data_6T8B
# 
_entry.id   6T8B 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6T8B         
WWPDB D_1292105035 
EMDB  EMD-10399    
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB 'FtsK motor domain with dsDNA, translocating state' EMD-10399 'associated EM volume' 
PDB  .                                                   6T8G      unspecified            
PDB  .                                                   6T8O      unspecified            
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6T8B 
_pdbx_database_status.recvd_initial_deposition_date   2019-10-24 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Jean, N.L.' 1 0000-0001-7759-4757 
'Lowe, J.'   2 0000-0002-5218-6615 
# 
loop_
_citation.abstract 
_citation.abstract_id_CAS 
_citation.book_id_ISBN 
_citation.book_publisher 
_citation.book_publisher_city 
_citation.book_title 
_citation.coordinate_linkage 
_citation.country 
_citation.database_id_Medline 
_citation.details 
_citation.id 
_citation.journal_abbrev 
_citation.journal_id_ASTM 
_citation.journal_id_CSD 
_citation.journal_id_ISSN 
_citation.journal_full 
_citation.journal_issue 
_citation.journal_volume 
_citation.language 
_citation.page_first 
_citation.page_last 
_citation.title 
_citation.year 
_citation.database_id_CSD 
_citation.pdbx_database_id_DOI 
_citation.pdbx_database_id_PubMed 
_citation.unpublished_flag 
? ? ? ? ? ? ? US ? ? primary Proc.Natl.Acad.Sci.USA PNASA6 0040 1091-6490 ? ? 117 ? 14202 14208 
'FtsK in motion reveals its mechanism for double-stranded DNA translocation.' 2020 ? 10.1073/pnas.2001324117 32513722 ? 
? ? ? ? ? ? ? US ? ? 1       Biorxiv                ?      ?    ?         ? ? ?   ? ?     ?     
'FtsK in motion reveals its mechanism for double-stranded DNA translocation'  ?    ? 10.1101/828319          ?        ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Jean, N.L.'       1 ?                   
primary 'Rutherford, T.J.' 2 ?                   
primary 'Lowe, J.'         3 ?                   
1       'Jean, N.L.'       4 0000-0001-7759-4757 
1       'Rutherford, T.J.' 5 0000-0001-7294-1668 
1       'Lowe, J.'         6 0000-0002-5218-6615 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6T8B 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.00 
_cell.length_a_esd                 ? 
_cell.length_b                     1.00 
_cell.length_b_esd                 ? 
_cell.length_c                     1.00 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6T8B 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA translocase FtsK'                       54001.441 6 ? ? 'Motor domain, residues 247-728' ? 
2 polymer     syn 'dsDNA substrate'                            6129.039  2 ? ? ?                                
'Sequence not determined due to sequence heterogeneity of the protein-bound DNA' 
3 non-polymer syn 'PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER' 523.247   3 ? ? ?                                ? 
4 non-polymer syn 'MAGNESIUM ION'                              24.305    4 ? ? ?                                ? 
5 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"                   427.201   3 ? ? ?                                ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MVPDRREQSKAKERLLEREEALAKHMSEREKRPPPKIDPPPSPKAPEPSKRVLKEKQAPLFVDTAVEGTLPPLSLLDPAE
VKQKSYSPESLEAMSRLLEIKLKEFGVEVSVDSVHPGPVITRFEIQPAAGVKVSRISNLAKDLARSLAVISVRVVEVIPG
KTTVGIEIPNEDRQMVRFSEVLSSPEYDEHKSTVPLALGHDIGGRPIITDLAKMPHLLVAGTTGSGKSVGVNAMLLSILF
KSTPSEARLIMIDPKMLELSIYEGIPHLLCPVVTDMKEAANALRWSVAEMERRYRLMAAMGVRNLAGFNRKVKDAEEAGT
PLTDPLFRRESPDDEPPQLSTLPTIVVVVDEFADMMMIVGKKVEELIARIAQKARAAGIHLILATQRPSVDVITGLIKAN
IPTRIAFQVSSKIDSRTILDQGGAEQLLGHGDMLYLPPGTGLPIRVHGAFVSDDEVHRVVEAWKLRGAPDYIEDILAGVD
EGGKLHHHHHH
;
;MVPDRREQSKAKERLLEREEALAKHMSEREKRPPPKIDPPPSPKAPEPSKRVLKEKQAPLFVDTAVEGTLPPLSLLDPAE
VKQKSYSPESLEAMSRLLEIKLKEFGVEVSVDSVHPGPVITRFEIQPAAGVKVSRISNLAKDLARSLAVISVRVVEVIPG
KTTVGIEIPNEDRQMVRFSEVLSSPEYDEHKSTVPLALGHDIGGRPIITDLAKMPHLLVAGTTGSGKSVGVNAMLLSILF
KSTPSEARLIMIDPKMLELSIYEGIPHLLCPVVTDMKEAANALRWSVAEMERRYRLMAAMGVRNLAGFNRKVKDAEEAGT
PLTDPLFRRESPDDEPPQLSTLPTIVVVVDEFADMMMIVGKKVEELIARIAQKARAAGIHLILATQRPSVDVITGLIKAN
IPTRIAFQVSSKIDSRTILDQGGAEQLLGHGDMLYLPPGTGLPIRVHGAFVSDDEVHRVVEAWKLRGAPDYIEDILAGVD
EGGKLHHHHHH
;
A,B,C,D,E,F ? 
2 polydeoxyribonucleotide no no '(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)' 
ATATATATATATATATATAT G,H         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   VAL n 
1 3   PRO n 
1 4   ASP n 
1 5   ARG n 
1 6   ARG n 
1 7   GLU n 
1 8   GLN n 
1 9   SER n 
1 10  LYS n 
1 11  ALA n 
1 12  LYS n 
1 13  GLU n 
1 14  ARG n 
1 15  LEU n 
1 16  LEU n 
1 17  GLU n 
1 18  ARG n 
1 19  GLU n 
1 20  GLU n 
1 21  ALA n 
1 22  LEU n 
1 23  ALA n 
1 24  LYS n 
1 25  HIS n 
1 26  MET n 
1 27  SER n 
1 28  GLU n 
1 29  ARG n 
1 30  GLU n 
1 31  LYS n 
1 32  ARG n 
1 33  PRO n 
1 34  PRO n 
1 35  PRO n 
1 36  LYS n 
1 37  ILE n 
1 38  ASP n 
1 39  PRO n 
1 40  PRO n 
1 41  PRO n 
1 42  SER n 
1 43  PRO n 
1 44  LYS n 
1 45  ALA n 
1 46  PRO n 
1 47  GLU n 
1 48  PRO n 
1 49  SER n 
1 50  LYS n 
1 51  ARG n 
1 52  VAL n 
1 53  LEU n 
1 54  LYS n 
1 55  GLU n 
1 56  LYS n 
1 57  GLN n 
1 58  ALA n 
1 59  PRO n 
1 60  LEU n 
1 61  PHE n 
1 62  VAL n 
1 63  ASP n 
1 64  THR n 
1 65  ALA n 
1 66  VAL n 
1 67  GLU n 
1 68  GLY n 
1 69  THR n 
1 70  LEU n 
1 71  PRO n 
1 72  PRO n 
1 73  LEU n 
1 74  SER n 
1 75  LEU n 
1 76  LEU n 
1 77  ASP n 
1 78  PRO n 
1 79  ALA n 
1 80  GLU n 
1 81  VAL n 
1 82  LYS n 
1 83  GLN n 
1 84  LYS n 
1 85  SER n 
1 86  TYR n 
1 87  SER n 
1 88  PRO n 
1 89  GLU n 
1 90  SER n 
1 91  LEU n 
1 92  GLU n 
1 93  ALA n 
1 94  MET n 
1 95  SER n 
1 96  ARG n 
1 97  LEU n 
1 98  LEU n 
1 99  GLU n 
1 100 ILE n 
1 101 LYS n 
1 102 LEU n 
1 103 LYS n 
1 104 GLU n 
1 105 PHE n 
1 106 GLY n 
1 107 VAL n 
1 108 GLU n 
1 109 VAL n 
1 110 SER n 
1 111 VAL n 
1 112 ASP n 
1 113 SER n 
1 114 VAL n 
1 115 HIS n 
1 116 PRO n 
1 117 GLY n 
1 118 PRO n 
1 119 VAL n 
1 120 ILE n 
1 121 THR n 
1 122 ARG n 
1 123 PHE n 
1 124 GLU n 
1 125 ILE n 
1 126 GLN n 
1 127 PRO n 
1 128 ALA n 
1 129 ALA n 
1 130 GLY n 
1 131 VAL n 
1 132 LYS n 
1 133 VAL n 
1 134 SER n 
1 135 ARG n 
1 136 ILE n 
1 137 SER n 
1 138 ASN n 
1 139 LEU n 
1 140 ALA n 
1 141 LYS n 
1 142 ASP n 
1 143 LEU n 
1 144 ALA n 
1 145 ARG n 
1 146 SER n 
1 147 LEU n 
1 148 ALA n 
1 149 VAL n 
1 150 ILE n 
1 151 SER n 
1 152 VAL n 
1 153 ARG n 
1 154 VAL n 
1 155 VAL n 
1 156 GLU n 
1 157 VAL n 
1 158 ILE n 
1 159 PRO n 
1 160 GLY n 
1 161 LYS n 
1 162 THR n 
1 163 THR n 
1 164 VAL n 
1 165 GLY n 
1 166 ILE n 
1 167 GLU n 
1 168 ILE n 
1 169 PRO n 
1 170 ASN n 
1 171 GLU n 
1 172 ASP n 
1 173 ARG n 
1 174 GLN n 
1 175 MET n 
1 176 VAL n 
1 177 ARG n 
1 178 PHE n 
1 179 SER n 
1 180 GLU n 
1 181 VAL n 
1 182 LEU n 
1 183 SER n 
1 184 SER n 
1 185 PRO n 
1 186 GLU n 
1 187 TYR n 
1 188 ASP n 
1 189 GLU n 
1 190 HIS n 
1 191 LYS n 
1 192 SER n 
1 193 THR n 
1 194 VAL n 
1 195 PRO n 
1 196 LEU n 
1 197 ALA n 
1 198 LEU n 
1 199 GLY n 
1 200 HIS n 
1 201 ASP n 
1 202 ILE n 
1 203 GLY n 
1 204 GLY n 
1 205 ARG n 
1 206 PRO n 
1 207 ILE n 
1 208 ILE n 
1 209 THR n 
1 210 ASP n 
1 211 LEU n 
1 212 ALA n 
1 213 LYS n 
1 214 MET n 
1 215 PRO n 
1 216 HIS n 
1 217 LEU n 
1 218 LEU n 
1 219 VAL n 
1 220 ALA n 
1 221 GLY n 
1 222 THR n 
1 223 THR n 
1 224 GLY n 
1 225 SER n 
1 226 GLY n 
1 227 LYS n 
1 228 SER n 
1 229 VAL n 
1 230 GLY n 
1 231 VAL n 
1 232 ASN n 
1 233 ALA n 
1 234 MET n 
1 235 LEU n 
1 236 LEU n 
1 237 SER n 
1 238 ILE n 
1 239 LEU n 
1 240 PHE n 
1 241 LYS n 
1 242 SER n 
1 243 THR n 
1 244 PRO n 
1 245 SER n 
1 246 GLU n 
1 247 ALA n 
1 248 ARG n 
1 249 LEU n 
1 250 ILE n 
1 251 MET n 
1 252 ILE n 
1 253 ASP n 
1 254 PRO n 
1 255 LYS n 
1 256 MET n 
1 257 LEU n 
1 258 GLU n 
1 259 LEU n 
1 260 SER n 
1 261 ILE n 
1 262 TYR n 
1 263 GLU n 
1 264 GLY n 
1 265 ILE n 
1 266 PRO n 
1 267 HIS n 
1 268 LEU n 
1 269 LEU n 
1 270 CYS n 
1 271 PRO n 
1 272 VAL n 
1 273 VAL n 
1 274 THR n 
1 275 ASP n 
1 276 MET n 
1 277 LYS n 
1 278 GLU n 
1 279 ALA n 
1 280 ALA n 
1 281 ASN n 
1 282 ALA n 
1 283 LEU n 
1 284 ARG n 
1 285 TRP n 
1 286 SER n 
1 287 VAL n 
1 288 ALA n 
1 289 GLU n 
1 290 MET n 
1 291 GLU n 
1 292 ARG n 
1 293 ARG n 
1 294 TYR n 
1 295 ARG n 
1 296 LEU n 
1 297 MET n 
1 298 ALA n 
1 299 ALA n 
1 300 MET n 
1 301 GLY n 
1 302 VAL n 
1 303 ARG n 
1 304 ASN n 
1 305 LEU n 
1 306 ALA n 
1 307 GLY n 
1 308 PHE n 
1 309 ASN n 
1 310 ARG n 
1 311 LYS n 
1 312 VAL n 
1 313 LYS n 
1 314 ASP n 
1 315 ALA n 
1 316 GLU n 
1 317 GLU n 
1 318 ALA n 
1 319 GLY n 
1 320 THR n 
1 321 PRO n 
1 322 LEU n 
1 323 THR n 
1 324 ASP n 
1 325 PRO n 
1 326 LEU n 
1 327 PHE n 
1 328 ARG n 
1 329 ARG n 
1 330 GLU n 
1 331 SER n 
1 332 PRO n 
1 333 ASP n 
1 334 ASP n 
1 335 GLU n 
1 336 PRO n 
1 337 PRO n 
1 338 GLN n 
1 339 LEU n 
1 340 SER n 
1 341 THR n 
1 342 LEU n 
1 343 PRO n 
1 344 THR n 
1 345 ILE n 
1 346 VAL n 
1 347 VAL n 
1 348 VAL n 
1 349 VAL n 
1 350 ASP n 
1 351 GLU n 
1 352 PHE n 
1 353 ALA n 
1 354 ASP n 
1 355 MET n 
1 356 MET n 
1 357 MET n 
1 358 ILE n 
1 359 VAL n 
1 360 GLY n 
1 361 LYS n 
1 362 LYS n 
1 363 VAL n 
1 364 GLU n 
1 365 GLU n 
1 366 LEU n 
1 367 ILE n 
1 368 ALA n 
1 369 ARG n 
1 370 ILE n 
1 371 ALA n 
1 372 GLN n 
1 373 LYS n 
1 374 ALA n 
1 375 ARG n 
1 376 ALA n 
1 377 ALA n 
1 378 GLY n 
1 379 ILE n 
1 380 HIS n 
1 381 LEU n 
1 382 ILE n 
1 383 LEU n 
1 384 ALA n 
1 385 THR n 
1 386 GLN n 
1 387 ARG n 
1 388 PRO n 
1 389 SER n 
1 390 VAL n 
1 391 ASP n 
1 392 VAL n 
1 393 ILE n 
1 394 THR n 
1 395 GLY n 
1 396 LEU n 
1 397 ILE n 
1 398 LYS n 
1 399 ALA n 
1 400 ASN n 
1 401 ILE n 
1 402 PRO n 
1 403 THR n 
1 404 ARG n 
1 405 ILE n 
1 406 ALA n 
1 407 PHE n 
1 408 GLN n 
1 409 VAL n 
1 410 SER n 
1 411 SER n 
1 412 LYS n 
1 413 ILE n 
1 414 ASP n 
1 415 SER n 
1 416 ARG n 
1 417 THR n 
1 418 ILE n 
1 419 LEU n 
1 420 ASP n 
1 421 GLN n 
1 422 GLY n 
1 423 GLY n 
1 424 ALA n 
1 425 GLU n 
1 426 GLN n 
1 427 LEU n 
1 428 LEU n 
1 429 GLY n 
1 430 HIS n 
1 431 GLY n 
1 432 ASP n 
1 433 MET n 
1 434 LEU n 
1 435 TYR n 
1 436 LEU n 
1 437 PRO n 
1 438 PRO n 
1 439 GLY n 
1 440 THR n 
1 441 GLY n 
1 442 LEU n 
1 443 PRO n 
1 444 ILE n 
1 445 ARG n 
1 446 VAL n 
1 447 HIS n 
1 448 GLY n 
1 449 ALA n 
1 450 PHE n 
1 451 VAL n 
1 452 SER n 
1 453 ASP n 
1 454 ASP n 
1 455 GLU n 
1 456 VAL n 
1 457 HIS n 
1 458 ARG n 
1 459 VAL n 
1 460 VAL n 
1 461 GLU n 
1 462 ALA n 
1 463 TRP n 
1 464 LYS n 
1 465 LEU n 
1 466 ARG n 
1 467 GLY n 
1 468 ALA n 
1 469 PRO n 
1 470 ASP n 
1 471 TYR n 
1 472 ILE n 
1 473 GLU n 
1 474 ASP n 
1 475 ILE n 
1 476 LEU n 
1 477 ALA n 
1 478 GLY n 
1 479 VAL n 
1 480 ASP n 
1 481 GLU n 
1 482 GLY n 
1 483 GLY n 
1 484 LYS n 
1 485 LEU n 
1 486 HIS n 
1 487 HIS n 
1 488 HIS n 
1 489 HIS n 
1 490 HIS n 
1 491 HIS n 
2 1   DA  n 
2 2   DT  n 
2 3   DA  n 
2 4   DT  n 
2 5   DA  n 
2 6   DT  n 
2 7   DA  n 
2 8   DT  n 
2 9   DA  n 
2 10  DT  n 
2 11  DA  n 
2 12  DT  n 
2 13  DA  n 
2 14  DT  n 
2 15  DA  n 
2 16  DT  n 
2 17  DA  n 
2 18  DT  n 
2 19  DA  n 
2 20  DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   491 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ftsK, PA2615' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pseudomonas aeruginosa PAO1' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     208964 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              C41 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       20 
_pdbx_entity_src_syn.organism_scientific    'synthetic construct' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP FTSK_PSEAE Q9I0M3 ? 1 
;VPDRREQSKAKERLLEREEALAKHMSEREKRPPPKIDPPPSPKAPEPSKRVLKEKQAPLFVDTAVEGTLPPLSLLDPAEV
KQKSYSPESLEAMSRLLEIKLKEFGVEVSVDSVHPGPVITRFEIQPAAGVKVSRISNLAKDLARSLAVISVRVVEVIPGK
TTVGIEIPNEDRQMVRFSEVLSSPEYDEHKSTVPLALGHDIGGRPIITDLAKMPHLLVAGTTGSGKSVGVNAMLLSILFK
STPSEARLIMIDPKMLELSIYEGIPHLLCPVVTDMKEAANALRWSVAEMERRYRLMAAMGVRNLAGFNRKVKDAEEAGTP
LTDPLFRRESPDDEPPQLSTLPTIVVVVDEFADMMMIVGKKVEELIARIAQKARAAGIHLILATQRPSVDVITGLIKANI
PTRIAFQVSSKIDSRTILDQGGAEQLLGHGDMLYLPPGTGLPIRVHGAFVSDDEVHRVVEAWKLRGAPDYIEDILAGVDE
GG
;
247 
2 PDB 6T8B       6T8B   ? 2 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6T8B A 2 ? 483 ? Q9I0M3 247 ? 728 ? 247 728 
2 1 6T8B B 2 ? 483 ? Q9I0M3 247 ? 728 ? 247 728 
3 1 6T8B C 2 ? 483 ? Q9I0M3 247 ? 728 ? 247 728 
4 1 6T8B D 2 ? 483 ? Q9I0M3 247 ? 728 ? 247 728 
5 1 6T8B E 2 ? 483 ? Q9I0M3 247 ? 728 ? 247 728 
6 1 6T8B F 2 ? 483 ? Q9I0M3 247 ? 728 ? 247 728 
7 2 6T8B G 1 ? 20  ? 6T8B   1   ? 20  ? 1   20  
8 2 6T8B H 1 ? 20  ? 6T8B   1   ? 20  ? 1   20  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6T8B MET A 1   ? UNP Q9I0M3 ? ? 'initiating methionine' 246 1  
1 6T8B LYS A 484 ? UNP Q9I0M3 ? ? 'expression tag'        729 2  
1 6T8B LEU A 485 ? UNP Q9I0M3 ? ? 'expression tag'        730 3  
1 6T8B HIS A 486 ? UNP Q9I0M3 ? ? 'expression tag'        731 4  
1 6T8B HIS A 487 ? UNP Q9I0M3 ? ? 'expression tag'        732 5  
1 6T8B HIS A 488 ? UNP Q9I0M3 ? ? 'expression tag'        733 6  
1 6T8B HIS A 489 ? UNP Q9I0M3 ? ? 'expression tag'        734 7  
1 6T8B HIS A 490 ? UNP Q9I0M3 ? ? 'expression tag'        735 8  
1 6T8B HIS A 491 ? UNP Q9I0M3 ? ? 'expression tag'        736 9  
2 6T8B MET B 1   ? UNP Q9I0M3 ? ? 'initiating methionine' 246 10 
2 6T8B LYS B 484 ? UNP Q9I0M3 ? ? 'expression tag'        729 11 
2 6T8B LEU B 485 ? UNP Q9I0M3 ? ? 'expression tag'        730 12 
2 6T8B HIS B 486 ? UNP Q9I0M3 ? ? 'expression tag'        731 13 
2 6T8B HIS B 487 ? UNP Q9I0M3 ? ? 'expression tag'        732 14 
2 6T8B HIS B 488 ? UNP Q9I0M3 ? ? 'expression tag'        733 15 
2 6T8B HIS B 489 ? UNP Q9I0M3 ? ? 'expression tag'        734 16 
2 6T8B HIS B 490 ? UNP Q9I0M3 ? ? 'expression tag'        735 17 
2 6T8B HIS B 491 ? UNP Q9I0M3 ? ? 'expression tag'        736 18 
3 6T8B MET C 1   ? UNP Q9I0M3 ? ? 'initiating methionine' 246 19 
3 6T8B LYS C 484 ? UNP Q9I0M3 ? ? 'expression tag'        729 20 
3 6T8B LEU C 485 ? UNP Q9I0M3 ? ? 'expression tag'        730 21 
3 6T8B HIS C 486 ? UNP Q9I0M3 ? ? 'expression tag'        731 22 
3 6T8B HIS C 487 ? UNP Q9I0M3 ? ? 'expression tag'        732 23 
3 6T8B HIS C 488 ? UNP Q9I0M3 ? ? 'expression tag'        733 24 
3 6T8B HIS C 489 ? UNP Q9I0M3 ? ? 'expression tag'        734 25 
3 6T8B HIS C 490 ? UNP Q9I0M3 ? ? 'expression tag'        735 26 
3 6T8B HIS C 491 ? UNP Q9I0M3 ? ? 'expression tag'        736 27 
4 6T8B MET D 1   ? UNP Q9I0M3 ? ? 'initiating methionine' 246 28 
4 6T8B LYS D 484 ? UNP Q9I0M3 ? ? 'expression tag'        729 29 
4 6T8B LEU D 485 ? UNP Q9I0M3 ? ? 'expression tag'        730 30 
4 6T8B HIS D 486 ? UNP Q9I0M3 ? ? 'expression tag'        731 31 
4 6T8B HIS D 487 ? UNP Q9I0M3 ? ? 'expression tag'        732 32 
4 6T8B HIS D 488 ? UNP Q9I0M3 ? ? 'expression tag'        733 33 
4 6T8B HIS D 489 ? UNP Q9I0M3 ? ? 'expression tag'        734 34 
4 6T8B HIS D 490 ? UNP Q9I0M3 ? ? 'expression tag'        735 35 
4 6T8B HIS D 491 ? UNP Q9I0M3 ? ? 'expression tag'        736 36 
5 6T8B MET E 1   ? UNP Q9I0M3 ? ? 'initiating methionine' 246 37 
5 6T8B LYS E 484 ? UNP Q9I0M3 ? ? 'expression tag'        729 38 
5 6T8B LEU E 485 ? UNP Q9I0M3 ? ? 'expression tag'        730 39 
5 6T8B HIS E 486 ? UNP Q9I0M3 ? ? 'expression tag'        731 40 
5 6T8B HIS E 487 ? UNP Q9I0M3 ? ? 'expression tag'        732 41 
5 6T8B HIS E 488 ? UNP Q9I0M3 ? ? 'expression tag'        733 42 
5 6T8B HIS E 489 ? UNP Q9I0M3 ? ? 'expression tag'        734 43 
5 6T8B HIS E 490 ? UNP Q9I0M3 ? ? 'expression tag'        735 44 
5 6T8B HIS E 491 ? UNP Q9I0M3 ? ? 'expression tag'        736 45 
6 6T8B MET F 1   ? UNP Q9I0M3 ? ? 'initiating methionine' 246 46 
6 6T8B LYS F 484 ? UNP Q9I0M3 ? ? 'expression tag'        729 47 
6 6T8B LEU F 485 ? UNP Q9I0M3 ? ? 'expression tag'        730 48 
6 6T8B HIS F 486 ? UNP Q9I0M3 ? ? 'expression tag'        731 49 
6 6T8B HIS F 487 ? UNP Q9I0M3 ? ? 'expression tag'        732 50 
6 6T8B HIS F 488 ? UNP Q9I0M3 ? ? 'expression tag'        733 51 
6 6T8B HIS F 489 ? UNP Q9I0M3 ? ? 'expression tag'        734 52 
6 6T8B HIS F 490 ? UNP Q9I0M3 ? ? 'expression tag'        735 53 
6 6T8B HIS F 491 ? UNP Q9I0M3 ? ? 'expression tag'        736 54 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE"                   ? 'C10 H15 N5 O10 P2'   427.201 
AGS non-polymer         . 'PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER' 
;ATP-GAMMA-S; ADENOSINE 5'-(3-THIOTRIPHOSPHATE); ADENOSINE 5'-(GAMMA-THIOTRIPHOSPHATE); ADENOSINE-5'-DIPHOSPHATE MONOTHIOPHOSPHATE
;
'C10 H16 N5 O12 P3 S' 523.247 
ALA 'L-peptide linking' y ALANINE                                      ? 'C3 H7 N O2'          89.093  
ARG 'L-peptide linking' y ARGININE                                     ? 'C6 H15 N4 O2 1'      175.209 
ASN 'L-peptide linking' y ASPARAGINE                                   ? 'C4 H8 N2 O3'         132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                              ? 'C4 H7 N O4'          133.103 
CYS 'L-peptide linking' y CYSTEINE                                     ? 'C3 H7 N O2 S'        121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O6 P'     331.222 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                 ? 'C10 H15 N2 O8 P'     322.208 
GLN 'L-peptide linking' y GLUTAMINE                                    ? 'C5 H10 N2 O3'        146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                              ? 'C5 H9 N O4'          147.129 
GLY 'peptide linking'   y GLYCINE                                      ? 'C2 H5 N O2'          75.067  
HIS 'L-peptide linking' y HISTIDINE                                    ? 'C6 H10 N3 O2 1'      156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                   ? 'C6 H13 N O2'         131.173 
LEU 'L-peptide linking' y LEUCINE                                      ? 'C6 H13 N O2'         131.173 
LYS 'L-peptide linking' y LYSINE                                       ? 'C6 H15 N2 O2 1'      147.195 
MET 'L-peptide linking' y METHIONINE                                   ? 'C5 H11 N O2 S'       149.211 
MG  non-polymer         . 'MAGNESIUM ION'                              ? 'Mg 2'                24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                ? 'C9 H11 N O2'         165.189 
PRO 'L-peptide linking' y PROLINE                                      ? 'C5 H9 N O2'          115.130 
SER 'L-peptide linking' y SERINE                                       ? 'C3 H7 N O3'          105.093 
THR 'L-peptide linking' y THREONINE                                    ? 'C4 H9 N O3'          119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                   ? 'C11 H12 N2 O2'       204.225 
TYR 'L-peptide linking' y TYROSINE                                     ? 'C9 H11 N O3'         181.189 
VAL 'L-peptide linking' y VALINE                                       ? 'C5 H11 N O2'         117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6T8B 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6T8B 
_struct.title                        'FtsK motor domain with dsDNA, translocating state' 
_struct.pdbx_descriptor              'DNA translocase FtsK/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6T8B 
_struct_keywords.text            'DNA translocation, DNA motor, RecA fold, Divisome, DNA BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 4 ? 
K N N 3 ? 
L N N 4 ? 
M N N 3 ? 
N N N 4 ? 
O N N 5 ? 
P N N 5 ? 
Q N N 5 ? 
R N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 PRO A 72  ? LEU A 76  ? PRO A 317 LEU A 321 5 ? 5  
HELX_P HELX_P2  AA2 SER A 87  ? PHE A 105 ? SER A 332 PHE A 350 1 ? 19 
HELX_P HELX_P3  AA3 LYS A 132 ? LEU A 147 ? LYS A 377 LEU A 392 1 ? 16 
HELX_P HELX_P4  AA4 PHE A 178 ? SER A 183 ? PHE A 423 SER A 428 1 ? 6  
HELX_P HELX_P5  AA5 SER A 184 ? HIS A 190 ? SER A 429 HIS A 435 1 ? 7  
HELX_P HELX_P6  AA6 ALA A 212 ? MET A 214 ? ALA A 457 MET A 459 5 ? 3  
HELX_P HELX_P7  AA7 GLY A 226 ? PHE A 240 ? GLY A 471 PHE A 485 1 ? 15 
HELX_P HELX_P8  AA8 GLU A 278 ? ALA A 299 ? GLU A 523 ALA A 544 1 ? 22 
HELX_P HELX_P9  AA9 ASN A 304 ? ALA A 318 ? ASN A 549 ALA A 563 1 ? 15 
HELX_P HELX_P10 AB1 ASP A 354 ? VAL A 359 ? ASP A 599 VAL A 604 1 ? 6  
HELX_P HELX_P11 AB2 GLY A 360 ? ALA A 374 ? GLY A 605 ALA A 619 1 ? 15 
HELX_P HELX_P12 AB3 THR A 394 ? ALA A 399 ? THR A 639 ALA A 644 1 ? 6  
HELX_P HELX_P13 AB4 LYS A 412 ? ASP A 420 ? LYS A 657 ASP A 665 1 ? 9  
HELX_P HELX_P14 AB5 SER A 452 ? LEU A 465 ? SER A 697 LEU A 710 1 ? 14 
HELX_P HELX_P15 AB6 PRO B 72  ? LEU B 76  ? PRO B 317 LEU B 321 5 ? 5  
HELX_P HELX_P16 AB7 SER B 87  ? PHE B 105 ? SER B 332 PHE B 350 1 ? 19 
HELX_P HELX_P17 AB8 VAL B 133 ? ASN B 138 ? VAL B 378 ASN B 383 1 ? 6  
HELX_P HELX_P18 AB9 LYS B 141 ? LEU B 147 ? LYS B 386 LEU B 392 1 ? 7  
HELX_P HELX_P19 AC1 PHE B 178 ? SER B 183 ? PHE B 423 SER B 428 1 ? 6  
HELX_P HELX_P20 AC2 SER B 184 ? HIS B 190 ? SER B 429 HIS B 435 1 ? 7  
HELX_P HELX_P21 AC3 SER B 228 ? PHE B 240 ? SER B 473 PHE B 485 1 ? 13 
HELX_P HELX_P22 AC4 GLU B 258 ? TYR B 262 ? GLU B 503 TYR B 507 5 ? 5  
HELX_P HELX_P23 AC5 GLU B 278 ? ALA B 299 ? GLU B 523 ALA B 544 1 ? 22 
HELX_P HELX_P24 AC6 ASN B 304 ? ALA B 318 ? ASN B 549 ALA B 563 1 ? 15 
HELX_P HELX_P25 AC7 GLU B 351 ? VAL B 359 ? GLU B 596 VAL B 604 1 ? 9  
HELX_P HELX_P26 AC8 GLY B 360 ? LYS B 373 ? GLY B 605 LYS B 618 1 ? 14 
HELX_P HELX_P27 AC9 ASP B 414 ? LEU B 419 ? ASP B 659 LEU B 664 1 ? 6  
HELX_P HELX_P28 AD1 SER B 452 ? GLY B 467 ? SER B 697 GLY B 712 1 ? 16 
HELX_P HELX_P29 AD2 PRO C 72  ? LEU C 76  ? PRO C 317 LEU C 321 5 ? 5  
HELX_P HELX_P30 AD3 SER C 87  ? PHE C 105 ? SER C 332 PHE C 350 1 ? 19 
HELX_P HELX_P31 AD4 LYS C 132 ? ASN C 138 ? LYS C 377 ASN C 383 1 ? 7  
HELX_P HELX_P32 AD5 LEU C 139 ? LEU C 147 ? LEU C 384 LEU C 392 1 ? 9  
HELX_P HELX_P33 AD6 PHE C 178 ? SER C 183 ? PHE C 423 SER C 428 1 ? 6  
HELX_P HELX_P34 AD7 SER C 184 ? HIS C 190 ? SER C 429 HIS C 435 1 ? 7  
HELX_P HELX_P35 AD8 ALA C 212 ? MET C 214 ? ALA C 457 MET C 459 5 ? 3  
HELX_P HELX_P36 AD9 VAL C 231 ? PHE C 240 ? VAL C 476 PHE C 485 1 ? 10 
HELX_P HELX_P37 AE1 ASP C 275 ? ALA C 299 ? ASP C 520 ALA C 544 1 ? 25 
HELX_P HELX_P38 AE2 ASN C 304 ? ALA C 318 ? ASN C 549 ALA C 563 1 ? 15 
HELX_P HELX_P39 AE3 GLU C 351 ? ALA C 374 ? GLU C 596 ALA C 619 1 ? 24 
HELX_P HELX_P40 AE4 THR C 394 ? ALA C 399 ? THR C 639 ALA C 644 1 ? 6  
HELX_P HELX_P41 AE5 LYS C 412 ? LEU C 419 ? LYS C 657 LEU C 664 1 ? 8  
HELX_P HELX_P42 AE6 SER C 452 ? LEU C 465 ? SER C 697 LEU C 710 1 ? 14 
HELX_P HELX_P43 AE7 ILE C 472 ? LEU C 476 ? ILE C 717 LEU C 721 5 ? 5  
HELX_P HELX_P44 AE8 PRO D 72  ? LEU D 76  ? PRO D 317 LEU D 321 5 ? 5  
HELX_P HELX_P45 AE9 SER D 87  ? LYS D 103 ? SER D 332 LYS D 348 1 ? 17 
HELX_P HELX_P46 AF1 LYS D 132 ? LEU D 147 ? LYS D 377 LEU D 392 1 ? 16 
HELX_P HELX_P47 AF2 ARG D 177 ? SER D 183 ? ARG D 422 SER D 428 1 ? 7  
HELX_P HELX_P48 AF3 SER D 184 ? GLU D 189 ? SER D 429 GLU D 434 1 ? 6  
HELX_P HELX_P49 AF4 ALA D 212 ? MET D 214 ? ALA D 457 MET D 459 5 ? 3  
HELX_P HELX_P50 AF5 GLY D 226 ? PHE D 240 ? GLY D 471 PHE D 485 1 ? 15 
HELX_P HELX_P51 AF6 MET D 276 ? GLY D 301 ? MET D 521 GLY D 546 1 ? 26 
HELX_P HELX_P52 AF7 ASN D 304 ? ALA D 318 ? ASN D 549 ALA D 563 1 ? 15 
HELX_P HELX_P53 AF8 GLU D 351 ? MET D 356 ? GLU D 596 MET D 601 1 ? 6  
HELX_P HELX_P54 AF9 LYS D 362 ? ALA D 371 ? LYS D 607 ALA D 616 1 ? 10 
HELX_P HELX_P55 AG1 THR D 394 ? ASN D 400 ? THR D 639 ASN D 645 1 ? 7  
HELX_P HELX_P56 AG2 LYS D 412 ? LEU D 419 ? LYS D 657 LEU D 664 1 ? 8  
HELX_P HELX_P57 AG3 SER D 452 ? LEU D 465 ? SER D 697 LEU D 710 1 ? 14 
HELX_P HELX_P58 AG4 ILE D 472 ? LEU D 476 ? ILE D 717 LEU D 721 5 ? 5  
HELX_P HELX_P59 AG5 SER E 87  ? PHE E 105 ? SER E 332 PHE E 350 1 ? 19 
HELX_P HELX_P60 AG6 LYS E 132 ? LEU E 139 ? LYS E 377 LEU E 384 1 ? 8  
HELX_P HELX_P61 AG7 LEU E 139 ? LEU E 147 ? LEU E 384 LEU E 392 1 ? 9  
HELX_P HELX_P62 AG8 ARG E 177 ? SER E 183 ? ARG E 422 SER E 428 1 ? 7  
HELX_P HELX_P63 AG9 SER E 184 ? HIS E 190 ? SER E 429 HIS E 435 1 ? 7  
HELX_P HELX_P64 AH1 ALA E 212 ? MET E 214 ? ALA E 457 MET E 459 5 ? 3  
HELX_P HELX_P65 AH2 GLY E 226 ? LYS E 241 ? GLY E 471 LYS E 486 1 ? 16 
HELX_P HELX_P66 AH3 GLU E 278 ? ALA E 299 ? GLU E 523 ALA E 544 1 ? 22 
HELX_P HELX_P67 AH4 ASN E 304 ? ALA E 315 ? ASN E 549 ALA E 560 1 ? 12 
HELX_P HELX_P68 AH5 GLU E 351 ? GLY E 360 ? GLU E 596 GLY E 605 1 ? 10 
HELX_P HELX_P69 AH6 GLY E 360 ? GLU E 365 ? GLY E 605 GLU E 610 1 ? 6  
HELX_P HELX_P70 AH7 LEU E 366 ? ALA E 371 ? LEU E 611 ALA E 616 1 ? 6  
HELX_P HELX_P71 AH8 GLN E 372 ? ALA E 377 ? GLN E 617 ALA E 622 5 ? 6  
HELX_P HELX_P72 AH9 THR E 394 ? ALA E 399 ? THR E 639 ALA E 644 1 ? 6  
HELX_P HELX_P73 AI1 SER E 411 ? LEU E 419 ? SER E 656 LEU E 664 1 ? 9  
HELX_P HELX_P74 AI2 SER E 452 ? GLY E 467 ? SER E 697 GLY E 712 1 ? 16 
HELX_P HELX_P75 AI3 ILE E 472 ? LEU E 476 ? ILE E 717 LEU E 721 5 ? 5  
HELX_P HELX_P76 AI4 PRO F 72  ? LEU F 76  ? PRO F 317 LEU F 321 5 ? 5  
HELX_P HELX_P77 AI5 GLU F 80  ? LYS F 84  ? GLU F 325 LYS F 329 5 ? 5  
HELX_P HELX_P78 AI6 SER F 87  ? GLU F 104 ? SER F 332 GLU F 349 1 ? 18 
HELX_P HELX_P79 AI7 VAL F 133 ? ASN F 138 ? VAL F 378 ASN F 383 1 ? 6  
HELX_P HELX_P80 AI8 LYS F 141 ? SER F 146 ? LYS F 386 SER F 391 1 ? 6  
HELX_P HELX_P81 AI9 ARG F 177 ? SER F 183 ? ARG F 422 SER F 428 1 ? 7  
HELX_P HELX_P82 AJ1 SER F 184 ? GLU F 189 ? SER F 429 GLU F 434 1 ? 6  
HELX_P HELX_P83 AJ2 GLY F 226 ? PHE F 240 ? GLY F 471 PHE F 485 1 ? 15 
HELX_P HELX_P84 AJ3 LEU F 259 ? GLU F 263 ? LEU F 504 GLU F 508 5 ? 5  
HELX_P HELX_P85 AJ4 ASP F 275 ? ALA F 299 ? ASP F 520 ALA F 544 1 ? 25 
HELX_P HELX_P86 AJ5 ASN F 304 ? ALA F 318 ? ASN F 549 ALA F 563 1 ? 15 
HELX_P HELX_P87 AJ6 GLU F 351 ? GLY F 360 ? GLU F 596 GLY F 605 1 ? 10 
HELX_P HELX_P88 AJ7 VAL F 363 ? LYS F 373 ? VAL F 608 LYS F 618 1 ? 11 
HELX_P HELX_P89 AJ8 THR F 394 ? ALA F 399 ? THR F 639 ALA F 644 1 ? 6  
HELX_P HELX_P90 AJ9 ILE F 413 ? ASP F 420 ? ILE F 658 ASP F 665 1 ? 8  
HELX_P HELX_P91 AK1 SER F 452 ? LEU F 465 ? SER F 697 LEU F 710 1 ? 14 
HELX_P HELX_P92 AK2 ILE F 472 ? LEU F 476 ? ILE F 717 LEU F 721 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A SER 228 OG  ? ? ? 1_555 J MG .  MG ? ? A SER 473 A MG 802 1_555 ? ? ? ? ? ? ?            2.073 ? 
metalc2  metalc ? ? B SER 228 OG  ? ? ? 1_555 L MG .  MG ? ? B SER 473 B MG 802 1_555 ? ? ? ? ? ? ?            1.961 ? 
metalc3  metalc ? ? C SER 228 OG  ? ? ? 1_555 N MG .  MG ? ? C SER 473 C MG 802 1_555 ? ? ? ? ? ? ?            2.796 ? 
metalc4  metalc ? ? C GLU 258 OE1 ? ? ? 1_555 N MG .  MG ? ? C GLU 503 C MG 802 1_555 ? ? ? ? ? ? ?            2.031 ? 
metalc5  metalc ? ? C GLU 258 OE2 ? ? ? 1_555 N MG .  MG ? ? C GLU 503 C MG 802 1_555 ? ? ? ? ? ? ?            2.832 ? 
metalc6  metalc ? ? F SER 228 OG  ? ? ? 1_555 R MG .  MG ? ? F SER 473 F MG 802 1_555 ? ? ? ? ? ? ?            2.194 ? 
metalc7  metalc ? ? I AGS .   O2G ? ? ? 1_555 J MG .  MG ? ? A AGS 801 A MG 802 1_555 ? ? ? ? ? ? ?            2.012 ? 
metalc8  metalc ? ? I AGS .   O2B ? ? ? 1_555 J MG .  MG ? ? A AGS 801 A MG 802 1_555 ? ? ? ? ? ? ?            2.063 ? 
metalc9  metalc ? ? K AGS .   O2G ? ? ? 1_555 L MG .  MG ? ? B AGS 801 B MG 802 1_555 ? ? ? ? ? ? ?            1.942 ? 
metalc10 metalc ? ? K AGS .   O1B ? ? ? 1_555 L MG .  MG ? ? B AGS 801 B MG 802 1_555 ? ? ? ? ? ? ?            2.292 ? 
metalc11 metalc ? ? K AGS .   O2B ? ? ? 1_555 L MG .  MG ? ? B AGS 801 B MG 802 1_555 ? ? ? ? ? ? ?            1.965 ? 
metalc12 metalc ? ? M AGS .   O2G ? ? ? 1_555 N MG .  MG ? ? C AGS 801 C MG 802 1_555 ? ? ? ? ? ? ?            2.140 ? 
metalc13 metalc ? ? M AGS .   O2B ? ? ? 1_555 N MG .  MG ? ? C AGS 801 C MG 802 1_555 ? ? ? ? ? ? ?            2.093 ? 
metalc14 metalc ? ? Q ADP .   O3B ? ? ? 1_555 R MG .  MG ? ? F ADP 801 F MG 802 1_555 ? ? ? ? ? ? ?            1.987 ? 
hydrog1  hydrog ? ? G DA  1   N1  ? ? ? 1_555 H DT 20 N3 ? ? G DA  1   H DT 20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? G DA  1   N6  ? ? ? 1_555 H DT 20 O4 ? ? G DA  1   H DT 20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? G DT  2   N3  ? ? ? 1_555 H DA 19 N1 ? ? G DT  2   H DA 19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? G DT  2   O4  ? ? ? 1_555 H DA 19 N6 ? ? G DT  2   H DA 19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? G DA  3   N1  ? ? ? 1_555 H DT 18 N3 ? ? G DA  3   H DT 18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? G DA  3   N6  ? ? ? 1_555 H DT 18 O4 ? ? G DA  3   H DT 18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? G DT  4   N3  ? ? ? 1_555 H DA 17 N1 ? ? G DT  4   H DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? G DT  4   O4  ? ? ? 1_555 H DA 17 N6 ? ? G DT  4   H DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? G DA  5   N1  ? ? ? 1_555 H DT 16 N3 ? ? G DA  5   H DT 16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? G DA  5   N6  ? ? ? 1_555 H DT 16 O4 ? ? G DA  5   H DT 16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? G DT  6   N3  ? ? ? 1_555 H DA 15 N1 ? ? G DT  6   H DA 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? G DT  6   O4  ? ? ? 1_555 H DA 15 N6 ? ? G DT  6   H DA 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? G DA  7   N1  ? ? ? 1_555 H DT 14 N3 ? ? G DA  7   H DT 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? G DA  7   N6  ? ? ? 1_555 H DT 14 O4 ? ? G DA  7   H DT 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? G DT  8   N3  ? ? ? 1_555 H DA 13 N1 ? ? G DT  8   H DA 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? G DT  8   O4  ? ? ? 1_555 H DA 13 N6 ? ? G DT  8   H DA 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? G DA  9   N1  ? ? ? 1_555 H DT 12 N3 ? ? G DA  9   H DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? G DA  9   N6  ? ? ? 1_555 H DT 12 O4 ? ? G DA  9   H DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? G DT  10  N3  ? ? ? 1_555 H DA 11 N1 ? ? G DT  10  H DA 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? G DT  10  O4  ? ? ? 1_555 H DA 11 N6 ? ? G DT  10  H DA 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? G DA  11  N1  ? ? ? 1_555 H DT 10 N3 ? ? G DA  11  H DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? G DA  11  N6  ? ? ? 1_555 H DT 10 O4 ? ? G DA  11  H DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? G DT  12  N3  ? ? ? 1_555 H DA 9  N1 ? ? G DT  12  H DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? G DT  12  O4  ? ? ? 1_555 H DA 9  N6 ? ? G DT  12  H DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? G DA  13  N1  ? ? ? 1_555 H DT 8  N3 ? ? G DA  13  H DT 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? G DA  13  N6  ? ? ? 1_555 H DT 8  O4 ? ? G DA  13  H DT 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? G DT  14  N3  ? ? ? 1_555 H DA 7  N1 ? ? G DT  14  H DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? G DT  14  O4  ? ? ? 1_555 H DA 7  N6 ? ? G DT  14  H DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? G DA  15  N1  ? ? ? 1_555 H DT 6  N3 ? ? G DA  15  H DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? G DA  15  N6  ? ? ? 1_555 H DT 6  O4 ? ? G DA  15  H DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? G DT  16  N3  ? ? ? 1_555 H DA 5  N1 ? ? G DT  16  H DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? G DT  16  O4  ? ? ? 1_555 H DA 5  N6 ? ? G DT  16  H DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? G DA  17  N1  ? ? ? 1_555 H DT 4  N3 ? ? G DA  17  H DT 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? G DA  17  N6  ? ? ? 1_555 H DT 4  O4 ? ? G DA  17  H DT 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? G DT  18  N3  ? ? ? 1_555 H DA 3  N1 ? ? G DT  18  H DA 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? G DT  18  O4  ? ? ? 1_555 H DA 3  N6 ? ? G DT  18  H DA 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? G DA  19  N1  ? ? ? 1_555 H DT 2  N3 ? ? G DA  19  H DT 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? G DA  19  N6  ? ? ? 1_555 H DT 2  O4 ? ? G DA  19  H DT 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? G DT  20  N3  ? ? ? 1_555 H DA 1  N1 ? ? G DT  20  H DA 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? G DT  20  O4  ? ? ? 1_555 H DA 1  N6 ? ? G DT  20  H DA 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 MET 214 A . ? MET 459 A PRO 215 A ? PRO 460 A 1 -5.64  
2 MET 214 B . ? MET 459 B PRO 215 B ? PRO 460 B 1 -1.72  
3 MET 214 C . ? MET 459 C PRO 215 C ? PRO 460 C 1 -13.75 
4 MET 214 D . ? MET 459 D PRO 215 D ? PRO 460 D 1 -18.50 
5 MET 214 E . ? MET 459 E PRO 215 E ? PRO 460 E 1 -7.97  
6 MET 214 F . ? MET 459 F PRO 215 F ? PRO 460 F 1 -19.88 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 5 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 2 ? 
AA6 ? 7 ? 
AA7 ? 4 ? 
AA8 ? 3 ? 
AA9 ? 5 ? 
AB1 ? 4 ? 
AB2 ? 9 ? 
AB3 ? 4 ? 
AB4 ? 4 ? 
AB5 ? 3 ? 
AB6 ? 4 ? 
AB7 ? 4 ? 
AB8 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? parallel      
AA3 3 4 ? parallel      
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? parallel      
AA6 2 3 ? parallel      
AA6 3 4 ? parallel      
AA6 4 5 ? parallel      
AA6 5 6 ? anti-parallel 
AA6 6 7 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA9 1 2 ? parallel      
AA9 2 3 ? parallel      
AA9 3 4 ? parallel      
AA9 4 5 ? parallel      
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB2 4 5 ? anti-parallel 
AB2 5 6 ? parallel      
AB2 6 7 ? parallel      
AB2 7 8 ? parallel      
AB2 8 9 ? parallel      
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? parallel      
AB5 2 3 ? parallel      
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB8 1 2 ? parallel      
AB8 2 3 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 109 ? PRO A 116 ? VAL A 354 PRO A 361 
AA1 2 ILE A 120 ? PRO A 127 ? ILE A 365 PRO A 372 
AA1 3 VAL A 164 ? PRO A 169 ? VAL A 409 PRO A 414 
AA1 4 ARG A 153 ? VAL A 154 ? ARG A 398 VAL A 399 
AA2 1 PRO A 206 ? ASP A 210 ? PRO A 451 ASP A 455 
AA2 2 PRO A 195 ? ASP A 201 ? PRO A 440 ASP A 446 
AA2 3 ILE A 444 ? GLY A 448 ? ILE A 689 GLY A 693 
AA2 4 ASP A 432 ? LEU A 436 ? ASP A 677 LEU A 681 
AA2 5 ARG A 404 ? ALA A 406 ? ARG A 649 ALA A 651 
AA3 1 HIS A 216 ? LEU A 217 ? HIS A 461 LEU A 462 
AA3 2 HIS A 380 ? LEU A 383 ? HIS A 625 LEU A 628 
AA3 3 VAL A 346 ? VAL A 349 ? VAL A 591 VAL A 594 
AA3 4 ILE A 250 ? ILE A 252 ? ILE A 495 ILE A 497 
AA4 1 VAL B 109 ? HIS B 115 ? VAL B 354 HIS B 360 
AA4 2 ILE B 120 ? PRO B 127 ? ILE B 365 PRO B 372 
AA4 3 VAL B 164 ? PRO B 169 ? VAL B 409 PRO B 414 
AA4 4 ARG B 153 ? VAL B 155 ? ARG B 398 VAL B 400 
AA5 1 PRO B 195 ? HIS B 200 ? PRO B 440 HIS B 445 
AA5 2 PRO B 206 ? ASP B 210 ? PRO B 451 ASP B 455 
AA6 1 ALA B 247 ? ILE B 252 ? ALA B 492 ILE B 497 
AA6 2 THR B 344 ? VAL B 349 ? THR B 589 VAL B 594 
AA6 3 ILE B 379 ? THR B 385 ? ILE B 624 THR B 630 
AA6 4 LEU B 217 ? ALA B 220 ? LEU B 462 ALA B 465 
AA6 5 THR B 403 ? PHE B 407 ? THR B 648 PHE B 652 
AA6 6 MET B 433 ? LEU B 436 ? MET B 678 LEU B 681 
AA6 7 ILE B 444 ? VAL B 446 ? ILE B 689 VAL B 691 
AA7 1 VAL C 109 ? PRO C 116 ? VAL C 354 PRO C 361 
AA7 2 ILE C 120 ? PRO C 127 ? ILE C 365 PRO C 372 
AA7 3 GLY C 165 ? PRO C 169 ? GLY C 410 PRO C 414 
AA7 4 VAL C 154 ? VAL C 155 ? VAL C 399 VAL C 400 
AA8 1 PRO C 206 ? ASP C 210 ? PRO C 451 ASP C 455 
AA8 2 PRO C 195 ? ASP C 201 ? PRO C 440 ASP C 446 
AA8 3 VAL C 446 ? GLY C 448 ? VAL C 691 GLY C 693 
AA9 1 ILE C 250 ? ILE C 252 ? ILE C 495 ILE C 497 
AA9 2 ILE C 345 ? ASP C 350 ? ILE C 590 ASP C 595 
AA9 3 ILE C 379 ? ALA C 384 ? ILE C 624 ALA C 629 
AA9 4 LEU C 217 ? GLY C 221 ? LEU C 462 GLY C 466 
AA9 5 THR C 403 ? PHE C 407 ? THR C 648 PHE C 652 
AB1 1 VAL D 111 ? PRO D 116 ? VAL D 356 PRO D 361 
AB1 2 ILE D 120 ? ILE D 125 ? ILE D 365 ILE D 370 
AB1 3 GLY D 165 ? PRO D 169 ? GLY D 410 PRO D 414 
AB1 4 ARG D 153 ? VAL D 155 ? ARG D 398 VAL D 400 
AB2 1 PRO D 206 ? ASP D 210 ? PRO D 451 ASP D 455 
AB2 2 PRO D 195 ? ASP D 201 ? PRO D 440 ASP D 446 
AB2 3 ILE D 444 ? HIS D 447 ? ILE D 689 HIS D 692 
AB2 4 ASP D 432 ? LEU D 436 ? ASP D 677 LEU D 681 
AB2 5 ARG D 404 ? PHE D 407 ? ARG D 649 PHE D 652 
AB2 6 LEU D 217 ? ALA D 220 ? LEU D 462 ALA D 465 
AB2 7 ILE D 379 ? LEU D 383 ? ILE D 624 LEU D 628 
AB2 8 THR D 344 ? VAL D 349 ? THR D 589 VAL D 594 
AB2 9 ALA D 247 ? MET D 251 ? ALA D 492 MET D 496 
AB3 1 VAL E 109 ? HIS E 115 ? VAL E 354 HIS E 360 
AB3 2 ILE E 120 ? PRO E 127 ? ILE E 365 PRO E 372 
AB3 3 VAL E 164 ? PRO E 169 ? VAL E 409 PRO E 414 
AB3 4 ARG E 153 ? VAL E 155 ? ARG E 398 VAL E 400 
AB4 1 PRO E 206 ? ASP E 210 ? PRO E 451 ASP E 455 
AB4 2 PRO E 195 ? ASP E 201 ? PRO E 440 ASP E 446 
AB4 3 ILE E 444 ? HIS E 447 ? ILE E 689 HIS E 692 
AB4 4 ASP E 432 ? TYR E 435 ? ASP E 677 TYR E 680 
AB5 1 LEU E 249 ? ILE E 252 ? LEU E 494 ILE E 497 
AB5 2 ILE E 345 ? VAL E 349 ? ILE E 590 VAL E 594 
AB5 3 ILE E 379 ? LEU E 381 ? ILE E 624 LEU E 626 
AB6 1 VAL F 109 ? SER F 113 ? VAL F 354 SER F 358 
AB6 2 ILE F 120 ? PRO F 127 ? ILE F 365 PRO F 372 
AB6 3 VAL F 164 ? PRO F 169 ? VAL F 409 PRO F 414 
AB6 4 ARG F 153 ? VAL F 155 ? ARG F 398 VAL F 400 
AB7 1 PRO F 206 ? ASP F 210 ? PRO F 451 ASP F 455 
AB7 2 PRO F 195 ? HIS F 200 ? PRO F 440 HIS F 445 
AB7 3 ILE F 444 ? GLY F 448 ? ILE F 689 GLY F 693 
AB7 4 ASP F 432 ? TYR F 435 ? ASP F 677 TYR F 680 
AB8 1 ARG F 248 ? ILE F 252 ? ARG F 493 ILE F 497 
AB8 2 ILE F 345 ? VAL F 349 ? ILE F 590 VAL F 594 
AB8 3 HIS F 380 ? LEU F 383 ? HIS F 625 LEU F 628 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N HIS A 115 ? N HIS A 360 O ARG A 122 ? O ARG A 367 
AA1 2 3 N THR A 121 ? N THR A 366 O ILE A 168 ? O ILE A 413 
AA1 3 4 O GLU A 167 ? O GLU A 412 N ARG A 153 ? N ARG A 398 
AA2 1 2 O ILE A 207 ? O ILE A 452 N GLY A 199 ? N GLY A 444 
AA2 2 3 N HIS A 200 ? N HIS A 445 O HIS A 447 ? O HIS A 692 
AA2 3 4 O ILE A 444 ? O ILE A 689 N TYR A 435 ? N TYR A 680 
AA2 4 5 O LEU A 436 ? O LEU A 681 N ARG A 404 ? N ARG A 649 
AA3 1 2 N LEU A 217 ? N LEU A 462 O LEU A 381 ? O LEU A 626 
AA3 2 3 O HIS A 380 ? O HIS A 625 N VAL A 347 ? N VAL A 592 
AA3 3 4 O VAL A 348 ? O VAL A 593 N ILE A 250 ? N ILE A 495 
AA4 1 2 N HIS B 115 ? N HIS B 360 O ARG B 122 ? O ARG B 367 
AA4 2 3 N ILE B 125 ? N ILE B 370 O VAL B 164 ? O VAL B 409 
AA4 3 4 O GLY B 165 ? O GLY B 410 N VAL B 155 ? N VAL B 400 
AA5 1 2 N GLY B 199 ? N GLY B 444 O ILE B 207 ? O ILE B 452 
AA6 1 2 N ILE B 250 ? N ILE B 495 O VAL B 346 ? O VAL B 591 
AA6 2 3 N VAL B 349 ? N VAL B 594 O ILE B 382 ? O ILE B 627 
AA6 3 4 O THR B 385 ? O THR B 630 N VAL B 219 ? N VAL B 464 
AA6 4 5 N ALA B 220 ? N ALA B 465 O PHE B 407 ? O PHE B 652 
AA6 5 6 N ARG B 404 ? N ARG B 649 O LEU B 436 ? O LEU B 681 
AA6 6 7 N TYR B 435 ? N TYR B 680 O ILE B 444 ? O ILE B 689 
AA7 1 2 N SER C 110 ? N SER C 355 O GLN C 126 ? O GLN C 371 
AA7 2 3 N PHE C 123 ? N PHE C 368 O ILE C 166 ? O ILE C 411 
AA7 3 4 O GLY C 165 ? O GLY C 410 N VAL C 155 ? N VAL C 400 
AA8 1 2 O ILE C 207 ? O ILE C 452 N GLY C 199 ? N GLY C 444 
AA8 2 3 N HIS C 200 ? N HIS C 445 O HIS C 447 ? O HIS C 692 
AA9 1 2 N ILE C 250 ? N ILE C 495 O VAL C 348 ? O VAL C 593 
AA9 2 3 N VAL C 347 ? N VAL C 592 O HIS C 380 ? O HIS C 625 
AA9 3 4 O LEU C 383 ? O LEU C 628 N LEU C 217 ? N LEU C 462 
AA9 4 5 N ALA C 220 ? N ALA C 465 O PHE C 407 ? O PHE C 652 
AB1 1 2 N SER D 113 ? N SER D 358 O GLU D 124 ? O GLU D 369 
AB1 2 3 N PHE D 123 ? N PHE D 368 O ILE D 166 ? O ILE D 411 
AB1 3 4 O GLY D 165 ? O GLY D 410 N VAL D 155 ? N VAL D 400 
AB2 1 2 O ILE D 207 ? O ILE D 452 N LEU D 198 ? N LEU D 443 
AB2 2 3 N HIS D 200 ? N HIS D 445 O HIS D 447 ? O HIS D 692 
AB2 3 4 O ILE D 444 ? O ILE D 689 N TYR D 435 ? N TYR D 680 
AB2 4 5 O LEU D 436 ? O LEU D 681 N ARG D 404 ? N ARG D 649 
AB2 5 6 O ILE D 405 ? O ILE D 650 N LEU D 218 ? N LEU D 463 
AB2 6 7 N VAL D 219 ? N VAL D 464 O LEU D 383 ? O LEU D 628 
AB2 7 8 O HIS D 380 ? O HIS D 625 N ILE D 345 ? N ILE D 590 
AB2 8 9 O THR D 344 ? O THR D 589 N ARG D 248 ? N ARG D 493 
AB3 1 2 N SER E 110 ? N SER E 355 O GLN E 126 ? O GLN E 371 
AB3 2 3 N PHE E 123 ? N PHE E 368 O ILE E 166 ? O ILE E 411 
AB3 3 4 O GLY E 165 ? O GLY E 410 N VAL E 155 ? N VAL E 400 
AB4 1 2 O ILE E 207 ? O ILE E 452 N GLY E 199 ? N GLY E 444 
AB4 2 3 N HIS E 200 ? N HIS E 445 O HIS E 447 ? O HIS E 692 
AB4 3 4 O ILE E 444 ? O ILE E 689 N TYR E 435 ? N TYR E 680 
AB5 1 2 N ILE E 252 ? N ILE E 497 O VAL E 348 ? O VAL E 593 
AB5 2 3 N VAL E 347 ? N VAL E 592 O HIS E 380 ? O HIS E 625 
AB6 1 2 N ASP F 112 ? N ASP F 357 O GLU F 124 ? O GLU F 369 
AB6 2 3 N PHE F 123 ? N PHE F 368 O ILE F 166 ? O ILE F 411 
AB6 3 4 O GLY F 165 ? O GLY F 410 N VAL F 155 ? N VAL F 400 
AB7 1 2 O ILE F 207 ? O ILE F 452 N GLY F 199 ? N GLY F 444 
AB7 2 3 N HIS F 200 ? N HIS F 445 O HIS F 447 ? O HIS F 692 
AB7 3 4 O ILE F 444 ? O ILE F 689 N TYR F 435 ? N TYR F 680 
AB8 1 2 N ILE F 250 ? N ILE F 495 O VAL F 348 ? O VAL F 593 
AB8 2 3 N VAL F 347 ? N VAL F 592 O HIS F 380 ? O HIS F 625 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A AGS 801 ? 12 'binding site for residue AGS A 801' 
AC2 Software A MG  802 ? 3  'binding site for residue MG A 802'  
AC3 Software B AGS 801 ? 11 'binding site for residue AGS B 801' 
AC4 Software B MG  802 ? 2  'binding site for residue MG B 802'  
AC5 Software C AGS 801 ? 15 'binding site for residue AGS C 801' 
AC6 Software C MG  802 ? 4  'binding site for residue MG C 802'  
AC7 Software D ADP 801 ? 9  'binding site for residue ADP D 801' 
AC8 Software E ADP 801 ? 11 'binding site for residue ADP E 801' 
AC9 Software F ADP 801 ? 13 'binding site for residue ADP F 801' 
AD1 Software F MG  802 ? 2  'binding site for residue MG F 802'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 THR A 223 ? THR A 468 . ? 1_555 ? 
