85362  ? 24  GLN G CB    1 
ATOM 4354  C CG    . GLN G 3 25  ? 84.41500  89.85000  124.75200 1.000 39.85362  ? 24  GLN G CG    1 
ATOM 4355  C CD    . GLN G 3 25  ? 83.99000  88.61300  125.51400 1.000 39.85362  ? 24  GLN G CD    1 
ATOM 4356  O OE1   . GLN G 3 25  ? 84.81300  87.92400  126.11400 1.000 39.85362  ? 24  GLN G OE1   1 
ATOM 4357  N NE2   . GLN G 3 25  ? 82.69800  88.32700  125.50100 1.000 39.85362  ? 24  GLN G NE2   1 
ATOM 4358  N N     . PHE G 3 26  ? 88.21900  92.24300  126.11700 1.000 37.05567  ? 25  PHE G N     1 
ATOM 4359  C CA    . PHE G 3 26  ? 89.62700  92.50300  126.36300 1.000 37.05567  ? 25  PHE G CA    1 
ATOM 4360  C C     . PHE G 3 26  ? 89.80800  92.96800  127.80400 1.000 37.05567  ? 25  PHE G C     1 
ATOM 4361  O O     . PHE G 3 26  ? 88.95500  93.68800  128.32300 1.000 37.05567  ? 25  PHE G O     1 
ATOM 4362  C CB    . PHE G 3 26  ? 90.14400  93.56400  125.40000 1.000 37.05567  ? 25  PHE G CB    1 
ATOM 4363  C CG    . PHE G 3 26  ? 90.76000  93.00100  124.16600 1.000 37.05567  ? 25  PHE G CG    1 
ATOM 4364  C CD1   . PHE G 3 26  ? 89.97400  92.39200  123.20400 1.000 37.05567  ? 25  PHE G CD1   1 
ATOM 4365  C CD2   . PHE G 3 26  ? 92.12400  93.06200  123.97200 1.000 37.05567  ? 25  PHE G CD2   1 
ATOM 4366  C CE1   . PHE G 3 26  ? 90.53400  91.87000  122.06500 1.000 37.05567  ? 25  PHE G CE1   1 
ATOM 4367  C CE2   . PHE G 3 26  ? 92.69000  92.53500  122.83700 1.000 37.05567  ? 25  PHE G CE2   1 
ATOM 4368  C CZ    . PHE G 3 26  ? 91.89400  91.94100  121.88100 1.000 37.05567  ? 25  PHE G CZ    1 
ATOM 4369  N N     . PRO G 3 27  ? 90.89600  92.57600  128.47100 1.000 39.56979  ? 26  PRO G N     1 
ATOM 4370  C CA    . PRO G 3 27  ? 90.98600  92.80400  129.91700 1.000 39.56979  ? 26  PRO G CA    1 
ATOM 4371  C C     . PRO G 3 27  ? 91.23300  94.26300  130.25200 1.000 39.56979  ? 26  PRO G C     1 
ATOM 4372  O O     . PRO G 3 27  ? 92.00500  94.95400  129.58800 1.000 39.56979  ? 26  PRO G O     1 
ATOM 4373  C CB    . PRO G 3 27  ? 92.17100  91.93300  130.33500 1.000 39.56979  ? 26  PRO G CB    1 
ATOM 4374  C CG    . PRO G 3 27  ? 93.02600  91.89700  129.13500 1.000 39.56979  ? 26  PRO G CG    1 
ATOM 4375  C CD    . PRO G 3 27  ? 92.11200  91.92600  127.95300 1.000 39.56979  ? 26  PRO G CD    1 
ATOM 4376  N N     . VAL G 3 28  ? 90.54500  94.73800  131.28000 1.000 41.11652  ? 27  VAL G N     1 
ATOM 4377  C CA    . VAL G 3 28  ? 90.75000  96.10500  131.72700 1.000 41.11652  ? 27  VAL G CA    1 
ATOM 4378  C C     . VAL G 3 28  ? 91.89300  96.18600  132.72700 1.000 41.11652  ? 27  VAL G C     1 
ATOM 4379  O O     . VAL G 3 28  ? 92.71200  97.10300  132.65900 1.000 41.11652  ? 27  VAL G O     1 
ATOM 4380  C CB    . VAL G 3 28  ? 89.42600  96.65500  132.29700 1.000 41.11652  ? 27  VAL G CB    1 
ATOM 4381  C CG1   . VAL G 3 28  ? 89.63600  97.92900  133.08200 1.000 41.11652  ? 27  VAL G CG1   1 
ATOM 4382  C CG2   . VAL G 3 28  ? 88.44400  96.89700  131.17400 1.000 41.11652  ? 27  VAL G CG2   1 
ATOM 4383  N N     . GLY G 3 29  ? 92.01100  95.19300  133.61300 1.000 43.79525  ? 28  GLY G N     1 
ATOM 4384  C CA    . GLY G 3 29  ? 93.08600  95.19400  134.59300 1.000 43.79525  ? 28  GLY G CA    1 
ATOM 4385  C C     . GLY G 3 29  ? 94.46200  94.99200  133.99600 1.000 43.79525  ? 28  GLY G C     1 
ATOM 4386  O O     . GLY G 3 29  ? 95.43700  95.59200  134.46200 1.000 43.79525  ? 28  GLY G O     1 
ATOM 4387  N N     . ARG G 3 30  ? 94.55700  94.19900  132.93000 1.000 44.52135  ? 29  ARG G N     1 
ATOM 4388  C CA    . ARG G 3 30  ? 95.85200  93.97800  132.29900 1.000 44.52135  ? 29  ARG G CA    1 
ATOM 4389  C C     . ARG G 3 30  ? 96.28100  95.19700  131.50100 1.000 44.52135  ? 29  ARG G C     1 
ATOM 4390  O O     . ARG G 3 30  ? 97.45000  95.59100  131.54300 1.000 44.52135  ? 29  ARG G O     1 
ATOM 4391  C CB    . ARG G 3 30  ? 95.82100  92.74000  131.40800 1.000 44.52135  ? 29  ARG G CB    1 
ATOM 4392  C CG    . ARG G 3 30  ? 97.17900  92.39900  130.83500 1.000 44.52135  ? 29  ARG G CG    1 
ATOM 4393  C CD    . ARG G 3 30  ? 97.12100  91.26600  129.84400 1.000 44.52135  ? 29  ARG G CD    1 
ATOM 4394  N NE    . ARG G 3 30  ? 97.09700  89.97400  130.51200 1.000 44.52135  ? 29  ARG G NE    1 
ATOM 4395  C CZ    . ARG G 3 30  ? 97.13800  88.81100  129.87600 1.000 44.52135  ? 29  ARG G CZ    1 
ATOM 4396  N NH1   . ARG G 3 30  ? 97.21700  88.78600  128.55500 1.000 44.52135  ? 29  ARG G NH1   1 
ATOM 4397  N NH2   . ARG G 3 30  ? 97.10800  87.67800  130.56000 1.000 44.52135  ? 29  ARG G NH2   1 
ATOM 4398  N N     . VAL G 3 31  ? 95.34700  95.82700  130.78600 1.000 39.96014  ? 30  VAL G N     1 
ATOM 4399  C CA    . VAL G 3 31  ? 95.69000  97.04500  130.07100 1.000 39.96014  ? 30  VAL G CA    1 
ATOM 4400  C C     . VAL G 3 31  ? 95.88500  98.21300  131.03600 1.000 39.96014  ? 30  VAL G C     1 
ATOM 4401  O O     . VAL G 3 31  ? 96.67900  99.11600  130.75700 1.000 39.96014  ? 30  VAL G O     1 
ATOM 4402  C CB    . VAL G 3 31  ? 94.58400  97.28500  129.02100 1.000 39.96014  ? 30  VAL G CB    1 
ATOM 4403  C CG1   . VAL G 3 31  ? 94.72000  98.60500  128.32600 1.000 39.96014  ? 30  VAL G CG1   1 
ATOM 4404  C CG2   . VAL G 3 31  ? 94.61200  96.17800  127.98700 1.000 39.96014  ? 30  VAL G CG2   1 
ATOM 4405  N N     . HIS G 3 32  ? 95.31100  98.13800  132.23900 1.000 40.01704  ? 31  HIS G N     1 
ATOM 4406  C CA    . HIS G 3 32  ? 95.62500  99.12100  133.27200 1.000 40.01704  ? 31  HIS G CA    1 
ATOM 4407  C C     . HIS G 3 32  ? 97.04500  98.94000  133.78800 1.000 40.01704  ? 31  HIS G C     1 
ATOM 4408  O O     . HIS G 3 32  ? 97.77300  99.92300  133.97000 1.000 40.01704  ? 31  HIS G O     1 
ATOM 4409  C CB    . HIS G 3 32  ? 94.62800  99.01600  134.41900 1.000 40.01704  ? 31  HIS G CB    1 
ATOM 4410  C CG    . HIS G 3 32  ? 94.53600  100.25000 135.25600 1.000 40.01704  ? 31  HIS G CG    1 
ATOM 4411  N ND1   . HIS G 3 32  ? 93.64000  100.37500 136.29400 1.000 40.01704  ? 31  HIS G ND1   1 
ATOM 4412  C CD2   . HIS G 3 32  ? 95.21100  101.42000 135.19900 1.000 40.01704  ? 31  HIS G CD2   1 
ATOM 4413  C CE1   . HIS G 3 32  ? 93.77200  101.56600 136.84500 1.000 40.01704  ? 31  HIS G CE1   1 
ATOM 4414  N NE2   . HIS G 3 32  ? 94.72000  102.22000 136.20000 1.000 40.01704  ? 31  HIS G NE2   1 
ATOM 4415  N N     . ARG G 3 33  ? 97.46500  97.68800  133.99900 1.000 42.56534  ? 32  ARG G N     1 
ATOM 4416  C CA    . ARG G 3 33  ? 98.84000  97.42300  134.41200 1.000 42.56534  ? 32  ARG G CA    1 
ATOM 4417  C C     . ARG G 3 33  ? 99.83900  97.78000  133.32200 1.000 42.56534  ? 32  ARG G C     1 
ATOM 4418  O O     . ARG G 3 33  ? 100.94100 98.25200  133.62100 1.000 42.56534  ? 32  ARG G O     1 
ATOM 4419  C CB    . ARG G 3 33  ? 99.00000  95.95500  134.79100 1.000 42.56534  ? 32  ARG G CB    1 
ATOM 4420  C CG    . ARG G 3 33  ? 100.25700 95.65800  135.56900 1.000 42.56534  ? 32  ARG G CG    1 
ATOM 4421  C CD    . ARG G 3 33  ? 100.65800 94.20600  135.43100 1.000 42.56534  ? 32  ARG G CD    1 
ATOM 4422  N NE    . ARG G 3 33  ? 101.26400 93.93400  134.13400 1.000 42.56534  ? 32  ARG G NE    1 
ATOM 4423  C CZ    . ARG G 3 33  ? 100.72700 93.15800  133.20200 1.000 42.56534  ? 32  ARG G CZ    1 
ATOM 4424  N NH1   . ARG G 3 33  ? 99.56900  92.55900  133.42100 1.000 42.56534  ? 32  ARG G NH1   1 
ATOM 4425  N NH2   . ARG G 3 33  ? 101.35600 92.97000  132.05400 1.000 42.56534  ? 32  ARG G NH2   1 
ATOM 4426  N N     . LEU G 3 34  ? 99.46400  97.59500  132.06000 1.000 37.67233  ? 33  LEU G N     1 
ATOM 4427  C CA    . LEU G 3 34  ? 100.34800 97.94400  130.95900 1.000 37.67233  ? 33  LEU G CA    1 
ATOM 4428  C C     . LEU G 3 34  ? 100.42700 99.44800  130.73300 1.000 37.67233  ? 33  LEU G C     1 
ATOM 4429  O O     . LEU G 3 34  ? 101.46900 99.94500  130.29800 1.000 37.67233  ? 33  LEU G O     1 
ATOM 4430  C CB    . LEU G 3 34  ? 99.89700  97.23000  129.69100 1.000 37.67233  ? 33  LEU G CB    1 
ATOM 4431  C CG    . LEU G 3 34  ? 100.16300 95.73000  129.65200 1.000 37.67233  ? 33  LEU G CG    1 
ATOM 4432  C CD1   . LEU G 3 34  ? 99.59700  95.12900  128.39000 1.000 37.67233  ? 33  LEU G CD1   1 
ATOM 4433  C CD2   . LEU G 3 34  ? 101.65200 95.47800  129.72900 1.000 37.67233  ? 33  LEU G CD2   1 
ATOM 4434  N N     . LEU G 3 35  ? 99.35200  100.18700 131.01600 1.000 37.52404  ? 34  LEU G N     1 
ATOM 4435  C CA    . LEU G 3 35  ? 99.42600  101.64100 130.94600 1.000 37.52404  ? 34  LEU G CA    1 
ATOM 4436  C C     . LEU G 3 35  ? 100.18900 102.21400 132.13000 1.000 37.52404  ? 34  LEU G C     1 
ATOM 4437  O O     . LEU G 3 35  ? 100.86200 103.24000 131.99000 1.000 37.52404  ? 34  LEU G O     1 
ATOM 4438  C CB    . LEU G 3 35  ? 98.02300  102.24300 130.88400 1.000 37.52404  ? 34  LEU G CB    1 
ATOM 4439  C CG    . LEU G 3 35  ? 97.29400  102.22300 129.54100 1.000 37.52404  ? 34  LEU G CG    1 
ATOM 4440  C CD1   . LEU G 3 35  ? 95.81300  102.40200 129.75700 1.000 37.52404  ? 34  LEU G CD1   1 
ATOM 4441  C CD2   . LEU G 3 35  ? 97.82300  103.30500 128.63200 1.000 37.52404  ? 34  LEU G CD2   1 
ATOM 4442  N N     . ARG G 3 36  ? 100.10400 101.57100 133.29800 1.000 41.04062  ? 35  ARG G N     1 
ATOM 4443  C CA    . ARG G 3 36  ? 100.80800 102.07800 134.47000 1.000 41.04062  ? 35  ARG G CA    1 
ATOM 4444  C C     . ARG G 3 36  ? 102.29900 101.78900 134.40000 1.000 41.04062  ? 35  ARG G C     1 
ATOM 4445  O O     . ARG G 3 36  ? 103.12100 102.68200 134.63000 1.000 41.04062  ? 35  ARG G O     1 
ATOM 4446  C CB    . ARG G 3 36  ? 100.22000 101.47300 135.74200 1.000 41.04062  ? 35  ARG G CB    1 
ATOM 4447  C CG    . ARG G 3 36  ? 98.95900  102.14000 136.22900 1.000 41.04062  ? 35  ARG G CG    1 
ATOM 4448  C CD    . ARG G 3 36  ? 98.73400  101.80100 137.68100 1.000 41.04062  ? 35  ARG G CD    1 
ATOM 4449  N NE    . ARG G 3 36  ? 98.72100  100.35800 137.88400 1.000 41.04062  ? 35  ARG G NE    1 
ATOM 4450  C CZ    . ARG G 3 36  ? 97.61800  99.64500  138.07500 1.000 41.04062  ? 35  ARG G CZ    1 
ATOM 4451  N NH1   . ARG G 3 36  ? 96.43900  100.24900 138.10000 1.000 41.04062  ? 35  ARG G NH1   1 
ATOM 4452  N NH2   . ARG G 3 36  ? 97.69300  98.33300  138.24600 1.000 41.04062  ? 35  ARG G NH2   1 
ATOM 4453  N N     . LYS G 3 37  ? 102.67000 100.55100 134.09200 1.000 39.66948  ? 36  LYS G N     1 
ATOM 4454  C CA    . LYS G 3 37  ? 104.06700 100.14600 134.04700 1.000 39.66948  ? 36  LYS G CA    1 
ATOM 4455  C C     . LYS G 3 37  ? 104.72200 100.43100 132.70200 1.000 39.66948  ? 36  LYS G C     1 
ATOM 4456  O O     . LYS G 3 37  ? 105.87200 100.03900 132.49100 1.000 39.66948  ? 36  LYS G O     1 
ATOM 4457  C CB    . LYS G 3 37  ? 104.21000 98.65900  134.40000 1.000 39.66948  ? 36  LYS G CB    1 
ATOM 4458  C CG    . LYS G 3 37  ? 104.19100 98.34400  135.90200 1.000 39.66948  ? 36  LYS G CG    1 
ATOM 4459  C CD    . LYS G 3 37  ? 102.79000 98.32300  136.50500 1.000 39.66948  ? 36  LYS G CD    1 
ATOM 4460  C CE    . LYS G 3 37  ? 102.82100 98.52000  138.01200 1.000 39.66948  ? 36  LYS G CE    1 
ATOM 4461  N NZ    . LYS G 3 37  ? 101.47800 98.32600  138.62000 1.000 39.66948  ? 36  LYS G NZ    1 
ATOM 4462  N N     . GLY G 3 38  ? 104.02100 101.10000 131.79500 1.000 38.61218  ? 37  GLY G N     1 
ATOM 4463  C CA    . GLY G 3 38  ? 104.51700 101.42300 130.47900 1.000 38.61218  ? 37  GLY G CA    1 
ATOM 4464  C C     . GLY G 3 38  ? 105.22100 102.74900 130.34100 1.000 38.61218  ? 37  GLY G C     1 
ATOM 4465  O O     . GLY G 3 38  ? 105.66700 103.06300 129.23300 1.000 38.61218  ? 37  GLY G O     1 
ATOM 4466  N N     . ASN G 3 39  ? 105.26700 103.55300 131.41400 1.000 38.04922  ? 38  ASN G N     1 
ATOM 4467  C CA    . ASN G 3 39  ? 105.93000 104.86800 131.46600 1.000 38.04922  ? 38  ASN G CA    1 
ATOM 4468  C C     . ASN G 3 39  ? 105.29500 105.87900 130.51900 1.000 38.04922  ? 38  ASN G C     1 
ATOM 4469  O O     . ASN G 3 39  ? 105.95800 106.80500 130.05400 1.000 38.04922  ? 38  ASN G O     1 
ATOM 4470  C CB    . ASN G 3 39  ? 107.43900 104.78000 131.20600 1.000 38.04922  ? 38  ASN G CB    1 
ATOM 4471  C CG    . ASN G 3 39  ? 108.11600 103.74700 132.06300 1.000 38.04922  ? 38  ASN G CG    1 
ATOM 4472  O OD1   . ASN G 3 39  ? 108.99700 103.02500 131.60400 1.000 38.04922  ? 38  ASN G OD1   1 
ATOM 4473  N ND2   . ASN G 3 39  ? 107.71800 103.67700 133.32500 1.000 38.04922  ? 38  ASN G ND2   1 
ATOM 4474  N N     . TYR G 3 40  ? 104.01800 105.69600 130.18900 1.000 35.84256  ? 39  TYR G N     1 
ATOM 4475  C CA    . TYR G 3 40  ? 103.33300 106.67900 129.35900 1.000 35.84256  ? 39  TYR G CA    1 
ATOM 4476  C C     . TYR G 3 40  ? 103.06500 107.95700 130.14000 1.000 35.84256  ? 39  TYR G C     1 
ATOM 4477  O O     . TYR G 3 40  ? 103.29500 109.06100 129.63700 1.000 35.84256  ? 39  TYR G O     1 
ATOM 4478  C CB    . TYR G 3 40  ? 102.04400 106.07600 128.82100 1.000 35.84256  ? 39  TYR G CB    1 
ATOM 4479  C CG    . TYR G 3 40  ? 102.31000 104.86300 127.97500 1.000 35.84256  ? 39  TYR G CG    1 
ATOM 4480  C CD1   . TYR G 3 40  ? 103.07500 104.95300 126.82700 1.000 35.84256  ? 39  TYR G CD1   1 
ATOM 4481  C CD2   . TYR G 3 40  ? 101.82900 103.62000 128.34700 1.000 35.84256  ? 39  TYR G CD2   1 
ATOM 4482  C CE1   . TYR G 3 40  ? 103.33400 103.84400 126.06000 1.000 35.84256  ? 39  TYR G CE1   1 
ATOM 4483  C CE2   . TYR G 3 40  ? 102.08600 102.50400 127.58800 1.000 35.84256  ? 39  TYR G CE2   1 
ATOM 4484  C CZ    . TYR G 3 40  ? 102.83400 102.62500 126.44400 1.000 35.84256  ? 39  TYR G CZ    1 
ATOM 4485  O OH    . TYR G 3 40  ? 103.09300 101.51800 125.67700 1.000 35.84256  ? 39  TYR G OH    1 
ATOM 4486  N N     . ALA G 3 41  ? 102.61400 107.82600 131.38100 1.000 41.37355  ? 40  ALA G N     1 
ATOM 4487  C CA    . ALA G 3 41  ? 102.42000 108.97200 132.25100 1.000 41.37355  ? 40  ALA G CA    1 
ATOM 4488  C C     . ALA G 3 41  ? 102.61500 108.50600 133.68200 1.000 41.37355  ? 40  ALA G C     1 
ATOM 4489  O O     . ALA G 3 41  ? 102.51400 107.31500 133.98300 1.000 41.37355  ? 40  ALA G O     1 
ATOM 4490  C CB    . ALA G 3 41  ? 101.04100 109.60500 132.06600 1.000 41.37355  ? 40  ALA G CB    1 
ATOM 4491  N N     . GLU G 3 42  ? 102.90200 109.46000 134.56800 1.000 46.41396  ? 41  GLU G N     1 
ATOM 4492  C CA    . GLU G 3 42  ? 103.10800 109.12100 135.97100 1.000 46.41396  ? 41  GLU G CA    1 
ATOM 4493  C C     . GLU G 3 42  ? 101.80900 108.80000 136.69500 1.000 46.41396  ? 41  GLU G C     1 
ATOM 4494  O O     . GLU G 3 42  ? 101.85500 108.30300 137.82400 1.000 46.41396  ? 41  GLU G O     1 
ATOM 4495  C CB    . GLU G 3 42  ? 103.84000 110.25400 136.68700 1.000 46.41396  ? 41  GLU G CB    1 
ATOM 4496  C CG    . GLU G 3 42  ? 102.97700 111.44900 137.01500 1.000 46.41396  ? 41  GLU G CG    1 
ATOM 4497  C CD    . GLU G 3 42  ? 103.60100 112.33300 138.07500 1.000 46.41396  ? 41  GLU G CD    1 
ATOM 4498  O OE1   . GLU G 3 42  ? 104.71100 112.00300 138.54300 1.000 46.41396  ? 41  GLU G OE1   1 
ATOM 4499  O OE2   . GLU G 3 42  ? 102.98200 113.35400 138.44100 1.000 46.41396  ? 41  GLU G OE2   1 
ATOM 4500  N N     . ARG G 3 43  ? 100.66500 109.07000 136.08000 1.000 47.79844  ? 42  ARG G N     1 
ATOM 4501  C CA    . ARG G 3 43  ? 99.37200  108.78000 136.66700 1.000 47.79844  ? 42  ARG G CA    1 
ATOM 4502  C C     . ARG G 3 43  ? 98.42300  108.36800 135.55200 1.000 47.79844  ? 42  ARG G C     1 
ATOM 4503  O O     . ARG G 3 43  ? 98.44900  108.94900 134.46700 1.000 47.79844  ? 42  ARG G O     1 
ATOM 4504  C CB    . ARG G 3 43  ? 98.87000  109.99100 137.45800 1.000 47.79844  ? 42  ARG G CB    1 
ATOM 4505  C CG    . ARG G 3 43  ? 97.53100  109.80800 138.09200 1.000 47.79844  ? 42  ARG G CG    1 
ATOM 4506  C CD    . ARG G 3 43  ? 97.18100  110.96500 138.99200 1.000 47.79844  ? 42  ARG G CD    1 
ATOM 4507  N NE    . ARG G 3 43  ? 98.07900  110.96300 140.14000 1.000 47.79844  ? 42  ARG G NE    1 
ATOM 4508  C CZ    . ARG G 3 43  ? 97.96600  111.77300 141.18300 1.000 47.79844  ? 42  ARG G CZ    1 
ATOM 4509  N NH1   . ARG G 3 43  ? 96.95100  112.61900 141.25900 1.000 47.79844  ? 42  ARG G NH1   1 
ATOM 4510  N NH2   . ARG G 3 43  ? 98.83800  111.69600 142.17800 1.000 47.79844  ? 42  ARG G NH2   1 
ATOM 4511  N N     . VAL G 3 44  ? 97.62300  107.33300 135.80100 1.000 42.25858  ? 43  VAL G N     1 
ATOM 4512  C CA    . VAL G 3 44  ? 96.69400  106.78200 134.81800 1.000 42.25858  ? 43  VAL G CA    1 
ATOM 4513  C C     . VAL G 3 44  ? 95.30200  106.75100 135.42800 1.000 42.25858  ? 43  VAL G C     1 
ATOM 4514  O O     . VAL G 3 44  ? 95.10800  106.17700 136.50300 1.000 42.25858  ? 43  VAL G O     1 
ATOM 4515  C CB    . VAL G 3 44  ? 97.10700  105.36700 134.36800 1.000 42.25858  ? 43  VAL G CB    1 
ATOM 4516  C CG1   . VAL G 3 44  ? 96.09900  104.80600 133.39400 1.000 42.25858  ? 43  VAL G CG1   1 
ATOM 4517  C CG2   . VAL G 3 44  ? 98.47600  105.38500 133.72400 1.000 42.25858  ? 43  VAL G CG2   1 
ATOM 4518  N N     . GLY G 3 45  ? 94.33700  107.35200 134.74000 1.000 40.08482  ? 44  GLY G N     1 
ATOM 4519  C CA    . GLY G 3 45  ? 92.98100  107.42500 135.24000 1.000 40.08482  ? 44  GLY G CA    1 
ATOM 4520  C C     . GLY G 3 45  ? 92.27400  106.08100 135.24800 1.000 40.08482  ? 44  GLY G C     1 
ATOM 4521  O O     . GLY G 3 45  ? 92.81600  105.04200 134.87400 1.000 40.08482  ? 44  GLY G O     1 
ATOM 4522  N N     . ALA G 3 46  ? 91.01400  106.11100 135.68000 1.000 40.11456  ? 45  ALA G N     1 
ATOM 4523  C CA    . ALA G 3 46  ? 90.24900  104.87700 135.79000 1.000 40.11456  ? 45  ALA G CA    1 
ATOM 4524  C C     . ALA G 3 46  ? 89.56300  104.49400 134.49100 1.000 40.11456  ? 45  ALA G C     1 
ATOM 4525  O O     . ALA G 3 46  ? 89.51400  103.31100 134.14500 1.000 40.11456  ? 45  ALA G O     1 
ATOM 4526  C CB    . ALA G 3 46  ? 89.19800  104.99100 136.89300 1.000 40.11456  ? 45  ALA G CB    1 
ATOM 4527  N N     . GLY G 3 47  ? 89.01900  105.46600 133.76800 1.000 37.43871  ? 46  GLY G N     1 
ATOM 4528  C CA    . GLY G 3 47  ? 88.28200  105.14200 132.56700 1.000 37.43871  ? 46  GLY G CA    1 
ATOM 4529  C C     . GLY G 3 47  ? 89.13300  104.95300 131.34100 1.000 37.43871  ? 46  GLY G C     1 
ATOM 4530  O O     . GLY G 3 47  ? 88.62100  104.51300 130.30700 1.000 37.43871  ? 46  GLY G O     1 
ATOM 4531  N N     . ALA G 3 48  ? 90.41700  105.26800 131.43100 1.000 35.49385  ? 47  ALA G N     1 
ATOM 4532  C CA    . ALA G 3 48  ? 91.33300  105.08100 130.31500 1.000 35.49385  ? 47  ALA G CA    1 
ATOM 4533  C C     . ALA G 3 48  ? 91.60600  103.61000 129.98400 1.000 35.49385  ? 47  ALA G C     1 
ATOM 4534  O O     . ALA G 3 48  ? 91.63600  103.29200 128.79200 1.000 35.49385  ? 47  ALA G O     1 
ATOM 4535  C CB    . ALA G 3 48  ? 92.63900  105.84400 130.56100 1.000 35.49385  ? 47  ALA G CB    1 
ATOM 4536  N N     . PRO G 3 49  ? 91.80500  102.67700 130.93900 1.000 36.07867  ? 48  PRO G N     1 
ATOM 4537  C CA    . PRO G 3 49  ? 91.87800  101.26600 130.52500 1.000 36.07867  ? 48  PRO G CA    1 
ATOM 4538  C C     . PRO G 3 49  ? 90.57600  100.70300 129.98600 1.000 36.07867  ? 48  PRO G C     1 
ATOM 4539  O O     . PRO G 3 49  ? 90.63100  99.85600  129.08800 1.000 36.07867  ? 48  PRO G O     1 
ATOM 4540  C CB    . PRO G 3 49  ? 92.31400  100.54200 131.80400 1.000 36.07867  ? 48  PRO G CB    1 
ATOM 4541  C CG    . PRO G 3 49  ? 91.93800  101.43000 132.87300 1.000 36.07867  ? 48  PRO G CG    1 
ATOM 4542  C CD    . PRO G 3 49  ? 92.24700  102.77600 132.34400 1.000 36.07867  ? 48  PRO G CD    1 
ATOM 4543  N N     . VAL G 3 50  ? 89.41700  101.16200 130.46900 1.000 35.26171  ? 49  VAL G N     1 
ATOM 4544  C CA    . VAL G 3 50  ? 88.14200  100.70800 129.91500 1.000 35.26171  ? 49  VAL G CA    1 
ATOM 4545  C C     . VAL G 3 50  ? 87.97300  101.19500 128.48200 1.000 35.26171  ? 49  VAL G C     1 
ATOM 4546  O O     . VAL G 3 50  ? 87.59400  100.42300 127.59000 1.000 35.26171  ? 49  VAL G O     1 
ATOM 4547  C CB    . VAL G 3 50  ? 86.98400  101.17800 130.80800 1.000 35.26171  ? 49  VAL G CB    1 
ATOM 4548  C CG1   . VAL G 3 50  ? 85.65900  100.79200 130.20800 1.000 35.26171  ? 49  VAL G CG1   1 
ATOM 4549  C CG2   . VAL G 3 50  ? 87.11600  100.58600 132.18900 1.000 35.26171  ? 49  VAL G CG2   1 
ATOM 4550  N N     . TYR G 3 51  ? 88.30800  102.46400 128.23200 1.000 34.90242  ? 50  TYR G N     1 
ATOM 4551  C CA    . TYR G 3 51  ? 88.23600  103.02400 126.88600 1.000 34.90242  ? 50  TYR G CA    1 
ATOM 4552  C C     . TYR G 3 51  ? 89.22400  102.34600 125.95400 1.000 34.90242  ? 50  TYR G C     1 
ATOM 4553  O O     . TYR G 3 51  ? 88.88400  102.00600 124.81400 1.000 34.90242  ? 50  TYR G O     1 
ATOM 4554  C CB    . TYR G 3 51  ? 88.52600  104.52000 126.94200 1.000 34.90242  ? 50  TYR G CB    1 
ATOM 4555  C CG    . TYR G 3 51  ? 87.86300  105.35100 125.87900 1.000 34.90242  ? 50  TYR G CG    1 
ATOM 4556  C CD1   . TYR G 3 51  ? 86.78900  106.16300 126.19100 1.000 34.90242  ? 50  TYR G CD1   1 
ATOM 4557  C CD2   . TYR G 3 51  ? 88.32100  105.34200 124.57200 1.000 34.90242  ? 50  TYR G CD2   1 
ATOM 4558  C CE1   . TYR G 3 51  ? 86.18400  106.93200 125.24100 1.000 34.90242  ? 50  TYR G CE1   1 
ATOM 4559  C CE2   . TYR G 3 51  ? 87.71700  106.11200 123.60800 1.000 34.90242  ? 50  TYR G CE2   1 
ATOM 4560  C CZ    . TYR G 3 51  ? 86.64700  106.90400 123.95400 1.000 34.90242  ? 50  TYR G CZ    1 
ATOM 4561  O OH    . TYR G 3 51  ? 86.02600  107.68100 123.01200 1.000 34.90242  ? 50  TYR G OH    1 
ATOM 4562  N N     . MET G 3 52  ? 90.45400  102.15300 126.42900 1.000 32.51304  ? 51  MET G N     1 
ATOM 4563  C CA    . MET G 3 52  ? 91.50800  101.54000 125.63500 1.000 32.51304  ? 51  MET G CA    1 
ATOM 4564  C C     . MET G 3 52  ? 91.16800  100.09800 125.28000 1.000 32.51304  ? 51  MET G C     1 
ATOM 4565  O O     . MET G 3 52  ? 91.38300  99.66000  124.14300 1.000 32.51304  ? 51  MET G O     1 
ATOM 4566  C CB    . MET G 3 52  ? 92.80800  101.62100 126.41600 1.000 32.51304  ? 51  MET G CB    1 
ATOM 4567  C CG    . MET G 3 52  ? 93.96600  101.05700 125.71400 1.000 32.51304  ? 51  MET G CG    1 
ATOM 4568  S SD    . MET G 3 52  ? 94.37500  102.36000 124.57200 1.000 32.51304  ? 51  MET G SD    1 
ATOM 4569  C CE    . MET G 3 52  ? 95.99300  101.85300 124.10100 1.000 32.51304  ? 51  MET G CE    1 
ATOM 4570  N N     . ALA G 3 53  ? 90.61600  99.34900  126.23900 1.000 34.64985  ? 52  ALA G N     1 
ATOM 4571  C CA    . ALA G 3 53  ? 90.25100  97.96500  125.98900 1.000 34.64985  ? 52  ALA G CA    1 
ATOM 4572  C C     . ALA G 3 53  ? 89.04900  97.87000  125.07000 1.000 34.64985  ? 52  ALA G C     1 
ATOM 4573  O O     . ALA G 3 53  ? 88.96900  96.94000  124.26600 1.000 34.64985  ? 52  ALA G O     1 
ATOM 4574  C CB    . ALA G 3 53  ? 89.96700  97.24700  127.30300 1.000 34.64985  ? 52  ALA G CB    1 
ATOM 4575  N N     . ALA G 3 54  ? 88.13300  98.84100  125.13100 1.000 34.11915  ? 53  ALA G N     1 
ATOM 4576  C CA    . ALA G 3 54  ? 87.00900  98.83500  124.20200 1.000 34.11915  ? 53  ALA G CA    1 
ATOM 4577  C C     . ALA G 3 54  ? 87.45800  99.15500  122.78500 1.000 34.11915  ? 53  ALA G C     1 
ATOM 4578  O O     . ALA G 3 54  ? 86.95800  98.55900  121.82500 1.000 34.11915  ? 53  ALA G O     1 
ATOM 4579  C CB    . ALA G 3 54  ? 85.95400  99.83500  124.64800 1.000 34.11915  ? 53  ALA G CB    1 
ATOM 4580  N N     . VAL G 3 55  ? 88.41700  100.07100 122.63700 1.000 32.99964  ? 54  VAL G N     1 
ATOM 4581  C CA    . VAL G 3 55  ? 88.93200  100.40400 121.31100 1.000 32.99964  ? 54  VAL G CA    1 
ATOM 4582  C C     . VAL G 3 55  ? 89.71800  99.23300  120.72700 1.000 32.99964  ? 54  VAL G C     1 
ATOM 4583  O O     . VAL G 3 55  ? 89.57100  98.89800  119.54200 1.000 32.99964  ? 54  VAL G O     1 
ATOM 4584  C CB    . VAL G 3 55  ? 89.76900  101.69400 121.38100 1.000 32.99964  ? 54  VAL G CB    1 
ATOM 4585  C CG1   . VAL G 3 55  ? 90.56400  101.90600 120.10900 1.000 32.99964  ? 54  VAL G CG1   1 
ATOM 4586  C CG2   . VAL G 3 55  ? 88.86600  102.87900 121.61300 1.000 32.99964  ? 54  VAL G CG2   1 
ATOM 4587  N N     . LEU G 3 56  ? 90.51700  98.55300  121.55700 1.000 33.28328  ? 55  LEU G N     1 
ATOM 4588  C CA    . LEU G 3 56  ? 91.24600  97.38300  121.07500 1.000 33.28328  ? 55  LEU G CA    1 
ATOM 4589  C C     . LEU G 3 56  ? 90.31700  96.21200  120.77700 1.000 33.28328  ? 55  LEU G C     1 
ATOM 4590  O O     . LEU G 3 56  ? 90.55000  95.47500  119.81400 1.000 33.28328  ? 55  LEU G O     1 
ATOM 4591  C CB    . LEU G 3 56  ? 92.29500  96.96400  122.10100 1.000 33.28328  ? 55  LEU G CB    1 
ATOM 4592  C CG    . LEU G 3 56  ? 93.53300  97.84000  122.24600 1.000 33.28328  ? 55  LEU G CG    1 
ATOM 4593  C CD1   . LEU G 3 56  ? 94.51200  97.20200  123.20200 1.000 33.28328  ? 55  LEU G CD1   1 
ATOM 4594  C CD2   . LEU G 3 56  ? 94.17200  98.04000  120.90300 1.000 33.28328  ? 55  LEU G CD2   1 
ATOM 4595  N N     . GLU G 3 57  ? 89.21900  96.07800  121.52500 1.000 34.65356  ? 56  GLU G N     1 
ATOM 4596  C CA    . GLU G 3 57  ? 88.26600  95.01000  121.25400 1.000 34.65356  ? 56  GLU G CA    1 
ATOM 4597  C C     . GLU G 3 57  ? 87.45500  95.29800  120.00100 1.000 34.65356  ? 56  GLU G C     1 
ATOM 4598  O O     . GLU G 3 57  ? 87.14900  94.37400  119.23600 1.000 34.65356  ? 56  GLU G O     1 
ATOM 4599  C CB    . GLU G 3 57  ? 87.35900  94.82500  122.47200 1.000 34.65356  ? 56  GLU G CB    1 
ATOM 4600  C CG    . GLU G 3 57  ? 86.44000  93.62900  122.43700 1.000 34.65356  ? 56  GLU G CG    1 
ATOM 4601  C CD    . GLU G 3 57  ? 84.98500  94.01800  122.28500 1.000 34.65356  ? 56  GLU G CD    1 
ATOM 4602  O OE1   . GLU G 3 57  ? 84.68400  95.22600  122.34800 1.000 34.65356  ? 56  GLU G OE1   1 
ATOM 4603  O OE2   . GLU G 3 57  ? 84.14100  93.11500  122.11100 1.000 34.65356  ? 56  GLU G OE2   1 
ATOM 4604  N N     . TYR G 3 58  ? 87.20200  96.57700  119.71500 1.000 35.91246  ? 57  TYR G N     1 
ATOM 4605  C CA    . TYR G 3 58  ? 86.53400  96.92900  118.46900 1.000 35.91246  ? 57  TYR G CA    1 
ATOM 4606  C C     . TYR G 3 58  ? 87.44000  96.69700  117.27100 1.000 35.91246  ? 57  TYR G C     1 
ATOM 4607  O O     . TYR G 3 58  ? 86.98900  96.17800  116.24800 1.000 35.91246  ? 57  TYR G O     1 
ATOM 4608  C CB    . TYR G 3 58  ? 86.06300  98.38000  118.48900 1.000 35.91246  ? 57  TYR G CB    1 
ATOM 4609  C CG    . TYR G 3 58  ? 85.58200  98.82300  117.13300 1.000 35.91246  ? 57  TYR G CG    1 
ATOM 4610  C CD1   . TYR G 3 58  ? 84.41400  98.30800  116.59800 1.000 35.91246  ? 57  TYR G CD1   1 
ATOM 4611  C CD2   . TYR G 3 58  ? 86.30200  99.73600  116.37600 1.000 35.91246  ? 57  TYR G CD2   1 
ATOM 4612  C CE1   . TYR G 3 58  ? 83.97100  98.69100  115.35400 1.000 35.91246  ? 57  TYR G CE1   1 
ATOM 4613  C CE2   . TYR G 3 58  ? 85.86900  100.12100 115.12800 1.000 35.91246  ? 57  TYR G CE2   1 
ATOM 4614  C CZ    . TYR G 3 58  ? 84.70000  99.59800  114.62700 1.000 35.91246  ? 57  TYR G CZ    1 
ATOM 4615  O OH    . TYR G 3 58  ? 84.25600  99.97500  113.38500 1.000 35.91246  ? 57  TYR G OH    1 
ATOM 4616  N N     . LEU G 3 59  ? 88.71600  97.08000  117.36800 1.000 32.82126  ? 58  LEU G N     1 
ATOM 4617  C CA    . LEU G 3 59  ? 89.60800  96.91300  116.22400 1.000 32.82126  ? 58  LEU G CA    1 
ATOM 4618  C C     . LEU G 3 59  ? 89.94300  95.44300  115.98600 1.000 32.82126  ? 58  LEU G C     1 
ATOM 4619  O O     . LEU G 3 59  ? 90.08200  95.01100  114.82700 1.000 32.82126  ? 58  LEU G O     1 
ATOM 4620  C CB    . LEU G 3 59  ? 90.88300  97.72200  116.44300 1.000 32.82126  ? 58  LEU G CB    1 
ATOM 4621  C CG    . LEU G 3 59  ? 90.78900  99.22900  116.22400 1.000 32.82126  ? 58  LEU G CG    1 
ATOM 4622  C CD1   . LEU G 3 59  ? 92.16000  99.84100  116.23400 1.000 32.82126  ? 58  LEU G CD1   1 
ATOM 4623  C CD2   . LEU G 3 59  ? 90.09600  99.54600  114.92300 1.000 32.82126  ? 58  LEU G CD2   1 
ATOM 4624  N N     . THR G 3 60  ? 89.96300  94.64600  117.06200 1.000 34.62459  ? 59  THR G N     1 
ATOM 4625  C CA    . THR G 3 60  ? 90.14600  93.20900  116.92300 1.000 34.62459  ? 59  THR G CA    1 
ATOM 4626  C C     . THR G 3 60  ? 88.93400  92.56400  116.27300 1.000 34.62459  ? 59  THR G C     1 
ATOM 4627  O O     . THR G 3 60  ? 89.08900  91.75700  115.35200 1.000 34.62459  ? 59  THR G O     1 
ATOM 4628  C CB    . THR G 3 60  ? 90.41900  92.58800  118.29100 1.000 34.62459  ? 59  THR G CB    1 
ATOM 4629  O OG1   . THR G 3 60  ? 91.54700  93.23300  118.88800 1.000 34.62459  ? 59  THR G OG1   1 
ATOM 4630  C CG2   . THR G 3 60  ? 90.70100  91.11300  118.17100 1.000 34.62459  ? 59  THR G CG2   1 
ATOM 4631  N N     . ALA G 3 61  ? 87.71800  92.96300  116.66700 1.000 35.32743  ? 60  ALA G N     1 
ATOM 4632  C CA    . ALA G 3 61  ? 86.54900  92.40600  115.99700 1.000 35.32743  ? 60  ALA G CA    1 
ATOM 4633  C C     . ALA G 3 61  ? 86.38000  92.94600  114.58900 1.000 35.32743  ? 60  ALA G C     1 
ATOM 4634  O O     . ALA G 3 61  ? 85.84200  92.23700  113.73100 1.000 35.32743  ? 60  ALA G O     1 
ATOM 4635  C CB    . ALA G 3 61  ? 85.28700  92.69900  116.80300 1.000 35.32743  ? 60  ALA G CB    1 
ATOM 4636  N N     . GLU G 3 62  ? 86.97800  94.09800  114.29200 1.000 37.82120  ? 61  GLU G N     1 
ATOM 4637  C CA    . GLU G 3 62  ? 86.82800  94.67900  112.96900 1.000 37.82120  ? 61  GLU G CA    1 
ATOM 4638  C C     . GLU G 3 62  ? 87.74200  94.01500  111.95900 1.000 37.82120  ? 61  GLU G C     1 
ATOM 4639  O O     . GLU G 3 62  ? 87.35400  93.88000  110.79500 1.000 37.82120  ? 61  GLU G O     1 
ATOM 4640  C CB    . GLU G 3 62  ? 87.09300  96.18100  113.00700 1.000 37.82120  ? 61  GLU G CB    1 
ATOM 4641  C CG    . GLU G 3 62  ? 86.60100  96.95400  111.78500 1.000 37.82120  ? 61  GLU G CG    1 
ATOM 4642  C CD    . GLU G 3 62  ? 85.09000  96.87200  111.57500 1.000 37.82120  ? 61  GLU G CD    1 
ATOM 4643  O OE1   . GLU G 3 62  ? 84.60300  95.90300  110.95300 1.000 37.82120  ? 61  GLU G OE1   1 
ATOM 4644  O OE2   . GLU G 3 62  ? 84.38100  97.78800  112.04100 1.000 37.82120  ? 61  GLU G OE2   1 
ATOM 4645  N N     . ILE G 3 63  ? 88.94400  93.58600  112.35400 1.000 36.00813  ? 62  ILE G N     1 
ATOM 4646  C CA    . ILE G 3 63  ? 89.71300  92.83500  111.36400 1.000 36.00813  ? 62  ILE G CA    1 
ATOM 4647  C C     . ILE G 3 63  ? 89.43300  91.33900  111.45300 1.000 36.00813  ? 62  ILE G C     1 
ATOM 4648  O O     . ILE G 3 63  ? 89.63200  90.62900  110.45800 1.000 36.00813  ? 62  ILE G O     1 
ATOM 4649  C CB    . ILE G 3 63  ? 91.23600  93.05700  111.42400 1.000 36.00813  ? 62  ILE G CB    1 
ATOM 4650  C CG1   . ILE G 3 63  ? 91.86400  92.52100  112.69200 1.000 36.00813  ? 62  ILE G CG1   1 
ATOM 4651  C CG2   . ILE G 3 63  ? 91.56400  94.51100  111.36700 1.000 36.00813  ? 62  ILE G CG2   1 
ATOM 4652  C CD1   . ILE G 3 63  ? 93.37500  92.57800  112.60400 1.000 36.00813  ? 62  ILE G CD1   1 
ATOM 4653  N N     . LEU G 3 64  ? 88.88900  90.85000  112.57500 1.000 36.38154  ? 63  LEU G N     1 
ATOM 4654  C CA    . LEU G 3 64  ? 88.49500  89.44700  112.63100 1.000 36.38154  ? 63  LEU G CA    1 
ATOM 4655  C C     . LEU G 3 64  ? 87.23500  89.16000  111.82600 1.000 36.38154  ? 63  LEU G C     1 
ATOM 4656  O O     . LEU G 3 64  ? 87.09800  88.05400  111.29600 1.000 36.38154  ? 63  LEU G O     1 
ATOM 4657  C CB    . LEU G 3 64  ? 88.31900  88.99700  114.07700 1.000 36.38154  ? 63  LEU G CB    1 
ATOM 4658  C CG    . LEU G 3 64  ? 89.61900  88.58100  114.76000 1.000 36.38154  ? 63  LEU G CG    1 
ATOM 4659  C CD1   . LEU G 3 64  ? 89.35600  88.14400  116.17700 1.000 36.38154  ? 63  LEU G CD1   1 
ATOM 4660  C CD2   . LEU G 3 64  ? 90.30900  87.48900  113.98100 1.000 36.38154  ? 63  LEU G CD2   1 
ATOM 4661  N N     . GLU G 3 65  ? 86.32200  90.13000  111.68700 1.000 40.45462  ? 64  GLU G N     1 
ATOM 4662  C CA    . GLU G 3 65  ? 85.15200  89.89000  110.84500 1.000 40.45462  ? 64  GLU G CA    1 
ATOM 4663  C C     . GLU G 3 65  ? 85.53000  89.79600  109.37400 1.000 40.45462  ? 64  GLU G C     1 
ATOM 4664  O O     . GLU G 3 65  ? 85.05300  88.90500  108.66000 1.000 40.45462  ? 64  GLU G O     1 
ATOM 4665  C CB    . GLU G 3 65  ? 84.10800  90.98300  111.04400 1.000 40.45462  ? 64  GLU G CB    1 
ATOM 4666  C CG    . GLU G 3 65  ? 82.79200  90.65700  110.36600 1.000 40.45462  ? 64  GLU G CG    1 
ATOM 4667  C CD    . GLU G 3 65  ? 81.65800  91.54500  110.81700 1.000 40.45462  ? 64  GLU G CD    1 
ATOM 4668  O OE1   . GLU G 3 65  ? 81.93100  92.67400  111.27400 1.000 40.45462  ? 64  GLU G OE1   1 
ATOM 4669  O OE2   . GLU G 3 65  ? 80.49200  91.11300  110.71200 1.000 40.45462  ? 64  GLU G OE2   1 
ATOM 4670  N N     . LEU G 3 66  ? 86.38400  90.70300  108.90100 1.000 39.74442  ? 65  LEU G N     1 
ATOM 4671  C CA    . LEU G 3 66  ? 86.83600  90.63300  107.51700 1.000 39.74442  ? 65  LEU G CA    1 
ATOM 4672  C C     . LEU G 3 66  ? 87.74500  89.43300  107.27400 1.000 39.74442  ? 65  LEU G C     1 
ATOM 4673  O O     . LEU G 3 66  ? 87.73900  88.87000  106.17100 1.000 39.74442  ? 65  LEU G O     1 
ATOM 4674  C CB    . LEU G 3 66  ? 87.53000  91.93400  107.13500 1.000 39.74442  ? 65  LEU G CB    1 
ATOM 4675  C CG    . LEU G 3 66  ? 86.71000  93.18700  107.41500 1.000 39.74442  ? 65  LEU G CG    1 
ATOM 4676  C CD1   . LEU G 3 66  ? 87.59500  94.39700  107.34900 1.000 39.74442  ? 65  LEU G CD1   1 
ATOM 4677  C CD2   . LEU G 3 66  ? 85.58300  93.30100  106.41500 1.000 39.74442  ? 65  LEU G CD2   1 
ATOM 4678  N N     . ALA G 3 67  ? 88.50000  88.99800  108.28900 1.000 40.25661  ? 66  ALA G N     1 
ATOM 4679  C CA    . ALA G 3 67  ? 89.28900  87.78100  108.14000 1.000 40.25661  ? 66  ALA G CA    1 
ATOM 4680  C C     . ALA G 3 67  ? 88.40000  86.54800  108.06000 1.000 40.25661  ? 66  ALA G C     1 
ATOM 4681  O O     . ALA G 3 67  ? 88.67400  85.63200  107.27900 1.000 40.25661  ? 66  ALA G O     1 
ATOM 4682  C CB    . ALA G 3 67  ? 90.27700  87.65500  109.29500 1.000 40.25661  ? 66  ALA G CB    1 
ATOM 4683  N N     . GLY G 3 68  ? 87.32100  86.51200  108.84500 1.000 42.65364  ? 67  GLY G N     1 
ATOM 4684  C CA    . GLY G 3 68  ? 86.37800  85.41300  108.74200 1.000 42.65364  ? 67  GLY G CA    1 
ATOM 4685  C C     . GLY G 3 68  ? 85.62500  85.41000  107.43000 1.000 42.65364  ? 67  GLY G C     1 
ATOM 4686  O O     . GLY G 3 68  ? 85.32400  84.34200  106.88700 1.000 42.65364  ? 67  GLY G O     1 
ATOM 4687  N N     . ASN G 3 69  ? 85.34700  86.59700  106.88300 1.000 43.29983  ? 68  ASN G N     1 
ATOM 4688  C CA    . ASN G 3 69  ? 84.74300  86.68700  105.55800 1.000 43.29983  ? 68  ASN G CA    1 
ATOM 4689  C C     . ASN G 3 69  ? 85.68700  86.17700  104.47600 1.000 43.29983  ? 68  ASN G C     1 
ATOM 4690  O O     . ASN G 3 69  ? 85.26300  85.44900  103.57400 1.000 43.29983  ? 68  ASN G O     1 
ATOM 4691  C CB    . ASN G 3 69  ? 84.33600  88.12600  105.26200 1.000 43.29983  ? 68  ASN G CB    1 
ATOM 4692  C CG    . ASN G 3 69  ? 83.05600  88.51900  105.95300 1.000 43.29983  ? 68  ASN G CG    1 
ATOM 4693  O OD1   . ASN G 3 69  ? 82.16400  87.69600  106.14000 1.000 43.29983  ? 68  ASN G OD1   1 
ATOM 4694  N ND2   . ASN G 3 69  ? 82.94900  89.78600  106.32300 1.000 43.29983  ? 68  ASN G ND2   1 
ATOM 4695  N N     . ALA G 3 70  ? 86.97200  86.53100  104.54900 1.000 44.23436  ? 69  ALA G N     1 
ATOM 4696  C CA    . ALA G 3 70  ? 87.90700  86.03900  103.54200 1.000 44.23436  ? 69  ALA G CA    1 
ATOM 4697  C C     . ALA G 3 70  ? 88.23000  84.56100  103.71900 1.000 44.23436  ? 69  ALA G C     1 
ATOM 4698  O O     . ALA G 3 70  ? 88.52400  83.87900  102.73000 1.000 44.23436  ? 69  ALA G O     1 
ATOM 4699  C CB    . ALA G 3 70  ? 89.19600  86.85600  103.57300 1.000 44.23436  ? 69  ALA G CB    1 
ATOM 4700  N N     . ALA G 3 71  ? 88.08500  84.02600  104.93000 1.000 45.87564  ? 70  ALA G N     1 
ATOM 4701  C CA    . ALA G 3 71  ? 88.23200  82.58900  105.09800 1.000 45.87564  ? 70  ALA G CA    1 
ATOM 4702  C C     . ALA G 3 71  ? 87.01000  81.84600  104.59200 1.000 45.87564  ? 70  ALA G C     1 
ATOM 4703  O O     . ALA G 3 71  ? 87.14300  80.73400  104.07200 1.000 45.87564  ? 70  ALA G O     1 
ATOM 4704  C CB    . ALA G 3 71  ? 88.48100  82.24400  106.56600 1.000 45.87564  ? 70  ALA G CB    1 
ATOM 4705  N N     . ARG G 3 72  ? 85.82100  82.43700  104.71700 1.000 45.58300  ? 71  ARG G N     1 
ATOM 4706  C CA    . ARG G 3 72  ? 84.64400  81.80000  104.14400 1.000 45.58300  ? 71  ARG G CA    1 
ATOM 4707  C C     . ARG G 3 72  ? 84.64300  81.92200  102.62700 1.000 45.58300  ? 71  ARG G C     1 
ATOM 4708  O O     . ARG G 3 72  ? 84.06000  81.07900  101.93900 1.000 45.58300  ? 71  ARG G O     1 
ATOM 4709  C CB    . ARG G 3 72  ? 83.37700  82.40700  104.74200 1.000 45.58300  ? 71  ARG G CB    1 
ATOM 4710  C CG    . ARG G 3 72  ? 82.18800  81.47300  104.75100 1.000 45.58300  ? 71  ARG G CG    1 
ATOM 4711  C CD    . ARG G 3 72  ? 80.88100  82.23600  104.86600 1.000 45.58300  ? 71  ARG G CD    1 
ATOM 4712  N NE    . ARG G 3 72  ? 80.91100  83.20700  105.95600 1.000 45.58300  ? 71  ARG G NE    1 
ATOM 4713  C CZ    . ARG G 3 72  ? 79.91700  84.04000  106.23900 1.000 45.58300  ? 71  ARG G CZ    1 
ATOM 4714  N NH1   . ARG G 3 72  ? 80.03100  84.89400  107.24600 1.000 45.58300  ? 71  ARG G NH1   1 
ATOM 4715  N NH2   . ARG G 3 72  ? 78.80600  84.01700  105.52100 1.000 45.58300  ? 71  ARG G NH2   1 
ATOM 4716  N N     . ASP G 3 73  ? 85.29300  82.95700  102.08900 1.000 46.43884  ? 72  ASP G N     1 
ATOM 4717  C CA    . ASP G 3 73  ? 85.45200  83.08600  100.64600 1.000 46.43884  ? 72  ASP G CA    1 
ATOM 4718  C C     . ASP G 3 73  ? 86.52900  82.16300  100.08900 1.000 46.43884  ? 72  ASP G C     1 
ATOM 4719  O O     . ASP G 3 73  ? 86.48000  81.82600  98.90300  1.000 46.43884  ? 72  ASP G O     1 
ATOM 4720  C CB    . ASP G 3 73  ? 85.77500  84.53300  100.26900 1.000 46.43884  ? 72  ASP G CB    1 
ATOM 4721  C CG    . ASP G 3 73  ? 84.58400  85.45500  100.42800 1.000 46.43884  ? 72  ASP G CG    1 
ATOM 4722  O OD1   . ASP G 3 73  ? 84.60200  86.55800  99.84500  1.000 46.43884  ? 72  ASP G OD1   1 
ATOM 4723  O OD2   . ASP G 3 73  ? 83.63200  85.08000  101.14000 1.000 46.43884  ? 72  ASP G OD2   1 
ATOM 4724  N N     . ASN G 3 74  ? 87.49900  81.75200  100.90500 1.000 47.49357  ? 73  ASN G N     1 
ATOM 4725  C CA    . ASN G 3 74  ? 88.49700  80.78100  100.47100 1.000 47.49357  ? 73  ASN G CA    1 
ATOM 4726  C C     . ASN G 3 74  ? 88.08800  79.34900  100.78200 1.000 47.49357  ? 73  ASN G C     1 
ATOM 4727  O O     . ASN G 3 74  ? 88.90000  78.43800  100.58700 1.000 47.49357  ? 73  ASN G O     1 
ATOM 4728  C CB    . ASN G 3 74  ? 89.86100  81.07300  101.10300 1.000 47.49357  ? 73  ASN G CB    1 
ATOM 4729  C CG    . ASN G 3 74  ? 90.52200  82.30800  100.52600 1.000 47.49357  ? 73  ASN G CG    1 
ATOM 4730  O OD1   . ASN G 3 74  ? 91.39100  82.20900  99.66100  1.000 47.49357  ? 73  ASN G OD1   1 
ATOM 4731  N ND2   . ASN G 3 74  ? 90.12300  83.47700  101.00500 1.000 47.49357  ? 73  ASN G ND2   1 
ATOM 4732  N N     . LYS G 3 75  ? 86.85400  79.15200  101.26600 1.000 49.91690  ? 74  LYS G N     1 
ATOM 4733  C CA    . LYS G 3 75  ? 86.29400  77.85400  101.67100 1.000 49.91690  ? 74  LYS G CA    1 
ATOM 4734  C C     . LYS G 3 75  ? 87.15600  77.18100  102.73900 1.000 49.91690  ? 74  LYS G C     1 
ATOM 4735  O O     . LYS G 3 75  ? 87.45200  75.98600  102.67700 1.000 49.91690  ? 74  LYS G O     1 
ATOM 4736  C CB    . LYS G 3 75  ? 86.08500  76.93200  100.46400 1.000 49.91690  ? 74  LYS G CB    1 
ATOM 4737  C CG    . LYS G 3 75  ? 84.73900  77.09800  99.77600  1.000 49.91690  ? 74  LYS G CG    1 
ATOM 4738  C CD    . LYS G 3 75  ? 84.77400  78.23600  98.76300  1.000 49.91690  ? 74  LYS G CD    1 
ATOM 4739  C CE    . LYS G 3 75  ? 83.37500  78.67000  98.35900  1.000 49.91690  ? 74  LYS G CE    1 
ATOM 4740  N NZ    . LYS G 3 75  ? 83.35100  80.07400  97.87200  1.000 49.91690  ? 74  LYS G NZ    1 
ATOM 4741  N N     . LYS G 3 76  ? 87.56600  77.97100  103.72700 1.000 56.12718  ? 75  LYS G N     1 
ATOM 4742  C CA    . LYS G 3 76  ? 88.29700  77.48900  104.88700 1.000 56.12718  ? 75  LYS G CA    1 
ATOM 4743  C C     . LYS G 3 76  ? 87.51700  77.80800  106.15300 1.000 56.12718  ? 75  LYS G C     1 
ATOM 4744  O O     . LYS G 3 76  ? 86.86900  78.85300  106.24400 1.000 56.12718  ? 75  LYS G O     1 
ATOM 4745  C CB    . LYS G 3 76  ? 89.68600  78.12500  104.96000 1.000 56.12718  ? 75  LYS G CB    1 
ATOM 4746  C CG    . LYS G 3 76  ? 90.49100  78.00900  103.68000 1.000 56.12718  ? 75  LYS G CG    1 
ATOM 4747  C CD    . LYS G 3 76  ? 90.90100  76.57800  103.41400 1.000 56.12718  ? 75  LYS G CD    1 
ATOM 4748  C CE    . LYS G 3 76  ? 92.28800  76.51800  102.81300 1.000 56.12718  ? 75  LYS G CE    1 
ATOM 4749  N NZ    . LYS G 3 76  ? 92.38500  77.33600  101.57700 1.000 56.12718  ? 75  LYS G NZ    1 
ATOM 4750  N N     . THR G 3 77  ? 87.57300  76.90500  107.13000 1.000 59.40204  ? 76  THR G N     1 
ATOM 4751  C CA    . THR G 3 77  ? 86.99900  77.16000  108.44500 1.000 59.40204  ? 76  THR G CA    1 
ATOM 4752  C C     . THR G 3 77  ? 88.07000  77.48900  109.47400 1.000 59.40204  ? 76  THR G C     1 
ATOM 4753  O O     . THR G 3 77  ? 87.93600  77.12700  110.64700 1.000 59.40204  ? 76  THR G O     1 
ATOM 4754  C CB    . THR G 3 77  ? 86.16800  75.97000  108.92300 1.000 59.40204  ? 76  THR G CB    1 
ATOM 4755  O OG1   . THR G 3 77  ? 87.03800  74.97100  109.46700 1.000 59.40204  ? 76  THR G OG1   1 
ATOM 4756  C CG2   . THR G 3 77  ? 85.36900  75.37500  107.77400 1.000 59.40204  ? 76  THR G CG2   1 
ATOM 4757  N N     . ARG G 3 78  ? 89.13900  78.15600  109.04900 1.000 54.71528  ? 77  ARG G N     1 
ATOM 4758  C CA    . ARG G 3 78  ? 90.26500  78.47400  109.91300 1.000 54.71528  ? 77  ARG G CA    1 
ATOM 4759  C C     . ARG G 3 78  ? 91.01400  79.63600  109.28000 1.000 54.71528  ? 77  ARG G C     1 
ATOM 4760  O O     . ARG G 3 78  ? 91.22700  79.64600  108.06800 1.000 54.71528  ? 77  ARG G O     1 
ATOM 4761  C CB    . ARG G 3 78  ? 91.19100  77.26900  110.09500 1.000 54.71528  ? 77  ARG G CB    1 
ATOM 4762  C CG    . ARG G 3 78  ? 92.28800  77.45900  111.12300 1.000 54.71528  ? 77  ARG G CG    1 
ATOM 4763  C CD    . ARG G 3 78  ? 93.07500  76.17600  111.32200 1.000 54.71528  ? 77  ARG G CD    1 
ATOM 4764  N NE    . ARG G 3 78  ? 92.26900  75.13100  111.94300 1.000 54.71528  ? 77  ARG G NE    1 
ATOM 4765  C CZ    . ARG G 3 78  ? 92.64200  73.86000  112.04300 1.000 54.71528  ? 77  ARG G CZ    1 
ATOM 4766  N NH1   . ARG G 3 78  ? 93.81800  73.47300  111.57300 1.000 54.71528  ? 77  ARG G NH1   1 
ATOM 4767  N NH2   . ARG G 3 78  ? 91.84600  72.97700  112.62600 1.000 54.71528  ? 77  ARG G NH2   1 
ATOM 4768  N N     . ILE G 3 79  ? 91.41300  80.60200  110.09900 1.000 43.48094  ? 78  ILE G N     1 
ATOM 4769  C CA    . ILE G 3 79  ? 92.01000  81.84400  109.62200 1.000 43.48094  ? 78  ILE G CA    1 
ATOM 4770  C C     . ILE G 3 79  ? 93.52300  81.70300  109.65900 1.000 43.48094  ? 78  ILE G C     1 
ATOM 4771  O O     . ILE G 3 79  ? 94.11100  81.49800  110.72600 1.000 43.48094  ? 78  ILE G O     1 
ATOM 4772  C CB    . ILE G 3 79  ? 91.55000  83.05000  110.45400 1.000 43.48094  ? 78  ILE G CB    1 
ATOM 4773  C CG1   . ILE G 3 79  ? 90.03900  83.22000  110.35900 1.000 43.48094  ? 78  ILE G CG1   1 
ATOM 4774  C CG2   . ILE G 3 79  ? 92.25700  84.31100  110.00300 1.000 43.48094  ? 78  ILE G CG2   1 
ATOM 4775  C CD1   . ILE G 3 79  ? 89.52300  84.38500  111.14100 1.000 43.48094  ? 78  ILE G CD1   1 
ATOM 4776  N N     . ILE G 3 80  ? 94.14900  81.81200  108.49500 1.000 40.79815  ? 79  ILE G N     1 
ATOM 4777  C CA    . ILE G 3 80  ? 95.60100  81.81300  108.37200 1.000 40.79815  ? 79  ILE G CA    1 
ATOM 4778  C C     . ILE G 3 80  ? 95.99000  83.25900  108.07800 1.000 40.79815  ? 79  ILE G C     1 
ATOM 4779  O O     . ILE G 3 80  ? 95.10700  84.04200  107.70300 1.000 40.79815  ? 79  ILE G O     1 
ATOM 4780  C CB    . ILE G 3 80  ? 96.04800  80.82000  107.28600 1.000 40.79815  ? 79  ILE G CB    1 
ATOM 4781  C CG1   . ILE G 3 80  ? 95.71700  81.34700  105.89600 1.000 40.79815  ? 79  ILE G CG1   1 
ATOM 4782  C CG2   . ILE G 3 80  ? 95.38900  79.47500  107.50300 1.000 40.79815  ? 79  ILE G CG2   1 
ATOM 4783  C CD1   . ILE G 3 80  ? 96.22400  80.46300  104.78500 1.000 40.79815  ? 79  ILE G CD1   1 
ATOM 4784  N N     . PRO G 3 81  ? 97.25300  83.68400  108.25300 1.000 39.34317  ? 80  PRO G N     1 
ATOM 4785  C CA    . PRO G 3 81  ? 97.58000  85.10600  108.04000 1.000 39.34317  ? 80  PRO G CA    1 
ATOM 4786  C C     . PRO G 3 81  ? 97.48300  85.58000  106.59800 1.000 39.34317  ? 80  PRO G C     1 
ATOM 4787  O O     . PRO G 3 81  ? 97.58200  86.79100  106.36900 1.000 39.34317  ? 80  PRO G O     1 
ATOM 4788  C CB    . PRO G 3 81  ? 99.02000  85.21800  108.55700 1.000 39.34317  ? 80  PRO G CB    1 
ATOM 4789  C CG    . PRO G 3 81  ? 99.53100  83.84900  108.59200 1.000 39.34317  ? 80  PRO G CG    1 
ATOM 4790  C CD    . PRO G 3 81  ? 98.36600  82.99900  108.93200 1.000 39.34317  ? 80  PRO G CD    1 
ATOM 4791  N N     . ARG G 3 82  ? 97.32700  84.68000  105.62500 1.000 39.10180  ? 81  ARG G N     1 
ATOM 4792  C CA    . ARG G 3 82  ? 96.95100  85.09900  104.28000 1.000 39.10180  ? 81  ARG G CA    1 
ATOM 4793  C C     . ARG G 3 82  ? 95.57700  85.75900  104.26800 1.000 39.10180  ? 81  ARG G C     1 
ATOM 4794  O O     . ARG G 3 82  ? 95.38100  86.78600  103.60600 1.000 39.10180  ? 81  ARG G O     1 
ATOM 4795  C CB    . ARG G 3 82  ? 96.99100  83.89300  103.34300 1.000 39.10180  ? 81  ARG G CB    1 
ATOM 4796  C CG    . ARG G 3 82  ? 96.33100  84.08200  101.98900 1.000 39.10180  ? 81  ARG G CG    1 
ATOM 4797  C CD    . ARG G 3 82  ? 97.00900  85.13600  101.13800 1.000 39.10180  ? 81  ARG G CD    1 
ATOM 4798  N NE    . ARG G 3 82  ? 96.36400  85.23500  99.83500  1.000 39.10180  ? 81  ARG G NE    1 
ATOM 4799  C CZ    . ARG G 3 82  ? 96.67100  86.13800  98.91400  1.000 39.10180  ? 81  ARG G CZ    1 
ATOM 4800  N NH1   . ARG G 3 82  ? 97.60400  87.04000  99.15600  1.000 39.10180  ? 81  ARG G NH1   1 
ATOM 4801  N NH2   . ARG G 3 82  ? 96.03000  86.15000  97.75600  1.000 39.10180  ? 81  ARG G NH2   1 
ATOM 4802  N N     . HIS G 3 83  ? 94.62200  85.20600  105.01900 1.000 40.76563  ? 82  HIS G N     1 
ATOM 4803  C CA    . HIS G 3 83  ? 93.30900  85.83200  105.13000 1.000 40.76563  ? 82  HIS G CA    1 
ATOM 4804  C C     . HIS G 3 83  ? 93.36000  87.13200  105.91900 1.000 40.76563  ? 82  HIS G C     1 
ATOM 4805  O O     . HIS G 3 83  ? 92.56500  88.03700  105.65700 1.000 40.76563  ? 82  HIS G O     1 
ATOM 4806  C CB    . HIS G 3 83  ? 92.30700  84.86900  105.75800 1.000 40.76563  ? 82  HIS G CB    1 
ATOM 4807  C CG    . HIS G 3 83  ? 92.27000  83.52900  105.09800 1.000 40.76563  ? 82  HIS G CG    1 
ATOM 4808  N ND1   . HIS G 3 83  ? 92.16000  82.35200  105.80400 1.000 40.76563  ? 82  HIS G ND1   1 
ATOM 4809  C CD2   . HIS G 3 83  ? 92.34500  83.17900  103.79400 1.000 40.76563  ? 82  HIS G CD2   1 
ATOM 4810  C CE1   . HIS G 3 83  ? 92.16000  81.33600  104.96200 1.000 40.76563  ? 82  HIS G CE1   1 
ATOM 4811  N NE2   . HIS G 3 83  ? 92.27400  81.81000  103.73700 1.000 40.76563  ? 82  HIS G NE2   1 
ATOM 4812  N N     . LEU G 3 84  ? 94.29000  87.25800  106.86500 1.000 38.67033  ? 83  LEU G N     1 
ATOM 4813  C CA    . LEU G 3 84  ? 94.45200  88.53200  107.55800 1.000 38.67033  ? 83  LEU G CA    1 
ATOM 4814  C C     . LEU G 3 84  ? 95.01200  89.60000  106.62700 1.000 38.67033  ? 83  LEU G C     1 
ATOM 4815  O O     . LEU G 3 84  ? 94.61700  90.76700  106.71100 1.000 38.67033  ? 83  LEU G O     1 
ATOM 4816  C CB    . LEU G 3 84  ? 95.34400  88.35700  108.78200 1.000 38.67033  ? 83  LEU G CB    1 
ATOM 4817  C CG    . LEU G 3 84  ? 94.62500  87.76500  109.98800 1.000 38.67033  ? 83  LEU G CG    1 
ATOM 4818  C CD1   . LEU G 3 84  ? 95.60500  87.37600  111.05200 1.000 38.67033  ? 83  LEU G CD1   1 
ATOM 4819  C CD2   . LEU G 3 84  ? 93.64400  88.76900  110.52900 1.000 38.67033  ? 83  LEU G CD2   1 
ATOM 4820  N N     . GLN G 3 85  ? 95.89300  89.21200  105.70400 1.000 38.29050  ? 84  GLN G N     1 
ATOM 4821  C CA    . GLN G 3 85  ? 96.38200  90.15500  104.70300 1.000 38.29050  ? 84  GLN G CA    1 
ATOM 4822  C C     . GLN G 3 85  ? 95.28100  90.54300  103.72600 1.000 38.29050  ? 84  GLN G C     1 
ATOM 4823  O O     . GLN G 3 85  ? 95.13400  91.72300  103.38400 1.000 38.29050  ? 84  GLN G O     1 
ATOM 4824  C CB    . GLN G 3 85  ? 97.57400  89.56100  103.95700 1.000 38.29050  ? 84  GLN G CB    1 
ATOM 4825  C CG    . GLN G 3 85  ? 98.10500  90.42800  102.83600 1.000 38.29050  ? 84  GLN G CG    1 
ATOM 4826  C CD    . GLN G 3 85  ? 99.09500  91.46400  103.31000 1.000 38.29050  ? 84  GLN G CD    1 
ATOM 4827  O OE1   . GLN G 3 85  ? 98.76300  92.35300  104.09000 1.000 38.29050  ? 84  GLN G OE1   1 
ATOM 4828  N NE2   . GLN G 3 85  ? 100.32600 91.36000  102.83100 1.000 38.29050  ? 84  GLN G NE2   1 
ATOM 4829  N N     . LEU G 3 86  ? 94.48200  89.56800  103.28300 1.000 38.66900  ? 85  LEU G N     1 
ATOM 4830  C CA    . LEU G 3 86  ? 93.35800  89.86200  102.40000 1.000 38.66900  ? 85  LEU G CA    1 
ATOM 4831  C C     . LEU G 3 86  ? 92.27100  90.67100  103.09200 1.000 38.66900  ? 85  LEU G C     1 
ATOM 4832  O O     . LEU G 3 86  ? 91.48800  91.33800  102.41300 1.000 38.66900  ? 85  LEU G O     1 
ATOM 4833  C CB    . LEU G 3 86  ? 92.75600  88.56800  101.85800 1.000 38.66900  ? 85  LEU G CB    1 
ATOM 4834  C CG    . LEU G 3 86  ? 93.64000  87.76500  100.91400 1.000 38.66900  ? 85  LEU G CG    1 
ATOM 4835  C CD1   . LEU G 3 86  ? 92.93300  86.50000  100.48000 1.000 38.66900  ? 85  LEU G CD1   1 
ATOM 4836  C CD2   . LEU G 3 86  ? 94.01800  88.60100  99.71800  1.000 38.66900  ? 85  LEU G CD2   1 
ATOM 4837  N N     . ALA G 3 87  ? 92.19600  90.60700  104.42100 1.000 40.05151  ? 86  ALA G N     1 
ATOM 4838  C CA    . ALA G 3 87  ? 91.24600  91.42000  105.16400 1.000 40.05151  ? 86  ALA G CA    1 
ATOM 4839  C C     . ALA G 3 87  ? 91.75600  92.84100  105.34700 1.000 40.05151  ? 86  ALA G C     1 
ATOM 4840  O O     . ALA G 3 87  ? 90.98500  93.79700  105.22400 1.000 40.05151  ? 86  ALA G O     1 
ATOM 4841  C CB    . ALA G 3 87  ? 90.97400  90.78100  106.52100 1.000 40.05151  ? 86  ALA G CB    1 
ATOM 4842  N N     . ILE G 3 88  ? 93.04700  92.99300  105.64200 1.000 37.81445  ? 87  ILE G N     1 
ATOM 4843  C CA    . ILE G 3 88  ? 93.60700  94.31300  105.90700 1.000 37.81445  ? 87  ILE G CA    1 
ATOM 4844  C C     . ILE G 3 88  ? 93.71700  95.12100  104.62000 1.000 37.81445  ? 87  ILE G C     1 
ATOM 4845  O O     . ILE G 3 88  ? 93.27900  96.27500  104.55900 1.000 37.81445  ? 87  ILE G O     1 
ATOM 4846  C CB    . ILE G 3 88  ? 94.96400  94.17500  106.61800 1.000 37.81445  ? 87  ILE G CB    1 
ATOM 4847  C CG1   . ILE G 3 88  ? 94.75300  93.75500  108.07000 1.000 37.81445  ? 87  ILE G CG1   1 
ATOM 4848  C CG2   . ILE G 3 88  ? 95.74500  95.46500  106.56400 1.000 37.81445  ? 87  ILE G CG2   1 
ATOM 4849  C CD1   . ILE G 3 88  ? 95.96100  93.10700  108.69600 1.000 37.81445  ? 87  ILE G CD1   1 
ATOM 4850  N N     . ARG G 3 89  ? 94.27400  94.52400  103.56100 1.000 39.41257  ? 88  ARG G N     1 
ATOM 4851  C CA    . ARG G 3 89  ? 94.55200  95.28200  102.34400 1.000 39.41257  ? 88  ARG G CA    1 
ATOM 4852  C C     . ARG G 3 89  ? 93.30800  95.60000  101.52500 1.000 39.41257  ? 88  ARG G C     1 
ATOM 4853  O O     . ARG G 3 89  ? 93.39600  96.40900  100.59900 1.000 39.41257  ? 88  ARG G O     1 
ATOM 4854  C CB    . ARG G 3 89  ? 95.54700  94.53400  101.46100 1.000 39.41257  ? 88  ARG G CB    1 
ATOM 4855  C CG    . ARG G 3 89  ? 96.88600  94.27000  102.11300 1.000 39.41257  ? 88  ARG G CG    1 
ATOM 4856  C CD    . ARG G 3 89  ? 97.46600  95.51600  102.75200 1.000 39.41257  ? 88  ARG G CD    1 
ATOM 4857  N NE    . ARG G 3 89  ? 98.62200  95.19600  103.58100 1.000 39.41257  ? 88  ARG G NE    1 
ATOM 4858  C CZ    . ARG G 3 89  ? 99.11700  96.00000  104.51300 1.000 39.41257  ? 88  ARG G CZ    1 
ATOM 4859  N NH1   . ARG G 3 89  ? 100.16800 95.62400  105.22000 1.000 39.41257  ? 88  ARG G NH1   1 
ATOM 4860  N NH2   . ARG G 3 89  ? 98.56000  97.17800  104.73500 1.000 39.41257  ? 88  ARG G NH2   1 
ATOM 4861  N N     . ASN G 3 90  ? 92.16800  94.98300  101.82300 1.000 41.60887  ? 89  ASN G N     1 
ATOM 4862  C CA    . ASN G 3 90  ? 90.95300  95.23600  101.06000 1.000 41.60887  ? 89  ASN G CA    1 
ATOM 4863  C C     . ASN G 3 90  ? 90.11700  96.37200  101.63900 1.000 41.60887  ? 89  ASN G C     1 
ATOM 4864  O O     . ASN G 3 90  ? 89.58000  97.18500  100.88000 1.000 41.60887  ? 89  ASN G O     1 
ATOM 4865  C CB    . ASN G 3 90  ? 90.11300  93.96400  100.96300 1.000 41.60887  ? 89  ASN G CB    1 
ATOM 4866  C CG    . ASN G 3 90  ? 90.47600  93.12500  99.76100  1.000 41.60887  ? 89  ASN G CG    1 
ATOM 4867  O OD1   . ASN G 3 90  ? 90.95500  93.64200  98.75500  1.000 41.60887  ? 89  ASN G OD1   1 
ATOM 4868  N ND2   . ASN G 3 90  ? 90.25700  91.82300  99.86000  1.000 41.60887  ? 89  ASN G ND2   1 
ATOM 4869  N N     . ASP G 3 91  ? 89.99400  96.45700  102.96100 1.000 42.92910  ? 90  ASP G N     1 
ATOM 4870  C CA    . ASP G 3 91  ? 89.28200  97.57200  103.57000 1.000 42.92910  ? 90  ASP G CA    1 
ATOM 4871  C C     . ASP G 3 91  ? 90.18800  98.79400  103.60500 1.000 42.92910  ? 90  ASP G C     1 
ATOM 4872  O O     . ASP G 3 91  ? 91.36900  98.69900  103.94500 1.000 42.92910  ? 90  ASP G O     1 
ATOM 4873  C CB    . ASP G 3 91  ? 88.82900  97.20800  104.98300 1.000 42.92910  ? 90  ASP G CB    1 
ATOM 4874  C CG    . ASP G 3 91  ? 87.75500  98.13700  105.51200 1.000 42.92910  ? 90  ASP G CG    1 
ATOM 4875  O OD1   . ASP G 3 91  ? 87.33200  97.95600  106.67300 1.000 42.92910  ? 90  ASP G OD1   1 
ATOM 4876  O OD2   . ASP G 3 91  ? 87.31700  99.03600  104.76500 1.000 42.92910  ? 90  ASP G OD2   1 
ATOM 4877  N N     . GLU G 3 92  ? 89.62500  99.95000  103.25100 1.000 45.47905  ? 91  GLU G N     1 
ATOM 4878  C CA    . GLU G 3 92  ? 90.45900  101.12200 103.02000 1.000 45.47905  ? 91  GLU G CA    1 
ATOM 4879  C C     . GLU G 3 92  ? 90.89500  101.81300 104.30300 1.000 45.47905  ? 91  GLU G C     1 
ATOM 4880  O O     . GLU G 3 92  ? 91.96500  102.42900 104.32600 1.000 45.47905  ? 91  GLU G O     1 
ATOM 4881  C CB    . GLU G 3 92  ? 89.72900  102.11300 102.11700 1.000 45.47905  ? 91  GLU G CB    1 
ATOM 4882  C CG    . GLU G 3 92  ? 89.74000  101.70600 100.65700 1.000 45.47905  ? 91  GLU G CG    1 
ATOM 4883  C CD    . GLU G 3 92  ? 91.13000  101.76600 100.05000 1.000 45.47905  ? 91  GLU G CD    1 
ATOM 4884  O OE1   . GLU G 3 92  ? 91.80500  102.80300 100.21300 1.000 45.47905  ? 91  GLU G OE1   1 
ATOM 4885  O OE2   . GLU G 3 92  ? 91.55000  100.77400 99.41500  1.000 45.47905  ? 91  GLU G OE2   1 
ATOM 4886  N N     . GLU G 3 93  ? 90.09500  101.74300 105.36500 1.000 40.99025  ? 92  GLU G N     1 
ATOM 4887  C CA    . GLU G 3 93  ? 90.49500  102.37300 106.61800 1.000 40.99025  ? 92  GLU G CA    1 
ATOM 4888  C C     . GLU G 3 93  ? 91.60300  101.58300 107.30000 1.000 40.99025  ? 92  GLU G C     1 
ATOM 4889  O O     . GLU G 3 93  ? 92.57100  102.16100 107.80800 1.000 40.99025  ? 92  GLU G O     1 
ATOM 4890  C CB    . GLU G 3 93  ? 89.29100  102.51000 107.54400 1.000 40.99025  ? 92  GLU G CB    1 
ATOM 4891  C CG    . GLU G 3 93  ? 88.20300  103.42500 107.02000 1.000 40.99025  ? 92  GLU G CG    1 
ATOM 4892  C CD    . GLU G 3 93  ? 87.07400  102.66500 106.35500 1.000 40.99025  ? 92  GLU G CD    1 
ATOM 4893  O OE1   . GLU G 3 93  ? 86.17400  103.31100 105.78300 1.000 40.99025  ? 92  GLU G OE1   1 
ATOM 4894  O OE2   . GLU G 3 93  ? 87.08200  101.41900 106.41400 1.000 40.99025  ? 92  GLU G OE2   1 
ATOM 4895  N N     . LEU G 3 94  ? 91.48800  100.25600 107.29200 1.000 39.31353  ? 93  LEU G N     1 
ATOM 4896  C CA    . LEU G 3 94  ? 92.52000  99.38700  107.83700 1.000 39.31353  ? 93  LEU G CA    1 
ATOM 4897  C C     . LEU G 3 94  ? 93.76700  99.34100  106.97200 1.000 39.31353  ? 93  LEU G C     1 
ATOM 4898  O O     . LEU G 3 94  ? 94.84300  99.01200  107.47800 1.000 39.31353  ? 93  LEU G O     1 
ATOM 4899  C CB    . LEU G 3 94  ? 91.94900  97.98900  107.99500 1.000 39.31353  ? 93  LEU G CB    1 
ATOM 4900  C CG    . LEU G 3 94  ? 90.84200  97.97700  109.03400 1.000 39.31353  ? 93  LEU G CG    1 
ATOM 4901  C CD1   . LEU G 3 94  ? 90.03900  96.71900  108.89500 1.000 39.31353  ? 93  LEU G CD1   1 
ATOM 4902  C CD2   . LEU G 3 94  ? 91.43200  98.09600  110.41900 1.000 39.31353  ? 93  LEU G CD2   1 
ATOM 4903  N N     . ASN G 3 95  ? 93.66200  99.70500  105.69700 1.000 40.33423  ? 94  ASN G N     1 
ATOM 4904  C CA    . ASN G 3 95  ? 94.84600  99.84000  104.86800 1.000 40.33423  ? 94  ASN G CA    1 
ATOM 4905  C C     . ASN G 3 95  ? 95.59600  101.13000 105.14700 1.000 40.33423  ? 94  ASN G C     1 
ATOM 4906  O O     . ASN G 3 95  ? 96.79100  101.21000 104.85600 1.000 40.33423  ? 94  ASN G O     1 
ATOM 4907  C CB    . ASN G 3 95  ? 94.46000  99.77400  103.39400 1.000 40.33423  ? 94  ASN G CB    1 
ATOM 4908  C CG    . ASN G 3 95  ? 95.63400  99.48300  102.50300 1.000 40.33423  ? 94  ASN G CG    1 
ATOM 4909  O OD1   . ASN G 3 95  ? 96.64100  98.93900  102.94900 1.000 40.33423  ? 94  ASN G OD1   1 
ATOM 4910  N ND2   . ASN G 3 95  ? 95.51400  99.84000  101.23000 1.000 40.33423  ? 94  ASN G ND2   1 
ATOM 4911  N N     . LYS G 3 96  ? 94.92600  102.13800 105.70400 1.000 37.36393  ? 95  LYS G N     1 
ATOM 4912  C CA    . LYS G 3 96  ? 95.61400  103.33800 106.15500 1.000 37.36393  ? 95  LYS G CA    1 
ATOM 4913  C C     . LYS G 3 96  ? 96.11900  103.19700 107.57900 1.000 37.36393  ? 95  LYS G C     1 
ATOM 4914  O O     . LYS G 3 96  ? 97.12900  103.81100 107.93600 1.000 37.36393  ? 95  LYS G O     1 
ATOM 4915  C CB    . LYS G 3 96  ? 94.69200  104.55300 106.05300 1.000 37.36393  ? 95  LYS G CB    1 
ATOM 4916  C CG    . LYS G 3 96  ? 94.44400  105.01100 104.62900 1.000 37.36393  ? 95  LYS G CG    1 
ATOM 4917  C CD    . LYS G 3 96  ? 93.77400  106.37300 104.58400 1.000 37.36393  ? 95  LYS G CD    1 
ATOM 4918  C CE    . LYS G 3 96  ? 92.35500  106.31800 105.11200 1.000 37.36393  ? 95  LYS G CE    1 
ATOM 4919  N NZ    . LYS G 3 96  ? 91.73600  107.66900 105.11800 1.000 37.36393  ? 95  LYS G NZ    1 
ATOM 4920  N N     . LEU G 3 97  ? 95.43300  102.40100 108.39700 1.000 35.65442  ? 96  LEU G N     1 
ATOM 4921  C CA    . LEU G 3 97  ? 95.91800  102.13200 109.74400 1.000 35.65442  ? 96  LEU G CA    1 
ATOM 4922  C C     . LEU G 3 97  ? 97.11200  101.18700 109.72500 1.000 35.65442  ? 96  LEU G C     1 
ATOM 4923  O O     . LEU G 3 97  ? 98.03000  101.33100 110.54000 1.000 35.65442  ? 96  LEU G O     1 
ATOM 4924  C CB    . LEU G 3 97  ? 94.78200  101.56800 110.59700 1.000 35.65442  ? 96  LEU G CB    1 
ATOM 4925  C CG    . LEU G 3 97  ? 95.10200  101.12100 112.01900 1.000 35.65442  ? 96  LEU G CG    1 
ATOM 4926  C CD1   . LEU G 3 97  ? 95.53900  102.30200 112.84000 1.000 35.65442  ? 96  LEU G CD1   1 
ATOM 4927  C CD2   . LEU G 3 97  ? 93.89600  100.45300 112.63700 1.000 35.65442  ? 96  LEU G CD2   1 
ATOM 4928  N N     . LEU G 3 98  ? 97.13400  100.24000 108.79100 1.000 35.26154  ? 97  LEU G N     1 
ATOM 4929  C CA    . LEU G 3 98  ? 98.20900  99.26000  108.71700 1.000 35.26154  ? 97  LEU G CA    1 
ATOM 4930  C C     . LEU G 3 98  ? 98.97200  99.39600  107.40900 1.000 35.26154  ? 97  LEU G C     1 
ATOM 4931  O O     . LEU G 3 98  ? 99.23800  98.39700  106.73500 1.000 35.26154  ? 97  LEU G O     1 
ATOM 4932  C CB    . LEU G 3 98  ? 97.66800  97.83900  108.87300 1.000 35.26154  ? 97  LEU G CB    1 
ATOM 4933  C CG    . LEU G 3 98  ? 97.28000  97.40900  110.28800 1.000 35.26154  ? 97  LEU G CG    1 
ATOM 4934  C CD1   . LEU G 3 98  ? 95.83700  97.72400  110.59500 1.000 35.26154  ? 97  LEU G CD1   1 
ATOM 4935  C CD2   . LEU G 3 98  ? 97.54600  95.94300  110.48200 1.000 35.26154  ? 97  LEU G CD2   1 
ATOM 4936  N N     . GLY G 3 99  ? 99.30700  100.63000 107.03200 1.000 38.80622  ? 98  GLY G N     1 
ATOM 4937  C CA    . GLY G 3 99  ? 100.04800 100.83800 105.80000 1.000 38.80622  ? 98  GLY G CA    1 
ATOM 4938  C C     . GLY G 3 99  ? 101.50600 100.44300 105.92900 1.000 38.80622  ? 98  GLY G C     1 
ATOM 4939  O O     . GLY G 3 99  ? 102.07700 99.84100  105.01800 1.000 38.80622  ? 98  GLY G O     1 
ATOM 4940  N N     . LYS G 3 100 ? 102.12200 100.75900 107.06800 1.000 38.15173  ? 99  LYS G N     1 
ATOM 4941  C CA    . LYS G 3 100 ? 103.52000 100.44500 107.33200 1.000 38.15173  ? 99  LYS G CA    1 
ATOM 4942  C C     . LYS G 3 100 ? 103.69800 99.11100  108.03100 1.000 38.15173  ? 99  LYS G C     1 
ATOM 4943  O O     . LYS G 3 100 ? 104.65100 98.94500  108.80000 1.000 38.15173  ? 99  LYS G O     1 
ATOM 4944  C CB    . LYS G 3 100 ? 104.17700 101.55100 108.15800 1.000 38.15173  ? 99  LYS G CB    1 
ATOM 4945  C CG    . LYS G 3 100 ? 104.26500 102.90100 107.49600 1.000 38.15173  ? 99  LYS G CG    1 
ATOM 4946  C CD    . LYS G 3 100 ? 105.24900 102.82600 106.34100 1.000 38.15173  ? 99  LYS G CD    1 
ATOM 4947  C CE    . LYS G 3 100 ? 105.39600 104.15800 105.64400 1.000 38.15173  ? 99  LYS G CE    1 
ATOM 4948  N NZ    . LYS G 3 100 ? 106.00300 105.16900 106.55600 1.000 38.15173  ? 99  LYS G NZ    1 
ATOM 4949  N N     . VAL G 3 101 ? 102.80800 98.15500  107.79700 1.000 35.66308  ? 100 VAL G N     1 
ATOM 4950  C CA    . VAL G 3 101 ? 102.81900 96.88400  108.50100 1.000 35.66308  ? 100 VAL G CA    1 
ATOM 4951  C C     . VAL G 3 101 ? 103.00700 95.76600  107.48900 1.000 35.66308  ? 100 VAL G C     1 
ATOM 4952  O O     . VAL G 3 101 ? 102.25100 95.66600  106.51700 1.000 35.66308  ? 100 VAL G O     1 
ATOM 4953  C CB    . VAL G 3 101 ? 101.52200 96.68700  109.30200 1.000 35.66308  ? 100 VAL G CB    1 
ATOM 4954  C CG1   . VAL G 3 101 ? 101.36700 95.25500  109.69700 1.000 35.66308  ? 100 VAL G CG1   1 
ATOM 4955  C CG2   . VAL G 3 101 ? 101.53300 97.56600  110.53100 1.000 35.66308  ? 100 VAL G CG2   1 
ATOM 4956  N N     . THR G 3 102 ? 104.01900 94.93600  107.71500 1.000 34.23319  ? 101 THR G N     1 
ATOM 4957  C CA    . THR G 3 102 ? 104.26000 93.73700  106.92900 1.000 34.23319  ? 101 THR G CA    1 
ATOM 4958  C C     . THR G 3 102 ? 103.69100 92.53400  107.67000 1.000 34.23319  ? 101 THR G C     1 
ATOM 4959  O O     . THR G 3 102 ? 104.03100 92.30500  108.83400 1.000 34.23319  ? 101 THR G O     1 
ATOM 4960  C CB    . THR G 3 102 ? 105.75600 93.55200  106.68400 1.000 34.23319  ? 101 THR G CB    1 
ATOM 4961  O OG1   . THR G 3 102 ? 106.24600 94.64200  105.89800 1.000 34.23319  ? 101 THR G OG1   1 
ATOM 4962  C CG2   . THR G 3 102 ? 106.02500 92.25700  105.95800 1.000 34.23319  ? 101 THR G CG2   1 
ATOM 4963  N N     . ILE G 3 103 ? 102.83200 91.77400  107.00600 1.000 35.63036  ? 102 ILE G N     1 
ATOM 4964  C CA    . ILE G 3 103 ? 102.25400 90.57300  107.59500 1.000 35.63036  ? 102 ILE G CA    1 
ATOM 4965  C C     . ILE G 3 103 ? 103.11000 89.38700  107.17700 1.000 35.63036  ? 102 ILE G C     1 
ATOM 4966  O O     . ILE G 3 103 ? 103.28100 89.13200  105.98000 1.000 35.63036  ? 102 ILE G O     1 
ATOM 4967  C CB    . ILE G 3 103 ? 100.79600 90.38000  107.15500 1.000 35.63036  ? 102 ILE G CB    1 
ATOM 4968  C CG1   . ILE G 3 103 ? 99.95300  91.59900  107.52000 1.000 35.63036  ? 102 ILE G CG1   1 
ATOM 4969  C CG2   . ILE G 3 103 ? 100.22300 89.12900  107.76800 1.000 35.63036  ? 102 ILE G CG2   1 
ATOM 4970  C CD1   . ILE G 3 103 ? 99.84300  91.83900  108.99200 1.000 35.63036  ? 102 ILE G CD1   1 
ATOM 4971  N N     . ALA G 3 104 ? 103.68000 88.69100  108.15900 1.000 35.57468  ? 103 ALA G N     1 
ATOM 4972  C CA    . ALA G 3 104 ? 104.50900 87.52500  107.88300 1.000 35.57468  ? 103 ALA G CA    1 
ATOM 4973  C C     . ALA G 3 104 ? 103.68000 86.40200  107.28100 1.000 35.57468  ? 103 ALA G C     1 
ATOM 4974  O O     . ALA G 3 104 ? 102.55400 86.14600  107.71900 1.000 35.57468  ? 103 ALA G O     1 
ATOM 4975  C CB    . ALA G 3 104 ? 105.18300 87.03600  109.15500 1.000 35.57468  ? 103 ALA G CB    1 
ATOM 4976  N N     . GLN G 3 105 ? 104.27400 85.71600  106.29600 1.000 38.86497  ? 104 GLN G N     1 
ATOM 4977  C CA    . GLN G 3 105 ? 103.66800 84.60200  105.55700 1.000 38.86497  ? 104 GLN G CA    1 
ATOM 4978  C C     . GLN G 3 105 ? 102.33600 85.04800  104.94100 1.000 38.86497  ? 104 GLN G C     1 
ATOM 4979  O O     . GLN G 3 105 ? 101.32700 84.34300  104.96000 1.000 38.86497  ? 104 GLN G O     1 
ATOM 4980  C CB    . GLN G 3 105 ? 103.54000 83.35400  106.44800 1.000 38.86497  ? 104 GLN G CB    1 
ATOM 4981  C CG    . GLN G 3 105 ? 103.25600 82.00100  105.75500 1.000 38.86497  ? 104 GLN G CG    1 
ATOM 4982  C CD    . GLN G 3 105 ? 104.44500 81.43300  104.99200 1.000 38.86497  ? 104 GLN G CD    1 
ATOM 4983  O OE1   . GLN G 3 105 ? 105.55500 81.96200  105.04400 1.000 38.86497  ? 104 GLN G OE1   1 
ATOM 4984  N NE2   . GLN G 3 105 ? 104.20900 80.34200  104.27400 1.000 38.86497  ? 104 GLN G NE2   1 
ATOM 4985  N N     . GLY G 3 106 ? 102.33000 86.26800  104.42100 1.000 39.42537  ? 105 GLY G N     1 
ATOM 4986  C CA    . GLY G 3 106 ? 101.16500 86.81100  103.76600 1.000 39.42537  ? 105 GLY G CA    1 
ATOM 4987  C C     . GLY G 3 106 ? 101.50400 87.19200  102.34600 1.000 39.42537  ? 105 GLY G C     1 
ATOM 4988  O O     . GLY G 3 106 ? 102.46000 87.93000  102.09900 1.000 39.42537  ? 105 GLY G O     1 
ATOM 4989  N N     . GLY G 3 107 ? 100.72800 86.68300  101.40500 1.000 41.11563  ? 106 GLY G N     1 