2  AC1 12 GLY A 224 ? GLY A 469 . ? 1_555 ? 
3  AC1 12 SER A 225 ? SER A 470 . ? 1_555 ? 
4  AC1 12 GLY A 226 ? GLY A 471 . ? 1_555 ? 
5  AC1 12 LYS A 227 ? LYS A 472 . ? 1_555 ? 
6  AC1 12 SER A 228 ? SER A 473 . ? 1_555 ? 
7  AC1 12 VAL A 229 ? VAL A 474 . ? 1_555 ? 
8  AC1 12 LYS A 255 ? LYS A 500 . ? 1_555 ? 
9  AC1 12 HIS A 430 ? HIS A 675 . ? 1_555 ? 
10 AC1 12 GLY A 448 ? GLY A 693 . ? 1_555 ? 
11 AC1 12 PHE A 450 ? PHE A 695 . ? 1_555 ? 
12 AC1 12 MG  J .   ? MG  A 802 . ? 1_555 ? 
13 AC2 3  SER A 228 ? SER A 473 . ? 1_555 ? 
14 AC2 3  GLU A 258 ? GLU A 503 . ? 1_555 ? 
15 AC2 3  AGS I .   ? AGS A 801 . ? 1_555 ? 
16 AC3 11 THR B 223 ? THR B 468 . ? 1_555 ? 
17 AC3 11 GLY B 224 ? GLY B 469 . ? 1_555 ? 
18 AC3 11 GLY B 226 ? GLY B 471 . ? 1_555 ? 
19 AC3 11 LYS B 227 ? LYS B 472 . ? 1_555 ? 
20 AC3 11 SER B 228 ? SER B 473 . ? 1_555 ? 
21 AC3 11 VAL B 229 ? VAL B 474 . ? 1_555 ? 
22 AC3 11 LYS B 255 ? LYS B 500 . ? 1_555 ? 
23 AC3 11 HIS B 430 ? HIS B 675 . ? 1_555 ? 
24 AC3 11 ALA B 449 ? ALA B 694 . ? 1_555 ? 
25 AC3 11 PHE B 450 ? PHE B 695 . ? 1_555 ? 
26 AC3 11 MG  L .   ? MG  B 802 . ? 1_555 ? 
27 AC4 2  SER B 228 ? SER B 473 . ? 1_555 ? 
28 AC4 2  AGS K .   ? AGS B 801 . ? 1_555 ? 
29 AC5 15 ARG B 375 ? ARG B 620 . ? 1_555 ? 
30 AC5 15 GLY C 224 ? GLY C 469 . ? 1_555 ? 
31 AC5 15 GLY C 226 ? GLY C 471 . ? 1_555 ? 
32 AC5 15 LYS C 227 ? LYS C 472 . ? 1_555 ? 
33 AC5 15 SER C 228 ? SER C 473 . ? 1_555 ? 
34 AC5 15 VAL C 229 ? VAL C 474 . ? 1_555 ? 
35 AC5 15 GLU C 258 ? GLU C 503 . ? 1_555 ? 
36 AC5 15 GLU C 351 ? GLU C 596 . ? 1_555 ? 
37 AC5 15 GLN C 386 ? GLN C 631 . ? 1_555 ? 
38 AC5 15 HIS C 430 ? HIS C 675 . ? 1_555 ? 
39 AC5 15 GLY C 431 ? GLY C 676 . ? 1_555 ? 
40 AC5 15 GLY C 448 ? GLY C 693 . ? 1_555 ? 
41 AC5 15 ALA C 449 ? ALA C 694 . ? 1_555 ? 
42 AC5 15 PHE C 450 ? PHE C 695 . ? 1_555 ? 
43 AC5 15 MG  N .   ? MG  C 802 . ? 1_555 ? 
44 AC6 4  SER C 228 ? SER C 473 . ? 1_555 ? 
45 AC6 4  GLU C 258 ? GLU C 503 . ? 1_555 ? 
46 AC6 4  GLU C 351 ? GLU C 596 . ? 1_555 ? 
47 AC6 4  AGS M .   ? AGS C 801 . ? 1_555 ? 
48 AC7 9  MET D 175 ? MET D 420 . ? 1_555 ? 
49 AC7 9  GLY D 224 ? GLY D 469 . ? 1_555 ? 
50 AC7 9  LYS D 227 ? LYS D 472 . ? 1_555 ? 
51 AC7 9  SER D 228 ? SER D 473 . ? 1_555 ? 
52 AC7 9  VAL D 229 ? VAL D 474 . ? 1_555 ? 
53 AC7 9  HIS D 430 ? HIS D 675 . ? 1_555 ? 
54 AC7 9  GLY D 448 ? GLY D 693 . ? 1_555 ? 
55 AC7 9  ALA D 449 ? ALA D 694 . ? 1_555 ? 
56 AC7 9  PHE D 450 ? PHE D 695 . ? 1_555 ? 
57 AC8 11 THR E 223 ? THR E 468 . ? 1_555 ? 
58 AC8 11 GLY E 224 ? GLY E 469 . ? 1_555 ? 
59 AC8 11 SER E 225 ? SER E 470 . ? 1_555 ? 
60 AC8 11 GLY E 226 ? GLY E 471 . ? 1_555 ? 
61 AC8 11 LYS E 227 ? LYS E 472 . ? 1_555 ? 
62 AC8 11 SER E 228 ? SER E 473 . ? 1_555 ? 
63 AC8 11 GLN E 386 ? GLN E 631 . ? 1_555 ? 
64 AC8 11 HIS E 430 ? HIS E 675 . ? 1_555 ? 
65 AC8 11 GLY E 431 ? GLY E 676 . ? 1_555 ? 
66 AC8 11 GLY E 448 ? GLY E 693 . ? 1_555 ? 
67 AC8 11 PHE E 450 ? PHE E 695 . ? 1_555 ? 
68 AC9 13 THR F 222 ? THR F 467 . ? 1_555 ? 
69 AC9 13 THR F 223 ? THR F 468 . ? 1_555 ? 
70 AC9 13 GLY F 224 ? GLY F 469 . ? 1_555 ? 
71 AC9 13 SER F 225 ? SER F 470 . ? 1_555 ? 
72 AC9 13 GLY F 226 ? GLY F 471 . ? 1_555 ? 
73 AC9 13 LYS F 227 ? LYS F 472 . ? 1_555 ? 
74 AC9 13 SER F 228 ? SER F 473 . ? 1_555 ? 
75 AC9 13 VAL F 229 ? VAL F 474 . ? 1_555 ? 
76 AC9 13 HIS F 430 ? HIS F 675 . ? 1_555 ? 
77 AC9 13 GLY F 448 ? GLY F 693 . ? 1_555 ? 
78 AC9 13 ALA F 449 ? ALA F 694 . ? 1_555 ? 
79 AC9 13 PHE F 450 ? PHE F 695 . ? 1_555 ? 
80 AC9 13 MG  R .   ? MG  F 802 . ? 1_555 ? 
81 AD1 2  SER F 228 ? SER F 473 . ? 1_555 ? 
82 AD1 2  ADP Q .   ? ADP F 801 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6T8B 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . THR A 1 69  ? 116.02500 106.88400 183.40400 1.000 66.94000  ? 314 THR A N     1 
ATOM   2     C  CA    . THR A 1 69  ? 116.04800 106.04300 182.21300 1.000 66.94000  ? 314 THR A CA    1 
ATOM   3     C  C     . THR A 1 69  ? 117.04500 106.56400 181.18300 1.000 66.94000  ? 314 THR A C     1 
ATOM   4     O  O     . THR A 1 69  ? 118.02700 105.89300 180.87200 1.000 66.94000  ? 314 THR A O     1 
ATOM   5     C  CB    . THR A 1 69  ? 114.65700 105.95000 181.56400 1.000 66.94000  ? 314 THR A CB    1 
ATOM   6     O  OG1   . THR A 1 69  ? 114.22500 107.25500 181.16100 1.000 66.94000  ? 314 THR A OG1   1 
ATOM   7     C  CG2   . THR A 1 69  ? 113.65100 105.36900 182.54600 1.000 66.94000  ? 314 THR A CG2   1 
ATOM   8     N  N     . LEU A 1 70  ? 116.78400 107.75800 180.65300 1.000 64.56000  ? 315 LEU A N     1 
ATOM   9     C  CA    . LEU A 1 70  ? 117.66600 108.34300 179.65500 1.000 64.56000  ? 315 LEU A CA    1 
ATOM   10    C  C     . LEU A 1 70  ? 119.08500 108.47600 180.20600 1.000 64.56000  ? 315 LEU A C     1 
ATOM   11    O  O     . LEU A 1 70  ? 119.27600 108.74000 181.39600 1.000 64.56000  ? 315 LEU A O     1 
ATOM   12    C  CB    . LEU A 1 70  ? 117.14700 109.71100 179.21900 1.000 64.56000  ? 315 LEU A CB    1 
ATOM   13    C  CG    . LEU A 1 70  ? 115.83600 109.72200 178.43400 1.000 64.56000  ? 315 LEU A CG    1 
ATOM   14    C  CD1   . LEU A 1 70  ? 115.36400 111.14600 178.19600 1.000 64.56000  ? 315 LEU A CD1   1 
ATOM   15    C  CD2   . LEU A 1 70  ? 116.01400 108.99000 177.11800 1.000 64.56000  ? 315 LEU A CD2   1 
ATOM   16    N  N     . PRO A 1 71  ? 120.09800 108.28400 179.36400 1.000 61.17000  ? 316 PRO A N     1 
ATOM   17    C  CA    . PRO A 1 71  ? 121.46900 108.42600 179.83600 1.000 61.17000  ? 316 PRO A CA    1 
ATOM   18    C  C     . PRO A 1 71  ? 121.74000 109.85600 180.25600 1.000 61.17000  ? 316 PRO A C     1 
ATOM   19    O  O     . PRO A 1 71  ? 121.18100 110.80800 179.68100 1.000 61.17000  ? 316 PRO A O     1 
ATOM   20    C  CB    . PRO A 1 71  ? 122.30600 108.02800 178.61200 1.000 61.17000  ? 316 PRO A CB    1 
ATOM   21    C  CG    . PRO A 1 71  ? 121.40200 107.17300 177.80200 1.000 61.17000  ? 316 PRO A CG    1 
ATOM   22    C  CD    . PRO A 1 71  ? 120.04200 107.77300 177.98600 1.000 61.17000  ? 316 PRO A CD    1 
ATOM   23    N  N     . PRO A 1 72  ? 122.58400 110.05500 181.26400 1.000 63.01000  ? 317 PRO A N     1 
ATOM   24    C  CA    . PRO A 1 72  ? 122.87200 111.41600 181.72000 1.000 63.01000  ? 317 PRO A CA    1 
ATOM   25    C  C     . PRO A 1 72  ? 123.75300 112.15800 180.73100 1.000 63.01000  ? 317 PRO A C     1 
ATOM   26    O  O     . PRO A 1 72  ? 124.60000 111.57100 180.05400 1.000 63.01000  ? 317 PRO A O     1 
ATOM   27    C  CB    . PRO A 1 72  ? 123.60000 111.19500 183.05000 1.000 63.01000  ? 317 PRO A CB    1 
ATOM   28    C  CG    . PRO A 1 72  ? 124.24500 109.85600 182.89000 1.000 63.01000  ? 317 PRO A CG    1 
ATOM   29    C  CD    . PRO A 1 72  ? 123.29700 109.03800 182.05800 1.000 63.01000  ? 317 PRO A CD    1 
ATOM   30    N  N     . LEU A 1 73  ? 123.54500 113.47400 180.65600 1.000 63.91000  ? 318 LEU A N     1 
ATOM   31    C  CA    . LEU A 1 73  ? 124.35000 114.31400 179.77800 1.000 63.91000  ? 318 LEU A CA    1 
ATOM   32    C  C     . LEU A 1 73  ? 125.80800 114.39000 180.20900 1.000 63.91000  ? 318 LEU A C     1 
ATOM   33    O  O     . LEU A 1 73  ? 126.61900 114.98000 179.48700 1.000 63.91000  ? 318 LEU A O     1 
ATOM   34    C  CB    . LEU A 1 73  ? 123.75700 115.72300 179.71200 1.000 63.91000  ? 318 LEU A CB    1 
ATOM   35    C  CG    . LEU A 1 73  ? 122.37100 115.83100 179.07300 1.000 63.91000  ? 318 LEU A CG    1 
ATOM   36    C  CD1   . LEU A 1 73  ? 121.82300 117.24200 179.19600 1.000 63.91000  ? 318 LEU A CD1   1 
ATOM   37    C  CD2   . LEU A 1 73  ? 122.42100 115.40100 177.61900 1.000 63.91000  ? 318 LEU A CD2   1 
ATOM   38    N  N     . SER A 1 74  ? 126.15800 113.81300 181.35800 1.000 64.48000  ? 319 SER A N     1 
ATOM   39    C  CA    . SER A 1 74  ? 127.52700 113.81600 181.85400 1.000 64.48000  ? 319 SER A CA    1 
ATOM   40    C  C     . SER A 1 74  ? 128.37700 112.70100 181.26300 1.000 64.48000  ? 319 SER A C     1 
ATOM   41    O  O     . SER A 1 74  ? 129.53900 112.55800 181.65700 1.000 64.48000  ? 319 SER A O     1 
ATOM   42    C  CB    . SER A 1 74  ? 127.53100 113.70700 183.38000 1.000 64.48000  ? 319 SER A CB    1 
ATOM   43    O  OG    . SER A 1 74  ? 126.90900 114.83400 183.97000 1.000 64.48000  ? 319 SER A OG    1 
ATOM   44    N  N     . LEU A 1 75  ? 127.83400 111.90700 180.33800 1.000 64.50000  ? 320 LEU A N     1 
ATOM   45    C  CA    . LEU A 1 75  ? 128.63800 110.89300 179.66900 1.000 64.50000  ? 320 LEU A CA    1 
ATOM   46    C  C     . LEU A 1 75  ? 129.57400 111.49700 178.63400 1.000 64.50000  ? 320 LEU A C     1 
ATOM   47    O  O     . LEU A 1 75  ? 130.54500 110.84500 178.23600 1.000 64.50000  ? 320 LEU A O     1 
ATOM   48    C  CB    . LEU A 1 75  ? 127.73600 109.85700 179.00200 1.000 64.50000  ? 320 LEU A CB    1 
ATOM   49    C  CG    . LEU A 1 75  ? 126.93100 108.95600 179.93500 1.000 64.50000  ? 320 LEU A CG    1 
ATOM   50    C  CD1   . LEU A 1 75  ? 125.96600 108.10700 179.13400 1.000 64.50000  ? 320 LEU A CD1   1 
ATOM   51    C  CD2   . LEU A 1 75  ? 127.86700 108.08000 180.74700 1.000 64.50000  ? 320 LEU A CD2   1 
ATOM   52    N  N     . LEU A 1 76  ? 129.30600 112.72100 178.19500 1.000 66.17000  ? 321 LEU A N     1 
ATOM   53    C  CA    . LEU A 1 76  ? 130.15100 113.37000 177.21000 1.000 66.17000  ? 321 LEU A CA    1 
ATOM   54    C  C     . LEU A 1 76  ? 131.46900 113.80500 177.84900 1.000 66.17000  ? 321 LEU A C     1 
ATOM   55    O  O     . LEU A 1 76  ? 131.66400 113.72100 179.06400 1.000 66.17000  ? 321 LEU A O     1 
ATOM   56    C  CB    . LEU A 1 76  ? 129.42700 114.57000 176.60700 1.000 66.17000  ? 321 LEU A CB    1 
ATOM   57    C  CG    . LEU A 1 76  ? 128.14500 114.23000 175.85000 1.000 66.17000  ? 321 LEU A CG    1 
ATOM   58    C  CD1   . LEU A 1 76  ? 127.42100 115.49700 175.44800 1.000 66.17000  ? 321 LEU A CD1   1 
ATOM   59    C  CD2   . LEU A 1 76  ? 128.45300 113.37300 174.63600 1.000 66.17000  ? 321 LEU A CD2   1 
ATOM   60    N  N     . ASP A 1 77  ? 132.38500 114.27500 177.00700 1.000 73.22000  ? 322 ASP A N     1 
ATOM   61    C  CA    . ASP A 1 77  ? 133.65200 114.80700 177.48800 1.000 73.22000  ? 322 ASP A CA    1 
ATOM   62    C  C     . ASP A 1 77  ? 133.48800 116.29200 177.77500 1.000 73.22000  ? 322 ASP A C     1 
ATOM   63    O  O     . ASP A 1 77  ? 133.17500 117.05600 176.85200 1.000 73.22000  ? 322 ASP A O     1 
ATOM   64    C  CB    . ASP A 1 77  ? 134.75100 114.58800 176.46600 1.000 73.22000  ? 322 ASP A CB    1 
ATOM   65    C  CG    . ASP A 1 77  ? 135.06400 113.12000 176.25100 1.000 73.22000  ? 322 ASP A CG    1 
ATOM   66    O  OD1   . ASP A 1 77  ? 134.88700 112.32600 177.19900 1.000 73.22000  ? 322 ASP A OD1   1 
ATOM   67    O  OD2   . ASP A 1 77  ? 135.48000 112.75900 175.13100 1.000 73.22000  ? 322 ASP A OD2   1 
ATOM   68    N  N     . PRO A 1 78  ? 133.67600 116.74000 179.01300 1.000 84.18000  ? 323 PRO A N     1 
ATOM   69    C  CA    . PRO A 1 78  ? 133.39200 118.13900 179.34800 1.000 84.18000  ? 323 PRO A CA    1 
ATOM   70    C  C     . PRO A 1 78  ? 134.34000 119.10300 178.65100 1.000 84.18000  ? 323 PRO A C     1 
ATOM   71    O  O     . PRO A 1 78  ? 135.42800 118.74000 178.19700 1.000 84.18000  ? 323 PRO A O     1 
ATOM   72    C  CB    . PRO A 1 78  ? 133.58300 118.18500 180.86800 1.000 84.18000  ? 323 PRO A CB    1 
ATOM   73    C  CG    . PRO A 1 78  ? 133.41400 116.76700 181.31600 1.000 84.18000  ? 323 PRO A CG    1 
ATOM   74    C  CD    . PRO A 1 78  ? 133.98700 115.93900 180.20800 1.000 84.18000  ? 323 PRO A CD    1 
ATOM   75    N  N     . ALA A 1 79  ? 133.90000 120.35700 178.57100 1.000 96.97000  ? 324 ALA A N     1 
ATOM   76    C  CA    . ALA A 1 79  ? 134.74700 121.41200 178.03400 1.000 96.97000  ? 324 ALA A CA    1 
ATOM   77    C  C     . ALA A 1 79  ? 135.97800 121.59400 178.91200 1.000 96.97000  ? 324 ALA A C     1 
ATOM   78    O  O     . ALA A 1 79  ? 135.96200 121.30100 180.11100 1.000 96.97000  ? 324 ALA A O     1 
ATOM   79    C  CB    . ALA A 1 79  ? 133.97100 122.72500 177.93900 1.000 96.97000  ? 324 ALA A CB    1 
ATOM   80    N  N     . GLU A 1 80  ? 137.05800 122.08800 178.30800 1.000 109.40000 ? 325 GLU A N     1 
ATOM   81    C  CA    . GLU A 1 80  ? 138.34400 122.14100 178.99400 1.000 109.40000 ? 325 GLU A CA    1 
ATOM   82    C  C     . GLU A 1 80  ? 138.66500 123.52500 179.55500 1.000 109.40000 ? 325 GLU A C     1 
ATOM   83    O  O     . GLU A 1 80  ? 138.82300 123.67600 180.77000 1.000 109.40000 ? 325 GLU A O     1 
ATOM   84    C  CB    . GLU A 1 80  ? 139.44500 121.64100 178.03600 1.000 109.40000 ? 325 GLU A CB    1 
ATOM   85    C  CG    . GLU A 1 80  ? 139.69500 122.48900 176.78700 1.000 109.40000 ? 325 GLU A CG    1 
ATOM   86    C  CD    . GLU A 1 80  ? 138.72000 122.20400 175.65700 1.000 109.40000 ? 325 GLU A CD    1 
ATOM   87    O  OE1   . GLU A 1 80  ? 137.67300 121.57000 175.90700 1.000 109.40000 ? 325 GLU A OE1   1 
ATOM   88    O  OE2   . GLU A 1 80  ? 138.99800 122.62500 174.51600 1.000 109.40000 ? 325 GLU A OE2   1 
ATOM   89    N  N     . VAL A 1 81  ? 138.75000 124.54300 178.69900 1.000 113.63000 ? 326 VAL A N     1 
ATOM   90    C  CA    . VAL A 1 81  ? 139.18100 125.87100 179.11700 1.000 113.63000 ? 326 VAL A CA    1 
ATOM   91    C  C     . VAL A 1 81  ? 138.89400 126.83200 177.97500 1.000 113.63000 ? 326 VAL A C     1 
ATOM   92    O  O     . VAL A 1 81  ? 138.70300 126.40900 176.82900 1.000 113.63000 ? 326 VAL A O     1 
ATOM   93    C  CB    . VAL A 1 81  ? 140.68700 125.85400 179.49900 1.000 113.63000 ? 326 VAL A CB    1 
ATOM   94    C  CG1   . VAL A 1 81  ? 141.55400 125.63600 178.26600 1.000 113.63000 ? 326 VAL A CG1   1 
ATOM   95    C  CG2   . VAL A 1 81  ? 141.08200 127.12200 180.24900 1.000 113.63000 ? 326 VAL A CG2   1 
ATOM   96    N  N     . LYS A 1 82  ? 138.85400 128.12700 178.28100 1.000 110.65000 ? 327 LYS A N     1 
ATOM   97    C  CA    . LYS A 1 82  ? 138.95600 129.11600 177.21700 1.000 110.65000 ? 327 LYS A CA    1 
ATOM   98    C  C     . LYS A 1 82  ? 140.37600 129.06400 176.67100 1.000 110.65000 ? 327 LYS A C     1 
ATOM   99    O  O     . LYS A 1 82  ? 141.28100 129.69700 177.22400 1.000 110.65000 ? 327 LYS A O     1 
ATOM   100   C  CB    . LYS A 1 82  ? 138.62200 130.52000 177.72300 1.000 110.65000 ? 327 LYS A CB    1 
ATOM   101   C  CG    . LYS A 1 82  ? 137.16400 130.73800 178.08300 1.000 110.65000 ? 327 LYS A CG    1 
ATOM   102   C  CD    . LYS A 1 82  ? 136.92700 132.17700 178.51300 1.000 110.65000 ? 327 LYS A CD    1 
ATOM   103   C  CE    . LYS A 1 82  ? 135.48100 132.40900 178.91200 1.000 110.65000 ? 327 LYS A CE    1 
ATOM   104   N  NZ    . LYS A 1 82  ? 134.56600 132.31700 177.74100 1.000 110.65000 ? 327 LYS A NZ    1 
ATOM   105   N  N     . GLN A 1 83  ? 140.57500 128.29600 175.59600 1.000 102.51000 ? 328 GLN A N     1 
ATOM   106   C  CA    . GLN A 1 83  ? 141.91800 127.98600 175.11400 1.000 102.51000 ? 328 GLN A CA    1 
ATOM   107   C  C     . GLN A 1 83  ? 142.70800 129.25300 174.80800 1.000 102.51000 ? 328 GLN A C     1 
ATOM   108   O  O     . GLN A 1 83  ? 143.72500 129.54200 175.44800 1.000 102.51000 ? 328 GLN A O     1 
ATOM   109   C  CB    . GLN A 1 83  ? 141.82700 127.09800 173.87200 1.000 102.51000 ? 328 GLN A CB    1 
ATOM   110   C  CG    . GLN A 1 83  ? 141.22800 125.72700 174.13100 1.000 102.51000 ? 328 GLN A CG    1 
ATOM   111   C  CD    . GLN A 1 83  ? 141.11000 124.89800 172.86900 1.000 102.51000 ? 328 GLN A CD    1 
ATOM   112   O  OE1   . GLN A 1 83  ? 141.42400 125.36400 171.77400 1.000 102.51000 ? 328 GLN A OE1   1 
ATOM   113   N  NE2   . GLN A 1 83  ? 140.65100 123.66100 173.01500 1.000 102.51000 ? 328 GLN A NE2   1 
ATOM   114   N  N     . LYS A 1 84  ? 142.24800 130.02200 173.82700 1.000 89.94000  ? 329 LYS A N     1 
ATOM   115   C  CA    . LYS A 1 84  ? 142.86700 131.29000 173.48300 1.000 89.94000  ? 329 LYS A CA    1 
ATOM   116   C  C     . LYS A 1 84  ? 141.78500 132.21500 172.94700 1.000 89.94000  ? 329 LYS A C     1 
ATOM   117   O  O     . LYS A 1 84  ? 140.81500 131.77300 172.32700 1.000 89.94000  ? 329 LYS A O     1 
ATOM   118   C  CB    . LYS A 1 84  ? 144.00000 131.10000 172.46300 1.000 89.94000  ? 329 LYS A CB    1 
ATOM   119   C  CG    . LYS A 1 84  ? 144.73300 132.37200 172.07800 1.000 89.94000  ? 329 LYS A CG    1 
ATOM   120   C  CD    . LYS A 1 84  ? 145.51400 132.94600 173.24300 1.000 89.94000  ? 329 LYS A CD    1 
ATOM   121   C  CE    . LYS A 1 84  ? 146.34100 134.13800 172.80000 1.000 89.94000  ? 329 LYS A CE    1 
ATOM   122   N  NZ    . LYS A 1 84  ? 145.47900 135.27400 172.37200 1.000 89.94000  ? 329 LYS A NZ    1 
ATOM   123   N  N     . SER A 1 85  ? 141.95700 133.51100 173.19600 1.000 83.88000  ? 330 SER A N     1 
ATOM   124   C  CA    . SER A 1 85  ? 140.94700 134.49100 172.83300 1.000 83.88000  ? 330 SER A CA    1 
ATOM   125   C  C     . SER A 1 85  ? 141.62500 135.76700 172.36100 1.000 83.88000  ? 330 SER A C     1 
ATOM   126   O  O     . SER A 1 85  ? 142.84800 135.83200 172.21100 1.000 83.88000  ? 330 SER A O     1 
ATOM   127   C  CB    . SER A 1 85  ? 140.01200 134.78200 174.01100 1.000 83.88000  ? 330 SER A CB    1 
ATOM   128   O  OG    . SER A 1 85  ? 140.71900 135.39400 175.07500 1.000 83.88000  ? 330 SER A OG    1 
ATOM   129   N  N     . TYR A 1 86  ? 140.80600 136.78700 172.12200 1.000 79.35000  ? 331 TYR A N     1 
ATOM   130   C  CA    . TYR A 1 86  ? 141.27600 138.12800 171.80300 1.000 79.35000  ? 331 TYR A CA    1 
ATOM   131   C  C     . TYR A 1 86  ? 140.90000 139.05800 172.94600 1.000 79.35000  ? 331 TYR A C     1 
ATOM   132   O  O     . TYR A 1 86  ? 139.72400 139.14700 173.31600 1.000 79.35000  ? 331 TYR A O     1 
ATOM   133   C  CB    . TYR A 1 86  ? 140.68000 138.64000 170.49100 1.000 79.35000  ? 331 TYR A CB    1 
ATOM   134   C  CG    . TYR A 1 86  ? 141.24300 138.00000 169.24600 1.000 79.35000  ? 331 TYR A CG    1 
ATOM   135   C  CD1   . TYR A 1 86  ? 142.38300 137.21000 169.29700 1.000 79.35000  ? 331 TYR A CD1   1 
ATOM   136   C  CD2   . TYR A 1 86  ? 140.64900 138.21500 168.01000 1.000 79.35000  ? 331 TYR A CD2   1 
ATOM   137   C  CE1   . TYR A 1 86  ? 142.90100 136.63400 168.15300 1.000 79.35000  ? 331 TYR A CE1   1 
ATOM   138   C  CE2   . TYR A 1 86  ? 141.16200 137.64700 166.86300 1.000 79.35000  ? 331 TYR A CE2   1 
ATOM   139   C  CZ    . TYR A 1 86  ? 142.28700 136.85700 166.93900 1.000 79.35000  ? 331 TYR A CZ    1 
ATOM   140   O  OH    . TYR A 1 86  ? 142.79800 136.28800 165.79600 1.000 79.35000  ? 331 TYR A OH    1 
ATOM   141   N  N     . SER A 1 87  ? 141.89100 139.74100 173.50000 1.000 79.88000  ? 332 SER A N     1 
ATOM   142   C  CA    . SER A 1 87  ? 141.61700 140.72900 174.52500 1.000 79.88000  ? 332 SER A CA    1 
ATOM   143   C  C     . SER A 1 87  ? 141.01200 141.97500 173.88300 1.000 79.88000  ? 332 SER A C     1 
ATOM   144   O  O     . SER A 1 87  ? 141.39000 142.33900 172.76600 1.000 79.88000  ? 332 SER A O     1 
ATOM   145   C  CB    . SER A 1 87  ? 142.89500 141.08800 175.27900 1.000 79.88000  ? 332 SER A CB    1 
ATOM   146   O  OG    . SER A 1 87  ? 143.81600 141.73800 174.42300 1.000 79.88000  ? 332 SER A OG    1 
ATOM   147   N  N     . PRO A 1 88  ? 140.07500 142.64600 174.56000 1.000 78.47000  ? 333 PRO A N     1 
ATOM   148   C  CA    . PRO A 1 88  ? 139.40100 143.79700 173.93600 1.000 78.47000  ? 333 PRO A CA    1 
ATOM   149   C  C     . PRO A 1 88  ? 140.34700 144.89100 173.47600 1.000 78.47000  ? 333 PRO A C     1 
ATOM   150   O  O     . PRO A 1 88  ? 139.97600 145.67200 172.59100 1.000 78.47000  ? 333 PRO A O     1 
ATOM   151   C  CB    . PRO A 1 88  ? 138.45900 144.29400 175.04000 1.000 78.47000  ? 333 PRO A CB    1 
ATOM   152   C  CG    . PRO A 1 88  ? 139.06500 143.79800 176.30800 1.000 78.47000  ? 333 PRO A CG    1 
ATOM   153   C  CD    . PRO A 1 88  ? 139.68700 142.47600 175.96900 1.000 78.47000  ? 333 PRO A CD    1 
ATOM   154   N  N     . GLU A 1 89  ? 141.55300 144.97200 174.03900 1.000 80.24000  ? 334 GLU A N     1 
ATOM   155   C  CA    . GLU A 1 89  ? 142.54200 145.91500 173.52800 1.000 80.24000  ? 334 GLU A CA    1 
ATOM   156   C  C     . GLU A 1 89  ? 142.88600 145.60400 172.07700 1.000 80.24000  ? 334 GLU A C     1 
ATOM   157   O  O     . GLU A 1 89  ? 142.86500 146.49000 171.21300 1.000 80.24000  ? 334 GLU A O     1 
ATOM   158   C  CB    . GLU A 1 89  ? 143.79900 145.88300 174.39900 1.000 80.24000  ? 334 GLU A CB    1 
ATOM   159   C  CG    . GLU A 1 89  ? 143.58900 146.38300 175.82100 1.000 80.24000  ? 334 GLU A CG    1 
ATOM   160   C  CD    . GLU A 1 89  ? 143.06200 145.30600 176.75200 1.000 80.24000  ? 334 GLU A CD    1 
ATOM   161   O  OE1   . GLU A 1 89  ? 142.92900 144.14800 176.30700 1.000 80.24000  ? 334 GLU A OE1   1 
ATOM   162   O  OE2   . GLU A 1 89  ? 142.77800 145.61900 177.92600 1.000 80.24000  ? 334 GLU A OE2   1 
ATOM   163   N  N     . SER A 1 90  ? 143.19000 144.33600 171.78700 1.000 76.20000  ? 335 SER A N     1 
ATOM   164   C  CA    . SER A 1 90  ? 143.50500 143.94800 170.41800 1.000 76.20000  ? 335 SER A CA    1 
ATOM   165   C  C     . SER A 1 90  ? 142.28800 144.06100 169.51100 1.000 76.20000  ? 335 SER A C     1 
ATOM   166   O  O     . SER A 1 90  ? 142.42900 144.40200 168.33200 1.000 76.20000  ? 335 SER A O     1 
ATOM   167   C  CB    . SER A 1 90  ? 144.06100 142.52500 170.38900 1.000 76.20000  ? 335 SER A CB    1 
ATOM   168   O  OG    . SER A 1 90  ? 144.36500 142.12400 169.06500 1.000 76.20000  ? 335 SER A OG    1 
ATOM   169   N  N     . LEU A 1 91  ? 141.09000 143.79500 170.03800 1.000 71.78000  ? 336 LEU A N     1 
ATOM   170   C  CA    . LEU A 1 91  ? 139.88800 143.95000 169.22600 1.000 71.78000  ? 336 LEU A CA    1 
ATOM   171   C  C     . LEU A 1 91  ? 139.66800 145.40600 168.83400 1.000 71.78000  ? 336 LEU A C     1 
ATOM   172   O  O     . LEU A 1 91  ? 139.32200 145.69500 167.68500 1.000 71.78000  ? 336 LEU A O     1 
ATOM   173   C  CB    . LEU A 1 91  ? 138.67000 143.40100 169.96700 1.000 71.78000  ? 336 LEU A CB    1 
ATOM   174   C  CG    . LEU A 1 91  ? 138.65100 141.88400 170.15500 1.000 71.78000  ? 336 LEU A CG    1 
ATOM   175   C  CD1   . LEU A 1 91  ? 137.45100 141.45700 170.98400 1.000 71.78000  ? 336 LEU A CD1   1 
ATOM   176   C  CD2   . LEU A 1 91  ? 138.65600 141.18300 168.80700 1.000 71.78000  ? 336 LEU A CD2   1 
ATOM   177   N  N     . GLU A 1 92  ? 139.87900 146.33800 169.76500 1.000 71.46000  ? 337 GLU A N     1 
ATOM   178   C  CA    . GLU A 1 92  ? 139.74300 147.75100 169.42300 1.000 71.46000  ? 337 GLU A CA    1 
ATOM   179   C  C     . GLU A 1 92  ? 140.84000 148.19500 168.46400 1.000 71.46000  ? 337 GLU A C     1 
ATOM   180   O  O     . GLU A 1 92  ? 140.58900 148.98300 167.54000 1.000 71.46000  ? 337 GLU A O     1 
ATOM   181   C  CB    . GLU A 1 92  ? 139.76200 148.60200 170.69100 1.000 71.46000  ? 337 GLU A CB    1 
ATOM   182   C  CG    . GLU A 1 92  ? 138.55100 148.41200 171.58100 1.000 71.46000  ? 337 GLU A CG    1 
ATOM   183   C  CD    . GLU A 1 92  ? 138.63400 149.23700 172.84800 1.000 71.46000  ? 337 GLU A CD    1 
ATOM   184   O  OE1   . GLU A 1 92  ? 139.69600 149.84600 173.09300 1.000 71.46000  ? 337 GLU A OE1   1 
ATOM   185   O  OE2   . GLU A 1 92  ? 137.63700 149.27800 173.59800 1.000 71.46000  ? 337 GLU A OE2   1 
ATOM   186   N  N     . ALA A 1 93  ? 142.06500 147.70700 168.67300 1.000 66.36000  ? 338 ALA A N     1 
ATOM   187   C  CA    . ALA A 1 93  ? 143.14900 148.00900 167.74500 1.000 66.36000  ? 338 ALA A CA    1 
ATOM   188   C  C     . ALA A 1 93  ? 142.79200 147.56600 166.33200 1.000 66.36000  ? 338 ALA A C     1 
ATOM   189   O  O     . ALA A 1 93  ? 142.96300 148.32300 165.36800 1.000 66.36000  ? 338 ALA A O     1 
ATOM   190   C  CB    . ALA A 1 93  ? 144.44000 147.34000 168.21300 1.000 66.36000  ? 338 ALA A CB    1 
ATOM   191   N  N     . MET A 1 94  ? 142.27700 146.34200 166.19300 1.000 61.60000  ? 339 MET A N     1 
ATOM   192   C  CA    . MET A 1 94  ? 141.90600 145.84000 164.87500 1.000 61.60000  ? 339 MET A CA    1 
ATOM   193   C  C     . MET A 1 94  ? 140.68900 146.56700 164.31900 1.000 61.60000  ? 339 MET A C     1 
ATOM   194   O  O     . MET A 1 94  ? 140.58600 146.74500 163.10400 1.000 61.60000  ? 339 MET A O     1 
ATOM   195   C  CB    . MET A 1 94  ? 141.64700 144.33600 164.93800 1.000 61.60000  ? 339 MET A CB    1 
ATOM   196   C  CG    . MET A 1 94  ? 141.40200 143.69500 163.58600 1.000 61.60000  ? 339 MET A CG    1 
ATOM   197   S  SD    . MET A 1 94  ? 141.15700 141.91500 163.70500 1.000 61.60000  ? 339 MET A SD    1 
ATOM   198   C  CE    . MET A 1 94  ? 142.82300 141.37400 164.07800 1.000 61.60000  ? 339 MET A CE    1 
ATOM   199   N  N     . SER A 1 95  ? 139.77500 147.01300 165.18200 1.000 58.55000  ? 340 SER A N     1 
ATOM   200   C  CA    . SER A 1 95  ? 138.63300 147.79000 164.71000 1.000 58.55000  ? 340 SER A CA    1 
ATOM   201   C  C     . SER A 1 95  ? 139.08300 149.09700 164.07400 1.000 58.55000  ? 340 SER A C     1 
ATOM   202   O  O     . SER A 1 95  ? 138.65600 149.44100 162.96300 1.000 58.55000  ? 340 SER A O     1 
ATOM   203   C  CB    . SER A 1 95  ? 137.67400 148.06300 165.86700 1.000 58.55000  ? 340 SER A CB    1 
ATOM   204   O  OG    . SER A 1 95  ? 137.14400 146.85700 166.38600 1.000 58.55000  ? 340 SER A OG    1 
ATOM   205   N  N     . ARG A 1 96  ? 139.94200 149.84400 164.76100 1.000 61.20000  ? 341 ARG A N     1 
ATOM   206   C  CA    . ARG A 1 96  ? 140.42500 151.09100 164.18100 1.000 61.20000  ? 341 ARG A CA    1 
ATOM   207   C  C     . ARG A 1 96  ? 141.35200 150.87100 162.99200 1.000 61.20000  ? 341 ARG A C     1 
ATOM   208   O  O     . ARG A 1 96  ? 141.31600 151.67000 162.04800 1.000 61.20000  ? 341 ARG A O     1 
ATOM   209   C  CB    . ARG A 1 96  ? 141.11400 151.94800 165.24600 1.000 61.20000  ? 341 ARG A CB    1 
ATOM   210   C  CG    . ARG A 1 96  ? 140.12700 152.73700 166.09400 1.000 61.20000  ? 341 ARG A CG    1 
ATOM   211   C  CD    . ARG A 1 96  ? 139.58400 151.90100 167.23600 1.000 61.20000  ? 341 ARG A CD    1 
ATOM   212   N  NE    . ARG A 1 96  ? 138.71400 152.66300 168.12400 1.000 61.20000  ? 341 ARG A NE    1 
ATOM   213   C  CZ    . ARG A 1 96  ? 137.39100 152.70600 168.00600 1.000 61.20000  ? 341 ARG A CZ    1 
ATOM   214   N  NH1   . ARG A 1 96  ? 136.78900 152.03000 167.03700 1.000 61.20000  ? 341 ARG A NH1   1 
ATOM   215   N  NH2   . ARG A 1 96  ? 136.66900 153.42200 168.85700 1.000 61.20000  ? 341 ARG A NH2   1 
ATOM   216   N  N     . LEU A 1 97  ? 142.15100 149.80400 162.99200 1.000 54.14000  ? 342 LEU A N     1 
ATOM   217   C  CA    . LEU A 1 97  ? 142.92900 149.44200 161.81600 1.000 54.14000  ? 342 LEU A CA    1 
ATOM   218   C  C     . LEU A 1 97  ? 142.05100 149.04600 160.63700 1.000 54.14000  ? 342 LEU A C     1 
ATOM   219   O  O     . LEU A 1 97  ? 142.45400 149.24000 159.48800 1.000 54.14000  ? 342 LEU A O     1 
ATOM   220   C  CB    . LEU A 1 97  ? 143.88800 148.29800 162.15800 1.000 54.14000  ? 342 LEU A CB    1 
ATOM   221   C  CG    . LEU A 1 97  ? 144.84800 147.83200 161.06500 1.000 54.14000  ? 342 LEU A CG    1 
ATOM   222   C  CD1   . LEU A 1 97  ? 145.75500 148.96900 160.63600 1.000 54.14000  ? 342 LEU A CD1   1 
ATOM   223   C  CD2   . LEU A 1 97  ? 145.66900 146.65400 161.55800 1.000 54.14000  ? 342 LEU A CD2   1 
ATOM   224   N  N     . LEU A 1 98  ? 140.86100 148.51300 160.90000 1.000 51.41000  ? 343 LEU A N     1 
ATOM   225   C  CA    . LEU A 1 98  ? 139.88500 148.23900 159.85600 1.000 51.41000  ? 343 LEU A CA    1 
ATOM   226   C  C     . LEU A 1 98  ? 139.31900 149.53400 159.29800 1.000 51.41000  ? 343 LEU A C     1 
ATOM   227   O  O     . LEU A 1 98  ? 139.25400 149.72500 158.07700 1.000 51.41000  ? 343 LEU A O     1 
ATOM   228   C  CB    . LEU A 1 98  ? 138.76100 147.37500 160.42900 1.000 51.41000  ? 343 LEU A CB    1 
ATOM   229   C  CG    . LEU A 1 98  ? 137.64900 146.86500 159.52100 1.000 51.41000  ? 343 LEU A CG    1 
ATOM   230   C  CD1   . LEU A 1 98  ? 138.20600 145.84400 158.56300 1.000 51.41000  ? 343 LEU A CD1   1 
ATOM   231   C  CD2   . LEU A 1 98  ? 136.52800 146.27300 160.34900 1.000 51.41000  ? 343 LEU A CD2   1 
ATOM   232   N  N     . GLU A 1 99  ? 138.90400 150.43100 160.19400 1.000 52.79000  ? 344 GLU A N     1 
ATOM   233   C  CA    . GLU A 1 99  ? 138.28900 151.68100 159.76400 1.000 52.79000  ? 344 GLU A CA    1 
ATOM   234   C  C     . GLU A 1 99  ? 139.25600 152.52900 158.94800 1.000 52.79000  ? 344 GLU A C     1 
ATOM   235   O  O     . GLU A 1 99  ? 138.87500 153.09500 157.91800 1.000 52.79000  ? 344 GLU A O     1 
ATOM   236   C  CB    . GLU A 1 99  ? 137.78400 152.45800 160.97600 1.000 52.79000  ? 344 GLU A CB    1 
ATOM   237   C  CG    . GLU A 1 99  ? 137.06700 153.74000 160.62100 1.000 52.79000  ? 344 GLU A CG    1 
ATOM   238   C  CD    . GLU A 1 99  ? 136.52800 154.45500 161.84000 1.000 52.79000  ? 344 GLU A CD    1 
ATOM   239   O  OE1   . GLU A 1 99  ? 136.72600 153.94600 162.96200 1.000 52.79000  ? 344 GLU A OE1   1 
ATOM   240   O  OE2   . GLU A 1 99  ? 135.91200 155.52900 161.67800 1.000 52.79000  ? 344 GLU A OE2   1 
ATOM   241   N  N     . ILE A 1 100 ? 140.51500 152.62400 159.38300 1.000 52.22000  ? 345 ILE A N     1 
ATOM   242   C  CA    . ILE A 1 100 ? 141.48800 153.43700 158.65500 1.000 52.22000  ? 345 ILE A CA    1 
ATOM   243   C  C     . ILE A 1 100 ? 141.74500 152.85400 157.27000 1.000 52.22000  ? 345 ILE A C     1 
ATOM   244   O  O     . ILE A 1 100 ? 141.72900 153.57000 156.25800 1.000 52.22000  ? 345 ILE A O     1 
ATOM   245   C  CB    . ILE A 1 100 ? 142.79100 153.56900 159.46200 1.000 52.22000  ? 345 ILE A CB    1 
ATOM   246   C  CG1   . ILE A 1 100 ? 142.52700 154.29600 160.78000 1.000 52.22000  ? 345 ILE A CG1   1 
ATOM   247   C  CG2   . ILE A 1 100 ? 143.84700 154.29700 158.65100 1.000 52.22000  ? 345 ILE A CG2   1 
ATOM   248   C  CD1   . ILE A 1 100 ? 141.99900 155.70100 160.60100 1.000 52.22000  ? 345 ILE A CD1   1 
ATOM   249   N  N     . LYS A 1 101 ? 141.98900 151.54400 157.20300 1.000 54.25000  ? 346 LYS A N     1 
ATOM   250   C  CA    . LYS A 1 101 ? 142.30100 150.92500 155.92100 1.000 54.25000  ? 346 LYS A CA    1 
ATOM   251   C  C     . LYS A 1 101 ? 141.10700 150.94500 154.97700 1.000 54.25000  ? 346 LYS A C     1 
ATOM   252   O  O     . LYS A 1 101 ? 141.29100 150.91500 153.75600 1.000 54.25000  ? 346 LYS A O     1 
ATOM   253   C  CB    . LYS A 1 101 ? 142.79900 149.49700 156.13000 1.000 54.25000  ? 346 LYS A CB    1 
ATOM   254   C  CG    . LYS A 1 101 ? 144.08800 149.40700 156.92900 1.000 54.25000  ? 346 LYS A CG    1 
ATOM   255   C  CD    . LYS A 1 101 ? 145.26300 149.99800 156.18000 1.000 54.25000  ? 346 LYS A CD    1 
ATOM   256   C  CE    . LYS A 1 101 ? 146.54800 149.82000 156.96800 1.000 54.25000  ? 346 LYS A CE    1 
ATOM   257   N  NZ    . LYS A 1 101 ? 147.71500 150.42000 156.26900 1.000 54.25000  ? 346 LYS A NZ    1 
ATOM   258   N  N     . LEU A 1 102 ? 139.88200 150.99600 155.50700 1.000 48.97000  ? 347 LEU A N     1 
ATOM   259   C  CA    . LEU A 1 102 ? 138.74100 151.22600 154.62700 1.000 48.97000  ? 347 LEU A CA    1 
ATOM   260   C  C     . LEU A 1 102 ? 138.66700 152.67900 154.17900 1.000 48.97000  ? 347 LEU A C     1 
ATOM   261   O  O     . LEU A 1 102 ? 138.33100 152.95700 153.02300 1.000 48.97000  ? 347 LEU A O     1 
ATOM   262   C  CB    . LEU A 1 102 ? 137.43700 150.81400 155.30700 1.000 48.97000  ? 347 LEU A CB    1 
ATOM   263   C  CG    . LEU A 1 102 ? 137.19400 149.31200 155.39900 1.000 48.97000  ? 347 LEU A CG    1 
ATOM   264   C  CD1   . LEU A 1 102 ? 135.94000 149.01400 156.19700 1.000 48.97000  ? 347 LEU A CD1   1 
ATOM   265   C  CD2   . LEU A 1 102 ? 137.08100 148.74300 153.99900 1.000 48.97000  ? 347 LEU A CD2   1 
ATOM   266   N  N     . LYS A 1 103 ? 138.97000 153.61700 155.07900 1.000 55.15000  ? 348 LYS A N     1 
ATOM   267   C  CA    . LYS A 1 103 ? 138.97100 155.02500 154.70000 1.000 55.15000  ? 348 LYS A CA    1 
ATOM   268   C  C     . LYS A 1 103 ? 139.98100 155.31000 153.59700 1.000 55.15000  ? 348 LYS A C     1 
ATOM   269   O  O     . LYS A 1 103 ? 139.76800 156.21700 152.78500 1.000 55.15000  ? 348 LYS A O     1 
ATOM   270   C  CB    . LYS A 1 103 ? 139.25200 155.90000 155.92000 1.000 55.15000  ? 348 LYS A CB    1 
ATOM   271   C  CG    . LYS A 1 103 ? 139.25600 157.38600 155.62000 1.000 55.15000  ? 348 LYS A CG    1 
ATOM   272   C  CD    . LYS A 1 103 ? 137.87000 157.86000 155.22900 1.000 55.15000  ? 348 LYS A CD    1 
ATOM   273   C  CE    . LYS A 1 103 ? 137.83700 159.36200 155.01700 1.000 55.15000  ? 348 LYS A CE    1 
ATOM   274   N  NZ    . LYS A 1 103 ? 136.50100 159.82800 154.55600 1.000 55.15000  ? 348 LYS A NZ    1 
ATOM   275   N  N     . GLU A 1 104 ? 141.08100 154.55200 153.54500 1.000 56.03000  ? 349 GLU A N     1 
ATOM   276   C  CA    . GLU A 1 104 ? 142.03200 154.74500 152.45300 1.000 56.03000  ? 349 GLU A CA    1 
ATOM   277   C  C     . GLU A 1 104 ? 141.38900 154.51200 151.09300 1.000 56.03000  ? 349 GLU A C     1 
ATOM   278   O  O     . GLU A 1 104 ? 141.76600 155.16100 150.11200 1.000 56.03000  ? 349 GLU A O     1 
ATOM   279   C  CB    . GLU A 1 104 ? 143.24400 153.82700 152.60900 1.000 56.03000  ? 349 GLU A CB    1 
ATOM   280   C  CG    . GLU A 1 104 ? 144.19700 154.20700 153.72200 1.000 56.03000  ? 349 GLU A CG    1 
ATOM   281   C  CD    . GLU A 1 104 ? 145.43000 153.32400 153.74100 1.000 56.03000  ? 349 GLU A CD    1 
ATOM   282   O  OE1   . GLU A 1 104 ? 145.46600 152.33500 152.97800 1.000 56.03000  ? 349 GLU A OE1   1 
ATOM   283   O  OE2   . GLU A 1 104 ? 146.37000 153.62500 154.50700 1.000 56.03000  ? 349 GLU A OE2   1 
ATOM   284   N  N     . PHE A 1 105 ? 140.42800 153.59600 151.00800 1.000 53.07000  ? 350 PHE A N     1 
ATOM   285   C  CA    . PHE A 1 105 ? 139.76100 153.29600 149.74900 1.000 53.07000  ? 350 PHE A CA    1 
ATOM   286   C  C     . PHE A 1 105 ? 138.54900 154.18200 149.49800 1.000 53.07000  ? 350 PHE A C     1 
ATOM   287   O  O     . PHE A 1 105 ? 137.75700 153.88700 148.59800 1.000 53.07000  ? 350 PHE A O     1 
ATOM   288   C  CB    . PHE A 1 105 ? 139.34000 151.82500 149.70800 1.000 53.07000  ? 350 PHE A CB    1 
ATOM   289   C  CG    . PHE A 1 105 ? 140.49200 150.86800 149.66600 1.000 53.07000  ? 350 PHE A CG    1 
ATOM   290   C  CD1   . PHE A 1 105 ? 141.16300 150.62500 148.48400 1.000 53.07000  ? 350 PHE A CD1   1 
ATOM   291   C  CD2   . PHE A 1 105 ? 140.89700 150.20500 150.80800 1.000 53.07000  ? 350 PHE A CD2   1 
ATOM   292   C  CE1   . PHE A 1 105 ? 142.22200 149.74500 148.44400 1.000 53.07000  ? 350 PHE A CE1   1 
ATOM   293   C  CE2   . PHE A 1 105 ? 141.95300 149.32500 150.77500 1.000 53.07000  ? 350 PHE A CE2   1 
ATOM   294   C  CZ    . PHE A 1 105 ? 142.61700 149.09300 149.59200 1.000 53.07000  ? 350 PHE A CZ    1 
ATOM   295   N  N     . GLY A 1 106 ? 138.38500 155.25700 150.26800 1.000 51.03000  ? 351 GLY A N     1 
ATOM   296   C  CA    . GLY A 1 106 ? 137.27200 156.15900 150.09000 1.000 51.03000  ? 351 GLY A CA    1 
ATOM   297   C  C     . GLY A 1 106 ? 136.00200 155.77000 150.81100 1.000 51.03000  ? 351 GLY A C     1 
ATOM   298   O  O     . GLY A 1 106 ? 135.06500 156.57600 150.85500 1.000 51.03000  ? 351 GLY A O     1 
ATOM   299   N  N     . VAL A 1 107 ? 135.93300 154.56800 151.37800 1.000 51.67000  ? 352 VAL A N     1 
ATOM   300   C  CA    . VAL A 1 107 ? 134.70700 154.07400 152.00600 1.000 51.67000  ? 352 VAL A CA    1 
ATOM   301   C  C     . VAL A 1 107 ? 134.76600 154.48000 153.47500 1.000 51.67000  ? 352 VAL A C     1 
ATOM   302   O  O     . VAL A 1 107 ? 135.35400 153.79500 154.31200 1.000 51.67000  ? 352 VAL A O     1 
ATOM   303   C  CB    . VAL A 1 107 ? 134.54300 152.57000 151.83100 1.000 51.67000  ? 352 VAL A CB    1 
ATOM   304   C  CG1   . VAL A 1 107 ? 133.26600 152.10800 152.50300 1.000 51.67000  ? 352 VAL A CG1   1 
ATOM   305   C  CG2   . VAL A 1 107 ? 134.55200 152.20300 150.36300 1.000 51.67000  ? 352 VAL A CG2   1 
ATOM   306   N  N     . GLU A 1 108 ? 134.15000 155.61400 153.79300 1.000 56.29000  ? 353 GLU A N     1 
ATOM   307   C  CA    . GLU A 1 108 ? 134.01600 156.01500 155.18500 1.000 56.29000  ? 353 GLU A CA    1 
ATOM   308   C  C     . GLU A 1 108 ? 133.08400 155.05700 155.91200 1.000 56.29000  ? 353 GLU A C     1 
ATOM   309   O  O     . GLU A 1 108 ? 132.07200 154.61700 155.36100 1.000 56.29000  ? 353 GLU A O     1 
ATOM   310   C  CB    . GLU A 1 108 ? 133.48400 157.44200 155.28100 1.000 56.29000  ? 353 GLU A CB    1 
ATOM   311   C  CG    . GLU A 1 108 ? 133.36200 157.95600 156.70500 1.000 56.29000  ? 353 GLU A CG    1 
ATOM   312   C  CD    . GLU A 1 108 ? 132.87200 159.38600 156.76800 1.000 56.29000  ? 353 GLU A CD    1 
ATOM   313   O  OE1   . GLU A 1 108 ? 132.62800 159.98000 155.69600 1.000 56.29000  ? 353 GLU A OE1   1 
ATOM   314   O  OE2   . GLU A 1 108 ? 132.72300 159.91300 157.89000 1.000 56.29000  ? 353 GLU A OE2   1 
ATOM   315   N  N     . VAL A 1 109 ? 133.42700 154.72900 157.15700 1.000 51.84000  ? 354 VAL A N     1 
ATOM   316   C  CA    . VAL A 1 109 ? 132.67300 153.74400 157.92400 1.000 51.84000  ? 354 VAL A CA    1 
ATOM   317   C  C     . VAL A 1 109 ? 133.03000 153.91200 159.39400 1.000 51.84000  ? 354 VAL A C     1 
ATOM   318   O  O     . VAL A 1 109 ? 134.07400 154.46600 159.73500 1.000 51.84000  ? 354 VAL A O     1 
ATOM   319   C  CB    . VAL A 1 109 ? 132.97400 152.31100 157.41700 1.000 51.84000  ? 354 VAL A CB    1 
ATOM   320   C  CG1   . VAL A 1 109 ? 134.37600 151.88500 157.81100 1.000 51.84000  ? 354 VAL A CG1   1 
ATOM   321   C  CG2   . VAL A 1 109 ? 131.93700 151.34300 157.91200 1.000 51.84000  ? 354 VAL A CG2   1 
ATOM   322   N  N     . SER A 1 110 ? 132.15100 153.43600 160.27400 1.000 49.75000  ? 355 SER A N     1 
ATOM   323   C  CA    . SER A 1 110 ? 132.36300 153.53100 161.71400 1.000 49.75000  ? 355 SER A CA    1 
ATOM   324   C  C     . SER A 1 110 ? 131.91400 152.23400 162.36600 1.000 49.75000  ? 355 SER A C     1 
ATOM   325   O  O     . SER A 1 110 ? 130.73100 151.89000 162.31200 1.000 49.75000  ? 355 SER A O     1 
ATOM   326   C  CB    . SER A 1 110 ? 131.60300 154.72000 162.30600 1.000 49.75000  ? 355 SER A CB    1 
ATOM   327   O  OG    . SER A 1 110 ? 130.20500 154.53300 162.18500 1.000 49.75000  ? 355 SER A OG    1 
ATOM   328   N  N     . VAL A 1 111 ? 132.85600 151.52300 162.98200 1.000 51.91000  ? 356 VAL A N     1 
ATOM   329   C  CA    . VAL A 1 111 ? 132.55500 150.24400 163.61700 1.000 51.91000  ? 356 VAL A CA    1 
ATOM   330   C  C     . VAL A 1 111 ? 131.67000 150.48200 164.83200 1.000 51.91000  ? 356 VAL A C     1 
ATOM   331   O  O     . VAL A 1 111 ? 132.06500 151.17000 165.78000 1.000 51.91000  ? 356 VAL A O     1 
ATOM   332   C  CB    . VAL A 1 111 ? 133.84300 149.51400 164.01200 1.000 51.91000  ? 356 VAL A CB    1 
ATOM   333   C  CG1   . VAL A 1 111 ? 133.51300 148.25600 164.79100 1.000 51.91000  ? 356 VAL A CG1   1 
ATOM   334   C  CG2   . VAL A 1 111 ? 134.66300 149.18700 162.77800 1.000 51.91000  ? 356 VAL A CG2   1 
ATOM   335   N  N     . ASP A 1 112 ? 130.46700 149.90600 164.81500 1.000 58.71000  ? 357 ASP A N     1 
ATOM   336   C  CA    . ASP A 1 112 ? 129.56700 150.04300 165.95600 1.000 58.71000  ? 357 ASP A CA    1 
ATOM   337   C  C     . ASP A 1 112 ? 129.95900 149.10500 167.09100 1.000 58.71000  ? 357 ASP A C     1 
ATOM   338   O  O     . ASP A 1 112 ? 130.27300 149.55200 168.19900 1.000 58.71000  ? 357 ASP A O     1 
ATOM   339   C  CB    . ASP A 1 112 ? 128.12000 149.79000 165.52500 1.000 58.71000  ? 357 ASP A CB    1 
ATOM   340   C  CG    . ASP A 1 112 ? 127.55200 150.92600 164.70000 1.000 58.71000  ? 357 ASP A CG    1 
ATOM   341   O  OD1   . ASP A 1 112 ? 127.99200 152.07900 164.89100 1.000 58.71000  ? 357 ASP A OD1   1 
ATOM   342   O  OD2   . ASP A 1 112 ? 126.65800 150.66900 163.86800 1.000 58.71000  ? 357 ASP A OD2   1 
ATOM   343   N  N     . SER A 1 113 ? 129.94600 147.80000 166.83400 1.000 57.32000  ? 358 SER A N     1 
ATOM   344   C  CA    . SER A 1 113 ? 130.26100 146.81600 167.85600 1.000 57.32000  ? 358 SER A CA    1 
ATOM   345   C  C     . SER A 1 113 ? 131.08800 145.69800 167.24100 1.000 57.32000  ? 358 SER A C     1 
ATOM   346   O  O     . SER A 1 113 ? 131.20300 145.57600 166.01900 1.000 57.32000  ? 358 SER A O     1 
ATOM   347   C  CB    . SER A 1 113 ? 128.99300 146.25000 168.50100 1.000 57.32000  ? 358 SER A CB    1 
ATOM   348   O  OG    . SER A 1 113 ? 128.24300 145.49800 167.56500 1.000 57.32000  ? 358 SER A OG    1 
ATOM   349   N  N     . VAL A 1 114 ? 131.66800 144.87600 168.11100 1.000 55.85000  ? 359 VAL A N     1 
ATOM   350   C  CA    . VAL A 1 114 ? 132.49100 143.74300 167.71100 1.000 55.85000  ? 359 VAL A CA    1 
ATOM   351   C  C     . VAL A 1 114 ? 131.94000 142.50400 168.39700 1.000 55.85000  ? 359 VAL A C     1 
ATOM   352   O  O     . VAL A 1 114 ? 131.90300 142.44200 169.63100 1.000 55.85000  ? 359 VAL A O     1 
ATOM   353   C  CB    . VAL A 1 114 ? 133.96900 143.94800 168.07600 1.000 55.85000  ? 359 VAL A CB    1 
ATOM   354   C  CG1   . VAL A 1 114 ? 134.78300 142.73100 167.68100 1.000 55.85000  ? 359 VAL A CG1   1 
ATOM   355   C  CG2   . VAL A 1 114 ? 134.50700 145.20700 167.42200 1.000 55.85000  ? 359 VAL A CG2   1 
ATOM   356   N  N     . HIS A 1 115 ? 131.51100 141.52300 167.60500 1.000 54.60000  ? 360 HIS A N     1 
ATOM   357   C  CA    . HIS A 1 115 ? 130.96300 140.28000 168.14000 1.000 54.60000  ? 360 HIS A CA    1 
ATOM   358   C  C     . HIS A 1 115 ? 131.90400 139.12400 167.83300 1.000 54.60000  ? 360 HIS A C     1 
ATOM   359   O  O     . HIS A 1 115 ? 131.83800 138.54300 166.73800 1.000 54.60000  ? 360 HIS A O     1 
ATOM   360   C  CB    . HIS A 1 115 ? 129.57200 140.01200 167.56000 1.000 54.60000  ? 360 HIS A CB    1 
ATOM   361   C  CG    . HIS A 1 115 ? 128.54200 141.01100 167.98300 1.000 54.60000  ? 360 HIS A CG    1 
ATOM   362   N  ND1   . HIS A 1 115 ? 127.98000 141.01200 169.24100 1.000 54.60000  ? 360 HIS A ND1   1 
ATOM   363   C  CD2   . HIS A 1 115 ? 127.97500 142.04300 167.31600 1.000 54.60000  ? 360 HIS A CD2   1 
ATOM   364   C  CE1   . HIS A 1 115 ? 127.10900 142.00100 169.33100 1.000 54.60000  ? 360 HIS A CE1   1 
ATOM   365   N  NE2   . HIS A 1 115 ? 127.08700 142.64200 168.17600 1.000 54.60000  ? 360 HIS A NE2   1 
ATOM   366   N  N     . PRO A 1 116 ? 132.79100 138.75400 168.75100 1.000 52.16000  ? 361 PRO A N     1 
ATOM   367   C  CA    . PRO A 1 116 ? 133.68600 137.62300 168.50300 1.000 52.16000  ? 361 PRO A CA    1 
ATOM   368   C  C     . PRO A 1 116 ? 133.02000 136.29700 168.82300 1.000 52.16000  ? 361 PRO A C     1 
ATOM   369   O  O     . PRO A 1 116 ? 132.14900 136.20200 169.68900 1.000 52.16000  ? 361 PRO A O     1 
ATOM   370   C  CB    . PRO A 1 116 ? 134.85600 137.89000 169.45500 1.000 52.16000  ? 361 PRO A CB    1 
ATOM   371   C  CG    . PRO A 1 116 ? 134.22500 138.61600 170.58900 1.000 52.16000  ? 361 PRO A CG    1 
ATOM   372   C  CD    . PRO A 1 116 ? 133.13300 139.46400 169.99400 1.000 52.16000  ? 361 PRO A CD    1 
ATOM   373   N  N     . GLY A 1 117 ? 133.45200 135.26400 168.10700 1.000 52.90000  ? 362 GLY A N     1 
ATOM   374   C  CA    . GLY A 1 117 ? 132.89900 133.94400 168.27400 1.000 52.90000  ? 362 GLY A CA    1 
ATOM   375   C  C     . GLY A 1 117 ? 133.97200 132.89300 168.45800 1.000 52.90000  ? 362 GLY A C     1 
ATOM   376   O  O     . GLY A 1 117 ? 135.13600 133.20100 168.72900 1.000 52.90000  ? 362 GLY A O     1 
ATOM   377   N  N     . PRO A 1 118 ? 133.59800 131.62600 168.31100 1.000 53.08000  ? 363 PRO A N     1 
ATOM   378   C  CA    . PRO A 1 118 ? 134.55800 130.54400 168.55700 1.000 53.08000  ? 363 PRO A CA    1 
ATOM   379   C  C     . PRO A 1 118 ? 135.55700 130.35800 167.42700 1.000 53.08000  ? 363 PRO A C     1 
ATOM   380   O  O     . PRO A 1 118 ? 136.68400 129.91400 167.66400 1.000 53.08000  ? 363 PRO A O     1 
ATOM   381   C  CB    . PRO A 1 118 ? 133.65700 129.31400 168.71200 1.000 53.08000  ? 363 PRO A CB    1 
ATOM   382   C  CG    . PRO A 1 118 ? 132.46600 129.63200 167.89000 1.000 53.08000  ? 363 PRO A CG    1 
ATOM   383   C  CD    . PRO A 1 118 ? 132.24900 131.11400 168.02000 1.000 53.08000  ? 363 PRO A CD    1 
ATOM   384   N  N     . VAL A 1 119 ? 135.16800 130.69100 166.19700 1.000 48.25000  ? 364 VAL A N     1 
ATOM   385   C  CA    . VAL A 1 119 ? 135.99700 130.46100 165.02100 1.000 48.25000  ? 364 VAL A CA    1 
ATOM   386   C  C     . VAL A 1 119 ? 136.26500 131.75400 164.26100 1.000 48.25000  ? 364 VAL A C     1 
ATOM   387   O  O     . VAL A 1 119 ? 137.41100 132.05700 163.91400 1.000 48.25000  ? 364 VAL A O     1 
ATOM   388   C  CB    . VAL A 1 119 ? 135.37200 129.40400 164.08900 1.000 48.25000  ? 364 VAL A CB    1 
ATOM   389   C  CG1   . VAL A 1 119 ? 136.20700 129.25600 162.83700 1.000 48.25000  ? 364 VAL A CG1   1 
ATOM   390   C  CG2   . VAL A 1 119 ? 135.24900 128.07400 164.80800 1.000 48.25000  ? 364 VAL A CG2   1 
ATOM   391   N  N     . ILE A 1 120 ? 135.21700 132.52200 163.97200 1.000 44.48000  ? 365 ILE A N     1 
ATOM   392   C  CA    . ILE A 1 120 ? 135.36400 133.79000 163.27500 1.000 44.48000  ? 365 ILE A CA    1 
ATOM   393   C  C     . ILE A 1 120 ? 134.87800 134.91600 164.17500 1.000 44.48000  ? 365 ILE A C     1 
ATOM   394   O  O     . ILE A 1 120 ? 134.17400 134.70000 165.16500 1.000 44.48000  ? 365 ILE A O     1 
ATOM   395   C  CB    . ILE A 1 120 ? 134.61300 133.81200 161.93300 1.000 44.48000  ? 365 ILE A CB    1 
ATOM   396   C  CG1   . ILE A 1 120 ? 133.11100 133.68300 162.16100 1.000 44.48000  ? 365 ILE A CG1   1 
ATOM   397   C  CG2   . ILE A 1 120 ? 135.10600 132.70000 161.03100 1.000 44.48000  ? 365 ILE A CG2   1 
ATOM   398   C  CD1   . ILE A 1 120 ? 132.31100 133.91100 160.91200 1.000 44.48000  ? 365 ILE A CD1   1 
ATOM   399   N  N     . THR A 1 121 ? 135.26000 136.13500 163.80900 1.000 47.99000  ? 366 THR A N     1 
ATOM   400   C  CA    . THR A 1 121 ? 134.90100 137.34000 164.54300 1.000 47.99000  ? 366 THR A CA    1 
ATOM   401   C  C     . THR A 1 121 ? 134.18500 138.29400 163.60100 1.000 47.99000  ? 366 THR A C     1 
ATOM   402   O  O     . THR A 1 121 ? 134.68600 138.58700 162.51200 1.000 47.99000  ? 366 THR A O     1 
ATOM   403   C  CB    . THR A 1 121 ? 136.13900 138.01400 165.13400 1.000 47.99000  ? 366 THR A CB    1 
ATOM   404   O  OG1   . THR A 1 121 ? 136.79400 137.10700 166.02900 1.000 47.99000  ? 366 THR A OG1   1 
ATOM   405   C  CG2   . THR A 1 121 ? 135.75000 139.27000 165.89200 1.000 47.99000  ? 366 THR A CG2   1 
ATOM   406   N  N     . ARG A 1 122 ? 133.02100 138.77900 164.02100 1.000 50.64000  ? 367 ARG A N     1 
ATOM   407   C  CA    . ARG A 1 122 ? 132.18300 139.63200 163.18800 1.000 50.64000  ? 367 ARG A CA    1 
ATOM   408   C  C     . ARG A 1 122 ? 132.32400 141.08100 163.63400 1.000 50.64000  ? 367 ARG A C     1 
ATOM   409   O  O     . ARG A 1 122 ? 131.89500 141.44400 164.73400 1.000 50.64000  ? 367 ARG A O     1 
ATOM   410   C  CB    . ARG A 1 122 ? 130.72300 139.19100 163.24800 1.000 50.64000  ? 367 ARG A CB    1 
ATOM   411   C  CG    . ARG A 1 122 ? 129.80300 140.07000 162.42400 1.000 50.64000  ? 367 ARG A CG    1 
ATOM   412   C  CD    . ARG A 1 122 ? 128.37800 139.56400 162.43400 1.000 50.64000  ? 367 ARG A CD    1 
ATOM   413   N  NE    . ARG A 1 122 ? 128.24000 138.32800 161.67600 1.000 50.64000  ? 367 ARG A NE    1 
ATOM   414   C  CZ    . ARG A 1 122 ? 127.14000 137.58600 161.65700 1.000 50.64000  ? 367 ARG A CZ    1 
ATOM   415   N  NH1   . ARG A 1 122 ? 126.07800 137.95400 162.36100 1.000 50.64000  ? 367 ARG A NH1   1 
ATOM   416   N  NH2   . ARG A 1 122 ? 127.10000 136.47400 160.93500 1.000 50.64000  ? 367 ARG A NH2   1 
ATOM   417   N  N     . PHE A 1 123 ? 132.92100 141.90600 162.78000 1.000 48.97000  ? 368 PHE A N     1 
ATOM   418   C  CA    . PHE A 1 123 ? 132.92800 143.34900 162.97300 1.000 48.97000  ? 368 PHE A CA    1 
ATOM   419   C  C     . PHE A 1 123 ? 131.70600 143.93200 162.27800 1.000 48.97000  ? 368 PHE A C     1 
ATOM   420   O  O     . PHE A 1 123 ? 131.54100 143.76400 161.06600 1.000 48.97000  ? 368 PHE A O     1 
ATOM   421   C  CB    . PHE A 1 123 ? 134.21000 143.96600 162.41900 1.000 48.97000  ? 368 PHE A CB    1 
ATOM   422   C  CG    . PHE A 1 123 ? 135.43900 143.58500 163.17900 1.000 48.97000  ? 368 PHE A CG    1 
ATOM   423   C  CD1   . PHE A 1 123 ? 135.77200 144.24000 164.34600 1.000 48.97000  ? 368 PHE A CD1   1 
ATOM   424   C  CD2   . PHE A 1 123 ? 136.25700 142.56700 162.73300 1.000 48.97000  ? 368 PHE A CD2   1 
ATOM   425   C  CE1   . PHE A 1 123 ? 136.90000 143.89000 165.05300 1.000 48.97000  ? 368 PHE A CE1   1 
ATOM   426   C  CE2   . PHE A 1 123 ? 137.38700 142.21300 163.43900 1.000 48.97000  ? 368 PHE A CE2   1 
ATOM   427   C  CZ    . PHE A 1 123 ? 137.70800 142.87500 164.59900 1.000 48.97000  ? 368 PHE A CZ    1 
ATOM   428   N  N     . GLU A 1 124 ? 130.85500 144.61300 163.03700 1.000 50.63000  ? 369 GLU A N     1 
ATOM   429   C  CA    . GLU A 1 124 ? 129.63000 145.20100 162.50000 1.000 50.63000  ? 369 GLU A CA    1 
ATOM   430   C  C     . GLU A 1 124 ? 129.90400 146.67100 162.21000 1.000 50.63000  ? 369 GLU A C     1 
ATOM   431   O  O     . GLU A 1 124 ? 129.81300 147.51900 163.10000 1.000 50.63000  ? 369 GLU A O     1 
ATOM   432   C  CB    . GLU A 1 124 ? 128.46500 145.02500 163.46900 1.000 50.63000  ? 369 GLU A CB    1 
ATOM   433   C  CG    . GLU A 1 124 ? 128.01900 143.58400 163.64200 1.000 50.63000  ? 369 GLU A CG    1 
ATOM   434   C  CD    . GLU A 1 124 ? 126.83100 143.44800 164.57300 1.000 50.63000  ? 369 GLU A CD    1 
ATOM   435   O  OE1   . GLU A 1 124 ? 126.42500 144.46200 165.17600 1.000 50.63000  ? 369 GLU A OE1   1 
ATOM   436   O  OE2   . GLU A 1 124 ? 126.30200 142.32400 164.70100 1.000 50.63000  ? 369 GLU A OE2   1 
ATOM   437   N  N     . ILE A 1 125 ? 130.23600 146.96800 160.96300 1.000 44.25000  ? 370 ILE A N     1 
ATOM   438   C  CA    . ILE A 1 125 ? 130.60500 148.31600 160.55400 1.000 44.25000  ? 370 ILE A CA    1 
ATOM   439   C  C     . ILE A 1 125 ? 129.36700 149.04800 160.05700 1.000 44.25000  ? 370 ILE A C     1 
ATOM   440   O  O     . ILE A 1 125 ? 128.49000 148.45800 159.41700 1.000 44.25000  ? 370 ILE A O     1 
ATOM   441   C  CB    . ILE A 1 125 ? 131.70600 148.27900 159.47800 1.000 44.25000  ? 370 ILE A CB    1 
ATOM   442   C  CG1   . ILE A 1 125 ? 131.19100 147.63800 158.19300 1.000 44.25000  ? 370 ILE A CG1   1 
ATOM   443   C  CG2   . ILE A 1 125 ? 132.91200 147.51900 159.98400 1.000 44.25000  ? 370 ILE A CG2   1 
ATOM   444   C  CD1   . ILE A 1 125 ? 132.12900 147.78100 157.02200 1.000 44.25000  ? 370 ILE A CD1   1 
ATOM   445   N  N     . GLN A 1 126 ? 129.28500 150.34000 160.37300 1.000 51.39000  ? 371 GLN A N     1 
ATOM   446   C  CA    . GLN A 1 126 ? 128.18200 151.18800 159.94800 1.000 51.39000  ? 371 GLN A CA    1 
ATOM   447   C  C     . GLN A 1 126 ? 128.65700 152.07200 158.80600 1.000 51.39000  ? 371 GLN A C     1 
ATOM   448   O  O     . GLN A 1 126 ? 129.36200 153.06300 159.05100 1.000 51.39000  ? 371 GLN A O     1 
ATOM   449   C  CB    . GLN A 1 126 ? 127.67900 152.04200 161.11400 1.000 51.39000  ? 371 GLN A CB    1 
ATOM   450   C  CG    . GLN A 1 126 ? 126.47500 152.89400 160.78000 1.000 51.39000  ? 371 GLN A CG    1 
ATOM   451   C  CD    . GLN A 1 126 ? 125.23800 152.06300 160.53900 1.000 51.39000  ? 371 GLN A CD    1 
ATOM   452   O  OE1   . GLN A 1 126 ? 124.97600 151.10100 161.26000 1.000 51.39000  ? 371 GLN A OE1   1 
ATOM   453   N  NE2   . GLN A 1 126 ? 124.46800 152.42700 159.52100 1.000 51.39000  ? 371 GLN A NE2   1 
ATOM   454   N  N     . PRO A 1 127 ? 128.31700 151.76800 157.55500 1.000 51.00000  ? 372 PRO A N     1 
ATOM   455   C  CA    . PRO A 1 127 ? 128.80700 152.58700 156.44300 1.000 51.00000  ? 372 PRO A CA    1 
ATOM   456   C  C     . PRO A 1 127 ? 128.26800 154.00500 156.51300 1.000 51.00000  ? 372 PRO A C     1 
ATOM   457   O  O     . PRO A 1 127 ? 127.15000 154.24900 156.97000 1.000 51.00000  ? 372 PRO A O     1 
ATOM   458   C  CB    . PRO A 1 127 ? 128.28100 151.85500 155.20400 1.000 51.00000  ? 372 PRO A CB    1 
ATOM   459   C  CG    . PRO A 1 127 ? 128.04100 150.46700 155.66000 1.000 51.00000  ? 372 PRO A CG    1 
ATOM   460   C  CD    . PRO A 1 127 ? 127.58000 150.58900 157.08000 1.000 51.00000  ? 372 PRO A CD    1 
ATOM   461   N  N     . ALA A 1 128 ? 129.09100 154.94700 156.06100 1.000 55.23000  ? 373 ALA A N     1 
ATOM   462   C  CA    . ALA A 1 128 ? 128.66200 156.33300 155.97300 1.000 55.23000  ? 373 ALA A CA    1 
ATOM   463   C  C     . ALA A 1 128 ? 127.46300 156.45400 155.04300 1.000 55.23000  ? 373 ALA A C     1 
ATOM   464   O  O     . ALA A 1 128 ? 127.27600 155.65000 154.12600 1.000 55.23000  ? 373 ALA A O     1 
ATOM   465   C  CB    . ALA A 1 128 ? 129.80500 157.21600 155.47600 1.000 55.23000  ? 373 ALA A CB    1 
ATOM   466   N  N     . ALA A 1 129 ? 126.64000 157.46800 155.29500 1.000 59.58000  ? 374 ALA A N     1 
ATOM   467   C  CA    . ALA A 1 129 ? 125.42300 157.65900 154.51800 1.000 59.58000  ? 374 ALA A CA    1 
ATOM   468   C  C     . ALA A 1 129 ? 125.75200 157.85700 153.04500 1.000 59.58000  ? 374 ALA A C     1 
ATOM   469   O  O     . ALA A 1 129 ? 126.41100 158.83200 152.67000 1.000 59.58000  ? 374 ALA A O     1 
ATOM   470   C  CB    . ALA A 1 129 ? 124.64300 158.85600 155.05800 1.000 59.58000  ? 374 ALA A CB    1 
ATOM   471   N  N     . GLY A 1 130 ? 125.29400 156.93100 152.21300 1.000 56.23000  ? 375 GLY A N     1 
ATOM   472   C  CA    . GLY A 1 130 ? 125.48000 157.01900 150.78600 1.000 56.23000  ? 375 GLY A CA    1 
ATOM   473   C  C     . GLY A 1 130 ? 126.56400 156.14100 150.20700 1.000 56.23000  ? 375 GLY A C     1 
ATOM   474   O  O     . GLY A 1 130 ? 127.13200 156.49700 149.16900 1.000 56.23000  ? 375 GLY A O     1 
ATOM   475   N  N     . VAL A 1 131 ? 126.87000 155.00900 150.83500 1.000 55.26000  ? 376 VAL A N     1 
ATOM   476   C  CA    . VAL A 1 131 ? 127.92500 154.11200 150.37800 1.000 55.26000  ? 376 VAL A CA    1 
ATOM   477   C  C     . VAL A 1 131 ? 127.31400 152.74500 150.11600 1.000 55.26000  ? 376 VAL A C     1 
ATOM   478   O  O     . VAL A 1 131 ? 126.71600 152.14300 151.01700 1.000 55.26000  ? 376 VAL A O     1 
ATOM   479   C  CB    . VAL A 1 131 ? 129.06900 154.00900 151.39700 1.000 55.26000  ? 376 VAL A CB    1 
ATOM   480   C  CG1   . VAL A 1 131 ? 130.08300 152.98400 150.93600 1.000 55.26000  ? 376 VAL A CG1   1 
ATOM   481   C  CG2   . VAL A 1 131 ? 129.72600 155.36300 151.59300 1.000 55.26000  ? 376 VAL A CG2   1 
ATOM   482   N  N     . LYS A 1 132 ? 127.46000 152.25900 148.88700 1.000 55.86000  ? 377 LYS A N     1 
ATOM   483   C  CA    . LYS A 1 132 ? 127.00400 150.91900 148.55300 1.000 55.86000  ? 377 LYS A CA    1 
ATOM   484   C  C     . LYS A 1 132 ? 127.86400 149.87400 149.25100 1.000 55.86000  ? 377 LYS A C     1 
ATOM   485   O  O     . LYS A 1 132 ? 129.03000 150.11000 149.57400 1.000 55.86000  ? 377 LYS A O     1 
ATOM   486   C  CB    . LYS A 1 132 ? 127.05400 150.69300 147.04300 1.000 55.86000  ? 377 LYS A CB    1 
ATOM   487   C  CG    . LYS A 1 132 ? 126.07300 151.52100 146.23600 1.000 55.86000  ? 377 LYS A CG    1 
ATOM   488   C  CD    . LYS A 1 132 ? 126.19100 151.18800 144.75700 1.000 55.86000  ? 377 LYS A CD    1 
ATOM   489   C  CE    . LYS A 1 132 ? 125.25000 152.03000 143.91200 1.000 55.86000  ? 377 LYS A CE    1 
ATOM   490   N  NZ    . LYS A 1 132 ? 125.36400 151.70600 142.46200 1.000 55.86000  ? 377 LYS A NZ    1 
ATOM   491   N  N     . VAL A 1 133 ? 127.27400 148.69900 149.48500 1.000 50.24000  ? 378 VAL A N     1 
ATOM   492   C  CA    . VAL A 1 133 ? 128.04600 147.58100 150.02200 1.000 50.24000  ? 378 VAL A CA    1 
ATOM   493   C  C     . VAL A 1 133 ? 128.83500 146.85800 148.94700 1.000 50.24000  ? 378 VAL A C     1 
ATOM   494   O  O     . VAL A 1 133 ? 129.64900 145.98300 149.27200 1.000 50.24000  ? 378 VAL A O     1 
ATOM   495   C  CB    . VAL A 1 133 ? 127.14100 146.56400 150.74000 1.000 50.24000  ? 378 VAL A CB    1 
ATOM   496   C  CG1   . VAL A 1 133 ? 126.44800 147.21900 151.91600 1.000 50.24000  ? 378 VAL A CG1   1 
ATOM   497   C  CG2   . VAL A 1 133 ? 126.12900 145.98700 149.77200 1.000 50.24000  ? 378 VAL A CG2   1 
ATOM   498   N  N     . SER A 1 134 ? 128.61800 147.19700 147.67600 1.000 50.55000  ? 379 SER A N     1 
ATOM   499   C  CA    . SER A 1 134 ? 129.37400 146.55900 146.60600 1.000 50.55000  ? 379 SER A CA    1 
ATOM   500   C  C     . SER A 1 134 ? 130.84800 146.92500 146.68700 1.000 50.55000  ? 379 SER A C     1 
ATOM   501   O  O     . SER A 1 134 ? 131.71300 146.09800 146.38100 1.000 50.55000  ? 379 SER A O     1 
ATOM   502   C  CB    . SER A 1 134 ? 128.80000 146.95500 145.24900 1.000 50.55000  ? 379 SER A CB    1 
ATOM   503   O  OG    . SER A 1 134 ? 129.00200 148.33500 145.00800 1.000 50.55000  ? 379 SER A OG    1 
ATOM   504   N  N     . ARG A 1 135 ? 131.15200 148.15900 147.09400 1.000 50.97000  ? 380 ARG A N     1 
ATOM   505   C  CA    . ARG A 1 135 ? 132.53800 148.55500 147.31300 1.000 50.97000  ? 380 ARG A CA    1 
ATOM   506   C  C     . ARG A 1 135 ? 133.23300 147.59200 148.26700 1.000 50.97000  ? 380 ARG A C     1 
ATOM   507   O  O     . ARG A 1 135 ? 134.28200 147.02200 147.94600 1.000 50.97000  ? 380 ARG A O     1 
ATOM   508   C  CB    . ARG A 1 135 ? 132.59700 149.98200 147.86200 1.000 50.97000  ? 380 ARG A CB    1 
ATOM   509   C  CG    . ARG A 1 135 ? 132.19600 151.07400 146.88600 1.000 50.97000  ? 380 ARG A CG    1 
ATOM   510   C  CD    . ARG A 1 135 ? 132.29700 152.42900 147.56800 1.000 50.97000  ? 380 ARG A CD    1 
ATOM   511   N  NE    . ARG A 1 135 ? 131.93700 153.54300 146.69900 1.000 50.97000  ? 380 ARG A NE    1 
ATOM   512   C  CZ    . ARG A 1 135 ? 131.90000 154.80900 147.09800 1.000 50.97000  ? 380 ARG A CZ    1 
ATOM   513   N  NH1   . ARG A 1 135 ? 132.19800 155.11600 148.35200 1.000 50.97000  ? 380 ARG A NH1   1 
ATOM   514   N  NH2   . ARG A 1 135 ? 131.56400 155.76800 146.24800 1.000 50.97000  ? 380 ARG A NH2   1 
ATOM   515   N  N     . ILE A 1 136 ? 132.65400 147.41200 149.45600 1.000 49.28000  ? 381 ILE A N     1 
ATOM   516   C  CA    . ILE A 1 136 ? 133.23900 146.52000 150.45200 1.000 49.28000  ? 381 ILE A CA    1 
ATOM   517   C  C     . ILE A 1 136 ? 133.31100 145.09600 149.91900 1.000 49.28000  ? 381 ILE A C     1 
ATOM   518   O  O     . ILE A 1 136 ? 134.32500 144.40700 150.08200 1.000 49.28000  ? 381 ILE A O     1 
ATOM   519   C  CB    . ILE A 1 136 ? 132.44100 146.58900 151.76500 1.000 49.28000  ? 381 ILE A CB    1 
ATOM   520   C  CG1   . ILE A 1 136 ? 132.36200 148.02600 152.26100 1.000 49.28000  ? 381 ILE A CG1   1 
ATOM   521   C  CG2   . ILE A 1 136 ? 133.11500 145.75100 152.82600 1.000 49.28000  ? 381 ILE A CG2   1 
ATOM   522   C  CD1   . ILE A 1 136 ? 133.70600 148.60500 152.58900 1.000 49.28000  ? 381 ILE A CD1   1 
ATOM   523   N  N     . SER A 1 137 ? 132.23600 144.62800 149.28400 1.000 46.84000  ? 382 SER A N     1 
ATOM   524   C  CA    . SER A 1 137 ? 132.21200 143.24800 148.81100 1.000 46.84000  ? 382 SER A CA    1 
ATOM   525   C  C     . SER A 1 137 ? 133.27200 142.99600 147.74700 1.000 46.84000  ? 382 SER A C     1 
ATOM   526   O  O     . SER A 1 137 ? 133.76400 141.87000 147.62000 1.000 46.84000  ? 382 SER A O     1 
ATOM   527   C  CB    . SER A 1 137 ? 130.82500 142.90000 148.27300 1.000 46.84000  ? 382 SER A CB    1 
ATOM   528   O  OG    . SER A 1 137 ? 129.85400 142.94600 149.30200 1.000 46.84000  ? 382 SER A OG    1 
ATOM   529   N  N     . ASN A 1 138 ? 133.63900 144.02100 146.97800 1.000 49.28000  ? 383 ASN A N     1 
ATOM   530   C  CA    . ASN A 1 138 ? 134.64300 143.84800 145.93500 1.000 49.28000  ? 383 ASN A CA    1 
ATOM   531   C  C     . ASN A 1 138 ? 136.06700 144.08500 146.41600 1.000 49.28000  ? 383 ASN A C     1 
ATOM   532   O  O     . ASN A 1 138 ? 136.99900 143.49900 145.85500 1.000 49.28000  ? 383 ASN A O     1 
ATOM   533   C  CB    . ASN A 1 138 ? 134.34600 144.76900 144.74800 1.000 49.28000  ? 383 ASN A CB    1 
ATOM   534   C  CG    . ASN A 1 138 ? 133.11600 144.33800 143.97000 1.000 49.28000  ? 383 ASN A CG    1 
ATOM   535   O  OD1   . ASN A 1 138 ? 132.12200 145.05800 143.90200 1.000 49.28000  ? 383 ASN A OD1   1 
ATOM   536   N  ND2   . ASN A 1 138 ? 133.18200 143.15300 143.37800 1.000 49.28000  ? 383 ASN A ND2   1 
ATOM   537   N  N     . LEU A 1 139 ? 136.27300 144.92600 147.43300 1.000 48.80000  ? 384 LEU A N     1 
ATOM   538   C  CA    . LEU A 1 139 ? 137.61600 145.14700 147.95900 1.000 48.80000  ? 384 LEU A CA    1 
ATOM   539   C  C     . LEU A 1 139 ? 137.84700 144.42300 149.28200 1.000 48.80000  ? 384 LEU A C     1 
ATOM   540   O  O     . LEU A 1 139 ? 138.77000 144.77300 150.02300 1.000 48.80000  ? 384 LEU A O     1 
ATOM   541   C  CB    . LEU A 1 139 ? 137.91200 146.64400 148.09400 1.000 48.80000  ? 384 LEU A CB    1 
ATOM   542   C  CG    . LEU A 1 139 ? 137.10000 147.58200 148.99000 1.000 48.80000  ? 384 LEU A CG    1 
ATOM   543   C  CD1   . LEU A 1 139 ? 137.60100 147.60900 150.42400 1.000 48.80000  ? 384 LEU A CD1   1 
ATOM   544   C  CD2   . LEU A 1 139 ? 137.09600 148.98600 148.40400 1.000 48.80000  ? 384 LEU A CD2   1 
ATOM   545   N  N     . ALA A 1 140 ? 137.01200 143.42900 149.59500 1.000 48.43000  ? 385 ALA A N     1 
ATOM   546   C  CA    . ALA A 1 140 ? 137.26500 142.58300 150.75600 1.000 48.43000  ? 385 ALA A CA    1 
ATOM   547   C  C     . ALA A 1 140 ? 138.63700 141.92400 150.70500 1.000 48.43000  ? 385 ALA A C     1 
ATOM   548   O  O     . ALA A 1 140 ? 139.23900 141.68200 151.75200 1.000 48.43000  ? 385 ALA A O     1 
ATOM   549   C  CB    . ALA A 1 140 ? 136.17800 141.51600 150.87200 1.000 48.43000  ? 385 ALA A CB    1 
ATOM   550   N  N     . LYS A 1 141 ? 139.15500 141.63500 149.51200 1.000 47.93000  ? 386 LYS A N     1 
ATOM   551   C  CA    . LYS A 1 141 ? 140.47300 141.01300 149.42200 1.000 47.93000  ? 386 LYS A CA    1 
ATOM   552   C  C     . LYS A 1 141 ? 141.56500 141.97300 149.88500 1.000 47.93000  ? 386 LYS A C     1 
ATOM   553   O  O     . LYS A 1 141 ? 142.44800 141.60300 150.67200 1.000 47.93000  ? 386 LYS A O     1 
ATOM   554   C  CB    . LYS A 1 141 ? 140.72800 140.54700 147.99000 1.000 47.93000  ? 386 LYS A CB    1 
ATOM   555   C  CG    . LYS A 1 141 ? 142.02100 139.78200 147.80600 1.000 47.93000  ? 386 LYS A CG    1 
ATOM   556   C  CD    . LYS A 1 141 ? 141.98400 138.46900 148.56400 1.000 47.93000  ? 386 LYS A CD    1 
ATOM   557   C  CE    . LYS A 1 141 ? 140.99900 137.50000 147.92900 1.000 47.93000  ? 386 LYS A CE    1 
ATOM   558   N  NZ    . LYS A 1 141 ? 140.99100 136.17800 148.61400 1.000 47.93000  ? 386 LYS A NZ    1 
ATOM   559   N  N     . ASP A 1 142 ? 141.51400 143.22000 149.41400 1.000 51.62000  ? 387 ASP A N     1 
ATOM   560   C  CA    . ASP A 1 142 ? 142.48600 144.21600 149.85000 1.000 51.62000  ? 387 ASP A CA    1 
ATOM   561   C  C     . ASP A 1 142 ? 142.29500 144.57600 151.31300 1.000 51.62000  ? 387 ASP A C     1 
ATOM   562   O  O     . ASP A 1 142 ? 143.26600 144.91000 152.00000 1.000 51.62000  ? 387 ASP A O     1 
ATOM   563   C  CB    . ASP A 1 142 ? 142.37300 145.46200 148.98100 1.000 51.62000  ? 387 ASP A CB    1 
ATOM   564   C  CG    . ASP A 1 142 ? 142.81100 145.21200 147.56300 1.000 51.62000  ? 387 ASP A CG    1 
ATOM   565   O  OD1   . ASP A 1 142 ? 143.72300 144.38600 147.36400 1.000 51.62000  ? 387 ASP A OD1   1 
ATOM   566   O  OD2   . ASP A 1 142 ? 142.22700 145.82100 146.64700 1.000 51.62000  ? 387 ASP A OD2   1 
ATOM   567   N  N     . LEU A 1 143 ? 141.05800 144.52400 151.80400 1.000 47.67000  ? 388 LEU A N     1 
ATOM   568   C  CA    . LEU A 1 143 ? 140.82700 144.73600 153.22700 1.000 47.67000  ? 388 LEU A CA    1 
ATOM   569   C  C     . LEU A 1 143 ? 141.41300 143.59900 154.05100 1.000 47.67000  ? 388 LEU A C     1 
ATOM   570   O  O     . LEU A 1 143 ? 141.91300 143.81800 155.16000 1.000 47.67000  ? 388 LEU A O     1 
ATOM   571   C  CB    . LEU A 1 143 ? 139.33200 144.87900 153.49300 1.000 47.67000  ? 388 LEU A CB    1 
ATOM   572   C  CG    . LEU A 1 143 ? 138.96800 145.17500 154.94000 1.000 47.67000  ? 388 LEU A CG    1 
ATOM   573   C  CD1   . LEU A 1 143 ? 139.59000 146.49000 155.34800 1.000 47.67000  ? 388 LEU A CD1   1 
ATOM   574   C  CD2   . LEU A 1 143 ? 137.46200 145.21200 155.09500 1.000 47.67000  ? 388 LEU A CD2   1 
ATOM   575   N  N     . ALA A 1 144 ? 141.35700 142.37500 153.52400 1.000 46.77000  ? 389 ALA A N     1 
ATOM   576   C  CA    . ALA A 1 144 ? 141.98700 141.24300 154.19000 1.000 46.77000  ? 389 ALA A CA    1 
ATOM   577   C  C     . ALA A 1 144 ? 143.49600 141.40200 154.22400 1.000 46.77000  ? 389 ALA A C     1 
ATOM   578   O  O     . ALA A 1 144 ? 144.13600 141.09700 155.23600 1.000 46.77000  ? 389 ALA A O     1 
ATOM   579   C  CB    . ALA A 1 144 ? 141.60800 139.94400 153.48300 1.000 46.77000  ? 389 ALA A CB    1 
ATOM   580   N  N     . ARG A 1 145 ? 144.08200 141.87400 153.12700 1.000 48.77000  ? 390 ARG A N     1 
ATOM   581   C  CA    . ARG A 1 145 ? 145.52400 142.07200 153.09400 1.000 48.77000  ? 390 ARG A CA    1 
ATOM   582   C  C     . ARG A 1 145 ? 145.98500 143.24300 153.94900 1.000 48.77000  ? 390 ARG A C     1 
ATOM   583   O  O     . ARG A 1 145 ? 147.09500 143.19500 154.48900 1.000 48.77000  ? 390 ARG A O     1 
ATOM   584   C  CB    . ARG A 1 145 ? 146.01300 142.29500 151.66500 1.000 48.77000  ? 390 ARG A CB    1 
ATOM   585   C  CG    . ARG A 1 145 ? 147.52500 142.27100 151.54600 1.000 48.77000  ? 390 ARG A CG    1 
ATOM   586   C  CD    . ARG A 1 145 ? 147.95000 142.56400 150.13700 1.000 48.77000  ? 390 ARG A CD    1 
ATOM   587   N  NE    . ARG A 1 145 ? 147.66500 143.95100 149.79100 1.000 48.77000  ? 390 ARG A NE    1 
ATOM   588   C  CZ    . ARG A 1 145 ? 146.70300 144.32400 148.95900 1.000 48.77000  ? 390 ARG A CZ    1 
ATOM   589   N  NH1   . ARG A 1 145 ? 145.92100 143.41000 148.40200 1.000 48.77000  ? 390 ARG A NH1   1 
ATOM   590   N  NH2   . ARG A 1 145 ? 146.50900 145.60800 148.69800 1.000 48.77000  ? 390 ARG A NH2   1 
ATOM   591   N  N     . SER A 1 146 ? 145.17400 144.29600 154.07700 1.000 49.05000  ? 391 SER A N     1 
ATOM   592   C  CA    . SER A 1 146 ? 145.56700 145.42000 154.92000 1.000 49.05000  ? 391 SER A CA    1 
ATOM   593   C  C     . SER A 1 146 ? 145.64200 144.99900 156.38000 1.000 49.05000  ? 391 SER A C     1 
ATOM   594   O  O     . SER A 1 146 ? 146.57000 145.38700 157.09800 1.000 49.05000  ? 391 SER A O     1 
ATOM   595   C  CB    . SER A 1 146 ? 144.59100 146.57800 154.74300 1.000 49.05000  ? 391 SER A CB    1 
ATOM   596   O  OG    . SER A 1 146 ? 143.31400 146.23700 155.24700 1.000 49.05000  ? 391 SER A OG    1 
ATOM   597   N  N     . LEU A 1 147 ? 144.67200 144.21500 156.83700 1.000 47.22000  ? 392 LEU A N     1 
ATOM   598   C  CA    . LEU A 1 147 ? 144.81900 143.50600 158.09300 1.000 47.22000  ? 392 LEU A CA    1 
ATOM   599   C  C     . LEU A 1 147 ? 145.81300 142.35800 157.92000 1.000 47.22000  ? 392 LEU A C     1 
ATOM   600   O  O     . LEU A 1 147 ? 146.18100 141.98100 156.80500 1.000 47.22000  ? 392 LEU A O     1 
ATOM   601   C  CB    . LEU A 1 147 ? 143.46700 142.97900 158.56800 1.000 47.22000  ? 392 LEU A CB    1 
ATOM   602   C  CG    . LEU A 1 147 ? 142.41700 144.03600 158.90400 1.000 47.22000  ? 392 LEU A CG    1 
ATOM   603   C  CD1   . LEU A 1 147 ? 141.07600 143.39200 159.20500 1.000 47.22000  ? 392 LEU A CD1   1 
ATOM   604   C  CD2   . LEU A 1 147 ? 142.87900 144.86600 160.07700 1.000 47.22000  ? 392 LEU A CD2   1 
ATOM   605   N  N     . ALA A 1 148 ? 146.25500 141.79700 159.03900 1.000 49.83000  ? 393 ALA A N     1 
ATOM   606   C  CA    . ALA A 1 148 ? 147.13900 140.64100 159.00700 1.000 49.83000  ? 393 ALA A CA    1 
ATOM   607   C  C     . ALA A 1 148 ? 146.38400 139.33500 158.80300 1.000 49.83000  ? 393 ALA A C     1 
ATOM   608   O  O     . ALA A 1 148 ? 146.98800 138.26200 158.88800 1.000 49.83000  ? 393 ALA A O     1 
ATOM   609   C  CB    . ALA A 1 148 ? 147.96500 140.57000 160.29400 1.000 49.83000  ? 393 ALA A CB    1 
ATOM   610   N  N     . VAL A 1 149 ? 145.08500 139.40400 158.52800 1.000 48.66000  ? 394 VAL A N     1 
ATOM   611   C  CA    . VAL A 1 149 ? 144.25800 138.20900 158.46000 1.000 48.66000  ? 394 VAL A CA    1 
ATOM   612   C  C     . VAL A 1 149 ? 144.48000 137.50400 157.12400 1.000 48.66000  ? 394 VAL A C     1 
ATOM   613   O  O     . VAL A 1 149 ? 145.00000 138.07800 156.16500 1.000 48.66000  ? 394 VAL A O     1 
ATOM   614   C  CB    . VAL A 1 149 ? 142.78200 138.58900 158.67600 1.000 48.66000  ? 394 VAL A CB    1 
ATOM   615   C  CG1   . VAL A 1 149 ? 141.88200 137.36300 158.77100 1.000 48.66000  ? 394 VAL A CG1   1 
ATOM   616   C  CG2   . VAL A 1 149 ? 142.65400 139.45300 159.91400 1.000 48.66000  ? 394 VAL A CG2   1 
ATOM   617   N  N     . ILE A 1 150 ? 144.08800 136.23000 157.06500 1.000 46.66000  ? 395 ILE A N     1 
ATOM   618   C  CA    . ILE A 1 150 ? 144.28500 135.44800 155.84900 1.000 46.66000  ? 395 ILE A CA    1 
ATOM   619   C  C     . ILE A 1 150 ? 143.15500 135.68600 154.85000 1.000 46.66000  ? 395 ILE A C     1 
ATOM   620   O  O     . ILE A 1 150 ? 143.38500 135.69900 153.63600 1.000 46.66000  ? 395 ILE A O     1 
ATOM   621   C  CB    . ILE A 1 150 ? 144.44200 133.95500 156.19800 1.000 46.66000  ? 395 ILE A CB    1 
ATOM   622   C  CG1   . ILE A 1 150 ? 144.83400 133.15100 154.95600 1.000 46.66000  ? 395 ILE A CG1   1 
ATOM   623   C  CG2   . ILE A 1 150 ? 143.17700 133.40100 156.84000 1.000 46.66000  ? 395 ILE A CG2   1 
ATOM   624   C  CD1   . ILE A 1 150 ? 145.31400 131.74900 155.26000 1.000 46.66000  ? 395 ILE A CD1   1 
ATOM   625   N  N     . SER A 1 151 ? 141.92800 135.88600 155.32900 1.000 45.90000  ? 396 SER A N     1 
ATOM   626   C  CA    . SER A 1 151 ? 140.78900 136.07900 154.44200 1.000 45.90000  ? 396 SER A CA    1 
ATOM   627   C  C     . SER A 1 151 ? 139.71200 136.86800 155.17200 1.000 45.90000  ? 396 SER A C     1 
ATOM   628   O  O     . SER A 1 151 ? 139.71100 136.96700 156.39900 1.000 45.90000  ? 396 SER A O     1 
ATOM   629   C  CB    . SER A 1 151 ? 140.23100 134.74200 153.94700 1.000 45.90000  ? 396 SER A CB    1 
ATOM   630   O  OG    . SER A 1 151 ? 139.67200 134.00200 155.01700 1.000 45.90000  ? 396 SER A OG    1 
ATOM   631   N  N     . VAL A 1 152 ? 138.78700 137.43200 154.39600 1.000 47.10000  ? 397 VAL A N     1 
ATOM   632   C  CA    . VAL A 1 152 ? 137.68900 138.23400 154.92700 1.000 47.10000  ? 397 VAL A CA    1 
ATOM   633   C  C     . VAL A 1 152 ? 136.43900 137.97200 154.10100 1.000 47.10000  ? 397 VAL A C     1 
ATOM   634   O  O     . VAL A 1 152 ? 136.47700 138.04000 152.86900 1.000 47.10000  ? 397 VAL A O     1 
ATOM   635   C  CB    . VAL A 1 152 ? 138.00900 139.74200 154.91900 1.000 47.10000  ? 397 VAL A CB    1 
ATOM   636   C  CG1   . VAL A 1 152 ? 136.76700 140.54000 155.24000 1.000 47.10000  ? 397 VAL A CG1   1 
ATOM   637   C  CG2   . VAL A 1 152 ? 139.08400 140.06200 155.92200 1.000 47.10000  ? 397 VAL A CG2   1 
ATOM   638   N  N     . ARG A 1 153 ? 135.33500 137.67600 154.77900 1.000 48.71000  ? 398 ARG A N     1 
ATOM   639   C  CA    . ARG A 1 153 ? 134.01300 137.66700 154.17400 1.000 48.71000  ? 398 ARG A CA    1 
ATOM   640   C  C     . ARG A 1 153 ? 133.25100 138.89500 154.64600 1.000 48.71000  ? 398 ARG A C     1 
ATOM   641   O  O     . ARG A 1 153 ? 133.45400 139.36400 155.76900 1.000 48.71000  ? 398 ARG A O     1 
ATOM   642   C  CB    . ARG A 1 153 ? 133.23800 136.39800 154.53700 1.000 48.71000  ? 398 ARG A CB    1 
ATOM   643   C  CG    . ARG A 1 153 ? 131.87100 136.31900 153.88100 1.000 48.71000  ? 398 ARG A CG    1 
ATOM   644   C  CD    . ARG A 1 153 ? 131.14500 135.03100 154.19900 1.000 48.71000  ? 398 ARG A CD    1 
ATOM   645   N  NE    . ARG A 1 153 ? 129.81000 135.02700 153.61000 1.000 48.71000  ? 398 ARG A NE    1 
ATOM   646   C  CZ    . ARG A 1 153 ? 129.55200 134.66300 152.35900 1.000 48.71000  ? 398 ARG A CZ    1 
ATOM   647   N  NH1   . ARG A 1 153 ? 130.54000 134.27600 151.56500 1.000 48.71000  ? 398 ARG A NH1   1 
ATOM   648   N  NH2   . ARG A 1 153 ? 128.30900 134.69000 151.89900 1.000 48.71000  ? 398 ARG A NH2   1 
ATOM   649   N  N     . VAL A 1 154 ? 132.38000 139.41700 153.79200 1.000 44.69000  ? 399 VAL A N     1 
ATOM   650   C  CA    . VAL A 1 154 ? 131.61800 140.62200 154.08700 1.000 44.69000  ? 399 VAL A CA    1 
ATOM   651   C  C     . VAL A 1 154 ? 130.14400 140.24200 154.11000 1.000 44.69000  ? 399 VAL A C     1 
ATOM   652   O  O     . VAL A 1 154 ? 129.49200 140.17400 153.06200 1.000 44.69000  ? 399 VAL A O     1 
ATOM   653   C  CB    . VAL A 1 154 ? 131.89000 141.73400 153.07200 1.000 44.69000  ? 399 VAL A CB    1 
ATOM   654   C  CG1   . VAL A 1 154 ? 131.01000 142.93200 153.36600 1.000 44.69000  ? 399 VAL A CG1   1 
ATOM   655   C  CG2   . VAL A 1 154 ? 133.35200 142.12000 153.10300 1.000 44.69000  ? 399 VAL A CG2   1 
ATOM   656   N  N     . VAL A 1 155 ? 129.61400 139.98000 155.30200 1.000 45.19000  ? 400 VAL A N     1 
ATOM   657   C  CA    . VAL A 1 155 ? 128.17400 139.82900 155.46800 1.000 45.19000  ? 400 VAL A CA    1 
ATOM   658   C  C     . VAL A 1 155 ? 127.53400 141.15900 155.11300 1.000 45.19000  ? 400 VAL A C     1 
ATOM   659   O  O     . VAL A 1 155 ? 127.76400 142.16900 155.78400 1.000 45.19000  ? 400 VAL A O     1 
ATOM   660   C  CB    . VAL A 1 155 ? 127.80200 139.39400 156.89600 1.000 45.19000  ? 400 VAL A CB    1 
ATOM   661   C  CG1   . VAL A 1 155 ? 126.29500 139.39200 157.06600 1.000 45.19000  ? 400 VAL A CG1   1 
ATOM   662   C  CG2   . VAL A 1 155 ? 128.36700 138.02400 157.18500 1.000 45.19000  ? 400 VAL A CG2   1 
ATOM   663   N  N     . GLU A 1 156 ? 126.72500 141.16800 154.06100 1.000 45.88000  ? 401 GLU A N     1 
ATOM   664   C  CA    . GLU A 1 156 ? 126.20600 142.40700 153.50300 1.000 45.88000  ? 401 GLU A CA    1 
ATOM   665   C  C     . GLU A 1 156 ? 124.80900 142.75600 153.99200 1.000 45.88000  ? 401 GLU A C     1 
ATOM   666   O  O     . GLU A 1 156 ? 124.37200 143.89400 153.79500 1.000 45.88000  ? 401 GLU A O     1 
ATOM   667   C  CB    . GLU A 1 156 ? 126.23000 142.31800 151.97500 1.000 45.88000  ? 401 GLU A CB    1 
ATOM   668   C  CG    . GLU A 1 156 ? 125.44200 141.14700 151.42200 1.000 45.88000  ? 401 GLU A CG    1 
ATOM   669   C  CD    . GLU A 1 156 ? 125.64000 140.97000 149.93100 1.000 45.88000  ? 401 GLU A CD    1 
ATOM   670   O  OE1   . GLU A 1 156 ? 126.40300 141.75700 149.33300 1.000 45.88000  ? 401 GLU A OE1   1 
ATOM   671   O  OE2   . GLU A 1 156 ? 125.03800 140.03800 149.36000 1.000 45.88000  ? 401 GLU A OE2   1 
ATOM   672   N  N     . VAL A 1 157 ? 124.10500 141.82200 154.62600 1.000 47.97000  ? 402 VAL A N     1 
ATOM   673   C  CA    . VAL A 1 157 ? 122.81200 142.08900 155.24800 1.000 47.97000  ? 402 VAL A CA    1 
ATOM   674   C  C     . VAL A 1 157 ? 122.75500 141.28600 156.54000 1.000 47.97000  ? 402 VAL A C     1 
ATOM   675   O  O     . VAL A 1 157 ? 122.66000 140.05400 156.50100 1.000 47.97000  ? 402 VAL A O     1 
ATOM   676   C  CB    . VAL A 1 157 ? 121.62400 141.72200 154.34500 1.000 47.97000  ? 402 VAL A CB    1 
ATOM   677   C  CG1   . VAL A 1 157 ? 120.32000 141.88500 155.10700 1.000 47.97000  ? 402 VAL A CG1   1 
ATOM   678   C  CG2   . VAL A 1 157 ? 121.60700 142.57400 153.08700 1.000 47.97000  ? 402 VAL A CG2   1 
ATOM   679   N  N     . ILE A 1 158 ? 122.81300 141.96900 157.67700 1.000 50.46000  ? 403 ILE A N     1 
ATOM   680   C  CA    . ILE A 1 158 ? 122.60300 141.34100 158.97800 1.000 50.46000  ? 403 ILE A CA    1 
ATOM   681   C  C     . ILE A 1 158 ? 121.11300 141.41600 159.29500 1.000 50.46000  ? 403 ILE A C     1 
ATOM   682   O  O     . ILE A 1 158 ? 120.56900 142.52800 159.38200 1.000 50.46000  ? 403 ILE A O     1 
ATOM   683   C  CB    . ILE A 1 158 ? 123.43200 142.01000 160.07800 1.000 50.46000  ? 403 ILE A CB    1 
ATOM   684   C  CG1   . ILE A 1 158 ? 124.92000 141.76300 159.84500 1.000 50.46000  ? 403 ILE A CG1   1 
ATOM   685   C  CG2   . ILE A 1 158 ? 123.01900 141.48900 161.44100 1.000 50.46000  ? 403 ILE A CG2   1 
ATOM   686   C  CD1   . ILE A 1 158 ? 125.80900 142.54500 160.77100 1.000 50.46000  ? 403 ILE A CD1   1 
ATOM   687   N  N     . PRO A 1 159 ? 120.42800 140.28700 159.46600 1.000 52.85000  ? 404 PRO A N     1 
ATOM   688   C  CA    . PRO A 1 159 ? 118.97800 140.32500 159.70500 1.000 52.85000  ? 404 PRO A CA    1 
ATOM   689   C  C     . PRO A 1 159 ? 118.64800 141.01200 161.01900 1.000 52.85000  ? 404 PRO A C     1 
ATOM   690   O  O     . PRO A 1 159 ? 119.05900 140.56800 162.09300 1.000 52.85000  ? 404 PRO A O     1 
ATOM   691   C  CB    . PRO A 1 159 ? 118.59000 138.84300 159.72700 1.000 52.85000  ? 404 PRO A CB    1 
ATOM   692   C  CG    . PRO A 1 159 ? 119.67800 138.15100 158.97400 1.000 52.85000  ? 404 PRO A CG    1 
ATOM   693   C  CD    . PRO A 1 159 ? 120.92500 138.91300 159.29700 1.000 52.85000  ? 404 PRO A CD    1 
ATOM   694   N  N     . GLY A 1 160 ? 117.89500 142.10600 160.92600 1.000 54.90000  ? 405 GLY A N     1 
ATOM   695   C  CA    . GLY A 1 160 ? 117.42700 142.82400 162.09200 1.000 54.90000  ? 405 GLY A CA    1 
ATOM   696   C  C     . GLY A 1 160 ? 118.25800 144.02000 162.49900 1.000 54.90000  ? 405 GLY A C     1 
ATOM   697   O  O     . GLY A 1 160 ? 117.93900 144.65400 163.51100 1.000 54.90000  ? 405 GLY A O     1 
ATOM   698   N  N     . LYS A 1 161 ? 119.30700 144.35100 161.75000 1.000 53.54000  ? 406 LYS A N     1 
ATOM   699   C  CA    . LYS A 1 161 ? 120.17200 145.47200 162.08300 1.000 53.54000  ? 406 LYS A CA    1 
ATOM   700   C  C     . LYS A 1 161 ? 120.49400 146.24900 160.81400 1.000 53.54000  ? 406 LYS A C     1 
ATOM   701   O  O     . LYS A 1 161 ? 120.03100 145.91600 159.71900 1.000 53.54000  ? 406 LYS A O     1 
ATOM   702   C  CB    . LYS A 1 161 ? 121.45300 145.00000 162.78200 1.000 53.54000  ? 406 LYS A CB    1 
ATOM   703   C  CG    . LYS A 1 161 ? 121.23600 144.45600 164.18100 1.000 53.54000  ? 406 LYS A CG    1 
ATOM   704   C  CD    . LYS A 1 161 ? 122.55200 144.05700 164.82600 1.000 53.54000  ? 406 LYS A CD    1 
ATOM   705   C  CE    . LYS A 1 161 ? 122.33500 143.51100 166.22700 1.000 53.54000  ? 406 LYS A CE    1 
ATOM   706   N  NZ    . LYS A 1 161 ? 123.61300 143.11400 166.87900 1.000 53.54000  ? 406 LYS A NZ    1 
ATOM   707   N  N     . THR A 1 162 ? 121.30100 147.29800 160.97400 1.000 50.16000  ? 407 THR A N     1 
ATOM   708   C  CA    . THR A 1 162 ? 121.68000 148.17800 159.87900 1.000 50.16000  ? 407 THR A CA    1 
ATOM   709   C  C     . THR A 1 162 ? 123.12500 147.99200 159.43400 1.000 50.16000  ? 407 THR A C     1 
ATOM   710   O  O     . THR A 1 162 ? 123.46700 148.38100 158.31300 1.000 50.16000  ? 407 THR A O     1 
ATOM   711   C  CB    . THR A 1 162 ? 121.45700 149.64200 160.29600 1.000 50.16000  ? 407 THR A CB    1 
ATOM   712   O  OG1   . THR A 1 162 ? 120.10800 149.80200 160.75100 1.000 50.16000  ? 407 THR A OG1   1 
ATOM   713   C  CG2   . THR A 1 162 ? 121.69000 150.60000 159.13500 1.000 50.16000  ? 407 THR A CG2   1 
ATOM   714   N  N     . THR A 1 163 ? 123.95900 147.36600 160.25700 1.000 47.46000  ? 408 THR A N     1 
ATOM   715   C  CA    . THR A 1 163 ? 125.39100 147.30600 160.01900 1.000 47.46000  ? 408 THR A CA    1 
ATOM   716   C  C     . THR A 1 163 ? 125.72100 146.33500 158.88500 1.000 47.46000  ? 408 THR A C     1 
ATOM   717   O  O     . THR A 1 163 ? 124.84900 145.68900 158.30000 1.000 47.46000  ? 408 THR A O     1 
ATOM   718   C  CB    . THR A 1 163 ? 126.11300 146.91000 161.30300 1.000 47.46000  ? 408 THR A CB    1 
ATOM   719   O  OG1   . THR A 1 163 ? 125.68900 145.60400 161.70400 1.000 47.46000  ? 408 THR A OG1   1 
ATOM   720   C  CG2   . THR A 1 163 ? 125.78100 147.88700 162.41200 1.000 47.46000  ? 408 THR A CG2   1 
ATOM   721   N  N     . VAL A 1 164 ? 127.01000 146.23500 158.57500 1.000 43.29000  ? 409 VAL A N     1 
ATOM   722   C  CA    . VAL A 1 164 ? 127.53100 145.36200 157.52900 1.000 43.29000  ? 409 VAL A CA    1 
ATOM   723   C  C     . VAL A 1 164 ? 128.60400 144.50600 158.18400 1.000 43.29000  ? 409 VAL A C     1 
ATOM   724   O  O     . VAL A 1 164 ? 129.75300 144.94000 158.32100 1.000 43.29000  ? 409 VAL A O     1 
ATOM   725   C  CB    . VAL A 1 164 ? 128.10600 146.14800 156.34800 1.000 43.29000  ? 409 VAL A CB    1 
ATOM   726   C  CG1   . VAL A 1 164 ? 128.68500 145.20700 155.30800 1.000 43.29000  ? 409 VAL A CG1   1 
ATOM   727   C  CG2   . VAL A 1 164 ? 127.05700 147.02600 155.74200 1.000 43.29000  ? 409 VAL A CG2   1 
ATOM   728   N  N     . GLY A 1 165 ? 128.24200 143.30000 158.60500 1.000 43.45000  ? 410 GLY A N     1 
ATOM   729   C  CA    . GLY A 1 165 ? 129.20200 142.45600 159.28800 1.000 43.45000  ? 410 GLY A CA    1 
ATOM   730   C  C     . GLY A 1 165 ? 130.41900 142.16200 158.43200 1.000 43.45000  ? 410 GLY A C     1 
ATOM   731   O  O     . GLY A 1 165 ? 130.33000 141.99600 157.21600 1.000 43.45000  ? 410 GLY A O     1 
ATOM   732   N  N     . ILE A 1 166 ? 131.57500 142.10800 159.08600 1.000 43.43000  ? 411 ILE A N     1 
ATOM   733   C  CA    . ILE A 1 166 ? 132.81800 141.65300 158.47500 1.000 43.43000  ? 411 ILE A CA    1 
ATOM   734   C  C     . ILE A 1 166 ? 133.33400 140.49500 159.31200 1.000 43.43000  ? 411 ILE A C     1 
ATOM   735   O  O     . ILE A 1 166 ? 133.59900 140.66100 160.50800 1.000 43.43000  ? 411 ILE A O     1 
ATOM   736   C  CB    . ILE A 1 166 ? 133.87300 142.76700 158.38400 1.000 43.43000  ? 411 ILE A CB    1 
ATOM   737   C  CG1   . ILE A 1 166 ? 133.44600 143.83900 157.38500 1.000 43.43000  ? 411 ILE A CG1   1 
ATOM   738   C  CG2   . ILE A 1 166 ? 135.22100 142.19400 158.00700 1.000 43.43000  ? 411 ILE A CG2   1 
ATOM   739   C  CD1   . ILE A 1 166 ? 134.35800 145.03800 157.37900 1.000 43.43000  ? 411 ILE A CD1   1 
ATOM   740   N  N     . GLU A 1 167 ? 133.48600 139.33100 158.69000 1.000 46.11000  ? 412 GLU A N     1 
ATOM   741   C  CA    . GLU A 1 167 ? 133.80000 138.09700 159.40400 1.000 46.11000  ? 412 GLU A CA    1 
ATOM   742   C  C     . GLU A 1 167 ? 135.29600 137.82700 159.30200 1.000 46.11000  ? 412 GLU A C     1 
ATOM   743   O  O     . GLU A 1 167 ? 135.78800 137.35200 158.27600 1.000 46.11000  ? 412 GLU A O     1 
ATOM   744   C  CB    . GLU A 1 167 ? 132.97800 136.93600 158.85700 1.000 46.11000  ? 412 GLU A CB    1 
ATOM   745   C  CG    . GLU A 1 167 ? 131.49700 137.02200 159.18900 1.000 46.11000  ? 412 GLU A CG    1 
ATOM   746   C  CD    . GLU A 1 167 ? 130.70200 135.85700 158.63200 1.000 46.11000  ? 412 GLU A CD    1 
ATOM   747   O  OE1   . GLU A 1 167 ? 131.26400 135.07200 157.84100 1.000 46.11000  ? 412 GLU A OE1   1 
ATOM   748   O  OE2   . GLU A 1 167 ? 129.51700 135.71200 159.00000 1.000 46.11000  ? 412 GLU A OE2   1 
ATOM   749   N  N     . ILE A 1 168 ? 136.01400 138.12500 160.37800 1.000 46.07000  ? 413 ILE A N     1 
ATOM   750   C  CA    . ILE A 1 168 ? 137.44700 137.86700 160.46800 1.000 46.07000  ? 413 ILE A CA    1 
ATOM   751   C  C     . ILE A 1 168 ? 137.64000 136.49000 161.09500 1.000 46.07000  ? 413 ILE A C     1 
ATOM   752   O  O     . ILE A 1 168 ? 137.24000 136.29100 162.25200 1.000 46.07000  ? 413 ILE A O     1 
ATOM   753   C  CB    . ILE A 1 168 ? 138.15400 138.93900 161.30400 1.000 46.07000  ? 413 ILE A CB    1 
ATOM   754   C  CG1   . ILE A 1 168 ? 138.00700 140.31600 160.66200 1.000 46.07000  ? 413 ILE A CG1   1 
ATOM   755   C  CG2   . ILE A 1 168 ? 139.61100 138.57900 161.50100 1.000 46.07000  ? 413 ILE A CG2   1 
ATOM   756   C  CD1   . ILE A 1 168 ? 138.66500 140.43000 159.33500 1.000 46.07000  ? 413 ILE A CD1   1 
ATOM   757   N  N     . PRO A 1 169 ? 138.23800 135.53200 160.39300 1.000 45.36000  ? 414 PRO A N     1 
ATOM   758   C  CA    . PRO A 1 169 ? 138.52300 134.24000 161.02100 1.000 45.36000  ? 414 PRO A CA    1 
ATOM   759   C  C     . PRO A 1 169 ? 139.64200 134.37100 162.03900 1.000 45.36000  ? 414 PRO A C     1 
ATOM   760   O  O     . PRO A 1 169 ? 140.57500 135.15600 161.86400 1.000 45.36000  ? 414 PRO A O     1 
ATOM   761   C  CB    . PRO A 1 169 ? 138.93700 133.35700 159.84100 1.000 45.36000  ? 414 PRO A CB    1 
ATOM   762   C  CG    . PRO A 1 169 ? 139.47300 134.31200 158.84100 1.000 45.36000  ? 414 PRO A CG    1 
ATOM   763   C  CD    . PRO A 1 169 ? 138.65300 135.56400 158.98300 1.000 45.36000  ? 414 PRO A CD    1 
ATOM   764   N  N     . ASN A 1 170 ? 139.54200 133.59200 163.11200 1.000 55.56000  ? 415 ASN A N     1 
ATOM   765   C  CA    . ASN A 1 170 ? 140.54800 133.63800 164.16000 1.000 55.56000  ? 415 ASN A CA    1 
ATOM   766   C  C     . ASN A 1 170 ? 141.77900 132.83000 163.77600 1.000 55.56000  ? 415 ASN A C     1 
ATOM   767   O  O     . ASN A 1 170 ? 141.70600 131.86500 163.00900 1.000 55.56000  ? 415 ASN A O     1 
ATOM   768   C  CB    . ASN A 1 170 ? 139.99300 133.10400 165.48000 1.000 55.56000  ? 415 ASN A CB    1 
ATOM   769   C  CG    . ASN A 1 170 ? 138.91200 133.98200 166.05500 1.000 55.56000  ? 415 ASN A CG    1 
ATOM   770   O  OD1   . ASN A 1 170 ? 137.76900 133.55900 166.20600 1.000 55.56000  ? 415 ASN A OD1   1 
ATOM   771   N  ND2   . ASN A 1 170 ? 139.26600 135.21700 166.37900 1.000 55.56000  ? 415 ASN A ND2   1 
ATOM   772   N  N     . GLU A 1 171 ? 142.92400 133.23800 164.32300 1.000 68.75000  ? 416 GLU A N     1 
ATOM   773   C  CA    . GLU A 1 171 ? 144.11600 132.40500 164.26400 1.000 68.75000  ? 416 GLU A CA    1 
ATOM   774   C  C     . GLU A 1 171 ? 144.03800 131.26500 165.26900 1.000 68.75000  ? 416 GLU A C     1 
ATOM   775   O  O     . GLU A 1 171 ? 144.59900 130.18900 165.03400 1.000 68.75000  ? 416 GLU A O     1 
ATOM   776   C  CB    . GLU A 1 171 ? 145.36300 133.25100 164.52100 1.000 68.75000  ? 416 GLU A CB    1 
ATOM   777   C  CG    . GLU A 1 171 ? 145.42700 133.85400 165.91800 1.000 68.75000  ? 416 GLU A CG    1 
ATOM   778   C  CD    . GLU A 1 171 ? 146.64700 134.72600 166.12600 1.000 68.75000  ? 416 GLU A CD    1 
ATOM   779   O  OE1   . GLU A 1 171 ? 147.42500 134.90000 165.16500 1.000 68.75000  ? 416 GLU A OE1   1 
ATOM   780   O  OE2   . GLU A 1 171 ? 146.83400 135.23300 167.25200 1.000 68.75000  ? 416 GLU A OE2   1 
ATOM   781   N  N     . ASP A 1 172 ? 143.35100 131.49200 166.38700 1.000 72.84000  ? 417 ASP A N     1 
ATOM   782   C  CA    . ASP A 1 172 ? 143.16100 130.49300 167.43300 1.000 72.84000  ? 417 ASP A CA    1 
ATOM   783   C  C     . ASP A 1 172 ? 141.78000 129.86500 167.25900 1.000 72.84000  ? 417 ASP A C     1 
ATOM   784   O  O     . ASP A 1 172 ? 140.82900 130.16700 167.97800 1.000 72.84000  ? 417 ASP A O     1 
ATOM   785   C  CB    . ASP A 1 172 ? 143.33400 131.13900 168.80400 1.000 72.84000  ? 417 ASP A CB    1 
ATOM   786   C  CG    . ASP A 1 172 ? 142.46000 132.37100 168.98200 1.000 72.84000  ? 417 ASP A CG    1 
ATOM   787   O  OD1   . ASP A 1 172 ? 141.79500 132.77900 168.00900 1.000 72.84000  ? 417 ASP A OD1   1 
ATOM   788   O  OD2   . ASP A 1 172 ? 142.42900 132.93500 170.09300 1.000 72.84000  ? 417 ASP A OD2   1 
ATOM   789   N  N     . ARG A 1 173 ? 141.67600 128.96800 166.28100 1.000 59.23000  ? 418 ARG A N     1 
ATOM   790   C  CA    . ARG A 1 173 ? 140.39700 128.32600 166.01200 1.000 59.23000  ? 418 ARG A CA    1 
ATOM   791   C  C     . ARG A 1 173 ? 140.09800 127.32900 167.12100 1.000 59.23000  ? 418 ARG A C     1 
ATOM   792   O  O     . ARG A 1 173 ? 140.56300 126.18600 167.08200 1.000 59.23000  ? 418 ARG A O     1 
ATOM   793   C  CB    . ARG A 1 173 ? 140.41000 127.65000 164.63800 1.000 59.23000  ? 418 ARG A CB    1 
ATOM   794   C  CG    . ARG A 1 173 ? 139.07100 127.07600 164.20100 1.000 59.23000  ? 418 ARG A CG    1 
ATOM   795   C  CD    . ARG A 1 173 ? 138.96700 125.57700 164.43100 1.000 59.23000  ? 418 ARG A CD    1 
ATOM   796   N  NE    . ARG A 1 173 ? 137.67700 125.06600 163.97900 1.000 59.23000  ? 418 ARG A NE    1 
ATOM   797   C  CZ    . ARG A 1 173 ? 137.41200 124.70400 162.73000 1.000 59.23000  ? 418 ARG A CZ    1 
ATOM   798   N  NH1   . ARG A 1 173 ? 138.35000 124.79200 161.79700 1.000 59.23000  ? 418 ARG A NH1   1 
ATOM   799   N  NH2   . ARG A 1 173 ? 136.20700 124.25400 162.41200 1.000 59.23000  ? 418 ARG A NH2   1 
ATOM   800   N  N     . GLN A 1 174 ? 139.33700 127.75600 168.12300 1.000 64.75000  ? 419 GLN A N     1 
ATOM   801   C  CA    . GLN A 1 174 ? 139.11100 126.91600 169.28400 1.000 64.75000  ? 419 GLN A CA    1 
ATOM   802   C  C     . GLN A 1 174 ? 137.94700 125.96000 169.04200 1.000 64.75000  ? 419 GLN A C     1 
ATOM   803   O  O     . GLN A 1 174 ? 137.03600 126.22800 168.25500 1.000 64.75000  ? 419 GLN A O     1 
ATOM   804   C  CB    . GLN A 1 174 ? 138.85600 127.76800 170.52600 1.000 64.75000  ? 419 GLN A CB    1 
ATOM   805   C  CG    . GLN A 1 174 ? 137.59500 128.60000 170.48000 1.000 64.75000  ? 419 GLN A CG    1 
ATOM   806   C  CD    . GLN A 1 174 ? 137.44600 129.47300 171.70600 1.000 64.75000  ? 419 GLN A CD    1 
ATOM   807   O  OE1   . GLN A 1 174 ? 138.27300 129.42700 172.61600 1.000 64.75000  ? 419 GLN A OE1   1 
ATOM   808   N  NE2   . GLN A 1 174 ? 136.38700 130.27200 171.74100 1.000 64.75000  ? 419 GLN A NE2   1 
ATOM   809   N  N     . MET A 1 175 ? 137.98800 124.83500 169.74700 1.000 60.79000  ? 420 MET A N     1 
ATOM   810   C  CA    . MET A 1 175 ? 137.08700 123.72200 169.49500 1.000 60.79000  ? 420 MET A CA    1 
ATOM   811   C  C     . MET A 1 175 ? 135.74900 123.92400 170.19300 1.000 60.79000  ? 420 MET A C     1 
ATOM   812   O  O     . MET A 1 175 ? 135.66500 124.53200 171.26300 1.000 60.79000  ? 420 MET A O     1 
ATOM   813   C  CB    . MET A 1 175 ? 137.72400 122.41000 169.96200 1.000 60.79000  ? 420 MET A CB    1 
ATOM   814   C  CG    . MET A 1 175 ? 136.93200 121.16500 169.61100 1.000 60.79000  ? 420 MET A CG    1 
ATOM   815   S  SD    . MET A 1 175 ? 137.74500 119.66000 170.16600 1.000 60.79000  ? 420 MET A SD    1 
ATOM   816   C  CE    . MET A 1 175 ? 139.13700 119.61600 169.04300 1.000 60.79000  ? 420 MET A CE    1 
ATOM   817   N  N     . VAL A 1 176 ? 134.69800 123.40700 169.56800 1.000 56.06000  ? 421 VAL A N     1 
ATOM   818   C  CA    . VAL A 1 176 ? 133.35900 123.37700 170.14000 1.000 56.06000  ? 421 VAL A CA    1 
ATOM   819   C  C     . VAL A 1 176 ? 133.11800 121.95500 170.63000 1.000 56.06000  ? 421 VAL A C     1 
ATOM   820   O  O     . VAL A 1 176 ? 132.85000 121.05000 169.83200 1.000 56.06000  ? 421 VAL A O     1 
ATOM   821   C  CB    . VAL A 1 176 ? 132.29300 123.80300 169.12600 1.000 56.06000  ? 421 VAL A CB    1 
ATOM   822   C  CG1   . VAL A 1 176 ? 130.91200 123.55900 169.69400 1.000 56.06000  ? 421 VAL A CG1   1 
ATOM   823   C  CG2   . VAL A 1 176 ? 132.46400 125.26400 168.75700 1.000 56.06000  ? 421 VAL A CG2   1 
ATOM   824   N  N     . ARG A 1 177 ? 133.22300 121.74200 171.93900 1.000 60.98000  ? 422 ARG A N     1 
ATOM   825   C  CA    . ARG A 1 177 ? 132.88600 120.43800 172.48300 1.000 60.98000  ? 422 ARG A CA    1 
ATOM   826   C  C     . ARG A 1 177 ? 131.38700 120.19600 172.34600 1.000 60.98000  ? 422 ARG A C     1 
ATOM   827   O  O     . ARG A 1 177 ? 130.59700 121.12100 172.14700 1.000 60.98000  ? 422 ARG A O     1 
ATOM   828   C  CB    . ARG A 1 177 ? 133.30400 120.33000 173.94900 1.000 60.98000  ? 422 ARG A CB    1 
ATOM   829   C  CG    . ARG A 1 177 ? 134.78200 120.56600 174.20700 1.000 60.98000  ? 422 ARG A CG    1 
ATOM   830   C  CD    . ARG A 1 177 ? 135.65900 119.57000 173.46800 1.000 60.98000  ? 422 ARG A CD    1 
ATOM   831   N  NE    . ARG A 1 177 ? 135.41200 118.18800 173.86200 1.000 60.98000  ? 422 ARG A NE    1 
ATOM   832   C  CZ    . ARG A 1 177 ? 135.83100 117.13700 173.16600 1.000 60.98000  ? 422 ARG A CZ    1 
ATOM   833   N  NH1   . ARG A 1 177 ? 136.52500 117.31800 172.05300 1.000 60.98000  ? 422 ARG A NH1   1 
ATOM   834   N  NH2   . ARG A 1 177 ? 135.56600 115.90800 173.58200 1.000 60.98000  ? 422 ARG A NH2   1 
ATOM   835   N  N     . PHE A 1 178 ? 130.99500 118.93000 172.45700 1.000 55.97000  ? 423 PHE A N     1 
ATOM   836   C  CA    . PHE A 1 178 ? 129.60000 118.57100 172.24700 1.000 55.97000  ? 423 PHE A CA    1 
ATOM   837   C  C     . PHE A 1 178 ? 128.75900 118.70700 173.50600 1.000 55.97000  ? 423 PHE A C     1 
ATOM   838   O  O     . PHE A 1 178 ? 127.53400 118.82300 173.40600 1.000 55.97000  ? 423 PHE A O     1 
ATOM   839   C  CB    . PHE A 1 178 ? 129.50400 117.14600 171.69600 1.000 55.97000  ? 423 PHE A CB    1 
ATOM   840   C  CG    . PHE A 1 178 ? 128.11400 116.73500 171.31500 1.000 55.97000  ? 423 PHE A CG    1 
ATOM   841   C  CD1   . PHE A 1 178 ? 127.46500 117.34900 170.26200 1.000 55.97000  ? 423 PHE A CD1   1 
ATOM   842   C  CD2   . PHE A 1 178 ? 127.47800 115.70100 171.97000 1.000 55.97000  ? 423 PHE A CD2   1 
ATOM   843   C  CE1   . PHE A 1 178 ? 126.19400 116.96900 169.89900 1.000 55.97000  ? 423 PHE A CE1   1 
ATOM   844   C  CE2   . PHE A 1 178 ? 126.20800 115.31300 171.60600 1.000 55.97000  ? 423 PHE A CE2   1 
ATOM   845   C  CZ    . PHE A 1 178 ? 125.56600 115.95000 170.57100 1.000 55.97000  ? 423 PHE A CZ    1 
ATOM   846   N  N     . SER A 1 179 ? 129.38300 118.70500 174.68300 1.000 61.54000  ? 424 SER A N     1 
ATOM   847   C  CA    . SER A 1 179 ? 128.64900 118.97000 175.91200 1.000 61.54000  ? 424 SER A CA    1 
ATOM   848   C  C     . SER A 1 179 ? 128.28500 120.43800 176.07200 1.000 61.54000  ? 424 SER A C     1 
ATOM   849   O  O     . SER A 1 179 ? 127.46400 120.76200 176.93500 1.000 61.54000  ? 424 SER A O     1 
ATOM   850   C  CB    . SER A 1 179 ? 129.46300 118.50500 177.11900 1.000 61.54000  ? 424 SER A CB    1 
ATOM   851   O  OG    . SER A 1 179 ? 130.63900 119.27800 177.26900 1.000 61.54000  ? 424 SER A OG    1 
ATOM   852   N  N     . GLU A 1 180 ? 128.86800 121.32900 175.26800 1.000 60.29000  ? 425 GLU A N     1 
ATOM   853   C  CA    . GLU A 1 180 ? 128.52900 122.74400 175.32700 1.000 60.29000  ? 425 GLU A CA    1 
ATOM   854   C  C     . GLU A 1 180 ? 127.24400 123.07600 174.58500 1.000 60.29000  ? 425 GLU A C     1 
ATOM   855   O  O     . GLU A 1 180 ? 126.76000 124.20800 174.69400 1.000 60.29000  ? 425 GLU A O     1 
ATOM   856   C  CB    . GLU A 1 180 ? 129.66700 123.59100 174.75200 1.000 60.29000  ? 425 GLU A CB    1 
ATOM   857   C  CG    . GLU A 1 180 ? 130.94100 123.58200 175.57100 1.000 60.29000  ? 425 GLU A CG    1 
ATOM   858   C  CD    . GLU A 1 180 ? 132.03000 124.43000 174.94300 1.000 60.29000  ? 425 GLU A CD    1 
ATOM   859   O  OE1   . GLU A 1 180 ? 131.82700 124.91500 173.81200 1.000 60.29000  ? 425 GLU A OE1   1 
ATOM   860   O  OE2   . GLU A 1 180 ? 133.08700 124.61500 175.57800 1.000 60.29000  ? 425 GLU A OE2   1 
ATOM   861   N  N     . VAL A 1 181 ? 126.68900 122.12900 173.83500 1.000 57.17000  ? 426 VAL A N     1 
ATOM   862   C  CA    . VAL A 1 181 ? 125.46600 122.35000 173.07800 1.000 57.17000  ? 426 VAL A CA    1 
ATOM   863   C  C     . VAL A 1 181 ? 124.25300 121.77300 173.79400 1.000 57.17000  ? 426 VAL A C     1 
ATOM   864   O  O     . VAL A 1 181 ? 123.19500 122.40200 173.83300 1.000 57.17000  ? 426 VAL A O     1 
ATOM   865   C  CB    . VAL A 1 181 ? 125.60400 121.75800 171.66000 1.000 57.17000  ? 426 VAL A CB    1 
ATOM   866   C  CG1   . VAL A 1 181 ? 124.31100 121.92900 170.89100 1.000 57.17000  ? 426 VAL A CG1   1 
ATOM   867   C  CG2   . VAL A 1 181 ? 126.75700 122.41000 170.92400 1.000 57.17000  ? 426 VAL A CG2   1 
ATOM   868   N  N     . LEU A 1 182 ? 124.39000 120.57800 174.36900 1.000 59.30000  ? 427 LEU A N     1 
ATOM   869   C  CA    . LEU A 1 182 ? 123.24900 119.91500 174.98800 1.000 59.30000  ? 427 LEU A CA    1 
ATOM   870   C  C     . LEU A 1 182 ? 122.87300 120.53300 176.32700 1.000 59.30000  ? 427 LEU A C     1 
ATOM   871   O  O     . LEU A 1 182 ? 121.68700 120.57400 176.67100 1.000 59.30000  ? 427 LEU A O     1 
ATOM   872   C  CB    . LEU A 1 182 ? 123.54300 118.42900 175.16400 1.000 59.30000  ? 427 LEU A CB    1 
ATOM   873   C  CG    . LEU A 1 182 ? 123.76600 117.69100 173.84900 1.000 59.30000  ? 427 LEU A CG    1 
ATOM   874   C  CD1   . LEU A 1 182 ? 124.11100 116.25400 174.12500 1.000 59.30000  ? 427 LEU A CD1   1 
ATOM   875   C  CD2   . LEU A 1 182 ? 122.54600 117.79400 172.96300 1.000 59.30000  ? 427 LEU A CD2   1 
ATOM   876   N  N     . SER A 1 183 ? 123.85100 121.01400 177.09500 1.000 62.85000  ? 428 SER A N     1 
ATOM   877   C  CA    . SER A 1 183 ? 123.54700 121.64300 178.37400 1.000 62.85000  ? 428 SER A CA    1 
ATOM   878   C  C     . SER A 1 183 ? 122.75400 122.93400 178.22100 1.000 62.85000  ? 428 SER A C     1 
ATOM   879   O  O     . SER A 1 183 ? 122.32000 123.49600 179.23200 1.000 62.85000  ? 428 SER A O     1 
ATOM   880   C  CB    . SER A 1 183 ? 124.84000 121.91500 179.14400 1.000 62.85000  ? 428 SER A CB    1 
ATOM   881   O  OG    . SER A 1 183 ? 125.63800 122.87400 178.47400 1.000 62.85000  ? 428 SER A OG    1 
ATOM   882   N  N     . SER A 1 184 ? 122.56100 123.41500 176.99200 1.000 62.33000  ? 429 SER A N     1 
ATOM   883   C  CA    . SER A 1 184 ? 121.78500 124.61700 176.74900 1.000 62.33000  ? 429 SER A CA    1 
ATOM   884   C  C     . SER A 1 184 ? 120.34800 124.44100 177.23700 1.000 62.33000  ? 429 SER A C     1 
ATOM   885   O  O     . SER A 1 184 ? 119.86800 123.31600 177.39500 1.000 62.33000  ? 429 SER A O     1 
ATOM   886   C  CB    . SER A 1 184 ? 121.79000 124.94600 175.26000 1.000 62.33000  ? 429 SER A CB    1 
ATOM   887   O  OG    . SER A 1 184 ? 121.09600 123.95400 174.52400 1.000 62.33000  ? 429 SER A OG    1 
ATOM   888   N  N     . PRO A 1 185 ? 119.63600 125.54600 177.48100 1.000 65.40000  ? 430 PRO A N     1 
ATOM   889   C  CA    . PRO A 1 185 ? 118.22500 125.42700 177.87700 1.000 65.40000  ? 430 PRO A CA    1 
ATOM   890   C  C     . PRO A 1 185 ? 117.31600 124.98300 176.74700 1.000 65.40000  ? 430 PRO A C     1 
ATOM   891   O  O     . PRO A 1 185 ? 116.26400 124.39300 177.02200 1.000 65.40000  ? 430 PRO A O     1 
ATOM   892   C  CB    . PRO A 1 185 ? 117.87100 126.84200 178.35100 1.000 65.40000  ? 430 PRO A CB    1 
ATOM   893   C  CG    . PRO A 1 185 ? 118.81100 127.72500 177.61000 1.000 65.40000  ? 430 PRO A CG    1 
ATOM   894   C  CD    . PRO A 1 185 ? 120.09200 126.94700 177.48000 1.000 65.40000  ? 430 PRO A CD    1 
ATOM   895   N  N     . GLU A 1 186 ? 117.67700 125.26200 175.49200 1.000 66.38000  ? 431 GLU A N     1 
ATOM   896   C  CA    . GLU A 1 186 ? 116.84600 124.84100 174.36700 1.000 66.38000  ? 431 GLU A CA    1 
ATOM   897   C  C     . GLU A 1 186 ? 116.67900 123.32800 174.34300 1.000 66.38000  ? 431 GLU A C     1 
ATOM   898   O  O     . GLU A 1 186 ? 115.55700 122.81800 174.25400 1.000 66.38000  ? 431 GLU A O     1 
ATOM   899   C  CB    . GLU A 1 186 ? 117.45200 125.33200 173.05100 1.000 66.38000  ? 431 GLU A CB    1 
ATOM   900   C  CG    . GLU A 1 186 ? 117.42800 126.83800 172.87200 1.000 66.38000  ? 431 GLU A CG    1 
ATOM   901   C  CD    . GLU A 1 186 ? 118.60400 127.52100 173.53500 1.000 66.38000  ? 431 GLU A CD    1 
ATOM   902   O  OE1   . GLU A 1 186 ? 119.47900 126.81300 174.07300 1.000 66.38000  ? 431 GLU A OE1   1 
ATOM   903   O  OE2   . GLU A 1 186 ? 118.65300 128.76900 173.51800 1.000 66.38000  ? 431 GLU A OE2   1 
ATOM   904   N  N     . TYR A 1 187 ? 117.78900 122.59400 174.43800 1.000 59.36000  ? 432 TYR A N     1 
ATOM   905   C  CA    . TYR A 1 187 ? 117.74300 121.14400 174.29400 1.000 59.36000  ? 432 TYR A CA    1 
ATOM   906   C  C     . TYR A 1 187 ? 116.88100 120.47600 175.35500 1.000 59.36000  ? 432 TYR A C     1 
ATOM   907   O  O     . TYR A 1 187 ? 116.38100 119.37000 175.12300 1.000 59.36000  ? 432 TYR A O     1 
ATOM   908   C  CB    . TYR A 1 187 ? 119.15700 120.57200 174.34100 1.000 59.36000  ? 432 TYR A CB    1 
ATOM   909   C  CG    . TYR A 1 187 ? 119.22100 119.09200 174.07700 1.000 59.36000  ? 432 TYR A CG    1 
ATOM   910   C  CD1   . TYR A 1 187 ? 119.09300 118.59400 172.79000 1.000 59.36000  ? 432 TYR A CD1   1 
ATOM   911   C  CD2   . TYR A 1 187 ? 119.40700 118.19100 175.11200 1.000 59.36000  ? 432 TYR A CD2   1 
ATOM   912   C  CE1   . TYR A 1 187 ? 119.15000 117.24100 172.54200 1.000 59.36000  ? 432 TYR A CE1   1 
ATOM   913   C  CE2   . TYR A 1 187 ? 119.46500 116.83600 174.87300 1.000 59.36000  ? 432 TYR A CE2   1 
ATOM   914   C  CZ    . TYR A 1 187 ? 119.33800 116.36700 173.58700 1.000 59.36000  ? 432 TYR A CZ    1 
ATOM   915   O  OH    . TYR A 1 187 ? 119.39500 115.01600 173.34600 1.000 59.36000  ? 432 TYR A OH    1 
ATOM   916   N  N     . ASP A 1 188 ? 116.69000 121.11400 176.50800 1.000 64.26000  ? 433 ASP A N     1 
ATOM   917   C  CA    . ASP A 1 188 ? 115.83200 120.55400 177.54400 1.000 64.26000  ? 433 ASP A CA    1 
ATOM   918   C  C     . ASP A 1 188 ? 114.36000 120.83700 177.26800 1.000 64.26000  ? 433 ASP A C     1 
ATOM   919   O  O     . ASP A 1 188 ? 113.54900 119.90900 177.19700 1.000 64.26000  ? 433 ASP A O     1 
ATOM   920   C  CB    . ASP A 1 188 ? 116.22700 121.10300 178.91800 1.000 64.26000  ? 433 ASP A CB    1 
ATOM   921   C  CG    . ASP A 1 188 ? 117.56200 120.56800 179.39800 1.000 64.26000  ? 433 ASP A CG    1 
ATOM   922   O  OD1   . ASP A 1 188 ? 117.92600 119.43800 179.01200 1.000 64.26000  ? 433 ASP A OD1   1 
ATOM   923   O  OD2   . ASP A 1 188 ? 118.24400 121.27500 180.16800 1.000 64.26000  ? 433 ASP A OD2   1 
ATOM   924   N  N     . GLU A 1 189 ? 114.00200 122.10900 177.10800 1.000 65.64000  ? 434 GLU A N     1 
ATOM   925   C  CA    . GLU A 1 189 ? 112.62300 122.49400 176.84100 1.000 65.64000  ? 434 GLU A CA    1 
ATOM   926   C  C     . GLU A 1 189 ? 112.18500 122.19900 175.41200 1.000 65.64000  ? 434 GLU A C     1 
ATOM   927   O  O     . GLU A 1 189 ? 111.04400 122.51300 175.05800 1.000 65.64000  ? 434 GLU A O     1 
ATOM   928   C  CB    . GLU A 1 189 ? 112.42700 123.98000 177.14100 1.000 65.64000  ? 434 GLU A CB    1 
ATOM   929   C  CG    . GLU A 1 189 ? 112.56400 124.33600 178.61000 1.000 65.64000  ? 434 GLU A CG    1 
ATOM   930   C  CD    . GLU A 1 189 ? 112.37500 125.81500 178.86600 1.000 65.64000  ? 434 GLU A CD    1 
ATOM   931   O  OE1   . GLU A 1 189 ? 112.25500 126.57600 177.88300 1.000 65.64000  ? 434 GLU A OE1   1 
ATOM   932   O  OE2   . GLU A 1 189 ? 112.34800 126.21800 180.04700 1.000 65.64000  ? 434 GLU A OE2   1 
ATOM   933   N  N     . HIS A 1 190 ? 113.05100 121.61700 174.58900 1.000 58.95000  ? 435 HIS A N     1 
ATOM   934   C  CA    . HIS A 1 190 ? 112.67100 121.27100 173.22700 1.000 58.95000  ? 435 HIS A CA    1 
ATOM   935   C  C     . HIS A 1 190 ? 111.69400 120.10300 173.25800 1.000 58.95000  ? 435 HIS A C     1 
ATOM   936   O  O     . HIS A 1 190 ? 111.96600 119.07200 173.87800 1.000 58.95000  ? 435 HIS A O     1 
ATOM   937   C  CB    . HIS A 1 190 ? 113.91200 120.91600 172.41000 1.000 58.95000  ? 435 HIS A CB    1 
ATOM   938   C  CG    . HIS A 1 190 ? 113.65100 120.74100 170.94800 1.000 58.95000  ? 435 HIS A CG    1 
ATOM   939   N  ND1   . HIS A 1 190 ? 113.40200 121.80300 170.10700 1.000 58.95000  ? 435 HIS A ND1   1 
ATOM   940   C  CD2   . HIS A 1 190 ? 113.62100 119.63200 170.17300 1.000 58.95000  ? 435 HIS A CD2   1 
ATOM   941   C  CE1   . HIS A 1 190 ? 113.21900 121.35600 168.87800 1.000 58.95000  ? 435 HIS A CE1   1 
ATOM   942   N  NE2   . HIS A 1 190 ? 113.34700 120.04200 168.89000 1.000 58.95000  ? 435 HIS A NE2   1 
ATOM   943   N  N     . LYS A 1 191 ? 110.54300 120.27100 172.62000 1.000 58.52000  ? 436 LYS A N     1 
ATOM   944   C  CA    . LYS A 1 191 ? 109.49100 119.25800 172.63100 1.000 58.52000  ? 436 LYS A CA    1 
ATOM   945   C  C     . LYS A 1 191 ? 109.41800 118.63300 171.24100 1.000 58.52000  ? 436 LYS A C     1 
ATOM   946   O  O     . LYS A 1 191 ? 108.62400 119.04700 170.39600 1.000 58.52000  ? 436 LYS A O     1 
ATOM   947   C  CB    . LYS A 1 191 ? 108.15800 119.86600 173.05100 1.000 58.52000  ? 436 LYS A CB    1 
ATOM   948   C  CG    . LYS A 1 191 ? 108.14700 120.33900 174.49300 1.000 58.52000  ? 436 LYS A CG    1 
ATOM   949   C  CD    . LYS A 1 191 ? 106.81600 120.94900 174.87800 1.000 58.52000  ? 436 LYS A CD    1 
ATOM   950   C  CE    . LYS A 1 191 ? 106.80500 121.31600 176.35100 1.000 58.52000  ? 436 LYS A CE    1 
ATOM   951   N  NZ    . LYS A 1 191 ? 107.78400 122.39500 176.65700 1.000 58.52000  ? 436 LYS A NZ    1 
ATOM   952   N  N     . SER A 1 192 ? 110.25400 117.62200 171.01800 1.000 52.33000  ? 437 SER A N     1 
ATOM   953   C  CA    . SER A 1 192 ? 110.27800 116.89700 169.75600 1.000 52.33000  ? 437 SER A CA    1 
ATOM   954   C  C     . SER A 1 192 ? 111.03600 115.58900 169.92300 1.000 52.33000  ? 437 SER A C     1 
ATOM   955   O  O     . SER A 1 192 ? 112.15100 115.57400 170.45200 1.000 52.33000  ? 437 SER A O     1 
ATOM   956   C  CB    . SER A 1 192 ? 110.91500 117.74100 168.65200 1.000 52.33000  ? 437 SER A CB    1 
ATOM   957   O  OG    . SER A 1 192 ? 110.97300 117.01600 167.43600 1.000 52.33000  ? 437 SER A OG    1 
ATOM   958   N  N     . THR A 1 193 ? 110.43700 114.48300 169.48200 1.000 50.23000  ? 438 THR A N     1 
ATOM   959   C  CA    . THR A 1 193 ? 111.07500 113.18100 169.61300 1.000 50.23000  ? 438 THR A CA    1 
ATOM   960   C  C     . THR A 1 193 ? 112.35700 113.06200 168.80200 1.000 50.23000  ? 438 THR A C     1 
ATOM   961   O  O     . THR A 1 193 ? 113.13400 112.13400 169.04400 1.000 50.23000  ? 438 THR A O     1 
ATOM   962   C  CB    . THR A 1 193 ? 110.11000 112.07700 169.18800 1.000 50.23000  ? 438 THR A CB    1 
ATOM   963   O  OG1   . THR A 1 193 ? 109.74600 112.26400 167.81600 1.000 50.23000  ? 438 THR A OG1   1 
ATOM   964   C  CG2   . THR A 1 193 ? 108.85900 112.11400 170.04700 1.000 50.23000  ? 438 THR A CG2   1 
ATOM   965   N  N     . VAL A 1 194 ? 112.59500 113.96000 167.85300 1.000 46.29000  ? 439 VAL A N     1 
ATOM   966   C  CA    . VAL A 1 194 ? 113.75100 113.85200 166.96900 1.000 46.29000  ? 439 VAL A CA    1 
ATOM   967   C  C     . VAL A 1 194 ? 114.37900 115.23400 166.81500 1.000 46.29000  ? 439 VAL A C     1 
ATOM   968   O  O     . VAL A 1 194 ? 114.08900 115.94200 165.84100 1.000 46.29000  ? 439 VAL A O     1 
ATOM   969   C  CB    . VAL A 1 194 ? 113.34400 113.24900 165.61000 1.000 46.29000  ? 439 VAL A CB    1 
ATOM   970   C  CG1   . VAL A 1 194 ? 114.51000 113.19400 164.66700 1.000 46.29000  ? 439 VAL A CG1   1 
ATOM   971   C  CG2   . VAL A 1 194 ? 112.79000 111.84900 165.79200 1.000 46.29000  ? 439 VAL A CG2   1 
ATOM   972   N  N     . PRO A 1 195 ? 115.20300 115.67400 167.76000 1.000 46.59000  ? 440 PRO A N     1 
ATOM   973   C  CA    . PRO A 1 195 ? 115.95400 116.91800 167.59000 1.000 46.59000  ? 440 PRO A CA    1 
ATOM   974   C  C     . PRO A 1 195 ? 117.33700 116.64600 167.01400 1.000 46.59000  ? 440 PRO A C     1 
ATOM   975   O  O     . PRO A 1 195 ? 117.81700 115.51500 166.99300 1.000 46.59000  ? 440 PRO A O     1 
ATOM   976   C  CB    . PRO A 1 195 ? 116.07000 117.44800 169.01800 1.000 46.59000  ? 440 PRO A CB    1 
ATOM   977   C  CG    . PRO A 1 195 ? 116.16200 116.20900 169.81900 1.000 46.59000  ? 440 PRO A CG    1 
ATOM   978   C  CD    . PRO A 1 195 ? 115.27000 115.19400 169.14900 1.000 46.59000  ? 440 PRO A CD    1 
ATOM   979   N  N     . LEU A 1 196 ? 117.98300 117.72200 166.57500 1.000 42.34000  ? 441 LEU A N     1 
ATOM   980   C  CA    . LEU A 1 196 ? 119.34500 117.65900 166.06100 1.000 42.34000  ? 441 LEU A CA    1 
ATOM   981   C  C     . LEU A 1 196 ? 120.13000 118.82100 166.64500 1.000 42.34000  ? 441 LEU A C     1 
ATOM   982   O  O     . LEU A 1 196 ? 119.72300 119.97800 166.50100 1.000 42.34000  ? 441 LEU A O     1 
ATOM   983   C  CB    . LEU A 1 196 ? 119.35800 117.71400 164.53300 1.000 42.34000  ? 441 LEU A CB    1 
ATOM   984   C  CG    . LEU A 1 196 ? 118.65000 116.56400 163.81600 1.000 42.34000  ? 441 LEU A CG    1 
ATOM   985   C  CD1   . LEU A 1 196 ? 118.64500 116.79500 162.32000 1.000 42.34000  ? 441 LEU A CD1   1 
ATOM   986   C  CD2   . LEU A 1 196 ? 119.29000 115.23400 164.15500 1.000 42.34000  ? 441 LEU A CD2   1 
ATOM   987   N  N     . ALA A 1 197 ? 121.24400 118.51900 167.30800 1.000 40.86000  ? 442 ALA A N     1 
ATOM   988   C  CA    . ALA A 1 197 ? 122.12700 119.54200 167.86100 1.000 40.86000  ? 442 ALA A CA    1 
ATOM   989   C  C     . ALA A 1 197 ? 123.25600 119.76100 166.86300 1.000 40.86000  ? 442 ALA A C     1 
ATOM   990   O  O     . ALA A 1 197 ? 124.20000 118.97100 166.79100 1.000 40.86000  ? 442 ALA A O     1 
ATOM   991   C  CB    . ALA A 1 197 ? 122.65800 119.13500 169.23100 1.000 40.86000  ? 442 ALA A CB    1 
ATOM   992   N  N     . LEU A 1 198 ? 123.15700 120.84300 166.09600 1.000 37.30000  ? 443 LEU A N     1 
ATOM   993   C  CA    . LEU A 1 198 ? 124.14600 121.11200 165.06100 1.000 37.30000  ? 443 LEU A CA    1 
ATOM   994   C  C     . LEU A 1 198 ? 125.44300 121.64400 165.65900 1.000 37.30000  ? 443 LEU A C     1 
ATOM   995   O  O     . LEU A 1 198 ? 126.52700 121.12800 165.36800 1.000 37.30000  ? 443 LEU A O     1 
ATOM   996   C  CB    . LEU A 1 198 ? 123.57500 122.09800 164.04500 1.000 37.30000  ? 443 LEU A CB    1 
ATOM   997   C  CG    . LEU A 1 198 ? 122.34300 121.60500 163.28900 1.000 37.30000  ? 443 LEU A CG    1 
ATOM   998   C  CD1   . LEU A 1 198 ? 121.78600 122.71200 162.42000 1.000 37.30000  ? 443 LEU A CD1   1 
ATOM   999   C  CD2   . LEU A 1 198 ? 122.66200 120.37600 162.45900 1.000 37.30000  ? 443 LEU A CD2   1 
ATOM   1000  N  N     . GLY A 1 199 ? 125.35000 122.67100 166.49300 1.000 41.82000  ? 444 GLY A N     1 
ATOM   1001  C  CA    . GLY A 1 199 ? 126.52700 123.22800 167.13200 1.000 41.82000  ? 444 GLY A CA    1 
ATOM   1002  C  C     . GLY A 1 199 ? 126.28800 124.68000 167.50900 1.000 41.82000  ? 444 GLY A C     1 
ATOM   1003  O  O     . GLY A 1 199 ? 125.14900 125.12500 167.62400 1.000 41.82000  ? 444 GLY A O     1 
ATOM   1004  N  N     . HIS A 1 200 ? 127.39100 125.39600 167.70200 1.000 48.99000  ? 445 HIS A N     1 
ATOM   1005  C  CA    . HIS A 1 200 ? 127.34200 126.82200 167.98800 1.000 48.99000  ? 445 HIS A CA    1 
ATOM   1006  C  C     . HIS A 1 200 ? 127.50600 127.62400 166.70600 1.000 48.99000  ? 445 HIS A C     1 
ATOM   1007  O  O     . HIS A 1 200 ? 128.36100 127.31700 165.87100 1.000 48.99000  ? 445 HIS A O     1 
ATOM   1008  C  CB    . HIS A 1 200 ? 128.42800 127.22100 168.98900 1.000 48.99000  ? 445 HIS A CB    1 
ATOM   1009  C  CG    . HIS A 1 200 ? 128.20000 126.70000 170.37300 1.000 48.99000  ? 445 HIS A CG    1 
ATOM   1010  N  ND1   . HIS A 1 200 ? 127.24300 127.22400 171.21400 1.000 48.99000  ? 445 HIS A ND1   1 
ATOM   1011  C  CD2   . HIS A 1 200 ? 128.81200 125.71500 171.06900 1.000 48.99000  ? 445 HIS A CD2   1 
ATOM   1012  C  CE1   . HIS A 1 200 ? 127.26900 126.57600 172.36400 1.000 48.99000  ? 445 HIS A CE1   1 
ATOM   1013  N  NE2   . HIS A 1 200 ? 128.21300 125.65500 172.30300 1.000 48.99000  ? 445 HIS A NE2   1 
ATOM   1014  N  N     . ASP A 1 201 ? 126.67800 128.65300 166.55500 1.000 49.65000  ? 446 ASP A N     1 
ATOM   1015  C  CA    . ASP A 1 201 ? 126.78200 129.55500 165.41600 1.000 49.65000  ? 446 ASP A CA    1 
ATOM   1016  C  C     . ASP A 1 201 ? 127.88200 130.58000 165.64500 1.000 49.65000  ? 446 ASP A C     1 
ATOM   1017  O  O     . ASP A 1 201 ? 128.72100 130.40800 166.53500 1.000 49.65000  ? 446 ASP A O     1 
ATOM   1018  C  CB    . ASP A 1 201 ? 125.44800 130.25700 165.15900 1.000 49.65000  ? 446 ASP A CB    1 
ATOM   1019  C  CG    . ASP A 1 201 ? 124.98400 131.07600 166.34600 1.000 49.65000  ? 446 ASP A CG    1 
ATOM   1020  O  OD1   . ASP A 1 201 ? 125.65900 131.04200 167.39400 1.000 49.65000  ? 446 ASP A OD1   1 
ATOM   1021  O  OD2   . ASP A 1 201 ? 123.94500 131.75800 166.22900 1.000 49.65000  ? 446 ASP A OD2   1 
ATOM   1022  N  N     . ILE A 1 202 ? 127.88800 131.65000 164.85400 1.000 47.94000  ? 447 ILE A N     1 
ATOM   1023  C  CA    . ILE A 1 202 ? 128.83600 132.74300 165.05000 1.000 47.94000  ? 447 ILE A CA    1 
ATOM   1024  C  C     . ILE A 1 202 ? 128.35400 133.52200 166.26900 1.000 47.94000  ? 447 ILE A C     1 
ATOM   1025  O  O     . ILE A 1 202 ? 127.45000 134.35400 166.17200 1.000 47.94000  ? 447 ILE A O     1 
ATOM   1026  C  CB    . ILE A 1 202 ? 128.94500 133.64100 163.81600 1.000 47.94000  ? 447 ILE A CB    1 
ATOM   1027  C  CG1   . ILE A 1 202 ? 129.41200 132.83600 162.60700 1.000 47.94000  ? 447 ILE A CG1   1 
ATOM   1028  C  CG2   . ILE A 1 202 ? 129.89800 134.79200 164.08000 1.000 47.94000  ? 447 ILE A CG2   1 
ATOM   1029  C  CD1   . ILE A 1 202 ? 128.28500 132.28200 161.77800 1.000 47.94000  ? 447 ILE A CD1   1 
ATOM   1030  N  N     . GLY A 1 203 ? 128.95800 133.25800 167.42100 1.000 52.38000  ? 448 GLY A N     1 
ATOM   1031  C  CA    . GLY A 1 203 ? 128.52400 133.87900 168.65500 1.000 52.38000  ? 448 GLY A CA    1 
ATOM   1032  C  C     . GLY A 1 203 ? 128.40700 132.87700 169.78100 1.000 52.38000  ? 448 GLY A C     1 
ATOM   1033  O  O     . GLY A 1 203 ? 127.99000 133.22100 170.89100 1.000 52.38000  ? 448 GLY A O     1 
ATOM   1034  N  N     . GLY A 1 204 ? 128.77500 131.63000 169.50000 1.000 52.76000  ? 449 GLY A N     1 
ATOM   1035  C  CA    . GLY A 1 204 ? 128.81600 130.60100 170.52300 1.000 52.76000  ? 449 GLY A CA    1 
ATOM   1036  C  C     . GLY A 1 204 ? 127.49500 130.31300 171.19800 1.000 52.76000  ? 449 GLY A C     1 
ATOM   1037  O  O     . GLY A 1 204 ? 127.48500 129.86000 172.34800 1.000 52.76000  ? 449 GLY A O     1 
ATOM   1038  N  N     . ARG A 1 205 ? 126.37500 130.55600 170.52100 1.000 53.99000  ? 450 ARG A N     1 
ATOM   1039  C  CA    . ARG A 1 205 ? 125.07500 130.20000 171.07800 1.000 53.99000  ? 450 ARG A CA    1 
ATOM   1040  C  C     . ARG A 1 205 ? 124.52900 128.98100 170.34700 1.000 53.99000  ? 450 ARG A C     1 
ATOM   1041  O  O     . ARG A 1 205 ? 124.66900 128.88700 169.11700 1.000 53.99000  ? 450 ARG A O     1 
ATOM   1042  C  CB    . ARG A 1 205 ? 124.09500 131.37300 170.99400 1.000 53.99000  ? 450 ARG A CB    1 
ATOM   1043  C  CG    . ARG A 1 205 ? 123.66000 131.76500 169.60100 1.000 53.99000  ? 450 ARG A CG    1 
ATOM   1044  C  CD    . ARG A 1 205 ? 122.83300 133.03600 169.62900 1.000 53.99000  ? 450 ARG A CD    1 
ATOM   1045  N  NE    . ARG A 1 205 ? 123.64000 134.19300 170.00500 1.000 53.99000  ? 450 ARG A NE    1 
ATOM   1046  C  CZ    . ARG A 1 205 ? 123.14600 135.40000 170.25500 1.000 53.99000  ? 450 ARG A CZ    1 
ATOM   1047  N  NH1   . ARG A 1 205 ? 121.84100 135.61600 170.17100 1.000 53.99000  ? 450 ARG A NH1   1 
ATOM   1048  N  NH2   . ARG A 1 205 ? 123.95700 136.39300 170.59000 1.000 53.99000  ? 450 ARG A NH2   1 
ATOM   1049  N  N     . PRO A 1 206 ? 123.92800 128.02500 171.05000 1.000 50.48000  ? 451 PRO A N     1 
ATOM   1050  C  CA    . PRO A 1 206 ? 123.59800 126.73500 170.42900 1.000 50.48000  ? 451 PRO A CA    1 
ATOM   1051  C  C     . PRO A 1 206 ? 122.52300 126.81700 169.36000 1.000 50.48000  ? 451 PRO A C     1 
ATOM   1052  O  O     . PRO A 1 206 ? 121.44400 127.37100 169.59000 1.000 50.48000  ? 451 PRO A O     1 
ATOM   1053  C  CB    . PRO A 1 206 ? 123.12200 125.89300 171.61900 1.000 50.48000  ? 451 PRO A CB    1 
ATOM   1054  C  CG    . PRO A 1 206 ? 123.72100 126.54800 172.81200 1.000 50.48000  ? 451 PRO A CG    1 
ATOM   1055  C  CD    . PRO A 1 206 ? 123.71300 128.00500 172.50400 1.000 50.48000  ? 451 PRO A CD    1 
ATOM   1056  N  N     . ILE A 1 207 ? 122.81400 126.26200 168.18600 1.000 42.73000  ? 452 ILE A N     1 
ATOM   1057  C  CA    . ILE A 1 207 ? 121.83500 126.13000 167.11300 1.000 42.73000  ? 452 ILE A CA    1 
ATOM   1058  C  C     . ILE A 1 207 ? 121.31600 124.69700 167.15400 1.000 42.73000  ? 452 ILE A C     1 
ATOM   1059  O  O     . ILE A 1 207 ? 121.98900 123.76600 166.71400 1.000 42.73000  ? 452 ILE A O     1 
ATOM   1060  C  CB    . ILE A 1 207 ? 122.43100 126.47900 165.75000 1.000 42.73000  ? 452 ILE A CB    1 
ATOM   1061  C  CG1   . ILE A 1 207 ? 122.85500 127.94300 165.72200 1.000 42.73000  ? 452 ILE A CG1   1 
ATOM   1062  C  CG2   . ILE A 1 207 ? 121.42900 126.20700 164.64700 1.000 42.73000  ? 452 ILE A CG2   1 
ATOM   1063  C  CD1   . ILE A 1 207 ? 121.70600 128.90500 165.91600 1.000 42.73000  ? 452 ILE A CD1   1 
ATOM   1064  N  N     . ILE A 1 208 ? 120.11200 124.52000 167.69000 1.000 45.40000  ? 453 ILE A N     1 
ATOM   1065  C  CA    . ILE A 1 208 ? 119.45900 123.22000 167.75500 1.000 45.40000  ? 453 ILE A CA    1 
ATOM   1066  C  C     . ILE A 1 208 ? 118.22100 123.27500 166.87600 1.000 45.40000  ? 453 ILE A C     1 
ATOM   1067  O  O     . ILE A 1 208 ? 117.34500 124.12400 167.08100 1.000 45.40000  ? 453 ILE A O     1 
ATOM   1068  C  CB    . ILE A 1 208 ? 119.09200 122.83200 169.19300 1.000 45.40000  ? 453 ILE A CB    1 
ATOM   1069  C  CG1   . ILE A 1 208 ? 120.35600 122.66200 170.03000 1.000 45.40000  ? 453 ILE A CG1   1 
ATOM   1070  C  CG2   . ILE A 1 208 ? 118.27600 121.55600 169.20300 1.000 45.40000  ? 453 ILE A CG2   1 
ATOM   1071  C  CD1   . ILE A 1 208 ? 120.08700 122.56300 171.50600 1.000 45.40000  ? 453 ILE A CD1   1 
ATOM   1072  N  N     . THR A 1 209 ? 118.14800 122.37200 165.90700 1.000 40.30000  ? 454 THR A N     1 
ATOM   1073  C  CA    . THR A 1 209 ? 117.05400 122.32200 164.95500 1.000 40.30000  ? 454 THR A CA    1 
ATOM   1074  C  C     . THR A 1 209 ? 116.31200 120.99900 165.07200 1.000 40.30000  ? 454 THR A C     1 
ATOM   1075  O  O     . THR A 1 209 ? 116.82300 120.01800 165.61900 1.000 40.30000  ? 454 THR A O     1 
ATOM   1076  C  CB    . THR A 1 209 ? 117.56800 122.51300 163.52700 1.000 40.30000  ? 454 THR A CB    1 
ATOM   1077  O  OG1   . THR A 1 209 ? 118.52500 121.49200 163.23000 1.000 40.30000  ? 454 THR A OG1   1 
ATOM   1078  C  CG2   . THR A 1 209 ? 118.22600 123.87200 163.38100 1.000 40.30000  ? 454 THR A CG2   1 
ATOM   1079  N  N     . ASP A 1 210 ? 115.09600 120.98500 164.53900 1.000 44.46000  ? 455 ASP A N     1 
ATOM   1080  C  CA    . ASP A 1 210 ? 114.18600 119.85400 164.65500 1.000 44.46000  ? 455 ASP A CA    1 
ATOM   1081  C  C     . ASP A 1 210 ? 114.12100 119.13500 163.31600 1.000 44.46000  ? 455 ASP A C     1 
ATOM   1082  O  O     . ASP A 1 210 ? 113.85100 119.76100 162.28600 1.000 44.46000  ? 455 ASP A O     1 
ATOM   1083  C  CB    . ASP A 1 210 ? 112.79900 120.33000 165.08400 1.000 44.46000  ? 455 ASP A CB    1 
ATOM   1084  C  CG    . ASP A 1 210 ? 111.88300 119.19200 165.46700 1.000 44.46000  ? 455 ASP A CG    1 
ATOM   1085  O  OD1   . ASP A 1 210 ? 112.31100 118.02300 165.38000 1.000 44.46000  ? 455 ASP A OD1   1 
ATOM   1086  O  OD2   . ASP A 1 210 ? 110.73000 119.46600 165.85800 1.000 44.46000  ? 455 ASP A OD2   1 
ATOM   1087  N  N     . LEU A 1 211 ? 114.36100 117.82300 163.33100 1.000 38.68000  ? 456 LEU A N     1 
ATOM   1088  C  CA    . LEU A 1 211 ? 114.31500 117.05800 162.08900 1.000 38.68000  ? 456 LEU A CA    1 
ATOM   1089  C  C     . LEU A 1 211 ? 112.88400 116.82800 161.62600 1.000 38.68000  ? 456 LEU A C     1 
ATOM   1090  O  O     . LEU A 1 211 ? 112.63400 116.72800 160.42000 1.000 38.68000  ? 456 LEU A O     1 
ATOM   1091  C  CB    . LEU A 1 211 ? 115.04400 115.72600 162.25800 1.000 38.68000  ? 456 LEU A CB    1 
ATOM   1092  C  CG    . LEU A 1 211 ? 115.12900 114.82500 161.02600 1.000 38.68000  ? 456 LEU A CG    1 
ATOM   1093  C  CD1   . LEU A 1 211 ? 115.86600 115.52900 159.91300 1.000 38.68000  ? 456 LEU A CD1   1 
ATOM   1094  C  CD2   . LEU A 1 211 ? 115.82400 113.52500 161.36000 1.000 38.68000  ? 456 LEU A CD2   1 
ATOM   1095  N  N     . ALA A 1 212 ? 111.93300 116.75700 162.55600 1.000 39.58000  ? 457 ALA A N     1 
ATOM   1096  C  CA    . ALA A 1 212 ? 110.53300 116.56700 162.19400 1.000 39.58000  ? 457 ALA A CA    1 
ATOM   1097  C  C     . ALA A 1 212 ? 109.94000 117.75500 161.45300 1.000 39.58000  ? 457 ALA A C     1 
ATOM   1098  O  O     . ALA A 1 212 ? 108.75800 117.70500 161.09700 1.000 39.58000  ? 457 ALA A O     1 
ATOM   1099  C  CB    . ALA A 1 212 ? 109.70200 116.27900 163.44400 1.000 39.58000  ? 457 ALA A CB    1 
ATOM   1100  N  N     . LYS A 1 213 ? 110.71100 118.81500 161.21900 1.000 37.80000  ? 458 LYS A N     1 
ATOM   1101  C  CA    . LYS A 1 213 ? 110.22900 119.99400 160.51900 1.000 37.80000  ? 458 LYS A CA    1 
ATOM   1102  C  C     . LYS A 1 213 ? 111.02800 120.31100 159.26400 1.000 37.80000  ? 458 LYS A C     1 
ATOM   1103  O  O     . LYS A 1 213 ? 110.66800 121.24500 158.54100 1.000 37.80000  ? 458 LYS A O     1 
ATOM   1104  C  CB    . LYS A 1 213 ? 110.25000 121.21300 161.45300 1.000 37.80000  ? 458 LYS A CB    1 
ATOM   1105  C  CG    . LYS A 1 213 ? 109.37300 121.07700 162.68900 1.000 37.80000  ? 458 LYS A CG    1 
ATOM   1106  C  CD    . LYS A 1 213 ? 107.90400 120.98200 162.32300 1.000 37.80000  ? 458 LYS A CD    1 
ATOM   1107  C  CE    . LYS A 1 213 ? 107.39800 122.29300 161.74800 1.000 37.80000  ? 458 LYS A CE    1 
ATOM   1108  N  NZ    . LYS A 1 213 ? 107.44000 123.38700 162.75600 1.000 37.80000  ? 458 LYS A NZ    1 
ATOM   1109  N  N     . MET A 1 214 ? 112.09600 119.56600 158.98200 1.000 36.31000  ? 459 MET A N     1 
ATOM   1110  C  CA    . MET A 1 214 ? 112.98000 119.89300 157.87100 1.000 36.31000  ? 459 MET A CA    1 
ATOM   1111  C  C     . MET A 1 214 ? 112.36900 119.51100 156.52500 1.000 36.31000  ? 459 MET A C     1 
ATOM   1112  O  O     . MET A 1 214 ? 112.29100 120.36500 155.63400 1.000 36.31000  ? 459 MET A O     1 
ATOM   1113  C  CB    . MET A 1 214 ? 114.34400 119.22700 158.05800 1.000 36.31000  ? 459 MET A CB    1 
ATOM   1114  C  CG    . MET A 1 214 ? 115.13000 119.80000 159.21000 1.000 36.31000  ? 459 MET A CG    1 
ATOM   1115  S  SD    . MET A 1 214 ? 116.71200 118.99200 159.42500 1.000 36.31000  ? 459 MET A SD    1 
ATOM   1116  C  CE    . MET A 1 214 ? 117.33500 119.87800 160.84200 1.000 36.31000  ? 459 MET A CE    1 
ATOM   1117  N  N     . PRO A 1 215 ? 111.91800 118.25900 156.31500 1.000 35.48000  ? 460 PRO A N     1 
ATOM   1118  C  CA    . PRO A 1 215 ? 111.96000 117.02800 157.10900 1.000 35.48000  ? 460 PRO A CA    1 
ATOM   1119  C  C     . PRO A 1 215 ? 112.97900 116.01300 156.60000 1.000 35.48000  ? 460 PRO A C     1 
ATOM   1120  O  O     . PRO A 1 215 ? 112.82600 114.82500 156.86500 1.000 35.48000  ? 460 PRO A O     1 
ATOM   1121  C  CB    . PRO A 1 215 ? 110.55400 116.47500 156.94900 1.000 35.48000  ? 460 PRO A CB    1 
ATOM   1122  C  CG    . PRO A 1 215 ? 110.20200 116.86700 155.56200 1.000 35.48000  ? 460 PRO A CG    1 
ATOM   1123  C  CD    . PRO A 1 215 ? 110.85500 118.19400 155.30200 1.000 35.48000  ? 460 PRO A CD    1 
ATOM   1124  N  N     . HIS A 1 216 ? 113.99800 116.46700 155.87200 1.000 34.64000  ? 461 HIS A N     1 
ATOM   1125  C  CA    . HIS A 1 216 ? 114.98500 115.56800 155.28800 1.000 34.64000  ? 461 HIS A CA    1 
ATOM   1126  C  C     . HIS A 1 216 ? 116.30200 116.31400 155.14500 1.000 34.64000  ? 461 HIS A C     1 
ATOM   1127  O  O     . HIS A 1 216 ? 116.31800 117.51800 154.88600 1.000 34.64000  ? 461 HIS A O     1 
ATOM   1128  C  CB    . HIS A 1 216 ? 114.53200 115.04400 153.92000 1.000 34.64000  ? 461 HIS A CB    1 
ATOM   1129  C  CG    . HIS A 1 216 ? 113.28300 114.22000 153.96400 1.000 34.64000  ? 461 HIS A CG    1 
ATOM   1130  N  ND1   . HIS A 1 216 ? 112.02600 114.77400 153.86400 1.000 34.64000  ? 461 HIS A ND1   1 
ATOM   1131  C  CD2   . HIS A 1 216 ? 113.09600 112.88500 154.08100 1.000 34.64000  ? 461 HIS A CD2   1 
ATOM   1132  C  CE1   . HIS A 1 216 ? 111.11800 113.81700 153.92500 1.000 34.64000  ? 461 HIS A CE1   1 
ATOM   1133  N  NE2   . HIS A 1 216 ? 111.74100 112.66000 154.05600 1.000 34.64000  ? 461 HIS A NE2   1 
ATOM   1134  N  N     . LEU A 1 217 ? 117.40600 115.59300 155.30700 1.000 33.64000  ? 462 LEU A N     1 
ATOM   1135  C  CA    . LEU A 1 217 ? 118.73300 116.18800 155.25500 1.000 33.64000  ? 462 LEU A CA    1 
ATOM   1136  C  C     . LEU A 1 217 ? 119.51500 115.70400 154.04400 1.000 33.64000  ? 462 LEU A C     1 
ATOM   1137  O  O     . LEU A 1 217 ? 119.25600 114.63400 153.49300 1.000 33.64000  ? 462 LEU A O     1 
ATOM   1138  C  CB    . LEU A 1 217 ? 119.52300 115.87500 156.52600 1.000 33.64000  ? 462 LEU A CB    1 
ATOM   1139  C  CG    . LEU A 1 217 ? 119.08300 116.61700 157.77400 1.000 33.64000  ? 462 LEU A CG    1 
ATOM   1140  C  CD1   . LEU A 1 217 ? 119.82200 116.07900 158.96800 1.000 33.64000  ? 462 LEU A CD1   1 
ATOM   1141  C  CD2   . LEU A 1 217 ? 119.40000 118.07300 157.57500 1.000 33.64000  ? 462 LEU A CD2   1 
ATOM   1142  N  N     . LEU A 1 218 ? 120.48300 116.51900 153.63600 1.000 31.18000  ? 463 LEU A N     1 
ATOM   1143  C  CA    . LEU A 1 218 ? 121.36300 116.20700 152.51800 1.000 31.18000  ? 463 LEU A CA    1 
ATOM   1144  C  C     . LEU A 1 218 ? 122.80400 116.56100 152.88200 1.000 31.18000  ? 463 LEU A C     1 
ATOM   1145  O  O     . LEU A 1 218 ? 123.49500 117.28400 152.16300 1.000 31.18000  ? 463 LEU A O     1 
ATOM   1146  C  CB    . LEU A 1 218 ? 120.90400 116.91900 151.24800 1.000 31.18000  ? 463 LEU A CB    1 
ATOM   1147  C  CG    . LEU A 1 218 ? 121.59600 116.49000 149.95700 1.000 31.18000  ? 463 LEU A CG    1 
ATOM   1148  C  CD1   . LEU A 1 218 ? 121.32900 115.03000 149.70300 1.000 31.18000  ? 463 LEU A CD1   1 
ATOM   1149  C  CD2   . LEU A 1 218 ? 121.11700 117.32700 148.79600 1.000 31.18000  ? 463 LEU A CD2   1 
ATOM   1150  N  N     . VAL A 1 219 ? 123.24600 116.09500 154.05300 1.000 33.41000  ? 464 VAL A N     1 
ATOM   1151  C  CA    . VAL A 1 219 ? 124.60800 116.33600 154.52000 1.000 33.41000  ? 464 VAL A CA    1 
ATOM   1152  C  C     . VAL A 1 219 ? 125.60600 116.04400 153.40900 1.000 33.41000  ? 464 VAL A C     1 
ATOM   1153  O  O     . VAL A 1 219 ? 125.57300 114.97500 152.79100 1.000 33.41000  ? 464 VAL A O     1 
ATOM   1154  C  CB    . VAL A 1 219 ? 124.89000 115.48200 155.76700 1.000 33.41000  ? 464 VAL A CB    1 
ATOM   1155  C  CG1   . VAL A 1 219 ? 126.33100 115.63100 156.19100 1.000 33.41000  ? 464 VAL A CG1   1 
ATOM   1156  C  CG2   . VAL A 1 219 ? 123.95500 115.87000 156.89600 1.000 33.41000  ? 464 VAL A CG2   1 
ATOM   1157  N  N     . ALA A 1 220 ? 126.50200 116.99500 153.15400 1.000 34.19000  ? 465 ALA A N     1 
ATOM   1158  C  CA    . ALA A 1 220 ? 127.44600 116.88200 152.05200 1.000 34.19000  ? 465 ALA A CA    1 
ATOM   1159  C  C     . ALA A 1 220 ? 128.71400 117.65200 152.39000 1.000 34.19000  ? 465 ALA A C     1 
ATOM   1160  O  O     . ALA A 1 220 ? 128.73600 118.48100 153.30300 1.000 34.19000  ? 465 ALA A O     1 
ATOM   1161  C  CB    . ALA A 1 220 ? 126.84000 117.39500 150.74400 1.000 34.19000  ? 465 ALA A CB    1 
ATOM   1162  N  N     . GLY A 1 221 ? 129.77600 117.36700 151.64000 1.000 38.04000  ? 466 GLY A N     1 
ATOM   1163  C  CA    . GLY A 1 221 ? 131.07300 117.96900 151.89100 1.000 38.04000  ? 466 GLY A CA    1 
ATOM   1164  C  C     . GLY A 1 221 ? 132.21900 117.05200 151.51700 1.000 38.04000  ? 466 GLY A C     1 
ATOM   1165  O  O     . GLY A 1 221 ? 132.11900 115.83500 151.69000 1.000 38.04000  ? 466 GLY A O     1 
ATOM   1166  N  N     . THR A 1 222 ? 133.31100 117.61000 151.00300 1.000 39.50000  ? 467 THR A N     1 
ATOM   1167  C  CA    . THR A 1 222 ? 134.40000 116.78700 150.49900 1.000 39.50000  ? 467 THR A CA    1 
ATOM   1168  C  C     . THR A 1 222 ? 135.12400 116.08900 151.64800 1.000 39.50000  ? 467 THR A C     1 
ATOM   1169  O  O     . THR A 1 222 ? 134.90600 116.37400 152.82800 1.000 39.50000  ? 467 THR A O     1 
ATOM   1170  C  CB    . THR A 1 222 ? 135.37300 117.63100 149.68300 1.000 39.50000  ? 467 THR A CB    1 
ATOM   1171  O  OG1   . THR A 1 222 ? 135.92800 118.65600 150.51400 1.000 39.50000  ? 467 THR A OG1   1 
ATOM   1172  C  CG2   . THR A 1 222 ? 134.66000 118.26200 148.50100 1.000 39.50000  ? 467 THR A CG2   1 
ATOM   1173  N  N     . THR A 1 223 ? 136.00500 115.16100 151.28300 1.000 43.35000  ? 468 THR A N     1 
ATOM   1174  C  CA    . THR A 1 223 ? 136.72700 114.32400 152.24000 1.000 43.35000  ? 468 THR A CA    1 
ATOM   1175  C  C     . THR A 1 223 ? 137.63100 115.19600 153.09600 1.000 43.35000  ? 468 THR A C     1 
ATOM   1176  O  O     . THR A 1 223 ? 138.59300 115.78700 152.60300 1.000 43.35000  ? 468 THR A O     1 
ATOM   1177  C  CB    . THR A 1 223 ? 137.54000 113.26300 151.51000 1.000 43.35000  ? 468 THR A CB    1 
ATOM   1178  O  OG1   . THR A 1 223 ? 138.52000 113.90000 150.68300 1.000 43.35000  ? 468 THR A OG1   1 
ATOM   1179  C  CG2   . THR A 1 223 ? 136.63700 112.40400 150.64200 1.000 43.35000  ? 468 THR A CG2   1 
ATOM   1180  N  N     . GLY A 1 224 ? 137.33000 115.27600 154.38700 1.000 43.27000  ? 469 GLY A N     1 
ATOM   1181  C  CA    . GLY A 1 224 ? 138.16000 116.03500 155.29700 1.000 43.27000  ? 469 GLY A CA    1 
ATOM   1182  C  C     . GLY A 1 224 ? 137.36000 116.89100 156.25200 1.000 43.27000  ? 469 GLY A C     1 
ATOM   1183  O  O     . GLY A 1 224 ? 137.83300 117.22400 157.34200 1.000 43.27000  ? 469 GLY A O     1 
ATOM   1184  N  N     . SER A 1 225 ? 136.14800 117.25700 155.85300 1.000 45.01000  ? 470 SER A N     1 
ATOM   1185  C  CA    . SER A 1 225 ? 135.28200 118.03000 156.72300 1.000 45.01000  ? 470 SER A CA    1 
ATOM   1186  C  C     . SER A 1 225 ? 134.54600 117.11000 157.68900 1.000 45.01000  ? 470 SER A C     1 
ATOM   1187  O  O     . SER A 1 225 ? 134.55600 115.88400 157.55300 1.000 45.01000  ? 470 SER A O     1 
ATOM   1188  C  CB    . SER A 1 225 ? 134.28100 118.83600 155.90600 1.000 45.01000  ? 470 SER A CB    1 
ATOM   1189  O  OG    . SER A 1 225 ? 133.39200 117.97400 155.22500 1.000 45.01000  ? 470 SER A OG    1 
ATOM   1190  N  N     . GLY A 1 226 ? 133.90000 117.72000 158.67600 1.000 48.38000  ? 471 GLY A N     1 
ATOM   1191  C  CA    . GLY A 1 226 ? 133.25000 116.96100 159.72400 1.000 48.38000  ? 471 GLY A CA    1 
ATOM   1192  C  C     . GLY A 1 226 ? 131.90200 116.38700 159.34500 1.000 48.38000  ? 471 GLY A C     1 
ATOM   1193  O  O     . GLY A 1 226 ? 130.87500 116.80800 159.88100 1.000 48.38000  ? 471 GLY A O     1 
ATOM   1194  N  N     . LYS A 1 227 ? 131.88600 115.41700 158.43400 1.000 41.25000  ? 472 LYS A N     1 
ATOM   1195  C  CA    . LYS A 1 227 ? 130.64800 114.73100 158.09400 1.000 41.25000  ? 472 LYS A CA    1 
ATOM   1196  C  C     . LYS A 1 227 ? 130.35800 113.55400 159.00500 1.000 41.25000  ? 472 LYS A C     1 
ATOM   1197  O  O     . LYS A 1 227 ? 129.30700 113.53300 159.65500 1.000 41.25000  ? 472 LYS A O     1 
ATOM   1198  C  CB    . LYS A 1 227 ? 130.69400 114.21000 156.66100 1.000 41.25000  ? 472 LYS A CB    1 
ATOM   1199  C  CG    . LYS A 1 227 ? 130.74500 115.26000 155.59800 1.000 41.25000  ? 472 LYS A CG    1 
ATOM   1200  C  CD    . LYS A 1 227 ? 130.69700 114.57000 154.26900 1.000 41.25000  ? 472 LYS A CD    1 
ATOM   1201  C  CE    . LYS A 1 227 ? 131.98400 113.81500 154.07100 1.000 41.25000  ? 472 LYS A CE    1 
ATOM   1202  N  NZ    . LYS A 1 227 ? 132.03900 113.16900 152.75300 1.000 41.25000  ? 472 LYS A NZ    1 
ATOM   1203  N  N     . SER A 1 228 ? 131.26200 112.57900 159.06400 1.000 45.95000  ? 473 SER A N     1 
ATOM   1204  C  CA    . SER A 1 228 ? 131.12200 111.42900 159.94100 1.000 45.95000  ? 473 SER A CA    1 
ATOM   1205  C  C     . SER A 1 228 ? 131.03800 111.82300 161.40400 1.000 45.95000  ? 473 SER A C     1 
ATOM   1206  O  O     . SER A 1 228 ? 130.66100 110.99300 162.23600 1.000 45.95000  ? 473 SER A O     1 
ATOM   1207  C  CB    . SER A 1 228 ? 132.29300 110.46600 159.73400 1.000 45.95000  ? 473 SER A CB    1 
ATOM   1208  O  OG    . SER A 1 228 ? 132.29500 109.94800 158.41600 1.000 45.95000  ? 473 SER A OG    1 
ATOM   1209  N  N     . VAL A 1 229 ? 131.38000 113.06400 161.73700 1.000 42.63000  ? 474 VAL A N     1 
ATOM   1210  C  CA    . VAL A 1 229 ? 131.14700 113.60900 163.06800 1.000 42.63000  ? 474 VAL A CA    1 
ATOM   1211  C  C     . VAL A 1 229 ? 129.82700 114.35400 163.15400 1.000 42.63000  ? 474 VAL A C     1 
ATOM   1212  O  O     . VAL A 1 229 ? 129.18000 114.31600 164.21200 1.000 42.63000  ? 474 VAL A O     1 
ATOM   1213  C  CB    . VAL A 1 229 ? 132.30900 114.52300 163.50900 1.000 42.63000  ? 474 VAL A CB    1 
ATOM   1214  C  CG1   . VAL A 1 229 ? 132.02900 115.15100 164.85900 1.000 42.63000  ? 474 VAL A CG1   1 
ATOM   1215  C  CG2   . VAL A 1 229 ? 133.60200 113.73600 163.55000 1.000 42.63000  ? 474 VAL A CG2   1 
ATOM   1216  N  N     . GLY A 1 230 ? 129.38200 114.98700 162.07300 1.000 42.04000  ? 475 GLY A N     1 
ATOM   1217  C  CA    . GLY A 1 230 ? 128.07100 115.59700 162.05000 1.000 42.04000  ? 475 GLY A CA    1 
ATOM   1218  C  C     . GLY A 1 230 ? 126.97000 114.57100 162.21200 1.000 42.04000  ? 475 GLY A C     1 
ATOM   1219  O  O     . GLY A 1 230 ? 126.03300 114.77300 162.98800 1.000 42.04000  ? 475 GLY A O     1 
ATOM   1220  N  N     . VAL A 1 231 ? 127.08200 113.45500 161.48900 1.000 41.96000  ? 476 VAL A N     1 
ATOM   1221  C  CA    . VAL A 1 231 ? 126.08300 112.39700 161.60300 1.000 41.96000  ? 476 VAL A CA    1 
ATOM   1222  C  C     . VAL A 1 231 ? 126.07400 111.82200 163.01300 1.000 41.96000  ? 476 VAL A C     1 
ATOM   1223  O  O     . VAL A 1 231 ? 125.01100 111.52900 163.57400 1.000 41.96000  ? 476 VAL A O     1 
ATOM   1224  C  CB    . VAL A 1 231 ? 126.33600 111.30700 160.54500 1.000 41.96000  ? 476 VAL A CB    1 
ATOM   1225  C  CG1   . VAL A 1 231 ? 125.37400 110.15500 160.73800 1.000 41.96000  ? 476 VAL A CG1   1 
ATOM   1226  C  CG2   . VAL A 1 231 ? 126.20000 111.88400 159.14800 1.000 41.96000  ? 476 VAL A CG2   1 
ATOM   1227  N  N     . ASN A 1 232 ? 127.25600 111.65900 163.61300 1.000 42.99000  ? 477 ASN A N     1 
ATOM   1228  C  CA    . ASN A 1 232 ? 127.32100 111.13800 164.97400 1.000 42.99000  ? 477 ASN A CA    1 
ATOM   1229  C  C     . ASN A 1 232 ? 126.69700 112.10900 165.96500 1.000 42.99000  ? 477 ASN A C     1 
ATOM   1230  O  O     . ASN A 1 232 ? 125.97400 111.69500 166.87400 1.000 42.99000  ? 477 ASN A O     1 
ATOM   1231  C  CB    . ASN A 1 232 ? 128.76800 110.83800 165.36000 1.000 42.99000  ? 477 ASN A CB    1 
ATOM   1232  C  CG    . ASN A 1 232 ? 129.31900 109.62800 164.64300 1.000 42.99000  ? 477 ASN A CG    1 
ATOM   1233  O  OD1   . ASN A 1 232 ? 128.62700 108.62700 164.47100 1.000 42.99000  ? 477 ASN A OD1   1 
ATOM   1234  N  ND2   . ASN A 1 232 ? 130.57600 109.71000 164.22700 1.000 42.99000  ? 477 ASN A ND2   1 
ATOM   1235  N  N     . ALA A 1 233 ? 126.96800 113.40600 165.80900 1.000 43.05000  ? 478 ALA A N     1 
ATOM   1236  C  CA    . ALA A 1 233 ? 126.34700 114.39500 166.68200 1.000 43.05000  ? 478 ALA A CA    1 
ATOM   1237  C  C     . ALA A 1 233 ? 124.83400 114.37500 166.53700 1.000 43.05000  ? 478 ALA A C     1 