ATOM 4990  C CA    . GLY G 3 107 ? 100.93800 87.00800  100.01400 1.000 41.11563  ? 106 GLY G CA    1 
ATOM 4991  C C     . GLY G 3 107 ? 100.42400 88.39300  99.68300  1.000 41.11563  ? 106 GLY G C     1 
ATOM 4992  O O     . GLY G 3 107 ? 99.46700  88.87900  100.28100 1.000 41.11563  ? 106 GLY G O     1 
ATOM 4993  N N     . VAL G 3 108 ? 101.11400 89.05100  98.74900  1.000 40.23407  ? 107 VAL G N     1 
ATOM 4994  C CA    . VAL G 3 108 ? 100.68100 90.35900  98.27500  1.000 40.23407  ? 107 VAL G CA    1 
ATOM 4995  C C     . VAL G 3 108 ? 99.31400  90.23500  97.60700  1.000 40.23407  ? 107 VAL G C     1 
ATOM 4996  O O     . VAL G 3 108 ? 98.96800  89.18500  97.04700  1.000 40.23407  ? 107 VAL G O     1 
ATOM 4997  C CB    . VAL G 3 108 ? 101.74500 90.96700  97.34000  1.000 40.23407  ? 107 VAL G CB    1 
ATOM 4998  C CG1   . VAL G 3 108 ? 101.78200 90.27900  95.99000  1.000 40.23407  ? 107 VAL G CG1   1 
ATOM 4999  C CG2   . VAL G 3 108 ? 101.53700 92.46800  97.17200  1.000 40.23407  ? 107 VAL G CG2   1 
ATOM 5000  N N     . LEU G 3 109 ? 98.47300  91.24500  97.83300  1.000 43.01861  ? 108 LEU G N     1 
ATOM 5001  C CA    . LEU G 3 109 ? 97.12400  91.29100  97.27900  1.000 43.01861  ? 108 LEU G CA    1 
ATOM 5002  C C     . LEU G 3 109 ? 97.17400  91.17300  95.75900  1.000 43.01861  ? 108 LEU G C     1 
ATOM 5003  O O     . LEU G 3 109 ? 97.99900  91.84500  95.12300  1.000 43.01861  ? 108 LEU G O     1 
ATOM 5004  C CB    . LEU G 3 109 ? 96.46300  92.60900  97.67400  1.000 43.01861  ? 108 LEU G CB    1 
ATOM 5005  C CG    . LEU G 3 109 ? 95.01200  92.91600  97.32300  1.000 43.01861  ? 108 LEU G CG    1 
ATOM 5006  C CD1   . LEU G 3 109 ? 94.06500  91.93900  97.99100  1.000 43.01861  ? 108 LEU G CD1   1 
ATOM 5007  C CD2   . LEU G 3 109 ? 94.68500  94.34000  97.71300  1.000 43.01861  ? 108 LEU G CD2   1 
ATOM 5008  N N     . PRO G 3 110 ? 96.35100  90.30400  95.14300  1.000 43.87633  ? 109 PRO G N     1 
ATOM 5009  C CA    . PRO G 3 110 ? 96.40500  90.13300  93.68300  1.000 43.87633  ? 109 PRO G CA    1 
ATOM 5010  C C     . PRO G 3 110 ? 96.01400  91.37400  92.89500  1.000 43.87633  ? 109 PRO G C     1 
ATOM 5011  O O     . PRO G 3 110 ? 94.83600  91.72900  92.81500  1.000 43.87633  ? 109 PRO G O     1 
ATOM 5012  C CB    . PRO G 3 110 ? 95.41800  88.98500  93.43000  1.000 43.87633  ? 109 PRO G CB    1 
ATOM 5013  C CG    . PRO G 3 110 ? 95.29500  88.28900  94.72900  1.000 43.87633  ? 109 PRO G CG    1 
ATOM 5014  C CD    . PRO G 3 110 ? 95.43200  89.34300  95.77000  1.000 43.87633  ? 109 PRO G CD    1 
ATOM 5015  N N     . ASN G 3 111 ? 97.01400  92.04500  92.31400  1.000 47.61543  ? 110 ASN G N     1 
ATOM 5016  C CA    . ASN G 3 111 ? 96.78900  93.17200  91.41200  1.000 47.61543  ? 110 ASN G CA    1 
ATOM 5017  C C     . ASN G 3 111 ? 97.73800  93.05100  90.21100  1.000 47.61543  ? 110 ASN G C     1 
ATOM 5018  O O     . ASN G 3 111 ? 98.81200  93.64700  90.13800  1.000 47.61543  ? 110 ASN G O     1 
ATOM 5019  C CB    . ASN G 3 111 ? 96.90800  94.51100  92.15800  1.000 47.61543  ? 110 ASN G CB    1 
ATOM 5020  C CG    . ASN G 3 111 ? 98.12200  94.59200  93.08500  1.000 47.61543  ? 110 ASN G CG    1 
ATOM 5021  O OD1   . ASN G 3 111 ? 99.26500  94.71800  92.65400  1.000 47.61543  ? 110 ASN G OD1   1 
ATOM 5022  N ND2   . ASN G 3 111 ? 97.85800  94.53000  94.38300  1.000 47.61543  ? 110 ASN G ND2   1 
ATOM 5023  N N     . ILE G 3 112 ? 97.31000  92.27700  89.21700  1.000 49.39287  ? 111 ILE G N     1 
ATOM 5024  C CA    . ILE G 3 112 ? 97.94600  92.28400  87.90600  1.000 49.39287  ? 111 ILE G CA    1 
ATOM 5025  C C     . ILE G 3 112 ? 97.21100  93.33200  87.07300  1.000 49.39287  ? 111 ILE G C     1 
ATOM 5026  O O     . ILE G 3 112 ? 96.09500  93.11600  86.59400  1.000 49.39287  ? 111 ILE G O     1 
ATOM 5027  C CB    . ILE G 3 112 ? 97.96600  90.88700  87.27100  1.000 49.39287  ? 111 ILE G CB    1 
ATOM 5028  C CG1   . ILE G 3 112 ? 98.48000  90.92800  85.82700  1.000 49.39287  ? 111 ILE G CG1   1 
ATOM 5029  C CG2   . ILE G 3 112 ? 96.65400  90.10200  87.49300  1.000 49.39287  ? 111 ILE G CG2   1 
ATOM 5030  C CD1   . ILE G 3 112 ? 99.93100  91.31300  85.70700  1.000 49.39287  ? 111 ILE G CD1   1 
ATOM 5031  N N     . GLN G 3 113 ? 97.83400  94.50000  86.94300  1.000 49.74430  ? 112 GLN G N     1 
ATOM 5032  C CA    . GLN G 3 113 ? 97.18200  95.66000  86.35400  1.000 49.74430  ? 112 GLN G CA    1 
ATOM 5033  C C     . GLN G 3 113 ? 96.99300  95.49200  84.85300  1.000 49.74430  ? 112 GLN G C     1 
ATOM 5034  O O     . GLN G 3 113 ? 97.79200  94.84900  84.16800  1.000 49.74430  ? 112 GLN G O     1 
ATOM 5035  C CB    . GLN G 3 113 ? 97.97600  96.92100  86.68400  1.000 49.74430  ? 112 GLN G CB    1 
ATOM 5036  C CG    . GLN G 3 113 ? 99.47400  96.76500  86.57600  1.000 49.74430  ? 112 GLN G CG    1 
ATOM 5037  C CD    . GLN G 3 113 ? 100.19900 97.78800  87.42400  1.000 49.74430  ? 112 GLN G CD    1 
ATOM 5038  O OE1   . GLN G 3 113 ? 99.57700  98.50600  88.20800  1.000 49.74430  ? 112 GLN G OE1   1 
ATOM 5039  N NE2   . GLN G 3 113 ? 101.51700 97.83500  87.30400  1.000 49.74430  ? 112 GLN G NE2   1 
ATOM 5040  N N     . ALA G 3 114 ? 95.90900  96.08200  84.34700  1.000 51.06838  ? 113 ALA G N     1 
ATOM 5041  C CA    . ALA G 3 114 ? 95.39100  95.78300  83.02000  1.000 51.06838  ? 113 ALA G CA    1 
ATOM 5042  C C     . ALA G 3 114 ? 96.02100  96.62100  81.91500  1.000 51.06838  ? 113 ALA G C     1 
ATOM 5043  O O     . ALA G 3 114 ? 95.40500  96.78800  80.85700  1.000 51.06838  ? 113 ALA G O     1 
ATOM 5044  C CB    . ALA G 3 114 ? 93.87100  95.96200  83.00400  1.000 51.06838  ? 113 ALA G CB    1 
ATOM 5045  N N     . VAL G 3 115 ? 97.21900  97.15000  82.12700  1.000 49.94458  ? 114 VAL G N     1 
ATOM 5046  C CA    . VAL G 3 115 ? 97.95000  97.79200  81.04500  1.000 49.94458  ? 114 VAL G CA    1 
ATOM 5047  C C     . VAL G 3 115 ? 98.44600  96.72300  80.07800  1.000 49.94458  ? 114 VAL G C     1 
ATOM 5048  O O     . VAL G 3 115 ? 98.62900  95.56600  80.46000  1.000 49.94458  ? 114 VAL G O     1 
ATOM 5049  C CB    . VAL G 3 115 ? 99.10900  98.64800  81.57200  1.000 49.94458  ? 114 VAL G CB    1 
ATOM 5050  C CG1   . VAL G 3 115 ? 99.80200  99.36000  80.42000  1.000 49.94458  ? 114 VAL G CG1   1 
ATOM 5051  C CG2   . VAL G 3 115 ? 98.59900  99.64800  82.59400  1.000 49.94458  ? 114 VAL G CG2   1 
ATOM 5052  N N     . GLU H 4 36  ? 102.49000 86.10900  128.98600 1.000 50.79242  ? 35  GLU H N     1 
ATOM 5053  C CA    . GLU H 4 36  ? 101.16900 86.70500  128.83700 1.000 50.79242  ? 35  GLU H CA    1 
ATOM 5054  C C     . GLU H 4 36  ? 100.94400 87.27500  127.45000 1.000 50.79242  ? 35  GLU H C     1 
ATOM 5055  O O     . GLU H 4 36  ? 101.72800 88.08600  126.96500 1.000 50.79242  ? 35  GLU H O     1 
ATOM 5056  C CB    . GLU H 4 36  ? 100.94800 87.79500  129.88000 1.000 50.79242  ? 35  GLU H CB    1 
ATOM 5057  C CG    . GLU H 4 36  ? 101.09600 87.31100  131.30500 1.000 50.79242  ? 35  GLU H CG    1 
ATOM 5058  C CD    . GLU H 4 36  ? 100.59500 88.32000  132.30900 1.000 50.79242  ? 35  GLU H CD    1 
ATOM 5059  O OE1   . GLU H 4 36  ? 99.84000  87.91900  133.21900 1.000 50.79242  ? 35  GLU H OE1   1 
ATOM 5060  O OE2   . GLU H 4 36  ? 100.95400 89.51000  132.19100 1.000 50.79242  ? 35  GLU H OE2   1 
ATOM 5061  N N     . SER H 4 37  ? 99.85000  86.85300  126.82400 1.000 46.65968  ? 36  SER H N     1 
ATOM 5062  C CA    . SER H 4 37  ? 99.51700  87.24800  125.46600 1.000 46.65968  ? 36  SER H CA    1 
ATOM 5063  C C     . SER H 4 37  ? 98.02700  87.54500  125.39000 1.000 46.65968  ? 36  SER H C     1 
ATOM 5064  O O     . SER H 4 37  ? 97.28900  87.38900  126.36600 1.000 46.65968  ? 36  SER H O     1 
ATOM 5065  C CB    . SER H 4 37  ? 99.91000  86.15800  124.46600 1.000 46.65968  ? 36  SER H CB    1 
ATOM 5066  O OG    . SER H 4 37  ? 99.36400  84.90700  124.84900 1.000 46.65968  ? 36  SER H OG    1 
ATOM 5067  N N     . TYR H 4 38  ? 97.58200  87.98000  124.21200 1.000 39.15225  ? 37  TYR H N     1 
ATOM 5068  C CA    . TYR H 4 38  ? 96.18400  88.30700  123.97100 1.000 39.15225  ? 37  TYR H CA    1 
ATOM 5069  C C     . TYR H 4 38  ? 95.44900  87.18100  123.26300 1.000 39.15225  ? 37  TYR H C     1 
ATOM 5070  O O     . TYR H 4 38  ? 94.52300  87.44000  122.49200 1.000 39.15225  ? 37  TYR H O     1 
ATOM 5071  C CB    . TYR H 4 38  ? 96.06800  89.58900  123.15300 1.000 39.15225  ? 37  TYR H CB    1 
ATOM 5072  C CG    . TYR H 4 38  ? 96.46400  90.83400  123.89800 1.000 39.15225  ? 37  TYR H CG    1 
ATOM 5073  C CD1   . TYR H 4 38  ? 95.58000  91.46100  124.76100 1.000 39.15225  ? 37  TYR H CD1   1 
ATOM 5074  C CD2   . TYR H 4 38  ? 97.72000  91.39300  123.72300 1.000 39.15225  ? 37  TYR H CD2   1 
ATOM 5075  C CE1   . TYR H 4 38  ? 95.94200  92.60200  125.44100 1.000 39.15225  ? 37  TYR H CE1   1 
ATOM 5076  C CE2   . TYR H 4 38  ? 98.08900  92.53300  124.39400 1.000 39.15225  ? 37  TYR H CE2   1 
ATOM 5077  C CZ    . TYR H 4 38  ? 97.19700  93.13100  125.25000 1.000 39.15225  ? 37  TYR H CZ    1 
ATOM 5078  O OH    . TYR H 4 38  ? 97.56400  94.27100  125.91700 1.000 39.15225  ? 37  TYR H OH    1 
ATOM 5079  N N     . SER H 4 39  ? 95.85200  85.93200  123.49900 1.000 40.03009  ? 38  SER H N     1 
ATOM 5080  C CA    . SER H 4 39  ? 95.28700  84.82000  122.74300 1.000 40.03009  ? 38  SER H CA    1 
ATOM 5081  C C     . SER H 4 39  ? 93.86900  84.50600  123.19400 1.000 40.03009  ? 38  SER H C     1 
ATOM 5082  O O     . SER H 4 39  ? 93.02400  84.12900  122.37600 1.000 40.03009  ? 38  SER H O     1 
ATOM 5083  C CB    . SER H 4 39  ? 96.18000  83.59100  122.88000 1.000 40.03009  ? 38  SER H CB    1 
ATOM 5084  O OG    . SER H 4 39  ? 97.53200  83.91900  122.61900 1.000 40.03009  ? 38  SER H OG    1 
ATOM 5085  N N     . VAL H 4 40  ? 93.60500  84.62600  124.49600 1.000 41.83515  ? 39  VAL H N     1 
ATOM 5086  C CA    . VAL H 4 40  ? 92.29300  84.30400  125.05300 1.000 41.83515  ? 39  VAL H CA    1 
ATOM 5087  C C     . VAL H 4 40  ? 91.23600  85.27900  124.54500 1.000 41.83515  ? 39  VAL H C     1 
ATOM 5088  O O     . VAL H 4 40  ? 90.12700  84.88100  124.16800 1.000 41.83515  ? 39  VAL H O     1 
ATOM 5089  C CB    . VAL H 4 40  ? 92.37900  84.29800  126.58900 1.000 41.83515  ? 39  VAL H CB    1 
ATOM 5090  C CG1   . VAL H 4 40  ? 91.02100  84.09200  127.21400 1.000 41.83515  ? 39  VAL H CG1   1 
ATOM 5091  C CG2   . VAL H 4 40  ? 93.33200  83.22200  127.04800 1.000 41.83515  ? 39  VAL H CG2   1 
ATOM 5092  N N     . TYR H 4 41  ? 91.58600  86.56000  124.46800 1.000 40.45152  ? 40  TYR H N     1 
ATOM 5093  C CA    . TYR H 4 41  ? 90.61900  87.59500  124.12700 1.000 40.45152  ? 40  TYR H CA    1 
ATOM 5094  C C     . TYR H 4 41  ? 90.37000  87.68300  122.63400 1.000 40.45152  ? 40  TYR H C     1 
ATOM 5095  O O     . TYR H 4 41  ? 89.24000  87.96000  122.22100 1.000 40.45152  ? 40  TYR H O     1 
ATOM 5096  C CB    . TYR H 4 41  ? 91.10900  88.93600  124.65200 1.000 40.45152  ? 40  TYR H CB    1 
ATOM 5097  C CG    . TYR H 4 41  ? 91.82500  88.78500  125.95500 1.000 40.45152  ? 40  TYR H CG    1 
ATOM 5098  C CD1   . TYR H 4 41  ? 91.13300  88.46100  127.10600 1.000 40.45152  ? 40  TYR H CD1   1 
ATOM 5099  C CD2   . TYR H 4 41  ? 93.19800  88.94200  126.03400 1.000 40.45152  ? 40  TYR H CD2   1 
ATOM 5100  C CE1   . TYR H 4 41  ? 91.78300  88.31100  128.29500 1.000 40.45152  ? 40  TYR H CE1   1 
ATOM 5101  C CE2   . TYR H 4 41  ? 93.85800  88.79100  127.22700 1.000 40.45152  ? 40  TYR H CE2   1 
ATOM 5102  C CZ    . TYR H 4 41  ? 93.14500  88.47100  128.35100 1.000 40.45152  ? 40  TYR H CZ    1 
ATOM 5103  O OH    . TYR H 4 41  ? 93.79600  88.32500  129.54500 1.000 40.45152  ? 40  TYR H OH    1 
ATOM 5104  N N     . VAL H 4 42  ? 91.39800  87.44700  121.81900 1.000 39.57477  ? 41  VAL H N     1 
ATOM 5105  C CA    . VAL H 4 42  ? 91.20900  87.37800  120.37600 1.000 39.57477  ? 41  VAL H CA    1 
ATOM 5106  C C     . VAL H 4 42  ? 90.33400  86.18400  120.02000 1.000 39.57477  ? 41  VAL H C     1 
ATOM 5107  O O     . VAL H 4 42  ? 89.44800  86.28100  119.16500 1.000 39.57477  ? 41  VAL H O     1 
ATOM 5108  C CB    . VAL H 4 42  ? 92.57900  87.34000  119.67300 1.000 39.57477  ? 41  VAL H CB    1 
ATOM 5109  C CG1   . VAL H 4 42  ? 92.46000  86.87900  118.23300 1.000 39.57477  ? 41  VAL H CG1   1 
ATOM 5110  C CG2   . VAL H 4 42  ? 93.22800  88.70600  119.72900 1.000 39.57477  ? 41  VAL H CG2   1 
ATOM 5111  N N     . TYR H 4 43  ? 90.50200  85.07200  120.73500 1.000 44.73895  ? 42  TYR H N     1 
ATOM 5112  C CA    . TYR H 4 43  ? 89.66100  83.90500  120.49600 1.000 44.73895  ? 42  TYR H CA    1 
ATOM 5113  C C     . TYR H 4 43  ? 88.23300  84.12800  120.97800 1.000 44.73895  ? 42  TYR H C     1 
ATOM 5114  O O     . TYR H 4 43  ? 87.28400  83.67100  120.33500 1.000 44.73895  ? 42  TYR H O     1 
ATOM 5115  C CB    . TYR H 4 43  ? 90.26300  82.68100  121.17400 1.000 44.73895  ? 42  TYR H CB    1 
ATOM 5116  C CG    . TYR H 4 43  ? 89.90900  81.41200  120.46500 1.000 44.73895  ? 42  TYR H CG    1 
ATOM 5117  C CD1   . TYR H 4 43  ? 90.65700  80.96700  119.38900 1.000 44.73895  ? 42  TYR H CD1   1 
ATOM 5118  C CD2   . TYR H 4 43  ? 88.81600  80.66500  120.86100 1.000 44.73895  ? 42  TYR H CD2   1 
ATOM 5119  C CE1   . TYR H 4 43  ? 90.32800  79.80900  118.72800 1.000 44.73895  ? 42  TYR H CE1   1 
ATOM 5120  C CE2   . TYR H 4 43  ? 88.48000  79.50400  120.21200 1.000 44.73895  ? 42  TYR H CE2   1 
ATOM 5121  C CZ    . TYR H 4 43  ? 89.23600  79.08200  119.14300 1.000 44.73895  ? 42  TYR H CZ    1 
ATOM 5122  O OH    . TYR H 4 43  ? 88.89500  77.92200  118.49200 1.000 44.73895  ? 42  TYR H OH    1 
ATOM 5123  N N     . LYS H 4 44  ? 88.06000  84.85000  122.09000 1.000 40.86850  ? 43  LYS H N     1 
ATOM 5124  C CA    . LYS H 4 44  ? 86.72000  85.16600  122.58100 1.000 40.86850  ? 43  LYS H CA    1 
ATOM 5125  C C     . LYS H 4 44  ? 85.98400  86.09700  121.62500 1.000 40.86850  ? 43  LYS H C     1 
ATOM 5126  O O     . LYS H 4 44  ? 84.80400  85.88400  121.31800 1.000 40.86850  ? 43  LYS H O     1 
ATOM 5127  C CB    . LYS H 4 44  ? 86.81400  85.80300  123.96500 1.000 40.86850  ? 43  LYS H CB    1 
ATOM 5128  C CG    . LYS H 4 44  ? 86.90700  84.82500  125.11700 1.000 40.86850  ? 43  LYS H CG    1 
ATOM 5129  C CD    . LYS H 4 44  ? 87.09300  85.55600  126.43400 1.000 40.86850  ? 43  LYS H CD    1 
ATOM 5130  C CE    . LYS H 4 44  ? 86.90000  84.62100  127.60700 1.000 40.86850  ? 43  LYS H CE    1 
ATOM 5131  N NZ    . LYS H 4 44  ? 87.64000  83.34700  127.41400 1.000 40.86850  ? 43  LYS H NZ    1 
ATOM 5132  N N     . VAL H 4 45  ? 86.68400  87.12100  121.13500 1.000 39.72864  ? 44  VAL H N     1 
ATOM 5133  C CA    . VAL H 4 45  ? 86.12900  88.05500  120.16300 1.000 39.72864  ? 44  VAL H CA    1 
ATOM 5134  C C     . VAL H 4 45  ? 85.80800  87.34500  118.85200 1.000 39.72864  ? 44  VAL H C     1 
ATOM 5135  O O     . VAL H 4 45  ? 84.76200  87.59100  118.23500 1.000 39.72864  ? 44  VAL H O     1 
ATOM 5136  C CB    . VAL H 4 45  ? 87.12300  89.21600  119.97600 1.000 39.72864  ? 44  VAL H CB    1 
ATOM 5137  C CG1   . VAL H 4 45  ? 86.92600  89.92700  118.68000 1.000 39.72864  ? 44  VAL H CG1   1 
ATOM 5138  C CG2   . VAL H 4 45  ? 87.00200  90.18700  121.12300 1.000 39.72864  ? 44  VAL H CG2   1 
ATOM 5139  N N     . LEU H 4 46  ? 86.68300  86.42600  118.42900 1.000 40.28810  ? 45  LEU H N     1 
ATOM 5140  C CA    . LEU H 4 46  ? 86.46200  85.66000  117.20700 1.000 40.28810  ? 45  LEU H CA    1 
ATOM 5141  C C     . LEU H 4 46  ? 85.24600  84.75400  117.31800 1.000 40.28810  ? 45  LEU H C     1 
ATOM 5142  O O     . LEU H 4 46  ? 84.44600  84.66600  116.38200 1.000 40.28810  ? 45  LEU H O     1 
ATOM 5143  C CB    . LEU H 4 46  ? 87.70600  84.84100  116.88200 1.000 40.28810  ? 45  LEU H CB    1 
ATOM 5144  C CG    . LEU H 4 46  ? 87.59800  83.85000  115.73500 1.000 40.28810  ? 45  LEU H CG    1 
ATOM 5145  C CD1   . LEU H 4 46  ? 87.91800  84.55500  114.46000 1.000 40.28810  ? 45  LEU H CD1   1 
ATOM 5146  C CD2   . LEU H 4 46  ? 88.55900  82.71400  115.95500 1.000 40.28810  ? 45  LEU H CD2   1 
ATOM 5147  N N     . LYS H 4 47  ? 85.08100  84.07600  118.45400 1.000 43.56433  ? 46  LYS H N     1 
ATOM 5148  C CA    . LYS H 4 47  ? 83.88700  83.26300  118.64100 1.000 43.56433  ? 46  LYS H CA    1 
ATOM 5149  C C     . LYS H 4 47  ? 82.63000  84.09700  118.85700 1.000 43.56433  ? 46  LYS H C     1 
ATOM 5150  O O     . LYS H 4 47  ? 81.52700  83.57400  118.68400 1.000 43.56433  ? 46  LYS H O     1 
ATOM 5151  C CB    . LYS H 4 47  ? 84.09400  82.27500  119.78400 1.000 43.56433  ? 46  LYS H CB    1 
ATOM 5152  C CG    . LYS H 4 47  ? 85.17400  81.25800  119.46400 1.000 43.56433  ? 46  LYS H CG    1 
ATOM 5153  C CD    . LYS H 4 47  ? 84.75300  80.42300  118.26500 1.000 43.56433  ? 46  LYS H CD    1 
ATOM 5154  C CE    . LYS H 4 47  ? 85.75500  79.33900  117.93600 1.000 43.56433  ? 46  LYS H CE    1 
ATOM 5155  N NZ    . LYS H 4 47  ? 85.33900  78.55300  116.74300 1.000 43.56433  ? 46  LYS H NZ    1 
ATOM 5156  N N     . GLN H 4 48  ? 82.75800  85.36600  119.24300 1.000 42.30783  ? 47  GLN H N     1 
ATOM 5157  C CA    . GLN H 4 48  ? 81.57900  86.22900  119.23600 1.000 42.30783  ? 47  GLN H CA    1 
ATOM 5158  C C     . GLN H 4 48  ? 81.19100  86.61900  117.81500 1.000 42.30783  ? 47  GLN H C     1 
ATOM 5159  O O     . GLN H 4 48  ? 80.01500  86.56000  117.44200 1.000 42.30783  ? 47  GLN H O     1 
ATOM 5160  C CB    . GLN H 4 48  ? 81.82000  87.48600  120.06800 1.000 42.30783  ? 47  GLN H CB    1 
ATOM 5161  C CG    . GLN H 4 48  ? 81.75700  87.29600  121.56400 1.000 42.30783  ? 47  GLN H CG    1 
ATOM 5162  C CD    . GLN H 4 48  ? 81.77700  88.61700  122.30400 1.000 42.30783  ? 47  GLN H CD    1 
ATOM 5163  O OE1   . GLN H 4 48  ? 81.50500  88.67100  123.49900 1.000 42.30783  ? 47  GLN H OE1   1 
ATOM 5164  N NE2   . GLN H 4 48  ? 82.07900  89.69300  121.59000 1.000 42.30783  ? 47  GLN H NE2   1 
ATOM 5165  N N     . VAL H 4 49  ? 82.17100  87.03300  117.01300 1.000 41.87928  ? 48  VAL H N     1 
ATOM 5166  C CA    . VAL H 4 49  ? 81.88400  87.58600  115.69000 1.000 41.87928  ? 48  VAL H CA    1 
ATOM 5167  C C     . VAL H 4 49  ? 81.52800  86.48300  114.70000 1.000 41.87928  ? 48  VAL H C     1 
ATOM 5168  O O     . VAL H 4 49  ? 80.44100  86.48000  114.11300 1.000 41.87928  ? 48  VAL H O     1 
ATOM 5169  C CB    . VAL H 4 49  ? 83.06800  88.42700  115.18800 1.000 41.87928  ? 48  VAL H CB    1 
ATOM 5170  C CG1   . VAL H 4 49  ? 82.79200  88.90300  113.79500 1.000 41.87928  ? 48  VAL H CG1   1 
ATOM 5171  C CG2   . VAL H 4 49  ? 83.28000  89.61200  116.09000 1.000 41.87928  ? 48  VAL H CG2   1 
ATOM 5172  N N     . HIS H 4 50  ? 82.44800  85.54500  114.48400 1.000 43.02730  ? 49  HIS H N     1 
ATOM 5173  C CA    . HIS H 4 50  ? 82.22800  84.40500  113.60000 1.000 43.02730  ? 49  HIS H CA    1 
ATOM 5174  C C     . HIS H 4 50  ? 82.19700  83.13300  114.43000 1.000 43.02730  ? 49  HIS H C     1 
ATOM 5175  O O     . HIS H 4 50  ? 83.25900  82.57700  114.74700 1.000 43.02730  ? 49  HIS H O     1 
ATOM 5176  C CB    . HIS H 4 50  ? 83.32900  84.32700  112.54200 1.000 43.02730  ? 49  HIS H CB    1 
ATOM 5177  C CG    . HIS H 4 50  ? 83.19800  85.35200  111.46400 1.000 43.02730  ? 49  HIS H CG    1 
ATOM 5178  N ND1   . HIS H 4 50  ? 82.18700  85.32100  110.52900 1.000 43.02730  ? 49  HIS H ND1   1 
ATOM 5179  C CD2   . HIS H 4 50  ? 83.95000  86.43800  111.17000 1.000 43.02730  ? 49  HIS H CD2   1 
ATOM 5180  C CE1   . HIS H 4 50  ? 82.32000  86.34500  109.70600 1.000 43.02730  ? 49  HIS H CE1   1 
ATOM 5181  N NE2   . HIS H 4 50  ? 83.38200  87.03800  110.07300 1.000 43.02730  ? 49  HIS H NE2   1 
ATOM 5182  N N     . PRO H 4 51  ? 81.01700  82.62100  114.79600 1.000 44.74340  ? 50  PRO H N     1 
ATOM 5183  C CA    . PRO H 4 51  ? 80.95300  81.55300  115.80600 1.000 44.74340  ? 50  PRO H CA    1 
ATOM 5184  C C     . PRO H 4 51  ? 81.41000  80.18900  115.31500 1.000 44.74340  ? 50  PRO H C     1 
ATOM 5185  O O     . PRO H 4 51  ? 81.63200  79.30200  116.14900 1.000 44.74340  ? 50  PRO H O     1 
ATOM 5186  C CB    . PRO H 4 51  ? 79.46600  81.52500  116.18700 1.000 44.74340  ? 50  PRO H CB    1 
ATOM 5187  C CG    . PRO H 4 51  ? 78.90000  82.81600  115.67700 1.000 44.74340  ? 50  PRO H CG    1 
ATOM 5188  C CD    . PRO H 4 51  ? 79.68100  83.12800  114.45200 1.000 44.74340  ? 50  PRO H CD    1 
ATOM 5189  N N     . ASP H 4 52  ? 81.56100  79.98700  114.00800 1.000 45.97076  ? 51  ASP H N     1 
ATOM 5190  C CA    . ASP H 4 52  ? 81.92000  78.68800  113.46200 1.000 45.97076  ? 51  ASP H CA    1 
ATOM 5191  C C     . ASP H 4 52  ? 83.34600  78.61900  112.93800 1.000 45.97076  ? 51  ASP H C     1 
ATOM 5192  O O     . ASP H 4 52  ? 83.82300  77.51900  112.64100 1.000 45.97076  ? 51  ASP H O     1 
ATOM 5193  C CB    . ASP H 4 52  ? 80.95400  78.29600  112.33600 1.000 45.97076  ? 51  ASP H CB    1 
ATOM 5194  C CG    . ASP H 4 52  ? 79.56800  77.95200  112.84600 1.000 45.97076  ? 51  ASP H CG    1 
ATOM 5195  O OD1   . ASP H 4 52  ? 78.88000  77.14200  112.19100 1.000 45.97076  ? 51  ASP H OD1   1 
ATOM 5196  O OD2   . ASP H 4 52  ? 79.16300  78.49600  113.89300 1.000 45.97076  ? 51  ASP H OD2   1 
ATOM 5197  N N     . THR H 4 53  ? 84.03100  79.74800  112.80900 1.000 45.67475  ? 52  THR H N     1 
ATOM 5198  C CA    . THR H 4 53  ? 85.37900  79.79000  112.26600 1.000 45.67475  ? 52  THR H CA    1 
ATOM 5199  C C     . THR H 4 53  ? 86.38900  79.63900  113.41000 1.000 45.67475  ? 52  THR H C     1 
ATOM 5200  O O     . THR H 4 53  ? 86.04400  79.73700  114.58800 1.000 45.67475  ? 52  THR H O     1 
ATOM 5201  C CB    . THR H 4 53  ? 85.56600  81.10900  111.49800 1.000 45.67475  ? 52  THR H CB    1 
ATOM 5202  O OG1   . THR H 4 53  ? 84.35500  81.40500  110.79500 1.000 45.67475  ? 52  THR H OG1   1 
ATOM 5203  C CG2   . THR H 4 53  ? 86.64900  81.00600  110.42700 1.000 45.67475  ? 52  THR H CG2   1 
ATOM 5204  N N     . GLY H 4 54  ? 87.64900  79.37900  113.05400 1.000 46.21236  ? 53  GLY H N     1 
ATOM 5205  C CA    . GLY H 4 54  ? 88.73300  79.32800  114.01100 1.000 46.21236  ? 53  GLY H CA    1 
ATOM 5206  C C     . GLY H 4 54  ? 89.92500  80.11000  113.49100 1.000 46.21236  ? 53  GLY H C     1 
ATOM 5207  O O     . GLY H 4 54  ? 89.90100  80.64100  112.38200 1.000 46.21236  ? 53  GLY H O     1 
ATOM 5208  N N     . ILE H 4 55  ? 90.95600  80.19000  114.32300 1.000 44.48448  ? 54  ILE H N     1 
ATOM 5209  C CA    . ILE H 4 55  ? 92.16800  80.91900  113.97400 1.000 44.48448  ? 54  ILE H CA    1 
ATOM 5210  C C     . ILE H 4 55  ? 93.37400  80.00200  114.15700 1.000 44.48448  ? 54  ILE H C     1 
ATOM 5211  O O     . ILE H 4 55  ? 93.40600  79.17500  115.07400 1.000 44.48448  ? 54  ILE H O     1 
ATOM 5212  C CB    . ILE H 4 55  ? 92.26600  82.22400  114.80600 1.000 44.48448  ? 54  ILE H CB    1 
ATOM 5213  C CG1   . ILE H 4 55  ? 93.44000  83.09900  114.37900 1.000 44.48448  ? 54  ILE H CG1   1 
ATOM 5214  C CG2   . ILE H 4 55  ? 92.27100  81.95100  116.29600 1.000 44.48448  ? 54  ILE H CG2   1 
ATOM 5215  C CD1   . ILE H 4 55  ? 93.39700  84.48100  114.96500 1.000 44.48448  ? 54  ILE H CD1   1 
ATOM 5216  N N     . SER H 4 56  ? 94.35400  80.12700  113.26500 1.000 43.13131  ? 55  SER H N     1 
ATOM 5217  C CA    . SER H 4 56  ? 95.58700  79.36000  113.35800 1.000 43.13131  ? 55  SER H CA    1 
ATOM 5218  C C     . SER H 4 56  ? 96.53100  79.98400  114.38100 1.000 43.13131  ? 55  SER H C     1 
ATOM 5219  O O     . SER H 4 56  ? 96.26400  81.04500  114.94500 1.000 43.13131  ? 55  SER H O     1 
ATOM 5220  C CB    . SER H 4 56  ? 96.25000  79.25600  111.98900 1.000 43.13131  ? 55  SER H CB    1 
ATOM 5221  O OG    . SER H 4 56  ? 96.67200  80.52400  111.53000 1.000 43.13131  ? 55  SER H OG    1 
ATOM 5222  N N     . SER H 4 57  ? 97.65800  79.31100  114.62700 1.000 43.03053  ? 56  SER H N     1 
ATOM 5223  C CA    . SER H 4 57  ? 98.61100  79.80400  115.61700 1.000 43.03053  ? 56  SER H CA    1 
ATOM 5224  C C     . SER H 4 57  ? 99.40200  80.99600  115.10200 1.000 43.03053  ? 56  SER H C     1 
ATOM 5225  O O     . SER H 4 57  ? 99.72300  81.90700  115.87300 1.000 43.03053  ? 56  SER H O     1 
ATOM 5226  C CB    . SER H 4 57  ? 99.56400  78.69400  116.04100 1.000 43.03053  ? 56  SER H CB    1 
ATOM 5227  O OG    . SER H 4 57  ? 100.51900 79.18100  116.96400 1.000 43.03053  ? 56  SER H OG    1 
ATOM 5228  N N     . LYS H 4 58  ? 99.75600  80.99800  113.81300 1.000 39.29038  ? 57  LYS H N     1 
ATOM 5229  C CA    . LYS H 4 58  ? 100.51900 82.11700  113.26900 1.000 39.29038  ? 57  LYS H CA    1 
ATOM 5230  C C     . LYS H 4 58  ? 99.64600  83.35300  113.11500 1.000 39.29038  ? 57  LYS H C     1 
ATOM 5231  O O     . LYS H 4 58  ? 100.09900 84.47600  113.37100 1.000 39.29038  ? 57  LYS H O     1 
ATOM 5232  C CB    . LYS H 4 58  ? 101.13800 81.74100  111.92700 1.000 39.29038  ? 57  LYS H CB    1 
ATOM 5233  C CG    . LYS H 4 58  ? 102.20300 80.67000  111.99700 1.000 39.29038  ? 57  LYS H CG    1 
ATOM 5234  C CD    . LYS H 4 58  ? 102.61600 80.23500  110.60300 1.000 39.29038  ? 57  LYS H CD    1 
ATOM 5235  C CE    . LYS H 4 58  ? 103.73400 79.20900  110.64700 1.000 39.29038  ? 57  LYS H CE    1 
ATOM 5236  N NZ    . LYS H 4 58  ? 104.03800 78.65400  109.29900 1.000 39.29038  ? 57  LYS H NZ    1 
ATOM 5237  N N     . ALA H 4 59  ? 98.38300  83.16200  112.72800 1.000 39.21696  ? 58  ALA H N     1 
ATOM 5238  C CA    . ALA H 4 59  ? 97.43500  84.26700  112.69200 1.000 39.21696  ? 58  ALA H CA    1 
ATOM 5239  C C     . ALA H 4 59  ? 97.12600  84.79200  114.08500 1.000 39.21696  ? 58  ALA H C     1 
ATOM 5240  O O     . ALA H 4 59  ? 96.87100  85.98900  114.24800 1.000 39.21696  ? 58  ALA H O     1 
ATOM 5241  C CB    . ALA H 4 59  ? 96.15400  83.83300  111.99100 1.000 39.21696  ? 58  ALA H CB    1 
ATOM 5242  N N     . MET H 4 60  ? 97.18300  83.93300  115.10300 1.000 39.87525  ? 59  MET H N     1 
ATOM 5243  C CA    . MET H 4 60  ? 97.05700  84.42200  116.47100 1.000 39.87525  ? 59  MET H CA    1 
ATOM 5244  C C     . MET H 4 60  ? 98.26000  85.26100  116.87500 1.000 39.87525  ? 59  MET H C     1 
ATOM 5245  O O     . MET H 4 60  ? 98.10800  86.23500  117.61600 1.000 39.87525  ? 59  MET H O     1 
ATOM 5246  C CB    . MET H 4 60  ? 96.87900  83.25700  117.44000 1.000 39.87525  ? 59  MET H CB    1 
ATOM 5247  C CG    . MET H 4 60  ? 96.49900  83.68400  118.84200 1.000 39.87525  ? 59  MET H CG    1 
ATOM 5248  S SD    . MET H 4 60  ? 94.74100  83.97000  119.04100 1.000 39.87525  ? 59  MET H SD    1 
ATOM 5249  C CE    . MET H 4 60  ? 94.21700  82.31000  119.45100 1.000 39.87525  ? 59  MET H CE    1 
ATOM 5250  N N     . GLY H 4 61  ? 99.45300  84.91100  116.39400 1.000 36.76398  ? 60  GLY H N     1 
ATOM 5251  C CA    . GLY H 4 61  ? 100.61100 85.75700  116.63300 1.000 36.76398  ? 60  GLY H CA    1 
ATOM 5252  C C     . GLY H 4 61  ? 100.50100 87.09500  115.93000 1.000 36.76398  ? 60  GLY H C     1 
ATOM 5253  O O     . GLY H 4 61  ? 100.93600 88.12200  116.46500 1.000 36.76398  ? 60  GLY H O     1 
ATOM 5254  N N     . ILE H 4 62  ? 99.90100  87.10100  114.73200 1.000 35.16272  ? 61  ILE H N     1 
ATOM 5255  C CA    . ILE H 4 62  ? 99.59200  88.35200  114.03900 1.000 35.16272  ? 61  ILE H CA    1 
ATOM 5256  C C     . ILE H 4 62  ? 98.63200  89.19300  114.87000 1.000 35.16272  ? 61  ILE H C     1 
ATOM 5257  O O     . ILE H 4 62  ? 98.80700  90.40700  115.00200 1.000 35.16272  ? 61  ILE H O     1 
ATOM 5258  C CB    . ILE H 4 62  ? 99.01500  88.07300  112.63600 1.000 35.16272  ? 61  ILE H CB    1 
ATOM 5259  C CG1   . ILE H 4 62  ? 99.99800  87.29200  111.76700 1.000 35.16272  ? 61  ILE H CG1   1 
ATOM 5260  C CG2   . ILE H 4 62  ? 98.62900  89.36700  111.93400 1.000 35.16272  ? 61  ILE H CG2   1 
ATOM 5261  C CD1   . ILE H 4 62  ? 101.18500 88.07200  111.31900 1.000 35.16272  ? 61  ILE H CD1   1 
ATOM 5262  N N     . MET H 4 63  ? 97.62300  88.55700  115.47100 1.000 35.74356  ? 62  MET H N     1 
ATOM 5263  C CA    . MET H 4 63  ? 96.64100  89.30800  116.25400 1.000 35.74356  ? 62  MET H CA    1 
ATOM 5264  C C     . MET H 4 63  ? 97.22100  89.83700  117.56200 1.000 35.74356  ? 62  MET H C     1 
ATOM 5265  O O     . MET H 4 63  ? 96.88800  90.95400  117.97900 1.000 35.74356  ? 62  MET H O     1 
ATOM 5266  C CB    . MET H 4 63  ? 95.42300  88.43700  116.54400 1.000 35.74356  ? 62  MET H CB    1 
ATOM 5267  C CG    . MET H 4 63  ? 94.62300  88.06700  115.32500 1.000 35.74356  ? 62  MET H CG    1 
ATOM 5268  S SD    . MET H 4 63  ? 94.23500  89.52100  114.36700 1.000 35.74356  ? 62  MET H SD    1 
ATOM 5269  C CE    . MET H 4 63  ? 93.15800  90.35300  115.51800 1.000 35.74356  ? 62  MET H CE    1 
ATOM 5270  N N     . ASN H 4 64  ? 98.10400  89.07000  118.20800 1.000 36.28005  ? 63  ASN H N     1 
ATOM 5271  C CA    . ASN H 4 64  ? 98.78900  89.56000  119.40300 1.000 36.28005  ? 63  ASN H CA    1 
ATOM 5272  C C     . ASN H 4 64  ? 99.69200  90.73900  119.07500 1.000 36.28005  ? 63  ASN H C     1 
ATOM 5273  O O     . ASN H 4 64  ? 99.69400  91.74900  119.79000 1.000 36.28005  ? 63  ASN H O     1 
ATOM 5274  C CB    . ASN H 4 64  ? 99.60400  88.44600  120.05400 1.000 36.28005  ? 63  ASN H CB    1 
ATOM 5275  C CG    . ASN H 4 64  ? 98.75900  87.27200  120.45700 1.000 36.28005  ? 63  ASN H CG    1 
ATOM 5276  O OD1   . ASN H 4 64  ? 97.53900  87.30300  120.32600 1.000 36.28005  ? 63  ASN H OD1   1 
ATOM 5277  N ND2   . ASN H 4 64  ? 99.40200  86.21800  120.94200 1.000 36.28005  ? 63  ASN H ND2   1 
ATOM 5278  N N     . SER H 4 65  ? 100.46500 90.63000  117.98900 1.000 34.46346  ? 64  SER H N     1 
ATOM 5279  C CA    . SER H 4 65  ? 101.32800 91.73100  117.58400 1.000 34.46346  ? 64  SER H CA    1 
ATOM 5280  C C     . SER H 4 65  ? 100.52500 92.95200  117.14900 1.000 34.46346  ? 64  SER H C     1 
ATOM 5281  O O     . SER H 4 65  ? 100.94400 94.08300  117.40800 1.000 34.46346  ? 64  SER H O     1 
ATOM 5282  C CB    . SER H 4 65  ? 102.26200 91.27400  116.47100 1.000 34.46346  ? 64  SER H CB    1 
ATOM 5283  O OG    . SER H 4 65  ? 103.25000 92.25200  116.21800 1.000 34.46346  ? 64  SER H OG    1 
ATOM 5284  N N     . PHE H 4 66  ? 99.35600  92.74400  116.54100 1.000 32.08688  ? 65  PHE H N     1 
ATOM 5285  C CA    . PHE H 4 66  ? 98.51500  93.85700  116.11000 1.000 32.08688  ? 65  PHE H CA    1 
ATOM 5286  C C     . PHE H 4 66  ? 97.92500  94.59700  117.29900 1.000 32.08688  ? 65  PHE H C     1 
ATOM 5287  O O     . PHE H 4 66  ? 97.92600  95.83500  117.33300 1.000 32.08688  ? 65  PHE H O     1 
ATOM 5288  C CB    . PHE H 4 66  ? 97.40800  93.33900  115.19400 1.000 32.08688  ? 65  PHE H CB    1 
ATOM 5289  C CG    . PHE H 4 66  ? 96.30200  94.31700  114.96200 1.000 32.08688  ? 65  PHE H CG    1 
ATOM 5290  C CD1   . PHE H 4 66  ? 96.49400  95.40900  114.14200 1.000 32.08688  ? 65  PHE H CD1   1 
ATOM 5291  C CD2   . PHE H 4 66  ? 95.05700  94.12700  115.53600 1.000 32.08688  ? 65  PHE H CD2   1 
ATOM 5292  C CE1   . PHE H 4 66  ? 95.47500  96.30600  113.91700 1.000 32.08688  ? 65  PHE H CE1   1 
ATOM 5293  C CE2   . PHE H 4 66  ? 94.03800  95.02400  115.31700 1.000 32.08688  ? 65  PHE H CE2   1 
ATOM 5294  C CZ    . PHE H 4 66  ? 94.24900  96.11400  114.50600 1.000 32.08688  ? 65  PHE H CZ    1 
ATOM 5295  N N     . VAL H 4 67  ? 97.39800  93.84900  118.27400 1.000 31.60086  ? 66  VAL H N     1 
ATOM 5296  C CA    . VAL H 4 67  ? 96.84600  94.45000  119.48400 1.000 31.60086  ? 66  VAL H CA    1 
ATOM 5297  C C     . VAL H 4 67  ? 97.93100  95.18300  120.26300 1.000 31.60086  ? 66  VAL H C     1 
ATOM 5298  O O     . VAL H 4 67  ? 97.71900  96.30800  120.73000 1.000 31.60086  ? 66  VAL H O     1 
ATOM 5299  C CB    . VAL H 4 67  ? 96.14700  93.37000  120.33000 1.000 31.60086  ? 66  VAL H CB    1 
ATOM 5300  C CG1   . VAL H 4 67  ? 95.84900  93.86900  121.72000 1.000 31.60086  ? 66  VAL H CG1   1 
ATOM 5301  C CG2   . VAL H 4 67  ? 94.86200  92.94900  119.65900 1.000 31.60086  ? 66  VAL H CG2   1 
ATOM 5302  N N     . ASN H 4 68  ? 99.13700  94.60600  120.33200 1.000 32.76031  ? 67  ASN H N     1 
ATOM 5303  C CA    . ASN H 4 68  ? 100.22700 95.27800  121.03400 1.000 32.76031  ? 67  ASN H CA    1 
ATOM 5304  C C     . ASN H 4 68  ? 100.69500 96.52900  120.30000 1.000 32.76031  ? 67  ASN H C     1 
ATOM 5305  O O     . ASN H 4 68  ? 100.98400 97.54200  120.93800 1.000 32.76031  ? 67  ASN H O     1 
ATOM 5306  C CB    . ASN H 4 68  ? 101.39900 94.32300  121.24500 1.000 32.76031  ? 67  ASN H CB    1 
ATOM 5307  C CG    . ASN H 4 68  ? 101.19500 93.40400  122.42700 1.000 32.76031  ? 67  ASN H CG    1 
ATOM 5308  O OD1   . ASN H 4 68  ? 101.15400 92.18600  122.28300 1.000 32.76031  ? 67  ASN H OD1   1 
ATOM 5309  N ND2   . ASN H 4 68  ? 101.07100 93.98800  123.61000 1.000 32.76031  ? 67  ASN H ND2   1 
ATOM 5310  N N     . ASP H 4 69  ? 100.71800 96.50900  118.96600 1.000 32.82440  ? 68  ASP H N     1 
ATOM 5311  C CA    . ASP H 4 69  ? 101.20400 97.67200  118.22900 1.000 32.82440  ? 68  ASP H CA    1 
ATOM 5312  C C     . ASP H 4 69  ? 100.20300 98.81900  118.26700 1.000 32.82440  ? 68  ASP H C     1 
ATOM 5313  O O     . ASP H 4 69  ? 100.59400 99.98400  118.42400 1.000 32.82440  ? 68  ASP H O     1 
ATOM 5314  C CB    . ASP H 4 69  ? 101.52700 97.27600  116.79100 1.000 32.82440  ? 68  ASP H CB    1 
ATOM 5315  C CG    . ASP H 4 69  ? 101.80300 98.46800  115.90600 1.000 32.82440  ? 68  ASP H CG    1 
ATOM 5316  O OD1   . ASP H 4 69  ? 101.02500 98.69700  114.95900 1.000 32.82440  ? 68  ASP H OD1   1 
ATOM 5317  O OD2   . ASP H 4 69  ? 102.79100 99.18500  116.16400 1.000 32.82440  ? 68  ASP H OD2   1 
ATOM 5318  N N     . ILE H 4 70  ? 98.90800  98.51000  118.16900 1.000 30.81381  ? 69  ILE H N     1 
ATOM 5319  C CA    . ILE H 4 70  ? 97.88900  99.54600  118.30100 1.000 30.81381  ? 69  ILE H CA    1 
ATOM 5320  C C     . ILE H 4 70  ? 97.84000  100.06700 119.73700 1.000 30.81381  ? 69  ILE H C     1 
ATOM 5321  O O     . ILE H 4 70  ? 97.62100  101.26800 119.96100 1.000 30.81381  ? 69  ILE H O     1 
ATOM 5322  C CB    . ILE H 4 70  ? 96.53300  99.00000  117.81400 1.000 30.81381  ? 69  ILE H CB    1 
ATOM 5323  C CG1   . ILE H 4 70  ? 96.60200  98.70700  116.32000 1.000 30.81381  ? 69  ILE H CG1   1 
ATOM 5324  C CG2   . ILE H 4 70  ? 95.42700  99.99500  118.00600 1.000 30.81381  ? 69  ILE H CG2   1 
ATOM 5325  C CD1   . ILE H 4 70  ? 96.98300  99.89400  115.47400 1.000 30.81381  ? 69  ILE H CD1   1 
ATOM 5326  N N     . PHE H 4 71  ? 98.10900  99.19800  120.72200 1.000 31.96860  ? 70  PHE H N     1 
ATOM 5327  C CA    . PHE H 4 71  ? 98.21500  99.63300  122.11100 1.000 31.96860  ? 70  PHE H CA    1 
ATOM 5328  C C     . PHE H 4 71  ? 99.35600  100.62000 122.31200 1.000 31.96860  ? 70  PHE H C     1 
ATOM 5329  O O     . PHE H 4 71  ? 99.16900  101.66700 122.94100 1.000 31.96860  ? 70  PHE H O     1 
ATOM 5330  C CB    . PHE H 4 71  ? 98.41000  98.41500  123.01800 1.000 31.96860  ? 70  PHE H CB    1 
ATOM 5331  C CG    . PHE H 4 71  ? 98.89800  98.75600  124.39900 1.000 31.96860  ? 70  PHE H CG    1 
ATOM 5332  C CD1   . PHE H 4 71  ? 98.05400  99.32800  125.32400 1.000 31.96860  ? 70  PHE H CD1   1 
ATOM 5333  C CD2   . PHE H 4 71  ? 100.21200 98.51400  124.76400 1.000 31.96860  ? 70  PHE H CD2   1 
ATOM 5334  C CE1   . PHE H 4 71  ? 98.49900  99.66300  126.57600 1.000 31.96860  ? 70  PHE H CE1   1 
ATOM 5335  C CE2   . PHE H 4 71  ? 100.66400 98.84600  126.01900 1.000 31.96860  ? 70  PHE H CE2   1 
ATOM 5336  C CZ    . PHE H 4 71  ? 99.80400  99.42400  126.92100 1.000 31.96860  ? 70  PHE H CZ    1 
ATOM 5337  N N     . GLU H 4 72  ? 100.54000 100.31800 121.76300 1.000 31.55987  ? 71  GLU H N     1 
ATOM 5338  C CA    . GLU H 4 72  ? 101.66700 101.23800 121.91000 1.000 31.55987  ? 71  GLU H CA    1 
ATOM 5339  C C     . GLU H 4 72  ? 101.43600 102.54400 121.16700 1.000 31.55987  ? 71  GLU H C     1 
ATOM 5340  O O     . GLU H 4 72  ? 101.80700 103.60700 121.67400 1.000 31.55987  ? 71  GLU H O     1 
ATOM 5341  C CB    . GLU H 4 72  ? 102.98800 100.61100 121.45900 1.000 31.55987  ? 71  GLU H CB    1 
ATOM 5342  C CG    . GLU H 4 72  ? 103.35100 99.28800  122.09900 1.000 31.55987  ? 71  GLU H CG    1 
ATOM 5343  C CD    . GLU H 4 72  ? 103.97500 99.43900  123.46600 1.000 31.55987  ? 71  GLU H CD    1 
ATOM 5344  O OE1   . GLU H 4 72  ? 104.11700 98.41500  124.16900 1.000 31.55987  ? 71  GLU H OE1   1 
ATOM 5345  O OE2   . GLU H 4 72  ? 104.32400 100.57600 123.84200 1.000 31.55987  ? 71  GLU H OE2   1 
ATOM 5346  N N     . ARG H 4 73  ? 100.77400 102.49900 120.00500 1.000 29.85896  ? 72  ARG H N     1 
ATOM 5347  C CA    . ARG H 4 73  ? 100.51800 103.73600 119.26900 1.000 29.85896  ? 72  ARG H CA    1 
ATOM 5348  C C     . ARG H 4 73  ? 99.53000  104.63900 120.00200 1.000 29.85896  ? 72  ARG H C     1 
ATOM 5349  O O     . ARG H 4 73  ? 99.79900  105.83300 120.19000 1.000 29.85896  ? 72  ARG H O     1 
ATOM 5350  C CB    . ARG H 4 73  ? 100.00900 103.42400 117.86400 1.000 29.85896  ? 72  ARG H CB    1 
ATOM 5351  C CG    . ARG H 4 73  ? 101.11000 103.03400 116.91100 1.000 29.85896  ? 72  ARG H CG    1 
ATOM 5352  C CD    . ARG H 4 73  ? 100.61600 102.18600 115.76000 1.000 29.85896  ? 72  ARG H CD    1 
ATOM 5353  N NE    . ARG H 4 73  ? 99.87100  102.96100 114.77900 1.000 29.85896  ? 72  ARG H NE    1 
ATOM 5354  C CZ    . ARG H 4 73  ? 99.50200  102.49300 113.59300 1.000 29.85896  ? 72  ARG H CZ    1 
ATOM 5355  N NH1   . ARG H 4 73  ? 99.80800  101.25200 113.24600 1.000 29.85896  ? 72  ARG H NH1   1 
ATOM 5356  N NH2   . ARG H 4 73  ? 98.83100  103.26600 112.75200 1.000 29.85896  ? 72  ARG H NH2   1 
ATOM 5357  N N     . ILE H 4 74  ? 98.40800  104.07900 120.46800 1.000 28.81676  ? 73  ILE H N     1 
ATOM 5358  C CA    . ILE H 4 74  ? 97.39300  104.89300 121.13700 1.000 28.81676  ? 73  ILE H CA    1 
ATOM 5359  C C     . ILE H 4 74  ? 97.90500  105.38700 122.48400 1.000 28.81676  ? 73  ILE H C     1 
ATOM 5360  O O     . ILE H 4 74  ? 97.69400  106.55000 122.85400 1.000 28.81676  ? 73  ILE H O     1 
ATOM 5361  C CB    . ILE H 4 74  ? 96.06900  104.12000 121.26300 1.000 28.81676  ? 73  ILE H CB    1 
ATOM 5362  C CG1   . ILE H 4 74  ? 95.46500  103.84700 119.89100 1.000 28.81676  ? 73  ILE H CG1   1 
ATOM 5363  C CG2   . ILE H 4 74  ? 95.04600  104.91400 122.04900 1.000 28.81676  ? 73  ILE H CG2   1 
ATOM 5364  C CD1   . ILE H 4 74  ? 94.23000  102.98100 119.94900 1.000 28.81676  ? 73  ILE H CD1   1 
ATOM 5365  N N     . ALA H 4 75  ? 98.62600  104.53500 123.21900 1.000 30.55616  ? 74  ALA H N     1 
ATOM 5366  C CA    . ALA H 4 75  ? 99.12900  104.93500 124.52500 1.000 30.55616  ? 74  ALA H CA    1 
ATOM 5367  C C     . ALA H 4 75  ? 100.24200 105.96700 124.40800 1.000 30.55616  ? 74  ALA H C     1 
ATOM 5368  O O     . ALA H 4 75  ? 100.30800 106.89000 125.22200 1.000 30.55616  ? 74  ALA H O     1 
ATOM 5369  C CB    . ALA H 4 75  ? 99.60700  103.71100 125.29300 1.000 30.55616  ? 74  ALA H CB    1 
ATOM 5370  N N     . GLY H 4 76  ? 101.10800 105.86000 123.39300 1.000 31.16538  ? 75  GLY H N     1 
ATOM 5371  C CA    . GLY H 4 76  ? 102.12600 106.87900 123.21200 1.000 31.16538  ? 75  GLY H CA    1 
ATOM 5372  C C     . GLY H 4 76  ? 101.55900 108.19500 122.72200 1.000 31.16538  ? 75  GLY H C     1 
ATOM 5373  O O     . GLY H 4 76  ? 102.05700 109.26600 123.09300 1.000 31.16538  ? 75  GLY H O     1 
ATOM 5374  N N     . GLU H 4 77  ? 100.46700 108.14500 121.95200 1.000 31.66979  ? 76  GLU H N     1 
ATOM 5375  C CA    . GLU H 4 77  ? 99.84600  109.38600 121.51000 1.000 31.66979  ? 76  GLU H CA    1 
ATOM 5376  C C     . GLU H 4 77  ? 99.12600  110.07100 122.66200 1.000 31.66979  ? 76  GLU H C     1 
ATOM 5377  O O     . GLU H 4 77  ? 99.18200  111.29700 122.79300 1.000 31.66979  ? 76  GLU H O     1 
ATOM 5378  C CB    . GLU H 4 77  ? 98.88400  109.11700 120.35800 1.000 31.66979  ? 76  GLU H CB    1 
ATOM 5379  C CG    . GLU H 4 77  ? 98.33100  110.37400 119.73600 1.000 31.66979  ? 76  GLU H CG    1 
ATOM 5380  C CD    . GLU H 4 77  ? 99.42300  111.27100 119.19800 1.000 31.66979  ? 76  GLU H CD    1 
ATOM 5381  O OE1   . GLU H 4 77  ? 100.31200 110.76100 118.48800 1.000 31.66979  ? 76  GLU H OE1   1 
ATOM 5382  O OE2   . GLU H 4 77  ? 99.40400  112.48400 119.49200 1.000 31.66979  ? 76  GLU H OE2   1 
ATOM 5383  N N     . ALA H 4 78  ? 98.47300  109.29400 123.53000 1.000 31.53106  ? 77  ALA H N     1 
ATOM 5384  C CA    . ALA H 4 78  ? 97.86800  109.87800 124.72100 1.000 31.53106  ? 77  ALA H CA    1 
ATOM 5385  C C     . ALA H 4 78  ? 98.92500  110.35600 125.70700 1.000 31.53106  ? 77  ALA H C     1 
ATOM 5386  O O     . ALA H 4 78  ? 98.69600  111.33100 126.43200 1.000 31.53106  ? 77  ALA H O     1 
ATOM 5387  C CB    . ALA H 4 78  ? 96.94100  108.86800 125.38900 1.000 31.53106  ? 77  ALA H CB    1 
ATOM 5388  N N     . SER H 4 79  ? 100.09500 109.71200 125.71800 1.000 31.63666  ? 78  SER H N     1 
ATOM 5389  C CA    . SER H 4 79  ? 101.19300 110.14500 126.57300 1.000 31.63666  ? 78  SER H CA    1 
ATOM 5390  C C     . SER H 4 79  ? 101.71700 111.50600 126.14900 1.000 31.63666  ? 78  SER H C     1 
ATOM 5391  O O     . SER H 4 79  ? 101.89900 112.40000 126.98400 1.000 31.63666  ? 78  SER H O     1 
ATOM 5392  C CB    . SER H 4 79  ? 102.31800 109.12000 126.53500 1.000 31.63666  ? 78  SER H CB    1 
ATOM 5393  O OG    . SER H 4 79  ? 103.47100 109.62900 127.17700 1.000 31.63666  ? 78  SER H OG    1 
ATOM 5394  N N     . ARG H 4 80  ? 101.94200 111.69600 124.85000 1.000 32.33718  ? 79  ARG H N     1 
ATOM 5395  C CA    . ARG H 4 80  ? 102.40000 113.00700 124.41400 1.000 32.33718  ? 79  ARG H CA    1 
ATOM 5396  C C     . ARG H 4 80  ? 101.28000 114.04100 124.41300 1.000 32.33718  ? 79  ARG H C     1 
ATOM 5397  O O     . ARG H 4 80  ? 101.56600 115.23000 124.56800 1.000 32.33718  ? 79  ARG H O     1 
ATOM 5398  C CB    . ARG H 4 80  ? 103.06200 112.92500 123.03900 1.000 32.33718  ? 79  ARG H CB    1 
ATOM 5399  C CG    . ARG H 4 80  ? 102.15900 112.51000 121.91100 1.000 32.33718  ? 79  ARG H CG    1 
ATOM 5400  C CD    . ARG H 4 80  ? 102.93300 112.44300 120.60800 1.000 32.33718  ? 79  ARG H CD    1 
ATOM 5401  N NE    . ARG H 4 80  ? 103.98000 111.42900 120.64900 1.000 32.33718  ? 79  ARG H NE    1 
ATOM 5402  C CZ    . ARG H 4 80  ? 103.88500 110.23400 120.07800 1.000 32.33718  ? 79  ARG H CZ    1 
ATOM 5403  N NH1   . ARG H 4 80  ? 102.79000 109.90000 119.41000 1.000 32.33718  ? 79  ARG H NH1   1 
ATOM 5404  N NH2   . ARG H 4 80  ? 104.88900 109.37400 120.16700 1.000 32.33718  ? 79  ARG H NH2   1 
ATOM 5405  N N     . LEU H 4 81  ? 100.01600 113.61600 124.34400 1.000 31.96441  ? 80  LEU H N     1 
ATOM 5406  C CA    . LEU H 4 81  ? 98.90800  114.54600 124.54600 1.000 31.96441  ? 80  LEU H CA    1 
ATOM 5407  C C     . LEU H 4 81  ? 98.85800  115.05600 125.97600 1.000 31.96441  ? 80  LEU H C     1 
ATOM 5408  O O     . LEU H 4 81  ? 98.57300  116.23300 126.21000 1.000 31.96441  ? 80  LEU H O     1 
ATOM 5409  C CB    . LEU H 4 81  ? 97.58900  113.86900 124.20600 1.000 31.96441  ? 80  LEU H CB    1 
ATOM 5410  C CG    . LEU H 4 81  ? 97.09100  113.94700 122.78200 1.000 31.96441  ? 80  LEU H CG    1 
ATOM 5411  C CD1   . LEU H 4 81  ? 96.05400  112.88300 122.60700 1.000 31.96441  ? 80  LEU H CD1   1 
ATOM 5412  C CD2   . LEU H 4 81  ? 96.48700  115.30100 122.56800 1.000 31.96441  ? 80  LEU H CD2   1 
ATOM 5413  N N     . ALA H 4 82  ? 99.11400  114.18100 126.94800 1.000 33.74392  ? 81  ALA H N     1 
ATOM 5414  C CA    . ALA H 4 82  ? 99.16000  114.63300 128.33200 1.000 33.74392  ? 81  ALA H CA    1 
ATOM 5415  C C     . ALA H 4 82  ? 100.41400 115.44600 128.60300 1.000 33.74392  ? 81  ALA H C     1 
ATOM 5416  O O     . ALA H 4 82  ? 100.40600 116.32200 129.47200 1.000 33.74392  ? 81  ALA H O     1 
ATOM 5417  C CB    . ALA H 4 82  ? 99.08400  113.44000 129.28000 1.000 33.74392  ? 81  ALA H CB    1 
ATOM 5418  N N     . HIS H 4 83  ? 101.49800 115.17200 127.87300 1.000 35.67631  ? 82  HIS H N     1 
ATOM 5419  C CA    . HIS H 4 83  ? 102.73000 115.92600 128.06800 1.000 35.67631  ? 82  HIS H CA    1 
ATOM 5420  C C     . HIS H 4 83  ? 102.65600 117.32400 127.46800 1.000 35.67631  ? 82  HIS H C     1 
ATOM 5421  O O     . HIS H 4 83  ? 103.33800 118.23200 127.95500 1.000 35.67631  ? 82  HIS H O     1 
ATOM 5422  C CB    . HIS H 4 83  ? 103.91300 115.16300 127.47800 1.000 35.67631  ? 82  HIS H CB    1 
ATOM 5423  C CG    . HIS H 4 83  ? 105.24400 115.65900 127.94500 1.000 35.67631  ? 82  HIS H CG    1 
ATOM 5424  N ND1   . HIS H 4 83  ? 105.85500 116.77200 127.40800 1.000 35.67631  ? 82  HIS H ND1   1 
ATOM 5425  C CD2   . HIS H 4 83  ? 106.08000 115.20000 128.90600 1.000 35.67631  ? 82  HIS H CD2   1 
ATOM 5426  C CE1   . HIS H 4 83  ? 107.01200 116.97300 128.01300 1.000 35.67631  ? 82  HIS H CE1   1 
ATOM 5427  N NE2   . HIS H 4 83  ? 107.17200 116.03200 128.92600 1.000 35.67631  ? 82  HIS H NE2   1 
ATOM 5428  N N     . TYR H 4 84  ? 101.86500 117.51900 126.40600 1.000 34.26025  ? 83  TYR H N     1 
ATOM 5429  C CA    . TYR H 4 84  ? 101.77100 118.85100 125.80700 1.000 34.26025  ? 83  TYR H CA    1 
ATOM 5430  C C     . TYR H 4 84  ? 101.01300 119.81800 126.70600 1.000 34.26025  ? 83  TYR H C     1 
ATOM 5431  O O     . TYR H 4 84  ? 101.36400 120.99900 126.79000 1.000 34.26025  ? 83  TYR H O     1 
ATOM 5432  C CB    . TYR H 4 84  ? 101.08500 118.79600 124.44300 1.000 34.26025  ? 83  TYR H CB    1 
ATOM 5433  C CG    . TYR H 4 84  ? 101.81000 118.02600 123.37100 1.000 34.26025  ? 83  TYR H CG    1 
ATOM 5434  C CD1   . TYR H 4 84  ? 103.18000 117.81700 123.43300 1.000 34.26025  ? 83  TYR H CD1   1 
ATOM 5435  C CD2   . TYR H 4 84  ? 101.11600 117.50500 122.29000 1.000 34.26025  ? 83  TYR H CD2   1 
ATOM 5436  C CE1   . TYR H 4 84  ? 103.83700 117.10500 122.44600 1.000 34.26025  ? 83  TYR H CE1   1 
ATOM 5437  C CE2   . TYR H 4 84  ? 101.76300 116.79700 121.30000 1.000 34.26025  ? 83  TYR H CE2   1 
ATOM 5438  C CZ    . TYR H 4 84  ? 103.11900 116.59900 121.38400 1.000 34.26025  ? 83  TYR H CZ    1 
ATOM 5439  O OH    . TYR H 4 84  ? 103.75700 115.89600 120.39400 1.000 34.26025  ? 83  TYR H OH    1 
ATOM 5440  N N     . ASN H 4 85  ? 99.96400  119.34300 127.37000 1.000 37.29705  ? 84  ASN H N     1 
ATOM 5441  C CA    . ASN H 4 85  ? 99.09500  120.18700 128.17700 1.000 37.29705  ? 84  ASN H CA    1 
ATOM 5442  C C     . ASN H 4 85  ? 99.55200  120.32000 129.62100 1.000 37.29705  ? 84  ASN H C     1 
ATOM 5443  O O     . ASN H 4 85  ? 98.79600  120.86400 130.43300 1.000 37.29705  ? 84  ASN H O     1 
ATOM 5444  C CB    . ASN H 4 85  ? 97.67200  119.64700 128.13700 1.000 37.29705  ? 84  ASN H CB    1 
ATOM 5445  C CG    . ASN H 4 85  ? 97.19800  119.40600 126.73700 1.000 37.29705  ? 84  ASN H CG    1 
ATOM 5446  O OD1   . ASN H 4 85  ? 96.61900  118.37200 126.44200 1.000 37.29705  ? 84  ASN H OD1   1 
ATOM 5447  N ND2   . ASN H 4 85  ? 97.44900  120.36300 125.85500 1.000 37.29705  ? 84  ASN H ND2   1 
ATOM 5448  N N     . LYS H 4 86  ? 100.75600 119.83100 129.94300 1.000 40.03369  ? 85  LYS H N     1 
ATOM 5449  C CA    . LYS H 4 86  ? 101.32900 119.83200 131.29500 1.000 40.03369  ? 85  LYS H CA    1 
ATOM 5450  C C     . LYS H 4 86  ? 100.43000 119.10300 132.29200 1.000 40.03369  ? 85  LYS H C     1 
ATOM 5451  O O     . LYS H 4 86  ? 100.20700 119.56800 133.41100 1.000 40.03369  ? 85  LYS H O     1 
ATOM 5452  C CB    . LYS H 4 86  ? 101.64200 121.25100 131.77800 1.000 40.03369  ? 85  LYS H CB    1 
ATOM 5453  C CG    . LYS H 4 86  ? 102.47300 122.07800 130.81300 1.000 40.03369  ? 85  LYS H CG    1 
ATOM 5454  C CD    . LYS H 4 86  ? 102.58800 123.50900 131.30600 1.000 40.03369  ? 85  LYS H CD    1 
ATOM 5455  C CE    . LYS H 4 86  ? 103.38800 124.36700 130.35200 1.000 40.03369  ? 85  LYS H CE    1 
ATOM 5456  N NZ    . LYS H 4 86  ? 103.43700 125.78300 130.80900 1.000 40.03369  ? 85  LYS H NZ    1 
ATOM 5457  N N     . ARG H 4 87  ? 99.90200  117.95800 131.88000 1.000 45.44876  ? 86  ARG H N     1 
ATOM 5458  C CA    . ARG H 4 87  ? 99.08100  117.11700 132.73400 1.000 45.44876  ? 86  ARG H CA    1 
ATOM 5459  C C     . ARG H 4 87  ? 99.82900  115.83500 133.06400 1.000 45.44876  ? 86  ARG H C     1 
ATOM 5460  O O     . ARG H 4 87  ? 100.75500 115.42800 132.35900 1.000 45.44876  ? 86  ARG H O     1 
ATOM 5461  C CB    . ARG H 4 87  ? 97.75000  116.78300 132.06000 1.000 45.44876  ? 86  ARG H CB    1 
ATOM 5462  C CG    . ARG H 4 87  ? 97.02600  117.98400 131.50400 1.000 45.44876  ? 86  ARG H CG    1 
ATOM 5463  C CD    . ARG H 4 87  ? 95.85200  118.38300 132.36800 1.000 45.44876  ? 86  ARG H CD    1 
ATOM 5464  N NE    . ARG H 4 87  ? 95.52300  119.79400 132.21100 1.000 45.44876  ? 86  ARG H NE    1 
ATOM 5465  C CZ    . ARG H 4 87  ? 94.38900  120.34500 132.62500 1.000 45.44876  ? 86  ARG H CZ    1 
ATOM 5466  N NH1   . ARG H 4 87  ? 93.46500  119.59700 133.21000 1.000 45.44876  ? 86  ARG H NH1   1 
ATOM 5467  N NH2   . ARG H 4 87  ? 94.17100  121.64000 132.44400 1.000 45.44876  ? 86  ARG H NH2   1 
ATOM 5468  N N     . SER H 4 88  ? 99.41000  115.19300 134.15100 1.000 47.95204  ? 87  SER H N     1 
ATOM 5469  C CA    . SER H 4 88  ? 100.03300 113.95900 134.59300 1.000 47.95204  ? 87  SER H CA    1 
ATOM 5470  C C     . SER H 4 88  ? 99.13800  112.74600 134.43000 1.000 47.95204  ? 87  SER H C     1 
ATOM 5471  O O     . SER H 4 88  ? 99.63000  111.62100 134.54000 1.000 47.95204  ? 87  SER H O     1 
ATOM 5472  C CB    . SER H 4 88  ? 100.45600 114.06700 136.06600 1.000 47.95204  ? 87  SER H CB    1 
ATOM 5473  O OG    . SER H 4 88  ? 101.26300 115.20700 136.29000 1.000 47.95204  ? 87  SER H OG    1 
ATOM 5474  N N     . THR H 4 89  ? 97.85200  112.93500 134.16300 1.000 44.34800  ? 88  THR H N     1 
ATOM 5475  C CA    . THR H 4 89  ? 96.89200  111.84500 134.12800 1.000 44.34800  ? 88  THR H CA    1 
ATOM 5476  C C     . THR H 4 89  ? 96.49700  111.55800 132.68800 1.000 44.34800  ? 88  THR H C     1 
ATOM 5477  O O     . THR H 4 89  ? 96.12800  112.47400 131.94700 1.000 44.34800  ? 88  THR H O     1 
ATOM 5478  C CB    . THR H 4 89  ? 95.65400  112.18700 134.95600 1.000 44.34800  ? 88  THR H CB    1 
ATOM 5479  O OG1   . THR H 4 89  ? 96.05700  112.55400 136.27800 1.000 44.34800  ? 88  THR H OG1   1 
ATOM 5480  C CG2   . THR H 4 89  ? 94.74400  110.99100 135.05900 1.000 44.34800  ? 88  THR H CG2   1 
ATOM 5481  N N     . ILE H 4 90  ? 96.59100  110.29100 132.29000 1.000 37.56823  ? 89  ILE H N     1 
ATOM 5482  C CA    . ILE H 4 90  ? 95.94000  109.80800 131.07700 1.000 37.56823  ? 89  ILE H CA    1 
ATOM 5483  C C     . ILE H 4 90  ? 94.49700  109.48100 131.45100 1.000 37.56823  ? 89  ILE H C     1 
ATOM 5484  O O     . ILE H 4 90  ? 94.22500  108.48400 132.11900 1.000 37.56823  ? 89  ILE H O     1 
ATOM 5485  C CB    . ILE H 4 90  ? 96.66400  108.60200 130.47800 1.000 37.56823  ? 89  ILE H CB    1 
ATOM 5486  C CG1   . ILE H 4 90  ? 98.02700  109.02600 129.94100 1.000 37.56823  ? 89  ILE H CG1   1 
ATOM 5487  C CG2   . ILE H 4 90  ? 95.85800  108.00200 129.34700 1.000 37.56823  ? 89  ILE H CG2   1 
ATOM 5488  C CD1   . ILE H 4 90  ? 98.79600  107.91500 129.28000 1.000 37.56823  ? 89  ILE H CD1   1 
ATOM 5489  N N     . THR H 4 91  ? 93.57000  110.34400 131.06200 1.000 35.91444  ? 90  THR H N     1 
ATOM 5490  C CA    . THR H 4 91  ? 92.16000  110.11800 131.32600 1.000 35.91444  ? 90  THR H CA    1 
ATOM 5491  C C     . THR H 4 91  ? 91.54400  109.39400 130.13400 1.000 35.91444  ? 90  THR H C     1 
ATOM 5492  O O     . THR H 4 91  ? 92.24500  108.91300 129.24300 1.000 35.91444  ? 90  THR H O     1 
ATOM 5493  C CB    . THR H 4 91  ? 91.44500  111.43600 131.60600 1.000 35.91444  ? 90  THR H CB    1 
ATOM 5494  O OG1   . THR H 4 91  ? 91.72000  112.36200 130.55200 1.000 35.91444  ? 90  THR H OG1   1 
ATOM 5495  C CG2   . THR H 4 91  ? 91.91100  112.03000 132.91000 1.000 35.91444  ? 90  THR H CG2   1 
ATOM 5496  N N     . SER H 4 92  ? 90.21600  109.30700 130.10500 1.000 34.81950  ? 91  SER H N     1 
ATOM 5497  C CA    . SER H 4 92  ? 89.54200  108.79600 128.92200 1.000 34.81950  ? 91  SER H CA    1 
ATOM 5498  C C     . SER H 4 92  ? 89.46000  109.83400 127.81600 1.000 34.81950  ? 91  SER H C     1 
ATOM 5499  O O     . SER H 4 92  ? 89.22800  109.46700 126.66200 1.000 34.81950  ? 91  SER H O     1 
ATOM 5500  C CB    . SER H 4 92  ? 88.14000  108.30300 129.27900 1.000 34.81950  ? 91  SER H CB    1 
ATOM 5501  O OG    . SER H 4 92  ? 87.43600  109.25800 130.04800 1.000 34.81950  ? 91  SER H OG    1 
ATOM 5502  N N     . ARG H 4 93  ? 89.62400  111.11600 128.14500 1.000 34.73147  ? 92  ARG H N     1 
ATOM 5503  C CA    . ARG H 4 93  ? 89.68500  112.15200 127.11900 1.000 34.73147  ? 92  ARG H CA    1 
ATOM 5504  C C     . ARG H 4 93  ? 90.96400  112.05200 126.29800 1.000 34.73147  ? 92  ARG H C     1 
ATOM 5505  O O     . ARG H 4 93  ? 90.94800  112.29600 125.08500 1.000 34.73147  ? 92  ARG H O     1 
ATOM 5506  C CB    . ARG H 4 93  ? 89.58800  113.52900 127.76200 1.000 34.73147  ? 92  ARG H CB    1 
ATOM 5507  C CG    . ARG H 4 93  ? 88.22000  113.87000 128.29900 1.000 34.73147  ? 92  ARG H CG    1 
ATOM 5508  C CD    . ARG H 4 93  ? 88.12200  115.34500 128.65500 1.000 34.73147  ? 92  ARG H CD    1 
ATOM 5509  N NE    . ARG H 4 93  ? 88.15300  116.21100 127.47900 1.000 34.73147  ? 92  ARG H NE    1 
ATOM 5510  C CZ    . ARG H 4 93  ? 89.19800  116.94600 127.11600 1.000 34.73147  ? 92  ARG H CZ    1 
ATOM 5511  N NH1   . ARG H 4 93  ? 90.31000  116.92200 127.83600 1.000 34.73147  ? 92  ARG H NH1   1 
ATOM 5512  N NH2   . ARG H 4 93  ? 89.13000  117.70800 126.03400 1.000 34.73147  ? 92  ARG H NH2   1 
ATOM 5513  N N     . GLU H 4 94  ? 92.08100  111.70700 126.94300 1.000 33.20044  ? 93  GLU H N     1 
ATOM 5514  C CA    . GLU H 4 94  ? 93.34500  111.54600 126.23200 1.000 33.20044  ? 93  GLU H CA    1 
ATOM 5515  C C     . GLU H 4 94  ? 93.30500  110.35400 125.29000 1.000 33.20044  ? 93  GLU H C     1 
ATOM 5516  O O     . GLU H 4 94  ? 93.81200  110.43000 124.16500 1.000 33.20044  ? 93  GLU H O     1 
ATOM 5517  C CB    . GLU H 4 94  ? 94.49100  111.38600 127.22800 1.000 33.20044  ? 93  GLU H CB    1 
ATOM 5518  C CG    . GLU H 4 94  ? 95.20900  112.66600 127.58200 1.000 33.20044  ? 93  GLU H CG    1 
ATOM 5519  C CD    . GLU H 4 94  ? 94.42000  113.54700 128.52600 1.000 33.20044  ? 93  GLU H CD    1 
ATOM 5520  O OE1   . GLU H 4 94  ? 93.47500  113.05100 129.17000 1.000 33.20044  ? 93  GLU H OE1   1 
ATOM 5521  O OE2   . GLU H 4 94  ? 94.75100  114.74300 128.63800 1.000 33.20044  ? 93  GLU H OE2   1 
ATOM 5522  N N     . ILE H 4 95  ? 92.67200  109.26000 125.71600 1.000 31.33964  ? 94  ILE H N     1 
ATOM 5523  C CA    . ILE H 4 95  ? 92.53700  108.09700 124.84800 1.000 31.33964  ? 94  ILE H CA    1 
ATOM 5524  C C     . ILE H 4 95  ? 91.57600  108.39800 123.70700 1.000 31.33964  ? 94  ILE H C     1 
ATOM 5525  O O     . ILE H 4 95  ? 91.80300  107.97800 122.56900 1.000 31.33964  ? 94  ILE H O     1 
ATOM 5526  C CB    . ILE H 4 95  ? 92.09900  106.87100 125.66700 1.000 31.33964  ? 94  ILE H CB    1 
ATOM 5527  C CG1   . ILE H 4 95  ? 93.07600  106.62900 126.81400 1.000 31.33964  ? 94  ILE H CG1   1 
ATOM 5528  C CG2   . ILE H 4 95  ? 92.02900  105.63200 124.80100 1.000 31.33964  ? 94  ILE H CG2   1 
ATOM 5529  C CD1   . ILE H 4 95  ? 94.45000  106.21800 126.36800 1.000 31.33964  ? 94  ILE H CD1   1 
ATOM 5530  N N     . GLN H 4 96  ? 90.52000  109.16900 123.97800 1.000 32.73346  ? 95  GLN H N     1 
ATOM 5531  C CA    . GLN H 4 96  ? 89.56400  109.53100 122.93300 1.000 32.73346  ? 95  GLN H CA    1 
ATOM 5532  C C     . GLN H 4 96  ? 90.19500  110.43500 121.88400 1.000 32.73346  ? 95  GLN H C     1 
ATOM 5533  O O     . GLN H 4 96  ? 89.96800  110.25700 120.67900 1.000 32.73346  ? 95  GLN H O     1 
ATOM 5534  C CB    . GLN H 4 96  ? 88.35600  110.21300 123.56300 1.000 32.73346  ? 95  GLN H CB    1 
ATOM 5535  C CG    . GLN H 4 96  ? 87.30700  110.68400 122.59000 1.000 32.73346  ? 95  GLN H CG    1 
ATOM 5536  C CD    . GLN H 4 96  ? 86.10000  111.24600 123.29700 1.000 32.73346  ? 95  GLN H CD    1 
ATOM 5537  O OE1   . GLN H 4 96  ? 85.06200  110.59500 123.38700 1.000 32.73346  ? 95  GLN H OE1   1 
ATOM 5538  N NE2   . GLN H 4 96  ? 86.23000  112.45800 123.81500 1.000 32.73346  ? 95  GLN H NE2   1 
ATOM 5539  N N     . THR H 4 97  ? 91.06100  111.35000 122.31500 1.000 31.32054  ? 96  THR H N     1 
ATOM 5540  C CA    . THR H 4 97  ? 91.75500  112.20300 121.36100 1.000 31.32054  ? 96  THR H CA    1 
ATOM 5541  C C     . THR H 4 97  ? 92.81600  111.42400 120.59300 1.000 31.32054  ? 96  THR H C     1 
ATOM 5542  O O     . THR H 4 97  ? 92.98600  111.63200 119.38700 1.000 31.32054  ? 96  THR H O     1 
ATOM 5543  C CB    . THR H 4 97  ? 92.35700  113.40200 122.08600 1.000 31.32054  ? 96  THR H CB    1 
ATOM 5544  O OG1   . THR H 4 97  ? 91.31600  114.08700 122.79000 1.000 31.32054  ? 96  THR H OG1   1 
ATOM 5545  C CG2   . THR H 4 97  ? 92.99500  114.36100 121.11200 1.000 31.32054  ? 96  THR H CG2   1 
ATOM 5546  N N     . ALA H 4 98  ? 93.49600  110.47800 121.24800 1.000 30.43109  ? 97  ALA H N     1 
ATOM 5547  C CA    . ALA H 4 98  ? 94.48800  109.68200 120.53500 1.000 30.43109  ? 97  ALA H CA    1 
ATOM 5548  C C     . ALA H 4 98  ? 93.83800  108.72700 119.54300 1.000 30.43109  ? 97  ALA H C     1 
ATOM 5549  O O     . ALA H 4 98  ? 94.41500  108.44600 118.48800 1.000 30.43109  ? 97  ALA H O     1 
ATOM 5550  C CB    . ALA H 4 98  ? 95.34000  108.90300 121.52900 1.000 30.43109  ? 97  ALA H CB    1 
ATOM 5551  N N     . VAL H 4 99  ? 92.60800  108.29900 119.81800 1.000 31.48439  ? 98  VAL H N     1 
ATOM 5552  C CA    . VAL H 4 99  ? 91.87200  107.47600 118.86600 1.000 31.48439  ? 98  VAL H CA    1 
ATOM 5553  C C     . VAL H 4 99  ? 91.40600  108.31200 117.68000 1.000 31.48439  ? 98  VAL H C     1 
ATOM 5554  O O     . VAL H 4 99  ? 91.56400  107.90300 116.52000 1.000 31.48439  ? 98  VAL H O     1 
ATOM 5555  C CB    . VAL H 4 99  ? 90.70600  106.77800 119.59000 1.000 31.48439  ? 98  VAL H CB    1 
ATOM 5556  C CG1   . VAL H 4 99  ? 89.71400  106.24000 118.62700 1.000 31.48439  ? 98  VAL H CG1   1 
ATOM 5557  C CG2   . VAL H 4 99  ? 91.23300  105.63000 120.40400 1.000 31.48439  ? 98  VAL H CG2   1 
ATOM 5558  N N     . ARG H 4 100 ? 90.92800  109.53600 117.94000 1.000 33.28145  ? 99  ARG H N     1 
ATOM 5559  C CA    . ARG H 4 100 ? 90.50600  110.41300 116.85000 1.000 33.28145  ? 99  ARG H CA    1 
ATOM 5560  C C     . ARG H 4 100 ? 91.67800  110.92500 116.02600 1.000 33.28145  ? 99  ARG H C     1 
ATOM 5561  O O     . ARG H 4 100 ? 91.47600  111.36000 114.89000 1.000 33.28145  ? 99  ARG H O     1 
ATOM 5562  C CB    . ARG H 4 100 ? 89.69700  111.58600 117.39300 1.000 33.28145  ? 99  ARG H CB    1 
ATOM 5563  C CG    . ARG H 4 100 ? 88.33600  111.18700 117.91300 1.000 33.28145  ? 99  ARG H CG    1 
ATOM 5564  C CD    . ARG H 4 100 ? 87.29700  112.23800 117.60600 1.000 33.28145  ? 99  ARG H CD    1 
ATOM 5565  N NE    . ARG H 4 100 ? 87.83700  113.58500 117.73900 1.000 33.28145  ? 99  ARG H NE    1 
ATOM 5566  C CZ    . ARG H 4 100 ? 87.79500  114.29800 118.85800 1.000 33.28145  ? 99  ARG H CZ    1 
ATOM 5567  N NH1   . ARG H 4 100 ? 87.23200  113.79300 119.94500 1.000 33.28145  ? 99  ARG H NH1   1 
ATOM 5568  N NH2   . ARG H 4 100 ? 88.31300  115.51700 118.88800 1.000 33.28145  ? 99  ARG H NH2   1 
ATOM 5569  N N     . LEU H 4 101 ? 92.89000  110.89300 116.57100 1.000 30.98396  ? 100 LEU H N     1 
ATOM 5570  C CA    . LEU H 4 101 ? 94.06700  111.28200 115.80600 1.000 30.98396  ? 100 LEU H CA    1 
ATOM 5571  C C     . LEU H 4 101 ? 94.60000  110.11900 114.98200 1.000 30.98396  ? 100 LEU H C     1 
ATOM 5572  O O     . LEU H 4 101 ? 94.75700  110.24300 113.76500 1.000 30.98396  ? 100 LEU H O     1 
ATOM 5573  C CB    . LEU H 4 101 ? 95.16700  111.79500 116.73500 1.000 30.98396  ? 100 LEU H CB    1 
ATOM 5574  C CG    . LEU H 4 101 ? 95.04100  113.18000 117.35200 1.000 30.98396  ? 100 LEU H CG    1 
ATOM 5575  C CD1   . LEU H 4 101 ? 96.25300  113.45900 118.18300 1.000 30.98396  ? 100 LEU H CD1   1 
ATOM 5576  C CD2   . LEU H 4 101 ? 94.94600  114.18500 116.25200 1.000 30.98396  ? 100 LEU H CD2   1 
ATOM 5577  N N     . LEU H 4 102 ? 94.87600  108.98500 115.63100 1.000 32.10297  ? 101 LEU H N     1 
ATOM 5578  C CA    . LEU H 4 102 ? 95.51000  107.86600 114.94400 1.000 32.10297  ? 101 LEU H CA    1 
ATOM 5579  C C     . LEU H 4 102 ? 94.58200  107.18200 113.94700 1.000 32.10297  ? 101 LEU H C     1 
ATOM 5580  O O     . LEU H 4 102 ? 95.00900  106.86800 112.83200 1.000 32.10297  ? 101 LEU H O     1 
ATOM 5581  C CB    . LEU H 4 102 ? 96.04000  106.86900 115.96000 1.000 32.10297  ? 101 LEU H CB    1 
ATOM 5582  C CG    . LEU H 4 102 ? 97.14200  107.51400 116.79200 1.000 32.10297  ? 101 LEU H CG    1 
ATOM 5583  C CD1   . LEU H 4 102 ? 97.52000  106.58000 117.87300 1.000 32.10297  ? 101 LEU H CD1   1 
ATOM 5584  C CD2   . LEU H 4 102 ? 98.34900  107.85900 115.94300 1.000 32.10297  ? 101 LEU H CD2   1 
ATOM 5585  N N     . LEU H 4 103 ? 93.32500  106.91800 114.31800 1.000 33.96609  ? 102 LEU H N     1 
ATOM 5586  C CA    . LEU H 4 103 ? 92.51200  106.12600 113.40600 1.000 33.96609  ? 102 LEU H CA    1 
ATOM 5587  C C     . LEU H 4 103 ? 91.97900  106.98700 112.26200 1.000 33.96609  ? 102 LEU H C     1 
ATOM 5588  O O     . LEU H 4 103 ? 91.87400  108.20800 112.39100 1.000 33.96609  ? 102 LEU H O     1 
ATOM 5589  C CB    . LEU H 4 103 ? 91.36100  105.46400 114.16100 1.000 33.96609  ? 102 LEU H CB    1 
ATOM 5590  C CG    . LEU H 4 103 ? 91.76000  104.44500 115.22700 1.000 33.96609  ? 102 LEU H CG    1 
ATOM 5591  C CD1   . LEU H 4 103 ? 90.55300  103.92000 115.93100 1.000 33.96609  ? 102 LEU H CD1   1 
ATOM 5592  C CD2   . LEU H 4 103 ? 92.51300  103.31200 114.63500 1.000 33.96609  ? 102 LEU H CD2   1 
ATOM 5593  N N     . PRO H 4 104 ? 91.63300  106.37600 111.12500 1.000 36.56766  ? 103 PRO H N     1 
ATOM 5594  C CA    . PRO H 4 104 ? 91.00200  107.13800 110.04000 1.000 36.56766  ? 103 PRO H CA    1 
ATOM 5595  C C     . PRO H 4 104 ? 89.56600  107.50900 110.37700 1.000 36.56766  ? 103 PRO H C     1 
ATOM 5596  O O     . PRO H 4 104 ? 89.01000  107.07900 111.38700 1.000 36.56766  ? 103 PRO H O     1 
ATOM 5597  C CB    . PRO H 4 104 ? 91.08200  106.19400 108.83800 1.000 36.56766  ? 103 PRO H CB    1 
ATOM 5598  C CG    . PRO H 4 104 ? 92.14000  105.21300 109.20500 1.000 36.56766  ? 103 PRO H CG    1 
ATOM 5599  C CD    . PRO H 4 104 ? 92.00900  105.02800 110.66700 1.000 36.56766  ? 103 PRO H CD    1 
ATOM 5600  N N     . GLY H 4 105 ? 88.98700  108.33500 109.49400 1.000 37.11303  ? 104 GLY H N     1 
ATOM 5601  C CA    . GLY H 4 105 ? 87.71300  108.99700 109.76900 1.000 37.11303  ? 104 GLY H CA    1 
ATOM 5602  C C     . GLY H 4 105 ? 86.55100  108.07000 110.07900 1.000 37.11303  ? 104 GLY H C     1 
ATOM 5603  O O     . GLY H 4 105 ? 85.76300  108.33800 110.98900 1.000 37.11303  ? 104 GLY H O     1 
ATOM 5604  N N     . GLU H 4 106 ? 86.39900  106.99500 109.30500 1.000 38.74131  ? 105 GLU H N     1 
ATOM 5605  C CA    . GLU H 4 106 ? 85.31900  106.05100 109.57200 1.000 38.74131  ? 105 GLU H CA    1 
ATOM 5606  C C     . GLU H 4 106 ? 85.54700  105.25800 110.85300 1.000 38.74131  ? 105 GLU H C     1 
ATOM 5607  O O     . GLU H 4 106 ? 84.59300  104.98200 111.58700 1.000 38.74131  ? 105 GLU H O     1 
ATOM 5608  C CB    . GLU H 4 106 ? 85.11900  105.10700 108.38700 1.000 38.74131  ? 105 GLU H CB    1 
ATOM 5609  C CG    . GLU H 4 106 ? 83.77300  104.36200 108.37600 1.000 38.74131  ? 105 GLU H CG    1 
ATOM 5610  C CD    . GLU H 4 106 ? 82.51600  105.24100 108.27900 1.000 38.74131  ? 105 GLU H CD    1 
ATOM 5611  O OE1   . GLU H 4 106 ? 81.41300  104.66500 108.39100 1.000 38.74131  ? 105 GLU H OE1   1 
ATOM 5612  O OE2   . GLU H 4 106 ? 82.58900  106.46000 108.00400 1.000 38.74131  ? 105 GLU H OE2   1 
ATOM 5613  N N     . LEU H 4 107 ? 86.78700  104.84700 111.12300 1.000 36.27755  ? 106 LEU H N     1 
ATOM 5614  C CA    . LEU H 4 107 ? 87.04000  104.07500 112.33600 1.000 36.27755  ? 106 LEU H CA    1 
ATOM 5615  C C     . LEU H 4 107 ? 87.01700  104.95300 113.57800 1.000 36.27755  ? 106 LEU H C     1 
ATOM 5616  O O     . LEU H 4 107 ? 86.52600  104.52800 114.62800 1.000 36.27755  ? 106 LEU H O     1 
ATOM 5617  C CB    . LEU H 4 107 ? 88.37600  103.34600 112.24200 1.000 36.27755  ? 106 LEU H CB    1 
ATOM 5618  C CG    . LEU H 4 107 ? 88.53000  102.24100 111.21100 1.000 36.27755  ? 106 LEU H CG    1 
ATOM 5619  C CD1   . LEU H 4 107 ? 89.95900  101.75700 111.22200 1.000 36.27755  ? 106 LEU H CD1   1 
ATOM 5620  C CD2   . LEU H 4 107 ? 87.58200  101.10900 111.52400 1.000 36.27755  ? 106 LEU H CD2   1 
ATOM 5621  N N     . ALA H 4 108 ? 87.54000  106.17600 113.48600 1.000 36.18015  ? 107 ALA H N     1 
ATOM 5622  C CA    . ALA H 4 108 ? 87.53100  107.08900 114.62400 1.000 36.18015  ? 107 ALA H CA    1 
ATOM 5623  C C     . ALA H 4 108 ? 86.14700  107.60400 114.99700 1.000 36.18015  ? 107 ALA H C     1 
ATOM 5624  O O     . ALA H 4 108 ? 86.04500  108.32700 115.98900 1.000 36.18015  ? 107 ALA H O     1 
ATOM 5625  C CB    . ALA H 4 108 ? 88.45000  108.27900 114.35900 1.000 36.18015  ? 107 ALA H CB    1 
ATOM 5626  N N     . LYS H 4 109 ? 85.09400  107.29500 114.24400 1.000 36.82182  ? 108 LYS H N     1 
ATOM 5627  C CA    . LYS H 4 109 ? 83.74100  107.59500 114.67900 1.000 36.82182  ? 108 LYS H CA    1 
ATOM 5628  C C     . LYS H 4 109 ? 83.03000  106.38700 115.26300 1.000 36.82182  ? 108 LYS H C     1 
ATOM 5629  O O     . LYS H 4 109 ? 81.99800  106.55400 115.91900 1.000 36.82182  ? 108 LYS H O     1 
ATOM 5630  C CB    . LYS H 4 109 ? 82.91900  108.15600 113.51600 1.000 36.82182  ? 108 LYS H CB    1 
ATOM 5631  C CG    . LYS H 4 109 ? 83.35800  109.53300 113.06600 1.000 36.82182  ? 108 LYS H CG    1 
ATOM 5632  C CD    . LYS H 4 109 ? 82.41600  110.10100 112.01900 1.000 36.82182  ? 108 LYS H CD    1 
ATOM 5633  C CE    . LYS H 4 109 ? 81.01100  110.26600 112.57300 1.000 36.82182  ? 108 LYS H CE    1 
ATOM 5634  N NZ    . LYS H 4 109 ? 80.96700  111.19500 113.73800 1.000 36.82182  ? 108 LYS H NZ    1 
ATOM 5635  N N     . HIS H 4 110 ? 83.55600  105.18600 115.04600 1.000 39.05374  ? 109 HIS H N     1 
ATOM 5636  C CA    . HIS H 4 110 ? 83.02800  103.96000 115.63100 1.000 39.05374  ? 109 HIS H CA    1 
ATOM 5637  C C     . HIS H 4 110 ? 83.75700  103.56500 116.90200 1.000 39.05374  ? 109 HIS H C     1 
ATOM 5638  O O     . HIS H 4 110 ? 83.12500  103.11800 117.86400 1.000 39.05374  ? 109 HIS H O     1 
ATOM 5639  C CB    . HIS H 4 110 ? 83.12100  102.81000 114.62800 1.000 39.05374  ? 109 HIS H CB    1 
ATOM 5640  C CG    . HIS H 4 110 ? 82.05400  102.82400 113.57900 1.000 39.05374  ? 109 HIS H CG    1 
ATOM 5641  N ND1   . HIS H 4 110 ? 80.80800  103.37200 113.79000 1.000 39.05374  ? 109 HIS H ND1   1 
ATOM 5642  C CD2   . HIS H 4 110 ? 82.04800  102.35100 112.31100 1.000 39.05374  ? 109 HIS H CD2   1 
ATOM 5643  C CE1   . HIS H 4 110 ? 80.07900  103.23600 112.69700 1.000 39.05374  ? 109 HIS H CE1   1 
ATOM 5644  N NE2   . HIS H 4 110 ? 80.80900  102.62000 111.78500 1.000 39.05374  ? 109 HIS H NE2   1 
ATOM 5645  N N     . ALA H 4 111 ? 85.08300  103.69200 116.90100 1.000 37.47829  ? 110 ALA H N     1 
ATOM 5646  C CA    . ALA H 4 111 ? 85.88100  103.36400 118.07500 1.000 37.47829  ? 110 ALA H CA    1 
ATOM 5647  C C     . ALA H 4 111 ? 85.57000  104.28100 119.25000 1.000 37.47829  ? 110 ALA H C     1 
ATOM 5648  O O     . ALA H 4 111 ? 85.50800  103.82100 120.39500 1.000 37.47829  ? 110 ALA H O     1 
ATOM 5649  C CB    . ALA H 4 111 ? 87.36300  103.42500 117.73100 1.000 37.47829  ? 110 ALA H CB    1 
ATOM 5650  N N     . VAL H 4 112 ? 85.38400  105.58100 119.00100 1.000 37.09021  ? 111 VAL H N     1 
ATOM 5651  C CA    . VAL H 4 112 ? 84.97400  106.45000 120.09600 1.000 37.09021  ? 111 VAL H CA    1 
ATOM 5652  C C     . VAL H 4 112 ? 83.51800  106.25200 120.49400 1.000 37.09021  ? 111 VAL H C     1 
ATOM 5653  O O     . VAL H 4 112 ? 83.17100  106.52600 121.64600 1.000 37.09021  ? 111 VAL H O     1 
ATOM 5654  C CB    . VAL H 4 112 ? 85.21800  107.93100 119.75100 1.000 37.09021  ? 111 VAL H CB    1 
ATOM 5655  C CG1   . VAL H 4 112 ? 86.60900  108.12200 119.23400 1.000 37.09021  ? 111 VAL H CG1   1 
ATOM 5656  C CG2   . VAL H 4 112 ? 84.20500  108.43900 118.75400 1.000 37.09021  ? 111 VAL H CG2   1 
ATOM 5657  N N     . SER H 4 113 ? 82.70200  105.61600 119.65200 1.000 39.01391  ? 112 SER H N     1 
ATOM 5658  C CA    . SER H 4 113 ? 81.37700  105.20400 120.09600 1.000 39.01391  ? 112 SER H CA    1 
ATOM 5659  C C     . SER H 4 113 ? 81.47800  104.01600 121.03300 1.000 39.01391  ? 112 SER H C     1 
ATOM 5660  O O     . SER H 4 113 ? 80.77900  103.96100 122.04800 1.000 39.01391  ? 112 SER H O     1 
ATOM 5661  C CB    . SER H 4 113 ? 80.48900  104.88100 118.89900 1.000 39.01391  ? 112 SER H CB    1 
ATOM 5662  O OG    . SER H 4 113 ? 79.14400  104.70600 119.30500 1.000 39.01391  ? 112 SER H OG    1 
ATOM 5663  N N     . GLU H 4 114 ? 82.33600  103.05200 120.69500 1.000 40.70846  ? 113 GLU H N     1 
ATOM 5664  C CA    . GLU H 4 114 ? 82.51200  101.87800 121.54400 1.000 40.70846  ? 113 GLU H CA    1 
ATOM 5665  C C     . GLU H 4 114 ? 83.13100  102.26100 122.88100 1.000 40.70846  ? 113 GLU H C     1 
ATOM 5666  O O     . GLU H 4 114 ? 82.68900  101.78500 123.93200 1.000 40.70846  ? 113 GLU H O     1 
ATOM 5667  C CB    . GLU H 4 114 ? 83.36200  100.82900 120.83500 1.000 40.70846  ? 113 GLU H CB    1 
ATOM 5668  C CG    . GLU H 4 114 ? 82.75300  100.34500 119.54200 1.000 40.70846  ? 113 GLU H CG    1 
ATOM 5669  C CD    . GLU H 4 114 ? 81.47800  99.56900  119.76300 1.000 40.70846  ? 113 GLU H CD    1 
ATOM 5670  O OE1   . GLU H 4 114 ? 81.42400  98.76900  120.71900 1.000 40.70846  ? 113 GLU H OE1   1 
ATOM 5671  O OE2   . GLU H 4 114 ? 80.52100  99.77100  118.98900 1.000 40.70846  ? 113 GLU H OE2   1 
ATOM 5672  N N     . GLY H 4 115 ? 84.15900  103.11200 122.85400 1.000 38.04454  ? 114 GLY H N     1 
ATOM 5673  C CA    . GLY H 4 115 ? 84.74000  103.62500 124.08700 1.000 38.04454  ? 114 GLY H CA    1 
ATOM 5674  C C     . GLY H 4 115 ? 83.77900  104.43400 124.94100 1.000 38.04454  ? 114 GLY H C     1 
ATOM 5675  O O     . GLY H 4 115 ? 83.71900  104.25200 126.15900 1.000 38.04454  ? 114 GLY H O     1 
ATOM 5676  N N     . THR H 4 116 ? 83.00700  105.33400 124.32300 1.000 38.89728  ? 115 THR H N     1 
ATOM 5677  C CA    . THR H 4 116 ? 82.08100  106.14800 125.09600 1.000 38.89728  ? 115 THR H CA    1 
ATOM 5678  C C     . THR H 4 116 ? 80.81300  105.38500 125.47000 1.000 38.89728  ? 115 THR H C     1 
ATOM 5679  O O     . THR H 4 116 ? 80.03800  105.86200 126.30200 1.000 38.89728  ? 115 THR H O     1 
ATOM 5680  C CB    . THR H 4 116 ? 81.75200  107.41300 124.29100 1.000 38.89728  ? 115 THR H CB    1 
ATOM 5681  O OG1   . THR H 4 116 ? 82.94400  107.85800 123.63600 1.000 38.89728  ? 115 THR H OG1   1 
ATOM 5682  C CG2   . THR H 4 116 ? 81.31200  108.55900 125.19500 1.000 38.89728  ? 115 THR H CG2   1 
ATOM 5683  N N     . LYS H 4 117 ? 80.60100  104.19300 124.92000 1.000 39.50353  ? 116 LYS H N     1 
ATOM 5684  C CA    . LYS H 4 117 ? 79.56000  103.32000 125.44000 1.000 39.50353  ? 116 LYS H CA    1 
ATOM 5685  C C     . LYS H 4 117 ? 80.07800  102.42300 126.55000 1.000 39.50353  ? 116 LYS H C     1 
ATOM 5686  O O     . LYS H 4 117 ? 79.36000  102.17200 127.52600 1.000 39.50353  ? 116 LYS H O     1 
ATOM 5687  C CB    . LYS H 4 117 ? 78.99000  102.46600 124.30700 1.000 39.50353  ? 116 LYS H CB    1 
ATOM 5688  C CG    . LYS H 4 117 ? 77.73400  101.69200 124.64900 1.000 39.50353  ? 116 LYS H CG    1 
ATOM 5689  C CD    . LYS H 4 117 ? 77.30000  100.81800 123.47900 1.000 39.50353  ? 116 LYS H CD    1 
ATOM 5690  C CE    . LYS H 4 117 ? 78.40700  99.87600  123.03900 1.000 39.50353  ? 116 LYS H CE    1 
ATOM 5691  N NZ    . LYS H 4 117 ? 78.08300  99.19600  121.75700 1.000 39.50353  ? 116 LYS H NZ    1 
ATOM 5692  N N     . ALA H 4 118 ? 81.36000  102.06800 126.49800 1.000 39.01213  ? 117 ALA H N     1 
ATOM 5693  C CA    . ALA H 4 118 ? 81.92200  101.15900 127.48500 1.000 39.01213  ? 117 ALA H CA    1 
ATOM 5694  C C     . ALA H 4 118 ? 82.21700  101.88500 128.78500 1.000 39.01213  ? 117 ALA H C     1 
ATOM 5695  O O     . ALA H 4 118 ? 81.95600  101.34900 129.86200 1.000 39.01213  ? 117 ALA H O     1 
ATOM 5696  C CB    . ALA H 4 118 ? 83.18500  100.50200 126.94800 1.000 39.01213  ? 117 ALA H CB    1 
ATOM 5697  N N     . VAL H 4 119 ? 82.81900  103.07500 128.70600 1.000 37.91702  ? 118 VAL H N     1 
ATOM 5698  C CA    . VAL H 4 119 ? 83.06600  103.86800 129.91000 1.000 37.91702  ? 118 VAL H CA    1 
ATOM 5699  C C     . VAL H 4 119 ? 81.75600  104.27100 130.58200 1.000 37.91702  ? 118 VAL H C     1 
ATOM 5700  O O     . VAL H 4 119 ? 81.62000  104.16800 131.80500 1.000 37.91702  ? 118 VAL H O     1 
ATOM 5701  C CB    . VAL H 4 119 ? 83.94300  105.08800 129.57500 1.000 37.91702  ? 118 VAL H CB    1 
ATOM 5702  C CG1   . VAL H 4 119 ? 84.14300  105.95800 130.79500 1.000 37.91702  ? 118 VAL H CG1   1 
ATOM 5703  C CG2   . VAL H 4 119 ? 85.28400  104.61900 129.09200 1.000 37.91702  ? 118 VAL H CG2   1 
ATOM 5704  N N     . THR H 4 120 ? 80.76300  104.70600 129.80200 1.000 39.17102  ? 119 THR H N     1 
ATOM 5705  C CA    . THR H 4 120 ? 79.46300  105.06000 130.37100 1.000 39.17102  ? 119 THR H CA    1 
ATOM 5706  C C     . THR H 4 120 ? 78.71300  103.84000 130.91600 1.000 39.17102  ? 119 THR H C     1 
ATOM 5707  O O     . THR H 4 120 ? 77.94200  103.97100 131.87300 1.000 39.17102  ? 119 THR H O     1 
ATOM 5708  C CB    . THR H 4 120 ? 78.66000  105.81600 129.29900 1.000 39.17102  ? 119 THR H CB    1 
ATOM 5709  O OG1   . THR H 4 120 ? 79.36000  107.01900 128.96300 1.000 39.17102  ? 119 THR H OG1   1 
ATOM 5710  C CG2   . THR H 4 120 ? 77.27500  106.23000 129.77000 1.000 39.17102  ? 119 THR H CG2   1 
ATOM 5711  N N     . LYS H 4 121 ? 79.02400  102.63800 130.43400 1.000 41.34179  ? 120 LYS H N     1 
ATOM 5712  C CA    . LYS H 4 121 ? 78.52400  101.44400 131.10600 1.000 41.34179  ? 120 LYS H CA    1 
ATOM 5713  C C     . LYS H 4 121 ? 79.30000  101.15500 132.38600 1.000 41.34179  ? 120 LYS H C     1 
ATOM 5714  O O     . LYS H 4 121 ? 78.71200  100.74800 133.39300 1.000 41.34179  ? 120 LYS H O     1 
ATOM 5715  C CB    . LYS H 4 121 ? 78.57900  100.24400 130.16300 1.000 41.34179  ? 120 LYS H CB    1 
ATOM 5716  C CG    . LYS H 4 121 ? 77.86100  99.02700  130.69700 1.000 41.34179  ? 120 LYS H CG    1 
ATOM 5717  C CD    . LYS H 4 121 ? 77.69500  97.96500  129.63700 1.000 41.34179  ? 120 LYS H CD    1 
ATOM 5718  C CE    . LYS H 4 121 ? 76.73300  96.88900  130.09800 1.000 41.34179  ? 120 LYS H CE    1 
ATOM 5719  N NZ    . LYS H 4 121 ? 76.45700  95.91100  129.01600 1.000 41.34179  ? 120 LYS H NZ    1 
ATOM 5720  N N     . TYR H 4 122 ? 80.62100  101.32900 132.34600 1.000 41.70224  ? 121 TYR H N     1 
ATOM 5721  C CA    . TYR H 4 122 ? 81.49100  100.97900 133.46300 1.000 41.70224  ? 121 TYR H CA    1 
ATOM 5722  C C     . TYR H 4 122 ? 81.24500  101.86300 134.68000 1.000 41.70224  ? 121 TYR H C     1 
ATOM 5723  O O     . TYR H 4 122 ? 81.23300  101.36300 135.81000 1.000 41.70224  ? 121 TYR H O     1 
ATOM 5724  C CB    . TYR H 4 122 ? 82.94600  101.06200 133.00000 1.000 41.70224  ? 121 TYR H CB    1 
ATOM 5725  C CG    . TYR H 4 122 ? 83.98800  101.09100 134.08900 1.000 41.70224  ? 121 TYR H CG    1 
ATOM 5726  C CD1   . TYR H 4 122 ? 84.34300  99.93400  134.75800 1.000 41.70224  ? 121 TYR H CD1   1 
ATOM 5727  C CD2   . TYR H 4 122 ? 84.65700  102.26400 134.40800 1.000 41.70224  ? 121 TYR H CD2   1 
ATOM 5728  C CE1   . TYR H 4 122 ? 85.30300  99.94300  135.74000 1.000 41.70224  ? 121 TYR H CE1   1 
ATOM 5729  C CE2   . TYR H 4 122 ? 85.62400  102.28400 135.38900 1.000 41.70224  ? 121 TYR H CE2   1 
ATOM 5730  C CZ    . TYR H 4 122 ? 85.94100  101.11900 136.05000 1.000 41.70224  ? 121 TYR H CZ    1 
ATOM 5731  O OH    . TYR H 4 122 ? 86.90300  101.12300 137.03200 1.000 41.70224  ? 121 TYR H OH    1 
ATOM 5732  N N     . THR H 4 123 ? 81.09800  103.18100 134.47900 1.000 41.44964  ? 122 THR H N     1 
ATOM 5733  C CA    . THR H 4 123 ? 80.85400  104.09700 135.59500 1.000 41.44964  ? 122 THR H CA    1 
ATOM 5734  C C     . THR H 4 123 ? 79.54500  103.82000 136.32400 1.000 41.44964  ? 122 THR H C     1 
ATOM 5735  O O     . THR H 4 123 ? 79.40600  104.23000 137.48200 1.000 41.44964  ? 122 THR H O     1 
ATOM 5736  C CB    . THR H 4 123 ? 80.87600  105.55500 135.13700 1.000 41.44964  ? 122 THR H CB    1 
ATOM 5737  O OG1   . THR H 4 123 ? 79.78300  105.80500 134.24500 1.000 41.44964  ? 122 THR H OG1   1 
ATOM 5738  C CG2   . THR H 4 123 ? 82.20400  105.91300 134.49200 1.000 41.44964  ? 122 THR H CG2   1 
ATOM 5739  N N     . SER H 4 124 ? 78.56600  103.19700 135.65900 1.000 43.42676  ? 123 SER H N     1 
ATOM 5740  C CA    . SER H 4 124 ? 77.32500  102.83200 136.33300 1.000 43.42676  ? 123 SER H CA    1 
ATOM 5741  C C     . SER H 4 124 ? 77.59000  101.80000 137.42300 1.000 43.42676  ? 123 SER H C     1 
ATOM 5742  O O     . SER H 4 124 ? 77.09300  101.93700 138.54800 1.000 43.42676  ? 123 SER H O     1 
ATOM 5743  C CB    . SER H 4 124 ? 76.31700  102.29300 135.32600 1.000 43.42676  ? 123 SER H CB    1 
ATOM 5744  O OG    . SER H 4 124 ? 76.53000  100.91100 135.10900 1.000 43.42676  ? 123 SER H OG    1 
ATOM 5745  N N     . SER H 4 125 ? 78.42700  100.80400 137.11200 1.000 42.35063  ? 124 SER H N     1 
ATOM 5746  C CA    . SER H 4 125 ? 78.87200  99.70300  137.98600 1.000 42.35063  ? 124 SER H CA    1 
ATOM 5747  C C     . SER H 4 125 ? 77.84300  99.08500  138.93700 1.000 42.35063  ? 124 SER H C     1 
ATOM 5748  O O     . SER H 4 125 ? 78.19800  98.56300  139.99400 1.000 42.35063  ? 124 SER H O     1 
ATOM 5749  C CB    . SER H 4 125 ? 80.07900  100.17600 138.80500 1.000 42.35063  ? 124 SER H CB    1 
ATOM 5750  O OG    . SER H 4 125 ? 79.75300  101.27600 139.63700 1.000 42.35063  ? 124 SER H OG    1 
ATOM 5751  O "O5'" . DA  I 5 1   ? 135.45100 132.71600 66.27000  1.000 190.80340 ? -72 DA  I "O5'" 1 
ATOM 5752  C "C5'" . DA  I 5 1   ? 134.96900 133.88200 66.92200  1.000 190.80340 ? -72 DA  I "C5'" 1 
ATOM 5753  C "C4'" . DA  I 5 1   ? 134.61500 134.95300 65.91000  1.000 190.80340 ? -72 DA  I "C4'" 1 
ATOM 5754  O "O4'" . DA  I 5 1   ? 133.66000 134.40600 64.96200  1.000 190.80340 ? -72 DA  I "O4'" 1 
ATOM 5755  C "C3'" . DA  I 5 1   ? 133.96100 136.20300 66.50000  1.000 190.80340 ? -72 DA  I "C3'" 1 
ATOM 5756  O "O3'" . DA  I 5 1   ? 134.41600 137.38100 65.82000  1.000 190.80340 ? -72 DA  I "O3'" 1 
ATOM 5757  C "C2'" . DA  I 5 1   ? 132.48200 135.94700 66.24500  1.000 190.80340 ? -72 DA  I "C2'" 1 
ATOM 5758  C "C1'" . DA  I 5 1   ? 132.52400 135.23500 64.90600  1.000 190.80340 ? -72 DA  I "C1'" 1 
ATOM 5759  N N9    . DA  I 5 1   ? 131.35100 134.39800 64.67500  1.000 190.80340 ? -72 DA  I N9    1 
ATOM 5760  C C8    . DA  I 5 1   ? 131.28700 133.03300 64.73400  1.000 190.80340 ? -72 DA  I C8    1 
ATOM 5761  N N7    . DA  I 5 1   ? 130.09300 132.54900 64.48700  1.000 190.80340 ? -72 DA  I N7    1 
ATOM 5762  C C5    . DA  I 5 1   ? 129.32200 133.67400 64.24500  1.000 190.80340 ? -72 DA  I C5    1 
ATOM 5763  C C6    . DA  I 5 1   ? 127.96100 133.84300 63.91800  1.000 190.80340 ? -72 DA  I C6    1 
ATOM 5764  N N6    . DA  I 5 1   ? 127.10600 132.82500 63.77300  1.000 190.80340 ? -72 DA  I N6    1 
ATOM 5765  N N1    . DA  I 5 1   ? 127.51100 135.10600 63.74100  1.000 190.80340 ? -72 DA  I N1    1 
ATOM 5766  C C2    . DA  I 5 1   ? 128.36700 136.12500 63.88300  1.000 190.80340 ? -72 DA  I C2    1 
ATOM 5767  N N3    . DA  I 5 1   ? 129.66300 136.08800 64.18800  1.000 190.80340 ? -72 DA  I N3    1 
ATOM 5768  C C4    . DA  I 5 1   ? 130.08200 134.82200 64.35700  1.000 190.80340 ? -72 DA  I C4    1 
ATOM 5769  P P     . DT  I 5 2   ? 133.90200 138.83700 66.27900  1.000 190.06065 ? -71 DT  I P     1 
ATOM 5770  O OP1   . DT  I 5 2   ? 134.93100 139.81700 65.86600  1.000 190.06065 ? -71 DT  I OP1   1 
ATOM 5771  O OP2   . DT  I 5 2   ? 133.51600 138.74500 67.70300  1.000 190.06065 ? -71 DT  I OP2   1 
ATOM 5772  O "O5'" . DT  I 5 2   ? 132.57400 139.08500 65.41200  1.000 190.06065 ? -71 DT  I "O5'" 1 
ATOM 5773  C "C5'" . DT  I 5 2   ? 132.60900 139.92300 64.25100  1.000 190.06065 ? -71 DT  I "C5'" 1 
ATOM 5774  C "C4'" . DT  I 5 2   ? 131.52300 140.99400 64.31200  1.000 190.06065 ? -71 DT  I "C4'" 1 
ATOM 5775  O "O4'" . DT  I 5 2   ? 130.22800 140.35200 64.46300  1.000 190.06065 ? -71 DT  I "O4'" 1 
ATOM 5776  C "C3'" . DT  I 5 2   ? 131.64100 141.99200 65.46400  1.000 190.06065 ? -71 DT  I "C3'" 1 
ATOM 5777  O "O3'" . DT  I 5 2   ? 131.33800 143.31800 65.00800  1.000 190.06065 ? -71 DT  I "O3'" 1 
ATOM 5778  C "C2'" . DT  I 5 2   ? 130.61900 141.48400 66.47600  1.000 190.06065 ? -71 DT  I "C2'" 1 
ATOM 5779  C "C1'" . DT  I 5 2   ? 129.54700 140.89200 65.57400  1.000 190.06065 ? -71 DT  I "C1'" 1 
ATOM 5780  N N1    . DT  I 5 2   ? 128.78600 139.78000 66.22300  1.000 190.06065 ? -71 DT  I N1    1 
ATOM 5781  C C2    . DT  I 5 2   ? 127.42200 139.67800 66.03300  1.000 190.06065 ? -71 DT  I C2    1 
ATOM 5782  O O2    . DT  I 5 2   ? 126.77700 140.47100 65.37100  1.000 190.06065 ? -71 DT  I O2    1 
ATOM 5783  N N3    . DT  I 5 2   ? 126.83600 138.61000 66.66800  1.000 190.06065 ? -71 DT  I N3    1 
ATOM 5784  C C4    . DT  I 5 2   ? 127.46500 137.65300 67.44700  1.000 190.06065 ? -71 DT  I C4    1 
ATOM 5785  O O4    . DT  I 5 2   ? 126.85900 136.72900 67.97600  1.000 190.06065 ? -71 DT  I O4    1 
ATOM 5786  C C5    . DT  I 5 2   ? 128.88800 137.81500 67.59500  1.000 190.06065 ? -71 DT  I C5    1 
ATOM 5787  C C7    . DT  I 5 2   ? 129.66800 136.83700 68.41700  1.000 190.06065 ? -71 DT  I C7    1 
ATOM 5788  C C6    . DT  I 5 2   ? 129.47500 138.85300 66.98200  1.000 190.06065 ? -71 DT  I C6    1 
ATOM 5789  P P     . DC  I 5 3   ? 131.54200 144.57800 65.98800  1.000 187.31666 ? -70 DC  I P     1 
ATOM 5790  O OP1   . DC  I 5 3   ? 131.84000 145.76200 65.15400  1.000 187.31666 ? -70 DC  I OP1   1 
ATOM 5791  O OP2   . DC  I 5 3   ? 132.50200 144.17300 67.03800  1.000 187.31666 ? -70 DC  I OP2   1 
ATOM 5792  O "O5'" . DC  I 5 3   ? 130.11200 144.79300 66.68000  1.000 187.31666 ? -70 DC  I "O5'" 1 
ATOM 5793  C "C5'" . DC  I 5 3   ? 129.20000 145.75800 66.13200  1.000 187.31666 ? -70 DC  I "C5'" 1 
ATOM 5794  C "C4'" . DC  I 5 3   ? 127.74800 145.32200 66.27100  1.000 187.31666 ? -70 DC  I "C4'" 1 
ATOM 5795  O "O4'" . DC  I 5 3   ? 127.66000 143.91700 66.53000  1.000 187.31666 ? -70 DC  I "O4'" 1 
ATOM 5796  C "C3'" . DC  I 5 3   ? 126.99100 145.97200 67.41600  1.000 187.31666 ? -70 DC  I "C3'" 1 
ATOM 5797  O "O3'" . DC  I 5 3   ? 126.42000 147.20100 66.98700  1.000 187.31666 ? -70 DC  I "O3'" 1 
ATOM 5798  C "C2'" . DC  I 5 3   ? 125.89700 144.94600 67.75500  1.000 187.31666 ? -70 DC  I "C2'" 1 
ATOM 5799  C "C1'" . DC  I 5 3   ? 126.40100 143.65400 67.11700  1.000 187.31666 ? -70 DC  I "C1'" 1 
ATOM 5800  N N1    . DC  I 5 3   ? 126.51700 142.47100 68.01500  1.000 187.31666 ? -70 DC  I N1    1 
ATOM 5801  C C2    . DC  I 5 3   ? 125.38200 141.70800 68.31100  1.000 187.31666 ? -70 DC  I C2    1 
ATOM 5802  O O2    . DC  I 5 3   ? 124.28300 142.06500 67.87000  1.000 187.31666 ? -70 DC  I O2    1 
ATOM 5803  N N3    . DC  I 5 3   ? 125.52300 140.60500 69.08800  1.000 187.31666 ? -70 DC  I N3    1 
ATOM 5804  C C4    . DC  I 5 3   ? 126.73100 140.25600 69.54200  1.000 187.31666 ? -70 DC  I C4    1 
ATOM 5805  N N4    . DC  I 5 3   ? 126.82700 139.16300 70.30400  1.000 187.31666 ? -70 DC  I N4    1 
ATOM 5806  C C5    . DC  I 5 3   ? 127.89500 141.01300 69.23300  1.000 187.31666 ? -70 DC  I C5    1 
ATOM 5807  C C6    . DC  I 5 3   ? 127.74200 142.09800 68.47200  1.000 187.31666 ? -70 DC  I C6    1 
ATOM 5808  P P     . DA  I 5 4   ? 126.88200 148.59000 67.64600  1.000 183.74161 ? -69 DA  I P     1 
ATOM 5809  O OP1   . DA  I 5 4   ? 127.13700 149.54400 66.54500  1.000 183.74161 ? -69 DA  I OP1   1 
ATOM 5810  O OP2   . DA  I 5 4   ? 127.94900 148.29900 68.62800  1.000 183.74161 ? -69 DA  I OP2   1 
ATOM 5811  O "O5'" . DA  I 5 4   ? 125.58200 149.08000 68.43600  1.000 183.74161 ? -69 DA  I "O5'" 1 
ATOM 5812  C "C5'" . DA  I 5 4   ? 124.33500 149.19900 67.75600  1.000 183.74161 ? -69 DA  I "C5'" 1 
ATOM 5813  C "C4'" . DA  I 5 4   ? 123.23800 148.42700 68.47900  1.000 183.74161 ? -69 DA  I "C4'" 1 
ATOM 5814  O "O4'" . DA  I 5 4   ? 123.72700 147.11900 68.87600  1.000 183.74161 ? -69 DA  I "O4'" 1 
ATOM 5815  C "C3'" . DA  I 5 4   ? 122.70900 149.06600 69.75500  1.000 183.74161 ? -69 DA  I "C3'" 1 
ATOM 5816  O "O3'" . DA  I 5 4   ? 121.33800 148.77600 69.87600  1.000 183.74161 ? -69 DA  I "O3'" 1 
ATOM 5817  C "C2'" . DA  I 5 4   ? 123.52300 148.38000 70.84800  1.000 183.74161 ? -69 DA  I "C2'" 1 
ATOM 5818  C "C1'" . DA  I 5 4   ? 123.65700 146.97600 70.28300  1.000 183.74161 ? -69 DA  I "C1'" 1 
ATOM 5819  N N9    . DA  I 5 4   ? 124.86200 146.27900 70.72000  1.000 183.74161 ? -69 DA  I N9    1 
ATOM 5820  C C8    . DA  I 5 4   ? 126.14100 146.76000 70.70300  1.000 183.74161 ? -69 DA  I C8    1 
ATOM 5821  N N7    . DA  I 5 4   ? 127.03500 145.90600 71.14000  1.000 183.74161 ? -69 DA  I N7    1 
ATOM 5822  C C5    . DA  I 5 4   ? 126.28700 144.79600 71.49400  1.000 183.74161 ? -69 DA  I C5    1 
ATOM 5823  C C6    . DA  I 5 4   ? 126.64200 143.54500 72.03900  1.000 183.74161 ? -69 DA  I C6    1 
ATOM 5824  N N6    . DA  I 5 4   ? 127.90100 143.20300 72.33000  1.000 183.74161 ? -69 DA  I N6    1 
ATOM 5825  N N1    . DA  I 5 4   ? 125.64800 142.65700 72.27400  1.000 183.74161 ? -69 DA  I N1    1 
ATOM 5826  C C2    . DA  I 5 4   ? 124.38800 143.00400 71.98200  1.000 183.74161 ? -69 DA  I C2    1 
ATOM 5827  N N3    . DA  I 5 4   ? 123.93300 144.15000 71.46800  1.000 183.74161 ? -69 DA  I N3    1 
ATOM 5828  C C4    . DA  I 5 4   ? 124.94400 145.00900 71.24400  1.000 183.74161 ? -69 DA  I C4    1 
ATOM 5829  P P     . DG  I 5 5   ? 120.37700 149.72900 70.73400  1.000 178.44853 ? -68 DG  I P     1 
ATOM 5830  O OP1   . DG  I 5 5   ? 119.19400 150.04400 69.90300  1.000 178.44853 ? -68 DG  I OP1   1 
ATOM 5831  O OP2   . DG  I 5 5   ? 121.19900 150.82400 71.29400  1.000 178.44853 ? -68 DG  I OP2   1 
ATOM 5832  O "O5'" . DG  I 5 5   ? 119.92900 148.79100 71.94400  1.000 178.44853 ? -68 DG  I "O5'" 1 
ATOM 5833  C "C5'" . DG  I 5 5   ? 119.28500 147.54800 71.67400  1.000 178.44853 ? -68 DG  I "C5'" 1 
ATOM 5834  C "C4'" . DG  I 5 5   ? 119.23600 146.66200 72.91200  1.000 178.44853 ? -68 DG  I "C4'" 1 
ATOM 5835  O "O4'" . DG  I 5 5   ? 120.44300 145.85900 73.06200  1.000 178.44853 ? -68 DG  I "O4'" 1 
ATOM 5836  C "C3'" . DG  I 5 5   ? 119.03700 147.40200 74.23400  1.000 178.44853 ? -68 DG  I "C3'" 1 
ATOM 5837  O "O3'" . DG  I 5 5   ? 118.14700 146.66100 75.05600  1.000 178.44853 ? -68 DG  I "O3'" 1 
ATOM 5838  C "C2'" . DG  I 5 5   ? 120.44600 147.42700 74.82200  1.000 178.44853 ? -68 DG  I "C2'" 1 
ATOM 5839  C "C1'" . DG  I 5 5   ? 120.97200 146.08100 74.35100  1.000 178.44853 ? -68 DG  I "C1'" 1 
ATOM 5840  N N9    . DG  I 5 5   ? 122.42800 145.89300 74.38200  1.000 178.44853 ? -68 DG  I N9    1 
ATOM 5841  C C8    . DG  I 5 5   ? 123.41300 146.80700 74.08500  1.000 178.44853 ? -68 DG  I C8    1 
ATOM 5842  N N7    . DG  I 5 5   ? 124.62500 146.34000 74.25700  1.000 178.44853 ? -68 DG  I N7    1 
ATOM 5843  C C5    . DG  I 5 5   ? 124.42700 145.05400 74.75000  1.000 178.44853 ? -68 DG  I C5    1 
ATOM 5844  C C6    . DG  I 5 5   ? 125.36300 144.05700 75.14400  1.000 178.44853 ? -68 DG  I C6    1 
ATOM 5845  O O6    . DG  I 5 5   ? 126.60400 144.10600 75.13500  1.000 178.44853 ? -68 DG  I O6    1 
ATOM 5846  N N1    . DG  I 5 5   ? 124.72400 142.89800 75.58500  1.000 178.44853 ? -68 DG  I N1    1 
ATOM 5847  C C2    . DG  I 5 5   ? 123.36000 142.72300 75.63500  1.000 178.44853 ? -68 DG  I C2    1 
ATOM 5848  N N2    . DG  I 5 5   ? 122.92700 141.54100 76.09100  1.000 178.44853 ? -68 DG  I N2    1 
ATOM 5849  N N3    . DG  I 5 5   ? 122.48200 143.64500 75.28000  1.000 178.44853 ? -68 DG  I N3    1 
ATOM 5850  C C4    . DG  I 5 5   ? 123.08100 144.77700 74.84600  1.000 178.44853 ? -68 DG  I C4    1 
ATOM 5851  P P     . DA  I 5 6   ? 116.63800 147.16400 75.27600  1.000 172.37019 ? -67 DA  I P     1 
ATOM 5852  O OP1   . DA  I 5 6   ? 115.92900 147.09800 73.98000  1.000 172.37019 ? -67 DA  I OP1   1 
ATOM 5853  O OP2   . DA  I 5 6   ? 116.71200 148.44700 76.00800  1.000 172.37019 ? -67 DA  I OP2   1 
ATOM 5854  O "O5'" . DA  I 5 6   ? 116.00600 146.08800 76.27500  1.000 172.37019 ? -67 DA  I "O5'" 1 
ATOM 5855  C "C5'" . DA  I 5 6   ? 116.56700 145.90600 77.56600  1.000 172.37019 ? -67 DA  I "C5'" 1 
ATOM 5856  C "C4'" . DA  I 5 6   ? 117.23300 144.54700 77.72100  1.000 172.37019 ? -67 DA  I "C4'" 1 
ATOM 5857  O "O4'" . DA  I 5 6   ? 118.62200 144.61800 77.29500  1.000 172.37019 ? -67 DA  I "O4'" 1 
ATOM 5858  C "C3'" . DA  I 5 6   ? 117.25700 144.03700 79.16000  1.000 172.37019 ? -67 DA  I "C3'" 1 
ATOM 5859  O "O3'" . DA  I 5 6   ? 116.99800 142.63300 79.21000  1.000 172.37019 ? -67 DA  I "O3'" 1 
ATOM 5860  C "C2'" . DA  I 5 6   ? 118.66900 144.38000 79.60800  1.000 172.37019 ? -67 DA  I "C2'" 1 
ATOM 5861  C "C1'" . DA  I 5 6   ? 119.45000 144.14300 78.33200  1.000 172.37019 ? -67 DA  I "C1'" 1 
ATOM 5862  N N9    . DA  I 5 6   ? 120.71000 144.87800 78.26600  1.000 172.37019 ? -67 DA  I N9    1 
ATOM 5863  C C8    . DA  I 5 6   ? 120.86000 146.21000 78.01600  1.000 172.37019 ? -67 DA  I C8    1 
ATOM 5864  N N7    . DA  I 5 6   ? 122.10400 146.61900 78.02200  1.000 172.37019 ? -67 DA  I N7    1 
ATOM 5865  C C5    . DA  I 5 6   ? 122.82200 145.48600 78.34700  1.000 172.37019 ? -67 DA  I C5    1 
ATOM 5866  C C6    . DA  I 5 6   ? 124.19800 145.25700 78.52800  1.000 172.37019 ? -67 DA  I C6    1 
ATOM 5867  N N6    . DA  I 5 6   ? 125.12100 146.21500 78.40200  1.000 172.37019 ? -67 DA  I N6    1 
ATOM 5868  N N1    . DA  I 5 6   ? 124.59100 144.00600 78.85000  1.000 172.37019 ? -67 DA  I N1    1 
ATOM 5869  C C2    . DA  I 5 6   ? 123.66400 143.05000 78.98000  1.000 172.37019 ? -67 DA  I C2    1 
ATOM 5870  N N3    . DA  I 5 6   ? 122.34000 143.14400 78.83100  1.000 172.37019 ? -67 DA  I N3    1 
ATOM 5871  C C4    . DA  I 5 6   ? 121.98100 144.40000 78.51200  1.000 172.37019 ? -67 DA  I C4    1 
ATOM 5872  P P     . DA  I 5 7   ? 116.47800 141.97400 80.58000  1.000 164.04108 ? -66 DA  I P     1 
ATOM 5873  O OP1   . DA  I 5 7   ? 115.62500 140.81700 80.23000  1.000 164.04108 ? -66 DA  I OP1   1 
ATOM 5874  O OP2   . DA  I 5 7   ? 115.91900 143.08100 81.38500  1.000 164.04108 ? -66 DA  I OP2   1 
ATOM 5875  O "O5'" . DA  I 5 7   ? 117.79400 141.45400 81.33500  1.000 164.04108 ? -66 DA  I "O5'" 1 
ATOM 5876  C "C5'" . DA  I 5 7   ? 118.66100 140.48700 80.73200  1.000 164.04108 ? -66 DA  I "C5'" 1 
ATOM 5877  C "C4'" . DA  I 5 7   ? 119.80300 140.12600 81.67700  1.000 164.04108 ? -66 DA  I "C4'" 1 
ATOM 5878  O "O4'" . DA  I 5 7   ? 120.91900 141.01500 81.45300  1.000 164.04108 ? -66 DA  I "O4'" 1 
ATOM 5879  C "C3'" . DA  I 5 7   ? 119.46700 140.22400 83.16700  1.000 164.04108 ? -66 DA  I "C3'" 1 
ATOM 5880  O "O3'" . DA  I 5 7   ? 119.97400 139.07400 83.85900  1.000 164.04108 ? -66 DA  I "O3'" 1 
ATOM 5881  C "C2'" . DA  I 5 7   ? 120.16100 141.52400 83.59000  1.000 164.04108 ? -66 DA  I "C2'" 1 
ATOM 5882  C "C1'" . DA  I 5 7   ? 121.37400 141.53900 82.67900  1.000 164.04108 ? -66 DA  I "C1'" 1 
ATOM 5883  N N9    . DA  I 5 7   ? 121.86500 142.87800 82.37000  1.000 164.04108 ? -66 DA  I N9    1 
ATOM 5884  C C8    . DA  I 5 7   ? 121.12200 143.93400 81.93800  1.000 164.04108 ? -66 DA  I C8    1 
ATOM 5885  N N7    . DA  I 5 7   ? 121.81700 145.01300 81.68400  1.000 164.04108 ? -66 DA  I N7    1 
ATOM 5886  C C5    . DA  I 5 7   ? 123.11300 144.63800 81.96200  1.000 164.04108 ? -66 DA  I C5    1 
ATOM 5887  C C6    . DA  I 5 7   ? 124.33200 145.33200 81.89900  1.000 164.04108 ? -66 DA  I C6    1 
ATOM 5888  N N6    . DA  I 5 7   ? 124.43600 146.60800 81.51200  1.000 164.04108 ? -66 DA  I N6    1 
ATOM 5889  N N1    . DA  I 5 7   ? 125.44700 144.66200 82.24500  1.000 164.04108 ? -66 DA  I N1    1 
ATOM 5890  C C2    . DA  I 5 7   ? 125.34400 143.38700 82.63300  1.000 164.04108 ? -66 DA  I C2    1 
ATOM 5891  N N3    . DA  I 5 7   ? 124.25700 142.62600 82.72800  1.000 164.04108 ? -66 DA  I N3    1 
ATOM 5892  C C4    . DA  I 5 7   ? 123.16500 143.31700 82.37600  1.000 164.04108 ? -66 DA  I C4    1 
ATOM 5893  P P     . DT  I 5 8   ? 119.60700 138.80400 85.40500  1.000 158.92104 ? -65 DT  I P     1 
ATOM 5894  O OP1   . DT  I 5 8   ? 119.28700 137.36300 85.50300  1.000 158.92104 ? -65 DT  I OP1   1 
ATOM 5895  O OP2   . DT  I 5 8   ? 118.60900 139.79900 85.85900  1.000 158.92104 ? -65 DT  I OP2   1 
ATOM 5896  O "O5'" . DT  I 5 8   ? 120.97800 139.06200 86.19200  1.000 158.92104 ? -65 DT  I "O5'" 1 
ATOM 5897  C "C5'" . DT  I 5 8   ? 122.02300 138.08900 86.13800  1.000 158.92104 ? -65 DT  I "C5'" 1 
ATOM 5898  C "C4'" . DT  I 5 8   ? 123.37800 138.73100 86.38000  1.000 158.92104 ? -65 DT  I "C4'" 1 
ATOM 5899  O "O4'" . DT  I 5 8   ? 123.40900 140.04000 85.78600  1.000 158.92104 ? -65 DT  I "O4'" 1 
ATOM 5900  C "C3'" . DT  I 5 8   ? 123.77800 138.93400 87.84800  1.000 158.92104 ? -65 DT  I "C3'" 1 
ATOM 5901  O "O3'" . DT  I 5 8   ? 124.89300 138.10300 88.17000  1.000 158.92104 ? -65 DT  I "O3'" 1 
ATOM 5902  C "C2'" . DT  I 5 8   ? 124.14400 140.42200 87.94100  1.000 158.92104 ? -65 DT  I "C2'" 1 
ATOM 5903  C "C1'" . DT  I 5 8   ? 124.34500 140.80500 86.48900  1.000 158.92104 ? -65 DT  I "C1'" 1 
ATOM 5904  N N1    . DT  I 5 8   ? 124.13200 142.25100 86.15700  1.000 158.92104 ? -65 DT  I N1    1 
ATOM 5905  C C2    . DT  I 5 8   ? 125.22900 143.07500 86.05000  1.000 158.92104 ? -65 DT  I C2    1 
ATOM 5906  O O2    . DT  I 5 8   ? 126.37100 142.68900 86.21600  1.000 158.92104 ? -65 DT  I O2    1 
ATOM 5907  N N3    . DT  I 5 8   ? 124.94100 144.36900 85.70700  1.000 158.92104 ? -65 DT  I N3    1 
ATOM 5908  C C4    . DT  I 5 8   ? 123.69500 144.91700 85.48000  1.000 158.92104 ? -65 DT  I C4    1 
ATOM 5909  O O4    . DT  I 5 8   ? 123.54000 146.09600 85.18400  1.000 158.92104 ? -65 DT  I O4    1 
ATOM 5910  C C5    . DT  I 5 8   ? 122.58700 144.01100 85.61800  1.000 158.92104 ? -65 DT  I C5    1 
ATOM 5911  C C7    . DT  I 5 8   ? 121.19200 144.50900 85.40100  1.000 158.92104 ? -65 DT  I C7    1 
ATOM 5912  C C6    . DT  I 5 8   ? 122.85100 142.73000 85.94300  1.000 158.92104 ? -65 DT  I C6    1 
ATOM 5913  P P     . DC  I 5 9   ? 124.83500 137.12300 89.44100  1.000 153.20083 ? -64 DC  I P     1 
ATOM 5914  O OP1   . DC  I 5 9   ? 125.22500 135.77500 88.97600  1.000 153.20083 ? -64 DC  I OP1   1 
ATOM 5915  O OP2   . DC  I 5 9   ? 123.52500 137.32400 90.09900  1.000 153.20083 ? -64 DC  I OP2   1 
ATOM 5916  O "O5'" . DC  I 5 9   ? 125.98600 137.66100 90.42300  1.000 153.20083 ? -64 DC  I "O5'" 1 
ATOM 5917  C "C5'" . DC  I 5 9   ? 125.93400 138.98500 90.95900  1.000 153.20083 ? -64 DC  I "C5'" 1 
ATOM 5918  C "C4'" . DC  I 5 9   ? 127.25000 139.71400 90.73100  1.000 153.20083 ? -64 DC  I "C4'" 1 
ATOM 5919  O "O4'" . DC  I 5 9   ? 127.03000 140.87200 89.87700  1.000 153.20083 ? -64 DC  I "O4'" 1 
ATOM 5920  C "C3'" . DC  I 5 9   ? 127.91000 140.27000 91.98900  1.000 153.20083 ? -64 DC  I "C3'" 1 
ATOM 5921  O "O3'" . DC  I 5 9   ? 129.32900 140.28900 91.79700  1.000 153.20083 ? -64 DC  I "O3'" 1 
ATOM 5922  C "C2'" . DC  I 5 9   ? 127.32400 141.68000 92.03400  1.000 153.20083 ? -64 DC  I "C2'" 1 
ATOM 5923  C "C1'" . DC  I 5 9   ? 127.42700 142.04300 90.56600  1.000 153.20083 ? -64 DC  I "C1'" 1 
ATOM 5924  N N1    . DC  I 5 9   ? 126.52600 143.14400 90.12900  1.000 153.20083 ? -64 DC  I N1    1 
ATOM 5925  C C2    . DC  I 5 9   ? 127.05500 144.37300 89.72700  1.000 153.20083 ? -64 DC  I C2    1 
ATOM 5926  O O2    . DC  I 5 9   ? 128.27600 144.55700 89.79100  1.000 153.20083 ? -64 DC  I O2    1 
ATOM 5927  N N3    . DC  I 5 9   ? 126.20200 145.34200 89.31000  1.000 153.20083 ? -64 DC  I N3    1 
ATOM 5928  C C4    . DC  I 5 9   ? 124.89000 145.10500 89.26400  1.000 153.20083 ? -64 DC  I C4    1 
ATOM 5929  N N4    . DC  I 5 9   ? 124.08700 146.08100 88.84300  1.000 153.20083 ? -64 DC  I N4    1 
ATOM 5930  C C5    . DC  I 5 9   ? 124.34400 143.85500 89.64900  1.000 153.20083 ? -64 DC  I C5    1 
ATOM 5931  C C6    . DC  I 5 9   ? 125.19000 142.92100 90.07600  1.000 153.20083 ? -64 DC  I C6    1 
ATOM 5932  P P     . DC  I 5 10  ? 130.34300 140.35500 93.04300  1.000 145.50979 ? -63 DC  I P     1 
ATOM 5933  O OP1   . DC  I 5 10  ? 131.06700 139.06600 93.10700  1.000 145.50979 ? -63 DC  I OP1   1 
ATOM 5934  O OP2   . DC  I 5 10  ? 129.60000 140.82400 94.23200  1.000 145.50979 ? -63 DC  I OP2   1 
ATOM 5935  O "O5'" . DC  I 5 10  ? 131.37100 141.51100 92.63200  1.000 145.50979 ? -63 DC  I "O5'" 1 
ATOM 5936  C "C5'" . DC  I 5 10  ? 130.89300 142.68300 91.99200  1.000 145.50979 ? -63 DC  I "C5'" 1 
ATOM 5937  C "C4'" . DC  I 5 10  ? 131.79000 143.87400 92.28400  1.000 145.50979 ? -63 DC  I "C4'" 1 
ATOM 5938  O "O4'" . DC  I 5 10  ? 131.07800 145.08200 91.92300  1.000 145.50979 ? -63 DC  I "O4'" 1 
ATOM 5939  C "C3'" . DC  I 5 10  ? 132.14900 144.05800 93.74600  1.000 145.50979 ? -63 DC  I "C3'" 1 
ATOM 5940  O "O3'" . DC  I 5 10  ? 133.34800 144.82600 93.86100  1.000 145.50979 ? -63 DC  I "O3'" 1 
ATOM 5941  C "C2'" . DC  I 5 10  ? 130.93300 144.81400 94.25600  1.000 145.50979 ? -63 DC  I "C2'" 1 
ATOM 5942  C "C1'" . DC  I 5 10  ? 130.64400 145.75700 93.09000  1.000 145.50979 ? -63 DC  I "C1'" 1 
ATOM 5943  N N1    . DC  I 5 10  ? 129.19300 146.00500 92.90900  1.000 145.50979 ? -63 DC  I N1    1 
ATOM 5944  C C2    . DC  I 5 10  ? 128.73400 147.24700 92.44600  1.000 145.50979 ? -63 DC  I C2    1 
ATOM 5945  O O2    . DC  I 5 10  ? 129.54500 148.15300 92.22000  1.000 145.50979 ? -63 DC  I O2    1 
ATOM 5946  N N3    . DC  I 5 10  ? 127.39800 147.42100 92.27100  1.000 145.50979 ? -63 DC  I N3    1 
ATOM 5947  C C4    . DC  I 5 10  ? 126.55600 146.42100 92.52100  1.000 145.50979 ? -63 DC  I C4    1 
ATOM 5948  N N4    . DC  I 5 10  ? 125.25300 146.63500 92.33500  1.000 145.50979 ? -63 DC  I N4    1 
ATOM 5949  C C5    . DC  I 5 10  ? 127.00700 145.15800 92.98700  1.000 145.50979 ? -63 DC  I C5    1 
ATOM 5950  C C6    . DC  I 5 10  ? 128.31700 144.99200 93.15100  1.000 145.50979 ? -63 DC  I C6    1 
ATOM 5951  P P     . DC  I 5 11  ? 133.96500 145.16800 95.30600  1.000 137.37781 ? -62 DC  I P     1 
ATOM 5952  O OP1   . DC  I 5 11  ? 135.42300 145.33100 95.11800  1.000 137.37781 ? -62 DC  I OP1   1 
ATOM 5953  O OP2   . DC  I 5 11  ? 133.46400 144.17200 96.28000  1.000 137.37781 ? -62 DC  I OP2   1 
ATOM 5954  O "O5'" . DC  I 5 11  ? 133.34000 146.59200 95.67200  1.000 137.37781 ? -62 DC  I "O5'" 1 
ATOM 5955  C "C5'" . DC  I 5 11  ? 134.17900 147.64100 96.14400  1.000 137.37781 ? -62 DC  I "C5'" 1 
ATOM 5956  C "C4'" . DC  I 5 11  ? 133.79400 148.95900 95.50200  1.000 137.37781 ? -62 DC  I "C4'" 1 
ATOM 5957  O "O4'" . DC  I 5 11  ? 132.48300 148.84400 94.89900  1.000 137.37781 ? -62 DC  I "O4'" 1 
ATOM 5958  C "C3'" . DC  I 5 11  ? 133.71300 150.15300 96.44500  1.000 137.37781 ? -62 DC  I "C3'" 1 
ATOM 5959  O "O3'" . DC  I 5 11  ? 134.13500 151.31400 95.75500  1.000 137.37781 ? -62 DC  I "O3'" 1 
ATOM 5960  C "C2'" . DC  I 5 11  ? 132.22400 150.20300 96.78700  1.000 137.37781 ? -62 DC  I "C2'" 1 
ATOM 5961  C "C1'" . DC  I 5 11  ? 131.61000 149.80700 95.45500  1.000 137.37781 ? -62 DC  I "C1'" 1 
ATOM 5962  N N1    . DC  I 5 11  ? 130.26700 149.18100 95.55000  1.000 137.37781 ? -62 DC  I N1    1 
ATOM 5963  C C2    . DC  I 5 11  ? 129.13000 149.91900 95.21500  1.000 137.37781 ? -62 DC  I C2    1 
ATOM 5964  O O2    . DC  I 5 11  ? 129.26000 151.09400 94.86400  1.000 137.37781 ? -62 DC  I O2    1 
ATOM 5965  N N3    . DC  I 5 11  ? 127.91700 149.31700 95.27900  1.000 137.37781 ? -62 DC  I N3    1 
ATOM 5966  C C4    . DC  I 5 11  ? 127.82400 148.04300 95.65700  1.000 137.37781 ? -62 DC  I C4    1 
ATOM 5967  N N4    . DC  I 5 11  ? 126.60900 147.49000 95.71100  1.000 137.37781 ? -62 DC  I N4    1 
ATOM 5968  C C5    . DC  I 5 11  ? 128.97300 147.27800 96.00000  1.000 137.37781 ? -62 DC  I C5    1 
ATOM 5969  C C6    . DC  I 5 11  ? 130.16100 147.88300 95.93400  1.000 137.37781 ? -62 DC  I C6    1 
ATOM 5970  P P     . DG  I 5 12  ? 134.53800 152.64500 96.55500  1.000 129.23039 ? -61 DG  I P     1 
ATOM 5971  O OP1   . DG  I 5 12  ? 135.43000 153.44200 95.68400  1.000 129.23039 ? -61 DG  I OP1   1 
ATOM 5972  O OP2   . DG  I 5 12  ? 135.00200 152.23400 97.89800  1.000 129.23039 ? -61 DG  I OP2   1 
ATOM 5973  O "O5'" . DG  I 5 12  ? 133.14600 153.41200 96.75000  1.000 129.23039 ? -61 DG  I "O5'" 1 
ATOM 5974  C "C5'" . DG  I 5 12  ? 132.80800 153.94800 98.01800  1.000 129.23039 ? -61 DG  I "C5'" 1 
ATOM 5975  C "C4'" . DG  I 5 12  ? 131.50200 154.72000 97.95600  1.000 129.23039 ? -61 DG  I "C4'" 1 
ATOM 5976  O "O4'" . DG  I 5 12  ? 130.44700 153.86300 97.44100  1.000 129.23039 ? -61 DG  I "O4'" 1 
ATOM 5977  C "C3'" . DG  I 5 12  ? 130.99800 155.22400 99.30600  1.000 129.23039 ? -61 DG  I "C3'" 1 
ATOM 5978  O "O3'" . DG  I 5 12  ? 130.32300 156.46000 99.13700  1.000 129.23039 ? -61 DG  I "O3'" 1 
ATOM 5979  C "C2'" . DG  I 5 12  ? 130.03900 154.12100 99.72300  1.000 129.23039 ? -61 DG  I "C2'" 1 
ATOM 5980  C "C1'" . DG  I 5 12  ? 129.40000 153.81500 98.38500  1.000 129.23039 ? -61 DG  I "C1'" 1 
ATOM 5981  N N9    . DG  I 5 12  ? 128.75200 152.51500 98.31000  1.000 129.23039 ? -61 DG  I N9    1 
ATOM 5982  C C8    . DG  I 5 12  ? 129.32000 151.28700 98.53600  1.000 129.23039 ? -61 DG  I C8    1 
ATOM 5983  N N7    . DG  I 5 12  ? 128.47600 150.29800 98.41300  1.000 129.23039 ? -61 DG  I N7    1 
ATOM 5984  C C5    . DG  I 5 12  ? 127.26900 150.91800 98.12200  1.000 129.23039 ? -61 DG  I C5    1 
ATOM 5985  C C6    . DG  I 5 12  ? 125.99000 150.36500 97.89200  1.000 129.23039 ? -61 DG  I C6    1 
ATOM 5986  O O6    . DG  I 5 12  ? 125.65600 149.17600 97.90000  1.000 129.23039 ? -61 DG  I O6    1 
ATOM 5987  N N1    . DG  I 5 12  ? 125.04300 151.35200 97.63100  1.000 129.23039 ? -61 DG  I N1    1 
ATOM 5988  C C2    . DG  I 5 12  ? 125.30600 152.70000 97.59500  1.000 129.23039 ? -61 DG  I C2    1 
ATOM 5989  N N2    . DG  I 5 12  ? 124.27300 153.51000 97.33200  1.000 129.23039 ? -61 DG  I N2    1 
ATOM 5990  N N3    . DG  I 5 12  ? 126.49700 153.22600 97.81300  1.000 129.23039 ? -61 DG  I N3    1 
ATOM 5991  C C4    . DG  I 5 12  ? 127.42600 152.28100 98.06600  1.000 129.23039 ? -61 DG  I C4    1 
ATOM 5992  P P     . DG  I 5 13  ? 130.77500 157.73900 99.99300  1.000 119.82968 ? -60 DG  I P     1 
ATOM 5993  O OP1   . DG  I 5 13  ? 131.19800 158.77500 99.02600  1.000 119.82968 ? -60 DG  I OP1   1 
ATOM 5994  O OP2   . DG  I 5 13  ? 131.71800 157.27100 101.03300 1.000 119.82968 ? -60 DG  I OP2   1 
ATOM 5995  O "O5'" . DG  I 5 13  ? 129.43800 158.23800 100.72200 1.000 119.82968 ? -60 DG  I "O5'" 1 
ATOM 5996  C "C5'" . DG  I 5 13  ? 128.42500 157.31300 101.11900 1.000 119.82968 ? -60 DG  I "C5'" 1 
ATOM 5997  C "C4'" . DG  I 5 13  ? 127.05000 157.86100 100.77700 1.000 119.82968 ? -60 DG  I "C4'" 1 
ATOM 5998  O "O4'" . DG  I 5 13  ? 126.27200 156.85400 100.08200 1.000 119.82968 ? -60 DG  I "O4'" 1 
ATOM 5999  C "C3'" . DG  I 5 13  ? 126.21400 158.24700 101.98400 1.000 119.82968 ? -60 DG  I "C3'" 1 
ATOM 6000  O "O3'" . DG  I 5 13  ? 125.30100 159.28300 101.65000 1.000 119.82968 ? -60 DG  I "O3'" 1 
ATOM 6001  C "C2'" . DG  I 5 13  ? 125.49300 156.95000 102.32100 1.000 119.82968 ? -60 DG  I "C2'" 1 
ATOM 6002  C "C1'" . DG  I 5 13  ? 125.29400 156.30700 100.95000 1.000 119.82968 ? -60 DG  I "C1'" 1 
ATOM 6003  N N9    . DG  I 5 13  ? 125.42500 154.85300 100.95900 1.000 119.82968 ? -60 DG  I N9    1 
ATOM 6004  C C8    . DG  I 5 13  ? 126.58000 154.12700 101.10800 1.000 119.82968 ? -60 DG  I C8    1 
ATOM 6005  N N7    . DG  I 5 13  ? 126.39000 152.83800 101.07600 1.000 119.82968 ? -60 DG  I N7    1 
ATOM 6006  C C5    . DG  I 5 13  ? 125.02000 152.69900 100.88700 1.000 119.82968 ? -60 DG  I C5    1 
ATOM 6007  C C6    . DG  I 5 13  ? 124.23100 151.53100 100.76200 1.000 119.82968 ? -60 DG  I C6    1 
ATOM 6008  O O6    . DG  I 5 13  ? 124.59900 150.35000 100.80000 1.000 119.82968 ? -60 DG  I O6    1 
ATOM 6009  N N1    . DG  I 5 13  ? 122.88700 151.83200 100.57700 1.000 119.82968 ? -60 DG  I N1    1 
ATOM 6010  C C2    . DG  I 5 13  ? 122.37100 153.10300 100.51700 1.000 119.82968 ? -60 DG  I C2    1 
ATOM 6011  N N2    . DG  I 5 13  ? 121.04600 153.20300 100.33300 1.000 119.82968 ? -60 DG  I N2    1 
ATOM 6012  N N3    . DG  I 5 13  ? 123.10100 154.20600 100.62800 1.000 119.82968 ? -60 DG  I N3    1 
ATOM 6013  C C4    . DG  I 5 13  ? 124.41300 153.92800 100.80900 1.000 119.82968 ? -60 DG  I C4    1 
ATOM 6014  P P     . DT  I 5 14  ? 124.62900 160.15900 102.82000 1.000 110.54139 ? -59 DT  I P     1 
ATOM 6015  O OP1   . DT  I 5 14  ? 124.15900 161.42900 102.22600 1.000 110.54139 ? -59 DT  I OP1   1 
ATOM 6016  O OP2   . DT  I 5 14  ? 125.59300 160.18600 103.94100 1.000 110.54139 ? -59 DT  I OP2   1 
ATOM 6017  O "O5'" . DT  I 5 14  ? 123.36100 159.29900 103.29500 1.000 110.54139 ? -59 DT  I "O5'" 1 
ATOM 6018  C "C5'" . DT  I 5 14  ? 122.27700 159.06800 102.40000 1.000 110.54139 ? -59 DT  I "C5'" 1 
ATOM 6019  C "C4'" . DT  I 5 14  ? 121.23100 158.15100 103.02200 1.000 110.54139 ? -59 DT  I "C4'" 1 
ATOM 6020  O "O4'" . DT  I 5 14  ? 121.59600 156.76400 102.84700 1.000 110.54139 ? -59 DT  I "O4'" 1 
ATOM 6021  C "C3'" . DT  I 5 14  ? 120.97300 158.34400 104.52200 1.000 110.54139 ? -59 DT  I "C3'" 1 
ATOM 6022  O "O3'" . DT  I 5 14  ? 119.60400 158.69700 104.71900 1.000 110.54139 ? -59 DT  I "O3'" 1 
ATOM 6023  C "C2'" . DT  I 5 14  ? 121.32600 156.98000 105.14500 1.000 110.54139 ? -59 DT  I "C2'" 1 
ATOM 6024  C "C1'" . DT  I 5 14  ? 121.15000 156.04100 103.96500 1.000 110.54139 ? -59 DT  I "C1'" 1 
ATOM 6025  N N1    . DT  I 5 14  ? 121.94500 154.78500 104.03500 1.000 110.54139 ? -59 DT  I N1    1 
ATOM 6026  C C2    . DT  I 5 14  ? 121.31700 153.57900 103.83000 1.000 110.54139 ? -59 DT  I C2    1 
ATOM 6027  O O2    . DT  I 5 14  ? 120.11800 153.47400 103.65400 1.000 110.54139 ? -59 DT  I O2    1 
ATOM 6028  N N3    . DT  I 5 14  ? 122.14600 152.48800 103.87800 1.000 110.54139 ? -59 DT  I N3    1 
ATOM 6029  C C4    . DT  I 5 14  ? 123.51400 152.49000 104.07600 1.000 110.54139 ? -59 DT  I C4    1 
ATOM 6030  O O4    . DT  I 5 14  ? 124.17700 151.46200 104.09800 1.000 110.54139 ? -59 DT  I O4    1 
ATOM 6031  C C5    . DT  I 5 14  ? 124.10900 153.78800 104.25800 1.000 110.54139 ? -59 DT  I C5    1 
ATOM 6032  C C7    . DT  I 5 14  ? 125.58600 153.91100 104.48600 1.000 110.54139 ? -59 DT  I C7    1 
ATOM 6033  C C6    . DT  I 5 14  ? 123.30700 154.86000 104.22000 1.000 110.54139 ? -59 DT  I C6    1 
ATOM 6034  P P     . DG  I 5 15  ? 119.07100 159.19000 106.15300 1.000 99.22689  ? -58 DG  I P     1 
ATOM 6035  O OP1   . DG  I 5 15  ? 118.08000 160.26300 105.92300 1.000 99.22689  ? -58 DG  I OP1   1 
ATOM 6036  O OP2   . DG  I 5 15  ? 120.23600 159.45300 107.02500 1.000 99.22689  ? -58 DG  I OP2   1 
ATOM 6037  O "O5'" . DG  I 5 15  ? 118.30100 157.91000 106.71200 1.000 99.22689  ? -58 DG  I "O5'" 1 
ATOM 6038  C "C5'" . DG  I 5 15  ? 117.51800 157.11900 105.82400 1.000 99.22689  ? -58 DG  I "C5'" 1 
ATOM 6039  C "C4'" . DG  I 5 15  ? 117.14100 155.79700 106.46400 1.000 99.22689  ? -58 DG  I "C4'" 1 
ATOM 6040  O "O4'" . DG  I 5 15  ? 118.23000 154.85800 106.31800 1.000 99.22689  ? -58 DG  I "O4'" 1 
ATOM 6041  C "C3'" . DG  I 5 15  ? 116.82700 155.85200 107.96000 1.000 99.22689  ? -58 DG  I "C3'" 1 
ATOM 6042  O "O3'" . DG  I 5 15  ? 115.65300 155.09700 108.20900 1.000 99.22689  ? -58 DG  I "O3'" 1 
ATOM 6043  C "C2'" . DG  I 5 15  ? 118.06000 155.19900 108.59100 1.000 99.22689  ? -58 DG  I "C2'" 1 
ATOM 6044  C "C1'" . DG  I 5 15  ? 118.40700 154.17500 107.53100 1.000 99.22689  ? -58 DG  I "C1'" 1 
ATOM 6045  N N9    . DG  I 5 15  ? 119.78600 153.71100 107.56500 1.000 99.22689  ? -58 DG  I N9    1 
ATOM 6046  C C8    . DG  I 5 15  ? 120.91600 154.47400 107.72000 1.000 99.22689  ? -58 DG  I C8    1 
ATOM 6047  N N7    . DG  I 5 15  ? 122.02000 153.78100 107.66900 1.000 99.22689  ? -58 DG  I N7    1 
ATOM 6048  C C5    . DG  I 5 15  ? 121.59200 152.48000 107.44600 1.000 99.22689  ? -58 DG  I C5    1 
ATOM 6049  C C6    . DG  I 5 15  ? 122.33600 151.28800 107.29600 1.000 99.22689  ? -58 DG  I C6    1 
ATOM 6050  O O6    . DG  I 5 15  ? 123.56400 151.13900 107.33100 1.000 99.22689  ? -58 DG  I O6    1 
ATOM 6051  N N1    . DG  I 5 15  ? 121.51000 150.19000 107.08600 1.000 99.22689  ? -58 DG  I N1    1 
ATOM 6052  C C2    . DG  I 5 15  ? 120.13800 150.23700 107.02800 1.000 99.22689  ? -58 DG  I C2    1 
ATOM 6053  N N2    . DG  I 5 15  ? 119.50600 149.07600 106.81700 1.000 99.22689  ? -58 DG  I N2    1 
ATOM 6054  N N3    . DG  I 5 15  ? 119.43200 151.34600 107.16600 1.000 99.22689  ? -58 DG  I N3    1 
ATOM 6055  C C4    . DG  I 5 15  ? 120.22100 152.42500 107.37200 1.000 99.22689  ? -58 DG  I C4    1 
ATOM 6056  P P     . DC  I 5 16  ? 114.65200 155.50400 109.39400 1.000 92.88588  ? -57 DC  I P     1 
ATOM 6057  O OP1   . DC  I 5 16  ? 113.70100 156.48900 108.83700 1.000 92.88588  ? -57 DC  I OP1   1 
ATOM 6058  O OP2   . DC  I 5 16  ? 115.45800 155.84400 110.58600 1.000 92.88588  ? -57 DC  I OP2   1 
ATOM 6059  O "O5'" . DC  I 5 16  ? 113.86200 154.14900 109.70000 1.000 92.88588  ? -57 DC  I "O5'" 1 
ATOM 6060  C "C5'" . DC  I 5 16  ? 113.57500 153.23900 108.63700 1.000 92.88588  ? -57 DC  I "C5'" 1 
ATOM 6061  C "C4'" . DC  I 5 16  ? 113.82400 151.79700 109.05900 1.000 92.88588  ? -57 DC  I "C4'" 1 
ATOM 6062  O "O4'" . DC  I 5 16  ? 115.24100 151.50000 109.05500 1.000 92.88588  ? -57 DC  I "O4'" 1 
ATOM 6063  C "C3'" . DC  I 5 16  ? 113.30800 151.41100 110.43700 1.000 92.88588  ? -57 DC  I "C3'" 1 
ATOM 6064  O "O3'" . DC  I 5 16  ? 112.69900 150.14600 110.35000 1.000 92.88588  ? -57 DC  I "O3'" 1 
ATOM 6065  C "C2'" . DC  I 5 16  ? 114.57900 151.37000 111.28800 1.000 92.88588  ? -57 DC  I "C2'" 1 
ATOM 6066  C "C1'" . DC  I 5 16  ? 115.60600 150.89700 110.27700 1.000 92.88588  ? -57 DC  I "C1'" 1 
ATOM 6067  N N1    . DC  I 5 16  ? 116.99800 151.31400 110.57200 1.000 92.88588  ? -57 DC  I N1    1 
ATOM 6068  C C2    . DC  I 5 16  ? 118.05000 150.43900 110.29700 1.000 92.88588  ? -57 DC  I C2    1 
ATOM 6069  O O2    . DC  I 5 16  ? 117.79700 149.31500 109.85400 1.000 92.88588  ? -57 DC  I O2    1 
ATOM 6070  N N3    . DC  I 5 16  ? 119.31800 150.84200 110.53900 1.000 92.88588  ? -57 DC  I N3    1 
ATOM 6071  C C4    . DC  I 5 16  ? 119.54900 152.06100 111.02000 1.000 92.88588  ? -57 DC  I C4    1 
ATOM 6072  N N4    . DC  I 5 16  ? 120.81700 152.41500 111.24500 1.000 92.88588  ? -57 DC  I N4    1 
ATOM 6073  C C5    . DC  I 5 16  ? 118.49000 152.96900 111.29900 1.000 92.88588  ? -57 DC  I C5    1 
ATOM 6074  C C6    . DC  I 5 16  ? 117.24300 152.56300 111.05100 1.000 92.88588  ? -57 DC  I C6    1 
ATOM 6075  P P     . DC  I 5 17  ? 111.54100 149.72000 111.37200 1.000 85.85186  ? -56 DC  I P     1 
ATOM 6076  O OP1   . DC  I 5 17  ? 110.27300 149.71500 110.61100 1.000 85.85186  ? -56 DC  I OP1   1 
ATOM 6077  O OP2   . DC  I 5 17  ? 111.66100 150.54500 112.59400 1.000 85.85186  ? -56 DC  I OP2   1 
ATOM 6078  O "O5'" . DC  I 5 17  ? 111.92400 148.21600 111.74400 1.000 85.85186  ? -56 DC  I "O5'" 1 
ATOM 6079  C "C5'" . DC  I 5 17  ? 113.01900 147.58100 111.08900 1.000 85.85186  ? -56 DC  I "C5'" 1 
ATOM 6080  C "C4'" . DC  I 5 17  ? 113.87900 146.82500 112.08700 1.000 85.85186  ? -56 DC  I "C4'" 1 
ATOM 6081  O "O4'" . DC  I 5 17  ? 115.11500 147.54600 112.33900 1.000 85.85186  ? -56 DC  I "O4'" 1 
ATOM 6082  C "C3'" . DC  I 5 17  ? 113.23300 146.60700 113.45400 1.000 85.85186  ? -56 DC  I "C3'" 1 
ATOM 6083  O "O3'" . DC  I 5 17  ? 113.54900 145.30300 113.92600 1.000 85.85186  ? -56 DC  I "O3'" 1 
ATOM 6084  C "C2'" . DC  I 5 17  ? 113.90800 147.68500 114.29700 1.000 85.85186  ? -56 DC  I "C2'" 1 
ATOM 6085  C "C1'" . DC  I 5 17  ? 115.31000 147.61800 113.72700 1.000 85.85186  ? -56 DC  I "C1'" 1 
ATOM 6086  N N1    . DC  I 5 17  ? 116.16400 148.80500 114.02500 1.000 85.85186  ? -56 DC  I N1    1 
ATOM 6087  C C2    . DC  I 5 17  ? 117.55100 148.70400 113.89300 1.000 85.85186  ? -56 DC  I C2    1 
ATOM 6088  O O2    . DC  I 5 17  ? 118.04200 147.62600 113.55200 1.000 85.85186  ? -56 DC  I O2    1 
ATOM 6089  N N3    . DC  I 5 17  ? 118.31800 149.78800 114.15400 1.000 85.85186  ? -56 DC  I N3    1 
ATOM 6090  C C4    . DC  I 5 17  ? 117.74900 150.93100 114.52100 1.000 85.85186  ? -56 DC  I C4    1 
ATOM 6091  N N4    . DC  I 5 17  ? 118.54400 151.97600 114.76500 1.000 85.85186  ? -56 DC  I N4    1 
ATOM 6092  C C5    . DC  I 5 17  ? 116.33500 151.05800 114.65500 1.000 85.85186  ? -56 DC  I C5    1 
ATOM 6093  C C6    . DC  I 5 17  ? 115.59000 149.97900 114.40000 1.000 85.85186  ? -56 DC  I C6    1 
ATOM 6094  P P     . DG  I 5 18  ? 112.56100 144.06000 113.66100 1.000 80.69317  ? -55 DG  I P     1 
ATOM 6095  O OP1   . DG  I 5 18  ? 112.03400 144.13200 112.28200 1.000 80.69317  ? -55 DG  I OP1   1 
ATOM 6096  O OP2   . DG  I 5 18  ? 111.62200 143.98600 114.79900 1.000 80.69317  ? -55 DG  I OP2   1 
ATOM 6097  O "O5'" . DG  I 5 18  ? 113.52800 142.79400 113.74800 1.000 80.69317  ? -55 DG  I "O5'" 1 
ATOM 6098  C "C5'" . DG  I 5 18  ? 114.69500 142.74300 112.93900 1.000 80.69317  ? -55 DG  I "C5'" 1 
ATOM 6099  C "C4'" . DG  I 5 18  ? 115.94900 142.50100 113.77300 1.000 80.69317  ? -55 DG  I "C4'" 1 
ATOM 6100  O "O4'" . DG  I 5 18  ? 116.47100 143.74100 114.29900 1.000 80.69317  ? -55 DG  I "O4'" 1 
ATOM 6101  C "C3'" . DG  I 5 18  ? 115.80300 141.58300 114.97400 1.000 80.69317  ? -55 DG  I "C3'" 1 
ATOM 6102  O "O3'" . DG  I 5 18  ? 116.97200 140.81100 115.04500 1.000 80.69317  ? -55 DG  I "O3'" 1 
ATOM 6103  C "C2'" . DG  I 5 18  ? 115.71100 142.56700 116.13800 1.000 80.69317  ? -55 DG  I "C2'" 1 
ATOM 6104  C "C1'" . DG  I 5 18  ? 116.72000 143.59000 115.68000 1.000 80.69317  ? -55 DG  I "C1'" 1 
ATOM 6105  N N9    . DG  I 5 18  ? 116.59000 144.90600 116.27200 1.000 80.69317  ? -55 DG  I N9    1 
ATOM 6106  C C8    . DG  I 5 18  ? 115.43700 145.56300 116.60400 1.000 80.69317  ? -55 DG  I C8    1 
ATOM 6107  N N7    . DG  I 5 18  ? 115.64300 146.76800 117.06100 1.000 80.69317  ? -55 DG  I N7    1 
ATOM 6108  C C5    . DG  I 5 18  ? 117.02100 146.91400 117.00900 1.000 80.69317  ? -55 DG  I C5    1 
ATOM 6109  C C6    . DG  I 5 18  ? 117.83900 148.00300 117.37900 1.000 80.69317  ? -55 DG  I C6    1 
ATOM 6110  O O6    . DG  I 5 18  ? 117.50200 149.10200 117.83600 1.000 80.69317  ? -55 DG  I O6    1 
ATOM 6111  N N1    . DG  I 5 18  ? 119.18300 147.72700 117.16900 1.000 80.69317  ? -55 DG  I N1    1 
ATOM 6112  C C2    . DG  I 5 18  ? 119.67200 146.55100 116.66500 1.000 80.69317  ? -55 DG  I C2    1 
ATOM 6113  N N2    . DG  I 5 18  ? 121.00100 146.46000 116.53500 1.000 80.69317  ? -55 DG  I N2    1 
ATOM 6114  N N3    . DG  I 5 18  ? 118.91700 145.52800 116.32000 1.000 80.69317  ? -55 DG  I N3    1 
ATOM 6115  C C4    . DG  I 5 18  ? 117.61000 145.78000 116.51600 1.000 80.69317  ? -55 DG  I C4    1 
ATOM 6116  P P     . DA  I 5 19  ? 116.92300 139.28700 115.52000 1.000 71.00973  ? -54 DA  I P     1 
ATOM 6117  O OP1   . DA  I 5 19  ? 116.69000 138.42800 114.34100 1.000 71.00973  ? -54 DA  I OP1   1 
ATOM 6118  O OP2   . DA  I 5 19  ? 115.99900 139.25900 116.67100 1.000 71.00973  ? -54 DA  I OP2   1 
ATOM 6119  O "O5'" . DA  I 5 19  ? 118.39200 139.02900 116.08200 1.000 71.00973  ? -54 DA  I "O5'" 1 
ATOM 6120  C "C5'" . DA  I 5 19  ? 119.52700 139.11600 115.21100 1.000 71.00973  ? -54 DA  I "C5'" 1 
ATOM 6121  C "C4'" . DA  I 5 19  ? 120.69600 139.81600 115.89300 1.000 71.00973  ? -54 DA  I "C4'" 1 
ATOM 6122  O "O4'" . DA  I 5 19  ? 120.30100 141.10200 116.40800 1.000 71.00973  ? -54 DA  I "O4'" 1 
ATOM 6123  C "C3'" . DA  I 5 19  ? 121.32200 139.08000 117.06000 1.000 71.00973  ? -54 DA  I "C3'" 1 
ATOM 6124  O "O3'" . DA  I 5 19  ? 122.70900 139.31100 117.02800 1.000 71.00973  ? -54 DA  I "O3'" 1 
ATOM 6125  C "C2'" . DA  I 5 19  ? 120.65800 139.76000 118.25100 1.000 71.00973  ? -54 DA  I "C2'" 1 
ATOM 6126  C "C1'" . DA  I 5 19  ? 120.65500 141.19300 117.76800 1.000 71.00973  ? -54 DA  I "C1'" 1 
ATOM 6127  N N9    . DA  I 5 19  ? 119.64900 142.06100 118.35300 1.000 71.00973  ? -54 DA  I N9    1 
ATOM 6128  C C8    . DA  I 5 19  ? 118.30500 141.84700 118.37400 1.000 71.00973  ? -54 DA  I C8    1 
ATOM 6129  N N7    . DA  I 5 19  ? 117.61900 142.83600 118.88900 1.000 71.00973  ? -54 DA  I N7    1 
ATOM 6130  C C5    . DA  I 5 19  ? 118.57700 143.77300 119.20500 1.000 71.00973  ? -54 DA  I C5    1 
ATOM 6131  C C6    . DA  I 5 19  ? 118.49400 145.04800 119.78900 1.000 71.00973  ? -54 DA  I C6    1 
ATOM 6132  N N6    . DA  I 5 19  ? 117.34100 145.60600 120.16400 1.000 71.00973  ? -54 DA  I N6    1 
ATOM 6133  N N1    . DA  I 5 19  ? 119.64400 145.72800 119.97900 1.000 71.00973  ? -54 DA  I N1    1 
ATOM 6134  C C2    . DA  I 5 19  ? 120.80000 145.16200 119.60500 1.000 71.00973  ? -54 DA  I C2    1 
ATOM 6135  N N3    . DA  I 5 19  ? 121.00000 143.96900 119.04300 1.000 71.00973  ? -54 DA  I N3    1 
ATOM 6136  C C4    . DA  I 5 19  ? 119.83600 143.32000 118.87100 1.000 71.00973  ? -54 DA  I C4    1 
ATOM 6137  P P     . DG  I 5 20  ? 123.73200 138.20100 117.55500 1.000 73.30466  ? -53 DG  I P     1 
ATOM 6138  O OP1   . DG  I 5 20  ? 124.75700 138.06300 116.50500 1.000 73.30466  ? -53 DG  I OP1   1 
ATOM 6139  O OP2   . DG  I 5 20  ? 122.93500 137.03700 117.99000 1.000 73.30466  ? -53 DG  I OP2   1 
ATOM 6140  O "O5'" . DG  I 5 20  ? 124.42900 138.87700 118.82200 1.000 73.30466  ? -53 DG  I "O5'" 1 
ATOM 6141  C "C5'" . DG  I 5 20  ? 125.09800 140.12700 118.67700 1.000 73.30466  ? -53 DG  I "C5'" 1 
ATOM 6142  C "C4'" . DG  I 5 20  ? 125.15600 140.88000 119.99600 1.000 73.30466  ? -53 DG  I "C4'" 1 
ATOM 6143  O "O4'" . DG  I 5 20  ? 123.91200 141.58800 120.24000 1.000 73.30466  ? -53 DG  I "O4'" 1 
ATOM 6144  C "C3'" . DG  I 5 20  ? 125.39600 140.01900 121.23500 1.000 73.30466  ? -53 DG  I "C3'" 1 
ATOM 6145  O "O3'" . DG  I 5 20  ? 126.31800 140.68300 122.07500 1.000 73.30466  ? -53 DG  I "O3'" 1 
ATOM 6146  C "C2'" . DG  I 5 20  ? 124.01100 139.97100 121.87200 1.000 73.30466  ? -53 DG  I "C2'" 1 
ATOM 6147  C "C1'" . DG  I 5 20  ? 123.55500 141.38200 121.58200 1.000 73.30466  ? -53 DG  I "C1'" 1 
ATOM 6148  N N9    . DG  I 5 20  ? 122.12200 141.60800 121.73800 1.000 73.30466  ? -53 DG  I N9    1 
ATOM 6149  C C8    . DG  I 5 20  ? 121.11600 140.73300 121.45400 1.000 73.30466  ? -53 DG  I C8    1 
ATOM 6150  N N7    . DG  I 5 20  ? 119.92600 141.21100 121.67600 1.000 73.30466  ? -53 DG  I N7    1 
ATOM 6151  C C5    . DG  I 5 20  ? 120.16200 142.47400 122.18800 1.000 73.30466  ? -53 DG  I C5    1 
ATOM 6152  C C6    . DG  I 5 20  ? 119.25300 143.45600 122.63500 1.000 73.30466  ? -53 DG  I C6    1 
ATOM 6153  O O6    . DG  I 5 20  ? 118.01700 143.40100 122.66300 1.000 73.30466  ? -53 DG  I O6    1 
ATOM 6154  N N1    . DG  I 5 20  ? 119.90700 144.59900 123.07700 1.000 73.30466  ? -53 DG  I N1    1 
ATOM 6155  C C2    . DG  I 5 20  ? 121.27000 144.76800 123.09100 1.000 73.30466  ? -53 DG  I C2    1 
ATOM 6156  N N2    . DG  I 5 20  ? 121.72300 145.93800 123.55500 1.000 73.30466  ? -53 DG  I N2    1 
ATOM 6157  N N3    . DG  I 5 20  ? 122.13300 143.85200 122.67600 1.000 73.30466  ? -53 DG  I N3    1 
ATOM 6158  C C4    . DG  I 5 20  ? 121.51000 142.73400 122.23800 1.000 73.30466  ? -53 DG  I C4    1 
ATOM 6159  P P     . DG  I 5 21  ? 127.54200 139.89400 122.74500 1.000 78.90874  ? -52 DG  I P     1 
ATOM 6160  O OP1   . DG  I 5 21  ? 128.60600 139.76600 121.72700 1.000 78.90874  ? -52 DG  I OP1   1 
ATOM 6161  O OP2   . DG  I 5 21  ? 126.99500 138.68700 123.40100 1.000 78.90874  ? -52 DG  I OP2   1 
ATOM 6162  O "O5'" . DG  I 5 21  ? 128.03600 140.89200 123.89100 1.000 78.90874  ? -52 DG  I "O5'" 1 
ATOM 6163  C "C5'" . DG  I 5 21  ? 128.08600 142.29800 123.63900 1.000 78.90874  ? -52 DG  I "C5'" 1 
ATOM 6164  C "C4'" . DG  I 5 21  ? 127.33000 143.06200 124.71400 1.000 78.90874  ? -52 DG  I "C4'" 1 
ATOM 6165  O "O4'" . DG  I 5 21  ? 125.91100 142.96400 124.50100 1.000 78.90874  ? -52 DG  I "O4'" 1 
ATOM 6166  C "C3'" . DG  I 5 21  ? 127.57100 142.58900 126.14800 1.000 78.90874  ? -52 DG  I "C3'" 1 
ATOM 6167  O "O3'" . DG  I 5 21  ? 128.18900 143.63000 126.88800 1.000 78.90874  ? -52 DG  I "O3'" 1 
ATOM 6168  C "C2'" . DG  I 5 21  ? 126.16700 142.25700 126.67500 1.000 78.90874  ? -52 DG  I "C2'" 1 
ATOM 6169  C "C1'" . DG  I 5 21  ? 125.28000 143.06600 125.74700 1.000 78.90874  ? -52 DG  I "C1'" 1 
ATOM 6170  N N9    . DG  I 5 21  ? 123.93400 142.52900 125.58900 1.000 78.90874  ? -52 DG  I N9    1 
ATOM 6171  C C8    . DG  I 5 21  ? 123.60800 141.33000 125.02900 1.000 78.90874  ? -52 DG  I C8    1 
ATOM 6172  N N7    . DG  I 5 21  ? 122.33200 141.10900 124.96700 1.000 78.90874  ? -52 DG  I N7    1 
ATOM 6173  C C5    . DG  I 5 21  ? 121.76500 142.23200 125.53800 1.000 78.90874  ? -52 DG  I C5    1 
ATOM 6174  C C6    . DG  I 5 21  ? 120.40900 142.54200 125.75700 1.000 78.90874  ? -52 DG  I C6    1 
ATOM 6175  O O6    . DG  I 5 21  ? 119.42000 141.85800 125.47500 1.000 78.90874  ? -52 DG  I O6    1 
ATOM 6176  N N1    . DG  I 5 21  ? 120.25300 143.78100 126.36700 1.000 78.90874  ? -52 DG  I N1    1 
ATOM 6177  C C2    . DG  I 5 21  ? 121.28500 144.61800 126.72200 1.000 78.90874  ? -52 DG  I C2    1 
ATOM 6178  N N2    . DG  I 5 21  ? 120.93900 145.77900 127.30300 1.000 78.90874  ? -52 DG  I N2    1 
ATOM 6179  N N3    . DG  I 5 21  ? 122.57200 144.33500 126.52100 1.000 78.90874  ? -52 DG  I N3    1 
ATOM 6180  C C4    . DG  I 5 21  ? 122.73400 143.13000 125.92000 1.000 78.90874  ? -52 DG  I C4    1 
ATOM 6181  P P     . DC  I 5 22  ? 128.82800 143.33700 128.33000 1.000 80.47240  ? -51 DC  I P     1 
ATOM 6182  O OP1   . DC  I 5 22  ? 130.05400 144.15300 128.43700 1.000 80.47240  ? -51 DC  I OP1   1 
ATOM 6183  O OP2   . DC  I 5 22  ? 128.91100 141.87000 128.49800 1.000 80.47240  ? -51 DC  I OP2   1 
ATOM 6184  O "O5'" . DC  I 5 22  ? 127.73400 143.90100 129.35400 1.000 80.47240  ? -51 DC  I "O5'" 1 
ATOM 6185  C "C5'" . DC  I 5 22  ? 127.18000 145.20500 129.17000 1.000 80.47240  ? -51 DC  I "C5'" 1 
ATOM 6186  C "C4'" . DC  I 5 22  ? 125.94800 145.39100 130.04100 1.000 80.47240  ? -51 DC  I "C4'" 1 
ATOM 6187  O "O4'" . DC  I 5 22  ? 124.81800 144.74200 129.43000 1.000 80.47240  ? -51 DC  I "O4'" 1 
ATOM 6188  C "C3'" . DC  I 5 22  ? 126.06000 144.80500 131.44900 1.000 80.47240  ? -51 DC  I "C3'" 1 
ATOM 6189  O "O3'" . DC  I 5 22  ? 126.01000 145.85800 132.42600 1.000 80.47240  ? -51 DC  I "O3'" 1 
ATOM 6190  C "C2'" . DC  I 5 22  ? 124.86700 143.83900 131.55600 1.000 80.47240  ? -51 DC  I "C2'" 1 
ATOM 6191  C "C1'" . DC  I 5 22  ? 123.95100 144.30100 130.43900 1.000 80.47240  ? -51 DC  I "C1'" 1 
ATOM 6192  N N1    . DC  I 5 22  ? 123.12300 143.21500 129.85000 1.000 80.47240  ? -51 DC  I N1    1 
ATOM 6193  C C2    . DC  I 5 22  ? 121.72200 143.27200 129.90700 1.000 80.47240  ? -51 DC  I C2    1 
ATOM 6194  O O2    . DC  I 5 22  ? 121.17500 144.21900 130.48000 1.000 80.47240  ? -51 DC  I O2    1 
ATOM 6195  N N3    . DC  I 5 22  ? 121.00700 142.27000 129.33300 1.000 80.47240  ? -51 DC  I N3    1 
ATOM 6196  C C4    . DC  I 5 22  ? 121.63600 141.26400 128.72700 1.000 80.47240  ? -51 DC  I C4    1 
ATOM 6197  N N4    . DC  I 5 22  ? 120.89900 140.29800 128.17400 1.000 80.47240  ? -51 DC  I N4    1 
ATOM 6198  C C5    . DC  I 5 22  ? 123.05300 141.19900 128.65700 1.000 80.47240  ? -51 DC  I C5    1 
ATOM 6199  C C6    . DC  I 5 22  ? 123.74400 142.18500 129.22300 1.000 80.47240  ? -51 DC  I C6    1 
ATOM 6200  P P     . DC  I 5 23  ? 126.21100 145.54000 133.99100 1.000 80.02532  ? -50 DC  I P     1 
ATOM 6201  O OP1   . DC  I 5 23  ? 126.86900 146.72100 134.58700 1.000 80.02532  ? -50 DC  I OP1   1 
ATOM 6202  O OP2   . DC  I 5 23  ? 126.85400 144.21400 134.12600 1.000 80.02532  ? -50 DC  I OP2   1 
ATOM 6203  O "O5'" . DC  I 5 23  ? 124.72300 145.43300 134.57300 1.000 80.02532  ? -50 DC  I "O5'" 1 
ATOM 6204  C "C5'" . DC  I 5 23  ? 123.79700 146.50100 134.37900 1.000 80.02532  ? -50 DC  I "C5'" 1 
ATOM 6205  C "C4'" . DC  I 5 23  ? 122.43100 146.14800 134.94800 1.000 80.02532  ? -50 DC  I "C4'" 1 
ATOM 6206  O "O4'" . DC  I 5 23  ? 121.75900 145.21900 134.06900 1.000 80.02532  ? -50 DC  I "O4'" 1 
ATOM 6207  C "C3'" . DC  I 5 23  ? 122.43700 145.49600 136.33300 1.000 80.02532  ? -50 DC  I "C3'" 1 
ATOM 6208  O "O3'" . DC  I 5 23  ? 121.47500 146.13300 137.16900 1.000 80.02532  ? -50 DC  I "O3'" 1 
ATOM 6209  C "C2'" . DC  I 5 23  ? 122.06700 144.04200 136.04700 1.000 80.02532  ? -50 DC  I "C2'" 1 
ATOM 6210  C "C1'" . DC  I 5 23  ? 121.17600 144.18800 134.83000 1.000 80.02532  ? -50 DC  I "C1'" 1 
ATOM 6211  N N1    . DC  I 5 23  ? 121.14800 142.99400 133.97900 1.000 80.02532  ? -50 DC  I N1    1 
ATOM 6212  C C2    . DC  I 5 23  ? 119.92900 142.44300 133.59900 1.000 80.02532  ? -50 DC  I C2    1 
ATOM 6213  O O2    . DC  I 5 23  ? 118.88300 142.96100 134.00700 1.000 80.02532  ? -50 DC  I O2    1 
ATOM 6214  N N3    . DC  I 5 23  ? 119.93100 141.35600 132.79100 1.000 80.02532  ? -50 DC  I N3    1 
ATOM 6215  C C4    . DC  I 5 23  ? 121.08800 140.83800 132.37500 1.000 80.02532  ? -50 DC  I C4    1 
ATOM 6216  N N4    . DC  I 5 23  ? 121.05000 139.76700 131.58300 1.000 80.02532  ? -50 DC  I N4    1 
ATOM 6217  C C5    . DC  I 5 23  ? 122.33700 141.39400 132.75400 1.000 80.02532  ? -50 DC  I C5    1 
ATOM 6218  C C6    . DC  I 5 23  ? 122.31700 142.45900 133.54900 1.000 80.02532  ? -50 DC  I C6    1 
ATOM 6219  P P     . DG  I 5 24  ? 121.59300 146.02500 138.76600 1.000 76.54311  ? -49 DG  I P     1 
ATOM 6220  O OP1   . DG  I 5 24  ? 121.55300 147.40100 139.30300 1.000 76.54311  ? -49 DG  I OP1   1 
ATOM 6221  O OP2   . DG  I 5 24  ? 122.74600 145.15200 139.07500 1.000 76.54311  ? -49 DG  I OP2   1 
ATOM 6222  O "O5'" . DG  I 5 24  ? 120.24900 145.27500 139.21300 1.000 76.54311  ? -49 DG  I "O5'" 1 
ATOM 6223  C "C5'" . DG  I 5 24  ? 118.97400 145.89000 138.98800 1.000 76.54311  ? -49 DG  I "C5'" 1 
ATOM 6224  C "C4'" . DG  I 5 24  ? 117.83500 144.88100 139.10500 1.000 76.54311  ? -49 DG  I "C4'" 1 
ATOM 6225  O "O4'" . DG  I 5 24  ? 117.95900 143.87400 138.07300 1.000 76.54311  ? -49 DG  I "O4'" 1 
ATOM 6226  C "C3'" . DG  I 5 24  ? 117.74800 144.12800 140.43100 1.000 76.54311  ? -49 DG  I "C3'" 1 
ATOM 6227  O "O3'" . DG  I 5 24  ? 116.38100 144.04300 140.83400 1.000 76.54311  ? -49 DG  I "O3'" 1 
ATOM 6228  C "C2'" . DG  I 5 24  ? 118.32900 142.75500 140.07500 1.000 76.54311  ? -49 DG  I "C2'" 1 
ATOM 6229  C "C1'" . DG  I 5 24  ? 117.85400 142.59000 138.64100 1.000 76.54311  ? -49 DG  I "C1'" 1 
ATOM 6230  N N9    . DG  I 5 24  ? 118.70800 141.73100 137.83600 1.000 76.54311  ? -49 DG  I N9    1 
ATOM 6231  C C8    . DG  I 5 24  ? 120.07300 141.78300 137.77000 1.000 76.54311  ? -49 DG  I C8    1 
ATOM 6232  N N7    . DG  I 5 24  ? 120.58700 140.93100 136.93400 1.000 76.54311  ? -49 DG  I N7    1 
ATOM 6233  C C5    . DG  I 5 24  ? 119.49100 140.27400 136.40100 1.000 76.54311  ? -49 DG  I C5    1 
ATOM 6234  C C6    . DG  I 5 24  ? 119.43800 139.24400 135.44500 1.000 76.54311  ? -49 DG  I C6    1 
ATOM 6235  O O6    . DG  I 5 24  ? 120.38100 138.69800 134.86900 1.000 76.54311  ? -49 DG  I O6    1 
ATOM 6236  N N1    . DG  I 5 24  ? 118.13500 138.85000 135.17600 1.000 76.54311  ? -49 DG  I N1    1 
ATOM 6237  C C2    . DG  I 5 24  ? 117.01700 139.39000 135.75800 1.000 76.54311  ? -49 DG  I C2    1 
ATOM 6238  N N2    . DG  I 5 24  ? 115.83700 138.87700 135.37100 1.000 76.54311  ? -49 DG  I N2    1 
ATOM 6239  N N3    . DG  I 5 24  ? 117.05100 140.36400 136.66600 1.000 76.54311  ? -49 DG  I N3    1 
ATOM 6240  C C4    . DG  I 5 24  ? 118.32100 140.75600 136.93600 1.000 76.54311  ? -49 DG  I C4    1 
ATOM 6241  P P     . DC  I 5 25  ? 115.98200 143.57300 142.31900 1.000 77.57138  ? -48 DC  I P     1 
ATOM 6242  O OP1   . DC  I 5 25  ? 114.96200 144.52100 142.81000 1.000 77.57138  ? -48 DC  I OP1   1 
ATOM 6243  O OP2   . DC  I 5 25  ? 117.21700 143.36100 143.10400 1.000 77.57138  ? -48 DC  I OP2   1 
ATOM 6244  O "O5'" . DC  I 5 25  ? 115.28300 142.15600 142.09300 1.000 77.57138  ? -48 DC  I "O5'" 1 
ATOM 6245  C "C5'" . DC  I 5 25  ? 114.27500 142.01300 141.09900 1.000 77.57138  ? -48 DC  I "C5'" 1 
ATOM 6246  C "C4'" . DC  I 5 25  ? 114.17800 140.57000 140.65000 1.000 77.57138  ? -48 DC  I "C4'" 1 
ATOM 6247  O "O4'" . DC  I 5 25  ? 115.43800 140.19700 140.06200 1.000 77.57138  ? -48 DC  I "O4'" 1 
ATOM 6248  C "C3'" . DC  I 5 25  ? 113.91700 139.56500 141.76800 1.000 77.57138  ? -48 DC  I "C3'" 1 
ATOM 6249  O "O3'" . DC  I 5 25  ? 112.82900 138.72900 141.41200 1.000 77.57138  ? -48 DC  I "O3'" 1 
ATOM 6250  C "C2'" . DC  I 5 25  ? 115.23700 138.78700 141.87200 1.000 77.57138  ? -48 DC  I "C2'" 1 
ATOM 6251  C "C1'" . DC  I 5 25  ? 115.78600 138.90200 140.46100 1.000 77.57138  ? -48 DC  I "C1'" 1 
ATOM 6252  N N1    . DC  I 5 25  ? 117.27100 138.85400 140.40000 1.000 77.57138  ? -48 DC  I N1    1 
ATOM 6253  C C2    . DC  I 5 25  ? 117.90300 138.23100 139.32300 1.000 77.57138  ? -48 DC  I C2    1 
ATOM 6254  O O2    . DC  I 5 25  ? 117.21400 137.72900 138.43100 1.000 77.57138  ? -48 DC  I O2    1 
ATOM 6255  N N3    . DC  I 5 25  ? 119.25600 138.22600 139.27000 1.000 77.57138  ? -48 DC  I N3    1 
ATOM 6256  C C4    . DC  I 5 25  ? 119.96400 138.79000 140.24700 1.000 77.57138  ? -48 DC  I C4    1 
ATOM 6257  N N4    . DC  I 5 25  ? 121.29600 138.75100 140.15700 1.000 77.57138  ? -48 DC  I N4    1 
ATOM 6258  C C5    . DC  I 5 25  ? 119.33900 139.42100 141.36000 1.000 77.57138  ? -48 DC  I C5    1 
ATOM 6259  C C6    . DC  I 5 25  ? 118.00400 139.42800 141.39500 1.000 77.57138  ? -48 DC  I C6    1 
ATOM 6260  P P     . DT  I 5 26  ? 111.73400 138.31100 142.51300 1.000 75.01870  ? -47 DT  I P     1 
ATOM 6261  O OP1   . DT  I 5 26  ? 110.56700 139.20500 142.34900 1.000 75.01870  ? -47 DT  I OP1   1 
ATOM 6262  O OP2   . DT  I 5 26  ? 112.41400 138.21300 143.82300 1.000 75.01870  ? -47 DT  I OP2   1 