ATOM   1238  O  O     . ALA A 1 233 ? 124.10600 114.45300 167.53200 1.000 43.05000  ? 478 ALA A O     1 
ATOM   1239  C  CB    . ALA A 1 233 ? 126.89600 115.78600 166.37500 1.000 43.05000  ? 478 ALA A CB    1 
ATOM   1240  N  N     . MET A 1 234 ? 124.34200 114.24200 165.30600 1.000 43.53000  ? 479 MET A N     1 
ATOM   1241  C  CA    . MET A 1 234 ? 122.90300 114.18100 165.08200 1.000 43.53000  ? 479 MET A CA    1 
ATOM   1242  C  C     . MET A 1 234 ? 122.29400 112.96200 165.76400 1.000 43.53000  ? 479 MET A C     1 
ATOM   1243  O  O     . MET A 1 234 ? 121.27300 113.06200 166.45300 1.000 43.53000  ? 479 MET A O     1 
ATOM   1244  C  CB    . MET A 1 234 ? 122.61600 114.15600 163.58300 1.000 43.53000  ? 479 MET A CB    1 
ATOM   1245  C  CG    . MET A 1 234 ? 122.99700 115.43400 162.87400 1.000 43.53000  ? 479 MET A CG    1 
ATOM   1246  S  SD    . MET A 1 234 ? 122.74100 115.35900 161.09800 1.000 43.53000  ? 479 MET A SD    1 
ATOM   1247  C  CE    . MET A 1 234 ? 123.45900 116.92400 160.62300 1.000 43.53000  ? 479 MET A CE    1 
ATOM   1248  N  N     . LEU A 1 235 ? 122.91300 111.79600 165.58500 1.000 43.14000  ? 480 LEU A N     1 
ATOM   1249  C  CA    . LEU A 1 235 ? 122.34400 110.57800 166.14800 1.000 43.14000  ? 480 LEU A CA    1 
ATOM   1250  C  C     . LEU A 1 235 ? 122.45300 110.54700 167.66800 1.000 43.14000  ? 480 LEU A C     1 
ATOM   1251  O  O     . LEU A 1 235 ? 121.56200 110.01600 168.33600 1.000 43.14000  ? 480 LEU A O     1 
ATOM   1252  C  CB    . LEU A 1 235 ? 123.00200 109.35900 165.51000 1.000 43.14000  ? 480 LEU A CB    1 
ATOM   1253  C  CG    . LEU A 1 235 ? 122.61900 109.28700 164.02900 1.000 43.14000  ? 480 LEU A CG    1 
ATOM   1254  C  CD1   . LEU A 1 235 ? 123.35600 108.18800 163.29500 1.000 43.14000  ? 480 LEU A CD1   1 
ATOM   1255  C  CD2   . LEU A 1 235 ? 121.11800 109.11200 163.88600 1.000 43.14000  ? 480 LEU A CD2   1 
ATOM   1256  N  N     . LEU A 1 236 ? 123.50500 111.13100 168.24300 1.000 46.34000  ? 481 LEU A N     1 
ATOM   1257  C  CA    . LEU A 1 236 ? 123.53900 111.26200 169.69600 1.000 46.34000  ? 481 LEU A CA    1 
ATOM   1258  C  C     . LEU A 1 236 ? 122.52500 112.28200 170.19300 1.000 46.34000  ? 481 LEU A C     1 
ATOM   1259  O  O     . LEU A 1 236 ? 121.99900 112.13700 171.30200 1.000 46.34000  ? 481 LEU A O     1 
ATOM   1260  C  CB    . LEU A 1 236 ? 124.94300 111.62300 170.17500 1.000 46.34000  ? 481 LEU A CB    1 
ATOM   1261  C  CG    . LEU A 1 236 ? 125.87200 110.44300 170.47100 1.000 46.34000  ? 481 LEU A CG    1 
ATOM   1262  C  CD1   . LEU A 1 236 ? 126.30100 109.71300 169.21600 1.000 46.34000  ? 481 LEU A CD1   1 
ATOM   1263  C  CD2   . LEU A 1 236 ? 127.08400 110.91200 171.25600 1.000 46.34000  ? 481 LEU A CD2   1 
ATOM   1264  N  N     . SER A 1 237 ? 122.23100 113.31100 169.39600 1.000 45.96000  ? 482 SER A N     1 
ATOM   1265  C  CA    . SER A 1 237 ? 121.13400 114.20600 169.74000 1.000 45.96000  ? 482 SER A CA    1 
ATOM   1266  C  C     . SER A 1 237 ? 119.81600 113.45300 169.74400 1.000 45.96000  ? 482 SER A C     1 
ATOM   1267  O  O     . SER A 1 237 ? 118.92700 113.73800 170.55200 1.000 45.96000  ? 482 SER A O     1 
ATOM   1268  C  CB    . SER A 1 237 ? 121.07900 115.36900 168.75500 1.000 45.96000  ? 482 SER A CB    1 
ATOM   1269  O  OG    . SER A 1 237 ? 122.27900 116.11400 168.79800 1.000 45.96000  ? 482 SER A OG    1 
ATOM   1270  N  N     . ILE A 1 238 ? 119.67300 112.49100 168.83400 1.000 46.67000  ? 483 ILE A N     1 
ATOM   1271  C  CA    . ILE A 1 238 ? 118.50300 111.61800 168.85100 1.000 46.67000  ? 483 ILE A CA    1 
ATOM   1272  C  C     . ILE A 1 238 ? 118.48500 110.79700 170.13300 1.000 46.67000  ? 483 ILE A C     1 
ATOM   1273  O  O     . ILE A 1 238 ? 117.45800 110.69000 170.81200 1.000 46.67000  ? 483 ILE A O     1 
ATOM   1274  C  CB    . ILE A 1 238 ? 118.48700 110.70200 167.61500 1.000 46.67000  ? 483 ILE A CB    1 
ATOM   1275  C  CG1   . ILE A 1 238 ? 118.61800 111.51000 166.32900 1.000 46.67000  ? 483 ILE A CG1   1 
ATOM   1276  C  CG2   . ILE A 1 238 ? 117.20500 109.89100 167.58000 1.000 46.67000  ? 483 ILE A CG2   1 
ATOM   1277  C  CD1   . ILE A 1 238 ? 117.53600 112.50000 166.14000 1.000 46.67000  ? 483 ILE A CD1   1 
ATOM   1278  N  N     . LEU A 1 239 ? 119.63100 110.21000 170.48500 1.000 48.23000  ? 484 LEU A N     1 
ATOM   1279  C  CA    . LEU A 1 239 ? 119.65600 109.19100 171.53000 1.000 48.23000  ? 484 LEU A CA    1 
ATOM   1280  C  C     . LEU A 1 239 ? 119.50000 109.79000 172.92100 1.000 48.23000  ? 484 LEU A C     1 
ATOM   1281  O  O     . LEU A 1 239 ? 118.81300 109.21500 173.77100 1.000 48.23000  ? 484 LEU A O     1 
ATOM   1282  C  CB    . LEU A 1 239 ? 120.95000 108.38500 171.44900 1.000 48.23000  ? 484 LEU A CB    1 
ATOM   1283  C  CG    . LEU A 1 239 ? 121.13800 107.53000 170.19800 1.000 48.23000  ? 484 LEU A CG    1 
ATOM   1284  C  CD1   . LEU A 1 239 ? 122.50000 106.86300 170.21100 1.000 48.23000  ? 484 LEU A CD1   1 
ATOM   1285  C  CD2   . LEU A 1 239 ? 120.03600 106.50200 170.08000 1.000 48.23000  ? 484 LEU A CD2   1 
ATOM   1286  N  N     . PHE A 1 240 ? 120.11800 110.94100 173.18000 1.000 50.87000  ? 485 PHE A N     1 
ATOM   1287  C  CA    . PHE A 1 240 ? 120.02600 111.50600 174.52300 1.000 50.87000  ? 485 PHE A CA    1 
ATOM   1288  C  C     . PHE A 1 240 ? 118.64600 112.04500 174.85900 1.000 50.87000  ? 485 PHE A C     1 
ATOM   1289  O  O     . PHE A 1 240 ? 118.46100 112.55700 175.96700 1.000 50.87000  ? 485 PHE A O     1 
ATOM   1290  C  CB    . PHE A 1 240 ? 121.04900 112.62600 174.71200 1.000 50.87000  ? 485 PHE A CB    1 
ATOM   1291  C  CG    . PHE A 1 240 ? 122.44200 112.14300 174.96600 1.000 50.87000  ? 485 PHE A CG    1 
ATOM   1292  C  CD1   . PHE A 1 240 ? 122.68700 110.82900 175.30800 1.000 50.87000  ? 485 PHE A CD1   1 
ATOM   1293  C  CD2   . PHE A 1 240 ? 123.50600 113.01800 174.88900 1.000 50.87000  ? 485 PHE A CD2   1 
ATOM   1294  C  CE1   . PHE A 1 240 ? 123.97200 110.39700 175.55200 1.000 50.87000  ? 485 PHE A CE1   1 
ATOM   1295  C  CE2   . PHE A 1 240 ? 124.78900 112.59300 175.13000 1.000 50.87000  ? 485 PHE A CE2   1 
ATOM   1296  C  CZ    . PHE A 1 240 ? 125.02300 111.28400 175.46500 1.000 50.87000  ? 485 PHE A CZ    1 
ATOM   1297  N  N     . LYS A 1 241 ? 117.68000 111.94700 173.95300 1.000 52.86000  ? 486 LYS A N     1 
ATOM   1298  C  CA    . LYS A 1 241 ? 116.37900 112.54700 174.19200 1.000 52.86000  ? 486 LYS A CA    1 
ATOM   1299  C  C     . LYS A 1 241 ? 115.21800 111.66500 173.75100 1.000 52.86000  ? 486 LYS A C     1 
ATOM   1300  O  O     . LYS A 1 241 ? 114.06400 112.02800 173.99600 1.000 52.86000  ? 486 LYS A O     1 
ATOM   1301  C  CB    . LYS A 1 241 ? 116.31800 113.91200 173.48300 1.000 52.86000  ? 486 LYS A CB    1 
ATOM   1302  C  CG    . LYS A 1 241 ? 115.11900 114.77300 173.79800 1.000 52.86000  ? 486 LYS A CG    1 
ATOM   1303  C  CD    . LYS A 1 241 ? 115.28200 116.13200 173.17200 1.000 52.86000  ? 486 LYS A CD    1 
ATOM   1304  C  CE    . LYS A 1 241 ? 114.01100 116.92900 173.27300 1.000 52.86000  ? 486 LYS A CE    1 
ATOM   1305  N  NZ    . LYS A 1 241 ? 113.67900 117.25300 174.68500 1.000 52.86000  ? 486 LYS A NZ    1 
ATOM   1306  N  N     . SER A 1 242 ? 115.47600 110.50300 173.15700 1.000 53.74000  ? 487 SER A N     1 
ATOM   1307  C  CA    . SER A 1 242 ? 114.42300 109.69300 172.55200 1.000 53.74000  ? 487 SER A CA    1 
ATOM   1308  C  C     . SER A 1 242 ? 114.56500 108.24600 172.99900 1.000 53.74000  ? 487 SER A C     1 
ATOM   1309  O  O     . SER A 1 242 ? 115.54000 107.57500 172.64700 1.000 53.74000  ? 487 SER A O     1 
ATOM   1310  C  CB    . SER A 1 242 ? 114.47200 109.79200 171.03000 1.000 53.74000  ? 487 SER A CB    1 
ATOM   1311  O  OG    . SER A 1 242 ? 114.24200 111.12300 170.60700 1.000 53.74000  ? 487 SER A OG    1 
ATOM   1312  N  N     . THR A 1 243 ? 113.59400 107.77200 173.76600 1.000 57.01000  ? 488 THR A N     1 
ATOM   1313  C  CA    . THR A 1 243 ? 113.50100 106.36500 174.10400 1.000 57.01000  ? 488 THR A CA    1 
ATOM   1314  C  C     . THR A 1 243 ? 113.01800 105.57400 172.89300 1.000 57.01000  ? 488 THR A C     1 
ATOM   1315  O  O     . THR A 1 243 ? 112.39000 106.13000 171.98900 1.000 57.01000  ? 488 THR A O     1 
ATOM   1316  C  CB    . THR A 1 243 ? 112.54600 106.17200 175.27800 1.000 57.01000  ? 488 THR A CB    1 
ATOM   1317  O  OG1   . THR A 1 243 ? 111.24000 106.63300 174.91300 1.000 57.01000  ? 488 THR A OG1   1 
ATOM   1318  C  CG2   . THR A 1 243 ? 113.03000 106.95200 176.48600 1.000 57.01000  ? 488 THR A CG2   1 
ATOM   1319  N  N     . PRO A 1 244 ? 113.30200 104.26900 172.84300 1.000 54.20000  ? 489 PRO A N     1 
ATOM   1320  C  CA    . PRO A 1 244 ? 112.87700 103.46800 171.68300 1.000 54.20000  ? 489 PRO A CA    1 
ATOM   1321  C  C     . PRO A 1 244 ? 111.37500 103.45300 171.44900 1.000 54.20000  ? 489 PRO A C     1 
ATOM   1322  O  O     . PRO A 1 244 ? 110.93100 102.87200 170.45300 1.000 54.20000  ? 489 PRO A O     1 
ATOM   1323  C  CB    . PRO A 1 244 ? 113.39800 102.06400 172.01700 1.000 54.20000  ? 489 PRO A CB    1 
ATOM   1324  C  CG    . PRO A 1 244 ? 114.53700 102.30400 172.93100 1.000 54.20000  ? 489 PRO A CG    1 
ATOM   1325  C  CD    . PRO A 1 244 ? 114.15500 103.49200 173.75800 1.000 54.20000  ? 489 PRO A CD    1 
ATOM   1326  N  N     . SER A 1 245 ? 110.57900 104.05700 172.32300 1.000 58.27000  ? 490 SER A N     1 
ATOM   1327  C  CA    . SER A 1 245 ? 109.15400 104.20500 172.08100 1.000 58.27000  ? 490 SER A CA    1 
ATOM   1328  C  C     . SER A 1 245 ? 108.79700 105.58300 171.54200 1.000 58.27000  ? 490 SER A C     1 
ATOM   1329  O  O     . SER A 1 245 ? 107.61900 105.95500 171.55900 1.000 58.27000  ? 490 SER A O     1 
ATOM   1330  C  CB    . SER A 1 245 ? 108.36900 103.92700 173.36400 1.000 58.27000  ? 490 SER A CB    1 
ATOM   1331  O  OG    . SER A 1 245 ? 108.63900 104.90700 174.34800 1.000 58.27000  ? 490 SER A OG    1 
ATOM   1332  N  N     . GLU A 1 246 ? 109.78200 106.34900 171.07300 1.000 57.53000  ? 491 GLU A N     1 
ATOM   1333  C  CA    . GLU A 1 246 ? 109.50000 107.65500 170.49100 1.000 57.53000  ? 491 GLU A CA    1 
ATOM   1334  C  C     . GLU A 1 246 ? 110.20900 107.85400 169.15800 1.000 57.53000  ? 491 GLU A C     1 
ATOM   1335  O  O     . GLU A 1 246 ? 109.71000 108.58000 168.29300 1.000 57.53000  ? 491 GLU A O     1 
ATOM   1336  C  CB    . GLU A 1 246 ? 109.90200 108.76800 171.45700 1.000 57.53000  ? 491 GLU A CB    1 
ATOM   1337  C  CG    . GLU A 1 246 ? 109.06700 108.82700 172.71700 1.000 57.53000  ? 491 GLU A CG    1 
ATOM   1338  C  CD    . GLU A 1 246 ? 109.49300 109.95000 173.63500 1.000 57.53000  ? 491 GLU A CD    1 
ATOM   1339  O  OE1   . GLU A 1 246 ? 110.51500 110.60200 173.34000 1.000 57.53000  ? 491 GLU A OE1   1 
ATOM   1340  O  OE2   . GLU A 1 246 ? 108.80500 110.18300 174.64900 1.000 57.53000  ? 491 GLU A OE2   1 
ATOM   1341  N  N     . ALA A 1 247 ? 111.36900 107.22300 168.97600 1.000 49.49000  ? 492 ALA A N     1 
ATOM   1342  C  CA    . ALA A 1 247 ? 112.14600 107.42500 167.75400 1.000 49.49000  ? 492 ALA A CA    1 
ATOM   1343  C  C     . ALA A 1 247 ? 113.00000 106.18500 167.50700 1.000 49.49000  ? 492 ALA A C     1 
ATOM   1344  O  O     . ALA A 1 247 ? 114.04800 106.02100 168.13600 1.000 49.49000  ? 492 ALA A O     1 
ATOM   1345  C  CB    . ALA A 1 247 ? 113.00400 108.67700 167.85500 1.000 49.49000  ? 492 ALA A CB    1 
ATOM   1346  N  N     . ARG A 1 248 ? 112.55400 105.32900 166.59400 1.000 50.32000  ? 493 ARG A N     1 
ATOM   1347  C  CA    . ARG A 1 248 ? 113.37200 104.20800 166.16200 1.000 50.32000  ? 493 ARG A CA    1 
ATOM   1348  C  C     . ARG A 1 248 ? 114.34500 104.66900 165.07900 1.000 50.32000  ? 493 ARG A C     1 
ATOM   1349  O  O     . ARG A 1 248 ? 114.36000 105.83300 164.67500 1.000 50.32000  ? 493 ARG A O     1 
ATOM   1350  C  CB    . ARG A 1 248 ? 112.49300 103.05900 165.67700 1.000 50.32000  ? 493 ARG A CB    1 
ATOM   1351  C  CG    . ARG A 1 248 ? 111.57200 102.50100 166.74700 1.000 50.32000  ? 493 ARG A CG    1 
ATOM   1352  C  CD    . ARG A 1 248 ? 112.36100 101.86400 167.87900 1.000 50.32000  ? 493 ARG A CD    1 
ATOM   1353  N  NE    . ARG A 1 248 ? 113.14100 100.70700 167.45500 1.000 50.32000  ? 493 ARG A NE    1 
ATOM   1354  C  CZ    . ARG A 1 248 ? 112.68200 99.46100  167.44900 1.000 50.32000  ? 493 ARG A CZ    1 
ATOM   1355  N  NH1   . ARG A 1 248 ? 111.44400 99.20800  167.84200 1.000 50.32000  ? 493 ARG A NH1   1 
ATOM   1356  N  NH2   . ARG A 1 248 ? 113.46100 98.46800  167.04600 1.000 50.32000  ? 493 ARG A NH2   1 
ATOM   1357  N  N     . LEU A 1 249 ? 115.17300 103.74600 164.59900 1.000 45.95000  ? 494 LEU A N     1 
ATOM   1358  C  CA    . LEU A 1 249 ? 116.21600 104.07800 163.64100 1.000 45.95000  ? 494 LEU A CA    1 
ATOM   1359  C  C     . LEU A 1 249 ? 116.35100 102.96900 162.61100 1.000 45.95000  ? 494 LEU A C     1 
ATOM   1360  O  O     . LEU A 1 249 ? 116.00700 101.81300 162.86100 1.000 45.95000  ? 494 LEU A O     1 
ATOM   1361  C  CB    . LEU A 1 249 ? 117.56500 104.30500 164.33600 1.000 45.95000  ? 494 LEU A CB    1 
ATOM   1362  C  CG    . LEU A 1 249 ? 117.69300 105.53200 165.23500 1.000 45.95000  ? 494 LEU A CG    1 
ATOM   1363  C  CD1   . LEU A 1 249 ? 118.98500 105.49100 166.02200 1.000 45.95000  ? 494 LEU A CD1   1 
ATOM   1364  C  CD2   . LEU A 1 249 ? 117.63600 106.78900 164.39900 1.000 45.95000  ? 494 LEU A CD2   1 
ATOM   1365  N  N     . ILE A 1 250 ? 116.86300 103.34800 161.44200 1.000 41.86000  ? 495 ILE A N     1 
ATOM   1366  C  CA    . ILE A 1 250 ? 117.24800 102.42400 160.38000 1.000 41.86000  ? 495 ILE A CA    1 
ATOM   1367  C  C     . ILE A 1 250 ? 118.49300 103.00200 159.72900 1.000 41.86000  ? 495 ILE A C     1 
ATOM   1368  O  O     . ILE A 1 250 ? 118.47300 104.14400 159.26000 1.000 41.86000  ? 495 ILE A O     1 
ATOM   1369  C  CB    . ILE A 1 250 ? 116.14700 102.22700 159.32400 1.000 41.86000  ? 495 ILE A CB    1 
ATOM   1370  C  CG1   . ILE A 1 250 ? 114.94300 101.49600 159.91400 1.000 41.86000  ? 495 ILE A CG1   1 
ATOM   1371  C  CG2   . ILE A 1 250 ? 116.68900 101.47900 158.11800 1.000 41.86000  ? 495 ILE A CG2   1 
ATOM   1372  C  CD1   . ILE A 1 250 ? 113.75500 101.46600 158.99300 1.000 41.86000  ? 495 ILE A CD1   1 
ATOM   1373  N  N     . MET A 1 251 ? 119.57100 102.23100 159.70000 1.000 41.78000  ? 496 MET A N     1 
ATOM   1374  C  CA    . MET A 1 251 ? 120.85500 102.73700 159.24500 1.000 41.78000  ? 496 MET A CA    1 
ATOM   1375  C  C     . MET A 1 251 ? 121.37300 101.90500 158.08500 1.000 41.78000  ? 496 MET A C     1 
ATOM   1376  O  O     . MET A 1 251 ? 121.21400 100.68100 158.06400 1.000 41.78000  ? 496 MET A O     1 
ATOM   1377  C  CB    . MET A 1 251 ? 121.86600 102.74100 160.38500 1.000 41.78000  ? 496 MET A CB    1 
ATOM   1378  C  CG    . MET A 1 251 ? 121.50000 103.70700 161.48800 1.000 41.78000  ? 496 MET A CG    1 
ATOM   1379  S  SD    . MET A 1 251 ? 122.66200 103.69200 162.85500 1.000 41.78000  ? 496 MET A SD    1 
ATOM   1380  C  CE    . MET A 1 251 ? 121.84000 104.82200 163.96500 1.000 41.78000  ? 496 MET A CE    1 
ATOM   1381  N  N     . ILE A 1 252 ? 121.99100 102.58100 157.12200 1.000 43.70000  ? 497 ILE A N     1 
ATOM   1382  C  CA    . ILE A 1 252 ? 122.59300 101.94500 155.95900 1.000 43.70000  ? 497 ILE A CA    1 
ATOM   1383  C  C     . ILE A 1 252 ? 123.95400 102.58100 155.73100 1.000 43.70000  ? 497 ILE A C     1 
ATOM   1384  O  O     . ILE A 1 252 ? 124.09400 103.80600 155.80700 1.000 43.70000  ? 497 ILE A O     1 
ATOM   1385  C  CB    . ILE A 1 252 ? 121.71200 102.09600 154.70300 1.000 43.70000  ? 497 ILE A CB    1 
ATOM   1386  C  CG1   . ILE A 1 252 ? 120.35100 101.43900 154.91700 1.000 43.70000  ? 497 ILE A CG1   1 
ATOM   1387  C  CG2   . ILE A 1 252 ? 122.39500 101.48100 153.50500 1.000 43.70000  ? 497 ILE A CG2   1 
ATOM   1388  C  CD1   . ILE A 1 252 ? 119.34900 101.78700 153.85200 1.000 43.70000  ? 497 ILE A CD1   1 
ATOM   1389  N  N     . ASP A 1 253 ? 124.95600 101.75600 155.45200 1.000 54.73000  ? 498 ASP A N     1 
ATOM   1390  C  CA    . ASP A 1 253 ? 126.29100 102.30200 155.25800 1.000 54.73000  ? 498 ASP A CA    1 
ATOM   1391  C  C     . ASP A 1 253 ? 127.13500 101.39000 154.37800 1.000 54.73000  ? 498 ASP A C     1 
ATOM   1392  O  O     . ASP A 1 253 ? 127.43400 100.25400 154.76400 1.000 54.73000  ? 498 ASP A O     1 
ATOM   1393  C  CB    . ASP A 1 253 ? 126.96900 102.52100 156.61000 1.000 54.73000  ? 498 ASP A CB    1 
ATOM   1394  C  CG    . ASP A 1 253 ? 128.25300 103.31700 156.49700 1.000 54.73000  ? 498 ASP A CG    1 
ATOM   1395  O  OD1   . ASP A 1 253 ? 128.66200 103.64800 155.36500 1.000 54.73000  ? 498 ASP A OD1   1 
ATOM   1396  O  OD2   . ASP A 1 253 ? 128.85100 103.62800 157.54600 1.000 54.73000  ? 498 ASP A OD2   1 
ATOM   1397  N  N     . PRO A 1 254 ? 127.53800 101.85100 153.19100 1.000 55.05000  ? 499 PRO A N     1 
ATOM   1398  C  CA    . PRO A 1 254 ? 128.48600 101.06800 152.38800 1.000 55.05000  ? 499 PRO A CA    1 
ATOM   1399  C  C     . PRO A 1 254 ? 129.89300 101.08100 152.94800 1.000 55.05000  ? 499 PRO A C     1 
ATOM   1400  O  O     . PRO A 1 254 ? 130.69700 100.21700 152.58000 1.000 55.05000  ? 499 PRO A O     1 
ATOM   1401  C  CB    . PRO A 1 254 ? 128.42700 101.74600 151.01500 1.000 55.05000  ? 499 PRO A CB    1 
ATOM   1402  C  CG    . PRO A 1 254 ? 128.01900 103.13900 151.31300 1.000 55.05000  ? 499 PRO A CG    1 
ATOM   1403  C  CD    . PRO A 1 254 ? 127.09300 103.06700 152.49300 1.000 55.05000  ? 499 PRO A CD    1 
ATOM   1404  N  N     . LYS A 1 255 ? 130.22100 102.04100 153.81000 1.000 57.82000  ? 500 LYS A N     1 
ATOM   1405  C  CA    . LYS A 1 255 ? 131.49600 102.05300 154.51800 1.000 57.82000  ? 500 LYS A CA    1 
ATOM   1406  C  C     . LYS A 1 255 ? 131.26700 101.35500 155.85500 1.000 57.82000  ? 500 LYS A C     1 
ATOM   1407  O  O     . LYS A 1 255 ? 130.95900 101.97600 156.87200 1.000 57.82000  ? 500 LYS A O     1 
ATOM   1408  C  CB    . LYS A 1 255 ? 132.00900 103.47800 154.68600 1.000 57.82000  ? 500 LYS A CB    1 
ATOM   1409  C  CG    . LYS A 1 255 ? 133.38900 103.56600 155.30200 1.000 57.82000  ? 500 LYS A CG    1 
ATOM   1410  C  CD    . LYS A 1 255 ? 133.82500 105.00700 155.48700 1.000 57.82000  ? 500 LYS A CD    1 
ATOM   1411  C  CE    . LYS A 1 255 ? 134.21100 105.63900 154.16300 1.000 57.82000  ? 500 LYS A CE    1 
ATOM   1412  N  NZ    . LYS A 1 255 ? 134.77000 107.00400 154.35100 1.000 57.82000  ? 500 LYS A NZ    1 
ATOM   1413  N  N     . MET A 1 256 ? 131.42400 100.03100 155.83500 1.000 60.55000  ? 501 MET A N     1 
ATOM   1414  C  CA    . MET A 1 256 ? 131.11300 99.15100  156.95900 1.000 60.55000  ? 501 MET A CA    1 
ATOM   1415  C  C     . MET A 1 256 ? 131.64200 99.65500  158.29700 1.000 60.55000  ? 501 MET A C     1 
ATOM   1416  O  O     . MET A 1 256 ? 131.06300 99.35200  159.34500 1.000 60.55000  ? 501 MET A O     1 
ATOM   1417  C  CB    . MET A 1 256 ? 131.66100 97.75100  156.68000 1.000 60.55000  ? 501 MET A CB    1 
ATOM   1418  C  CG    . MET A 1 256 ? 130.77200 96.90700  155.78400 1.000 60.55000  ? 501 MET A CG    1 
ATOM   1419  S  SD    . MET A 1 256 ? 130.71500 97.46200  154.07100 1.000 60.55000  ? 501 MET A SD    1 
ATOM   1420  C  CE    . MET A 1 256 ? 132.30500 96.90100  153.47500 1.000 60.55000  ? 501 MET A CE    1 
ATOM   1421  N  N     . LEU A 1 257 ? 132.73700 100.41700 158.27100 1.000 63.09000  ? 502 LEU A N     1 
ATOM   1422  C  CA    . LEU A 1 257 ? 133.35200 100.90400 159.50300 1.000 63.09000  ? 502 LEU A CA    1 
ATOM   1423  C  C     . LEU A 1 257 ? 132.36900 101.71500 160.33700 1.000 63.09000  ? 502 LEU A C     1 
ATOM   1424  O  O     . LEU A 1 257 ? 132.04900 101.35300 161.47500 1.000 63.09000  ? 502 LEU A O     1 
ATOM   1425  C  CB    . LEU A 1 257 ? 134.58300 101.74600 159.17000 1.000 63.09000  ? 502 LEU A CB    1 
ATOM   1426  C  CG    . LEU A 1 257 ? 135.77200 100.99300 158.58700 1.000 63.09000  ? 502 LEU A CG    1 
ATOM   1427  C  CD1   . LEU A 1 257 ? 136.86000 101.95600 158.15700 1.000 63.09000  ? 502 LEU A CD1   1 
ATOM   1428  C  CD2   . LEU A 1 257 ? 136.29300 100.03100 159.62600 1.000 63.09000  ? 502 LEU A CD2   1 
ATOM   1429  N  N     . GLU A 1 258 ? 131.88500 102.82200 159.78700 1.000 59.45000  ? 503 GLU A N     1 
ATOM   1430  C  CA    . GLU A 1 258 ? 131.08800 103.75100 160.56600 1.000 59.45000  ? 503 GLU A CA    1 
ATOM   1431  C  C     . GLU A 1 258 ? 129.64400 103.26500 160.67800 1.000 59.45000  ? 503 GLU A C     1 
ATOM   1432  O  O     . GLU A 1 258 ? 129.19600 102.37200 159.95400 1.000 59.45000  ? 503 GLU A O     1 
ATOM   1433  C  CB    . GLU A 1 258 ? 131.16200 105.14200 159.94600 1.000 59.45000  ? 503 GLU A CB    1 
ATOM   1434  C  CG    . GLU A 1 258 ? 132.56600 105.71300 160.00500 1.000 59.45000  ? 503 GLU A CG    1 
ATOM   1435  C  CD    . GLU A 1 258 ? 132.68400 107.06000 159.33500 1.000 59.45000  ? 503 GLU A CD    1 
ATOM   1436  O  OE1   . GLU A 1 258 ? 131.69200 107.50900 158.72600 1.000 59.45000  ? 503 GLU A OE1   1 
ATOM   1437  O  OE2   . GLU A 1 258 ? 133.77500 107.66400 159.41100 1.000 59.45000  ? 503 GLU A OE2   1 
ATOM   1438  N  N     . LEU A 1 259 ? 128.92800 103.84600 161.64100 1.000 51.68000  ? 504 LEU A N     1 
ATOM   1439  C  CA    . LEU A 1 259 ? 127.54300 103.51100 161.95800 1.000 51.68000  ? 504 LEU A CA    1 
ATOM   1440  C  C     . LEU A 1 259 ? 127.38600 102.06900 162.42600 1.000 51.68000  ? 504 LEU A C     1 
ATOM   1441  O  O     . LEU A 1 259 ? 126.26900 101.62400 162.70100 1.000 51.68000  ? 504 LEU A O     1 
ATOM   1442  C  CB    . LEU A 1 259 ? 126.62200 103.76900 160.76500 1.000 51.68000  ? 504 LEU A CB    1 
ATOM   1443  C  CG    . LEU A 1 259 ? 126.40700 105.22800 160.37400 1.000 51.68000  ? 504 LEU A CG    1 
ATOM   1444  C  CD1   . LEU A 1 259 ? 125.52800 105.29600 159.15000 1.000 51.68000  ? 504 LEU A CD1   1 
ATOM   1445  C  CD2   . LEU A 1 259 ? 125.78900 106.00300 161.51800 1.000 51.68000  ? 504 LEU A CD2   1 
ATOM   1446  N  N     . SER A 1 260 ? 128.48800 101.33300 162.52500 1.000 55.23000  ? 505 SER A N     1 
ATOM   1447  C  CA    . SER A 1 260 ? 128.47200 100.02600 163.15900 1.000 55.23000  ? 505 SER A CA    1 
ATOM   1448  C  C     . SER A 1 260 ? 128.75100 100.11300 164.64900 1.000 55.23000  ? 505 SER A C     1 
ATOM   1449  O  O     . SER A 1 260 ? 128.53800 99.13100  165.36500 1.000 55.23000  ? 505 SER A O     1 
ATOM   1450  C  CB    . SER A 1 260 ? 129.49200 99.09900  162.49600 1.000 55.23000  ? 505 SER A CB    1 
ATOM   1451  O  OG    . SER A 1 260 ? 129.13600 98.84000  161.15100 1.000 55.23000  ? 505 SER A OG    1 
ATOM   1452  N  N     . ILE A 1 261 ? 129.22800 101.26500 165.12100 1.000 55.23000  ? 506 ILE A N     1 
ATOM   1453  C  CA    . ILE A 1 261 ? 129.39100 101.49200 166.55100 1.000 55.23000  ? 506 ILE A CA    1 
ATOM   1454  C  C     . ILE A 1 261 ? 128.04100 101.43000 167.24400 1.000 55.23000  ? 506 ILE A C     1 
ATOM   1455  O  O     . ILE A 1 261 ? 127.94200 101.02600 168.40900 1.000 55.23000  ? 506 ILE A O     1 
ATOM   1456  C  CB    . ILE A 1 261 ? 130.08200 102.84700 166.77900 1.000 55.23000  ? 506 ILE A CB    1 
ATOM   1457  C  CG1   . ILE A 1 261 ? 131.41100 102.88800 166.02900 1.000 55.23000  ? 506 ILE A CG1   1 
ATOM   1458  C  CG2   . ILE A 1 261 ? 130.33200 103.07500 168.25400 1.000 55.23000  ? 506 ILE A CG2   1 
ATOM   1459  C  CD1   . ILE A 1 261 ? 131.99400 104.26700 165.93200 1.000 55.23000  ? 506 ILE A CD1   1 
ATOM   1460  N  N     . TYR A 1 262 ? 126.98300 101.81200 166.53600 1.000 50.86000  ? 507 TYR A N     1 
ATOM   1461  C  CA    . TYR A 1 262 ? 125.61700 101.83600 167.03900 1.000 50.86000  ? 507 TYR A CA    1 
ATOM   1462  C  C     . TYR A 1 262 ? 124.98900 100.45400 167.12800 1.000 50.86000  ? 507 TYR A C     1 
ATOM   1463  O  O     . TYR A 1 262 ? 123.87100 100.33100 167.63900 1.000 50.86000  ? 507 TYR A O     1 
ATOM   1464  C  CB    . TYR A 1 262 ? 124.77600 102.73100 166.13000 1.000 50.86000  ? 507 TYR A CB    1 
ATOM   1465  C  CG    . TYR A 1 262 ? 125.17200 104.18000 166.20500 1.000 50.86000  ? 507 TYR A CG    1 
ATOM   1466  C  CD1   . TYR A 1 262 ? 125.72800 104.70200 167.35700 1.000 50.86000  ? 507 TYR A CD1   1 
ATOM   1467  C  CD2   . TYR A 1 262 ? 125.07000 105.00400 165.10000 1.000 50.86000  ? 507 TYR A CD2   1 
ATOM   1468  C  CE1   . TYR A 1 262 ? 126.10600 106.02200 167.42800 1.000 50.86000  ? 507 TYR A CE1   1 
ATOM   1469  C  CE2   . TYR A 1 262 ? 125.45700 106.32100 165.16000 1.000 50.86000  ? 507 TYR A CE2   1 
ATOM   1470  C  CZ    . TYR A 1 262 ? 125.97400 106.82500 166.32400 1.000 50.86000  ? 507 TYR A CZ    1 
ATOM   1471  O  OH    . TYR A 1 262 ? 126.36000 108.14100 166.38400 1.000 50.86000  ? 507 TYR A OH    1 
ATOM   1472  N  N     . GLU A 1 263 ? 125.67600 99.42000  166.64800 1.000 60.28000  ? 508 GLU A N     1 
ATOM   1473  C  CA    . GLU A 1 263 ? 125.12900 98.07100  166.61500 1.000 60.28000  ? 508 GLU A CA    1 
ATOM   1474  C  C     . GLU A 1 263 ? 124.75600 97.58000  168.00600 1.000 60.28000  ? 508 GLU A C     1 
ATOM   1475  O  O     . GLU A 1 263 ? 125.62900 97.40100  168.86000 1.000 60.28000  ? 508 GLU A O     1 
ATOM   1476  C  CB    . GLU A 1 263 ? 126.13500 97.11200  165.97900 1.000 60.28000  ? 508 GLU A CB    1 
ATOM   1477  C  CG    . GLU A 1 263 ? 125.64500 95.68600  165.85500 1.000 60.28000  ? 508 GLU A CG    1 
ATOM   1478  C  CD    . GLU A 1 263 ? 124.50400 95.55200  164.87400 1.000 60.28000  ? 508 GLU A CD    1 
ATOM   1479  O  OE1   . GLU A 1 263 ? 124.40500 96.39600  163.96100 1.000 60.28000  ? 508 GLU A OE1   1 
ATOM   1480  O  OE2   . GLU A 1 263 ? 123.70900 94.59800  165.01000 1.000 60.28000  ? 508 GLU A OE2   1 
ATOM   1481  N  N     . GLY A 1 264 ? 123.46500 97.36600  168.24700 1.000 60.29000  ? 509 GLY A N     1 
ATOM   1482  C  CA    . GLY A 1 264 ? 122.98200 96.76400  169.47600 1.000 60.29000  ? 509 GLY A CA    1 
ATOM   1483  C  C     . GLY A 1 264 ? 122.05400 97.63500  170.29300 1.000 60.29000  ? 509 GLY A C     1 
ATOM   1484  O  O     . GLY A 1 264 ? 121.36300 97.11500  171.18100 1.000 60.29000  ? 509 GLY A O     1 
ATOM   1485  N  N     . ILE A 1 265 ? 122.01300 98.93800  170.03800 1.000 55.64000  ? 510 ILE A N     1 
ATOM   1486  C  CA    . ILE A 1 265 ? 121.17600 99.84900  170.81600 1.000 55.64000  ? 510 ILE A CA    1 
ATOM   1487  C  C     . ILE A 1 265 ? 119.70900 99.48000  170.62400 1.000 55.64000  ? 510 ILE A C     1 
ATOM   1488  O  O     . ILE A 1 265 ? 119.34700 98.89000  169.59700 1.000 55.64000  ? 510 ILE A O     1 
ATOM   1489  C  CB    . ILE A 1 265 ? 121.44800 101.31200 170.43300 1.000 55.64000  ? 510 ILE A CB    1 
ATOM   1490  C  CG1   . ILE A 1 265 ? 121.17000 101.54000 168.94700 1.000 55.64000  ? 510 ILE A CG1   1 
ATOM   1491  C  CG2   . ILE A 1 265 ? 122.87400 101.69400 170.77700 1.000 55.64000  ? 510 ILE A CG2   1 
ATOM   1492  C  CD1   . ILE A 1 265 ? 121.20800 102.99300 168.54100 1.000 55.64000  ? 510 ILE A CD1   1 
ATOM   1493  N  N     . PRO A 1 266 ? 118.83300 99.79100  171.58500 1.000 56.96000  ? 511 PRO A N     1 
ATOM   1494  C  CA    . PRO A 1 266 ? 117.42500 99.38400  171.45900 1.000 56.96000  ? 511 PRO A CA    1 
ATOM   1495  C  C     . PRO A 1 266 ? 116.63600 100.18200 170.43700 1.000 56.96000  ? 511 PRO A C     1 
ATOM   1496  O  O     . PRO A 1 266 ? 115.44400 99.90600  170.26000 1.000 56.96000  ? 511 PRO A O     1 
ATOM   1497  C  CB    . PRO A 1 266 ? 116.86900 99.61000  172.87200 1.000 56.96000  ? 511 PRO A CB    1 
ATOM   1498  C  CG    . PRO A 1 266 ? 118.06600 99.63000  173.75900 1.000 56.96000  ? 511 PRO A CG    1 
ATOM   1499  C  CD    . PRO A 1 266 ? 119.14400 100.26300 172.94300 1.000 56.96000  ? 511 PRO A CD    1 
ATOM   1500  N  N     . HIS A 1 267 ? 117.24600 101.15900 169.76800 1.000 54.09000  ? 512 HIS A N     1 
ATOM   1501  C  CA    . HIS A 1 267 ? 116.50100 101.97300 168.81500 1.000 54.09000  ? 512 HIS A CA    1 
ATOM   1502  C  C     . HIS A 1 267 ? 116.43800 101.34300 167.43300 1.000 54.09000  ? 512 HIS A C     1 
ATOM   1503  O  O     . HIS A 1 267 ? 115.44100 101.52300 166.72600 1.000 54.09000  ? 512 HIS A O     1 
ATOM   1504  C  CB    . HIS A 1 267 ? 117.11800 103.36600 168.71700 1.000 54.09000  ? 512 HIS A CB    1 
ATOM   1505  C  CG    . HIS A 1 267 ? 116.94500 104.18700 169.95300 1.000 54.09000  ? 512 HIS A CG    1 
ATOM   1506  N  ND1   . HIS A 1 267 ? 117.84000 104.15400 171.00000 1.000 54.09000  ? 512 HIS A ND1   1 
ATOM   1507  C  CD2   . HIS A 1 267 ? 115.97700 105.06100 170.31200 1.000 54.09000  ? 512 HIS A CD2   1 
ATOM   1508  C  CE1   . HIS A 1 267 ? 117.43100 104.97500 171.95000 1.000 54.09000  ? 512 HIS A CE1   1 
ATOM   1509  N  NE2   . HIS A 1 267 ? 116.30300 105.53900 171.55700 1.000 54.09000  ? 512 HIS A NE2   1 
ATOM   1510  N  N     . LEU A 1 268 ? 117.48200 100.62600 167.02600 1.000 52.91000  ? 513 LEU A N     1 
ATOM   1511  C  CA    . LEU A 1 268 ? 117.55500 100.11600 165.66400 1.000 52.91000  ? 513 LEU A CA    1 
ATOM   1512  C  C     . LEU A 1 268 ? 116.38800 99.18800  165.35400 1.000 52.91000  ? 513 LEU A C     1 
ATOM   1513  O  O     . LEU A 1 268 ? 115.99100 98.36200  166.17800 1.000 52.91000  ? 513 LEU A O     1 
ATOM   1514  C  CB    . LEU A 1 268 ? 118.87600 99.38100  165.44700 1.000 52.91000  ? 513 LEU A CB    1 
ATOM   1515  C  CG    . LEU A 1 268 ? 120.14100 100.23200 165.48300 1.000 52.91000  ? 513 LEU A CG    1 
ATOM   1516  C  CD1   . LEU A 1 268 ? 121.36600 99.35300  165.35700 1.000 52.91000  ? 513 LEU A CD1   1 
ATOM   1517  C  CD2   . LEU A 1 268 ? 120.10600 101.25000 164.36900 1.000 52.91000  ? 513 LEU A CD2   1 
ATOM   1518  N  N     . LEU A 1 269 ? 115.83500 99.33600  164.15300 1.000 54.13000  ? 514 LEU A N     1 
ATOM   1519  C  CA    . LEU A 1 269 ? 114.79900 98.44600  163.64800 1.000 54.13000  ? 514 LEU A CA    1 
ATOM   1520  C  C     . LEU A 1 269 ? 115.36900 97.25800  162.89500 1.000 54.13000  ? 514 LEU A C     1 
ATOM   1521  O  O     . LEU A 1 269 ? 114.60600 96.39700  162.45000 1.000 54.13000  ? 514 LEU A O     1 
ATOM   1522  C  CB    . LEU A 1 269 ? 113.84200 99.21300  162.73300 1.000 54.13000  ? 514 LEU A CB    1 
ATOM   1523  C  CG    . LEU A 1 269 ? 112.91800 100.24000 163.37900 1.000 54.13000  ? 514 LEU A CG    1 
ATOM   1524  C  CD1   . LEU A 1 269 ? 112.25500 101.06200 162.30800 1.000 54.13000  ? 514 LEU A CD1   1 
ATOM   1525  C  CD2   . LEU A 1 269 ? 111.86900 99.54300  164.21700 1.000 54.13000  ? 514 LEU A CD2   1 
ATOM   1526  N  N     . CYS A 1 270 ? 116.68300 97.20300  162.73900 1.000 62.42000  ? 515 CYS A N     1 
ATOM   1527  C  CA    . CYS A 1 270 ? 117.36700 96.12700  162.04000 1.000 62.42000  ? 515 CYS A CA    1 
ATOM   1528  C  C     . CYS A 1 270 ? 118.85900 96.28100  162.29800 1.000 62.42000  ? 515 CYS A C     1 
ATOM   1529  O  O     . CYS A 1 270 ? 119.31200 97.37100  162.65900 1.000 62.42000  ? 515 CYS A O     1 
ATOM   1530  C  CB    . CYS A 1 270 ? 117.07900 96.16500  160.53100 1.000 62.42000  ? 515 CYS A CB    1 
ATOM   1531  S  SG    . CYS A 1 270 ? 117.72900 97.62300  159.69100 1.000 62.42000  ? 515 CYS A SG    1 
ATOM   1532  N  N     . PRO A 1 271 ? 119.63200 95.20800  162.14700 1.000 62.08000  ? 516 PRO A N     1 
ATOM   1533  C  CA    . PRO A 1 271 ? 121.08900 95.35300  162.18500 1.000 62.08000  ? 516 PRO A CA    1 
ATOM   1534  C  C     . PRO A 1 271 ? 121.53800 96.38800  161.16600 1.000 62.08000  ? 516 PRO A C     1 
ATOM   1535  O  O     . PRO A 1 271 ? 120.90000 96.58400  160.12900 1.000 62.08000  ? 516 PRO A O     1 
ATOM   1536  C  CB    . PRO A 1 271 ? 121.59600 93.95100  161.83600 1.000 62.08000  ? 516 PRO A CB    1 
ATOM   1537  C  CG    . PRO A 1 271 ? 120.48800 93.04800  162.25000 1.000 62.08000  ? 516 PRO A CG    1 
ATOM   1538  C  CD    . PRO A 1 271 ? 119.22400 93.80500  161.96400 1.000 62.08000  ? 516 PRO A CD    1 
ATOM   1539  N  N     . VAL A 1 272 ? 122.63600 97.07100  161.48300 1.000 55.01000  ? 517 VAL A N     1 
ATOM   1540  C  CA    . VAL A 1 272 ? 123.12700 98.12200  160.60200 1.000 55.01000  ? 517 VAL A CA    1 
ATOM   1541  C  C     . VAL A 1 272 ? 123.40700 97.51700  159.23800 1.000 55.01000  ? 517 VAL A C     1 
ATOM   1542  O  O     . VAL A 1 272 ? 124.28200 96.65600  159.08900 1.000 55.01000  ? 517 VAL A O     1 
ATOM   1543  C  CB    . VAL A 1 272 ? 124.36800 98.78600  161.19600 1.000 55.01000  ? 517 VAL A CB    1 
ATOM   1544  C  CG1   . VAL A 1 272 ? 124.91200 99.82400  160.23600 1.000 55.01000  ? 517 VAL A CG1   1 
ATOM   1545  C  CG2   . VAL A 1 272 ? 124.02700 99.41300  162.53400 1.000 55.01000  ? 517 VAL A CG2   1 
ATOM   1546  N  N     . VAL A 1 273 ? 122.65900 97.96700  158.23200 1.000 54.52000  ? 518 VAL A N     1 
ATOM   1547  C  CA    . VAL A 1 273 ? 122.66000 97.33500  156.91700 1.000 54.52000  ? 518 VAL A CA    1 
ATOM   1548  C  C     . VAL A 1 273 ? 123.96800 97.70300  156.22600 1.000 54.52000  ? 518 VAL A C     1 
ATOM   1549  O  O     . VAL A 1 273 ? 124.13600 98.81900  155.73500 1.000 54.52000  ? 518 VAL A O     1 
ATOM   1550  C  CB    . VAL A 1 273 ? 121.44800 97.75300  156.08500 1.000 54.52000  ? 518 VAL A CB    1 
ATOM   1551  C  CG1   . VAL A 1 273 ? 121.53200 97.13400  154.70900 1.000 54.52000  ? 518 VAL A CG1   1 
ATOM   1552  C  CG2   . VAL A 1 273 ? 120.16300 97.34700  156.78700 1.000 54.52000  ? 518 VAL A CG2   1 
ATOM   1553  N  N     . THR A 1 274 ? 124.90100 96.75600  156.18600 1.000 59.82000  ? 519 THR A N     1 
ATOM   1554  C  CA    . THR A 1 274 ? 126.18100 96.94900  155.52700 1.000 59.82000  ? 519 THR A CA    1 
ATOM   1555  C  C     . THR A 1 274 ? 126.47000 95.88600  154.47900 1.000 59.82000  ? 519 THR A C     1 
ATOM   1556  O  O     . THR A 1 274 ? 127.48200 95.98900  153.77700 1.000 59.82000  ? 519 THR A O     1 
ATOM   1557  C  CB    . THR A 1 274 ? 127.31200 96.97000  156.56100 1.000 59.82000  ? 519 THR A CB    1 
ATOM   1558  O  OG1   . THR A 1 274 ? 127.33800 95.72300  157.26500 1.000 59.82000  ? 519 THR A OG1   1 
ATOM   1559  C  CG2   . THR A 1 274 ? 127.10500 98.10300  157.55100 1.000 59.82000  ? 519 THR A CG2   1 
ATOM   1560  N  N     . ASP A 1 275 ? 125.61800 94.86500  154.36200 1.000 66.69000  ? 520 ASP A N     1 
ATOM   1561  C  CA    . ASP A 1 275 ? 125.78700 93.87100  153.30900 1.000 66.69000  ? 520 ASP A CA    1 
ATOM   1562  C  C     . ASP A 1 275 ? 125.67400 94.51500  151.93400 1.000 66.69000  ? 520 ASP A C     1 
ATOM   1563  O  O     . ASP A 1 275 ? 126.33000 94.08100  150.97900 1.000 66.69000  ? 520 ASP A O     1 
ATOM   1564  C  CB    . ASP A 1 275 ? 124.74700 92.76000  153.47700 1.000 66.69000  ? 520 ASP A CB    1 
ATOM   1565  C  CG    . ASP A 1 275 ? 125.03900 91.54000  152.62000 1.000 66.69000  ? 520 ASP A CG    1 
ATOM   1566  O  OD1   . ASP A 1 275 ? 126.05900 91.53300  151.89900 1.000 66.69000  ? 520 ASP A OD1   1 
ATOM   1567  O  OD2   . ASP A 1 275 ? 124.23900 90.58100  152.66500 1.000 66.69000  ? 520 ASP A OD2   1 
ATOM   1568  N  N     . MET A 1 276 ? 124.83200 95.54500  151.81800 1.000 65.73000  ? 521 MET A N     1 
ATOM   1569  C  CA    . MET A 1 276 ? 124.59000 96.30500  150.59500 1.000 65.73000  ? 521 MET A CA    1 
ATOM   1570  C  C     . MET A 1 276 ? 123.82400 95.47800  149.57000 1.000 65.73000  ? 521 MET A C     1 
ATOM   1571  O  O     . MET A 1 276 ? 123.43000 95.99000  148.51800 1.000 65.73000  ? 521 MET A O     1 
ATOM   1572  C  CB    . MET A 1 276 ? 125.90100 96.82900  150.00700 1.000 65.73000  ? 521 MET A CB    1 
ATOM   1573  C  CG    . MET A 1 276 ? 126.64100 97.75400  150.95200 1.000 65.73000  ? 521 MET A CG    1 
ATOM   1574  S  SD    . MET A 1 276 ? 125.59400 99.11000  151.50100 1.000 65.73000  ? 521 MET A SD    1 
ATOM   1575  C  CE    . MET A 1 276 ? 125.38700 99.99600  149.96900 1.000 65.73000  ? 521 MET A CE    1 
ATOM   1576  N  N     . LYS A 1 277 ? 123.61400 94.19800  149.86400 1.000 63.31000  ? 522 LYS A N     1 
ATOM   1577  C  CA    . LYS A 1 277 ? 122.56300 93.42400  149.22400 1.000 63.31000  ? 522 LYS A CA    1 
ATOM   1578  C  C     . LYS A 1 277 ? 121.26600 93.48000  150.01400 1.000 63.31000  ? 522 LYS A C     1 
ATOM   1579  O  O     . LYS A 1 277 ? 120.24600 92.96200  149.54800 1.000 63.31000  ? 522 LYS A O     1 
ATOM   1580  C  CB    . LYS A 1 277 ? 122.99200 91.96300  149.05700 1.000 63.31000  ? 522 LYS A CB    1 
ATOM   1581  C  CG    . LYS A 1 277 ? 124.10600 91.73500  148.04900 1.000 63.31000  ? 522 LYS A CG    1 
ATOM   1582  C  CD    . LYS A 1 277 ? 124.40900 90.25000  147.91100 1.000 63.31000  ? 522 LYS A CD    1 
ATOM   1583  C  CE    . LYS A 1 277 ? 125.52100 89.99600  146.91100 1.000 63.31000  ? 522 LYS A CE    1 
ATOM   1584  N  NZ    . LYS A 1 277 ? 125.81200 88.54200  146.77600 1.000 63.31000  ? 522 LYS A NZ    1 
ATOM   1585  N  N     . GLU A 1 278 ? 121.29200 94.09700  151.19400 1.000 64.75000  ? 523 GLU A N     1 
ATOM   1586  C  CA    . GLU A 1 278 ? 120.15500 94.15600  152.09600 1.000 64.75000  ? 523 GLU A CA    1 
ATOM   1587  C  C     . GLU A 1 278 ? 119.59200 95.56100  152.24600 1.000 64.75000  ? 523 GLU A C     1 
ATOM   1588  O  O     . GLU A 1 278 ? 118.56800 95.73400  152.91500 1.000 64.75000  ? 523 GLU A O     1 
ATOM   1589  C  CB    . GLU A 1 278 ? 120.56200 93.61200  153.46800 1.000 64.75000  ? 523 GLU A CB    1 
ATOM   1590  C  CG    . GLU A 1 278 ? 120.94900 92.14600  153.44600 1.000 64.75000  ? 523 GLU A CG    1 
ATOM   1591  C  CD    . GLU A 1 278 ? 121.47500 91.66000  154.78000 1.000 64.75000  ? 523 GLU A CD    1 
ATOM   1592  O  OE1   . GLU A 1 278 ? 121.67400 92.50000  155.68200 1.000 64.75000  ? 523 GLU A OE1   1 
ATOM   1593  O  OE2   . GLU A 1 278 ? 121.69200 90.43800  154.92600 1.000 64.75000  ? 523 GLU A OE2   1 
ATOM   1594  N  N     . ALA A 1 279 ? 120.23300 96.56800  151.64900 1.000 57.48000  ? 524 ALA A N     1 
ATOM   1595  C  CA    . ALA A 1 279 ? 119.71600 97.93000  151.73200 1.000 57.48000  ? 524 ALA A CA    1 
ATOM   1596  C  C     . ALA A 1 279 ? 118.37500 98.04400  151.02500 1.000 57.48000  ? 524 ALA A C     1 
ATOM   1597  O  O     . ALA A 1 279 ? 117.44100 98.68400  151.52700 1.000 57.48000  ? 524 ALA A O     1 
ATOM   1598  C  CB    . ALA A 1 279 ? 120.72500 98.91000  151.13600 1.000 57.48000  ? 524 ALA A CB    1 
ATOM   1599  N  N     . ALA A 1 280 ? 118.26700 97.43000  149.84600 1.000 57.32000  ? 525 ALA A N     1 
ATOM   1600  C  CA    . ALA A 1 280 ? 116.99900 97.41200  149.13200 1.000 57.32000  ? 525 ALA A CA    1 
ATOM   1601  C  C     . ALA A 1 280 ? 115.89500 96.81100  149.99100 1.000 57.32000  ? 525 ALA A C     1 
ATOM   1602  O  O     . ALA A 1 280 ? 114.76100 97.29700  149.98000 1.000 57.32000  ? 525 ALA A O     1 
ATOM   1603  C  CB    . ALA A 1 280 ? 117.14900 96.64100  147.82200 1.000 57.32000  ? 525 ALA A CB    1 
ATOM   1604  N  N     . ASN A 1 281 ? 116.21600 95.77800  150.77300 1.000 58.04000  ? 526 ASN A N     1 
ATOM   1605  C  CA    . ASN A 1 281 ? 115.20000 95.13800  151.60300 1.000 58.04000  ? 526 ASN A CA    1 
ATOM   1606  C  C     . ASN A 1 281 ? 114.78500 96.03200  152.76500 1.000 58.04000  ? 526 ASN A C     1 
ATOM   1607  O  O     . ASN A 1 281 ? 113.59400 96.12800  153.08700 1.000 58.04000  ? 526 ASN A O     1 
ATOM   1608  C  CB    . ASN A 1 281 ? 115.71400 93.79500  152.11800 1.000 58.04000  ? 526 ASN A CB    1 
ATOM   1609  C  CG    . ASN A 1 281 ? 115.77400 92.74100  151.03400 1.000 58.04000  ? 526 ASN A CG    1 
ATOM   1610  O  OD1   . ASN A 1 281 ? 114.85600 92.61400  150.22600 1.000 58.04000  ? 526 ASN A OD1   1 
ATOM   1611  N  ND2   . ASN A 1 281 ? 116.86200 91.98000  151.00700 1.000 58.04000  ? 526 ASN A ND2   1 
ATOM   1612  N  N     . ALA A 1 282 ? 115.75000 96.69400  153.40500 1.000 56.06000  ? 527 ALA A N     1 
ATOM   1613  C  CA    . ALA A 1 282 ? 115.41400 97.62100  154.48000 1.000 56.06000  ? 527 ALA A CA    1 
ATOM   1614  C  C     . ALA A 1 282 ? 114.53200 98.75100  153.97000 1.000 56.06000  ? 527 ALA A C     1 
ATOM   1615  O  O     . ALA A 1 282 ? 113.56700 99.15000  154.63300 1.000 56.06000  ? 527 ALA A O     1 
ATOM   1616  C  CB    . ALA A 1 282 ? 116.68800 98.17800  155.11200 1.000 56.06000  ? 527 ALA A CB    1 
ATOM   1617  N  N     . LEU A 1 283 ? 114.83600 99.26900  152.78100 1.000 50.96000  ? 528 LEU A N     1 
ATOM   1618  C  CA    . LEU A 1 283 ? 114.03000 100.35400 152.23700 1.000 50.96000  ? 528 LEU A CA    1 
ATOM   1619  C  C     . LEU A 1 283 ? 112.65200 99.86500  151.80000 1.000 50.96000  ? 528 LEU A C     1 
ATOM   1620  O  O     . LEU A 1 283 ? 111.66000 100.58700 151.95100 1.000 50.96000  ? 528 LEU A O     1 
ATOM   1621  C  CB    . LEU A 1 283 ? 114.78100 101.02600 151.09300 1.000 50.96000  ? 528 LEU A CB    1 
ATOM   1622  C  CG    . LEU A 1 283 ? 116.02900 101.72700 151.63000 1.000 50.96000  ? 528 LEU A CG    1 
ATOM   1623  C  CD1   . LEU A 1 283 ? 116.88200 102.25900 150.50900 1.000 50.96000  ? 528 LEU A CD1   1 
ATOM   1624  C  CD2   . LEU A 1 283 ? 115.63300 102.84400 152.58300 1.000 50.96000  ? 528 LEU A CD2   1 
ATOM   1625  N  N     . ARG A 1 284 ? 112.56400 98.64600  151.25700 1.000 53.92000  ? 529 ARG A N     1 
ATOM   1626  C  CA    . ARG A 1 284 ? 111.25400 98.06100  150.98900 1.000 53.92000  ? 529 ARG A CA    1 
ATOM   1627  C  C     . ARG A 1 284 ? 110.43000 97.97200  152.26200 1.000 53.92000  ? 529 ARG A C     1 
ATOM   1628  O  O     . ARG A 1 284 ? 109.23000 98.27300  152.25700 1.000 53.92000  ? 529 ARG A O     1 
ATOM   1629  C  CB    . ARG A 1 284 ? 111.38900 96.67000  150.36900 1.000 53.92000  ? 529 ARG A CB    1 
ATOM   1630  C  CG    . ARG A 1 284 ? 111.91000 96.62900  148.94800 1.000 53.92000  ? 529 ARG A CG    1 
ATOM   1631  C  CD    . ARG A 1 284 ? 111.90800 95.20200  148.42200 1.000 53.92000  ? 529 ARG A CD    1 
ATOM   1632  N  NE    . ARG A 1 284 ? 112.42600 95.12200  147.06200 1.000 53.92000  ? 529 ARG A NE    1 
ATOM   1633  C  CZ    . ARG A 1 284 ? 113.69500 94.86900  146.76700 1.000 53.92000  ? 529 ARG A CZ    1 
ATOM   1634  N  NH1   . ARG A 1 284 ? 114.56900 94.65900  147.74000 1.000 53.92000  ? 529 ARG A NH1   1 
ATOM   1635  N  NH2   . ARG A 1 284 ? 114.09000 94.81600  145.50300 1.000 53.92000  ? 529 ARG A NH2   1 
ATOM   1636  N  N     . TRP A 1 285 ? 111.05400 97.55400  153.36500 1.000 58.42000  ? 530 TRP A N     1 
ATOM   1637  C  CA    . TRP A 1 285 ? 110.31300 97.46700  154.61700 1.000 58.42000  ? 530 TRP A CA    1 
ATOM   1638  C  C     . TRP A 1 285 ? 109.88500 98.84400  155.10200 1.000 58.42000  ? 530 TRP A C     1 
ATOM   1639  O  O     . TRP A 1 285 ? 108.79200 98.99900  155.65000 1.000 58.42000  ? 530 TRP A O     1 
ATOM   1640  C  CB    . TRP A 1 285 ? 111.12800 96.78400  155.70600 1.000 58.42000  ? 530 TRP A CB    1 
ATOM   1641  C  CG    . TRP A 1 285 ? 110.30900 96.66100  156.94500 1.000 58.42000  ? 530 TRP A CG    1 
ATOM   1642  C  CD1   . TRP A 1 285 ? 109.29300 95.78100  157.16700 1.000 58.42000  ? 530 TRP A CD1   1 
ATOM   1643  C  CD2   . TRP A 1 285 ? 110.35200 97.51900  158.08800 1.000 58.42000  ? 530 TRP A CD2   1 
ATOM   1644  N  NE1   . TRP A 1 285 ? 108.74000 95.99900  158.40400 1.000 58.42000  ? 530 TRP A NE1   1 
ATOM   1645  C  CE2   . TRP A 1 285 ? 109.37000 97.06600  158.98800 1.000 58.42000  ? 530 TRP A CE2   1 
ATOM   1646  C  CE3   . TRP A 1 285 ? 111.14200 98.61200  158.44800 1.000 58.42000  ? 530 TRP A CE3   1 
ATOM   1647  C  CZ2   . TRP A 1 285 ? 109.15900 97.66600  160.22400 1.000 58.42000  ? 530 TRP A CZ2   1 
ATOM   1648  C  CZ3   . TRP A 1 285 ? 110.93100 99.20500  159.67400 1.000 58.42000  ? 530 TRP A CZ3   1 
ATOM   1649  C  CH2   . TRP A 1 285 ? 109.94800 98.73200  160.54800 1.000 58.42000  ? 530 TRP A CH2   1 
ATOM   1650  N  N     . SER A 1 286 ? 110.74500 99.85000  154.94000 1.000 51.17000  ? 531 SER A N     1 
ATOM   1651  C  CA    . SER A 1 286 ? 110.36100 101.20200 155.34100 1.000 51.17000  ? 531 SER A CA    1 
ATOM   1652  C  C     . SER A 1 286 ? 109.17300 101.69800 154.52600 1.000 51.17000  ? 531 SER A C     1 
ATOM   1653  O  O     . SER A 1 286 ? 108.25900 102.33300 155.06600 1.000 51.17000  ? 531 SER A O     1 
ATOM   1654  C  CB    . SER A 1 286 ? 111.54600 102.15200 155.19200 1.000 51.17000  ? 531 SER A CB    1 
ATOM   1655  O  OG    . SER A 1 286 ? 111.90200 102.29800 153.83000 1.000 51.17000  ? 531 SER A OG    1 
ATOM   1656  N  N     . VAL A 1 287 ? 109.16600 101.40900 153.22400 1.000 49.74000  ? 532 VAL A N     1 
ATOM   1657  C  CA    . VAL A 1 287 ? 108.03800 101.80700 152.38700 1.000 49.74000  ? 532 VAL A CA    1 
ATOM   1658  C  C     . VAL A 1 287 ? 106.77100 101.08100 152.81900 1.000 49.74000  ? 532 VAL A C     1 
ATOM   1659  O  O     . VAL A 1 287 ? 105.69500 101.68200 152.91300 1.000 49.74000  ? 532 VAL A O     1 
ATOM   1660  C  CB    . VAL A 1 287 ? 108.35400 101.55700 150.90200 1.000 49.74000  ? 532 VAL A CB    1 
ATOM   1661  C  CG1   . VAL A 1 287 ? 107.12900 101.83000 150.05400 1.000 49.74000  ? 532 VAL A CG1   1 
ATOM   1662  C  CG2   . VAL A 1 287 ? 109.50300 102.43300 150.45600 1.000 49.74000  ? 532 VAL A CG2   1 
ATOM   1663  N  N     . ALA A 1 288 ? 106.87500 99.78100  153.09900 1.000 50.71000  ? 533 ALA A N     1 
ATOM   1664  C  CA    . ALA A 1 288 ? 105.69800 99.04800  153.55000 1.000 50.71000  ? 533 ALA A CA    1 
ATOM   1665  C  C     . ALA A 1 288 ? 105.20600 99.55900  154.89900 1.000 50.71000  ? 533 ALA A C     1 
ATOM   1666  O  O     . ALA A 1 288 ? 103.99300 99.59500  155.14900 1.000 50.71000  ? 533 ALA A O     1 
ATOM   1667  C  CB    . ALA A 1 288 ? 106.00500 97.55400  153.62400 1.000 50.71000  ? 533 ALA A CB    1 
ATOM   1668  N  N     . GLU A 1 289 ? 106.12700 99.97700  155.76800 1.000 52.94000  ? 534 GLU A N     1 
ATOM   1669  C  CA    . GLU A 1 289 ? 105.73500 100.52100 157.06100 1.000 52.94000  ? 534 GLU A CA    1 
ATOM   1670  C  C     . GLU A 1 289 ? 105.01500 101.84900 156.90200 1.000 52.94000  ? 534 GLU A C     1 
ATOM   1671  O  O     . GLU A 1 289 ? 103.99900 102.08900 157.56300 1.000 52.94000  ? 534 GLU A O     1 
ATOM   1672  C  CB    . GLU A 1 289 ? 106.95700 100.68100 157.96300 1.000 52.94000  ? 534 GLU A CB    1 
ATOM   1673  C  CG    . GLU A 1 289 ? 106.64100 101.28400 159.31800 1.000 52.94000  ? 534 GLU A CG    1 
ATOM   1674  C  CD    . GLU A 1 289 ? 105.75100 100.40000 160.16900 1.000 52.94000  ? 534 GLU A CD    1 
ATOM   1675  O  OE1   . GLU A 1 289 ? 105.77500 99.16500  159.98100 1.000 52.94000  ? 534 GLU A OE1   1 
ATOM   1676  O  OE2   . GLU A 1 289 ? 105.02300 100.94100 161.02700 1.000 52.94000  ? 534 GLU A OE2   1 
ATOM   1677  N  N     . MET A 1 290 ? 105.51100 102.72400 156.02400 1.000 51.40000  ? 535 MET A N     1 
ATOM   1678  C  CA    . MET A 1 290 ? 104.79000 103.97400 155.81900 1.000 51.40000  ? 535 MET A CA    1 
ATOM   1679  C  C     . MET A 1 290 ? 103.44000 103.72000 155.16100 1.000 51.40000  ? 535 MET A C     1 
ATOM   1680  O  O     . MET A 1 290 ? 102.47200 104.42300 155.45800 1.000 51.40000  ? 535 MET A O     1 
ATOM   1681  C  CB    . MET A 1 290 ? 105.60400 104.97100 154.99000 1.000 51.40000  ? 535 MET A CB    1 
ATOM   1682  C  CG    . MET A 1 290 ? 105.66900 104.68600 153.50900 1.000 51.40000  ? 535 MET A CG    1 
ATOM   1683  S  SD    . MET A 1 290 ? 106.58400 105.94200 152.60500 1.000 51.40000  ? 535 MET A SD    1 
ATOM   1684  C  CE    . MET A 1 290 ? 106.40200 105.34200 150.93100 1.000 51.40000  ? 535 MET A CE    1 
ATOM   1685  N  N     . GLU A 1 291 ? 103.33800 102.70000 154.30400 1.000 52.36000  ? 536 GLU A N     1 
ATOM   1686  C  CA    . GLU A 1 291 ? 102.05200 102.38400 153.69000 1.000 52.36000  ? 536 GLU A CA    1 
ATOM   1687  C  C     . GLU A 1 291 ? 101.04100 101.93300 154.73600 1.000 52.36000  ? 536 GLU A C     1 
ATOM   1688  O  O     . GLU A 1 291 ? 99.90900  102.43500 154.78200 1.000 52.36000  ? 536 GLU A O     1 
ATOM   1689  C  CB    . GLU A 1 291 ? 102.22500 101.30900 152.61800 1.000 52.36000  ? 536 GLU A CB    1 
ATOM   1690  C  CG    . GLU A 1 291 ? 102.99700 101.75200 151.38800 1.000 52.36000  ? 536 GLU A CG    1 
ATOM   1691  C  CD    . GLU A 1 291 ? 102.25400 102.78300 150.56500 1.000 52.36000  ? 536 GLU A CD    1 
ATOM   1692  O  OE1   . GLU A 1 291 ? 101.00700 102.75800 150.56500 1.000 52.36000  ? 536 GLU A OE1   1 
ATOM   1693  O  OE2   . GLU A 1 291 ? 102.91800 103.61000 149.90600 1.000 52.36000  ? 536 GLU A OE2   1 
ATOM   1694  N  N     . ARG A 1 292 ? 101.42500 100.97100 155.58000 1.000 50.18000  ? 537 ARG A N     1 
ATOM   1695  C  CA    . ARG A 1 292 ? 100.49700 100.51900 156.61000 1.000 50.18000  ? 537 ARG A CA    1 
ATOM   1696  C  C     . ARG A 1 292 ? 100.20500 101.62300 157.61400 1.000 50.18000  ? 537 ARG A C     1 
ATOM   1697  O  O     . ARG A 1 292 ? 99.11000  101.66900 158.18400 1.000 50.18000  ? 537 ARG A O     1 
ATOM   1698  C  CB    . ARG A 1 292 ? 101.02800 99.26600  157.31500 1.000 50.18000  ? 537 ARG A CB    1 
ATOM   1699  C  CG    . ARG A 1 292 ? 102.39500 99.40100  157.95600 1.000 50.18000  ? 537 ARG A CG    1 
ATOM   1700  C  CD    . ARG A 1 292 ? 102.31600 99.80300  159.42300 1.000 50.18000  ? 537 ARG A CD    1 
ATOM   1701  N  NE    . ARG A 1 292 ? 101.63400 98.80800  160.24300 1.000 50.18000  ? 537 ARG A NE    1 
ATOM   1702  C  CZ    . ARG A 1 292 ? 100.86400 99.10200  161.28500 1.000 50.18000  ? 537 ARG A CZ    1 
ATOM   1703  N  NH1   . ARG A 1 292 ? 100.67900 100.36500 161.64100 1.000 50.18000  ? 537 ARG A NH1   1 
ATOM   1704  N  NH2   . ARG A 1 292 ? 100.28100 98.13200  161.97500 1.000 50.18000  ? 537 ARG A NH2   1 
ATOM   1705  N  N     . ARG A 1 293 ? 101.14100 102.55200 157.81000 1.000 47.49000  ? 538 ARG A N     1 
ATOM   1706  C  CA    . ARG A 1 293 ? 100.87200 103.64300 158.73300 1.000 47.49000  ? 538 ARG A CA    1 
ATOM   1707  C  C     . ARG A 1 293 ? 99.91900  104.67100 158.13700 1.000 47.49000  ? 538 ARG A C     1 
ATOM   1708  O  O     . ARG A 1 293 ? 99.09000  105.22600 158.86400 1.000 47.49000  ? 538 ARG A O     1 
ATOM   1709  C  CB    . ARG A 1 293 ? 102.17900 104.30300 159.16400 1.000 47.49000  ? 538 ARG A CB    1 
ATOM   1710  C  CG    . ARG A 1 293 ? 102.00600 105.31600 160.27100 1.000 47.49000  ? 538 ARG A CG    1 
ATOM   1711  C  CD    . ARG A 1 293 ? 103.34200 105.82700 160.74900 1.000 47.49000  ? 538 ARG A CD    1 
ATOM   1712  N  NE    . ARG A 1 293 ? 104.12200 104.78700 161.40700 1.000 47.49000  ? 538 ARG A NE    1 
ATOM   1713  C  CZ    . ARG A 1 293 ? 105.38200 104.94000 161.79700 1.000 47.49000  ? 538 ARG A CZ    1 
ATOM   1714  N  NH1   . ARG A 1 293 ? 105.99700 106.09600 161.60100 1.000 47.49000  ? 538 ARG A NH1   1 
ATOM   1715  N  NH2   . ARG A 1 293 ? 106.02300 103.94400 162.38900 1.000 47.49000  ? 538 ARG A NH2   1 
ATOM   1716  N  N     . TYR A 1 294 ? 99.99200  104.92600 156.82800 1.000 47.88000  ? 539 TYR A N     1 
ATOM   1717  C  CA    . TYR A 1 294 ? 98.97600  105.77000 156.20700 1.000 47.88000  ? 539 TYR A CA    1 
ATOM   1718  C  C     . TYR A 1 294 ? 97.61400  105.09600 156.23900 1.000 47.88000  ? 539 TYR A C     1 
ATOM   1719  O  O     . TYR A 1 294 ? 96.59700  105.76000 156.46200 1.000 47.88000  ? 539 TYR A O     1 
ATOM   1720  C  CB    . TYR A 1 294 ? 99.35200  106.13600 154.77200 1.000 47.88000  ? 539 TYR A CB    1 
ATOM   1721  C  CG    . TYR A 1 294 ? 100.42000 107.19600 154.66000 1.000 47.88000  ? 539 TYR A CG    1 
ATOM   1722  C  CD1   . TYR A 1 294 ? 100.13900 108.52200 154.94500 1.000 47.88000  ? 539 TYR A CD1   1 
ATOM   1723  C  CD2   . TYR A 1 294 ? 101.69200 106.88300 154.22100 1.000 47.88000  ? 539 TYR A CD2   1 
ATOM   1724  C  CE1   . TYR A 1 294 ? 101.10700 109.49200 154.83400 1.000 47.88000  ? 539 TYR A CE1   1 
ATOM   1725  C  CE2   . TYR A 1 294 ? 102.66400 107.84500 154.11100 1.000 47.88000  ? 539 TYR A CE2   1 
ATOM   1726  C  CZ    . TYR A 1 294 ? 102.36600 109.14800 154.41300 1.000 47.88000  ? 539 TYR A CZ    1 
ATOM   1727  O  OH    . TYR A 1 294 ? 103.33700 110.11300 154.29600 1.000 47.88000  ? 539 TYR A OH    1 
ATOM   1728  N  N     . ARG A 1 295 ? 97.57200  103.78100 156.01500 1.000 51.43000  ? 540 ARG A N     1 
ATOM   1729  C  CA    . ARG A 1 295 ? 96.33100  103.03900 156.22200 1.000 51.43000  ? 540 ARG A CA    1 
ATOM   1730  C  C     . ARG A 1 295 ? 95.77400  103.28800 157.62000 1.000 51.43000  ? 540 ARG A C     1 
ATOM   1731  O  O     . ARG A 1 295 ? 94.61000  103.67300 157.78900 1.000 51.43000  ? 540 ARG A O     1 
ATOM   1732  C  CB    . ARG A 1 295 ? 96.57000  101.54300 156.01900 1.000 51.43000  ? 540 ARG A CB    1 
ATOM   1733  C  CG    . ARG A 1 295 ? 96.89000  101.10400 154.60400 1.000 51.43000  ? 540 ARG A CG    1 
ATOM   1734  C  CD    . ARG A 1 295 ? 97.11700  99.60100  154.59900 1.000 51.43000  ? 540 ARG A CD    1 
ATOM   1735  N  NE    . ARG A 1 295 ? 97.42200  99.06000  153.28000 1.000 51.43000  ? 540 ARG A NE    1 
ATOM   1736  C  CZ    . ARG A 1 295 ? 97.71800  97.78400  153.05700 1.000 51.43000  ? 540 ARG A CZ    1 
ATOM   1737  N  NH1   . ARG A 1 295 ? 97.75500  96.92600  154.06700 1.000 51.43000  ? 540 ARG A NH1   1 
ATOM   1738  N  NH2   . ARG A 1 295 ? 97.98100  97.36400  151.82700 1.000 51.43000  ? 540 ARG A NH2   1 
ATOM   1739  N  N     . LEU A 1 296 ? 96.61100  103.07700 158.63600 1.000 53.95000  ? 541 LEU A N     1 
ATOM   1740  C  CA    . LEU A 1 296 ? 96.15000  103.12900 160.01800 1.000 53.95000  ? 541 LEU A CA    1 
ATOM   1741  C  C     . LEU A 1 296 ? 95.78600  104.54900 160.44100 1.000 53.95000  ? 541 LEU A C     1 
ATOM   1742  O  O     . LEU A 1 296 ? 94.95500  104.74100 161.33600 1.000 53.95000  ? 541 LEU A O     1 
ATOM   1743  C  CB    . LEU A 1 296 ? 97.22500  102.53200 160.92600 1.000 53.95000  ? 541 LEU A CB    1 
ATOM   1744  C  CG    . LEU A 1 296 ? 96.93700  102.32800 162.40700 1.000 53.95000  ? 541 LEU A CG    1 
ATOM   1745  C  CD1   . LEU A 1 296 ? 97.66900  101.10000 162.89400 1.000 53.95000  ? 541 LEU A CD1   1 
ATOM   1746  C  CD2   . LEU A 1 296 ? 97.41900  103.53200 163.16000 1.000 53.95000  ? 541 LEU A CD2   1 
ATOM   1747  N  N     . MET A 1 297 ? 96.40100  105.55700 159.82200 1.000 54.05000  ? 542 MET A N     1 
ATOM   1748  C  CA    . MET A 1 297 ? 96.03800  106.93500 160.13400 1.000 54.05000  ? 542 MET A CA    1 
ATOM   1749  C  C     . MET A 1 297 ? 94.79300  107.38000 159.38200 1.000 54.05000  ? 542 MET A C     1 
ATOM   1750  O  O     . MET A 1 297 ? 94.04500  108.22800 159.88100 1.000 54.05000  ? 542 MET A O     1 
ATOM   1751  C  CB    . MET A 1 297 ? 97.19500  107.88300 159.81900 1.000 54.05000  ? 542 MET A CB    1 
ATOM   1752  C  CG    . MET A 1 297 ? 98.39200  107.74400 160.73700 1.000 54.05000  ? 542 MET A CG    1 
ATOM   1753  S  SD    . MET A 1 297 ? 99.66200  108.96300 160.36700 1.000 54.05000  ? 542 MET A SD    1 
ATOM   1754  C  CE    . MET A 1 297 ? 100.33300 108.28800 158.85700 1.000 54.05000  ? 542 MET A CE    1 
ATOM   1755  N  N     . ALA A 1 298 ? 94.55500  106.83600 158.18900 1.000 53.58000  ? 543 ALA A N     1 
ATOM   1756  C  CA    . ALA A 1 298 ? 93.32300  107.14900 157.47900 1.000 53.58000  ? 543 ALA A CA    1 
ATOM   1757  C  C     . ALA A 1 298 ? 92.13000  106.45800 158.11600 1.000 53.58000  ? 543 ALA A C     1 
ATOM   1758  O  O     . ALA A 1 298 ? 91.00400  106.95900 158.02600 1.000 53.58000  ? 543 ALA A O     1 
ATOM   1759  C  CB    . ALA A 1 298 ? 93.44500  106.75400 156.01000 1.000 53.58000  ? 543 ALA A CB    1 
ATOM   1760  N  N     . ALA A 1 299 ? 92.35400  105.31400 158.76300 1.000 56.51000  ? 544 ALA A N     1 
ATOM   1761  C  CA    . ALA A 1 299 ? 91.26200  104.64700 159.45900 1.000 56.51000  ? 544 ALA A CA    1 
ATOM   1762  C  C     . ALA A 1 299 ? 90.87000  105.35100 160.75000 1.000 56.51000  ? 544 ALA A C     1 
ATOM   1763  O  O     . ALA A 1 299 ? 89.80800  105.04400 161.30100 1.000 56.51000  ? 544 ALA A O     1 
ATOM   1764  C  CB    . ALA A 1 299 ? 91.63600  103.19500 159.75600 1.000 56.51000  ? 544 ALA A CB    1 
ATOM   1765  N  N     . MET A 1 300 ? 91.68800  106.28300 161.24100 1.000 63.88000  ? 545 MET A N     1 
ATOM   1766  C  CA    . MET A 1 300 ? 91.38300  107.02400 162.45600 1.000 63.88000  ? 545 MET A CA    1 
ATOM   1767  C  C     . MET A 1 300 ? 90.93500  108.45500 162.20000 1.000 63.88000  ? 545 MET A C     1 
ATOM   1768  O  O     . MET A 1 300 ? 90.54600  109.14000 163.15100 1.000 63.88000  ? 545 MET A O     1 
ATOM   1769  C  CB    . MET A 1 300 ? 92.60400  107.04700 163.38900 1.000 63.88000  ? 545 MET A CB    1 
ATOM   1770  C  CG    . MET A 1 300 ? 93.01600  105.69400 163.94800 1.000 63.88000  ? 545 MET A CG    1 
ATOM   1771  S  SD    . MET A 1 300 ? 91.76400  104.92400 164.99100 1.000 63.88000  ? 545 MET A SD    1 
ATOM   1772  C  CE    . MET A 1 300 ? 91.14500  103.64300 163.90400 1.000 63.88000  ? 545 MET A CE    1 
ATOM   1773  N  N     . GLY A 1 301 ? 90.98100  108.92600 160.95600 1.000 57.10000  ? 546 GLY A N     1 
ATOM   1774  C  CA    . GLY A 1 301 ? 90.56700  110.27900 160.64500 1.000 57.10000  ? 546 GLY A CA    1 
ATOM   1775  C  C     . GLY A 1 301 ? 91.59400  111.35300 160.92200 1.000 57.10000  ? 546 GLY A C     1 
ATOM   1776  O  O     . GLY A 1 301 ? 91.24500  112.53900 160.89700 1.000 57.10000  ? 546 GLY A O     1 
ATOM   1777  N  N     . VAL A 1 302 ? 92.84300  110.98300 161.18700 1.000 57.52000  ? 547 VAL A N     1 
ATOM   1778  C  CA    . VAL A 1 302 ? 93.89800  111.93300 161.52200 1.000 57.52000  ? 547 VAL A CA    1 
ATOM   1779  C  C     . VAL A 1 302 ? 94.88200  112.00900 160.36500 1.000 57.52000  ? 547 VAL A C     1 
ATOM   1780  O  O     . VAL A 1 302 ? 95.19500  110.99200 159.73700 1.000 57.52000  ? 547 VAL A O     1 
ATOM   1781  C  CB    . VAL A 1 302 ? 94.60700  111.52700 162.82600 1.000 57.52000  ? 547 VAL A CB    1 
ATOM   1782  C  CG1   . VAL A 1 302 ? 95.73000  112.48500 163.12600 1.000 57.52000  ? 547 VAL A CG1   1 
ATOM   1783  C  CG2   . VAL A 1 302 ? 93.61400  111.48500 163.97600 1.000 57.52000  ? 547 VAL A CG2   1 
ATOM   1784  N  N     . ARG A 1 303 ? 95.38900  113.21500 160.09300 1.000 58.98000  ? 548 ARG A N     1 
ATOM   1785  C  CA    . ARG A 1 303 ? 96.18300  113.46800 158.89700 1.000 58.98000  ? 548 ARG A CA    1 
ATOM   1786  C  C     . ARG A 1 303 ? 97.68800  113.29700 159.08900 1.000 58.98000  ? 548 ARG A C     1 
ATOM   1787  O  O     . ARG A 1 303 ? 98.38400  113.00700 158.11100 1.000 58.98000  ? 548 ARG A O     1 
ATOM   1788  C  CB    . ARG A 1 303 ? 95.89600  114.88000 158.36200 1.000 58.98000  ? 548 ARG A CB    1 
ATOM   1789  C  CG    . ARG A 1 303 ? 96.66600  115.23100 157.09600 1.000 58.98000  ? 548 ARG A CG    1 
ATOM   1790  C  CD    . ARG A 1 303 ? 96.23000  116.54700 156.49000 1.000 58.98000  ? 548 ARG A CD    1 
ATOM   1791  N  NE    . ARG A 1 303 ? 94.91600  116.44400 155.86600 1.000 58.98000  ? 548 ARG A NE    1 
ATOM   1792  C  CZ    . ARG A 1 303 ? 94.24400  117.47800 155.37500 1.000 58.98000  ? 548 ARG A CZ    1 
ATOM   1793  N  NH1   . ARG A 1 303 ? 94.76400  118.69600 155.43800 1.000 58.98000  ? 548 ARG A NH1   1 
ATOM   1794  N  NH2   . ARG A 1 303 ? 93.05400  117.29600 154.81900 1.000 58.98000  ? 548 ARG A NH2   1 
ATOM   1795  N  N     . ASN A 1 304 ? 98.22300  113.46200 160.29500 1.000 58.26000  ? 549 ASN A N     1 
ATOM   1796  C  CA    . ASN A 1 304 ? 99.66200  113.31600 160.47400 1.000 58.26000  ? 549 ASN A CA    1 
ATOM   1797  C  C     . ASN A 1 304 ? 99.96400  112.58100 161.77300 1.000 58.26000  ? 549 ASN A C     1 
ATOM   1798  O  O     . ASN A 1 304 ? 99.09200  112.37900 162.62100 1.000 58.26000  ? 549 ASN A O     1 
ATOM   1799  C  CB    . ASN A 1 304 ? 100.37600 114.67300 160.42700 1.000 58.26000  ? 549 ASN A CB    1 
ATOM   1800  C  CG    . ASN A 1 304 ? 99.88300  115.63300 161.48600 1.000 58.26000  ? 549 ASN A CG    1 
ATOM   1801  O  OD1   . ASN A 1 304 ? 99.05800  115.28400 162.32800 1.000 58.26000  ? 549 ASN A OD1   1 
ATOM   1802  N  ND2   . ASN A 1 304 ? 100.39300 116.85800 161.45000 1.000 58.26000  ? 549 ASN A ND2   1 
ATOM   1803  N  N     . LEU A 1 305 ? 101.23100 112.18100 161.91100 1.000 57.99000  ? 550 LEU A N     1 
ATOM   1804  C  CA    . LEU A 1 305 ? 101.64100 111.34100 163.03300 1.000 57.99000  ? 550 LEU A CA    1 
ATOM   1805  C  C     . LEU A 1 305 ? 101.44800 112.04600 164.36800 1.000 57.99000  ? 550 LEU A C     1 
ATOM   1806  O  O     . LEU A 1 305 ? 100.99700 111.43000 165.34200 1.000 57.99000  ? 550 LEU A O     1 
ATOM   1807  C  CB    . LEU A 1 305 ? 103.09800 110.91900 162.86200 1.000 57.99000  ? 550 LEU A CB    1 
ATOM   1808  C  CG    . LEU A 1 305 ? 103.64000 109.99500 163.94800 1.000 57.99000  ? 550 LEU A CG    1 
ATOM   1809  C  CD1   . LEU A 1 305 ? 102.86200 108.69900 163.95900 1.000 57.99000  ? 550 LEU A CD1   1 
ATOM   1810  C  CD2   . LEU A 1 305 ? 105.11300 109.73000 163.72500 1.000 57.99000  ? 550 LEU A CD2   1 
ATOM   1811  N  N     . ALA A 1 306 ? 101.82000 113.32500 164.44500 1.000 63.07000  ? 551 ALA A N     1 
ATOM   1812  C  CA    . ALA A 1 306 ? 101.64400 114.06900 165.68800 1.000 63.07000  ? 551 ALA A CA    1 
ATOM   1813  C  C     . ALA A 1 306 ? 100.18200 114.09100 166.10900 1.000 63.07000  ? 551 ALA A C     1 
ATOM   1814  O  O     . ALA A 1 306 ? 99.86400  113.91000 167.29100 1.000 63.07000  ? 551 ALA A O     1 
ATOM   1815  C  CB    . ALA A 1 306 ? 102.18200 115.49000 165.52900 1.000 63.07000  ? 551 ALA A CB    1 
ATOM   1816  N  N     . GLY A 1 307 ? 99.27600  114.29800 165.15400 1.000 65.72000  ? 552 GLY A N     1 
ATOM   1817  C  CA    . GLY A 1 307 ? 97.86100  114.25000 165.47500 1.000 65.72000  ? 552 GLY A CA    1 
ATOM   1818  C  C     . GLY A 1 307 ? 97.42300  112.87900 165.95000 1.000 65.72000  ? 552 GLY A C     1 
ATOM   1819  O  O     . GLY A 1 307 ? 96.57900  112.76000 166.83900 1.000 65.72000  ? 552 GLY A O     1 
ATOM   1820  N  N     . PHE A 1 308 ? 97.99500  111.82500 165.36700 1.000 65.52000  ? 553 PHE A N     1 
ATOM   1821  C  CA    . PHE A 1 308 ? 97.63600  110.47400 165.78000 1.000 65.52000  ? 553 PHE A CA    1 
ATOM   1822  C  C     . PHE A 1 308 ? 98.08900  110.19400 167.20600 1.000 65.52000  ? 553 PHE A C     1 
ATOM   1823  O  O     . PHE A 1 308 ? 97.36100  109.56700 167.98800 1.000 65.52000  ? 553 PHE A O     1 
ATOM   1824  C  CB    . PHE A 1 308 ? 98.23400  109.45200 164.81700 1.000 65.52000  ? 553 PHE A CB    1 
ATOM   1825  C  CG    . PHE A 1 308 ? 97.92500  108.03900 165.18500 1.000 65.52000  ? 553 PHE A CG    1 
ATOM   1826  C  CD1   . PHE A 1 308 ? 96.66100  107.52100 164.98300 1.000 65.52000  ? 553 PHE A CD1   1 
ATOM   1827  C  CD2   . PHE A 1 308 ? 98.89500  107.22900 165.74300 1.000 65.52000  ? 553 PHE A CD2   1 
ATOM   1828  C  CE1   . PHE A 1 308 ? 96.37000  106.22300 165.32900 1.000 65.52000  ? 553 PHE A CE1   1 
ATOM   1829  C  CE2   . PHE A 1 308 ? 98.61000  105.93100 166.08900 1.000 65.52000  ? 553 PHE A CE2   1 
ATOM   1830  C  CZ    . PHE A 1 308 ? 97.34700  105.43000 165.88600 1.000 65.52000  ? 553 PHE A CZ    1 
ATOM   1831  N  N     . ASN A 1 309 ? 99.29200  110.64600 167.56200 1.000 69.29000  ? 554 ASN A N     1 
ATOM   1832  C  CA    . ASN A 1 309 ? 99.75000  110.48500 168.93600 1.000 69.29000  ? 554 ASN A CA    1 
ATOM   1833  C  C     . ASN A 1 309 ? 98.91400  111.32100 169.89700 1.000 69.29000  ? 554 ASN A C     1 
ATOM   1834  O  O     . ASN A 1 309 ? 98.61800  110.87800 171.01100 1.000 69.29000  ? 554 ASN A O     1 
ATOM   1835  C  CB    . ASN A 1 309 ? 101.23200 110.83500 169.04700 1.000 69.29000  ? 554 ASN A CB    1 
ATOM   1836  C  CG    . ASN A 1 309 ? 102.12300 109.76300 168.45500 1.000 69.29000  ? 554 ASN A CG    1 
ATOM   1837  O  OD1   . ASN A 1 309 ? 101.88500 108.57100 168.64400 1.000 69.29000  ? 554 ASN A OD1   1 
ATOM   1838  N  ND2   . ASN A 1 309 ? 103.15600 110.18200 167.73600 1.000 69.29000  ? 554 ASN A ND2   1 
ATOM   1839  N  N     . ARG A 1 310 ? 98.50700  112.52300 169.48200 1.000 76.36000  ? 555 ARG A N     1 
ATOM   1840  C  CA    . ARG A 1 310 ? 97.58300  113.29800 170.30600 1.000 76.36000  ? 555 ARG A CA    1 
ATOM   1841  C  C     . ARG A 1 310 ? 96.27800  112.54200 170.52100 1.000 76.36000  ? 555 ARG A C     1 
ATOM   1842  O  O     . ARG A 1 310 ? 95.73400  112.52300 171.63300 1.000 76.36000  ? 555 ARG A O     1 
ATOM   1843  C  CB    . ARG A 1 310 ? 97.30700  114.65800 169.66500 1.000 76.36000  ? 555 ARG A CB    1 
ATOM   1844  C  CG    . ARG A 1 310 ? 98.49700  115.59900 169.64200 1.000 76.36000  ? 555 ARG A CG    1 
ATOM   1845  C  CD    . ARG A 1 310 ? 98.13000  116.92700 168.99600 1.000 76.36000  ? 555 ARG A CD    1 
ATOM   1846  N  NE    . ARG A 1 310 ? 97.85200  116.78600 167.56900 1.000 76.36000  ? 555 ARG A NE    1 
ATOM   1847  C  CZ    . ARG A 1 310 ? 97.36200  117.75500 166.80200 1.000 76.36000  ? 555 ARG A CZ    1 
ATOM   1848  N  NH1   . ARG A 1 310 ? 97.08800  118.94300 167.32400 1.000 76.36000  ? 555 ARG A NH1   1 
ATOM   1849  N  NH2   . ARG A 1 310 ? 97.14300  117.53600 165.51300 1.000 76.36000  ? 555 ARG A NH2   1 
ATOM   1850  N  N     . LYS A 1 311 ? 95.76900  111.90200 169.46700 1.000 80.44000  ? 556 LYS A N     1 
ATOM   1851  C  CA    . LYS A 1 311 ? 94.50600  111.18000 169.56300 1.000 80.44000  ? 556 LYS A CA    1 
ATOM   1852  C  C     . LYS A 1 311 ? 94.61600  109.99600 170.51400 1.000 80.44000  ? 556 LYS A C     1 
ATOM   1853  O  O     . LYS A 1 311 ? 93.74200  109.78900 171.36300 1.000 80.44000  ? 556 LYS A O     1 
ATOM   1854  C  CB    . LYS A 1 311 ? 94.06000  110.71800 168.17600 1.000 80.44000  ? 556 LYS A CB    1 
ATOM   1855  C  CG    . LYS A 1 311 ? 92.73400  109.98100 168.17000 1.000 80.44000  ? 556 LYS A CG    1 
ATOM   1856  C  CD    . LYS A 1 311 ? 91.58700  110.90400 168.54200 1.000 80.44000  ? 556 LYS A CD    1 
ATOM   1857  C  CE    . LYS A 1 311 ? 90.26300  110.15600 168.57800 1.000 80.44000  ? 556 LYS A CE    1 
ATOM   1858  N  NZ    . LYS A 1 311 ? 89.85700  109.67500 167.22900 1.000 80.44000  ? 556 LYS A NZ    1 
ATOM   1859  N  N     . VAL A 1 312 ? 95.67900  109.19800 170.38300 1.000 83.98000  ? 557 VAL A N     1 
ATOM   1860  C  CA    . VAL A 1 312 ? 95.82800  108.05000 171.27700 1.000 83.98000  ? 557 VAL A CA    1 
ATOM   1861  C  C     . VAL A 1 312 ? 96.06300  108.51000 172.71200 1.000 83.98000  ? 557 VAL A C     1 
ATOM   1862  O  O     . VAL A 1 312 ? 95.54700  107.90700 173.66300 1.000 83.98000  ? 557 VAL A O     1 
ATOM   1863  C  CB    . VAL A 1 312 ? 96.94100  107.10300 170.79000 1.000 83.98000  ? 557 VAL A CB    1 
ATOM   1864  C  CG1   . VAL A 1 312 ? 98.26800  107.80300 170.73300 1.000 83.98000  ? 557 VAL A CG1   1 
ATOM   1865  C  CG2   . VAL A 1 312 ? 97.04500  105.90900 171.72400 1.000 83.98000  ? 557 VAL A CG2   1 
ATOM   1866  N  N     . LYS A 1 313 ? 96.81700  109.59900 172.89600 1.000 88.41000  ? 558 LYS A N     1 
ATOM   1867  C  CA    . LYS A 1 313 ? 97.04600  110.11200 174.24100 1.000 88.41000  ? 558 LYS A CA    1 
ATOM   1868  C  C     . LYS A 1 313 ? 95.74300  110.56500 174.88400 1.000 88.41000  ? 558 LYS A C     1 
ATOM   1869  O  O     . LYS A 1 313 ? 95.48700  110.26700 176.05400 1.000 88.41000  ? 558 LYS A O     1 
ATOM   1870  C  CB    . LYS A 1 313 ? 98.06100  111.25300 174.19200 1.000 88.41000  ? 558 LYS A CB    1 
ATOM   1871  C  CG    . LYS A 1 313 ? 98.45700  111.80600 175.54500 1.000 88.41000  ? 558 LYS A CG    1 
ATOM   1872  C  CD    . LYS A 1 313 ? 99.59200  112.81200 175.41200 1.000 88.41000  ? 558 LYS A CD    1 
ATOM   1873  C  CE    . LYS A 1 313 ? 99.07300  114.21700 175.14900 1.000 88.41000  ? 558 LYS A CE    1 
ATOM   1874  N  NZ    . LYS A 1 313 ? 98.82200  114.46700 173.70400 1.000 88.41000  ? 558 LYS A NZ    1 
ATOM   1875  N  N     . ASP A 1 314 ? 94.89200  111.26300 174.12800 1.000 94.82000  ? 559 ASP A N     1 
ATOM   1876  C  CA    . ASP A 1 314 ? 93.60300  111.68500 174.66800 1.000 94.82000  ? 559 ASP A CA    1 
ATOM   1877  C  C     . ASP A 1 314 ? 92.70000  110.49000 174.95500 1.000 94.82000  ? 559 ASP A C     1 
ATOM   1878  O  O     . ASP A 1 314 ? 92.03300  110.44300 175.99800 1.000 94.82000  ? 559 ASP A O     1 
ATOM   1879  C  CB    . ASP A 1 314 ? 92.92200  112.65300 173.70300 1.000 94.82000  ? 559 ASP A CB    1 
ATOM   1880  C  CG    . ASP A 1 314 ? 93.63300  113.98700 173.61900 1.000 94.82000  ? 559 ASP A CG    1 
ATOM   1881  O  OD1   . ASP A 1 314 ? 94.26600  114.38500 174.61900 1.000 94.82000  ? 559 ASP A OD1   1 
ATOM   1882  O  OD2   . ASP A 1 314 ? 93.56100  114.63600 172.55400 1.000 94.82000  ? 559 ASP A OD2   1 
ATOM   1883  N  N     . ALA A 1 315 ? 92.65200  109.52200 174.03800 1.000 100.47000 ? 560 ALA A N     1 
ATOM   1884  C  CA    . ALA A 1 315 ? 91.79000  108.36200 174.23400 1.000 100.47000 ? 560 ALA A CA    1 
ATOM   1885  C  C     . ALA A 1 315 ? 92.22100  107.55400 175.45000 1.000 100.47000 ? 560 ALA A C     1 
ATOM   1886  O  O     . ALA A 1 315 ? 91.39200  106.92400 176.11500 1.000 100.47000 ? 560 ALA A O     1 
ATOM   1887  C  CB    . ALA A 1 315 ? 91.78600  107.49200 172.97900 1.000 100.47000 ? 560 ALA A CB    1 
ATOM   1888  N  N     . GLU A 1 316 ? 93.51900  107.55800 175.76000 1.000 101.89000 ? 561 GLU A N     1 
ATOM   1889  C  CA    . GLU A 1 316 ? 93.95400  106.89300 176.98200 1.000 101.89000 ? 561 GLU A CA    1 
ATOM   1890  C  C     . GLU A 1 316 ? 93.73700  107.76900 178.21100 1.000 101.89000 ? 561 GLU A C     1 
ATOM   1891  O  O     . GLU A 1 316 ? 93.53700  107.23600 179.30700 1.000 101.89000 ? 561 GLU A O     1 
ATOM   1892  C  CB    . GLU A 1 316 ? 95.42100  106.47400 176.87000 1.000 101.89000 ? 561 GLU A CB    1 
ATOM   1893  C  CG    . GLU A 1 316 ? 95.91100  105.61400 178.02700 1.000 101.89000 ? 561 GLU A CG    1 
ATOM   1894  C  CD    . GLU A 1 316 ? 97.33200  105.12600 177.82900 1.000 101.89000 ? 561 GLU A CD    1 
ATOM   1895  O  OE1   . GLU A 1 316 ? 97.94400  105.47700 176.79800 1.000 101.89000 ? 561 GLU A OE1   1 
ATOM   1896  O  OE2   . GLU A 1 316 ? 97.83600  104.38800 178.70100 1.000 101.89000 ? 561 GLU A OE2   1 
ATOM   1897  N  N     . GLU A 1 317 ? 93.76900  109.09600 178.05300 1.000 101.37000 ? 562 GLU A N     1 
ATOM   1898  C  CA    . GLU A 1 317 ? 93.29700  109.97800 179.11500 1.000 101.37000 ? 562 GLU A CA    1 
ATOM   1899  C  C     . GLU A 1 317 ? 91.85800  109.67600 179.50100 1.000 101.37000 ? 562 GLU A C     1 
ATOM   1900  O  O     . GLU A 1 317 ? 91.51500  109.74100 180.68600 1.000 101.37000 ? 562 GLU A O     1 
ATOM   1901  C  CB    . GLU A 1 317 ? 93.40100  111.44500 178.69000 1.000 101.37000 ? 562 GLU A CB    1 
ATOM   1902  C  CG    . GLU A 1 317 ? 94.80800  111.99400 178.57700 1.000 101.37000 ? 562 GLU A CG    1 
ATOM   1903  C  CD    . GLU A 1 317 ? 94.82500  113.43000 178.08200 1.000 101.37000 ? 562 GLU A CD    1 
ATOM   1904  O  OE1   . GLU A 1 317 ? 93.75000  113.93800 177.69800 1.000 101.37000 ? 562 GLU A OE1   1 
ATOM   1905  O  OE2   . GLU A 1 317 ? 95.90900  114.05000 178.07700 1.000 101.37000 ? 562 GLU A OE2   1 
ATOM   1906  N  N     . ALA A 1 318 ? 91.01100  109.34800 178.52600 1.000 107.88000 ? 563 ALA A N     1 
ATOM   1907  C  CA    . ALA A 1 318 ? 89.60900  109.04500 178.77400 1.000 107.88000 ? 563 ALA A CA    1 
ATOM   1908  C  C     . ALA A 1 318 ? 89.36500  107.56400 179.03300 1.000 107.88000 ? 563 ALA A C     1 
ATOM   1909  O  O     . ALA A 1 318 ? 88.20700  107.14000 179.10700 1.000 107.88000 ? 563 ALA A O     1 
ATOM   1910  C  CB    . ALA A 1 318 ? 88.74900  109.52000 177.60100 1.000 107.88000 ? 563 ALA A CB    1 
ATOM   1911  N  N     . GLY A 1 319 ? 90.42100  106.76600 179.17100 1.000 112.09000 ? 564 GLY A N     1 
ATOM   1912  C  CA    . GLY A 1 319 ? 90.25400  105.35200 179.44300 1.000 112.09000 ? 564 GLY A CA    1 
ATOM   1913  C  C     . GLY A 1 319 ? 90.96600  104.43500 178.46900 1.000 112.09000 ? 564 GLY A C     1 
ATOM   1914  O  O     . GLY A 1 319 ? 92.19900  104.42300 178.40200 1.000 112.09000 ? 564 GLY A O     1 
ATOM   1915  N  N     . THR A 1 320 ? 90.19700  103.66200 177.70800 1.000 114.87000 ? 565 THR A N     1 
ATOM   1916  C  CA    . THR A 1 320 ? 90.77100  102.63200 176.84900 1.000 114.87000 ? 565 THR A CA    1 
ATOM   1917  C  C     . THR A 1 320 ? 91.30400  103.24500 175.55700 1.000 114.87000 ? 565 THR A C     1 
ATOM   1918  O  O     . THR A 1 320 ? 90.73400  104.22200 175.05900 1.000 114.87000 ? 565 THR A O     1 
ATOM   1919  C  CB    . THR A 1 320 ? 89.73400  101.55300 176.53100 1.000 114.87000 ? 565 THR A CB    1 
ATOM   1920  O  OG1   . THR A 1 320 ? 90.34900  100.50300 175.77300 1.000 114.87000 ? 565 THR A OG1   1 
ATOM   1921  C  CG2   . THR A 1 320 ? 88.56400  102.12900 175.74500 1.000 114.87000 ? 565 THR A CG2   1 
ATOM   1922  N  N     . PRO A 1 321 ? 92.39600  102.71900 175.00400 1.000 112.60000 ? 566 PRO A N     1 
ATOM   1923  C  CA    . PRO A 1 321 ? 92.90300  103.23300 173.72900 1.000 112.60000 ? 566 PRO A CA    1 
ATOM   1924  C  C     . PRO A 1 321 ? 91.99900  102.84800 172.56700 1.000 112.60000 ? 566 PRO A C     1 
ATOM   1925  O  O     . PRO A 1 321 ? 90.93400  102.25100 172.73700 1.000 112.60000 ? 566 PRO A O     1 
ATOM   1926  C  CB    . PRO A 1 321 ? 94.28000  102.56900 173.60100 1.000 112.60000 ? 566 PRO A CB    1 
ATOM   1927  C  CG    . PRO A 1 321 ? 94.65200  102.18900 174.99800 1.000 112.60000 ? 566 PRO A CG    1 
ATOM   1928  C  CD    . PRO A 1 321 ? 93.35700  101.81200 175.65100 1.000 112.60000 ? 566 PRO A CD    1 
ATOM   1929  N  N     . LEU A 1 322 ? 92.44300  103.20800 171.36400 1.000 104.26000 ? 567 LEU A N     1 
ATOM   1930  C  CA    . LEU A 1 322 ? 91.69400  102.88100 170.15900 1.000 104.26000 ? 567 LEU A CA    1 
ATOM   1931  C  C     . LEU A 1 322 ? 91.76100  101.38600 169.87800 1.000 104.26000 ? 567 LEU A C     1 
ATOM   1932  O  O     . LEU A 1 322 ? 92.66900  100.69300 170.34500 1.000 104.26000 ? 567 LEU A O     1 
ATOM   1933  C  CB    . LEU A 1 322 ? 92.24400  103.65500 168.95800 1.000 104.26000 ? 567 LEU A CB    1 
ATOM   1934  C  CG    . LEU A 1 322 ? 91.78600  105.09200 168.69000 1.000 104.26000 ? 567 LEU A CG    1 
ATOM   1935  C  CD1   . LEU A 1 322 ? 90.28000  105.15800 168.46700 1.000 104.26000 ? 567 LEU A CD1   1 
ATOM   1936  C  CD2   . LEU A 1 322 ? 92.22100  106.04100 169.78900 1.000 104.26000 ? 567 LEU A CD2   1 
ATOM   1937  N  N     . THR A 1 323 ? 90.79000  100.89000 169.11800 1.000 107.74000 ? 568 THR A N     1 
ATOM   1938  C  CA    . THR A 1 323 ? 90.87400  99.53900  168.58000 1.000 107.74000 ? 568 THR A CA    1 
ATOM   1939  C  C     . THR A 1 323 ? 91.36000  99.60700  167.13500 1.000 107.74000 ? 568 THR A C     1 
ATOM   1940  O  O     . THR A 1 323 ? 91.01000  100.53400 166.39600 1.000 107.74000 ? 568 THR A O     1 
ATOM   1941  C  CB    . THR A 1 323 ? 89.52200  98.83200  168.68300 1.000 107.74000 ? 568 THR A CB    1 
ATOM   1942  O  OG1   . THR A 1 323 ? 89.65600  97.46900  168.25800 1.000 107.74000 ? 568 THR A OG1   1 
ATOM   1943  C  CG2   . THR A 1 323 ? 88.46400  99.53200  167.84000 1.000 107.74000 ? 568 THR A CG2   1 
ATOM   1944  N  N     . ASP A 1 324 ? 92.18800  98.65000  166.73900 1.000 104.35000 ? 569 ASP A N     1 
ATOM   1945  C  CA    . ASP A 1 324 ? 92.87200  98.75600  165.45600 1.000 104.35000 ? 569 ASP A CA    1 
ATOM   1946  C  C     . ASP A 1 324 ? 92.20000  97.88000  164.40700 1.000 104.35000 ? 569 ASP A C     1 
ATOM   1947  O  O     . ASP A 1 324 ? 92.00800  96.68000  164.63700 1.000 104.35000 ? 569 ASP A O     1 
ATOM   1948  C  CB    . ASP A 1 324 ? 94.33800  98.37200  165.60900 1.000 104.35000 ? 569 ASP A CB    1 
ATOM   1949  C  CG    . ASP A 1 324 ? 95.11400  99.39400  166.39800 1.000 104.35000 ? 569 ASP A CG    1 
ATOM   1950  O  OD1   . ASP A 1 324 ? 94.70700  100.57100 166.36900 1.000 104.35000 ? 569 ASP A OD1   1 
ATOM   1951  O  OD2   . ASP A 1 324 ? 96.12200  99.03000  167.04000 1.000 104.35000 ? 569 ASP A OD2   1 
ATOM   1952  N  N     . PRO A 1 325 ? 91.82700  98.43700  163.24500 1.000 102.24000 ? 570 PRO A N     1 
ATOM   1953  C  CA    . PRO A 1 325 ? 91.23900  97.69900  162.12200 1.000 102.24000 ? 570 PRO A CA    1 
ATOM   1954  C  C     . PRO A 1 325 ? 92.15600  96.59100  161.61700 1.000 102.24000 ? 570 PRO A C     1 
ATOM   1955  O  O     . PRO A 1 325 ? 93.37300  96.74700  161.72000 1.000 102.24000 ? 570 PRO A O     1 
ATOM   1956  C  CB    . PRO A 1 325 ? 91.05200  98.77800  161.05100 1.000 102.24000 ? 570 PRO A CB    1 
ATOM   1957  C  CG    . PRO A 1 325 ? 90.97400  100.05400 161.81100 1.000 102.24000 ? 570 PRO A CG    1 
ATOM   1958  C  CD    . PRO A 1 325 ? 91.91100  99.88100  162.96600 1.000 102.24000 ? 570 PRO A CD    1 
ATOM   1959  N  N     . PRO A 1 337 ? 94.01300  94.79200  167.98900 1.000 104.84000 ? 582 PRO A N     1 
ATOM   1960  C  CA    . PRO A 1 337 ? 94.44200  94.73400  169.39000 1.000 104.84000 ? 582 PRO A CA    1 
ATOM   1961  C  C     . PRO A 1 337 ? 94.27900  96.06700  170.11200 1.000 104.84000 ? 582 PRO A C     1 
ATOM   1962  O  O     . PRO A 1 337 ? 93.26300  96.74100  169.94400 1.000 104.84000 ? 582 PRO A O     1 
ATOM   1963  C  CB    . PRO A 1 337 ? 95.92000  94.34800  169.28900 1.000 104.84000 ? 582 PRO A CB    1 
ATOM   1964  C  CG    . PRO A 1 337 ? 96.02800  93.63500  167.99000 1.000 104.84000 ? 582 PRO A CG    1 
ATOM   1965  C  CD    . PRO A 1 337 ? 95.06700  94.32600  167.07300 1.000 104.84000 ? 582 PRO A CD    1 
ATOM   1966  N  N     . GLN A 1 338 ? 95.27600  96.43800  170.90900 1.000 101.77000 ? 583 GLN A N     1 
ATOM   1967  C  CA    . GLN A 1 338 ? 95.25400  97.68300  171.66100 1.000 101.77000 ? 583 GLN A CA    1 
ATOM   1968  C  C     . GLN A 1 338 ? 96.20100  98.68500  171.01600 1.000 101.77000 ? 583 GLN A C     1 
ATOM   1969  O  O     . GLN A 1 338 ? 97.36800  98.37800  170.76000 1.000 101.77000 ? 583 GLN A O     1 
ATOM   1970  C  CB    . GLN A 1 338 ? 95.64600  97.44300  173.11900 1.000 101.77000 ? 583 GLN A CB    1 
ATOM   1971  C  CG    . GLN A 1 338 ? 95.50100  98.65600  174.01600 1.000 101.77000 ? 583 GLN A CG    1 
ATOM   1972  C  CD    . GLN A 1 338 ? 95.85200  98.34800  175.45600 1.000 101.77000 ? 583 GLN A CD    1 
ATOM   1973  O  OE1   . GLN A 1 338 ? 96.26600  97.23500  175.78000 1.000 101.77000 ? 583 GLN A OE1   1 
ATOM   1974  N  NE2   . GLN A 1 338 ? 95.67900  99.33000  176.33100 1.000 101.77000 ? 583 GLN A NE2   1 
ATOM   1975  N  N     . LEU A 1 339 ? 95.69000  99.88300  170.75600 1.000 94.37000  ? 584 LEU A N     1 
ATOM   1976  C  CA    . LEU A 1 339 ? 96.44400  100.89200 170.03500 1.000 94.37000  ? 584 LEU A CA    1 
ATOM   1977  C  C     . LEU A 1 339 ? 97.34100  101.67000 170.99900 1.000 94.37000  ? 584 LEU A C     1 
ATOM   1978  O  O     . LEU A 1 339 ? 97.08500  101.75200 172.20200 1.000 94.37000  ? 584 LEU A O     1 
ATOM   1979  C  CB    . LEU A 1 339 ? 95.47700  101.80000 169.27300 1.000 94.37000  ? 584 LEU A CB    1 
ATOM   1980  C  CG    . LEU A 1 339 ? 95.95100  102.81700 168.23300 1.000 94.37000  ? 584 LEU A CG    1 
ATOM   1981  C  CD1   . LEU A 1 339 ? 96.34100  104.11200 168.88400 1.000 94.37000  ? 584 LEU A CD1   1 
ATOM   1982  C  CD2   . LEU A 1 339 ? 97.11900  102.25200 167.42900 1.000 94.37000  ? 584 LEU A CD2   1 
ATOM   1983  N  N     . SER A 1 340 ? 98.40900  102.24200 170.45500 1.000 83.63000  ? 585 SER A N     1 
ATOM   1984  C  CA    . SER A 1 340 ? 99.45900  102.85400 171.26400 1.000 83.63000  ? 585 SER A CA    1 
ATOM   1985  C  C     . SER A 1 340 ? 100.03000 104.04400 170.49700 1.000 83.63000  ? 585 SER A C     1 
ATOM   1986  O  O     . SER A 1 340 ? 99.41100  104.54600 169.55400 1.000 83.63000  ? 585 SER A O     1 
ATOM   1987  C  CB    . SER A 1 340 ? 100.52800 101.80900 171.62300 1.000 83.63000  ? 585 SER A CB    1 
ATOM   1988  O  OG    . SER A 1 340 ? 101.21000 101.36700 170.46300 1.000 83.63000  ? 585 SER A OG    1 
ATOM   1989  N  N     . THR A 1 341 ? 101.21000 104.50300 170.90600 1.000 73.60000  ? 586 THR A N     1 
ATOM   1990  C  CA    . THR A 1 341 ? 101.87800 105.63400 170.28200 1.000 73.60000  ? 586 THR A CA    1 
ATOM   1991  C  C     . THR A 1 341 ? 102.93500 105.12700 169.31200 1.000 73.60000  ? 586 THR A C     1 
ATOM   1992  O  O     . THR A 1 341 ? 103.59300 104.11400 169.57000 1.000 73.60000  ? 586 THR A O     1 
ATOM   1993  C  CB    . THR A 1 341 ? 102.53100 106.54600 171.32600 1.000 73.60000  ? 586 THR A CB    1 
ATOM   1994  O  OG1   . THR A 1 341 ? 103.52300 105.81100 172.05200 1.000 73.60000  ? 586 THR A OG1   1 
ATOM   1995  C  CG2   . THR A 1 341 ? 101.49100 107.07400 172.29900 1.000 73.60000  ? 586 THR A CG2   1 
ATOM   1996  N  N     . LEU A 1 342 ? 103.09500 105.83500 168.20100 1.000 59.06000  ? 587 LEU A N     1 
ATOM   1997  C  CA    . LEU A 1 342 ? 104.00700 105.36300 167.17500 1.000 59.06000  ? 587 LEU A CA    1 
ATOM   1998  C  C     . LEU A 1 342 ? 105.33200 106.11100 167.24100 1.000 59.06000  ? 587 LEU A C     1 
ATOM   1999  O  O     . LEU A 1 342 ? 105.37000 107.29400 167.59100 1.000 59.06000  ? 587 LEU A O     1 
ATOM   2000  C  CB    . LEU A 1 342 ? 103.39300 105.54500 165.78500 1.000 59.06000  ? 587 LEU A CB    1 
ATOM   2001  C  CG    . LEU A 1 342 ? 102.15100 104.70200 165.50000 1.000 59.06000  ? 587 LEU A CG    1 
ATOM   2002  C  CD1   . LEU A 1 342 ? 101.54600 105.07600 164.15800 1.000 59.06000  ? 587 LEU A CD1   1 
ATOM   2003  C  CD2   . LEU A 1 342 ? 102.49700 103.22300 165.54800 1.000 59.06000  ? 587 LEU A CD2   1 
ATOM   2004  N  N     . PRO A 1 343 ? 106.43500 105.44300 166.91000 1.000 50.58000  ? 588 PRO A N     1 
ATOM   2005  C  CA    . PRO A 1 343 ? 107.73400 106.12600 166.90400 1.000 50.58000  ? 588 PRO A CA    1 
ATOM   2006  C  C     . PRO A 1 343 ? 107.91200 107.00500 165.67900 1.000 50.58000  ? 588 PRO A C     1 
ATOM   2007  O  O     . PRO A 1 343 ? 107.01500 107.10000 164.83700 1.000 50.58000  ? 588 PRO A O     1 
ATOM   2008  C  CB    . PRO A 1 343 ? 108.73400 104.96600 166.91500 1.000 50.58000  ? 588 PRO A CB    1 
ATOM   2009  C  CG    . PRO A 1 343 ? 108.01000 103.85400 166.25000 1.000 50.58000  ? 588 PRO A CG    1 
ATOM   2010  C  CD    . PRO A 1 343 ? 106.56600 104.00300 166.63900 1.000 50.58000  ? 588 PRO A CD    1 
ATOM   2011  N  N     . THR A 1 344 ? 109.06700 107.65000 165.57000 1.000 44.03000  ? 589 THR A N     1 
ATOM   2012  C  CA    . THR A 1 344 ? 109.39900 108.51500 164.44200 1.000 44.03000  ? 589 THR A CA    1 
ATOM   2013  C  C     . THR A 1 344 ? 110.60900 107.89600 163.74500 1.000 44.03000  ? 589 THR A C     1 
ATOM   2014  O  O     . THR A 1 344 ? 111.75500 108.17700 164.09600 1.000 44.03000  ? 589 THR A O     1 
ATOM   2015  C  CB    . THR A 1 344 ? 109.68000 109.94300 164.90600 1.000 44.03000  ? 589 THR A CB    1 
ATOM   2016  O  OG1   . THR A 1 344 ? 108.53800 110.45100 165.60500 1.000 44.03000  ? 589 THR A OG1   1 
ATOM   2017  C  CG2   . THR A 1 344 ? 109.96500 110.84300 163.71900 1.000 44.03000  ? 589 THR A CG2   1 
ATOM   2018  N  N     . ILE A 1 345 ? 110.33700 107.03300 162.76300 1.000 40.51000  ? 590 ILE A N     1 
ATOM   2019  C  CA    . ILE A 1 345 ? 111.40300 106.33200 162.05800 1.000 40.51000  ? 590 ILE A CA    1 
ATOM   2020  C  C     . ILE A 1 345 ? 112.36500 107.34100 161.45100 1.000 40.51000  ? 590 ILE A C     1 
ATOM   2021  O  O     . ILE A 1 345 ? 111.95200 108.38000 160.92100 1.000 40.51000  ? 590 ILE A O     1 
ATOM   2022  C  CB    . ILE A 1 345 ? 110.80800 105.42000 160.97300 1.000 40.51000  ? 590 ILE A CB    1 
ATOM   2023  C  CG1   . ILE A 1 345 ? 109.66700 104.58300 161.54800 1.000 40.51000  ? 590 ILE A CG1   1 
ATOM   2024  C  CG2   . ILE A 1 345 ? 111.87800 104.52300 160.38000 1.000 40.51000  ? 590 ILE A CG2   1 
ATOM   2025  C  CD1   . ILE A 1 345 ? 110.05500 103.74900 162.72500 1.000 40.51000  ? 590 ILE A CD1   1 
ATOM   2026  N  N     . VAL A 1 346 ? 113.66000 107.04600 161.53300 1.000 37.61000  ? 591 VAL A N     1 
ATOM   2027  C  CA    . VAL A 1 346 ? 114.70600 107.92400 161.01500 1.000 37.61000  ? 591 VAL A CA    1 
ATOM   2028  C  C     . VAL A 1 346 ? 115.66000 107.06100 160.20000 1.000 37.61000  ? 591 VAL A C     1 
ATOM   2029  O  O     . VAL A 1 346 ? 116.55400 106.41400 160.75700 1.000 37.61000  ? 591 VAL A O     1 
ATOM   2030  C  CB    . VAL A 1 346 ? 115.45200 108.66800 162.12800 1.000 37.61000  ? 591 VAL A CB    1 
ATOM   2031  C  CG1   . VAL A 1 346 ? 116.58600 109.49000 161.54600 1.000 37.61000  ? 591 VAL A CG1   1 
ATOM   2032  C  CG2   . VAL A 1 346 ? 114.50200 109.55500 162.90600 1.000 37.61000  ? 591 VAL A CG2   1 
ATOM   2033  N  N     . VAL A 1 347 ? 115.47300 107.03700 158.88700 1.000 35.33000  ? 592 VAL A N     1 
ATOM   2034  C  CA    . VAL A 1 347 ? 116.39400 106.33600 158.00200 1.000 35.33000  ? 592 VAL A CA    1 
ATOM   2035  C  C     . VAL A 1 347 ? 117.65500 107.17300 157.84800 1.000 35.33000  ? 592 VAL A C     1 
ATOM   2036  O  O     . VAL A 1 347 ? 117.58500 108.37300 157.55800 1.000 35.33000  ? 592 VAL A O     1 
ATOM   2037  C  CB    . VAL A 1 347 ? 115.73600 106.06300 156.64100 1.000 35.33000  ? 592 VAL A CB    1 
ATOM   2038  C  CG1   . VAL A 1 347 ? 116.71600 105.38200 155.71100 1.000 35.33000  ? 592 VAL A CG1   1 
ATOM   2039  C  CG2   . VAL A 1 347 ? 114.48600 105.22300 156.82000 1.000 35.33000  ? 592 VAL A CG2   1 
ATOM   2040  N  N     . VAL A 1 348 ? 118.81200 106.54800 158.03900 1.000 38.44000  ? 593 VAL A N     1 
ATOM   2041  C  CA    . VAL A 1 348 ? 120.09800 107.23300 157.96600 1.000 38.44000  ? 593 VAL A CA    1 
ATOM   2042  C  C     . VAL A 1 348 ? 120.94200 106.50000 156.93400 1.000 38.44000  ? 593 VAL A C     1 
ATOM   2043  O  O     . VAL A 1 348 ? 121.58600 105.49300 157.24700 1.000 38.44000  ? 593 VAL A O     1 
ATOM   2044  C  CB    . VAL A 1 348 ? 120.80800 107.28600 159.32000 1.000 38.44000  ? 593 VAL A CB    1 
ATOM   2045  C  CG1   . VAL A 1 348 ? 122.16300 107.95100 159.17100 1.000 38.44000  ? 593 VAL A CG1   1 
ATOM   2046  C  CG2   . VAL A 1 348 ? 119.95600 108.02100 160.33300 1.000 38.44000  ? 593 VAL A CG2   1 
ATOM   2047  N  N     . VAL A 1 349 ? 120.94300 106.99800 155.70300 1.000 40.71000  ? 594 VAL A N     1 
ATOM   2048  C  CA    . VAL A 1 349 ? 121.73700 106.40400 154.63700 1.000 40.71000  ? 594 VAL A CA    1 
ATOM   2049  C  C     . VAL A 1 349 ? 123.04600 107.16500 154.49500 1.000 40.71000  ? 594 VAL A C     1 
ATOM   2050  O  O     . VAL A 1 349 ? 123.11400 108.17500 153.78900 1.000 40.71000  ? 594 VAL A O     1 
ATOM   2051  C  CB    . VAL A 1 349 ? 120.96300 106.39200 153.30900 1.000 40.71000  ? 594 VAL A CB    1 
ATOM   2052  C  CG1   . VAL A 1 349 ? 121.82700 105.82200 152.20800 1.000 40.71000  ? 594 VAL A CG1   1 
ATOM   2053  C  CG2   . VAL A 1 349 ? 119.67900 105.60200 153.45500 1.000 40.71000  ? 594 VAL A CG2   1 
ATOM   2054  N  N     . ASP A 1 350 ? 124.08800 106.70400 155.17800 1.000 45.84000  ? 595 ASP A N     1 
ATOM   2055  C  CA    . ASP A 1 350 ? 125.39500 107.32500 155.02800 1.000 45.84000  ? 595 ASP A CA    1 
ATOM   2056  C  C     . ASP A 1 350 ? 125.99400 106.95700 153.67800 1.000 45.84000  ? 595 ASP A C     1 
ATOM   2057  O  O     . ASP A 1 350 ? 125.69900 105.89600 153.12100 1.000 45.84000  ? 595 ASP A O     1 
ATOM   2058  C  CB    . ASP A 1 350 ? 126.32200 106.88400 156.15900 1.000 45.84000  ? 595 ASP A CB    1 
ATOM   2059  C  CG    . ASP A 1 350 ? 127.60800 107.68500 156.21500 1.000 45.84000  ? 595 ASP A CG    1 
ATOM   2060  O  OD1   . ASP A 1 350 ? 127.80100 108.58300 155.37000 1.000 45.84000  ? 595 ASP A OD1   1 
ATOM   2061  O  OD2   . ASP A 1 350 ? 128.43300 107.41100 157.11200 1.000 45.84000  ? 595 ASP A OD2   1 
ATOM   2062  N  N     . GLU A 1 351 ? 126.84600 107.84200 153.15900 1.000 45.50000  ? 596 GLU A N     1 
ATOM   2063  C  CA    . GLU A 1 351 ? 127.48700 107.65600 151.86200 1.000 45.50000  ? 596 GLU A CA    1 
ATOM   2064  C  C     . GLU A 1 351 ? 126.47700 107.29400 150.78100 1.000 45.50000  ? 596 GLU A C     1 
ATOM   2065  O  O     . GLU A 1 351 ? 126.60100 106.25000 150.13400 1.000 45.50000  ? 596 GLU A O     1 
ATOM   2066  C  CB    . GLU A 1 351 ? 128.57500 106.58700 151.94700 1.000 45.50000  ? 596 GLU A CB    1 
ATOM   2067  C  CG    . GLU A 1 351 ? 129.77200 107.00100 152.77100 1.000 45.50000  ? 596 GLU A CG    1 
ATOM   2068  C  CD    . GLU A 1 351 ? 130.54300 108.13900 152.13300 1.000 45.50000  ? 596 GLU A CD    1 
ATOM   2069  O  OE1   . GLU A 1 351 ? 130.56400 108.22100 150.88700 1.000 45.50000  ? 596 GLU A OE1   1 
ATOM   2070  O  OE2   . GLU A 1 351 ? 131.13100 108.95100 152.87600 1.000 45.50000  ? 596 GLU A OE2   1 
ATOM   2071  N  N     . PHE A 1 352 ? 125.48300 108.15300 150.57100 1.000 42.57000  ? 597 PHE A N     1 
ATOM   2072  C  CA    . PHE A 1 352 ? 124.47200 107.89900 149.55600 1.000 42.57000  ? 597 PHE A CA    1 
ATOM   2073  C  C     . PHE A 1 352 ? 125.02400 108.31700 148.19900 1.000 42.57000  ? 597 PHE A C     1 
ATOM   2074  O  O     . PHE A 1 352 ? 124.39600 109.07300 147.45400 1.000 42.57000  ? 597 PHE A O     1 
ATOM   2075  C  CB    . PHE A 1 352 ? 123.18200 108.64200 149.91600 1.000 42.57000  ? 597 PHE A CB    1 
ATOM   2076  C  CG    . PHE A 1 352 ? 122.03400 108.38400 148.98700 1.000 42.57000  ? 597 PHE A CG    1 
ATOM   2077  C  CD1   . PHE A 1 352 ? 121.38100 107.17200 148.98900 1.000 42.57000  ? 597 PHE A CD1   1 
ATOM   2078  C  CD2   . PHE A 1 352 ? 121.57300 109.37800 148.15000 1.000 42.57000  ? 597 PHE A CD2   1 
ATOM   2079  C  CE1   . PHE A 1 352 ? 120.31400 106.94500 148.14500 1.000 42.57000  ? 597 PHE A CE1   1 
ATOM   2080  C  CE2   . PHE A 1 352 ? 120.51100 109.15300 147.30700 1.000 42.57000  ? 597 PHE A CE2   1 
ATOM   2081  C  CZ    . PHE A 1 352 ? 119.87900 107.93700 147.30900 1.000 42.57000  ? 597 PHE A CZ    1 
ATOM   2082  N  N     . ALA A 1 353 ? 126.21700 107.82200 147.88400 1.000 44.98000  ? 598 ALA A N     1 
ATOM   2083  C  CA    . ALA A 1 353 ? 126.82500 107.96400 146.57400 1.000 44.98000  ? 598 ALA A CA    1 
ATOM   2084  C  C     . ALA A 1 353 ? 127.45300 106.67100 146.09400 1.000 44.98000  ? 598 ALA A C     1 
ATOM   2085  O  O     . ALA A 1 353 ? 127.76400 106.55800 144.90400 1.000 44.98000  ? 598 ALA A O     1 
ATOM   2086  C  CB    . ALA A 1 353 ? 127.89400 109.06700 146.58400 1.000 44.98000  ? 598 ALA A CB    1 
ATOM   2087  N  N     . ASP A 1 354 ? 127.65700 105.70600 146.98400 1.000 53.93000  ? 599 ASP A N     1 
ATOM   2088  C  CA    . ASP A 1 354 ? 128.10700 104.36100 146.66200 1.000 53.93000  ? 599 ASP A CA    1 
ATOM   2089  C  C     . ASP A 1 354 ? 127.02100 103.31900 146.84900 1.000 53.93000  ? 599 ASP A C     1 
ATOM   2090  O  O     . ASP A 1 354 ? 127.12700 102.21900 146.30800 1.000 53.93000  ? 599 ASP A O     1 
ATOM   2091  C  CB    . ASP A 1 354 ? 129.31600 103.99700 147.52600 1.000 53.93000  ? 599 ASP A CB    1 
ATOM   2092  C  CG    . ASP A 1 354 ? 130.55900 104.74100 147.11100 1.000 53.93000  ? 599 ASP A CG    1 
ATOM   2093  O  OD1   . ASP A 1 354 ? 130.73600 104.95700 145.89600 1.000 53.93000  ? 599 ASP A OD1   1 
ATOM   2094  O  OD2   . ASP A 1 354 ? 131.33600 105.14700 147.99600 1.000 53.93000  ? 599 ASP A OD2   1 
ATOM   2095  N  N     . MET A 1 355 ? 125.98300 103.63100 147.62600 1.000 53.48000  ? 600 MET A N     1 
ATOM   2096  C  CA    . MET A 1 355 ? 124.83200 102.74500 147.66500 1.000 53.48000  ? 600 MET A CA    1 
ATOM   2097  C  C     . MET A 1 355 ? 124.13800 102.70500 146.31400 1.000 53.48000  ? 600 MET A C     1 
ATOM   2098  O  O     . MET A 1 355 ? 123.54900 101.68200 145.94700 1.000 53.48000  ? 600 MET A O     1 
ATOM   2099  C  CB    . MET A 1 355 ? 123.85500 103.17400 148.75800 1.000 53.48000  ? 600 MET A CB    1 
ATOM   2100  C  CG    . MET A 1 355 ? 122.73300 102.18000 148.95800 1.000 53.48000  ? 600 MET A CG    1 
ATOM   2101  S  SD    . MET A 1 355 ? 121.59500 102.59300 150.28600 1.000 53.48000  ? 600 MET A SD    1 
ATOM   2102  C  CE    . MET A 1 355 ? 120.64000 103.88100 149.51200 1.000 53.48000  ? 600 MET A CE    1 
ATOM   2103  N  N     . MET A 1 356 ? 124.20700 103.80000 145.55200 1.000 56.55000  ? 601 MET A N     1 
ATOM   2104  C  CA    . MET A 1 356 ? 123.68300 103.82900 144.19300 1.000 56.55000  ? 601 MET A CA    1 
ATOM   2105  C  C     . MET A 1 356 ? 124.74400 103.49200 143.16000 1.000 56.55000  ? 601 MET A C     1 
ATOM   2106  O  O     . MET A 1 356 ? 124.61400 103.86200 141.98800 1.000 56.55000  ? 601 MET A O     1 
ATOM   2107  C  CB    . MET A 1 356 ? 123.05600 105.18800 143.89400 1.000 56.55000  ? 601 MET A CB    1 
ATOM   2108  C  CG    . MET A 1 356 ? 121.79400 105.46700 144.68000 1.000 56.55000  ? 601 MET A CG    1 
ATOM   2109  S  SD    . MET A 1 356 ? 121.11300 107.08800 144.30000 1.000 56.55000  ? 601 MET A SD    1 
ATOM   2110  C  CE    . MET A 1 356 ? 120.51700 106.81600 142.63400 1.000 56.55000  ? 601 MET A CE    1 
ATOM   2111  N  N     . MET A 1 357 ? 125.78900 102.81400 143.57100 1.000 55.83000  ? 602 MET A N     1 
ATOM   2112  C  CA    . MET A 1 357 ? 126.76700 102.20800 142.68000 1.000 55.83000  ? 602 MET A CA    1 
ATOM   2113  C  C     . MET A 1 357 ? 126.90800 100.71900 142.92500 1.000 55.83000  ? 602 MET A C     1 
ATOM   2114  O  O     . MET A 1 357 ? 127.13400 99.96400  141.97300 1.000 55.83000  ? 602 MET A O     1 
ATOM   2115  C  CB    . MET A 1 357 ? 128.12600 102.88900 142.83700 1.000 55.83000  ? 602 MET A CB    1 
ATOM   2116  C  CG    . MET A 1 357 ? 128.13300 104.32800 142.37300 1.000 55.83000  ? 602 MET A CG    1 
ATOM   2117  S  SD    . MET A 1 357 ? 129.73100 105.13200 142.55200 1.000 55.83000  ? 602 MET A SD    1 
ATOM   2118  C  CE    . MET A 1 357 ? 129.32900 106.79300 142.02100 1.000 55.83000  ? 602 MET A CE    1 
ATOM   2119  N  N     . ILE A 1 358 ? 126.80100 100.28400 144.18000 1.000 54.37000  ? 603 ILE A N     1 
ATOM   2120  C  CA    . ILE A 1 358 ? 126.66200 98.86200  144.46700 1.000 54.37000  ? 603 ILE A CA    1 
ATOM   2121  C  C     . ILE A 1 358 ? 125.29300 98.37200  144.01300 1.000 54.37000  ? 603 ILE A C     1 
ATOM   2122  O  O     . ILE A 1 358 ? 125.17500 97.40500  143.25200 1.000 54.37000  ? 603 ILE A O     1 
ATOM   2123  C  CB    . ILE A 1 358 ? 126.88100 98.58500  145.96400 1.000 54.37000  ? 603 ILE A CB    1 
ATOM   2124  C  CG1   . ILE A 1 358 ? 128.28700 98.98900  146.37500 1.000 54.37000  ? 603 ILE A CG1   1 
ATOM   2125  C  CG2   . ILE A 1 358 ? 126.66700 97.11200  146.26100 1.000 54.37000  ? 603 ILE A CG2   1 
ATOM   2126  C  CD1   . ILE A 1 358 ? 128.52400 98.96100  147.86100 1.000 54.37000  ? 603 ILE A CD1   1 
ATOM   2127  N  N     . VAL A 1 359 ? 124.23600 99.04100  144.47200 1.000 55.87000  ? 604 VAL A N     1 
ATOM   2128  C  CA    . VAL A 1 359 ? 122.87000 98.60300  144.20700 1.000 55.87000  ? 604 VAL A CA    1 
ATOM   2129  C  C     . VAL A 1 359 ? 122.36800 99.22600  142.91300 1.000 55.87000  ? 604 VAL A C     1 
ATOM   2130  O  O     . VAL A 1 359 ? 122.04600 98.51700  141.95500 1.000 55.87000  ? 604 VAL A O     1 
ATOM   2131  C  CB    . VAL A 1 359 ? 121.93700 98.96900  145.37300 1.000 55.87000  ? 604 VAL A CB    1 
ATOM   2132  C  CG1   . VAL A 1 359 ? 120.53600 98.46700  145.09500 1.000 55.87000  ? 604 VAL A CG1   1 
ATOM   2133  C  CG2   . VAL A 1 359 ? 122.47900 98.40800  146.66800 1.000 55.87000  ? 604 VAL A CG2   1 
ATOM   2134  N  N     . GLY A 1 360 ? 122.28600 100.55700 142.87700 1.000 57.66000  ? 605 GLY A N     1 
ATOM   2135  C  CA    . GLY A 1 360 ? 121.89600 101.28200 141.68300 1.000 57.66000  ? 605 GLY A CA    1 
ATOM   2136  C  C     . GLY A 1 360 ? 120.38400 101.37900 141.55000 1.000 57.66000  ? 605 GLY A C     1 
ATOM   2137  O  O     . GLY A 1 360 ? 119.70000 101.89300 142.44800 1.000 57.66000  ? 605 GLY A O     1 
ATOM   2138  N  N     . LYS A 1 361 ? 119.87300 100.89500 140.41900 1.000 62.85000  ? 606 LYS A N     1 
ATOM   2139  C  CA    . LYS A 1 361 ? 118.46700 101.00300 140.04400 1.000 62.85000  ? 606 LYS A CA    1 
ATOM   2140  C  C     . LYS A 1 361 ? 117.51500 100.46600 141.10700 1.000 62.85000  ? 606 LYS A C     1 
ATOM   2141  O  O     . LYS A 1 361 ? 116.41700 101.00300 141.28900 1.000 62.85000  ? 606 LYS A O     1 
ATOM   2142  C  CB    . LYS A 1 361 ? 118.21900 100.26500 138.72500 1.000 62.85000  ? 606 LYS A CB    1 
ATOM   2143  C  CG    . LYS A 1 361 ? 118.76100 100.97700 137.50100 1.000 62.85000  ? 606 LYS A CG    1 
ATOM   2144  C  CD    . LYS A 1 361 ? 120.20300 100.59000 137.22400 1.000 62.85000  ? 606 LYS A CD    1 
ATOM   2145  C  CE    . LYS A 1 361 ? 120.68200 101.16900 135.90600 1.000 62.85000  ? 606 LYS A CE    1 
ATOM   2146  N  NZ    . LYS A 1 361 ? 120.72400 102.65500 135.94300 1.000 62.85000  ? 606 LYS A NZ    1 
ATOM   2147  N  N     . LYS A 1 362 ? 117.92300 99.40500  141.80500 1.000 60.85000  ? 607 LYS A N     1 
ATOM   2148  C  CA    . LYS A 1 362 ? 117.01900 98.70900  142.71600 1.000 60.85000  ? 607 LYS A CA    1 
ATOM   2149  C  C     . LYS A 1 362 ? 116.51800 99.64300  143.81400 1.000 60.85000  ? 607 LYS A C     1 
ATOM   2150  O  O     . LYS A 1 362 ? 115.31000 99.83700  143.98500 1.000 60.85000  ? 607 LYS A O     1 
ATOM   2151  C  CB    . LYS A 1 362 ? 117.71800 97.48900  143.32400 1.000 60.85000  ? 607 LYS A CB    1 
ATOM   2152  C  CG    . LYS A 1 362 ? 117.89900 96.29500  142.38800 1.000 60.85000  ? 607 LYS A CG    1 
ATOM   2153  C  CD    . LYS A 1 362 ? 119.07300 96.49500  141.43600 1.000 60.85000  ? 607 LYS A CD    1 
ATOM   2154  C  CE    . LYS A 1 362 ? 119.34600 95.25600  140.60400 1.000 60.85000  ? 607 LYS A CE    1 
ATOM   2155  N  NZ    . LYS A 1 362 ? 120.43200 95.49500  139.61500 1.000 60.85000  ? 607 LYS A NZ    1 
ATOM   2156  N  N     . VAL A 1 363 ? 117.44500 100.23200 144.57000 1.000 52.68000  ? 608 VAL A N     1 
ATOM   2157  C  CA    . VAL A 1 363 ? 117.12600 101.12000 145.68500 1.000 52.68000  ? 608 VAL A CA    1 
ATOM   2158  C  C     . VAL A 1 363 ? 116.43100 102.39700 145.23700 1.000 52.68000  ? 608 VAL A C     1 
ATOM   2159  O  O     . VAL A 1 363 ? 115.39500 102.77200 145.79600 1.000 52.68000  ? 608 VAL A O     1 
ATOM   2160  C  CB    . VAL A 1 363 ? 118.39300 101.46100 146.48600 1.000 52.68000  ? 608 VAL A CB    1 
ATOM   2161  C  CG1   . VAL A 1 363 ? 118.16600 102.70300 147.30200 1.000 52.68000  ? 608 VAL A CG1   1 
ATOM   2162  C  CG2   . VAL A 1 363 ? 118.73300 100.32100 147.41600 1.000 52.68000  ? 608 VAL A CG2   1 
ATOM   2163  N  N     . GLU A 1 364 ? 116.99100 103.06100 144.22600 1.000 51.08000  ? 609 GLU A N     1 
ATOM   2164  C  CA    . GLU A 1 364 ? 116.70000 104.45400 143.89900 1.000 51.08000  ? 609 GLU A CA    1 
ATOM   2165  C  C     . GLU A 1 364 ? 115.24200 104.86700 144.07500 1.000 51.08000  ? 609 GLU A C     1 
ATOM   2166  O  O     . GLU A 1 364 ? 114.95200 105.84200 144.78000 1.000 51.08000  ? 609 GLU A O     1 
ATOM   2167  C  CB    . GLU A 1 364 ? 117.12500 104.72800 142.46000 1.000 51.08000  ? 609 GLU A CB    1 
ATOM   2168  C  CG    . GLU A 1 364 ? 116.87600 106.14000 141.99800 1.000 51.08000  ? 609 GLU A CG    1 
ATOM   2169  C  CD    . GLU A 1 364 ? 117.31700 106.34600 140.57000 1.000 51.08000  ? 609 GLU A CD    1 
ATOM   2170  O  OE1   . GLU A 1 364 ? 117.82400 105.38200 139.96100 1.000 51.08000  ? 609 GLU A OE1   1 
ATOM   2171  O  OE2   . GLU A 1 364 ? 117.14400 107.46400 140.05000 1.000 51.08000  ? 609 GLU A OE2   1 
ATOM   2172  N  N     . GLU A 1 365 ? 114.31500 104.13500 143.45700 1.000 49.67000  ? 610 GLU A N     1 
ATOM   2173  C  CA    . GLU A 1 365 ? 112.91500 104.53200 143.54100 1.000 49.67000  ? 610 GLU A CA    1 
ATOM   2174  C  C     . GLU A 1 365 ? 112.35000 104.37200 144.94500 1.000 49.67000  ? 610 GLU A C     1 
ATOM   2175  O  O     . GLU A 1 365 ? 111.38800 105.06100 145.29600 1.000 49.67000  ? 610 GLU A O     1 
ATOM   2176  C  CB    . GLU A 1 365 ? 112.08000 103.74600 142.53000 1.000 49.67000  ? 610 GLU A CB    1 
ATOM   2177  C  CG    . GLU A 1 365 ? 112.37800 104.12800 141.08600 1.000 49.67000  ? 610 GLU A CG    1 
ATOM   2178  C  CD    . GLU A 1 365 ? 111.50500 103.39900 140.08500 1.000 49.67000  ? 610 GLU A CD    1 
ATOM   2179  O  OE1   . GLU A 1 365 ? 110.72900 102.51300 140.49900 1.000 49.67000  ? 610 GLU A OE1   1 
ATOM   2180  O  OE2   . GLU A 1 365 ? 111.59800 103.71200 138.88000 1.000 49.67000  ? 610 GLU A OE2   1 
ATOM   2181  N  N     . LEU A 1 366 ? 112.94700 103.51400 145.77400 1.000 47.42000  ? 611 LEU A N     1 
ATOM   2182  C  CA    . LEU A 1 366 ? 112.49700 103.41300 147.15800 1.000 47.42000  ? 611 LEU A CA    1 
ATOM   2183  C  C     . LEU A 1 366 ? 112.87000 104.65400 147.95600 1.000 47.42000  ? 611 LEU A C     1 
ATOM   2184  O  O     . LEU A 1 366 ? 112.04100 105.17500 148.71300 1.000 47.42000  ? 611 LEU A O     1 
ATOM   2185  C  CB    . LEU A 1 366 ? 113.08300 102.16500 147.80600 1.000 47.42000  ? 611 LEU A CB    1 
ATOM   2186  C  CG    . LEU A 1 366 ? 112.63200 100.86700 147.14300 1.000 47.42000  ? 611 LEU A CG    1 
ATOM   2187  C  CD1   . LEU A 1 366 ? 113.36500 99.69200  147.74800 1.000 47.42000  ? 611 LEU A CD1   1 
ATOM   2188  C  CD2   . LEU A 1 366 ? 111.13000 100.70200 147.27700 1.000 47.42000  ? 611 LEU A CD2   1 
ATOM   2189  N  N     . ILE A 1 367 ? 114.10700 105.13600 147.81000 1.000 41.64000  ? 612 ILE A N     1 
ATOM   2190  C  CA    . ILE A 1 367 ? 114.47300 106.42400 148.38800 1.000 41.64000  ? 612 ILE A CA    1 
ATOM   2191  C  C     . ILE A 1 367 ? 113.57000 107.52100 147.84700 1.000 41.64000  ? 612 ILE A C     1 
ATOM   2192  O  O     . ILE A 1 367 ? 113.14900 108.41900 148.58700 1.000 41.64000  ? 612 ILE A O     1 
ATOM   2193  C  CB    . ILE A 1 367 ? 115.95700 106.72900 148.11900 1.000 41.64000  ? 612 ILE A CB    1 
ATOM   2194  C  CG1   . ILE A 1 367 ? 116.84200 105.73100 148.85400 1.000 41.64000  ? 612 ILE A CG1   1 
ATOM   2195  C  CG2   . ILE A 1 367 ? 116.30000 108.13700 148.55600 1.000 41.64000  ? 612 ILE A CG2   1 
ATOM   2196  C  CD1   . ILE A 1 367 ? 116.70000 105.81200 150.35500 1.000 41.64000  ? 612 ILE A CD1   1 
ATOM   2197  N  N     . ALA A 1 368 ? 113.25100 107.46400 146.55300 1.000 44.31000  ? 613 ALA A N     1 
ATOM   2198  C  CA    . ALA A 1 368 ? 112.37700 108.47600 145.97300 1.000 44.31000  ? 613 ALA A CA    1 
ATOM   2199  C  C     . ALA A 1 368 ? 111.00700 108.46800 146.63700 1.000 44.31000  ? 613 ALA A C     1 
ATOM   2200  O  O     . ALA A 1 368 ? 110.46100 109.53000 146.95300 1.000 44.31000  ? 613 ALA A O     1 
ATOM   2201  C  CB    . ALA A 1 368 ? 112.25000 108.26400 144.46700 1.000 44.31000  ? 613 ALA A CB    1 
ATOM   2202  N  N     . ARG A 1 369 ? 110.43900 107.28200 146.87300 1.000 46.09000  ? 614 ARG A N     1 
ATOM   2203  C  CA    . ARG A 1 369 ? 109.11600 107.22000 147.48900 1.000 46.09000  ? 614 ARG A CA    1 
ATOM   2204  C  C     . ARG A 1 369 ? 109.16100 107.63500 148.95400 1.000 46.09000  ? 614 ARG A C     1 
ATOM   2205  O  O     . ARG A 1 369 ? 108.23600 108.29700 149.43900 1.000 46.09000  ? 614 ARG A O     1 
ATOM   2206  C  CB    . ARG A 1 369 ? 108.52400 105.82000 147.35300 1.000 46.09000  ? 614 ARG A CB    1 
ATOM   2207  C  CG    . ARG A 1 369 ? 108.14500 105.44900 145.93900 1.000 46.09000  ? 614 ARG A CG    1 
ATOM   2208  C  CD    . ARG A 1 369 ? 107.52500 104.07100 145.88900 1.000 46.09000  ? 614 ARG A CD    1 
ATOM   2209  N  NE    . ARG A 1 369 ? 106.23600 104.03800 146.57000 1.000 46.09000  ? 614 ARG A NE    1 
ATOM   2210  C  CZ    . ARG A 1 369 ? 105.55000 102.92700 146.81000 1.000 46.09000  ? 614 ARG A CZ    1 
ATOM   2211  N  NH1   . ARG A 1 369 ? 106.03200 101.75400 146.42500 1.000 46.09000  ? 614 ARG A NH1   1 
ATOM   2212  N  NH2   . ARG A 1 369 ? 104.38400 102.98700 147.43600 1.000 46.09000  ? 614 ARG A NH2   1 
ATOM   2213  N  N     . ILE A 1 370 ? 110.21600 107.25200 149.67700 1.000 42.93000  ? 615 ILE A N     1 
ATOM   2214  C  CA    . ILE A 1 370 ? 110.37000 107.72100 151.05200 1.000 42.93000  ? 615 ILE A CA    1 
ATOM   2215  C  C     . ILE A 1 370 ? 110.41700 109.24100 151.09300 1.000 42.93000  ? 615 ILE A C     1 
ATOM   2216  O  O     . ILE A 1 370 ? 109.78300 109.87400 151.94500 1.000 42.93000  ? 615 ILE A O     1 
ATOM   2217  C  CB    . ILE A 1 370 ? 111.61800 107.10200 151.70600 1.000 42.93000  ? 615 ILE A CB    1 
ATOM   2218  C  CG1   . ILE A 1 370 ? 111.47800 105.58800 151.79900 1.000 42.93000  ? 615 ILE A CG1   1 
ATOM   2219  C  CG2   . ILE A 1 370 ? 111.81800 107.67000 153.09400 1.000 42.93000  ? 615 ILE A CG2   1 
ATOM   2220  C  CD1   . ILE A 1 370 ? 110.33400 105.15700 152.67300 1.000 42.93000  ? 615 ILE A CD1   1 
ATOM   2221  N  N     . ALA A 1 371 ? 111.16600 109.85300 150.17300 1.000 41.30000  ? 616 ALA A N     1 
ATOM   2222  C  CA    . ALA A 1 371 ? 111.26900 111.30800 150.15800 1.000 41.30000  ? 616 ALA A CA    1 
ATOM   2223  C  C     . ALA A 1 371 ? 109.94000 111.95400 149.78800 1.000 41.30000  ? 616 ALA A C     1 
ATOM   2224  O  O     . ALA A 1 371 ? 109.53200 112.94700 150.40000 1.000 41.30000  ? 616 ALA A O     1 
ATOM   2225  C  CB    . ALA A 1 371 ? 112.36700 111.74400 149.19000 1.000 41.30000  ? 616 ALA A CB    1 
ATOM   2226  N  N     . GLN A 1 372 ? 109.25300 111.40600 148.78700 1.000 45.06000  ? 617 GLN A N     1 
ATOM   2227  C  CA    . GLN A 1 372 ? 107.99600 111.98700 148.33000 1.000 45.06000  ? 617 GLN A CA    1 
ATOM   2228  C  C     . GLN A 1 372 ? 106.91900 111.89300 149.40000 1.000 45.06000  ? 617 GLN A C     1 
ATOM   2229  O  O     . GLN A 1 372 ? 106.37600 112.91000 149.84500 1.000 45.06000  ? 617 GLN A O     1 
ATOM   2230  C  CB    . GLN A 1 372 ? 107.53500 111.28900 147.05200 1.000 45.06000  ? 617 GLN A CB    1 
ATOM   2231  C  CG    . GLN A 1 372 ? 108.40400 111.57000 145.85100 1.000 45.06000  ? 617 GLN A CG    1 
ATOM   2232  C  CD    . GLN A 1 372 ? 107.95600 110.81100 144.62700 1.000 45.06000  ? 617 GLN A CD    1 
ATOM   2233  O  OE1   . GLN A 1 372 ? 107.04100 109.99100 144.69200 1.000 45.06000  ? 617 GLN A OE1   1 
ATOM   2234  N  NE2   . GLN A 1 372 ? 108.59500 111.08200 143.49700 1.000 45.06000  ? 617 GLN A NE2   1 
ATOM   2235  N  N     . LYS A 1 373 ? 106.59800 110.67700 149.82700 1.000 47.95000  ? 618 LYS A N     1 
ATOM   2236  C  CA    . LYS A 1 373 ? 105.39200 110.45300 150.61000 1.000 47.95000  ? 618 LYS A CA    1 
ATOM   2237  C  C     . LYS A 1 373 ? 105.62500 110.52700 152.11400 1.000 47.95000  ? 618 LYS A C     1 
ATOM   2238  O  O     . LYS A 1 373 ? 104.78700 111.06900 152.84100 1.000 47.95000  ? 618 LYS A O     1 
ATOM   2239  C  CB    . LYS A 1 373 ? 104.79400 109.09400 150.24500 1.000 47.95000  ? 618 LYS A CB    1 
ATOM   2240  C  CG    . LYS A 1 373 ? 103.47600 108.79900 150.91300 1.000 47.95000  ? 618 LYS A CG    1 
ATOM   2241  C  CD    . LYS A 1 373 ? 103.00100 107.40600 150.56900 1.000 47.95000  ? 618 LYS A CD    1 
ATOM   2242  C  CE    . LYS A 1 373 ? 102.48600 107.35100 149.15200 1.000 47.95000  ? 618 LYS A CE    1 
ATOM   2243  N  NZ    . LYS A 1 373 ? 101.92400 106.01300 148.83600 1.000 47.95000  ? 618 LYS A NZ    1 
ATOM   2244  N  N     . ALA A 1 374 ? 106.74900 110.00500 152.60000 1.000 44.25000  ? 619 ALA A N     1 
ATOM   2245  C  CA    . ALA A 1 374 ? 106.95000 109.80000 154.03500 1.000 44.25000  ? 619 ALA A CA    1 
ATOM   2246  C  C     . ALA A 1 374 ? 107.37300 111.10500 154.70000 1.000 44.25000  ? 619 ALA A C     1 
ATOM   2247  O  O     . ALA A 1 374 ? 108.54900 111.36100 154.96200 1.000 44.25000  ? 619 ALA A O     1 
ATOM   2248  C  CB    . ALA A 1 374 ? 107.97500 108.70200 154.27900 1.000 44.25000  ? 619 ALA A CB    1 
ATOM   2249  N  N     . ARG A 1 375 ? 106.39500 111.94200 154.96800 1.000 42.90000  ? 620 ARG A N     1 
ATOM   2250  C  CA    . ARG A 1 375 ? 106.60200 113.04800 155.89500 1.000 42.90000  ? 620 ARG A CA    1 
ATOM   2251  C  C     . ARG A 1 375 ? 105.52100 113.10600 156.95900 1.000 42.90000  ? 620 ARG A C     1 
ATOM   2252  O  O     . ARG A 1 375 ? 105.81900 113.40800 158.11500 1.000 42.90000  ? 620 ARG A O     1 
ATOM   2253  C  CB    . ARG A 1 375 ? 106.67300 114.39200 155.15100 1.000 42.90000  ? 620 ARG A CB    1 
ATOM   2254  C  CG    . ARG A 1 375 ? 106.99400 115.57500 156.06100 1.000 42.90000  ? 620 ARG A CG    1 
ATOM   2255  C  CD    . ARG A 1 375 ? 105.75300 116.33600 156.50400 1.000 42.90000  ? 620 ARG A CD    1 
ATOM   2256  N  NE    . ARG A 1 375 ? 106.07700 117.42000 157.42700 1.000 42.90000  ? 620 ARG A NE    1 
ATOM   2257  C  CZ    . ARG A 1 375 ? 106.43400 118.64200 157.05100 1.000 42.90000  ? 620 ARG A CZ    1 
ATOM   2258  N  NH1   . ARG A 1 375 ? 106.51900 118.94100 155.76400 1.000 42.90000  ? 620 ARG A NH1   1 
ATOM   2259  N  NH2   . ARG A 1 375 ? 106.70900 119.56500 157.96200 1.000 42.90000  ? 620 ARG A NH2   1 
ATOM   2260  N  N     . ALA A 1 376 ? 104.27100 112.82800 156.59600 1.000 43.95000  ? 621 ALA A N     1 
ATOM   2261  C  CA    . ALA A 1 376 ? 103.19900 112.73800 157.57300 1.000 43.95000  ? 621 ALA A CA    1 
ATOM   2262  C  C     . ALA A 1 376 ? 103.19000 111.40600 158.30400 1.000 43.95000  ? 621 ALA A C     1 
ATOM   2263  O  O     . ALA A 1 376 ? 102.48300 111.27200 159.30800 1.000 43.95000  ? 621 ALA A O     1 
ATOM   2264  C  CB    . ALA A 1 376 ? 101.84700 112.96100 156.89400 1.000 43.95000  ? 621 ALA A CB    1 
ATOM   2265  N  N     . ALA A 1 377 ? 103.94900 110.42500 157.82800 1.000 41.76000  ? 622 ALA A N     1 
ATOM   2266  C  CA    . ALA A 1 377 ? 104.04400 109.12800 158.47700 1.000 41.76000  ? 622 ALA A CA    1 
ATOM   2267  C  C     . ALA A 1 377 ? 105.21300 109.03800 159.44700 1.000 41.76000  ? 622 ALA A C     1 
ATOM   2268  O  O     . ALA A 1 377 ? 105.42800 107.97900 160.04000 1.000 41.76000  ? 622 ALA A O     1 
ATOM   2269  C  CB    . ALA A 1 377 ? 104.16100 108.02200 157.42600 1.000 41.76000  ? 622 ALA A CB    1 
ATOM   2270  N  N     . GLY A 1 378 ? 105.97500 110.11200 159.61700 1.000 39.23000  ? 623 GLY A N     1 
ATOM   2271  C  CA    . GLY A 1 378 ? 107.04600 110.12200 160.58800 1.000 39.23000  ? 623 GLY A CA    1 
ATOM   2272  C  C     . GLY A 1 378 ? 108.33700 109.47400 160.14700 1.000 39.23000  ? 623 GLY A C     1 
ATOM   2273  O  O     . GLY A 1 378 ? 109.29200 109.45400 160.92800 1.000 39.23000  ? 623 GLY A O     1 
ATOM   2274  N  N     . ILE A 1 379 ? 108.40600 108.94500 158.93000 1.000 38.41000  ? 624 ILE A N     1 
ATOM   2275  C  CA    . ILE A 1 379 ? 109.63100 108.33900 158.42000 1.000 38.41000  ? 624 ILE A CA    1 
ATOM   2276  C  C     . ILE A 1 379 ? 110.46900 109.44200 157.79000 1.000 38.41000  ? 624 ILE A C     1 
ATOM   2277  O  O     . ILE A 1 379 ? 110.11100 109.98300 156.74200 1.000 38.41000  ? 624 ILE A O     1 
ATOM   2278  C  CB    . ILE A 1 379 ? 109.34100 107.21800 157.41400 1.000 38.41000  ? 624 ILE A CB    1 
ATOM   2279  C  CG1   . ILE A 1 379 ? 108.70000 106.01700 158.10800 1.000 38.41000  ? 624 ILE A CG1   1 
ATOM   2280  C  CG2   . ILE A 1 379 ? 110.61700 106.79700 156.70600 1.000 38.41000  ? 624 ILE A CG2   1 
ATOM   2281  C  CD1   . ILE A 1 379 ? 107.20000 106.05100 158.14500 1.000 38.41000  ? 624 ILE A CD1   1 
ATOM   2282  N  N     . HIS A 1 380 ? 111.58700 109.77400 158.42300 1.000 35.34000  ? 625 HIS A N     1 
ATOM   2283  C  CA    . HIS A 1 380 ? 112.48200 110.81500 157.94600 1.000 35.34000  ? 625 HIS A CA    1 
ATOM   2284  C  C     . HIS A 1 380 ? 113.73500 110.19200 157.34800 1.000 35.34000  ? 625 HIS A C     1 
ATOM   2285  O  O     . HIS A 1 380 ? 113.96500 108.98500 157.43900 1.000 35.34000  ? 625 HIS A O     1 
ATOM   2286  C  CB    . HIS A 1 380 ? 112.83900 111.77900 159.07800 1.000 35.34000  ? 625 HIS A CB    1 
ATOM   2287  C  CG    . HIS A 1 380 ? 111.66800 112.55200 159.59500 1.000 35.34000  ? 625 HIS A CG    1 
ATOM   2288  N  ND1   . HIS A 1 380 ? 110.87800 112.10100 160.63000 1.000 35.34000  ? 625 HIS A ND1   1 
ATOM   2289  C  CD2   . HIS A 1 380 ? 111.14100 113.73700 159.20800 1.000 35.34000  ? 625 HIS A CD2   1 
ATOM   2290  C  CE1   . HIS A 1 380 ? 109.92200 112.98000 160.86600 1.000 35.34000  ? 625 HIS A CE1   1 
ATOM   2291  N  NE2   . HIS A 1 380 ? 110.05800 113.98200 160.01600 1.000 35.34000  ? 625 HIS A NE2   1 
ATOM   2292  N  N     . LEU A 1 381 ? 114.55600 111.03800 156.73400 1.000 37.42000  ? 626 LEU A N     1 
ATOM   2293  C  CA    . LEU A 1 381 ? 115.68300 110.56900 155.94200 1.000 37.42000  ? 626 LEU A CA    1 
ATOM   2294  C  C     . LEU A 1 381 ? 116.84000 111.54400 156.06800 1.000 37.42000  ? 626 LEU A C     1 
ATOM   2295  O  O     . LEU A 1 381 ? 116.64700 112.75700 155.95400 1.000 37.42000  ? 626 LEU A O     1 
ATOM   2296  C  CB    . LEU A 1 381 ? 115.27900 110.40700 154.47300 1.000 37.42000  ? 626 LEU A CB    1 
ATOM   2297  C  CG    . LEU A 1 381 ? 116.31000 109.89700 153.47300 1.000 37.42000  ? 626 LEU A CG    1 
ATOM   2298  C  CD1   . LEU A 1 381 ? 116.74200 108.49000 153.81200 1.000 37.42000  ? 626 LEU A CD1   1 
ATOM   2299  C  CD2   . LEU A 1 381 ? 115.72400 109.94800 152.08100 1.000 37.42000  ? 626 LEU A CD2   1 
ATOM   2300  N  N     . ILE A 1 382 ? 118.03700 111.01000 156.30200 1.000 62.18000  ? 627 ILE A N     1 
ATOM   2301  C  CA    . ILE A 1 382 ? 119.25300 111.80900 156.45100 1.000 62.18000  ? 627 ILE A CA    1 
ATOM   2302  C  C     . ILE A 1 382 ? 120.27000 111.23300 155.47000 1.000 62.18000  ? 627 ILE A C     1 
ATOM   2303  O  O     . ILE A 1 382 ? 120.99100 110.28200 155.78400 1.000 62.18000  ? 627 ILE A O     1 
ATOM   2304  C  CB    . ILE A 1 382 ? 119.79700 111.79100 157.88300 1.000 62.18000  ? 627 ILE A CB    1 
ATOM   2305  C  CG1   . ILE A 1 382 ? 118.77300 112.37500 158.85200 1.000 62.18000  ? 627 ILE A CG1   1 
ATOM   2306  C  CG2   . ILE A 1 382 ? 121.09600 112.56900 157.96800 1.000 62.18000  ? 627 ILE A CG2   1 
ATOM   2307  C  CD1   . ILE A 1 382 ? 119.10800 112.12900 160.30200 1.000 62.18000  ? 627 ILE A CD1   1 
ATOM   2308  N  N     . LEU A 1 383 ? 120.33400 111.80500 154.27300 1.000 40.35000  ? 628 LEU A N     1 
ATOM   2309  C  CA    . LEU A 1 383 ? 121.26600 111.34900 153.25300 1.000 40.35000  ? 628 LEU A CA    1 
ATOM   2310  C  C     . LEU A 1 383 ? 122.59500 112.07300 153.39900 1.000 40.35000  ? 628 LEU A C     1 
ATOM   2311  O  O     . LEU A 1 383 ? 122.65300 113.29900 153.28400 1.000 40.35000  ? 628 LEU A O     1 
ATOM   2312  C  CB    . LEU A 1 383 ? 120.70300 111.58500 151.85400 1.000 40.35000  ? 628 LEU A CB    1 
ATOM   2313  C  CG    . LEU A 1 383 ? 119.45100 110.80000 151.48600 1.000 40.35000  ? 628 LEU A CG    1 
ATOM   2314  C  CD1   . LEU A 1 383 ? 119.02400 111.16200 150.08400 1.000 40.35000  ? 628 LEU A CD1   1 
ATOM   2315  C  CD2   . LEU A 1 383 ? 119.70700 109.31900 151.60600 1.000 40.35000  ? 628 LEU A CD2   1 
ATOM   2316  N  N     . ALA A 1 384 ? 123.65700 111.31400 153.64000 1.000 38.65000  ? 629 ALA A N     1 
ATOM   2317  C  CA    . ALA A 1 384 ? 125.00700 111.85400 153.70900 1.000 38.65000  ? 629 ALA A CA    1 
ATOM   2318  C  C     . ALA A 1 384 ? 125.74800 111.47400 152.43900 1.000 38.65000  ? 629 ALA A C     1 
ATOM   2319  O  O     . ALA A 1 384 ? 125.84700 110.29000 152.10900 1.000 38.65000  ? 629 ALA A O     1 
ATOM   2320  C  CB    . ALA A 1 384 ? 125.75300 111.33000 154.93600 1.000 38.65000  ? 629 ALA A CB    1 
ATOM   2321  N  N     . THR A 1 385 ? 126.26500 112.47300 151.73000 1.000 37.62000  ? 630 THR A N     1 
ATOM   2322  C  CA    . THR A 1 385 ? 126.94400 112.25700 150.45800 1.000 37.62000  ? 630 THR A CA    1 
ATOM   2323  C  C     . THR A 1 385 ? 128.21200 113.09700 150.44700 1.000 37.62000  ? 630 THR A C     1 
ATOM   2324  O  O     . THR A 1 385 ? 128.62400 113.65200 151.46900 1.000 37.62000  ? 630 THR A O     1 
ATOM   2325  C  CB    . THR A 1 385 ? 126.04100 112.61200 149.27000 1.000 37.62000  ? 630 THR A CB    1 
ATOM   2326  O  OG1   . THR A 1 385 ? 125.64700 113.98600 149.36300 1.000 37.62000  ? 630 THR A OG1   1 
ATOM   2327  C  CG2   . THR A 1 385 ? 124.80900 111.73900 149.24300 1.000 37.62000  ? 630 THR A CG2   1 
ATOM   2328  N  N     . GLN A 1 386 ? 128.84000 113.18400 149.28400 1.000 38.86000  ? 631 GLN A N     1 
ATOM   2329  C  CA    . GLN A 1 386 ? 130.01300 114.02600 149.10100 1.000 38.86000  ? 631 GLN A CA    1 
ATOM   2330  C  C     . GLN A 1 386 ? 129.81400 115.09100 148.03900 1.000 38.86000  ? 631 GLN A C     1 
ATOM   2331  O  O     . GLN A 1 386 ? 130.34500 116.19700 148.17400 1.000 38.86000  ? 631 GLN A O     1 
ATOM   2332  C  CB    . GLN A 1 386 ? 131.22800 113.16400 148.74900 1.000 38.86000  ? 631 GLN A CB    1 
ATOM   2333  C  CG    . GLN A 1 386 ? 131.61100 112.22400 149.86400 1.000 38.86000  ? 631 GLN A CG    1 
ATOM   2334  C  CD    . GLN A 1 386 ? 132.83800 111.40800 149.56200 1.000 38.86000  ? 631 GLN A CD    1 
ATOM   2335  O  OE1   . GLN A 1 386 ? 133.38800 111.47800 148.46800 1.000 38.86000  ? 631 GLN A OE1   1 
ATOM   2336  N  NE2   . GLN A 1 386 ? 133.28300 110.62700 150.53800 1.000 38.86000  ? 631 GLN A NE2   1 
ATOM   2337  N  N     . ARG A 1 387 ? 129.05400 114.78700 146.99000 1.000 36.92000  ? 632 ARG A N     1 
ATOM   2338  C  CA    . ARG A 1 387 ? 128.70400 115.77300 145.96900 1.000 36.92000  ? 632 ARG A CA    1 
ATOM   2339  C  C     . ARG A 1 387 ? 127.43100 115.28700 145.29700 1.000 36.92000  ? 632 ARG A C     1 
ATOM   2340  O  O     . ARG A 1 387 ? 127.47300 114.54400 144.30800 1.000 36.92000  ? 632 ARG A O     1 
ATOM   2341  C  CB    . ARG A 1 387 ? 129.83700 115.96800 144.96300 1.000 36.92000  ? 632 ARG A CB    1 
ATOM   2342  C  CG    . ARG A 1 387 ? 129.61000 117.06400 143.93800 1.000 36.92000  ? 632 ARG A CG    1 
ATOM   2343  C  CD    . ARG A 1 387 ? 129.16100 116.50100 142.60800 1.000 36.92000  ? 632 ARG A CD    1 
ATOM   2344  N  NE    . ARG A 1 387 ? 128.96400 117.55100 141.61800 1.000 36.92000  ? 632 ARG A NE    1 
ATOM   2345  C  CZ    . ARG A 1 387 ? 129.93700 118.05500 140.87100 1.000 36.92000  ? 632 ARG A CZ    1 
ATOM   2346  N  NH1   . ARG A 1 387 ? 131.17700 117.61300 141.01400 1.000 36.92000  ? 632 ARG A NH1   1 
ATOM   2347  N  NH2   . ARG A 1 387 ? 129.67600 119.01100 139.99300 1.000 36.92000  ? 632 ARG A NH2   1 
ATOM   2348  N  N     . PRO A 1 388 ? 126.27000 115.65600 145.83400 1.000 32.78000  ? 633 PRO A N     1 
ATOM   2349  C  CA    . PRO A 1 388 ? 125.00300 115.17300 145.27700 1.000 32.78000  ? 633 PRO A CA    1 
ATOM   2350  C  C     . PRO A 1 388 ? 124.62300 115.80500 143.95000 1.000 32.78000  ? 633 PRO A C     1 
ATOM   2351  O  O     . PRO A 1 388 ? 123.59200 116.47800 143.85700 1.000 32.78000  ? 633 PRO A O     1 
ATOM   2352  C  CB    . PRO A 1 388 ? 123.98700 115.53300 146.36700 1.000 32.78000  ? 633 PRO A CB    1 
ATOM   2353  C  CG    . PRO A 1 388 ? 124.59600 116.65100 147.09900 1.000 32.78000  ? 633 PRO A CG    1 
ATOM   2354  C  CD    . PRO A 1 388 ? 126.06700 116.37100 147.10000 1.000 32.78000  ? 633 PRO A CD    1 
ATOM   2355  N  N     . SER A 1 389 ? 125.43900 115.60500 142.92100 1.000 36.41000  ? 634 SER A N     1 
ATOM   2356  C  CA    . SER A 1 389 ? 125.00900 115.94500 141.57700 1.000 36.41000  ? 634 SER A CA    1 
ATOM   2357  C  C     . SER A 1 389 ? 123.96600 114.93600 141.10400 1.000 36.41000  ? 634 SER A C     1 
ATOM   2358  O  O     . SER A 1 389 ? 123.72900 113.90500 141.73700 1.000 36.41000  ? 634 SER A O     1 
ATOM   2359  C  CB    . SER A 1 389 ? 126.19700 115.97300 140.62000 1.000 36.41000  ? 634 SER A CB    1 
ATOM   2360  O  OG    . SER A 1 389 ? 126.74100 114.67700 140.45200 1.000 36.41000  ? 634 SER A OG    1 
ATOM   2361  N  N     . VAL A 1 390 ? 123.33200 115.24400 139.97000 1.000 37.15000  ? 635 VAL A N     1 
ATOM   2362  C  CA    . VAL A 1 390 ? 122.27500 114.37400 139.46100 1.000 37.15000  ? 635 VAL A CA    1 
ATOM   2363  C  C     . VAL A 1 390 ? 122.81500 112.98600 139.14100 1.000 37.15000  ? 635 VAL A C     1 
ATOM   2364  O  O     . VAL A 1 390 ? 122.07900 111.99400 139.21100 1.000 37.15000  ? 635 VAL A O     1 
ATOM   2365  C  CB    . VAL A 1 390 ? 121.60000 115.03300 138.24500 1.000 37.15000  ? 635 VAL A CB    1 
ATOM   2366  C  CG1   . VAL A 1 390 ? 120.58400 114.10000 137.61100 1.000 37.15000  ? 635 VAL A CG1   1 
ATOM   2367  C  CG2   . VAL A 1 390 ? 120.92600 116.31000 138.68200 1.000 37.15000  ? 635 VAL A CG2   1 
ATOM   2368  N  N     . ASP A 1 391 ? 124.10500 112.88300 138.81300 1.000 40.77000  ? 636 ASP A N     1 
ATOM   2369  C  CA    . ASP A 1 391 ? 124.72700 111.57200 138.66000 1.000 40.77000  ? 636 ASP A CA    1 
ATOM   2370  C  C     . ASP A 1 391 ? 124.59000 110.73500 139.92400 1.000 40.77000  ? 636 ASP A C     1 
ATOM   2371  O  O     . ASP A 1 391 ? 124.47600 109.50700 139.84700 1.000 40.77000  ? 636 ASP A O     1 
ATOM   2372  C  CB    . ASP A 1 391 ? 126.20200 111.72900 138.29900 1.000 40.77000  ? 636 ASP A CB    1 
ATOM   2373  C  CG    . ASP A 1 391 ? 126.40100 112.32300 136.92500 1.000 40.77000  ? 636 ASP A CG    1 
ATOM   2374  O  OD1   . ASP A 1 391 ? 125.52600 112.11900 136.06000 1.000 40.77000  ? 636 ASP A OD1   1 
ATOM   2375  O  OD2   . ASP A 1 391 ? 127.43100 112.99600 136.71000 1.000 40.77000  ? 636 ASP A OD2   1 
ATOM   2376  N  N     . VAL A 1 392 ? 124.59700 111.37400 141.08700 1.000 38.51000  ? 637 VAL A N     1 
ATOM   2377  C  CA    . VAL A 1 392 ? 124.53100 110.68300 142.36600 1.000 38.51000  ? 637 VAL A CA    1 
ATOM   2378  C  C     . VAL A 1 392 ? 123.11300 110.65500 142.91300 1.000 38.51000  ? 637 VAL A C     1 
ATOM   2379  O  O     . VAL A 1 392 ? 122.62100 109.60600 143.32700 1.000 38.51000  ? 637 VAL A O     1 
ATOM   2380  C  CB    . VAL A 1 392 ? 125.50300 111.34000 143.36900 1.000 38.51000  ? 637 VAL A CB    1 
ATOM   2381  C  CG1   . VAL A 1 392 ? 125.31500 110.75200 144.74700 1.000 38.51000  ? 637 VAL A CG1   1 
ATOM   2382  C  CG2   . VAL A 1 392 ? 126.92700 111.16000 142.90000 1.000 38.51000  ? 637 VAL A CG2   1 
ATOM   2383  N  N     . ILE A 1 393 ? 122.43800 111.80000 142.92400 1.000 35.74000  ? 638 ILE A N     1 
ATOM   2384  C  CA    . ILE A 1 393 ? 121.07500 111.90200 143.43000 1.000 35.74000  ? 638 ILE A CA    1 
ATOM   2385  C  C     . ILE A 1 393 ? 120.23500 112.60000 142.37300 1.000 35.74000  ? 638 ILE A C     1 
ATOM   2386  O  O     . ILE A 1 393 ? 120.46000 113.78000 142.08100 1.000 35.74000  ? 638 ILE A O     1 
ATOM   2387  C  CB    . ILE A 1 393 ? 121.00800 112.66400 144.76100 1.000 35.74000  ? 638 ILE A CB    1 
ATOM   2388  C  CG1   . ILE A 1 393 ? 121.83100 111.94200 145.81800 1.000 35.74000  ? 638 ILE A CG1   1 
ATOM   2389  C  CG2   . ILE A 1 393 ? 119.58000 112.77000 145.23700 1.000 35.74000  ? 638 ILE A CG2   1 
ATOM   2390  C  CD1   . ILE A 1 393 ? 121.96300 112.70700 147.09400 1.000 35.74000  ? 638 ILE A CD1   1 
ATOM   2391  N  N     . THR A 1 394 ? 119.27400 111.87800 141.80400 1.000 35.83000  ? 639 THR A N     1 
ATOM   2392  C  CA    . THR A 1 394 ? 118.44200 112.44800 140.75500 1.000 35.83000  ? 639 THR A CA    1 
ATOM   2393  C  C     . THR A 1 394 ? 117.61300 113.60600 141.29500 1.000 35.83000  ? 639 THR A C     1 
ATOM   2394  O  O     . THR A 1 394 ? 117.25500 113.64800 142.47400 1.000 35.83000  ? 639 THR A O     1 
ATOM   2395  C  CB    . THR A 1 394 ? 117.52900 111.38200 140.15900 1.000 35.83000  ? 639 THR A CB    1 
ATOM   2396  O  OG1   . THR A 1 394 ? 116.69400 110.84000 141.18700 1.000 35.83000  ? 639 THR A OG1   1 
ATOM   2397  C  CG2   . THR A 1 394 ? 118.36100 110.27600 139.54200 1.000 35.83000  ? 639 THR A CG2   1 
ATOM   2398  N  N     . GLY A 1 395 ? 117.31400 114.55700 140.40800 1.000 36.14000  ? 640 GLY A N     1 
ATOM   2399  C  CA    . GLY A 1 395 ? 116.64400 115.77600 140.82600 1.000 36.14000  ? 640 GLY A CA    1 
ATOM   2400  C  C     . GLY A 1 395 ? 115.30900 115.54100 141.50000 1.000 36.14000  ? 640 GLY A C     1 
ATOM   2401  O  O     . GLY A 1 395 ? 114.86600 116.36100 142.30700 1.000 36.14000  ? 640 GLY A O     1 
ATOM   2402  N  N     . LEU A 1 396 ? 114.65500 114.42000 141.19400 1.000 36.24000  ? 641 LEU A N     1 
ATOM   2403  C  CA    . LEU A 1 396 ? 113.36400 114.13300 141.80800 1.000 36.24000  ? 641 LEU A CA    1 
ATOM   2404  C  C     . LEU A 1 396 ? 113.49400 113.89700 143.30600 1.000 36.24000  ? 641 LEU A C     1 
ATOM   2405  O  O     . LEU A 1 396 ? 112.54900 114.16000 144.05700 1.000 36.24000  ? 641 LEU A O     1 
ATOM   2406  C  CB    . LEU A 1 396 ? 112.72300 112.92600 141.12700 1.000 36.24000  ? 641 LEU A CB    1 
ATOM   2407  C  CG    . LEU A 1 396 ? 111.33000 112.52500 141.60400 1.000 36.24000  ? 641 LEU A CG    1 
ATOM   2408  C  CD1   . LEU A 1 396 ? 110.34500 113.65200 141.36900 1.000 36.24000  ? 641 LEU A CD1   1 
ATOM   2409  C  CD2   . LEU A 1 396 ? 110.88000 111.26500 140.89200 1.000 36.24000  ? 641 LEU A CD2   1 
ATOM   2410  N  N     . ILE A 1 397 ? 114.65100 113.41400 143.75800 1.000 32.57000  ? 642 ILE A N     1 
ATOM   2411  C  CA    . ILE A 1 397 ? 114.88500 113.24500 145.18800 1.000 32.57000  ? 642 ILE A CA    1 
ATOM   2412  C  C     . ILE A 1 397 ? 115.34400 114.55500 145.81500 1.000 32.57000  ? 642 ILE A C     1 
ATOM   2413  O  O     . ILE A 1 397 ? 114.82300 114.97500 146.85400 1.000 32.57000  ? 642 ILE A O     1 
ATOM   2414  C  CB    . ILE A 1 397 ? 115.90000 112.11700 145.43500 1.000 32.57000  ? 642 ILE A CB    1 
ATOM   2415  C  CG1   . ILE A 1 397 ? 115.34500 110.78600 144.93500 1.000 32.57000  ? 642 ILE A CG1   1 
ATOM   2416  C  CG2   . ILE A 1 397 ? 116.24000 112.02400 146.90600 1.000 32.57000  ? 642 ILE A CG2   1 
ATOM   2417  C  CD1   . ILE A 1 397 ? 116.36800 109.67900 144.91200 1.000 32.57000  ? 642 ILE A CD1   1 
ATOM   2418  N  N     . LYS A 1 398 ? 116.33500 115.21300 145.20200 1.000 31.74000  ? 643 LYS A N     1 
ATOM   2419  C  CA    . LYS A 1 398 ? 116.82800 116.48100 145.73300 1.000 31.74000  ? 643 LYS A CA    1 
ATOM   2420  C  C     . LYS A 1 398 ? 115.71900 117.51300 145.86700 1.000 31.74000  ? 643 LYS A C     1 
ATOM   2421  O  O     . LYS A 1 398 ? 115.75000 118.33800 146.78700 1.000 31.74000  ? 643 LYS A O     1 
ATOM   2422  C  CB    . LYS A 1 398 ? 117.94000 117.03900 144.84800 1.000 31.74000  ? 643 LYS A CB    1 
ATOM   2423  C  CG    . LYS A 1 398 ? 119.25200 116.30600 144.95300 1.000 31.74000  ? 643 LYS A CG    1 
ATOM   2424  C  CD    . LYS A 1 398 ? 120.25100 116.86300 143.96300 1.000 31.74000  ? 643 LYS A CD    1 
ATOM   2425  C  CE    . LYS A 1 398 ? 120.69900 118.24900 144.36700 1.000 31.74000  ? 643 LYS A CE    1 
ATOM   2426  N  NZ    . LYS A 1 398 ? 121.75400 118.75000 143.45300 1.000 31.74000  ? 643 LYS A NZ    1 
ATOM   2427  N  N     . ALA A 1 399 ? 114.74000 117.49500 144.96500 1.000 33.06000  ? 644 ALA A N     1 
ATOM   2428  C  CA    . ALA A 1 399 ? 113.63600 118.43800 145.06300 1.000 33.06000  ? 644 ALA A CA    1 
ATOM   2429  C  C     . ALA A 1 399 ? 112.72500 118.15300 146.24300 1.000 33.06000  ? 644 ALA A C     1 
ATOM   2430  O  O     . ALA A 1 399 ? 111.90300 119.00600 146.58400 1.000 33.06000  ? 644 ALA A O     1 
ATOM   2431  C  CB    . ALA A 1 399 ? 112.81800 118.42900 143.77700 1.000 33.06000  ? 644 ALA A CB    1 
ATOM   2432  N  N     . ASN A 1 400 ? 112.84400 116.98600 146.86800 1.000 35.16000  ? 645 ASN A N     1 
ATOM   2433  C  CA    . ASN A 1 400 ? 112.03500 116.63800 148.02400 1.000 35.16000  ? 645 ASN A CA    1 
ATOM   2434  C  C     . ASN A 1 400 ? 112.81100 116.71600 149.32800 1.000 35.16000  ? 645 ASN A C     1 
ATOM   2435  O  O     . ASN A 1 400 ? 112.23100 116.48400 150.39300 1.000 35.16000  ? 645 ASN A O     1 
ATOM   2436  C  CB    . ASN A 1 400 ? 111.44600 115.23800 147.84600 1.000 35.16000  ? 645 ASN A CB    1 
ATOM   2437  C  CG    . ASN A 1 400 ? 110.39100 115.19300 146.76600 1.000 35.16000  ? 645 ASN A CG    1 
ATOM   2438  O  OD1   . ASN A 1 400 ? 109.54600 116.08000 146.67800 1.000 35.16000  ? 645 ASN A OD1   1 
ATOM   2439  N  ND2   . ASN A 1 400 ? 110.44200 114.16800 145.92600 1.000 35.16000  ? 645 ASN A ND2   1 
ATOM   2440  N  N     . ILE A 1 401 ? 114.10000 117.03200 149.27400 1.000 30.56000  ? 646 ILE A N     1 
ATOM   2441  C  CA    . ILE A 1 401 ? 114.91400 117.23400 150.46800 1.000 30.56000  ? 646 ILE A CA    1 
ATOM   2442  C  C     . ILE A 1 401 ? 115.31800 118.70300 150.50100 1.000 30.56000  ? 646 ILE A C     1 
ATOM   2443  O  O     . ILE A 1 401 ? 116.39700 119.06300 150.01100 1.000 30.56000  ? 646 ILE A O     1 
ATOM   2444  C  CB    . ILE A 1 401 ? 116.13500 116.30400 150.47000 1.000 30.56000  ? 646 ILE A CB    1 
ATOM   2445  C  CG1   . ILE A 1 401 ? 115.68200 114.84900 150.44200 1.000 30.56000  ? 646 ILE A CG1   1 
ATOM   2446  C  CG2   . ILE A 1 401 ? 116.98700 116.53500 151.69800 1.000 30.56000  ? 646 ILE A CG2   1 
ATOM   2447  C  CD1   . ILE A 1 401 ? 116.79600 113.88300 150.17900 1.000 30.56000  ? 646 ILE A CD1   1 
ATOM   2448  N  N     . PRO A 1 402 ? 114.47800 119.58800 151.03800 1.000 30.35000  ? 647 PRO A N     1 
ATOM   2449  C  CA    . PRO A 1 402 ? 114.75500 121.02700 150.97100 1.000 30.35000  ? 647 PRO A CA    1 
ATOM   2450  C  C     . PRO A 1 402 ? 115.68200 121.55300 152.05300 1.000 30.35000  ? 647 PRO A C     1 
ATOM   2451  O  O     . PRO A 1 402 ? 115.88400 122.76800 152.12000 1.000 30.35000  ? 647 PRO A O     1 
ATOM   2452  C  CB    . PRO A 1 402 ? 113.35400 121.63700 151.12700 1.000 30.35000  ? 647 PRO A CB    1 
ATOM   2453  C  CG    . PRO A 1 402 ? 112.63100 120.66000 151.96700 1.000 30.35000  ? 647 PRO A CG    1 
ATOM   2454  C  CD    . PRO A 1 402 ? 113.13500 119.30700 151.57400 1.000 30.35000  ? 647 PRO A CD    1 
ATOM   2455  N  N     . THR A 1 403 ? 116.25100 120.69500 152.89400 1.000 29.71000  ? 648 THR A N     1 
ATOM   2456  C  CA    . THR A 1 403 ? 117.10000 121.12000 154.00600 1.000 29.71000  ? 648 THR A CA    1 
ATOM   2457  C  C     . THR A 1 403 ? 118.48500 120.52100 153.80000 1.000 29.71000  ? 648 THR A C     1 
ATOM   2458  O  O     . THR A 1 403 ? 118.70700 119.34000 154.08000 1.000 29.71000  ? 648 THR A O     1 
ATOM   2459  C  CB    . THR A 1 403 ? 116.51000 120.69000 155.34300 1.000 29.71000  ? 648 THR A CB    1 
ATOM   2460  O  OG1   . THR A 1 403 ? 115.20500 121.25800 155.49300 1.000 29.71000  ? 648 THR A OG1   1 
ATOM   2461  C  CG2   . THR A 1 403 ? 117.38800 121.16300 156.48300 1.000 29.71000  ? 648 THR A CG2   1 
ATOM   2462  N  N     . ARG A 1 404 ? 119.41500 121.33300 153.31200 1.000 28.90000  ? 649 ARG A N     1 
ATOM   2463  C  CA    . ARG A 1 404 ? 120.76600 120.88900 153.01600 1.000 28.90000  ? 649 ARG A CA    1 
ATOM   2464  C  C     . ARG A 1 404 ? 121.73300 121.42700 154.06000 1.000 28.90000  ? 649 ARG A C     1 
ATOM   2465  O  O     . ARG A 1 404 ? 121.56600 122.53800 154.56800 1.000 28.90000  ? 649 ARG A O     1 
ATOM   2466  C  CB    . ARG A 1 404 ? 121.20700 121.34800 151.62400 1.000 28.90000  ? 649 ARG A CB    1 
ATOM   2467  C  CG    . ARG A 1 404 ? 120.62900 120.54000 150.47600 1.000 28.90000  ? 649 ARG A CG    1 
ATOM   2468  C  CD    . ARG A 1 404 ? 119.20500 120.94900 150.16000 1.000 28.90000  ? 649 ARG A CD    1 
ATOM   2469  N  NE    . ARG A 1 404 ? 118.67200 120.21600 149.01800 1.000 28.90000  ? 649 ARG A NE    1 
ATOM   2470  C  CZ    . ARG A 1 404 ? 118.82500 120.59200 147.75400 1.000 28.90000  ? 649 ARG A CZ    1 
ATOM   2471  N  NH1   . ARG A 1 404 ? 119.50100 121.69300 147.46700 1.000 28.90000  ? 649 ARG A NH1   1 
ATOM   2472  N  NH2   . ARG A 1 404 ? 118.30500 119.86600 146.77600 1.000 28.90000  ? 649 ARG A NH2   1 
ATOM   2473  N  N     . ILE A 1 405 ? 122.75100 120.63100 154.37400 1.000 28.49000  ? 650 ILE A N     1 
ATOM   2474  C  CA    . ILE A 1 405 ? 123.81400 121.02600 155.29100 1.000 28.49000  ? 650 ILE A CA    1 
ATOM   2475  C  C     . ILE A 1 405 ? 125.14000 120.83500 154.57700 1.000 28.49000  ? 650 ILE A C     1 
ATOM   2476  O  O     . ILE A 1 405 ? 125.51600 119.70300 154.25200 1.000 28.49000  ? 650 ILE A O     1 
ATOM   2477  C  CB    . ILE A 1 405 ? 123.78800 120.22400 156.60100 1.000 28.49000  ? 650 ILE A CB    1 
ATOM   2478  C  CG1   . ILE A 1 405 ? 122.52700 120.54600 157.39300 1.000 28.49000  ? 650 ILE A CG1   1 
ATOM   2479  C  CG2   . ILE A 1 405 ? 125.00900 120.52600 157.43200 1.000 28.49000  ? 650 ILE A CG2   1 
ATOM   2480  C  CD1   . ILE A 1 405 ? 122.36200 119.69100 158.60500 1.000 28.49000  ? 650 ILE A CD1   1 
ATOM   2481  N  N     . ALA A 1 406 ? 125.84400 121.93200 154.33300 1.000 33.91000  ? 651 ALA A N     1 
ATOM   2482  C  CA    . ALA A 1 406 ? 127.06200 121.93500 153.53200 1.000 33.91000  ? 651 ALA A CA    1 
ATOM   2483  C  C     . ALA A 1 406 ? 128.26900 122.10500 154.44000 1.000 33.91000  ? 651 ALA A C     1 
ATOM   2484  O  O     . ALA A 1 406 ? 128.46400 123.17300 155.02600 1.000 33.91000  ? 651 ALA A O     1 
ATOM   2485  C  CB    . ALA A 1 406 ? 127.01800 123.05300 152.49500 1.000 33.91000  ? 651 ALA A CB    1 
ATOM   2486  N  N     . PHE A 1 407 ? 129.08400 121.06300 154.54600 1.000 62.18000  ? 652 PHE A N     1 
ATOM   2487  C  CA    . PHE A 1 407 ? 130.39900 121.19900 155.15500 1.000 62.18000  ? 652 PHE A CA    1 
ATOM   2488  C  C     . PHE A 1 407 ? 131.34500 121.77200 154.10300 1.000 62.18000  ? 652 PHE A C     1 
ATOM   2489  O  O     . PHE A 1 407 ? 130.91300 122.23700 153.04600 1.000 62.18000  ? 652 PHE A O     1 
ATOM   2490  C  CB    . PHE A 1 407 ? 130.86300 119.86400 155.72200 1.000 62.18000  ? 652 PHE A CB    1 
ATOM   2491  C  CG    . PHE A 1 407 ? 130.04500 119.39100 156.88200 1.000 62.18000  ? 652 PHE A CG    1 
ATOM   2492  C  CD1   . PHE A 1 407 ? 130.26300 119.89300 158.14700 1.000 62.18000  ? 652 PHE A CD1   1 
ATOM   2493  C  CD2   . PHE A 1 407 ? 129.05100 118.45300 156.70300 1.000 62.18000  ? 652 PHE A CD2   1 
ATOM   2494  C  CE1   . PHE A 1 407 ? 129.50900 119.46300 159.21300 1.000 62.18000  ? 652 PHE A CE1   1 
ATOM   2495  C  CE2   . PHE A 1 407 ? 128.29500 118.02100 157.76600 1.000 62.18000  ? 652 PHE A CE2   1 
ATOM   2496  C  CZ    . PHE A 1 407 ? 128.52200 118.52600 159.02100 1.000 62.18000  ? 652 PHE A CZ    1 
ATOM   2497  N  N     . GLN A 1 408 ? 132.64700 121.77000 154.37700 1.000 43.81000  ? 653 GLN A N     1 
ATOM   2498  C  CA    . GLN A 1 408 ? 133.58500 122.33300 153.41600 1.000 43.81000  ? 653 GLN A CA    1 
ATOM   2499  C  C     . GLN A 1 408 ? 133.51400 121.56700 152.10500 1.000 43.81000  ? 653 GLN A C     1 
ATOM   2500  O  O     . GLN A 1 408 ? 133.51300 120.33300 152.09000 1.000 43.81000  ? 653 GLN A O     1 
ATOM   2501  C  CB    . GLN A 1 408 ? 135.01000 122.30000 153.95600 1.000 43.81000  ? 653 GLN A CB    1 
ATOM   2502  C  CG    . GLN A 1 408 ? 135.98900 123.02000 153.04500 1.000 43.81000  ? 653 GLN A CG    1 
ATOM   2503  C  CD    . GLN A 1 408 ? 137.41600 122.96900 153.53800 1.000 43.81000  ? 653 GLN A CD    1 
ATOM   2504  O  OE1   . GLN A 1 408 ? 137.72300 122.29400 154.51700 1.000 43.81000  ? 653 GLN A OE1   1 
ATOM   2505  N  NE2   . GLN A 1 408 ? 138.29700 123.70100 152.86900 1.000 43.81000  ? 653 GLN A NE2   1 
ATOM   2506  N  N     . VAL A 1 409 ? 133.44600 122.30300 151.00200 1.000 41.55000  ? 654 VAL A N     1 
ATOM   2507  C  CA    . VAL A 1 409 ? 133.39000 121.72300 149.66900 1.000 41.55000  ? 654 VAL A CA    1 
ATOM   2508  C  C     . VAL A 1 409 ? 134.49100 122.36000 148.83400 1.000 41.55000  ? 654 VAL A C     1 
ATOM   2509  O  O     . VAL A 1 409 ? 134.72300 123.57100 148.91700 1.000 41.55000  ? 654 VAL A O     1 
ATOM   2510  C  CB    . VAL A 1 409 ? 132.00600 121.92700 149.02200 1.000 41.55000  ? 654 VAL A CB    1 