ATOM 6263  O "O5'" . DT  I 5 26  ? 111.29900 136.84600 142.06600 1.000 75.01870  ? -47 DT  I "O5'" 1 
ATOM 6264  C "C5'" . DT  I 5 26  ? 111.45000 136.46200 140.71500 1.000 75.01870  ? -47 DT  I "C5'" 1 
ATOM 6265  C "C4'" . DT  I 5 26  ? 112.03600 135.07000 140.60100 1.000 75.01870  ? -47 DT  I "C4'" 1 
ATOM 6266  O "O4'" . DT  I 5 26  ? 113.47600 135.18100 140.45600 1.000 75.01870  ? -47 DT  I "O4'" 1 
ATOM 6267  C "C3'" . DT  I 5 26  ? 111.81000 134.15500 141.80900 1.000 75.01870  ? -47 DT  I "C3'" 1 
ATOM 6268  O "O3'" . DT  I 5 26  ? 111.56700 132.84300 141.36500 1.000 75.01870  ? -47 DT  I "O3'" 1 
ATOM 6269  C "C2'" . DT  I 5 26  ? 113.15000 134.22000 142.53000 1.000 75.01870  ? -47 DT  I "C2'" 1 
ATOM 6270  C "C1'" . DT  I 5 26  ? 114.09200 134.28600 141.34200 1.000 75.01870  ? -47 DT  I "C1'" 1 
ATOM 6271  N N1    . DT  I 5 26  ? 115.44400 134.79600 141.67500 1.000 75.01870  ? -47 DT  I N1    1 
ATOM 6272  C C2    . DT  I 5 26  ? 116.46600 134.58800 140.79100 1.000 75.01870  ? -47 DT  I C2    1 
ATOM 6273  O O2    . DT  I 5 26  ? 116.31100 134.04500 139.71600 1.000 75.01870  ? -47 DT  I O2    1 
ATOM 6274  N N3    . DT  I 5 26  ? 117.67400 135.08600 141.18600 1.000 75.01870  ? -47 DT  I N3    1 
ATOM 6275  C C4    . DT  I 5 26  ? 117.96200 135.72900 142.37200 1.000 75.01870  ? -47 DT  I C4    1 
ATOM 6276  O O4    . DT  I 5 26  ? 119.08300 136.13800 142.64200 1.000 75.01870  ? -47 DT  I O4    1 
ATOM 6277  C C5    . DT  I 5 26  ? 116.84800 135.89000 143.26900 1.000 75.01870  ? -47 DT  I C5    1 
ATOM 6278  C C7    . DT  I 5 26  ? 117.03500 136.57400 144.58900 1.000 75.01870  ? -47 DT  I C7    1 
ATOM 6279  C C6    . DT  I 5 26  ? 115.66100 135.41000 142.88600 1.000 75.01870  ? -47 DT  I C6    1 
ATOM 6280  P P     . DC  I 5 27  ? 110.09200 132.21900 141.42400 1.000 71.49273  ? -46 DC  I P     1 
ATOM 6281  O OP1   . DC  I 5 27  ? 109.17200 133.18600 140.79300 1.000 71.49273  ? -46 DC  I OP1   1 
ATOM 6282  O OP2   . DC  I 5 27  ? 109.85500 131.76700 142.81200 1.000 71.49273  ? -46 DC  I OP2   1 
ATOM 6283  O "O5'" . DC  I 5 27  ? 110.20900 130.91600 140.50600 1.000 71.49273  ? -46 DC  I "O5'" 1 
ATOM 6284  C "C5'" . DC  I 5 27  ? 110.93700 130.97100 139.28600 1.000 71.49273  ? -46 DC  I "C5'" 1 
ATOM 6285  C "C4'" . DC  I 5 27  ? 112.12700 130.02400 139.30600 1.000 71.49273  ? -46 DC  I "C4'" 1 
ATOM 6286  O "O4'" . DC  I 5 27  ? 113.20600 130.61700 140.07500 1.000 71.49273  ? -46 DC  I "O4'" 1 
ATOM 6287  C "C3'" . DC  I 5 27  ? 111.87600 128.64900 139.93300 1.000 71.49273  ? -46 DC  I "C3'" 1 
ATOM 6288  O "O3'" . DC  I 5 27  ? 112.52400 127.65400 139.17300 1.000 71.49273  ? -46 DC  I "O3'" 1 
ATOM 6289  C "C2'" . DC  I 5 27  ? 112.54700 128.78200 141.29400 1.000 71.49273  ? -46 DC  I "C2'" 1 
ATOM 6290  C "C1'" . DC  I 5 27  ? 113.74200 129.63800 140.92500 1.000 71.49273  ? -46 DC  I "C1'" 1 
ATOM 6291  N N1    . DC  I 5 27  ? 114.37000 130.31800 142.09300 1.000 71.49273  ? -46 DC  I N1    1 
ATOM 6292  C C2    . DC  I 5 27  ? 115.72300 130.65700 142.05100 1.000 71.49273  ? -46 DC  I C2    1 
ATOM 6293  O O2    . DC  I 5 27  ? 116.36900 130.42500 141.02700 1.000 71.49273  ? -46 DC  I O2    1 
ATOM 6294  N N3    . DC  I 5 27  ? 116.27700 131.27100 143.12100 1.000 71.49273  ? -46 DC  I N3    1 
ATOM 6295  C C4    . DC  I 5 27  ? 115.54300 131.51400 144.20300 1.000 71.49273  ? -46 DC  I C4    1 
ATOM 6296  N N4    . DC  I 5 27  ? 116.13400 132.11300 145.23800 1.000 71.49273  ? -46 DC  I N4    1 
ATOM 6297  C C5    . DC  I 5 27  ? 114.17000 131.15400 144.27500 1.000 71.49273  ? -46 DC  I C5    1 
ATOM 6298  C C6    . DC  I 5 27  ? 113.63200 130.56000 143.21100 1.000 71.49273  ? -46 DC  I C6    1 
ATOM 6299  P P     . DA  I 5 28  ? 111.69600 126.61900 138.26700 1.000 67.44073  ? -45 DA  I P     1 
ATOM 6300  O OP1   . DA  I 5 28  ? 111.03100 127.37900 137.18900 1.000 67.44073  ? -45 DA  I OP1   1 
ATOM 6301  O OP2   . DA  I 5 28  ? 110.90400 125.75100 139.16400 1.000 67.44073  ? -45 DA  I OP2   1 
ATOM 6302  O "O5'" . DA  I 5 28  ? 112.85200 125.72500 137.62900 1.000 67.44073  ? -45 DA  I "O5'" 1 
ATOM 6303  C "C5'" . DA  I 5 28  ? 113.89800 126.36000 136.91800 1.000 67.44073  ? -45 DA  I "C5'" 1 
ATOM 6304  C "C4'" . DA  I 5 28  ? 115.26600 125.91300 137.41200 1.000 67.44073  ? -45 DA  I "C4'" 1 
ATOM 6305  O "O4'" . DA  I 5 28  ? 115.53900 126.51700 138.70200 1.000 67.44073  ? -45 DA  I "O4'" 1 
ATOM 6306  C "C3'" . DA  I 5 28  ? 115.45200 124.41400 137.60900 1.000 67.44073  ? -45 DA  I "C3'" 1 
ATOM 6307  O "O3'" . DA  I 5 28  ? 116.74300 124.05800 137.17600 1.000 67.44073  ? -45 DA  I "O3'" 1 
ATOM 6308  C "C2'" . DA  I 5 28  ? 115.32000 124.24700 139.11700 1.000 67.44073  ? -45 DA  I "C2'" 1 
ATOM 6309  C "C1'" . DA  I 5 28  ? 115.96500 125.52400 139.60600 1.000 67.44073  ? -45 DA  I "C1'" 1 
ATOM 6310  N N9    . DA  I 5 28  ? 115.52100 125.91000 140.93600 1.000 67.44073  ? -45 DA  I N9    1 
ATOM 6311  C C8    . DA  I 5 28  ? 114.28400 125.71000 141.47600 1.000 67.44073  ? -45 DA  I C8    1 
ATOM 6312  N N7    . DA  I 5 28  ? 114.15800 126.17200 142.69400 1.000 67.44073  ? -45 DA  I N7    1 
ATOM 6313  C C5    . DA  I 5 28  ? 115.39800 126.72000 142.96900 1.000 67.44073  ? -45 DA  I C5    1 
ATOM 6314  C C6    . DA  I 5 28  ? 115.91400 127.37400 144.10000 1.000 67.44073  ? -45 DA  I C6    1 
ATOM 6315  N N6    . DA  I 5 28  ? 115.20400 127.58900 145.21100 1.000 67.44073  ? -45 DA  I N6    1 
ATOM 6316  N N1    . DA  I 5 28  ? 117.19300 127.79800 144.04800 1.000 67.44073  ? -45 DA  I N1    1 
ATOM 6317  C C2    . DA  I 5 28  ? 117.90000 127.58000 142.93800 1.000 67.44073  ? -45 DA  I C2    1 
ATOM 6318  N N3    . DA  I 5 28  ? 117.52500 126.97800 141.81500 1.000 67.44073  ? -45 DA  I N3    1 
ATOM 6319  C C4    . DA  I 5 28  ? 116.25000 126.57100 141.89600 1.000 67.44073  ? -45 DA  I C4    1 
ATOM 6320  P P     . DA  I 5 29  ? 117.03800 122.59300 136.60200 1.000 61.88162  ? -44 DA  I P     1 
ATOM 6321  O OP1   . DA  I 5 29  ? 116.71800 122.63400 135.16100 1.000 61.88162  ? -44 DA  I OP1   1 
ATOM 6322  O OP2   . DA  I 5 29  ? 116.37500 121.59700 137.46900 1.000 61.88162  ? -44 DA  I OP2   1 
ATOM 6323  O "O5'" . DA  I 5 29  ? 118.60900 122.42600 136.81700 1.000 61.88162  ? -44 DA  I "O5'" 1 
ATOM 6324  C "C5'" . DA  I 5 29  ? 119.46500 123.55300 136.70600 1.000 61.88162  ? -44 DA  I "C5'" 1 
ATOM 6325  C "C4'" . DA  I 5 29  ? 120.49800 123.57500 137.82200 1.000 61.88162  ? -44 DA  I "C4'" 1 
ATOM 6326  O "O4'" . DA  I 5 29  ? 119.91100 124.05800 139.05000 1.000 61.88162  ? -44 DA  I "O4'" 1 
ATOM 6327  C "C3'" . DA  I 5 29  ? 121.14400 122.23800 138.16400 1.000 61.88162  ? -44 DA  I "C3'" 1 
ATOM 6328  O "O3'" . DA  I 5 29  ? 122.52000 122.45700 138.38000 1.000 61.88162  ? -44 DA  I "O3'" 1 
ATOM 6329  C "C2'" . DA  I 5 29  ? 120.42900 121.84900 139.45500 1.000 61.88162  ? -44 DA  I "C2'" 1 
ATOM 6330  C "C1'" . DA  I 5 29  ? 120.28500 123.20600 140.10500 1.000 61.88162  ? -44 DA  I "C1'" 1 
ATOM 6331  N N9    . DA  I 5 29  ? 119.23300 123.30500 141.10600 1.000 61.88162  ? -44 DA  I N9    1 
ATOM 6332  C C8    . DA  I 5 29  ? 117.95100 122.85400 140.99900 1.000 61.88162  ? -44 DA  I C8    1 
ATOM 6333  N N7    . DA  I 5 29  ? 117.20500 123.12500 142.04200 1.000 61.88162  ? -44 DA  I N7    1 
ATOM 6334  C C5    . DA  I 5 29  ? 118.05500 123.81800 142.88500 1.000 61.88162  ? -44 DA  I C5    1 
ATOM 6335  C C6    . DA  I 5 29  ? 117.87600 124.38500 144.16000 1.000 61.88162  ? -44 DA  I C6    1 
ATOM 6336  N N6    . DA  I 5 29  ? 116.72200 124.34000 144.82700 1.000 61.88162  ? -44 DA  I N6    1 
ATOM 6337  N N1    . DA  I 5 29  ? 118.93200 125.00600 144.72600 1.000 61.88162  ? -44 DA  I N1    1 
ATOM 6338  C C2    . DA  I 5 29  ? 120.08800 125.05400 144.05700 1.000 61.88162  ? -44 DA  I C2    1 
ATOM 6339  N N3    . DA  I 5 29  ? 120.37700 124.55700 142.85700 1.000 61.88162  ? -44 DA  I N3    1 
ATOM 6340  C C4    . DA  I 5 29  ? 119.30700 123.94600 142.32000 1.000 61.88162  ? -44 DA  I C4    1 
ATOM 6341  P P     . DT  I 5 30  ? 123.58000 121.26300 138.26300 1.000 62.12549  ? -43 DT  I P     1 
ATOM 6342  O OP1   . DT  I 5 30  ? 124.43800 121.59900 137.10900 1.000 62.12549  ? -43 DT  I OP1   1 
ATOM 6343  O OP2   . DT  I 5 30  ? 122.87000 119.96900 138.30500 1.000 62.12549  ? -43 DT  I OP2   1 
ATOM 6344  O "O5'" . DT  I 5 30  ? 124.44700 121.39700 139.59700 1.000 62.12549  ? -43 DT  I "O5'" 1 
ATOM 6345  C "C5'" . DT  I 5 30  ? 125.01700 122.65100 139.95000 1.000 62.12549  ? -43 DT  I "C5'" 1 
ATOM 6346  C "C4'" . DT  I 5 30  ? 125.30200 122.71000 141.43800 1.000 62.12549  ? -43 DT  I "C4'" 1 
ATOM 6347  O "O4'" . DT  I 5 30  ? 124.07200 122.93300 142.16800 1.000 62.12549  ? -43 DT  I "O4'" 1 
ATOM 6348  C "C3'" . DT  I 5 30  ? 125.92200 121.43900 142.02200 1.000 62.12549  ? -43 DT  I "C3'" 1 
ATOM 6349  O "O3'" . DT  I 5 30  ? 127.12000 121.75200 142.69500 1.000 62.12549  ? -43 DT  I "O3'" 1 
ATOM 6350  C "C2'" . DT  I 5 30  ? 124.86300 120.92400 142.99200 1.000 62.12549  ? -43 DT  I "C2'" 1 
ATOM 6351  C "C1'" . DT  I 5 30  ? 124.11900 122.18800 143.35200 1.000 62.12549  ? -43 DT  I "C1'" 1 
ATOM 6352  N N1    . DT  I 5 30  ? 122.72700 121.95800 143.84000 1.000 62.12549  ? -43 DT  I N1    1 
ATOM 6353  C C2    . DT  I 5 30  ? 122.35100 122.48400 145.04900 1.000 62.12549  ? -43 DT  I C2    1 
ATOM 6354  O O2    . DT  I 5 30  ? 123.10500 123.11700 145.76300 1.000 62.12549  ? -43 DT  I O2    1 
ATOM 6355  N N3    . DT  I 5 30  ? 121.05900 122.22200 145.41100 1.000 62.12549  ? -43 DT  I N3    1 
ATOM 6356  C C4    . DT  I 5 30  ? 120.12200 121.51800 144.68900 1.000 62.12549  ? -43 DT  I C4    1 
ATOM 6357  O O4    . DT  I 5 30  ? 118.98100 121.33700 145.09100 1.000 62.12549  ? -43 DT  I O4    1 
ATOM 6358  C C5    . DT  I 5 30  ? 120.57300 121.00300 143.43200 1.000 62.12549  ? -43 DT  I C5    1 
ATOM 6359  C C7    . DT  I 5 30  ? 119.63300 120.21200 142.58100 1.000 62.12549  ? -43 DT  I C7    1 
ATOM 6360  C C6    . DT  I 5 30  ? 121.83700 121.25300 143.06100 1.000 62.12549  ? -43 DT  I C6    1 
ATOM 6361  P P     . DT  I 5 31  ? 128.06200 120.58000 143.25800 1.000 67.57133  ? -42 DT  I P     1 
ATOM 6362  O OP1   . DT  I 5 31  ? 129.45700 121.05500 143.17000 1.000 67.57133  ? -42 DT  I OP1   1 
ATOM 6363  O OP2   . DT  I 5 31  ? 127.68900 119.31300 142.59600 1.000 67.57133  ? -42 DT  I OP2   1 
ATOM 6364  O "O5'" . DT  I 5 31  ? 127.65700 120.48900 144.79800 1.000 67.57133  ? -42 DT  I "O5'" 1 
ATOM 6365  C "C5'" . DT  I 5 31  ? 127.69500 121.65600 145.61100 1.000 67.57133  ? -42 DT  I "C5'" 1 
ATOM 6366  C "C4'" . DT  I 5 31  ? 127.27800 121.34500 147.04000 1.000 67.57133  ? -42 DT  I "C4'" 1 
ATOM 6367  O "O4'" . DT  I 5 31  ? 125.84000 121.20800 147.12700 1.000 67.57133  ? -42 DT  I "O4'" 1 
ATOM 6368  C "C3'" . DT  I 5 31  ? 127.85700 120.06600 147.63000 1.000 67.57133  ? -42 DT  I "C3'" 1 
ATOM 6369  O "O3'" . DT  I 5 31  ? 128.25700 120.32100 148.96400 1.000 67.57133  ? -42 DT  I "O3'" 1 
ATOM 6370  C "C2'" . DT  I 5 31  ? 126.68300 119.08700 147.55600 1.000 67.57133  ? -42 DT  I "C2'" 1 
ATOM 6371  C "C1'" . DT  I 5 31  ? 125.52200 120.02000 147.81400 1.000 67.57133  ? -42 DT  I "C1'" 1 
ATOM 6372  N N1    . DT  I 5 31  ? 124.21700 119.54800 147.29000 1.000 67.57133  ? -42 DT  I N1    1 
ATOM 6373  C C2    . DT  I 5 31  ? 123.09500 119.72200 148.05400 1.000 67.57133  ? -42 DT  I C2    1 
ATOM 6374  O O2    . DT  I 5 31  ? 123.12100 120.17800 149.18000 1.000 67.57133  ? -42 DT  I O2    1 
ATOM 6375  N N3    . DT  I 5 31  ? 121.93900 119.29600 147.47600 1.000 67.57133  ? -42 DT  I N3    1 
ATOM 6376  C C4    . DT  I 5 31  ? 121.78800 118.76200 146.21500 1.000 67.57133  ? -42 DT  I C4    1 
ATOM 6377  O O4    . DT  I 5 31  ? 120.70100 118.41000 145.77900 1.000 67.57133  ? -42 DT  I O4    1 
ATOM 6378  C C5    . DT  I 5 31  ? 122.99600 118.63100 145.45200 1.000 67.57133  ? -42 DT  I C5    1 
ATOM 6379  C C7    . DT  I 5 31  ? 122.94800 118.04300 144.07000 1.000 67.57133  ? -42 DT  I C7    1 
ATOM 6380  C C6    . DT  I 5 31  ? 124.14200 119.04000 146.01400 1.000 67.57133  ? -42 DT  I C6    1 
ATOM 6381  P P     . DG  I 5 32  ? 129.63600 119.73000 149.52700 1.000 71.60603  ? -41 DG  I P     1 
ATOM 6382  O OP1   . DG  I 5 32  ? 130.48400 120.86900 149.94000 1.000 71.60603  ? -41 DG  I OP1   1 
ATOM 6383  O OP2   . DG  I 5 32  ? 130.14000 118.74800 148.54600 1.000 71.60603  ? -41 DG  I OP2   1 
ATOM 6384  O "O5'" . DG  I 5 32  ? 129.18400 118.92900 150.82700 1.000 71.60603  ? -41 DG  I "O5'" 1 
ATOM 6385  C "C5'" . DG  I 5 32  ? 128.17700 117.95100 150.72000 1.000 71.60603  ? -41 DG  I "C5'" 1 
ATOM 6386  C "C4'" . DG  I 5 32  ? 127.40700 117.81600 152.01600 1.000 71.60603  ? -41 DG  I "C4'" 1 
ATOM 6387  O "O4'" . DG  I 5 32  ? 125.99500 118.05900 151.76800 1.000 71.60603  ? -41 DG  I "O4'" 1 
ATOM 6388  C "C3'" . DG  I 5 32  ? 127.48600 116.42600 152.61100 1.000 71.60603  ? -41 DG  I "C3'" 1 
ATOM 6389  O "O3'" . DG  I 5 32  ? 127.35500 116.46100 154.02500 1.000 71.60603  ? -41 DG  I "O3'" 1 
ATOM 6390  C "C2'" . DG  I 5 32  ? 126.31400 115.71900 151.94500 1.000 71.60603  ? -41 DG  I "C2'" 1 
ATOM 6391  C "C1'" . DG  I 5 32  ? 125.28300 116.83900 151.81000 1.000 71.60603  ? -41 DG  I "C1'" 1 
ATOM 6392  N N9    . DG  I 5 32  ? 124.46400 116.71400 150.60400 1.000 71.60603  ? -41 DG  I N9    1 
ATOM 6393  C C8    . DG  I 5 32  ? 124.91800 116.61500 149.31400 1.000 71.60603  ? -41 DG  I C8    1 
ATOM 6394  N N7    . DG  I 5 32  ? 123.96800 116.47400 148.43600 1.000 71.60603  ? -41 DG  I N7    1 
ATOM 6395  C C5    . DG  I 5 32  ? 122.80800 116.42700 149.19300 1.000 71.60603  ? -41 DG  I C5    1 
ATOM 6396  C C6    . DG  I 5 32  ? 121.46500 116.27300 148.78500 1.000 71.60603  ? -41 DG  I C6    1 
ATOM 6397  O O6    . DG  I 5 32  ? 121.02700 116.14200 147.63900 1.000 71.60603  ? -41 DG  I O6    1 
ATOM 6398  N N1    . DG  I 5 32  ? 120.59300 116.27700 149.86200 1.000 71.60603  ? -41 DG  I N1    1 
ATOM 6399  C C2    . DG  I 5 32  ? 120.96900 116.41100 151.17300 1.000 71.60603  ? -41 DG  I C2    1 
ATOM 6400  N N2    . DG  I 5 32  ? 119.98200 116.38800 152.08000 1.000 71.60603  ? -41 DG  I N2    1 
ATOM 6401  N N3    . DG  I 5 32  ? 122.22900 116.55700 151.57300 1.000 71.60603  ? -41 DG  I N3    1 
ATOM 6402  C C4    . DG  I 5 32  ? 123.09300 116.55500 150.53100 1.000 71.60603  ? -41 DG  I C4    1 
ATOM 6403  P P     . DG  I 5 33  ? 127.89000 115.21700 154.89100 1.000 73.01228  ? -40 DG  I P     1 
ATOM 6404  O OP1   . DG  I 5 33  ? 128.33700 115.73400 156.20200 1.000 73.01228  ? -40 DG  I OP1   1 
ATOM 6405  O OP2   . DG  I 5 33  ? 128.82200 114.45100 154.03500 1.000 73.01228  ? -40 DG  I OP2   1 
ATOM 6406  O "O5'" . DG  I 5 33  ? 126.59100 114.31900 155.12200 1.000 73.01228  ? -40 DG  I "O5'" 1 
ATOM 6407  C "C5'" . DG  I 5 33  ? 125.37300 114.93200 155.48800 1.000 73.01228  ? -40 DG  I "C5'" 1 
ATOM 6408  C "C4'" . DG  I 5 33  ? 124.21600 113.96600 155.34200 1.000 73.01228  ? -40 DG  I "C4'" 1 
ATOM 6409  O "O4'" . DG  I 5 33  ? 123.62600 114.09500 154.02400 1.000 73.01228  ? -40 DG  I "O4'" 1 
ATOM 6410  C "C3'" . DG  I 5 33  ? 124.56100 112.48000 155.50900 1.000 73.01228  ? -40 DG  I "C3'" 1 
ATOM 6411  O "O3'" . DG  I 5 33  ? 123.58300 111.87900 156.36200 1.000 73.01228  ? -40 DG  I "O3'" 1 
ATOM 6412  C "C2'" . DG  I 5 33  ? 124.45600 111.96000 154.07400 1.000 73.01228  ? -40 DG  I "C2'" 1 
ATOM 6413  C "C1'" . DG  I 5 33  ? 123.31700 112.81000 153.56500 1.000 73.01228  ? -40 DG  I "C1'" 1 
ATOM 6414  N N9    . DG  I 5 33  ? 123.20400 112.85400 152.11300 1.000 73.01228  ? -40 DG  I N9    1 
ATOM 6415  C C8    . DG  I 5 33  ? 124.22100 113.00700 151.20600 1.000 73.01228  ? -40 DG  I C8    1 
ATOM 6416  N N7    . DG  I 5 33  ? 123.81600 113.01400 149.97100 1.000 73.01228  ? -40 DG  I N7    1 
ATOM 6417  C C5    . DG  I 5 33  ? 122.44500 112.84500 150.06500 1.000 73.01228  ? -40 DG  I C5    1 
ATOM 6418  C C6    . DG  I 5 33  ? 121.46900 112.77000 149.05000 1.000 73.01228  ? -40 DG  I C6    1 
ATOM 6419  O O6    . DG  I 5 33  ? 121.63400 112.84200 147.82800 1.000 73.01228  ? -40 DG  I O6    1 
ATOM 6420  N N1    . DG  I 5 33  ? 120.19100 112.59900 149.57500 1.000 73.01228  ? -40 DG  I N1    1 
ATOM 6421  C C2    . DG  I 5 33  ? 119.89800 112.50900 150.91400 1.000 73.01228  ? -40 DG  I C2    1 
ATOM 6422  N N2    . DG  I 5 33  ? 118.60800 112.34000 151.23700 1.000 73.01228  ? -40 DG  I N2    1 
ATOM 6423  N N3    . DG  I 5 33  ? 120.80600 112.57900 151.87500 1.000 73.01228  ? -40 DG  I N3    1 
ATOM 6424  C C4    . DG  I 5 33  ? 122.05300 112.74500 151.37700 1.000 73.01228  ? -40 DG  I C4    1 
ATOM 6425  P P     . DT  I 5 34  ? 123.76600 110.40600 156.98900 1.000 72.31554  ? -39 DT  I P     1 
ATOM 6426  O OP1   . DT  I 5 34  ? 123.91100 110.58200 158.44900 1.000 72.31554  ? -39 DT  I OP1   1 
ATOM 6427  O OP2   . DT  I 5 34  ? 124.79700 109.63300 156.26600 1.000 72.31554  ? -39 DT  I OP2   1 
ATOM 6428  O "O5'" . DT  I 5 34  ? 122.34500 109.73200 156.69900 1.000 72.31554  ? -39 DT  I "O5'" 1 
ATOM 6429  C "C5'" . DT  I 5 34  ? 121.45200 110.36700 155.78600 1.000 72.31554  ? -39 DT  I "C5'" 1 
ATOM 6430  C "C4'" . DT  I 5 34  ? 120.08900 109.69900 155.76300 1.000 72.31554  ? -39 DT  I "C4'" 1 
ATOM 6431  O "O4'" . DT  I 5 34  ? 119.55500 109.75500 154.41900 1.000 72.31554  ? -39 DT  I "O4'" 1 
ATOM 6432  C "C3'" . DT  I 5 34  ? 120.08300 108.22200 156.07200 1.000 72.31554  ? -39 DT  I "C3'" 1 
ATOM 6433  O "O3'" . DT  I 5 34  ? 118.73300 107.82200 156.29500 1.000 72.31554  ? -39 DT  I "O3'" 1 
ATOM 6434  C "C2'" . DT  I 5 34  ? 120.60700 107.67000 154.75500 1.000 72.31554  ? -39 DT  I "C2'" 1 
ATOM 6435  C "C1'" . DT  I 5 34  ? 119.80800 108.51700 153.76900 1.000 72.31554  ? -39 DT  I "C1'" 1 
ATOM 6436  N N1    . DT  I 5 34  ? 120.49600 108.79200 152.49300 1.000 72.31554  ? -39 DT  I N1    1 
ATOM 6437  C C2    . DT  I 5 34  ? 119.75300 108.87200 151.34900 1.000 72.31554  ? -39 DT  I C2    1 
ATOM 6438  O O2    . DT  I 5 34  ? 118.54800 108.70400 151.32500 1.000 72.31554  ? -39 DT  I O2    1 
ATOM 6439  N N3    . DT  I 5 34  ? 120.47100 109.14500 150.22100 1.000 72.31554  ? -39 DT  I N3    1 
ATOM 6440  C C4    . DT  I 5 34  ? 121.82900 109.35200 150.13200 1.000 72.31554  ? -39 DT  I C4    1 
ATOM 6441  O O4    . DT  I 5 34  ? 122.38600 109.59500 149.07200 1.000 72.31554  ? -39 DT  I O4    1 
ATOM 6442  C C5    . DT  I 5 34  ? 122.54800 109.26200 151.36900 1.000 72.31554  ? -39 DT  I C5    1 
ATOM 6443  C C7    . DT  I 5 34  ? 124.03000 109.46600 151.38900 1.000 72.31554  ? -39 DT  I C7    1 
ATOM 6444  C C6    . DT  I 5 34  ? 121.85600 108.99200 152.48100 1.000 72.31554  ? -39 DT  I C6    1 
ATOM 6445  P P     . DC  I 5 35  ? 118.38100 106.44200 157.03600 1.000 70.70629  ? -38 DC  I P     1 
ATOM 6446  O OP1   . DC  I 5 35  ? 117.65100 106.79600 158.27200 1.000 70.70629  ? -38 DC  I OP1   1 
ATOM 6447  O OP2   . DC  I 5 35  ? 119.60600 105.61500 157.11300 1.000 70.70629  ? -38 DC  I OP2   1 
ATOM 6448  O "O5'" . DC  I 5 35  ? 117.35600 105.72900 156.03800 1.000 70.70629  ? -38 DC  I "O5'" 1 
ATOM 6449  C "C5'" . DC  I 5 35  ? 116.99300 106.36900 154.81700 1.000 70.70629  ? -38 DC  I "C5'" 1 
ATOM 6450  C "C4'" . DC  I 5 35  ? 116.61500 105.35500 153.75400 1.000 70.70629  ? -38 DC  I "C4'" 1 
ATOM 6451  O "O4'" . DC  I 5 35  ? 117.41100 105.58800 152.55400 1.000 70.70629  ? -38 DC  I "O4'" 1 
ATOM 6452  C "C3'" . DC  I 5 35  ? 116.88300 103.90400 154.12900 1.000 70.70629  ? -38 DC  I "C3'" 1 
ATOM 6453  O "O3'" . DC  I 5 35  ? 115.98700 103.07400 153.41800 1.000 70.70629  ? -38 DC  I "O3'" 1 
ATOM 6454  C "C2'" . DC  I 5 35  ? 118.30500 103.72600 153.62500 1.000 70.70629  ? -38 DC  I "C2'" 1 
ATOM 6455  C "C1'" . DC  I 5 35  ? 118.18000 104.43500 152.29200 1.000 70.70629  ? -38 DC  I "C1'" 1 
ATOM 6456  N N1    . DC  I 5 35  ? 119.47500 104.84500 151.68700 1.000 70.70629  ? -38 DC  I N1    1 
ATOM 6457  C C2    . DC  I 5 35  ? 119.51600 105.23300 150.35100 1.000 70.70629  ? -38 DC  I C2    1 
ATOM 6458  O O2    . DC  I 5 35  ? 118.47900 105.19000 149.68600 1.000 70.70629  ? -38 DC  I O2    1 
ATOM 6459  N N3    . DC  I 5 35  ? 120.70100 105.61000 149.81400 1.000 70.70629  ? -38 DC  I N3    1 
ATOM 6460  C C4    . DC  I 5 35  ? 121.79800 105.63200 150.57100 1.000 70.70629  ? -38 DC  I C4    1 
ATOM 6461  N N4    . DC  I 5 35  ? 122.94600 106.01900 150.00700 1.000 70.70629  ? -38 DC  I N4    1 
ATOM 6462  C C5    . DC  I 5 35  ? 121.76900 105.25800 151.94200 1.000 70.70629  ? -38 DC  I C5    1 
ATOM 6463  C C6    . DC  I 5 35  ? 120.59800 104.88100 152.45300 1.000 70.70629  ? -38 DC  I C6    1 
ATOM 6464  P P     . DG  I 5 36  ? 114.72100 102.42000 154.15600 1.000 69.86417  ? -37 DG  I P     1 
ATOM 6465  O OP1   . DG  I 5 36  ? 113.80900 103.52000 154.53200 1.000 69.86417  ? -37 DG  I OP1   1 
ATOM 6466  O OP2   . DG  I 5 36  ? 115.22500 101.49900 155.19800 1.000 69.86417  ? -37 DG  I OP2   1 
ATOM 6467  O "O5'" . DG  I 5 36  ? 114.03200 101.54800 153.00800 1.000 69.86417  ? -37 DG  I "O5'" 1 
ATOM 6468  C "C5'" . DG  I 5 36  ? 113.31400 102.18900 151.96200 1.000 69.86417  ? -37 DG  I "C5'" 1 
ATOM 6469  C "C4'" . DG  I 5 36  ? 113.85400 101.77800 150.60300 1.000 69.86417  ? -37 DG  I "C4'" 1 
ATOM 6470  O "O4'" . DG  I 5 36  ? 115.24600 102.13000 150.48800 1.000 69.86417  ? -37 DG  I "O4'" 1 
ATOM 6471  C "C3'" . DG  I 5 36  ? 113.77100 100.28900 150.26300 1.000 69.86417  ? -37 DG  I "C3'" 1 
ATOM 6472  O "O3'" . DG  I 5 36  ? 113.21400 100.15600 148.97900 1.000 69.86417  ? -37 DG  I "O3'" 1 
ATOM 6473  C "C2'" . DG  I 5 36  ? 115.23900 99.85800  150.27300 1.000 69.86417  ? -37 DG  I "C2'" 1 
ATOM 6474  C "C1'" . DG  I 5 36  ? 115.88600 101.12000 149.76000 1.000 69.86417  ? -37 DG  I "C1'" 1 
ATOM 6475  N N9    . DG  I 5 36  ? 117.31100 101.24600 150.02300 1.000 69.86417  ? -37 DG  I N9    1 
ATOM 6476  C C8    . DG  I 5 36  ? 117.95200 101.03800 151.21600 1.000 69.86417  ? -37 DG  I C8    1 
ATOM 6477  N N7    . DG  I 5 36  ? 119.23200 101.27200 151.16200 1.000 69.86417  ? -37 DG  I N7    1 
ATOM 6478  C C5    . DG  I 5 36  ? 119.45100 101.66900 149.85300 1.000 69.86417  ? -37 DG  I C5    1 
ATOM 6479  C C6    . DG  I 5 36  ? 120.64600 102.05100 149.20900 1.000 69.86417  ? -37 DG  I C6    1 
ATOM 6480  O O6    . DG  I 5 36  ? 121.78500 102.11300 149.68500 1.000 69.86417  ? -37 DG  I O6    1 
ATOM 6481  N N1    . DG  I 5 36  ? 120.43000 102.38200 147.87600 1.000 69.86417  ? -37 DG  I N1    1 
ATOM 6482  C C2    . DG  I 5 36  ? 119.21000 102.34800 147.24600 1.000 69.86417  ? -37 DG  I C2    1 
ATOM 6483  N N2    . DG  I 5 36  ? 119.19500 102.69800 145.95400 1.000 69.86417  ? -37 DG  I N2    1 
ATOM 6484  N N3    . DG  I 5 36  ? 118.08000 101.99300 147.84200 1.000 69.86417  ? -37 DG  I N3    1 
ATOM 6485  C C4    . DG  I 5 36  ? 118.27700 101.66800 149.14100 1.000 69.86417  ? -37 DG  I C4    1 
ATOM 6486  P P     . DT  I 5 37  ? 112.36600 98.85800  148.57600 1.000 69.30879  ? -36 DT  I P     1 
ATOM 6487  O OP1   . DT  I 5 37  ? 110.93600 99.23100  148.57300 1.000 69.30879  ? -36 DT  I OP1   1 
ATOM 6488  O OP2   . DT  I 5 37  ? 112.82100 97.73100  149.41800 1.000 69.30879  ? -36 DT  I OP2   1 
ATOM 6489  O "O5'" . DT  I 5 37  ? 112.84500 98.57100  147.07900 1.000 69.30879  ? -36 DT  I "O5'" 1 
ATOM 6490  C "C5'" . DT  I 5 37  ? 113.07100 99.65500  146.16700 1.000 69.30879  ? -36 DT  I "C5'" 1 
ATOM 6491  C "C4'" . DT  I 5 37  ? 114.19400 99.32600  145.19100 1.000 69.30879  ? -36 DT  I "C4'" 1 
ATOM 6492  O "O4'" . DT  I 5 37  ? 115.50400 99.55500  145.79300 1.000 69.30879  ? -36 DT  I "O4'" 1 
ATOM 6493  C "C3'" . DT  I 5 37  ? 114.21600 97.88100  144.69300 1.000 69.30879  ? -36 DT  I "C3'" 1 
ATOM 6494  O "O3'" . DT  I 5 37  ? 114.52600 97.85400  143.29100 1.000 69.30879  ? -36 DT  I "O3'" 1 
ATOM 6495  C "C2'" . DT  I 5 37  ? 115.34500 97.28100  145.53200 1.000 69.30879  ? -36 DT  I "C2'" 1 
ATOM 6496  C "C1'" . DT  I 5 37  ? 116.31300 98.43900  145.50000 1.000 69.30879  ? -36 DT  I "C1'" 1 
ATOM 6497  N N1    . DT  I 5 37  ? 117.45500 98.37200  146.48500 1.000 69.30879  ? -36 DT  I N1    1 
ATOM 6498  C C2    . DT  I 5 37  ? 118.70600 98.81100  146.09900 1.000 69.30879  ? -36 DT  I C2    1 
ATOM 6499  O O2    . DT  I 5 37  ? 118.95700 99.20600  144.97600 1.000 69.30879  ? -36 DT  I O2    1 
ATOM 6500  N N3    . DT  I 5 37  ? 119.67000 98.73000  147.07200 1.000 69.30879  ? -36 DT  I N3    1 
ATOM 6501  C C4    . DT  I 5 37  ? 119.50600 98.29600  148.36800 1.000 69.30879  ? -36 DT  I C4    1 
ATOM 6502  O O4    . DT  I 5 37  ? 120.42700 98.26500  149.17300 1.000 69.30879  ? -36 DT  I O4    1 
ATOM 6503  C C5    . DT  I 5 37  ? 118.17400 97.87400  148.71400 1.000 69.30879  ? -36 DT  I C5    1 
ATOM 6504  C C7    . DT  I 5 37  ? 117.89000 97.37600  150.10000 1.000 69.30879  ? -36 DT  I C7    1 
ATOM 6505  C C6    . DT  I 5 37  ? 117.22100 97.93800  147.77000 1.000 69.30879  ? -36 DT  I C6    1 
ATOM 6506  P P     . DA  I 5 38  ? 113.36000 97.83100  142.18300 1.000 64.28347  ? -35 DA  I P     1 
ATOM 6507  O OP1   . DA  I 5 38  ? 112.45500 98.97500  142.40300 1.000 64.28347  ? -35 DA  I OP1   1 
ATOM 6508  O OP2   . DA  I 5 38  ? 112.80700 96.46300  142.14600 1.000 64.28347  ? -35 DA  I OP2   1 
ATOM 6509  O "O5'" . DA  I 5 38  ? 114.12100 98.08000  140.80000 1.000 64.28347  ? -35 DA  I "O5'" 1 
ATOM 6510  C "C5'" . DA  I 5 38  ? 114.81600 99.30300  140.56200 1.000 64.28347  ? -35 DA  I "C5'" 1 
ATOM 6511  C "C4'" . DA  I 5 38  ? 116.21700 99.06600  139.99600 1.000 64.28347  ? -35 DA  I "C4'" 1 
ATOM 6512  O "O4'" . DA  I 5 38  ? 117.14400 98.66900  141.03000 1.000 64.28347  ? -35 DA  I "O4'" 1 
ATOM 6513  C "C3'" . DA  I 5 38  ? 116.35900 98.04100  138.89500 1.000 64.28347  ? -35 DA  I "C3'" 1 
ATOM 6514  O "O3'" . DA  I 5 38  ? 117.31800 98.54000  137.98500 1.000 64.28347  ? -35 DA  I "O3'" 1 
ATOM 6515  C "C2'" . DA  I 5 38  ? 116.86100 96.81700  139.66500 1.000 64.28347  ? -35 DA  I "C2'" 1 
ATOM 6516  C "C1'" . DA  I 5 38  ? 117.79900 97.47300  140.66000 1.000 64.28347  ? -35 DA  I "C1'" 1 
ATOM 6517  N N9    . DA  I 5 38  ? 117.97000 96.75900  141.91200 1.000 64.28347  ? -35 DA  I N9    1 
ATOM 6518  C C8    . DA  I 5 38  ? 117.00800 96.08700  142.59700 1.000 64.28347  ? -35 DA  I C8    1 
ATOM 6519  N N7    . DA  I 5 38  ? 117.41900 95.59600  143.73400 1.000 64.28347  ? -35 DA  I N7    1 
ATOM 6520  C C5    . DA  I 5 38  ? 118.72800 96.00100  143.82200 1.000 64.28347  ? -35 DA  I C5    1 
ATOM 6521  C C6    . DA  I 5 38  ? 119.71000 95.79400  144.80000 1.000 64.28347  ? -35 DA  I C6    1 
ATOM 6522  N N6    . DA  I 5 38  ? 119.48700 95.11100  145.92200 1.000 64.28347  ? -35 DA  I N6    1 
ATOM 6523  N N1    . DA  I 5 38  ? 120.93200 96.31200  144.58200 1.000 64.28347  ? -35 DA  I N1    1 
ATOM 6524  C C2    . DA  I 5 38  ? 121.15100 97.00000  143.45600 1.000 64.28347  ? -35 DA  I C2    1 
ATOM 6525  N N3    . DA  I 5 38  ? 120.29900 97.26000  142.46000 1.000 64.28347  ? -35 DA  I N3    1 
ATOM 6526  C C4    . DA  I 5 38  ? 119.09200 96.72600  142.71100 1.000 64.28347  ? -35 DA  I C4    1 
ATOM 6527  P P     . DG  I 5 39  ? 117.44500 97.96600  136.49800 1.000 63.09168  ? -34 DG  I P     1 
ATOM 6528  O OP1   . DG  I 5 39  ? 117.23400 99.10200  135.58300 1.000 63.09168  ? -34 DG  I OP1   1 
ATOM 6529  O OP2   . DG  I 5 39  ? 116.60600 96.75600  136.37900 1.000 63.09168  ? -34 DG  I OP2   1 
ATOM 6530  O "O5'" . DG  I 5 39  ? 118.97200 97.52300  136.41000 1.000 63.09168  ? -34 DG  I "O5'" 1 
ATOM 6531  C "C5'" . DG  I 5 39  ? 119.99800 98.44800  136.75100 1.000 63.09168  ? -34 DG  I "C5'" 1 
ATOM 6532  C "C4'" . DG  I 5 39  ? 121.25600 97.72800  137.21800 1.000 63.09168  ? -34 DG  I "C4'" 1 
ATOM 6533  O "O4'" . DG  I 5 39  ? 121.03300 97.09600  138.49800 1.000 63.09168  ? -34 DG  I "O4'" 1 
ATOM 6534  C "C3'" . DG  I 5 39  ? 121.76900 96.63100  136.29100 1.000 63.09168  ? -34 DG  I "C3'" 1 
ATOM 6535  O "O3'" . DG  I 5 39  ? 123.18100 96.72300  136.21000 1.000 63.09168  ? -34 DG  I "O3'" 1 
ATOM 6536  C "C2'" . DG  I 5 39  ? 121.32500 95.35400  136.99900 1.000 63.09168  ? -34 DG  I "C2'" 1 
ATOM 6537  C "C1'" . DG  I 5 39  ? 121.49900 95.76900  138.44200 1.000 63.09168  ? -34 DG  I "C1'" 1 
ATOM 6538  N N9    . DG  I 5 39  ? 120.72800 94.99200  139.40100 1.000 63.09168  ? -34 DG  I N9    1 
ATOM 6539  C C8    . DG  I 5 39  ? 119.42300 94.60400  139.28900 1.000 63.09168  ? -34 DG  I C8    1 
ATOM 6540  N N7    . DG  I 5 39  ? 118.98400 93.94700  140.32400 1.000 63.09168  ? -34 DG  I N7    1 
ATOM 6541  C C5    . DG  I 5 39  ? 120.07900 93.87700  141.16800 1.000 63.09168  ? -34 DG  I C5    1 
ATOM 6542  C C6    . DG  I 5 39  ? 120.21500 93.27300  142.43500 1.000 63.09168  ? -34 DG  I C6    1 
ATOM 6543  O O6    . DG  I 5 39  ? 119.36400 92.65700  143.08900 1.000 63.09168  ? -34 DG  I O6    1 
ATOM 6544  N N1    . DG  I 5 39  ? 121.49300 93.43600  142.94400 1.000 63.09168  ? -34 DG  I N1    1 
ATOM 6545  C C2    . DG  I 5 39  ? 122.51400 94.09800  142.31000 1.000 63.09168  ? -34 DG  I C2    1 
ATOM 6546  N N2    . DG  I 5 39  ? 123.68200 94.15600  142.95800 1.000 63.09168  ? -34 DG  I N2    1 
ATOM 6547  N N3    . DG  I 5 39  ? 122.39900 94.67200  141.12700 1.000 63.09168  ? -34 DG  I N3    1 
ATOM 6548  C C4    . DG  I 5 39  ? 121.15900 94.51900  140.61500 1.000 63.09168  ? -34 DG  I C4    1 
ATOM 6549  P P     . DA  I 5 40  ? 123.94700 96.34800  134.85200 1.000 68.37387  ? -33 DA  I P     1 
ATOM 6550  O OP1   . DA  I 5 40  ? 124.11200 97.59600  134.07800 1.000 68.37387  ? -33 DA  I OP1   1 
ATOM 6551  O OP2   . DA  I 5 40  ? 123.24900 95.19400  134.24800 1.000 68.37387  ? -33 DA  I OP2   1 
ATOM 6552  O "O5'" . DA  I 5 40  ? 125.38700 95.85800  135.34900 1.000 68.37387  ? -33 DA  I "O5'" 1 
ATOM 6553  C "C5'" . DA  I 5 40  ? 126.11300 96.62400  136.30600 1.000 68.37387  ? -33 DA  I "C5'" 1 
ATOM 6554  C "C4'" . DA  I 5 40  ? 126.85100 95.72600  137.29200 1.000 68.37387  ? -33 DA  I "C4'" 1 
ATOM 6555  O "O4'" . DA  I 5 40  ? 125.92600 95.10300  138.21500 1.000 68.37387  ? -33 DA  I "O4'" 1 
ATOM 6556  C "C3'" . DA  I 5 40  ? 127.66200 94.58900  136.68100 1.000 68.37387  ? -33 DA  I "C3'" 1 
ATOM 6557  O "O3'" . DA  I 5 40  ? 128.90200 94.52100  137.36500 1.000 68.37387  ? -33 DA  I "O3'" 1 
ATOM 6558  C "C2'" . DA  I 5 40  ? 126.77700 93.36400  136.95600 1.000 68.37387  ? -33 DA  I "C2'" 1 
ATOM 6559  C "C1'" . DA  I 5 40  ? 126.22600 93.72900  138.31800 1.000 68.37387  ? -33 DA  I "C1'" 1 
ATOM 6560  N N9    . DA  I 5 40  ? 124.97000 93.08500  138.67100 1.000 68.37387  ? -33 DA  I N9    1 
ATOM 6561  C C8    . DA  I 5 40  ? 123.81200 93.16300  137.96900 1.000 68.37387  ? -33 DA  I C8    1 
ATOM 6562  N N7    . DA  I 5 40  ? 122.80700 92.54200  138.52100 1.000 68.37387  ? -33 DA  I N7    1 
ATOM 6563  C C5    . DA  I 5 40  ? 123.34500 91.99600  139.66400 1.000 68.37387  ? -33 DA  I C5    1 
ATOM 6564  C C6    . DA  I 5 40  ? 122.78800 91.20000  140.67400 1.000 68.37387  ? -33 DA  I C6    1 
ATOM 6565  N N6    . DA  I 5 40  ? 121.51100 90.82200  140.67500 1.000 68.37387  ? -33 DA  I N6    1 
ATOM 6566  N N1    . DA  I 5 40  ? 123.58700 90.81600  141.68800 1.000 68.37387  ? -33 DA  I N1    1 
ATOM 6567  C C2    . DA  I 5 40  ? 124.87200 91.20300  141.68200 1.000 68.37387  ? -33 DA  I C2    1 
ATOM 6568  N N3    . DA  I 5 40  ? 125.51300 91.95600  140.77700 1.000 68.37387  ? -33 DA  I N3    1 
ATOM 6569  C C4    . DA  I 5 40  ? 124.68200 92.32100  139.78400 1.000 68.37387  ? -33 DA  I C4    1 
ATOM 6570  P P     . DC  I 5 41  ? 130.10500 93.61000  136.82400 1.000 73.80256  ? -32 DC  I P     1 
ATOM 6571  O OP1   . DC  I 5 41  ? 131.36300 94.17400  137.35700 1.000 73.80256  ? -32 DC  I OP1   1 
ATOM 6572  O OP2   . DC  I 5 41  ? 129.93900 93.43600  135.36400 1.000 73.80256  ? -32 DC  I OP2   1 
ATOM 6573  O "O5'" . DC  I 5 41  ? 129.83400 92.20600  137.52000 1.000 73.80256  ? -32 DC  I "O5'" 1 
ATOM 6574  C "C5'" . DC  I 5 41  ? 129.67200 92.12100  138.93600 1.000 73.80256  ? -32 DC  I "C5'" 1 
ATOM 6575  C "C4'" . DC  I 5 41  ? 129.53200 90.67100  139.35400 1.000 73.80256  ? -32 DC  I "C4'" 1 
ATOM 6576  O "O4'" . DC  I 5 41  ? 128.13400 90.36000  139.60400 1.000 73.80256  ? -32 DC  I "O4'" 1 
ATOM 6577  C "C3'" . DC  I 5 41  ? 130.00000 89.66800  138.29600 1.000 73.80256  ? -32 DC  I "C3'" 1 
ATOM 6578  O "O3'" . DC  I 5 41  ? 130.72000 88.61200  138.91000 1.000 73.80256  ? -32 DC  I "O3'" 1 
ATOM 6579  C "C2'" . DC  I 5 41  ? 128.69100 89.18200  137.68700 1.000 73.80256  ? -32 DC  I "C2'" 1 
ATOM 6580  C "C1'" . DC  I 5 41  ? 127.81900 89.17900  138.91500 1.000 73.80256  ? -32 DC  I "C1'" 1 
ATOM 6581  N N1    . DC  I 5 41  ? 126.37800 89.13800  138.62600 1.000 73.80256  ? -32 DC  I N1    1 
ATOM 6582  C C2    . DC  I 5 41  ? 125.53800 88.43800  139.48200 1.000 73.80256  ? -32 DC  I C2    1 
ATOM 6583  O O2    . DC  I 5 41  ? 126.03600 87.84000  140.43900 1.000 73.80256  ? -32 DC  I O2    1 
ATOM 6584  N N3    . DC  I 5 41  ? 124.21300 88.39800  139.21300 1.000 73.80256  ? -32 DC  I N3    1 
ATOM 6585  C C4    . DC  I 5 41  ? 123.72900 89.05000  138.15600 1.000 73.80256  ? -32 DC  I C4    1 
ATOM 6586  N N4    . DC  I 5 41  ? 122.41400 88.99700  137.93700 1.000 73.80256  ? -32 DC  I N4    1 
ATOM 6587  C C5    . DC  I 5 41  ? 124.57200 89.79000  137.28000 1.000 73.80256  ? -32 DC  I C5    1 
ATOM 6588  C C6    . DC  I 5 41  ? 125.87900 89.80900  137.55300 1.000 73.80256  ? -32 DC  I C6    1 
ATOM 6589  P P     . DA  I 5 42  ? 131.89500 87.87300  138.10600 1.000 73.84664  ? -31 DA  I P     1 
ATOM 6590  O OP1   . DA  I 5 42  ? 133.16000 88.53500  138.48400 1.000 73.84664  ? -31 DA  I OP1   1 
ATOM 6591  O OP2   . DA  I 5 42  ? 131.51100 87.80200  136.67900 1.000 73.84664  ? -31 DA  I OP2   1 
ATOM 6592  O "O5'" . DA  I 5 42  ? 131.89800 86.39000  138.70000 1.000 73.84664  ? -31 DA  I "O5'" 1 
ATOM 6593  C "C5'" . DA  I 5 42  ? 132.05900 86.18300  140.09600 1.000 73.84664  ? -31 DA  I "C5'" 1 
ATOM 6594  C "C4'" . DA  I 5 42  ? 131.03500 85.19700  140.63700 1.000 73.84664  ? -31 DA  I "C4'" 1 
ATOM 6595  O "O4'" . DA  I 5 42  ? 129.69000 85.61600  140.31500 1.000 73.84664  ? -31 DA  I "O4'" 1 
ATOM 6596  C "C3'" . DA  I 5 42  ? 131.17400 83.76500  140.12300 1.000 73.84664  ? -31 DA  I "C3'" 1 
ATOM 6597  O "O3'" . DA  I 5 42  ? 131.29800 82.88900  141.22800 1.000 73.84664  ? -31 DA  I "O3'" 1 
ATOM 6598  C "C2'" . DA  I 5 42  ? 129.87700 83.52700  139.33000 1.000 73.84664  ? -31 DA  I "C2'" 1 
ATOM 6599  C "C1'" . DA  I 5 42  ? 128.91700 84.47900  140.01500 1.000 73.84664  ? -31 DA  I "C1'" 1 
ATOM 6600  N N9    . DA  I 5 42  ? 127.80800 84.93400  139.18300 1.000 73.84664  ? -31 DA  I N9    1 
ATOM 6601  C C8    . DA  I 5 42  ? 127.89400 85.79600  138.13500 1.000 73.84664  ? -31 DA  I C8    1 
ATOM 6602  N N7    . DA  I 5 42  ? 126.74800 86.07600  137.57900 1.000 73.84664  ? -31 DA  I N7    1 
ATOM 6603  C C5    . DA  I 5 42  ? 125.84100 85.33000  138.29800 1.000 73.84664  ? -31 DA  I C5    1 
ATOM 6604  C C6    . DA  I 5 42  ? 124.45200 85.18800  138.18900 1.000 73.84664  ? -31 DA  I C6    1 
ATOM 6605  N N6    . DA  I 5 42  ? 123.72900 85.81900  137.26500 1.000 73.84664  ? -31 DA  I N6    1 
ATOM 6606  N N1    . DA  I 5 42  ? 123.83300 84.36800  139.05800 1.000 73.84664  ? -31 DA  I N1    1 
ATOM 6607  C C2    . DA  I 5 42  ? 124.56800 83.73500  139.98300 1.000 73.84664  ? -31 DA  I C2    1 
ATOM 6608  N N3    . DA  I 5 42  ? 125.88900 83.79300  140.18400 1.000 73.84664  ? -31 DA  I N3    1 
ATOM 6609  C C4    . DA  I 5 42  ? 126.47000 84.61900  139.29900 1.000 73.84664  ? -31 DA  I C4    1 
ATOM 6610  P P     . DG  I 5 43  ? 131.81400 81.38600  141.02100 1.000 72.96512  ? -30 DG  I P     1 
ATOM 6611  O OP1   . DG  I 5 43  ? 132.46100 80.95200  142.27800 1.000 72.96512  ? -30 DG  I OP1   1 
ATOM 6612  O OP2   . DG  I 5 43  ? 132.57800 81.34600  139.75500 1.000 72.96512  ? -30 DG  I OP2   1 
ATOM 6613  O "O5'" . DG  I 5 43  ? 130.46500 80.56000  140.81900 1.000 72.96512  ? -30 DG  I "O5'" 1 
ATOM 6614  C "C5'" . DG  I 5 43  ? 129.48500 80.55100  141.85100 1.000 72.96512  ? -30 DG  I "C5'" 1 
ATOM 6615  C "C4'" . DG  I 5 43  ? 128.28300 79.72200  141.43900 1.000 72.96512  ? -30 DG  I "C4'" 1 
ATOM 6616  O "O4'" . DG  I 5 43  ? 127.36600 80.52800  140.66000 1.000 72.96512  ? -30 DG  I "O4'" 1 
ATOM 6617  C "C3'" . DG  I 5 43  ? 128.61200 78.49500  140.59000 1.000 72.96512  ? -30 DG  I "C3'" 1 
ATOM 6618  O "O3'" . DG  I 5 43  ? 128.02300 77.34600  141.18900 1.000 72.96512  ? -30 DG  I "O3'" 1 
ATOM 6619  C "C2'" . DG  I 5 43  ? 128.00800 78.83300  139.21500 1.000 72.96512  ? -30 DG  I "C2'" 1 
ATOM 6620  C "C1'" . DG  I 5 43  ? 126.87100 79.76100  139.59500 1.000 72.96512  ? -30 DG  I "C1'" 1 
ATOM 6621  N N9    . DG  I 5 43  ? 126.49000 80.69700  138.54300 1.000 72.96512  ? -30 DG  I N9    1 
ATOM 6622  C C8    . DG  I 5 43  ? 127.32900 81.51600  137.83000 1.000 72.96512  ? -30 DG  I C8    1 
ATOM 6623  N N7    . DG  I 5 43  ? 126.71100 82.26200  136.96000 1.000 72.96512  ? -30 DG  I N7    1 
ATOM 6624  C C5    . DG  I 5 43  ? 125.37800 81.90700  137.09200 1.000 72.96512  ? -30 DG  I C5    1 
ATOM 6625  C C6    . DG  I 5 43  ? 124.24200 82.37700  136.40000 1.000 72.96512  ? -30 DG  I C6    1 
ATOM 6626  O O6    . DG  I 5 43  ? 124.19000 83.23500  135.50900 1.000 72.96512  ? -30 DG  I O6    1 
ATOM 6627  N N1    . DG  I 5 43  ? 123.08000 81.75700  136.83700 1.000 72.96512  ? -30 DG  I N1    1 
ATOM 6628  C C2    . DG  I 5 43  ? 123.02300 80.79700  137.81800 1.000 72.96512  ? -30 DG  I C2    1 
ATOM 6629  N N2    . DG  I 5 43  ? 121.81100 80.30900  138.10600 1.000 72.96512  ? -30 DG  I N2    1 
ATOM 6630  N N3    . DG  I 5 43  ? 124.08200 80.34600  138.47500 1.000 72.96512  ? -30 DG  I N3    1 
ATOM 6631  C C4    . DG  I 5 43  ? 125.22200 80.94300  138.06000 1.000 72.96512  ? -30 DG  I C4    1 
ATOM 6632  P P     . DC  I 5 44  ? 128.17500 75.88900  140.53300 1.000 71.90910  ? -29 DC  I P     1 
ATOM 6633  O OP1   . DC  I 5 44  ? 128.13200 74.91000  141.63900 1.000 71.90910  ? -29 DC  I OP1   1 
ATOM 6634  O OP2   . DC  I 5 44  ? 129.32900 75.88200  139.60600 1.000 71.90910  ? -29 DC  I OP2   1 
ATOM 6635  O "O5'" . DC  I 5 44  ? 126.83500 75.73600  139.69100 1.000 71.90910  ? -29 DC  I "O5'" 1 
ATOM 6636  C "C5'" . DC  I 5 44  ? 125.58300 75.84100  140.34900 1.000 71.90910  ? -29 DC  I "C5'" 1 
ATOM 6637  C "C4'" . DC  I 5 44  ? 124.44000 75.63300  139.37400 1.000 71.90910  ? -29 DC  I "C4'" 1 
ATOM 6638  O "O4'" . DC  I 5 44  ? 124.28700 76.80000  138.52300 1.000 71.90910  ? -29 DC  I "O4'" 1 
ATOM 6639  C "C3'" . DC  I 5 44  ? 124.59700 74.44200  138.42900 1.000 71.90910  ? -29 DC  I "C3'" 1 
ATOM 6640  O "O3'" . DC  I 5 44  ? 123.35800 73.78900  138.30500 1.000 71.90910  ? -29 DC  I "O3'" 1 
ATOM 6641  C "C2'" . DC  I 5 44  ? 124.99100 75.10700  137.12100 1.000 71.90910  ? -29 DC  I "C2'" 1 
ATOM 6642  C "C1'" . DC  I 5 44  ? 124.16000 76.36500  137.19200 1.000 71.90910  ? -29 DC  I "C1'" 1 
ATOM 6643  N N1    . DC  I 5 44  ? 124.61600 77.45000  136.28800 1.000 71.90910  ? -29 DC  I N1    1 
ATOM 6644  C C2    . DC  I 5 44  ? 123.67100 78.17700  135.56900 1.000 71.90910  ? -29 DC  I C2    1 
ATOM 6645  O O2    . DC  I 5 44  ? 122.48000 77.88100  135.68500 1.000 71.90910  ? -29 DC  I O2    1 
ATOM 6646  N N3    . DC  I 5 44  ? 124.09000 79.17200  134.75500 1.000 71.90910  ? -29 DC  I N3    1 
ATOM 6647  C C4    . DC  I 5 44  ? 125.38700 79.45100  134.66000 1.000 71.90910  ? -29 DC  I C4    1 
ATOM 6648  N N4    . DC  I 5 44  ? 125.75500 80.44400  133.84700 1.000 71.90910  ? -29 DC  I N4    1 
ATOM 6649  C C5    . DC  I 5 44  ? 126.36600 78.72700  135.39700 1.000 71.90910  ? -29 DC  I C5    1 
ATOM 6650  C C6    . DC  I 5 44  ? 125.93900 77.74700  136.19400 1.000 71.90910  ? -29 DC  I C6    1 
ATOM 6651  P P     . DT  I 5 45  ? 123.28000 72.22700  137.95400 1.000 68.63547  ? -28 DT  I P     1 
ATOM 6652  O OP1   . DT  I 5 45  ? 122.94100 71.50500  139.20000 1.000 68.63547  ? -28 DT  I OP1   1 
ATOM 6653  O OP2   . DT  I 5 45  ? 124.49000 71.85000  137.18700 1.000 68.63547  ? -28 DT  I OP2   1 
ATOM 6654  O "O5'" . DT  I 5 45  ? 122.02900 72.15600  136.96800 1.000 68.63547  ? -28 DT  I "O5'" 1 
ATOM 6655  C "C5'" . DT  I 5 45  ? 120.82500 72.81500  137.32200 1.000 68.63547  ? -28 DT  I "C5'" 1 
ATOM 6656  C "C4'" . DT  I 5 45  ? 120.07600 73.28000  136.08600 1.000 68.63547  ? -28 DT  I "C4'" 1 
ATOM 6657  O "O4'" . DT  I 5 45  ? 120.77500 74.37300  135.43600 1.000 68.63547  ? -28 DT  I "O4'" 1 
ATOM 6658  C "C3'" . DT  I 5 45  ? 119.88000 72.20900  135.01600 1.000 68.63547  ? -28 DT  I "C3'" 1 
ATOM 6659  O "O3'" . DT  I 5 45  ? 118.52500 72.21500  134.60500 1.000 68.63547  ? -28 DT  I "O3'" 1 
ATOM 6660  C "C2'" . DT  I 5 45  ? 120.82800 72.65900  133.89800 1.000 68.63547  ? -28 DT  I "C2'" 1 
ATOM 6661  C "C1'" . DT  I 5 45  ? 120.73500 74.15900  134.04800 1.000 68.63547  ? -28 DT  I "C1'" 1 
ATOM 6662  N N1    . DT  I 5 45  ? 121.83600 74.95900  133.41200 1.000 68.63547  ? -28 DT  I N1    1 
ATOM 6663  C C2    . DT  I 5 45  ? 121.50000 75.99200  132.57200 1.000 68.63547  ? -28 DT  I C2    1 
ATOM 6664  O O2    . DT  I 5 45  ? 120.35300 76.25600  132.26900 1.000 68.63547  ? -28 DT  I O2    1 
ATOM 6665  N N3    . DT  I 5 45  ? 122.56500 76.69100  132.06900 1.000 68.63547  ? -28 DT  I N3    1 
ATOM 6666  C C4    . DT  I 5 45  ? 123.89800 76.48200  132.33300 1.000 68.63547  ? -28 DT  I C4    1 
ATOM 6667  O O4    . DT  I 5 45  ? 124.78200 77.16200  131.83900 1.000 68.63547  ? -28 DT  I O4    1 
ATOM 6668  C C5    . DT  I 5 45  ? 124.18600 75.40900  133.23500 1.000 68.63547  ? -28 DT  I C5    1 
ATOM 6669  C C7    . DT  I 5 45  ? 125.61000 75.10100  133.57600 1.000 68.63547  ? -28 DT  I C7    1 
ATOM 6670  C C6    . DT  I 5 45  ? 123.15400 74.70500  133.73900 1.000 68.63547  ? -28 DT  I C6    1 
ATOM 6671  P P     . DC  I 5 46  ? 117.86000 70.90000  133.97600 1.000 65.01836  ? -27 DC  I P     1 
ATOM 6672  O OP1   . DC  I 5 46  ? 116.76600 70.49600  134.88400 1.000 65.01836  ? -27 DC  I OP1   1 
ATOM 6673  O OP2   . DC  I 5 46  ? 118.95100 69.95000  133.66100 1.000 65.01836  ? -27 DC  I OP2   1 
ATOM 6674  O "O5'" . DC  I 5 46  ? 117.22300 71.40000  132.59900 1.000 65.01836  ? -27 DC  I "O5'" 1 
ATOM 6675  C "C5'" . DC  I 5 46  ? 117.14400 72.79400  132.29500 1.000 65.01836  ? -27 DC  I "C5'" 1 
ATOM 6676  C "C4'" . DC  I 5 46  ? 117.47700 73.03800  130.83300 1.000 65.01836  ? -27 DC  I "C4'" 1 
ATOM 6677  O "O4'" . DC  I 5 46  ? 118.81700 73.59100  130.69400 1.000 65.01836  ? -27 DC  I "O4'" 1 
ATOM 6678  C "C3'" . DC  I 5 46  ? 117.46000 71.79400  129.94800 1.000 65.01836  ? -27 DC  I "C3'" 1 
ATOM 6679  O "O3'" . DC  I 5 46  ? 116.93200 72.13200  128.67300 1.000 65.01836  ? -27 DC  I "O3'" 1 
ATOM 6680  C "C2'" . DC  I 5 46  ? 118.94300 71.46700  129.85600 1.000 65.01836  ? -27 DC  I "C2'" 1 
ATOM 6681  C "C1'" . DC  I 5 46  ? 119.47400 72.86700  129.68100 1.000 65.01836  ? -27 DC  I "C1'" 1 
ATOM 6682  N N1    . DC  I 5 46  ? 120.94700 73.01900  129.84100 1.000 65.01836  ? -27 DC  I N1    1 
ATOM 6683  C C2    . DC  I 5 46  ? 121.57600 74.11500  129.25800 1.000 65.01836  ? -27 DC  I C2    1 
ATOM 6684  O O2    . DC  I 5 46  ? 120.89200 74.91500  128.61900 1.000 65.01836  ? -27 DC  I O2    1 
ATOM 6685  N N3    . DC  I 5 46  ? 122.91100 74.26400  129.40300 1.000 65.01836  ? -27 DC  I N3    1 
ATOM 6686  C C4    . DC  I 5 46  ? 123.60400 73.37500  130.10300 1.000 65.01836  ? -27 DC  I C4    1 
ATOM 6687  N N4    . DC  I 5 46  ? 124.92000 73.56500  130.22300 1.000 65.01836  ? -27 DC  I N4    1 
ATOM 6688  C C5    . DC  I 5 46  ? 122.98000 72.25000  130.71200 1.000 65.01836  ? -27 DC  I C5    1 
ATOM 6689  C C6    . DC  I 5 46  ? 121.66300 72.10900  130.54900 1.000 65.01836  ? -27 DC  I C6    1 
ATOM 6690  P P     . DT  I 5 47  ? 115.55300 71.49700  128.15800 1.000 64.35763  ? -26 DT  I P     1 
ATOM 6691  O OP1   . DT  I 5 47  ? 114.58400 71.57100  129.27100 1.000 64.35763  ? -26 DT  I OP1   1 
ATOM 6692  O OP2   . DT  I 5 47  ? 115.87300 70.19000  127.54800 1.000 64.35763  ? -26 DT  I OP2   1 
ATOM 6693  O "O5'" . DT  I 5 47  ? 115.08400 72.48600  126.98900 1.000 64.35763  ? -26 DT  I "O5'" 1 
ATOM 6694  C "C5'" . DT  I 5 47  ? 114.85100 73.86100  127.27400 1.000 64.35763  ? -26 DT  I "C5'" 1 
ATOM 6695  C "C4'" . DT  I 5 47  ? 115.55700 74.77000  126.27600 1.000 64.35763  ? -26 DT  I "C4'" 1 
ATOM 6696  O "O4'" . DT  I 5 47  ? 116.99200 74.68000  126.44000 1.000 64.35763  ? -26 DT  I "O4'" 1 
ATOM 6697  C "C3'" . DT  I 5 47  ? 115.29200 74.48300  124.80200 1.000 64.35763  ? -26 DT  I "C3'" 1 
ATOM 6698  O "O3'" . DT  I 5 47  ? 115.03300 75.71500  124.15100 1.000 64.35763  ? -26 DT  I "O3'" 1 
ATOM 6699  C "C2'" . DT  I 5 47  ? 116.60700 73.84800  124.33300 1.000 64.35763  ? -26 DT  I "C2'" 1 
ATOM 6700  C "C1'" . DT  I 5 47  ? 117.59900 74.62100  125.16900 1.000 64.35763  ? -26 DT  I "C1'" 1 
ATOM 6701  N N1    . DT  I 5 47  ? 118.91800 73.96500  125.37200 1.000 64.35763  ? -26 DT  I N1    1 
ATOM 6702  C C2    . DT  I 5 47  ? 120.07000 74.68600  125.16100 1.000 64.35763  ? -26 DT  I C2    1 
ATOM 6703  O O2    . DT  I 5 47  ? 120.07500 75.82900  124.74900 1.000 64.35763  ? -26 DT  I O2    1 
ATOM 6704  N N3    . DT  I 5 47  ? 121.22300 74.00700  125.44000 1.000 64.35763  ? -26 DT  I N3    1 
ATOM 6705  C C4    . DT  I 5 47  ? 121.33900 72.71900  125.90900 1.000 64.35763  ? -26 DT  I C4    1 
ATOM 6706  O O4    . DT  I 5 47  ? 122.41700 72.19300  126.12600 1.000 64.35763  ? -26 DT  I O4    1 
ATOM 6707  C C5    . DT  I 5 47  ? 120.10500 72.03000  126.12400 1.000 64.35763  ? -26 DT  I C5    1 
ATOM 6708  C C7    . DT  I 5 47  ? 120.12700 70.61900  126.61400 1.000 64.35763  ? -26 DT  I C7    1 
ATOM 6709  C C6    . DT  I 5 47  ? 118.96200 72.67800  125.85900 1.000 64.35763  ? -26 DT  I C6    1 
ATOM 6710  P P     . DA  I 5 48  ? 114.12000 75.77800  122.83500 1.000 61.63036  ? -25 DA  I P     1 
ATOM 6711  O OP1   . DA  I 5 48  ? 113.18300 76.91100  122.97400 1.000 61.63036  ? -25 DA  I OP1   1 
ATOM 6712  O OP2   . DA  I 5 48  ? 113.60000 74.41800  122.59000 1.000 61.63036  ? -25 DA  I OP2   1 
ATOM 6713  O "O5'" . DA  I 5 48  ? 115.17000 76.13000  121.68900 1.000 61.63036  ? -25 DA  I "O5'" 1 
ATOM 6714  C "C5'" . DA  I 5 48  ? 116.06600 77.22100  121.87200 1.000 61.63036  ? -25 DA  I "C5'" 1 
ATOM 6715  C "C4'" . DA  I 5 48  ? 117.32700 77.05500  121.03700 1.000 61.63036  ? -25 DA  I "C4'" 1 
ATOM 6716  O "O4'" . DA  I 5 48  ? 118.18600 76.05500  121.64000 1.000 61.63036  ? -25 DA  I "O4'" 1 
ATOM 6717  C "C3'" . DA  I 5 48  ? 117.11200 76.60100  119.59200 1.000 61.63036  ? -25 DA  I "C3'" 1 
ATOM 6718  O "O3'" . DA  I 5 48  ? 118.01700 77.29000  118.73900 1.000 61.63036  ? -25 DA  I "O3'" 1 
ATOM 6719  C "C2'" . DA  I 5 48  ? 117.46800 75.11900  119.66100 1.000 61.63036  ? -25 DA  I "C2'" 1 
ATOM 6720  C "C1'" . DA  I 5 48  ? 118.62300 75.18700  120.63100 1.000 61.63036  ? -25 DA  I "C1'" 1 
ATOM 6721  N N9    . DA  I 5 48  ? 118.99700 73.91400  121.22800 1.000 61.63036  ? -25 DA  I N9    1 
ATOM 6722  C C8    . DA  I 5 48  ? 118.19100 72.84200  121.47500 1.000 61.63036  ? -25 DA  I C8    1 
ATOM 6723  N N7    . DA  I 5 48  ? 118.81400 71.83100  122.03000 1.000 61.63036  ? -25 DA  I N7    1 
ATOM 6724  C C5    . DA  I 5 48  ? 120.12300 72.26700  122.13100 1.000 61.63036  ? -25 DA  I C5    1 
ATOM 6725  C C6    . DA  I 5 48  ? 121.29400 71.66100  122.62800 1.000 61.63036  ? -25 DA  I C6    1 
ATOM 6726  N N6    . DA  I 5 48  ? 121.32500 70.42900  123.13700 1.000 61.63036  ? -25 DA  I N6    1 
ATOM 6727  N N1    . DA  I 5 48  ? 122.43900 72.37400  122.57600 1.000 61.63036  ? -25 DA  I N1    1 
ATOM 6728  C C2    . DA  I 5 48  ? 122.40700 73.60700  122.06400 1.000 61.63036  ? -25 DA  I C2    1 
ATOM 6729  N N3    . DA  I 5 48  ? 121.37000 74.27900  121.57400 1.000 61.63036  ? -25 DA  I N3    1 
ATOM 6730  C C4    . DA  I 5 48  ? 120.25100 73.54500  121.63600 1.000 61.63036  ? -25 DA  I C4    1 
ATOM 6731  P P     . DG  I 5 49  ? 117.53300 78.55300  117.87700 1.000 56.89161  ? -24 DG  I P     1 
ATOM 6732  O OP1   . DG  I 5 49  ? 116.98200 79.54200  118.82200 1.000 56.89161  ? -24 DG  I OP1   1 
ATOM 6733  O OP2   . DG  I 5 49  ? 116.68400 78.05600  116.77900 1.000 56.89161  ? -24 DG  I OP2   1 
ATOM 6734  O "O5'" . DG  I 5 49  ? 118.88400 79.14700  117.24800 1.000 56.89161  ? -24 DG  I "O5'" 1 
ATOM 6735  C "C5'" . DG  I 5 49  ? 119.98000 79.53100  118.08400 1.000 56.89161  ? -24 DG  I "C5'" 1 
ATOM 6736  C "C4'" . DG  I 5 49  ? 121.26000 78.81500  117.67700 1.000 56.89161  ? -24 DG  I "C4'" 1 
ATOM 6737  O "O4'" . DG  I 5 49  ? 121.29400 77.50200  118.24800 1.000 56.89161  ? -24 DG  I "O4'" 1 
ATOM 6738  C "C3'" . DG  I 5 49  ? 121.47500 78.62800  116.17500 1.000 56.89161  ? -24 DG  I "C3'" 1 
ATOM 6739  O "O3'" . DG  I 5 49  ? 122.63800 79.35700  115.77000 1.000 56.89161  ? -24 DG  I "O3'" 1 
ATOM 6740  C "C2'" . DG  I 5 49  ? 121.63500 77.10900  116.00500 1.000 56.89161  ? -24 DG  I "C2'" 1 
ATOM 6741  C "C1'" . DG  I 5 49  ? 122.02000 76.66400  117.39800 1.000 56.89161  ? -24 DG  I "C1'" 1 
ATOM 6742  N N9    . DG  I 5 49  ? 121.61700 75.30700  117.72300 1.000 56.89161  ? -24 DG  I N9    1 
ATOM 6743  C C8    . DG  I 5 49  ? 120.34900 74.79800  117.67000 1.000 56.89161  ? -24 DG  I C8    1 
ATOM 6744  N N7    . DG  I 5 49  ? 120.26600 73.56200  118.06100 1.000 56.89161  ? -24 DG  I N7    1 
ATOM 6745  C C5    . DG  I 5 49  ? 121.56700 73.22500  118.38600 1.000 56.89161  ? -24 DG  I C5    1 
ATOM 6746  C C6    . DG  I 5 49  ? 122.09400 72.00700  118.86100 1.000 56.89161  ? -24 DG  I C6    1 
ATOM 6747  O O6    . DG  I 5 49  ? 121.49200 70.95200  119.09300 1.000 56.89161  ? -24 DG  I O6    1 
ATOM 6748  N N1    . DG  I 5 49  ? 123.46900 72.08600  119.06400 1.000 56.89161  ? -24 DG  I N1    1 
ATOM 6749  C C2    . DG  I 5 49  ? 124.23500 73.20600  118.84000 1.000 56.89161  ? -24 DG  I C2    1 
ATOM 6750  N N2    . DG  I 5 49  ? 125.54600 73.09300  119.09100 1.000 56.89161  ? -24 DG  I N2    1 
ATOM 6751  N N3    . DG  I 5 49  ? 123.74900 74.35600  118.39500 1.000 56.89161  ? -24 DG  I N3    1 
ATOM 6752  C C4    . DG  I 5 49  ? 122.41300 74.29100  118.19000 1.000 56.89161  ? -24 DG  I C4    1 
ATOM 6753  P P     . DC  I 5 50  ? 123.16100 79.33300  114.25300 1.000 58.70631  ? -23 DC  I P     1 
ATOM 6754  O OP1   . DC  I 5 50  ? 123.82800 80.62400  114.00800 1.000 58.70631  ? -23 DC  I OP1   1 
ATOM 6755  O OP2   . DC  I 5 50  ? 122.07300 78.91600  113.34800 1.000 58.70631  ? -23 DC  I OP2   1 
ATOM 6756  O "O5'" . DC  I 5 50  ? 124.29800 78.21500  114.27200 1.000 58.70631  ? -23 DC  I "O5'" 1 
ATOM 6757  C "C5'" . DC  I 5 50  ? 125.36600 78.32600  115.20900 1.000 58.70631  ? -23 DC  I "C5'" 1 
ATOM 6758  C "C4'" . DC  I 5 50  ? 126.33800 77.15900  115.09800 1.000 58.70631  ? -23 DC  I "C4'" 1 
ATOM 6759  O "O4'" . DC  I 5 50  ? 125.74500 75.95000  115.62900 1.000 58.70631  ? -23 DC  I "O4'" 1 
ATOM 6760  C "C3'" . DC  I 5 50  ? 126.81100 76.82500  113.68800 1.000 58.70631  ? -23 DC  I "C3'" 1 
ATOM 6761  O "O3'" . DC  I 5 50  ? 128.21400 76.59500  113.71700 1.000 58.70631  ? -23 DC  I "O3'" 1 
ATOM 6762  C "C2'" . DC  I 5 50  ? 126.02300 75.56000  113.34400 1.000 58.70631  ? -23 DC  I "C2'" 1 
ATOM 6763  C "C1'" . DC  I 5 50  ? 125.89900 74.89900  114.70500 1.000 58.70631  ? -23 DC  I "C1'" 1 
ATOM 6764  N N1    . DC  I 5 50  ? 124.71900 74.00500  114.85600 1.000 58.70631  ? -23 DC  I N1    1 
ATOM 6765  C C2    . DC  I 5 50  ? 124.88200 72.71800  115.36700 1.000 58.70631  ? -23 DC  I C2    1 
ATOM 6766  O O2    . DC  I 5 50  ? 126.01800 72.31700  115.62600 1.000 58.70631  ? -23 DC  I O2    1 
ATOM 6767  N N3    . DC  I 5 50  ? 123.79000 71.93300  115.52400 1.000 58.70631  ? -23 DC  I N3    1 
ATOM 6768  C C4    . DC  I 5 50  ? 122.58500 72.40500  115.22600 1.000 58.70631  ? -23 DC  I C4    1 
ATOM 6769  N N4    . DC  I 5 50  ? 121.53300 71.60100  115.40100 1.000 58.70631  ? -23 DC  I N4    1 
ATOM 6770  C C5    . DC  I 5 50  ? 122.40000 73.72300  114.73200 1.000 58.70631  ? -23 DC  I C5    1 
ATOM 6771  C C6    . DC  I 5 50  ? 123.48300 74.47800  114.57000 1.000 58.70631  ? -23 DC  I C6    1 
ATOM 6772  P P     . DA  I 5 51  ? 129.10600 76.72900  112.38800 1.000 69.59139  ? -22 DA  I P     1 
ATOM 6773  O OP1   . DA  I 5 51  ? 130.31800 77.49800  112.74300 1.000 69.59139  ? -22 DA  I OP1   1 
ATOM 6774  O OP2   . DA  I 5 51  ? 128.24100 77.16800  111.27200 1.000 69.59139  ? -22 DA  I OP2   1 
ATOM 6775  O "O5'" . DA  I 5 51  ? 129.54500 75.22700  112.10400 1.000 69.59139  ? -22 DA  I "O5'" 1 
ATOM 6776  C "C5'" . DA  I 5 51  ? 129.99900 74.42800  113.18200 1.000 69.59139  ? -22 DA  I "C5'" 1 
ATOM 6777  C "C4'" . DA  I 5 51  ? 129.88400 72.96000  112.84300 1.000 69.59139  ? -22 DA  I "C4'" 1 
ATOM 6778  O "O4'" . DA  I 5 51  ? 128.58600 72.47700  113.22600 1.000 69.59139  ? -22 DA  I "O4'" 1 
ATOM 6779  C "C3'" . DA  I 5 51  ? 130.04100 72.63300  111.36000 1.000 69.59139  ? -22 DA  I "C3'" 1 
ATOM 6780  O "O3'" . DA  I 5 51  ? 131.24200 71.89100  111.17200 1.000 69.59139  ? -22 DA  I "O3'" 1 
ATOM 6781  C "C2'" . DA  I 5 51  ? 128.77900 71.81900  111.01000 1.000 69.59139  ? -22 DA  I "C2'" 1 
ATOM 6782  C "C1'" . DA  I 5 51  ? 128.23400 71.42900  112.37500 1.000 69.59139  ? -22 DA  I "C1'" 1 
ATOM 6783  N N9    . DA  I 5 51  ? 126.78400 71.30800  112.41800 1.000 69.59139  ? -22 DA  I N9    1 
ATOM 6784  C C8    . DA  I 5 51  ? 125.87600 72.27400  112.10600 1.000 69.59139  ? -22 DA  I C8    1 
ATOM 6785  N N7    . DA  I 5 51  ? 124.63200 71.89500  112.24100 1.000 69.59139  ? -22 DA  I N7    1 
ATOM 6786  C C5    . DA  I 5 51  ? 124.73000 70.58400  112.65700 1.000 69.59139  ? -22 DA  I C5    1 
ATOM 6787  C C6    . DA  I 5 51  ? 123.76100 69.61600  112.97100 1.000 69.59139  ? -22 DA  I C6    1 
ATOM 6788  N N6    . DA  I 5 51  ? 122.44700 69.84600  112.90700 1.000 69.59139  ? -22 DA  I N6    1 
ATOM 6789  N N1    . DA  I 5 51  ? 124.19200 68.40000  113.35500 1.000 69.59139  ? -22 DA  I N1    1 
ATOM 6790  C C2    . DA  I 5 51  ? 125.50800 68.17100  113.41800 1.000 69.59139  ? -22 DA  I C2    1 
ATOM 6791  N N3    . DA  I 5 51  ? 126.51300 69.00300  113.14700 1.000 69.59139  ? -22 DA  I N3    1 
ATOM 6792  C C4    . DA  I 5 51  ? 126.05100 70.20400  112.77000 1.000 69.59139  ? -22 DA  I C4    1 
ATOM 6793  P P     . DC  I 5 52  ? 131.73500 71.46500  109.70500 1.000 75.50275  ? -21 DC  I P     1 
ATOM 6794  O OP1   . DC  I 5 52  ? 133.21300 71.44000  109.73500 1.000 75.50275  ? -21 DC  I OP1   1 
ATOM 6795  O OP2   . DC  I 5 52  ? 131.04300 72.30200  108.70000 1.000 75.50275  ? -21 DC  I OP2   1 
ATOM 6796  O "O5'" . DC  I 5 52  ? 131.21700 69.96600  109.56100 1.000 75.50275  ? -21 DC  I "O5'" 1 
ATOM 6797  C "C5'" . DC  I 5 52  ? 131.32800 69.06900  110.65900 1.000 75.50275  ? -21 DC  I "C5'" 1 
ATOM 6798  C "C4'" . DC  I 5 52  ? 130.54700 67.80700  110.37500 1.000 75.50275  ? -21 DC  I "C4'" 1 
ATOM 6799  O "O4'" . DC  I 5 52  ? 129.16000 68.01300  110.68400 1.000 75.50275  ? -21 DC  I "O4'" 1 
ATOM 6800  C "C3'" . DC  I 5 52  ? 130.59000 67.35300  108.92000 1.000 75.50275  ? -21 DC  I "C3'" 1 
ATOM 6801  O "O3'" . DC  I 5 52  ? 131.37600 66.17900  108.80900 1.000 75.50275  ? -21 DC  I "O3'" 1 
ATOM 6802  C "C2'" . DC  I 5 52  ? 129.12500 67.11200  108.53800 1.000 75.50275  ? -21 DC  I "C2'" 1 
ATOM 6803  C "C1'" . DC  I 5 52  ? 128.39700 67.17100  109.87000 1.000 75.50275  ? -21 DC  I "C1'" 1 
ATOM 6804  N N1    . DC  I 5 52  ? 127.03500 67.74500  109.77900 1.000 75.50275  ? -21 DC  I N1    1 
ATOM 6805  C C2    . DC  I 5 52  ? 125.92500 66.94200  110.04300 1.000 75.50275  ? -21 DC  I C2    1 
ATOM 6806  O O2    . DC  I 5 52  ? 126.10000 65.74800  110.30200 1.000 75.50275  ? -21 DC  I O2    1 
ATOM 6807  N N3    . DC  I 5 52  ? 124.69000 67.49000  109.96800 1.000 75.50275  ? -21 DC  I N3    1 
ATOM 6808  C C4    . DC  I 5 52  ? 124.55200 68.78200  109.67100 1.000 75.50275  ? -21 DC  I C4    1 
ATOM 6809  N N4    . DC  I 5 52  ? 123.31800 69.28600  109.61500 1.000 75.50275  ? -21 DC  I N4    1 
ATOM 6810  C C5    . DC  I 5 52  ? 125.67500 69.61900  109.41900 1.000 75.50275  ? -21 DC  I C5    1 
ATOM 6811  C C6    . DC  I 5 52  ? 126.88500 69.06500  109.49100 1.000 75.50275  ? -21 DC  I C6    1 
ATOM 6812  P P     . DC  I 5 53  ? 131.76200 65.59000  107.36700 1.000 76.43397  ? -20 DC  I P     1 
ATOM 6813  O OP1   . DC  I 5 53  ? 133.06700 64.91100  107.51100 1.000 76.43397  ? -20 DC  I OP1   1 
ATOM 6814  O OP2   . DC  I 5 53  ? 131.60900 66.67000  106.36900 1.000 76.43397  ? -20 DC  I OP2   1 
ATOM 6815  O "O5'" . DC  I 5 53  ? 130.63700 64.49000  107.08400 1.000 76.43397  ? -20 DC  I "O5'" 1 
ATOM 6816  C "C5'" . DC  I 5 53  ? 130.29500 63.54000  108.09100 1.000 76.43397  ? -20 DC  I "C5'" 1 
ATOM 6817  C "C4'" . DC  I 5 53  ? 129.15300 62.65600  107.62100 1.000 76.43397  ? -20 DC  I "C4'" 1 
ATOM 6818  O "O4'" . DC  I 5 53  ? 127.87100 63.28100  107.88700 1.000 76.43397  ? -20 DC  I "O4'" 1 
ATOM 6819  C "C3'" . DC  I 5 53  ? 129.17400 62.33700  106.13000 1.000 76.43397  ? -20 DC  I "C3'" 1 
ATOM 6820  O "O3'" . DC  I 5 53  ? 129.02100 60.94600  105.93700 1.000 76.43397  ? -20 DC  I "O3'" 1 
ATOM 6821  C "C2'" . DC  I 5 53  ? 127.99600 63.13100  105.57300 1.000 76.43397  ? -20 DC  I "C2'" 1 
ATOM 6822  C "C1'" . DC  I 5 53  ? 127.04700 63.14600  106.75300 1.000 76.43397  ? -20 DC  I "C1'" 1 
ATOM 6823  N N1    . DC  I 5 53  ? 126.12200 64.29500  106.73700 1.000 76.43397  ? -20 DC  I N1    1 
ATOM 6824  C C2    . DC  I 5 53  ? 124.74500 64.10500  106.90700 1.000 76.43397  ? -20 DC  I C2    1 
ATOM 6825  O O2    . DC  I 5 53  ? 124.29900 62.95600  107.02300 1.000 76.43397  ? -20 DC  I O2    1 
ATOM 6826  N N3    . DC  I 5 53  ? 123.93600 65.19200  106.90100 1.000 76.43397  ? -20 DC  I N3    1 
ATOM 6827  C C4    . DC  I 5 53  ? 124.46000 66.41000  106.76600 1.000 76.43397  ? -20 DC  I C4    1 
ATOM 6828  N N4    . DC  I 5 53  ? 123.63700 67.45500  106.77300 1.000 76.43397  ? -20 DC  I N4    1 
ATOM 6829  C C5    . DC  I 5 53  ? 125.85400 66.61500  106.61500 1.000 76.43397  ? -20 DC  I C5    1 
ATOM 6830  C C6    . DC  I 5 53  ? 126.63500 65.54200  106.60800 1.000 76.43397  ? -20 DC  I C6    1 
ATOM 6831  P P     . DG  I 5 54  ? 129.43300 60.27200  104.54200 1.000 75.11324  ? -19 DG  I P     1 
ATOM 6832  O OP1   . DG  I 5 54  ? 130.22300 59.05900  104.84500 1.000 75.11324  ? -19 DG  I OP1   1 
ATOM 6833  O OP2   . DG  I 5 54  ? 130.00500 61.32000  103.66900 1.000 75.11324  ? -19 DG  I OP2   1 
ATOM 6834  O "O5'" . DG  I 5 54  ? 128.03000 59.83600  103.92300 1.000 75.11324  ? -19 DG  I "O5'" 1 
ATOM 6835  C "C5'" . DG  I 5 54  ? 127.05400 59.20500  104.74900 1.000 75.11324  ? -19 DG  I "C5'" 1 
ATOM 6836  C "C4'" . DG  I 5 54  ? 125.68400 59.26500  104.09700 1.000 75.11324  ? -19 DG  I "C4'" 1 
ATOM 6837  O "O4'" . DG  I 5 54  ? 124.99200 60.49500  104.44600 1.000 75.11324  ? -19 DG  I "O4'" 1 
ATOM 6838  C "C3'" . DG  I 5 54  ? 125.70600 59.20400  102.56800 1.000 75.11324  ? -19 DG  I "C3'" 1 
ATOM 6839  O "O3'" . DG  I 5 54  ? 124.74700 58.26600  102.12200 1.000 75.11324  ? -19 DG  I "O3'" 1 
ATOM 6840  C "C2'" . DG  I 5 54  ? 125.34700 60.63500  102.15500 1.000 75.11324  ? -19 DG  I "C2'" 1 
ATOM 6841  C "C1'" . DG  I 5 54  ? 124.41500 61.03200  103.27700 1.000 75.11324  ? -19 DG  I "C1'" 1 
ATOM 6842  N N9    . DG  I 5 54  ? 124.26400 62.47000  103.44200 1.000 75.11324  ? -19 DG  I N9    1 
ATOM 6843  C C8    . DG  I 5 54  ? 125.26200 63.40500  103.46400 1.000 75.11324  ? -19 DG  I C8    1 
ATOM 6844  N N7    . DG  I 5 54  ? 124.83200 64.62100  103.62500 1.000 75.11324  ? -19 DG  I N7    1 
ATOM 6845  C C5    . DG  I 5 54  ? 123.45500 64.48600  103.67900 1.000 75.11324  ? -19 DG  I C5    1 
ATOM 6846  C C6    . DG  I 5 54  ? 122.45800 65.46700  103.83200 1.000 75.11324  ? -19 DG  I C6    1 
ATOM 6847  O O6    . DG  I 5 54  ? 122.60300 66.68800  103.95300 1.000 75.11324  ? -19 DG  I O6    1 
ATOM 6848  N N1    . DG  I 5 54  ? 121.18400 64.91100  103.83600 1.000 75.11324  ? -19 DG  I N1    1 
ATOM 6849  C C2    . DG  I 5 54  ? 120.91200 63.57300  103.71100 1.000 75.11324  ? -19 DG  I C2    1 
ATOM 6850  N N2    . DG  I 5 54  ? 119.62000 63.21900  103.73800 1.000 75.11324  ? -19 DG  I N2    1 
ATOM 6851  N N3    . DG  I 5 54  ? 121.84300 62.64100  103.57000 1.000 75.11324  ? -19 DG  I N3    1 
ATOM 6852  C C4    . DG  I 5 54  ? 123.08800 63.17000  103.56300 1.000 75.11324  ? -19 DG  I C4    1 
ATOM 6853  P P     . DC  I 5 55  ? 124.81000 57.67300  100.63200 1.000 75.67225  ? -18 DC  I P     1 
ATOM 6854  O OP1   . DC  I 5 55  ? 124.93000 56.20600  100.76400 1.000 75.67225  ? -18 DC  I OP1   1 
ATOM 6855  O OP2   . DC  I 5 55  ? 125.81400 58.41800  99.84000  1.000 75.67225  ? -18 DC  I OP2   1 
ATOM 6856  O "O5'" . DC  I 5 55  ? 123.36800 58.02300  100.04600 1.000 75.67225  ? -18 DC  I "O5'" 1 
ATOM 6857  C "C5'" . DC  I 5 55  ? 122.20400 57.74100  100.81500 1.000 75.67225  ? -18 DC  I "C5'" 1 
ATOM 6858  C "C4'" . DC  I 5 55  ? 121.07500 58.67700  100.43300 1.000 75.67225  ? -18 DC  I "C4'" 1 
ATOM 6859  O "O4'" . DC  I 5 55  ? 121.37800 60.03400  100.84600 1.000 75.67225  ? -18 DC  I "O4'" 1 
ATOM 6860  C "C3'" . DC  I 5 55  ? 120.78400 58.75300  98.93400  1.000 75.67225  ? -18 DC  I "C3'" 1 
ATOM 6861  O "O3'" . DC  I 5 55  ? 119.40800 58.58100  98.70600  1.000 75.67225  ? -18 DC  I "O3'" 1 
ATOM 6862  C "C2'" . DC  I 5 55  ? 121.23800 60.16200  98.56100  1.000 75.67225  ? -18 DC  I "C2'" 1 
ATOM 6863  C "C1'" . DC  I 5 55  ? 120.92400 60.90000  99.84000  1.000 75.67225  ? -18 DC  I "C1'" 1 
ATOM 6864  N N1    . DC  I 5 55  ? 121.62100 62.20700  99.98500  1.000 75.67225  ? -18 DC  I N1    1 
ATOM 6865  C C2    . DC  I 5 55  ? 120.88000 63.35900  100.27400 1.000 75.67225  ? -18 DC  I C2    1 
ATOM 6866  O O2    . DC  I 5 55  ? 119.65400 63.27100  100.38400 1.000 75.67225  ? -18 DC  I O2    1 
ATOM 6867  N N3    . DC  I 5 55  ? 121.53100 64.53900  100.41700 1.000 75.67225  ? -18 DC  I N3    1 
ATOM 6868  C C4    . DC  I 5 55  ? 122.85600 64.58600  100.29000 1.000 75.67225  ? -18 DC  I C4    1 
ATOM 6869  N N4    . DC  I 5 55  ? 123.45900 65.76900  100.44100 1.000 75.67225  ? -18 DC  I N4    1 
ATOM 6870  C C5    . DC  I 5 55  ? 123.62600 63.42200  100.00300 1.000 75.67225  ? -18 DC  I C5    1 
ATOM 6871  C C6    . DC  I 5 55  ? 122.97400 62.26600  99.86400  1.000 75.67225  ? -18 DC  I C6    1 
ATOM 6872  P P     . DT  I 5 56  ? 118.89500 57.45700  97.68800  1.000 74.16053  ? -17 DT  I P     1 
ATOM 6873  O OP1   . DT  I 5 56  ? 118.33300 56.33700  98.47400  1.000 74.16053  ? -17 DT  I OP1   1 
ATOM 6874  O OP2   . DT  I 5 56  ? 119.97900 57.21700  96.71100  1.000 74.16053  ? -17 DT  I OP2   1 
ATOM 6875  O "O5'" . DT  I 5 56  ? 117.71400 58.19000  96.91700  1.000 74.16053  ? -17 DT  I "O5'" 1 
ATOM 6876  C "C5'" . DT  I 5 56  ? 117.92900 59.49300  96.40400  1.000 74.16053  ? -17 DT  I "C5'" 1 
ATOM 6877  C "C4'" . DT  I 5 56  ? 116.96400 60.48600  97.02300  1.000 74.16053  ? -17 DT  I "C4'" 1 
ATOM 6878  O "O4'" . DT  I 5 56  ? 117.69900 61.55200  97.68500  1.000 74.16053  ? -17 DT  I "O4'" 1 
ATOM 6879  C "C3'" . DT  I 5 56  ? 116.07400 61.18800  96.02000  1.000 74.16053  ? -17 DT  I "C3'" 1 
ATOM 6880  O "O3'" . DT  I 5 56  ? 114.87200 61.59600  96.65200  1.000 74.16053  ? -17 DT  I "O3'" 1 
ATOM 6881  C "C2'" . DT  I 5 56  ? 116.93700 62.37700  95.63900  1.000 74.16053  ? -17 DT  I "C2'" 1 
ATOM 6882  C "C1'" . DT  I 5 56  ? 117.48300 62.76700  96.99200  1.000 74.16053  ? -17 DT  I "C1'" 1 
ATOM 6883  N N1    . DT  I 5 56  ? 118.76400 63.54600  96.98300  1.000 74.16053  ? -17 DT  I N1    1 
ATOM 6884  C C2    . DT  I 5 56  ? 118.75100 64.86100  97.38500  1.000 74.16053  ? -17 DT  I C2    1 
ATOM 6885  O O2    . DT  I 5 56  ? 117.73400 65.45700  97.67400  1.000 74.16053  ? -17 DT  I O2    1 
ATOM 6886  N N3    . DT  I 5 56  ? 119.97600 65.47000  97.39200  1.000 74.16053  ? -17 DT  I N3    1 
ATOM 6887  C C4    . DT  I 5 56  ? 121.19200 64.89900  97.07800  1.000 74.16053  ? -17 DT  I C4    1 
ATOM 6888  O O4    . DT  I 5 56  ? 122.24500 65.52600  97.11900  1.000 74.16053  ? -17 DT  I O4    1 
ATOM 6889  C C5    . DT  I 5 56  ? 121.14200 63.51500  96.69600  1.000 74.16053  ? -17 DT  I C5    1 
ATOM 6890  C C7    . DT  I 5 56  ? 122.40600 62.79900  96.32700  1.000 74.16053  ? -17 DT  I C7    1 
ATOM 6891  C C6    . DT  I 5 56  ? 119.94500 62.90700  96.67700  1.000 74.16053  ? -17 DT  I C6    1 
ATOM 6892  P P     . DT  I 5 57  ? 113.47500 61.50000  95.86700  1.000 73.45412  ? -16 DT  I P     1 
ATOM 6893  O OP1   . DT  I 5 57  ? 112.40800 61.34400  96.88000  1.000 73.45412  ? -16 DT  I OP1   1 
ATOM 6894  O OP2   . DT  I 5 57  ? 113.64500 60.49400  94.79600  1.000 73.45412  ? -16 DT  I OP2   1 
ATOM 6895  O "O5'" . DT  I 5 57  ? 113.31600 62.92800  95.16500  1.000 73.45412  ? -16 DT  I "O5'" 1 
ATOM 6896  C "C5'" . DT  I 5 57  ? 113.67400 64.12400  95.86200  1.000 73.45412  ? -16 DT  I "C5'" 1 
ATOM 6897  C "C4'" . DT  I 5 57  ? 113.92900 65.24800  94.87800  1.000 73.45412  ? -16 DT  I "C4'" 1 
ATOM 6898  O "O4'" . DT  I 5 57  ? 115.34300 65.56900  94.83200  1.000 73.45412  ? -16 DT  I "O4'" 1 
ATOM 6899  C "C3'" . DT  I 5 57  ? 113.51900 64.93100  93.43600  1.000 73.45412  ? -16 DT  I "C3'" 1 
ATOM 6900  O "O3'" . DT  I 5 57  ? 112.83700 66.03800  92.89100  1.000 73.45412  ? -16 DT  I "O3'" 1 
ATOM 6901  C "C2'" . DT  I 5 57  ? 114.86700 64.70600  92.74400  1.000 73.45412  ? -16 DT  I "C2'" 1 
ATOM 6902  C "C1'" . DT  I 5 57  ? 115.71700 65.71500  93.48800  1.000 73.45412  ? -16 DT  I "C1'" 1 
ATOM 6903  N N1    . DT  I 5 57  ? 117.19100 65.50400  93.38400  1.000 73.45412  ? -16 DT  I N1    1 
ATOM 6904  C C2    . DT  I 5 57  ? 118.03100 66.49300  93.82200  1.000 73.45412  ? -16 DT  I C2    1 
ATOM 6905  O O2    . DT  I 5 57  ? 117.63400 67.55800  94.25100  1.000 73.45412  ? -16 DT  I O2    1 
ATOM 6906  N N3    . DT  I 5 57  ? 119.36300 66.20700  93.70600  1.000 73.45412  ? -16 DT  I N3    1 
ATOM 6907  C C4    . DT  I 5 57  ? 119.92600 65.04100  93.23300  1.000 73.45412  ? -16 DT  I C4    1 
ATOM 6908  O O4    . DT  I 5 57  ? 121.13900 64.87500  93.17300  1.000 73.45412  ? -16 DT  I O4    1 
ATOM 6909  C C5    . DT  I 5 57  ? 118.98900 64.03400  92.80900  1.000 73.45412  ? -16 DT  I C5    1 
ATOM 6910  C C7    . DT  I 5 57  ? 119.48100 62.72400  92.27300  1.000 73.45412  ? -16 DT  I C7    1 
ATOM 6911  C C6    . DT  I 5 57  ? 117.68300 64.31600  92.89300  1.000 73.45412  ? -16 DT  I C6    1 
ATOM 6912  P P     . DA  I 5 58  ? 111.23300 66.11100  92.90200  1.000 71.14210  ? -15 DA  I P     1 
ATOM 6913  O OP1   . DA  I 5 58  ? 110.73000 65.49300  94.14500  1.000 71.14210  ? -15 DA  I OP1   1 
ATOM 6914  O OP2   . DA  I 5 58  ? 110.75200 65.61300  91.59700  1.000 71.14210  ? -15 DA  I OP2   1 
ATOM 6915  O "O5'" . DA  I 5 58  ? 110.93200 67.67700  92.98000  1.000 71.14210  ? -15 DA  I "O5'" 1 
ATOM 6916  C "C5'" . DA  I 5 58  ? 111.07300 68.36300  94.21700  1.000 71.14210  ? -15 DA  I "C5'" 1 
ATOM 6917  C "C4'" . DA  I 5 58  ? 111.92100 69.62200  94.07400  1.000 71.14210  ? -15 DA  I "C4'" 1 
ATOM 6918  O "O4'" . DA  I 5 58  ? 113.29600 69.29800  93.74300  1.000 71.14210  ? -15 DA  I "O4'" 1 
ATOM 6919  C "C3'" . DA  I 5 58  ? 111.45000 70.62100  93.02600  1.000 71.14210  ? -15 DA  I "C3'" 1 
ATOM 6920  O "O3'" . DA  I 5 58  ? 111.53300 71.92700  93.58200  1.000 71.14210  ? -15 DA  I "O3'" 1 
ATOM 6921  C "C2'" . DA  I 5 58  ? 112.43200 70.40200  91.86300  1.000 71.14210  ? -15 DA  I "C2'" 1 
ATOM 6922  C "C1'" . DA  I 5 58  ? 113.70700 70.02000  92.59900  1.000 71.14210  ? -15 DA  I "C1'" 1 
ATOM 6923  N N9    . DA  I 5 58  ? 114.61100 69.14600  91.85500  1.000 71.14210  ? -15 DA  I N9    1 
ATOM 6924  C C8    . DA  I 5 58  ? 114.27100 68.06000  91.10500  1.000 71.14210  ? -15 DA  I C8    1 
ATOM 6925  N N7    . DA  I 5 58  ? 115.29600 67.43300  90.58200  1.000 71.14210  ? -15 DA  I N7    1 
ATOM 6926  C C5    . DA  I 5 58  ? 116.38700 68.16300  91.01400  1.000 71.14210  ? -15 DA  I C5    1 
ATOM 6927  C C6    . DA  I 5 58  ? 117.77200 68.01700  90.80100  1.000 71.14210  ? -15 DA  I C6    1 
ATOM 6928  N N6    . DA  I 5 58  ? 118.30100 67.04300  90.05900  1.000 71.14210  ? -15 DA  I N6    1 
ATOM 6929  N N1    . DA  I 5 58  ? 118.59300 68.91900  91.37300  1.000 71.14210  ? -15 DA  I N1    1 
ATOM 6930  C C2    . DA  I 5 58  ? 118.06100 69.89400  92.12000  1.000 71.14210  ? -15 DA  I C2    1 
ATOM 6931  N N3    . DA  I 5 58  ? 116.77700 70.13000  92.39400  1.000 71.14210  ? -15 DA  I N3    1 
ATOM 6932  C C4    . DA  I 5 58  ? 115.98600 69.21800  91.80700  1.000 71.14210  ? -15 DA  I C4    1 
ATOM 6933  P P     . DA  I 5 59  ? 110.75800 73.16900  92.92800  1.000 66.21110  ? -14 DA  I P     1 
ATOM 6934  O OP1   . DA  I 5 59  ? 109.97700 73.82000  94.00000  1.000 66.21110  ? -14 DA  I OP1   1 
ATOM 6935  O OP2   . DA  I 5 59  ? 110.09000 72.72400  91.68600  1.000 66.21110  ? -14 DA  I OP2   1 
ATOM 6936  O "O5'" . DA  I 5 59  ? 111.94600 74.14100  92.52400  1.000 66.21110  ? -14 DA  I "O5'" 1 
ATOM 6937  C "C5'" . DA  I 5 59  ? 112.85500 74.56600  93.51900  1.000 66.21110  ? -14 DA  I "C5'" 1 
ATOM 6938  C "C4'" . DA  I 5 59  ? 114.23100 74.74700  92.92500  1.000 66.21110  ? -14 DA  I "C4'" 1 
ATOM 6939  O "O4'" . DA  I 5 59  ? 114.61000 73.56100  92.20800  1.000 66.21110  ? -14 DA  I "O4'" 1 
ATOM 6940  C "C3'" . DA  I 5 59  ? 114.35500 75.89400  91.93000  1.000 66.21110  ? -14 DA  I "C3'" 1 
ATOM 6941  O "O3'" . DA  I 5 59  ? 115.20000 76.89500  92.47400  1.000 66.21110  ? -14 DA  I "O3'" 1 
ATOM 6942  C "C2'" . DA  I 5 59  ? 114.95000 75.24000  90.67000  1.000 66.21110  ? -14 DA  I "C2'" 1 
ATOM 6943  C "C1'" . DA  I 5 59  ? 115.50000 73.93600  91.20300  1.000 66.21110  ? -14 DA  I "C1'" 1 
ATOM 6944  N N9    . DA  I 5 59  ? 115.54400 72.85800  90.22500  1.000 66.21110  ? -14 DA  I N9    1 
ATOM 6945  C C8    . DA  I 5 59  ? 114.48000 72.24100  89.64100  1.000 66.21110  ? -14 DA  I C8    1 
ATOM 6946  N N7    . DA  I 5 59  ? 114.81200 71.29000  88.80700  1.000 66.21110  ? -14 DA  I N7    1 
ATOM 6947  C C5    . DA  I 5 59  ? 116.19100 71.28900  88.83900  1.000 66.21110  ? -14 DA  I C5    1 
ATOM 6948  C C6    . DA  I 5 59  ? 117.15200 70.51400  88.17000  1.000 66.21110  ? -14 DA  I C6    1 
ATOM 6949  N N6    . DA  I 5 59  ? 116.84000 69.55200  87.29900  1.000 66.21110  ? -14 DA  I N6    1 
ATOM 6950  N N1    . DA  I 5 59  ? 118.45100 70.76700  88.42500  1.000 66.21110  ? -14 DA  I N1    1 
ATOM 6951  C C2    . DA  I 5 59  ? 118.76100 71.73600  89.29400  1.000 66.21110  ? -14 DA  I C2    1 
ATOM 6952  N N3    . DA  I 5 59  ? 117.94300 72.52700  89.98800  1.000 66.21110  ? -14 DA  I N3    1 
ATOM 6953  C C4    . DA  I 5 59  ? 116.66100 72.25100  89.70800  1.000 66.21110  ? -14 DA  I C4    1 
ATOM 6954  P P     . DA  I 5 60  ? 115.43100 78.27700  91.69500  1.000 60.43842  ? -13 DA  I P     1 
ATOM 6955  O OP1   . DA  I 5 60  ? 115.60400 79.32100  92.72300  1.000 60.43842  ? -13 DA  I OP1   1 
ATOM 6956  O OP2   . DA  I 5 60  ? 114.36800 78.42800  90.67800  1.000 60.43842  ? -13 DA  I OP2   1 
ATOM 6957  O "O5'" . DA  I 5 60  ? 116.83600 78.08000  90.96100  1.000 60.43842  ? -13 DA  I "O5'" 1 
ATOM 6958  C "C5'" . DA  I 5 60  ? 118.03300 78.08700  91.72100  1.000 60.43842  ? -13 DA  I "C5'" 1 
ATOM 6959  C "C4'" . DA  I 5 60  ? 119.22800 77.69700  90.86900  1.000 60.43842  ? -13 DA  I "C4'" 1 
ATOM 6960  O "O4'" . DA  I 5 60  ? 118.98600 76.43100  90.21300  1.000 60.43842  ? -13 DA  I "O4'" 1 
ATOM 6961  C "C3'" . DA  I 5 60  ? 119.60300 78.68700  89.76600  1.000 60.43842  ? -13 DA  I "C3'" 1 
ATOM 6962  O "O3'" . DA  I 5 60  ? 121.01300 78.82300  89.72200  1.000 60.43842  ? -13 DA  I "O3'" 1 
ATOM 6963  C "C2'" . DA  I 5 60  ? 119.06400 78.00800  88.51100  1.000 60.43842  ? -13 DA  I "C2'" 1 
ATOM 6964  C "C1'" . DA  I 5 60  ? 119.30800 76.55300  88.85100  1.000 60.43842  ? -13 DA  I "C1'" 1 
ATOM 6965  N N9    . DA  I 5 60  ? 118.48200 75.61900  88.10400  1.000 60.43842  ? -13 DA  I N9    1 
ATOM 6966  C C8    . DA  I 5 60  ? 117.12600 75.60400  88.03400  1.000 60.43842  ? -13 DA  I C8    1 
ATOM 6967  N N7    . DA  I 5 60  ? 116.64200 74.64600  87.28500  1.000 60.43842  ? -13 DA  I N7    1 
ATOM 6968  C C5    . DA  I 5 60  ? 117.76500 74.00500  86.80800  1.000 60.43842  ? -13 DA  I C5    1 
ATOM 6969  C C6    . DA  I 5 60  ? 117.93500 72.91100  85.94400  1.000 60.43842  ? -13 DA  I C6    1 
ATOM 6970  N N6    . DA  I 5 60  ? 116.91900 72.24200  85.39700  1.000 60.43842  ? -13 DA  I N6    1 
ATOM 6971  N N1    . DA  I 5 60  ? 119.19500 72.52500  85.66800  1.000 60.43842  ? -13 DA  I N1    1 
ATOM 6972  C C2    . DA  I 5 60  ? 120.21200 73.19700  86.21600  1.000 60.43842  ? -13 DA  I C2    1 
ATOM 6973  N N3    . DA  I 5 60  ? 120.17500 74.24000  87.04000  1.000 60.43842  ? -13 DA  I N3    1 
ATOM 6974  C C4    . DA  I 5 60  ? 118.91000 74.59500  87.29900  1.000 60.43842  ? -13 DA  I C4    1 
ATOM 6975  P P     . DC  I 5 61  ? 121.70500 80.04000  88.93500  1.000 64.67341  ? -12 DC  I P     1 
ATOM 6976  O OP1   . DC  I 5 61  ? 122.69500 80.64000  89.85300  1.000 64.67341  ? -12 DC  I OP1   1 
ATOM 6977  O OP2   . DC  I 5 61  ? 120.65800 80.88200  88.32100  1.000 64.67341  ? -12 DC  I OP2   1 
ATOM 6978  O "O5'" . DC  I 5 61  ? 122.50100 79.33100  87.75300  1.000 64.67341  ? -12 DC  I "O5'" 1 
ATOM 6979  C "C5'" . DC  I 5 61  ? 122.78600 77.94600  87.81900  1.000 64.67341  ? -12 DC  I "C5'" 1 
ATOM 6980  C "C4'" . DC  I 5 61  ? 123.19000 77.42500  86.45600  1.000 64.67341  ? -12 DC  I "C4'" 1 
ATOM 6981  O "O4'" . DC  I 5 61  ? 122.16500 76.54400  85.93700  1.000 64.67341  ? -12 DC  I "O4'" 1 
ATOM 6982  C "C3'" . DC  I 5 61  ? 123.38900 78.49400  85.39100  1.000 64.67341  ? -12 DC  I "C3'" 1 
ATOM 6983  O "O3'" . DC  I 5 61  ? 124.53000 78.16700  84.63200  1.000 64.67341  ? -12 DC  I "O3'" 1 
ATOM 6984  C "C2'" . DC  I 5 61  ? 122.10500 78.39100  84.57100  1.000 64.67341  ? -12 DC  I "C2'" 1 
ATOM 6985  C "C1'" . DC  I 5 61  ? 121.89500 76.90000  84.60400  1.000 64.67341  ? -12 DC  I "C1'" 1 
ATOM 6986  N N1    . DC  I 5 61  ? 120.51900 76.46800  84.31200  1.000 64.67341  ? -12 DC  I N1    1 
ATOM 6987  C C2    . DC  I 5 61  ? 120.31000 75.38000  83.46800  1.000 64.67341  ? -12 DC  I C2    1 
ATOM 6988  O O2    . DC  I 5 61  ? 121.28500 74.84400  82.93500  1.000 64.67341  ? -12 DC  I O2    1 
ATOM 6989  N N3    . DC  I 5 61  ? 119.04500 74.96700  83.23400  1.000 64.67341  ? -12 DC  I N3    1 
ATOM 6990  C C4    . DC  I 5 61  ? 118.02600 75.57800  83.82900  1.000 64.67341  ? -12 DC  I C4    1 
ATOM 6991  N N4    . DC  I 5 61  ? 116.79400 75.13500  83.57300  1.000 64.67341  ? -12 DC  I N4    1 
ATOM 6992  C C5    . DC  I 5 61  ? 118.22100 76.67900  84.71000  1.000 64.67341  ? -12 DC  I C5    1 
ATOM 6993  C C6    . DC  I 5 61  ? 119.47500 77.07700  84.93100  1.000 64.67341  ? -12 DC  I C6    1 
ATOM 6994  P P     . DG  I 5 62  ? 125.39900 79.31500  83.93200  1.000 71.28302  ? -11 DG  I P     1 
ATOM 6995  O OP1   . DG  I 5 62  ? 126.65500 79.44000  84.70000  1.000 71.28302  ? -11 DG  I OP1   1 
ATOM 6996  O OP2   . DG  I 5 62  ? 124.52700 80.49400  83.73800  1.000 71.28302  ? -11 DG  I OP2   1 
ATOM 6997  O "O5'" . DG  I 5 62  ? 125.73300 78.70000  82.49900  1.000 71.28302  ? -11 DG  I "O5'" 1 
ATOM 6998  C "C5'" . DG  I 5 62  ? 126.16100 77.34800  82.39600  1.000 71.28302  ? -11 DG  I "C5'" 1 
ATOM 6999  C "C4'" . DG  I 5 62  ? 125.87000 76.78700  81.01400  1.000 71.28302  ? -11 DG  I "C4'" 1 
ATOM 7000  O "O4'" . DG  I 5 62  ? 124.50600 76.32600  80.92800  1.000 71.28302  ? -11 DG  I "O4'" 1 
ATOM 7001  C "C3'" . DG  I 5 62  ? 126.08800 77.75000  79.86100  1.000 71.28302  ? -11 DG  I "C3'" 1 
ATOM 7002  O "O3'" . DG  I 5 62  ? 126.82900 77.08500  78.84500  1.000 71.28302  ? -11 DG  I "O3'" 1 
ATOM 7003  C "C2'" . DG  I 5 62  ? 124.66300 78.12000  79.41900  1.000 71.28302  ? -11 DG  I "C2'" 1 
ATOM 7004  C "C1'" . DG  I 5 62  ? 123.86600 76.88200  79.80400  1.000 71.28302  ? -11 DG  I "C1'" 1 
ATOM 7005  N N9    . DG  I 5 62  ? 122.49400 77.14300  80.21800  1.000 71.28302  ? -11 DG  I N9    1 
ATOM 7006  C C8    . DG  I 5 62  ? 122.07300 78.08000  81.12200  1.000 71.28302  ? -11 DG  I C8    1 
ATOM 7007  N N7    . DG  I 5 62  ? 120.79000 78.05800  81.33700  1.000 71.28302  ? -11 DG  I N7    1 
ATOM 7008  C C5    . DG  I 5 62  ? 120.32900 77.04300  80.51700  1.000 71.28302  ? -11 DG  I C5    1 
ATOM 7009  C C6    . DG  I 5 62  ? 119.01800 76.56200  80.31600  1.000 71.28302  ? -11 DG  I C6    1 
ATOM 7010  O O6    . DG  I 5 62  ? 117.96900 76.95400  80.84000  1.000 71.28302  ? -11 DG  I O6    1 
ATOM 7011  N N1    . DG  I 5 62  ? 118.98700 75.52000  79.39500  1.000 71.28302  ? -11 DG  I N1    1 
ATOM 7012  C C2    . DG  I 5 62  ? 120.08900 75.01000  78.75200  1.000 71.28302  ? -11 DG  I C2    1 
ATOM 7013  N N2    . DG  I 5 62  ? 119.87300 74.00300  77.89600  1.000 71.28302  ? -11 DG  I N2    1 
ATOM 7014  N N3    . DG  I 5 62  ? 121.32300 75.45200  78.93600  1.000 71.28302  ? -11 DG  I N3    1 
ATOM 7015  C C4    . DG  I 5 62  ? 121.36700 76.46500  79.82600  1.000 71.28302  ? -11 DG  I C4    1 
ATOM 7016  P P     . DC  I 5 63  ? 127.38000 77.88600  77.57200  1.000 72.41229  ? -10 DC  I P     1 
ATOM 7017  O OP1   . DC  I 5 63  ? 128.62900 77.22000  77.14700  1.000 72.41229  ? -10 DC  I OP1   1 
ATOM 7018  O OP2   . DC  I 5 63  ? 127.39000 79.32700  77.90600  1.000 72.41229  ? -10 DC  I OP2   1 
ATOM 7019  O "O5'" . DC  I 5 63  ? 126.26600 77.63800  76.46400  1.000 72.41229  ? -10 DC  I "O5'" 1 
ATOM 7020  C "C5'" . DC  I 5 63  ? 125.85200 76.31300  76.15900  1.000 72.41229  ? -10 DC  I "C5'" 1 
ATOM 7021  C "C4'" . DC  I 5 63  ? 124.72600 76.35200  75.15000  1.000 72.41229  ? -10 DC  I "C4'" 1 
ATOM 7022  O "O4'" . DC  I 5 63  ? 123.47900 76.49600  75.84300  1.000 72.41229  ? -10 DC  I "O4'" 1 
ATOM 7023  C "C3'" . DC  I 5 63  ? 124.79900 77.50900  74.15400  1.000 72.41229  ? -10 DC  I "C3'" 1 
ATOM 7024  O "O3'" . DC  I 5 63  ? 125.02100 76.99400  72.83900  1.000 72.41229  ? -10 DC  I "O3'" 1 
ATOM 7025  C "C2'" . DC  I 5 63  ? 123.44900 78.22500  74.29600  1.000 72.41229  ? -10 DC  I "C2'" 1 
ATOM 7026  C "C1'" . DC  I 5 63  ? 122.59200 77.21800  75.04200  1.000 72.41229  ? -10 DC  I "C1'" 1 
ATOM 7027  N N1    . DC  I 5 63  ? 121.62000 77.84500  75.96100  1.000 72.41229  ? -10 DC  I N1    1 
ATOM 7028  C C2    . DC  I 5 63  ? 120.27700 77.46600  75.92700  1.000 72.41229  ? -10 DC  I C2    1 
ATOM 7029  O O2    . DC  I 5 63  ? 119.90600 76.64700  75.08300  1.000 72.41229  ? -10 DC  I O2    1 
ATOM 7030  N N3    . DC  I 5 63  ? 119.41700 78.03700  76.80000  1.000 72.41229  ? -10 DC  I N3    1 
ATOM 7031  C C4    . DC  I 5 63  ? 119.86300 78.92100  77.69100  1.000 72.41229  ? -10 DC  I C4    1 
ATOM 7032  N N4    . DC  I 5 63  ? 118.98400 79.45600  78.53800  1.000 72.41229  ? -10 DC  I N4    1 
ATOM 7033  C C5    . DC  I 5 63  ? 121.23100 79.29600  77.75500  1.000 72.41229  ? -10 DC  I C5    1 
ATOM 7034  C C6    . DC  I 5 63  ? 122.06600 78.73300  76.88700  1.000 72.41229  ? -10 DC  I C6    1 
ATOM 7035  P P     . DA  I 5 64  ? 125.13000 77.96600  71.56200  1.000 71.78504  ? -9  DA  I P     1 
ATOM 7036  O OP1   . DA  I 5 64  ? 126.05200 77.30300  70.61800  1.000 71.78504  ? -9  DA  I OP1   1 
ATOM 7037  O OP2   . DA  I 5 64  ? 125.42800 79.34900  71.99500  1.000 71.78504  ? -9  DA  I OP2   1 
ATOM 7038  O "O5'" . DA  I 5 64  ? 123.66300 77.90900  70.92700  1.000 71.78504  ? -9  DA  I "O5'" 1 
ATOM 7039  C "C5'" . DA  I 5 64  ? 122.95800 76.66500  70.90000  1.000 71.78504  ? -9  DA  I "C5'" 1 
ATOM 7040  C "C4'" . DA  I 5 64  ? 121.49500 76.87300  70.55400  1.000 71.78504  ? -9  DA  I "C4'" 1 
ATOM 7041  O "O4'" . DA  I 5 64  ? 120.76100 77.30500  71.71800  1.000 71.78504  ? -9  DA  I "O4'" 1 
ATOM 7042  C "C3'" . DA  I 5 64  ? 121.22500 77.90000  69.45900  1.000 71.78504  ? -9  DA  I "C3'" 1 
ATOM 7043  O "O3'" . DA  I 5 64  ? 120.41600 77.29900  68.45400  1.000 71.78504  ? -9  DA  I "O3'" 1 
ATOM 7044  C "C2'" . DA  I 5 64  ? 120.51000 79.04500  70.19400  1.000 71.78504  ? -9  DA  I "C2'" 1 
ATOM 7045  C "C1'" . DA  I 5 64  ? 119.85600 78.31700  71.35400  1.000 71.78504  ? -9  DA  I "C1'" 1 
ATOM 7046  N N9    . DA  I 5 64  ? 119.65500 79.13000  72.54300  1.000 71.78504  ? -9  DA  I N9    1 
ATOM 7047  C C8    . DA  I 5 64  ? 120.60700 79.82900  73.21500  1.000 71.78504  ? -9  DA  I C8    1 
ATOM 7048  N N7    . DA  I 5 64  ? 120.16500 80.44400  74.28000  1.000 71.78504  ? -9  DA  I N7    1 
ATOM 7049  C C5    . DA  I 5 64  ? 118.82300 80.14100  74.29800  1.000 71.78504  ? -9  DA  I C5    1 
ATOM 7050  C C6    . DA  I 5 64  ? 117.78800 80.50300  75.17200  1.000 71.78504  ? -9  DA  I C6    1 
ATOM 7051  N N6    . DA  I 5 64  ? 117.97500 81.28200  76.23800  1.000 71.78504  ? -9  DA  I N6    1 
ATOM 7052  N N1    . DA  I 5 64  ? 116.55100 80.03100  74.91100  1.000 71.78504  ? -9  DA  I N1    1 
ATOM 7053  C C2    . DA  I 5 64  ? 116.37000 79.24800  73.84200  1.000 71.78504  ? -9  DA  I C2    1 
ATOM 7054  N N3    . DA  I 5 64  ? 117.27100 78.83900  72.94600  1.000 71.78504  ? -9  DA  I N3    1 
ATOM 7055  C C4    . DA  I 5 64  ? 118.48800 79.32700  73.23500  1.000 71.78504  ? -9  DA  I C4    1 
ATOM 7056  P P     . DC  I 5 65  ? 120.19200 78.01700  67.03800  1.000 70.49167  ? -8  DC  I P     1 
ATOM 7057  O OP1   . DC  I 5 65  ? 120.22700 76.96000  66.00600  1.000 70.49167  ? -8  DC  I OP1   1 
ATOM 7058  O OP2   . DC  I 5 65  ? 121.11700 79.16700  66.94100  1.000 70.49167  ? -8  DC  I OP2   1 
ATOM 7059  O "O5'" . DC  I 5 65  ? 118.71200 78.59800  67.13400  1.000 70.49167  ? -8  DC  I "O5'" 1 
ATOM 7060  C "C5'" . DC  I 5 65  ? 117.67800 77.83100  67.74100  1.000 70.49167  ? -8  DC  I "C5'" 1 
ATOM 7061  C "C4'" . DC  I 5 65  ? 116.42100 78.66500  67.88600  1.000 70.49167  ? -8  DC  I "C4'" 1 
ATOM 7062  O "O4'" . DC  I 5 65  ? 116.39800 79.30000  69.19000  1.000 70.49167  ? -8  DC  I "O4'" 1 
ATOM 7063  C "C3'" . DC  I 5 65  ? 116.28000 79.79100  66.86200  1.000 70.49167  ? -8  DC  I "C3'" 1 
ATOM 7064  O "O3'" . DC  I 5 65  ? 114.93600 79.83500  66.37500  1.000 70.49167  ? -8  DC  I "O3'" 1 
ATOM 7065  C "C2'" . DC  I 5 65  ? 116.64100 81.03300  67.67200  1.000 70.49167  ? -8  DC  I "C2'" 1 
ATOM 7066  C "C1'" . DC  I 5 65  ? 116.08000 80.66000  69.02700  1.000 70.49167  ? -8  DC  I "C1'" 1 
ATOM 7067  N N1    . DC  I 5 65  ? 116.69000 81.40900  70.14600  1.000 70.49167  ? -8  DC  I N1    1 
ATOM 7068  C C2    . DC  I 5 65  ? 115.90100 81.80900  71.22200  1.000 70.49167  ? -8  DC  I C2    1 
ATOM 7069  O O2    . DC  I 5 65  ? 114.69300 81.56500  71.19900  1.000 70.49167  ? -8  DC  I O2    1 
ATOM 7070  N N3    . DC  I 5 65  ? 116.48000 82.47900  72.24100  1.000 70.49167  ? -8  DC  I N3    1 
ATOM 7071  C C4    . DC  I 5 65  ? 117.78800 82.72600  72.21600  1.000 70.49167  ? -8  DC  I C4    1 
ATOM 7072  N N4    . DC  I 5 65  ? 118.32300 83.38500  73.24500  1.000 70.49167  ? -8  DC  I N4    1 
ATOM 7073  C C5    . DC  I 5 65  ? 118.61000 82.30600  71.13700  1.000 70.49167  ? -8  DC  I C5    1 
ATOM 7074  C C6    . DC  I 5 65  ? 118.02500 81.65400  70.13600  1.000 70.49167  ? -8  DC  I C6    1 
ATOM 7075  P P     . DG  I 5 66  ? 114.61200 80.41000  64.90900  1.000 67.22114  ? -7  DG  I P     1 
ATOM 7076  O OP1   . DG  I 5 66  ? 114.49600 79.25000  64.00000  1.000 67.22114  ? -7  DG  I OP1   1 
ATOM 7077  O OP2   . DG  I 5 66  ? 115.56300 81.49800  64.59200  1.000 67.22114  ? -7  DG  I OP2   1 
ATOM 7078  O "O5'" . DG  I 5 66  ? 113.16600 81.06300  65.06400  1.000 67.22114  ? -7  DG  I "O5'" 1 
ATOM 7079  C "C5'" . DG  I 5 66  ? 112.14700 80.38500  65.79200  1.000 67.22114  ? -7  DG  I "C5'" 1 
ATOM 7080  C "C4'" . DG  I 5 66  ? 111.36800 81.34900  66.67500  1.000 67.22114  ? -7  DG  I "C4'" 1 
ATOM 7081  O "O4'" . DG  I 5 66  ? 112.22600 81.90500  67.69900  1.000 67.22114  ? -7  DG  I "O4'" 1 
ATOM 7082  C "C3'" . DG  I 5 66  ? 110.74200 82.54000  65.96000  1.000 67.22114  ? -7  DG  I "C3'" 1 
ATOM 7083  O "O3'" . DG  I 5 66  ? 109.45700 82.76100  66.48000  1.000 67.22114  ? -7  DG  I "O3'" 1 
ATOM 7084  C "C2'" . DG  I 5 66  ? 111.68800 83.68400  66.31300  1.000 67.22114  ? -7  DG  I "C2'" 1 
ATOM 7085  C "C1'" . DG  I 5 66  ? 112.07800 83.30800  67.72700  1.000 67.22114  ? -7  DG  I "C1'" 1 
ATOM 7086  N N9    . DG  I 5 66  ? 113.35500 83.85000  68.16700  1.000 67.22114  ? -7  DG  I N9    1 
ATOM 7087  C C8    . DG  I 5 66  ? 114.55000 83.75300  67.50900  1.000 67.22114  ? -7  DG  I C8    1 
ATOM 7088  N N7    . DG  I 5 66  ? 115.54600 84.28200  68.15600  1.000 67.22114  ? -7  DG  I N7    1 
ATOM 7089  C C5    . DG  I 5 66  ? 114.97500 84.76200  69.32200  1.000 67.22114  ? -7  DG  I C5    1 
ATOM 7090  C C6    . DG  I 5 66  ? 115.56600 85.44400  70.40200  1.000 67.22114  ? -7  DG  I C6    1 
ATOM 7091  O O6    . DG  I 5 66  ? 116.74800 85.76100  70.54500  1.000 67.22114  ? -7  DG  I O6    1 
ATOM 7092  N N1    . DG  I 5 66  ? 114.63900 85.76000  71.38600  1.000 67.22114  ? -7  DG  I N1    1 
ATOM 7093  C C2    . DG  I 5 66  ? 113.30400 85.45400  71.33000  1.000 67.22114  ? -7  DG  I C2    1 
ATOM 7094  N N2    . DG  I 5 66  ? 112.56100 85.83800  72.37600  1.000 67.22114  ? -7  DG  I N2    1 
ATOM 7095  N N3    . DG  I 5 66  ? 112.73200 84.81100  70.31900  1.000 67.22114  ? -7  DG  I N3    1 
ATOM 7096  C C4    . DG  I 5 66  ? 113.62700 84.49800  69.35200  1.000 67.22114  ? -7  DG  I C4    1 
ATOM 7097  P P     . DT  I 5 67  ? 108.33100 83.46900  65.58700  1.000 67.18291  ? -6  DT  I P     1 
ATOM 7098  O OP1   . DT  I 5 67  ? 107.14400 82.58800  65.54800  1.000 67.18291  ? -6  DT  I OP1   1 
ATOM 7099  O OP2   . DT  I 5 67  ? 108.97200 83.89600  64.32600  1.000 67.18291  ? -6  DT  I OP2   1 
ATOM 7100  O "O5'" . DT  I 5 67  ? 107.97500 84.77600  66.42800  1.000 67.18291  ? -6  DT  I "O5'" 1 
ATOM 7101  C "C5'" . DT  I 5 67  ? 107.84000 84.69900  67.84300  1.000 67.18291  ? -6  DT  I "C5'" 1 
ATOM 7102  C "C4'" . DT  I 5 67  ? 108.17300 86.03200  68.48500  1.000 67.18291  ? -6  DT  I "C4'" 1 
ATOM 7103  O "O4'" . DT  I 5 67  ? 109.61200 86.20900  68.58400  1.000 67.18291  ? -6  DT  I "O4'" 1 
ATOM 7104  C "C3'" . DT  I 5 67  ? 107.65700 87.25100  67.72200  1.000 67.18291  ? -6  DT  I "C3'" 1 
ATOM 7105  O "O3'" . DT  I 5 67  ? 107.06800 88.15800  68.63500  1.000 67.18291  ? -6  DT  I "O3'" 1 
ATOM 7106  C "C2'" . DT  I 5 67  ? 108.93500 87.82100  67.10400  1.000 67.18291  ? -6  DT  I "C2'" 1 
ATOM 7107  C "C1'" . DT  I 5 67  ? 109.90400 87.53100  68.22400  1.000 67.18291  ? -6  DT  I "C1'" 1 
ATOM 7108  N N1    . DT  I 5 67  ? 111.34600 87.62800  67.85300  1.000 67.18291  ? -6  DT  I N1    1 
ATOM 7109  C C2    . DT  I 5 67  ? 112.24200 88.13400  68.76600  1.000 67.18291  ? -6  DT  I C2    1 
ATOM 7110  O O2    . DT  I 5 67  ? 111.91600 88.54000  69.86500  1.000 67.18291  ? -6  DT  I O2    1 
ATOM 7111  N N3    . DT  I 5 67  ? 113.54000 88.16700  68.33600  1.000 67.18291  ? -6  DT  I N3    1 
ATOM 7112  C C4    . DT  I 5 67  ? 114.02600 87.73800  67.12200  1.000 67.18291  ? -6  DT  I C4    1 
ATOM 7113  O O4    . DT  I 5 67  ? 115.21500 87.80400  66.83100  1.000 67.18291  ? -6  DT  I O4    1 
ATOM 7114  C C5    . DT  I 5 67  ? 113.03900 87.20700  66.21800  1.000 67.18291  ? -6  DT  I C5    1 
ATOM 7115  C C7    . DT  I 5 67  ? 113.45000 86.71000  64.86400  1.000 67.18291  ? -6  DT  I C7    1 
ATOM 7116  C C6    . DT  I 5 67  ? 111.76100 87.18200  66.62200  1.000 67.18291  ? -6  DT  I C6    1 
ATOM 7117  P P     . DA  I 5 68  ? 105.47100 88.26500  68.75800  1.000 62.60950  ? -5  DA  I P     1 
ATOM 7118  O OP1   . DA  I 5 68  ? 104.96000 86.89900  69.00000  1.000 62.60950  ? -5  DA  I OP1   1 
ATOM 7119  O OP2   . DA  I 5 68  ? 104.96500 89.03600  67.60400  1.000 62.60950  ? -5  DA  I OP2   1 
ATOM 7120  O "O5'" . DA  I 5 68  ? 105.24200 89.13200  70.08300  1.000 62.60950  ? -5  DA  I "O5'" 1 
ATOM 7121  C "C5'" . DA  I 5 68  ? 105.68100 88.63500  71.34900  1.000 62.60950  ? -5  DA  I "C5'" 1 
ATOM 7122  C "C4'" . DA  I 5 68  ? 106.51000 89.66400  72.11100  1.000 62.60950  ? -5  DA  I "C4'" 1 
ATOM 7123  O "O4'" . DA  I 5 68  ? 107.84100 89.80000  71.55600  1.000 62.60950  ? -5  DA  I "O4'" 1 
ATOM 7124  C "C3'" . DA  I 5 68  ? 105.93700 91.06700  72.17300  1.000 62.60950  ? -5  DA  I "C3'" 1 
ATOM 7125  O "O3'" . DA  I 5 68  ? 106.11900 91.54300  73.48000  1.000 62.60950  ? -5  DA  I "O3'" 1 
ATOM 7126  C "C2'" . DA  I 5 68  ? 106.79100 91.82800  71.14800  1.000 62.60950  ? -5  DA  I "C2'" 1 
ATOM 7127  C "C1'" . DA  I 5 68  ? 108.14000 91.16900  71.34400  1.000 62.60950  ? -5  DA  I "C1'" 1 
ATOM 7128  N N9    . DA  I 5 68  ? 109.02700 91.19800  70.18700  1.000 62.60950  ? -5  DA  I N9    1 
ATOM 7129  C C8    . DA  I 5 68  ? 108.70500 90.82400  68.92300  1.000 62.60950  ? -5  DA  I C8    1 
ATOM 7130  N N7    . DA  I 5 68  ? 109.70300 90.87900  68.08200  1.000 62.60950  ? -5  DA  I N7    1 
ATOM 7131  C C5    . DA  I 5 68  ? 110.76600 91.29300  68.84700  1.000 62.60950  ? -5  DA  I C5    1 
ATOM 7132  C C6    . DA  I 5 68  ? 112.10700 91.54500  68.52600  1.000 62.60950  ? -5  DA  I C6    1 
ATOM 7133  N N6    . DA  I 5 68  ? 112.60000 91.39000  67.30000  1.000 62.60950  ? -5  DA  I N6    1 
ATOM 7134  N N1    . DA  I 5 68  ? 112.92300 91.96500  69.50900  1.000 62.60950  ? -5  DA  I N1    1 
ATOM 7135  C C2    . DA  I 5 68  ? 112.42200 92.12000  70.74400  1.000 62.60950  ? -5  DA  I C2    1 
ATOM 7136  N N3    . DA  I 5 68  ? 111.16800 91.91000  71.16700  1.000 62.60950  ? -5  DA  I N3    1 
ATOM 7137  C C4    . DA  I 5 68  ? 110.38200 91.49200  70.15500  1.000 62.60950  ? -5  DA  I C4    1 
ATOM 7138  P P     . DC  I 5 69  ? 105.42100 92.89100  73.98100  1.000 57.52651  ? -4  DC  I P     1 
ATOM 7139  O OP1   . DC  I 5 69  ? 105.04700 92.69800  75.39700  1.000 57.52651  ? -4  DC  I OP1   1 
ATOM 7140  O OP2   . DC  I 5 69  ? 104.40300 93.30300  72.99300  1.000 57.52651  ? -4  DC  I OP2   1 
ATOM 7141  O "O5'" . DC  I 5 69  ? 106.62500 93.91800  73.91000  1.000 57.52651  ? -4  DC  I "O5'" 1 
ATOM 7142  C "C5'" . DC  I 5 69  ? 107.77000 93.66300  74.67900  1.000 57.52651  ? -4  DC  I "C5'" 1 
ATOM 7143  C "C4'" . DC  I 5 69  ? 108.91600 94.54900  74.26200  1.000 57.52651  ? -4  DC  I "C4'" 1 
ATOM 7144  O "O4'" . DC  I 5 69  ? 109.34600 94.23300  72.91900  1.000 57.52651  ? -4  DC  I "O4'" 1 
ATOM 7145  C "C3'" . DC  I 5 69  ? 108.60900 96.03400  74.27000  1.000 57.52651  ? -4  DC  I "C3'" 1 
ATOM 7146  O "O3'" . DC  I 5 69  ? 109.67800 96.69600  74.87100  1.000 57.52651  ? -4  DC  I "O3'" 1 
ATOM 7147  C "C2'" . DC  I 5 69  ? 108.50000 96.37300  72.78600  1.000 57.52651  ? -4  DC  I "C2'" 1 
ATOM 7148  C "C1'" . DC  I 5 69  ? 109.53700 95.43400  72.22400  1.000 57.52651  ? -4  DC  I "C1'" 1 
ATOM 7149  N N1    . DC  I 5 69  ? 109.42100 95.16600  70.77600  1.000 57.52651  ? -4  DC  I N1    1 
ATOM 7150  C C2    . DC  I 5 69  ? 110.57700 95.12700  70.00800  1.000 57.52651  ? -4  DC  I C2    1 
ATOM 7151  O O2    . DC  I 5 69  ? 111.65500 95.34900  70.55900  1.000 57.52651  ? -4  DC  I O2    1 
ATOM 7152  N N3    . DC  I 5 69  ? 110.48000 94.86600  68.68800  1.000 57.52651  ? -4  DC  I N3    1 
ATOM 7153  C C4    . DC  I 5 69  ? 109.28900 94.63500  68.14200  1.000 57.52651  ? -4  DC  I C4    1 
ATOM 7154  N N4    . DC  I 5 69  ? 109.24200 94.37600  66.83200  1.000 57.52651  ? -4  DC  I N4    1 
ATOM 7155  C C5    . DC  I 5 69  ? 108.09400 94.65500  68.91500  1.000 57.52651  ? -4  DC  I C5    1 
ATOM 7156  C C6    . DC  I 5 69  ? 108.20700 94.92200  70.21800  1.000 57.52651  ? -4  DC  I C6    1 
ATOM 7157  P P     . DG  I 5 70  ? 109.40300 97.91400  75.86300  1.000 55.18036  ? -3  DG  I P     1 
ATOM 7158  O OP1   . DG  I 5 70  ? 109.17200 97.33400  77.19900  1.000 55.18036  ? -3  DG  I OP1   1 
ATOM 7159  O OP2   . DG  I 5 70  ? 108.37800 98.77800  75.25200  1.000 55.18036  ? -3  DG  I OP2   1 
ATOM 7160  O "O5'" . DG  I 5 70  ? 110.77800 98.71500  75.87300  1.000 55.18036  ? -3  DG  I "O5'" 1 
ATOM 7161  C "C5'" . DG  I 5 70  ? 111.99700 98.03800  76.12800  1.000 55.18036  ? -3  DG  I "C5'" 1 
ATOM 7162  C "C4'" . DG  I 5 70  ? 113.13400 98.63500  75.31600  1.000 55.18036  ? -3  DG  I "C4'" 1 
ATOM 7163  O "O4'" . DG  I 5 70  ? 113.03000 98.24300  73.93100  1.000 55.18036  ? -3  DG  I "O4'" 1 
ATOM 7164  C "C3'" . DG  I 5 70  ? 113.23000 100.15100 75.32900  1.000 55.18036  ? -3  DG  I "C3'" 1 
ATOM 7165  O "O3'" . DG  I 5 70  ? 114.59500 100.52100 75.44800  1.000 55.18036  ? -3  DG  I "O3'" 1 
ATOM 7166  C "C2'" . DG  I 5 70  ? 112.64000 100.54100 73.97100  1.000 55.18036  ? -3  DG  I "C2'" 1 
ATOM 7167  C "C1'" . DG  I 5 70  ? 113.07900 99.37800  73.10000  1.000 55.18036  ? -3  DG  I "C1'" 1 
ATOM 7168  N N9    . DG  I 5 70  ? 112.20100 99.07600  71.97900  1.000 55.18036  ? -3  DG  I N9    1 
ATOM 7169  C C8    . DG  I 5 70  ? 110.85900 98.83200  72.04200  1.000 55.18036  ? -3  DG  I C8    1 
ATOM 7170  N N7    . DG  I 5 70  ? 110.32800 98.53500  70.89500  1.000 55.18036  ? -3  DG  I N7    1 
ATOM 7171  C C5    . DG  I 5 70  ? 111.38800 98.58100  70.00900  1.000 55.18036  ? -3  DG  I C5    1 
ATOM 7172  C C6    . DG  I 5 70  ? 111.41300 98.35600  68.61800  1.000 55.18036  ? -3  DG  I C6    1 
ATOM 7173  O O6    . DG  I 5 70  ? 110.46900 98.05700  67.87500  1.000 55.18036  ? -3  DG  I O6    1 
ATOM 7174  N N1    . DG  I 5 70  ? 112.68800 98.50700  68.09400  1.000 55.18036  ? -3  DG  I N1    1 
ATOM 7175  C C2    . DG  I 5 70  ? 113.80100 98.83300  68.82500  1.000 55.18036  ? -3  DG  I C2    1 
ATOM 7176  N N2    . DG  I 5 70  ? 114.95100 98.93300  68.14500  1.000 55.18036  ? -3  DG  I N2    1 
ATOM 7177  N N3    . DG  I 5 70  ? 113.79200 99.04800  70.13400  1.000 55.18036  ? -3  DG  I N3    1 
ATOM 7178  C C4    . DG  I 5 70  ? 112.55300 98.90500  70.65800  1.000 55.18036  ? -3  DG  I C4    1 
ATOM 7179  P P     . DC  I 5 71  ? 115.01000 102.01900 75.83700  1.000 59.95539  ? -2  DC  I P     1 
ATOM 7180  O OP1   . DC  I 5 71  ? 116.22400 101.95900 76.67400  1.000 59.95539  ? -2  DC  I OP1   1 
ATOM 7181  O OP2   . DC  I 5 71  ? 113.80000 102.70400 76.33200  1.000 59.95539  ? -2  DC  I OP2   1 
ATOM 7182  O "O5'" . DC  I 5 71  ? 115.39400 102.67500 74.44200  1.000 59.95539  ? -2  DC  I "O5'" 1 
ATOM 7183  C "C5'" . DC  I 5 71  ? 116.15500 101.94400 73.48700  1.000 59.95539  ? -2  DC  I "C5'" 1 
ATOM 7184  C "C4'" . DC  I 5 71  ? 116.16100 102.67200 72.15700  1.000 59.95539  ? -2  DC  I "C4'" 1 
ATOM 7185  O "O4'" . DC  I 5 71  ? 115.09500 102.18000 71.30900  1.000 59.95539  ? -2  DC  I "O4'" 1 
ATOM 7186  C "C3'" . DC  I 5 71  ? 115.95200 104.18100 72.25500  1.000 59.95539  ? -2  DC  I "C3'" 1 
ATOM 7187  O "O3'" . DC  I 5 71  ? 116.85700 104.83600 71.38500  1.000 59.95539  ? -2  DC  I "O3'" 1 
ATOM 7188  C "C2'" . DC  I 5 71  ? 114.50400 104.35400 71.81200  1.000 59.95539  ? -2  DC  I "C2'" 1 
ATOM 7189  C "C1'" . DC  I 5 71  ? 114.42300 103.28100 70.75700  1.000 59.95539  ? -2  DC  I "C1'" 1 
ATOM 7190  N N1    . DC  I 5 71  ? 113.04700 102.86600 70.40200  1.000 59.95539  ? -2  DC  I N1    1 
ATOM 7191  C C2    . DC  I 5 71  ? 112.77900 102.46500 69.10200  1.000 59.95539  ? -2  DC  I C2    1 
ATOM 7192  O O2    . DC  I 5 71  ? 113.68700 102.52300 68.26900  1.000 59.95539  ? -2  DC  I O2    1 
ATOM 7193  N N3    . DC  I 5 71  ? 111.52800 102.07200 68.78300  1.000 59.95539  ? -2  DC  I N3    1 
ATOM 7194  C C4    . DC  I 5 71  ? 110.58200 102.03800 69.71700  1.000 59.95539  ? -2  DC  I C4    1 
ATOM 7195  N N4    . DC  I 5 71  ? 109.36300 101.63200 69.35900  1.000 59.95539  ? -2  DC  I N4    1 
ATOM 7196  C C5    . DC  I 5 71  ? 110.84400 102.41500 71.06100  1.000 59.95539  ? -2  DC  I C5    1 
ATOM 7197  C C6    . DC  I 5 71  ? 112.08000 102.82000 71.35400  1.000 59.95539  ? -2  DC  I C6    1 
ATOM 7198  P P     . DG  I 5 72  ? 117.51000 106.24000 71.79900  1.000 65.71044  ? -1  DG  I P     1 
ATOM 7199  O OP1   . DG  I 5 72  ? 118.80000 105.94300 72.45500  1.000 65.71044  ? -1  DG  I OP1   1 
ATOM 7200  O OP2   . DG  I 5 72  ? 116.48000 107.02000 72.51800  1.000 65.71044  ? -1  DG  I OP2   1 
ATOM 7201  O "O5'" . DG  I 5 72  ? 117.79100 106.96400 70.40200  1.000 65.71044  ? -1  DG  I "O5'" 1 
ATOM 7202  C "C5'" . DG  I 5 72  ? 118.40700 106.24900 69.33200  1.000 65.71044  ? -1  DG  I "C5'" 1 
ATOM 7203  C "C4'" . DG  I 5 72  ? 117.65500 106.47200 68.03100  1.000 65.71044  ? -1  DG  I "C4'" 1 
ATOM 7204  O "O4'" . DG  I 5 72  ? 116.38200 105.79400 68.07100  1.000 65.71044  ? -1  DG  I "O4'" 1 
ATOM 7205  C "C3'" . DG  I 5 72  ? 117.35100 107.93600 67.70400  1.000 65.71044  ? -1  DG  I "C3'" 1 
ATOM 7206  O "O3'" . DG  I 5 72  ? 117.97800 108.30800 66.48000  1.000 65.71044  ? -1  DG  I "O3'" 1 
ATOM 7207  C "C2'" . DG  I 5 72  ? 115.82300 107.98800 67.60800  1.000 65.71044  ? -1  DG  I "C2'" 1 
ATOM 7208  C "C1'" . DG  I 5 72  ? 115.45800 106.54100 67.33400  1.000 65.71044  ? -1  DG  I "C1'" 1 
ATOM 7209  N N9    . DG  I 5 72  ? 114.13300 106.19400 67.81100  1.000 65.71044  ? -1  DG  I N9    1 
ATOM 7210  C C8    . DG  I 5 72  ? 113.68900 106.29800 69.09600  1.000 65.71044  ? -1  DG  I C8    1 
ATOM 7211  N N7    . DG  I 5 72  ? 112.45800 105.91900 69.25700  1.000 65.71044  ? -1  DG  I N7    1 
ATOM 7212  C C5    . DG  I 5 72  ? 112.04200 105.57400 67.98600  1.000 65.71044  ? -1  DG  I C5    1 
ATOM 7213  C C6    . DG  I 5 72  ? 110.79200 105.10700 67.54700  1.000 65.71044  ? -1  DG  I C6    1 
ATOM 7214  O O6    . DG  I 5 72  ? 109.77800 104.90300 68.22200  1.000 65.71044  ? -1  DG  I O6    1 
ATOM 7215  N N1    . DG  I 5 72  ? 110.78000 104.87600 66.18100  1.000 65.71044  ? -1  DG  I N1    1 
ATOM 7216  C C2    . DG  I 5 72  ? 111.85100 105.06700 65.34300  1.000 65.71044  ? -1  DG  I C2    1 
ATOM 7217  N N2    . DG  I 5 72  ? 111.65000 104.79100 64.04900  1.000 65.71044  ? -1  DG  I N2    1 
ATOM 7218  N N3    . DG  I 5 72  ? 113.03700 105.50800 65.74400  1.000 65.71044  ? -1  DG  I N3    1 
ATOM 7219  C C4    . DG  I 5 72  ? 113.06100 105.73400 67.07700  1.000 65.71044  ? -1  DG  I C4    1 
ATOM 7220  P P     . DC  I 5 73  ? 117.99200 109.84500 66.00900  1.000 71.06750  ? 0   DC  I P     1 
ATOM 7221  O OP1   . DC  I 5 73  ? 119.27300 110.08200 65.30900  1.000 71.06750  ? 0   DC  I OP1   1 
ATOM 7222  O OP2   . DC  I 5 73  ? 117.63000 110.69000 67.16700  1.000 71.06750  ? 0   DC  I OP2   1 
ATOM 7223  O "O5'" . DC  I 5 73  ? 116.80900 109.93500 64.93700  1.000 71.06750  ? 0   DC  I "O5'" 1 
ATOM 7224  C "C5'" . DC  I 5 73  ? 116.82200 109.09000 63.79100  1.000 71.06750  ? 0   DC  I "C5'" 1 
ATOM 7225  C "C4'" . DC  I 5 73  ? 115.48200 109.12900 63.07800  1.000 71.06750  ? 0   DC  I "C4'" 1 
ATOM 7226  O "O4'" . DC  I 5 73  ? 114.46400 108.53700 63.90800  1.000 71.06750  ? 0   DC  I "O4'" 1 
ATOM 7227  C "C3'" . DC  I 5 73  ? 114.97300 110.52700 62.71000  1.000 71.06750  ? 0   DC  I "C3'" 1 
ATOM 7228  O "O3'" . DC  I 5 73  ? 114.82900 110.63300 61.29600  1.000 71.06750  ? 0   DC  I "O3'" 1 
ATOM 7229  C "C2'" . DC  I 5 73  ? 113.62900 110.64500 63.43900  1.000 71.06750  ? 0   DC  I "C2'" 1 
ATOM 7230  C "C1'" . DC  I 5 73  ? 113.25500 109.19100 63.65500  1.000 71.06750  ? 0   DC  I "C1'" 1 
ATOM 7231  N N1    . DC  I 5 73  ? 112.37100 108.96300 64.81400  1.000 71.06750  ? 0   DC  I N1    1 
ATOM 7232  C C2    . DC  I 5 73  ? 111.07000 108.50800 64.61500  1.000 71.06750  ? 0   DC  I C2    1 
ATOM 7233  O O2    . DC  I 5 73  ? 110.66600 108.34300 63.46200  1.000 71.06750  ? 0   DC  I O2    1 
ATOM 7234  N N3    . DC  I 5 73  ? 110.28100 108.29100 65.69500  1.000 71.06750  ? 0   DC  I N3    1 
ATOM 7235  C C4    . DC  I 5 73  ? 110.76100 108.49200 66.91900  1.000 71.06750  ? 0   DC  I C4    1 
ATOM 7236  N N4    . DC  I 5 73  ? 109.95700 108.25900 67.95700  1.000 71.06750  ? 0   DC  I N4    1 
ATOM 7237  C C5    . DC  I 5 73  ? 112.09000 108.94200 67.13700  1.000 71.06750  ? 0   DC  I C5    1 
ATOM 7238  C C6    . DC  I 5 73  ? 112.85400 109.14600 66.06600  1.000 71.06750  ? 0   DC  I C6    1 
ATOM 7239  P P     . DT  I 5 74  ? 114.62300 112.06700 60.60300  1.000 72.42923  ? 1   DT  I P     1 
ATOM 7240  O OP1   . DT  I 5 74  ? 115.18700 111.99800 59.23900  1.000 72.42923  ? 1   DT  I OP1   1 
ATOM 7241  O OP2   . DT  I 5 74  ? 115.11200 113.09300 61.54900  1.000 72.42923  ? 1   DT  I OP2   1 
ATOM 7242  O "O5'" . DT  I 5 74  ? 113.03600 112.21900 60.48800  1.000 72.42923  ? 1   DT  I "O5'" 1 
ATOM 7243  C "C5'" . DT  I 5 74  ? 112.27300 111.22900 59.80500  1.000 72.42923  ? 1   DT  I "C5'" 1 
ATOM 7244  C "C4'" . DT  I 5 74  ? 110.78000 111.53200 59.87300  1.000 72.42923  ? 1   DT  I "C4'" 1 
ATOM 7245  O "O4'" . DT  I 5 74  ? 110.22800 111.05700 61.13400  1.000 72.42923  ? 1   DT  I "O4'" 1 
ATOM 7246  C "C3'" . DT  I 5 74  ? 110.40000 113.01700 59.78500  1.000 72.42923  ? 1   DT  I "C3'" 1 
ATOM 7247  O "O3'" . DT  I 5 74  ? 109.24300 113.16600 58.96900  1.000 72.42923  ? 1   DT  I "O3'" 1 
ATOM 7248  C "C2'" . DT  I 5 74  ? 110.09500 113.36000 61.23600  1.000 72.42923  ? 1   DT  I "C2'" 1 
ATOM 7249  C "C1'" . DT  I 5 74  ? 109.42500 112.07700 61.67100  1.000 72.42923  ? 1   DT  I "C1'" 1 
ATOM 7250  N N1    . DT  I 5 74  ? 109.34700 111.90800 63.13700  1.000 72.42923  ? 1   DT  I N1    1 
ATOM 7251  C C2    . DT  I 5 74  ? 108.19900 111.40300 63.68800  1.000 72.42923  ? 1   DT  I C2    1 
ATOM 7252  O O2    . DT  I 5 74  ? 107.21700 111.11000 63.03100  1.000 72.42923  ? 1   DT  I O2    1 
ATOM 7253  N N3    . DT  I 5 74  ? 108.22300 111.28200 65.04600  1.000 72.42923  ? 1   DT  I N3    1 
ATOM 7254  C C4    . DT  I 5 74  ? 109.27200 111.59000 65.89000  1.000 72.42923  ? 1   DT  I C4    1 
ATOM 7255  O O4    . DT  I 5 74  ? 109.20200 111.43800 67.10300  1.000 72.42923  ? 1   DT  I O4    1 
ATOM 7256  C C5    . DT  I 5 74  ? 110.45100 112.10500 65.24300  1.000 72.42923  ? 1   DT  I C5    1 
ATOM 7257  C C7    . DT  I 5 74  ? 111.65100 112.48300 66.05500  1.000 72.42923  ? 1   DT  I C7    1 
ATOM 7258  C C6    . DT  I 5 74  ? 110.43200 112.23500 63.91400  1.000 72.42923  ? 1   DT  I C6    1 
ATOM 7259  P P     . DG  I 5 75  ? 108.93700 114.55700 58.22400  1.000 70.28366  ? 2   DG  I P     1 
ATOM 7260  O OP1   . DG  I 5 75  ? 109.81800 114.62500 57.03800  1.000 70.28366  ? 2   DG  I OP1   1 
ATOM 7261  O OP2   . DG  I 5 75  ? 108.96000 115.65200 59.21700  1.000 70.28366  ? 2   DG  I OP2   1 
ATOM 7262  O "O5'" . DG  I 5 75  ? 107.42300 114.40400 57.73400  1.000 70.28366  ? 2   DG  I "O5'" 1 
ATOM 7263  C "C5'" . DG  I 5 75  ? 106.66500 113.25100 58.09200  1.000 70.28366  ? 2   DG  I "C5'" 1 
ATOM 7264  C "C4'" . DG  I 5 75  ? 105.37300 113.63700 58.80100  1.000 70.28366  ? 2   DG  I "C4'" 1 
ATOM 7265  O "O4'" . DG  I 5 75  ? 105.51200 113.44900 60.23100  1.000 70.28366  ? 2   DG  I "O4'" 1 
ATOM 7266  C "C3'" . DG  I 5 75  ? 104.92200 115.08100 58.61400  1.000 70.28366  ? 2   DG  I "C3'" 1 
ATOM 7267  O "O3'" . DG  I 5 75  ? 103.51900 115.11900 58.49900  1.000 70.28366  ? 2   DG  I "O3'" 1 
ATOM 7268  C "C2'" . DG  I 5 75  ? 105.38600 115.74900 59.90200  1.000 70.28366  ? 2   DG  I "C2'" 1 
ATOM 7269  C "C1'" . DG  I 5 75  ? 105.15200 114.63600 60.90300  1.000 70.28366  ? 2   DG  I "C1'" 1 
ATOM 7270  N N9    . DG  I 5 75  ? 105.97500 114.72400 62.10200  1.000 70.28366  ? 2   DG  I N9    1 
ATOM 7271  C C8    . DG  I 5 75  ? 107.27700 115.13200 62.18600  1.000 70.28366  ? 2   DG  I C8    1 
ATOM 7272  N N7    . DG  I 5 75  ? 107.76200 115.07000 63.39300  1.000 70.28366  ? 2   DG  I N7    1 
ATOM 7273  C C5    . DG  I 5 75  ? 106.71200 114.58500 64.15300  1.000 70.28366  ? 2   DG  I C5    1 
ATOM 7274  C C6    . DG  I 5 75  ? 106.63700 114.31100 65.53400  1.000 70.28366  ? 2   DG  I C6    1 
ATOM 7275  O O6    . DG  I 5 75  ? 107.51700 114.44600 66.39300  1.000 70.28366  ? 2   DG  I O6    1 
ATOM 7276  N N1    . DG  I 5 75  ? 105.38000 113.83300 65.89400  1.000 70.28366  ? 2   DG  I N1    1 
ATOM 7277  C C2    . DG  I 5 75  ? 104.33500 113.64500 65.02500  1.000 70.28366  ? 2   DG  I C2    1 
ATOM 7278  N N2    . DG  I 5 75  ? 103.19600 113.17500 65.54200  1.000 70.28366  ? 2   DG  I N2    1 
ATOM 7279  N N3    . DG  I 5 75  ? 104.39700 113.89900 63.73300  1.000 70.28366  ? 2   DG  I N3    1 
ATOM 7280  C C4    . DG  I 5 75  ? 105.60900 114.36200 63.36900  1.000 70.28366  ? 2   DG  I C4    1 
ATOM 7281  P P     . DT  I 5 76  ? 102.82700 115.88500 57.27300  1.000 69.87160  ? 3   DT  I P     1 
ATOM 7282  O OP1   . DT  I 5 76  ? 102.37300 114.86200 56.30600  1.000 69.87160  ? 3   DT  I OP1   1 
ATOM 7283  O OP2   . DT  I 5 76  ? 103.73900 116.96800 56.84200  1.000 69.87160  ? 3   DT  I OP2   1 
ATOM 7284  O "O5'" . DT  I 5 76  ? 101.54300 116.55400 57.93600  1.000 69.87160  ? 3   DT  I "O5'" 1 
ATOM 7285  C "C5'" . DT  I 5 76  ? 101.63000 117.09900 59.24200  1.000 69.87160  ? 3   DT  I "C5'" 1 
ATOM 7286  C "C4'" . DT  I 5 76  ? 100.51500 116.56500 60.12000  1.000 69.87160  ? 3   DT  I "C4'" 1 
ATOM 7287  O "O4'" . DT  I 5 76  ? 101.06800 116.07500 61.37000  1.000 69.87160  ? 3   DT  I "O4'" 1 
ATOM 7288  C "C3'" . DT  I 5 76  ? 99.50900  117.60800 60.54300  1.000 69.87160  ? 3   DT  I "C3'" 1 
ATOM 7289  O "O3'" . DT  I 5 76  ? 98.30400  116.97200 60.94200  1.000 69.87160  ? 3   DT  I "O3'" 1 
ATOM 7290  C "C2'" . DT  I 5 76  ? 100.22700 118.24100 61.71900  1.000 69.87160  ? 3   DT  I "C2'" 1 
ATOM 7291  C "C1'" . DT  I 5 76  ? 100.81000 117.01400 62.40200  1.000 69.87160  ? 3   DT  I "C1'" 1 
ATOM 7292  N N1    . DT  I 5 76  ? 102.09100 117.25000 63.14400  1.000 69.87160  ? 3   DT  I N1    1 
ATOM 7293  C C2    . DT  I 5 76  ? 102.17800 116.90000 64.47400  1.000 69.87160  ? 3   DT  I C2    1 
ATOM 7294  O O2    . DT  I 5 76  ? 101.24200 116.45300 65.10800  1.000 69.87160  ? 3   DT  I O2    1 
ATOM 7295  N N3    . DT  I 5 76  ? 103.40300 117.13000 65.04500  1.000 69.87160  ? 3   DT  I N3    1 
ATOM 7296  C C4    . DT  I 5 76  ? 104.52700 117.64000 64.42500  1.000 69.87160  ? 3   DT  I C4    1 
ATOM 7297  O O4    . DT  I 5 76  ? 105.58700 117.80600 65.01400  1.000 69.87160  ? 3   DT  I O4    1 
ATOM 7298  C C5    . DT  I 5 76  ? 104.37500 117.96000 63.03500  1.000 69.87160  ? 3   DT  I C5    1 
ATOM 7299  C C7    . DT  I 5 76  ? 105.53300 118.52300 62.27200  1.000 69.87160  ? 3   DT  I C7    1 
ATOM 7300  C C6    . DT  I 5 76  ? 103.18100 117.74800 62.46400  1.000 69.87160  ? 3   DT  I C6    1 
ATOM 7301  P P     . DC  I 5 77  ? 96.93800  117.81000 61.02300  1.000 66.31930  ? 4   DC  I P     1 
ATOM 7302  O OP1   . DC  I 5 77  ? 95.81400  116.86200 60.86400  1.000 66.31930  ? 4   DC  I OP1   1 
ATOM 7303  O OP2   . DC  I 5 77  ? 97.06600  118.97200 60.11700  1.000 66.31930  ? 4   DC  I OP2   1 
ATOM 7304  O "O5'" . DC  I 5 77  ? 96.92500  118.36300 62.51800  1.000 66.31930  ? 4   DC  I "O5'" 1 
ATOM 7305  C "C5'" . DC  I 5 77  ? 97.09900  117.46400 63.60600  1.000 66.31930  ? 4   DC  I "C5'" 1 
ATOM 7306  C "C4'" . DC  I 5 77  ? 97.38200  118.22200 64.88800  1.000 66.31930  ? 4   DC  I "C4'" 1 
ATOM 7307  O "O4'" . DC  I 5 77  ? 98.79800  118.50400 65.01400  1.000 66.31930  ? 4   DC  I "O4'" 1 
ATOM 7308  C "C3'" . DC  I 5 77  ? 96.67600  119.57200 65.01700  1.000 66.31930  ? 4   DC  I "C3'" 1 
ATOM 7309  O "O3'" . DC  I 5 77  ? 96.13900  119.67800 66.31800  1.000 66.31930  ? 4   DC  I "O3'" 1 
ATOM 7310  C "C2'" . DC  I 5 77  ? 97.81600  120.56700 64.80000  1.000 66.31930  ? 4   DC  I "C2'" 1 
ATOM 7311  C "C1'" . DC  I 5 77  ? 98.92900  119.81600 65.49000  1.000 66.31930  ? 4   DC  I "C1'" 1 
ATOM 7312  N N1    . DC  I 5 77  ? 100.30800 120.29700 65.20700  1.000 66.31930  ? 4   DC  I N1    1 
ATOM 7313  C C2    . DC  I 5 77  ? 101.28200 120.14600 66.18600  1.000 66.31930  ? 4   DC  I C2    1 
ATOM 7314  O O2    . DC  I 5 77  ? 100.96300 119.64800 67.26500  1.000 66.31930  ? 4   DC  I O2    1 
ATOM 7315  N N3    . DC  I 5 77  ? 102.54100 120.55500 65.92900  1.000 66.31930  ? 4   DC  I N3    1 
ATOM 7316  C C4    . DC  I 5 77  ? 102.84000 121.08700 64.74900  1.000 66.31930  ? 4   DC  I C4    1 
ATOM 7317  N N4    . DC  I 5 77  ? 104.10200 121.47800 64.54300  1.000 66.31930  ? 4   DC  I N4    1 
ATOM 7318  C C5    . DC  I 5 77  ? 101.86000 121.24300 63.72800  1.000 66.31930  ? 4   DC  I C5    1 
ATOM 7319  C C6    . DC  I 5 77  ? 100.61600 120.84200 64.00200  1.000 66.31930  ? 4   DC  I C6    1 
ATOM 7320  P P     . DC  I 5 78  ? 94.79500  120.50500 66.59100  1.000 63.77919  ? 5   DC  I P     1 
ATOM 7321  O OP1   . DC  I 5 78  ? 93.66800  119.75400 66.00000  1.000 63.77919  ? 5   DC  I OP1   1 
ATOM 7322  O OP2   . DC  I 5 78  ? 95.04500  121.90700 66.19800  1.000 63.77919  ? 5   DC  I OP2   1 
ATOM 7323  O "O5'" . DC  I 5 78  ? 94.64800  120.46200 68.18000  1.000 63.77919  ? 5   DC  I "O5'" 1 
ATOM 7324  C "C5'" . DC  I 5 78  ? 95.03800  119.29300 68.90500  1.000 63.77919  ? 5   DC  I "C5'" 1 
ATOM 7325  C "C4'" . DC  I 5 78  ? 96.08500  119.61300 69.96900  1.000 63.77919  ? 5   DC  I "C4'" 1 
ATOM 7326  O "O4'" . DC  I 5 78  ? 97.33700  120.07300 69.39100  1.000 63.77919  ? 5   DC  I "O4'" 1 
ATOM 7327  C "C3'" . DC  I 5 78  ? 95.68400  120.67100 70.98200  1.000 63.77919  ? 5   DC  I "C3'" 1 
ATOM 7328  O "O3'" . DC  I 5 78  ? 96.12400  120.24800 72.24800  1.000 63.77919  ? 5   DC  I "O3'" 1 
ATOM 7329  C "C2'" . DC  I 5 78  ? 96.45400  121.89800 70.48900  1.000 63.77919  ? 5   DC  I "C2'" 1 
ATOM 7330  C "C1'" . DC  I 5 78  ? 97.74700  121.24600 70.07000  1.000 63.77919  ? 5   DC  I "C1'" 1 
ATOM 7331  N N1    . DC  I 5 78  ? 98.63000  122.02000 69.13800  1.000 63.77919  ? 5   DC  I N1    1 
ATOM 7332  C C2    . DC  I 5 78  ? 99.98500  122.21300 69.45300  1.000 63.77919  ? 5   DC  I C2    1 
ATOM 7333  O O2    . DC  I 5 78  ? 100.41600 121.84100 70.54700  1.000 63.77919  ? 5   DC  I O2    1 
ATOM 7334  N N3    . DC  I 5 78  ? 100.78000 122.85700 68.56600  1.000 63.77919  ? 5   DC  I N3    1 
ATOM 7335  C C4    . DC  I 5 78  ? 100.29000 123.25300 67.40000  1.000 63.77919  ? 5   DC  I C4    1 
ATOM 7336  N N4    . DC  I 5 78  ? 101.11300 123.87600 66.55300  1.000 63.77919  ? 5   DC  I N4    1 
ATOM 7337  C C5    . DC  I 5 78  ? 98.93100  123.04200 67.05100  1.000 63.77919  ? 5   DC  I C5    1 
ATOM 7338  C C6    . DC  I 5 78  ? 98.15100  122.40700 67.93000  1.000 63.77919  ? 5   DC  I C6    1 
ATOM 7339  P P     . DC  I 5 79  ? 95.37600  120.71100 73.58600  1.000 60.95941  ? 6   DC  I P     1 
ATOM 7340  O OP1   . DC  I 5 79  ? 94.55500  119.57700 74.05900  1.000 60.95941  ? 6   DC  I OP1   1 
ATOM 7341  O OP2   . DC  I 5 79  ? 94.73100  122.01600 73.31700  1.000 60.95941  ? 6   DC  I OP2   1 
ATOM 7342  O "O5'" . DC  I 5 79  ? 96.58700  120.92300 74.60900  1.000 60.95941  ? 6   DC  I "O5'" 1 
ATOM 7343  C "C5'" . DC  I 5 79  ? 97.91900  121.09500 74.10700  1.000 60.95941  ? 6   DC  I "C5'" 1 
ATOM 7344  C "C4'" . DC  I 5 79  ? 98.55400  122.33200 74.70300  1.000 60.95941  ? 6   DC  I "C4'" 1 
ATOM 7345  O "O4'" . DC  I 5 79  ? 99.16200  123.12400 73.63900  1.000 60.95941  ? 6   DC  I "O4'" 1 
ATOM 7346  C "C3'" . DC  I 5 79  ? 97.55700  123.26600 75.37700  1.000 60.95941  ? 6   DC  I "C3'" 1 
ATOM 7347  O "O3'" . DC  I 5 79  ? 98.20300  124.02300 76.39200  1.000 60.95941  ? 6   DC  I "O3'" 1 
ATOM 7348  C "C2'" . DC  I 5 79  ? 97.16300  124.15600 74.20700  1.000 60.95941  ? 6   DC  I "C2'" 1 
ATOM 7349  C "C1'" . DC  I 5 79  ? 98.53900  124.38800 73.61300  1.000 60.95941  ? 6   DC  I "C1'" 1 
ATOM 7350  N N1    . DC  I 5 79  ? 98.54600  124.92600 72.21700  1.000 60.95941  ? 6   DC  I N1    1 
ATOM 7351  C C2    . DC  I 5 79  ? 99.75700  125.26800 71.61300  1.000 60.95941  ? 6   DC  I C2    1 
ATOM 7352  O O2    . DC  I 5 79  ? 100.79900 125.15900 72.25700  1.000 60.95941  ? 6   DC  I O2    1 
ATOM 7353  N N3    . DC  I 5 79  ? 99.74700  125.73700 70.34000  1.000 60.95941  ? 6   DC  I N3    1 
ATOM 7354  C C4    . DC  I 5 79  ? 98.59700  125.84500 69.67900  1.000 60.95941  ? 6   DC  I C4    1 
ATOM 7355  N N4    . DC  I 5 79  ? 98.63400  126.30800 68.42600  1.000 60.95941  ? 6   DC  I N4    1 
ATOM 7356  C C5    . DC  I 5 79  ? 97.35500  125.48900 70.27500  1.000 60.95941  ? 6   DC  I C5    1 
ATOM 7357  C C6    . DC  I 5 79  ? 97.37800  125.05400 71.53600  1.000 60.95941  ? 6   DC  I C6    1 
ATOM 7358  P P     . DC  I 5 80  ? 98.76400  123.33100 77.73200  1.000 55.06688  ? 7   DC  I P     1 
ATOM 7359  O OP1   . DC  I 5 80  ? 98.15900  121.99900 77.93300  1.000 55.06688  ? 7   DC  I OP1   1 
ATOM 7360  O OP2   . DC  I 5 80  ? 98.59700  124.34500 78.79200  1.000 55.06688  ? 7   DC  I OP2   1 
ATOM 7361  O "O5'" . DC  I 5 80  ? 100.33200 123.18600 77.44500  1.000 55.06688  ? 7   DC  I "O5'" 1 
ATOM 7362  C "C5'" . DC  I 5 80  ? 101.27300 123.42100 78.48000  1.000 55.06688  ? 7   DC  I "C5'" 1 
ATOM 7363  C "C4'" . DC  I 5 80  ? 102.21400 124.55400 78.11100  1.000 55.06688  ? 7   DC  I "C4'" 1 
ATOM 7364  O "O4'" . DC  I 5 80  ? 101.81700 125.13500 76.84300  1.000 55.06688  ? 7   DC  I "O4'" 1 
ATOM 7365  C "C3'" . DC  I 5 80  ? 102.24600 125.71100 79.10300  1.000 55.06688  ? 7   DC  I "C3'" 1 
ATOM 7366  O "O3'" . DC  I 5 80  ? 103.58400 126.10100 79.35400  1.000 55.06688  ? 7   DC  I "O3'" 1 
ATOM 7367  C "C2'" . DC  I 5 80  ? 101.45700 126.78800 78.38500  1.000 55.06688  ? 7   DC  I "C2'" 1 
ATOM 7368  C "C1'" . DC  I 5 80  ? 101.86000 126.53600 76.95200  1.000 55.06688  ? 7   DC  I "C1'" 1 
ATOM 7369  N N1    . DC  I 5 80  ? 100.90200 127.08200 75.96500  1.000 55.06688  ? 7   DC  I N1    1 
ATOM 7370  C C2    . DC  I 5 80  ? 101.36400 127.74200 74.81900  1.000 55.06688  ? 7   DC  I C2    1 
ATOM 7371  O O2    . DC  I 5 80  ? 102.57800 127.88200 74.64300  1.000 55.06688  ? 7   DC  I O2    1 
ATOM 7372  N N3    . DC  I 5 80  ? 100.45900 128.20700 73.92800  1.000 55.06688  ? 7   DC  I N3    1 
ATOM 7373  C C4    . DC  I 5 80  ? 99.15800  128.03800 74.14800  1.000 55.06688  ? 7   DC  I C4    1 
ATOM 7374  N N4    . DC  I 5 80  ? 98.30300  128.51600 73.24200  1.000 55.06688  ? 7   DC  I N4    1 
ATOM 7375  C C5    . DC  I 5 80  ? 98.67400  127.39500 75.31700  1.000 55.06688  ? 7   DC  I C5    1 
ATOM 7376  C C6    . DC  I 5 80  ? 99.57100  126.91700 76.17600  1.000 55.06688  ? 7   DC  I C6    1 
ATOM 7377  P P     . DC  I 5 81  ? 103.97400 126.87600 80.70400  1.000 57.04221  ? 8   DC  I P     1 
ATOM 7378  O OP1   . DC  I 5 81  ? 104.71100 125.94800 81.57200  1.000 57.04221  ? 8   DC  I OP1   1 
ATOM 7379  O OP2   . DC  I 5 81  ? 102.78400 127.55600 81.24100  1.000 57.04221  ? 8   DC  I OP2   1 
ATOM 7380  O "O5'" . DC  I 5 81  ? 104.98400 128.00200 80.21000  1.000 57.04221  ? 8   DC  I "O5'" 1 
ATOM 7381  C "C5'" . DC  I 5 81  ? 105.97800 127.69300 79.23800  1.000 57.04221  ? 8   DC  I "C5'" 1 
ATOM 7382  C "C4'" . DC  I 5 81  ? 106.31400 128.91800 78.41000  1.000 57.04221  ? 8   DC  I "C4'" 1 
ATOM 7383  O "O4'" . DC  I 5 81  ? 105.26400 129.18500 77.45100  1.000 57.04221  ? 8   DC  I "O4'" 1 
ATOM 7384  C "C3'" . DC  I 5 81  ? 106.50100 130.19500 79.21200  1.000 57.04221  ? 8   DC  I "C3'" 1 
ATOM 7385  O "O3'" . DC  I 5 81  ? 107.71500 130.80900 78.83000  1.000 57.04221  ? 8   DC  I "O3'" 1 
ATOM 7386  C "C2'" . DC  I 5 81  ? 105.27200 131.03200 78.84900  1.000 57.04221  ? 8   DC  I "C2'" 1 
ATOM 7387  C "C1'" . DC  I 5 81  ? 104.96700 130.56000 77.44000  1.000 57.04221  ? 8   DC  I "C1'" 1 
ATOM 7388  N N1    . DC  I 5 81  ? 103.53300 130.66900 77.06400  1.000 57.04221  ? 8   DC  I N1    1 
ATOM 7389  C C2    . DC  I 5 81  ? 103.14300 131.26400 75.85400  1.000 57.04221  ? 8   DC  I C2    1 
ATOM 7390  O O2    . DC  I 5 81  ? 103.99300 131.77000 75.11900  1.000 57.04221  ? 8   DC  I O2    1 
ATOM 7391  N N3    . DC  I 5 81  ? 101.82200 131.30100 75.54500  1.000 57.04221  ? 8   DC  I N3    1 
ATOM 7392  C C4    . DC  I 5 81  ? 100.93200 130.75100 76.36000  1.000 57.04221  ? 8   DC  I C4    1 
ATOM 7393  N N4    . DC  I 5 81  ? 99.64100  130.79900 76.02300  1.000 57.04221  ? 8   DC  I N4    1 
ATOM 7394  C C5    . DC  I 5 81  ? 101.31500 130.14400 77.57300  1.000 57.04221  ? 8   DC  I C5    1 
ATOM 7395  C C6    . DC  I 5 81  ? 102.60900 130.10700 77.87200  1.000 57.04221  ? 8   DC  I C6    1 
ATOM 7396  P P     . DG  I 5 82  ? 108.33600 132.01100 79.69000  1.000 66.08763  ? 9   DG  I P     1 
ATOM 7397  O OP1   . DG  I 5 82  ? 109.79400 131.79700 79.76100  1.000 66.08763  ? 9   DG  I OP1   1 
ATOM 7398  O OP2   . DG  I 5 82  ? 107.56300 132.14400 80.94200  1.000 66.08763  ? 9   DG  I OP2   1 
ATOM 7399  O "O5'" . DG  I 5 82  ? 108.05300 133.28400 78.77600  1.000 66.08763  ? 9   DG  I "O5'" 1 
ATOM 7400  C "C5'" . DG  I 5 82  ? 108.41800 133.25100 77.39900  1.000 66.08763  ? 9   DG  I "C5'" 1 
ATOM 7401  C "C4'" . DG  I 5 82  ? 107.92400 134.48700 76.66900  1.000 66.08763  ? 9   DG  I "C4'" 1 
ATOM 7402  O "O4'" . DG  I 5 82  ? 106.55300 134.30000 76.24900  1.000 66.08763  ? 9   DG  I "O4'" 1 
ATOM 7403  C "C3'" . DG  I 5 82  ? 107.96000 135.78200 77.47100  1.000 66.08763  ? 9   DG  I "C3'" 1 
ATOM 7404  O "O3'" . DG  I 5 82  ? 108.45600 136.82100 76.64300  1.000 66.08763  ? 9   DG  I "O3'" 1 
ATOM 7405  C "C2'" . DG  I 5 82  ? 106.49500 135.99500 77.84800  1.000 66.08763  ? 9   DG  I "C2'" 1 
ATOM 7406  C "C1'" . DG  I 5 82  ? 105.77900 135.40300 76.65000  1.000 66.08763  ? 9   DG  I "C1'" 1 
ATOM 7407  N N9    . DG  I 5 82  ? 104.45300 134.89300 76.95800  1.000 66.08763  ? 9   DG  I N9    1 
ATOM 7408  C C8    . DG  I 5 82  ? 104.10400 134.14100 78.04000  1.000 66.08763  ? 9   DG  I C8    1 
ATOM 7409  N N7    . DG  I 5 82  ? 102.85000 133.80500 78.06200  1.000 66.08763  ? 9   DG  I N7    1 
ATOM 7410  C C5    . DG  I 5 82  ? 102.32400 134.40200 76.93500  1.000 66.08763  ? 9   DG  I C5    1 
ATOM 7411  C C6    . DG  I 5 82  ? 101.00500 134.39900 76.44500  1.000 66.08763  ? 9   DG  I C6    1 
ATOM 7412  O O6    . DG  I 5 82  ? 100.01200 133.85100 76.93300  1.000 66.08763  ? 9   DG  I O6    1 
ATOM 7413  N N1    . DG  I 5 82  ? 100.89100 135.13300 75.27000  1.000 66.08763  ? 9   DG  I N1    1 
ATOM 7414  C C2    . DG  I 5 82  ? 101.92700 135.78300 74.64600  1.000 66.08763  ? 9   DG  I C2    1 
ATOM 7415  N N2    . DG  I 5 82  ? 101.62900 136.44200 73.51900  1.000 66.08763  ? 9   DG  I N2    1 
ATOM 7416  N N3    . DG  I 5 82  ? 103.17400 135.79100 75.09800  1.000 66.08763  ? 9   DG  I N3    1 
ATOM 7417  C C4    . DG  I 5 82  ? 103.29700 135.08200 76.24300  1.000 66.08763  ? 9   DG  I C4    1 
ATOM 7418  P P     . DC  I 5 83  ? 108.86900 138.24800 77.25300  1.000 70.52682  ? 10  DC  I P     1 
ATOM 7419  O OP1   . DC  I 5 83  ? 110.17000 138.61200 76.65100  1.000 70.52682  ? 10  DC  I OP1   1 
ATOM 7420  O OP2   . DC  I 5 83  ? 108.74600 138.20800 78.72700  1.000 70.52682  ? 10  DC  I OP2   1 
ATOM 7421  O "O5'" . DC  I 5 83  ? 107.74800 139.22800 76.67900  1.000 70.52682  ? 10  DC  I "O5'" 1 
ATOM 7422  C "C5'" . DC  I 5 83  ? 107.37700 139.15200 75.30400  1.000 70.52682  ? 10  DC  I "C5'" 1 
ATOM 7423  C "C4'" . DC  I 5 83  ? 106.16500 140.01800 75.02900  1.000 70.52682  ? 10  DC  I "C4'" 1 
ATOM 7424  O "O4'" . DC  I 5 83  ? 104.95500 139.27100 75.30000  1.000 70.52682  ? 10  DC  I "O4'" 1 
ATOM 7425  C "C3'" . DC  I 5 83  ? 106.08800 141.28700 75.87500  1.000 70.52682  ? 10  DC  I "C3'" 1 
ATOM 7426  O "O3'" . DC  I 5 83  ? 105.81800 142.40700 75.04400  1.000 70.52682  ? 10  DC  I "O3'" 1 
ATOM 7427  C "C2'" . DC  I 5 83  ? 104.95600 140.99800 76.86200  1.000 70.52682  ? 10  DC  I "C2'" 1 
ATOM 7428  C "C1'" . DC  I 5 83  ? 104.07500 140.06200 76.05900  1.000 70.52682  ? 10  DC  I "C1'" 1 
ATOM 7429  N N1    . DC  I 5 83  ? 103.28100 139.14600 76.89900  1.000 70.52682  ? 10  DC  I N1    1 
ATOM 7430  C C2    . DC  I 5 83  ? 101.93000 138.94700 76.63000  1.000 70.52682  ? 10  DC  I C2    1 
ATOM 7431  O O2    . DC  I 5 83  ? 101.40300 139.58500 75.71900  1.000 70.52682  ? 10  DC  I O2    1 
ATOM 7432  N N3    . DC  I 5 83  ? 101.23100 138.08800 77.40700  1.000 70.52682  ? 10  DC  I N3    1 
ATOM 7433  C C4    . DC  I 5 83  ? 101.84300 137.42600 78.38500  1.000 70.52682  ? 10  DC  I C4    1 
ATOM 7434  N N4    . DC  I 5 83  ? 101.12100 136.58100 79.12200  1.000 70.52682  ? 10  DC  I N4    1 
ATOM 7435  C C5    . DC  I 5 83  ? 103.22300 137.59900 78.65500  1.000 70.52682  ? 10  DC  I C5    1 
ATOM 7436  C C6    . DC  I 5 83  ? 103.89700 138.45500 77.89100  1.000 70.52682  ? 10  DC  I C6    1 
ATOM 7437  P P     . DG  I 5 84  ? 106.23500 143.88200 75.52000  1.000 72.54032  ? 11  DG  I P     1 
ATOM 7438  O OP1   . DG  I 5 84  ? 107.15500 144.44600 74.51000  1.000 72.54032  ? 11  DG  I OP1   1 
ATOM 7439  O OP2   . DG  I 5 84  ? 106.66300 143.79700 76.93300  1.000 72.54032  ? 11  DG  I OP2   1 
ATOM 7440  O "O5'" . DG  I 5 84  ? 104.86500 144.69800 75.47100  1.000 72.54032  ? 11  DG  I "O5'" 1 
ATOM 7441  C "C5'" . DG  I 5 84  ? 103.96200 144.52800 74.37900  1.000 72.54032  ? 11  DG  I "C5'" 1 
ATOM 7442  C "C4'" . DG  I 5 84  ? 102.53000 144.67900 74.85400  1.000 72.54032  ? 11  DG  I "C4'" 1 
ATOM 7443  O "O4'" . DG  I 5 84  ? 102.10200 143.49300 75.54300  1.000 72.54032  ? 11  DG  I "O4'" 1 
ATOM 7444  C "C3'" . DG  I 5 84  ? 102.29700 145.83900 75.82100  1.000 72.54032  ? 11  DG  I "C3'" 1 
ATOM 7445  O "O3'" . DG  I 5 84  ? 101.51300 146.85100 75.19700  1.000 72.54032  ? 11  DG  I "O3'" 1 
ATOM 7446  C "C2'" . DG  I 5 84  ? 101.57100 145.20300 77.01500  1.000 72.54032  ? 11  DG  I "C2'" 1 
ATOM 7447  C "C1'" . DG  I 5 84  ? 101.11900 143.86000 76.46800  1.000 72.54032  ? 11  DG  I "C1'" 1 
ATOM 7448  N N9    . DG  I 5 84  ? 101.03600 142.80500 77.47100  1.000 72.54032  ? 11  DG  I N9    1 
ATOM 7449  C C8    . DG  I 5 84  ? 102.05900 142.32600 78.24200  1.000 72.54032  ? 11  DG  I C8    1 
ATOM 7450  N N7    . DG  I 5 84  ? 101.70300 141.36600 79.04300  1.000 72.54032  ? 11  DG  I N7    1 
ATOM 7451  C C5    . DG  I 5 84  ? 100.35000 141.20400 78.79600  1.000 72.54032  ? 11  DG  I C5    1 
ATOM 7452  C C6    . DG  I 5 84  ? 99.42800  140.31000 79.37400  1.000 72.54032  ? 11  DG  I C6    1 
ATOM 7453  O O6    . DG  I 5 84  ? 99.63500  139.46000 80.24700  1.000 72.54032  ? 11  DG  I O6    1 
ATOM 7454  N N1    . DG  I 5 84  ? 98.15200  140.47000 78.84500  1.000 72.54032  ? 11  DG  I N1    1 
ATOM 7455  C C2    . DG  I 5 84  ? 97.81400  141.38000 77.87600  1.000 72.54032  ? 11  DG  I C2    1 
ATOM 7456  N N2    . DG  I 5 84  ? 96.53100  141.39100 77.48600  1.000 72.54032  ? 11  DG  I N2    1 
ATOM 7457  N N3    . DG  I 5 84  ? 98.67500  142.22500 77.32200  1.000 72.54032  ? 11  DG  I N3    1 
ATOM 7458  C C4    . DG  I 5 84  ? 99.92100  142.08000 77.83100  1.000 72.54032  ? 11  DG  I C4    1 
ATOM 7459  P P     . DT  I 5 85  ? 101.33400 148.28500 75.90100  1.000 73.30855  ? 12  DT  I P     1 
ATOM 7460  O OP1   . DT  I 5 85  ? 101.23600 149.28800 74.82000  1.000 73.30855  ? 12  DT  I OP1   1 
ATOM 7461  O OP2   . DT  I 5 85  ? 102.38600 148.42100 76.93100  1.000 73.30855  ? 12  DT  I OP2   1 
ATOM 7462  O "O5'" . DT  I 5 85  ? 99.91500  148.19200 76.63900  1.000 73.30855  ? 12  DT  I "O5'" 1 
ATOM 7463  C "C5'" . DT  I 5 85  ? 98.72100  148.15400 75.87100  1.000 73.30855  ? 12  DT  I "C5'" 1 
ATOM 7464  C "C4'" . DT  I 5 85  ? 97.57700  147.51400 76.64500  1.000 73.30855  ? 12  DT  I "C4'" 1 
ATOM 7465  O "O4'" . DT  I 5 85  ? 98.03400  146.34900 77.36700  1.000 73.30855  ? 12  DT  I "O4'" 1 
ATOM 7466  C "C3'" . DT  I 5 85  ? 96.89300  148.41300 77.68200  1.000 73.30855  ? 12  DT  I "C3'" 1 
ATOM 7467  O "O3'" . DT  I 5 85  ? 95.51600  148.53800 77.34500  1.000 73.30855  ? 12  DT  I "O3'" 1 
ATOM 7468  C "C2'" . DT  I 5 85  ? 97.10400  147.66900 79.01600  1.000 73.30855  ? 12  DT  I "C2'" 1 
ATOM 7469  C "C1'" . DT  I 5 85  ? 97.27400  146.24100 78.54400  1.000 73.30855  ? 12  DT  I "C1'" 1 
ATOM 7470  N N1    . DT  I 5 85  ? 98.01700  145.34800 79.48200  1.000 73.30855  ? 12  DT  I N1    1 
ATOM 7471  C C2    . DT  I 5 85  ? 97.37900  144.26800 80.04900  1.000 73.30855  ? 12  DT  I C2    1 
ATOM 7472  O O2    . DT  I 5 85  ? 96.20400  144.01600 79.87100  1.000 73.30855  ? 12  DT  I O2    1 
ATOM 7473  N N3    . DT  I 5 85  ? 98.17300  143.50000 80.86000  1.000 73.30855  ? 12  DT  I N3    1 
ATOM 7474  C C4    . DT  I 5 85  ? 99.51100  143.69000 81.13700  1.000 73.30855  ? 12  DT  I C4    1 
ATOM 7475  O O4    . DT  I 5 85  ? 100.14200 142.94900 81.87800  1.000 73.30855  ? 12  DT  I O4    1 
ATOM 7476  C C5    . DT  I 5 85  ? 100.11700 144.82200 80.49800  1.000 73.30855  ? 12  DT  I C5    1 
ATOM 7477  C C7    . DT  I 5 85  ? 101.56600 145.12700 80.72800  1.000 73.30855  ? 12  DT  I C7    1 
ATOM 7478  C C6    . DT  I 5 85  ? 99.35000  145.58500 79.71000  1.000 73.30855  ? 12  DT  I C6    1 
ATOM 7479  P P     . DT  I 5 86  ? 94.62800  149.75500 77.90500  1.000 72.61278  ? 13  DT  I P     1 
ATOM 7480  O OP1   . DT  I 5 86  ? 94.05200  150.47600 76.75100  1.000 72.61278  ? 13  DT  I OP1   1 
ATOM 7481  O OP2   . DT  I 5 86  ? 95.42200  150.49600 78.90800  1.000 72.61278  ? 13  DT  I OP2   1 
ATOM 7482  O "O5'" . DT  I 5 86  ? 93.45400  149.00900 78.68000  1.000 72.61278  ? 13  DT  I "O5'" 1 
ATOM 7483  C "C5'" . DT  I 5 86  ? 93.64300  148.64000 80.02500  1.000 72.61278  ? 13  DT  I "C5'" 1 
ATOM 7484  C "C4'" . DT  I 5 86  ? 92.83400  147.40800 80.37300  1.000 72.61278  ? 13  DT  I "C4'" 1 
ATOM 7485  O "O4'" . DT  I 5 86  ? 93.73700  146.34100 80.75600  1.000 72.61278  ? 13  DT  I "O4'" 1 
ATOM 7486  C "C3'" . DT  I 5 86  ? 91.93000  147.58100 81.57000  1.000 72.61278  ? 13  DT  I "C3'" 1 
ATOM 7487  O "O3'" . DT  I 5 86  ? 90.93200  146.57800 81.56900  1.000 72.61278  ? 13  DT  I "O3'" 1 
ATOM 7488  C "C2'" . DT  I 5 86  ? 92.91600  147.36900 82.69400  1.000 72.61278  ? 13  DT  I "C2'" 1 
ATOM 7489  C "C1'" . DT  I 5 86  ? 93.69200  146.17500 82.16000  1.000 72.61278  ? 13  DT  I "C1'" 1 
ATOM 7490  N N1    . DT  I 5 86  ? 95.08700  146.08200 82.66100  1.000 72.61278  ? 13  DT  I N1    1 
ATOM 7491  C C2    . DT  I 5 86  ? 95.47800  144.95700 83.33400  1.000 72.61278  ? 13  DT  I C2    1 
ATOM 7492  O O2    . DT  I 5 86  ? 94.72800  144.03200 83.57100  1.000 72.61278  ? 13  DT  I O2    1 
ATOM 7493  N N3    . DT  I 5 86  ? 96.78200  144.95800 83.74100  1.000 72.61278  ? 13  DT  I N3    1 
ATOM 7494  C C4    . DT  I 5 86  ? 97.71900  145.94900 83.53200  1.000 72.61278  ? 13  DT  I C4    1 
ATOM 7495  O O4    . DT  I 5 86  ? 98.87300  145.86000 83.93500  1.000 72.61278  ? 13  DT  I O4    1 
ATOM 7496  C C5    . DT  I 5 86  ? 97.24800  147.09800 82.81100  1.000 72.61278  ? 13  DT  I C5    1 
ATOM 7497  C C7    . DT  I 5 86  ? 98.17800  148.23600 82.52700  1.000 72.61278  ? 13  DT  I C7    1 
ATOM 7498  C C6    . DT  I 5 86  ? 95.96900  147.10900 82.41000  1.000 72.61278  ? 13  DT  I C6    1 
ATOM 7499  P P     . DT  I 5 87  ? 89.48600  146.88900 82.18800  1.000 69.98580  ? 14  DT  I P     1 
ATOM 7500  O OP1   . DT  I 5 87  ? 88.47600  146.31800 81.27100  1.000 69.98580  ? 14  DT  I OP1   1 
ATOM 7501  O OP2   . DT  I 5 87  ? 89.45100  148.33000 82.51700  1.000 69.98580  ? 14  DT  I OP2   1 
ATOM 7502  O "O5'" . DT  I 5 87  ? 89.46000  146.06800 83.56300  1.000 69.98580  ? 14  DT  I "O5'" 1 
ATOM 7503  C "C5'" . DT  I 5 87  ? 90.29100  144.91900 83.74600  1.000 69.98580  ? 14  DT  I "C5'" 1 
ATOM 7504  C "C4'" . DT  I 5 87  ? 90.41100  144.56300 85.22100  1.000 69.98580  ? 14  DT  I "C4'" 1 
ATOM 7505  O "O4'" . DT  I 5 87  ? 91.80300  144.56100 85.64400  1.000 69.98580  ? 14  DT  I "O4'" 1 
ATOM 7506  C "C3'" . DT  I 5 87  ? 89.71400  145.51300 86.18300  1.000 69.98580  ? 14  DT  I "C3'" 1 
ATOM 7507  O "O3'" . DT  I 5 87  ? 89.41000  144.80300 87.35100  1.000 69.98580  ? 14  DT  I "O3'" 1 
ATOM 7508  C "C2'" . DT  I 5 87  ? 90.84700  146.48800 86.47200  1.000 69.98580  ? 14  DT  I "C2'" 1 
ATOM 7509  C "C1'" . DT  I 5 87  ? 91.94500  145.47300 86.71600  1.000 69.98580  ? 14  DT  I "C1'" 1 
ATOM 7510  N N1    . DT  I 5 87  ? 93.32700  145.99600 86.69200  1.000 69.98580  ? 14  DT  I N1    1 
ATOM 7511  C C2    . DT  I 5 87  ? 94.32600  145.23100 87.22400  1.000 69.98580  ? 14  DT  I C2    1 
ATOM 7512  O O2    . DT  I 5 87  ? 94.12900  144.15600 87.75500  1.000 69.98580  ? 14  DT  I O2    1 
ATOM 7513  N N3    . DT  I 5 87  ? 95.57100  145.77200 87.13100  1.000 69.98580  ? 14  DT  I N3    1 
ATOM 7514  C C4    . DT  I 5 87  ? 95.91500  146.97300 86.56000  1.000 69.98580  ? 14  DT  I C4    1 
ATOM 7515  O O4    . DT  I 5 87  ? 97.07100  147.37100 86.52600  1.000 69.98580  ? 14  DT  I O4    1 
ATOM 7516  C C5    . DT  I 5 87  ? 94.82300  147.72200 86.00500  1.000 69.98580  ? 14  DT  I C5    1 
ATOM 7517  C C7    . DT  I 5 87  ? 95.07400  149.04700 85.35500  1.000 69.98580  ? 14  DT  I C7    1 
ATOM 7518  C C6    . DT  I 5 87  ? 93.59400  147.20400 86.10200  1.000 69.98580  ? 14  DT  I C6    1 
ATOM 7519  P P     . DT  I 5 88  ? 87.95100  144.20100 87.62200  1.000 67.83249  ? 15  DT  I P     1 
ATOM 7520  O OP1   . DT  I 5 88  ? 87.54000  143.40400 86.44600  1.000 67.83249  ? 15  DT  I OP1   1 
ATOM 7521  O OP2   . DT  I 5 88  ? 87.08500  145.29700 88.10900  1.000 67.83249  ? 15  DT  I OP2   1 
ATOM 7522  O "O5'" . DT  I 5 88  ? 88.23400  143.20900 88.83600  1.000 67.83249  ? 15  DT  I "O5'" 1 
ATOM 7523  C "C5'" . DT  I 5 88  ? 89.37100  142.35100 88.77100  1.000 67.83249  ? 15  DT  I "C5'" 1 
ATOM 7524  C "C4'" . DT  I 5 88  ? 90.10000  142.28400 90.10300  1.000 67.83249  ? 15  DT  I "C4'" 1 
ATOM 7525  O "O4'" . DT  I 5 88  ? 91.34000  143.04000 90.03800  1.000 67.83249  ? 15  DT  I "O4'" 1 
ATOM 7526  C "C3'" . DT  I 5 88  ? 89.34500  142.83800 91.30400  1.000 67.83249  ? 15  DT  I "C3'" 1 
ATOM 7527  O "O3'" . DT  I 5 88  ? 89.64100  142.03300 92.41500  1.000 67.83249  ? 15  DT  I "O3'" 1 
ATOM 7528  C "C2'" . DT  I 5 88  ? 89.97100  144.22500 91.46200  1.000 67.83249  ? 15  DT  I "C2'" 1 
ATOM 7529  C "C1'" . DT  I 5 88  ? 91.41500  143.88700 91.16100  1.000 67.83249  ? 15  DT  I "C1'" 1 
ATOM 7530  N N1    . DT  I 5 88  ? 92.27400  145.04600 90.80900  1.000 67.83249  ? 15  DT  I N1    1 
ATOM 7531  C C2    . DT  I 5 88  ? 93.63200  144.94200 90.98700  1.000 67.83249  ? 15  DT  I C2    1 
ATOM 7532  O O2    . DT  I 5 88  ? 94.16700  143.95000 91.43800  1.000 67.83249  ? 15  DT  I O2    1 
ATOM 7533  N N3    . DT  I 5 88  ? 94.34600  146.04700 90.62000  1.000 67.83249  ? 15  DT  I N3    1 
ATOM 7534  C C4    . DT  I 5 88  ? 93.84800  147.21900 90.09500  1.000 67.83249  ? 15  DT  I C4    1 
ATOM 7535  O O4    . DT  I 5 88  ? 94.57200  148.16000 89.79300  1.000 67.83249  ? 15  DT  I O4    1 
ATOM 7536  C C5    . DT  I 5 88  ? 92.41900  147.26400 89.92700  1.000 67.83249  ? 15  DT  I C5    1 