ATOM   2511  C  CG1   . VAL A 1 409 ? 131.97600 121.30400 147.66600 1.000 41.55000  ? 654 VAL A CG1   1 
ATOM   2512  C  CG2   . VAL A 1 409 ? 130.92100 121.33400 149.89600 1.000 41.55000  ? 654 VAL A CG2   1 
ATOM   2513  N  N     . SER A 1 410 ? 135.16300 121.54800 148.02300 1.000 42.32000  ? 655 SER A N     1 
ATOM   2514  C  CA    . SER A 1 410 ? 136.44800 121.91900 147.44700 1.000 42.32000  ? 655 SER A CA    1 
ATOM   2515  C  C     . SER A 1 410 ? 136.34500 122.84300 146.23700 1.000 42.32000  ? 655 SER A C     1 
ATOM   2516  O  O     . SER A 1 410 ? 137.35300 123.01600 145.54300 1.000 42.32000  ? 655 SER A O     1 
ATOM   2517  C  CB    . SER A 1 410 ? 137.22600 120.65800 147.06600 1.000 42.32000  ? 655 SER A CB    1 
ATOM   2518  O  OG    . SER A 1 410 ? 137.51700 119.88100 148.21600 1.000 42.32000  ? 655 SER A OG    1 
ATOM   2519  N  N     . SER A 1 411 ? 135.19300 123.44100 145.96500 1.000 41.95000  ? 656 SER A N     1 
ATOM   2520  C  CA    . SER A 1 411 ? 135.05200 124.39400 144.86300 1.000 41.95000  ? 656 SER A CA    1 
ATOM   2521  C  C     . SER A 1 411 ? 133.73900 125.14500 145.05600 1.000 41.95000  ? 656 SER A C     1 
ATOM   2522  O  O     . SER A 1 411 ? 133.07300 125.00400 146.08800 1.000 41.95000  ? 656 SER A O     1 
ATOM   2523  C  CB    . SER A 1 411 ? 135.11400 123.69300 143.50600 1.000 41.95000  ? 656 SER A CB    1 
ATOM   2524  O  OG    . SER A 1 411 ? 134.00700 122.83100 143.33200 1.000 41.95000  ? 656 SER A OG    1 
ATOM   2525  N  N     . LYS A 1 412 ? 133.36700 125.94800 144.06000 1.000 40.26000  ? 657 LYS A N     1 
ATOM   2526  C  CA    . LYS A 1 412 ? 132.11900 126.69300 144.09100 1.000 40.26000  ? 657 LYS A CA    1 
ATOM   2527  C  C     . LYS A 1 412 ? 131.04500 126.08100 143.20600 1.000 40.26000  ? 657 LYS A C     1 
ATOM   2528  O  O     . LYS A 1 412 ? 129.85700 126.20200 143.52500 1.000 40.26000  ? 657 LYS A O     1 
ATOM   2529  C  CB    . LYS A 1 412 ? 132.36700 128.15000 143.67200 1.000 40.26000  ? 657 LYS A CB    1 
ATOM   2530  C  CG    . LYS A 1 412 ? 131.18200 129.07700 143.85700 1.000 40.26000  ? 657 LYS A CG    1 
ATOM   2531  C  CD    . LYS A 1 412 ? 131.58500 130.51600 143.58300 1.000 40.26000  ? 657 LYS A CD    1 
ATOM   2532  C  CE    . LYS A 1 412 ? 130.42000 131.46700 143.79100 1.000 40.26000  ? 657 LYS A CE    1 
ATOM   2533  N  NZ    . LYS A 1 412 ? 130.80000 132.88200 143.52900 1.000 40.26000  ? 657 LYS A NZ    1 
ATOM   2534  N  N     . ILE A 1 413 ? 131.42800 125.42400 142.11300 1.000 40.97000  ? 658 ILE A N     1 
ATOM   2535  C  CA    . ILE A 1 413 ? 130.49100 124.59600 141.36500 1.000 40.97000  ? 658 ILE A CA    1 
ATOM   2536  C  C     . ILE A 1 413 ? 129.93300 123.49400 142.25400 1.000 40.97000  ? 658 ILE A C     1 
ATOM   2537  O  O     . ILE A 1 413 ? 128.71600 123.27700 142.32400 1.000 40.97000  ? 658 ILE A O     1 
ATOM   2538  C  CB    . ILE A 1 413 ? 131.17500 124.00800 140.11800 1.000 40.97000  ? 658 ILE A CB    1 
ATOM   2539  C  CG1   . ILE A 1 413 ? 131.57800 125.11100 139.13700 1.000 40.97000  ? 658 ILE A CG1   1 
ATOM   2540  C  CG2   . ILE A 1 413 ? 130.27500 123.00500 139.45500 1.000 40.97000  ? 658 ILE A CG2   1 
ATOM   2541  C  CD1   . ILE A 1 413 ? 132.99200 125.61500 139.32000 1.000 40.97000  ? 658 ILE A CD1   1 
ATOM   2542  N  N     . ASP A 1 414 ? 130.82300 122.77900 142.94300 1.000 39.07000  ? 659 ASP A N     1 
ATOM   2543  C  CA    . ASP A 1 414 ? 130.41800 121.72300 143.85700 1.000 39.07000  ? 659 ASP A CA    1 
ATOM   2544  C  C     . ASP A 1 414 ? 129.65300 122.25700 145.05800 1.000 39.07000  ? 659 ASP A C     1 
ATOM   2545  O  O     . ASP A 1 414 ? 129.08100 121.46200 145.80900 1.000 39.07000  ? 659 ASP A O     1 
ATOM   2546  C  CB    . ASP A 1 414 ? 131.64300 120.94600 144.33300 1.000 39.07000  ? 659 ASP A CB    1 
ATOM   2547  C  CG    . ASP A 1 414 ? 132.38200 120.26600 143.20400 1.000 39.07000  ? 659 ASP A CG    1 
ATOM   2548  O  OD1   . ASP A 1 414 ? 131.75100 119.95800 142.17500 1.000 39.07000  ? 659 ASP A OD1   1 
ATOM   2549  O  OD2   . ASP A 1 414 ? 133.60000 120.03400 143.34900 1.000 39.07000  ? 659 ASP A OD2   1 
ATOM   2550  N  N     . SER A 1 415 ? 129.63700 123.57300 145.26200 1.000 36.47000  ? 660 SER A N     1 
ATOM   2551  C  CA    . SER A 1 415 ? 128.82100 124.18400 146.30200 1.000 36.47000  ? 660 SER A CA    1 
ATOM   2552  C  C     . SER A 1 415 ? 127.44900 124.58000 145.78600 1.000 36.47000  ? 660 SER A C     1 
ATOM   2553  O  O     . SER A 1 415 ? 126.45600 124.46100 146.51200 1.000 36.47000  ? 660 SER A O     1 
ATOM   2554  C  CB    . SER A 1 415 ? 129.51900 125.41700 146.87100 1.000 36.47000  ? 660 SER A CB    1 
ATOM   2555  O  OG    . SER A 1 415 ? 128.67000 126.08000 147.79000 1.000 36.47000  ? 660 SER A OG    1 
ATOM   2556  N  N     . ARG A 1 416 ? 127.37900 125.07000 144.54800 1.000 41.60000  ? 661 ARG A N     1 
ATOM   2557  C  CA    . ARG A 1 416 ? 126.08100 125.28400 143.92300 1.000 41.60000  ? 661 ARG A CA    1 
ATOM   2558  C  C     . ARG A 1 416 ? 125.34500 123.97300 143.72900 1.000 41.60000  ? 661 ARG A C     1 
ATOM   2559  O  O     . ARG A 1 416 ? 124.11300 123.95600 143.66000 1.000 41.60000  ? 661 ARG A O     1 
ATOM   2560  C  CB    . ARG A 1 416 ? 126.23500 125.98100 142.57700 1.000 41.60000  ? 661 ARG A CB    1 
ATOM   2561  C  CG    . ARG A 1 416 ? 126.71900 127.40300 142.64800 1.000 41.60000  ? 661 ARG A CG    1 
ATOM   2562  C  CD    . ARG A 1 416 ? 126.64400 128.00300 141.27200 1.000 41.60000  ? 661 ARG A CD    1 
ATOM   2563  N  NE    . ARG A 1 416 ? 125.27800 127.85700 140.78500 1.000 41.60000  ? 661 ARG A NE    1 
ATOM   2564  C  CZ    . ARG A 1 416 ? 124.27700 128.67100 141.10000 1.000 41.60000  ? 661 ARG A CZ    1 
ATOM   2565  N  NH1   . ARG A 1 416 ? 124.48300 129.70500 141.90400 1.000 41.60000  ? 661 ARG A NH1   1 
ATOM   2566  N  NH2   . ARG A 1 416 ? 123.06500 128.44500 140.61400 1.000 41.60000  ? 661 ARG A NH2   1 
ATOM   2567  N  N     . THR A 1 417 ? 126.08400 122.87200 143.61300 1.000 36.97000  ? 662 THR A N     1 
ATOM   2568  C  CA    . THR A 1 417 ? 125.43600 121.57300 143.50200 1.000 36.97000  ? 662 THR A CA    1 
ATOM   2569  C  C     . THR A 1 417 ? 124.60300 121.26000 144.73900 1.000 36.97000  ? 662 THR A C     1 
ATOM   2570  O  O     . THR A 1 417 ? 123.48500 120.74700 144.62500 1.000 36.97000  ? 662 THR A O     1 
ATOM   2571  C  CB    . THR A 1 417 ? 126.47800 120.48400 143.26300 1.000 36.97000  ? 662 THR A CB    1 
ATOM   2572  O  OG1   . THR A 1 417 ? 127.15600 120.73600 142.02700 1.000 36.97000  ? 662 THR A OG1   1 
ATOM   2573  C  CG2   . THR A 1 417 ? 125.81600 119.13300 143.19000 1.000 36.97000  ? 662 THR A CG2   1 
ATOM   2574  N  N     . ILE A 1 418 ? 125.10900 121.58500 145.92700 1.000 33.85000  ? 663 ILE A N     1 
ATOM   2575  C  CA    . ILE A 1 418 ? 124.52100 121.08200 147.16200 1.000 33.85000  ? 663 ILE A CA    1 
ATOM   2576  C  C     . ILE A 1 418 ? 123.75500 122.14100 147.94200 1.000 33.85000  ? 663 ILE A C     1 
ATOM   2577  O  O     . ILE A 1 418 ? 122.92400 121.77500 148.78700 1.000 33.85000  ? 663 ILE A O     1 
ATOM   2578  C  CB    . ILE A 1 418 ? 125.59000 120.44200 148.06500 1.000 33.85000  ? 663 ILE A CB    1 
ATOM   2579  C  CG1   . ILE A 1 418 ? 126.42500 121.51200 148.74800 1.000 33.85000  ? 663 ILE A CG1   1 
ATOM   2580  C  CG2   . ILE A 1 418 ? 126.54600 119.65800 147.22700 1.000 33.85000  ? 663 ILE A CG2   1 
ATOM   2581  C  CD1   . ILE A 1 418 ? 127.33800 120.94500 149.77900 1.000 33.85000  ? 663 ILE A CD1   1 
ATOM   2582  N  N     . LEU A 1 419 ? 124.01000 123.42800 147.71200 1.000 33.87000  ? 664 LEU A N     1 
ATOM   2583  C  CA    . LEU A 1 419 ? 123.21800 124.48800 148.31600 1.000 33.87000  ? 664 LEU A CA    1 
ATOM   2584  C  C     . LEU A 1 419 ? 122.36800 125.25400 147.31900 1.000 33.87000  ? 664 LEU A C     1 
ATOM   2585  O  O     . LEU A 1 419 ? 121.54900 126.07800 147.74200 1.000 33.87000  ? 664 LEU A O     1 
ATOM   2586  C  CB    . LEU A 1 419 ? 124.11700 125.48900 149.05700 1.000 33.87000  ? 664 LEU A CB    1 
ATOM   2587  C  CG    . LEU A 1 419 ? 124.76200 125.00800 150.35000 1.000 33.87000  ? 664 LEU A CG    1 
ATOM   2588  C  CD1   . LEU A 1 419 ? 125.73300 126.04800 150.86100 1.000 33.87000  ? 664 LEU A CD1   1 
ATOM   2589  C  CD2   . LEU A 1 419 ? 123.68700 124.74200 151.37500 1.000 33.87000  ? 664 LEU A CD2   1 
ATOM   2590  N  N     . ASP A 1 420 ? 122.53600 125.00800 146.02000 1.000 42.03000  ? 665 ASP A N     1 
ATOM   2591  C  CA    . ASP A 1 420 ? 121.94600 125.84300 144.97700 1.000 42.03000  ? 665 ASP A CA    1 
ATOM   2592  C  C     . ASP A 1 420 ? 122.33700 127.30000 145.20000 1.000 42.03000  ? 665 ASP A C     1 
ATOM   2593  O  O     . ASP A 1 420 ? 121.56000 128.22900 144.96800 1.000 42.03000  ? 665 ASP A O     1 
ATOM   2594  C  CB    . ASP A 1 420 ? 120.42900 125.66700 144.92300 1.000 42.03000  ? 665 ASP A CB    1 
ATOM   2595  C  CG    . ASP A 1 420 ? 119.81700 126.27000 143.67700 1.000 42.03000  ? 665 ASP A CG    1 
ATOM   2596  O  OD1   . ASP A 1 420 ? 119.99200 125.67900 142.59200 1.000 42.03000  ? 665 ASP A OD1   1 
ATOM   2597  O  OD2   . ASP A 1 420 ? 119.16200 127.32800 143.78200 1.000 42.03000  ? 665 ASP A OD2   1 
ATOM   2598  N  N     . GLN A 1 421 ? 123.56900 127.49400 145.66000 1.000 39.05000  ? 666 GLN A N     1 
ATOM   2599  C  CA    . GLN A 1 421 ? 124.07400 128.79200 146.07200 1.000 39.05000  ? 666 GLN A CA    1 
ATOM   2600  C  C     . GLN A 1 421 ? 125.56600 128.66400 146.32400 1.000 39.05000  ? 666 GLN A C     1 
ATOM   2601  O  O     . GLN A 1 421 ? 126.02000 127.64500 146.84700 1.000 39.05000  ? 666 GLN A O     1 
ATOM   2602  C  CB    . GLN A 1 421 ? 123.36100 129.27600 147.33900 1.000 39.05000  ? 666 GLN A CB    1 
ATOM   2603  C  CG    . GLN A 1 421 ? 123.81900 130.61900 147.85000 1.000 39.05000  ? 666 GLN A CG    1 
ATOM   2604  C  CD    . GLN A 1 421 ? 123.05700 131.03900 149.08400 1.000 39.05000  ? 666 GLN A CD    1 
ATOM   2605  O  OE1   . GLN A 1 421 ? 122.19500 130.30900 149.57100 1.000 39.05000  ? 666 GLN A OE1   1 
ATOM   2606  N  NE2   . GLN A 1 421 ? 123.37500 132.21600 149.60500 1.000 39.05000  ? 666 GLN A NE2   1 
ATOM   2607  N  N     . GLY A 1 422 ? 126.32000 129.69000 145.94900 1.000 37.18000  ? 667 GLY A N     1 
ATOM   2608  C  CA    . GLY A 1 422 ? 127.73000 129.71000 146.26500 1.000 37.18000  ? 667 GLY A CA    1 
ATOM   2609  C  C     . GLY A 1 422 ? 127.97500 130.09300 147.71300 1.000 37.18000  ? 667 GLY A C     1 
ATOM   2610  O  O     . GLY A 1 422 ? 127.19600 130.81700 148.33100 1.000 37.18000  ? 667 GLY A O     1 
ATOM   2611  N  N     . GLY A 1 423 ? 129.07700 129.59300 148.26200 1.000 35.51000  ? 668 GLY A N     1 
ATOM   2612  C  CA    . GLY A 1 423 ? 129.44500 129.96600 149.61200 1.000 35.51000  ? 668 GLY A CA    1 
ATOM   2613  C  C     . GLY A 1 423 ? 130.02500 128.85500 150.46000 1.000 35.51000  ? 668 GLY A C     1 
ATOM   2614  O  O     . GLY A 1 423 ? 130.66100 129.12800 151.48200 1.000 35.51000  ? 668 GLY A O     1 
ATOM   2615  N  N     . ALA A 1 424 ? 129.81200 127.60300 150.06800 1.000 36.52000  ? 669 ALA A N     1 
ATOM   2616  C  CA    . ALA A 1 424 ? 130.37100 126.48200 150.82100 1.000 36.52000  ? 669 ALA A CA    1 
ATOM   2617  C  C     . ALA A 1 424 ? 131.73400 126.06800 150.28100 1.000 36.52000  ? 669 ALA A C     1 
ATOM   2618  O  O     . ALA A 1 424 ? 131.99900 124.90000 150.01300 1.000 36.52000  ? 669 ALA A O     1 
ATOM   2619  C  CB    . ALA A 1 424 ? 129.39600 125.31200 150.81200 1.000 36.52000  ? 669 ALA A CB    1 
ATOM   2620  N  N     . GLU A 1 425 ? 132.61700 127.04900 150.12900 1.000 39.34000  ? 670 GLU A N     1 
ATOM   2621  C  CA    . GLU A 1 425 ? 134.03100 126.80100 149.87200 1.000 39.34000  ? 670 GLU A CA    1 
ATOM   2622  C  C     . GLU A 1 425 ? 134.94100 127.68800 150.69900 1.000 39.34000  ? 670 GLU A C     1 
ATOM   2623  O  O     . GLU A 1 425 ? 136.13200 127.38200 150.81700 1.000 39.34000  ? 670 GLU A O     1 
ATOM   2624  C  CB    . GLU A 1 425 ? 134.36000 126.99800 148.38900 1.000 39.34000  ? 670 GLU A CB    1 
ATOM   2625  C  CG    . GLU A 1 425 ? 134.32300 128.44500 147.92700 1.000 39.34000  ? 670 GLU A CG    1 
ATOM   2626  C  CD    . GLU A 1 425 ? 132.92600 128.91300 147.56600 1.000 39.34000  ? 670 GLU A CD    1 
ATOM   2627  O  OE1   . GLU A 1 425 ? 131.94900 128.24000 147.95300 1.000 39.34000  ? 670 GLU A OE1   1 
ATOM   2628  O  OE2   . GLU A 1 425 ? 132.80400 129.95800 146.89400 1.000 39.34000  ? 670 GLU A OE2   1 
ATOM   2629  N  N     . GLN A 1 426 ? 134.42500 128.77500 151.27200 1.000 45.01000  ? 671 GLN A N     1 
ATOM   2630  C  CA    . GLN A 1 426 ? 135.13600 129.59100 152.24100 1.000 45.01000  ? 671 GLN A CA    1 
ATOM   2631  C  C     . GLN A 1 426 ? 135.21700 128.92500 153.60300 1.000 45.01000  ? 671 GLN A C     1 
ATOM   2632  O  O     . GLN A 1 426 ? 135.96100 129.40400 154.46600 1.000 45.01000  ? 671 GLN A O     1 
ATOM   2633  C  CB    . GLN A 1 426 ? 134.43800 130.94300 152.37700 1.000 45.01000  ? 671 GLN A CB    1 
ATOM   2634  C  CG    . GLN A 1 426 ? 134.38900 131.74400 151.09500 1.000 45.01000  ? 671 GLN A CG    1 
ATOM   2635  C  CD    . GLN A 1 426 ? 133.61800 133.03500 151.25400 1.000 45.01000  ? 671 GLN A CD    1 
ATOM   2636  O  OE1   . GLN A 1 426 ? 133.07900 133.31900 152.32200 1.000 45.01000  ? 671 GLN A OE1   1 
ATOM   2637  N  NE2   . GLN A 1 426 ? 133.54800 133.82000 150.18700 1.000 45.01000  ? 671 GLN A NE2   1 
ATOM   2638  N  N     . LEU A 1 427 ? 134.45600 127.85300 153.81400 1.000 40.77000  ? 672 LEU A N     1 
ATOM   2639  C  CA    . LEU A 1 427 ? 134.40900 127.18900 155.10700 1.000 40.77000  ? 672 LEU A CA    1 
ATOM   2640  C  C     . LEU A 1 427 ? 135.79800 126.73600 155.53300 1.000 40.77000  ? 672 LEU A C     1 
ATOM   2641  O  O     . LEU A 1 427 ? 136.59500 126.26200 154.72000 1.000 40.77000  ? 672 LEU A O     1 
ATOM   2642  C  CB    . LEU A 1 427 ? 133.46000 125.99800 155.03900 1.000 40.77000  ? 672 LEU A CB    1 
ATOM   2643  C  CG    . LEU A 1 427 ? 132.02600 126.42400 154.74500 1.000 40.77000  ? 672 LEU A CG    1 
ATOM   2644  C  CD1   . LEU A 1 427 ? 131.14500 125.22200 154.49800 1.000 40.77000  ? 672 LEU A CD1   1 
ATOM   2645  C  CD2   . LEU A 1 427 ? 131.48900 127.26200 155.88500 1.000 40.77000  ? 672 LEU A CD2   1 
ATOM   2646  N  N     . LEU A 1 428 ? 136.08200 126.88400 156.82100 1.000 42.49000  ? 673 LEU A N     1 
ATOM   2647  C  CA    . LEU A 1 428 ? 137.41700 126.66500 157.35300 1.000 42.49000  ? 673 LEU A CA    1 
ATOM   2648  C  C     . LEU A 1 428 ? 137.68900 125.21100 157.70900 1.000 42.49000  ? 673 LEU A C     1 
ATOM   2649  O  O     . LEU A 1 428 ? 138.68400 124.93300 158.38400 1.000 42.49000  ? 673 LEU A O     1 
ATOM   2650  C  CB    . LEU A 1 428 ? 137.63200 127.55500 158.57700 1.000 42.49000  ? 673 LEU A CB    1 
ATOM   2651  C  CG    . LEU A 1 428 ? 137.54400 129.05000 158.27200 1.000 42.49000  ? 673 LEU A CG    1 
ATOM   2652  C  CD1   . LEU A 1 428 ? 137.64900 129.86300 159.54500 1.000 42.49000  ? 673 LEU A CD1   1 
ATOM   2653  C  CD2   . LEU A 1 428 ? 138.61300 129.46300 157.27700 1.000 42.49000  ? 673 LEU A CD2   1 
ATOM   2654  N  N     . GLY A 1 429 ? 136.83900 124.28600 157.28000 1.000 45.19000  ? 674 GLY A N     1 
ATOM   2655  C  CA    . GLY A 1 429 ? 137.08400 122.87600 157.50900 1.000 45.19000  ? 674 GLY A CA    1 
ATOM   2656  C  C     . GLY A 1 429 ? 136.93400 122.47400 158.96600 1.000 45.19000  ? 674 GLY A C     1 
ATOM   2657  O  O     . GLY A 1 429 ? 136.65100 123.27800 159.85100 1.000 45.19000  ? 674 GLY A O     1 
ATOM   2658  N  N     . HIS A 1 430 ? 137.13100 121.17600 159.19900 1.000 51.28000  ? 675 HIS A N     1 
ATOM   2659  C  CA    . HIS A 1 430 ? 137.01600 120.57300 160.52500 1.000 51.28000  ? 675 HIS A CA    1 
ATOM   2660  C  C     . HIS A 1 430 ? 135.63600 120.79700 161.13300 1.000 51.28000  ? 675 HIS A C     1 
ATOM   2661  O  O     . HIS A 1 430 ? 135.51000 121.08000 162.32600 1.000 51.28000  ? 675 HIS A O     1 
ATOM   2662  C  CB    . HIS A 1 430 ? 138.10400 121.08600 161.47200 1.000 51.28000  ? 675 HIS A CB    1 
ATOM   2663  C  CG    . HIS A 1 430 ? 139.48700 120.68400 161.07300 1.000 51.28000  ? 675 HIS A CG    1 
ATOM   2664  N  ND1   . HIS A 1 430 ? 139.97100 119.40700 161.25100 1.000 51.28000  ? 675 HIS A ND1   1 
ATOM   2665  C  CD2   . HIS A 1 430 ? 140.49100 121.39200 160.50400 1.000 51.28000  ? 675 HIS A CD2   1 
ATOM   2666  C  CE1   . HIS A 1 430 ? 141.21400 119.34400 160.80900 1.000 51.28000  ? 675 HIS A CE1   1 
ATOM   2667  N  NE2   . HIS A 1 430 ? 141.55400 120.53500 160.35000 1.000 51.28000  ? 675 HIS A NE2   1 
ATOM   2668  N  N     . GLY A 1 431 ? 134.59200 120.67600 160.31900 1.000 45.54000  ? 676 GLY A N     1 
ATOM   2669  C  CA    . GLY A 1 431 ? 133.23700 120.75600 160.82400 1.000 45.54000  ? 676 GLY A CA    1 
ATOM   2670  C  C     . GLY A 1 431 ? 132.69900 122.16600 160.90300 1.000 45.54000  ? 676 GLY A C     1 
ATOM   2671  O  O     . GLY A 1 431 ? 132.19800 122.58900 161.94500 1.000 45.54000  ? 676 GLY A O     1 
ATOM   2672  N  N     . ASP A 1 432 ? 132.80200 122.91000 159.80900 1.000 41.35000  ? 677 ASP A N     1 
ATOM   2673  C  CA    . ASP A 1 432 ? 132.27400 124.26800 159.72600 1.000 41.35000  ? 677 ASP A CA    1 
ATOM   2674  C  C     . ASP A 1 432 ? 131.16900 124.22400 158.67800 1.000 41.35000  ? 677 ASP A C     1 
ATOM   2675  O  O     . ASP A 1 432 ? 131.41400 124.47600 157.49900 1.000 41.35000  ? 677 ASP A O     1 
ATOM   2676  C  CB    . ASP A 1 432 ? 133.37500 125.25600 159.36600 1.000 41.35000  ? 677 ASP A CB    1 
ATOM   2677  C  CG    . ASP A 1 432 ? 132.95600 126.69300 159.56200 1.000 41.35000  ? 677 ASP A CG    1 
ATOM   2678  O  OD1   . ASP A 1 432 ? 131.80200 126.93000 159.96900 1.000 41.35000  ? 677 ASP A OD1   1 
ATOM   2679  O  OD2   . ASP A 1 432 ? 133.78500 127.59100 159.30900 1.000 41.35000  ? 677 ASP A OD2   1 
ATOM   2680  N  N     . MET A 1 433 ? 129.95600 123.89700 159.10700 1.000 38.54000  ? 678 MET A N     1 
ATOM   2681  C  CA    . MET A 1 433 ? 128.86900 123.63700 158.17900 1.000 38.54000  ? 678 MET A CA    1 
ATOM   2682  C  C     . MET A 1 433 ? 128.14400 124.92500 157.79600 1.000 38.54000  ? 678 MET A C     1 
ATOM   2683  O  O     . MET A 1 433 ? 128.37700 125.99500 158.35900 1.000 38.54000  ? 678 MET A O     1 
ATOM   2684  C  CB    . MET A 1 433 ? 127.88800 122.63100 158.77800 1.000 38.54000  ? 678 MET A CB    1 
ATOM   2685  C  CG    . MET A 1 433 ? 127.14800 123.13200 159.99600 1.000 38.54000  ? 678 MET A CG    1 
ATOM   2686  S  SD    . MET A 1 433 ? 126.08400 121.88000 160.73400 1.000 38.54000  ? 678 MET A SD    1 
ATOM   2687  C  CE    . MET A 1 433 ? 127.28900 120.83900 161.54300 1.000 38.54000  ? 678 MET A CE    1 
ATOM   2688  N  N     . LEU A 1 434 ? 127.26200 124.80800 156.80200 1.000 31.24000  ? 679 LEU A N     1 
ATOM   2689  C  CA    . LEU A 1 434 ? 126.34400 125.87500 156.39000 1.000 31.24000  ? 679 LEU A CA    1 
ATOM   2690  C  C     . LEU A 1 434 ? 124.93900 125.28600 156.37200 1.000 31.24000  ? 679 LEU A C     1 
ATOM   2691  O  O     . LEU A 1 434 ? 124.50500 124.72700 155.36300 1.000 31.24000  ? 679 LEU A O     1 
ATOM   2692  C  CB    . LEU A 1 434 ? 126.71400 126.45700 155.03200 1.000 31.24000  ? 679 LEU A CB    1 
ATOM   2693  C  CG    . LEU A 1 434 ? 127.95800 127.32700 154.91800 1.000 31.24000  ? 679 LEU A CG    1 
ATOM   2694  C  CD1   . LEU A 1 434 ? 128.19000 127.69300 153.47300 1.000 31.24000  ? 679 LEU A CD1   1 
ATOM   2695  C  CD2   . LEU A 1 434 ? 127.78100 128.57100 155.74300 1.000 31.24000  ? 679 LEU A CD2   1 
ATOM   2696  N  N     . TYR A 1 435 ? 124.22600 125.42000 157.48300 1.000 32.81000  ? 680 TYR A N     1 
ATOM   2697  C  CA    . TYR A 1 435 ? 122.87100 124.89400 157.57800 1.000 32.81000  ? 680 TYR A CA    1 
ATOM   2698  C  C     . TYR A 1 435 ? 121.91800 125.75800 156.76400 1.000 32.81000  ? 680 TYR A C     1 
ATOM   2699  O  O     . TYR A 1 435 ? 121.80100 126.96200 157.00700 1.000 32.81000  ? 680 TYR A O     1 
ATOM   2700  C  CB    . TYR A 1 435 ? 122.44100 124.83700 159.04000 1.000 32.81000  ? 680 TYR A CB    1 
ATOM   2701  C  CG    . TYR A 1 435 ? 121.03200 124.35000 159.26400 1.000 32.81000  ? 680 TYR A CG    1 
ATOM   2702  C  CD1   . TYR A 1 435 ? 120.70200 123.01900 159.08300 1.000 32.81000  ? 680 TYR A CD1   1 
ATOM   2703  C  CD2   . TYR A 1 435 ? 120.04000 125.21700 159.68600 1.000 32.81000  ? 680 TYR A CD2   1 
ATOM   2704  C  CE1   . TYR A 1 435 ? 119.41900 122.56800 159.29800 1.000 32.81000  ? 680 TYR A CE1   1 
ATOM   2705  C  CE2   . TYR A 1 435 ? 118.75400 124.77600 159.90500 1.000 32.81000  ? 680 TYR A CE2   1 
ATOM   2706  C  CZ    . TYR A 1 435 ? 118.45000 123.45000 159.71000 1.000 32.81000  ? 680 TYR A CZ    1 
ATOM   2707  O  OH    . TYR A 1 435 ? 117.16900 123.00100 159.92600 1.000 32.81000  ? 680 TYR A OH    1 
ATOM   2708  N  N     . LEU A 1 436 ? 121.24400 125.14500 155.79100 1.000 32.35000  ? 681 LEU A N     1 
ATOM   2709  C  CA    . LEU A 1 436 ? 120.29200 125.85800 154.95100 1.000 32.35000  ? 681 LEU A CA    1 
ATOM   2710  C  C     . LEU A 1 436 ? 118.87900 125.47700 155.36600 1.000 32.35000  ? 681 LEU A C     1 
ATOM   2711  O  O     . LEU A 1 436 ? 118.40300 124.40000 154.98000 1.000 32.35000  ? 681 LEU A O     1 
ATOM   2712  C  CB    . LEU A 1 436 ? 120.52000 125.52700 153.48600 1.000 32.35000  ? 681 LEU A CB    1 
ATOM   2713  C  CG    . LEU A 1 436 ? 119.58500 126.22200 152.50000 1.000 32.35000  ? 681 LEU A CG    1 
ATOM   2714  C  CD1   . LEU A 1 436 ? 119.75500 127.72000 152.58400 1.000 32.35000  ? 681 LEU A CD1   1 
ATOM   2715  C  CD2   . LEU A 1 436 ? 119.85600 125.73700 151.09100 1.000 32.35000  ? 681 LEU A CD2   1 
ATOM   2716  N  N     . PRO A 1 437 ? 118.17800 126.30500 156.13200 1.000 34.07000  ? 682 PRO A N     1 
ATOM   2717  C  CA    . PRO A 1 437 ? 116.86300 125.91600 156.64300 1.000 34.07000  ? 682 PRO A CA    1 
ATOM   2718  C  C     . PRO A 1 437 ? 115.85300 125.77900 155.51900 1.000 34.07000  ? 682 PRO A C     1 
ATOM   2719  O  O     . PRO A 1 437 ? 116.07500 126.27300 154.40400 1.000 34.07000  ? 682 PRO A O     1 
ATOM   2720  C  CB    . PRO A 1 437 ? 116.49200 127.07700 157.57800 1.000 34.07000  ? 682 PRO A CB    1 
ATOM   2721  C  CG    . PRO A 1 437 ? 117.78400 127.72800 157.91200 1.000 34.07000  ? 682 PRO A CG    1 
ATOM   2722  C  CD    . PRO A 1 437 ? 118.61700 127.59700 156.67900 1.000 34.07000  ? 682 PRO A CD    1 
ATOM   2723  N  N     . PRO A 1 438 ? 114.73500 125.10300 155.77200 1.000 36.16000  ? 683 PRO A N     1 
ATOM   2724  C  CA    . PRO A 1 438 ? 113.62900 125.11200 154.80600 1.000 36.16000  ? 683 PRO A CA    1 
ATOM   2725  C  C     . PRO A 1 438 ? 112.79900 126.37700 154.96900 1.000 36.16000  ? 683 PRO A C     1 
ATOM   2726  O  O     . PRO A 1 438 ? 112.66600 126.90900 156.07200 1.000 36.16000  ? 683 PRO A O     1 
ATOM   2727  C  CB    . PRO A 1 438 ? 112.82900 123.85900 155.17300 1.000 36.16000  ? 683 PRO A CB    1 
ATOM   2728  C  CG    . PRO A 1 438 ? 113.09400 123.68400 156.63400 1.000 36.16000  ? 683 PRO A CG    1 
ATOM   2729  C  CD    . PRO A 1 438 ? 114.50500 124.14600 156.86900 1.000 36.16000  ? 683 PRO A CD    1 
ATOM   2730  N  N     . GLY A 1 439 ? 112.23800 126.85700 153.86300 1.000 39.60000  ? 684 GLY A N     1 
ATOM   2731  C  CA    . GLY A 1 439 ? 111.56900 128.14400 153.87200 1.000 39.60000  ? 684 GLY A CA    1 
ATOM   2732  C  C     . GLY A 1 439 ? 112.50800 129.31100 154.04400 1.000 39.60000  ? 684 GLY A C     1 
ATOM   2733  O  O     . GLY A 1 439 ? 112.13100 130.31000 154.66500 1.000 39.60000  ? 684 GLY A O     1 
ATOM   2734  N  N     . THR A 1 440 ? 113.72300 129.20900 153.51200 1.000 42.01000  ? 685 THR A N     1 
ATOM   2735  C  CA    . THR A 1 440 ? 114.83200 130.10600 153.80900 1.000 42.01000  ? 685 THR A CA    1 
ATOM   2736  C  C     . THR A 1 440 ? 115.69700 130.14900 152.55100 1.000 42.01000  ? 685 THR A C     1 
ATOM   2737  O  O     . THR A 1 440 ? 115.18700 129.92800 151.44800 1.000 42.01000  ? 685 THR A O     1 
ATOM   2738  C  CB    . THR A 1 440 ? 115.59600 129.63600 155.05500 1.000 42.01000  ? 685 THR A CB    1 
ATOM   2739  O  OG1   . THR A 1 440 ? 114.65400 129.33600 156.09100 1.000 42.01000  ? 685 THR A OG1   1 
ATOM   2740  C  CG2   . THR A 1 440 ? 116.49900 130.74100 155.60200 1.000 42.01000  ? 685 THR A CG2   1 
ATOM   2741  N  N     . GLY A 1 441 ? 116.98800 130.43200 152.68600 1.000 41.55000  ? 686 GLY A N     1 
ATOM   2742  C  CA    . GLY A 1 441 ? 117.83500 130.70500 151.54500 1.000 41.55000  ? 686 GLY A CA    1 
ATOM   2743  C  C     . GLY A 1 441 ? 118.95900 131.65700 151.88600 1.000 41.55000  ? 686 GLY A C     1 
ATOM   2744  O  O     . GLY A 1 441 ? 119.77300 132.01100 151.02700 1.000 41.55000  ? 686 GLY A O     1 
ATOM   2745  N  N     . LEU A 1 442 ? 119.00600 132.08400 153.14400 1.000 39.10000  ? 687 LEU A N     1 
ATOM   2746  C  CA    . LEU A 1 442 ? 120.20500 132.68400 153.72700 1.000 39.10000  ? 687 LEU A CA    1 
ATOM   2747  C  C     . LEU A 1 442 ? 120.85900 131.61600 154.58900 1.000 39.10000  ? 687 LEU A C     1 
ATOM   2748  O  O     . LEU A 1 442 ? 120.41200 131.37200 155.72400 1.000 39.10000  ? 687 LEU A O     1 
ATOM   2749  C  CB    . LEU A 1 442 ? 119.87400 133.92300 154.55800 1.000 39.10000  ? 687 LEU A CB    1 
ATOM   2750  C  CG    . LEU A 1 442 ? 119.75800 135.26500 153.83000 1.000 39.10000  ? 687 LEU A CG    1 
ATOM   2751  C  CD1   . LEU A 1 442 ? 121.08200 135.62300 153.17500 1.000 39.10000  ? 687 LEU A CD1   1 
ATOM   2752  C  CD2   . LEU A 1 442 ? 118.62500 135.27800 152.81200 1.000 39.10000  ? 687 LEU A CD2   1 
ATOM   2753  N  N     . PRO A 1 443 ? 121.90100 130.94100 154.09700 1.000 31.86000  ? 688 PRO A N     1 
ATOM   2754  C  CA    . PRO A 1 443 ? 122.46200 129.80100 154.83200 1.000 31.86000  ? 688 PRO A CA    1 
ATOM   2755  C  C     . PRO A 1 443 ? 122.96700 130.16700 156.21600 1.000 31.86000  ? 688 PRO A C     1 
ATOM   2756  O  O     . PRO A 1 443 ? 123.92600 130.93000 156.35600 1.000 31.86000  ? 688 PRO A O     1 
ATOM   2757  C  CB    . PRO A 1 443 ? 123.61300 129.34000 153.93000 1.000 31.86000  ? 688 PRO A CB    1 
ATOM   2758  C  CG    . PRO A 1 443 ? 123.25400 129.83200 152.57700 1.000 31.86000  ? 688 PRO A CG    1 
ATOM   2759  C  CD    . PRO A 1 443 ? 122.56400 131.13900 152.79900 1.000 31.86000  ? 688 PRO A CD    1 
ATOM   2760  N  N     . ILE A 1 444 ? 122.32000 129.62600 157.24400 1.000 32.11000  ? 689 ILE A N     1 
ATOM   2761  C  CA    . ILE A 1 444 ? 122.78400 129.80000 158.61600 1.000 32.11000  ? 689 ILE A CA    1 
ATOM   2762  C  C     . ILE A 1 444 ? 124.12200 129.08100 158.74800 1.000 32.11000  ? 689 ILE A C     1 
ATOM   2763  O  O     . ILE A 1 444 ? 124.19600 127.86200 158.57900 1.000 32.11000  ? 689 ILE A O     1 
ATOM   2764  C  CB    . ILE A 1 444 ? 121.76700 129.26400 159.62600 1.000 32.11000  ? 689 ILE A CB    1 
ATOM   2765  C  CG1   . ILE A 1 444 ? 120.42500 129.97700 159.46100 1.000 32.11000  ? 689 ILE A CG1   1 
ATOM   2766  C  CG2   . ILE A 1 444 ? 122.29200 129.42500 161.03900 1.000 32.11000  ? 689 ILE A CG2   1 
ATOM   2767  C  CD1   . ILE A 1 444 ? 120.49300 131.46600 159.69300 1.000 32.11000  ? 689 ILE A CD1   1 
ATOM   2768  N  N     . ARG A 1 445 ? 125.18200 129.82700 159.04400 1.000 37.51000  ? 690 ARG A N     1 
ATOM   2769  C  CA    . ARG A 1 445 ? 126.48700 129.21600 159.25400 1.000 37.51000  ? 690 ARG A CA    1 
ATOM   2770  C  C     . ARG A 1 445 ? 126.59400 128.72300 160.68900 1.000 37.51000  ? 690 ARG A C     1 
ATOM   2771  O  O     . ARG A 1 445 ? 126.46700 129.50800 161.63300 1.000 37.51000  ? 690 ARG A O     1 
ATOM   2772  C  CB    . ARG A 1 445 ? 127.61100 130.19800 158.94400 1.000 37.51000  ? 690 ARG A CB    1 
ATOM   2773  C  CG    . ARG A 1 445 ? 128.98300 129.58400 159.12800 1.000 37.51000  ? 690 ARG A CG    1 
ATOM   2774  C  CD    . ARG A 1 445 ? 130.08600 130.51000 158.66500 1.000 37.51000  ? 690 ARG A CD    1 
ATOM   2775  N  NE    . ARG A 1 445 ? 131.40100 129.92400 158.89000 1.000 37.51000  ? 690 ARG A NE    1 
ATOM   2776  C  CZ    . ARG A 1 445 ? 132.54300 130.49500 158.52800 1.000 37.51000  ? 690 ARG A CZ    1 
ATOM   2777  N  NH1   . ARG A 1 445 ? 132.53300 131.66800 157.91400 1.000 37.51000  ? 690 ARG A NH1   1 
ATOM   2778  N  NH2   . ARG A 1 445 ? 133.69600 129.89000 158.77500 1.000 37.51000  ? 690 ARG A NH2   1 
ATOM   2779  N  N     . VAL A 1 446 ? 126.83300 127.42800 160.84700 1.000 37.17000  ? 691 VAL A N     1 
ATOM   2780  C  CA    . VAL A 1 446 ? 126.93400 126.78600 162.14900 1.000 37.17000  ? 691 VAL A CA    1 
ATOM   2781  C  C     . VAL A 1 446 ? 128.28700 126.09900 162.22600 1.000 37.17000  ? 691 VAL A C     1 
ATOM   2782  O  O     . VAL A 1 446 ? 128.79300 125.59600 161.21800 1.000 37.17000  ? 691 VAL A O     1 
ATOM   2783  C  CB    . VAL A 1 446 ? 125.78500 125.77800 162.36500 1.000 37.17000  ? 691 VAL A CB    1 
ATOM   2784  C  CG1   . VAL A 1 446 ? 125.94600 125.04200 163.67800 1.000 37.17000  ? 691 VAL A CG1   1 
ATOM   2785  C  CG2   . VAL A 1 446 ? 124.44700 126.48800 162.31300 1.000 37.17000  ? 691 VAL A CG2   1 
ATOM   2786  N  N     . HIS A 1 447 ? 128.87900 126.09100 163.41400 1.000 39.28000  ? 692 HIS A N     1 
ATOM   2787  C  CA    . HIS A 1 447 ? 130.14300 125.41100 163.64000 1.000 39.28000  ? 692 HIS A CA    1 
ATOM   2788  C  C     . HIS A 1 447 ? 129.87000 124.05200 164.26500 1.000 39.28000  ? 692 HIS A C     1 
ATOM   2789  O  O     . HIS A 1 447 ? 129.06700 123.93600 165.19500 1.000 39.28000  ? 692 HIS A O     1 
ATOM   2790  C  CB    . HIS A 1 447 ? 131.05500 126.24100 164.54100 1.000 39.28000  ? 692 HIS A CB    1 
ATOM   2791  C  CG    . HIS A 1 447 ? 131.37500 127.59100 163.98400 1.000 39.28000  ? 692 HIS A CG    1 
ATOM   2792  N  ND1   . HIS A 1 447 ? 132.22400 127.77200 162.91500 1.000 39.28000  ? 692 HIS A ND1   1 
ATOM   2793  C  CD2   . HIS A 1 447 ? 130.95800 128.82700 164.34700 1.000 39.28000  ? 692 HIS A CD2   1 
ATOM   2794  C  CE1   . HIS A 1 447 ? 132.31300 129.06100 162.63900 1.000 39.28000  ? 692 HIS A CE1   1 
ATOM   2795  N  NE2   . HIS A 1 447 ? 131.55600 129.72300 163.49600 1.000 39.28000  ? 692 HIS A NE2   1 
ATOM   2796  N  N     . GLY A 1 448 ? 130.53500 123.02500 163.74300 1.000 41.84000  ? 693 GLY A N     1 
ATOM   2797  C  CA    . GLY A 1 448 ? 130.25200 121.67400 164.17200 1.000 41.84000  ? 693 GLY A CA    1 
ATOM   2798  C  C     . GLY A 1 448 ? 130.54100 121.45400 165.64300 1.000 41.84000  ? 693 GLY A C     1 
ATOM   2799  O  O     . GLY A 1 448 ? 131.37000 122.12200 166.26000 1.000 41.84000  ? 693 GLY A O     1 
ATOM   2800  N  N     . ALA A 1 449 ? 129.82900 120.49000 166.20900 1.000 46.23000  ? 694 ALA A N     1 
ATOM   2801  C  CA    . ALA A 1 449 ? 129.98200 120.10100 167.60600 1.000 46.23000  ? 694 ALA A CA    1 
ATOM   2802  C  C     . ALA A 1 449 ? 130.75900 118.79200 167.61800 1.000 46.23000  ? 694 ALA A C     1 
ATOM   2803  O  O     . ALA A 1 449 ? 130.18700 117.71900 167.40600 1.000 46.23000  ? 694 ALA A O     1 
ATOM   2804  C  CB    . ALA A 1 449 ? 128.62600 119.96700 168.28900 1.000 46.23000  ? 694 ALA A CB    1 
ATOM   2805  N  N     . PHE A 1 450 ? 132.06600 118.89100 167.85000 1.000 51.21000  ? 695 PHE A N     1 
ATOM   2806  C  CA    . PHE A 1 450 ? 132.93700 117.72700 167.77600 1.000 51.21000  ? 695 PHE A CA    1 
ATOM   2807  C  C     . PHE A 1 450 ? 132.48200 116.64600 168.74400 1.000 51.21000  ? 695 PHE A C     1 
ATOM   2808  O  O     . PHE A 1 450 ? 132.11100 116.92500 169.88500 1.000 51.21000  ? 695 PHE A O     1 
ATOM   2809  C  CB    . PHE A 1 450 ? 134.37800 118.12600 168.08600 1.000 51.21000  ? 695 PHE A CB    1 
ATOM   2810  C  CG    . PHE A 1 450 ? 135.35000 116.99100 167.99600 1.000 51.21000  ? 695 PHE A CG    1 
ATOM   2811  C  CD1   . PHE A 1 450 ? 135.77800 116.52800 166.76700 1.000 51.21000  ? 695 PHE A CD1   1 
ATOM   2812  C  CD2   . PHE A 1 450 ? 135.83300 116.38400 169.13800 1.000 51.21000  ? 695 PHE A CD2   1 
ATOM   2813  C  CE1   . PHE A 1 450 ? 136.67200 115.48400 166.68100 1.000 51.21000  ? 695 PHE A CE1   1 
ATOM   2814  C  CE2   . PHE A 1 450 ? 136.72700 115.34000 169.05700 1.000 51.21000  ? 695 PHE A CE2   1 
ATOM   2815  C  CZ    . PHE A 1 450 ? 137.14700 114.89000 167.82600 1.000 51.21000  ? 695 PHE A CZ    1 
ATOM   2816  N  N     . VAL A 1 451 ? 132.51600 115.40000 168.27800 1.000 51.43000  ? 696 VAL A N     1 
ATOM   2817  C  CA    . VAL A 1 451 ? 132.13800 114.26000 169.10300 1.000 51.43000  ? 696 VAL A CA    1 
ATOM   2818  C  C     . VAL A 1 451 ? 133.20900 113.18900 168.97700 1.000 51.43000  ? 696 VAL A C     1 
ATOM   2819  O  O     . VAL A 1 451 ? 133.28800 112.49300 167.96000 1.000 51.43000  ? 696 VAL A O     1 
ATOM   2820  C  CB    . VAL A 1 451 ? 130.75700 113.70600 168.70800 1.000 51.43000  ? 696 VAL A CB    1 
ATOM   2821  C  CG1   . VAL A 1 451 ? 130.45100 112.44700 169.49500 1.000 51.43000  ? 696 VAL A CG1   1 
ATOM   2822  C  CG2   . VAL A 1 451 ? 129.68000 114.74500 168.94000 1.000 51.43000  ? 696 VAL A CG2   1 
ATOM   2823  N  N     . SER A 1 452 ? 134.04700 113.06100 170.00200 1.000 58.87000  ? 697 SER A N     1 
ATOM   2824  C  CA    . SER A 1 452 ? 135.05200 112.01100 170.00500 1.000 58.87000  ? 697 SER A CA    1 
ATOM   2825  C  C     . SER A 1 452 ? 134.38000 110.64500 169.98300 1.000 58.87000  ? 697 SER A C     1 
ATOM   2826  O  O     . SER A 1 452 ? 133.29300 110.45500 170.53300 1.000 58.87000  ? 697 SER A O     1 
ATOM   2827  C  CB    . SER A 1 452 ? 135.95400 112.13200 171.23200 1.000 58.87000  ? 697 SER A CB    1 
ATOM   2828  O  OG    . SER A 1 452 ? 136.90400 111.08200 171.26200 1.000 58.87000  ? 697 SER A OG    1 
ATOM   2829  N  N     . ASP A 1 453 ? 135.03900 109.68800 169.32800 1.000 62.82000  ? 698 ASP A N     1 
ATOM   2830  C  CA    . ASP A 1 453 ? 134.44700 108.36500 169.16700 1.000 62.82000  ? 698 ASP A CA    1 
ATOM   2831  C  C     . ASP A 1 453 ? 134.22100 107.68600 170.51400 1.000 62.82000  ? 698 ASP A C     1 
ATOM   2832  O  O     . ASP A 1 453 ? 133.26600 106.91400 170.67000 1.000 62.82000  ? 698 ASP A O     1 
ATOM   2833  C  CB    . ASP A 1 453 ? 135.33900 107.50700 168.27100 1.000 62.82000  ? 698 ASP A CB    1 
ATOM   2834  C  CG    . ASP A 1 453 ? 134.63900 106.26200 167.77100 1.000 62.82000  ? 698 ASP A CG    1 
ATOM   2835  O  OD1   . ASP A 1 453 ? 133.45800 106.05800 168.11800 1.000 62.82000  ? 698 ASP A OD1   1 
ATOM   2836  O  OD2   . ASP A 1 453 ? 135.26900 105.48700 167.02300 1.000 62.82000  ? 698 ASP A OD2   1 
ATOM   2837  N  N     . ASP A 1 454 ? 135.07700 107.96900 171.49800 1.000 65.22000  ? 699 ASP A N     1 
ATOM   2838  C  CA    . ASP A 1 454 ? 134.89300 107.39100 172.82400 1.000 65.22000  ? 699 ASP A CA    1 
ATOM   2839  C  C     . ASP A 1 454 ? 133.56500 107.80900 173.43600 1.000 65.22000  ? 699 ASP A C     1 
ATOM   2840  O  O     . ASP A 1 454 ? 132.93900 107.02100 174.15100 1.000 65.22000  ? 699 ASP A O     1 
ATOM   2841  C  CB    . ASP A 1 454 ? 136.05000 107.79300 173.73600 1.000 65.22000  ? 699 ASP A CB    1 
ATOM   2842  C  CG    . ASP A 1 454 ? 137.36000 107.16100 173.32100 1.000 65.22000  ? 699 ASP A CG    1 
ATOM   2843  O  OD1   . ASP A 1 454 ? 137.32700 106.05200 172.74700 1.000 65.22000  ? 699 ASP A OD1   1 
ATOM   2844  O  OD2   . ASP A 1 454 ? 138.42100 107.77400 173.56200 1.000 65.22000  ? 699 ASP A OD2   1 
ATOM   2845  N  N     . GLU A 1 455 ? 133.11600 109.03700 173.16400 1.000 64.86000  ? 700 GLU A N     1 
ATOM   2846  C  CA    . GLU A 1 455 ? 131.79200 109.44900 173.61500 1.000 64.86000  ? 700 GLU A CA    1 
ATOM   2847  C  C     . GLU A 1 455 ? 130.71500 108.55300 173.02200 1.000 64.86000  ? 700 GLU A C     1 
ATOM   2848  O  O     . GLU A 1 455 ? 129.78900 108.12600 173.72400 1.000 64.86000  ? 700 GLU A O     1 
ATOM   2849  C  CB    . GLU A 1 455 ? 131.53700 110.90500 173.23000 1.000 64.86000  ? 700 GLU A CB    1 
ATOM   2850  C  CG    . GLU A 1 455 ? 132.43100 111.90300 173.92900 1.000 64.86000  ? 700 GLU A CG    1 
ATOM   2851  C  CD    . GLU A 1 455 ? 132.16600 113.32100 173.47500 1.000 64.86000  ? 700 GLU A CD    1 
ATOM   2852  O  OE1   . GLU A 1 455 ? 131.37200 113.50200 172.53100 1.000 64.86000  ? 700 GLU A OE1   1 
ATOM   2853  O  OE2   . GLU A 1 455 ? 132.75000 114.25600 174.05900 1.000 64.86000  ? 700 GLU A OE2   1 
ATOM   2854  N  N     . VAL A 1 456 ? 130.83200 108.25000 171.72900 1.000 59.83000  ? 701 VAL A N     1 
ATOM   2855  C  CA    . VAL A 1 456 ? 129.84100 107.41100 171.06700 1.000 59.83000  ? 701 VAL A CA    1 
ATOM   2856  C  C     . VAL A 1 456 ? 129.85500 106.00800 171.65500 1.000 59.83000  ? 701 VAL A C     1 
ATOM   2857  O  O     . VAL A 1 456 ? 128.80200 105.39100 171.84500 1.000 59.83000  ? 701 VAL A O     1 
ATOM   2858  C  CB    . VAL A 1 456 ? 130.09100 107.39500 169.54900 1.000 59.83000  ? 701 VAL A CB    1 
ATOM   2859  C  CG1   . VAL A 1 456 ? 129.14700 106.43600 168.87300 1.000 59.83000  ? 701 VAL A CG1   1 
ATOM   2860  C  CG2   . VAL A 1 456 ? 129.93100 108.78900 168.97600 1.000 59.83000  ? 701 VAL A CG2   1 
ATOM   2861  N  N     . HIS A 1 457 ? 131.04400 105.48400 171.95900 1.000 62.53000  ? 702 HIS A N     1 
ATOM   2862  C  CA    . HIS A 1 457 ? 131.11400 104.17200 172.59600 1.000 62.53000  ? 702 HIS A CA    1 
ATOM   2863  C  C     . HIS A 1 457 ? 130.46600 104.19300 173.97500 1.000 62.53000  ? 702 HIS A C     1 
ATOM   2864  O  O     . HIS A 1 457 ? 129.73300 103.26400 174.33800 1.000 62.53000  ? 702 HIS A O     1 
ATOM   2865  C  CB    . HIS A 1 457 ? 132.56300 103.69900 172.68900 1.000 62.53000  ? 702 HIS A CB    1 
ATOM   2866  C  CG    . HIS A 1 457 ? 133.17800 103.37800 171.36300 1.000 62.53000  ? 702 HIS A CG    1 
ATOM   2867  N  ND1   . HIS A 1 457 ? 132.85800 102.24100 170.65300 1.000 62.53000  ? 702 HIS A ND1   1 
ATOM   2868  C  CD2   . HIS A 1 457 ? 134.09800 104.03900 170.62200 1.000 62.53000  ? 702 HIS A CD2   1 
ATOM   2869  C  CE1   . HIS A 1 457 ? 133.55100 102.21800 169.52800 1.000 62.53000  ? 702 HIS A CE1   1 
ATOM   2870  N  NE2   . HIS A 1 457 ? 134.31100 103.29800 169.48500 1.000 62.53000  ? 702 HIS A NE2   1 
ATOM   2871  N  N     . ARG A 1 458 ? 130.73200 105.24100 174.76000 1.000 62.55000  ? 703 ARG A N     1 
ATOM   2872  C  CA    . ARG A 1 458 ? 130.07400 105.38200 176.05500 1.000 62.55000  ? 703 ARG A CA    1 
ATOM   2873  C  C     . ARG A 1 458 ? 128.56100 105.33900 175.90200 1.000 62.55000  ? 703 ARG A C     1 
ATOM   2874  O  O     . ARG A 1 458 ? 127.86800 104.64300 176.65100 1.000 62.55000  ? 703 ARG A O     1 
ATOM   2875  C  CB    . ARG A 1 458 ? 130.48700 106.69000 176.73200 1.000 62.55000  ? 703 ARG A CB    1 
ATOM   2876  C  CG    . ARG A 1 458 ? 131.94000 106.79700 177.14100 1.000 62.55000  ? 703 ARG A CG    1 
ATOM   2877  C  CD    . ARG A 1 458 ? 132.16000 108.10900 177.87800 1.000 62.55000  ? 703 ARG A CD    1 
ATOM   2878  N  NE    . ARG A 1 458 ? 133.55100 108.32300 178.25800 1.000 62.55000  ? 703 ARG A NE    1 
ATOM   2879  C  CZ    . ARG A 1 458 ? 134.42300 109.00700 177.52600 1.000 62.55000  ? 703 ARG A CZ    1 
ATOM   2880  N  NH1   . ARG A 1 458 ? 134.04500 109.54900 176.37700 1.000 62.55000  ? 703 ARG A NH1   1 
ATOM   2881  N  NH2   . ARG A 1 458 ? 135.67200 109.15600 177.94500 1.000 62.55000  ? 703 ARG A NH2   1 
ATOM   2882  N  N     . VAL A 1 459 ? 128.03000 106.08600 174.93200 1.000 57.24000  ? 704 VAL A N     1 
ATOM   2883  C  CA    . VAL A 1 459 ? 126.58000 106.17600 174.77400 1.000 57.24000  ? 704 VAL A CA    1 
ATOM   2884  C  C     . VAL A 1 459 ? 126.00200 104.84000 174.32400 1.000 57.24000  ? 704 VAL A C     1 
ATOM   2885  O  O     . VAL A 1 459 ? 124.95600 104.39800 174.82000 1.000 57.24000  ? 704 VAL A O     1 
ATOM   2886  C  CB    . VAL A 1 459 ? 126.22000 107.30100 173.78900 1.000 57.24000  ? 704 VAL A CB    1 
ATOM   2887  C  CG1   . VAL A 1 459 ? 124.71900 107.35900 173.58300 1.000 57.24000  ? 704 VAL A CG1   1 
ATOM   2888  C  CG2   . VAL A 1 459 ? 126.74700 108.62300 174.29200 1.000 57.24000  ? 704 VAL A CG2   1 
ATOM   2889  N  N     . VAL A 1 460 ? 126.66400 104.18300 173.37100 1.000 60.69000  ? 705 VAL A N     1 
ATOM   2890  C  CA    . VAL A 1 460 ? 126.18700 102.88900 172.89400 1.000 60.69000  ? 705 VAL A CA    1 
ATOM   2891  C  C     . VAL A 1 460 ? 126.16600 101.87700 174.03100 1.000 60.69000  ? 705 VAL A C     1 
ATOM   2892  O  O     . VAL A 1 460 ? 125.22600 101.08500 174.15500 1.000 60.69000  ? 705 VAL A O     1 
ATOM   2893  C  CB    . VAL A 1 460 ? 127.04300 102.39900 171.71300 1.000 60.69000  ? 705 VAL A CB    1 
ATOM   2894  C  CG1   . VAL A 1 460 ? 126.66800 100.97800 171.34600 1.000 60.69000  ? 705 VAL A CG1   1 
ATOM   2895  C  CG2   . VAL A 1 460 ? 126.85400 103.31100 170.51900 1.000 60.69000  ? 705 VAL A CG2   1 
ATOM   2896  N  N     . GLU A 1 461 ? 127.18800 101.89400 174.88900 1.000 63.60000  ? 706 GLU A N     1 
ATOM   2897  C  CA    . GLU A 1 461 ? 127.18800 100.97000 176.01900 1.000 63.60000  ? 706 GLU A CA    1 
ATOM   2898  C  C     . GLU A 1 461 ? 126.10000 101.32700 177.02400 1.000 63.60000  ? 706 GLU A C     1 
ATOM   2899  O  O     . GLU A 1 461 ? 125.41900 100.43900 177.55300 1.000 63.60000  ? 706 GLU A O     1 
ATOM   2900  C  CB    . GLU A 1 461 ? 128.55900 100.95700 176.68900 1.000 63.60000  ? 706 GLU A CB    1 
ATOM   2901  C  CG    . GLU A 1 461 ? 129.65900 100.39700 175.81000 1.000 63.60000  ? 706 GLU A CG    1 
ATOM   2902  C  CD    . GLU A 1 461 ? 129.47000 98.92600  175.50700 1.000 63.60000  ? 706 GLU A CD    1 
ATOM   2903  O  OE1   . GLU A 1 461 ? 128.92300 98.20400  176.36700 1.000 63.60000  ? 706 GLU A OE1   1 
ATOM   2904  O  OE2   . GLU A 1 461 ? 129.86800 98.49100  174.40600 1.000 63.60000  ? 706 GLU A OE2   1 
ATOM   2905  N  N     . ALA A 1 462 ? 125.91600 102.62200 177.29200 1.000 60.54000  ? 707 ALA A N     1 
ATOM   2906  C  CA    . ALA A 1 462 ? 124.87600 103.05200 178.21900 1.000 60.54000  ? 707 ALA A CA    1 
ATOM   2907  C  C     . ALA A 1 462 ? 123.49200 102.65200 177.73400 1.000 60.54000  ? 707 ALA A C     1 
ATOM   2908  O  O     . ALA A 1 462 ? 122.58900 102.43400 178.54900 1.000 60.54000  ? 707 ALA A O     1 
ATOM   2909  C  CB    . ALA A 1 462 ? 124.95200 104.56400 178.42500 1.000 60.54000  ? 707 ALA A CB    1 
ATOM   2910  N  N     . TRP A 1 463 ? 123.30000 102.55500 176.41900 1.000 58.17000  ? 708 TRP A N     1 
ATOM   2911  C  CA    . TRP A 1 463 ? 122.01700 102.06900 175.91900 1.000 58.17000  ? 708 TRP A CA    1 
ATOM   2912  C  C     . TRP A 1 463 ? 121.93600 100.54800 175.92400 1.000 58.17000  ? 708 TRP A C     1 
ATOM   2913  O  O     . TRP A 1 463 ? 120.89100 99.98600  176.27100 1.000 58.17000  ? 708 TRP A O     1 
ATOM   2914  C  CB    . TRP A 1 463 ? 121.74100 102.61100 174.51900 1.000 58.17000  ? 708 TRP A CB    1 
ATOM   2915  C  CG    . TRP A 1 463 ? 121.22500 103.99800 174.54300 1.000 58.17000  ? 708 TRP A CG    1 
ATOM   2916  C  CD1   . TRP A 1 463 ? 121.91800 105.14200 174.29000 1.000 58.17000  ? 708 TRP A CD1   1 
ATOM   2917  C  CD2   . TRP A 1 463 ? 119.89400 104.39600 174.87400 1.000 58.17000  ? 708 TRP A CD2   1 
ATOM   2918  N  NE1   . TRP A 1 463 ? 121.09100 106.23100 174.42600 1.000 58.17000  ? 708 TRP A NE1   1 
ATOM   2919  C  CE2   . TRP A 1 463 ? 119.84300 105.79700 174.78600 1.000 58.17000  ? 708 TRP A CE2   1 
ATOM   2920  C  CE3   . TRP A 1 463 ? 118.73600 103.70000 175.22700 1.000 58.17000  ? 708 TRP A CE3   1 
ATOM   2921  C  CZ2   . TRP A 1 463 ? 118.68100 106.51600 175.03900 1.000 58.17000  ? 708 TRP A CZ2   1 
ATOM   2922  C  CZ3   . TRP A 1 463 ? 117.58500 104.41500 175.47900 1.000 58.17000  ? 708 TRP A CZ3   1 
ATOM   2923  C  CH2   . TRP A 1 463 ? 117.56500 105.80800 175.38300 1.000 58.17000  ? 708 TRP A CH2   1 
ATOM   2924  N  N     . LYS A 1 464 ? 123.01400 99.86400  175.54100 1.000 62.24000  ? 709 LYS A N     1 
ATOM   2925  C  CA    . LYS A 1 464 ? 123.00900 98.40700  175.57500 1.000 62.24000  ? 709 LYS A CA    1 
ATOM   2926  C  C     . LYS A 1 464 ? 122.83200 97.87000  176.98800 1.000 62.24000  ? 709 LYS A C     1 
ATOM   2927  O  O     . LYS A 1 464 ? 122.42900 96.71400  177.15500 1.000 62.24000  ? 709 LYS A O     1 
ATOM   2928  C  CB    . LYS A 1 464 ? 124.29600 97.86700  174.95200 1.000 62.24000  ? 709 LYS A CB    1 
ATOM   2929  C  CG    . LYS A 1 464 ? 124.37100 98.08900  173.45200 1.000 62.24000  ? 709 LYS A CG    1 
ATOM   2930  C  CD    . LYS A 1 464 ? 125.73400 97.73400  172.89200 1.000 62.24000  ? 709 LYS A CD    1 
ATOM   2931  C  CE    . LYS A 1 464 ? 125.96200 96.23800  172.87500 1.000 62.24000  ? 709 LYS A CE    1 
ATOM   2932  N  NZ    . LYS A 1 464 ? 127.25100 95.91100  172.21000 1.000 62.24000  ? 709 LYS A NZ    1 
ATOM   2933  N  N     . LEU A 1 465 ? 123.11600 98.68100  178.00700 1.000 64.57000  ? 710 LEU A N     1 
ATOM   2934  C  CA    . LEU A 1 465 ? 122.81700 98.29700  179.38000 1.000 64.57000  ? 710 LEU A CA    1 
ATOM   2935  C  C     . LEU A 1 465 ? 121.37000 98.56600  179.76900 1.000 64.57000  ? 710 LEU A C     1 
ATOM   2936  O  O     . LEU A 1 465 ? 120.97800 98.23000  180.89100 1.000 64.57000  ? 710 LEU A O     1 
ATOM   2937  C  CB    . LEU A 1 465 ? 123.74400 99.02900  180.35300 1.000 64.57000  ? 710 LEU A CB    1 
ATOM   2938  C  CG    . LEU A 1 465 ? 125.22800 98.66900  180.29900 1.000 64.57000  ? 710 LEU A CG    1 
ATOM   2939  C  CD1   . LEU A 1 465 ? 126.02400 99.56500  181.23000 1.000 64.57000  ? 710 LEU A CD1   1 
ATOM   2940  C  CD2   . LEU A 1 465 ? 125.44000 97.20500  180.64700 1.000 64.57000  ? 710 LEU A CD2   1 
ATOM   2941  N  N     . ARG A 1 466 ? 120.57000 99.15700  178.88100 1.000 63.31000  ? 711 ARG A N     1 
ATOM   2942  C  CA    . ARG A 1 466 ? 119.19600 99.52700  179.20100 1.000 63.31000  ? 711 ARG A CA    1 
ATOM   2943  C  C     . ARG A 1 466 ? 118.16400 98.84400  178.31600 1.000 63.31000  ? 711 ARG A C     1 
ATOM   2944  O  O     . ARG A 1 466 ? 116.97400 99.16500  178.41600 1.000 63.31000  ? 711 ARG A O     1 
ATOM   2945  C  CB    . ARG A 1 466 ? 119.01500 101.04300 179.10600 1.000 63.31000  ? 711 ARG A CB    1 
ATOM   2946  C  CG    . ARG A 1 466 ? 119.71700 101.82300 180.19000 1.000 63.31000  ? 711 ARG A CG    1 
ATOM   2947  C  CD    . ARG A 1 466 ? 119.44300 103.30000 180.02600 1.000 63.31000  ? 711 ARG A CD    1 
ATOM   2948  N  NE    . ARG A 1 466 ? 120.04000 104.09500 181.09200 1.000 63.31000  ? 711 ARG A NE    1 
ATOM   2949  C  CZ    . ARG A 1 466 ? 121.26000 104.61500 181.03600 1.000 63.31000  ? 711 ARG A CZ    1 
ATOM   2950  N  NH1   . ARG A 1 466 ? 122.01300 104.42300 179.96300 1.000 63.31000  ? 711 ARG A NH1   1 
ATOM   2951  N  NH2   . ARG A 1 466 ? 121.72600 105.32700 182.05200 1.000 63.31000  ? 711 ARG A NH2   1 
ATOM   2952  N  N     . GLY A 1 467 ? 118.57200 97.92400  177.45300 1.000 68.04000  ? 712 GLY A N     1 
ATOM   2953  C  CA    . GLY A 1 467 ? 117.61500 97.27900  176.57500 1.000 68.04000  ? 712 GLY A CA    1 
ATOM   2954  C  C     . GLY A 1 467 ? 118.29600 96.26400  175.68700 1.000 68.04000  ? 712 GLY A C     1 
ATOM   2955  O  O     . GLY A 1 467 ? 119.52200 96.25200  175.53400 1.000 68.04000  ? 712 GLY A O     1 
ATOM   2956  N  N     . ALA A 1 468 ? 117.46800 95.40800  175.09400 1.000 78.45000  ? 713 ALA A N     1 
ATOM   2957  C  CA    . ALA A 1 468 ? 117.89300 94.33700  174.21500 1.000 78.45000  ? 713 ALA A CA    1 
ATOM   2958  C  C     . ALA A 1 468 ? 117.52200 94.65300  172.77000 1.000 78.45000  ? 713 ALA A C     1 
ATOM   2959  O  O     . ALA A 1 468 ? 116.53700 95.35400  172.51600 1.000 78.45000  ? 713 ALA A O     1 
ATOM   2960  C  CB    . ALA A 1 468 ? 117.25400 93.00400  174.62300 1.000 78.45000  ? 713 ALA A CB    1 
ATOM   2961  N  N     . PRO A 1 469 ? 118.30000 94.16000  171.80000 1.000 80.34000  ? 714 PRO A N     1 
ATOM   2962  C  CA    . PRO A 1 469 ? 117.99300 94.43900  170.39000 1.000 80.34000  ? 714 PRO A CA    1 
ATOM   2963  C  C     . PRO A 1 469 ? 116.61300 93.95700  169.97200 1.000 80.34000  ? 714 PRO A C     1 
ATOM   2964  O  O     . PRO A 1 469 ? 116.34800 92.75200  169.94100 1.000 80.34000  ? 714 PRO A O     1 
ATOM   2965  C  CB    . PRO A 1 469 ? 119.09700 93.68500  169.63900 1.000 80.34000  ? 714 PRO A CB    1 
ATOM   2966  C  CG    . PRO A 1 469 ? 120.21300 93.57900  170.62000 1.000 80.34000  ? 714 PRO A CG    1 
ATOM   2967  C  CD    . PRO A 1 469 ? 119.55700 93.40800  171.95200 1.000 80.34000  ? 714 PRO A CD    1 
ATOM   2968  N  N     . ASP A 1 470 ? 115.72900 94.89700  169.64500 1.000 76.47000  ? 715 ASP A N     1 
ATOM   2969  C  CA    . ASP A 1 470 ? 114.39000 94.57000  169.16100 1.000 76.47000  ? 715 ASP A CA    1 
ATOM   2970  C  C     . ASP A 1 470 ? 114.38200 94.61000  167.63300 1.000 76.47000  ? 715 ASP A C     1 
ATOM   2971  O  O     . ASP A 1 470 ? 113.71400 95.42700  166.99700 1.000 76.47000  ? 715 ASP A O     1 
ATOM   2972  C  CB    . ASP A 1 470 ? 113.36500 95.52900  169.76200 1.000 76.47000  ? 715 ASP A CB    1 
ATOM   2973  C  CG    . ASP A 1 470 ? 111.93300 95.09800  169.49800 1.000 76.47000  ? 715 ASP A CG    1 
ATOM   2974  O  OD1   . ASP A 1 470 ? 111.72800 94.06600  168.82600 1.000 76.47000  ? 715 ASP A OD1   1 
ATOM   2975  O  OD2   . ASP A 1 470 ? 111.00800 95.79500  169.96500 1.000 76.47000  ? 715 ASP A OD2   1 
ATOM   2976  N  N     . TYR A 1 471 ? 115.14900 93.69500  167.04800 1.000 72.88000  ? 716 TYR A N     1 
ATOM   2977  C  CA    . TYR A 1 471 ? 115.31800 93.64100  165.59700 1.000 72.88000  ? 716 TYR A CA    1 
ATOM   2978  C  C     . TYR A 1 471 ? 114.11400 92.93700  164.98800 1.000 72.88000  ? 716 TYR A C     1 
ATOM   2979  O  O     . TYR A 1 471 ? 113.99100 91.71300  165.06400 1.000 72.88000  ? 716 TYR A O     1 
ATOM   2980  C  CB    . TYR A 1 471 ? 116.61100 92.92600  165.22600 1.000 72.88000  ? 716 TYR A CB    1 
ATOM   2981  C  CG    . TYR A 1 471 ? 117.86900 93.66100  165.62200 1.000 72.88000  ? 716 TYR A CG    1 
ATOM   2982  C  CD1   . TYR A 1 471 ? 117.82800 94.98900  166.02000 1.000 72.88000  ? 716 TYR A CD1   1 
ATOM   2983  C  CD2   . TYR A 1 471 ? 119.10100 93.02600  165.59000 1.000 72.88000  ? 716 TYR A CD2   1 
ATOM   2984  C  CE1   . TYR A 1 471 ? 118.97600 95.65900  166.38300 1.000 72.88000  ? 716 TYR A CE1   1 
ATOM   2985  C  CE2   . TYR A 1 471 ? 120.25400 93.68900  165.94900 1.000 72.88000  ? 716 TYR A CE2   1 
ATOM   2986  C  CZ    . TYR A 1 471 ? 120.18600 95.00500  166.34400 1.000 72.88000  ? 716 TYR A CZ    1 
ATOM   2987  O  OH    . TYR A 1 471 ? 121.33600 95.66800  166.70200 1.000 72.88000  ? 716 TYR A OH    1 
ATOM   2988  N  N     . ILE A 1 472 ? 113.21200 93.71600  164.38500 1.000 83.60000  ? 717 ILE A N     1 
ATOM   2989  C  CA    . ILE A 1 472 ? 112.10100 93.12600  163.65200 1.000 83.60000  ? 717 ILE A CA    1 
ATOM   2990  C  C     . ILE A 1 472 ? 112.65300 92.31000  162.49100 1.000 83.60000  ? 717 ILE A C     1 
ATOM   2991  O  O     . ILE A 1 472 ? 113.65200 92.68300  161.86400 1.000 83.60000  ? 717 ILE A O     1 
ATOM   2992  C  CB    . ILE A 1 472 ? 111.13400 94.22200  163.17300 1.000 83.60000  ? 717 ILE A CB    1 
ATOM   2993  C  CG1   . ILE A 1 472 ? 110.52900 94.95300  164.37400 1.000 83.60000  ? 717 ILE A CG1   1 
ATOM   2994  C  CG2   . ILE A 1 472 ? 110.02900 93.63700  162.30600 1.000 83.60000  ? 717 ILE A CG2   1 
ATOM   2995  C  CD1   . ILE A 1 472 ? 109.74900 96.19400  164.00600 1.000 83.60000  ? 717 ILE A CD1   1 
ATOM   2996  N  N     . GLU A 1 473 ? 112.01800 91.17200  162.21300 1.000 93.42000  ? 718 GLU A N     1 
ATOM   2997  C  CA    . GLU A 1 473 ? 112.50200 90.27100  161.17600 1.000 93.42000  ? 718 GLU A CA    1 
ATOM   2998  C  C     . GLU A 1 473 ? 111.88600 90.54000  159.80900 1.000 93.42000  ? 718 GLU A C     1 
ATOM   2999  O  O     . GLU A 1 473 ? 112.49200 90.17500  158.79400 1.000 93.42000  ? 718 GLU A O     1 
ATOM   3000  C  CB    . GLU A 1 473 ? 112.23900 88.81300  161.57900 1.000 93.42000  ? 718 GLU A CB    1 
ATOM   3001  C  CG    . GLU A 1 473 ? 112.81600 87.77400  160.62600 1.000 93.42000  ? 718 GLU A CG    1 
ATOM   3002  C  CD    . GLU A 1 473 ? 114.33300 87.80300  160.57600 1.000 93.42000  ? 718 GLU A CD    1 
ATOM   3003  O  OE1   . GLU A 1 473 ? 114.95700 88.22100  161.57400 1.000 93.42000  ? 718 GLU A OE1   1 
ATOM   3004  O  OE2   . GLU A 1 473 ? 114.90200 87.40900  159.53600 1.000 93.42000  ? 718 GLU A OE2   1 
ATOM   3005  N  N     . ASP A 1 474 ? 110.71100 91.17600  159.75900 1.000 86.92000  ? 719 ASP A N     1 
ATOM   3006  C  CA    . ASP A 1 474 ? 110.08600 91.49500  158.47800 1.000 86.92000  ? 719 ASP A CA    1 
ATOM   3007  C  C     . ASP A 1 474 ? 111.02600 92.29800  157.58900 1.000 86.92000  ? 719 ASP A C     1 
ATOM   3008  O  O     . ASP A 1 474 ? 111.09800 92.06700  156.37600 1.000 86.92000  ? 719 ASP A O     1 
ATOM   3009  C  CB    . ASP A 1 474 ? 108.78500 92.26300  158.70900 1.000 86.92000  ? 719 ASP A CB    1 
ATOM   3010  C  CG    . ASP A 1 474 ? 107.72300 91.41700  159.37600 1.000 86.92000  ? 719 ASP A CG    1 
ATOM   3011  O  OD1   . ASP A 1 474 ? 107.73600 90.18300  159.18200 1.000 86.92000  ? 719 ASP A OD1   1 
ATOM   3012  O  OD2   . ASP A 1 474 ? 106.87500 91.98500  160.09500 1.000 86.92000  ? 719 ASP A OD2   1 
ATOM   3013  N  N     . ILE A 1 475 ? 111.75200 93.24300  158.17400 1.000 76.43000  ? 720 ILE A N     1 
ATOM   3014  C  CA    . ILE A 1 475 ? 112.77300 93.98500  157.44600 1.000 76.43000  ? 720 ILE A CA    1 
ATOM   3015  C  C     . ILE A 1 475 ? 113.92500 93.04500  157.11200 1.000 76.43000  ? 720 ILE A C     1 
ATOM   3016  O  O     . ILE A 1 475 ? 114.43900 92.33500  157.98600 1.000 76.43000  ? 720 ILE A O     1 
ATOM   3017  C  CB    . ILE A 1 475 ? 113.24100 95.20600  158.25800 1.000 76.43000  ? 720 ILE A CB    1 
ATOM   3018  C  CG1   . ILE A 1 475 ? 114.23600 96.04000  157.45500 1.000 76.43000  ? 720 ILE A CG1   1 
ATOM   3019  C  CG2   . ILE A 1 475 ? 113.80900 94.80400  159.60700 1.000 76.43000  ? 720 ILE A CG2   1 
ATOM   3020  C  CD1   . ILE A 1 475 ? 114.48800 97.40800  158.04200 1.000 76.43000  ? 720 ILE A CD1   1 
ATOM   3021  N  N     . LEU A 1 476 ? 114.31300 93.02800  155.83800 1.000 74.62000  ? 721 LEU A N     1 
ATOM   3022  C  CA    . LEU A 1 476 ? 115.30800 92.10200  155.28300 1.000 74.62000  ? 721 LEU A CA    1 
ATOM   3023  C  C     . LEU A 1 476 ? 115.18700 90.68900  155.85100 1.000 74.62000  ? 721 LEU A C     1 
ATOM   3024  O  O     . LEU A 1 476 ? 114.09900 90.11400  155.88100 1.000 74.62000  ? 721 LEU A O     1 
ATOM   3025  C  CB    . LEU A 1 476 ? 116.73100 92.64300  155.49400 1.000 74.62000  ? 721 LEU A CB    1 
ATOM   3026  C  CG    . LEU A 1 476 ? 117.34100 92.86400  156.88100 1.000 74.62000  ? 721 LEU A CG    1 
ATOM   3027  C  CD1   . LEU A 1 476 ? 117.99900 91.59700  157.41000 1.000 74.62000  ? 721 LEU A CD1   1 
ATOM   3028  C  CD2   . LEU A 1 476 ? 118.33700 94.01100  156.84300 1.000 74.62000  ? 721 LEU A CD2   1 
ATOM   3029  N  N     . THR B 1 69  ? 69.82500  123.45000 150.04600 1.000 72.16000  ? 314 THR B N     1 
ATOM   3030  C  CA    . THR B 1 69  ? 70.63400  123.57400 148.84000 1.000 72.16000  ? 314 THR B CA    1 
ATOM   3031  C  C     . THR B 1 69  ? 72.11100  123.74100 149.18100 1.000 72.16000  ? 314 THR B C     1 
ATOM   3032  O  O     . THR B 1 69  ? 72.69800  122.90500 149.86300 1.000 72.16000  ? 314 THR B O     1 
ATOM   3033  C  CB    . THR B 1 69  ? 70.18100  124.76300 147.97400 1.000 72.16000  ? 314 THR B CB    1 
ATOM   3034  O  OG1   . THR B 1 69  ? 70.30100  125.97800 148.72200 1.000 72.16000  ? 314 THR B OG1   1 
ATOM   3035  C  CG2   . THR B 1 69  ? 68.73800  124.58100 147.53500 1.000 72.16000  ? 314 THR B CG2   1 
ATOM   3036  N  N     . LEU B 1 70  ? 72.70400  124.82700 148.70400 1.000 65.75000  ? 315 LEU B N     1 
ATOM   3037  C  CA    . LEU B 1 70  ? 74.12800  125.04300 148.90400 1.000 65.75000  ? 315 LEU B CA    1 
ATOM   3038  C  C     . LEU B 1 70  ? 74.41000  125.40600 150.36200 1.000 65.75000  ? 315 LEU B C     1 
ATOM   3039  O  O     . LEU B 1 70  ? 73.66400  126.18400 150.96300 1.000 65.75000  ? 315 LEU B O     1 
ATOM   3040  C  CB    . LEU B 1 70  ? 74.63300  126.14500 147.97500 1.000 65.75000  ? 315 LEU B CB    1 
ATOM   3041  C  CG    . LEU B 1 70  ? 74.56700  125.80500 146.48500 1.000 65.75000  ? 315 LEU B CG    1 
ATOM   3042  C  CD1   . LEU B 1 70  ? 74.95700  127.00500 145.63600 1.000 65.75000  ? 315 LEU B CD1   1 
ATOM   3043  C  CD2   . LEU B 1 70  ? 75.45400  124.61200 146.17400 1.000 65.75000  ? 315 LEU B CD2   1 
ATOM   3044  N  N     . PRO B 1 71  ? 75.46600  124.85400 150.95400 1.000 66.67000  ? 316 PRO B N     1 
ATOM   3045  C  CA    . PRO B 1 71  ? 75.77000  125.12900 152.36200 1.000 66.67000  ? 316 PRO B CA    1 
ATOM   3046  C  C     . PRO B 1 71  ? 76.06700  126.60100 152.58000 1.000 66.67000  ? 316 PRO B C     1 
ATOM   3047  O  O     . PRO B 1 71  ? 76.49000  127.30400 151.65000 1.000 66.67000  ? 316 PRO B O     1 
ATOM   3048  C  CB    . PRO B 1 71  ? 77.01200  124.26500 152.62800 1.000 66.67000  ? 316 PRO B CB    1 
ATOM   3049  C  CG    . PRO B 1 71  ? 76.95100  123.19400 151.60000 1.000 66.67000  ? 316 PRO B CG    1 
ATOM   3050  C  CD    . PRO B 1 71  ? 76.38900  123.86600 150.38200 1.000 66.67000  ? 316 PRO B CD    1 
ATOM   3051  N  N     . PRO B 1 72  ? 75.86300  127.10300 153.79400 1.000 72.43000  ? 317 PRO B N     1 
ATOM   3052  C  CA    . PRO B 1 72  ? 76.14100  128.51700 154.06300 1.000 72.43000  ? 317 PRO B CA    1 
ATOM   3053  C  C     . PRO B 1 72  ? 77.63500  128.77900 154.16300 1.000 72.43000  ? 317 PRO B C     1 
ATOM   3054  O  O     . PRO B 1 72  ? 78.39900  127.95000 154.66300 1.000 72.43000  ? 317 PRO B O     1 
ATOM   3055  C  CB    . PRO B 1 72  ? 75.44800  128.76000 155.40800 1.000 72.43000  ? 317 PRO B CB    1 
ATOM   3056  C  CG    . PRO B 1 72  ? 75.48700  127.42300 156.07600 1.000 72.43000  ? 317 PRO B CG    1 
ATOM   3057  C  CD    . PRO B 1 72  ? 75.33600  126.40500 154.97900 1.000 72.43000  ? 317 PRO B CD    1 
ATOM   3058  N  N     . LEU B 1 73  ? 78.04800  129.95300 153.67900 1.000 73.96000  ? 318 LEU B N     1 
ATOM   3059  C  CA    . LEU B 1 73  ? 79.45200  130.34300 153.75100 1.000 73.96000  ? 318 LEU B CA    1 
ATOM   3060  C  C     . LEU B 1 73  ? 79.94100  130.48900 155.18600 1.000 73.96000  ? 318 LEU B C     1 
ATOM   3061  O  O     . LEU B 1 73  ? 81.15400  130.54900 155.41400 1.000 73.96000  ? 318 LEU B O     1 
ATOM   3062  C  CB    . LEU B 1 73  ? 79.67300  131.65400 152.99600 1.000 73.96000  ? 318 LEU B CB    1 
ATOM   3063  C  CG    . LEU B 1 73  ? 79.41700  131.61400 151.48800 1.000 73.96000  ? 318 LEU B CG    1 
ATOM   3064  C  CD1   . LEU B 1 73  ? 79.57000  132.99500 150.86400 1.000 73.96000  ? 318 LEU B CD1   1 
ATOM   3065  C  CD2   . LEU B 1 73  ? 80.34400  130.61300 150.82600 1.000 73.96000  ? 318 LEU B CD2   1 
ATOM   3066  N  N     . SER B 1 74  ? 79.02700  130.55000 156.15400 1.000 75.00000  ? 319 SER B N     1 
ATOM   3067  C  CA    . SER B 1 74  ? 79.38100  130.73000 157.55500 1.000 75.00000  ? 319 SER B CA    1 
ATOM   3068  C  C     . SER B 1 74  ? 79.69400  129.42100 158.26500 1.000 75.00000  ? 319 SER B C     1 
ATOM   3069  O  O     . SER B 1 74  ? 79.92900  129.43800 159.47700 1.000 75.00000  ? 319 SER B O     1 
ATOM   3070  C  CB    . SER B 1 74  ? 78.25000  131.45300 158.29200 1.000 75.00000  ? 319 SER B CB    1 
ATOM   3071  O  OG    . SER B 1 74  ? 78.08000  132.77100 157.79900 1.000 75.00000  ? 319 SER B OG    1 
ATOM   3072  N  N     . LEU B 1 75  ? 79.70100  128.29400 157.55200 1.000 71.76000  ? 320 LEU B N     1 
ATOM   3073  C  CA    . LEU B 1 75  ? 80.07500  127.03100 158.17400 1.000 71.76000  ? 320 LEU B CA    1 
ATOM   3074  C  C     . LEU B 1 75  ? 81.57700  126.93800 158.40800 1.000 71.76000  ? 320 LEU B C     1 
ATOM   3075  O  O     . LEU B 1 75  ? 82.02300  126.08800 159.18300 1.000 71.76000  ? 320 LEU B O     1 
ATOM   3076  C  CB    . LEU B 1 75  ? 79.59500  125.86300 157.31100 1.000 71.76000  ? 320 LEU B CB    1 
ATOM   3077  C  CG    . LEU B 1 75  ? 79.79300  124.44500 157.85000 1.000 71.76000  ? 320 LEU B CG    1 
ATOM   3078  C  CD1   . LEU B 1 75  ? 78.99400  124.23400 159.12600 1.000 71.76000  ? 320 LEU B CD1   1 
ATOM   3079  C  CD2   . LEU B 1 75  ? 79.40900  123.42600 156.79600 1.000 71.76000  ? 320 LEU B CD2   1 
ATOM   3080  N  N     . LEU B 1 76  ? 82.35600  127.81000 157.77700 1.000 71.83000  ? 321 LEU B N     1 
ATOM   3081  C  CA    . LEU B 1 76  ? 83.79800  127.84200 157.95700 1.000 71.83000  ? 321 LEU B CA    1 
ATOM   3082  C  C     . LEU B 1 76  ? 84.12300  128.53300 159.27800 1.000 71.83000  ? 321 LEU B C     1 
ATOM   3083  O  O     . LEU B 1 76  ? 83.24700  128.81200 160.10100 1.000 71.83000  ? 321 LEU B O     1 
ATOM   3084  C  CB    . LEU B 1 76  ? 84.45800  128.54600 156.78000 1.000 71.83000  ? 321 LEU B CB    1 
ATOM   3085  C  CG    . LEU B 1 76  ? 84.25900  127.90500 155.41000 1.000 71.83000  ? 321 LEU B CG    1 
ATOM   3086  C  CD1   . LEU B 1 76  ? 84.84400  128.79200 154.33800 1.000 71.83000  ? 321 LEU B CD1   1 
ATOM   3087  C  CD2   . LEU B 1 76  ? 84.89000  126.53200 155.36900 1.000 71.83000  ? 321 LEU B CD2   1 
ATOM   3088  N  N     . ASP B 1 77  ? 85.39900  128.81600 159.49900 1.000 78.53000  ? 322 ASP B N     1 
ATOM   3089  C  CA    . ASP B 1 77  ? 85.78500  129.59200 160.66700 1.000 78.53000  ? 322 ASP B CA    1 
ATOM   3090  C  C     . ASP B 1 77  ? 85.65600  131.08200 160.36900 1.000 78.53000  ? 322 ASP B C     1 
ATOM   3091  O  O     . ASP B 1 77  ? 85.90100  131.52000 159.24300 1.000 78.53000  ? 322 ASP B O     1 
ATOM   3092  C  CB    . ASP B 1 77  ? 87.21600  129.27600 161.08800 1.000 78.53000  ? 322 ASP B CB    1 
ATOM   3093  C  CG    . ASP B 1 77  ? 87.36800  127.86900 161.62900 1.000 78.53000  ? 322 ASP B CG    1 
ATOM   3094  O  OD1   . ASP B 1 77  ? 86.39900  127.34500 162.22200 1.000 78.53000  ? 322 ASP B OD1   1 
ATOM   3095  O  OD2   . ASP B 1 77  ? 88.45900  127.28800 161.47500 1.000 78.53000  ? 322 ASP B OD2   1 
ATOM   3096  N  N     . PRO B 1 78  ? 85.27500  131.87800 161.36300 1.000 89.83000  ? 323 PRO B N     1 
ATOM   3097  C  CA    . PRO B 1 78  ? 85.06900  133.31100 161.13000 1.000 89.83000  ? 323 PRO B CA    1 
ATOM   3098  C  C     . PRO B 1 78  ? 86.38500  134.02700 160.85700 1.000 89.83000  ? 323 PRO B C     1 
ATOM   3099  O  O     . PRO B 1 78  ? 87.47700  133.49800 161.07100 1.000 89.83000  ? 323 PRO B O     1 
ATOM   3100  C  CB    . PRO B 1 78  ? 84.42300  133.79100 162.43200 1.000 89.83000  ? 323 PRO B CB    1 
ATOM   3101  C  CG    . PRO B 1 78  ? 84.88500  132.81200 163.45900 1.000 89.83000  ? 323 PRO B CG    1 
ATOM   3102  C  CD    . PRO B 1 78  ? 84.99900  131.49200 162.75700 1.000 89.83000  ? 323 PRO B CD    1 
ATOM   3103  N  N     . ALA B 1 79  ? 86.25900  135.25800 160.36000 1.000 99.39000  ? 324 ALA B N     1 
ATOM   3104  C  CA    . ALA B 1 79  ? 87.42900  136.02900 159.96500 1.000 99.39000  ? 324 ALA B CA    1 
ATOM   3105  C  C     . ALA B 1 79  ? 88.35300  136.25200 161.15600 1.000 99.39000  ? 324 ALA B C     1 
ATOM   3106  O  O     . ALA B 1 79  ? 87.90600  136.56800 162.26100 1.000 99.39000  ? 324 ALA B O     1 
ATOM   3107  C  CB    . ALA B 1 79  ? 87.00500  137.37000 159.36500 1.000 99.39000  ? 324 ALA B CB    1 
ATOM   3108  N  N     . GLU B 1 80  ? 89.65000  136.07300 160.92400 1.000 105.61000 ? 325 GLU B N     1 
ATOM   3109  C  CA    . GLU B 1 80  ? 90.63500  136.19600 161.98600 1.000 105.61000 ? 325 GLU B CA    1 
ATOM   3110  C  C     . GLU B 1 80  ? 90.98900  137.66500 162.18500 1.000 105.61000 ? 325 GLU B C     1 
ATOM   3111  O  O     . GLU B 1 80  ? 91.34900  138.35900 161.22900 1.000 105.61000 ? 325 GLU B O     1 
ATOM   3112  C  CB    . GLU B 1 80  ? 91.87700  135.37000 161.64300 1.000 105.61000 ? 325 GLU B CB    1 
ATOM   3113  C  CG    . GLU B 1 80  ? 92.84500  135.13100 162.79600 1.000 105.61000 ? 325 GLU B CG    1 
ATOM   3114  C  CD    . GLU B 1 80  ? 93.88700  136.21900 162.92900 1.000 105.61000 ? 325 GLU B CD    1 
ATOM   3115  O  OE1   . GLU B 1 80  ? 94.22000  136.85100 161.90400 1.000 105.61000 ? 325 GLU B OE1   1 
ATOM   3116  O  OE2   . GLU B 1 80  ? 94.38100  136.43700 164.05500 1.000 105.61000 ? 325 GLU B OE2   1 
ATOM   3117  N  N     . VAL B 1 81  ? 90.86700  138.13900 163.42800 1.000 109.83000 ? 326 VAL B N     1 
ATOM   3118  C  CA    . VAL B 1 81  ? 91.12800  139.54300 163.72100 1.000 109.83000 ? 326 VAL B CA    1 
ATOM   3119  C  C     . VAL B 1 81  ? 92.57900  139.87400 163.40300 1.000 109.83000 ? 326 VAL B C     1 
ATOM   3120  O  O     . VAL B 1 81  ? 93.48200  139.04800 163.58500 1.000 109.83000 ? 326 VAL B O     1 
ATOM   3121  C  CB    . VAL B 1 81  ? 90.78400  139.85800 165.18600 1.000 109.83000 ? 326 VAL B CB    1 
ATOM   3122  C  CG1   . VAL B 1 81  ? 89.29800  139.65200 165.43300 1.000 109.83000 ? 326 VAL B CG1   1 
ATOM   3123  C  CG2   . VAL B 1 81  ? 91.60100  138.98600 166.12400 1.000 109.83000 ? 326 VAL B CG2   1 
ATOM   3124  N  N     . LYS B 1 82  ? 92.80800  141.09200 162.91600 1.000 110.17000 ? 327 LYS B N     1 
ATOM   3125  C  CA    . LYS B 1 82  ? 94.11800  141.44600 162.39100 1.000 110.17000 ? 327 LYS B CA    1 
ATOM   3126  C  C     . LYS B 1 82  ? 95.18200  141.37300 163.48000 1.000 110.17000 ? 327 LYS B C     1 
ATOM   3127  O  O     . LYS B 1 82  ? 94.92000  141.65900 164.65000 1.000 110.17000 ? 327 LYS B O     1 
ATOM   3128  C  CB    . LYS B 1 82  ? 94.07700  142.84200 161.77000 1.000 110.17000 ? 327 LYS B CB    1 
ATOM   3129  C  CG    . LYS B 1 82  ? 93.23000  142.90600 160.51000 1.000 110.17000 ? 327 LYS B CG    1 
ATOM   3130  C  CD    . LYS B 1 82  ? 93.20200  144.30000 159.91500 1.000 110.17000 ? 327 LYS B CD    1 
ATOM   3131  C  CE    . LYS B 1 82  ? 94.54800  144.65800 159.30700 1.000 110.17000 ? 327 LYS B CE    1 
ATOM   3132  N  NZ    . LYS B 1 82  ? 94.87800  143.81200 158.12600 1.000 110.17000 ? 327 LYS B NZ    1 
ATOM   3133  N  N     . GLN B 1 83  ? 96.39000  140.98000 163.08200 1.000 104.91000 ? 328 GLN B N     1 
ATOM   3134  C  CA    . GLN B 1 83  ? 97.46900  140.64500 164.00700 1.000 104.91000 ? 328 GLN B CA    1 
ATOM   3135  C  C     . GLN B 1 83  ? 98.54600  141.72100 163.93400 1.000 104.91000 ? 328 GLN B C     1 
ATOM   3136  O  O     . GLN B 1 83  ? 99.43700  141.66100 163.08100 1.000 104.91000 ? 328 GLN B O     1 
ATOM   3137  C  CB    . GLN B 1 83  ? 98.04200  139.26900 163.68200 1.000 104.91000 ? 328 GLN B CB    1 
ATOM   3138  C  CG    . GLN B 1 83  ? 99.13100  138.80700 164.63200 1.000 104.91000 ? 328 GLN B CG    1 
ATOM   3139  C  CD    . GLN B 1 83  ? 98.63600  138.66300 166.05600 1.000 104.91000 ? 328 GLN B CD    1 
ATOM   3140  O  OE1   . GLN B 1 83  ? 98.93400  139.49200 166.91600 1.000 104.91000 ? 328 GLN B OE1   1 
ATOM   3141  N  NE2   . GLN B 1 83  ? 97.87100  137.60800 166.31300 1.000 104.91000 ? 328 GLN B NE2   1 
ATOM   3142  N  N     . LYS B 1 84  ? 98.46300  142.69400 164.84100 1.000 105.10000 ? 329 LYS B N     1 
ATOM   3143  C  CA    . LYS B 1 84  ? 99.47200  143.74300 164.99300 1.000 105.10000 ? 329 LYS B CA    1 
ATOM   3144  C  C     . LYS B 1 84  ? 99.78500  144.41900 163.65900 1.000 105.10000 ? 329 LYS B C     1 
ATOM   3145  O  O     . LYS B 1 84  ? 100.94200 144.67200 163.31900 1.000 105.10000 ? 329 LYS B O     1 
ATOM   3146  C  CB    . LYS B 1 84  ? 100.74600 143.18600 165.62900 1.000 105.10000 ? 329 LYS B CB    1 
ATOM   3147  C  CG    . LYS B 1 84  ? 100.59500 142.74300 167.07100 1.000 105.10000 ? 329 LYS B CG    1 