ATOM 7537  C C7    . DT  I 5 88  ? 91.77100  148.49400 89.37400  1.000 67.83249  ? 15  DT  I C7    1 
ATOM 7538  C C6    . DT  I 5 88  ? 91.70600  146.18600 90.28800  1.000 67.83249  ? 15  DT  I C6    1 
ATOM 7539  P P     . DA  I 5 89  ? 88.64900  140.86100 92.87700  1.000 66.20538  ? 16  DA  I P     1 
ATOM 7540  O OP1   . DA  I 5 89  ? 88.56800  139.86000 91.79500  1.000 66.20538  ? 16  DA  I OP1   1 
ATOM 7541  O OP2   . DA  I 5 89  ? 87.41800  141.49100 93.39700  1.000 66.20538  ? 16  DA  I OP2   1 
ATOM 7542  O "O5'" . DA  I 5 89  ? 89.42600  140.19900 94.10300  1.000 66.20538  ? 16  DA  I "O5'" 1 
ATOM 7543  C "C5'" . DA  I 5 89  ? 90.67900  139.56900 93.87500  1.000 66.20538  ? 16  DA  I "C5'" 1 
ATOM 7544  C "C4'" . DA  I 5 89  ? 91.78100  140.18800 94.72100  1.000 66.20538  ? 16  DA  I "C4'" 1 
ATOM 7545  O "O4'" . DA  I 5 89  ? 92.07800  141.53400 94.27800  1.000 66.20538  ? 16  DA  I "O4'" 1 
ATOM 7546  C "C3'" . DA  I 5 89  ? 91.49600  140.30200 96.21700  1.000 66.20538  ? 16  DA  I "C3'" 1 
ATOM 7547  O "O3'" . DA  I 5 89  ? 92.65500  139.92700 96.90100  1.000 66.20538  ? 16  DA  I "O3'" 1 
ATOM 7548  C "C2'" . DA  I 5 89  ? 91.23100  141.79900 96.38400  1.000 66.20538  ? 16  DA  I "C2'" 1 
ATOM 7549  C "C1'" . DA  I 5 89  ? 92.26200  142.33000 95.41900  1.000 66.20538  ? 16  DA  I "C1'" 1 
ATOM 7550  N N9    . DA  I 5 89  ? 92.08000  143.71800 95.02500  1.000 66.20538  ? 16  DA  I N9    1 
ATOM 7551  C C8    . DA  I 5 89  ? 90.90100  144.36300 94.81400  1.000 66.20538  ? 16  DA  I C8    1 
ATOM 7552  N N7    . DA  I 5 89  ? 91.04200  145.61100 94.44300  1.000 66.20538  ? 16  DA  I N7    1 
ATOM 7553  C C5    . DA  I 5 89  ? 92.41000  145.79700 94.41900  1.000 66.20538  ? 16  DA  I C5    1 
ATOM 7554  C C6    . DA  I 5 89  ? 93.20800  146.91000 94.10800  1.000 66.20538  ? 16  DA  I C6    1 
ATOM 7555  N N6    . DA  I 5 89  ? 92.70700  148.09200 93.74600  1.000 66.20538  ? 16  DA  I N6    1 
ATOM 7556  N N1    . DA  I 5 89  ? 94.54600  146.76200 94.18400  1.000 66.20538  ? 16  DA  I N1    1 
ATOM 7557  C C2    . DA  I 5 89  ? 95.04300  145.57500 94.54800  1.000 66.20538  ? 16  DA  I C2    1 
ATOM 7558  N N3    . DA  I 5 89  ? 94.38900  144.45800 94.85800  1.000 66.20538  ? 16  DA  I N3    1 
ATOM 7559  C C4    . DA  I 5 89  ? 93.06600  144.63900 94.77100  1.000 66.20538  ? 16  DA  I C4    1 
ATOM 7560  P P     . DA  I 5 90  ? 92.61800  138.80200 98.03700  1.000 62.55274  ? 17  DA  I P     1 
ATOM 7561  O OP1   . DA  I 5 90  ? 92.39700  137.50200 97.37100  1.000 62.55274  ? 17  DA  I OP1   1 
ATOM 7562  O OP2   . DA  I 5 90  ? 91.68900  139.24700 99.09500  1.000 62.55274  ? 17  DA  I OP2   1 
ATOM 7563  O "O5'" . DA  I 5 90  ? 94.10000  138.85100 98.61700  1.000 62.55274  ? 17  DA  I "O5'" 1 
ATOM 7564  C "C5'" . DA  I 5 90  ? 95.20200  138.60800 97.75400  1.000 62.55274  ? 17  DA  I "C5'" 1 
ATOM 7565  C "C4'" . DA  I 5 90  ? 96.36300  139.52700 98.07900  1.000 62.55274  ? 17  DA  I "C4'" 1 
ATOM 7566  O "O4'" . DA  I 5 90  ? 96.06300  140.87400 97.66500  1.000 62.55274  ? 17  DA  I "O4'" 1 
ATOM 7567  C "C3'" . DA  I 5 90  ? 96.76100  139.60100 99.54100  1.000 62.55274  ? 17  DA  I "C3'" 1 
ATOM 7568  O "O3'" . DA  I 5 90  ? 98.17100  139.53600 99.62400  1.000 62.55274  ? 17  DA  I "O3'" 1 
ATOM 7569  C "C2'" . DA  I 5 90  ? 96.19900  140.95800 99.99100  1.000 62.55274  ? 17  DA  I "C2'" 1 
ATOM 7570  C "C1'" . DA  I 5 90  ? 96.30600  141.77600 98.71700  1.000 62.55274  ? 17  DA  I "C1'" 1 
ATOM 7571  N N9    . DA  I 5 90  ? 95.29800  142.81700 98.56100  1.000 62.55274  ? 17  DA  I N9    1 
ATOM 7572  C C8    . DA  I 5 90  ? 93.94500  142.64900 98.59900  1.000 62.55274  ? 17  DA  I C8    1 
ATOM 7573  N N7    . DA  I 5 90  ? 93.26800  143.74400 98.37100  1.000 62.55274  ? 17  DA  I N7    1 
ATOM 7574  C C5    . DA  I 5 90  ? 94.24300  144.69800 98.15500  1.000 62.55274  ? 17  DA  I C5    1 
ATOM 7575  C C6    . DA  I 5 90  ? 94.17300  146.07200 97.86300  1.000 62.55274  ? 17  DA  I C6    1 
ATOM 7576  N N6    . DA  I 5 90  ? 93.02400  146.73400 97.73300  1.000 62.55274  ? 17  DA  I N6    1 
ATOM 7577  N N1    . DA  I 5 90  ? 95.33000  146.74000 97.70900  1.000 62.55274  ? 17  DA  I N1    1 
ATOM 7578  C C2    . DA  I 5 90  ? 96.48200  146.07300 97.84100  1.000 62.55274  ? 17  DA  I C2    1 
ATOM 7579  N N3    . DA  I 5 90  ? 96.67300  144.78200 98.11300  1.000 62.55274  ? 17  DA  I N3    1 
ATOM 7580  C C4    . DA  I 5 90  ? 95.50200  144.14500 98.25900  1.000 62.55274  ? 17  DA  I C4    1 
ATOM 7581  P P     . DC  I 5 91  ? 98.90900  139.41200 101.03800 1.000 66.27104  ? 18  DC  I P     1 
ATOM 7582  O OP1   . DC  I 5 91  ? 100.16400 138.65800 100.86000 1.000 66.27104  ? 18  DC  I OP1   1 
ATOM 7583  O OP2   . DC  I 5 91  ? 97.91200  138.96800 102.03100 1.000 66.27104  ? 18  DC  I OP2   1 
ATOM 7584  O "O5'" . DC  I 5 91  ? 99.28800  140.91200 101.36500 1.000 66.27104  ? 18  DC  I "O5'" 1 
ATOM 7585  C "C5'" . DC  I 5 91  ? 99.92400  141.72000 100.38500 1.000 66.27104  ? 18  DC  I "C5'" 1 
ATOM 7586  C "C4'" . DC  I 5 91  ? 100.14800 143.11100 100.93700 1.000 66.27104  ? 18  DC  I "C4'" 1 
ATOM 7587  O "O4'" . DC  I 5 91  ? 99.00900  143.95600 100.63600 1.000 66.27104  ? 18  DC  I "O4'" 1 
ATOM 7588  C "C3'" . DC  I 5 91  ? 100.32300 143.16400 102.45000 1.000 66.27104  ? 18  DC  I "C3'" 1 
ATOM 7589  O "O3'" . DC  I 5 91  ? 101.38900 144.03100 102.77000 1.000 66.27104  ? 18  DC  I "O3'" 1 
ATOM 7590  C "C2'" . DC  I 5 91  ? 98.97900  143.70100 102.92800 1.000 66.27104  ? 18  DC  I "C2'" 1 
ATOM 7591  C "C1'" . DC  I 5 91  ? 98.64000  144.64900 101.79900 1.000 66.27104  ? 18  DC  I "C1'" 1 
ATOM 7592  N N1    . DC  I 5 91  ? 97.19500  144.98600 101.69100 1.000 66.27104  ? 18  DC  I N1    1 
ATOM 7593  C C2    . DC  I 5 91  ? 96.80600  146.29200 101.36800 1.000 66.27104  ? 18  DC  I C2    1 
ATOM 7594  O O2    . DC  I 5 91  ? 97.67100  147.16100 101.23300 1.000 66.27104  ? 18  DC  I O2    1 
ATOM 7595  N N3    . DC  I 5 91  ? 95.48500  146.57300 101.25100 1.000 66.27104  ? 18  DC  I N3    1 
ATOM 7596  C C4    . DC  I 5 91  ? 94.58300  145.60700 101.41200 1.000 66.27104  ? 18  DC  I C4    1 
ATOM 7597  N N4    . DC  I 5 91  ? 93.29200  145.92300 101.28000 1.000 66.27104  ? 18  DC  I N4    1 
ATOM 7598  C C5    . DC  I 5 91  ? 94.96400  144.26800 101.71500 1.000 66.27104  ? 18  DC  I C5    1 
ATOM 7599  C C6    . DC  I 5 91  ? 96.26600  144.00700 101.83900 1.000 66.27104  ? 18  DC  I C6    1 
ATOM 7600  P P     . DC  I 5 92  ? 102.29600 143.76100 104.06400 1.000 75.99212  ? 19  DC  I P     1 
ATOM 7601  O OP1   . DC  I 5 92  ? 103.52300 143.08000 103.60100 1.000 75.99212  ? 19  DC  I OP1   1 
ATOM 7602  O OP2   . DC  I 5 92  ? 101.44900 143.13000 105.09900 1.000 75.99212  ? 19  DC  I OP2   1 
ATOM 7603  O "O5'" . DC  I 5 92  ? 102.68400 145.22500 104.57300 1.000 75.99212  ? 19  DC  I "O5'" 1 
ATOM 7604  C "C5'" . DC  I 5 92  ? 102.87300 146.29000 103.64000 1.000 75.99212  ? 19  DC  I "C5'" 1 
ATOM 7605  C "C4'" . DC  I 5 92  ? 102.13600 147.53200 104.10100 1.000 75.99212  ? 19  DC  I "C4'" 1 
ATOM 7606  O "O4'" . DC  I 5 92  ? 100.73400 147.45300 103.79000 1.000 75.99212  ? 19  DC  I "O4'" 1 
ATOM 7607  C "C3'" . DC  I 5 92  ? 102.21800 147.81000 105.59400 1.000 75.99212  ? 19  DC  I "C3'" 1 
ATOM 7608  O "O3'" . DC  I 5 92  ? 103.10200 148.89000 105.83900 1.000 75.99212  ? 19  DC  I "O3'" 1 
ATOM 7609  C "C2'" . DC  I 5 92  ? 100.78400 148.13300 106.01500 1.000 75.99212  ? 19  DC  I "C2'" 1 
ATOM 7610  C "C1'" . DC  I 5 92  ? 100.03600 148.26600 104.70000 1.000 75.99212  ? 19  DC  I "C1'" 1 
ATOM 7611  N N1    . DC  I 5 92  ? 98.62200  147.79100 104.73800 1.000 75.99212  ? 19  DC  I N1    1 
ATOM 7612  C C2    . DC  I 5 92  ? 97.56000  148.67800 104.50000 1.000 75.99212  ? 19  DC  I C2    1 
ATOM 7613  O O2    . DC  I 5 92  ? 97.79500  149.87700 104.32600 1.000 75.99212  ? 19  DC  I O2    1 
ATOM 7614  N N3    . DC  I 5 92  ? 96.29100  148.19200 104.51000 1.000 75.99212  ? 19  DC  I N3    1 
ATOM 7615  C C4    . DC  I 5 92  ? 96.07700  146.89400 104.70800 1.000 75.99212  ? 19  DC  I C4    1 
ATOM 7616  N N4    . DC  I 5 92  ? 94.82000  146.45100 104.70400 1.000 75.99212  ? 19  DC  I N4    1 
ATOM 7617  C C5    . DC  I 5 92  ? 97.14100  145.98800 104.92600 1.000 75.99212  ? 19  DC  I C5    1 
ATOM 7618  C C6    . DC  I 5 92  ? 98.38000  146.47700 104.93100 1.000 75.99212  ? 19  DC  I C6    1 
ATOM 7619  P P     . DG  I 5 93  ? 103.58400 149.21900 107.33300 1.000 80.37560  ? 20  DG  I P     1 
ATOM 7620  O OP1   . DG  I 5 93  ? 104.94700 149.78700 107.25600 1.000 80.37560  ? 20  DG  I OP1   1 
ATOM 7621  O OP2   . DG  I 5 93  ? 103.33700 148.02500 108.16900 1.000 80.37560  ? 20  DG  I OP2   1 
ATOM 7622  O "O5'" . DG  I 5 93  ? 102.56300 150.35700 107.80600 1.000 80.37560  ? 20  DG  I "O5'" 1 
ATOM 7623  C "C5'" . DG  I 5 93  ? 102.18500 151.40200 106.90100 1.000 80.37560  ? 20  DG  I "C5'" 1 
ATOM 7624  C "C4'" . DG  I 5 93  ? 100.94800 152.13700 107.39700 1.000 80.37560  ? 20  DG  I "C4'" 1 
ATOM 7625  O "O4'" . DG  I 5 93  ? 99.73000  151.44200 107.00300 1.000 80.37560  ? 20  DG  I "O4'" 1 
ATOM 7626  C "C3'" . DG  I 5 93  ? 100.86100 152.31200 108.91200 1.000 80.37560  ? 20  DG  I "C3'" 1 
ATOM 7627  O "O3'" . DG  I 5 93  ? 100.48400 153.64100 109.19200 1.000 80.37560  ? 20  DG  I "O3'" 1 
ATOM 7628  C "C2'" . DG  I 5 93  ? 99.75800  151.31800 109.30200 1.000 80.37560  ? 20  DG  I "C2'" 1 
ATOM 7629  C "C1'" . DG  I 5 93  ? 98.84600  151.44700 108.10100 1.000 80.37560  ? 20  DG  I "C1'" 1 
ATOM 7630  N N9    . DG  I 5 93  ? 97.90800  150.34400 107.93100 1.000 80.37560  ? 20  DG  I N9    1 
ATOM 7631  C C8    . DG  I 5 93  ? 98.20800  149.01600 107.96700 1.000 80.37560  ? 20  DG  I C8    1 
ATOM 7632  N N7    . DG  I 5 93  ? 97.19400  148.23900 107.76800 1.000 80.37560  ? 20  DG  I N7    1 
ATOM 7633  C C5    . DG  I 5 93  ? 96.12800  149.10400 107.64300 1.000 80.37560  ? 20  DG  I C5    1 
ATOM 7634  C C6    . DG  I 5 93  ? 94.76900  148.82100 107.43900 1.000 80.37560  ? 20  DG  I C6    1 
ATOM 7635  O O6    . DG  I 5 93  ? 94.23800  147.71300 107.32600 1.000 80.37560  ? 20  DG  I O6    1 
ATOM 7636  N N1    . DG  I 5 93  ? 94.00800  149.97500 107.37300 1.000 80.37560  ? 20  DG  I N1    1 
ATOM 7637  C C2    . DG  I 5 93  ? 94.50200  151.25100 107.48700 1.000 80.37560  ? 20  DG  I C2    1 
ATOM 7638  N N2    . DG  I 5 93  ? 93.60700  152.24200 107.39500 1.000 80.37560  ? 20  DG  I N2    1 
ATOM 7639  N N3    . DG  I 5 93  ? 95.78700  151.53500 107.67800 1.000 80.37560  ? 20  DG  I N3    1 
ATOM 7640  C C4    . DG  I 5 93  ? 96.54100  150.41100 107.74700 1.000 80.37560  ? 20  DG  I C4    1 
ATOM 7641  P P     . DC  I 5 94  ? 100.86700 154.32300 110.58900 1.000 82.08028  ? 21  DC  I P     1 
ATOM 7642  O OP1   . DC  I 5 94  ? 101.72000 155.49400 110.29100 1.000 82.08028  ? 21  DC  I OP1   1 
ATOM 7643  O OP2   . DC  I 5 94  ? 101.36500 153.26200 111.49200 1.000 82.08028  ? 21  DC  I OP2   1 
ATOM 7644  O "O5'" . DC  I 5 94  ? 99.46200  154.82600 111.15100 1.000 82.08028  ? 21  DC  I "O5'" 1 
ATOM 7645  C "C5'" . DC  I 5 94  ? 98.51600  153.87900 111.59800 1.000 82.08028  ? 21  DC  I "C5'" 1 
ATOM 7646  C "C4'" . DC  I 5 94  ? 97.12300  154.46600 111.61300 1.000 82.08028  ? 21  DC  I "C4'" 1 
ATOM 7647  O "O4'" . DC  I 5 94  ? 96.21100  153.58900 110.89600 1.000 82.08028  ? 21  DC  I "O4'" 1 
ATOM 7648  C "C3'" . DC  I 5 94  ? 96.53600  154.60200 113.00200 1.000 82.08028  ? 21  DC  I "C3'" 1 
ATOM 7649  O "O3'" . DC  I 5 94  ? 95.59600  155.65500 113.02500 1.000 82.08028  ? 21  DC  I "O3'" 1 
ATOM 7650  C "C2'" . DC  I 5 94  ? 95.87900  153.24800 113.19700 1.000 82.08028  ? 21  DC  I "C2'" 1 
ATOM 7651  C "C1'" . DC  I 5 94  ? 95.31000  152.99500 111.81000 1.000 82.08028  ? 21  DC  I "C1'" 1 
ATOM 7652  N N1    . DC  I 5 94  ? 95.16900  151.54700 111.46900 1.000 82.08028  ? 21  DC  I N1    1 
ATOM 7653  C C2    . DC  I 5 94  ? 93.90300  151.00900 111.18600 1.000 82.08028  ? 21  DC  I C2    1 
ATOM 7654  O O2    . DC  I 5 94  ? 92.90600  151.72700 111.27100 1.000 82.08028  ? 21  DC  I O2    1 
ATOM 7655  N N3    . DC  I 5 94  ? 93.80400  149.69700 110.87600 1.000 82.08028  ? 21  DC  I N3    1 
ATOM 7656  C C4    . DC  I 5 94  ? 94.90400  148.94500 110.80600 1.000 82.08028  ? 21  DC  I C4    1 
ATOM 7657  N N4    . DC  I 5 94  ? 94.76200  147.65800 110.48200 1.000 82.08028  ? 21  DC  I N4    1 
ATOM 7658  C C5    . DC  I 5 94  ? 96.19900  149.47800 111.06400 1.000 82.08028  ? 21  DC  I C5    1 
ATOM 7659  C C6    . DC  I 5 94  ? 96.28500  150.77100 111.37900 1.000 82.08028  ? 21  DC  I C6    1 
ATOM 7660  P P     . DC  I 5 95  ? 95.19300  156.33700 114.41900 1.000 79.89298  ? 22  DC  I P     1 
ATOM 7661  O OP1   . DC  I 5 95  ? 94.72700  157.70900 114.12400 1.000 79.89298  ? 22  DC  I OP1   1 
ATOM 7662  O OP2   . DC  I 5 95  ? 96.30900  156.11800 115.36500 1.000 79.89298  ? 22  DC  I OP2   1 
ATOM 7663  O "O5'" . DC  I 5 95  ? 93.95200  155.46900 114.91700 1.000 79.89298  ? 22  DC  I "O5'" 1 
ATOM 7664  C "C5'" . DC  I 5 95  ? 92.83200  155.28500 114.06800 1.000 79.89298  ? 22  DC  I "C5'" 1 
ATOM 7665  C "C4'" . DC  I 5 95  ? 91.86700  154.28300 114.67000 1.000 79.89298  ? 22  DC  I "C4'" 1 
ATOM 7666  O "O4'" . DC  I 5 95  ? 92.06800  152.95700 114.11400 1.000 79.89298  ? 22  DC  I "O4'" 1 
ATOM 7667  C "C3'" . DC  I 5 95  ? 91.95400  154.11700 116.18800 1.000 79.89298  ? 22  DC  I "C3'" 1 
ATOM 7668  O "O3'" . DC  I 5 95  ? 90.65200  154.08600 116.69300 1.000 79.89298  ? 22  DC  I "O3'" 1 
ATOM 7669  C "C2'" . DC  I 5 95  ? 92.63700  152.75800 116.34000 1.000 79.89298  ? 22  DC  I "C2'" 1 
ATOM 7670  C "C1'" . DC  I 5 95  ? 92.00100  152.03700 115.17600 1.000 79.89298  ? 22  DC  I "C1'" 1 
ATOM 7671  N N1    . DC  I 5 95  ? 92.65500  150.76700 114.76900 1.000 79.89298  ? 22  DC  I N1    1 
ATOM 7672  C C2    . DC  I 5 95  ? 91.85700  149.69900 114.36900 1.000 79.89298  ? 22  DC  I C2    1 
ATOM 7673  O O2    . DC  I 5 95  ? 90.63100  149.83100 114.41500 1.000 79.89298  ? 22  DC  I O2    1 
ATOM 7674  N N3    . DC  I 5 95  ? 92.44600  148.54600 113.98300 1.000 79.89298  ? 22  DC  I N3    1 
ATOM 7675  C C4    . DC  I 5 95  ? 93.77500  148.45500 113.96100 1.000 79.89298  ? 22  DC  I C4    1 
ATOM 7676  N N4    . DC  I 5 95  ? 94.31700  147.30000 113.56500 1.000 79.89298  ? 22  DC  I N4    1 
ATOM 7677  C C5    . DC  I 5 95  ? 94.60800  149.54500 114.34500 1.000 79.89298  ? 22  DC  I C5    1 
ATOM 7678  C C6    . DC  I 5 95  ? 94.00900  150.67200 114.73700 1.000 79.89298  ? 22  DC  I C6    1 
ATOM 7679  P P     . DA  I 5 96  ? 90.30100  154.65800 118.14800 1.000 77.87909  ? 23  DA  I P     1 
ATOM 7680  O OP1   . DA  I 5 96  ? 90.15900  156.12600 118.03600 1.000 77.87909  ? 23  DA  I OP1   1 
ATOM 7681  O OP2   . DA  I 5 96  ? 91.27100  154.09000 119.11100 1.000 77.87909  ? 23  DA  I OP2   1 
ATOM 7682  O "O5'" . DA  I 5 96  ? 88.87600  153.99000 118.43300 1.000 77.87909  ? 23  DA  I "O5'" 1 
ATOM 7683  C "C5'" . DA  I 5 96  ? 88.23000  153.25500 117.38300 1.000 77.87909  ? 23  DA  I "C5'" 1 
ATOM 7684  C "C4'" . DA  I 5 96  ? 87.63600  151.95500 117.89800 1.000 77.87909  ? 23  DA  I "C4'" 1 
ATOM 7685  O "O4'" . DA  I 5 96  ? 88.30600  150.81800 117.27200 1.000 77.87909  ? 23  DA  I "O4'" 1 
ATOM 7686  C "C3'" . DA  I 5 96  ? 87.76600  151.72700 119.40500 1.000 77.87909  ? 23  DA  I "C3'" 1 
ATOM 7687  O "O3'" . DA  I 5 96  ? 86.63600  151.00000 119.85700 1.000 77.87909  ? 23  DA  I "O3'" 1 
ATOM 7688  C "C2'" . DA  I 5 96  ? 89.02400  150.87300 119.47500 1.000 77.87909  ? 23  DA  I "C2'" 1 
ATOM 7689  C "C1'" . DA  I 5 96  ? 88.76500  149.96200 118.29400 1.000 77.87909  ? 23  DA  I "C1'" 1 
ATOM 7690  N N9    . DA  I 5 96  ? 89.93900  149.22700 117.83700 1.000 77.87909  ? 23  DA  I N9    1 
ATOM 7691  C C8    . DA  I 5 96  ? 91.24200  149.63100 117.91500 1.000 77.87909  ? 23  DA  I C8    1 
ATOM 7692  N N7    . DA  I 5 96  ? 92.09700  148.75000 117.45700 1.000 77.87909  ? 23  DA  I N7    1 
ATOM 7693  C C5    . DA  I 5 96  ? 91.30500  147.67700 117.09200 1.000 77.87909  ? 23  DA  I C5    1 
ATOM 7694  C C6    . DA  I 5 96  ? 91.61000  146.41900 116.54200 1.000 77.87909  ? 23  DA  I C6    1 
ATOM 7695  N N6    . DA  I 5 96  ? 92.85200  146.03000 116.25900 1.000 77.87909  ? 23  DA  I N6    1 
ATOM 7696  N N1    . DA  I 5 96  ? 90.58600  145.57400 116.29600 1.000 77.87909  ? 23  DA  I N1    1 
ATOM 7697  C C2    . DA  I 5 96  ? 89.33700  145.96900 116.58100 1.000 77.87909  ? 23  DA  I C2    1 
ATOM 7698  N N3    . DA  I 5 96  ? 88.92800  147.12900 117.10100 1.000 77.87909  ? 23  DA  I N3    1 
ATOM 7699  C C4    . DA  I 5 96  ? 89.97200  147.94500 117.33500 1.000 77.87909  ? 23  DA  I C4    1 
ATOM 7700  P P     . DA  I 5 97  ? 86.19500  151.02600 121.40100 1.000 74.99784  ? 24  DA  I P     1 
ATOM 7701  O OP1   . DA  I 5 97  ? 85.54600  152.33200 121.65200 1.000 74.99784  ? 24  DA  I OP1   1 
ATOM 7702  O OP2   . DA  I 5 97  ? 87.32900  150.60100 122.25000 1.000 74.99784  ? 24  DA  I OP2   1 
ATOM 7703  O "O5'" . DA  I 5 97  ? 85.09300  149.87200 121.48300 1.000 74.99784  ? 24  DA  I "O5'" 1 
ATOM 7704  C "C5'" . DA  I 5 97  ? 84.47100  149.38400 120.29300 1.000 74.99784  ? 24  DA  I "C5'" 1 
ATOM 7705  C "C4'" . DA  I 5 97  ? 84.56000  147.86800 120.22500 1.000 74.99784  ? 24  DA  I "C4'" 1 
ATOM 7706  O "O4'" . DA  I 5 97  ? 85.86000  147.45400 119.74900 1.000 74.99784  ? 24  DA  I "O4'" 1 
ATOM 7707  C "C3'" . DA  I 5 97  ? 84.33700  147.13100 121.54300 1.000 74.99784  ? 24  DA  I "C3'" 1 
ATOM 7708  O "O3'" . DA  I 5 97  ? 83.43800  146.06000 121.31900 1.000 74.99784  ? 24  DA  I "O3'" 1 
ATOM 7709  C "C2'" . DA  I 5 97  ? 85.74200  146.64300 121.90400 1.000 74.99784  ? 24  DA  I "C2'" 1 
ATOM 7710  C "C1'" . DA  I 5 97  ? 86.30600  146.37100 120.52700 1.000 74.99784  ? 24  DA  I "C1'" 1 
ATOM 7711  N N9    . DA  I 5 97  ? 87.76000  146.36500 120.44000 1.000 74.99784  ? 24  DA  I N9    1 
ATOM 7712  C C8    . DA  I 5 97  ? 88.59900  147.39300 120.75000 1.000 74.99784  ? 24  DA  I C8    1 
ATOM 7713  N N7    . DA  I 5 97  ? 89.86100  147.13200 120.53100 1.000 74.99784  ? 24  DA  I N7    1 
ATOM 7714  C C5    . DA  I 5 97  ? 89.85200  145.84000 120.04600 1.000 74.99784  ? 24  DA  I C5    1 
ATOM 7715  C C6    . DA  I 5 97  ? 90.88200  144.98000 119.62800 1.000 74.99784  ? 24  DA  I C6    1 
ATOM 7716  N N6    . DA  I 5 97  ? 92.16900  145.32500 119.64600 1.000 74.99784  ? 24  DA  I N6    1 
ATOM 7717  N N1    . DA  I 5 97  ? 90.53900  143.75000 119.19200 1.000 74.99784  ? 24  DA  I N1    1 
ATOM 7718  C C2    . DA  I 5 97  ? 89.24600  143.40700 119.17700 1.000 74.99784  ? 24  DA  I C2    1 
ATOM 7719  N N3    . DA  I 5 97  ? 88.18700  144.13300 119.54500 1.000 74.99784  ? 24  DA  I N3    1 
ATOM 7720  C C4    . DA  I 5 97  ? 88.56500  145.35100 119.97500 1.000 74.99784  ? 24  DA  I C4    1 
ATOM 7721  P P     . DG  I 5 98  ? 82.40500  145.60500 122.45700 1.000 73.26835  ? 25  DG  I P     1 
ATOM 7722  O OP1   . DG  I 5 98  ? 81.04200  145.93600 121.99000 1.000 73.26835  ? 25  DG  I OP1   1 
ATOM 7723  O OP2   . DG  I 5 98  ? 82.89700  146.13600 123.74700 1.000 73.26835  ? 25  DG  I OP2   1 
ATOM 7724  O "O5'" . DG  I 5 98  ? 82.56600  144.01800 122.49600 1.000 73.26835  ? 25  DG  I "O5'" 1 
ATOM 7725  C "C5'" . DG  I 5 98  ? 83.15400  143.32600 121.39300 1.000 73.26835  ? 25  DG  I "C5'" 1 
ATOM 7726  C "C4'" . DG  I 5 98  ? 84.01300  142.17000 121.87900 1.000 73.26835  ? 25  DG  I "C4'" 1 
ATOM 7727  O "O4'" . DG  I 5 98  ? 85.41600  142.53300 121.81400 1.000 73.26835  ? 25  DG  I "O4'" 1 
ATOM 7728  C "C3'" . DG  I 5 98  ? 83.76500  141.73900 123.32500 1.000 73.26835  ? 25  DG  I "C3'" 1 
ATOM 7729  O "O3'" . DG  I 5 98  ? 83.86000  140.33100 123.42200 1.000 73.26835  ? 25  DG  I "O3'" 1 
ATOM 7730  C "C2'" . DG  I 5 98  ? 84.91700  142.41100 124.06300 1.000 73.26835  ? 25  DG  I "C2'" 1 
ATOM 7731  C "C1'" . DG  I 5 98  ? 86.00900  142.21000 123.04200 1.000 73.26835  ? 25  DG  I "C1'" 1 
ATOM 7732  N N9    . DG  I 5 98  ? 87.18500  143.04200 123.23700 1.000 73.26835  ? 25  DG  I N9    1 
ATOM 7733  C C8    . DG  I 5 98  ? 87.25000  144.25800 123.86100 1.000 73.26835  ? 25  DG  I C8    1 
ATOM 7734  N N7    . DG  I 5 98  ? 88.45000  144.76100 123.89300 1.000 73.26835  ? 25  DG  I N7    1 
ATOM 7735  C C5    . DG  I 5 98  ? 89.23600  143.78800 123.29700 1.000 73.26835  ? 25  DG  I C5    1 
ATOM 7736  C C6    . DG  I 5 98  ? 90.62800  143.75800 123.06400 1.000 73.26835  ? 25  DG  I C6    1 
ATOM 7737  O O6    . DG  I 5 98  ? 91.47400  144.61600 123.34600 1.000 73.26835  ? 25  DG  I O6    1 
ATOM 7738  N N1    . DG  I 5 98  ? 91.01600  142.58400 122.43500 1.000 73.26835  ? 25  DG  I N1    1 
ATOM 7739  C C2    . DG  I 5 98  ? 90.16500  141.56700 122.07600 1.000 73.26835  ? 25  DG  I C2    1 
ATOM 7740  N N2    . DG  I 5 98  ? 90.71800  140.50900 121.47300 1.000 73.26835  ? 25  DG  I N2    1 
ATOM 7741  N N3    . DG  I 5 98  ? 88.86200  141.58600 122.28900 1.000 73.26835  ? 25  DG  I N3    1 
ATOM 7742  C C4    . DG  I 5 98  ? 88.47000  142.72200 122.90000 1.000 73.26835  ? 25  DG  I C4    1 
ATOM 7743  P P     . DG  I 5 99  ? 82.54300  139.42200 123.53200 1.000 70.37578  ? 26  DG  I P     1 
ATOM 7744  O OP1   . DG  I 5 99  ? 81.47600  140.05700 122.73100 1.000 70.37578  ? 26  DG  I OP1   1 
ATOM 7745  O OP2   . DG  I 5 99  ? 82.31500  139.15700 124.96700 1.000 70.37578  ? 26  DG  I OP2   1 
ATOM 7746  O "O5'" . DG  I 5 99  ? 82.97000  138.03500 122.85300 1.000 70.37578  ? 26  DG  I "O5'" 1 
ATOM 7747  C "C5'" . DG  I 5 99  ? 83.62600  138.00600 121.57600 1.000 70.37578  ? 26  DG  I "C5'" 1 
ATOM 7748  C "C4'" . DG  I 5 99  ? 84.86300  137.10400 121.59900 1.000 70.37578  ? 26  DG  I "C4'" 1 
ATOM 7749  O "O4'" . DG  I 5 99  ? 86.03600  137.82000 122.04500 1.000 70.37578  ? 26  DG  I "O4'" 1 
ATOM 7750  C "C3'" . DG  I 5 99  ? 84.77700  135.85800 122.46000 1.000 70.37578  ? 26  DG  I "C3'" 1 
ATOM 7751  O "O3'" . DG  I 5 99  ? 85.40400  134.79700 121.75100 1.000 70.37578  ? 26  DG  I "O3'" 1 
ATOM 7752  C "C2'" . DG  I 5 99  ? 85.54600  136.27300 123.72300 1.000 70.37578  ? 26  DG  I "C2'" 1 
ATOM 7753  C "C1'" . DG  I 5 99  ? 86.63900  137.14300 123.13300 1.000 70.37578  ? 26  DG  I "C1'" 1 
ATOM 7754  N N9    . DG  I 5 99  ? 87.13800  138.20900 123.99100 1.000 70.37578  ? 26  DG  I N9    1 
ATOM 7755  C C8    . DG  I 5 99  ? 86.38400  139.10900 124.69200 1.000 70.37578  ? 26  DG  I C8    1 
ATOM 7756  N N7    . DG  I 5 99  ? 87.08600  140.00700 125.31500 1.000 70.37578  ? 26  DG  I N7    1 
ATOM 7757  C C5    . DG  I 5 99  ? 88.39300  139.69100 125.00300 1.000 70.37578  ? 26  DG  I C5    1 
ATOM 7758  C C6    . DG  I 5 99  ? 89.58900  140.31200 125.40200 1.000 70.37578  ? 26  DG  I C6    1 
ATOM 7759  O O6    . DG  I 5 99  ? 89.73300  141.30100 126.12700 1.000 70.37578  ? 26  DG  I O6    1 
ATOM 7760  N N1    . DG  I 5 99  ? 90.70100  139.67800 124.87100 1.000 70.37578  ? 26  DG  I N1    1 
ATOM 7761  C C2    . DG  I 5 99  ? 90.66500  138.57900 124.05500 1.000 70.37578  ? 26  DG  I C2    1 
ATOM 7762  N N2    . DG  I 5 99  ? 91.85200  138.10800 123.64700 1.000 70.37578  ? 26  DG  I N2    1 
ATOM 7763  N N3    . DG  I 5 99  ? 89.54500  137.98200 123.66700 1.000 70.37578  ? 26  DG  I N3    1 
ATOM 7764  C C4    . DG  I 5 99  ? 88.44900  138.59200 124.17900 1.000 70.37578  ? 26  DG  I C4    1 
ATOM 7765  P P     . DG  I 5 100 ? 85.27400  133.27400 122.23200 1.000 66.55133  ? 27  DG  I P     1 
ATOM 7766  O OP1   . DG  I 5 100 ? 85.18000  132.44800 121.01100 1.000 66.55133  ? 27  DG  I OP1   1 
ATOM 7767  O OP2   . DG  I 5 100 ? 84.22600  133.19700 123.27100 1.000 66.55133  ? 27  DG  I OP2   1 
ATOM 7768  O "O5'" . DG  I 5 100 ? 86.68400  132.98200 122.91100 1.000 66.55133  ? 27  DG  I "O5'" 1 
ATOM 7769  C "C5'" . DG  I 5 100 ? 87.87100  133.23100 122.17900 1.000 66.55133  ? 27  DG  I "C5'" 1 
ATOM 7770  C "C4'" . DG  I 5 100 ? 89.06900  133.33100 123.10000 1.000 66.55133  ? 27  DG  I "C4'" 1 
ATOM 7771  O "O4'" . DG  I 5 100 ? 89.00500  134.53800 123.89000 1.000 66.55133  ? 27  DG  I "O4'" 1 
ATOM 7772  C "C3'" . DG  I 5 100 ? 89.22700  132.18700 124.09200 1.000 66.55133  ? 27  DG  I "C3'" 1 
ATOM 7773  O "O3'" . DG  I 5 100 ? 90.58500  131.81300 124.10400 1.000 66.55133  ? 27  DG  I "O3'" 1 
ATOM 7774  C "C2'" . DG  I 5 100 ? 88.79900  132.83200 125.41900 1.000 66.55133  ? 27  DG  I "C2'" 1 
ATOM 7775  C "C1'" . DG  I 5 100 ? 89.35300  134.22200 125.21100 1.000 66.55133  ? 27  DG  I "C1'" 1 
ATOM 7776  N N9    . DG  I 5 100 ? 88.81100  135.27200 126.07000 1.000 66.55133  ? 27  DG  I N9    1 
ATOM 7777  C C8    . DG  I 5 100 ? 87.50400  135.47100 126.43100 1.000 66.55133  ? 27  DG  I C8    1 
ATOM 7778  N N7    . DG  I 5 100 ? 87.32600  136.52900 127.17300 1.000 66.55133  ? 27  DG  I N7    1 
ATOM 7779  C C5    . DG  I 5 100 ? 88.60000  137.05600 127.31900 1.000 66.55133  ? 27  DG  I C5    1 
ATOM 7780  C C6    . DG  I 5 100 ? 89.04300  138.19700 128.02500 1.000 66.55133  ? 27  DG  I C6    1 
ATOM 7781  O O6    . DG  I 5 100 ? 88.37700  139.00200 128.68800 1.000 66.55133  ? 27  DG  I O6    1 
ATOM 7782  N N1    . DG  I 5 100 ? 90.41800  138.36700 127.91400 1.000 66.55133  ? 27  DG  I N1    1 
ATOM 7783  C C2    . DG  I 5 100 ? 91.25500  137.54300 127.20800 1.000 66.55133  ? 27  DG  I C2    1 
ATOM 7784  N N2    . DG  I 5 100 ? 92.55100  137.86200 127.21100 1.000 66.55133  ? 27  DG  I N2    1 
ATOM 7785  N N3    . DG  I 5 100 ? 90.85200  136.47900 126.54300 1.000 66.55133  ? 27  DG  I N3    1 
ATOM 7786  C C4    . DG  I 5 100 ? 89.52000  136.29500 126.64300 1.000 66.55133  ? 27  DG  I C4    1 
ATOM 7787  P P     . DG  I 5 101 ? 91.01200  130.27600 124.21400 1.000 63.19150  ? 28  DG  I P     1 
ATOM 7788  O OP1   . DG  I 5 101 ? 90.82100  129.68000 122.88000 1.000 63.19150  ? 28  DG  I OP1   1 
ATOM 7789  O OP2   . DG  I 5 101 ? 90.33600  129.69200 125.38900 1.000 63.19150  ? 28  DG  I OP2   1 
ATOM 7790  O "O5'" . DG  I 5 101 ? 92.57800  130.34300 124.51400 1.000 63.19150  ? 28  DG  I "O5'" 1 
ATOM 7791  C "C5'" . DG  I 5 101 ? 93.44500  131.11500 123.68300 1.000 63.19150  ? 28  DG  I "C5'" 1 
ATOM 7792  C "C4'" . DG  I 5 101 ? 94.50700  131.83000 124.51100 1.000 63.19150  ? 28  DG  I "C4'" 1 
ATOM 7793  O "O4'" . DG  I 5 101 ? 93.92200  132.89100 125.29800 1.000 63.19150  ? 28  DG  I "O4'" 1 
ATOM 7794  C "C3'" . DG  I 5 101 ? 95.29200  130.96200 125.47800 1.000 63.19150  ? 28  DG  I "C3'" 1 
ATOM 7795  O "O3'" . DG  I 5 101 ? 96.65100  131.35300 125.43500 1.000 63.19150  ? 28  DG  I "O3'" 1 
ATOM 7796  C "C2'" . DG  I 5 101 ? 94.63800  131.27300 126.83000 1.000 63.19150  ? 28  DG  I "C2'" 1 
ATOM 7797  C "C1'" . DG  I 5 101 ? 94.26300  132.73500 126.66200 1.000 63.19150  ? 28  DG  I "C1'" 1 
ATOM 7798  N N9    . DG  I 5 101 ? 93.08900  133.17900 127.40500 1.000 63.19150  ? 28  DG  I N9    1 
ATOM 7799  C C8    . DG  I 5 101 ? 91.82000  132.68200 127.29000 1.000 63.19150  ? 28  DG  I C8    1 
ATOM 7800  N N7    . DG  I 5 101 ? 90.94700  133.30100 128.02700 1.000 63.19150  ? 28  DG  I N7    1 
ATOM 7801  C C5    . DG  I 5 101 ? 91.67900  134.27900 128.67400 1.000 63.19150  ? 28  DG  I C5    1 
ATOM 7802  C C6    . DG  I 5 101 ? 91.26000  135.25600 129.60300 1.000 63.19150  ? 28  DG  I C6    1 
ATOM 7803  O O6    . DG  I 5 101 ? 90.12300  135.44900 130.05400 1.000 63.19150  ? 28  DG  I O6    1 
ATOM 7804  N N1    . DG  I 5 101 ? 92.31500  136.05400 130.02100 1.000 63.19150  ? 28  DG  I N1    1 
ATOM 7805  C C2    . DG  I 5 101 ? 93.61300  135.92700 129.59200 1.000 63.19150  ? 28  DG  I C2    1 
ATOM 7806  N N2    . DG  I 5 101 ? 94.49800  136.79200 130.11200 1.000 63.19150  ? 28  DG  I N2    1 
ATOM 7807  N N3    . DG  I 5 101 ? 94.02000  135.01700 128.71300 1.000 63.19150  ? 28  DG  I N3    1 
ATOM 7808  C C4    . DG  I 5 101 ? 93.00000  134.22900 128.29700 1.000 63.19150  ? 28  DG  I C4    1 
ATOM 7809  P P     . DA  I 5 102 ? 97.79300  130.43000 126.07600 1.000 68.72704  ? 29  DA  I P     1 
ATOM 7810  O OP1   . DA  I 5 102 ? 99.03200  130.65800 125.30800 1.000 68.72704  ? 29  DA  I OP1   1 
ATOM 7811  O OP2   . DA  I 5 102 ? 97.25100  129.06200 126.20400 1.000 68.72704  ? 29  DA  I OP2   1 
ATOM 7812  O "O5'" . DA  I 5 102 ? 97.98200  131.03100 127.54300 1.000 68.72704  ? 29  DA  I "O5'" 1 
ATOM 7813  C "C5'" . DA  I 5 102 ? 98.20500  132.42600 127.72100 1.000 68.72704  ? 29  DA  I "C5'" 1 
ATOM 7814  C "C4'" . DA  I 5 102 ? 98.19000  132.79300 129.19600 1.000 68.72704  ? 29  DA  I "C4'" 1 
ATOM 7815  O "O4'" . DA  I 5 102 ? 96.85100  133.18100 129.60900 1.000 68.72704  ? 29  DA  I "O4'" 1 
ATOM 7816  C "C3'" . DA  I 5 102 ? 98.61400  131.67500 130.14800 1.000 68.72704  ? 29  DA  I "C3'" 1 
ATOM 7817  O "O3'" . DA  I 5 102 ? 99.44700  132.21200 131.14700 1.000 68.72704  ? 29  DA  I "O3'" 1 
ATOM 7818  C "C2'" . DA  I 5 102 ? 97.28100  131.20900 130.72700 1.000 68.72704  ? 29  DA  I "C2'" 1 
ATOM 7819  C "C1'" . DA  I 5 102 ? 96.54400  132.52400 130.81500 1.000 68.72704  ? 29  DA  I "C1'" 1 
ATOM 7820  N N9    . DA  I 5 102 ? 95.09800  132.37800 130.90300 1.000 68.72704  ? 29  DA  I N9    1 
ATOM 7821  C C8    . DA  I 5 102 ? 94.33200  131.45500 130.26000 1.000 68.72704  ? 29  DA  I C8    1 
ATOM 7822  N N7    . DA  I 5 102 ? 93.05600  131.54700 130.52400 1.000 68.72704  ? 29  DA  I N7    1 
ATOM 7823  C C5    . DA  I 5 102 ? 92.97900  132.59600 131.41500 1.000 68.72704  ? 29  DA  I C5    1 
ATOM 7824  C C6    . DA  I 5 102 ? 91.89600  133.18900 132.08000 1.000 68.72704  ? 29  DA  I C6    1 
ATOM 7825  N N6    . DA  I 5 102 ? 90.63500  132.78400 131.92400 1.000 68.72704  ? 29  DA  I N6    1 
ATOM 7826  N N1    . DA  I 5 102 ? 92.15500  134.22500 132.90100 1.000 68.72704  ? 29  DA  I N1    1 
ATOM 7827  C C2    . DA  I 5 102 ? 93.42000  134.63000 133.05200 1.000 68.72704  ? 29  DA  I C2    1 
ATOM 7828  N N3    . DA  I 5 102 ? 94.52300  134.14700 132.47900 1.000 68.72704  ? 29  DA  I N3    1 
ATOM 7829  C C4    . DA  I 5 102 ? 94.22900  133.12000 131.66700 1.000 68.72704  ? 29  DA  I C4    1 
ATOM 7830  P P     . DT  I 5 103 ? 100.48200 131.28300 131.94600 1.000 73.12149  ? 30  DT  I P     1 
ATOM 7831  O OP1   . DT  I 5 103 ? 101.82300 131.56300 131.39500 1.000 73.12149  ? 30  DT  I OP1   1 
ATOM 7832  O OP2   . DT  I 5 103 ? 99.98700  129.89100 131.97600 1.000 73.12149  ? 30  DT  I OP2   1 
ATOM 7833  O "O5'" . DT  I 5 103 ? 100.40700 131.86500 133.42700 1.000 73.12149  ? 30  DT  I "O5'" 1 
ATOM 7834  C "C5'" . DT  I 5 103 ? 100.18000 133.25200 133.62100 1.000 73.12149  ? 30  DT  I "C5'" 1 
ATOM 7835  C "C4'" . DT  I 5 103 ? 99.32300  133.49000 134.84600 1.000 73.12149  ? 30  DT  I "C4'" 1 
ATOM 7836  O "O4'" . DT  I 5 103 ? 97.93300  133.32000 134.51300 1.000 73.12149  ? 30  DT  I "O4'" 1 
ATOM 7837  C "C3'" . DT  I 5 103 ? 99.59000  132.54500 136.02000 1.000 73.12149  ? 30  DT  I "C3'" 1 
ATOM 7838  O "O3'" . DT  I 5 103 ? 100.18500 133.26100 137.09500 1.000 73.12149  ? 30  DT  I "O3'" 1 
ATOM 7839  C "C2'" . DT  I 5 103 ? 98.20200  132.00300 136.39400 1.000 73.12149  ? 30  DT  I "C2'" 1 
ATOM 7840  C "C1'" . DT  I 5 103 ? 97.25900  132.95400 135.68000 1.000 73.12149  ? 30  DT  I "C1'" 1 
ATOM 7841  N N1    . DT  I 5 103 ? 95.97900  132.32100 135.30100 1.000 73.12149  ? 30  DT  I N1    1 
ATOM 7842  C C2    . DT  I 5 103 ? 94.80800  132.79300 135.83700 1.000 73.12149  ? 30  DT  I C2    1 
ATOM 7843  O O2    . DT  I 5 103 ? 94.76000  133.71000 136.63000 1.000 73.12149  ? 30  DT  I O2    1 
ATOM 7844  N N3    . DT  I 5 103 ? 93.68600  132.13200 135.42100 1.000 73.12149  ? 30  DT  I N3    1 
ATOM 7845  C C4    . DT  I 5 103 ? 93.62500  131.07900 134.53100 1.000 73.12149  ? 30  DT  I C4    1 
ATOM 7846  O O4    . DT  I 5 103 ? 92.57400  130.54900 134.21300 1.000 73.12149  ? 30  DT  I O4    1 
ATOM 7847  C C5    . DT  I 5 103 ? 94.88300  130.64200 134.00600 1.000 73.12149  ? 30  DT  I C5    1 
ATOM 7848  C C7    . DT  I 5 103 ? 94.93200  129.50000 133.04100 1.000 73.12149  ? 30  DT  I C7    1 
ATOM 7849  C C6    . DT  I 5 103 ? 95.98700  131.28300 134.40100 1.000 73.12149  ? 30  DT  I C6    1 
ATOM 7850  P P     . DT  I 5 104 ? 100.62600 132.49800 138.43900 1.000 76.83681  ? 31  DT  I P     1 
ATOM 7851  O OP1   . DT  I 5 104 ? 101.76200 133.25000 139.01300 1.000 76.83681  ? 31  DT  I OP1   1 
ATOM 7852  O OP2   . DT  I 5 104 ? 100.78400 131.05600 138.14700 1.000 76.83681  ? 31  DT  I OP2   1 
ATOM 7853  O "O5'" . DT  I 5 104 ? 99.37600  132.68900 139.41400 1.000 76.83681  ? 31  DT  I "O5'" 1 
ATOM 7854  C "C5'" . DT  I 5 104 ? 98.78300  133.97200 139.55400 1.000 76.83681  ? 31  DT  I "C5'" 1 
ATOM 7855  C "C4'" . DT  I 5 104 ? 97.53600  133.90600 140.41900 1.000 76.83681  ? 31  DT  I "C4'" 1 
ATOM 7856  O "O4'" . DT  I 5 104 ? 96.42900  133.33900 139.67600 1.000 76.83681  ? 31  DT  I "O4'" 1 
ATOM 7857  C "C3'" . DT  I 5 104 ? 97.67300  133.06000 141.68200 1.000 76.83681  ? 31  DT  I "C3'" 1 
ATOM 7858  O "O3'" . DT  I 5 104 ? 97.14100  133.77200 142.77600 1.000 76.83681  ? 31  DT  I "O3'" 1 
ATOM 7859  C "C2'" . DT  I 5 104 ? 96.84800  131.81300 141.36000 1.000 76.83681  ? 31  DT  I "C2'" 1 
ATOM 7860  C "C1'" . DT  I 5 104 ? 95.76100  132.41000 140.49400 1.000 76.83681  ? 31  DT  I "C1'" 1 
ATOM 7861  N N1    . DT  I 5 104 ? 95.07500  131.43500 139.60600 1.000 76.83681  ? 31  DT  I N1    1 
ATOM 7862  C C2    . DT  I 5 104 ? 93.70300  131.35800 139.62000 1.000 76.83681  ? 31  DT  I C2    1 
ATOM 7863  O O2    . DT  I 5 104 ? 93.00500  132.02800 140.35500 1.000 76.83681  ? 31  DT  I O2    1 
ATOM 7864  N N3    . DT  I 5 104 ? 93.17400  130.44600 138.74900 1.000 76.83681  ? 31  DT  I N3    1 
ATOM 7865  C C4    . DT  I 5 104 ? 93.86800  129.63600 137.87300 1.000 76.83681  ? 31  DT  I C4    1 
ATOM 7866  O O4    . DT  I 5 104 ? 93.30700  128.84400 137.12600 1.000 76.83681  ? 31  DT  I O4    1 
ATOM 7867  C C5    . DT  I 5 104 ? 95.30000  129.77500 137.90400 1.000 76.83681  ? 31  DT  I C5    1 
ATOM 7868  C C7    . DT  I 5 104 ? 96.15600  128.93400 137.00700 1.000 76.83681  ? 31  DT  I C7    1 
ATOM 7869  C C6    . DT  I 5 104 ? 95.82700  130.66000 138.75400 1.000 76.83681  ? 31  DT  I C6    1 
ATOM 7870  P P     . DA  I 5 105 ? 97.57600  133.39800 144.27100 1.000 78.18127  ? 32  DA  I P     1 
ATOM 7871  O OP1   . DA  I 5 105 ? 97.88200  134.66000 144.97800 1.000 78.18127  ? 32  DA  I OP1   1 
ATOM 7872  O OP2   . DA  I 5 105 ? 98.59500  132.32800 144.19500 1.000 78.18127  ? 32  DA  I OP2   1 
ATOM 7873  O "O5'" . DA  I 5 105 ? 96.24400  132.77600 144.88300 1.000 78.18127  ? 32  DA  I "O5'" 1 
ATOM 7874  C "C5'" . DA  I 5 105 ? 95.02100  133.49300 144.77900 1.000 78.18127  ? 32  DA  I "C5'" 1 
ATOM 7875  C "C4'" . DA  I 5 105 ? 93.85400  132.62800 145.21600 1.000 78.18127  ? 32  DA  I "C4'" 1 
ATOM 7876  O "O4'" . DA  I 5 105 ? 93.37000  131.85600 144.08900 1.000 78.18127  ? 32  DA  I "O4'" 1 
ATOM 7877  C "C3'" . DA  I 5 105 ? 94.17200  131.63100 146.32700 1.000 78.18127  ? 32  DA  I "C3'" 1 
ATOM 7878  O "O3'" . DA  I 5 105 ? 93.14400  131.68000 147.31300 1.000 78.18127  ? 32  DA  I "O3'" 1 
ATOM 7879  C "C2'" . DA  I 5 105 ? 94.21600  130.28700 145.59000 1.000 78.18127  ? 32  DA  I "C2'" 1 
ATOM 7880  C "C1'" . DA  I 5 105 ? 93.22800  130.50900 144.46200 1.000 78.18127  ? 32  DA  I "C1'" 1 
ATOM 7881  N N9    . DA  I 5 105 ? 93.51000  129.69700 143.28500 1.000 78.18127  ? 32  DA  I N9    1 
ATOM 7882  C C8    . DA  I 5 105 ? 94.73700  129.41900 142.76200 1.000 78.18127  ? 32  DA  I C8    1 
ATOM 7883  N N7    . DA  I 5 105 ? 94.70100  128.67100 141.68900 1.000 78.18127  ? 32  DA  I N7    1 
ATOM 7884  C C5    . DA  I 5 105 ? 93.35600  128.42600 141.50300 1.000 78.18127  ? 32  DA  I C5    1 
ATOM 7885  C C6    . DA  I 5 105 ? 92.65400  127.68600 140.53700 1.000 78.18127  ? 32  DA  I C6    1 
ATOM 7886  N N6    . DA  I 5 105 ? 93.25200  127.03000 139.54000 1.000 78.18127  ? 32  DA  I N6    1 
ATOM 7887  N N1    . DA  I 5 105 ? 91.31200  127.64100 140.63600 1.000 78.18127  ? 32  DA  I N1    1 
ATOM 7888  C C2    . DA  I 5 105 ? 90.71300  128.29300 141.63800 1.000 78.18127  ? 32  DA  I C2    1 
ATOM 7889  N N3    . DA  I 5 105 ? 91.26800  129.02300 142.60600 1.000 78.18127  ? 32  DA  I N3    1 
ATOM 7890  C C4    . DA  I 5 105 ? 92.60400  129.05000 142.47800 1.000 78.18127  ? 32  DA  I C4    1 
ATOM 7891  P P     . DC  I 5 106 ? 93.27700  130.88600 148.70500 1.000 77.52555  ? 33  DC  I P     1 
ATOM 7892  O OP1   . DC  I 5 106 ? 92.91600  131.84700 149.76800 1.000 77.52555  ? 33  DC  I OP1   1 
ATOM 7893  O OP2   . DC  I 5 106 ? 94.58600  130.20000 148.78700 1.000 77.52555  ? 33  DC  I OP2   1 
ATOM 7894  O "O5'" . DC  I 5 106 ? 92.10700  129.80300 148.62500 1.000 77.52555  ? 33  DC  I "O5'" 1 
ATOM 7895  C "C5'" . DC  I 5 106 ? 90.77500  130.24400 148.39300 1.000 77.52555  ? 33  DC  I "C5'" 1 
ATOM 7896  C "C4'" . DC  I 5 106 ? 89.89600  129.11700 147.88300 1.000 77.52555  ? 33  DC  I "C4'" 1 
ATOM 7897  O "O4'" . DC  I 5 106 ? 90.38100  128.63200 146.61300 1.000 77.52555  ? 33  DC  I "O4'" 1 
ATOM 7898  C "C3'" . DC  I 5 106 ? 89.79100  127.89800 148.79700 1.000 77.52555  ? 33  DC  I "C3'" 1 
ATOM 7899  O "O3'" . DC  I 5 106 ? 88.42400  127.65300 149.06800 1.000 77.52555  ? 33  DC  I "O3'" 1 
ATOM 7900  C "C2'" . DC  I 5 106 ? 90.43400  126.76600 147.97600 1.000 77.52555  ? 33  DC  I "C2'" 1 
ATOM 7901  C "C1'" . DC  I 5 106 ? 90.18700  127.24400 146.55900 1.000 77.52555  ? 33  DC  I "C1'" 1 
ATOM 7902  N N1    . DC  I 5 106 ? 91.13300  126.72100 145.54400 1.000 77.52555  ? 33  DC  I N1    1 
ATOM 7903  C C2    . DC  I 5 106 ? 90.64900  126.03000 144.42800 1.000 77.52555  ? 33  DC  I C2    1 
ATOM 7904  O O2    . DC  I 5 106 ? 89.43700  125.80300 144.33700 1.000 77.52555  ? 33  DC  I O2    1 
ATOM 7905  N N3    . DC  I 5 106 ? 91.53000  125.59800 143.49400 1.000 77.52555  ? 33  DC  I N3    1 
ATOM 7906  C C4    . DC  I 5 106 ? 92.82800  125.86000 143.63400 1.000 77.52555  ? 33  DC  I C4    1 
ATOM 7907  N N4    . DC  I 5 106 ? 93.66200  125.42300 142.68900 1.000 77.52555  ? 33  DC  I N4    1 
ATOM 7908  C C5    . DC  I 5 106 ? 93.33300  126.58500 144.74900 1.000 77.52555  ? 33  DC  I C5    1 
ATOM 7909  C C6    . DC  I 5 106 ? 92.45800  127.00000 145.66300 1.000 77.52555  ? 33  DC  I C6    1 
ATOM 7910  P P     . DT  I 5 107 ? 87.98400  126.67100 150.25600 1.000 75.82396  ? 34  DT  I P     1 
ATOM 7911  O OP1   . DT  I 5 107 ? 86.71700  127.18200 150.81900 1.000 75.82396  ? 34  DT  I OP1   1 
ATOM 7912  O OP2   . DT  I 5 107 ? 89.15300  126.46000 151.13700 1.000 75.82396  ? 34  DT  I OP2   1 
ATOM 7913  O "O5'" . DT  I 5 107 ? 87.69100  125.30400 149.49900 1.000 75.82396  ? 34  DT  I "O5'" 1 
ATOM 7914  C "C5'" . DT  I 5 107 ? 87.01200  125.31800 148.24700 1.000 75.82396  ? 34  DT  I "C5'" 1 
ATOM 7915  C "C4'" . DT  I 5 107 ? 87.06000  123.94800 147.60600 1.000 75.82396  ? 34  DT  I "C4'" 1 
ATOM 7916  O "O4'" . DT  I 5 107 ? 88.25100  123.84000 146.78200 1.000 75.82396  ? 34  DT  I "O4'" 1 
ATOM 7917  C "C3'" . DT  I 5 107 ? 87.13200  122.79700 148.60400 1.000 75.82396  ? 34  DT  I "C3'" 1 
ATOM 7918  O "O3'" . DT  I 5 107 ? 86.23300  121.77100 148.24600 1.000 75.82396  ? 34  DT  I "O3'" 1 
ATOM 7919  C "C2'" . DT  I 5 107 ? 88.57600  122.33000 148.50600 1.000 75.82396  ? 34  DT  I "C2'" 1 
ATOM 7920  C "C1'" . DT  I 5 107 ? 88.89700  122.62400 147.05600 1.000 75.82396  ? 34  DT  I "C1'" 1 
ATOM 7921  N N1    . DT  I 5 107 ? 90.35500  122.77200 146.79800 1.000 75.82396  ? 34  DT  I N1    1 
ATOM 7922  C C2    . DT  I 5 107 ? 90.86500  122.38400 145.58500 1.000 75.82396  ? 34  DT  I C2    1 
ATOM 7923  O O2    . DT  I 5 107 ? 90.17600  121.96500 144.67600 1.000 75.82396  ? 34  DT  I O2    1 
ATOM 7924  N N3    . DT  I 5 107 ? 92.21500  122.54700 145.45400 1.000 75.82396  ? 34  DT  I N3    1 
ATOM 7925  C C4    . DT  I 5 107 ? 93.09400  123.01800 146.40600 1.000 75.82396  ? 34  DT  I C4    1 
ATOM 7926  O O4    . DT  I 5 107 ? 94.29500  123.12200 146.19700 1.000 75.82396  ? 34  DT  I O4    1 
ATOM 7927  C C5    . DT  I 5 107 ? 92.50000  123.38100 147.66500 1.000 75.82396  ? 34  DT  I C5    1 
ATOM 7928  C C7    . DT  I 5 107 ? 93.35700  123.90500 148.77800 1.000 75.82396  ? 34  DT  I C7    1 
ATOM 7929  C C6    . DT  I 5 107 ? 91.17600  123.23200 147.80300 1.000 75.82396  ? 34  DT  I C6    1 
ATOM 7930  P P     . DC  I 5 108 ? 85.40500  121.01700 149.39200 1.000 73.15979  ? 35  DC  I P     1 
ATOM 7931  O OP1   . DC  I 5 108 ? 84.29600  121.91300 149.78300 1.000 73.15979  ? 35  DC  I OP1   1 
ATOM 7932  O OP2   . DC  I 5 108 ? 86.36900  120.53900 150.40600 1.000 73.15979  ? 35  DC  I OP2   1 
ATOM 7933  O "O5'" . DC  I 5 108 ? 84.79500  119.73600 148.66500 1.000 73.15979  ? 35  DC  I "O5'" 1 
ATOM 7934  C "C5'" . DC  I 5 108 ? 84.21900  119.84800 147.37600 1.000 73.15979  ? 35  DC  I "C5'" 1 
ATOM 7935  C "C4'" . DC  I 5 108 ? 84.93700  118.95900 146.37300 1.000 73.15979  ? 35  DC  I "C4'" 1 
ATOM 7936  O "O4'" . DC  I 5 108 ? 86.35200  119.25000 146.30400 1.000 73.15979  ? 35  DC  I "O4'" 1 
ATOM 7937  C "C3'" . DC  I 5 108 ? 84.82800  117.46300 146.62800 1.000 73.15979  ? 35  DC  I "C3'" 1 
ATOM 7938  O "O3'" . DC  I 5 108 ? 84.51500  116.84400 145.40400 1.000 73.15979  ? 35  DC  I "O3'" 1 
ATOM 7939  C "C2'" . DC  I 5 108 ? 86.24100  117.10900 147.11300 1.000 73.15979  ? 35  DC  I "C2'" 1 
ATOM 7940  C "C1'" . DC  I 5 108 ? 87.05600  118.03200 146.24100 1.000 73.15979  ? 35  DC  I "C1'" 1 
ATOM 7941  N N1    . DC  I 5 108 ? 88.44500  118.32300 146.68300 1.000 73.15979  ? 35  DC  I N1    1 
ATOM 7942  C C2    . DC  I 5 108 ? 89.49400  118.27800 145.75300 1.000 73.15979  ? 35  DC  I C2    1 
ATOM 7943  O O2    . DC  I 5 108 ? 89.27300  117.88900 144.60200 1.000 73.15979  ? 35  DC  I O2    1 
ATOM 7944  N N3    . DC  I 5 108 ? 90.74100  118.61700 146.15500 1.000 73.15979  ? 35  DC  I N3    1 
ATOM 7945  C C4    . DC  I 5 108 ? 90.95200  119.02400 147.40000 1.000 73.15979  ? 35  DC  I C4    1 
ATOM 7946  N N4    . DC  I 5 108 ? 92.19700  119.34800 147.74500 1.000 73.15979  ? 35  DC  I N4    1 
ATOM 7947  C C5    . DC  I 5 108 ? 89.90100  119.10100 148.35100 1.000 73.15979  ? 35  DC  I C5    1 
ATOM 7948  C C6    . DC  I 5 108 ? 88.67000  118.77000 147.94700 1.000 73.15979  ? 35  DC  I C6    1 
ATOM 7949  P P     . DC  I 5 109 ? 83.59800  115.53200 145.33700 1.000 72.16145  ? 36  DC  I P     1 
ATOM 7950  O OP1   . DC  I 5 109 ? 82.18700  115.96300 145.22200 1.000 72.16145  ? 36  DC  I OP1   1 
ATOM 7951  O OP2   . DC  I 5 109 ? 84.01500  114.64000 146.44100 1.000 72.16145  ? 36  DC  I OP2   1 
ATOM 7952  O "O5'" . DC  I 5 109 ? 84.03400  114.87700 143.94800 1.000 72.16145  ? 36  DC  I "O5'" 1 
ATOM 7953  C "C5'" . DC  I 5 109 ? 85.15700  115.42000 143.24700 1.000 72.16145  ? 36  DC  I "C5'" 1 
ATOM 7954  C "C4'" . DC  I 5 109 ? 86.21800  114.36200 142.99700 1.000 72.16145  ? 36  DC  I "C4'" 1 
ATOM 7955  O "O4'" . DC  I 5 109 ? 87.39600  114.65000 143.80600 1.000 72.16145  ? 36  DC  I "O4'" 1 
ATOM 7956  C "C3'" . DC  I 5 109 ? 85.81600  112.93500 143.36100 1.000 72.16145  ? 36  DC  I "C3'" 1 
ATOM 7957  O "O3'" . DC  I 5 109 ? 86.49400  112.03900 142.50100 1.000 72.16145  ? 36  DC  I "O3'" 1 
ATOM 7958  C "C2'" . DC  I 5 109 ? 86.36000  112.82500 144.77800 1.000 72.16145  ? 36  DC  I "C2'" 1 
ATOM 7959  C "C1'" . DC  I 5 109 ? 87.69600  113.50700 144.57200 1.000 72.16145  ? 36  DC  I "C1'" 1 
ATOM 7960  N N1    . DC  I 5 109 ? 88.37400  113.93500 145.82000 1.000 72.16145  ? 36  DC  I N1    1 
ATOM 7961  C C2    . DC  I 5 109 ? 89.68500  114.40300 145.76000 1.000 72.16145  ? 36  DC  I C2    1 
ATOM 7962  O O2    . DC  I 5 109 ? 90.27900  114.39300 144.68300 1.000 72.16145  ? 36  DC  I O2    1 
ATOM 7963  N N3    . DC  I 5 109 ? 90.28700  114.81600 146.89700 1.000 72.16145  ? 36  DC  I N3    1 
ATOM 7964  C C4    . DC  I 5 109 ? 89.62300  114.80300 148.04600 1.000 72.16145  ? 36  DC  I C4    1 
ATOM 7965  N N4    . DC  I 5 109 ? 90.26200  115.23000 149.14000 1.000 72.16145  ? 36  DC  I N4    1 
ATOM 7966  C C5    . DC  I 5 109 ? 88.27500  114.34900 148.12700 1.000 72.16145  ? 36  DC  I C5    1 
ATOM 7967  C C6    . DC  I 5 109 ? 87.69600  113.92700 146.99900 1.000 72.16145  ? 36  DC  I C6    1 
ATOM 7968  P P     . DC  I 5 110 ? 85.78600  111.45400 141.18400 1.000 66.27150  ? 37  DC  I P     1 
ATOM 7969  O OP1   . DC  I 5 110 ? 85.00700  112.52500 140.53000 1.000 66.27150  ? 37  DC  I OP1   1 
ATOM 7970  O OP2   . DC  I 5 110 ? 85.13300  110.18600 141.56900 1.000 66.27150  ? 37  DC  I OP2   1 
ATOM 7971  O "O5'" . DC  I 5 110 ? 87.01900  111.08100 140.24200 1.000 66.27150  ? 37  DC  I "O5'" 1 
ATOM 7972  C "C5'" . DC  I 5 110 ? 88.01900  112.05800 139.95100 1.000 66.27150  ? 37  DC  I "C5'" 1 
ATOM 7973  C "C4'" . DC  I 5 110 ? 89.41200  111.51500 140.23700 1.000 66.27150  ? 37  DC  I "C4'" 1 
ATOM 7974  O "O4'" . DC  I 5 110 ? 89.79200  111.73100 141.61800 1.000 66.27150  ? 37  DC  I "O4'" 1 
ATOM 7975  C "C3'" . DC  I 5 110 ? 89.60000  110.03200 139.98400 1.000 66.27150  ? 37  DC  I "C3'" 1 
ATOM 7976  O "O3'" . DC  I 5 110 ? 90.83000  109.84600 139.35800 1.000 66.27150  ? 37  DC  I "O3'" 1 
ATOM 7977  C "C2'" . DC  I 5 110 ? 89.61300  109.45400 141.39300 1.000 66.27150  ? 37  DC  I "C2'" 1 
ATOM 7978  C "C1'" . DC  I 5 110 ? 90.35100  110.54200 142.13200 1.000 66.27150  ? 37  DC  I "C1'" 1 
ATOM 7979  N N1    . DC  I 5 110 ? 90.13900  110.56400 143.60600 1.000 66.27150  ? 37  DC  I N1    1 
ATOM 7980  C C2    . DC  I 5 110 ? 91.16000  111.03300 144.43900 1.000 66.27150  ? 37  DC  I C2    1 
ATOM 7981  O O2    . DC  I 5 110 ? 92.24100  111.36100 143.94200 1.000 66.27150  ? 37  DC  I O2    1 
ATOM 7982  N N3    . DC  I 5 110 ? 90.94500  111.09500 145.77100 1.000 66.27150  ? 37  DC  I N3    1 
ATOM 7983  C C4    . DC  I 5 110 ? 89.77000  110.73000 146.27400 1.000 66.27150  ? 37  DC  I C4    1 
ATOM 7984  N N4    . DC  I 5 110 ? 89.60800  110.81200 147.59700 1.000 66.27150  ? 37  DC  I N4    1 
ATOM 7985  C C5    . DC  I 5 110 ? 88.71400  110.25000 145.44600 1.000 66.27150  ? 37  DC  I C5    1 
ATOM 7986  C C6    . DC  I 5 110 ? 88.93400  110.20000 144.12800 1.000 66.27150  ? 37  DC  I C6    1 
ATOM 7987  P P     . DT  I 5 111 ? 91.00400  108.73600 138.22300 1.000 58.72080  ? 38  DT  I P     1 
ATOM 7988  O OP1   . DT  I 5 111 ? 90.94000  109.41100 136.90900 1.000 58.72080  ? 38  DT  I OP1   1 
ATOM 7989  O OP2   . DT  I 5 111 ? 90.05900  107.65600 138.56400 1.000 58.72080  ? 38  DT  I OP2   1 
ATOM 7990  O "O5'" . DT  I 5 111 ? 92.48700  108.20900 138.47000 1.000 58.72080  ? 38  DT  I "O5'" 1 
ATOM 7991  C "C5'" . DT  I 5 111 ? 93.51100  109.14300 138.73400 1.000 58.72080  ? 38  DT  I "C5'" 1 
ATOM 7992  C "C4'" . DT  I 5 111 ? 94.44200  108.63700 139.81800 1.000 58.72080  ? 38  DT  I "C4'" 1 
ATOM 7993  O "O4'" . DT  I 5 111 ? 93.83100  108.80000 141.12900 1.000 58.72080  ? 38  DT  I "O4'" 1 
ATOM 7994  C "C3'" . DT  I 5 111 ? 94.83800  107.16500 139.71600 1.000 58.72080  ? 38  DT  I "C3'" 1 
ATOM 7995  O "O3'" . DT  I 5 111 ? 96.23800  107.05100 139.94100 1.000 58.72080  ? 38  DT  I "O3'" 1 
ATOM 7996  C "C2'" . DT  I 5 111 ? 94.03300  106.52000 140.84200 1.000 58.72080  ? 38  DT  I "C2'" 1 
ATOM 7997  C "C1'" . DT  I 5 111 ? 94.06600  107.63000 141.86500 1.000 58.72080  ? 38  DT  I "C1'" 1 
ATOM 7998  N N1    . DT  I 5 111 ? 93.04900  107.50200 142.95000 1.000 58.72080  ? 38  DT  I N1    1 
ATOM 7999  C C2    . DT  I 5 111 ? 93.37400  107.89600 144.22100 1.000 58.72080  ? 38  DT  I C2    1 
ATOM 8000  O O2    . DT  I 5 111 ? 94.46800  108.32600 144.52400 1.000 58.72080  ? 38  DT  I O2    1 
ATOM 8001  N N3    . DT  I 5 111 ? 92.37800  107.74100 145.14000 1.000 58.72080  ? 38  DT  I N3    1 
ATOM 8002  C C4    . DT  I 5 111 ? 91.10800  107.25900 144.92000 1.000 58.72080  ? 38  DT  I C4    1 
ATOM 8003  O O4    . DT  I 5 111 ? 90.28000  107.16500 145.81600 1.000 58.72080  ? 38  DT  I O4    1 
ATOM 8004  C C5    . DT  I 5 111 ? 90.82300  106.87200 143.56700 1.000 58.72080  ? 38  DT  I C5    1 
ATOM 8005  C C7    . DT  I 5 111 ? 89.47100  106.32400 143.21400 1.000 58.72080  ? 38  DT  I C7    1 
ATOM 8006  C C6    . DT  I 5 111 ? 91.79900  107.00700 142.65600 1.000 58.72080  ? 38  DT  I C6    1 
ATOM 8007  P P     . DA  I 5 112 ? 97.07300  105.80600 139.36600 1.000 61.19068  ? 39  DA  I P     1 
ATOM 8008  O OP1   . DA  I 5 112 ? 97.66200  106.23000 138.08400 1.000 61.19068  ? 39  DA  I OP1   1 
ATOM 8009  O OP2   . DA  I 5 112 ? 96.24500  104.58600 139.42000 1.000 61.19068  ? 39  DA  I OP2   1 
ATOM 8010  O "O5'" . DA  I 5 112 ? 98.26200  105.62900 140.41100 1.000 61.19068  ? 39  DA  I "O5'" 1 
ATOM 8011  C "C5'" . DA  I 5 112 ? 99.12200  106.72400 140.70600 1.000 61.19068  ? 39  DA  I "C5'" 1 
ATOM 8012  C "C4'" . DA  I 5 112 ? 99.61900  106.66800 142.14300 1.000 61.19068  ? 39  DA  I "C4'" 1 
ATOM 8013  O "O4'" . DA  I 5 112 ? 98.52400  106.84700 143.06800 1.000 61.19068  ? 39  DA  I "O4'" 1 
ATOM 8014  C "C3'" . DA  I 5 112 ? 100.31200 105.37400 142.53400 1.000 61.19068  ? 39  DA  I "C3'" 1 
ATOM 8015  O "O3'" . DA  I 5 112 ? 101.47900 105.66800 143.27700 1.000 61.19068  ? 39  DA  I "O3'" 1 
ATOM 8016  C "C2'" . DA  I 5 112 ? 99.25500  104.63700 143.36000 1.000 61.19068  ? 39  DA  I "C2'" 1 
ATOM 8017  C "C1'" . DA  I 5 112 ? 98.48900  105.78600 143.99100 1.000 61.19068  ? 39  DA  I "C1'" 1 
ATOM 8018  N N9    . DA  I 5 112 ? 97.08000  105.50600 144.25000 1.000 61.19068  ? 39  DA  I N9    1 
ATOM 8019  C C8    . DA  I 5 112 ? 96.13700  105.18600 143.32700 1.000 61.19068  ? 39  DA  I C8    1 
ATOM 8020  N N7    . DA  I 5 112 ? 94.94100  105.00800 143.82700 1.000 61.19068  ? 39  DA  I N7    1 
ATOM 8021  C C5    . DA  I 5 112 ? 95.11700  105.20100 145.17900 1.000 61.19068  ? 39  DA  I C5    1 
ATOM 8022  C C6    . DA  I 5 112 ? 94.22700  105.14600 146.26200 1.000 61.19068  ? 39  DA  I C6    1 
ATOM 8023  N N6    . DA  I 5 112 ? 92.93200  104.85700 146.13100 1.000 61.19068  ? 39  DA  I N6    1 
ATOM 8024  N N1    . DA  I 5 112 ? 94.72100  105.38600 147.49200 1.000 61.19068  ? 39  DA  I N1    1 
ATOM 8025  C C2    . DA  I 5 112 ? 96.02100  105.67300 147.62000 1.000 61.19068  ? 39  DA  I C2    1 
ATOM 8026  N N3    . DA  I 5 112 ? 96.95300  105.75800 146.67300 1.000 61.19068  ? 39  DA  I N3    1 
ATOM 8027  C C4    . DA  I 5 112 ? 96.42900  105.51400 145.46300 1.000 61.19068  ? 39  DA  I C4    1 
ATOM 8028  P P     . DG  I 5 113 ? 102.65200 104.58200 143.40000 1.000 67.53785  ? 40  DG  I P     1 
ATOM 8029  O OP1   . DG  I 5 113 ? 103.92900 105.32100 143.43600 1.000 67.53785  ? 40  DG  I OP1   1 
ATOM 8030  O OP2   . DG  I 5 113 ? 102.42100 103.56000 142.35700 1.000 67.53785  ? 40  DG  I OP2   1 
ATOM 8031  O "O5'" . DG  I 5 113 ? 102.40000 103.90700 144.82500 1.000 67.53785  ? 40  DG  I "O5'" 1 
ATOM 8032  C "C5'" . DG  I 5 113 ? 102.18700 104.72800 145.96600 1.000 67.53785  ? 40  DG  I "C5'" 1 
ATOM 8033  C "C4'" . DG  I 5 113 ? 101.62400 103.91500 147.11500 1.000 67.53785  ? 40  DG  I "C4'" 1 
ATOM 8034  O "O4'" . DG  I 5 113 ? 100.18800 103.95200 147.07800 1.000 67.53785  ? 40  DG  I "O4'" 1 
ATOM 8035  C "C3'" . DG  I 5 113 ? 102.01300 102.43900 147.12000 1.000 67.53785  ? 40  DG  I "C3'" 1 
ATOM 8036  O "O3'" . DG  I 5 113 ? 102.84400 102.17900 148.24300 1.000 67.53785  ? 40  DG  I "O3'" 1 
ATOM 8037  C "C2'" . DG  I 5 113 ? 100.67400 101.68800 147.20000 1.000 67.53785  ? 40  DG  I "C2'" 1 
ATOM 8038  C "C1'" . DG  I 5 113 ? 99.69900  102.76800 147.63400 1.000 67.53785  ? 40  DG  I "C1'" 1 
ATOM 8039  N N9    . DG  I 5 113 ? 98.35400  102.57500 147.12200 1.000 67.53785  ? 40  DG  I N9    1 
ATOM 8040  C C8    . DG  I 5 113 ? 97.98200  102.52600 145.80700 1.000 67.53785  ? 40  DG  I C8    1 
ATOM 8041  N N7    . DG  I 5 113 ? 96.71000  102.35200 145.63200 1.000 67.53785  ? 40  DG  I N7    1 
ATOM 8042  C C5    . DG  I 5 113 ? 96.20100  102.28100 146.91500 1.000 67.53785  ? 40  DG  I C5    1 
ATOM 8043  C C6    . DG  I 5 113 ? 94.87600  102.09300 147.35000 1.000 67.53785  ? 40  DG  I C6    1 
ATOM 8044  O O6    . DG  I 5 113 ? 93.86000  101.96100 146.65800 1.000 67.53785  ? 40  DG  I O6    1 
ATOM 8045  N N1    . DG  I 5 113 ? 94.78600  102.08200 148.73500 1.000 67.53785  ? 40  DG  I N1    1 
ATOM 8046  C C2    . DG  I 5 113 ? 95.85000  102.22300 149.59300 1.000 67.53785  ? 40  DG  I C2    1 
ATOM 8047  N N2    . DG  I 5 113 ? 95.57100  102.17900 150.90100 1.000 67.53785  ? 40  DG  I N2    1 
ATOM 8048  N N3    . DG  I 5 113 ? 97.10400  102.39600 149.19500 1.000 67.53785  ? 40  DG  I N3    1 
ATOM 8049  C C4    . DG  I 5 113 ? 97.20200  102.41300 147.84700 1.000 67.53785  ? 40  DG  I C4    1 
ATOM 8050  P P     . DT  I 5 114 ? 103.48400 100.72500 148.48000 1.000 70.25631  ? 41  DT  I P     1 
ATOM 8051  O OP1   . DT  I 5 114 ? 104.74600 100.93400 149.21900 1.000 70.25631  ? 41  DT  I OP1   1 
ATOM 8052  O OP2   . DT  I 5 114 ? 103.49700 99.98900  147.19800 1.000 70.25631  ? 41  DT  I OP2   1 
ATOM 8053  O "O5'" . DT  I 5 114 ? 102.44100 100.00300 149.44900 1.000 70.25631  ? 41  DT  I "O5'" 1 
ATOM 8054  C "C5'" . DT  I 5 114 ? 101.92300 100.69500 150.58200 1.000 70.25631  ? 41  DT  I "C5'" 1 
ATOM 8055  C "C4'" . DT  I 5 114 ? 100.95000 99.81700  151.34600 1.000 70.25631  ? 41  DT  I "C4'" 1 
ATOM 8056  O "O4'" . DT  I 5 114 ? 99.62700  99.89700  150.76500 1.000 70.25631  ? 41  DT  I "O4'" 1 
ATOM 8057  C "C3'" . DT  I 5 114 ? 101.31400 98.33400  151.38500 1.000 70.25631  ? 41  DT  I "C3'" 1 
ATOM 8058  O "O3'" . DT  I 5 114 ? 101.17100 97.84900  152.71300 1.000 70.25631  ? 41  DT  I "O3'" 1 
ATOM 8059  C "C2'" . DT  I 5 114 ? 100.31100 97.70400  150.42400 1.000 70.25631  ? 41  DT  I "C2'" 1 
ATOM 8060  C "C1'" . DT  I 5 114 ? 99.10600  98.59900  150.63000 1.000 70.25631  ? 41  DT  I "C1'" 1 
ATOM 8061  N N1    . DT  I 5 114 ? 98.16700  98.61800  149.48600 1.000 70.25631  ? 41  DT  I N1    1 
ATOM 8062  C C2    . DT  I 5 114 ? 96.81800  98.54400  149.72000 1.000 70.25631  ? 41  DT  I C2    1 
ATOM 8063  O O2    . DT  I 5 114 ? 96.34100  98.38500  150.82600 1.000 70.25631  ? 41  DT  I O2    1 
ATOM 8064  N N3    . DT  I 5 114 ? 96.04200  98.59900  148.59900 1.000 70.25631  ? 41  DT  I N3    1 
ATOM 8065  C C4    . DT  I 5 114 ? 96.47200  98.76800  147.29900 1.000 70.25631  ? 41  DT  I C4    1 
ATOM 8066  O O4    . DT  I 5 114 ? 95.69700  98.81500  146.35300 1.000 70.25631  ? 41  DT  I O4    1 
ATOM 8067  C C5    . DT  I 5 114 ? 97.89800  98.87100  147.12900 1.000 70.25631  ? 41  DT  I C5    1 
ATOM 8068  C C7    . DT  I 5 114 ? 98.48300  99.04900  145.76300 1.000 70.25631  ? 41  DT  I C7    1 
ATOM 8069  C C6    . DT  I 5 114 ? 98.66500  98.80600  148.21800 1.000 70.25631  ? 41  DT  I C6    1 
ATOM 8070  P P     . DC  I 5 115 ? 101.88600 96.48900  153.17100 1.000 68.94967  ? 42  DC  I P     1 
ATOM 8071  O OP1   . DC  I 5 115 ? 102.58000 96.76600  154.44700 1.000 68.94967  ? 42  DC  I OP1   1 
ATOM 8072  O OP2   . DC  I 5 115 ? 102.64300 95.95400  152.01900 1.000 68.94967  ? 42  DC  I OP2   1 
ATOM 8073  O "O5'" . DC  I 5 115 ? 100.67000 95.49300  153.44700 1.000 68.94967  ? 42  DC  I "O5'" 1 
ATOM 8074  C "C5'" . DC  I 5 115 ? 99.62400  95.87200  154.33400 1.000 68.94967  ? 42  DC  I "C5'" 1 
ATOM 8075  C "C4'" . DC  I 5 115 ? 98.41800  94.97700  154.13300 1.000 68.94967  ? 42  DC  I "C4'" 1 
ATOM 8076  O "O4'" . DC  I 5 115 ? 97.68400  95.38400  152.95400 1.000 68.94967  ? 42  DC  I "O4'" 1 
ATOM 8077  C "C3'" . DC  I 5 115 ? 98.74500  93.49400  153.95400 1.000 68.94967  ? 42  DC  I "C3'" 1 
ATOM 8078  O "O3'" . DC  I 5 115 ? 98.02200  92.73000  154.91200 1.000 68.94967  ? 42  DC  I "O3'" 1 
ATOM 8079  C "C2'" . DC  I 5 115 ? 98.31400  93.19100  152.51500 1.000 68.94967  ? 42  DC  I "C2'" 1 
ATOM 8080  C "C1'" . DC  I 5 115 ? 97.24500  94.23600  152.27900 1.000 68.94967  ? 42  DC  I "C1'" 1 
ATOM 8081  N N1    . DC  I 5 115 ? 97.06800  94.58600  150.85600 1.000 68.94967  ? 42  DC  I N1    1 
ATOM 8082  C C2    . DC  I 5 115 ? 95.78700  94.65900  150.31900 1.000 68.94967  ? 42  DC  I C2    1 
ATOM 8083  O O2    . DC  I 5 115 ? 94.82700  94.36500  151.03200 1.000 68.94967  ? 42  DC  I O2    1 
ATOM 8084  N N3    . DC  I 5 115 ? 95.64500  94.99100  149.01500 1.000 68.94967  ? 42  DC  I N3    1 
ATOM 8085  C C4    . DC  I 5 115 ? 96.71600  95.28600  148.28400 1.000 68.94967  ? 42  DC  I C4    1 
ATOM 8086  N N4    . DC  I 5 115 ? 96.53300  95.62100  147.00500 1.000 68.94967  ? 42  DC  I N4    1 
ATOM 8087  C C5    . DC  I 5 115 ? 98.02800  95.24800  148.82800 1.000 68.94967  ? 42  DC  I C5    1 
ATOM 8088  C C6    . DC  I 5 115 ? 98.15200  94.90500  150.10700 1.000 68.94967  ? 42  DC  I C6    1 
ATOM 8089  P P     . DT  I 5 116 ? 98.20900  91.13800  155.02000 1.000 69.62651  ? 43  DT  I P     1 
ATOM 8090  O OP1   . DT  I 5 116 ? 98.09500  90.80600  156.45500 1.000 69.62651  ? 43  DT  I OP1   1 
ATOM 8091  O OP2   . DT  I 5 116 ? 99.41700  90.71700  154.27600 1.000 69.62651  ? 43  DT  I OP2   1 
ATOM 8092  O "O5'" . DT  I 5 116 ? 96.92100  90.56000  154.27300 1.000 69.62651  ? 43  DT  I "O5'" 1 
ATOM 8093  C "C5'" . DT  I 5 116 ? 95.61700  90.99000  154.66700 1.000 69.62651  ? 43  DT  I "C5'" 1 
ATOM 8094  C "C4'" . DT  I 5 116 ? 94.54900  90.50100  153.69500 1.000 69.62651  ? 43  DT  I "C4'" 1 
ATOM 8095  O "O4'" . DT  I 5 116 ? 94.67000  91.17200  152.41200 1.000 69.62651  ? 43  DT  I "O4'" 1 
ATOM 8096  C "C3'" . DT  I 5 116 ? 94.58000  89.00700  153.38100 1.000 69.62651  ? 43  DT  I "C3'" 1 
ATOM 8097  O "O3'" . DT  I 5 116 ? 93.25300  88.51800  153.32300 1.000 69.62651  ? 43  DT  I "O3'" 1 
ATOM 8098  C "C2'" . DT  I 5 116 ? 95.22900  88.97200  152.00300 1.000 69.62651  ? 43  DT  I "C2'" 1 
ATOM 8099  C "C1'" . DT  I 5 116 ? 94.59700  90.20000  151.39500 1.000 69.62651  ? 43  DT  I "C1'" 1 
ATOM 8100  N N1    . DT  I 5 116 ? 95.27500  90.72500  150.19000 1.000 69.62651  ? 43  DT  I N1    1 
ATOM 8101  C C2    . DT  I 5 116 ? 94.51500  91.08300  149.10800 1.000 69.62651  ? 43  DT  I C2    1 
ATOM 8102  O O2    . DT  I 5 116 ? 93.30600  90.95700  149.07400 1.000 69.62651  ? 43  DT  I O2    1 
ATOM 8103  N N3    . DT  I 5 116 ? 95.22100  91.58200  148.05300 1.000 69.62651  ? 43  DT  I N3    1 
ATOM 8104  C C4    . DT  I 5 116 ? 96.58400  91.76700  147.97800 1.000 69.62651  ? 43  DT  I C4    1 
ATOM 8105  O O4    . DT  I 5 116 ? 97.12800  92.22600  146.98100 1.000 69.62651  ? 43  DT  I O4    1 
ATOM 8106  C C5    . DT  I 5 116 ? 97.32400  91.38000  149.15200 1.000 69.62651  ? 43  DT  I C5    1 
ATOM 8107  C C7    . DT  I 5 116 ? 98.81400  91.52900  149.18600 1.000 69.62651  ? 43  DT  I C7    1 
ATOM 8108  C C6    . DT  I 5 116 ? 96.64100  90.88500  150.19100 1.000 69.62651  ? 43  DT  I C6    1 
ATOM 8109  P P     . DC  I 5 117 ? 92.70700  87.50900  154.44400 1.000 71.57236  ? 44  DC  I P     1 
ATOM 8110  O OP1   . DC  I 5 117 ? 91.55100  88.15600  155.10000 1.000 71.57236  ? 44  DC  I OP1   1 
ATOM 8111  O OP2   . DC  I 5 117 ? 93.86500  87.06000  155.25200 1.000 71.57236  ? 44  DC  I OP2   1 
ATOM 8112  O "O5'" . DC  I 5 117 ? 92.17500  86.26400  153.59600 1.000 71.57236  ? 44  DC  I "O5'" 1 
ATOM 8113  C "C5'" . DC  I 5 117 ? 92.71100  86.00500  152.30200 1.000 71.57236  ? 44  DC  I "C5'" 1 
ATOM 8114  C "C4'" . DC  I 5 117 ? 91.67600  86.27100  151.22300 1.000 71.57236  ? 44  DC  I "C4'" 1 
ATOM 8115  O "O4'" . DC  I 5 117 ? 92.18300  87.24200  150.26400 1.000 71.57236  ? 44  DC  I "O4'" 1 
ATOM 8116  C "C3'" . DC  I 5 117 ? 91.32800  85.05100  150.39700 1.000 71.57236  ? 44  DC  I "C3'" 1 
ATOM 8117  O "O3'" . DC  I 5 117 ? 90.00400  85.16100  149.89700 1.000 71.57236  ? 44  DC  I "O3'" 1 
ATOM 8118  C "C2'" . DC  I 5 117 ? 92.36900  85.12200  149.29500 1.000 71.57236  ? 44  DC  I "C2'" 1 
ATOM 8119  C "C1'" . DC  I 5 117 ? 92.38900  86.61000  149.01100 1.000 71.57236  ? 44  DC  I "C1'" 1 
ATOM 8120  N N1    . DC  I 5 117 ? 93.67400  87.12000  148.43900 1.000 71.57236  ? 44  DC  I N1    1 
ATOM 8121  C C2    . DC  I 5 117 ? 93.67300  87.84500  147.23900 1.000 71.57236  ? 44  DC  I C2    1 
ATOM 8122  O O2    . DC  I 5 117 ? 92.61300  88.00100  146.62800 1.000 71.57236  ? 44  DC  I O2    1 
ATOM 8123  N N3    . DC  I 5 117 ? 94.84900  88.31900  146.76000 1.000 71.57236  ? 44  DC  I N3    1 
ATOM 8124  C C4    . DC  I 5 117 ? 95.97300  88.12300  147.44200 1.000 71.57236  ? 44  DC  I C4    1 
ATOM 8125  N N4    . DC  I 5 117 ? 97.10800  88.61300  146.93900 1.000 71.57236  ? 44  DC  I N4    1 
ATOM 8126  C C5    . DC  I 5 117 ? 95.98700  87.41300  148.67200 1.000 71.57236  ? 44  DC  I C5    1 
ATOM 8127  C C6    . DC  I 5 117 ? 94.82800  86.93800  149.12800 1.000 71.57236  ? 44  DC  I C6    1 
ATOM 8128  P P     . DC  I 5 118 ? 89.12300  83.83700  149.68400 1.000 70.11766  ? 45  DC  I P     1 
ATOM 8129  O OP1   . DC  I 5 118 ? 87.83800  84.02200  150.39100 1.000 70.11766  ? 45  DC  I OP1   1 
ATOM 8130  O OP2   . DC  I 5 118 ? 89.99300  82.68800  150.01500 1.000 70.11766  ? 45  DC  I OP2   1 
ATOM 8131  O "O5'" . DC  I 5 118 ? 88.83600  83.79800  148.11200 1.000 70.11766  ? 45  DC  I "O5'" 1 
ATOM 8132  C "C5'" . DC  I 5 118 ? 88.92700  84.98800  147.33500 1.000 70.11766  ? 45  DC  I "C5'" 1 
ATOM 8133  C "C4'" . DC  I 5 118 ? 89.16300  84.66800  145.86700 1.000 70.11766  ? 45  DC  I "C4'" 1 
ATOM 8134  O "O4'" . DC  I 5 118 ? 90.49900  85.05500  145.45600 1.000 70.11766  ? 45  DC  I "O4'" 1 
ATOM 8135  C "C3'" . DC  I 5 118 ? 89.01800  83.20400  145.48400 1.000 70.11766  ? 45  DC  I "C3'" 1 
ATOM 8136  O "O3'" . DC  I 5 118 ? 88.49600  83.14500  144.18000 1.000 70.11766  ? 45  DC  I "O3'" 1 
ATOM 8137  C "C2'" . DC  I 5 118 ? 90.46600  82.71600  145.52500 1.000 70.11766  ? 45  DC  I "C2'" 1 
ATOM 8138  C "C1'" . DC  I 5 118 ? 91.17200  83.92500  144.94200 1.000 70.11766  ? 45  DC  I "C1'" 1 
ATOM 8139  N N1    . DC  I 5 118 ? 92.61000  84.05400  145.27900 1.000 70.11766  ? 45  DC  I N1    1 
ATOM 8140  C C2    . DC  I 5 118 ? 93.40200  84.89800  144.51100 1.000 70.11766  ? 45  DC  I C2    1 
ATOM 8141  O O2    . DC  I 5 118 ? 92.89500  85.45600  143.53800 1.000 70.11766  ? 45  DC  I O2    1 
ATOM 8142  N N3    . DC  I 5 118 ? 94.70800  85.04000  144.82300 1.000 70.11766  ? 45  DC  I N3    1 
ATOM 8143  C C4    . DC  I 5 118 ? 95.20900  84.40900  145.88100 1.000 70.11766  ? 45  DC  I C4    1 
ATOM 8144  N N4    . DC  I 5 118 ? 96.50400  84.58900  146.15900 1.000 70.11766  ? 45  DC  I N4    1 
ATOM 8145  C C5    . DC  I 5 118 ? 94.40700  83.56500  146.70000 1.000 70.11766  ? 45  DC  I C5    1 
ATOM 8146  C C6    . DC  I 5 118 ? 93.12200  83.41700  146.36200 1.000 70.11766  ? 45  DC  I C6    1 
ATOM 8147  P P     . DA  I 5 119 ? 87.00400  82.62100  143.91600 1.000 68.65519  ? 46  DA  I P     1 
ATOM 8148  O OP1   . DA  I 5 119 ? 86.07900  83.42800  144.73700 1.000 68.65519  ? 46  DA  I OP1   1 
ATOM 8149  O OP2   . DA  I 5 119 ? 87.02100  81.15000  144.05500 1.000 68.65519  ? 46  DA  I OP2   1 
ATOM 8150  O "O5'" . DA  I 5 119 ? 86.76900  82.97400  142.37900 1.000 68.65519  ? 46  DA  I "O5'" 1 
ATOM 8151  C "C5'" . DA  I 5 119 ? 86.72300  84.34000  141.96100 1.000 68.65519  ? 46  DA  I "C5'" 1 
ATOM 8152  C "C4'" . DA  I 5 119 ? 87.63800  84.60200  140.76700 1.000 68.65519  ? 46  DA  I "C4'" 1 
ATOM 8153  O "O4'" . DA  I 5 119 ? 89.01800  84.38700  141.14200 1.000 68.65519  ? 46  DA  I "O4'" 1 
ATOM 8154  C "C3'" . DA  I 5 119 ? 87.40700  83.74900  139.52700 1.000 68.65519  ? 46  DA  I "C3'" 1 
ATOM 8155  O "O3'" . DA  I 5 119 ? 87.67400  84.52500  138.37500 1.000 68.65519  ? 46  DA  I "O3'" 1 
ATOM 8156  C "C2'" . DA  I 5 119 ? 88.44100  82.64400  139.68400 1.000 68.65519  ? 46  DA  I "C2'" 1 
ATOM 8157  C "C1'" . DA  I 5 119 ? 89.59800  83.40600  140.30900 1.000 68.65519  ? 46  DA  I "C1'" 1 
ATOM 8158  N N9    . DA  I 5 119 ? 90.45700  82.58000  141.14000 1.000 68.65519  ? 46  DA  I N9    1 
ATOM 8159  C C8    . DA  I 5 119 ? 90.07800  81.52300  141.91300 1.000 68.65519  ? 46  DA  I C8    1 
ATOM 8160  N N7    . DA  I 5 119 ? 91.06400  80.97500  142.57600 1.000 68.65519  ? 46  DA  I N7    1 
ATOM 8161  C C5    . DA  I 5 119 ? 92.16500  81.73100  142.21700 1.000 68.65519  ? 46  DA  I C5    1 
ATOM 8162  C C6    . DA  I 5 119 ? 93.52200  81.66000  142.57800 1.000 68.65519  ? 46  DA  I C6    1 
ATOM 8163  N N6    . DA  I 5 119 ? 94.00700  80.74900  143.42400 1.000 68.65519  ? 46  DA  I N6    1 
ATOM 8164  N N1    . DA  I 5 119 ? 94.36200  82.56700  142.04000 1.000 68.65519  ? 46  DA  I N1    1 
ATOM 8165  C C2    . DA  I 5 119 ? 93.87300  83.47700  141.19500 1.000 68.65519  ? 46  DA  I C2    1 
ATOM 8166  N N3    . DA  I 5 119 ? 92.61900  83.64300  140.78500 1.000 68.65519  ? 46  DA  I N3    1 
ATOM 8167  C C4    . DA  I 5 119 ? 91.80900  82.72700  141.33600 1.000 68.65519  ? 46  DA  I C4    1 
ATOM 8168  P P     . DG  I 5 120 ? 86.89400  84.24300  137.00300 1.000 67.76531  ? 47  DG  I P     1 
ATOM 8169  O OP1   . DG  I 5 120 ? 85.67300  85.07400  137.00300 1.000 67.76531  ? 47  DG  I OP1   1 
ATOM 8170  O OP2   . DG  I 5 120 ? 86.80500  82.78000  136.81100 1.000 67.76531  ? 47  DG  I OP2   1 
ATOM 8171  O "O5'" . DG  I 5 120 ? 87.87700  84.80500  135.88500 1.000 67.76531  ? 47  DG  I "O5'" 1 
ATOM 8172  C "C5'" . DG  I 5 120 ? 88.44900  86.10100  136.01700 1.000 67.76531  ? 47  DG  I "C5'" 1 
ATOM 8173  C "C4'" . DG  I 5 120 ? 89.86500  86.15100  135.44800 1.000 67.76531  ? 47  DG  I "C4'" 1 
ATOM 8174  O "O4'" . DG  I 5 120 ? 90.80000  85.39400  136.25100 1.000 67.76531  ? 47  DG  I "O4'" 1 
ATOM 8175  C "C3'" . DG  I 5 120 ? 90.02600  85.65200  134.03100 1.000 67.76531  ? 47  DG  I "C3'" 1 
ATOM 8176  O "O3'" . DG  I 5 120 ? 90.94300  86.49400  133.38600 1.000 67.76531  ? 47  DG  I "O3'" 1 
ATOM 8177  C "C2'" . DG  I 5 120 ? 90.56600  84.22800  134.23000 1.000 67.76531  ? 47  DG  I "C2'" 1 
ATOM 8178  C "C1'" . DG  I 5 120 ? 91.42700  84.39000  135.47300 1.000 67.76531  ? 47  DG  I "C1'" 1 
ATOM 8179  N N9    . DG  I 5 120 ? 91.49000  83.22600  136.34600 1.000 67.76531  ? 47  DG  I N9    1 
ATOM 8180  C C8    . DG  I 5 120 ? 90.43400  82.46400  136.76300 1.000 67.76531  ? 47  DG  I C8    1 
ATOM 8181  N N7    . DG  I 5 120 ? 90.76600  81.52900  137.60200 1.000 67.76531  ? 47  DG  I N7    1 
ATOM 8182  C C5    . DG  I 5 120 ? 92.12700  81.69100  137.77500 1.000 67.76531  ? 47  DG  I C5    1 
ATOM 8183  C C6    . DG  I 5 120 ? 93.02700  80.95700  138.57200 1.000 67.76531  ? 47  DG  I C6    1 
ATOM 8184  O O6    . DG  I 5 120 ? 92.78700  79.99400  139.31000 1.000 67.76531  ? 47  DG  I O6    1 
ATOM 8185  N N1    . DG  I 5 120 ? 94.32500  81.43900  138.46300 1.000 67.76531  ? 47  DG  I N1    1 
ATOM 8186  C C2    . DG  I 5 120 ? 94.70600  82.50200  137.67800 1.000 67.76531  ? 47  DG  I C2    1 
ATOM 8187  N N2    . DG  I 5 120 ? 96.01100  82.82000  137.70100 1.000 67.76531  ? 47  DG  I N2    1 
ATOM 8188  N N3    . DG  I 5 120 ? 93.86600  83.20200  136.92000 1.000 67.76531  ? 47  DG  I N3    1 
ATOM 8189  C C4    . DG  I 5 120 ? 92.59400  82.73900  137.01800 1.000 67.76531  ? 47  DG  I C4    1 
ATOM 8190  P P     . DG  I 5 121 ? 91.19400  86.39800  131.81000 1.000 63.38069  ? 48  DG  I P     1 
ATOM 8191  O OP1   . DG  I 5 121 ? 91.40600  87.78700  131.36400 1.000 63.38069  ? 48  DG  I OP1   1 
ATOM 8192  O OP2   . DG  I 5 121 ? 90.14500  85.55700  131.19500 1.000 63.38069  ? 48  DG  I OP2   1 
ATOM 8193  O "O5'" . DG  I 5 121 ? 92.57400  85.61800  131.70800 1.000 63.38069  ? 48  DG  I "O5'" 1 
ATOM 8194  C "C5'" . DG  I 5 121 ? 93.76700  86.25400  132.12300 1.000 63.38069  ? 48  DG  I "C5'" 1 
ATOM 8195  C "C4'" . DG  I 5 121 ? 94.93700  85.28600  132.13100 1.000 63.38069  ? 48  DG  I "C4'" 1 
ATOM 8196  O "O4'" . DG  I 5 121 ? 94.72400  84.25000  133.11900 1.000 63.38069  ? 48  DG  I "O4'" 1 
ATOM 8197  C "C3'" . DG  I 5 121 ? 95.22300  84.56400  130.81700 1.000 63.38069  ? 48  DG  I "C3'" 1 
ATOM 8198  O "O3'" . DG  I 5 121 ? 96.61600  84.45000  130.67500 1.000 63.38069  ? 48  DG  I "O3'" 1 
ATOM 8199  C "C2'" . DG  I 5 121 ? 94.58600  83.19800  131.04700 1.000 63.38069  ? 48  DG  I "C2'" 1 
ATOM 8200  C "C1'" . DG  I 5 121 ? 94.91000  82.99600  132.51400 1.000 63.38069  ? 48  DG  I "C1'" 1 
ATOM 8201  N N9    . DG  I 5 121 ? 94.07100  82.02800  133.21000 1.000 63.38069  ? 48  DG  I N9    1 
ATOM 8202  C C8    . DG  I 5 121 ? 92.73000  81.82600  133.04600 1.000 63.38069  ? 48  DG  I C8    1 
ATOM 8203  N N7    . DG  I 5 121 ? 92.24500  80.89700  133.82200 1.000 63.38069  ? 48  DG  I N7    1 
ATOM 8204  C C5    . DG  I 5 121 ? 93.34600  80.43300  134.52200 1.000 63.38069  ? 48  DG  I C5    1 
ATOM 8205  C C6    . DG  I 5 121 ? 93.44400  79.41500  135.49900 1.000 63.38069  ? 48  DG  I C6    1 
ATOM 8206  O O6    . DG  I 5 121 ? 92.54500  78.69800  135.95400 1.000 63.38069  ? 48  DG  I O6    1 
ATOM 8207  N N1    . DG  I 5 121 ? 94.74700  79.26400  135.95400 1.000 63.38069  ? 48  DG  I N1    1 
ATOM 8208  C C2    . DG  I 5 121 ? 95.82000  80.00400  135.51900 1.000 63.38069  ? 48  DG  I C2    1 
ATOM 8209  N N2    . DG  I 5 121 ? 97.00500  79.72000  136.06800 1.000 63.38069  ? 48  DG  I N2    1 
ATOM 8210  N N3    . DG  I 5 121 ? 95.73900  80.95800  134.60600 1.000 63.38069  ? 48  DG  I N3    1 
ATOM 8211  C C4    . DG  I 5 121 ? 94.47700  81.11900  134.15600 1.000 63.38069  ? 48  DG  I C4    1 
ATOM 8212  P P     . DC  I 5 122 ? 97.31100  84.46800  129.23200 1.000 61.71606  ? 49  DC  I P     1 
ATOM 8213  O OP1   . DC  I 5 122 ? 97.71600  85.85900  128.96200 1.000 61.71606  ? 49  DC  I OP1   1 
ATOM 8214  O OP2   . DC  I 5 122 ? 96.43400  83.75800  128.28200 1.000 61.71606  ? 49  DC  I OP2   1 
ATOM 8215  O "O5'" . DC  I 5 122 ? 98.62600  83.59200  129.45200 1.000 61.71606  ? 49  DC  I "O5'" 1 
ATOM 8216  C "C5'" . DC  I 5 122 ? 99.38400  83.74300  130.64700 1.000 61.71606  ? 49  DC  I "C5'" 1 
ATOM 8217  C "C4'" . DC  I 5 122 ? 99.90400  82.39900  131.12300 1.000 61.71606  ? 49  DC  I "C4'" 1 
ATOM 8218  O "O4'" . DC  I 5 122 ? 98.85900  81.66600  131.79400 1.000 61.71606  ? 49  DC  I "O4'" 1 
ATOM 8219  C "C3'" . DC  I 5 122 ? 100.43400 81.48600  130.02300 1.000 61.71606  ? 49  DC  I "C3'" 1 
ATOM 8220  O "O3'" . DC  I 5 122 ? 101.80600 81.18400  130.26700 1.000 61.71606  ? 49  DC  I "O3'" 1 
ATOM 8221  C "C2'" . DC  I 5 122 ? 99.53300  80.25100  130.09200 1.000 61.71606  ? 49  DC  I "C2'" 1 
ATOM 8222  C "C1'" . DC  I 5 122 ? 99.00500  80.30100  131.50900 1.000 61.71606  ? 49  DC  I "C1'" 1 
ATOM 8223  N N1    . DC  I 5 122 ? 97.67700  79.67900  131.67400 1.000 61.71606  ? 49  DC  I N1    1 
ATOM 8224  C C2    . DC  I 5 122 ? 97.50200  78.60400  132.55000 1.000 61.71606  ? 49  DC  I C2    1 
ATOM 8225  O O2    . DC  I 5 122 ? 98.48100  78.14100  133.14300 1.000 61.71606  ? 49  DC  I O2    1 
ATOM 8226  N N3    . DC  I 5 122 ? 96.26100  78.08000  132.69700 1.000 61.71606  ? 49  DC  I N3    1 
ATOM 8227  C C4    . DC  I 5 122 ? 95.23500  78.60400  132.03400 1.000 61.71606  ? 49  DC  I C4    1 
ATOM 8228  N N4    . DC  I 5 122 ? 94.03000  78.06500  132.20700 1.000 61.71606  ? 49  DC  I N4    1 
ATOM 8229  C C5    . DC  I 5 122 ? 95.39600  79.70200  131.15700 1.000 61.71606  ? 49  DC  I C5    1 
ATOM 8230  C C6    . DC  I 5 122 ? 96.62000  80.20700  131.01600 1.000 61.71606  ? 49  DC  I C6    1 
ATOM 8231  P P     . DA  I 5 123 ? 102.69600 80.44000  129.15700 1.000 68.67899  ? 50  DA  I P     1 
ATOM 8232  O OP1   . DA  I 5 123 ? 104.04300 81.04300  129.17300 1.000 68.67899  ? 50  DA  I OP1   1 
ATOM 8233  O OP2   . DA  I 5 123 ? 101.93400 80.41400  127.89200 1.000 68.67899  ? 50  DA  I OP2   1 
ATOM 8234  O "O5'" . DA  I 5 123 ? 102.81800 78.94300  129.70200 1.000 68.67899  ? 50  DA  I "O5'" 1 
ATOM 8235  C "C5'" . DA  I 5 123 ? 103.50000 78.68200  130.93100 1.000 68.67899  ? 50  DA  I "C5'" 1 
ATOM 8236  C "C4'" . DA  I 5 123 ? 103.51600 77.19400  131.24100 1.000 68.67899  ? 50  DA  I "C4'" 1 
ATOM 8237  O "O4'" . DA  I 5 123 ? 102.19800 76.76300  131.65300 1.000 68.67899  ? 50  DA  I "O4'" 1 
ATOM 8238  C "C3'" . DA  I 5 123 ? 103.93200 76.28800  130.08900 1.000 68.67899  ? 50  DA  I "C3'" 1 
ATOM 8239  O "O3'" . DA  I 5 123 ? 104.82900 75.28700  130.56000 1.000 68.67899  ? 50  DA  I "O3'" 1 
ATOM 8240  C "C2'" . DA  I 5 123 ? 102.61500 75.69100  129.60500 1.000 68.67899  ? 50  DA  I "C2'" 1 
ATOM 8241  C "C1'" . DA  I 5 123 ? 101.76000 75.68500  130.85900 1.000 68.67899  ? 50  DA  I "C1'" 1 
ATOM 8242  N N9    . DA  I 5 123 ? 100.36100 75.92000  130.56900 1.000 68.67899  ? 50  DA  I N9    1 
ATOM 8243  C C8    . DA  I 5 123 ? 99.87000  76.88300  129.75400 1.000 68.67899  ? 50  DA  I C8    1 
ATOM 8244  N N7    . DA  I 5 123 ? 98.57000  76.89500  129.66500 1.000 68.67899  ? 50  DA  I N7    1 
ATOM 8245  C C5    . DA  I 5 123 ? 98.17900  75.84300  130.45800 1.000 68.67899  ? 50  DA  I C5    1 
ATOM 8246  C C6    . DA  I 5 123 ? 96.92000  75.32500  130.76600 1.000 68.67899  ? 50  DA  I C6    1 
ATOM 8247  N N6    . DA  I 5 123 ? 95.79200  75.83600  130.28000 1.000 68.67899  ? 50  DA  I N6    1 
ATOM 8248  N N1    . DA  I 5 123 ? 96.86200  74.26300  131.59100 1.000 68.67899  ? 50  DA  I N1    1 
ATOM 8249  C C2    . DA  I 5 123 ? 98.00200  73.75500  132.07200 1.000 68.67899  ? 50  DA  I C2    1 
ATOM 8250  N N3    . DA  I 5 123 ? 99.25200  74.16100  131.85000 1.000 68.67899  ? 50  DA  I N3    1 
ATOM 8251  C C4    . DA  I 5 123 ? 99.26800  75.22100  131.02600 1.000 68.67899  ? 50  DA  I C4    1 
ATOM 8252  P P     . DC  I 5 124 ? 105.44800 74.19500  129.55600 1.000 72.94444  ? 51  DC  I P     1 
ATOM 8253  O OP1   . DC  I 5 124 ? 106.77700 73.85400  130.10000 1.000 72.94444  ? 51  DC  I OP1   1 
ATOM 8254  O OP2   . DC  I 5 124 ? 105.34000 74.67100  128.15900 1.000 72.94444  ? 51  DC  I OP2   1 
ATOM 8255  O "O5'" . DC  I 5 124 ? 104.49900 72.92200  129.74000 1.000 72.94444  ? 51  DC  I "O5'" 1 
ATOM 8256  C "C5'" . DC  I 5 124 ? 104.12700 72.50400  131.04600 1.000 72.94444  ? 51  DC  I "C5'" 1 
ATOM 8257  C "C4'" . DC  I 5 124 ? 103.08900 71.39500  130.99500 1.000 72.94444  ? 51  DC  I "C4'" 1 
ATOM 8258  O "O4'" . DC  I 5 124 ? 101.76200 71.94000  130.78000 1.000 72.94444  ? 51  DC  I "O4'" 1 
ATOM 8259  C "C3'" . DC  I 5 124 ? 103.31100 70.34900  129.90400 1.000 72.94444  ? 51  DC  I "C3'" 1 
ATOM 8260  O "O3'" . DC  I 5 124 ? 103.24600 69.05400  130.47200 1.000 72.94444  ? 51  DC  I "O3'" 1 
ATOM 8261  C "C2'" . DC  I 5 124 ? 102.16400 70.60900  128.92100 1.000 72.94444  ? 51  DC  I "C2'" 1 
ATOM 8262  C "C1'" . DC  I 5 124 ? 101.08300 71.14200  129.84300 1.000 72.94444  ? 51  DC  I "C1'" 1 
ATOM 8263  N N1    . DC  I 5 124 ? 100.08300 71.99700  129.15500 1.000 72.94444  ? 51  DC  I N1    1 
ATOM 8264  C C2    . DC  I 5 124 ? 98.71600  71.71000  129.25500 1.000 72.94444  ? 51  DC  I C2    1 
ATOM 8265  O O2    . DC  I 5 124 ? 98.35300  70.72200  129.89800 1.000 72.94444  ? 51  DC  I O2    1 
ATOM 8266  N N3    . DC  I 5 124 ? 97.83200  72.51700  128.61900 1.000 72.94444  ? 51  DC  I N3    1 
ATOM 8267  C C4    . DC  I 5 124 ? 98.26700  73.57200  127.93100 1.000 72.94444  ? 51  DC  I C4    1 
ATOM 8268  N N4    . DC  I 5 124 ? 97.36500  74.34700  127.32200 1.000 72.94444  ? 51  DC  I N4    1 
ATOM 8269  C C5    . DC  I 5 124 ? 99.65000  73.88300  127.83200 1.000 72.94444  ? 51  DC  I C5    1 
ATOM 8270  C C6    . DC  I 5 124 ? 100.51000 73.07700  128.45200 1.000 72.94444  ? 51  DC  I C6    1 
ATOM 8271  P P     . DG  I 5 125 ? 103.80100 67.78000  129.67000 1.000 77.85016  ? 52  DG  I P     1 
ATOM 8272  O OP1   . DG  I 5 125 ? 104.60800 66.98200  130.61800 1.000 77.85016  ? 52  DG  I OP1   1 
ATOM 8273  O OP2   . DG  I 5 125 ? 104.42200 68.25100  128.41500 1.000 77.85016  ? 52  DG  I OP2   1 
ATOM 8274  O "O5'" . DG  I 5 125 ? 102.47500 66.97000  129.29800 1.000 77.85016  ? 52  DG  I "O5'" 1 
ATOM 8275  C "C5'" . DG  I 5 125 ? 101.42800 66.85000  130.25600 1.000 77.85016  ? 52  DG  I "C5'" 1 
ATOM 8276  C "C4'" . DG  I 5 125 ? 100.16000 66.34700  129.59700 1.000 77.85016  ? 52  DG  I "C4'" 1 
ATOM 8277  O "O4'" . DG  I 5 125 ? 99.35700  67.47100  129.17300 1.000 77.85016  ? 52  DG  I "O4'" 1 
ATOM 8278  C "C3'" . DG  I 5 125 ? 100.38800 65.48900  128.35300 1.000 77.85016  ? 52  DG  I "C3'" 1 
ATOM 8279  O "O3'" . DG  I 5 125 ? 99.78900  64.20800  128.53600 1.000 77.85016  ? 52  DG  I "O3'" 1 
ATOM 8280  C "C2'" . DG  I 5 125 ? 99.73100  66.29300  127.22400 1.000 77.85016  ? 52  DG  I "C2'" 1 
ATOM 8281  C "C1'" . DG  I 5 125 ? 98.72400  67.15100  127.96700 1.000 77.85016  ? 52  DG  I "C1'" 1 
ATOM 8282  N N9    . DG  I 5 125 ? 98.44400  68.41600  127.29200 1.000 77.85016  ? 52  DG  I N9    1 
ATOM 8283  C C8    . DG  I 5 125 ? 99.37600  69.33700  126.88800 1.000 77.85016  ? 52  DG  I C8    1 
ATOM 8284  N N7    . DG  I 5 125 ? 98.86200  70.38500  126.32100 1.000 77.85016  ? 52  DG  I N7    1 
ATOM 8285  C C5    . DG  I 5 125 ? 97.49800  70.14900  126.33700 1.000 77.85016  ? 52  DG  I C5    1 
ATOM 8286  C C6    . DG  I 5 125 ? 96.44300  70.94600  125.84900 1.000 77.85016  ? 52  DG  I C6    1 
ATOM 8287  O O6    . DG  I 5 125 ? 96.52000  72.04700  125.29700 1.000 77.85016  ? 52  DG  I O6    1 
ATOM 8288  N N1    . DG  I 5 125 ? 95.20400  70.35300  126.05500 1.000 77.85016  ? 52  DG  I N1    1 
ATOM 8289  C C2    . DG  I 5 125 ? 95.00700  69.13500  126.66300 1.000 77.85016  ? 52  DG  I C2    1 
ATOM 8290  N N2    . DG  I 5 125 ? 93.73400  68.72600  126.77100 1.000 77.85016  ? 52  DG  I N2    1 
ATOM 8291  N N3    . DG  I 5 125 ? 95.99600  68.36900  127.12800 1.000 77.85016  ? 52  DG  I N3    1 
ATOM 8292  C C4    . DG  I 5 125 ? 97.21400  68.94000  126.92900 1.000 77.85016  ? 52  DG  I C4    1 
ATOM 8293  P P     . DT  I 5 126 ? 99.92300  63.06300  127.41800 1.000 81.32571  ? 53  DT  I P     1 
ATOM 8294  O OP1   . DT  I 5 126 ? 99.89700  61.76500  128.12500 1.000 81.32571  ? 53  DT  I OP1   1 
ATOM 8295  O OP2   . DT  I 5 126 ? 101.05700 63.38000  126.52200 1.000 81.32571  ? 53  DT  I OP2   1 
ATOM 8296  O "O5'" . DT  I 5 126 ? 98.56300  63.19700  126.60100 1.000 81.32571  ? 53  DT  I "O5'" 1 
ATOM 8297  C "C5'" . DT  I 5 126 ? 97.33200  63.13100  127.30000 1.000 81.32571  ? 53  DT  I "C5'" 1 
ATOM 8298  C "C4'" . DT  I 5 126 ? 96.16600  63.39500  126.37300 1.000 81.32571  ? 53  DT  I "C4'" 1 
ATOM 8299  O "O4'" . DT  I 5 126 ? 96.20500  64.77700  125.94700 1.000 81.32571  ? 53  DT  I "O4'" 1 
ATOM 8300  C "C3'" . DT  I 5 126 ? 96.14400  62.56300  125.09300 1.000 81.32571  ? 53  DT  I "C3'" 1 
ATOM 8301  O "O3'" . DT  I 5 126 ? 94.82900  62.07700  124.87700 1.000 81.32571  ? 53  DT  I "O3'" 1 
ATOM 8302  C "C2'" . DT  I 5 126 ? 96.56100  63.56100  124.01400 1.000 81.32571  ? 53  DT  I "C2'" 1 
ATOM 8303  C "C1'" . DT  I 5 126 ? 95.97200  64.84400  124.56500 1.000 81.32571  ? 53  DT  I "C1'" 1 
ATOM 8304  N N1    . DT  I 5 126 ? 96.62300  66.07200  124.05300 1.000 81.32571  ? 53  DT  I N1    1 
ATOM 8305  C C2    . DT  I 5 126 ? 95.84400  67.06500  123.52600 1.000 81.32571  ? 53  DT  I C2    1 
ATOM 8306  O O2    . DT  I 5 126 ? 94.63100  67.00000  123.47100 1.000 81.32571  ? 53  DT  I O2    1 
ATOM 8307  N N3    . DT  I 5 126 ? 96.53500  68.15900  123.08700 1.000 81.32571  ? 53  DT  I N3    1 
ATOM 8308  C C4    . DT  I 5 126 ? 97.90100  68.34500  123.10700 1.000 81.32571  ? 53  DT  I C4    1 
ATOM 8309  O O4    . DT  I 5 126 ? 98.43100  69.36400  122.68400 1.000 81.32571  ? 53  DT  I O4    1 
ATOM 8310  C C5    . DT  I 5 126 ? 98.66200  67.26000  123.65900 1.000 81.32571  ? 53  DT  I C5    1 
ATOM 8311  C C7    . DT  I 5 126 ? 100.15600 67.35100  123.72600 1.000 81.32571  ? 53  DT  I C7    1 
ATOM 8312  C C6    . DT  I 5 126 ? 97.99400  66.18300  124.09900 1.000 81.32571  ? 53  DT  I C6    1 
ATOM 8313  P P     . DG  I 5 127 ? 94.58800  60.71400  124.06800 1.000 82.65480  ? 54  DG  I P     1 
ATOM 8314  O OP1   . DG  I 5 127 ? 94.04000  59.72000  125.01400 1.000 82.65480  ? 54  DG  I OP1   1 
ATOM 8315  O OP2   . DG  I 5 127 ? 95.81800  60.40500  123.30700 1.000 82.65480  ? 54  DG  I OP2   1 
ATOM 8316  O "O5'" . DG  I 5 127 ? 93.45400  61.09900  123.01100 1.000 82.65480  ? 54  DG  I "O5'" 1 
ATOM 8317  C "C5'" . DG  I 5 127 ? 92.08200  60.93200  123.35100 1.000 82.65480  ? 54  DG  I "C5'" 1 
ATOM 8318  C "C4'" . DG  I 5 127 ? 91.20500  61.97200  122.66700 1.000 82.65480  ? 54  DG  I "C4'" 1 
ATOM 8319  O "O4'" . DG  I 5 127 ? 91.93400  63.21200  122.47300 1.000 82.65480  ? 54  DG  I "O4'" 1 
ATOM 8320  C "C3'" . DG  I 5 127 ? 90.70300  61.59000  121.28600 1.000 82.65480  ? 54  DG  I "C3'" 1 
ATOM 8321  O "O3'" . DG  I 5 127 ? 89.47900  62.25300  121.06700 1.000 82.65480  ? 54  DG  I "O3'" 1 
ATOM 8322  C "C2'" . DG  I 5 127 ? 91.80900  62.16000  120.39800 1.000 82.65480  ? 54  DG  I "C2'" 1 
ATOM 8323  C "C1'" . DG  I 5 127 ? 92.02300  63.49200  121.08500 1.000 82.65480  ? 54  DG  I "C1'" 1 
ATOM 8324  N N9    . DG  I 5 127 ? 93.31800  64.12800  120.86800 1.000 82.65480  ? 54  DG  I N9    1 
ATOM 8325  C C8    . DG  I 5 127 ? 94.54900  63.60200  121.15800 1.000 82.65480  ? 54  DG  I C8    1 
ATOM 8326  N N7    . DG  I 5 127 ? 95.53400  64.41600  120.90900 1.000 82.65480  ? 54  DG  I N7    1 
ATOM 8327  C C5    . DG  I 5 127 ? 94.91900  65.55300  120.41400 1.000 82.65480  ? 54  DG  I C5    1 
ATOM 8328  C C6    . DG  I 5 127 ? 95.48600  66.76300  119.96800 1.000 82.65480  ? 54  DG  I C6    1 
ATOM 8329  O O6    . DG  I 5 127 ? 96.68000  67.07300  119.92000 1.000 82.65480  ? 54  DG  I O6    1 
ATOM 8330  N N1    . DG  I 5 127 ? 94.51500  67.66300  119.54200 1.000 82.65480  ? 54  DG  I N1    1 
ATOM 8331  C C2    . DG  I 5 127 ? 93.16200  67.42200  119.55000 1.000 82.65480  ? 54  DG  I C2    1 
ATOM 8332  N N2    . DG  I 5 127 ? 92.37700  68.41400  119.10100 1.000 82.65480  ? 54  DG  I N2    1 
ATOM 8333  N N3    . DG  I 5 127 ? 92.61500  66.28600  119.97100 1.000 82.65480  ? 54  DG  I N3    1 
ATOM 8334  C C4    . DG  I 5 127 ? 93.55400  65.39900  120.38500 1.000 82.65480  ? 54  DG  I C4    1 
ATOM 8335  P P     . DT  I 5 128 ? 88.40600  61.69000  120.01700 1.000 85.39862  ? 55  DT  I P     1 
ATOM 8336  O OP1   . DT  I 5 128 ? 87.28000  61.13000  120.79600 1.000 85.39862  ? 55  DT  I OP1   1 
ATOM 8337  O OP2   . DT  I 5 128 ? 89.11500  60.83700  119.03500 1.000 85.39862  ? 55  DT  I OP2   1 
ATOM 8338  O "O5'" . DT  I 5 128 ? 87.93200  63.01700  119.26600 1.000 85.39862  ? 55  DT  I "O5'" 1 
ATOM 8339  C "C5'" . DT  I 5 128 ? 88.87300  64.06500  119.08200 1.000 85.39862  ? 55  DT  I "C5'" 1 
ATOM 8340  C "C4'" . DT  I 5 128 ? 88.54500  64.88800  117.85800 1.000 85.39862  ? 55  DT  I "C4'" 1 
ATOM 8341  O "O4'" . DT  I 5 128 ? 89.78200  65.46600  117.36600 1.000 85.39862  ? 55  DT  I "O4'" 1 
ATOM 8342  C "C3'" . DT  I 5 128 ? 88.06800  64.07200  116.67800 1.000 85.39862  ? 55  DT  I "C3'" 1 
ATOM 8343  O "O3'" . DT  I 5 128 ? 87.63100  64.95000  115.65300 1.000 85.39862  ? 55  DT  I "O3'" 1 
ATOM 8344  C "C2'" . DT  I 5 128 ? 89.37100  63.41100  116.28500 1.000 85.39862  ? 55  DT  I "C2'" 1 
ATOM 8345  C "C1'" . DT  I 5 128 ? 90.28100  64.63200  116.32700 1.000 85.39862  ? 55  DT  I "C1'" 1 
ATOM 8346  N N1    . DT  I 5 128 ? 91.73000  64.34600  116.55400 1.000 85.39862  ? 55  DT  I N1    1 
ATOM 8347  C C2    . DT  I 5 128 ? 92.62500  65.37300  116.43400 1.000 85.39862  ? 55  DT  I C2    1 
ATOM 8348  O O2    . DT  I 5 128 ? 92.30100  66.50400  116.12900 1.000 85.39862  ? 55  DT  I O2    1 
ATOM 8349  N N3    . DT  I 5 128 ? 93.92500  65.03000  116.65200 1.000 85.39862  ? 55  DT  I N3    1 
ATOM 8350  C C4    . DT  I 5 128 ? 94.41400  63.79100  116.99500 1.000 85.39862  ? 55  DT  I C4    1 
ATOM 8351  O O4    . DT  I 5 128 ? 95.60700  63.58800  117.18200 1.000 85.39862  ? 55  DT  I O4    1 
ATOM 8352  C C5    . DT  I 5 128 ? 93.42600  62.75200  117.12000 1.000 85.39862  ? 55  DT  I C5    1 
ATOM 8353  C C7    . DT  I 5 128 ? 93.84800  61.36000  117.48400 1.000 85.39862  ? 55  DT  I C7    1 
ATOM 8354  C C6    . DT  I 5 128 ? 92.14100  63.07500  116.89700 1.000 85.39862  ? 55  DT  I C6    1 
ATOM 8355  P P     . DC  I 5 129 ? 86.07200  65.28100  115.46300 1.000 86.52832  ? 56  DC  I P     1 
ATOM 8356  O OP1   . DC  I 5 129 ? 85.51900  65.73600  116.75600 1.000 86.52832  ? 56  DC  I OP1   1 
ATOM 8357  O OP2   . DC  I 5 129 ? 85.45800  64.13500  114.76300 1.000 86.52832  ? 56  DC  I OP2   1 
ATOM 8358  O "O5'" . DC  I 5 129 ? 86.07200  66.51800  114.45200 1.000 86.52832  ? 56  DC  I "O5'" 1 
ATOM 8359  C "C5'" . DC  I 5 129 ? 86.81500  67.69200  114.76600 1.000 86.52832  ? 56  DC  I "C5'" 1 
ATOM 8360  C "C4'" . DC  I 5 129 ? 87.79300  68.03600  113.65500 1.000 86.52832  ? 56  DC  I "C4'" 1 
ATOM 8361  O "O4'" . DC  I 5 129 ? 89.00400  67.24700  113.77500 1.000 86.52832  ? 56  DC  I "O4'" 1 
ATOM 8362  C "C3'" . DC  I 5 129 ? 87.28400  67.80700  112.23100 1.000 86.52832  ? 56  DC  I "C3'" 1 
ATOM 8363  O "O3'" . DC  I 5 129 ? 87.63500  68.92900  111.44300 1.000 86.52832  ? 56  DC  I "O3'" 1 
ATOM 8364  C "C2'" . DC  I 5 129 ? 88.05400  66.55500  111.79700 1.000 86.52832  ? 56  DC  I "C2'" 1 
ATOM 8365  C "C1'" . DC  I 5 129 ? 89.37300  66.81400  112.49100 1.000 86.52832  ? 56  DC  I "C1'" 1 
ATOM 8366  N N1    . DC  I 5 129 ? 90.26700  65.63700  112.64000 1.000 86.52832  ? 56  DC  I N1    1 
ATOM 8367  C C2    . DC  I 5 129 ? 91.64500  65.83900  112.68300 1.000 86.52832  ? 56  DC  I C2    1 
ATOM 8368  O O2    . DC  I 5 129 ? 92.08000  66.98300  112.55600 1.000 86.52832  ? 56  DC  I O2    1 
ATOM 8369  N N3    . DC  I 5 129 ? 92.46100  64.77900  112.85100 1.000 86.52832  ? 56  DC  I N3    1 
ATOM 8370  C C4    . DC  I 5 129 ? 91.94900  63.56100  112.98700 1.000 86.52832  ? 56  DC  I C4    1 
ATOM 8371  N N4    . DC  I 5 129 ? 92.79900  62.54300  113.15600 1.000 86.52832  ? 56  DC  I N4    1 
ATOM 8372  C C5    . DC  I 5 129 ? 90.54400  63.33000  112.95300 1.000 86.52832  ? 56  DC  I C5    1 
ATOM 8373  C C6    . DC  I 5 129 ? 89.74500  64.39100  112.78700 1.000 86.52832  ? 56  DC  I C6    1 
ATOM 8374  P P     . DA  I 5 130 ? 86.50200  69.88200  110.82500 1.000 81.87531  ? 57  DA  I P     1 
ATOM 8375  O OP1   . DA  I 5 130 ? 85.75700  70.47900  111.95300 1.000 81.87531  ? 57  DA  I OP1   1 
ATOM 8376  O OP2   . DA  I 5 130 ? 85.77600  69.11800  109.78900 1.000 81.87531  ? 57  DA  I OP2   1 
ATOM 8377  O "O5'" . DA  I 5 130 ? 87.33500  71.03500  110.09700 1.000 81.87531  ? 57  DA  I "O5'" 1 
ATOM 8378  C "C5'" . DA  I 5 130 ? 88.15500  71.92700  110.85900 1.000 81.87531  ? 57  DA  I "C5'" 1 
ATOM 8379  C "C4'" . DA  I 5 130 ? 89.46100  72.26500  110.13600 1.000 81.87531  ? 57  DA  I "C4'" 1 
ATOM 8380  O "O4'" . DA  I 5 130 ? 90.42400  71.18700  110.23000 1.000 81.87531  ? 57  DA  I "O4'" 1 
ATOM 8381  C "C3'" . DA  I 5 130 ? 89.34500  72.60400  108.66200 1.000 81.87531  ? 57  DA  I "C3'" 1 
ATOM 8382  O "O3'" . DA  I 5 130 ? 90.25000  73.65800  108.37300 1.000 81.87531  ? 57  DA  I "O3'" 1 
ATOM 8383  C "C2'" . DA  I 5 130 ? 89.73900  71.28700  107.98700 1.000 81.87531  ? 57  DA  I "C2'" 1 
ATOM 8384  C "C1'" . DA  I 5 130 ? 90.79700  70.74400  108.93800 1.000 81.87531  ? 57  DA  I "C1'" 1 
ATOM 8385  N N9    . DA  I 5 130 ? 90.86600  69.29000  109.03200 1.000 81.87531  ? 57  DA  I N9    1 
ATOM 8386  C C8    . DA  I 5 130 ? 89.81400  68.43500  109.14800 1.000 81.87531  ? 57  DA  I C8    1 
ATOM 8387  N N7    . DA  I 5 130 ? 90.16200  67.18200  109.27300 1.000 81.87531  ? 57  DA  I N7    1 
ATOM 8388  C C5    . DA  I 5 130 ? 91.53800  67.21200  109.26200 1.000 81.87531  ? 57  DA  I C5    1 
ATOM 8389  C C6    . DA  I 5 130 ? 92.50300  66.19400  109.35700 1.000 81.87531  ? 57  DA  I C6    1 
ATOM 8390  N N6    . DA  I 5 130 ? 92.18800  64.90500  109.49400 1.000 81.87531  ? 57  DA  I N6    1 
ATOM 8391  N N1    . DA  I 5 130 ? 93.80500  66.54900  109.29800 1.000 81.87531  ? 57  DA  I N1    1 
ATOM 8392  C C2    . DA  I 5 130 ? 94.11200  67.84600  109.15100 1.000 81.87531  ? 57  DA  I C2    1 
ATOM 8393  N N3    . DA  I 5 130 ? 93.28500  68.89500  109.05800 1.000 81.87531  ? 57  DA  I N3    1 
ATOM 8394  C C4    . DA  I 5 130 ? 91.99900  68.50200  109.11900 1.000 81.87531  ? 57  DA  I C4    1 
ATOM 8395  P P     . DG  I 5 131 ? 90.27400  74.37200  106.93900 1.000 84.98476  ? 58  DG  I P     1 
ATOM 8396  O OP1   . DG  I 5 131 ? 90.47300  75.81200  107.17800 1.000 84.98476  ? 58  DG  I OP1   1 
ATOM 8397  O OP2   . DG  I 5 131 ? 89.11400  73.91300  106.15100 1.000 84.98476  ? 58  DG  I OP2   1 
ATOM 8398  O "O5'" . DG  I 5 131 ? 91.60100  73.80900  106.26700 1.000 84.98476  ? 58  DG  I "O5'" 1 
ATOM 8399  C "C5'" . DG  I 5 131 ? 92.84000  73.88700  106.96700 1.000 84.98476  ? 58  DG  I "C5'" 1 
ATOM 8400  C "C4'" . DG  I 5 131 ? 93.88900  73.00100  106.31400 1.000 84.98476  ? 58  DG  I "C4'" 1 
ATOM 8401  O "O4'" . DG  I 5 131 ? 93.62700  71.60700  106.59900 1.000 84.98476  ? 58  DG  I "O4'" 1 
ATOM 8402  C "C3'" . DG  I 5 131 ? 93.98700  73.10700  104.79900 1.000 84.98476  ? 58  DG  I "C3'" 1 
ATOM 8403  O "O3'" . DG  I 5 131 ? 95.35300  73.10700  104.43600 1.000 84.98476  ? 58  DG  I "O3'" 1 
ATOM 8404  C "C2'" . DG  I 5 131 ? 93.26800  71.84500  104.32100 1.000 84.98476  ? 58  DG  I "C2'" 1 
ATOM 8405  C "C1'" . DG  I 5 131 ? 93.68700  70.87400  105.39900 1.000 84.98476  ? 58  DG  I "C1'" 1 
ATOM 8406  N N9    . DG  I 5 131 ? 92.82600  69.71100  105.55400 1.000 84.98476  ? 58  DG  I N9    1 
ATOM 8407  C C8    . DG  I 5 131 ? 91.46200  69.68700  105.54400 1.000 84.98476  ? 58  DG  I C8    1 
ATOM 8408  N N7    . DG  I 5 131 ? 90.95900  68.50300  105.73800 1.000 84.98476  ? 58  DG  I N7    1 
ATOM 8409  C C5    . DG  I 5 131 ? 92.06700  67.68200  105.83900 1.000 84.98476  ? 58  DG  I C5    1 
ATOM 8410  C C6    . DG  I 5 131 ? 92.15100  66.28800  106.03200 1.000 84.98476  ? 58  DG  I C6    1 
ATOM 8411  O O6    . DG  I 5 131 ? 91.22700  65.47100  106.15700 1.000 84.98476  ? 58  DG  I O6    1 
ATOM 8412  N N1    . DG  I 5 131 ? 93.47100  65.85700  106.07900 1.000 84.98476  ? 58  DG  I N1    1 
ATOM 8413  C C2    . DG  I 5 131 ? 94.56900  66.67100  105.95300 1.000 84.98476  ? 58  DG  I C2    1 
ATOM 8414  N N2    . DG  I 5 131 ? 95.76700  66.08000  106.02500 1.000 84.98476  ? 58  DG  I N2    1 
ATOM 8415  N N3    . DG  I 5 131 ? 94.50100  67.97800  105.77500 1.000 84.98476  ? 58  DG  I N3    1 
ATOM 8416  C C4    . DG  I 5 131 ? 93.22400  68.41200  105.72600 1.000 84.98476  ? 58  DG  I C4    1 
ATOM 8417  P P     . DA  I 5 132 ? 95.86200  73.94800  103.17300 1.000 97.73714  ? 59  DA  I P     1 
ATOM 8418  O OP1   . DA  I 5 132 ? 96.35400  75.24600  103.68000 1.000 97.73714  ? 59  DA  I OP1   1 
ATOM 8419  O OP2   . DA  I 5 132 ? 94.79500  73.91600  102.14800 1.000 97.73714  ? 59  DA  I OP2   1 
ATOM 8420  O "O5'" . DA  I 5 132 ? 97.11100  73.11000  102.62600 1.000 97.73714  ? 59  DA  I "O5'" 1 
ATOM 8421  C "C5'" . DA  I 5 132 ? 98.12200  72.63900  103.52600 1.000 97.73714  ? 59  DA  I "C5'" 1 
ATOM 8422  C "C4'" . DA  I 5 132 ? 98.69300  71.29800  103.07100 1.000 97.73714  ? 59  DA  I "C4'" 1 
ATOM 8423  O "O4'" . DA  I 5 132 ? 97.79700  70.20500  103.38700 1.000 97.73714  ? 59  DA  I "O4'" 1 
ATOM 8424  C "C3'" . DA  I 5 132 ? 98.99700  71.19000  101.58300 1.000 97.73714  ? 59  DA  I "C3'" 1 
ATOM 8425  O "O3'" . DA  I 5 132 ? 100.24300 70.53100  101.42400 1.000 97.73714  ? 59  DA  I "O3'" 1 
ATOM 8426  C "C2'" . DA  I 5 132 ? 97.81400  70.35800  101.06100 1.000 97.73714  ? 59  DA  I "C2'" 1 
ATOM 8427  C "C1'" . DA  I 5 132 ? 97.58400  69.42100  102.23300 1.000 97.73714  ? 59  DA  I "C1'" 1 
ATOM 8428  N N9    . DA  I 5 132 ? 96.22400  68.90900  102.35700 1.000 97.73714  ? 59  DA  I N9    1 
ATOM 8429  C C8    . DA  I 5 132 ? 95.09100  69.65400  102.38800 1.000 97.73714  ? 59  DA  I C8    1 
ATOM 8430  N N7    . DA  I 5 132 ? 93.99600  68.95700  102.53000 1.000 97.73714  ? 59  DA  I N7    1 
ATOM 8431  C C5    . DA  I 5 132 ? 94.43500  67.65200  102.55500 1.000 97.73714  ? 59  DA  I C5    1 
ATOM 8432  C C6    . DA  I 5 132 ? 93.75000  66.42900  102.66900 1.000 97.73714  ? 59  DA  I C6    1 
ATOM 8433  N N6    . DA  I 5 132 ? 92.42400  66.34700  102.78200 1.000 97.73714  ? 59  DA  I N6    1 
ATOM 8434  N N1    . DA  I 5 132 ? 94.48000  65.29400  102.66200 1.000 97.73714  ? 59  DA  I N1    1 
ATOM 8435  C C2    . DA  I 5 132 ? 95.81400  65.38800  102.54800 1.000 97.73714  ? 59  DA  I C2    1 
ATOM 8436  N N3    . DA  I 5 132 ? 96.57100  66.48800  102.43500 1.000 97.73714  ? 59  DA  I N3    1 
ATOM 8437  C C4    . DA  I 5 132 ? 95.81100  67.59500  102.44500 1.000 97.73714  ? 59  DA  I C4    1 
ATOM 8438  P P     . DT  I 5 133 ? 101.16800 70.81500  100.14500 1.000 110.49010 ? 60  DT  I P     1 
ATOM 8439  O OP1   . DT  I 5 133 ? 102.49300 71.25500  100.63500 1.000 110.49010 ? 60  DT  I OP1   1 
ATOM 8440  O OP2   . DT  I 5 133 ? 100.40500 71.67900  99.21800  1.000 110.49010 ? 60  DT  I OP2   1 
ATOM 8441  O "O5'" . DT  I 5 133 ? 101.31700 69.37600  99.47500  1.000 110.49010 ? 60  DT  I "O5'" 1 
ATOM 8442  C "C5'" . DT  I 5 133 ? 100.28200 68.89200  98.66300  1.000 110.49010 ? 60  DT  I "C5'" 1 
ATOM 8443  C "C4'" . DT  I 5 133 ? 100.17200 67.38700  98.74800  1.000 110.49010 ? 60  DT  I "C4'" 1 
ATOM 8444  O "O4'" . DT  I 5 133 ? 98.92700  67.03700  99.40700  1.000 110.49010 ? 60  DT  I "O4'" 1 
ATOM 8445  C "C3'" . DT  I 5 133 ? 100.14000 66.68100  97.39800  1.000 110.49010 ? 60  DT  I "C3'" 1 
ATOM 8446  O "O3'" . DT  I 5 133 ? 100.73600 65.38700  97.50600  1.000 110.49010 ? 60  DT  I "O3'" 1 
ATOM 8447  C "C2'" . DT  I 5 133 ? 98.64900  66.60200  97.13300  1.000 110.49010 ? 60  DT  I "C2'" 1 
ATOM 8448  C "C1'" . DT  I 5 133 ? 98.14600  66.26900  98.52300  1.000 110.49010 ? 60  DT  I "C1'" 1 
ATOM 8449  N N1    . DT  I 5 133 ? 96.72600  66.61500  98.73900  1.000 110.49010 ? 60  DT  I N1    1 
ATOM 8450  C C2    . DT  I 5 133 ? 95.83100  65.61700  98.99800  1.000 110.49010 ? 60  DT  I C2    1 
ATOM 8451  O O2    . DT  I 5 133 ? 96.12700  64.43800  98.98500  1.000 110.49010 ? 60  DT  I O2    1 
ATOM 8452  N N3    . DT  I 5 133 ? 94.54800  66.03800  99.18900  1.000 110.49010 ? 60  DT  I N3    1 
ATOM 8453  C C4    . DT  I 5 133 ? 94.08900  67.33700  99.20100  1.000 110.49010 ? 60  DT  I C4    1 
ATOM 8454  O O4    . DT  I 5 133 ? 92.91200  67.61300  99.40200  1.000 110.49010 ? 60  DT  I O4    1 
ATOM 8455  C C5    . DT  I 5 133 ? 95.09000  68.34500  98.96300  1.000 110.49010 ? 60  DT  I C5    1 
ATOM 8456  C C7    . DT  I 5 133 ? 94.71400  69.79600  98.94800  1.000 110.49010 ? 60  DT  I C7    1 
ATOM 8457  C C6    . DT  I 5 133 ? 96.34900  67.93900  98.75400  1.000 110.49010 ? 60  DT  I C6    1 
ATOM 8458  P P     . DA  I 5 134 ? 101.30700 64.63500  96.20400  1.000 125.88956 ? 61  DA  I P     1 
ATOM 8459  O OP1   . DA  I 5 134 ? 102.77600 64.57200  96.36700  1.000 125.88956 ? 61  DA  I OP1   1 
ATOM 8460  O OP2   . DA  I 5 134 ? 100.72800 65.26000  94.99500  1.000 125.88956 ? 61  DA  I OP2   1 
ATOM 8461  O "O5'" . DA  I 5 134 ? 100.72000 63.14800  96.31600  1.000 125.88956 ? 61  DA  I "O5'" 1 
ATOM 8462  C "C5'" . DA  I 5 134 ? 99.50700  62.89900  97.02400  1.000 125.88956 ? 61  DA  I "C5'" 1 
ATOM 8463  C "C4'" . DA  I 5 134 ? 98.60600  61.96000  96.23700  1.000 125.88956 ? 61  DA  I "C4'" 1 
ATOM 8464  O "O4'" . DA  I 5 134 ? 97.21100  62.28800  96.48400  1.000 125.88956 ? 61  DA  I "O4'" 1 
ATOM 8465  C "C3'" . DA  I 5 134 ? 98.76900  62.02300  94.72700  1.000 125.88956 ? 61  DA  I "C3'" 1 
ATOM 8466  O "O3'" . DA  I 5 134 ? 98.44500  60.76100  94.17800  1.000 125.88956 ? 61  DA  I "O3'" 1 
ATOM 8467  C "C2'" . DA  I 5 134 ? 97.73300  63.07300  94.35500  1.000 125.88956 ? 61  DA  I "C2'" 1 
ATOM 8468  C "C1'" . DA  I 5 134 ? 96.59300  62.65400  95.26400  1.000 125.88956 ? 61  DA  I "C1'" 1 
ATOM 8469  N N9    . DA  I 5 134 ? 95.65000  63.71900  95.57100  1.000 125.88956 ? 61  DA  I N9    1 
ATOM 8470  C C8    . DA  I 5 134 ? 95.92500  65.04800  95.68300  1.000 125.88956 ? 61  DA  I C8    1 
ATOM 8471  N N7    . DA  I 5 134 ? 94.88800  65.78100  95.99500  1.000 125.88956 ? 61  DA  I N7    1 
ATOM 8472  C C5    . DA  I 5 134 ? 93.85800  64.87000  96.08600  1.000 125.88956 ? 61  DA  I C5    1 
ATOM 8473  C C6    . DA  I 5 134 ? 92.49500  65.01400  96.38200  1.000 125.88956 ? 61  DA  I C6    1 
ATOM 8474  N N6    . DA  I 5 134 ? 91.92700  66.19100  96.65200  1.000 125.88956 ? 61  DA  I N6    1 
ATOM 8475  N N1    . DA  I 5 134 ? 91.73300  63.90100  96.38800  1.000 125.88956 ? 61  DA  I N1    1 
ATOM 8476  C C2    . DA  I 5 134 ? 92.30500  62.72200  96.11000  1.000 125.88956 ? 61  DA  I C2    1 
ATOM 8477  N N3    . DA  I 5 134 ? 93.58000  62.46300  95.82600  1.000 125.88956 ? 61  DA  I N3    1 
ATOM 8478  C C4    . DA  I 5 134 ? 94.30800  63.59100  95.82900  1.000 125.88956 ? 61  DA  I C4    1 
ATOM 8479  P P     . DT  I 5 135 ? 99.10100  60.26600  92.80000  1.000 137.13819 ? 62  DT  I P     1 
ATOM 8480  O OP1   . DT  I 5 135 ? 100.12100 59.25100  93.14000  1.000 137.13819 ? 62  DT  I OP1   1 
ATOM 8481  O OP2   . DT  I 5 135 ? 99.49200  61.45900  92.01700  1.000 137.13819 ? 62  DT  I OP2   1 
ATOM 8482  O "O5'" . DT  I 5 135 ? 97.88300  59.54700  92.05200  1.000 137.13819 ? 62  DT  I "O5'" 1 
ATOM 8483  C "C5'" . DT  I 5 135 ? 96.80000  59.00200  92.81200  1.000 137.13819 ? 62  DT  I "C5'" 1 
ATOM 8484  C "C4'" . DT  I 5 135 ? 95.46400  59.18800  92.10100  1.000 137.13819 ? 62  DT  I "C4'" 1 
ATOM 8485  O "O4'" . DT  I 5 135 ? 94.76200  60.36300  92.60800  1.000 137.13819 ? 62  DT  I "O4'" 1 
ATOM 8486  C "C3'" . DT  I 5 135 ? 95.53400  59.37500  90.58000  1.000 137.13819 ? 62  DT  I "C3'" 1 
ATOM 8487  O "O3'" . DT  I 5 135 ? 94.41700  58.72800  89.99200  1.000 137.13819 ? 62  DT  I "O3'" 1 
ATOM 8488  C "C2'" . DT  I 5 135 ? 95.40700  60.88800  90.44400  1.000 137.13819 ? 62  DT  I "C2'" 1 
ATOM 8489  C "C1'" . DT  I 5 135 ? 94.34800  61.12500  91.49600  1.000 137.13819 ? 62  DT  I "C1'" 1 
ATOM 8490  N N1    . DT  I 5 135 ? 94.14300  62.54800  91.89100  1.000 137.13819 ? 62  DT  I N1    1 
ATOM 8491  C C2    . DT  I 5 135 ? 92.90200  62.94000  92.32200  1.000 137.13819 ? 62  DT  I C2    1 
ATOM 8492  O O2    . DT  I 5 135 ? 91.94300  62.19100  92.35600  1.000 137.13819 ? 62  DT  I O2    1 
ATOM 8493  N N3    . DT  I 5 135 ? 92.80400  64.25700  92.66400  1.000 137.13819 ? 62  DT  I N3    1 
ATOM 8494  C C4    . DT  I 5 135 ? 93.81300  65.20000  92.65400  1.000 137.13819 ? 62  DT  I C4    1 
ATOM 8495  O O4    . DT  I 5 135 ? 93.62600  66.36300  92.99500  1.000 137.13819 ? 62  DT  I O4    1 
ATOM 8496  C C5    . DT  I 5 135 ? 95.10100  64.72000  92.21500  1.000 137.13819 ? 62  DT  I C5    1 
ATOM 8497  C C7    . DT  I 5 135 ? 96.27300  65.65500  92.15800  1.000 137.13819 ? 62  DT  I C7    1 
ATOM 8498  C C6    . DT  I 5 135 ? 95.20400  63.42900  91.86000  1.000 137.13819 ? 62  DT  I C6    1 
ATOM 8499  P P     . DA  I 5 136 ? 94.60300  57.49200  88.98400  1.000 148.20672 ? 63  DA  I P     1 
ATOM 8500  O OP1   . DA  I 5 136 ? 94.22900  56.26000  89.71200  1.000 148.20672 ? 63  DA  I OP1   1 
ATOM 8501  O OP2   . DA  I 5 136 ? 95.94300  57.60000  88.36900  1.000 148.20672 ? 63  DA  I OP2   1 
ATOM 8502  O "O5'" . DA  I 5 136 ? 93.51700  57.78000  87.84500  1.000 148.20672 ? 63  DA  I "O5'" 1 
ATOM 8503  C "C5'" . DA  I 5 136 ? 92.38100  56.92800  87.71500  1.000 148.20672 ? 63  DA  I "C5'" 1 
ATOM 8504  C "C4'" . DA  I 5 136 ? 91.09100  57.68300  88.00100  1.000 148.20672 ? 63  DA  I "C4'" 1 
ATOM 8505  O "O4'" . DA  I 5 136 ? 91.37800  58.86800  88.80000  1.000 148.20672 ? 63  DA  I "O4'" 1 
ATOM 8506  C "C3'" . DA  I 5 136 ? 90.34600  58.17900  86.75300  1.000 148.20672 ? 63  DA  I "C3'" 1 
ATOM 8507  O "O3'" . DA  I 5 136 ? 88.95300  57.86600  86.83700  1.000 148.20672 ? 63  DA  I "O3'" 1 
ATOM 8508  C "C2'" . DA  I 5 136 ? 90.56900  59.68800  86.80100  1.000 148.20672 ? 63  DA  I "C2'" 1 
ATOM 8509  C "C1'" . DA  I 5 136 ? 90.61200  59.92900  88.29400  1.000 148.20672 ? 63  DA  I "C1'" 1 
ATOM 8510  N N9    . DA  I 5 136 ? 91.23200  61.20200  88.64100  1.000 148.20672 ? 63  DA  I N9    1 
ATOM 8511  C C8    . DA  I 5 136 ? 92.54200  61.55000  88.48800  1.000 148.20672 ? 63  DA  I C8    1 
ATOM 8512  N N7    . DA  I 5 136 ? 92.81000  62.78300  88.85400  1.000 148.20672 ? 63  DA  I N7    1 
ATOM 8513  C C5    . DA  I 5 136 ? 91.58100  63.28600  89.24700  1.000 148.20672 ? 63  DA  I C5    1 
ATOM 8514  C C6    . DA  I 5 136 ? 91.18000  64.54600  89.73600  1.000 148.20672 ? 63  DA  I C6    1 
ATOM 8515  N N6    . DA  I 5 136 ? 92.02400  65.56600  89.91900  1.000 148.20672 ? 63  DA  I N6    1 
ATOM 8516  N N1    . DA  I 5 136 ? 89.87400  64.71500  90.03200  1.000 148.20672 ? 63  DA  I N1    1 
ATOM 8517  C C2    . DA  I 5 136 ? 89.03100  63.69200  89.84700  1.000 148.20672 ? 63  DA  I C2    1 
ATOM 8518  N N3    . DA  I 5 136 ? 89.29100  62.46700  89.39500  1.000 148.20672 ? 63  DA  I N3    1 
ATOM 8519  C C4    . DA  I 5 136 ? 90.59500  62.32700  89.11400  1.000 148.20672 ? 63  DA  I C4    1 
ATOM 8520  P P     . DT  I 5 137 ? 88.03200  57.91300  85.51600  1.000 158.45360 ? 64  DT  I P     1 
ATOM 8521  O OP1   . DT  I 5 137 ? 87.49200  56.54600  85.35600  1.000 158.45360 ? 64  DT  I OP1   1 
ATOM 8522  O OP2   . DT  I 5 137 ? 88.77300  58.52100  84.38900  1.000 158.45360 ? 64  DT  I OP2   1 
ATOM 8523  O "O5'" . DT  I 5 137 ? 86.81500  58.88700  85.89400  1.000 158.45360 ? 64  DT  I "O5'" 1 
ATOM 8524  C "C5'" . DT  I 5 137 ? 86.81000  59.61700  87.11800  1.000 158.45360 ? 64  DT  I "C5'" 1 
ATOM 8525  C "C4'" . DT  I 5 137 ? 85.71500  60.67900  87.11000  1.000 158.45360 ? 64  DT  I "C4'" 1 
ATOM 8526  O "O4'" . DT  I 5 137 ? 86.25800  61.95300  87.54100  1.000 158.45360 ? 64  DT  I "O4'" 1 
ATOM 8527  C "C3'" . DT  I 5 137 ? 85.06600  60.94600  85.75600  1.000 158.45360 ? 64  DT  I "C3'" 1 
ATOM 8528  O "O3'" . DT  I 5 137 ? 83.68700  61.29000  85.93300  1.000 158.45360 ? 64  DT  I "O3'" 1 
ATOM 8529  C "C2'" . DT  I 5 137 ? 85.88300  62.12300  85.24200  1.000 158.45360 ? 64  DT  I "C2'" 1 
ATOM 8530  C "C1'" . DT  I 5 137 ? 86.08600  62.91900  86.52300  1.000 158.45360 ? 64  DT  I "C1'" 1 
ATOM 8531  N N1    . DT  I 5 137 ? 87.30500  63.77700  86.52600  1.000 158.45360 ? 64  DT  I N1    1 
ATOM 8532  C C2    . DT  I 5 137 ? 87.21100  65.09200  86.93100  1.000 158.45360 ? 64  DT  I C2    1 
ATOM 8533  O O2    . DT  I 5 137 ? 86.16300  65.61600  87.26300  1.000 158.45360 ? 64  DT  I O2    1 
ATOM 8534  N N3    . DT  I 5 137 ? 88.40000  65.77700  86.92200  1.000 158.45360 ? 64  DT  I N3    1 
ATOM 8535  C C4    . DT  I 5 137 ? 89.64000  65.28400  86.56700  1.000 158.45360 ? 64  DT  I C4    1 
ATOM 8536  O O4    . DT  I 5 137 ? 90.65000  65.97200  86.58900  1.000 158.45360 ? 64  DT  I O4    1 
ATOM 8537  C C5    . DT  I 5 137 ? 89.66700  63.90000  86.16400  1.000 158.45360 ? 64  DT  I C5    1 
ATOM 8538  C C7    . DT  I 5 137 ? 90.96100  63.26100  85.75200  1.000 158.45360 ? 64  DT  I C7    1 
ATOM 8539  C C6    . DT  I 5 137 ? 88.51400  63.22100  86.16800  1.000 158.45360 ? 64  DT  I C6    1 
ATOM 8540  P P     . DA  I 5 138 ? 82.70000  61.37800  84.66500  1.000 166.00441 ? 65  DA  I P     1 
ATOM 8541  O OP1   . DA  I 5 138 ? 81.39100  60.84000  85.09500  1.000 166.00441 ? 65  DA  I OP1   1 
ATOM 8542  O OP2   . DA  I 5 138 ? 83.39700  60.76300  83.51400  1.000 166.00441 ? 65  DA  I OP2   1 
ATOM 8543  O "O5'" . DA  I 5 138 ? 82.54200  62.95000  84.37400  1.000 166.00441 ? 65  DA  I "O5'" 1 
ATOM 8544  C "C5'" . DA  I 5 138 ? 81.69500  63.75800  85.21000  1.000 166.00441 ? 65  DA  I "C5'" 1 
ATOM 8545  C "C4'" . DA  I 5 138 ? 82.09100  65.22700  85.14400  1.000 166.00441 ? 65  DA  I "C4'" 1 
ATOM 8546  O "O4'" . DA  I 5 138 ? 83.51900  65.33700  85.21900  1.000 166.00441 ? 65  DA  I "O4'" 1 
ATOM 8547  C "C3'" . DA  I 5 138 ? 81.67400  65.98700  83.87700  1.000 166.00441 ? 65  DA  I "C3'" 1 
ATOM 8548  O "O3'" . DA  I 5 138 ? 80.70400  66.99300  84.21700  1.000 166.00441 ? 65  DA  I "O3'" 1 
ATOM 8549  C "C2'" . DA  I 5 138 ? 82.98800  66.60000  83.35300  1.000 166.00441 ? 65  DA  I "C2'" 1 
ATOM 8550  C "C1'" . DA  I 5 138 ? 83.91000  66.50500  84.56000  1.000 166.00441 ? 65  DA  I "C1'" 1 
ATOM 8551  N N9    . DA  I 5 138 ? 85.32000  66.34000  84.22700  1.000 166.00441 ? 65  DA  I N9    1 
ATOM 8552  C C8    . DA  I 5 138 ? 85.91400  65.21300  83.74200  1.000 166.00441 ? 65  DA  I C8    1 
ATOM 8553  N N7    . DA  I 5 138 ? 87.20500  65.32300  83.56400  1.000 166.00441 ? 65  DA  I N7    1 
ATOM 8554  C C5    . DA  I 5 138 ? 87.48000  66.61900  83.95500  1.000 166.00441 ? 65  DA  I C5    1 
ATOM 8555  C C6    . DA  I 5 138 ? 88.67400  67.36200  84.00300  1.000 166.00441 ? 65  DA  I C6    1 
ATOM 8556  N N6    . DA  I 5 138 ? 89.86100  66.87400  83.62800  1.000 166.00441 ? 65  DA  I N6    1 
ATOM 8557  N N1    . DA  I 5 138 ? 88.60100  68.63100  84.44700  1.000 166.00441 ? 65  DA  I N1    1 
ATOM 8558  C C2    . DA  I 5 138 ? 87.41300  69.12000  84.81800  1.000 166.00441 ? 65  DA  I C2    1 
ATOM 8559  N N3    . DA  I 5 138 ? 86.22500  68.52000  84.82400  1.000 166.00441 ? 65  DA  I N3    1 
ATOM 8560  C C4    . DA  I 5 138 ? 86.32900  67.25800  84.38200  1.000 166.00441 ? 65  DA  I C4    1 
ATOM 8561  P P     . DC  I 5 139 ? 80.03600  67.93300  83.09200  1.000 173.95014 ? 66  DC  I P     1 
ATOM 8562  O OP1   . DC  I 5 139 ? 78.69600  68.31200  83.59200  1.000 173.95014 ? 66  DC  I OP1   1 
ATOM 8563  O OP2   . DC  I 5 139 ? 80.16100  67.25400  81.78300  1.000 173.95014 ? 66  DC  I OP2   1 
ATOM 8564  O "O5'" . DC  I 5 139 ? 80.94600  69.25300  83.07200  1.000 173.95014 ? 66  DC  I "O5'" 1 
ATOM 8565  C "C5'" . DC  I 5 139 ? 81.25900  69.92000  84.29600  1.000 173.95014 ? 66  DC  I "C5'" 1 
ATOM 8566  C "C4'" . DC  I 5 139 ? 82.25800  71.04800  84.07400  1.000 173.95014 ? 66  DC  I "C4'" 1 
ATOM 8567  O "O4'" . DC  I 5 139 ? 83.57200  70.50000  83.81900  1.000 173.95014 ? 66  DC  I "O4'" 1 
ATOM 8568  C "C3'" . DC  I 5 139 ? 81.96800  71.99700  82.90600  1.000 173.95014 ? 66  DC  I "C3'" 1 
ATOM 8569  O "O3'" . DC  I 5 139 ? 82.09600  73.35400  83.36700  1.000 173.95014 ? 66  DC  I "O3'" 1 
ATOM 8570  C "C2'" . DC  I 5 139 ? 83.04500  71.63200  81.88700  1.000 173.95014 ? 66  DC  I "C2'" 1 
ATOM 8571  C "C1'" . DC  I 5 139 ? 84.18800  71.25500  82.80700  1.000 173.95014 ? 66  DC  I "C1'" 1 
ATOM 8572  N N1    . DC  I 5 139 ? 85.23500  70.39400  82.19100  1.000 173.95014 ? 66  DC  I N1    1 
ATOM 8573  C C2    . DC  I 5 139 ? 86.55000  70.86200  82.08900  1.000 173.95014 ? 66  DC  I C2    1 
ATOM 8574  O O2    . DC  I 5 139 ? 86.82100  71.99400  82.50700  1.000 173.95014 ? 66  DC  I O2    1 
ATOM 8575  N N3    . DC  I 5 139 ? 87.49500  70.04300  81.56200  1.000 173.95014 ? 66  DC  I N3    1 
ATOM 8576  C C4    . DC  I 5 139 ? 87.16000  68.82300  81.13500  1.000 173.95014 ? 66  DC  I C4    1 
ATOM 8577  N N4    . DC  I 5 139 ? 88.11900  68.05300  80.61100  1.000 173.95014 ? 66  DC  I N4    1 
ATOM 8578  C C5    . DC  I 5 139 ? 85.82400  68.33800  81.22200  1.000 173.95014 ? 66  DC  I C5    1 
ATOM 8579  C C6    . DC  I 5 139 ? 84.90700  69.14600  81.75600  1.000 173.95014 ? 66  DC  I C6    1 
ATOM 8580  P P     . DA  I 5 140 ? 81.26000  74.54500  82.68700  1.000 180.83252 ? 67  DA  I P     1 
ATOM 8581  O OP1   . DA  I 5 140 ? 81.37100  75.73000  83.56600  1.000 180.83252 ? 67  DA  I OP1   1 
ATOM 8582  O OP2   . DA  I 5 140 ? 79.92200  74.00700  82.35900  1.000 180.83252 ? 67  DA  I OP2   1 
ATOM 8583  O "O5'" . DA  I 5 140 ? 82.02100  74.82800  81.30500  1.000 180.83252 ? 67  DA  I "O5'" 1 
ATOM 8584  C "C5'" . DA  I 5 140 ? 82.30900  76.17800  80.89100  1.000 180.83252 ? 67  DA  I "C5'" 1 
ATOM 8585  C "C4'" . DA  I 5 140 ? 83.68100  76.64900  81.35400  1.000 180.83252 ? 67  DA  I "C4'" 1 
ATOM 8586  O "O4'" . DA  I 5 140 ? 84.60000  75.53000  81.42800  1.000 180.83252 ? 67  DA  I "O4'" 1 
ATOM 8587  C "C3'" . DA  I 5 140 ? 84.35300  77.63800  80.41400  1.000 180.83252 ? 67  DA  I "C3'" 1 
ATOM 8588  O "O3'" . DA  I 5 140 ? 85.33300  78.40500  81.11800  1.000 180.83252 ? 67  DA  I "O3'" 1 
ATOM 8589  C "C2'" . DA  I 5 140 ? 85.00700  76.69100  79.43300  1.000 180.83252 ? 67  DA  I "C2'" 1 
ATOM 8590  C "C1'" . DA  I 5 140 ? 85.55900  75.64800  80.39100  1.000 180.83252 ? 67  DA  I "C1'" 1 
ATOM 8591  N N9    . DA  I 5 140 ? 85.76700  74.31900  79.82400  1.000 180.83252 ? 67  DA  I N9    1 
ATOM 8592  C C8    . DA  I 5 140 ? 84.81100  73.38300  79.58100  1.000 180.83252 ? 67  DA  I C8    1 
ATOM 8593  N N7    . DA  I 5 140 ? 85.27400  72.25500  79.10400  1.000 180.83252 ? 67  DA  I N7    1 
ATOM 8594  C C5    . DA  I 5 140 ? 86.63500  72.47400  79.00500  1.000 180.83252 ? 67  DA  I C5    1 
ATOM 8595  C C6    . DA  I 5 140 ? 87.69400  71.66700  78.55000  1.000 180.83252 ? 67  DA  I C6    1 
ATOM 8596  N N6    . DA  I 5 140 ? 87.52500  70.42300  78.09500  1.000 180.83252 ? 67  DA  I N6    1 
ATOM 8597  N N1    . DA  I 5 140 ? 88.93500  72.18700  78.58300  1.000 180.83252 ? 67  DA  I N1    1 
ATOM 8598  C C2    . DA  I 5 140 ? 89.10200  73.43700  79.03600  1.000 180.83252 ? 67  DA  I C2    1 
ATOM 8599  N N3    . DA  I 5 140 ? 88.18400  74.29100  79.49200  1.000 180.83252 ? 67  DA  I N3    1 
ATOM 8600  C C4    . DA  I 5 140 ? 86.96000  73.74300  79.44800  1.000 180.83252 ? 67  DA  I C4    1 
ATOM 8601  P P     . DT  I 5 141 ? 85.79500  79.84500  80.57200  1.000 186.43487 ? 68  DT  I P     1 
ATOM 8602  O OP1   . DT  I 5 141 ? 85.33200  80.85200  81.55000  1.000 186.43487 ? 68  DT  I OP1   1 
ATOM 8603  O OP2   . DT  I 5 141 ? 85.39200  79.95700  79.15600  1.000 186.43487 ? 68  DT  I OP2   1 
ATOM 8604  O "O5'" . DT  I 5 141 ? 87.39900  79.78700  80.60400  1.000 186.43487 ? 68  DT  I "O5'" 1 
ATOM 8605  C "C5'" . DT  I 5 141 ? 88.09100  78.57300  80.28200  1.000 186.43487 ? 68  DT  I "C5'" 1 
ATOM 8606  C "C4'" . DT  I 5 141 ? 89.09400  78.79500  79.15700  1.000 186.43487 ? 68  DT  I "C4'" 1 
ATOM 8607  O "O4'" . DT  I 5 141 ? 89.34900  77.53900  78.47200  1.000 186.43487 ? 68  DT  I "O4'" 1 
ATOM 8608  C "C3'" . DT  I 5 141 ? 88.63500  79.76900  78.07800  1.000 186.43487 ? 68  DT  I "C3'" 1 
ATOM 8609  O "O3'" . DT  I 5 141 ? 89.75500  80.50400  77.55900  1.000 186.43487 ? 68  DT  I "O3'" 1 
ATOM 8610  C "C2'" . DT  I 5 141 ? 88.03700  78.83600  77.03700  1.000 186.43487 ? 68  DT  I "C2'" 1 
ATOM 8611  C "C1'" . DT  I 5 141 ? 89.01100  77.66700  77.10600  1.000 186.43487 ? 68  DT  I "C1'" 1 
ATOM 8612  N N1    . DT  I 5 141 ? 88.43600  76.36000  76.63400  1.000 186.43487 ? 68  DT  I N1    1 
ATOM 8613  C C2    . DT  I 5 141 ? 89.28200  75.36000  76.20700  1.000 186.43487 ? 68  DT  I C2    1 
ATOM 8614  O O2    . DT  I 5 141 ? 90.49200  75.47600  76.17400  1.000 186.43487 ? 68  DT  I O2    1 
ATOM 8615  N N3    . DT  I 5 141 ? 88.64900  74.20800  75.81700  1.000 186.43487 ? 68  DT  I N3    1 
ATOM 8616  C C4    . DT  I 5 141 ? 87.28800  73.96200  75.81200  1.000 186.43487 ? 68  DT  I C4    1 
ATOM 8617  O O4    . DT  I 5 141 ? 86.80800  72.89900  75.44300  1.000 186.43487 ? 68  DT  I O4    1 
ATOM 8618  C C5    . DT  I 5 141 ? 86.46600  75.04200  76.26900  1.000 186.43487 ? 68  DT  I C5    1 
ATOM 8619  C C7    . DT  I 5 141 ? 84.97600  74.87700  76.29500  1.000 186.43487 ? 68  DT  I C7    1 
ATOM 8620  C C6    . DT  I 5 141 ? 87.07000  76.17700  76.64900  1.000 186.43487 ? 68  DT  I C6    1 
ATOM 8621  P P     . DC  I 5 142 ? 89.52700  81.94000  76.86900  1.000 190.40911 ? 69  DC  I P     1 
ATOM 8622  O OP1   . DC  I 5 142 ? 90.73000  82.76000  77.13400  1.000 190.40911 ? 69  DC  I OP1   1 
ATOM 8623  O OP2   . DC  I 5 142 ? 88.20600  82.42600  77.32600  1.000 190.40911 ? 69  DC  I OP2   1 
ATOM 8624  O "O5'" . DC  I 5 142 ? 89.41600  81.63600  75.29400  1.000 190.40911 ? 69  DC  I "O5'" 1 
ATOM 8625  C "C5'" . DC  I 5 142 ? 90.55700  81.75200  74.41800  1.000 190.40911 ? 69  DC  I "C5'" 1 
ATOM 8626  C "C4'" . DC  I 5 142 ? 91.60200  80.67900  74.68200  1.000 190.40911 ? 69  DC  I "C4'" 1 
ATOM 8627  O "O4'" . DC  I 5 142 ? 90.99900  79.38000  74.85500  1.000 190.40911 ? 69  DC  I "O4'" 1 
ATOM 8628  C "C3'" . DC  I 5 142 ? 92.64000  80.48600  73.58800  1.000 190.40911 ? 69  DC  I "C3'" 1 
ATOM 8629  O "O3'" . DC  I 5 142 ? 93.74800  79.82500  74.18500  1.000 190.40911 ? 69  DC  I "O3'" 1 
ATOM 8630  C "C2'" . DC  I 5 142 ? 91.87100  79.52600  72.66600  1.000 190.40911 ? 69  DC  I "C2'" 1 
ATOM 8631  C "C1'" . DC  I 5 142 ? 91.28200  78.58400  73.72100  1.000 190.40911 ? 69  DC  I "C1'" 1 
ATOM 8632  N N1    . DC  I 5 142 ? 90.04000  77.83000  73.38400  1.000 190.40911 ? 69  DC  I N1    1 
ATOM 8633  C C2    . DC  I 5 142 ? 90.12500  76.49800  72.96300  1.000 190.40911 ? 69  DC  I C2    1 
ATOM 8634  O O2    . DC  I 5 142 ? 91.23900  76.00200  72.74800  1.000 190.40911 ? 69  DC  I O2    1 
ATOM 8635  N N3    . DC  I 5 142 ? 88.97900  75.81300  72.72000  1.000 190.40911 ? 69  DC  I N3    1 
ATOM 8636  C C4    . DC  I 5 142 ? 87.79800  76.38700  72.95000  1.000 190.40911 ? 69  DC  I C4    1 
ATOM 8637  N N4    . DC  I 5 142 ? 86.69500  75.67000  72.71100  1.000 190.40911 ? 69  DC  I N4    1 
ATOM 8638  C C5    . DC  I 5 142 ? 87.69400  77.72200  73.43300  1.000 190.40911 ? 69  DC  I C5    1 
ATOM 8639  C C6    . DC  I 5 142 ? 88.82900  78.39400  73.63800  1.000 190.40911 ? 69  DC  I C6    1 
ATOM 8640  P P     . DG  I 5 143 ? 95.12000  80.56100  74.60000  1.000 192.73153 ? 70  DG  I P     1 
ATOM 8641  O OP1   . DG  I 5 143 ? 95.96000  79.53300  75.25500  1.000 192.73153 ? 70  DG  I OP1   1 
ATOM 8642  O OP2   . DG  I 5 143 ? 94.72000  81.73700  75.40400  1.000 192.73153 ? 70  DG  I OP2   1 
ATOM 8643  O "O5'" . DG  I 5 143 ? 95.82200  81.15600  73.27600  1.000 192.73153 ? 70  DG  I "O5'" 1 
ATOM 8644  C "C5'" . DG  I 5 143 ? 97.17500  80.73400  72.99700  1.000 192.73153 ? 70  DG  I "C5'" 1 
ATOM 8645  C "C4'" . DG  I 5 143 ? 97.18400  79.41400  72.25200  1.000 192.73153 ? 70  DG  I "C4'" 1 
ATOM 8646  O "O4'" . DG  I 5 143 ? 95.88800  79.30400  71.62300  1.000 192.73153 ? 70  DG  I "O4'" 1 
ATOM 8647  C "C3'" . DG  I 5 143 ? 98.12800  79.32200  71.06400  1.000 192.73153 ? 70  DG  I "C3'" 1 
ATOM 8648  O "O3'" . DG  I 5 143 ? 99.33900  78.67400  71.44200  1.000 192.73153 ? 70  DG  I "O3'" 1 
ATOM 8649  C "C2'" . DG  I 5 143 ? 97.36100  78.54100  69.99500  1.000 192.73153 ? 70  DG  I "C2'" 1 
ATOM 8650  C "C1'" . DG  I 5 143 ? 95.97000  78.36700  70.58700  1.000 192.73153 ? 70  DG  I "C1'" 1 
ATOM 8651  N N9    . DG  I 5 143 ? 94.99400  78.78100  69.59200  1.000 192.73153 ? 70  DG  I N9    1 
ATOM 8652  C C8    . DG  I 5 143 ? 95.18600  79.77000  68.65900  1.000 192.73153 ? 70  DG  I C8    1 
ATOM 8653  N N7    . DG  I 5 143 ? 94.17500  79.95000  67.87000  1.000 192.73153 ? 70  DG  I N7    1 
ATOM 8654  C C5    . DG  I 5 143 ? 93.24900  79.01400  68.29200  1.000 192.73153 ? 70  DG  I C5    1 
ATOM 8655  C C6    . DG  I 5 143 ? 91.96000  78.74700  67.80000  1.000 192.73153 ? 70  DG  I C6    1 
ATOM 8656  O O6    . DG  I 5 143 ? 91.37500  79.29900  66.87700  1.000 192.73153 ? 70  DG  I O6    1 
ATOM 8657  N N1    . DG  I 5 143 ? 91.34100  77.72700  68.49700  1.000 192.73153 ? 70  DG  I N1    1 
ATOM 8658  C C2    . DG  I 5 143 ? 91.89300  77.04800  69.54600  1.000 192.73153 ? 70  DG  I C2    1 
ATOM 8659  N N2    . DG  I 5 143 ? 91.13500  76.09300  70.07200  1.000 192.73153 ? 70  DG  I N2    1 
ATOM 8660  N N3    . DG  I 5 143 ? 93.11200  77.28100  70.03200  1.000 192.73153 ? 70  DG  I N3    1 
ATOM 8661  C C4    . DG  I 5 143 ? 93.73200  78.27800  69.35400  1.000 192.73153 ? 70  DG  I C4    1 
ATOM 8662  P P     . DA  I 5 144 ? 100.65400 78.84100  70.53500  1.000 193.07870 ? 71  DA  I P     1 
ATOM 8663  O OP1   . DA  I 5 144 ? 101.83100 78.70400  71.42300  1.000 193.07870 ? 71  DA  I OP1   1 
ATOM 8664  O OP2   . DA  I 5 144 ? 100.49000 80.05800  69.70700  1.000 193.07870 ? 71  DA  I OP2   1 
ATOM 8665  O "O5'" . DA  I 5 144 ? 100.57900 77.56400  69.56600  1.000 193.07870 ? 71  DA  I "O5'" 1 
ATOM 8666  C "C5'" . DA  I 5 144 ? 100.43400 76.27200  70.15800  1.000 193.07870 ? 71  DA  I "C5'" 1 
ATOM 8667  C "C4'" . DA  I 5 144 ? 100.20900 75.16700  69.13400  1.000 193.07870 ? 71  DA  I "C4'" 1 
ATOM 8668  O "O4'" . DA  I 5 144 ? 98.85600  75.22800  68.61700  1.000 193.07870 ? 71  DA  I "O4'" 1 
ATOM 8669  C "C3'" . DA  I 5 144 ? 101.13800 75.17800  67.91300  1.000 193.07870 ? 71  DA  I "C3'" 1 
ATOM 8670  O "O3'" . DA  I 5 144 ? 101.73800 73.89800  67.75800  1.000 193.07870 ? 71  DA  I "O3'" 1 
ATOM 8671  C "C2'" . DA  I 5 144 ? 100.20300 75.50000  66.74600  1.000 193.07870 ? 71  DA  I "C2'" 1 
ATOM 8672  C "C1'" . DA  I 5 144 ? 98.88300  74.93600  67.24200  1.000 193.07870 ? 71  DA  I "C1'" 1 
ATOM 8673  N N9    . DA  I 5 144 ? 97.71700  75.53300  66.59400  1.000 193.07870 ? 71  DA  I N9    1 
ATOM 8674  C C8    . DA  I 5 144 ? 97.70600  76.27200  65.44600  1.000 193.07870 ? 71  DA  I C8    1 
ATOM 8675  N N7    . DA  I 5 144 ? 96.51400  76.69000  65.09600  1.000 193.07870 ? 71  DA  I N7    1 
ATOM 8676  C C5    . DA  I 5 144 ? 95.68900  76.20800  66.09400  1.000 193.07870 ? 71  DA  I C5    1 
ATOM 8677  C C6    . DA  I 5 144 ? 94.30200  76.31200  66.31300  1.000 193.07870 ? 71  DA  I C6    1 
ATOM 8678  N N6    . DA  I 5 144 ? 93.47600  76.97000  65.49400  1.000 193.07870 ? 71  DA  I N6    1 
ATOM 8679  N N1    . DA  I 5 144 ? 93.79500  75.70800  67.40800  1.000 193.07870 ? 71  DA  I N1    1 
ATOM 8680  C C2    . DA  I 5 144 ? 94.62300  75.05000  68.22800  1.000 193.07870 ? 71  DA  I C2    1 
ATOM 8681  N N3    . DA  I 5 144 ? 95.93900  74.88700  68.12900  1.000 193.07870 ? 71  DA  I N3    1 
ATOM 8682  C C4    . DA  I 5 144 ? 96.41400  75.49500  67.02900  1.000 193.07870 ? 71  DA  I C4    1 
ATOM 8683  P P     . DT  I 5 145 ? 103.04600 73.71400  66.84200  1.000 193.89909 ? 72  DT  I P     1 
ATOM 8684  O OP1   . DT  I 5 145 ? 103.71000 72.45300  67.24200  1.000 193.89909 ? 72  DT  I OP1   1 
ATOM 8685  O OP2   . DT  I 5 145 ? 103.79100 74.99100  66.89400  1.000 193.89909 ? 72  DT  I OP2   1 
ATOM 8686  O "O5'" . DT  I 5 145 ? 102.46200 73.55300  65.35700  1.000 193.89909 ? 72  DT  I "O5'" 1 
ATOM 8687  C "C5'" . DT  I 5 145 ? 102.14000 72.25200  64.85400  1.000 193.89909 ? 72  DT  I "C5'" 1 
ATOM 8688  C "C4'" . DT  I 5 145 ? 100.78600 71.79200  65.37400  1.000 193.89909 ? 72  DT  I "C4'" 1 
ATOM 8689  O "O4'" . DT  I 5 145 ? 99.75900  72.71500  64.93200  1.000 193.89909 ? 72  DT  I "O4'" 1 
ATOM 8690  C "C3'" . DT  I 5 145 ? 100.33800 70.40000  64.90700  1.000 193.89909 ? 72  DT  I "C3'" 1 
ATOM 8691  O "O3'" . DT  I 5 145 ? 99.98300  69.60700  66.03000  1.000 193.89909 ? 72  DT  I "O3'" 1 
ATOM 8692  C "C2'" . DT  I 5 145 ? 99.12000  70.68100  64.02100  1.000 193.89909 ? 72  DT  I "C2'" 1 
ATOM 8693  C "C1'" . DT  I 5 145 ? 98.60700  71.98800  64.60200  1.000 193.89909 ? 72  DT  I "C1'" 1 
ATOM 8694  N N1    . DT  I 5 145 ? 97.78700  72.78800  63.64300  1.000 193.89909 ? 72  DT  I N1    1 
ATOM 8695  C C2    . DT  I 5 145 ? 96.46200  73.02700  63.92800  1.000 193.89909 ? 72  DT  I C2    1 
ATOM 8696  O O2    . DT  I 5 145 ? 95.91700  72.63900  64.94600  1.000 193.89909 ? 72  DT  I O2    1 
ATOM 8697  N N3    . DT  I 5 145 ? 95.79700  73.76000  62.98400  1.000 193.89909 ? 72  DT  I N3    1 
ATOM 8698  C C4    . DT  I 5 145 ? 96.30700  74.25500  61.79900  1.000 193.89909 ? 72  DT  I C4    1 
ATOM 8699  O O4    . DT  I 5 145 ? 95.62600  74.90200  61.01200  1.000 193.89909 ? 72  DT  I O4    1 
ATOM 8700  C C5    . DT  I 5 145 ? 97.69800  73.95900  61.55400  1.000 193.89909 ? 72  DT  I C5    1 
ATOM 8701  C C7    . DT  I 5 145 ? 98.36400  74.44500  60.30100  1.000 193.89909 ? 72  DT  I C7    1 
ATOM 8702  C C6    . DT  I 5 145 ? 98.36200  73.24300  62.47500  1.000 193.89909 ? 72  DT  I C6    1 
ATOM 8703  O "O5'" . DA  J 6 1   ? 85.77900  82.31700  64.00100  1.000 192.76240 ? -72 DA  J "O5'" 1 
ATOM 8704  C "C5'" . DA  J 6 1   ? 87.01800  81.87400  63.46200  1.000 192.76240 ? -72 DA  J "C5'" 1 
ATOM 8705  C "C4'" . DA  J 6 1   ? 87.13200  80.36100  63.54100  1.000 192.76240 ? -72 DA  J "C4'" 1 
ATOM 8706  O "O4'" . DA  J 6 1   ? 88.38700  79.93900  62.94000  1.000 192.76240 ? -72 DA  J "O4'" 1 
ATOM 8707  C "C3'" . DA  J 6 1   ? 87.11700  79.78500  64.95500  1.000 192.76240 ? -72 DA  J "C3'" 1 
ATOM 8708  O "O3'" . DA  J 6 1   ? 86.36600  78.55200  64.99500  1.000 192.76240 ? -72 DA  J "O3'" 1 
ATOM 8709  C "C2'" . DA  J 6 1   ? 88.58900  79.57500  65.27500  1.000 192.76240 ? -72 DA  J "C2'" 1 
ATOM 8710  C "C1'" . DA  J 6 1   ? 89.18000  79.27900  63.90400  1.000 192.76240 ? -72 DA  J "C1'" 1 
ATOM 8711  N N9    . DA  J 6 1   ? 90.58700  79.64900  63.74200  1.000 192.76240 ? -72 DA  J N9    1 
ATOM 8712  C C8    . DA  J 6 1   ? 91.21300  80.76900  64.21600  1.000 192.76240 ? -72 DA  J C8    1 
ATOM 8713  N N7    . DA  J 6 1   ? 92.49900  80.80700  63.95500  1.000 192.76240 ? -72 DA  J N7    1 
ATOM 8714  C C5    . DA  J 6 1   ? 92.73900  79.61400  63.29400  1.000 192.76240 ? -72 DA  J C5    1 
ATOM 8715  C C6    . DA  J 6 1   ? 93.90900  79.04300  62.75000  1.000 192.76240 ? -72 DA  J C6    1 
ATOM 8716  N N6    . DA  J 6 1   ? 95.10700  79.63500  62.79500  1.000 192.76240 ? -72 DA  J N6    1 
ATOM 8717  N N1    . DA  J 6 1   ? 93.79900  77.83200  62.15500  1.000 192.76240 ? -72 DA  J N1    1 
ATOM 8718  C C2    . DA  J 6 1   ? 92.60000  77.23900  62.10900  1.000 192.76240 ? -72 DA  J C2    1 
ATOM 8719  N N3    . DA  J 6 1   ? 91.43500  77.67700  62.58300  1.000 192.76240 ? -72 DA  J N3    1 
ATOM 8720  C C4    . DA  J 6 1   ? 91.57400  78.88100  63.16800  1.000 192.76240 ? -72 DA  J C4    1 
ATOM 8721  P P     . DT  J 6 2   ? 85.59500  78.13900  66.34600  1.000 191.36634 ? -71 DT  J P     1 
ATOM 8722  O OP1   . DT  J 6 2   ? 84.87800  79.33800  66.83200  1.000 191.36634 ? -71 DT  J OP1   1 
ATOM 8723  O OP2   . DT  J 6 2   ? 86.58500  77.47800  67.22300  1.000 191.36634 ? -71 DT  J OP2   1 
ATOM 8724  O "O5'" . DT  J 6 2   ? 84.52300  77.02400  65.90700  1.000 191.36634 ? -71 DT  J "O5'" 1 
ATOM 8725  C "C5'" . DT  J 6 2   ? 83.30500  77.48500  65.35000  1.000 191.36634 ? -71 DT  J "C5'" 1 
ATOM 8726  C "C4'" . DT  J 6 2   ? 82.65400  76.51400  64.37000  1.000 191.36634 ? -71 DT  J "C4'" 1 
ATOM 8727  O "O4'" . DT  J 6 2   ? 83.30700  76.65100  63.07500  1.000 191.36634 ? -71 DT  J "O4'" 1 
ATOM 8728  C "C3'" . DT  J 6 2   ? 82.83300  75.04200  64.70000  1.000 191.36634 ? -71 DT  J "C3'" 1 
ATOM 8729  O "O3'" . DT  J 6 2   ? 81.78900  74.59900  65.54500  1.000 191.36634 ? -71 DT  J "O3'" 1 
ATOM 8730  C "C2'" . DT  J 6 2   ? 82.73700  74.36700  63.33700  1.000 191.36634 ? -71 DT  J "C2'" 1 
ATOM 8731  C "C1'" . DT  J 6 2   ? 83.38700  75.38700  62.41600  1.000 191.36634 ? -71 DT  J "C1'" 1 
ATOM 8732  N N1    . DT  J 6 2   ? 84.80700  75.01400  62.10600  1.000 191.36634 ? -71 DT  J N1    1 
ATOM 8733  C C2    . DT  J 6 2   ? 85.03300  74.04200  61.15600  1.000 191.36634 ? -71 DT  J C2    1 
ATOM 8734  O O2    . DT  J 6 2   ? 84.14700  73.54800  60.48200  1.000 191.36634 ? -71 DT  J O2    1 
ATOM 8735  N N3    . DT  J 6 2   ? 86.34900  73.72600  60.95800  1.000 191.36634 ? -71 DT  J N3    1 
ATOM 8736  C C4    . DT  J 6 2   ? 87.43700  74.22600  61.64000  1.000 191.36634 ? -71 DT  J C4    1 
ATOM 8737  O O4    . DT  J 6 2   ? 88.58600  73.86900  61.40000  1.000 191.36634 ? -71 DT  J O4    1 
ATOM 8738  C C5    . DT  J 6 2   ? 87.13300  75.19600  62.65800  1.000 191.36634 ? -71 DT  J C5    1 
ATOM 8739  C C7    . DT  J 6 2   ? 88.23800  75.79400  63.46200  1.000 191.36634 ? -71 DT  J C7    1 
ATOM 8740  C C6    . DT  J 6 2   ? 85.84700  75.53200  62.85400  1.000 191.36634 ? -71 DT  J C6    1 
ATOM 8741  P P     . DC  J 6 3   ? 82.09700  73.54400  66.71600  1.000 191.22620 ? -70 DC  J P     1 
ATOM 8742  O OP1   . DC  J 6 3   ? 80.81700  72.91100  67.10400  1.000 191.22620 ? -70 DC  J OP1   1 
ATOM 8743  O OP2   . DC  J 6 3   ? 82.90400  74.24600  67.73600  1.000 191.22620 ? -70 DC  J OP2   1 
ATOM 8744  O "O5'" . DC  J 6 3   ? 83.01900  72.44200  66.00300  1.000 191.22620 ? -70 DC  J "O5'" 1 
ATOM 8745  C "C5'" . DC  J 6 3   ? 83.32200  71.22500  66.67700  1.000 191.22620 ? -70 DC  J "C5'" 1 
ATOM 8746  C "C4'" . DC  J 6 3   ? 84.54800  70.54300  66.08600  1.000 191.22620 ? -70 DC  J "C4'" 1 
ATOM 8747  O "O4'" . DC  J 6 3   ? 85.66100  71.46400  66.02600  1.000 191.22620 ? -70 DC  J "O4'" 1 
ATOM 8748  C "C3'" . DC  J 6 3   ? 85.05900  69.36500  66.89200  1.000 191.22620 ? -70 DC  J "C3'" 1 
ATOM 8749  O "O3'" . DC  J 6 3   ? 85.79400  68.48000  66.02900  1.000 191.22620 ? -70 DC  J "O3'" 1 
ATOM 8750  C "C2'" . DC  J 6 3   ? 85.96000  70.06500  67.91500  1.000 191.22620 ? -70 DC  J "C2'" 1 
ATOM 8751  C "C1'" . DC  J 6 3   ? 86.57400  71.18600  67.07700  1.000 191.22620 ? -70 DC  J "C1'" 1 
ATOM 8752  N N1    . DC  J 6 3   ? 86.83400  72.46800  67.80200  1.000 191.22620 ? -70 DC  J N1    1 
ATOM 8753  C C2    . DC  J 6 3   ? 88.11900  73.02100  67.78600  1.000 191.22620 ? -70 DC  J C2    1 
ATOM 8754  O O2    . DC  J 6 3   ? 89.02900  72.41100  67.21600  1.000 191.22620 ? -70 DC  J O2    1 
ATOM 8755  N N3    . DC  J 6 3   ? 88.33400  74.20200  68.41500  1.000 191.22620 ? -70 DC  J N3    1 
ATOM 8756  C C4    . DC  J 6 3   ? 87.32500  74.82900  69.02200  1.000 191.22620 ? -70 DC  J C4    1 
ATOM 8757  N N4    . DC  J 6 3   ? 87.58600  75.99200  69.62600  1.000 191.22620 ? -70 DC  J N4    1 
ATOM 8758  C C5    . DC  J 6 3   ? 86.00600  74.29200  69.03300  1.000 191.22620 ? -70 DC  J C5    1 
ATOM 8759  C C6    . DC  J 6 3   ? 85.80800  73.12500  68.41200  1.000 191.22620 ? -70 DC  J C6    1 
ATOM 8760  P P     . DG  J 6 4   ? 86.46300  67.12500  66.58600  1.000 188.34413 ? -69 DG  J P     1 
ATOM 8761  O OP1   . DG  J 6 4   ? 86.47400  66.14400  65.48000  1.000 188.34413 ? -69 DG  J OP1   1 
ATOM 8762  O OP2   . DG  J 6 4   ? 85.78600  66.77100  67.85200  1.000 188.34413 ? -69 DG  J OP2   1 
ATOM 8763  O "O5'" . DG  J 6 4   ? 87.97300  67.51800  66.92800  1.000 188.34413 ? -69 DG  J "O5'" 1 
ATOM 8764  C "C5'" . DG  J 6 4   ? 88.73500  66.64900  67.75800  1.000 188.34413 ? -69 DG  J "C5'" 1 
ATOM 8765  C "C4'" . DG  J 6 4   ? 90.15800  67.14100  67.92800  1.000 188.34413 ? -69 DG  J "C4'" 1 
ATOM 8766  O "O4'" . DG  J 6 4   ? 90.12700  68.52000  68.34800  1.000 188.34413 ? -69 DG  J "O4'" 1 
ATOM 8767  C "C3'" . DG  J 6 4   ? 90.95100  66.42400  69.00100  1.000 188.34413 ? -69 DG  J "C3'" 1 
ATOM 8768  O "O3'" . DG  J 6 4   ? 92.34600  66.59300  68.76300  1.000 188.34413 ? -69 DG  J "O3'" 1 
ATOM 8769  C "C2'" . DG  J 6 4   ? 90.49300  67.17200  70.24100  1.000 188.34413 ? -69 DG  J "C2'" 1 
ATOM 8770  C "C1'" . DG  J 6 4   ? 90.45200  68.60600  69.72100  1.000 188.34413 ? -69 DG  J "C1'" 1 
ATOM 8771  N N9    . DG  J 6 4   ? 89.41000  69.42200  70.32500  1.000 188.34413 ? -69 DG  J N9    1 
ATOM 8772  C C8    . DG  J 6 4   ? 88.09200  69.07900  70.49300  1.000 188.34413 ? -69 DG  J C8    1 
ATOM 8773  N N7    . DG  J 6 4   ? 87.37400  70.02200  71.03400  1.000 188.34413 ? -69 DG  J N7    1 
ATOM 8774  C C5    . DG  J 6 4   ? 88.27400  71.05700  71.23500  1.000 188.34413 ? -69 DG  J C5    1 
ATOM 8775  C C6    . DG  J 6 4   ? 88.07400  72.33900  71.79300  1.000 188.34413 ? -69 DG  J C6    1 
ATOM 8776  O O6    . DG  J 6 4   ? 87.02800  72.82700  72.23400  1.000 188.34413 ? -69 DG  J O6    1 
ATOM 8777  N N1    . DG  J 6 4   ? 89.25100  73.07900  71.81100  1.000 188.34413 ? -69 DG  J N1    1 
ATOM 8778  C C2    . DG  J 6 4   ? 90.46800  72.63800  71.34300  1.000 188.34413 ? -69 DG  J C2    1 
ATOM 8779  N N2    . DG  J 6 4   ? 91.49300  73.48800  71.45200  1.000 188.34413 ? -69 DG  J N2    1 
ATOM 8780  N N3    . DG  J 6 4   ? 90.66900  71.43700  70.81900  1.000 188.34413 ? -69 DG  J N3    1 
ATOM 8781  C C4    . DG  J 6 4   ? 89.53200  70.70500  70.79500  1.000 188.34413 ? -69 DG  J C4    1 
ATOM 8782  P P     . DA  J 6 5   ? 93.35400  65.34300  68.83900  1.000 183.52356 ? -68 DA  J P     1 
ATOM 8783  O OP1   . DA  J 6 5   ? 93.86400  65.09000  67.47400  1.000 183.52356 ? -68 DA  J OP1   1 
ATOM 8784  O OP2   . DA  J 6 5   ? 92.68100  64.26200  69.59000  1.000 183.52356 ? -68 DA  J OP2   1 
ATOM 8785  O "O5'" . DA  J 6 5   ? 94.56400  65.87400  69.74500  1.000 183.52356 ? -68 DA  J "O5'" 1 
ATOM 8786  C "C5'" . DA  J 6 5   ? 94.41500  65.97100  71.15400  1.000 183.52356 ? -68 DA  J "C5'" 1 
ATOM 8787  C "C4'" . DA  J 6 5   ? 94.91300  67.31300  71.66600  1.000 183.52356 ? -68 DA  J "C4'" 1 
ATOM 8788  O "O4'" . DA  J 6 5   ? 93.79000  68.21800  71.80700  1.000 183.52356 ? -68 DA  J "O4'" 1 
ATOM 8789  C "C3'" . DA  J 6 5   ? 95.59100  67.26800  73.03400  1.000 183.52356 ? -68 DA  J "C3'" 1 
ATOM 8790  O "O3'" . DA  J 6 5   ? 96.72400  68.11500  73.04100  1.000 183.52356 ? -68 DA  J "O3'" 1 
ATOM 8791  C "C2'" . DA  J 6 5   ? 94.50500  67.77400  73.97400  1.000 183.52356 ? -68 DA  J "C2'" 1 
ATOM 8792  C "C1'" . DA  J 6 5   ? 93.79800  68.78700  73.09600  1.000 183.52356 ? -68 DA  J "C1'" 1 
ATOM 8793  N N9    . DA  J 6 5   ? 92.40700  68.99600  73.47200  1.000 183.52356 ? -68 DA  J N9    1 
ATOM 8794  C C8    . DA  J 6 5   ? 91.41000  68.06500  73.43300  1.000 183.52356 ? -68 DA  J C8    1 
ATOM 8795  N N7    . DA  J 6 5   ? 90.24400  68.51700  73.80900  1.000 183.52356 ? -68 DA  J N7    1 
ATOM 8796  C C5    . DA  J 6 5   ? 90.48900  69.83700  74.12500  1.000 183.52356 ? -68 DA  J C5    1 
ATOM 8797  C C6    . DA  J 6 5   ? 89.65500  70.85900  74.59000  1.000 183.52356 ? -68 DA  J C6    1 
ATOM 8798  N N6    . DA  J 6 5   ? 88.35800  70.68200  74.82600  1.000 183.52356 ? -68 DA  J N6    1 
ATOM 8799  N N1    . DA  J 6 5   ? 90.20500  72.07100  74.80800  1.000 183.52356 ? -68 DA  J N1    1 
ATOM 8800  C C2    . DA  J 6 5   ? 91.51300  72.24400  74.57000  1.000 183.52356 ? -68 DA  J C2    1 
ATOM 8801  N N3    . DA  J 6 5   ? 92.40300  71.35000  74.12700  1.000 183.52356 ? -68 DA  J N3    1 
ATOM 8802  C C4    . DA  J 6 5   ? 91.81900  70.15600  73.92200  1.000 183.52356 ? -68 DA  J C4    1 
ATOM 8803  P P     . DT  J 6 6   ? 97.72000  68.12300  74.30000  1.000 177.46662 ? -67 DT  J P     1 
ATOM 8804  O OP1   . DT  J 6 6   ? 99.06000  68.50200  73.80000  1.000 177.46662 ? -67 DT  J OP1   1 
ATOM 8805  O OP2   . DT  J 6 6   ? 97.54400  66.84200  75.01800  1.000 177.46662 ? -67 DT  J OP2   1 
ATOM 8806  O "O5'" . DT  J 6 6   ? 97.16200  69.29900  75.23200  1.000 177.46662 ? -67 DT  J "O5'" 1 
ATOM 8807  C "C5'" . DT  J 6 6   ? 97.15700  70.64200  74.75400  1.000 177.46662 ? -67 DT  J "C5'" 1 
ATOM 8808  C "C4'" . DT  J 6 6   ? 96.62900  71.61400  75.80400  1.000 177.46662 ? -67 DT  J "C4'" 1 
ATOM 8809  O "O4'" . DT  J 6 6   ? 95.17900  71.53500  75.89600  1.000 177.46662 ? -67 DT  J "O4'" 1 