ATOM   3148  C  CD    . LYS B 1 84  ? 101.91600 142.22300 167.61400 1.000 105.10000 ? 329 LYS B CD    1 
ATOM   3149  C  CE    . LYS B 1 84  ? 101.77900 141.74100 169.04800 1.000 105.10000 ? 329 LYS B CE    1 
ATOM   3150  N  NZ    . LYS B 1 84  ? 103.06800 141.21700 169.57900 1.000 105.10000 ? 329 LYS B NZ    1 
ATOM   3151  N  N     . SER B 1 85  ? 98.73300  144.70100 162.89400 1.000 104.26000 ? 330 SER B N     1 
ATOM   3152  C  CA    . SER B 1 85  ? 98.89900  145.39100 161.62200 1.000 104.26000 ? 330 SER B CA    1 
ATOM   3153  C  C     . SER B 1 85  ? 99.61000  146.72200 161.82900 1.000 104.26000 ? 330 SER B C     1 
ATOM   3154  O  O     . SER B 1 85  ? 99.37100  147.42400 162.81600 1.000 104.26000 ? 330 SER B O     1 
ATOM   3155  C  CB    . SER B 1 85  ? 97.54100  145.61400 160.95900 1.000 104.26000 ? 330 SER B CB    1 
ATOM   3156  O  OG    . SER B 1 85  ? 96.73900  146.49500 161.72700 1.000 104.26000 ? 330 SER B OG    1 
ATOM   3157  N  N     . TYR B 1 86  ? 100.50300 147.05700 160.89900 1.000 93.27000  ? 331 TYR B N     1 
ATOM   3158  C  CA    . TYR B 1 86  ? 101.28600 148.28100 161.01700 1.000 93.27000  ? 331 TYR B CA    1 
ATOM   3159  C  C     . TYR B 1 86  ? 100.37700 149.49800 161.09400 1.000 93.27000  ? 331 TYR B C     1 
ATOM   3160  O  O     . TYR B 1 86  ? 99.61600  149.77800 160.16400 1.000 93.27000  ? 331 TYR B O     1 
ATOM   3161  C  CB    . TYR B 1 86  ? 102.24600 148.41900 159.83700 1.000 93.27000  ? 331 TYR B CB    1 
ATOM   3162  C  CG    . TYR B 1 86  ? 103.44000 147.49600 159.88100 1.000 93.27000  ? 331 TYR B CG    1 
ATOM   3163  C  CD1   . TYR B 1 86  ? 103.76900 146.80600 161.03800 1.000 93.27000  ? 331 TYR B CD1   1 
ATOM   3164  C  CD2   . TYR B 1 86  ? 104.25400 147.33500 158.76900 1.000 93.27000  ? 331 TYR B CD2   1 
ATOM   3165  C  CE1   . TYR B 1 86  ? 104.86700 145.96700 161.08000 1.000 93.27000  ? 331 TYR B CE1   1 
ATOM   3166  C  CE2   . TYR B 1 86  ? 105.35200 146.50200 158.80100 1.000 93.27000  ? 331 TYR B CE2   1 
ATOM   3167  C  CZ    . TYR B 1 86  ? 105.65500 145.82000 159.95700 1.000 93.27000  ? 331 TYR B CZ    1 
ATOM   3168  O  OH    . TYR B 1 86  ? 106.75000 144.98900 159.98800 1.000 93.27000  ? 331 TYR B OH    1 
ATOM   3169  N  N     . SER B 1 87  ? 100.45400 150.21100 162.21100 1.000 97.28000  ? 332 SER B N     1 
ATOM   3170  C  CA    . SER B 1 87  ? 99.74100  151.46700 162.33900 1.000 97.28000  ? 332 SER B CA    1 
ATOM   3171  C  C     . SER B 1 87  ? 100.34200 152.49800 161.38500 1.000 97.28000  ? 332 SER B C     1 
ATOM   3172  O  O     . SER B 1 87  ? 101.53600 152.44800 161.07900 1.000 97.28000  ? 332 SER B O     1 
ATOM   3173  C  CB    . SER B 1 87  ? 99.80700  151.97100 163.77700 1.000 97.28000  ? 332 SER B CB    1 
ATOM   3174  O  OG    . SER B 1 87  ? 101.14000 152.27000 164.14700 1.000 97.28000  ? 332 SER B OG    1 
ATOM   3175  N  N     . PRO B 1 88  ? 99.52700  153.44200 160.89300 1.000 98.09000  ? 333 PRO B N     1 
ATOM   3176  C  CA    . PRO B 1 88  ? 100.00400 154.37500 159.85900 1.000 98.09000  ? 333 PRO B CA    1 
ATOM   3177  C  C     . PRO B 1 88  ? 101.25400 155.15300 160.23900 1.000 98.09000  ? 333 PRO B C     1 
ATOM   3178  O  O     . PRO B 1 88  ? 101.97900 155.62100 159.35600 1.000 98.09000  ? 333 PRO B O     1 
ATOM   3179  C  CB    . PRO B 1 88  ? 98.80800  155.31600 159.66600 1.000 98.09000  ? 333 PRO B CB    1 
ATOM   3180  C  CG    . PRO B 1 88  ? 97.63000  154.51100 160.07900 1.000 98.09000  ? 333 PRO B CG    1 
ATOM   3181  C  CD    . PRO B 1 88  ? 98.10700  153.65800 161.21500 1.000 98.09000  ? 333 PRO B CD    1 
ATOM   3182  N  N     . GLU B 1 89  ? 101.52800 155.29600 161.53800 1.000 97.71000  ? 334 GLU B N     1 
ATOM   3183  C  CA    . GLU B 1 89  ? 102.72300 156.02700 161.94700 1.000 97.71000  ? 334 GLU B CA    1 
ATOM   3184  C  C     . GLU B 1 89  ? 103.99000 155.29000 161.53000 1.000 97.71000  ? 334 GLU B C     1 
ATOM   3185  O  O     . GLU B 1 89  ? 104.93200 155.90600 161.01900 1.000 97.71000  ? 334 GLU B O     1 
ATOM   3186  C  CB    . GLU B 1 89  ? 102.70300 156.27500 163.45800 1.000 97.71000  ? 334 GLU B CB    1 
ATOM   3187  C  CG    . GLU B 1 89  ? 102.76400 155.02800 164.31800 1.000 97.71000  ? 334 GLU B CG    1 
ATOM   3188  C  CD    . GLU B 1 89  ? 102.68700 155.33900 165.79500 1.000 97.71000  ? 334 GLU B CD    1 
ATOM   3189  O  OE1   . GLU B 1 89  ? 102.55900 156.53000 166.14300 1.000 97.71000  ? 334 GLU B OE1   1 
ATOM   3190  O  OE2   . GLU B 1 89  ? 102.75600 154.39300 166.60800 1.000 97.71000  ? 334 GLU B OE2   1 
ATOM   3191  N  N     . SER B 1 90  ? 104.02300 153.96800 161.70600 1.000 93.91000  ? 335 SER B N     1 
ATOM   3192  C  CA    . SER B 1 90  ? 105.22100 153.21700 161.34600 1.000 93.91000  ? 335 SER B CA    1 
ATOM   3193  C  C     . SER B 1 90  ? 105.38500 153.13900 159.83500 1.000 93.91000  ? 335 SER B C     1 
ATOM   3194  O  O     . SER B 1 90  ? 106.50800 153.22000 159.32200 1.000 93.91000  ? 335 SER B O     1 
ATOM   3195  C  CB    . SER B 1 90  ? 105.17200 151.81800 161.95400 1.000 93.91000  ? 335 SER B CB    1 
ATOM   3196  O  OG    . SER B 1 90  ? 106.31900 151.07200 161.58600 1.000 93.91000  ? 335 SER B OG    1 
ATOM   3197  N  N     . LEU B 1 91  ? 104.27900 152.98700 159.10500 1.000 88.20000  ? 336 LEU B N     1 
ATOM   3198  C  CA    . LEU B 1 91  ? 104.35400 153.00100 157.64900 1.000 88.20000  ? 336 LEU B CA    1 
ATOM   3199  C  C     . LEU B 1 91  ? 104.85400 154.34600 157.14000 1.000 88.20000  ? 336 LEU B C     1 
ATOM   3200  O  O     . LEU B 1 91  ? 105.68200 154.40300 156.22400 1.000 88.20000  ? 336 LEU B O     1 
ATOM   3201  C  CB    . LEU B 1 91  ? 102.98800 152.67400 157.05000 1.000 88.20000  ? 336 LEU B CB    1 
ATOM   3202  C  CG    . LEU B 1 91  ? 102.45800 151.26700 157.32300 1.000 88.20000  ? 336 LEU B CG    1 
ATOM   3203  C  CD1   . LEU B 1 91  ? 101.04700 151.11700 156.78300 1.000 88.20000  ? 336 LEU B CD1   1 
ATOM   3204  C  CD2   . LEU B 1 91  ? 103.38000 150.21900 156.72600 1.000 88.20000  ? 336 LEU B CD2   1 
ATOM   3205  N  N     . GLU B 1 92  ? 104.37500 155.44000 157.73400 1.000 85.26000  ? 337 GLU B N     1 
ATOM   3206  C  CA    . GLU B 1 92  ? 104.82100 156.76400 157.31500 1.000 85.26000  ? 337 GLU B CA    1 
ATOM   3207  C  C     . GLU B 1 92  ? 106.29100 156.98000 157.65700 1.000 85.26000  ? 337 GLU B C     1 
ATOM   3208  O  O     . GLU B 1 92  ? 107.03700 157.58600 156.87600 1.000 85.26000  ? 337 GLU B O     1 
ATOM   3209  C  CB    . GLU B 1 92  ? 103.93600 157.82900 157.96400 1.000 85.26000  ? 337 GLU B CB    1 
ATOM   3210  C  CG    . GLU B 1 92  ? 104.08100 159.23300 157.39800 1.000 85.26000  ? 337 GLU B CG    1 
ATOM   3211  C  CD    . GLU B 1 92  ? 105.18900 160.02400 158.05900 1.000 85.26000  ? 337 GLU B CD    1 
ATOM   3212  O  OE1   . GLU B 1 92  ? 105.51700 159.73200 159.22700 1.000 85.26000  ? 337 GLU B OE1   1 
ATOM   3213  O  OE2   . GLU B 1 92  ? 105.71800 160.95300 157.41600 1.000 85.26000  ? 337 GLU B OE2   1 
ATOM   3214  N  N     . ALA B 1 93  ? 106.72900 156.47300 158.81200 1.000 80.67000  ? 338 ALA B N     1 
ATOM   3215  C  CA    . ALA B 1 93  ? 108.13800 156.56600 159.17800 1.000 80.67000  ? 338 ALA B CA    1 
ATOM   3216  C  C     . ALA B 1 93  ? 109.00900 155.80000 158.19100 1.000 80.67000  ? 338 ALA B C     1 
ATOM   3217  O  O     . ALA B 1 93  ? 110.05700 156.29400 157.75700 1.000 80.67000  ? 338 ALA B O     1 
ATOM   3218  C  CB    . ALA B 1 93  ? 108.34500 156.04900 160.60000 1.000 80.67000  ? 338 ALA B CB    1 
ATOM   3219  N  N     . MET B 1 94  ? 108.59200 154.58500 157.82700 1.000 78.45000  ? 339 MET B N     1 
ATOM   3220  C  CA    . MET B 1 94  ? 109.37000 153.80300 156.87100 1.000 78.45000  ? 339 MET B CA    1 
ATOM   3221  C  C     . MET B 1 94  ? 109.36500 154.44600 155.49200 1.000 78.45000  ? 339 MET B C     1 
ATOM   3222  O  O     . MET B 1 94  ? 110.36300 154.37500 154.77200 1.000 78.45000  ? 339 MET B O     1 
ATOM   3223  C  CB    . MET B 1 94  ? 108.84900 152.36900 156.79700 1.000 78.45000  ? 339 MET B CB    1 
ATOM   3224  C  CG    . MET B 1 94  ? 109.17800 151.53200 158.01600 1.000 78.45000  ? 339 MET B CG    1 
ATOM   3225  S  SD    . MET B 1 94  ? 108.59800 149.83600 157.86400 1.000 78.45000  ? 339 MET B SD    1 
ATOM   3226  C  CE    . MET B 1 94  ? 109.08800 149.17300 159.45200 1.000 78.45000  ? 339 MET B CE    1 
ATOM   3227  N  N     . SER B 1 95  ? 108.26600 155.09900 155.11400 1.000 73.36000  ? 340 SER B N     1 
ATOM   3228  C  CA    . SER B 1 95  ? 108.23500 155.79900 153.83300 1.000 73.36000  ? 340 SER B CA    1 
ATOM   3229  C  C     . SER B 1 95  ? 109.21300 156.96800 153.82600 1.000 73.36000  ? 340 SER B C     1 
ATOM   3230  O  O     . SER B 1 95  ? 109.97100 157.16000 152.86400 1.000 73.36000  ? 340 SER B O     1 
ATOM   3231  C  CB    . SER B 1 95  ? 106.81500 156.27700 153.53100 1.000 73.36000  ? 340 SER B CB    1 
ATOM   3232  O  OG    . SER B 1 95  ? 106.40000 157.26100 154.45900 1.000 73.36000  ? 340 SER B OG    1 
ATOM   3233  N  N     . ARG B 1 96  ? 109.20600 157.76800 154.89400 1.000 71.35000  ? 341 ARG B N     1 
ATOM   3234  C  CA    . ARG B 1 96  ? 110.15000 158.87700 154.98600 1.000 71.35000  ? 341 ARG B CA    1 
ATOM   3235  C  C     . ARG B 1 96  ? 111.58800 158.37700 154.96700 1.000 71.35000  ? 341 ARG B C     1 
ATOM   3236  O  O     . ARG B 1 96  ? 112.44500 158.95000 154.28400 1.000 71.35000  ? 341 ARG B O     1 
ATOM   3237  C  CB    . ARG B 1 96  ? 109.88500 159.69700 156.24700 1.000 71.35000  ? 341 ARG B CB    1 
ATOM   3238  C  CG    . ARG B 1 96  ? 108.54200 160.40600 156.27700 1.000 71.35000  ? 341 ARG B CG    1 
ATOM   3239  C  CD    . ARG B 1 96  ? 108.52100 161.65500 155.39800 1.000 71.35000  ? 341 ARG B CD    1 
ATOM   3240  N  NE    . ARG B 1 96  ? 108.32400 161.35600 153.98200 1.000 71.35000  ? 341 ARG B NE    1 
ATOM   3241  C  CZ    . ARG B 1 96  ? 107.14300 161.07800 153.43900 1.000 71.35000  ? 341 ARG B CZ    1 
ATOM   3242  N  NH1   . ARG B 1 96  ? 106.05200 161.06400 154.19200 1.000 71.35000  ? 341 ARG B NH1   1 
ATOM   3243  N  NH2   . ARG B 1 96  ? 107.05000 160.81600 152.14400 1.000 71.35000  ? 341 ARG B NH2   1 
ATOM   3244  N  N     . LEU B 1 97  ? 111.87300 157.31200 155.71900 1.000 64.73000  ? 342 LEU B N     1 
ATOM   3245  C  CA    . LEU B 1 97  ? 113.22600 156.77100 155.74400 1.000 64.73000  ? 342 LEU B CA    1 
ATOM   3246  C  C     . LEU B 1 97  ? 113.63000 156.22300 154.38300 1.000 64.73000  ? 342 LEU B C     1 
ATOM   3247  O  O     . LEU B 1 97  ? 114.78800 156.36100 153.97600 1.000 64.73000  ? 342 LEU B O     1 
ATOM   3248  C  CB    . LEU B 1 97  ? 113.33600 155.68700 156.81500 1.000 64.73000  ? 342 LEU B CB    1 
ATOM   3249  C  CG    . LEU B 1 97  ? 114.72900 155.10500 157.03000 1.000 64.73000  ? 342 LEU B CG    1 
ATOM   3250  C  CD1   . LEU B 1 97  ? 115.68700 156.20100 157.45000 1.000 64.73000  ? 342 LEU B CD1   1 
ATOM   3251  C  CD2   . LEU B 1 97  ? 114.67900 154.01900 158.08400 1.000 64.73000  ? 342 LEU B CD2   1 
ATOM   3252  N  N     . LEU B 1 98  ? 112.68800 155.61300 153.66300 1.000 60.99000  ? 343 LEU B N     1 
ATOM   3253  C  CA    . LEU B 1 98  ? 112.95300 155.16100 152.30400 1.000 60.99000  ? 343 LEU B CA    1 
ATOM   3254  C  C     . LEU B 1 98  ? 113.34100 156.32700 151.40700 1.000 60.99000  ? 343 LEU B C     1 
ATOM   3255  O  O     . LEU B 1 98  ? 114.32100 156.24700 150.65400 1.000 60.99000  ? 343 LEU B O     1 
ATOM   3256  C  CB    . LEU B 1 98  ? 111.72000 154.44600 151.75400 1.000 60.99000  ? 343 LEU B CB    1 
ATOM   3257  C  CG    . LEU B 1 98  ? 111.82000 153.85700 150.35200 1.000 60.99000  ? 343 LEU B CG    1 
ATOM   3258  C  CD1   . LEU B 1 98  ? 112.87300 152.77100 150.31800 1.000 60.99000  ? 343 LEU B CD1   1 
ATOM   3259  C  CD2   . LEU B 1 98  ? 110.47300 153.31300 149.92400 1.000 60.99000  ? 343 LEU B CD2   1 
ATOM   3260  N  N     . GLU B 1 99  ? 112.57700 157.42100 151.46900 1.000 63.98000  ? 344 GLU B N     1 
ATOM   3261  C  CA    . GLU B 1 99  ? 112.90200 158.58200 150.64600 1.000 63.98000  ? 344 GLU B CA    1 
ATOM   3262  C  C     . GLU B 1 99  ? 114.26500 159.15400 151.01100 1.000 63.98000  ? 344 GLU B C     1 
ATOM   3263  O  O     . GLU B 1 99  ? 115.04900 159.51900 150.12800 1.000 63.98000  ? 344 GLU B O     1 
ATOM   3264  C  CB    . GLU B 1 99  ? 111.82500 159.65600 150.78000 1.000 63.98000  ? 344 GLU B CB    1 
ATOM   3265  C  CG    . GLU B 1 99  ? 110.50200 159.28800 150.14500 1.000 63.98000  ? 344 GLU B CG    1 
ATOM   3266  C  CD    . GLU B 1 99  ? 109.47100 160.38700 150.28200 1.000 63.98000  ? 344 GLU B CD    1 
ATOM   3267  O  OE1   . GLU B 1 99  ? 109.75300 161.38800 150.97400 1.000 63.98000  ? 344 GLU B OE1   1 
ATOM   3268  O  OE2   . GLU B 1 99  ? 108.37500 160.24800 149.70000 1.000 63.98000  ? 344 GLU B OE2   1 
ATOM   3269  N  N     . ILE B 1 100 ? 114.57200 159.22600 152.30700 1.000 60.15000  ? 345 ILE B N     1 
ATOM   3270  C  CA    . ILE B 1 100 ? 115.86000 159.76900 152.73200 1.000 60.15000  ? 345 ILE B CA    1 
ATOM   3271  C  C     . ILE B 1 100 ? 117.00100 158.90300 152.21500 1.000 60.15000  ? 345 ILE B C     1 
ATOM   3272  O  O     . ILE B 1 100 ? 117.98900 159.40700 151.66700 1.000 60.15000  ? 345 ILE B O     1 
ATOM   3273  C  CB    . ILE B 1 100 ? 115.91000 159.91400 154.26300 1.000 60.15000  ? 345 ILE B CB    1 
ATOM   3274  C  CG1   . ILE B 1 100 ? 114.84600 160.90400 154.73600 1.000 60.15000  ? 345 ILE B CG1   1 
ATOM   3275  C  CG2   . ILE B 1 100 ? 117.29000 160.35600 154.71000 1.000 60.15000  ? 345 ILE B CG2   1 
ATOM   3276  C  CD1   . ILE B 1 100 ? 115.01100 162.29200 154.15700 1.000 60.15000  ? 345 ILE B CD1   1 
ATOM   3277  N  N     . LYS B 1 101 ? 116.88300 157.58300 152.37800 1.000 55.81000  ? 346 LYS B N     1 
ATOM   3278  C  CA    . LYS B 1 101 ? 117.96000 156.69800 151.95100 1.000 55.81000  ? 346 LYS B CA    1 
ATOM   3279  C  C     . LYS B 1 101 ? 118.13500 156.72300 150.43900 1.000 55.81000  ? 346 LYS B C     1 
ATOM   3280  O  O     . LYS B 1 101 ? 119.26600 156.70300 149.94200 1.000 55.81000  ? 346 LYS B O     1 
ATOM   3281  C  CB    . LYS B 1 101 ? 117.70700 155.27700 152.44900 1.000 55.81000  ? 346 LYS B CB    1 
ATOM   3282  C  CG    . LYS B 1 101 ? 117.66800 155.17700 153.96000 1.000 55.81000  ? 346 LYS B CG    1 
ATOM   3283  C  CD    . LYS B 1 101 ? 119.00800 155.54900 154.57000 1.000 55.81000  ? 346 LYS B CD    1 
ATOM   3284  C  CE    . LYS B 1 101 ? 118.98500 155.39700 156.08100 1.000 55.81000  ? 346 LYS B CE    1 
ATOM   3285  N  NZ    . LYS B 1 101 ? 120.27200 155.80800 156.70300 1.000 55.81000  ? 346 LYS B NZ    1 
ATOM   3286  N  N     . LEU B 1 102 ? 117.03400 156.78300 149.68500 1.000 56.85000  ? 347 LEU B N     1 
ATOM   3287  C  CA    . LEU B 1 102 ? 117.16300 156.88500 148.23600 1.000 56.85000  ? 347 LEU B CA    1 
ATOM   3288  C  C     . LEU B 1 102 ? 117.67300 158.24800 147.79600 1.000 56.85000  ? 347 LEU B C     1 
ATOM   3289  O  O     . LEU B 1 102 ? 118.21300 158.36500 146.69100 1.000 56.85000  ? 347 LEU B O     1 
ATOM   3290  C  CB    . LEU B 1 102 ? 115.83000 156.57700 147.55900 1.000 56.85000  ? 347 LEU B CB    1 
ATOM   3291  C  CG    . LEU B 1 102 ? 115.43100 155.10700 147.61500 1.000 56.85000  ? 347 LEU B CG    1 
ATOM   3292  C  CD1   . LEU B 1 102 ? 114.03700 154.90400 147.06900 1.000 56.85000  ? 347 LEU B CD1   1 
ATOM   3293  C  CD2   . LEU B 1 102 ? 116.43500 154.29500 146.82500 1.000 56.85000  ? 347 LEU B CD2   1 
ATOM   3294  N  N     . LYS B 1 103 ? 117.52200 159.27800 148.63000 1.000 58.83000  ? 348 LYS B N     1 
ATOM   3295  C  CA    . LYS B 1 103 ? 118.16800 160.54800 148.32900 1.000 58.83000  ? 348 LYS B CA    1 
ATOM   3296  C  C     . LYS B 1 103 ? 119.65600 160.49400 148.64000 1.000 58.83000  ? 348 LYS B C     1 
ATOM   3297  O  O     . LYS B 1 103 ? 120.45000 161.18000 147.98600 1.000 58.83000  ? 348 LYS B O     1 
ATOM   3298  C  CB    . LYS B 1 103 ? 117.50000 161.68000 149.10800 1.000 58.83000  ? 348 LYS B CB    1 
ATOM   3299  C  CG    . LYS B 1 103 ? 118.00300 163.06600 148.74000 1.000 58.83000  ? 348 LYS B CG    1 
ATOM   3300  C  CD    . LYS B 1 103 ? 117.28100 164.14300 149.52800 1.000 58.83000  ? 348 LYS B CD    1 
ATOM   3301  C  CE    . LYS B 1 103 ? 115.84300 164.28400 149.06600 1.000 58.83000  ? 348 LYS B CE    1 
ATOM   3302  N  NZ    . LYS B 1 103 ? 115.76400 164.80600 147.67700 1.000 58.83000  ? 348 LYS B NZ    1 
ATOM   3303  N  N     . GLU B 1 104 ? 120.05200 159.68800 149.62800 1.000 58.30000  ? 349 GLU B N     1 
ATOM   3304  C  CA    . GLU B 1 104 ? 121.47300 159.52500 149.92100 1.000 58.30000  ? 349 GLU B CA    1 
ATOM   3305  C  C     . GLU B 1 104 ? 122.21600 158.88400 148.75700 1.000 58.30000  ? 349 GLU B C     1 
ATOM   3306  O  O     . GLU B 1 104 ? 123.39000 159.19500 148.52500 1.000 58.30000  ? 349 GLU B O     1 
ATOM   3307  C  CB    . GLU B 1 104 ? 121.66400 158.69200 151.18700 1.000 58.30000  ? 349 GLU B CB    1 
ATOM   3308  C  CG    . GLU B 1 104 ? 121.20900 159.36900 152.46400 1.000 58.30000  ? 349 GLU B CG    1 
ATOM   3309  C  CD    . GLU B 1 104 ? 121.42600 158.49900 153.68600 1.000 58.30000  ? 349 GLU B CD    1 
ATOM   3310  O  OE1   . GLU B 1 104 ? 121.81000 157.32300 153.51900 1.000 58.30000  ? 349 GLU B OE1   1 
ATOM   3311  O  OE2   . GLU B 1 104 ? 121.21700 158.98900 154.81500 1.000 58.30000  ? 349 GLU B OE2   1 
ATOM   3312  N  N     . PHE B 1 105 ? 121.55900 157.99000 148.02000 1.000 55.06000  ? 350 PHE B N     1 
ATOM   3313  C  CA    . PHE B 1 105 ? 122.16000 157.33400 146.86800 1.000 55.06000  ? 350 PHE B CA    1 
ATOM   3314  C  C     . PHE B 1 105 ? 121.95000 158.10300 145.57100 1.000 55.06000  ? 350 PHE B C     1 
ATOM   3315  O  O     . PHE B 1 105 ? 122.18400 157.55000 144.49300 1.000 55.06000  ? 350 PHE B O     1 
ATOM   3316  C  CB    . PHE B 1 105 ? 121.60900 155.91500 146.71600 1.000 55.06000  ? 350 PHE B CB    1 
ATOM   3317  C  CG    . PHE B 1 105 ? 122.05000 154.97400 147.79700 1.000 55.06000  ? 350 PHE B CG    1 
ATOM   3318  C  CD1   . PHE B 1 105 ? 123.30500 154.39700 147.75900 1.000 55.06000  ? 350 PHE B CD1   1 
ATOM   3319  C  CD2   . PHE B 1 105 ? 121.20600 154.65900 148.84400 1.000 55.06000  ? 350 PHE B CD2   1 
ATOM   3320  C  CE1   . PHE B 1 105 ? 123.71100 153.53200 148.75100 1.000 55.06000  ? 350 PHE B CE1   1 
ATOM   3321  C  CE2   . PHE B 1 105 ? 121.60700 153.79500 149.83800 1.000 55.06000  ? 350 PHE B CE2   1 
ATOM   3322  C  CZ    . PHE B 1 105 ? 122.86100 153.23100 149.79100 1.000 55.06000  ? 350 PHE B CZ    1 
ATOM   3323  N  N     . GLY B 1 106 ? 121.51200 159.35600 145.64900 1.000 57.65000  ? 351 GLY B N     1 
ATOM   3324  C  CA    . GLY B 1 106 ? 121.38700 160.17600 144.45900 1.000 57.65000  ? 351 GLY B CA    1 
ATOM   3325  C  C     . GLY B 1 106 ? 120.23900 159.81200 143.54700 1.000 57.65000  ? 351 GLY B C     1 
ATOM   3326  O  O     . GLY B 1 106 ? 120.36100 159.95200 142.32600 1.000 57.65000  ? 351 GLY B O     1 
ATOM   3327  N  N     . VAL B 1 107 ? 119.12500 159.34200 144.10200 1.000 58.42000  ? 352 VAL B N     1 
ATOM   3328  C  CA    . VAL B 1 107 ? 117.93600 158.99800 143.32800 1.000 58.42000  ? 352 VAL B CA    1 
ATOM   3329  C  C     . VAL B 1 107 ? 116.75800 159.72300 143.96500 1.000 58.42000  ? 352 VAL B C     1 
ATOM   3330  O  O     . VAL B 1 107 ? 116.21200 159.26700 144.97600 1.000 58.42000  ? 352 VAL B O     1 
ATOM   3331  C  CB    . VAL B 1 107 ? 117.68700 157.48900 143.27200 1.000 58.42000  ? 352 VAL B CB    1 
ATOM   3332  C  CG1   . VAL B 1 107 ? 116.39300 157.20800 142.54500 1.000 58.42000  ? 352 VAL B CG1   1 
ATOM   3333  C  CG2   . VAL B 1 107 ? 118.84700 156.78600 142.58900 1.000 58.42000  ? 352 VAL B CG2   1 
ATOM   3334  N  N     . GLU B 1 108 ? 116.36200 160.85100 143.38400 1.000 58.31000  ? 353 GLU B N     1 
ATOM   3335  C  CA    . GLU B 1 108 ? 115.22200 161.60100 143.89000 1.000 58.31000  ? 353 GLU B CA    1 
ATOM   3336  C  C     . GLU B 1 108 ? 113.92800 160.83500 143.64700 1.000 58.31000  ? 353 GLU B C     1 
ATOM   3337  O  O     . GLU B 1 108 ? 113.59600 160.49100 142.51000 1.000 58.31000  ? 353 GLU B O     1 
ATOM   3338  C  CB    . GLU B 1 108 ? 115.14800 162.97500 143.22600 1.000 58.31000  ? 353 GLU B CB    1 
ATOM   3339  C  CG    . GLU B 1 108 ? 114.00900 163.83900 143.73300 1.000 58.31000  ? 353 GLU B CG    1 
ATOM   3340  C  CD    . GLU B 1 108 ? 113.97700 165.20500 143.08100 1.000 58.31000  ? 353 GLU B CD    1 
ATOM   3341  O  OE1   . GLU B 1 108 ? 114.84800 165.48000 142.23000 1.000 58.31000  ? 353 GLU B OE1   1 
ATOM   3342  O  OE2   . GLU B 1 108 ? 113.07500 166.00100 143.41500 1.000 58.31000  ? 353 GLU B OE2   1 
ATOM   3343  N  N     . VAL B 1 109 ? 113.19800 160.56700 144.72800 1.000 56.87000  ? 354 VAL B N     1 
ATOM   3344  C  CA    . VAL B 1 109 ? 111.94200 159.83000 144.65400 1.000 56.87000  ? 354 VAL B CA    1 
ATOM   3345  C  C     . VAL B 1 109 ? 110.90000 160.49200 145.54500 1.000 56.87000  ? 354 VAL B C     1 
ATOM   3346  O  O     . VAL B 1 109 ? 111.17700 161.50700 146.19300 1.000 56.87000  ? 354 VAL B O     1 
ATOM   3347  C  CB    . VAL B 1 109 ? 112.14400 158.35800 145.05100 1.000 56.87000  ? 354 VAL B CB    1 
ATOM   3348  C  CG1   . VAL B 1 109 ? 112.99100 157.63800 144.02100 1.000 56.87000  ? 354 VAL B CG1   1 
ATOM   3349  C  CG2   . VAL B 1 109 ? 112.80700 158.29000 146.40800 1.000 56.87000  ? 354 VAL B CG2   1 
ATOM   3350  N  N     . SER B 1 110 ? 109.69500 159.92300 145.58100 1.000 60.86000  ? 355 SER B N     1 
ATOM   3351  C  CA    . SER B 1 110 ? 108.62800 160.45000 146.43000 1.000 60.86000  ? 355 SER B CA    1 
ATOM   3352  C  C     . SER B 1 110 ? 107.59500 159.35300 146.64200 1.000 60.86000  ? 355 SER B C     1 
ATOM   3353  O  O     . SER B 1 110 ? 106.91400 158.95800 145.69100 1.000 60.86000  ? 355 SER B O     1 
ATOM   3354  C  CB    . SER B 1 110 ? 107.99600 161.68400 145.80200 1.000 60.86000  ? 355 SER B CB    1 
ATOM   3355  O  OG    . SER B 1 110 ? 106.94400 162.17600 146.61300 1.000 60.86000  ? 355 SER B OG    1 
ATOM   3356  N  N     . VAL B 1 111 ? 107.47200 158.87300 147.87800 1.000 62.75000  ? 356 VAL B N     1 
ATOM   3357  C  CA    . VAL B 1 111 ? 106.51000 157.82200 148.20000 1.000 62.75000  ? 356 VAL B CA    1 
ATOM   3358  C  C     . VAL B 1 111 ? 105.10300 158.38500 148.02600 1.000 62.75000  ? 356 VAL B C     1 
ATOM   3359  O  O     . VAL B 1 111 ? 104.71300 159.33000 148.71600 1.000 62.75000  ? 356 VAL B O     1 
ATOM   3360  C  CB    . VAL B 1 111 ? 106.71700 157.28300 149.61900 1.000 62.75000  ? 356 VAL B CB    1 
ATOM   3361  C  CG1   . VAL B 1 111 ? 105.62300 156.29200 149.96800 1.000 62.75000  ? 356 VAL B CG1   1 
ATOM   3362  C  CG2   . VAL B 1 111 ? 108.07700 156.63000 149.74100 1.000 62.75000  ? 356 VAL B CG2   1 
ATOM   3363  N  N     . ASP B 1 112 ? 104.33400 157.80200 147.10400 1.000 69.65000  ? 357 ASP B N     1 
ATOM   3364  C  CA    . ASP B 1 112 ? 102.95600 158.23500 146.89900 1.000 69.65000  ? 357 ASP B CA    1 
ATOM   3365  C  C     . ASP B 1 112 ? 102.01600 157.59900 147.91600 1.000 69.65000  ? 357 ASP B C     1 
ATOM   3366  O  O     . ASP B 1 112 ? 101.35400 158.30000 148.68900 1.000 69.65000  ? 357 ASP B O     1 
ATOM   3367  C  CB    . ASP B 1 112 ? 102.50800 157.90600 145.47300 1.000 69.65000  ? 357 ASP B CB    1 
ATOM   3368  C  CG    . ASP B 1 112 ? 103.19500 158.76800 144.43700 1.000 69.65000  ? 357 ASP B CG    1 
ATOM   3369  O  OD1   . ASP B 1 112 ? 103.56200 159.91400 144.76800 1.000 69.65000  ? 357 ASP B OD1   1 
ATOM   3370  O  OD2   . ASP B 1 112 ? 103.36600 158.30400 143.29200 1.000 69.65000  ? 357 ASP B OD2   1 
ATOM   3371  N  N     . SER B 1 113 ? 101.94700 156.27000 147.93300 1.000 71.67000  ? 358 SER B N     1 
ATOM   3372  C  CA    . SER B 1 113 ? 101.06400 155.55500 148.84000 1.000 71.67000  ? 358 SER B CA    1 
ATOM   3373  C  C     . SER B 1 113 ? 101.76100 154.29900 149.33900 1.000 71.67000  ? 358 SER B C     1 
ATOM   3374  O  O     . SER B 1 113 ? 102.81800 153.90700 148.84000 1.000 71.67000  ? 358 SER B O     1 
ATOM   3375  C  CB    . SER B 1 113 ? 99.73500  155.19400 148.16600 1.000 71.67000  ? 358 SER B CB    1 
ATOM   3376  O  OG    . SER B 1 113 ? 99.93200  154.24300 147.13600 1.000 71.67000  ? 358 SER B OG    1 
ATOM   3377  N  N     . VAL B 1 114 ? 101.15000 153.66800 150.33900 1.000 69.07000  ? 359 VAL B N     1 
ATOM   3378  C  CA    . VAL B 1 114 ? 101.68700 152.45700 150.94700 1.000 69.07000  ? 359 VAL B CA    1 
ATOM   3379  C  C     . VAL B 1 114 ? 100.58000 151.41900 151.05300 1.000 69.07000  ? 359 VAL B C     1 
ATOM   3380  O  O     . VAL B 1 114 ? 99.57600  151.63600 151.74000 1.000 69.07000  ? 359 VAL B O     1 
ATOM   3381  C  CB    . VAL B 1 114 ? 102.29600 152.74800 152.32900 1.000 69.07000  ? 359 VAL B CB    1 
ATOM   3382  C  CG1   . VAL B 1 114 ? 102.72900 151.45700 152.99300 1.000 69.07000  ? 359 VAL B CG1   1 
ATOM   3383  C  CG2   . VAL B 1 114 ? 103.46600 153.70500 152.20300 1.000 69.07000  ? 359 VAL B CG2   1 
ATOM   3384  N  N     . HIS B 1 115 ? 100.75200 150.28900 150.37300 1.000 67.53000  ? 360 HIS B N     1 
ATOM   3385  C  CA    . HIS B 1 115 ? 99.74400  149.23700 150.37500 1.000 67.53000  ? 360 HIS B CA    1 
ATOM   3386  C  C     . HIS B 1 115 ? 100.15900 148.12500 151.32800 1.000 67.53000  ? 360 HIS B C     1 
ATOM   3387  O  O     . HIS B 1 115 ? 101.07400 147.35800 151.00100 1.000 67.53000  ? 360 HIS B O     1 
ATOM   3388  C  CB    . HIS B 1 115 ? 99.55300  148.67500 148.97800 1.000 67.53000  ? 360 HIS B CB    1 
ATOM   3389  C  CG    . HIS B 1 115 ? 99.04300  149.67500 147.98900 1.000 67.53000  ? 360 HIS B CG    1 
ATOM   3390  N  ND1   . HIS B 1 115 ? 97.73900  150.11900 147.98400 1.000 67.53000  ? 360 HIS B ND1   1 
ATOM   3391  C  CD2   . HIS B 1 115 ? 99.66100  150.31200 146.96600 1.000 67.53000  ? 360 HIS B CD2   1 
ATOM   3392  C  CE1   . HIS B 1 115 ? 97.57600  150.99000 147.00500 1.000 67.53000  ? 360 HIS B CE1   1 
ATOM   3393  N  NE2   . HIS B 1 115 ? 98.72600  151.12400 146.37100 1.000 67.53000  ? 360 HIS B NE2   1 
ATOM   3394  N  N     . PRO B 1 116 ? 99.53600  147.99900 152.49300 1.000 66.58000  ? 361 PRO B N     1 
ATOM   3395  C  CA    . PRO B 1 116 ? 99.83800  146.88100 153.38700 1.000 66.58000  ? 361 PRO B CA    1 
ATOM   3396  C  C     . PRO B 1 116 ? 99.21300  145.59000 152.86700 1.000 66.58000  ? 361 PRO B C     1 
ATOM   3397  O  O     . PRO B 1 116 ? 98.25000  145.59800 152.09800 1.000 66.58000  ? 361 PRO B O     1 
ATOM   3398  C  CB    . PRO B 1 116 ? 99.19700  147.31100 154.71100 1.000 66.58000  ? 361 PRO B CB    1 
ATOM   3399  C  CG    . PRO B 1 116 ? 98.07500  148.19500 154.30000 1.000 66.58000  ? 361 PRO B CG    1 
ATOM   3400  C  CD    . PRO B 1 116 ? 98.54200  148.91900 153.07000 1.000 66.58000  ? 361 PRO B CD    1 
ATOM   3401  N  N     . GLY B 1 117 ? 99.78500  144.47300 153.30700 1.000 61.63000  ? 362 GLY B N     1 
ATOM   3402  C  CA    . GLY B 1 117 ? 99.35300  143.17600 152.84600 1.000 61.63000  ? 362 GLY B CA    1 
ATOM   3403  C  C     . GLY B 1 117 ? 99.56400  142.08600 153.87400 1.000 61.63000  ? 362 GLY B C     1 
ATOM   3404  O  O     . GLY B 1 117 ? 100.16300 142.30300 154.93200 1.000 61.63000  ? 362 GLY B O     1 
ATOM   3405  N  N     . PRO B 1 118 ? 99.06400  140.88500 153.58000 1.000 60.09000  ? 363 PRO B N     1 
ATOM   3406  C  CA    . PRO B 1 118 ? 99.21500  139.78000 154.53900 1.000 60.09000  ? 363 PRO B CA    1 
ATOM   3407  C  C     . PRO B 1 118 ? 100.65300 139.35200 154.74700 1.000 60.09000  ? 363 PRO B C     1 
ATOM   3408  O  O     . PRO B 1 118 ? 100.99500 138.87400 155.83500 1.000 60.09000  ? 363 PRO B O     1 
ATOM   3409  C  CB    . PRO B 1 118 ? 98.38300  138.65600 153.90700 1.000 60.09000  ? 363 PRO B CB    1 
ATOM   3410  C  CG    . PRO B 1 118 ? 97.42800  139.35400 152.99800 1.000 60.09000  ? 363 PRO B CG    1 
ATOM   3411  C  CD    . PRO B 1 118 ? 98.18900  140.52000 152.45500 1.000 60.09000  ? 363 PRO B CD    1 
ATOM   3412  N  N     . VAL B 1 119 ? 101.51100 139.50300 153.74200 1.000 60.47000  ? 364 VAL B N     1 
ATOM   3413  C  CA    . VAL B 1 119 ? 102.89400 139.05800 153.86400 1.000 60.47000  ? 364 VAL B CA    1 
ATOM   3414  C  C     . VAL B 1 119 ? 103.84500 140.21400 153.60100 1.000 60.47000  ? 364 VAL B C     1 
ATOM   3415  O  O     . VAL B 1 119 ? 104.74300 140.48700 154.40300 1.000 60.47000  ? 364 VAL B O     1 
ATOM   3416  C  CB    . VAL B 1 119 ? 103.19000 137.88700 152.91300 1.000 60.47000  ? 364 VAL B CB    1 
ATOM   3417  C  CG1   . VAL B 1 119 ? 104.66200 137.54000 152.96500 1.000 60.47000  ? 364 VAL B CG1   1 
ATOM   3418  C  CG2   . VAL B 1 119 ? 102.34400 136.68300 153.28300 1.000 60.47000  ? 364 VAL B CG2   1 
ATOM   3419  N  N     . ILE B 1 120 ? 103.66900 140.89300 152.47300 1.000 58.06000  ? 365 ILE B N     1 
ATOM   3420  C  CA    . ILE B 1 120 ? 104.55500 141.97600 152.07100 1.000 58.06000  ? 365 ILE B CA    1 
ATOM   3421  C  C     . ILE B 1 120 ? 103.75000 143.25900 151.92500 1.000 58.06000  ? 365 ILE B C     1 
ATOM   3422  O  O     . ILE B 1 120 ? 102.61900 143.24400 151.42800 1.000 58.06000  ? 365 ILE B O     1 
ATOM   3423  C  CB    . ILE B 1 120 ? 105.30400 141.63600 150.76700 1.000 58.06000  ? 365 ILE B CB    1 
ATOM   3424  C  CG1   . ILE B 1 120 ? 104.32000 141.37100 149.63200 1.000 58.06000  ? 365 ILE B CG1   1 
ATOM   3425  C  CG2   . ILE B 1 120 ? 106.20100 140.42900 150.96900 1.000 58.06000  ? 365 ILE B CG2   1 
ATOM   3426  C  CD1   . ILE B 1 120 ? 104.98300 141.21900 148.28800 1.000 58.06000  ? 365 ILE B CD1   1 
ATOM   3427  N  N     . THR B 1 121 ? 104.32700 144.36500 152.38500 1.000 62.78000  ? 366 THR B N     1 
ATOM   3428  C  CA    . THR B 1 121 ? 103.77700 145.69200 152.15400 1.000 62.78000  ? 366 THR B CA    1 
ATOM   3429  C  C     . THR B 1 121 ? 104.47700 146.30900 150.95400 1.000 62.78000  ? 366 THR B C     1 
ATOM   3430  O  O     . THR B 1 121 ? 105.69100 146.16600 150.78900 1.000 62.78000  ? 366 THR B O     1 
ATOM   3431  C  CB    . THR B 1 121 ? 103.94700 146.59700 153.37400 1.000 62.78000  ? 366 THR B CB    1 
ATOM   3432  O  OG1   . THR B 1 121 ? 105.34000 146.74500 153.67300 1.000 62.78000  ? 366 THR B OG1   1 
ATOM   3433  C  CG2   . THR B 1 121 ? 103.23200 146.01100 154.57300 1.000 62.78000  ? 366 THR B CG2   1 
ATOM   3434  N  N     . ARG B 1 122 ? 103.70700 146.99600 150.12000 1.000 62.76000  ? 367 ARG B N     1 
ATOM   3435  C  CA    . ARG B 1 122 ? 104.17900 147.45000 148.81900 1.000 62.76000  ? 367 ARG B CA    1 
ATOM   3436  C  C     . ARG B 1 122 ? 104.31000 148.96600 148.86200 1.000 62.76000  ? 367 ARG B C     1 
ATOM   3437  O  O     . ARG B 1 122 ? 103.31800 149.68300 148.70200 1.000 62.76000  ? 367 ARG B O     1 
ATOM   3438  C  CB    . ARG B 1 122 ? 103.21600 146.99900 147.72400 1.000 62.76000  ? 367 ARG B CB    1 
ATOM   3439  C  CG    . ARG B 1 122 ? 103.68900 147.20400 146.30000 1.000 62.76000  ? 367 ARG B CG    1 
ATOM   3440  C  CD    . ARG B 1 122 ? 102.66800 146.60500 145.35400 1.000 62.76000  ? 367 ARG B CD    1 
ATOM   3441  N  NE    . ARG B 1 122 ? 103.05300 146.70600 143.95300 1.000 62.76000  ? 367 ARG B NE    1 
ATOM   3442  C  CZ    . ARG B 1 122 ? 102.32200 146.22300 142.95500 1.000 62.76000  ? 367 ARG B CZ    1 
ATOM   3443  N  NH1   . ARG B 1 122 ? 101.17400 145.61500 143.21100 1.000 62.76000  ? 367 ARG B NH1   1 
ATOM   3444  N  NH2   . ARG B 1 122 ? 102.73600 146.34600 141.70200 1.000 62.76000  ? 367 ARG B NH2   1 
ATOM   3445  N  N     . PHE B 1 123 ? 105.53100 149.45100 149.08100 1.000 61.86000  ? 368 PHE B N     1 
ATOM   3446  C  CA    . PHE B 1 123 ? 105.79400 150.88700 149.12400 1.000 61.86000  ? 368 PHE B CA    1 
ATOM   3447  C  C     . PHE B 1 123 ? 105.75200 151.41800 147.70100 1.000 61.86000  ? 368 PHE B C     1 
ATOM   3448  O  O     . PHE B 1 123 ? 106.72400 151.31500 146.95000 1.000 61.86000  ? 368 PHE B O     1 
ATOM   3449  C  CB    . PHE B 1 123 ? 107.11900 151.18400 149.81400 1.000 61.86000  ? 368 PHE B CB    1 
ATOM   3450  C  CG    . PHE B 1 123 ? 107.05300 151.06900 151.30700 1.000 61.86000  ? 368 PHE B CG    1 
ATOM   3451  C  CD1   . PHE B 1 123 ? 106.56700 152.11500 152.06600 1.000 61.86000  ? 368 PHE B CD1   1 
ATOM   3452  C  CD2   . PHE B 1 123 ? 107.45200 149.91600 151.94900 1.000 61.86000  ? 368 PHE B CD2   1 
ATOM   3453  C  CE1   . PHE B 1 123 ? 106.49300 152.01800 153.43700 1.000 61.86000  ? 368 PHE B CE1   1 
ATOM   3454  C  CE2   . PHE B 1 123 ? 107.37700 149.81500 153.32400 1.000 61.86000  ? 368 PHE B CE2   1 
ATOM   3455  C  CZ    . PHE B 1 123 ? 106.89800 150.86600 154.06700 1.000 61.86000  ? 368 PHE B CZ    1 
ATOM   3456  N  N     . GLU B 1 124 ? 104.60900 151.98200 147.33800 1.000 65.32000  ? 369 GLU B N     1 
ATOM   3457  C  CA    . GLU B 1 124 ? 104.36100 152.52800 146.01000 1.000 65.32000  ? 369 GLU B CA    1 
ATOM   3458  C  C     . GLU B 1 124 ? 105.07600 153.86700 145.88800 1.000 65.32000  ? 369 GLU B C     1 
ATOM   3459  O  O     . GLU B 1 124 ? 104.54700 154.90700 146.28300 1.000 65.32000  ? 369 GLU B O     1 
ATOM   3460  C  CB    . GLU B 1 124 ? 102.85900 152.66300 145.79600 1.000 65.32000  ? 369 GLU B CB    1 
ATOM   3461  C  CG    . GLU B 1 124 ? 102.45600 153.19400 144.45200 1.000 65.32000  ? 369 GLU B CG    1 
ATOM   3462  C  CD    . GLU B 1 124 ? 100.95500 153.21000 144.26100 1.000 65.32000  ? 369 GLU B CD    1 
ATOM   3463  O  OE1   . GLU B 1 124 ? 100.22700 152.78100 145.18000 1.000 65.32000  ? 369 GLU B OE1   1 
ATOM   3464  O  OE2   . GLU B 1 124 ? 100.50300 153.66500 143.19200 1.000 65.32000  ? 369 GLU B OE2   1 
ATOM   3465  N  N     . ILE B 1 125 ? 106.28500 153.84400 145.33800 1.000 57.55000  ? 370 ILE B N     1 
ATOM   3466  C  CA    . ILE B 1 125 ? 107.14600 155.01600 145.26700 1.000 57.55000  ? 370 ILE B CA    1 
ATOM   3467  C  C     . ILE B 1 125 ? 107.27400 155.44600 143.81100 1.000 57.55000  ? 370 ILE B C     1 
ATOM   3468  O  O     . ILE B 1 125 ? 107.12900 154.63600 142.88900 1.000 57.55000  ? 370 ILE B O     1 
ATOM   3469  C  CB    . ILE B 1 125 ? 108.52100 154.71100 145.89600 1.000 57.55000  ? 370 ILE B CB    1 
ATOM   3470  C  CG1   . ILE B 1 125 ? 109.29000 155.99200 146.19800 1.000 57.55000  ? 370 ILE B CG1   1 
ATOM   3471  C  CG2   . ILE B 1 125 ? 109.34200 153.82300 144.98800 1.000 57.55000  ? 370 ILE B CG2   1 
ATOM   3472  C  CD1   . ILE B 1 125 ? 110.45500 155.76300 147.12000 1.000 57.55000  ? 370 ILE B CD1   1 
ATOM   3473  N  N     . GLN B 1 126 ? 107.53600 156.73400 143.60300 1.000 60.15000  ? 371 GLN B N     1 
ATOM   3474  C  CA    . GLN B 1 126 ? 107.57500 157.31300 142.26400 1.000 60.15000  ? 371 GLN B CA    1 
ATOM   3475  C  C     . GLN B 1 126 ? 108.90900 158.00200 142.01700 1.000 60.15000  ? 371 GLN B C     1 
ATOM   3476  O  O     . GLN B 1 126 ? 109.27400 158.92000 142.77100 1.000 60.15000  ? 371 GLN B O     1 
ATOM   3477  C  CB    . GLN B 1 126 ? 106.43100 158.30700 142.07400 1.000 60.15000  ? 371 GLN B CB    1 
ATOM   3478  C  CG    . GLN B 1 126 ? 106.39000 158.91900 140.68900 1.000 60.15000  ? 371 GLN B CG    1 
ATOM   3479  C  CD    . GLN B 1 126 ? 105.23800 159.88200 140.51100 1.000 60.15000  ? 371 GLN B CD    1 
ATOM   3480  O  OE1   . GLN B 1 126 ? 104.47200 160.13000 141.44100 1.000 60.15000  ? 371 GLN B OE1   1 
ATOM   3481  N  NE2   . GLN B 1 126 ? 105.11200 160.43700 139.31200 1.000 60.15000  ? 371 GLN B NE2   1 
ATOM   3482  N  N     . PRO B 1 127 ? 109.65800 157.61500 140.98800 1.000 55.29000  ? 372 PRO B N     1 
ATOM   3483  C  CA    . PRO B 1 127 ? 110.91600 158.30300 140.68300 1.000 55.29000  ? 372 PRO B CA    1 
ATOM   3484  C  C     . PRO B 1 127 ? 110.66900 159.71800 140.18600 1.000 55.29000  ? 372 PRO B C     1 
ATOM   3485  O  O     . PRO B 1 127 ? 109.53900 160.14400 139.93900 1.000 55.29000  ? 372 PRO B O     1 
ATOM   3486  C  CB    . PRO B 1 127 ? 111.54100 157.43500 139.58800 1.000 55.29000  ? 372 PRO B CB    1 
ATOM   3487  C  CG    . PRO B 1 127 ? 110.89100 156.10600 139.73700 1.000 55.29000  ? 372 PRO B CG    1 
ATOM   3488  C  CD    . PRO B 1 127 ? 109.48900 156.40400 140.17300 1.000 55.29000  ? 372 PRO B CD    1 
ATOM   3489  N  N     . ALA B 1 128 ? 111.76600 160.45500 140.03900 1.000 57.58000  ? 373 ALA B N     1 
ATOM   3490  C  CA    . ALA B 1 128 ? 111.72700 161.78700 139.46400 1.000 57.58000  ? 373 ALA B CA    1 
ATOM   3491  C  C     . ALA B 1 128 ? 111.90900 161.70100 137.95100 1.000 57.58000  ? 373 ALA B C     1 
ATOM   3492  O  O     . ALA B 1 128 ? 112.08800 160.62300 137.38000 1.000 57.58000  ? 373 ALA B O     1 
ATOM   3493  C  CB    . ALA B 1 128 ? 112.79100 162.67700 140.10100 1.000 57.58000  ? 373 ALA B CB    1 
ATOM   3494  N  N     . ALA B 1 129 ? 111.86200 162.85300 137.28900 1.000 58.61000  ? 374 ALA B N     1 
ATOM   3495  C  CA    . ALA B 1 129 ? 111.97800 162.90300 135.83600 1.000 58.61000  ? 374 ALA B CA    1 
ATOM   3496  C  C     . ALA B 1 129 ? 113.38600 162.50500 135.41600 1.000 58.61000  ? 374 ALA B C     1 
ATOM   3497  O  O     . ALA B 1 129 ? 114.34700 163.23800 135.66400 1.000 58.61000  ? 374 ALA B O     1 
ATOM   3498  C  CB    . ALA B 1 129 ? 111.63400 164.30000 135.32800 1.000 58.61000  ? 374 ALA B CB    1 
ATOM   3499  N  N     . GLY B 1 130 ? 113.51000 161.35000 134.77600 1.000 58.03000  ? 375 GLY B N     1 
ATOM   3500  C  CA    . GLY B 1 130 ? 114.77600 160.88700 134.26000 1.000 58.03000  ? 375 GLY B CA    1 
ATOM   3501  C  C     . GLY B 1 130 ? 115.49500 159.86700 135.11000 1.000 58.03000  ? 375 GLY B C     1 
ATOM   3502  O  O     . GLY B 1 130 ? 116.72000 159.74900 134.99800 1.000 58.03000  ? 375 GLY B O     1 
ATOM   3503  N  N     . VAL B 1 131 ? 114.78200 159.13100 135.95300 1.000 57.16000  ? 376 VAL B N     1 
ATOM   3504  C  CA    . VAL B 1 131 ? 115.37900 158.15400 136.85300 1.000 57.16000  ? 376 VAL B CA    1 
ATOM   3505  C  C     . VAL B 1 131 ? 115.10900 156.76800 136.28900 1.000 57.16000  ? 376 VAL B C     1 
ATOM   3506  O  O     . VAL B 1 131 ? 113.96600 156.29600 136.29900 1.000 57.16000  ? 376 VAL B O     1 
ATOM   3507  C  CB    . VAL B 1 131 ? 114.83500 158.28800 138.27900 1.000 57.16000  ? 376 VAL B CB    1 
ATOM   3508  C  CG1   . VAL B 1 131 ? 115.36600 157.16700 139.14400 1.000 57.16000  ? 376 VAL B CG1   1 
ATOM   3509  C  CG2   . VAL B 1 131 ? 115.21200 159.64000 138.86100 1.000 57.16000  ? 376 VAL B CG2   1 
ATOM   3510  N  N     . LYS B 1 132 ? 116.15400 156.11900 135.78500 1.000 51.75000  ? 377 LYS B N     1 
ATOM   3511  C  CA    . LYS B 1 132 ? 116.02500 154.74300 135.33200 1.000 51.75000  ? 377 LYS B CA    1 
ATOM   3512  C  C     . LYS B 1 132 ? 115.82800 153.81300 136.52100 1.000 51.75000  ? 377 LYS B C     1 
ATOM   3513  O  O     . LYS B 1 132 ? 116.47300 153.96400 137.56200 1.000 51.75000  ? 377 LYS B O     1 
ATOM   3514  C  CB    . LYS B 1 132 ? 117.25800 154.32800 134.53400 1.000 51.75000  ? 377 LYS B CB    1 
ATOM   3515  C  CG    . LYS B 1 132 ? 117.37600 155.01800 133.19100 1.000 51.75000  ? 377 LYS B CG    1 
ATOM   3516  C  CD    . LYS B 1 132 ? 118.68600 154.67000 132.51400 1.000 51.75000  ? 377 LYS B CD    1 
ATOM   3517  C  CE    . LYS B 1 132 ? 118.69700 153.22400 132.04900 1.000 51.75000  ? 377 LYS B CE    1 
ATOM   3518  N  NZ    . LYS B 1 132 ? 119.93300 152.89100 131.28600 1.000 51.75000  ? 377 LYS B NZ    1 
ATOM   3519  N  N     . VAL B 1 133 ? 114.92500 152.84400 136.36100 1.000 51.55000  ? 378 VAL B N     1 
ATOM   3520  C  CA    . VAL B 1 133 ? 114.59200 151.94000 137.45700 1.000 51.55000  ? 378 VAL B CA    1 
ATOM   3521  C  C     . VAL B 1 133 ? 115.79700 151.10600 137.87100 1.000 51.55000  ? 378 VAL B C     1 
ATOM   3522  O  O     . VAL B 1 133 ? 115.92100 150.72000 139.04000 1.000 51.55000  ? 378 VAL B O     1 
ATOM   3523  C  CB    . VAL B 1 133 ? 113.39500 151.05500 137.06100 1.000 51.55000  ? 378 VAL B CB    1 
ATOM   3524  C  CG1   . VAL B 1 133 ? 113.08900 150.04200 138.14500 1.000 51.55000  ? 378 VAL B CG1   1 
ATOM   3525  C  CG2   . VAL B 1 133 ? 112.18100 151.91600 136.79700 1.000 51.55000  ? 378 VAL B CG2   1 
ATOM   3526  N  N     . SER B 1 134 ? 116.70600 150.81800 136.93400 1.000 50.74000  ? 379 SER B N     1 
ATOM   3527  C  CA    . SER B 1 134 ? 117.88400 150.02000 137.26400 1.000 50.74000  ? 379 SER B CA    1 
ATOM   3528  C  C     . SER B 1 134 ? 118.66800 150.61900 138.42400 1.000 50.74000  ? 379 SER B C     1 
ATOM   3529  O  O     . SER B 1 134 ? 119.23600 149.88000 139.23800 1.000 50.74000  ? 379 SER B O     1 
ATOM   3530  C  CB    . SER B 1 134 ? 118.78500 149.87900 136.03800 1.000 50.74000  ? 379 SER B CB    1 
ATOM   3531  O  OG    . SER B 1 134 ? 119.32900 151.13200 135.66700 1.000 50.74000  ? 379 SER B OG    1 
ATOM   3532  N  N     . ARG B 1 135 ? 118.69600 151.94800 138.52900 1.000 53.07000  ? 380 ARG B N     1 
ATOM   3533  C  CA    . ARG B 1 135 ? 119.31900 152.60600 139.67000 1.000 53.07000  ? 380 ARG B CA    1 
ATOM   3534  C  C     . ARG B 1 135 ? 118.57500 152.36000 140.97300 1.000 53.07000  ? 380 ARG B C     1 
ATOM   3535  O  O     . ARG B 1 135 ? 119.05300 152.79900 142.02300 1.000 53.07000  ? 380 ARG B O     1 
ATOM   3536  C  CB    . ARG B 1 135 ? 119.42600 154.10900 139.41800 1.000 53.07000  ? 380 ARG B CB    1 
ATOM   3537  C  CG    . ARG B 1 135 ? 120.40600 154.48600 138.33100 1.000 53.07000  ? 380 ARG B CG    1 
ATOM   3538  C  CD    . ARG B 1 135 ? 120.40100 155.98300 138.10600 1.000 53.07000  ? 380 ARG B CD    1 
ATOM   3539  N  NE    . ARG B 1 135 ? 120.88600 156.70900 139.27300 1.000 53.07000  ? 380 ARG B NE    1 
ATOM   3540  C  CZ    . ARG B 1 135 ? 120.82900 158.02900 139.40300 1.000 53.07000  ? 380 ARG B CZ    1 
ATOM   3541  N  NH1   . ARG B 1 135 ? 120.30700 158.76700 138.43400 1.000 53.07000  ? 380 ARG B NH1   1 
ATOM   3542  N  NH2   . ARG B 1 135 ? 121.29400 158.61200 140.49900 1.000 53.07000  ? 380 ARG B NH2   1 
ATOM   3543  N  N     . ILE B 1 136 ? 117.42700 151.69200 140.93700 1.000 49.61000  ? 381 ILE B N     1 
ATOM   3544  C  CA    . ILE B 1 136 ? 116.76100 151.21100 142.13600 1.000 49.61000  ? 381 ILE B CA    1 
ATOM   3545  C  C     . ILE B 1 136 ? 116.90800 149.70300 142.28200 1.000 49.61000  ? 381 ILE B C     1 
ATOM   3546  O  O     . ILE B 1 136 ? 117.09300 149.19800 143.39000 1.000 49.61000  ? 381 ILE B O     1 
ATOM   3547  C  CB    . ILE B 1 136 ? 115.27300 151.61800 142.14600 1.000 49.61000  ? 381 ILE B CB    1 
ATOM   3548  C  CG1   . ILE B 1 136 ? 115.13600 153.13500 142.09300 1.000 49.61000  ? 381 ILE B CG1   1 
ATOM   3549  C  CG2   . ILE B 1 136 ? 114.58300 151.08500 143.38900 1.000 49.61000  ? 381 ILE B CG2   1 
ATOM   3550  C  CD1   . ILE B 1 136 ? 115.73900 153.81900 143.28600 1.000 49.61000  ? 381 ILE B CD1   1 
ATOM   3551  N  N     . SER B 1 137 ? 116.83500 148.97300 141.16900 1.000 49.32000  ? 382 SER B N     1 
ATOM   3552  C  CA    . SER B 1 137 ? 116.97900 147.52300 141.22400 1.000 49.32000  ? 382 SER B CA    1 
ATOM   3553  C  C     . SER B 1 137 ? 118.35800 147.12700 141.73100 1.000 49.32000  ? 382 SER B C     1 
ATOM   3554  O  O     . SER B 1 137 ? 118.50400 146.11600 142.42600 1.000 49.32000  ? 382 SER B O     1 
ATOM   3555  C  CB    . SER B 1 137 ? 116.71700 146.91500 139.84800 1.000 49.32000  ? 382 SER B CB    1 
ATOM   3556  O  OG    . SER B 1 137 ? 115.37700 147.13100 139.44200 1.000 49.32000  ? 382 SER B OG    1 
ATOM   3557  N  N     . ASN B 1 138 ? 119.38300 147.91400 141.39900 1.000 50.77000  ? 383 ASN B N     1 
ATOM   3558  C  CA    . ASN B 1 138 ? 120.71300 147.62500 141.92200 1.000 50.77000  ? 383 ASN B CA    1 
ATOM   3559  C  C     . ASN B 1 138 ? 120.80900 147.94000 143.40800 1.000 50.77000  ? 383 ASN B C     1 
ATOM   3560  O  O     . ASN B 1 138 ? 121.53200 147.25500 144.13900 1.000 50.77000  ? 383 ASN B O     1 
ATOM   3561  C  CB    . ASN B 1 138 ? 121.76800 148.40500 141.14300 1.000 50.77000  ? 383 ASN B CB    1 
ATOM   3562  C  CG    . ASN B 1 138 ? 121.94300 147.88900 139.73100 1.000 50.77000  ? 383 ASN B CG    1 
ATOM   3563  O  OD1   . ASN B 1 138 ? 121.93600 146.68200 139.49500 1.000 50.77000  ? 383 ASN B OD1   1 
ATOM   3564  N  ND2   . ASN B 1 138 ? 122.10600 148.80200 138.78300 1.000 50.77000  ? 383 ASN B ND2   1 
ATOM   3565  N  N     . LEU B 1 139 ? 120.09300 148.96000 143.87000 1.000 50.85000  ? 384 LEU B N     1 
ATOM   3566  C  CA    . LEU B 1 139 ? 120.08200 149.33700 145.27600 1.000 50.85000  ? 384 LEU B CA    1 
ATOM   3567  C  C     . LEU B 1 139 ? 119.13400 148.49200 146.10900 1.000 50.85000  ? 384 LEU B C     1 
ATOM   3568  O  O     . LEU B 1 139 ? 118.94200 148.79700 147.29000 1.000 50.85000  ? 384 LEU B O     1 
ATOM   3569  C  CB    . LEU B 1 139 ? 119.70100 150.80900 145.42400 1.000 50.85000  ? 384 LEU B CB    1 
ATOM   3570  C  CG    . LEU B 1 139 ? 120.66500 151.81900 144.81400 1.000 50.85000  ? 384 LEU B CG    1 
ATOM   3571  C  CD1   . LEU B 1 139 ? 120.09400 153.21200 144.94900 1.000 50.85000  ? 384 LEU B CD1   1 
ATOM   3572  C  CD2   . LEU B 1 139 ? 122.01800 151.72300 145.48300 1.000 50.85000  ? 384 LEU B CD2   1 
ATOM   3573  N  N     . ALA B 1 140 ? 118.53000 147.45400 145.52500 1.000 50.73000  ? 385 ALA B N     1 
ATOM   3574  C  CA    . ALA B 1 140 ? 117.53500 146.66200 146.23800 1.000 50.73000  ? 385 ALA B CA    1 
ATOM   3575  C  C     . ALA B 1 140 ? 118.07800 146.06100 147.52600 1.000 50.73000  ? 385 ALA B C     1 
ATOM   3576  O  O     . ALA B 1 140 ? 117.29200 145.68200 148.39900 1.000 50.73000  ? 385 ALA B O     1 
ATOM   3577  C  CB    . ALA B 1 140 ? 117.00500 145.55000 145.33400 1.000 50.73000  ? 385 ALA B CB    1 
ATOM   3578  N  N     . LYS B 1 141 ? 119.39600 145.97200 147.66900 1.000 48.68000  ? 386 LYS B N     1 
ATOM   3579  C  CA    . LYS B 1 141 ? 119.99000 145.39200 148.86300 1.000 48.68000  ? 386 LYS B CA    1 
ATOM   3580  C  C     . LYS B 1 141 ? 120.31500 146.44600 149.91300 1.000 48.68000  ? 386 LYS B C     1 
ATOM   3581  O  O     . LYS B 1 141 ? 120.16500 146.19300 151.11200 1.000 48.68000  ? 386 LYS B O     1 
ATOM   3582  C  CB    . LYS B 1 141 ? 121.25000 144.61300 148.48400 1.000 48.68000  ? 386 LYS B CB    1 
ATOM   3583  C  CG    . LYS B 1 141 ? 121.85900 143.82800 149.61600 1.000 48.68000  ? 386 LYS B CG    1 
ATOM   3584  C  CD    . LYS B 1 141 ? 123.05500 143.04700 149.12400 1.000 48.68000  ? 386 LYS B CD    1 
ATOM   3585  C  CE    . LYS B 1 141 ? 122.61700 141.89800 148.23500 1.000 48.68000  ? 386 LYS B CE    1 
ATOM   3586  N  NZ    . LYS B 1 141 ? 121.85600 140.87500 149.00200 1.000 48.68000  ? 386 LYS B NZ    1 
ATOM   3587  N  N     . ASP B 1 142 ? 120.75000 147.63200 149.48400 1.000 53.77000  ? 387 ASP B N     1 
ATOM   3588  C  CA    . ASP B 1 142 ? 121.04200 148.69900 150.43300 1.000 53.77000  ? 387 ASP B CA    1 
ATOM   3589  C  C     . ASP B 1 142 ? 119.77200 149.25200 151.06300 1.000 53.77000  ? 387 ASP B C     1 
ATOM   3590  O  O     . ASP B 1 142 ? 119.81200 149.76300 152.18700 1.000 53.77000  ? 387 ASP B O     1 
ATOM   3591  C  CB    . ASP B 1 142 ? 121.82700 149.81000 149.74200 1.000 53.77000  ? 387 ASP B CB    1 
ATOM   3592  C  CG    . ASP B 1 142 ? 123.21700 149.36900 149.34400 1.000 53.77000  ? 387 ASP B CG    1 
ATOM   3593  O  OD1   . ASP B 1 142 ? 123.77800 148.49400 150.03500 1.000 53.77000  ? 387 ASP B OD1   1 
ATOM   3594  O  OD2   . ASP B 1 142 ? 123.74700 149.88700 148.34100 1.000 53.77000  ? 387 ASP B OD2   1 
ATOM   3595  N  N     . LEU B 1 143 ? 118.64000 149.16200 150.36100 1.000 51.45000  ? 388 LEU B N     1 
ATOM   3596  C  CA    . LEU B 1 143 ? 117.37600 149.56800 150.96300 1.000 51.45000  ? 388 LEU B CA    1 
ATOM   3597  C  C     . LEU B 1 143 ? 116.95400 148.61400 152.07100 1.000 51.45000  ? 388 LEU B C     1 
ATOM   3598  O  O     . LEU B 1 143 ? 116.33500 149.04100 153.05100 1.000 51.45000  ? 388 LEU B O     1 
ATOM   3599  C  CB    . LEU B 1 143 ? 116.29000 149.66500 149.89600 1.000 51.45000  ? 388 LEU B CB    1 
ATOM   3600  C  CG    . LEU B 1 143 ? 116.49800 150.81700 148.91900 1.000 51.45000  ? 388 LEU B CG    1 
ATOM   3601  C  CD1   . LEU B 1 143 ? 115.46300 150.78700 147.81300 1.000 51.45000  ? 388 LEU B CD1   1 
ATOM   3602  C  CD2   . LEU B 1 143 ? 116.44200 152.12500 149.67800 1.000 51.45000  ? 388 LEU B CD2   1 
ATOM   3603  N  N     . ALA B 1 144 ? 117.27800 147.32900 151.93700 1.000 50.00000  ? 389 ALA B N     1 
ATOM   3604  C  CA    . ALA B 1 144 ? 117.03100 146.39100 153.02300 1.000 50.00000  ? 389 ALA B CA    1 
ATOM   3605  C  C     . ALA B 1 144 ? 118.00800 146.59400 154.16600 1.000 50.00000  ? 389 ALA B C     1 
ATOM   3606  O  O     . ALA B 1 144 ? 117.65700 146.36400 155.32800 1.000 50.00000  ? 389 ALA B O     1 
ATOM   3607  C  CB    . ALA B 1 144 ? 117.12300 144.95600 152.51200 1.000 50.00000  ? 389 ALA B CB    1 
ATOM   3608  N  N     . ARG B 1 145 ? 119.22900 147.02100 153.85300 1.000 50.71000  ? 390 ARG B N     1 
ATOM   3609  C  CA    . ARG B 1 145 ? 120.22900 147.25900 154.88600 1.000 50.71000  ? 390 ARG B CA    1 
ATOM   3610  C  C     . ARG B 1 145 ? 119.88100 148.48500 155.71800 1.000 50.71000  ? 390 ARG B C     1 
ATOM   3611  O  O     . ARG B 1 145 ? 119.95900 148.45400 156.95100 1.000 50.71000  ? 390 ARG B O     1 
ATOM   3612  C  CB    . ARG B 1 145 ? 121.59800 147.42300 154.23900 1.000 50.71000  ? 390 ARG B CB    1 
ATOM   3613  C  CG    . ARG B 1 145 ? 122.71300 147.63900 155.21400 1.000 50.71000  ? 390 ARG B CG    1 
ATOM   3614  C  CD    . ARG B 1 145 ? 124.00300 147.82300 154.46900 1.000 50.71000  ? 390 ARG B CD    1 
ATOM   3615  N  NE    . ARG B 1 145 ? 124.00400 149.03300 153.65800 1.000 50.71000  ? 390 ARG B NE    1 
ATOM   3616  C  CZ    . ARG B 1 145 ? 124.29900 150.24000 154.12700 1.000 50.71000  ? 390 ARG B CZ    1 
ATOM   3617  N  NH1   . ARG B 1 145 ? 124.61600 150.39400 155.40400 1.000 50.71000  ? 390 ARG B NH1   1 
ATOM   3618  N  NH2   . ARG B 1 145 ? 124.27900 151.29200 153.32100 1.000 50.71000  ? 390 ARG B NH2   1 
ATOM   3619  N  N     . SER B 1 146 ? 119.50400 149.58200 155.05900 1.000 51.52000  ? 391 SER B N     1 
ATOM   3620  C  CA    . SER B 1 146 ? 119.18000 150.80100 155.78900 1.000 51.52000  ? 391 SER B CA    1 
ATOM   3621  C  C     . SER B 1 146 ? 117.90100 150.64400 156.59700 1.000 51.52000  ? 391 SER B C     1 
ATOM   3622  O  O     . SER B 1 146 ? 117.77100 151.24000 157.67100 1.000 51.52000  ? 391 SER B O     1 
ATOM   3623  C  CB    . SER B 1 146 ? 119.05900 151.97300 154.82000 1.000 51.52000  ? 391 SER B CB    1 
ATOM   3624  O  OG    . SER B 1 146 ? 117.95300 151.79700 153.95500 1.000 51.52000  ? 391 SER B OG    1 
ATOM   3625  N  N     . LEU B 1 147 ? 116.95100 149.86000 156.10200 1.000 51.53000  ? 392 LEU B N     1 
ATOM   3626  C  CA    . LEU B 1 147 ? 115.79800 149.47400 156.89400 1.000 51.53000  ? 392 LEU B CA    1 
ATOM   3627  C  C     . LEU B 1 147 ? 116.18000 148.29500 157.78400 1.000 51.53000  ? 392 LEU B C     1 
ATOM   3628  O  O     . LEU B 1 147 ? 117.31500 147.81400 157.76800 1.000 51.53000  ? 392 LEU B O     1 
ATOM   3629  C  CB    . LEU B 1 147 ? 114.61800 149.13200 155.98800 1.000 51.53000  ? 392 LEU B CB    1 
ATOM   3630  C  CG    . LEU B 1 147 ? 114.04300 150.28400 155.16500 1.000 51.53000  ? 392 LEU B CG    1 
ATOM   3631  C  CD1   . LEU B 1 147 ? 113.00100 149.77800 154.18500 1.000 51.53000  ? 392 LEU B CD1   1 
ATOM   3632  C  CD2   . LEU B 1 147 ? 113.44100 151.32600 156.07900 1.000 51.53000  ? 392 LEU B CD2   1 
ATOM   3633  N  N     . ALA B 1 148 ? 115.22300 147.81900 158.57600 1.000 52.85000  ? 393 ALA B N     1 
ATOM   3634  C  CA    . ALA B 1 148 ? 115.43600 146.67300 159.44800 1.000 52.85000  ? 393 ALA B CA    1 
ATOM   3635  C  C     . ALA B 1 148 ? 114.87700 145.38500 158.85800 1.000 52.85000  ? 393 ALA B C     1 
ATOM   3636  O  O     . ALA B 1 148 ? 114.65300 144.41800 159.59300 1.000 52.85000  ? 393 ALA B O     1 
ATOM   3637  C  CB    . ALA B 1 148 ? 114.82400 146.93500 160.82400 1.000 52.85000  ? 393 ALA B CB    1 
ATOM   3638  N  N     . VAL B 1 149 ? 114.64700 145.35500 157.55200 1.000 53.33000  ? 394 VAL B N     1 
ATOM   3639  C  CA    . VAL B 1 149 ? 113.98400 144.23300 156.90900 1.000 53.33000  ? 394 VAL B CA    1 
ATOM   3640  C  C     . VAL B 1 149 ? 115.01800 143.21300 156.45100 1.000 53.33000  ? 394 VAL B C     1 
ATOM   3641  O  O     . VAL B 1 149 ? 116.21500 143.49500 156.36000 1.000 53.33000  ? 394 VAL B O     1 
ATOM   3642  C  CB    . VAL B 1 149 ? 113.11200 144.70600 155.73500 1.000 53.33000  ? 394 VAL B CB    1 
ATOM   3643  C  CG1   . VAL B 1 149 ? 112.06200 145.67000 156.23800 1.000 53.33000  ? 394 VAL B CG1   1 
ATOM   3644  C  CG2   . VAL B 1 149 ? 113.97000 145.36000 154.67700 1.000 53.33000  ? 394 VAL B CG2   1 
ATOM   3645  N  N     . ILE B 1 150 ? 114.54000 142.00300 156.16200 1.000 55.38000  ? 395 ILE B N     1 
ATOM   3646  C  CA    . ILE B 1 150 ? 115.43200 140.92400 155.75200 1.000 55.38000  ? 395 ILE B CA    1 
ATOM   3647  C  C     . ILE B 1 150 ? 115.99800 141.19600 154.36400 1.000 55.38000  ? 395 ILE B C     1 
ATOM   3648  O  O     . ILE B 1 150 ? 117.21600 141.15800 154.15400 1.000 55.38000  ? 395 ILE B O     1 
ATOM   3649  C  CB    . ILE B 1 150 ? 114.69500 139.57500 155.80400 1.000 55.38000  ? 395 ILE B CB    1 
ATOM   3650  C  CG1   . ILE B 1 150 ? 114.26000 139.26500 157.23700 1.000 55.38000  ? 395 ILE B CG1   1 
ATOM   3651  C  CG2   . ILE B 1 150 ? 115.57900 138.47100 155.25400 1.000 55.38000  ? 395 ILE B CG2   1 
ATOM   3652  C  CD1   . ILE B 1 150 ? 113.29900 138.10500 157.34800 1.000 55.38000  ? 395 ILE B CD1   1 
ATOM   3653  N  N     . SER B 1 151 ? 115.12600 141.47700 153.39900 1.000 53.58000  ? 396 SER B N     1 
ATOM   3654  C  CA    . SER B 1 151 ? 115.55200 141.75200 152.03400 1.000 53.58000  ? 396 SER B CA    1 
ATOM   3655  C  C     . SER B 1 151 ? 114.42400 142.46300 151.30500 1.000 53.58000  ? 396 SER B C     1 
ATOM   3656  O  O     . SER B 1 151 ? 113.25700 142.37200 151.69200 1.000 53.58000  ? 396 SER B O     1 
ATOM   3657  C  CB    . SER B 1 151 ? 115.94800 140.47000 151.29600 1.000 53.58000  ? 396 SER B CB    1 
ATOM   3658  O  OG    . SER B 1 151 ? 116.34100 140.75200 149.96400 1.000 53.58000  ? 396 SER B OG    1 
ATOM   3659  N  N     . VAL B 1 152 ? 114.78800 143.17100 150.24000 1.000 51.99000  ? 397 VAL B N     1 
ATOM   3660  C  CA    . VAL B 1 152 ? 113.85000 143.96900 149.46200 1.000 51.99000  ? 397 VAL B CA    1 
ATOM   3661  C  C     . VAL B 1 152 ? 113.91600 143.53600 148.00600 1.000 51.99000  ? 397 VAL B C     1 
ATOM   3662  O  O     . VAL B 1 152 ? 115.00400 143.34700 147.45200 1.000 51.99000  ? 397 VAL B O     1 
ATOM   3663  C  CB    . VAL B 1 152 ? 114.14700 145.47700 149.59200 1.000 51.99000  ? 397 VAL B CB    1 
ATOM   3664  C  CG1   . VAL B 1 152 ? 113.24400 146.28000 148.67900 1.000 51.99000  ? 397 VAL B CG1   1 
ATOM   3665  C  CG2   . VAL B 1 152 ? 113.97000 145.92100 151.02200 1.000 51.99000  ? 397 VAL B CG2   1 
ATOM   3666  N  N     . ARG B 1 153 ? 112.74900 143.37800 147.38900 1.000 54.89000  ? 398 ARG B N     1 
ATOM   3667  C  CA    . ARG B 1 153 ? 112.63600 143.11000 145.96400 1.000 54.89000  ? 398 ARG B CA    1 
ATOM   3668  C  C     . ARG B 1 153 ? 111.80300 144.21300 145.33500 1.000 54.89000  ? 398 ARG B C     1 
ATOM   3669  O  O     . ARG B 1 153 ? 110.71900 144.53600 145.83100 1.000 54.89000  ? 398 ARG B O     1 
ATOM   3670  C  CB    . ARG B 1 153 ? 112.00000 141.74300 145.70200 1.000 54.89000  ? 398 ARG B CB    1 
ATOM   3671  C  CG    . ARG B 1 153 ? 111.93300 141.36100 144.23100 1.000 54.89000  ? 398 ARG B CG    1 
ATOM   3672  C  CD    . ARG B 1 153 ? 111.28400 140.00000 144.04600 1.000 54.89000  ? 398 ARG B CD    1 
ATOM   3673  N  NE    . ARG B 1 153 ? 109.90100 139.99700 144.51300 1.000 54.89000  ? 398 ARG B NE    1 
ATOM   3674  C  CZ    . ARG B 1 153 ? 108.86600 140.40900 143.79000 1.000 54.89000  ? 398 ARG B CZ    1 
ATOM   3675  N  NH1   . ARG B 1 153 ? 109.05000 140.85600 142.55600 1.000 54.89000  ? 398 ARG B NH1   1 
ATOM   3676  N  NH2   . ARG B 1 153 ? 107.64400 140.37100 144.30100 1.000 54.89000  ? 398 ARG B NH2   1 
ATOM   3677  N  N     . VAL B 1 154 ? 112.31000 144.79000 144.25200 1.000 53.49000  ? 399 VAL B N     1 
ATOM   3678  C  CA    . VAL B 1 154 ? 111.66800 145.91500 143.58400 1.000 53.49000  ? 399 VAL B CA    1 
ATOM   3679  C  C     . VAL B 1 154 ? 110.81700 145.39000 142.43900 1.000 53.49000  ? 399 VAL B C     1 
ATOM   3680  O  O     . VAL B 1 154 ? 111.14700 144.37300 141.81600 1.000 53.49000  ? 399 VAL B O     1 
ATOM   3681  C  CB    . VAL B 1 154 ? 112.70900 146.92800 143.07800 1.000 53.49000  ? 399 VAL B CB    1 
ATOM   3682  C  CG1   . VAL B 1 154 ? 113.51300 147.47700 144.23800 1.000 53.49000  ? 399 VAL B CG1   1 
ATOM   3683  C  CG2   . VAL B 1 154 ? 113.62300 146.27800 142.06200 1.000 53.49000  ? 399 VAL B CG2   1 
ATOM   3684  N  N     . VAL B 1 155 ? 109.71600 146.07900 142.16600 1.000 55.39000  ? 400 VAL B N     1 
ATOM   3685  C  CA    . VAL B 1 155 ? 108.82100 145.74200 141.06600 1.000 55.39000  ? 400 VAL B CA    1 
ATOM   3686  C  C     . VAL B 1 155 ? 109.03300 146.80600 139.99700 1.000 55.39000  ? 400 VAL B C     1 
ATOM   3687  O  O     . VAL B 1 155 ? 108.44800 147.88900 140.05900 1.000 55.39000  ? 400 VAL B O     1 
ATOM   3688  C  CB    . VAL B 1 155 ? 107.36300 145.67600 141.52100 1.000 55.39000  ? 400 VAL B CB    1 
ATOM   3689  C  CG1   . VAL B 1 155 ? 106.45700 145.40100 140.33800 1.000 55.39000  ? 400 VAL B CG1   1 
ATOM   3690  C  CG2   . VAL B 1 155 ? 107.19400 144.61200 142.58600 1.000 55.39000  ? 400 VAL B CG2   1 
ATOM   3691  N  N     . GLU B 1 156 ? 109.87500 146.49000 139.00900 1.000 56.03000  ? 401 GLU B N     1 
ATOM   3692  C  CA    . GLU B 1 156 ? 110.30800 147.48800 138.03400 1.000 56.03000  ? 401 GLU B CA    1 
ATOM   3693  C  C     . GLU B 1 156 ? 109.13800 148.15100 137.32000 1.000 56.03000  ? 401 GLU B C     1 
ATOM   3694  O  O     . GLU B 1 156 ? 109.24300 149.31000 136.90600 1.000 56.03000  ? 401 GLU B O     1 
ATOM   3695  C  CB    . GLU B 1 156 ? 111.24400 146.84400 137.01300 1.000 56.03000  ? 401 GLU B CB    1 
ATOM   3696  C  CG    . GLU B 1 156 ? 112.56000 146.36700 137.59400 1.000 56.03000  ? 401 GLU B CG    1 
ATOM   3697  C  CD    . GLU B 1 156 ? 113.44300 145.70600 136.55700 1.000 56.03000  ? 401 GLU B CD    1 
ATOM   3698  O  OE1   . GLU B 1 156 ? 112.97400 145.51400 135.41600 1.000 56.03000  ? 401 GLU B OE1   1 
ATOM   3699  O  OE2   . GLU B 1 156 ? 114.60300 145.37700 136.88200 1.000 56.03000  ? 401 GLU B OE2   1 
ATOM   3700  N  N     . VAL B 1 157 ? 108.02300 147.44200 137.16000 1.000 53.28000  ? 402 VAL B N     1 
ATOM   3701  C  CA    . VAL B 1 157 ? 106.86500 147.95900 136.44000 1.000 53.28000  ? 402 VAL B CA    1 
ATOM   3702  C  C     . VAL B 1 157 ? 105.61100 147.52400 137.18000 1.000 53.28000  ? 402 VAL B C     1 
ATOM   3703  O  O     . VAL B 1 157 ? 105.39200 146.32400 137.38300 1.000 53.28000  ? 402 VAL B O     1 
ATOM   3704  C  CB    . VAL B 1 157 ? 106.81100 147.46400 134.98400 1.000 53.28000  ? 402 VAL B CB    1 
ATOM   3705  C  CG1   . VAL B 1 157 ? 105.51200 147.89200 134.33700 1.000 53.28000  ? 402 VAL B CG1   1 
ATOM   3706  C  CG2   . VAL B 1 157 ? 107.99200 147.99500 134.19200 1.000 53.28000  ? 402 VAL B CG2   1 
ATOM   3707  N  N     . ILE B 1 158 ? 104.79000 148.48300 137.57700 1.000 55.20000  ? 403 ILE B N     1 
ATOM   3708  C  CA    . ILE B 1 158 ? 103.48600 148.21100 138.17400 1.000 55.20000  ? 403 ILE B CA    1 
ATOM   3709  C  C     . ILE B 1 158 ? 102.43600 148.30900 137.07400 1.000 55.20000  ? 403 ILE B C     1 
ATOM   3710  O  O     . ILE B 1 158 ? 102.37800 149.33500 136.38400 1.000 55.20000  ? 403 ILE B O     1 
ATOM   3711  C  CB    . ILE B 1 158 ? 103.17000 149.18300 139.32300 1.000 55.20000  ? 403 ILE B CB    1 
ATOM   3712  C  CG1   . ILE B 1 158 ? 104.16400 148.98900 140.46500 1.000 55.20000  ? 403 ILE B CG1   1 
ATOM   3713  C  CG2   . ILE B 1 158 ? 101.75900 148.96600 139.82500 1.000 55.20000  ? 403 ILE B CG2   1 
ATOM   3714  C  CD1   . ILE B 1 158 ? 104.07100 150.04200 141.53700 1.000 55.20000  ? 403 ILE B CD1   1 
ATOM   3715  N  N     . PRO B 1 159 ? 101.60600 147.28900 136.87900 1.000 56.53000  ? 404 PRO B N     1 
ATOM   3716  C  CA    . PRO B 1 159 ? 100.67000 147.25900 135.73200 1.000 56.53000  ? 404 PRO B CA    1 
ATOM   3717  C  C     . PRO B 1 159 ? 99.45100  148.16500 135.88900 1.000 56.53000  ? 404 PRO B C     1 
ATOM   3718  O  O     . PRO B 1 159 ? 98.36000  147.75900 136.28600 1.000 56.53000  ? 404 PRO B O     1 
ATOM   3719  C  CB    . PRO B 1 159 ? 100.27000 145.78300 135.67000 1.000 56.53000  ? 404 PRO B CB    1 
ATOM   3720  C  CG    . PRO B 1 159 ? 100.40800 145.29900 137.06600 1.000 56.53000  ? 404 PRO B CG    1 
ATOM   3721  C  CD    . PRO B 1 159 ? 101.57800 146.03300 137.64900 1.000 56.53000  ? 404 PRO B CD    1 
ATOM   3722  N  N     . GLY B 1 160 ? 99.63700  149.44200 135.56900 1.000 57.32000  ? 405 GLY B N     1 
ATOM   3723  C  CA    . GLY B 1 160 ? 98.51800  150.36200 135.53900 1.000 57.32000  ? 405 GLY B CA    1 
ATOM   3724  C  C     . GLY B 1 160 ? 98.79300  151.72200 136.14300 1.000 57.32000  ? 405 GLY B C     1 
ATOM   3725  O  O     . GLY B 1 160 ? 97.89600  152.56800 136.20200 1.000 57.32000  ? 405 GLY B O     1 
ATOM   3726  N  N     . LYS B 1 161 ? 100.02200 151.95200 136.59800 1.000 56.92000  ? 406 LYS B N     1 
ATOM   3727  C  CA    . LYS B 1 161 ? 100.37400 153.19000 137.27800 1.000 56.92000  ? 406 LYS B CA    1 
ATOM   3728  C  C     . LYS B 1 161 ? 101.78400 153.59900 136.87600 1.000 56.92000  ? 406 LYS B C     1 
ATOM   3729  O  O     . LYS B 1 161 ? 102.53400 152.82600 136.27400 1.000 56.92000  ? 406 LYS B O     1 
ATOM   3730  C  CB    . LYS B 1 161 ? 100.25200 153.03500 138.79800 1.000 56.92000  ? 406 LYS B CB    1 
ATOM   3731  C  CG    . LYS B 1 161 ? 98.83400  152.80100 139.28500 1.000 56.92000  ? 406 LYS B CG    1 
ATOM   3732  C  CD    . LYS B 1 161 ? 98.77800  152.68400 140.79100 1.000 56.92000  ? 406 LYS B CD    1 
ATOM   3733  C  CE    . LYS B 1 161 ? 99.39500  151.38000 141.25500 1.000 56.92000  ? 406 LYS B CE    1 
ATOM   3734  N  NZ    . LYS B 1 161 ? 98.59800  150.21000 140.80100 1.000 56.92000  ? 406 LYS B NZ    1 
ATOM   3735  N  N     . THR B 1 162 ? 102.14400 154.83500 137.22000 1.000 58.86000  ? 407 THR B N     1 
ATOM   3736  C  CA    . THR B 1 162 ? 103.46700 155.36600 136.91600 1.000 58.86000  ? 407 THR B CA    1 
ATOM   3737  C  C     . THR B 1 162 ? 104.49900 154.96700 137.96100 1.000 58.86000  ? 407 THR B C     1 
ATOM   3738  O  O     . THR B 1 162 ? 105.69700 154.92100 137.66200 1.000 58.86000  ? 407 THR B O     1 
ATOM   3739  C  CB    . THR B 1 162 ? 103.39900 156.89400 136.80200 1.000 58.86000  ? 407 THR B CB    1 
ATOM   3740  O  OG1   . THR B 1 162 ? 102.42500 157.25300 135.81600 1.000 58.86000  ? 407 THR B OG1   1 
ATOM   3741  C  CG2   . THR B 1 162 ? 104.74200 157.47500 136.38600 1.000 58.86000  ? 407 THR B CG2   1 
ATOM   3742  N  N     . THR B 1 163 ? 104.04900 154.64200 139.16700 1.000 55.93000  ? 408 THR B N     1 
ATOM   3743  C  CA    . THR B 1 163 ? 104.95300 154.38100 140.27400 1.000 55.93000  ? 408 THR B CA    1 
ATOM   3744  C  C     . THR B 1 163 ? 105.75200 153.10200 140.05600 1.000 55.93000  ? 408 THR B C     1 
ATOM   3745  O  O     . THR B 1 163 ? 105.44000 152.28300 139.18900 1.000 55.93000  ? 408 THR B O     1 
ATOM   3746  C  CB    . THR B 1 163 ? 104.15700 154.27000 141.56600 1.000 55.93000  ? 408 THR B CB    1 
ATOM   3747  O  OG1   . THR B 1 163 ? 103.26600 153.15500 141.46700 1.000 55.93000  ? 408 THR B OG1   1 
ATOM   3748  C  CG2   . THR B 1 163 ? 103.34000 155.52700 141.78300 1.000 55.93000  ? 408 THR B CG2   1 
ATOM   3749  N  N     . VAL B 1 164 ? 106.79700 152.94200 140.86200 1.000 53.95000  ? 409 VAL B N     1 
ATOM   3750  C  CA    . VAL B 1 164 ? 107.59300 151.72300 140.91800 1.000 53.95000  ? 409 VAL B CA    1 
ATOM   3751  C  C     . VAL B 1 164 ? 107.47500 151.15700 142.32700 1.000 53.95000  ? 409 VAL B C     1 
ATOM   3752  O  O     . VAL B 1 164 ? 107.29200 151.89900 143.29800 1.000 53.95000  ? 409 VAL B O     1 
ATOM   3753  C  CB    . VAL B 1 164 ? 109.06300 151.99400 140.52400 1.000 53.95000  ? 409 VAL B CB    1 
ATOM   3754  C  CG1   . VAL B 1 164 ? 109.71900 152.93000 141.51700 1.000 53.95000  ? 409 VAL B CG1   1 
ATOM   3755  C  CG2   . VAL B 1 164 ? 109.84700 150.70300 140.41000 1.000 53.95000  ? 409 VAL B CG2   1 
ATOM   3756  N  N     . GLY B 1 165 ? 107.55800 149.83700 142.44100 1.000 54.30000  ? 410 GLY B N     1 
ATOM   3757  C  CA    . GLY B 1 165 ? 107.26600 149.17400 143.69500 1.000 54.30000  ? 410 GLY B CA    1 
ATOM   3758  C  C     . GLY B 1 165 ? 108.49200 148.88200 144.54400 1.000 54.30000  ? 410 GLY B C     1 
ATOM   3759  O  O     . GLY B 1 165 ? 109.58000 148.63100 144.03800 1.000 54.30000  ? 410 GLY B O     1 
ATOM   3760  N  N     . ILE B 1 166 ? 108.28800 148.91800 145.85900 1.000 56.58000  ? 411 ILE B N     1 
ATOM   3761  C  CA    . ILE B 1 166 ? 109.28900 148.53500 146.84900 1.000 56.58000  ? 411 ILE B CA    1 
ATOM   3762  C  C     . ILE B 1 166 ? 108.58600 147.60700 147.83000 1.000 56.58000  ? 411 ILE B C     1 
ATOM   3763  O  O     . ILE B 1 166 ? 107.76800 148.06400 148.63800 1.000 56.58000  ? 411 ILE B O     1 
ATOM   3764  C  CB    . ILE B 1 166 ? 109.88700 149.74400 147.58300 1.000 56.58000  ? 411 ILE B CB    1 
ATOM   3765  C  CG1   . ILE B 1 166 ? 110.53300 150.72400 146.60500 1.000 56.58000  ? 411 ILE B CG1   1 
ATOM   3766  C  CG2   . ILE B 1 166 ? 110.91100 149.28700 148.60200 1.000 56.58000  ? 411 ILE B CG2   1 
ATOM   3767  C  CD1   . ILE B 1 166 ? 111.71700 150.16100 145.87600 1.000 56.58000  ? 411 ILE B CD1   1 
ATOM   3768  N  N     . GLU B 1 167 ? 108.89400 146.31500 147.76700 1.000 59.92000  ? 412 GLU B N     1 
ATOM   3769  C  CA    . GLU B 1 167 ? 108.18400 145.32000 148.56000 1.000 59.92000  ? 412 GLU B CA    1 
ATOM   3770  C  C     . GLU B 1 167 ? 108.95000 145.00100 149.83700 1.000 59.92000  ? 412 GLU B C     1 
ATOM   3771  O  O     . GLU B 1 167 ? 110.13400 144.65600 149.79100 1.000 59.92000  ? 412 GLU B O     1 
ATOM   3772  C  CB    . GLU B 1 167 ? 107.94800 144.05000 147.74200 1.000 59.92000  ? 412 GLU B CB    1 
ATOM   3773  C  CG    . GLU B 1 167 ? 106.92300 144.22600 146.63100 1.000 59.92000  ? 412 GLU B CG    1 
ATOM   3774  C  CD    . GLU B 1 167 ? 106.70500 142.96200 145.82200 1.000 59.92000  ? 412 GLU B CD    1 
ATOM   3775  O  OE1   . GLU B 1 167 ? 107.45300 141.98300 146.02600 1.000 59.92000  ? 412 GLU B OE1   1 
ATOM   3776  O  OE2   . GLU B 1 167 ? 105.77900 142.94500 144.98400 1.000 59.92000  ? 412 GLU B OE2   1 
ATOM   3777  N  N     . ILE B 1 168 ? 108.26300 145.10900 150.96900 1.000 57.97000  ? 413 ILE B N     1 
ATOM   3778  C  CA    . ILE B 1 168 ? 108.84100 144.91000 152.29100 1.000 57.97000  ? 413 ILE B CA    1 
ATOM   3779  C  C     . ILE B 1 168 ? 108.17200 143.70700 152.94500 1.000 57.97000  ? 413 ILE B C     1 
ATOM   3780  O  O     . ILE B 1 168 ? 106.95900 143.72500 153.17200 1.000 57.97000  ? 413 ILE B O     1 
ATOM   3781  C  CB    . ILE B 1 168 ? 108.68200 146.15700 153.17700 1.000 57.97000  ? 413 ILE B CB    1 
ATOM   3782  C  CG1   . ILE B 1 168 ? 109.57300 147.29100 152.67100 1.000 57.97000  ? 413 ILE B CG1   1 
ATOM   3783  C  CG2   . ILE B 1 168 ? 108.95000 145.82400 154.63300 1.000 57.97000  ? 413 ILE B CG2   1 