ATOM 8810  C "C3'" . DT  J 6 6   ? 97.14800  71.40800  77.22900  1.000 177.46662 ? -67 DT  J "C3'" 1 
ATOM 8811  O "O3'" . DT  J 6 6   ? 97.39400  72.67400  77.81700  1.000 177.46662 ? -67 DT  J "O3'" 1 
ATOM 8812  C "C2'" . DT  J 6 6   ? 95.97500  70.71300  77.91300  1.000 177.46662 ? -67 DT  J "C2'" 1 
ATOM 8813  C "C1'" . DT  J 6 6   ? 94.81900  71.44200  77.25800  1.000 177.46662 ? -67 DT  J "C1'" 1 
ATOM 8814  N N1    . DT  J 6 6   ? 93.50300  70.75300  77.36500  1.000 177.46662 ? -67 DT  J N1    1 
ATOM 8815  C C2    . DT  J 6 6   ? 92.40400  71.47600  77.76400  1.000 177.46662 ? -67 DT  J C2    1 
ATOM 8816  O O2    . DT  J 6 6   ? 92.45000  72.65900  78.04600  1.000 177.46662 ? -67 DT  J O2    1 
ATOM 8817  N N3    . DT  J 6 6   ? 91.24100  70.76200  77.82100  1.000 177.46662 ? -67 DT  J N3    1 
ATOM 8818  C C4    . DT  J 6 6   ? 91.06800  69.42400  77.52400  1.000 177.46662 ? -67 DT  J C4    1 
ATOM 8819  O O4    . DT  J 6 6   ? 89.97800  68.86900  77.60600  1.000 177.46662 ? -67 DT  J O4    1 
ATOM 8820  C C5    . DT  J 6 6   ? 92.25500  68.72400  77.11100  1.000 177.46662 ? -67 DT  J C5    1 
ATOM 8821  C C7    . DT  J 6 6   ? 92.18300  67.26800  76.77000  1.000 177.46662 ? -67 DT  J C7    1 
ATOM 8822  C C6    . DT  J 6 6   ? 93.40400  69.41300  77.05100  1.000 177.46662 ? -67 DT  J C6    1 
ATOM 8823  P P     . DG  J 6 7   ? 98.84600  73.05500  78.38100  1.000 169.92902 ? -66 DG  J P     1 
ATOM 8824  O OP1   . DG  J 6 7   ? 99.53900  73.83700  77.33400  1.000 169.92902 ? -66 DG  J OP1   1 
ATOM 8825  O OP2   . DG  J 6 7   ? 99.45900  71.82600  78.93100  1.000 169.92902 ? -66 DG  J OP2   1 
ATOM 8826  O "O5'" . DG  J 6 7   ? 98.52300  74.02800  79.60600  1.000 169.92902 ? -66 DG  J "O5'" 1 
ATOM 8827  C "C5'" . DG  J 6 7   ? 97.89600  73.51500  80.77700  1.000 169.92902 ? -66 DG  J "C5'" 1 
ATOM 8828  C "C4'" . DG  J 6 7   ? 96.75400  74.41300  81.21800  1.000 169.92902 ? -66 DG  J "C4'" 1 
ATOM 8829  O "O4'" . DG  J 6 7   ? 95.50200  73.88300  80.69900  1.000 169.92902 ? -66 DG  J "O4'" 1 
ATOM 8830  C "C3'" . DG  J 6 7   ? 96.57500  74.50400  82.72900  1.000 169.92902 ? -66 DG  J "C3'" 1 
ATOM 8831  O "O3'" . DG  J 6 7   ? 96.08000  75.79100  83.10600  1.000 169.92902 ? -66 DG  J "O3'" 1 
ATOM 8832  C "C2'" . DG  J 6 7   ? 95.55200  73.41400  82.99900  1.000 169.92902 ? -66 DG  J "C2'" 1 
ATOM 8833  C "C1'" . DG  J 6 7   ? 94.65900  73.52100  81.77100  1.000 169.92902 ? -66 DG  J "C1'" 1 
ATOM 8834  N N9    . DG  J 6 7   ? 93.98600  72.26600  81.44700  1.000 169.92902 ? -66 DG  J N9    1 
ATOM 8835  C C8    . DG  J 6 7   ? 94.57600  71.09300  81.05300  1.000 169.92902 ? -66 DG  J C8    1 
ATOM 8836  N N7    . DG  J 6 7   ? 93.73000  70.12100  80.86500  1.000 169.92902 ? -66 DG  J N7    1 
ATOM 8837  C C5    . DG  J 6 7   ? 92.49900  70.67500  81.18500  1.000 169.92902 ? -66 DG  J C5    1 
ATOM 8838  C C6    . DG  J 6 7   ? 91.20700  70.09500  81.17300  1.000 169.92902 ? -66 DG  J C6    1 
ATOM 8839  O O6    . DG  J 6 7   ? 90.88900  68.93700  80.87100  1.000 169.92902 ? -66 DG  J O6    1 
ATOM 8840  N N1    . DG  J 6 7   ? 90.23100  71.00500  81.56700  1.000 169.92902 ? -66 DG  J N1    1 
ATOM 8841  C C2    . DG  J 6 7   ? 90.47100  72.31000  81.92600  1.000 169.92902 ? -66 DG  J C2    1 
ATOM 8842  N N2    . DG  J 6 7   ? 89.40300  73.04100  82.27600  1.000 169.92902 ? -66 DG  J N2    1 
ATOM 8843  N N3    . DG  J 6 7   ? 91.67600  72.86600  81.93600  1.000 169.92902 ? -66 DG  J N3    1 
ATOM 8844  C C4    . DG  J 6 7   ? 92.63900  71.99200  81.55600  1.000 169.92902 ? -66 DG  J C4    1 
ATOM 8845  P P     . DT  J 6 8   ? 96.01600  76.20100  84.66100  1.000 164.95614 ? -65 DT  J P     1 
ATOM 8846  O OP1   . DT  J 6 8   ? 96.16700  77.66900  84.73000  1.000 164.95614 ? -65 DT  J OP1   1 
ATOM 8847  O OP2   . DT  J 6 8   ? 96.95600  75.32800  85.39500  1.000 164.95614 ? -65 DT  J OP2   1 
ATOM 8848  O "O5'" . DT  J 6 8   ? 94.53000  75.82100  85.11900  1.000 164.95614 ? -65 DT  J "O5'" 1 
ATOM 8849  C "C5'" . DT  J 6 8   ? 93.41400  76.50700  84.56100  1.000 164.95614 ? -65 DT  J "C5'" 1 
ATOM 8850  C "C4'" . DT  J 6 8   ? 92.10600  75.92100  85.06900  1.000 164.95614 ? -65 DT  J "C4'" 1 
ATOM 8851  O "O4'" . DT  J 6 8   ? 91.95900  74.57300  84.57200  1.000 164.95614 ? -65 DT  J "O4'" 1 
ATOM 8852  C "C3'" . DT  J 6 8   ? 91.94900  75.82500  86.59600  1.000 164.95614 ? -65 DT  J "C3'" 1 
ATOM 8853  O "O3'" . DT  J 6 8   ? 90.71200  76.42600  86.98600  1.000 164.95614 ? -65 DT  J "O3'" 1 
ATOM 8854  C "C2'" . DT  J 6 8   ? 91.93400  74.31500  86.85400  1.000 164.95614 ? -65 DT  J "C2'" 1 
ATOM 8855  C "C1'" . DT  J 6 8   ? 91.31900  73.81800  85.56000  1.000 164.95614 ? -65 DT  J "C1'" 1 
ATOM 8856  N N1    . DT  J 6 8   ? 91.54700  72.38000  85.27300  1.000 164.95614 ? -65 DT  J N1    1 
ATOM 8857  C C2    . DT  J 6 8   ? 90.47200  71.53100  85.27000  1.000 164.95614 ? -65 DT  J C2    1 
ATOM 8858  O O2    . DT  J 6 8   ? 89.33200  71.90000  85.48500  1.000 164.95614 ? -65 DT  J O2    1 
ATOM 8859  N N3    . DT  J 6 8   ? 90.77100  70.23100  84.98100  1.000 164.95614 ? -65 DT  J N3    1 
ATOM 8860  C C4    . DT  J 6 8   ? 92.01400  69.69900  84.71600  1.000 164.95614 ? -65 DT  J C4    1 
ATOM 8861  O O4    . DT  J 6 8   ? 92.17700  68.50900  84.47300  1.000 164.95614 ? -65 DT  J O4    1 
ATOM 8862  C C5    . DT  J 6 8   ? 93.10600  70.64000  84.74000  1.000 164.95614 ? -65 DT  J C5    1 
ATOM 8863  C C7    . DT  J 6 8   ? 94.50500  70.17400  84.46600  1.000 164.95614 ? -65 DT  J C7    1 
ATOM 8864  C C6    . DT  J 6 8   ? 92.82400  71.92400  85.01600  1.000 164.95614 ? -65 DT  J C6    1 
ATOM 8865  P P     . DA  J 6 9   ? 90.67800  77.57000  88.11300  1.000 158.21484 ? -64 DA  J P     1 
ATOM 8866  O OP1   . DA  J 6 9   ? 90.86400  78.86500  87.42200  1.000 158.21484 ? -64 DA  J OP1   1 
ATOM 8867  O OP2   . DA  J 6 9   ? 91.61600  77.16600  89.18400  1.000 158.21484 ? -64 DA  J OP2   1 
ATOM 8868  O "O5'" . DA  J 6 9   ? 89.18600  77.52100  88.70900  1.000 158.21484 ? -64 DA  J "O5'" 1 
ATOM 8869  C "C5'" . DA  J 6 9   ? 88.82500  76.55200  89.70300  1.000 158.21484 ? -64 DA  J "C5'" 1 
ATOM 8870  C "C4'" . DA  J 6 9   ? 87.57900  75.76900  89.30600  1.000 158.21484 ? -64 DA  J "C4'" 1 
ATOM 8871  O "O4'" . DA  J 6 9   ? 87.95700  74.58700  88.54600  1.000 158.21484 ? -64 DA  J "O4'" 1 
ATOM 8872  C "C3'" . DA  J 6 9   ? 86.76500  75.22500  90.47600  1.000 158.21484 ? -64 DA  J "C3'" 1 
ATOM 8873  O "O3'" . DA  J 6 9   ? 85.40900  75.06900  90.06800  1.000 158.21484 ? -64 DA  J "O3'" 1 
ATOM 8874  C "C2'" . DA  J 6 9   ? 87.43700  73.88200  90.70400  1.000 158.21484 ? -64 DA  J "C2'" 1 
ATOM 8875  C "C1'" . DA  J 6 9   ? 87.56300  73.42800  89.26700  1.000 158.21484 ? -64 DA  J "C1'" 1 
ATOM 8876  N N9    . DA  J 6 9   ? 88.56400  72.39300  89.02000  1.000 158.21484 ? -64 DA  J N9    1 
ATOM 8877  C C8    . DA  J 6 9   ? 89.91700  72.54900  89.04500  1.000 158.21484 ? -64 DA  J C8    1 
ATOM 8878  N N7    . DA  J 6 9   ? 90.58300  71.46000  88.75100  1.000 158.21484 ? -64 DA  J N7    1 
ATOM 8879  C C5    . DA  J 6 9   ? 89.59800  70.51800  88.52800  1.000 158.21484 ? -64 DA  J C5    1 
ATOM 8880  C C6    . DA  J 6 9   ? 89.65300  69.15500  88.18400  1.000 158.21484 ? -64 DA  J C6    1 
ATOM 8881  N N6    . DA  J 6 9   ? 90.79800  68.49700  88.00300  1.000 158.21484 ? -64 DA  J N6    1 
ATOM 8882  N N1    . DA  J 6 9   ? 88.48300  68.49200  88.03600  1.000 158.21484 ? -64 DA  J N1    1 
ATOM 8883  C C2    . DA  J 6 9   ? 87.33600  69.15900  88.22800  1.000 158.21484 ? -64 DA  J C2    1 
ATOM 8884  N N3    . DA  J 6 9   ? 87.16100  70.44600  88.54600  1.000 158.21484 ? -64 DA  J N3    1 
ATOM 8885  C C4    . DA  J 6 9   ? 88.34300  71.07400  88.68500  1.000 158.21484 ? -64 DA  J C4    1 
ATOM 8886  P P     . DT  J 6 10  ? 84.26600  74.65800  91.12200  1.000 149.98750 ? -63 DT  J P     1 
ATOM 8887  O OP1   . DT  J 6 10  ? 82.96100  75.07300  90.56300  1.000 149.98750 ? -63 DT  J OP1   1 
ATOM 8888  O OP2   . DT  J 6 10  ? 84.69100  75.15300  92.44900  1.000 149.98750 ? -63 DT  J OP2   1 
ATOM 8889  O "O5'" . DT  J 6 10  ? 84.33300  73.05900  91.16300  1.000 149.98750 ? -63 DT  J "O5'" 1 
ATOM 8890  C "C5'" . DT  J 6 10  ? 83.94000  72.36100  92.33200  1.000 149.98750 ? -63 DT  J "C5'" 1 
ATOM 8891  C "C4'" . DT  J 6 10  ? 83.32300  71.02000  91.97500  1.000 149.98750 ? -63 DT  J "C4'" 1 
ATOM 8892  O "O4'" . DT  J 6 10  ? 84.26100  70.22400  91.19900  1.000 149.98750 ? -63 DT  J "O4'" 1 
ATOM 8893  C "C3'" . DT  J 6 10  ? 82.95500  70.15000  93.16000  1.000 149.98750 ? -63 DT  J "C3'" 1 
ATOM 8894  O "O3'" . DT  J 6 10  ? 81.88600  69.28500  92.79800  1.000 149.98750 ? -63 DT  J "O3'" 1 
ATOM 8895  C "C2'" . DT  J 6 10  ? 84.24100  69.38300  93.40800  1.000 149.98750 ? -63 DT  J "C2'" 1 
ATOM 8896  C "C1'" . DT  J 6 10  ? 84.71500  69.13500  91.98500  1.000 149.98750 ? -63 DT  J "C1'" 1 
ATOM 8897  N N1    . DT  J 6 10  ? 86.19800  68.98400  91.81800  1.000 149.98750 ? -63 DT  J N1    1 
ATOM 8898  C C2    . DT  J 6 10  ? 86.69300  67.80200  91.31700  1.000 149.98750 ? -63 DT  J C2    1 
ATOM 8899  O O2    . DT  J 6 10  ? 85.99000  66.84200  91.05700  1.000 149.98750 ? -63 DT  J O2    1 
ATOM 8900  N N3    . DT  J 6 10  ? 88.05200  67.76200  91.18000  1.000 149.98750 ? -63 DT  J N3    1 
ATOM 8901  C C4    . DT  J 6 10  ? 88.94900  68.77200  91.45700  1.000 149.98750 ? -63 DT  J C4    1 
ATOM 8902  O O4    . DT  J 6 10  ? 90.15800  68.64200  91.29200  1.000 149.98750 ? -63 DT  J O4    1 
ATOM 8903  C C5    . DT  J 6 10  ? 88.36900  69.99500  91.94500  1.000 149.98750 ? -63 DT  J C5    1 
ATOM 8904  C C7    . DT  J 6 10  ? 89.25500  71.15600  92.27600  1.000 149.98750 ? -63 DT  J C7    1 
ATOM 8905  C C6    . DT  J 6 10  ? 87.03300  70.04900  92.09300  1.000 149.98750 ? -63 DT  J C6    1 
ATOM 8906  P P     . DA  J 6 11  ? 80.99900  68.57100  93.92900  1.000 140.45505 ? -62 DA  J P     1 
ATOM 8907  O OP1   . DA  J 6 11  ? 79.69600  68.19100  93.34000  1.000 140.45505 ? -62 DA  J OP1   1 
ATOM 8908  O OP2   . DA  J 6 11  ? 81.03200  69.43700  95.12800  1.000 140.45505 ? -62 DA  J OP2   1 
ATOM 8909  O "O5'" . DA  J 6 11  ? 81.82200  67.24700  94.27500  1.000 140.45505 ? -62 DA  J "O5'" 1 
ATOM 8910  C "C5'" . DA  J 6 11  ? 82.04400  66.24400  93.28100  1.000 140.45505 ? -62 DA  J "C5'" 1 
ATOM 8911  C "C4'" . DA  J 6 11  ? 83.01300  65.20900  93.81300  1.000 140.45505 ? -62 DA  J "C4'" 1 
ATOM 8912  O "O4'" . DA  J 6 11  ? 84.37800  65.53800  93.43600  1.000 140.45505 ? -62 DA  J "O4'" 1 
ATOM 8913  C "C3'" . DA  J 6 11  ? 83.01000  65.09500  95.34000  1.000 140.45505 ? -62 DA  J "C3'" 1 
ATOM 8914  O "O3'" . DA  J 6 11  ? 82.80900  63.75500  95.74700  1.000 140.45505 ? -62 DA  J "O3'" 1 
ATOM 8915  C "C2'" . DA  J 6 11  ? 84.38700  65.60700  95.74100  1.000 140.45505 ? -62 DA  J "C2'" 1 
ATOM 8916  C "C1'" . DA  J 6 11  ? 85.21300  65.24400  94.53000  1.000 140.45505 ? -62 DA  J "C1'" 1 
ATOM 8917  N N9    . DA  J 6 11  ? 86.46200  65.99900  94.41100  1.000 140.45505 ? -62 DA  J N9    1 
ATOM 8918  C C8    . DA  J 6 11  ? 86.66300  67.31300  94.71800  1.000 140.45505 ? -62 DA  J C8    1 
ATOM 8919  N N7    . DA  J 6 11  ? 87.89000  67.72500  94.51800  1.000 140.45505 ? -62 DA  J N7    1 
ATOM 8920  C C5    . DA  J 6 11  ? 88.55100  66.59300  94.08500  1.000 140.45505 ? -62 DA  J C5    1 
ATOM 8921  C C6    . DA  J 6 11  ? 89.89000  66.35900  93.70500  1.000 140.45505 ? -62 DA  J C6    1 
ATOM 8922  N N6    . DA  J 6 11  ? 90.83500  67.30400  93.71700  1.000 140.45505 ? -62 DA  J N6    1 
ATOM 8923  N N1    . DA  J 6 11  ? 90.22100  65.10900  93.31800  1.000 140.45505 ? -62 DA  J N1    1 
ATOM 8924  C C2    . DA  J 6 11  ? 89.27400  64.16200  93.30900  1.000 140.45505 ? -62 DA  J C2    1 
ATOM 8925  N N3    . DA  J 6 11  ? 87.98500  64.26400  93.63700  1.000 140.45505 ? -62 DA  J N3    1 
ATOM 8926  C C4    . DA  J 6 11  ? 87.68700  65.51600  94.02000  1.000 140.45505 ? -62 DA  J C4    1 
ATOM 8927  P P     . DT  J 6 12  ? 82.01800  63.44100  97.11000  1.000 128.84218 ? -61 DT  J P     1 
ATOM 8928  O OP1   . DT  J 6 12  ? 80.63800  63.04800  96.74800  1.000 128.84218 ? -61 DT  J OP1   1 
ATOM 8929  O OP2   . DT  J 6 12  ? 82.24200  64.56400  98.04700  1.000 128.84218 ? -61 DT  J OP2   1 
ATOM 8930  O "O5'" . DT  J 6 12  ? 82.76800  62.15800  97.69200  1.000 128.84218 ? -61 DT  J "O5'" 1 
ATOM 8931  C "C5'" . DT  J 6 12  ? 82.91900  61.00800  96.88600  1.000 128.84218 ? -61 DT  J "C5'" 1 
ATOM 8932  C "C4'" . DT  J 6 12  ? 84.32900  60.45800  96.98300  1.000 128.84218 ? -61 DT  J "C4'" 1 
ATOM 8933  O "O4'" . DT  J 6 12  ? 85.30500  61.48400  96.64300  1.000 128.84218 ? -61 DT  J "O4'" 1 
ATOM 8934  C "C3'" . DT  J 6 12  ? 84.73600  59.92500  98.36700  1.000 128.84218 ? -61 DT  J "C3'" 1 
ATOM 8935  O "O3'" . DT  J 6 12  ? 85.38200  58.66200  98.19400  1.000 128.84218 ? -61 DT  J "O3'" 1 
ATOM 8936  C "C2'" . DT  J 6 12  ? 85.70400  61.00300  98.87200  1.000 128.84218 ? -61 DT  J "C2'" 1 
ATOM 8937  C "C1'" . DT  J 6 12  ? 86.35900  61.39500  97.56900  1.000 128.84218 ? -61 DT  J "C1'" 1 
ATOM 8938  N N1    . DT  J 6 12  ? 87.13900  62.67800  97.59600  1.000 128.84218 ? -61 DT  J N1    1 
ATOM 8939  C C2    . DT  J 6 12  ? 88.43300  62.66700  97.13500  1.000 128.84218 ? -61 DT  J C2    1 
ATOM 8940  O O2    . DT  J 6 12  ? 88.99900  61.65600  96.76500  1.000 128.84218 ? -61 DT  J O2    1 
ATOM 8941  N N3    . DT  J 6 12  ? 89.07200  63.87300  97.19500  1.000 128.84218 ? -61 DT  J N3    1 
ATOM 8942  C C4    . DT  J 6 12  ? 88.54700  65.07700  97.61300  1.000 128.84218 ? -61 DT  J C4    1 
ATOM 8943  O O4    . DT  J 6 12  ? 89.20200  66.11300  97.61500  1.000 128.84218 ? -61 DT  J O4    1 
ATOM 8944  C C5    . DT  J 6 12  ? 87.17700  65.03600  98.05500  1.000 128.84218 ? -61 DT  J C5    1 
ATOM 8945  C C7    . DT  J 6 12  ? 86.51400  66.29400  98.54500  1.000 128.84218 ? -61 DT  J C7    1 
ATOM 8946  C C6    . DT  J 6 12  ? 86.53700  63.84900  98.02000  1.000 128.84218 ? -61 DT  J C6    1 
ATOM 8947  P P     . DA  J 6 13  ? 85.61600  57.63700  99.41300  1.000 117.89068 ? -60 DA  J P     1 
ATOM 8948  O OP1   . DA  J 6 13  ? 84.69000  56.50600  99.19400  1.000 117.89068 ? -60 DA  J OP1   1 
ATOM 8949  O OP2   . DA  J 6 13  ? 85.60400  58.34000  100.71200 1.000 117.89068 ? -60 DA  J OP2   1 
ATOM 8950  O "O5'" . DA  J 6 13  ? 87.10800  57.12700  99.15500  1.000 117.89068 ? -60 DA  J "O5'" 1 
ATOM 8951  C "C5'" . DA  J 6 13  ? 88.00600  57.95500  98.42400  1.000 117.89068 ? -60 DA  J "C5'" 1 
ATOM 8952  C "C4'" . DA  J 6 13  ? 89.45400  57.66100  98.77500  1.000 117.89068 ? -60 DA  J "C4'" 1 
ATOM 8953  O "O4'" . DA  J 6 13  ? 90.23400  58.87200  98.61700  1.000 117.89068 ? -60 DA  J "O4'" 1 
ATOM 8954  C "C3'" . DA  J 6 13  ? 89.70400  57.22100  100.20700 1.000 117.89068 ? -60 DA  J "C3'" 1 
ATOM 8955  O "O3'" . DA  J 6 13  ? 90.90900  56.46400  100.26800 1.000 117.89068 ? -60 DA  J "O3'" 1 
ATOM 8956  C "C2'" . DA  J 6 13  ? 89.85300  58.55200  100.91900 1.000 117.89068 ? -60 DA  J "C2'" 1 
ATOM 8957  C "C1'" . DA  J 6 13  ? 90.64300  59.34700  99.88700  1.000 117.89068 ? -60 DA  J "C1'" 1 
ATOM 8958  N N9    . DA  J 6 13  ? 90.40200  60.78200  99.94400  1.000 117.89068 ? -60 DA  J N9    1 
ATOM 8959  C C8    . DA  J 6 13  ? 89.20800  61.41700  100.13800 1.000 117.89068 ? -60 DA  J C8    1 
ATOM 8960  N N7    . DA  J 6 13  ? 89.30200  62.72600  100.13100 1.000 117.89068 ? -60 DA  J N7    1 
ATOM 8961  C C5    . DA  J 6 13  ? 90.64200  62.96000  99.88000  1.000 117.89068 ? -60 DA  J C5    1 
ATOM 8962  C C6    . DA  J 6 13  ? 91.39400  64.14100  99.74100  1.000 117.89068 ? -60 DA  J C6    1 
ATOM 8963  N N6    . DA  J 6 13  ? 90.87000  65.36600  99.82900  1.000 117.89068 ? -60 DA  J N6    1 
ATOM 8964  N N1    . DA  J 6 13  ? 92.71700  64.01500  99.50800  1.000 117.89068 ? -60 DA  J N1    1 
ATOM 8965  C C2    . DA  J 6 13  ? 93.24600  62.79200  99.42500  1.000 117.89068 ? -60 DA  J C2    1 
ATOM 8966  N N3    . DA  J 6 13  ? 92.64200  61.61600  99.53300  1.000 117.89068 ? -60 DA  J N3    1 
ATOM 8967  C C4    . DA  J 6 13  ? 91.33100  61.77200  99.76600  1.000 117.89068 ? -60 DA  J C4    1 
ATOM 8968  P P     . DT  J 6 14  ? 91.05900  55.27300  101.33300 1.000 108.53999 ? -59 DT  J P     1 
ATOM 8969  O OP1   . DT  J 6 14  ? 92.27000  54.49600  100.98700 1.000 108.53999 ? -59 DT  J OP1   1 
ATOM 8970  O OP2   . DT  J 6 14  ? 89.75300  54.58400  101.39200 1.000 108.53999 ? -59 DT  J OP2   1 
ATOM 8971  O "O5'" . DT  J 6 14  ? 91.25600  56.03200  102.73000 1.000 108.53999 ? -59 DT  J "O5'" 1 
ATOM 8972  C "C5'" . DT  J 6 14  ? 92.45400  55.86400  103.49700 1.000 108.53999 ? -59 DT  J "C5'" 1 
ATOM 8973  C "C4'" . DT  J 6 14  ? 93.58500  56.74600  102.99200 1.000 108.53999 ? -59 DT  J "C4'" 1 
ATOM 8974  O "O4'" . DT  J 6 14  ? 93.06500  58.02600  102.57300 1.000 108.53999 ? -59 DT  J "O4'" 1 
ATOM 8975  C "C3'" . DT  J 6 14  ? 94.66800  57.04600  104.03300 1.000 108.53999 ? -59 DT  J "C3'" 1 
ATOM 8976  O "O3'" . DT  J 6 14  ? 95.94200  56.59900  103.57300 1.000 108.53999 ? -59 DT  J "O3'" 1 
ATOM 8977  C "C2'" . DT  J 6 14  ? 94.61700  58.57200  104.19700 1.000 108.53999 ? -59 DT  J "C2'" 1 
ATOM 8978  C "C1'" . DT  J 6 14  ? 94.00500  59.01900  102.88900 1.000 108.53999 ? -59 DT  J "C1'" 1 
ATOM 8979  N N1    . DT  J 6 14  ? 93.28000  60.32800  102.95100 1.000 108.53999 ? -59 DT  J N1    1 
ATOM 8980  C C2    . DT  J 6 14  ? 93.94800  61.50200  102.67100 1.000 108.53999 ? -59 DT  J C2    1 
ATOM 8981  O O2    . DT  J 6 14  ? 95.13400  61.54800  102.40000 1.000 108.53999 ? -59 DT  J O2    1 
ATOM 8982  N N3    . DT  J 6 14  ? 93.16700  62.63000  102.73000 1.000 108.53999 ? -59 DT  J N3    1 
ATOM 8983  C C4    . DT  J 6 14  ? 91.81700  62.69200  103.02800 1.000 108.53999 ? -59 DT  J C4    1 
ATOM 8984  O O4    . DT  J 6 14  ? 91.19500  63.74500  103.05700 1.000 108.53999 ? -59 DT  J O4    1 
ATOM 8985  C C5    . DT  J 6 14  ? 91.18600  61.42800  103.29700 1.000 108.53999 ? -59 DT  J C5    1 
ATOM 8986  C C7    . DT  J 6 14  ? 89.72600  61.37400  103.63000 1.000 108.53999 ? -59 DT  J C7    1 
ATOM 8987  C C6    . DT  J 6 14  ? 91.93600  60.32400  103.24400 1.000 108.53999 ? -59 DT  J C6    1 
ATOM 8988  P P     . DC  J 6 15  ? 97.00600  56.00100  104.62000 1.000 97.51983  ? -58 DC  J P     1 
ATOM 8989  O OP1   . DC  J 6 15  ? 98.10400  55.37500  103.85100 1.000 97.51983  ? -58 DC  J OP1   1 
ATOM 8990  O OP2   . DC  J 6 15  ? 96.25100  55.20400  105.61100 1.000 97.51983  ? -58 DC  J OP2   1 
ATOM 8991  O "O5'" . DC  J 6 15  ? 97.57900  57.29000  105.37000 1.000 97.51983  ? -58 DC  J "O5'" 1 
ATOM 8992  C "C5'" . DC  J 6 15  ? 98.25400  58.30600  104.63700 1.000 97.51983  ? -58 DC  J "C5'" 1 
ATOM 8993  C "C4'" . DC  J 6 15  ? 98.37300  59.56900  105.47000 1.000 97.51983  ? -58 DC  J "C4'" 1 
ATOM 8994  O "O4'" . DC  J 6 15  ? 97.16200  60.35100  105.36600 1.000 97.51983  ? -58 DC  J "O4'" 1 
ATOM 8995  C "C3'" . DC  J 6 15  ? 98.59800  59.34800  106.96900 1.000 97.51983  ? -58 DC  J "C3'" 1 
ATOM 8996  O "O3'" . DC  J 6 15  ? 99.75000  60.04400  107.36800 1.000 97.51983  ? -58 DC  J "O3'" 1 
ATOM 8997  C "C2'" . DC  J 6 15  ? 97.34300  59.94200  107.61600 1.000 97.51983  ? -58 DC  J "C2'" 1 
ATOM 8998  C "C1'" . DC  J 6 15  ? 96.95200  60.98700  106.59700 1.000 97.51983  ? -58 DC  J "C1'" 1 
ATOM 8999  N N1    . DC  J 6 15  ? 95.53200  61.40800  106.67100 1.000 97.51983  ? -58 DC  J N1    1 
ATOM 9000  C C2    . DC  J 6 15  ? 95.19600  62.71100  106.32700 1.000 97.51983  ? -58 DC  J C2    1 
ATOM 9001  O O2    . DC  J 6 15  ? 96.08700  63.47400  105.95400 1.000 97.51983  ? -58 DC  J O2    1 
ATOM 9002  N N3    . DC  J 6 15  ? 93.90400  63.09400  106.38500 1.000 97.51983  ? -58 DC  J N3    1 
ATOM 9003  C C4    . DC  J 6 15  ? 92.97100  62.23300  106.78600 1.000 97.51983  ? -58 DC  J C4    1 
ATOM 9004  N N4    . DC  J 6 15  ? 91.70600  62.65900  106.83200 1.000 97.51983  ? -58 DC  J N4    1 
ATOM 9005  C C5    . DC  J 6 15  ? 93.29400  60.89700  107.15600 1.000 97.51983  ? -58 DC  J C5    1 
ATOM 9006  C C6    . DC  J 6 15  ? 94.57800  60.53500  107.09700 1.000 97.51983  ? -58 DC  J C6    1 
ATOM 9007  P P     . DT  J 6 16  ? 100.63800 59.53700  108.60300 1.000 89.90948  ? -57 DT  J P     1 
ATOM 9008  O OP1   . DT  J 6 16  ? 101.53600 58.47500  108.10500 1.000 89.90948  ? -57 DT  J OP1   1 
ATOM 9009  O OP2   . DT  J 6 16  ? 99.75200  59.26900  109.75600 1.000 89.90948  ? -57 DT  J OP2   1 
ATOM 9010  O "O5'" . DT  J 6 16  ? 101.51500 60.82100  108.94400 1.000 89.90948  ? -57 DT  J "O5'" 1 
ATOM 9011  C "C5'" . DT  J 6 16  ? 101.75800 61.78600  107.92800 1.000 89.90948  ? -57 DT  J "C5'" 1 
ATOM 9012  C "C4'" . DT  J 6 16  ? 101.46600 63.19400  108.41900 1.000 89.90948  ? -57 DT  J "C4'" 1 
ATOM 9013  O "O4'" . DT  J 6 16  ? 100.04600 63.49800  108.31900 1.000 89.90948  ? -57 DT  J "O4'" 1 
ATOM 9014  C "C3'" . DT  J 6 16  ? 101.86800 63.46200  109.86600 1.000 89.90948  ? -57 DT  J "C3'" 1 
ATOM 9015  O "O3'" . DT  J 6 16  ? 102.55300 64.68800  109.92700 1.000 89.90948  ? -57 DT  J "O3'" 1 
ATOM 9016  C "C2'" . DT  J 6 16  ? 100.52100 63.52500  110.59600 1.000 89.90948  ? -57 DT  J "C2'" 1 
ATOM 9017  C "C1'" . DT  J 6 16  ? 99.62500  64.10800  109.51800 1.000 89.90948  ? -57 DT  J "C1'" 1 
ATOM 9018  N N1    . DT  J 6 16  ? 98.16100  63.83700  109.70700 1.000 89.90948  ? -57 DT  J N1    1 
ATOM 9019  C C2    . DT  J 6 16  ? 97.24200  64.80900  109.36600 1.000 89.90948  ? -57 DT  J C2    1 
ATOM 9020  O O2    . DT  J 6 16  ? 97.55700  65.90400  108.94500 1.000 89.90948  ? -57 DT  J O2    1 
ATOM 9021  N N3    . DT  J 6 16  ? 95.93300  64.45200  109.56300 1.000 89.90948  ? -57 DT  J N3    1 
ATOM 9022  C C4    . DT  J 6 16  ? 95.46500  63.24100  110.03700 1.000 89.90948  ? -57 DT  J C4    1 
ATOM 9023  O O4    . DT  J 6 16  ? 94.27100  63.00300  110.17500 1.000 89.90948  ? -57 DT  J O4    1 
ATOM 9024  C C5    . DT  J 6 16  ? 96.47500  62.27000  110.35700 1.000 89.90948  ? -57 DT  J C5    1 
ATOM 9025  C C7    . DT  J 6 16  ? 96.07600  60.92700  110.88500 1.000 89.90948  ? -57 DT  J C7    1 
ATOM 9026  C C6    . DT  J 6 16  ? 97.75800  62.60700  110.17500 1.000 89.90948  ? -57 DT  J C6    1 
ATOM 9027  P P     . DG  J 6 17  ? 103.63100 64.97300  111.08000 1.000 85.21776  ? -56 DG  J P     1 
ATOM 9028  O OP1   . DG  J 6 17  ? 104.97500 64.86400  110.47200 1.000 85.21776  ? -56 DG  J OP1   1 
ATOM 9029  O OP2   . DG  J 6 17  ? 103.29200 64.15000  112.26100 1.000 85.21776  ? -56 DG  J OP2   1 
ATOM 9030  O "O5'" . DG  J 6 17  ? 103.36000 66.50000  111.44200 1.000 85.21776  ? -56 DG  J "O5'" 1 
ATOM 9031  C "C5'" . DG  J 6 17  ? 102.53900 67.28100  110.58600 1.000 85.21776  ? -56 DG  J "C5'" 1 
ATOM 9032  C "C4'" . DG  J 6 17  ? 101.50300 68.05300  111.37700 1.000 85.21776  ? -56 DG  J "C4'" 1 
ATOM 9033  O "O4'" . DG  J 6 17  ? 100.30600 67.24800  111.53200 1.000 85.21776  ? -56 DG  J "O4'" 1 
ATOM 9034  C "C3'" . DG  J 6 17  ? 101.92500 68.45100  112.79400 1.000 85.21776  ? -56 DG  J "C3'" 1 
ATOM 9035  O "O3'" . DG  J 6 17  ? 101.46400 69.75500  113.06700 1.000 85.21776  ? -56 DG  J "O3'" 1 
ATOM 9036  C "C2'" . DG  J 6 17  ? 101.18200 67.43500  113.65700 1.000 85.21776  ? -56 DG  J "C2'" 1 
ATOM 9037  C "C1'" . DG  J 6 17  ? 99.89600  67.31900  112.87200 1.000 85.21776  ? -56 DG  J "C1'" 1 
ATOM 9038  N N9    . DG  J 6 17  ? 99.10000  66.14300  113.19300 1.000 85.21776  ? -56 DG  J N9    1 
ATOM 9039  C C8    . DG  J 6 17  ? 99.54500  64.93300  113.66000 1.000 85.21776  ? -56 DG  J C8    1 
ATOM 9040  N N7    . DG  J 6 17  ? 98.58600  64.07100  113.86000 1.000 85.21776  ? -56 DG  J N7    1 
ATOM 9041  C C5    . DG  J 6 17  ? 97.43800  64.75700  113.50200 1.000 85.21776  ? -56 DG  J C5    1 
ATOM 9042  C C6    . DG  J 6 17  ? 96.08700  64.34400  113.50400 1.000 85.21776  ? -56 DG  J C6    1 
ATOM 9043  O O6    . DG  J 6 17  ? 95.61500  63.24800  113.83000 1.000 85.21776  ? -56 DG  J O6    1 
ATOM 9044  N N1    . DG  J 6 17  ? 95.24200  65.35500  113.06500 1.000 85.21776  ? -56 DG  J N1    1 
ATOM 9045  C C2    . DG  J 6 17  ? 95.65000  66.60400  112.67300 1.000 85.21776  ? -56 DG  J C2    1 
ATOM 9046  N N2    . DG  J 6 17  ? 94.69400  67.45100  112.28900 1.000 85.21776  ? -56 DG  J N2    1 
ATOM 9047  N N3    . DG  J 6 17  ? 96.90800  67.00200  112.66900 1.000 85.21776  ? -56 DG  J N3    1 
ATOM 9048  C C4    . DG  J 6 17  ? 97.74300  66.03300  113.09200 1.000 85.21776  ? -56 DG  J C4    1 
ATOM 9049  P P     . DA  J 6 18  ? 102.42700 71.02800  112.90700 1.000 79.24957  ? -55 DA  J P     1 
ATOM 9050  O OP1   . DA  J 6 18  ? 103.03600 70.99400  111.56200 1.000 79.24957  ? -55 DA  J OP1   1 
ATOM 9051  O OP2   . DA  J 6 18  ? 103.29400 71.08900  114.10100 1.000 79.24957  ? -55 DA  J OP2   1 
ATOM 9052  O "O5'" . DA  J 6 18  ? 101.40800 72.25500  112.96200 1.000 79.24957  ? -55 DA  J "O5'" 1 
ATOM 9053  C "C5'" . DA  J 6 18  ? 100.27300 72.26400  112.10500 1.000 79.24957  ? -55 DA  J "C5'" 1 
ATOM 9054  C "C4'" . DA  J 6 18  ? 98.98100  72.44000  112.89200 1.000 79.24957  ? -55 DA  J "C4'" 1 
ATOM 9055  O "O4'" . DA  J 6 18  ? 98.52000  71.16600  113.40600 1.000 79.24957  ? -55 DA  J "O4'" 1 
ATOM 9056  C "C3'" . DA  J 6 18  ? 99.04700  73.36900  114.09900 1.000 79.24957  ? -55 DA  J "C3'" 1 
ATOM 9057  O "O3'" . DA  J 6 18  ? 97.87900  74.13800  114.12000 1.000 79.24957  ? -55 DA  J "O3'" 1 
ATOM 9058  C "C2'" . DA  J 6 18  ? 99.07400  72.39000  115.27000 1.000 79.24957  ? -55 DA  J "C2'" 1 
ATOM 9059  C "C1'" . DA  J 6 18  ? 98.13200  71.33500  114.74800 1.000 79.24957  ? -55 DA  J "C1'" 1 
ATOM 9060  N N9    . DA  J 6 18  ? 98.25800  70.04900  115.41000 1.000 79.24957  ? -55 DA  J N9    1 
ATOM 9061  C C8    . DA  J 6 18  ? 99.39600  69.48900  115.90800 1.000 79.24957  ? -55 DA  J C8    1 
ATOM 9062  N N7    . DA  J 6 18  ? 99.21400  68.30400  116.43200 1.000 79.24957  ? -55 DA  J N7    1 
ATOM 9063  C C5    . DA  J 6 18  ? 97.86500  68.07100  116.26100 1.000 79.24957  ? -55 DA  J C5    1 
ATOM 9064  C C6    . DA  J 6 18  ? 97.04000  66.98800  116.60300 1.000 79.24957  ? -55 DA  J C6    1 
ATOM 9065  N N6    . DA  J 6 18  ? 97.48700  65.89100  117.21700 1.000 79.24957  ? -55 DA  J N6    1 
ATOM 9066  N N1    . DA  J 6 18  ? 95.73200  67.07400  116.29000 1.000 79.24957  ? -55 DA  J N1    1 
ATOM 9067  C C2    . DA  J 6 18  ? 95.28200  68.17300  115.67400 1.000 79.24957  ? -55 DA  J C2    1 
ATOM 9068  N N3    . DA  J 6 18  ? 95.96400  69.25100  115.29900 1.000 79.24957  ? -55 DA  J N3    1 
ATOM 9069  C C4    . DA  J 6 18  ? 97.26000  69.13500  115.62700 1.000 79.24957  ? -55 DA  J C4    1 
ATOM 9070  P P     . DC  J 6 19  ? 97.86100  75.58600  114.79800 1.000 67.71908  ? -54 DC  J P     1 
ATOM 9071  O OP1   . DC  J 6 19  ? 98.08500  76.57500  113.72600 1.000 67.71908  ? -54 DC  J OP1   1 
ATOM 9072  O OP2   . DC  J 6 19  ? 98.74500  75.54500  115.98100 1.000 67.71908  ? -54 DC  J OP2   1 
ATOM 9073  O "O5'" . DC  J 6 19  ? 96.36300  75.72000  115.32600 1.000 67.71908  ? -54 DC  J "O5'" 1 
ATOM 9074  C "C5'" . DC  J 6 19  ? 95.28200  75.52000  114.43300 1.000 67.71908  ? -54 DC  J "C5'" 1 
ATOM 9075  C "C4'" . DC  J 6 19  ? 94.17200  74.73200  115.10200 1.000 67.71908  ? -54 DC  J "C4'" 1 
ATOM 9076  O "O4'" . DC  J 6 19  ? 94.68000  73.47800  115.61000 1.000 67.71908  ? -54 DC  J "O4'" 1 
ATOM 9077  C "C3'" . DC  J 6 19  ? 93.49700  75.42100  116.28100 1.000 67.71908  ? -54 DC  J "C3'" 1 
ATOM 9078  O "O3'" . DC  J 6 19  ? 92.09800  75.27800  116.15400 1.000 67.71908  ? -54 DC  J "O3'" 1 
ATOM 9079  C "C2'" . DC  J 6 19  ? 94.03600  74.64200  117.47700 1.000 67.71908  ? -54 DC  J "C2'" 1 
ATOM 9080  C "C1'" . DC  J 6 19  ? 94.13900  73.25700  116.88600 1.000 67.71908  ? -54 DC  J "C1'" 1 
ATOM 9081  N N1    . DC  J 6 19  ? 95.06500  72.33900  117.59300 1.000 67.71908  ? -54 DC  J N1    1 
ATOM 9082  C C2    . DC  J 6 19  ? 94.61000  71.09200  118.04800 1.000 67.71908  ? -54 DC  J C2    1 
ATOM 9083  O O2    . DC  J 6 19  ? 93.42000  70.79100  117.90800 1.000 67.71908  ? -54 DC  J O2    1 
ATOM 9084  N N3    . DC  J 6 19  ? 95.49100  70.25800  118.65200 1.000 67.71908  ? -54 DC  J N3    1 
ATOM 9085  C C4    . DC  J 6 19  ? 96.76600  70.61900  118.78300 1.000 67.71908  ? -54 DC  J C4    1 
ATOM 9086  N N4    . DC  J 6 19  ? 97.60100  69.76700  119.38000 1.000 67.71908  ? -54 DC  J N4    1 
ATOM 9087  C C5    . DC  J 6 19  ? 97.24400  71.87000  118.31000 1.000 67.71908  ? -54 DC  J C5    1 
ATOM 9088  C C6    . DC  J 6 19  ? 96.37100  72.68500  117.72100 1.000 67.71908  ? -54 DC  J C6    1 
ATOM 9089  P P     . DA  J 6 20  ? 91.12100  76.42900  116.68400 1.000 70.99458  ? -53 DA  J P     1 
ATOM 9090  O OP1   . DA  J 6 20  ? 90.13100  76.71300  115.62400 1.000 70.99458  ? -53 DA  J OP1   1 
ATOM 9091  O OP2   . DA  J 6 20  ? 91.99300  77.50000  117.20900 1.000 70.99458  ? -53 DA  J OP2   1 
ATOM 9092  O "O5'" . DA  J 6 20  ? 90.36400  75.75900  117.92100 1.000 70.99458  ? -53 DA  J "O5'" 1 
ATOM 9093  C "C5'" . DA  J 6 20  ? 89.71600  74.49600  117.77100 1.000 70.99458  ? -53 DA  J "C5'" 1 
ATOM 9094  C "C4'" . DA  J 6 20  ? 89.60600  73.77500  119.10800 1.000 70.99458  ? -53 DA  J "C4'" 1 
ATOM 9095  O "O4'" . DA  J 6 20  ? 90.86900  73.13000  119.42200 1.000 70.99458  ? -53 DA  J "O4'" 1 
ATOM 9096  C "C3'" . DA  J 6 20  ? 89.28400  74.65900  120.32000 1.000 70.99458  ? -53 DA  J "C3'" 1 
ATOM 9097  O "O3'" . DA  J 6 20  ? 88.36300  73.98700  121.16800 1.000 70.99458  ? -53 DA  J "O3'" 1 
ATOM 9098  C "C2'" . DA  J 6 20  ? 90.63800  74.78300  121.00100 1.000 70.99458  ? -53 DA  J "C2'" 1 
ATOM 9099  C "C1'" . DA  J 6 20  ? 91.15900  73.38400  120.76900 1.000 70.99458  ? -53 DA  J "C1'" 1 
ATOM 9100  N N9    . DA  J 6 20  ? 92.58900  73.24700  120.98300 1.000 70.99458  ? -53 DA  J N9    1 
ATOM 9101  C C8    . DA  J 6 20  ? 93.53700  74.20400  120.80200 1.000 70.99458  ? -53 DA  J C8    1 
ATOM 9102  N N7    . DA  J 6 20  ? 94.75300  73.80300  121.06900 1.000 70.99458  ? -53 DA  J N7    1 
ATOM 9103  C C5    . DA  J 6 20  ? 94.58400  72.50400  121.49700 1.000 70.99458  ? -53 DA  J C5    1 
ATOM 9104  C C6    . DA  J 6 20  ? 95.48900  71.53000  121.94000 1.000 70.99458  ? -53 DA  J C6    1 
ATOM 9105  N N6    . DA  J 6 20  ? 96.80500  71.74100  122.02800 1.000 70.99458  ? -53 DA  J N6    1 
ATOM 9106  N N1    . DA  J 6 20  ? 94.99200  70.32800  122.29700 1.000 70.99458  ? -53 DA  J N1    1 
ATOM 9107  C C2    . DA  J 6 20  ? 93.67400  70.12100  122.20900 1.000 70.99458  ? -53 DA  J C2    1 
ATOM 9108  N N3    . DA  J 6 20  ? 92.72600  70.96000  121.80200 1.000 70.99458  ? -53 DA  J N3    1 
ATOM 9109  C C4    . DA  J 6 20  ? 93.25400  72.14500  121.45800 1.000 70.99458  ? -53 DA  J C4    1 
ATOM 9110  P P     . DC  J 6 21  ? 87.05400  74.73700  121.71300 1.000 76.38445  ? -52 DC  J P     1 
ATOM 9111  O OP1   . DC  J 6 21  ? 86.07000  74.72500  120.61000 1.000 76.38445  ? -52 DC  J OP1   1 
ATOM 9112  O OP2   . DC  J 6 21  ? 87.47800  76.02500  122.29900 1.000 76.38445  ? -52 DC  J OP2   1 
ATOM 9113  O "O5'" . DC  J 6 21  ? 86.51800  73.79000  122.89500 1.000 76.38445  ? -52 DC  J "O5'" 1 
ATOM 9114  C "C5'" . DC  J 6 21  ? 86.44900  72.37000  122.71600 1.000 76.38445  ? -52 DC  J "C5'" 1 
ATOM 9115  C "C4'" . DC  J 6 21  ? 87.18500  71.61400  123.82100 1.000 76.38445  ? -52 DC  J "C4'" 1 
ATOM 9116  O "O4'" . DC  J 6 21  ? 88.61600  71.73200  123.66500 1.000 76.38445  ? -52 DC  J "O4'" 1 
ATOM 9117  C "C3'" . DC  J 6 21  ? 86.87800  72.05900  125.25500 1.000 76.38445  ? -52 DC  J "C3'" 1 
ATOM 9118  O "O3'" . DC  J 6 21  ? 86.24600  70.99000  125.96000 1.000 76.38445  ? -52 DC  J "O3'" 1 
ATOM 9119  C "C2'" . DC  J 6 21  ? 88.26000  72.39900  125.84100 1.000 76.38445  ? -52 DC  J "C2'" 1 
ATOM 9120  C "C1'" . DC  J 6 21  ? 89.19100  71.61100  124.93500 1.000 76.38445  ? -52 DC  J "C1'" 1 
ATOM 9121  N N1    . DC  J 6 21  ? 90.57100  72.16600  124.86200 1.000 76.38445  ? -52 DC  J N1    1 
ATOM 9122  C C2    . DC  J 6 21  ? 91.67700  71.40200  125.28000 1.000 76.38445  ? -52 DC  J C2    1 
ATOM 9123  O O2    . DC  J 6 21  ? 91.49500  70.27500  125.75900 1.000 76.38445  ? -52 DC  J O2    1 
ATOM 9124  N N3    . DC  J 6 21  ? 92.91700  71.94800  125.18700 1.000 76.38445  ? -52 DC  J N3    1 
ATOM 9125  C C4    . DC  J 6 21  ? 93.07000  73.16900  124.67500 1.000 76.38445  ? -52 DC  J C4    1 
ATOM 9126  N N4    . DC  J 6 21  ? 94.30300  73.66900  124.58800 1.000 76.38445  ? -52 DC  J N4    1 
ATOM 9127  C C5    . DC  J 6 21  ? 91.96500  73.94000  124.23100 1.000 76.38445  ? -52 DC  J C5    1 
ATOM 9128  C C6    . DC  J 6 21  ? 90.75000  73.40400  124.33700 1.000 76.38445  ? -52 DC  J C6    1 
ATOM 9129  P P     . DG  J 6 22  ? 85.57700  71.23300  127.40100 1.000 78.02022  ? -51 DG  J P     1 
ATOM 9130  O OP1   . DG  J 6 22  ? 84.38200  70.36600  127.48600 1.000 78.02022  ? -51 DG  J OP1   1 
ATOM 9131  O OP2   . DG  J 6 22  ? 85.43400  72.69400  127.58000 1.000 78.02022  ? -51 DG  J OP2   1 
ATOM 9132  O "O5'" . DG  J 6 22  ? 86.67700  70.70500  128.43800 1.000 78.02022  ? -51 DG  J "O5'" 1 
ATOM 9133  C "C5'" . DG  J 6 22  ? 87.05100  69.32800  128.44400 1.000 78.02022  ? -51 DG  J "C5'" 1 
ATOM 9134  C "C4'" . DG  J 6 22  ? 88.30900  69.11900  129.26700 1.000 78.02022  ? -51 DG  J "C4'" 1 
ATOM 9135  O "O4'" . DG  J 6 22  ? 89.40300  69.76100  128.60300 1.000 78.02022  ? -51 DG  J "O4'" 1 
ATOM 9136  C "C3'" . DG  J 6 22  ? 88.28500  69.72200  130.67000 1.000 78.02022  ? -51 DG  J "C3'" 1 
ATOM 9137  O "O3'" . DG  J 6 22  ? 88.09500  68.70300  131.65400 1.000 78.02022  ? -51 DG  J "O3'" 1 
ATOM 9138  C "C2'" . DG  J 6 22  ? 89.65700  70.38700  130.82600 1.000 78.02022  ? -51 DG  J "C2'" 1 
ATOM 9139  C "C1'" . DG  J 6 22  ? 90.39400  70.03700  129.54700 1.000 78.02022  ? -51 DG  J "C1'" 1 
ATOM 9140  N N9    . DG  J 6 22  ? 91.19500  71.13400  129.03400 1.000 78.02022  ? -51 DG  J N9    1 
ATOM 9141  C C8    . DG  J 6 22  ? 90.73900  72.22900  128.35000 1.000 78.02022  ? -51 DG  J C8    1 
ATOM 9142  N N7    . DG  J 6 22  ? 91.68400  73.04500  127.98800 1.000 78.02022  ? -51 DG  J N7    1 
ATOM 9143  C C5    . DG  J 6 22  ? 92.84200  72.44500  128.45000 1.000 78.02022  ? -51 DG  J C5    1 
ATOM 9144  C C6    . DG  J 6 22  ? 94.18000  72.87000  128.35000 1.000 78.02022  ? -51 DG  J C6    1 
ATOM 9145  O O6    . DG  J 6 22  ? 94.61500  73.89300  127.81400 1.000 78.02022  ? -51 DG  J O6    1 
ATOM 9146  N N1    . DG  J 6 22  ? 95.05400  71.97200  128.95700 1.000 78.02022  ? -51 DG  J N1    1 
ATOM 9147  C C2    . DG  J 6 22  ? 94.67700  70.80800  129.57900 1.000 78.02022  ? -51 DG  J C2    1 
ATOM 9148  N N2    . DG  J 6 22  ? 95.66100  70.06700  130.10900 1.000 78.02022  ? -51 DG  J N2    1 
ATOM 9149  N N3    . DG  J 6 22  ? 93.41900  70.39800  129.68000 1.000 78.02022  ? -51 DG  J N3    1 
ATOM 9150  C C4    . DG  J 6 22  ? 92.56000  71.26500  129.09500 1.000 78.02022  ? -51 DG  J C4    1 
ATOM 9151  P P     . DT  J 6 23  ? 87.88500  69.10700  133.19800 1.000 77.84985  ? -50 DT  J P     1 
ATOM 9152  O OP1   . DT  J 6 23  ? 87.10500  68.03000  133.84100 1.000 77.84985  ? -50 DT  J OP1   1 
ATOM 9153  O OP2   . DT  J 6 23  ? 87.37400  70.49400  133.22700 1.000 77.84985  ? -50 DT  J OP2   1 
ATOM 9154  O "O5'" . DT  J 6 23  ? 89.36100  69.12000  133.83000 1.000 77.84985  ? -50 DT  J "O5'" 1 
ATOM 9155  C "C5'" . DT  J 6 23  ? 90.25300  68.02700  133.62200 1.000 77.84985  ? -50 DT  J "C5'" 1 
ATOM 9156  C "C4'" . DT  J 6 23  ? 91.63200  68.33200  134.19500 1.000 77.84985  ? -50 DT  J "C4'" 1 
ATOM 9157  O "O4'" . DT  J 6 23  ? 92.35200  69.24700  133.32900 1.000 77.84985  ? -50 DT  J "O4'" 1 
ATOM 9158  C "C3'" . DT  J 6 23  ? 91.63800  68.96800  135.58700 1.000 77.84985  ? -50 DT  J "C3'" 1 
ATOM 9159  O "O3'" . DT  J 6 23  ? 92.54600  68.27200  136.43400 1.000 77.84985  ? -50 DT  J "O3'" 1 
ATOM 9160  C "C2'" . DT  J 6 23  ? 92.09300  70.40400  135.32200 1.000 77.84985  ? -50 DT  J "C2'" 1 
ATOM 9161  C "C1'" . DT  J 6 23  ? 92.99200  70.22600  134.11600 1.000 77.84985  ? -50 DT  J "C1'" 1 
ATOM 9162  N N1    . DT  J 6 23  ? 93.12900  71.45200  133.29200 1.000 77.84985  ? -50 DT  J N1    1 
ATOM 9163  C C2    . DT  J 6 23  ? 94.37900  71.93800  132.98900 1.000 77.84985  ? -50 DT  J C2    1 
ATOM 9164  O O2    . DT  J 6 23  ? 95.40900  71.42200  133.37300 1.000 77.84985  ? -50 DT  J O2    1 
ATOM 9165  N N3    . DT  J 6 23  ? 94.37400  73.06200  132.20900 1.000 77.84985  ? -50 DT  J N3    1 
ATOM 9166  C C4    . DT  J 6 23  ? 93.26900  73.72900  131.71500 1.000 77.84985  ? -50 DT  J C4    1 
ATOM 9167  O O4    . DT  J 6 23  ? 93.35700  74.73200  131.02400 1.000 77.84985  ? -50 DT  J O4    1 
ATOM 9168  C C5    . DT  J 6 23  ? 92.00200  73.16500  132.06700 1.000 77.84985  ? -50 DT  J C5    1 
ATOM 9169  C C7    . DT  J 6 23  ? 90.73800  73.81200  131.58900 1.000 77.84985  ? -50 DT  J C7    1 
ATOM 9170  C C6    . DT  J 6 23  ? 91.99300  72.07200  132.83400 1.000 77.84985  ? -50 DT  J C6    1 
ATOM 9171  P P     . DG  J 6 24  ? 92.49800  68.48400  138.02600 1.000 74.88819  ? -49 DG  J P     1 
ATOM 9172  O OP1   . DG  J 6 24  ? 92.59300  67.14900  138.65000 1.000 74.88819  ? -49 DG  J OP1   1 
ATOM 9173  O OP2   . DG  J 6 24  ? 91.35600  69.36500  138.34600 1.000 74.88819  ? -49 DG  J OP2   1 
ATOM 9174  O "O5'" . DG  J 6 24  ? 93.84500  69.28000  138.35600 1.000 74.88819  ? -49 DG  J "O5'" 1 
ATOM 9175  C "C5'" . DG  J 6 24  ? 95.11400  68.66800  138.12000 1.000 74.88819  ? -49 DG  J "C5'" 1 
ATOM 9176  C "C4'" . DG  J 6 24  ? 96.24300  69.68100  138.23200 1.000 74.88819  ? -49 DG  J "C4'" 1 
ATOM 9177  O "O4'" . DG  J 6 24  ? 96.10700  70.69400  137.20600 1.000 74.88819  ? -49 DG  J "O4'" 1 
ATOM 9178  C "C3'" . DG  J 6 24  ? 96.31400  70.42200  139.56400 1.000 74.88819  ? -49 DG  J "C3'" 1 
ATOM 9179  O "O3'" . DG  J 6 24  ? 97.66000  70.47600  140.00700 1.000 74.88819  ? -49 DG  J "O3'" 1 
ATOM 9180  C "C2'" . DG  J 6 24  ? 95.76300  71.81200  139.21900 1.000 74.88819  ? -49 DG  J "C2'" 1 
ATOM 9181  C "C1'" . DG  J 6 24  ? 96.21400  71.97600  137.78100 1.000 74.88819  ? -49 DG  J "C1'" 1 
ATOM 9182  N N9    . DG  J 6 24  ? 95.35800  72.85800  137.00200 1.000 74.88819  ? -49 DG  J N9    1 
ATOM 9183  C C8    . DG  J 6 24  ? 93.99300  72.81400  136.93500 1.000 74.88819  ? -49 DG  J C8    1 
ATOM 9184  N N7    . DG  J 6 24  ? 93.48200  73.70000  136.13500 1.000 74.88819  ? -49 DG  J N7    1 
ATOM 9185  C C5    . DG  J 6 24  ? 94.58100  74.37900  135.63800 1.000 74.88819  ? -49 DG  J C5    1 
ATOM 9186  C C6    . DG  J 6 24  ? 94.64200  75.44900  134.72700 1.000 74.88819  ? -49 DG  J C6    1 
ATOM 9187  O O6    . DG  J 6 24  ? 93.70400  76.02300  134.16700 1.000 74.88819  ? -49 DG  J O6    1 
ATOM 9188  N N1    . DG  J 6 24  ? 95.94900  75.84600  134.48400 1.000 74.88819  ? -49 DG  J N1    1 
ATOM 9189  C C2    . DG  J 6 24  ? 97.06000  75.27900  135.05200 1.000 74.88819  ? -49 DG  J C2    1 
ATOM 9190  N N2    . DG  J 6 24  ? 98.24400  75.79700  134.69400 1.000 74.88819  ? -49 DG  J N2    1 
ATOM 9191  N N3    . DG  J 6 24  ? 97.01800  74.26800  135.91100 1.000 74.88819  ? -49 DG  J N3    1 
ATOM 9192  C C4    . DG  J 6 24  ? 95.74700  73.87200  136.15600 1.000 74.88819  ? -49 DG  J C4    1 
ATOM 9193  P P     . DC  J 6 25  ? 98.01700  71.02800  141.47200 1.000 75.61656  ? -48 DC  J P     1 
ATOM 9194  O OP1   . DC  J 6 25  ? 99.08400  70.15500  142.00600 1.000 75.61656  ? -48 DC  J OP1   1 
ATOM 9195  O OP2   . DC  J 6 25  ? 96.76700  71.19700  142.24500 1.000 75.61656  ? -48 DC  J OP2   1 
ATOM 9196  O "O5'" . DC  J 6 25  ? 98.64100  72.47000  141.19200 1.000 75.61656  ? -48 DC  J "O5'" 1 
ATOM 9197  C "C5'" . DC  J 6 25  ? 99.64000  72.63100  140.19000 1.000 75.61656  ? -48 DC  J "C5'" 1 
ATOM 9198  C "C4'" . DC  J 6 25  ? 99.80800  74.09600  139.83100 1.000 75.61656  ? -48 DC  J "C4'" 1 
ATOM 9199  O "O4'" . DC  J 6 25  ? 98.66600  74.55700  139.07800 1.000 75.61656  ? -48 DC  J "O4'" 1 
ATOM 9200  C "C3'" . DC  J 6 25  ? 99.94200  75.04100  141.02400 1.000 75.61656  ? -48 DC  J "C3'" 1 
ATOM 9201  O "O3'" . DC  J 6 25  ? 101.06600 75.88000  140.83600 1.000 75.61656  ? -48 DC  J "O3'" 1 
ATOM 9202  C "C2'" . DC  J 6 25  ? 98.62600  75.83000  141.00700 1.000 75.61656  ? -48 DC  J "C2'" 1 
ATOM 9203  C "C1'" . DC  J 6 25  ? 98.31500  75.84100  139.52400 1.000 75.61656  ? -48 DC  J "C1'" 1 
ATOM 9204  N N1    . DC  J 6 25  ? 96.88100  76.05500  139.17800 1.000 75.61656  ? -48 DC  J N1    1 
ATOM 9205  C C2    . DC  J 6 25  ? 96.56200  76.87200  138.09500 1.000 75.61656  ? -48 DC  J C2    1 
ATOM 9206  O O2    . DC  J 6 25  ? 97.47300  77.42600  137.47700 1.000 75.61656  ? -48 DC  J O2    1 
ATOM 9207  N N3    . DC  J 6 25  ? 95.26400  77.04400  137.75700 1.000 75.61656  ? -48 DC  J N3    1 
ATOM 9208  C C4    . DC  J 6 25  ? 94.31000  76.42500  138.45100 1.000 75.61656  ? -48 DC  J C4    1 
ATOM 9209  N N4    . DC  J 6 25  ? 93.04100  76.62400  138.08000 1.000 75.61656  ? -48 DC  J N4    1 
ATOM 9210  C C5    . DC  J 6 25  ? 94.61500  75.57400  139.55400 1.000 75.61656  ? -48 DC  J C5    1 
ATOM 9211  C C6    . DC  J 6 25  ? 95.90300  75.41500  139.87700 1.000 75.61656  ? -48 DC  J C6    1 
ATOM 9212  P P     . DC  J 6 26  ? 101.96800 76.31300  142.09000 1.000 73.13540  ? -47 DC  J P     1 
ATOM 9213  O OP1   . DC  J 6 26  ? 103.18200 75.46800  142.08100 1.000 73.13540  ? -47 DC  J OP1   1 
ATOM 9214  O OP2   . DC  J 6 26  ? 101.09700 76.33900  143.28700 1.000 73.13540  ? -47 DC  J OP2   1 
ATOM 9215  O "O5'" . DC  J 6 26  ? 102.39500 77.81300  141.75300 1.000 73.13540  ? -47 DC  J "O5'" 1 
ATOM 9216  C "C5'" . DC  J 6 26  ? 102.64500 78.20200  140.40400 1.000 73.13540  ? -47 DC  J "C5'" 1 
ATOM 9217  C "C4'" . DC  J 6 26  ? 102.10100 79.59400  140.12400 1.000 73.13540  ? -47 DC  J "C4'" 1 
ATOM 9218  O "O4'" . DC  J 6 26  ? 100.68300 79.52700  139.81900 1.000 73.13540  ? -47 DC  J "O4'" 1 
ATOM 9219  C "C3'" . DC  J 6 26  ? 102.23900 80.59600  141.26900 1.000 73.13540  ? -47 DC  J "C3'" 1 
ATOM 9220  O "O3'" . DC  J 6 26  ? 102.62200 81.85000  140.74300 1.000 73.13540  ? -47 DC  J "O3'" 1 
ATOM 9221  C "C2'" . DC  J 6 26  ? 100.81900 80.64700  141.83200 1.000 73.13540  ? -47 DC  J "C2'" 1 
ATOM 9222  C "C1'" . DC  J 6 26  ? 100.01300 80.52100  140.55500 1.000 73.13540  ? -47 DC  J "C1'" 1 
ATOM 9223  N N1    . DC  J 6 26  ? 98.60300  80.07700  140.75300 1.000 73.13540  ? -47 DC  J N1    1 
ATOM 9224  C C2    . DC  J 6 26  ? 97.63600  80.40400  139.80000 1.000 73.13540  ? -47 DC  J C2    1 
ATOM 9225  O O2    . DC  J 6 26  ? 97.95000  81.08200  138.82200 1.000 73.13540  ? -47 DC  J O2    1 
ATOM 9226  N N3    . DC  J 6 26  ? 96.36500  79.98800  139.98600 1.000 73.13540  ? -47 DC  J N3    1 
ATOM 9227  C C4    . DC  J 6 26  ? 96.05100  79.26700  141.05300 1.000 73.13540  ? -47 DC  J C4    1 
ATOM 9228  N N4    . DC  J 6 26  ? 94.78600  78.87200  141.18700 1.000 73.13540  ? -47 DC  J N4    1 
ATOM 9229  C C5    . DC  J 6 26  ? 97.01900  78.91600  142.03200 1.000 73.13540  ? -47 DC  J C5    1 
ATOM 9230  C C6    . DC  J 6 26  ? 98.27200  79.33700  141.84200 1.000 73.13540  ? -47 DC  J C6    1 
ATOM 9231  P P     . DT  J 6 27  ? 104.03700 82.50400  141.13000 1.000 70.72843  ? -46 DT  J P     1 
ATOM 9232  O OP1   . DT  J 6 27  ? 105.09900 81.56200  140.71900 1.000 70.72843  ? -46 DT  J OP1   1 
ATOM 9233  O OP2   . DT  J 6 27  ? 103.95300 82.96500  142.53500 1.000 70.72843  ? -46 DT  J OP2   1 
ATOM 9234  O "O5'" . DT  J 6 27  ? 104.10700 83.80000  140.19900 1.000 70.72843  ? -46 DT  J "O5'" 1 
ATOM 9235  C "C5'" . DT  J 6 27  ? 103.47200 83.78700  138.92700 1.000 70.72843  ? -46 DT  J "C5'" 1 
ATOM 9236  C "C4'" . DT  J 6 27  ? 102.29100 84.74900  138.87800 1.000 70.72843  ? -46 DT  J "C4'" 1 
ATOM 9237  O "O4'" . DT  J 6 27  ? 101.13500 84.14300  139.51500 1.000 70.72843  ? -46 DT  J "O4'" 1 
ATOM 9238  C "C3'" . DT  J 6 27  ? 102.48000 86.09400  139.58400 1.000 70.72843  ? -46 DT  J "C3'" 1 
ATOM 9239  O "O3'" . DT  J 6 27  ? 101.81900 87.09500  138.84200 1.000 70.72843  ? -46 DT  J "O3'" 1 
ATOM 9240  C "C2'" . DT  J 6 27  ? 101.74400 85.86600  140.89500 1.000 70.72843  ? -46 DT  J "C2'" 1 
ATOM 9241  C "C1'" . DT  J 6 27  ? 100.55600 85.09900  140.36500 1.000 70.72843  ? -46 DT  J "C1'" 1 
ATOM 9242  N N1    . DT  J 6 27  ? 99.76600  84.40200  141.40100 1.000 70.72843  ? -46 DT  J N1    1 
ATOM 9243  C C2    . DT  J 6 27  ? 98.45500  84.11000  141.14300 1.000 70.72843  ? -46 DT  J C2    1 
ATOM 9244  O O2    . DT  J 6 27  ? 97.91000  84.38100  140.09100 1.000 70.72843  ? -46 DT  J O2    1 
ATOM 9245  N N3    . DT  J 6 27  ? 97.80000  83.46700  142.15300 1.000 70.72843  ? -46 DT  J N3    1 
ATOM 9246  C C4    . DT  J 6 27  ? 98.31300  83.10700  143.38000 1.000 70.72843  ? -46 DT  J C4    1 
ATOM 9247  O O4    . DT  J 6 27  ? 97.64200  82.53400  144.22700 1.000 70.72843  ? -46 DT  J O4    1 
ATOM 9248  C C5    . DT  J 6 27  ? 99.69300  83.45500  143.59600 1.000 70.72843  ? -46 DT  J C5    1 
ATOM 9249  C C7    . DT  J 6 27  ? 100.36100 83.11100  144.89400 1.000 70.72843  ? -46 DT  J C7    1 
ATOM 9250  C C6    . DT  J 6 27  ? 100.34600 84.08400  142.60800 1.000 70.72843  ? -46 DT  J C6    1 
ATOM 9251  P P     . DG  J 6 28  ? 102.61500 88.07200  137.85300 1.000 65.43638  ? -45 DG  J P     1 
ATOM 9252  O OP1   . DG  J 6 28  ? 103.20000 87.24600  136.77600 1.000 65.43638  ? -45 DG  J OP1   1 
ATOM 9253  O OP2   . DG  J 6 28  ? 103.47000 88.95800  138.67200 1.000 65.43638  ? -45 DG  J OP2   1 
ATOM 9254  O "O5'" . DG  J 6 28  ? 101.45000 88.95300  137.21400 1.000 65.43638  ? -45 DG  J "O5'" 1 
ATOM 9255  C "C5'" . DG  J 6 28  ? 100.41900 88.32000  136.46900 1.000 65.43638  ? -45 DG  J "C5'" 1 
ATOM 9256  C "C4'" . DG  J 6 28  ? 99.03000  88.77200  136.90800 1.000 65.43638  ? -45 DG  J "C4'" 1 
ATOM 9257  O "O4'" . DG  J 6 28  ? 98.64100  88.11700  138.13400 1.000 65.43638  ? -45 DG  J "O4'" 1 
ATOM 9258  C "C3'" . DG  J 6 28  ? 98.85200  90.26700  137.15700 1.000 65.43638  ? -45 DG  J "C3'" 1 
ATOM 9259  O "O3'" . DG  J 6 28  ? 97.57700  90.65100  136.68800 1.000 65.43638  ? -45 DG  J "O3'" 1 
ATOM 9260  C "C2'" . DG  J 6 28  ? 98.92600  90.35500  138.68100 1.000 65.43638  ? -45 DG  J "C2'" 1 
ATOM 9261  C "C1'" . DG  J 6 28  ? 98.19500  89.08400  139.05200 1.000 65.43638  ? -45 DG  J "C1'" 1 
ATOM 9262  N N9    . DG  J 6 28  ? 98.46000  88.58100  140.38800 1.000 65.43638  ? -45 DG  J N9    1 
ATOM 9263  C C8    . DG  J 6 28  ? 99.63900  88.61300  141.07900 1.000 65.43638  ? -45 DG  J C8    1 
ATOM 9264  N N7    . DG  J 6 28  ? 99.56400  88.04400  142.25000 1.000 65.43638  ? -45 DG  J N7    1 
ATOM 9265  C C5    . DG  J 6 28  ? 98.25300  87.60100  142.32600 1.000 65.43638  ? -45 DG  J C5    1 
ATOM 9266  C C6    . DG  J 6 28  ? 97.57300  86.91300  143.35800 1.000 65.43638  ? -45 DG  J C6    1 
ATOM 9267  O O6    . DG  J 6 28  ? 98.01000  86.53600  144.45300 1.000 65.43638  ? -45 DG  J O6    1 
ATOM 9268  N N1    . DG  J 6 28  ? 96.25000  86.66200  143.02000 1.000 65.43638  ? -45 DG  J N1    1 
ATOM 9269  C C2    . DG  J 6 28  ? 95.66100  87.03000  141.83900 1.000 65.43638  ? -45 DG  J C2    1 
ATOM 9270  N N2    . DG  J 6 28  ? 94.37600  86.70700  141.68000 1.000 65.43638  ? -45 DG  J N2    1 
ATOM 9271  N N3    . DG  J 6 28  ? 96.28600  87.66900  140.87300 1.000 65.43638  ? -45 DG  J N3    1 
ATOM 9272  C C4    . DG  J 6 28  ? 97.57100  87.92100  141.18400 1.000 65.43638  ? -45 DG  J C4    1 
ATOM 9273  P P     . DG  J 6 29  ? 97.31000  92.13700  136.15300 1.000 61.39643  ? -44 DG  J P     1 
ATOM 9274  O OP1   . DG  J 6 29  ? 97.64600  92.13900  134.71900 1.000 61.39643  ? -44 DG  J OP1   1 
ATOM 9275  O OP2   . DG  J 6 29  ? 97.96200  93.09600  137.06300 1.000 61.39643  ? -44 DG  J OP2   1 
ATOM 9276  O "O5'" . DG  J 6 29  ? 95.73700  92.32100  136.31400 1.000 61.39643  ? -44 DG  J "O5'" 1 
ATOM 9277  C "C5'" . DG  J 6 29  ? 94.85500  91.22300  136.10100 1.000 61.39643  ? -44 DG  J "C5'" 1 
ATOM 9278  C "C4'" . DG  J 6 29  ? 93.76300  91.18300  137.16400 1.000 61.39643  ? -44 DG  J "C4'" 1 
ATOM 9279  O "O4'" . DG  J 6 29  ? 94.26900  90.59700  138.38800 1.000 61.39643  ? -44 DG  J "O4'" 1 
ATOM 9280  C "C3'" . DG  J 6 29  ? 93.17900  92.53700  137.56100 1.000 61.39643  ? -44 DG  J "C3'" 1 
ATOM 9281  O "O3'" . DG  J 6 29  ? 91.78600  92.40400  137.74300 1.000 61.39643  ? -44 DG  J "O3'" 1 
ATOM 9282  C "C2'" . DG  J 6 29  ? 93.88000  92.82000  138.88700 1.000 61.39643  ? -44 DG  J "C2'" 1 
ATOM 9283  C "C1'" . DG  J 6 29  ? 93.91700  91.42600  139.46700 1.000 61.39643  ? -44 DG  J "C1'" 1 
ATOM 9284  N N9    . DG  J 6 29  ? 94.90100  91.23100  140.52000 1.000 61.39643  ? -44 DG  J N9    1 
ATOM 9285  C C8    . DG  J 6 29  ? 96.21200  91.62000  140.50300 1.000 61.39643  ? -44 DG  J C8    1 
ATOM 9286  N N7    . DG  J 6 29  ? 96.86400  91.29600  141.58100 1.000 61.39643  ? -44 DG  J N7    1 
ATOM 9287  C C5    . DG  J 6 29  ? 95.91700  90.66700  142.37400 1.000 61.39643  ? -44 DG  J C5    1 
ATOM 9288  C C6    . DG  J 6 29  ? 96.03800  90.10600  143.66200 1.000 61.39643  ? -44 DG  J C6    1 
ATOM 9289  O O6    . DG  J 6 29  ? 97.03900  90.06000  144.38300 1.000 61.39643  ? -44 DG  J O6    1 
ATOM 9290  N N1    . DG  J 6 29  ? 94.83700  89.56800  144.10600 1.000 61.39643  ? -44 DG  J N1    1 
ATOM 9291  C C2    . DG  J 6 29  ? 93.66700  89.56800  143.39000 1.000 61.39643  ? -44 DG  J C2    1 
ATOM 9292  N N2    . DG  J 6 29  ? 92.60600  89.00100  143.97900 1.000 61.39643  ? -44 DG  J N2    1 
ATOM 9293  N N3    . DG  J 6 29  ? 93.54100  90.08700  142.17800 1.000 61.39643  ? -44 DG  J N3    1 
ATOM 9294  C C4    . DG  J 6 29  ? 94.70400  90.61800  141.73400 1.000 61.39643  ? -44 DG  J C4    1 
ATOM 9295  P P     . DA  J 6 30  ? 90.81500  93.66400  137.55100 1.000 63.01302  ? -43 DA  J P     1 
ATOM 9296  O OP1   . DA  J 6 30  ? 90.07700  93.45200  136.29400 1.000 63.01302  ? -43 DA  J OP1   1 
ATOM 9297  O OP2   . DA  J 6 30  ? 91.58600  94.90600  137.75400 1.000 63.01302  ? -43 DA  J OP2   1 
ATOM 9298  O "O5'" . DA  J 6 30  ? 89.78400  93.54200  138.75800 1.000 63.01302  ? -43 DA  J "O5'" 1 
ATOM 9299  C "C5'" . DA  J 6 30  ? 89.10800  92.32300  139.00600 1.000 63.01302  ? -43 DA  J "C5'" 1 
ATOM 9300  C "C4'" . DA  J 6 30  ? 88.69900  92.23500  140.46400 1.000 63.01302  ? -43 DA  J "C4'" 1 
ATOM 9301  O "O4'" . DA  J 6 30  ? 89.85000  91.92700  141.27400 1.000 63.01302  ? -43 DA  J "O4'" 1 
ATOM 9302  C "C3'" . DA  J 6 30  ? 88.08900  93.51000  141.03600 1.000 63.01302  ? -43 DA  J "C3'" 1 
ATOM 9303  O "O3'" . DA  J 6 30  ? 86.87800  93.20300  141.71700 1.000 63.01302  ? -43 DA  J "O3'" 1 
ATOM 9304  C "C2'" . DA  J 6 30  ? 89.17300  94.05000  141.97300 1.000 63.01302  ? -43 DA  J "C2'" 1 
ATOM 9305  C "C1'" . DA  J 6 30  ? 89.90700  92.78900  142.38100 1.000 63.01302  ? -43 DA  J "C1'" 1 
ATOM 9306  N N9    . DA  J 6 30  ? 91.31700  92.99300  142.67800 1.000 63.01302  ? -43 DA  J N9    1 
ATOM 9307  C C8    . DA  J 6 30  ? 92.25200  93.53400  141.85300 1.000 63.01302  ? -43 DA  J C8    1 
ATOM 9308  N N7    . DA  J 6 30  ? 93.45500  93.57800  142.36600 1.000 63.01302  ? -43 DA  J N7    1 
ATOM 9309  C C5    . DA  J 6 30  ? 93.29200  93.04700  143.62600 1.000 63.01302  ? -43 DA  J C5    1 
ATOM 9310  C C6    . DA  J 6 30  ? 94.19200  92.82100  144.68200 1.000 63.01302  ? -43 DA  J C6    1 
ATOM 9311  N N6    . DA  J 6 30  ? 95.49100  93.13000  144.62000 1.000 63.01302  ? -43 DA  J N6    1 
ATOM 9312  N N1    . DA  J 6 30  ? 93.70400  92.26700  145.81200 1.000 63.01302  ? -43 DA  J N1    1 
ATOM 9313  C C2    . DA  J 6 30  ? 92.40200  91.96000  145.87200 1.000 63.01302  ? -43 DA  J C2    1 
ATOM 9314  N N3    . DA  J 6 30  ? 91.46200  92.12500  144.94300 1.000 63.01302  ? -43 DA  J N3    1 
ATOM 9315  C C4    . DA  J 6 30  ? 91.97900  92.67600  143.83600 1.000 63.01302  ? -43 DA  J C4    1 
ATOM 9316  P P     . DG  J 6 31  ? 85.91400  94.37500  142.24200 1.000 68.90447  ? -42 DG  J P     1 
ATOM 9317  O OP1   . DG  J 6 31  ? 84.51600  93.94700  142.04000 1.000 68.90447  ? -42 DG  J OP1   1 
ATOM 9318  O OP2   . DG  J 6 31  ? 86.35900  95.65900  141.66000 1.000 68.90447  ? -42 DG  J OP2   1 
ATOM 9319  O "O5'" . DG  J 6 31  ? 86.17900  94.38700  143.81000 1.000 68.90447  ? -42 DG  J "O5'" 1 
ATOM 9320  C "C5'" . DG  J 6 31  ? 85.93500  93.20900  144.57400 1.000 68.90447  ? -42 DG  J "C5'" 1 
ATOM 9321  C "C4'" . DG  J 6 31  ? 86.23800  93.43800  146.04600 1.000 68.90447  ? -42 DG  J "C4'" 1 
ATOM 9322  O "O4'" . DG  J 6 31  ? 87.66100  93.39700  146.28700 1.000 68.90447  ? -42 DG  J "O4'" 1 
ATOM 9323  C "C3'" . DG  J 6 31  ? 85.73900  94.75300  146.62500 1.000 68.90447  ? -42 DG  J "C3'" 1 
ATOM 9324  O "O3'" . DG  J 6 31  ? 85.16800  94.51200  147.90000 1.000 68.90447  ? -42 DG  J "O3'" 1 
ATOM 9325  C "C2'" . DG  J 6 31  ? 87.00300  95.61300  146.69700 1.000 68.90447  ? -42 DG  J "C2'" 1 
ATOM 9326  C "C1'" . DG  J 6 31  ? 88.07000  94.56700  146.95500 1.000 68.90447  ? -42 DG  J "C1'" 1 
ATOM 9327  N N9    . DG  J 6 31  ? 89.38400  94.90100  146.44200 1.000 68.90447  ? -42 DG  J N9    1 
ATOM 9328  C C8    . DG  J 6 31  ? 89.69100  95.32200  145.17600 1.000 68.90447  ? -42 DG  J C8    1 
ATOM 9329  N N7    . DG  J 6 31  ? 90.96200  95.53200  144.99300 1.000 68.90447  ? -42 DG  J N7    1 
ATOM 9330  C C5    . DG  J 6 31  ? 91.52500  95.26300  146.22700 1.000 68.90447  ? -42 DG  J C5    1 
ATOM 9331  C C6    . DG  J 6 31  ? 92.86600  95.33000  146.64200 1.000 68.90447  ? -42 DG  J C6    1 
ATOM 9332  O O6    . DG  J 6 31  ? 93.85300  95.65700  145.97700 1.000 68.90447  ? -42 DG  J O6    1 
ATOM 9333  N N1    . DG  J 6 31  ? 93.01000  94.97500  147.97700 1.000 68.90447  ? -42 DG  J N1    1 
ATOM 9334  C C2    . DG  J 6 31  ? 91.98200  94.60400  148.80400 1.000 68.90447  ? -42 DG  J C2    1 
ATOM 9335  N N2    . DG  J 6 31  ? 92.30700  94.29600  150.06500 1.000 68.90447  ? -42 DG  J N2    1 
ATOM 9336  N N3    . DG  J 6 31  ? 90.71700  94.53500  148.42500 1.000 68.90447  ? -42 DG  J N3    1 
ATOM 9337  C C4    . DG  J 6 31  ? 90.56500  94.87400  147.12900 1.000 68.90447  ? -42 DG  J C4    1 
ATOM 9338  P P     . DA  J 6 32  ? 84.20900  95.59800  148.58200 1.000 71.35904  ? -41 DA  J P     1 
ATOM 9339  O OP1   . DA  J 6 32  ? 83.12500  94.86500  149.27000 1.000 71.35904  ? -41 DA  J OP1   1 
ATOM 9340  O OP2   . DA  J 6 32  ? 83.88900  96.61200  147.55600 1.000 71.35904  ? -41 DA  J OP2   1 
ATOM 9341  O "O5'" . DA  J 6 32  ? 85.13200  96.28400  149.68900 1.000 71.35904  ? -41 DA  J "O5'" 1 
ATOM 9342  C "C5'" . DA  J 6 32  ? 85.81100  95.48100  150.65300 1.000 71.35904  ? -41 DA  J "C5'" 1 
ATOM 9343  C "C4'" . DA  J 6 32  ? 86.76500  96.33100  151.46900 1.000 71.35904  ? -41 DA  J "C4'" 1 
ATOM 9344  O "O4'" . DA  J 6 32  ? 88.03500  96.41700  150.79000 1.000 71.35904  ? -41 DA  J "O4'" 1 
ATOM 9345  C "C3'" . DA  J 6 32  ? 86.29700  97.76700  151.70700 1.000 71.35904  ? -41 DA  J "C3'" 1 
ATOM 9346  O "O3'" . DA  J 6 32  ? 86.39300  98.07700  153.10200 1.000 71.35904  ? -41 DA  J "O3'" 1 
ATOM 9347  C "C2'" . DA  J 6 32  ? 87.25100  98.59900  150.84200 1.000 71.35904  ? -41 DA  J "C2'" 1 
ATOM 9348  C "C1'" . DA  J 6 32  ? 88.49700  97.73700  150.84400 1.000 71.35904  ? -41 DA  J "C1'" 1 
ATOM 9349  N N9    . DA  J 6 32  ? 89.33700  97.93000  149.67300 1.000 71.35904  ? -41 DA  J N9    1 
ATOM 9350  C C8    . DA  J 6 32  ? 88.91300  98.06700  148.38600 1.000 71.35904  ? -41 DA  J C8    1 
ATOM 9351  N N7    . DA  J 6 32  ? 89.88200  98.22900  147.52400 1.000 71.35904  ? -41 DA  J N7    1 
ATOM 9352  C C5    . DA  J 6 32  ? 91.01900  98.23000  148.30300 1.000 71.35904  ? -41 DA  J C5    1 
ATOM 9353  C C6    . DA  J 6 32  ? 92.37600  98.38300  147.98700 1.000 71.35904  ? -41 DA  J C6    1 
ATOM 9354  N N6    . DA  J 6 32  ? 92.81800  98.55900  146.74100 1.000 71.35904  ? -41 DA  J N6    1 
ATOM 9355  N N1    . DA  J 6 32  ? 93.26600  98.34100  148.99800 1.000 71.35904  ? -41 DA  J N1    1 
ATOM 9356  C C2    . DA  J 6 32  ? 92.81800  98.16200  150.24600 1.000 71.35904  ? -41 DA  J C2    1 
ATOM 9357  N N3    . DA  J 6 32  ? 91.56300  98.01000  150.66600 1.000 71.35904  ? -41 DA  J N3    1 
ATOM 9358  C C4    . DA  J 6 32  ? 90.70600  98.05300  149.63400 1.000 71.35904  ? -41 DA  J C4    1 
ATOM 9359  P P     . DC  J 6 33  ? 85.73500  99.41400  153.70800 1.000 72.25070  ? -40 DC  J P     1 
ATOM 9360  O OP1   . DC  J 6 33  ? 85.01800  99.00800  154.93400 1.000 72.25070  ? -40 DC  J OP1   1 
ATOM 9361  O OP2   . DC  J 6 33  ? 84.99200  100.11400 152.64000 1.000 72.25070  ? -40 DC  J OP2   1 
ATOM 9362  O "O5'" . DC  J 6 33  ? 86.98400  100.30800 154.14800 1.000 72.25070  ? -40 DC  J "O5'" 1 
ATOM 9363  C "C5'" . DC  J 6 33  ? 88.02400  99.74200  154.94600 1.000 72.25070  ? -40 DC  J "C5'" 1 
ATOM 9364  C "C4'" . DC  J 6 33  ? 89.30700  100.53700 154.78900 1.000 72.25070  ? -40 DC  J "C4'" 1 
ATOM 9365  O "O4'" . DC  J 6 33  ? 89.86300  100.28600 153.49000 1.000 72.25070  ? -40 DC  J "O4'" 1 
ATOM 9366  C "C3'" . DC  J 6 33  ? 89.14800  102.05900 154.87400 1.000 72.25070  ? -40 DC  J "C3'" 1 
ATOM 9367  O "O3'" . DC  J 6 33  ? 89.69600  102.55600 156.09200 1.000 72.25070  ? -40 DC  J "O3'" 1 
ATOM 9368  C "C2'" . DC  J 6 33  ? 89.91600  102.58900 153.66100 1.000 72.25070  ? -40 DC  J "C2'" 1 
ATOM 9369  C "C1'" . DC  J 6 33  ? 90.66600  101.37500 153.15400 1.000 72.25070  ? -40 DC  J "C1'" 1 
ATOM 9370  N N1    . DC  J 6 33  ? 90.81800  101.39100 151.69500 1.000 72.25070  ? -40 DC  J N1    1 
ATOM 9371  C C2    . DC  J 6 33  ? 92.08700  101.51100 151.12900 1.000 72.25070  ? -40 DC  J C2    1 
ATOM 9372  O O2    . DC  J 6 33  ? 93.06900  101.60300 151.87400 1.000 72.25070  ? -40 DC  J O2    1 
ATOM 9373  N N3    . DC  J 6 33  ? 92.20000  101.52800 149.78400 1.000 72.25070  ? -40 DC  J N3    1 
ATOM 9374  C C4    . DC  J 6 33  ? 91.11000  101.43400 149.02500 1.000 72.25070  ? -40 DC  J C4    1 
ATOM 9375  N N4    . DC  J 6 33  ? 91.26500  101.44600 147.70100 1.000 72.25070  ? -40 DC  J N4    1 
ATOM 9376  C C5    . DC  J 6 33  ? 89.81000  101.30900 149.58700 1.000 72.25070  ? -40 DC  J C5    1 
ATOM 9377  C C6    . DC  J 6 33  ? 89.71300  101.29100 150.91200 1.000 72.25070  ? -40 DC  J C6    1 
ATOM 9378  P P     . DT  J 6 34  ? 89.62300  104.12700 156.43400 1.000 72.80575  ? -39 DT  J P     1 
ATOM 9379  O OP1   . DT  J 6 34  ? 89.61000  104.23800 157.90800 1.000 72.80575  ? -39 DT  J OP1   1 
ATOM 9380  O OP2   . DT  J 6 34  ? 88.52100  104.73700 155.66000 1.000 72.80575  ? -39 DT  J OP2   1 
ATOM 9381  O "O5'" . DT  J 6 34  ? 91.01500  104.71400 155.89600 1.000 72.80575  ? -39 DT  J "O5'" 1 
ATOM 9382  C "C5'" . DT  J 6 34  ? 92.24100  104.18400 156.38500 1.000 72.80575  ? -39 DT  J "C5'" 1 
ATOM 9383  C "C4'" . DT  J 6 34  ? 93.44700  104.79200 155.68000 1.000 72.80575  ? -39 DT  J "C4'" 1 
ATOM 9384  O "O4'" . DT  J 6 34  ? 93.43600  104.44800 154.26900 1.000 72.80575  ? -39 DT  J "O4'" 1 
ATOM 9385  C "C3'" . DT  J 6 34  ? 93.56700  106.31700 155.74400 1.000 72.80575  ? -39 DT  J "C3'" 1 
ATOM 9386  O "O3'" . DT  J 6 34  ? 94.93200  106.66000 155.98400 1.000 72.80575  ? -39 DT  J "O3'" 1 
ATOM 9387  C "C2'" . DT  J 6 34  ? 93.11800  106.74500 154.34400 1.000 72.80575  ? -39 DT  J "C2'" 1 
ATOM 9388  C "C1'" . DT  J 6 34  ? 93.68000  105.61100 153.51200 1.000 72.80575  ? -39 DT  J "C1'" 1 
ATOM 9389  N N1    . DT  J 6 34  ? 93.04400  105.43500 152.17400 1.000 72.80575  ? -39 DT  J N1    1 
ATOM 9390  C C2    . DT  J 6 34  ? 93.84200  105.39200 151.05800 1.000 72.80575  ? -39 DT  J C2    1 
ATOM 9391  O O2    . DT  J 6 34  ? 95.05000  105.52500 151.09900 1.000 72.80575  ? -39 DT  J O2    1 
ATOM 9392  N N3    . DT  J 6 34  ? 93.17100  105.19900 149.88300 1.000 72.80575  ? -39 DT  J N3    1 
ATOM 9393  C C4    . DT  J 6 34  ? 91.81000  105.03700 149.71900 1.000 72.80575  ? -39 DT  J C4    1 
ATOM 9394  O O4    . DT  J 6 34  ? 91.29600  104.86900 148.62100 1.000 72.80575  ? -39 DT  J O4    1 
ATOM 9395  C C5    . DT  J 6 34  ? 91.03400  105.08100 150.92700 1.000 72.80575  ? -39 DT  J C5    1 
ATOM 9396  C C7    . DT  J 6 34  ? 89.54700  104.92400 150.86300 1.000 72.80575  ? -39 DT  J C7    1 
ATOM 9397  C C6    . DT  J 6 34  ? 91.68000  105.27400 152.08500 1.000 72.80575  ? -39 DT  J C6    1 
ATOM 9398  P P     . DA  J 6 35  ? 95.34900  108.10800 156.54500 1.000 70.94636  ? -38 DA  J P     1 
ATOM 9399  O OP1   . DA  J 6 35  ? 95.85200  107.91100 157.92100 1.000 70.94636  ? -38 DA  J OP1   1 
ATOM 9400  O OP2   . DA  J 6 35  ? 94.26000  109.07500 156.30100 1.000 70.94636  ? -38 DA  J OP2   1 
ATOM 9401  O "O5'" . DA  J 6 35  ? 96.59500  108.52000 155.63300 1.000 70.94636  ? -38 DA  J "O5'" 1 
ATOM 9402  C "C5'" . DA  J 6 35  ? 96.71300  108.00600 154.30900 1.000 70.94636  ? -38 DA  J "C5'" 1 
ATOM 9403  C "C4'" . DA  J 6 35  ? 97.04100  109.11400 153.33400 1.000 70.94636  ? -38 DA  J "C4'" 1 
ATOM 9404  O "O4'" . DA  J 6 35  ? 96.24800  108.93900 152.12700 1.000 70.94636  ? -38 DA  J "O4'" 1 
ATOM 9405  C "C3'" . DA  J 6 35  ? 96.69100  110.51000 153.83100 1.000 70.94636  ? -38 DA  J "C3'" 1 
ATOM 9406  O "O3'" . DA  J 6 35  ? 97.48000  111.46500 153.15200 1.000 70.94636  ? -38 DA  J "O3'" 1 
ATOM 9407  C "C2'" . DA  J 6 35  ? 95.24200  110.61000 153.39700 1.000 70.94636  ? -38 DA  J "C2'" 1 
ATOM 9408  C "C1'" . DA  J 6 35  ? 95.37500  110.04100 151.99800 1.000 70.94636  ? -38 DA  J "C1'" 1 
ATOM 9409  N N9    . DA  J 6 35  ? 94.12000  109.59200 151.41400 1.000 70.94636  ? -38 DA  J N9    1 
ATOM 9410  C C8    . DA  J 6 35  ? 92.90500  109.50700 152.03000 1.000 70.94636  ? -38 DA  J C8    1 
ATOM 9411  N N7    . DA  J 6 35  ? 91.94600  109.08000 151.24700 1.000 70.94636  ? -38 DA  J N7    1 
ATOM 9412  C C5    . DA  J 6 35  ? 92.57600  108.88800 150.03200 1.000 70.94636  ? -38 DA  J C5    1 
ATOM 9413  C C6    . DA  J 6 35  ? 92.10900  108.44900 148.78100 1.000 70.94636  ? -38 DA  J C6    1 
ATOM 9414  N N6    . DA  J 6 35  ? 90.83900  108.10800 148.55000 1.000 70.94636  ? -38 DA  J N6    1 
ATOM 9415  N N1    . DA  J 6 35  ? 93.00300  108.37100 147.77100 1.000 70.94636  ? -38 DA  J N1    1 
ATOM 9416  C C2    . DA  J 6 35  ? 94.27400  108.71300 148.00400 1.000 70.94636  ? -38 DA  J C2    1 
ATOM 9417  N N3    . DA  J 6 35  ? 94.82600  109.13900 149.13700 1.000 70.94636  ? -38 DA  J N3    1 
ATOM 9418  C C4    . DA  J 6 35  ? 93.91400  109.20600 150.11800 1.000 70.94636  ? -38 DA  J C4    1 
ATOM 9419  P P     . DG  J 6 36  ? 98.72000  112.17000 153.88700 1.000 69.02709  ? -37 DG  J P     1 
ATOM 9420  O OP1   . DG  J 6 36  ? 99.68800  111.11400 154.24900 1.000 69.02709  ? -37 DG  J OP1   1 
ATOM 9421  O OP2   . DG  J 6 36  ? 98.17500  113.06800 154.92700 1.000 69.02709  ? -37 DG  J OP2   1 
ATOM 9422  O "O5'" . DG  J 6 36  ? 99.36500  113.07500 152.74300 1.000 69.02709  ? -37 DG  J "O5'" 1 
ATOM 9423  C "C5'" . DG  J 6 36  ? 100.11800 112.47200 151.70600 1.000 69.02709  ? -37 DG  J "C5'" 1 
ATOM 9424  C "C4'" . DG  J 6 36  ? 99.61300  112.91800 150.34500 1.000 69.02709  ? -37 DG  J "C4'" 1 
ATOM 9425  O "O4'" . DG  J 6 36  ? 98.24500  112.49600 150.15800 1.000 69.02709  ? -37 DG  J "O4'" 1 
ATOM 9426  C "C3'" . DG  J 6 36  ? 99.62500  114.42800 150.10300 1.000 69.02709  ? -37 DG  J "C3'" 1 
ATOM 9427  O "O3'" . DG  J 6 36  ? 100.28200 114.67800 148.88300 1.000 69.02709  ? -37 DG  J "O3'" 1 
ATOM 9428  C "C2'" . DG  J 6 36  ? 98.12900  114.78100 150.03300 1.000 69.02709  ? -37 DG  J "C2'" 1 
ATOM 9429  C "C1'" . DG  J 6 36  ? 97.57600  113.50000 149.45000 1.000 69.02709  ? -37 DG  J "C1'" 1 
ATOM 9430  N N9    . DG  J 6 36  ? 96.14700  113.29000 149.65600 1.000 69.02709  ? -37 DG  J N9    1 
ATOM 9431  C C8    . DG  J 6 36  ? 95.43400  113.51200 150.80500 1.000 69.02709  ? -37 DG  J C8    1 
ATOM 9432  N N7    . DG  J 6 36  ? 94.17100  113.20800 150.70000 1.000 69.02709  ? -37 DG  J N7    1 
ATOM 9433  C C5    . DG  J 6 36  ? 94.03800  112.75400 149.39800 1.000 69.02709  ? -37 DG  J C5    1 
ATOM 9434  C C6    . DG  J 6 36  ? 92.89600  112.29100 148.70800 1.000 69.02709  ? -37 DG  J C6    1 
ATOM 9435  O O6    . DG  J 6 36  ? 91.73700  112.18400 149.12600 1.000 69.02709  ? -37 DG  J O6    1 
ATOM 9436  N N1    . DG  J 6 36  ? 93.19500  111.92600 147.40400 1.000 69.02709  ? -37 DG  J N1    1 
ATOM 9437  C C2    . DG  J 6 36  ? 94.44000  112.00000 146.83200 1.000 69.02709  ? -37 DG  J C2    1 
ATOM 9438  N N2    . DG  J 6 36  ? 94.52800  111.60300 145.55800 1.000 69.02709  ? -37 DG  J N2    1 
ATOM 9439  N N3    . DG  J 6 36  ? 95.52100  112.43400 147.46500 1.000 69.02709  ? -37 DG  J N3    1 
ATOM 9440  C C4    . DG  J 6 36  ? 95.24500  112.79200 148.74300 1.000 69.02709  ? -37 DG  J C4    1 
ATOM 9441  P P     . DG  J 6 37  ? 101.21000 115.97300 148.69900 1.000 69.64613  ? -36 DG  J P     1 
ATOM 9442  O OP1   . DG  J 6 37  ? 102.61300 115.56600 148.93200 1.000 69.64613  ? -36 DG  J OP1   1 
ATOM 9443  O OP2   . DG  J 6 37  ? 100.61100 117.07500 149.48200 1.000 69.64613  ? -36 DG  J OP2   1 
ATOM 9444  O "O5'" . DG  J 6 37  ? 101.03000 116.32500 147.15900 1.000 69.64613  ? -36 DG  J "O5'" 1 
ATOM 9445  C "C5'" . DG  J 6 37  ? 101.10400 115.29100 146.18700 1.000 69.64613  ? -36 DG  J "C5'" 1 
ATOM 9446  C "C4'" .