ATOM   3784  C  CD1   . ILE B 1 168 ? 111.04100 146.98100 152.73000 1.000 57.97000  ? 413 ILE B CD1   1 
ATOM   3785  N  N     . PRO B 1 169 ? 108.90800 142.64500 153.26700 1.000 56.89000  ? 414 PRO B N     1 
ATOM   3786  C  CA    . PRO B 1 169 ? 108.30700 141.52900 154.01000 1.000 56.89000  ? 414 PRO B CA    1 
ATOM   3787  C  C     . PRO B 1 169 ? 107.93700 141.96000 155.42100 1.000 56.89000  ? 414 PRO B C     1 
ATOM   3788  O  O     . PRO B 1 169 ? 108.75700 142.52700 156.14400 1.000 56.89000  ? 414 PRO B O     1 
ATOM   3789  C  CB    . PRO B 1 169 ? 109.41500 140.47100 154.01900 1.000 56.89000  ? 414 PRO B CB    1 
ATOM   3790  C  CG    . PRO B 1 169 ? 110.29600 140.83600 152.87200 1.000 56.89000  ? 414 PRO B CG    1 
ATOM   3791  C  CD    . PRO B 1 169 ? 110.27000 142.33000 152.81300 1.000 56.89000  ? 414 PRO B CD    1 
ATOM   3792  N  N     . ASN B 1 170 ? 106.69000 141.69800 155.80300 1.000 67.62000  ? 415 ASN B N     1 
ATOM   3793  C  CA    . ASN B 1 170 ? 106.24600 142.01900 157.15200 1.000 67.62000  ? 415 ASN B CA    1 
ATOM   3794  C  C     . ASN B 1 170 ? 107.04300 141.23400 158.18500 1.000 67.62000  ? 415 ASN B C     1 
ATOM   3795  O  O     . ASN B 1 170 ? 107.54200 140.13800 157.92000 1.000 67.62000  ? 415 ASN B O     1 
ATOM   3796  C  CB    . ASN B 1 170 ? 104.75800 141.71500 157.32100 1.000 67.62000  ? 415 ASN B CB    1 
ATOM   3797  C  CG    . ASN B 1 170 ? 103.87600 142.72200 156.62700 1.000 67.62000  ? 415 ASN B CG    1 
ATOM   3798  O  OD1   . ASN B 1 170 ? 104.12500 143.92200 156.68800 1.000 67.62000  ? 415 ASN B OD1   1 
ATOM   3799  N  ND2   . ASN B 1 170 ? 102.83100 142.24000 155.96800 1.000 67.62000  ? 415 ASN B ND2   1 
ATOM   3800  N  N     . GLU B 1 171 ? 107.16000 141.81300 159.38100 1.000 75.91000  ? 416 GLU B N     1 
ATOM   3801  C  CA    . GLU B 1 171 ? 107.73800 141.07700 160.49900 1.000 75.91000  ? 416 GLU B CA    1 
ATOM   3802  C  C     . GLU B 1 171 ? 106.75100 140.04400 161.02300 1.000 75.91000  ? 416 GLU B C     1 
ATOM   3803  O  O     . GLU B 1 171 ? 107.09300 138.86900 161.19700 1.000 75.91000  ? 416 GLU B O     1 
ATOM   3804  C  CB    . GLU B 1 171 ? 108.14100 142.04300 161.61200 1.000 75.91000  ? 416 GLU B CB    1 
ATOM   3805  C  CG    . GLU B 1 171 ? 109.26600 142.99300 161.24400 1.000 75.91000  ? 416 GLU B CG    1 
ATOM   3806  C  CD    . GLU B 1 171 ? 109.61600 143.93800 162.37700 1.000 75.91000  ? 416 GLU B CD    1 
ATOM   3807  O  OE1   . GLU B 1 171 ? 108.90900 143.92000 163.40600 1.000 75.91000  ? 416 GLU B OE1   1 
ATOM   3808  O  OE2   . GLU B 1 171 ? 110.59500 144.70100 162.23800 1.000 75.91000  ? 416 GLU B OE2   1 
ATOM   3809  N  N     . ASP B 1 172 ? 105.51700 140.47100 161.28000 1.000 83.08000  ? 417 ASP B N     1 
ATOM   3810  C  CA    . ASP B 1 172 ? 104.45500 139.59200 161.75600 1.000 83.08000  ? 417 ASP B CA    1 
ATOM   3811  C  C     . ASP B 1 172 ? 103.61500 139.14900 160.56000 1.000 83.08000  ? 417 ASP B C     1 
ATOM   3812  O  O     . ASP B 1 172 ? 102.49900 139.61500 160.33400 1.000 83.08000  ? 417 ASP B O     1 
ATOM   3813  C  CB    . ASP B 1 172 ? 103.62600 140.30000 162.82300 1.000 83.08000  ? 417 ASP B CB    1 
ATOM   3814  C  CG    . ASP B 1 172 ? 103.09500 141.64500 162.35600 1.000 83.08000  ? 417 ASP B CG    1 
ATOM   3815  O  OD1   . ASP B 1 172 ? 103.42800 142.06800 161.22900 1.000 83.08000  ? 417 ASP B OD1   1 
ATOM   3816  O  OD2   . ASP B 1 172 ? 102.34800 142.28300 163.12000 1.000 83.08000  ? 417 ASP B OD2   1 
ATOM   3817  N  N     . ARG B 1 173 ? 104.17700 138.22600 159.78200 1.000 71.87000  ? 418 ARG B N     1 
ATOM   3818  C  CA    . ARG B 1 173 ? 103.45400 137.67200 158.64500 1.000 71.87000  ? 418 ARG B CA    1 
ATOM   3819  C  C     . ARG B 1 173 ? 102.19800 136.96700 159.13200 1.000 71.87000  ? 418 ARG B C     1 
ATOM   3820  O  O     . ARG B 1 173 ? 102.27400 135.91900 159.78000 1.000 71.87000  ? 418 ARG B O     1 
ATOM   3821  C  CB    . ARG B 1 173 ? 104.35300 136.70700 157.87200 1.000 71.87000  ? 418 ARG B CB    1 
ATOM   3822  C  CG    . ARG B 1 173 ? 103.70400 136.07300 156.64800 1.000 71.87000  ? 418 ARG B CG    1 
ATOM   3823  C  CD    . ARG B 1 173 ? 103.15200 134.68600 156.94900 1.000 71.87000  ? 418 ARG B CD    1 
ATOM   3824  N  NE    . ARG B 1 173 ? 102.54200 134.07200 155.77500 1.000 71.87000  ? 418 ARG B NE    1 
ATOM   3825  C  CZ    . ARG B 1 173 ? 103.20600 133.34800 154.88200 1.000 71.87000  ? 418 ARG B CZ    1 
ATOM   3826  N  NH1   . ARG B 1 173 ? 104.50700 133.14000 155.02700 1.000 71.87000  ? 418 ARG B NH1   1 
ATOM   3827  N  NH2   . ARG B 1 173 ? 102.56600 132.82800 153.84400 1.000 71.87000  ? 418 ARG B NH2   1 
ATOM   3828  N  N     . GLN B 1 174 ? 101.04200 137.54200 158.82100 1.000 73.10000  ? 419 GLN B N     1 
ATOM   3829  C  CA    . GLN B 1 174 ? 99.77500  136.99600 159.27600 1.000 73.10000  ? 419 GLN B CA    1 
ATOM   3830  C  C     . GLN B 1 174 ? 99.30300  135.91800 158.30200 1.000 73.10000  ? 419 GLN B C     1 
ATOM   3831  O  O     . GLN B 1 174 ? 100.04400 135.47800 157.42000 1.000 73.10000  ? 419 GLN B O     1 
ATOM   3832  C  CB    . GLN B 1 174 ? 98.74900  138.11200 159.44800 1.000 73.10000  ? 419 GLN B CB    1 
ATOM   3833  C  CG    . GLN B 1 174 ? 98.37500  138.81800 158.16800 1.000 73.10000  ? 419 GLN B CG    1 
ATOM   3834  C  CD    . GLN B 1 174 ? 97.37600  139.92600 158.40500 1.000 73.10000  ? 419 GLN B CD    1 
ATOM   3835  O  OE1   . GLN B 1 174 ? 96.91200  140.12700 159.52600 1.000 73.10000  ? 419 GLN B OE1   1 
ATOM   3836  N  NE2   . GLN B 1 174 ? 97.04000  140.65600 157.35000 1.000 73.10000  ? 419 GLN B NE2   1 
ATOM   3837  N  N     . MET B 1 175 ? 98.05700  135.48100 158.45300 1.000 73.58000  ? 420 MET B N     1 
ATOM   3838  C  CA    . MET B 1 175 ? 97.52100  134.37100 157.68300 1.000 73.58000  ? 420 MET B CA    1 
ATOM   3839  C  C     . MET B 1 175 ? 96.33100  134.83400 156.85400 1.000 73.58000  ? 420 MET B C     1 
ATOM   3840  O  O     . MET B 1 175 ? 95.86800  135.97200 156.97000 1.000 73.58000  ? 420 MET B O     1 
ATOM   3841  C  CB    . MET B 1 175 ? 97.10900  133.21300 158.60000 1.000 73.58000  ? 420 MET B CB    1 
ATOM   3842  C  CG    . MET B 1 175 ? 95.92900  133.52100 159.50900 1.000 73.58000  ? 420 MET B CG    1 
ATOM   3843  S  SD    . MET B 1 175 ? 95.54900  132.15000 160.61700 1.000 73.58000  ? 420 MET B SD    1 
ATOM   3844  C  CE    . MET B 1 175 ? 94.91500  130.94800 159.45600 1.000 73.58000  ? 420 MET B CE    1 
ATOM   3845  N  N     . VAL B 1 176 ? 95.84100  133.93400 156.01300 1.000 65.28000  ? 421 VAL B N     1 
ATOM   3846  C  CA    . VAL B 1 176 ? 94.78800  134.23900 155.04800 1.000 65.28000  ? 421 VAL B CA    1 
ATOM   3847  C  C     . VAL B 1 176 ? 93.65000  133.25700 155.30000 1.000 65.28000  ? 421 VAL B C     1 
ATOM   3848  O  O     . VAL B 1 176 ? 93.73000  132.07700 154.94800 1.000 65.28000  ? 421 VAL B O     1 
ATOM   3849  C  CB    . VAL B 1 176 ? 95.28200  134.15800 153.60300 1.000 65.28000  ? 421 VAL B CB    1 
ATOM   3850  C  CG1   . VAL B 1 176 ? 94.12300  134.32400 152.64600 1.000 65.28000  ? 421 VAL B CG1   1 
ATOM   3851  C  CG2   . VAL B 1 176 ? 96.34600  135.20900 153.34500 1.000 65.28000  ? 421 VAL B CG2   1 
ATOM   3852  N  N     . ARG B 1 177 ? 92.57700  133.73700 155.92300 1.000 68.73000  ? 422 ARG B N     1 
ATOM   3853  C  CA    . ARG B 1 177 ? 91.41600  132.88600 156.11000 1.000 68.73000  ? 422 ARG B CA    1 
ATOM   3854  C  C     . ARG B 1 177 ? 90.74000  132.60800 154.77100 1.000 68.73000  ? 422 ARG B C     1 
ATOM   3855  O  O     . ARG B 1 177 ? 90.93600  133.31800 153.78100 1.000 68.73000  ? 422 ARG B O     1 
ATOM   3856  C  CB    . ARG B 1 177 ? 90.42300  133.51800 157.08400 1.000 68.73000  ? 422 ARG B CB    1 
ATOM   3857  C  CG    . ARG B 1 177 ? 90.98600  133.73100 158.47600 1.000 68.73000  ? 422 ARG B CG    1 
ATOM   3858  C  CD    . ARG B 1 177 ? 91.50700  132.42500 159.02800 1.000 68.73000  ? 422 ARG B CD    1 
ATOM   3859  N  NE    . ARG B 1 177 ? 90.47900  131.39400 159.07100 1.000 68.73000  ? 422 ARG B NE    1 
ATOM   3860  C  CZ    . ARG B 1 177 ? 90.74000  130.09100 159.09500 1.000 68.73000  ? 422 ARG B CZ    1 
ATOM   3861  N  NH1   . ARG B 1 177 ? 91.99200  129.66100 159.07100 1.000 68.73000  ? 422 ARG B NH1   1 
ATOM   3862  N  NH2   . ARG B 1 177 ? 89.75000  129.21400 159.12300 1.000 68.73000  ? 422 ARG B NH2   1 
ATOM   3863  N  N     . PHE B 1 178 ? 89.93200  131.54900 154.75400 1.000 59.06000  ? 423 PHE B N     1 
ATOM   3864  C  CA    . PHE B 1 178 ? 89.27800  131.13500 153.51900 1.000 59.06000  ? 423 PHE B CA    1 
ATOM   3865  C  C     . PHE B 1 178 ? 87.90100  131.77400 153.39800 1.000 59.06000  ? 423 PHE B C     1 
ATOM   3866  O  O     . PHE B 1 178 ? 87.44600  132.09800 152.29300 1.000 59.06000  ? 423 PHE B O     1 
ATOM   3867  C  CB    . PHE B 1 178 ? 89.19900  129.61000 153.47700 1.000 59.06000  ? 423 PHE B CB    1 
ATOM   3868  C  CG    . PHE B 1 178 ? 88.76000  129.05800 152.15900 1.000 59.06000  ? 423 PHE B CG    1 
ATOM   3869  C  CD1   . PHE B 1 178 ? 89.57700  129.15900 151.05000 1.000 59.06000  ? 423 PHE B CD1   1 
ATOM   3870  C  CD2   . PHE B 1 178 ? 87.56600  128.38000 152.04000 1.000 59.06000  ? 423 PHE B CD2   1 
ATOM   3871  C  CE1   . PHE B 1 178 ? 89.18800  128.63900 149.83600 1.000 59.06000  ? 423 PHE B CE1   1 
ATOM   3872  C  CE2   . PHE B 1 178 ? 87.17800  127.85200 150.82900 1.000 59.06000  ? 423 PHE B CE2   1 
ATOM   3873  C  CZ    . PHE B 1 178 ? 87.98900  127.98400 149.72600 1.000 59.06000  ? 423 PHE B CZ    1 
ATOM   3874  N  N     . SER B 1 179 ? 87.22300  131.96500 154.53100 1.000 63.82000  ? 424 SER B N     1 
ATOM   3875  C  CA    . SER B 1 179 ? 85.95800  132.68900 154.52200 1.000 63.82000  ? 424 SER B CA    1 
ATOM   3876  C  C     . SER B 1 179 ? 86.15900  134.14500 154.12700 1.000 63.82000  ? 424 SER B C     1 
ATOM   3877  O  O     . SER B 1 179 ? 85.23600  134.79200 153.62100 1.000 63.82000  ? 424 SER B O     1 
ATOM   3878  C  CB    . SER B 1 179 ? 85.29100  132.59100 155.89400 1.000 63.82000  ? 424 SER B CB    1 
ATOM   3879  O  OG    . SER B 1 179 ? 86.06200  133.25800 156.87600 1.000 63.82000  ? 424 SER B OG    1 
ATOM   3880  N  N     . GLU B 1 180 ? 87.36100  134.68000 154.35300 1.000 67.04000  ? 425 GLU B N     1 
ATOM   3881  C  CA    . GLU B 1 180 ? 87.66700  136.02300 153.87200 1.000 67.04000  ? 425 GLU B CA    1 
ATOM   3882  C  C     . GLU B 1 180 ? 87.64900  136.07500 152.35200 1.000 67.04000  ? 425 GLU B C     1 
ATOM   3883  O  O     . GLU B 1 180 ? 87.22400  137.07300 151.76000 1.000 67.04000  ? 425 GLU B O     1 
ATOM   3884  C  CB    . GLU B 1 180 ? 89.02800  136.47900 154.39500 1.000 67.04000  ? 425 GLU B CB    1 
ATOM   3885  C  CG    . GLU B 1 180 ? 89.08300  136.70500 155.88700 1.000 67.04000  ? 425 GLU B CG    1 
ATOM   3886  C  CD    . GLU B 1 180 ? 90.45700  137.14400 156.34600 1.000 67.04000  ? 425 GLU B CD    1 
ATOM   3887  O  OE1   . GLU B 1 180 ? 91.38900  137.14400 155.51700 1.000 67.04000  ? 425 GLU B OE1   1 
ATOM   3888  O  OE2   . GLU B 1 180 ? 90.60500  137.49100 157.53600 1.000 67.04000  ? 425 GLU B OE2   1 
ATOM   3889  N  N     . VAL B 1 181 ? 88.11200  135.00700 151.70500 1.000 57.98000  ? 426 VAL B N     1 
ATOM   3890  C  CA    . VAL B 1 181 ? 88.13100  134.96900 150.24800 1.000 57.98000  ? 426 VAL B CA    1 
ATOM   3891  C  C     . VAL B 1 181 ? 86.73900  134.69000 149.70000 1.000 57.98000  ? 426 VAL B C     1 
ATOM   3892  O  O     . VAL B 1 181 ? 86.28500  135.34900 148.75800 1.000 57.98000  ? 426 VAL B O     1 
ATOM   3893  C  CB    . VAL B 1 181 ? 89.14900  133.92800 149.75400 1.000 57.98000  ? 426 VAL B CB    1 
ATOM   3894  C  CG1   . VAL B 1 181 ? 89.10700  133.83700 148.24600 1.000 57.98000  ? 426 VAL B CG1   1 
ATOM   3895  C  CG2   . VAL B 1 181 ? 90.54200  134.28600 150.22800 1.000 57.98000  ? 426 VAL B CG2   1 
ATOM   3896  N  N     . LEU B 1 182 ? 86.04000  133.70900 150.27500 1.000 58.86000  ? 427 LEU B N     1 
ATOM   3897  C  CA    . LEU B 1 182 ? 84.72300  133.34500 149.75800 1.000 58.86000  ? 427 LEU B CA    1 
ATOM   3898  C  C     . LEU B 1 182 ? 83.73000  134.49100 149.90800 1.000 58.86000  ? 427 LEU B C     1 
ATOM   3899  O  O     . LEU B 1 182 ? 83.13700  134.94800 148.92500 1.000 58.86000  ? 427 LEU B O     1 
ATOM   3900  C  CB    . LEU B 1 182 ? 84.20600  132.08800 150.45400 1.000 58.86000  ? 427 LEU B CB    1 
ATOM   3901  C  CG    . LEU B 1 182 ? 84.96900  130.80400 150.14700 1.000 58.86000  ? 427 LEU B CG    1 
ATOM   3902  C  CD1   . LEU B 1 182 ? 84.36100  129.66600 150.92700 1.000 58.86000  ? 427 LEU B CD1   1 
ATOM   3903  C  CD2   . LEU B 1 182 ? 84.96100  130.50600 148.65900 1.000 58.86000  ? 427 LEU B CD2   1 
ATOM   3904  N  N     . SER B 1 183 ? 83.54100  134.97700 151.13700 1.000 60.72000  ? 428 SER B N     1 
ATOM   3905  C  CA    . SER B 1 183 ? 82.53600  136.00400 151.39600 1.000 60.72000  ? 428 SER B CA    1 
ATOM   3906  C  C     . SER B 1 183 ? 82.76500  137.28500 150.60100 1.000 60.72000  ? 428 SER B C     1 
ATOM   3907  O  O     . SER B 1 183 ? 81.89100  138.15900 150.61000 1.000 60.72000  ? 428 SER B O     1 
ATOM   3908  C  CB    . SER B 1 183 ? 82.49300  136.32300 152.89100 1.000 60.72000  ? 428 SER B CB    1 
ATOM   3909  O  OG    . SER B 1 183 ? 83.71400  136.89600 153.32300 1.000 60.72000  ? 428 SER B OG    1 
ATOM   3910  N  N     . SER B 1 184 ? 83.90200  137.41900 149.92200 1.000 59.36000  ? 429 SER B N     1 
ATOM   3911  C  CA    . SER B 1 184 ? 84.12400  138.56200 149.05100 1.000 59.36000  ? 429 SER B CA    1 
ATOM   3912  C  C     . SER B 1 184 ? 83.10600  138.55500 147.91100 1.000 59.36000  ? 429 SER B C     1 
ATOM   3913  O  O     . SER B 1 184 ? 82.62800  137.49300 147.50400 1.000 59.36000  ? 429 SER B O     1 
ATOM   3914  C  CB    . SER B 1 184 ? 85.54200  138.52700 148.48600 1.000 59.36000  ? 429 SER B CB    1 
ATOM   3915  O  OG    . SER B 1 184 ? 85.70700  137.42200 147.61500 1.000 59.36000  ? 429 SER B OG    1 
ATOM   3916  N  N     . PRO B 1 185 ? 82.75900  139.72700 147.36800 1.000 60.37000  ? 430 PRO B N     1 
ATOM   3917  C  CA    . PRO B 1 185 ? 81.71100  139.77300 146.33700 1.000 60.37000  ? 430 PRO B CA    1 
ATOM   3918  C  C     . PRO B 1 185 ? 82.11700  139.15700 145.01100 1.000 60.37000  ? 430 PRO B C     1 
ATOM   3919  O  O     . PRO B 1 185 ? 81.27100  139.06700 144.11300 1.000 60.37000  ? 430 PRO B O     1 
ATOM   3920  C  CB    . PRO B 1 185 ? 81.43500  141.27300 146.18400 1.000 60.37000  ? 430 PRO B CB    1 
ATOM   3921  C  CG    . PRO B 1 185 ? 82.70600  141.92300 146.58100 1.000 60.37000  ? 430 PRO B CG    1 
ATOM   3922  C  CD    . PRO B 1 185 ? 83.28100  141.06900 147.67900 1.000 60.37000  ? 430 PRO B CD    1 
ATOM   3923  N  N     . GLU B 1 186 ? 83.37000  138.73300 144.84900 1.000 59.79000  ? 431 GLU B N     1 
ATOM   3924  C  CA    . GLU B 1 186 ? 83.79200  138.16100 143.57100 1.000 59.79000  ? 431 GLU B CA    1 
ATOM   3925  C  C     . GLU B 1 186 ? 83.40700  136.68600 143.48300 1.000 59.79000  ? 431 GLU B C     1 
ATOM   3926  O  O     . GLU B 1 186 ? 82.95700  136.21100 142.43600 1.000 59.79000  ? 431 GLU B O     1 
ATOM   3927  C  CB    . GLU B 1 186 ? 85.29800  138.36100 143.37700 1.000 59.79000  ? 431 GLU B CB    1 
ATOM   3928  C  CG    . GLU B 1 186 ? 85.80400  137.91400 142.01700 1.000 59.79000  ? 431 GLU B CG    1 
ATOM   3929  C  CD    . GLU B 1 186 ? 87.26400  138.25000 141.79900 1.000 59.79000  ? 431 GLU B CD    1 
ATOM   3930  O  OE1   . GLU B 1 186 ? 87.88300  138.83800 142.71000 1.000 59.79000  ? 431 GLU B OE1   1 
ATOM   3931  O  OE2   . GLU B 1 186 ? 87.79500  137.92500 140.71700 1.000 59.79000  ? 431 GLU B OE2   1 
ATOM   3932  N  N     . TYR B 1 187 ? 83.57700  135.94700 144.58100 1.000 56.13000  ? 432 TYR B N     1 
ATOM   3933  C  CA    . TYR B 1 187 ? 83.11600  134.56300 144.62200 1.000 56.13000  ? 432 TYR B CA    1 
ATOM   3934  C  C     . TYR B 1 187 ? 81.59800  134.49400 144.54600 1.000 56.13000  ? 432 TYR B C     1 
ATOM   3935  O  O     . TYR B 1 187 ? 81.03400  133.66700 143.82100 1.000 56.13000  ? 432 TYR B O     1 
ATOM   3936  C  CB    . TYR B 1 187 ? 83.61100  133.88000 145.89600 1.000 56.13000  ? 432 TYR B CB    1 
ATOM   3937  C  CG    . TYR B 1 187 ? 83.23500  132.42100 145.99200 1.000 56.13000  ? 432 TYR B CG    1 
ATOM   3938  C  CD1   . TYR B 1 187 ? 83.93300  131.45900 145.28000 1.000 56.13000  ? 432 TYR B CD1   1 
ATOM   3939  C  CD2   . TYR B 1 187 ? 82.18100  132.00700 146.79200 1.000 56.13000  ? 432 TYR B CD2   1 
ATOM   3940  C  CE1   . TYR B 1 187 ? 83.59700  130.12700 145.36400 1.000 56.13000  ? 432 TYR B CE1   1 
ATOM   3941  C  CE2   . TYR B 1 187 ? 81.83600  130.67600 146.88000 1.000 56.13000  ? 432 TYR B CE2   1 
ATOM   3942  C  CZ    . TYR B 1 187 ? 82.54800  129.74000 146.16400 1.000 56.13000  ? 432 TYR B CZ    1 
ATOM   3943  O  OH    . TYR B 1 187 ? 82.21000  128.41100 146.24700 1.000 56.13000  ? 432 TYR B OH    1 
ATOM   3944  N  N     . ASP B 1 188 ? 80.92100  135.35900 145.30300 1.000 61.89000  ? 433 ASP B N     1 
ATOM   3945  C  CA    . ASP B 1 188 ? 79.46600  135.33200 145.37500 1.000 61.89000  ? 433 ASP B CA    1 
ATOM   3946  C  C     . ASP B 1 188 ? 78.82000  135.62000 144.02600 1.000 61.89000  ? 433 ASP B C     1 
ATOM   3947  O  O     . ASP B 1 188 ? 77.67300  135.22200 143.79800 1.000 61.89000  ? 433 ASP B O     1 
ATOM   3948  C  CB    . ASP B 1 188 ? 78.99900  136.34900 146.42200 1.000 61.89000  ? 433 ASP B CB    1 
ATOM   3949  C  CG    . ASP B 1 188 ? 77.56100  136.13800 146.85100 1.000 61.89000  ? 433 ASP B CG    1 
ATOM   3950  O  OD1   . ASP B 1 188 ? 76.91300  135.18900 146.36300 1.000 61.89000  ? 433 ASP B OD1   1 
ATOM   3951  O  OD2   . ASP B 1 188 ? 77.07600  136.92800 147.68600 1.000 61.89000  ? 433 ASP B OD2   1 
ATOM   3952  N  N     . GLU B 1 189 ? 79.53600  136.28300 143.11900 1.000 64.37000  ? 434 GLU B N     1 
ATOM   3953  C  CA    . GLU B 1 189 ? 78.99200  136.65100 141.82100 1.000 64.37000  ? 434 GLU B CA    1 
ATOM   3954  C  C     . GLU B 1 189 ? 79.63600  135.92800 140.64800 1.000 64.37000  ? 434 GLU B C     1 
ATOM   3955  O  O     . GLU B 1 189 ? 79.16000  136.08700 139.51900 1.000 64.37000  ? 434 GLU B O     1 
ATOM   3956  C  CB    . GLU B 1 189 ? 79.12600  138.16500 141.59600 1.000 64.37000  ? 434 GLU B CB    1 
ATOM   3957  C  CG    . GLU B 1 189 ? 78.28900  138.99800 142.55100 1.000 64.37000  ? 434 GLU B CG    1 
ATOM   3958  C  CD    . GLU B 1 189 ? 78.46900  140.48400 142.33200 1.000 64.37000  ? 434 GLU B CD    1 
ATOM   3959  O  OE1   . GLU B 1 189 ? 79.33700  140.86100 141.51800 1.000 64.37000  ? 434 GLU B OE1   1 
ATOM   3960  O  OE2   . GLU B 1 189 ? 77.74600  141.27500 142.97500 1.000 64.37000  ? 434 GLU B OE2   1 
ATOM   3961  N  N     . HIS B 1 190 ? 80.69200  135.14700 140.87500 1.000 55.94000  ? 435 HIS B N     1 
ATOM   3962  C  CA    . HIS B 1 190 ? 81.39300  134.47400 139.78800 1.000 55.94000  ? 435 HIS B CA    1 
ATOM   3963  C  C     . HIS B 1 190 ? 80.48500  133.43700 139.13800 1.000 55.94000  ? 435 HIS B C     1 
ATOM   3964  O  O     . HIS B 1 190 ? 80.20000  132.39200 139.73100 1.000 55.94000  ? 435 HIS B O     1 
ATOM   3965  C  CB    . HIS B 1 190 ? 82.67600  133.82300 140.30700 1.000 55.94000  ? 435 HIS B CB    1 
ATOM   3966  C  CG    . HIS B 1 190 ? 83.54800  133.25800 139.23100 1.000 55.94000  ? 435 HIS B CG    1 
ATOM   3967  N  ND1   . HIS B 1 190 ? 84.29800  134.05100 138.39000 1.000 55.94000  ? 435 HIS B ND1   1 
ATOM   3968  C  CD2   . HIS B 1 190 ? 83.79800  131.98000 138.86400 1.000 55.94000  ? 435 HIS B CD2   1 
ATOM   3969  C  CE1   . HIS B 1 190 ? 84.96900  133.28600 137.54800 1.000 55.94000  ? 435 HIS B CE1   1 
ATOM   3970  N  NE2   . HIS B 1 190 ? 84.68300  132.02500 137.81400 1.000 55.94000  ? 435 HIS B NE2   1 
ATOM   3971  N  N     . LYS B 1 191 ? 80.02900  133.72000 137.92000 1.000 57.91000  ? 436 LYS B N     1 
ATOM   3972  C  CA    . LYS B 1 191 ? 79.04300  132.87900 137.24000 1.000 57.91000  ? 436 LYS B CA    1 
ATOM   3973  C  C     . LYS B 1 191 ? 79.72100  131.71000 136.52400 1.000 57.91000  ? 436 LYS B C     1 
ATOM   3974  O  O     . LYS B 1 191 ? 79.74300  131.61400 135.29800 1.000 57.91000  ? 436 LYS B O     1 
ATOM   3975  C  CB    . LYS B 1 191 ? 78.21800  133.71500 136.27000 1.000 57.91000  ? 436 LYS B CB    1 
ATOM   3976  C  CG    . LYS B 1 191 ? 77.30700  134.72500 136.94000 1.000 57.91000  ? 436 LYS B CG    1 
ATOM   3977  C  CD    . LYS B 1 191 ? 76.49400  135.49000 135.91100 1.000 57.91000  ? 436 LYS B CD    1 
ATOM   3978  C  CE    . LYS B 1 191 ? 75.59700  136.51900 136.57500 1.000 57.91000  ? 436 LYS B CE    1 
ATOM   3979  N  NZ    . LYS B 1 191 ? 74.80000  137.28400 135.57700 1.000 57.91000  ? 436 LYS B NZ    1 
ATOM   3980  N  N     . SER B 1 192 ? 80.28200  130.80700 137.32400 1.000 50.58000  ? 437 SER B N     1 
ATOM   3981  C  CA    . SER B 1 192 ? 80.88000  129.58100 136.81500 1.000 50.58000  ? 437 SER B CA    1 
ATOM   3982  C  C     . SER B 1 192 ? 80.53400  128.43500 137.74900 1.000 50.58000  ? 437 SER B C     1 
ATOM   3983  O  O     . SER B 1 192 ? 80.51500  128.61000 138.97100 1.000 50.58000  ? 437 SER B O     1 
ATOM   3984  C  CB    . SER B 1 192 ? 82.39700  129.70500 136.68000 1.000 50.58000  ? 437 SER B CB    1 
ATOM   3985  O  OG    . SER B 1 192 ? 82.95400  128.48600 136.22600 1.000 50.58000  ? 437 SER B OG    1 
ATOM   3986  N  N     . THR B 1 193 ? 80.25900  127.26700 137.17400 1.000 47.03000  ? 438 THR B N     1 
ATOM   3987  C  CA    . THR B 1 193 ? 79.92800  126.09100 137.96600 1.000 47.03000  ? 438 THR B CA    1 
ATOM   3988  C  C     . THR B 1 193 ? 81.15400  125.57000 138.70100 1.000 47.03000  ? 438 THR B C     1 
ATOM   3989  O  O     . THR B 1 193 ? 81.03100  124.77600 139.63700 1.000 47.03000  ? 438 THR B O     1 
ATOM   3990  C  CB    . THR B 1 193 ? 79.35300  124.98800 137.07900 1.000 47.03000  ? 438 THR B CB    1 
ATOM   3991  O  OG1   . THR B 1 193 ? 80.34100  124.57600 136.12900 1.000 47.03000  ? 438 THR B OG1   1 
ATOM   3992  C  CG2   . THR B 1 193 ? 78.12600  125.49300 136.33600 1.000 47.03000  ? 438 THR B CG2   1 
ATOM   3993  N  N     . VAL B 1 194 ? 82.34000  125.99800 138.28000 1.000 45.34000  ? 439 VAL B N     1 
ATOM   3994  C  CA    . VAL B 1 194 ? 83.58500  125.46100 138.82300 1.000 45.34000  ? 439 VAL B CA    1 
ATOM   3995  C  C     . VAL B 1 194 ? 84.56000  126.61000 139.06700 1.000 45.34000  ? 439 VAL B C     1 
ATOM   3996  O  O     . VAL B 1 194 ? 85.44600  126.85600 138.23900 1.000 45.34000  ? 439 VAL B O     1 
ATOM   3997  C  CB    . VAL B 1 194 ? 84.18200  124.40300 137.87800 1.000 45.34000  ? 439 VAL B CB    1 
ATOM   3998  C  CG1   . VAL B 1 194 ? 85.46400  123.84700 138.42600 1.000 45.34000  ? 439 VAL B CG1   1 
ATOM   3999  C  CG2   . VAL B 1 194 ? 83.20200  123.26800 137.64800 1.000 45.34000  ? 439 VAL B CG2   1 
ATOM   4000  N  N     . PRO B 1 195 ? 84.42000  127.35700 140.15900 1.000 45.71000  ? 440 PRO B N     1 
ATOM   4001  C  CA    . PRO B 1 195 ? 85.40500  128.38900 140.48900 1.000 45.71000  ? 440 PRO B CA    1 
ATOM   4002  C  C     . PRO B 1 195 ? 86.49600  127.86100 141.40800 1.000 45.71000  ? 440 PRO B C     1 
ATOM   4003  O  O     . PRO B 1 195 ? 86.37200  126.80800 142.03000 1.000 45.71000  ? 440 PRO B O     1 
ATOM   4004  C  CB    . PRO B 1 195 ? 84.56400  129.44800 141.21400 1.000 45.71000  ? 440 PRO B CB    1 
ATOM   4005  C  CG    . PRO B 1 195 ? 83.51400  128.64900 141.88500 1.000 45.71000  ? 440 PRO B CG    1 
ATOM   4006  C  CD    . PRO B 1 195 ? 83.19500  127.49800 140.96700 1.000 45.71000  ? 440 PRO B CD    1 
ATOM   4007  N  N     . LEU B 1 196 ? 87.57600  128.63200 141.48800 1.000 41.74000  ? 441 LEU B N     1 
ATOM   4008  C  CA    . LEU B 1 196 ? 88.68400  128.33100 142.38500 1.000 41.74000  ? 441 LEU B CA    1 
ATOM   4009  C  C     . LEU B 1 196 ? 89.02100  129.58700 143.17000 1.000 41.74000  ? 441 LEU B C     1 
ATOM   4010  O  O     . LEU B 1 196 ? 89.29200  130.63400 142.57500 1.000 41.74000  ? 441 LEU B O     1 
ATOM   4011  C  CB    . LEU B 1 196 ? 89.90700  127.84300 141.60900 1.000 41.74000  ? 441 LEU B CB    1 
ATOM   4012  C  CG    . LEU B 1 196 ? 89.74700  126.54100 140.83100 1.000 41.74000  ? 441 LEU B CG    1 
ATOM   4013  C  CD1   . LEU B 1 196 ? 91.02300  126.23900 140.07700 1.000 41.74000  ? 441 LEU B CD1   1 
ATOM   4014  C  CD2   . LEU B 1 196 ? 89.37600  125.39800 141.75200 1.000 41.74000  ? 441 LEU B CD2   1 
ATOM   4015  N  N     . ALA B 1 197 ? 89.00400  129.48600 144.49600 1.000 44.37000  ? 442 ALA B N     1 
ATOM   4016  C  CA    . ALA B 1 197 ? 89.35400  130.60600 145.36800 1.000 44.37000  ? 442 ALA B CA    1 
ATOM   4017  C  C     . ALA B 1 197 ? 90.76100  130.35200 145.89000 1.000 44.37000  ? 442 ALA B C     1 
ATOM   4018  O  O     . ALA B 1 197 ? 90.95900  129.68000 146.90200 1.000 44.37000  ? 442 ALA B O     1 
ATOM   4019  C  CB    . ALA B 1 197 ? 88.34600  130.76200 146.49900 1.000 44.37000  ? 442 ALA B CB    1 
ATOM   4020  N  N     . LEU B 1 198 ? 91.74900  130.90300 145.18700 1.000 42.17000  ? 443 LEU B N     1 
ATOM   4021  C  CA    . LEU B 1 198 ? 93.14000  130.66300 145.55100 1.000 42.17000  ? 443 LEU B CA    1 
ATOM   4022  C  C     . LEU B 1 198 ? 93.50700  131.39200 146.83700 1.000 42.17000  ? 443 LEU B C     1 
ATOM   4023  O  O     . LEU B 1 198 ? 94.09900  130.80300 147.74900 1.000 42.17000  ? 443 LEU B O     1 
ATOM   4024  C  CB    . LEU B 1 198 ? 94.05100  131.08400 144.40100 1.000 42.17000  ? 443 LEU B CB    1 
ATOM   4025  C  CG    . LEU B 1 198 ? 93.83000  130.25600 143.13700 1.000 42.17000  ? 443 LEU B CG    1 
ATOM   4026  C  CD1   . LEU B 1 198 ? 94.65600  130.79600 141.99000 1.000 42.17000  ? 443 LEU B CD1   1 
ATOM   4027  C  CD2   . LEU B 1 198 ? 94.15400  128.79900 143.40000 1.000 42.17000  ? 443 LEU B CD2   1 
ATOM   4028  N  N     . GLY B 1 199 ? 93.16000  132.66500 146.93400 1.000 50.14000  ? 444 GLY B N     1 
ATOM   4029  C  CA    . GLY B 1 199 ? 93.42300  133.43800 148.12900 1.000 50.14000  ? 444 GLY B CA    1 
ATOM   4030  C  C     . GLY B 1 199 ? 93.60600  134.90200 147.78500 1.000 50.14000  ? 444 GLY B C     1 
ATOM   4031  O  O     . GLY B 1 199 ? 93.20300  135.35500 146.71900 1.000 50.14000  ? 444 GLY B O     1 
ATOM   4032  N  N     . HIS B 1 200 ? 94.21800  135.62700 148.71600 1.000 56.41000  ? 445 HIS B N     1 
ATOM   4033  C  CA    . HIS B 1 200 ? 94.50000  137.04100 148.52900 1.000 56.41000  ? 445 HIS B CA    1 
ATOM   4034  C  C     . HIS B 1 200 ? 95.81000  137.23400 147.78000 1.000 56.41000  ? 445 HIS B C     1 
ATOM   4035  O  O     . HIS B 1 200 ? 96.74300  136.43700 147.90300 1.000 56.41000  ? 445 HIS B O     1 
ATOM   4036  C  CB    . HIS B 1 200 ? 94.56900  137.76800 149.87200 1.000 56.41000  ? 445 HIS B CB    1 
ATOM   4037  C  CG    . HIS B 1 200 ? 93.25000  137.88700 150.56900 1.000 56.41000  ? 445 HIS B CG    1 
ATOM   4038  N  ND1   . HIS B 1 200 ? 92.77300  136.92400 151.43000 1.000 56.41000  ? 445 HIS B ND1   1 
ATOM   4039  C  CD2   . HIS B 1 200 ? 92.31100  138.86200 150.53900 1.000 56.41000  ? 445 HIS B CD2   1 
ATOM   4040  C  CE1   . HIS B 1 200 ? 91.59600  137.29800 151.89700 1.000 56.41000  ? 445 HIS B CE1   1 
ATOM   4041  N  NE2   . HIS B 1 200 ? 91.29200  138.47000 151.37100 1.000 56.41000  ? 445 HIS B NE2   1 
ATOM   4042  N  N     . ASP B 1 201 ? 95.86600  138.30200 146.99400 1.000 55.86000  ? 446 ASP B N     1 
ATOM   4043  C  CA    . ASP B 1 201 ? 97.08500  138.68600 146.29800 1.000 55.86000  ? 446 ASP B CA    1 
ATOM   4044  C  C     . ASP B 1 201 ? 97.96600  139.50700 147.23900 1.000 55.86000  ? 446 ASP B C     1 
ATOM   4045  O  O     . ASP B 1 201 ? 97.74700  139.55000 148.45200 1.000 55.86000  ? 446 ASP B O     1 
ATOM   4046  C  CB    . ASP B 1 201 ? 96.74500  139.42800 145.00800 1.000 55.86000  ? 446 ASP B CB    1 
ATOM   4047  C  CG    . ASP B 1 201 ? 95.94200  140.69400 145.25100 1.000 55.86000  ? 446 ASP B CG    1 
ATOM   4048  O  OD1   . ASP B 1 201 ? 95.59900  140.98000 146.41700 1.000 55.86000  ? 446 ASP B OD1   1 
ATOM   4049  O  OD2   . ASP B 1 201 ? 95.65100  141.40600 144.26800 1.000 55.86000  ? 446 ASP B OD2   1 
ATOM   4050  N  N     . ILE B 1 202 ? 98.99100  140.15800 146.68400 1.000 55.41000  ? 447 ILE B N     1 
ATOM   4051  C  CA    . ILE B 1 202 ? 99.88400  140.98800 147.49100 1.000 55.41000  ? 447 ILE B CA    1 
ATOM   4052  C  C     . ILE B 1 202 ? 99.09400  142.06100 148.23000 1.000 55.41000  ? 447 ILE B C     1 
ATOM   4053  O  O     . ILE B 1 202 ? 99.09200  142.11800 149.46500 1.000 55.41000  ? 447 ILE B O     1 
ATOM   4054  C  CB    . ILE B 1 202 ? 100.97900 141.61400 146.61000 1.000 55.41000  ? 447 ILE B CB    1 
ATOM   4055  C  CG1   . ILE B 1 202 ? 101.91300 140.53600 146.06600 1.000 55.41000  ? 447 ILE B CG1   1 
ATOM   4056  C  CG2   . ILE B 1 202 ? 101.74500 142.67100 147.38300 1.000 55.41000  ? 447 ILE B CG2   1 
ATOM   4057  C  CD1   . ILE B 1 202 ? 102.85700 141.03900 144.99900 1.000 55.41000  ? 447 ILE B CD1   1 
ATOM   4058  N  N     . GLY B 1 203 ? 98.41100  142.92600 147.48000 1.000 60.62000  ? 448 GLY B N     1 
ATOM   4059  C  CA    . GLY B 1 203 ? 97.70900  144.03700 148.09700 1.000 60.62000  ? 448 GLY B CA    1 
ATOM   4060  C  C     . GLY B 1 203 ? 96.60200  143.60800 149.03700 1.000 60.62000  ? 448 GLY B C     1 
ATOM   4061  O  O     . GLY B 1 203 ? 96.31200  144.29800 150.01800 1.000 60.62000  ? 448 GLY B O     1 
ATOM   4062  N  N     . GLY B 1 204 ? 95.97700  142.46900 148.76500 1.000 57.91000  ? 449 GLY B N     1 
ATOM   4063  C  CA    . GLY B 1 204 ? 94.85700  142.00200 149.55100 1.000 57.91000  ? 449 GLY B CA    1 
ATOM   4064  C  C     . GLY B 1 204 ? 93.57100  141.80300 148.78200 1.000 57.91000  ? 449 GLY B C     1 
ATOM   4065  O  O     . GLY B 1 204 ? 92.51800  141.63800 149.40800 1.000 57.91000  ? 449 GLY B O     1 
ATOM   4066  N  N     . ARG B 1 205 ? 93.61500  141.82900 147.45500 1.000 56.76000  ? 450 ARG B N     1 
ATOM   4067  C  CA    . ARG B 1 205 ? 92.42900  141.53000 146.67200 1.000 56.76000  ? 450 ARG B CA    1 
ATOM   4068  C  C     . ARG B 1 205 ? 92.25700  140.01800 146.55600 1.000 56.76000  ? 450 ARG B C     1 
ATOM   4069  O  O     . ARG B 1 205 ? 93.24200  139.29200 146.39300 1.000 56.76000  ? 450 ARG B O     1 
ATOM   4070  C  CB    . ARG B 1 205 ? 92.53100  142.15000 145.27800 1.000 56.76000  ? 450 ARG B CB    1 
ATOM   4071  C  CG    . ARG B 1 205 ? 92.27200  143.64800 145.22600 1.000 56.76000  ? 450 ARG B CG    1 
ATOM   4072  C  CD    . ARG B 1 205 ? 93.53600  144.44400 145.50000 1.000 56.76000  ? 450 ARG B CD    1 
ATOM   4073  N  NE    . ARG B 1 205 ? 93.35900  145.86200 145.20600 1.000 56.76000  ? 450 ARG B NE    1 
ATOM   4074  C  CZ    . ARG B 1 205 ? 92.99600  146.77200 146.10400 1.000 56.76000  ? 450 ARG B CZ    1 
ATOM   4075  N  NH1   . ARG B 1 205 ? 92.76900  146.41400 147.36000 1.000 56.76000  ? 450 ARG B NH1   1 
ATOM   4076  N  NH2   . ARG B 1 205 ? 92.85800  148.04100 145.74600 1.000 56.76000  ? 450 ARG B NH2   1 
ATOM   4077  N  N     . PRO B 1 206 ? 91.02800  139.51200 146.64000 1.000 53.73000  ? 451 PRO B N     1 
ATOM   4078  C  CA    . PRO B 1 206 ? 90.82000  138.06600 146.49800 1.000 53.73000  ? 451 PRO B CA    1 
ATOM   4079  C  C     . PRO B 1 206 ? 90.98800  137.63500 145.04900 1.000 53.73000  ? 451 PRO B C     1 
ATOM   4080  O  O     . PRO B 1 206 ? 90.35600  138.18600 144.14600 1.000 53.73000  ? 451 PRO B O     1 
ATOM   4081  C  CB    . PRO B 1 206 ? 89.38100  137.86700 146.98400 1.000 53.73000  ? 451 PRO B CB    1 
ATOM   4082  C  CG    . PRO B 1 206 ? 88.72300  139.17500 146.71800 1.000 53.73000  ? 451 PRO B CG    1 
ATOM   4083  C  CD    . PRO B 1 206 ? 89.77400  140.22600 146.93500 1.000 53.73000  ? 451 PRO B CD    1 
ATOM   4084  N  N     . ILE B 1 207 ? 91.84800  136.64600 144.83300 1.000 47.30000  ? 452 ILE B N     1 
ATOM   4085  C  CA    . ILE B 1 207 ? 92.08900  136.09100 143.50800 1.000 47.30000  ? 452 ILE B CA    1 
ATOM   4086  C  C     . ILE B 1 207 ? 91.21800  134.85400 143.35700 1.000 47.30000  ? 452 ILE B C     1 
ATOM   4087  O  O     . ILE B 1 207 ? 91.35600  133.89200 144.12100 1.000 47.30000  ? 452 ILE B O     1 
ATOM   4088  C  CB    . ILE B 1 207 ? 93.57100  135.75100 143.29900 1.000 47.30000  ? 452 ILE B CB    1 
ATOM   4089  C  CG1   . ILE B 1 207 ? 94.42800  137.00200 143.47000 1.000 47.30000  ? 452 ILE B CG1   1 
ATOM   4090  C  CG2   . ILE B 1 207 ? 93.78300  135.16000 141.92300 1.000 47.30000  ? 452 ILE B CG2   1 
ATOM   4091  C  CD1   . ILE B 1 207 ? 94.10300  138.09200 142.48400 1.000 47.30000  ? 452 ILE B CD1   1 
ATOM   4092  N  N     . ILE B 1 208 ? 90.32400  134.87500 142.37300 1.000 48.57000  ? 453 ILE B N     1 
ATOM   4093  C  CA    . ILE B 1 208 ? 89.36600  133.79700 142.15300 1.000 48.57000  ? 453 ILE B CA    1 
ATOM   4094  C  C     . ILE B 1 208 ? 89.31200  133.53500 140.65600 1.000 48.57000  ? 453 ILE B C     1 
ATOM   4095  O  O     . ILE B 1 208 ? 88.72700  134.32500 139.90700 1.000 48.57000  ? 453 ILE B O     1 
ATOM   4096  C  CB    . ILE B 1 208 ? 87.97100  134.13600 142.69300 1.000 48.57000  ? 453 ILE B CB    1 
ATOM   4097  C  CG1   . ILE B 1 208 ? 88.02700  134.31900 144.20800 1.000 48.57000  ? 453 ILE B CG1   1 
ATOM   4098  C  CG2   . ILE B 1 208 ? 86.98300  133.04500 142.33800 1.000 48.57000  ? 453 ILE B CG2   1 
ATOM   4099  C  CD1   . ILE B 1 208 ? 86.80100  134.95900 144.78200 1.000 48.57000  ? 453 ILE B CD1   1 
ATOM   4100  N  N     . THR B 1 209 ? 89.91400  132.43500 140.21800 1.000 45.17000  ? 454 THR B N     1 
ATOM   4101  C  CA    . THR B 1 209 ? 90.02700  132.10500 138.80500 1.000 45.17000  ? 454 THR B CA    1 
ATOM   4102  C  C     . THR B 1 209 ? 89.12900  130.92500 138.46900 1.000 45.17000  ? 454 THR B C     1 
ATOM   4103  O  O     . THR B 1 209 ? 89.16800  129.89500 139.15000 1.000 45.17000  ? 454 THR B O     1 
ATOM   4104  C  CB    . THR B 1 209 ? 91.47400  131.78200 138.42900 1.000 45.17000  ? 454 THR B CB    1 
ATOM   4105  O  OG1   . THR B 1 209 ? 91.92400  130.65100 139.18400 1.000 45.17000  ? 454 THR B OG1   1 
ATOM   4106  C  CG2   . THR B 1 209 ? 92.37400  132.97000 138.71600 1.000 45.17000  ? 454 THR B CG2   1 
ATOM   4107  N  N     . ASP B 1 210 ? 88.31600  131.08600 137.42900 1.000 43.69000  ? 455 ASP B N     1 
ATOM   4108  C  CA    . ASP B 1 210 ? 87.52900  129.98000 136.90800 1.000 43.69000  ? 455 ASP B CA    1 
ATOM   4109  C  C     . ASP B 1 210 ? 88.44500  128.83900 136.48200 1.000 43.69000  ? 455 ASP B C     1 
ATOM   4110  O  O     . ASP B 1 210 ? 89.59600  129.05100 136.09300 1.000 43.69000  ? 455 ASP B O     1 
ATOM   4111  C  CB    . ASP B 1 210 ? 86.68600  130.45600 135.72400 1.000 43.69000  ? 455 ASP B CB    1 
ATOM   4112  C  CG    . ASP B 1 210 ? 85.66300  129.43200 135.27900 1.000 43.69000  ? 455 ASP B CG    1 
ATOM   4113  O  OD1   . ASP B 1 210 ? 85.62200  128.32900 135.86200 1.000 43.69000  ? 455 ASP B OD1   1 
ATOM   4114  O  OD2   . ASP B 1 210 ? 84.89200  129.73600 134.34500 1.000 43.69000  ? 455 ASP B OD2   1 
ATOM   4115  N  N     . LEU B 1 211 ? 87.92600  127.61600 136.56200 1.000 37.11000  ? 456 LEU B N     1 
ATOM   4116  C  CA    . LEU B 1 211 ? 88.67500  126.43400 136.15300 1.000 37.11000  ? 456 LEU B CA    1 
ATOM   4117  C  C     . LEU B 1 211 ? 88.34300  125.98600 134.74000 1.000 37.11000  ? 456 LEU B C     1 
ATOM   4118  O  O     . LEU B 1 211 ? 89.22900  125.51700 134.02100 1.000 37.11000  ? 456 LEU B O     1 
ATOM   4119  C  CB    . LEU B 1 211 ? 88.42900  125.27800 137.12800 1.000 37.11000  ? 456 LEU B CB    1 
ATOM   4120  C  CG    . LEU B 1 211 ? 89.14600  123.96300 136.81800 1.000 37.11000  ? 456 LEU B CG    1 
ATOM   4121  C  CD1   . LEU B 1 211 ? 90.63500  124.17400 136.76500 1.000 37.11000  ? 456 LEU B CD1   1 
ATOM   4122  C  CD2   . LEU B 1 211 ? 88.82100  122.92100 137.86100 1.000 37.11000  ? 456 LEU B CD2   1 
ATOM   4123  N  N     . ALA B 1 212 ? 87.09100  126.13500 134.31400 1.000 38.88000  ? 457 ALA B N     1 
ATOM   4124  C  CA    . ALA B 1 212 ? 86.71700  125.76400 132.95600 1.000 38.88000  ? 457 ALA B CA    1 
ATOM   4125  C  C     . ALA B 1 212 ? 87.41200  126.60600 131.89600 1.000 38.88000  ? 457 ALA B C     1 
ATOM   4126  O  O     . ALA B 1 212 ? 87.21900  126.34200 130.70500 1.000 38.88000  ? 457 ALA B O     1 
ATOM   4127  C  CB    . ALA B 1 212 ? 85.20100  125.86700 132.78400 1.000 38.88000  ? 457 ALA B CB    1 
ATOM   4128  N  N     . LYS B 1 213 ? 88.20500  127.60300 132.28800 1.000 39.49000  ? 458 LYS B N     1 
ATOM   4129  C  CA    . LYS B 1 213 ? 88.94900  128.42500 131.34900 1.000 39.49000  ? 458 LYS B CA    1 
ATOM   4130  C  C     . LYS B 1 213 ? 90.43000  128.08500 131.28700 1.000 39.49000  ? 458 LYS B C     1 
ATOM   4131  O  O     . LYS B 1 213 ? 91.13100  128.61900 130.42100 1.000 39.49000  ? 458 LYS B O     1 
ATOM   4132  C  CB    . LYS B 1 213 ? 88.80000  129.91000 131.70700 1.000 39.49000  ? 458 LYS B CB    1 
ATOM   4133  C  CG    . LYS B 1 213 ? 87.38000  130.43000 131.64600 1.000 39.49000  ? 458 LYS B CG    1 
ATOM   4134  C  CD    . LYS B 1 213 ? 86.82900  130.35200 130.23600 1.000 39.49000  ? 458 LYS B CD    1 
ATOM   4135  C  CE    . LYS B 1 213 ? 87.55800  131.31000 129.31100 1.000 39.49000  ? 458 LYS B CE    1 
ATOM   4136  N  NZ    . LYS B 1 213 ? 87.34300  132.72700 129.70900 1.000 39.49000  ? 458 LYS B NZ    1 
ATOM   4137  N  N     . MET B 1 214 ? 90.92600  127.22700 132.17200 1.000 37.22000  ? 459 MET B N     1 
ATOM   4138  C  CA    . MET B 1 214 ? 92.36400  127.02100 132.26800 1.000 37.22000  ? 459 MET B CA    1 
ATOM   4139  C  C     . MET B 1 214 ? 92.91200  126.18300 131.11400 1.000 37.22000  ? 459 MET B C     1 
ATOM   4140  O  O     . MET B 1 214 ? 93.86200  126.61700 130.45400 1.000 37.22000  ? 459 MET B O     1 
ATOM   4141  C  CB    . MET B 1 214 ? 92.72900  126.39500 133.61400 1.000 37.22000  ? 459 MET B CB    1 
ATOM   4142  C  CG    . MET B 1 214 ? 92.58100  127.34900 134.78700 1.000 37.22000  ? 459 MET B CG    1 
ATOM   4143  S  SD    . MET B 1 214 ? 93.09600  126.62600 136.35000 1.000 37.22000  ? 459 MET B SD    1 
ATOM   4144  C  CE    . MET B 1 214 ? 92.76500  127.98100 137.46600 1.000 37.22000  ? 459 MET B CE    1 
ATOM   4145  N  N     . PRO B 1 215 ? 92.35800  124.99300 130.81000 1.000 33.53000  ? 460 PRO B N     1 
ATOM   4146  C  CA    . PRO B 1 215 ? 91.26400  124.20400 131.38700 1.000 33.53000  ? 460 PRO B CA    1 
ATOM   4147  C  C     . PRO B 1 215 ? 91.74200  123.11000 132.33300 1.000 33.53000  ? 460 PRO B C     1 
ATOM   4148  O  O     . PRO B 1 215 ? 90.93500  122.32600 132.82300 1.000 33.53000  ? 460 PRO B O     1 
ATOM   4149  C  CB    . PRO B 1 215 ? 90.61500  123.58100 130.16300 1.000 33.53000  ? 460 PRO B CB    1 
ATOM   4150  C  CG    . PRO B 1 215 ? 91.77000  123.35700 129.25600 1.000 33.53000  ? 460 PRO B CG    1 
ATOM   4151  C  CD    . PRO B 1 215 ? 92.71800  124.49900 129.47400 1.000 33.53000  ? 460 PRO B CD    1 
ATOM   4152  N  N     . HIS B 1 216 ? 93.04600  123.05300 132.57800 1.000 33.93000  ? 461 HIS B N     1 
ATOM   4153  C  CA    . HIS B 1 216 ? 93.62800  122.05500 133.46000 1.000 33.93000  ? 461 HIS B CA    1 
ATOM   4154  C  C     . HIS B 1 216 ? 94.49900  122.79300 134.46600 1.000 33.93000  ? 461 HIS B C     1 
ATOM   4155  O  O     . HIS B 1 216 ? 94.54000  124.02500 134.48200 1.000 33.93000  ? 461 HIS B O     1 
ATOM   4156  C  CB    . HIS B 1 216 ? 94.39400  121.00500 132.64800 1.000 33.93000  ? 461 HIS B CB    1 
ATOM   4157  C  CG    . HIS B 1 216 ? 93.53900  120.26300 131.66700 1.000 33.93000  ? 461 HIS B CG    1 
ATOM   4158  N  ND1   . HIS B 1 216 ? 92.64400  119.28700 132.04600 1.000 33.93000  ? 461 HIS B ND1   1 
ATOM   4159  C  CD2   . HIS B 1 216 ? 93.44200  120.35900 130.32000 1.000 33.93000  ? 461 HIS B CD2   1 
ATOM   4160  C  CE1   . HIS B 1 216 ? 92.03400  118.81200 130.97500 1.000 33.93000  ? 461 HIS B CE1   1 
ATOM   4161  N  NE2   . HIS B 1 216 ? 92.50100  119.44500 129.91400 1.000 33.93000  ? 461 HIS B NE2   1 
ATOM   4162  N  N     . LEU B 1 217 ? 95.21800  122.05700 135.30700 1.000 32.09000  ? 462 LEU B N     1 
ATOM   4163  C  CA    . LEU B 1 217 ? 95.91600  122.71900 136.40000 1.000 32.09000  ? 462 LEU B CA    1 
ATOM   4164  C  C     . LEU B 1 217 ? 96.99100  121.80300 136.95700 1.000 32.09000  ? 462 LEU B C     1 
ATOM   4165  O  O     . LEU B 1 217 ? 96.76900  120.60200 137.11500 1.000 32.09000  ? 462 LEU B O     1 
ATOM   4166  C  CB    . LEU B 1 217 ? 94.93100  123.12000 137.50200 1.000 32.09000  ? 462 LEU B CB    1 
ATOM   4167  C  CG    . LEU B 1 217 ? 95.49200  123.92900 138.66400 1.000 32.09000  ? 462 LEU B CG    1 
ATOM   4168  C  CD1   . LEU B 1 217 ? 96.05700  125.22200 138.14300 1.000 32.09000  ? 462 LEU B CD1   1 
ATOM   4169  C  CD2   . LEU B 1 217 ? 94.40000  124.20400 139.67200 1.000 32.09000  ? 462 LEU B CD2   1 
ATOM   4170  N  N     . LEU B 1 218 ? 98.14900  122.38400 137.26600 1.000 35.00000  ? 463 LEU B N     1 
ATOM   4171  C  CA    . LEU B 1 218 ? 99.31200  121.63400 137.73900 1.000 35.00000  ? 463 LEU B CA    1 
ATOM   4172  C  C     . LEU B 1 218 ? 99.80800  122.25500 139.04100 1.000 35.00000  ? 463 LEU B C     1 
ATOM   4173  O  O     . LEU B 1 218 ? 100.67900 123.12800 139.03400 1.000 35.00000  ? 463 LEU B O     1 
ATOM   4174  C  CB    . LEU B 1 218 ? 100.40100 121.61300 136.67900 1.000 35.00000  ? 463 LEU B CB    1 
ATOM   4175  C  CG    . LEU B 1 218 ? 101.65200 120.82500 137.04500 1.000 35.00000  ? 463 LEU B CG    1 
ATOM   4176  C  CD1   . LEU B 1 218 ? 101.29600 119.38000 137.29600 1.000 35.00000  ? 463 LEU B CD1   1 
ATOM   4177  C  CD2   . LEU B 1 218 ? 102.66600 120.94100 135.93300 1.000 35.00000  ? 463 LEU B CD2   1 
ATOM   4178  N  N     . VAL B 1 219 ? 99.25100  121.79900 140.16200 1.000 37.54000  ? 464 VAL B N     1 
ATOM   4179  C  CA    . VAL B 1 219 ? 99.73200  122.23000 141.46700 1.000 37.54000  ? 464 VAL B CA    1 
ATOM   4180  C  C     . VAL B 1 219 ? 101.04400 121.51900 141.76500 1.000 37.54000  ? 464 VAL B C     1 
ATOM   4181  O  O     . VAL B 1 219 ? 101.17700 120.31100 141.53500 1.000 37.54000  ? 464 VAL B O     1 
ATOM   4182  C  CB    . VAL B 1 219 ? 98.67800  121.94000 142.54400 1.000 37.54000  ? 464 VAL B CB    1 
ATOM   4183  C  CG1   . VAL B 1 219 ? 99.19500  122.32000 143.91200 1.000 37.54000  ? 464 VAL B CG1   1 
ATOM   4184  C  CG2   . VAL B 1 219 ? 97.39300  122.67900 142.23800 1.000 37.54000  ? 464 VAL B CG2   1 
ATOM   4185  N  N     . ALA B 1 220 ? 102.02500 122.26200 142.27500 1.000 37.05000  ? 465 ALA B N     1 
ATOM   4186  C  CA    . ALA B 1 220 ? 103.34300 121.68800 142.49400 1.000 37.05000  ? 465 ALA B CA    1 
ATOM   4187  C  C     . ALA B 1 220 ? 104.05200 122.41800 143.62500 1.000 37.05000  ? 465 ALA B C     1 
ATOM   4188  O  O     . ALA B 1 220 ? 103.64800 123.50500 144.04200 1.000 37.05000  ? 465 ALA B O     1 
ATOM   4189  C  CB    . ALA B 1 220 ? 104.18100 121.73200 141.21700 1.000 37.05000  ? 465 ALA B CB    1 
ATOM   4190  N  N     . GLY B 1 221 ? 105.11700 121.80000 144.11200 1.000 36.74000  ? 466 GLY B N     1 
ATOM   4191  C  CA    . GLY B 1 221 ? 105.85700 122.32400 145.24100 1.000 36.74000  ? 466 GLY B CA    1 
ATOM   4192  C  C     . GLY B 1 221 ? 106.66700 121.22400 145.89100 1.000 36.74000  ? 466 GLY B C     1 
ATOM   4193  O  O     . GLY B 1 221 ? 106.72400 120.09400 145.40800 1.000 36.74000  ? 466 GLY B O     1 
ATOM   4194  N  N     . THR B 1 222 ? 107.30200 121.58300 147.00100 1.000 38.67000  ? 467 THR B N     1 
ATOM   4195  C  CA    . THR B 1 222 ? 108.07800 120.63700 147.78800 1.000 38.67000  ? 467 THR B CA    1 
ATOM   4196  C  C     . THR B 1 222 ? 107.30000 120.21000 149.02500 1.000 38.67000  ? 467 THR B C     1 
ATOM   4197  O  O     . THR B 1 222 ? 106.27500 120.79300 149.38100 1.000 38.67000  ? 467 THR B O     1 
ATOM   4198  C  CB    . THR B 1 222 ? 109.42300 121.23700 148.20400 1.000 38.67000  ? 467 THR B CB    1 
ATOM   4199  O  OG1   . THR B 1 222 ? 109.20300 122.42400 148.97400 1.000 38.67000  ? 467 THR B OG1   1 
ATOM   4200  C  CG2   . THR B 1 222 ? 110.24700 121.57100 146.98900 1.000 38.67000  ? 467 THR B CG2   1 
ATOM   4201  N  N     . THR B 1 223 ? 107.81100 119.17100 149.68500 1.000 43.74000  ? 468 THR B N     1 
ATOM   4202  C  CA    . THR B 1 223 ? 107.19900 118.66200 150.90500 1.000 43.74000  ? 468 THR B CA    1 
ATOM   4203  C  C     . THR B 1 223 ? 107.20900 119.72600 151.99500 1.000 43.74000  ? 468 THR B C     1 
ATOM   4204  O  O     . THR B 1 223 ? 108.27300 120.11700 152.48100 1.000 43.74000  ? 468 THR B O     1 
ATOM   4205  C  CB    . THR B 1 223 ? 107.92300 117.40400 151.38800 1.000 43.74000  ? 468 THR B CB    1 
ATOM   4206  O  OG1   . THR B 1 223 ? 109.29000 117.71600 151.68100 1.000 43.74000  ? 468 THR B OG1   1 
ATOM   4207  C  CG2   . THR B 1 223 ? 107.87700 116.32700 150.32300 1.000 43.74000  ? 468 THR B CG2   1 
ATOM   4208  N  N     . GLY B 1 224 ? 106.03000 120.20100 152.38000 1.000 43.67000  ? 469 GLY B N     1 
ATOM   4209  C  CA    . GLY B 1 224 ? 105.90800 121.23500 153.38300 1.000 43.67000  ? 469 GLY B CA    1 
ATOM   4210  C  C     . GLY B 1 224 ? 105.51600 122.59700 152.86000 1.000 43.67000  ? 469 GLY B C     1 
ATOM   4211  O  O     . GLY B 1 224 ? 105.48800 123.55500 153.64100 1.000 43.67000  ? 469 GLY B O     1 
ATOM   4212  N  N     . SER B 1 225 ? 105.20900 122.71900 151.57200 1.000 42.39000  ? 470 SER B N     1 
ATOM   4213  C  CA    . SER B 1 225 ? 104.86400 124.00900 150.99100 1.000 42.39000  ? 470 SER B CA    1 
ATOM   4214  C  C     . SER B 1 225 ? 103.39200 124.35100 151.19500 1.000 42.39000  ? 470 SER B C     1 
ATOM   4215  O  O     . SER B 1 225 ? 103.05400 125.51100 151.44700 1.000 42.39000  ? 470 SER B O     1 
ATOM   4216  C  CB    . SER B 1 225 ? 105.21400 124.01700 149.50300 1.000 42.39000  ? 470 SER B CB    1 
ATOM   4217  O  OG    . SER B 1 225 ? 104.42300 123.08000 148.80100 1.000 42.39000  ? 470 SER B OG    1 
ATOM   4218  N  N     . GLY B 1 226 ? 102.50900 123.36000 151.10700 1.000 45.10000  ? 471 GLY B N     1 
ATOM   4219  C  CA    . GLY B 1 226 ? 101.09600 123.61300 151.29700 1.000 45.10000  ? 471 GLY B CA    1 
ATOM   4220  C  C     . GLY B 1 226 ? 100.23300 123.25600 150.10700 1.000 45.10000  ? 471 GLY B C     1 
ATOM   4221  O  O     . GLY B 1 226 ? 99.17100  123.85100 149.90400 1.000 45.10000  ? 471 GLY B O     1 
ATOM   4222  N  N     . LYS B 1 227 ? 100.67400 122.28800 149.30600 1.000 43.94000  ? 472 LYS B N     1 
ATOM   4223  C  CA    . LYS B 1 227 ? 99.96200  121.90200 148.09900 1.000 43.94000  ? 472 LYS B CA    1 
ATOM   4224  C  C     . LYS B 1 227 ? 98.78500  120.97500 148.37700 1.000 43.94000  ? 472 LYS B C     1 
ATOM   4225  O  O     . LYS B 1 227 ? 98.20100  120.43500 147.43200 1.000 43.94000  ? 472 LYS B O     1 
ATOM   4226  C  CB    . LYS B 1 227 ? 100.91600 121.22800 147.11600 1.000 43.94000  ? 472 LYS B CB    1 
ATOM   4227  C  CG    . LYS B 1 227 ? 101.39700 119.88100 147.59400 1.000 43.94000  ? 472 LYS B CG    1 
ATOM   4228  C  CD    . LYS B 1 227 ? 102.26300 119.21500 146.56300 1.000 43.94000  ? 472 LYS B CD    1 
ATOM   4229  C  CE    . LYS B 1 227 ? 103.60500 119.88500 146.49800 1.000 43.94000  ? 472 LYS B CE    1 
ATOM   4230  N  NZ    . LYS B 1 227 ? 104.35600 119.68300 147.76100 1.000 43.94000  ? 472 LYS B NZ    1 
ATOM   4231  N  N     . SER B 1 228 ? 98.42800  120.77000 149.64300 1.000 46.00000  ? 473 SER B N     1 
ATOM   4232  C  CA    . SER B 1 228 ? 97.26200  119.96300 149.97500 1.000 46.00000  ? 473 SER B CA    1 
ATOM   4233  C  C     . SER B 1 228 ? 96.18600  120.83800 150.59500 1.000 46.00000  ? 473 SER B C     1 
ATOM   4234  O  O     . SER B 1 228 ? 94.99400  120.64000 150.34300 1.000 46.00000  ? 473 SER B O     1 
ATOM   4235  C  CB    . SER B 1 228 ? 97.64000  118.81700 150.91200 1.000 46.00000  ? 473 SER B CB    1 
ATOM   4236  O  OG    . SER B 1 228 ? 98.47500  117.88600 150.24900 1.000 46.00000  ? 473 SER B OG    1 
ATOM   4237  N  N     . VAL B 1 229 ? 96.59300  121.82900 151.38400 1.000 44.21000  ? 474 VAL B N     1 
ATOM   4238  C  CA    . VAL B 1 229 ? 95.65900  122.83100 151.88000 1.000 44.21000  ? 474 VAL B CA    1 
ATOM   4239  C  C     . VAL B 1 229 ? 95.20300  123.66300 150.68900 1.000 44.21000  ? 474 VAL B C     1 
ATOM   4240  O  O     . VAL B 1 229 ? 94.13100  124.27800 150.71300 1.000 44.21000  ? 474 VAL B O     1 
ATOM   4241  C  CB    . VAL B 1 229 ? 96.30200  123.70200 152.97500 1.000 44.21000  ? 474 VAL B CB    1 
ATOM   4242  C  CG1   . VAL B 1 229 ? 95.34200  124.77500 153.44900 1.000 44.21000  ? 474 VAL B CG1   1 
ATOM   4243  C  CG2   . VAL B 1 229 ? 96.73900  122.83800 154.13700 1.000 44.21000  ? 474 VAL B CG2   1 
ATOM   4244  N  N     . GLY B 1 230 ? 96.00000  123.65900 149.62500 1.000 44.27000  ? 475 GLY B N     1 
ATOM   4245  C  CA    . GLY B 1 230 ? 95.61500  124.31500 148.39400 1.000 44.27000  ? 475 GLY B CA    1 
ATOM   4246  C  C     . GLY B 1 230 ? 94.56800  123.52500 147.64000 1.000 44.27000  ? 475 GLY B C     1 
ATOM   4247  O  O     . GLY B 1 230 ? 93.59000  124.09200 147.14600 1.000 44.27000  ? 475 GLY B O     1 
ATOM   4248  N  N     . VAL B 1 231 ? 94.75600  122.20800 147.55000 1.000 40.98000  ? 476 VAL B N     1 
ATOM   4249  C  CA    . VAL B 1 231 ? 93.76100  121.37300 146.88700 1.000 40.98000  ? 476 VAL B CA    1 
ATOM   4250  C  C     . VAL B 1 231 ? 92.45900  121.37200 147.67600 1.000 40.98000  ? 476 VAL B C     1 
ATOM   4251  O  O     . VAL B 1 231 ? 91.36800  121.38100 147.09600 1.000 40.98000  ? 476 VAL B O     1 
ATOM   4252  C  CB    . VAL B 1 231 ? 94.30700  119.94900 146.67800 1.000 40.98000  ? 476 VAL B CB    1 
ATOM   4253  C  CG1   . VAL B 1 231 ? 93.22600  119.04400 146.13300 1.000 40.98000  ? 476 VAL B CG1   1 
ATOM   4254  C  CG2   . VAL B 1 231 ? 95.48700  119.97200 145.72600 1.000 40.98000  ? 476 VAL B CG2   1 
ATOM   4255  N  N     . ASN B 1 232 ? 92.54700  121.38700 149.00700 1.000 44.55000  ? 477 ASN B N     1 
ATOM   4256  C  CA    . ASN B 1 232 ? 91.33800  121.46800 149.82000 1.000 44.55000  ? 477 ASN B CA    1 
ATOM   4257  C  C     . ASN B 1 232 ? 90.64800  122.81500 149.65000 1.000 44.55000  ? 477 ASN B C     1 
ATOM   4258  O  O     . ASN B 1 232 ? 89.41500  122.88800 149.63300 1.000 44.55000  ? 477 ASN B O     1 
ATOM   4259  C  CB    . ASN B 1 232 ? 91.67100  121.21200 151.28800 1.000 44.55000  ? 477 ASN B CB    1 
ATOM   4260  C  CG    . ASN B 1 232 ? 92.04000  119.76900 151.55800 1.000 44.55000  ? 477 ASN B CG    1 
ATOM   4261  O  OD1   . ASN B 1 232 ? 91.42100  118.85100 151.02400 1.000 44.55000  ? 477 ASN B OD1   1 
ATOM   4262  N  ND2   . ASN B 1 232 ? 93.04900  119.56100 152.39400 1.000 44.55000  ? 477 ASN B ND2   1 
ATOM   4263  N  N     . ALA B 1 233 ? 91.42300  123.89200 149.51200 1.000 44.95000  ? 478 ALA B N     1 
ATOM   4264  C  CA    . ALA B 1 233 ? 90.82100  125.19000 149.23000 1.000 44.95000  ? 478 ALA B CA    1 
ATOM   4265  C  C     . ALA B 1 233 ? 90.11500  125.18000 147.88200 1.000 44.95000  ? 478 ALA B C     1 
ATOM   4266  O  O     . ALA B 1 233 ? 89.00200  125.70100 147.75300 1.000 44.95000  ? 478 ALA B O     1 
ATOM   4267  C  CB    . ALA B 1 233 ? 91.88400  126.28600 149.27300 1.000 44.95000  ? 478 ALA B CB    1 
ATOM   4268  N  N     . MET B 1 234 ? 90.73700  124.57200 146.87300 1.000 42.61000  ? 479 MET B N     1 
ATOM   4269  C  CA    . MET B 1 234 ? 90.09900  124.47200 145.56500 1.000 42.61000  ? 479 MET B CA    1 
ATOM   4270  C  C     . MET B 1 234 ? 88.80600  123.67000 145.64400 1.000 42.61000  ? 479 MET B C     1 
ATOM   4271  O  O     . MET B 1 234 ? 87.79000  124.04900 145.05200 1.000 42.61000  ? 479 MET B O     1 
ATOM   4272  C  CB    . MET B 1 234 ? 91.06300  123.83500 144.56600 1.000 42.61000  ? 479 MET B CB    1 
ATOM   4273  C  CG    . MET B 1 234 ? 92.29100  124.67700 144.29800 1.000 42.61000  ? 479 MET B CG    1 
ATOM   4274  S  SD    . MET B 1 234 ? 93.45400  123.91300 143.16100 1.000 42.61000  ? 479 MET B SD    1 
ATOM   4275  C  CE    . MET B 1 234 ? 94.78600  125.10300 143.24300 1.000 42.61000  ? 479 MET B CE    1 
ATOM   4276  N  N     . LEU B 1 235 ? 88.81900  122.56400 146.38800 1.000 41.72000  ? 480 LEU B N     1 
ATOM   4277  C  CA    . LEU B 1 235 ? 87.63300  121.71900 146.47000 1.000 41.72000  ? 480 LEU B CA    1 
ATOM   4278  C  C     . LEU B 1 235 ? 86.50700  122.40600 147.23000 1.000 41.72000  ? 480 LEU B C     1 
ATOM   4279  O  O     . LEU B 1 235 ? 85.34000  122.31200 146.83200 1.000 41.72000  ? 480 LEU B O     1 
ATOM   4280  C  CB    . LEU B 1 235 ? 87.99000  120.38300 147.11100 1.000 41.72000  ? 480 LEU B CB    1 
ATOM   4281  C  CG    . LEU B 1 235 ? 88.92400  119.54600 146.24100 1.000 41.72000  ? 480 LEU B CG    1 
ATOM   4282  C  CD1   . LEU B 1 235 ? 89.38000  118.30600 146.97800 1.000 41.72000  ? 480 LEU B CD1   1 
ATOM   4283  C  CD2   . LEU B 1 235 ? 88.23800  119.18200 144.94100 1.000 41.72000  ? 480 LEU B CD2   1 
ATOM   4284  N  N     . LEU B 1 236 ? 86.82400  123.10800 148.31900 1.000 44.14000  ? 481 LEU B N     1 
ATOM   4285  C  CA    . LEU B 1 236 ? 85.78200  123.86700 149.00200 1.000 44.14000  ? 481 LEU B CA    1 
ATOM   4286  C  C     . LEU B 1 236 ? 85.34400  125.08500 148.20600 1.000 44.14000  ? 481 LEU B C     1 
ATOM   4287  O  O     . LEU B 1 236 ? 84.26200  125.62100 148.46200 1.000 44.14000  ? 481 LEU B O     1 
ATOM   4288  C  CB    . LEU B 1 236 ? 86.24300  124.29300 150.39500 1.000 44.14000  ? 481 LEU B CB    1 
ATOM   4289  C  CG    . LEU B 1 236 ? 86.00800  123.27700 151.51300 1.000 44.14000  ? 481 LEU B CG    1 
ATOM   4290  C  CD1   . LEU B 1 236 ? 86.92000  122.07200 151.38800 1.000 44.14000  ? 481 LEU B CD1   1 
ATOM   4291  C  CD2   . LEU B 1 236 ? 86.18600  123.94600 152.86400 1.000 44.14000  ? 481 LEU B CD2   1 
ATOM   4292  N  N     . SER B 1 237 ? 86.15700  125.53600 147.25200 1.000 44.23000  ? 482 SER B N     1 
ATOM   4293  C  CA    . SER B 1 237 ? 85.65500  126.48000 146.26400 1.000 44.23000  ? 482 SER B CA    1 
ATOM   4294  C  C     . SER B 1 237 ? 84.62600  125.81100 145.36900 1.000 44.23000  ? 482 SER B C     1 
ATOM   4295  O  O     . SER B 1 237 ? 83.58800  126.40000 145.05100 1.000 44.23000  ? 482 SER B O     1 
ATOM   4296  C  CB    . SER B 1 237 ? 86.80800  127.03300 145.43100 1.000 44.23000  ? 482 SER B CB    1 
ATOM   4297  O  OG    . SER B 1 237 ? 87.73100  127.72800 146.24500 1.000 44.23000  ? 482 SER B OG    1 
ATOM   4298  N  N     . ILE B 1 238 ? 84.90600  124.57400 144.95800 1.000 43.25000  ? 483 ILE B N     1 
ATOM   4299  C  CA    . ILE B 1 238 ? 83.97500  123.83600 144.10800 1.000 43.25000  ? 483 ILE B CA    1 
ATOM   4300  C  C     . ILE B 1 238 ? 82.65000  123.61800 144.82600 1.000 43.25000  ? 483 ILE B C     1 
ATOM   4301  O  O     . ILE B 1 238 ? 81.57700  123.71700 144.22100 1.000 43.25000  ? 483 ILE B O     1 
ATOM   4302  C  CB    . ILE B 1 238 ? 84.58900  122.49300 143.66900 1.000 43.25000  ? 483 ILE B CB    1 
ATOM   4303  C  CG1   . ILE B 1 238 ? 85.95400  122.69900 143.02300 1.000 43.25000  ? 483 ILE B CG1   1 
ATOM   4304  C  CG2   . ILE B 1 238 ? 83.66600  121.78200 142.70000 1.000 43.25000  ? 483 ILE B CG2   1 
ATOM   4305  C  CD1   . ILE B 1 238 ? 85.92500  123.58000 141.83000 1.000 43.25000  ? 483 ILE B CD1   1 
ATOM   4306  N  N     . LEU B 1 239 ? 82.70000  123.33000 146.13000 1.000 45.85000  ? 484 LEU B N     1 
ATOM   4307  C  CA    . LEU B 1 239 ? 81.51900  122.80400 146.81000 1.000 45.85000  ? 484 LEU B CA    1 
ATOM   4308  C  C     . LEU B 1 239 ? 80.52600  123.89500 147.19100 1.000 45.85000  ? 484 LEU B C     1 
ATOM   4309  O  O     . LEU B 1 239 ? 79.31200  123.67900 147.11300 1.000 45.85000  ? 484 LEU B O     1 
ATOM   4310  C  CB    . LEU B 1 239 ? 81.92800  122.02300 148.05600 1.000 45.85000  ? 484 LEU B CB    1 
ATOM   4311  C  CG    . LEU B 1 239 ? 82.75000  120.75600 147.83800 1.000 45.85000  ? 484 LEU B CG    1 
ATOM   4312  C  CD1   . LEU B 1 239 ? 83.11900  120.13900 149.17300 1.000 45.85000  ? 484 LEU B CD1   1 
ATOM   4313  C  CD2   . LEU B 1 239 ? 82.00800  119.76600 146.97000 1.000 45.85000  ? 484 LEU B CD2   1 
ATOM   4314  N  N     . PHE B 1 240 ? 81.00100  125.06500 147.60200 1.000 54.69000  ? 485 PHE B N     1 
ATOM   4315  C  CA    . PHE B 1 240 ? 80.08300  126.11900 148.02300 1.000 54.69000  ? 485 PHE B CA    1 
ATOM   4316  C  C     . PHE B 1 240 ? 79.44900  126.86000 146.85700 1.000 54.69000  ? 485 PHE B C     1 
ATOM   4317  O  O     . PHE B 1 240 ? 78.83900  127.91200 147.07200 1.000 54.69000  ? 485 PHE B O     1 
ATOM   4318  C  CB    . PHE B 1 240 ? 80.79500  127.12200 148.93400 1.000 54.69000  ? 485 PHE B CB    1 
ATOM   4319  C  CG    . PHE B 1 240 ? 81.04700  126.61200 150.32000 1.000 54.69000  ? 485 PHE B CG    1 
ATOM   4320  C  CD1   . PHE B 1 240 ? 80.43400  125.46100 150.77600 1.000 54.69000  ? 485 PHE B CD1   1 
ATOM   4321  C  CD2   . PHE B 1 240 ? 81.88000  127.30200 151.17800 1.000 54.69000  ? 485 PHE B CD2   1 
ATOM   4322  C  CE1   . PHE B 1 240 ? 80.66300  125.00100 152.05500 1.000 54.69000  ? 485 PHE B CE1   1 
ATOM   4323  C  CE2   . PHE B 1 240 ? 82.11100  126.84900 152.45500 1.000 54.69000  ? 485 PHE B CE2   1 
ATOM   4324  C  CZ    . PHE B 1 240 ? 81.50100  125.69900 152.89500 1.000 54.69000  ? 485 PHE B CZ    1 
ATOM   4325  N  N     . LYS B 1 241 ? 79.56600  126.34200 145.63800 1.000 49.27000  ? 486 LYS B N     1 
ATOM   4326  C  CA    . LYS B 1 241 ? 79.02200  127.02800 144.47500 1.000 49.27000  ? 486 LYS B CA    1 
ATOM   4327  C  C     . LYS B 1 241 ? 78.19200  126.08100 143.61800 1.000 49.27000  ? 486 LYS B C     1 
ATOM   4328  O  O     . LYS B 1 241 ? 77.29400  126.51900 142.89200 1.000 49.27000  ? 486 LYS B O     1 
ATOM   4329  C  CB    . LYS B 1 241 ? 80.15900  127.64600 143.65400 1.000 49.27000  ? 486 LYS B CB    1 
ATOM   4330  C  CG    . LYS B 1 241 ? 79.71100  128.40300 142.41600 1.000 49.27000  ? 486 LYS B CG    1 
ATOM   4331  C  CD    . LYS B 1 241 ? 78.83200  129.58500 142.77100 1.000 49.27000  ? 486 LYS B CD    1 
ATOM   4332  C  CE    . LYS B 1 241 ? 79.61800  130.66000 143.49000 1.000 49.27000  ? 486 LYS B CE    1 
ATOM   4333  N  NZ    . LYS B 1 241 ? 80.59000  131.30700 142.57100 1.000 49.27000  ? 486 LYS B NZ    1 
ATOM   4334  N  N     . SER B 1 242 ? 78.46400  124.78200 143.70900 1.000 48.44000  ? 487 SER B N     1 
ATOM   4335  C  CA    . SER B 1 242 ? 77.93300  123.80500 142.76900 1.000 48.44000  ? 487 SER B CA    1 
ATOM   4336  C  C     . SER B 1 242 ? 77.14300  122.72800 143.49400 1.000 48.44000  ? 487 SER B C     1 
ATOM   4337  O  O     . SER B 1 242 ? 77.65100  122.09600 144.42400 1.000 48.44000  ? 487 SER B O     1 
ATOM   4338  C  CB    . SER B 1 242 ? 79.06300  123.16400 141.96600 1.000 48.44000  ? 487 SER B CB    1 
ATOM   4339  O  OG    . SER B 1 242 ? 79.72500  124.13000 141.17400 1.000 48.44000  ? 487 SER B OG    1 
ATOM   4340  N  N     . THR B 1 243 ? 75.90500  122.51900 143.05600 1.000 47.44000  ? 488 THR B N     1 
ATOM   4341  C  CA    . THR B 1 243 ? 75.11400  121.38600 143.48900 1.000 47.44000  ? 488 THR B CA    1 
ATOM   4342  C  C     . THR B 1 243 ? 75.67500  120.11800 142.85200 1.000 47.44000  ? 488 THR B C     1 
ATOM   4343  O  O     . THR B 1 243 ? 76.50000  120.18600 141.94000 1.000 47.44000  ? 488 THR B O     1 
ATOM   4344  C  CB    . THR B 1 243 ? 73.65100  121.59700 143.10400 1.000 47.44000  ? 488 THR B CB    1 
ATOM   4345  O  OG1   . THR B 1 243 ? 73.53900  121.67000 141.67800 1.000 47.44000  ? 488 THR B OG1   1 
ATOM   4346  C  CG2   . THR B 1 243 ? 73.12700  122.88600 143.71100 1.000 47.44000  ? 488 THR B CG2   1 
ATOM   4347  N  N     . PRO B 1 244 ? 75.25600  118.93600 143.31500 1.000 48.25000  ? 489 PRO B N     1 
ATOM   4348  C  CA    . PRO B 1 244 ? 75.72200  117.69900 142.66400 1.000 48.25000  ? 489 PRO B CA    1 
ATOM   4349  C  C     . PRO B 1 244 ? 75.36400  117.60800 141.19200 1.000 48.25000  ? 489 PRO B C     1 
ATOM   4350  O  O     . PRO B 1 244 ? 75.95300  116.78500 140.48200 1.000 48.25000  ? 489 PRO B O     1 
ATOM   4351  C  CB    . PRO B 1 244 ? 75.03200  116.59500 143.47400 1.000 48.25000  ? 489 PRO B CB    1 
ATOM   4352  C  CG    . PRO B 1 244 ? 74.79700  117.20500 144.80100 1.000 48.25000  ? 489 PRO B CG    1 
ATOM   4353  C  CD    . PRO B 1 244 ? 74.48800  118.64700 144.53900 1.000 48.25000  ? 489 PRO B CD    1 
ATOM   4354  N  N     . SER B 1 245 ? 74.42200  118.41600 140.70900 1.000 47.38000  ? 490 SER B N     1 
ATOM   4355  C  CA    . SER B 1 245 ? 74.04200  118.42200 139.30500 1.000 47.38000  ? 490 SER B CA    1 
ATOM   4356  C  C     . SER B 1 245 ? 74.79700  119.47100 138.49700 1.000 47.38000  ? 490 SER B C     1 
ATOM   4357  O  O     . SER B 1 245 ? 74.37800  119.80200 137.38200 1.000 47.38000  ? 490 SER B O     1 
ATOM   4358  C  CB    . SER B 1 245 ? 72.53600  118.64300 139.16900 1.000 47.38000  ? 490 SER B CB    1 
ATOM   4359  O  OG    . SER B 1 245 ? 72.17300  119.93600 139.61700 1.000 47.38000  ? 490 SER B OG    1 
ATOM   4360  N  N     . GLU B 1 246 ? 75.89400  120.00100 139.03300 1.000 46.72000  ? 491 GLU B N     1 
ATOM   4361  C  CA    . GLU B 1 246 ? 76.68600  121.00700 138.33700 1.000 46.72000  ? 491 GLU B CA    1 
ATOM   4362  C  C     . GLU B 1 246 ? 78.18100  120.74400 138.35800 1.000 46.72000  ? 491 GLU B C     1 
ATOM   4363  O  O     . GLU B 1 246 ? 78.89900  121.35200 137.55700 1.000 46.72000  ? 491 GLU B O     1 
ATOM   4364  C  CB    . GLU B 1 246 ? 76.43400  122.39800 138.93800 1.000 46.72000  ? 491 GLU B CB    1 
ATOM   4365  C  CG    . GLU B 1 246 ? 75.02500  122.91500 138.74000 1.000 46.72000  ? 491 GLU B CG    1 
ATOM   4366  C  CD    . GLU B 1 246 ? 74.80500  124.26300 139.39600 1.000 46.72000  ? 491 GLU B CD    1 
ATOM   4367  O  OE1   . GLU B 1 246 ? 75.71800  124.73700 140.10300 1.000 46.72000  ? 491 GLU B OE1   1 
ATOM   4368  O  OE2   . GLU B 1 246 ? 73.71800  124.84600 139.20800 1.000 46.72000  ? 491 GLU B OE2   1 
ATOM   4369  N  N     . ALA B 1 247 ? 78.67600  119.87300 139.23400 1.000 44.63000  ? 492 ALA B N     1 
ATOM   4370  C  CA    . ALA B 1 247 ? 80.10100  119.55600 139.28100 1.000 44.63000  ? 492 ALA B CA    1 
ATOM   4371  C  C     . ALA B 1 247 ? 80.26700  118.25000 140.03400 1.000 44.63000  ? 492 ALA B C     1 
ATOM   4372  O  O     . ALA B 1 247 ? 79.90600  118.17100 141.21100 1.000 44.63000  ? 492 ALA B O     1 
ATOM   4373  C  CB    . ALA B 1 247 ? 80.89300  120.67300 139.95400 1.000 44.63000  ? 492 ALA B CB    1 
ATOM   4374  N  N     . ARG B 1 248 ? 80.80900  117.23500 139.37000 1.000 43.39000  ? 493 ARG B N     1 
ATOM   4375  C  CA    . ARG B 1 248 ? 81.00500  115.92600 139.97400 1.000 43.39000  ? 493 ARG B CA    1 
ATOM   4376  C  C     . ARG B 1 248 ? 82.48200  115.57300 139.92900 1.000 43.39000  ? 493 ARG B C     1 
ATOM   4377  O  O     . ARG B 1 248 ? 83.10000  115.60300 138.86100 1.000 43.39000  ? 493 ARG B O     1 
ATOM   4378  C  CB    . ARG B 1 248 ? 80.17100  114.86100 139.26800 1.000 43.39000  ? 493 ARG B CB    1 
ATOM   4379  C  CG    . ARG B 1 248 ? 78.68100  115.10200 139.38800 1.000 43.39000  ? 493 ARG B CG    1 
ATOM   4380  C  CD    . ARG B 1 248 ? 77.88500  114.00800 138.71700 1.000 43.39000  ? 493 ARG B CD    1 
ATOM   4381  N  NE    . ARG B 1 248 ? 78.00500  112.74300 139.43100 1.000 43.39000  ? 493 ARG B NE    1 
ATOM   4382  C  CZ    . ARG B 1 248 ? 77.22000  112.38800 140.44100 1.000 43.39000  ? 493 ARG B CZ    1 
ATOM   4383  N  NH1   . ARG B 1 248 ? 76.26400  113.20600 140.85300 1.000 43.39000  ? 493 ARG B NH1   1 
ATOM   4384  N  NH2   . ARG B 1 248 ? 77.39000  111.21900 141.03900 1.000 43.39000  ? 493 ARG B NH2   1 
ATOM   4385  N  N     . LEU B 1 249 ? 83.03600  115.23200 141.08600 1.000 42.19000  ? 494 LEU B N     1 
ATOM   4386  C  CA    . LEU B 1 249 ? 84.46900  115.07900 141.27100 1.000 42.19000  ? 494 LEU B CA    1 
ATOM   4387  C  C     . LEU B 1 249 ? 84.88600  113.62300 141.11600 1.000 42.19000  ? 494 LEU B C     1 
ATOM   4388  O  O     . LEU B 1 249 ? 84.08600  112.70400 141.30700 1.000 42.19000  ? 494 LEU B O     1 
ATOM   4389  C  CB    . LEU B 1 249 ? 84.87300  115.58400 142.65600 1.000 42.19000  ? 494 LEU B CB    1 
ATOM   4390  C  CG    . LEU B 1 249 ? 84.58500  117.06100 142.92300 1.000 42.19000  ? 494 LEU B CG    1 
ATOM   4391  C  CD1   . LEU B 1 249 ? 84.81600  117.40600 144.37500 1.000 42.19000  ? 494 LEU B CD1   1 
ATOM   4392  C  CD2   . LEU B 1 249 ? 85.44300  117.93000 142.03900 1.000 42.19000  ? 494 LEU B CD2   1 
ATOM   4393  N  N     . ILE B 1 250 ? 86.15400  113.42200 140.76500 1.000 39.40000  ? 495 ILE B N     1 
ATOM   4394  C  CA    . ILE B 1 250 ? 86.78500  112.10500 140.76400 1.000 39.40000  ? 495 ILE B CA    1 
ATOM   4395  C  C     . ILE B 1 250 ? 88.11400  112.27100 141.48800 1.000 39.40000  ? 495 ILE B C     1 
ATOM   4396  O  O     . ILE B 1 250 ? 89.11100  112.68400 140.88500 1.000 39.40000  ? 495 ILE B O     1 
ATOM   4397  C  CB    . ILE B 1 250 ? 86.99000  111.54400 139.35300 1.000 39.40000  ? 495 ILE B CB    1 
ATOM   4398  C  CG1   . ILE B 1 250 ? 85.64100  111.31400 138.67400 1.000 39.40000  ? 495 ILE B CG1   1 
ATOM   4399  C  CG2   . ILE B 1 250 ? 87.78600  110.25100 139.40200 1.000 39.40000  ? 495 ILE B CG2   1 
ATOM   4400  C  CD1   . ILE B 1 250 ? 85.74500  110.94300 137.21800 1.000 39.40000  ? 495 ILE B CD1   1 
ATOM   4401  N  N     . MET B 1 251 ? 88.13500  111.95900 142.77900 1.000 45.15000  ? 496 MET B N     1 
ATOM   4402  C  CA    . MET B 1 251 ? 89.32500  112.14200 143.59300 1.000 45.15000  ? 496 MET B CA    1 
ATOM   4403  C  C     . MET B 1 251 ? 90.16300  110.87400 143.60600 1.000 45.15000  ? 496 MET B C     1 
ATOM   4404  O  O     . MET B 1 251 ? 89.63100  109.76500 143.70100 1.000 45.15000  ? 496 MET B O     1 
ATOM   4405  C  CB    . MET B 1 251 ? 88.94300  112.52200 145.02300 1.000 45.15000  ? 496 MET B CB    1 
ATOM   4406  C  CG    . MET B 1 251 ? 88.25700  113.86200 145.14200 1.000 45.15000  ? 496 MET B CG    1 
ATOM   4407  S  SD    . MET B 1 251 ? 87.85000  114.23100 146.85200 1.000 45.15000  ? 496 MET B SD    1 
ATOM   4408  C  CE    . MET B 1 251 ? 86.94500  115.75600 146.65700 1.000 45.15000  ? 496 MET B CE    1 
ATOM   4409  N  N     . ILE B 1 252 ? 91.48000  111.04500 143.51800 1.000 45.14000  ? 497 ILE B N     1 
ATOM   4410  C  CA    . ILE B 1 252 ? 92.42500  109.93800 143.57200 1.000 45.14000  ? 497 ILE B CA    1 
ATOM   4411  C  C     . ILE B 1 252 ? 93.57500  110.34300 144.48300 1.000 45.14000  ? 497 ILE B C     1 
ATOM   4412  O  O     . ILE B 1 252 ? 94.14700  111.42600 144.31800 1.000 45.14000  ? 497 ILE B O     1 
ATOM   4413  C  CB    . ILE B 1 252 ? 92.95400  109.56400 142.17700 1.000 45.14000  ? 497 ILE B CB    1 
ATOM   4414  C  CG1   . ILE B 1 252 ? 91.80000  109.23900 141.23600 1.000 45.14000  ? 497 ILE B CG1   1 
ATOM   4415  C  CG2   . ILE B 1 252 ? 93.83600  108.35100 142.27800 1.000 45.14000  ? 497 ILE B CG2   1 
ATOM   4416  C  CD1   . ILE B 1 252 ? 92.21700  109.12500 139.79900 1.000 45.14000  ? 497 ILE B CD1   1 
ATOM   4417  N  N     . ASP B 1 253 ? 93.91800  109.47600 145.43400 1.000 53.19000  ? 498 ASP B N     1 
ATOM   4418  C  CA    . ASP B 1 253 ? 94.93700  109.77800 146.43400 1.000 53.19000  ? 498 ASP B CA    1 
ATOM   4419  C  C     . ASP B 1 253 ? 95.84400  108.56900 146.61100 1.000 53.19000  ? 498 ASP B C     1 
ATOM   4420  O  O     . ASP B 1 253 ? 95.35500  107.47800 146.96800 1.000 53.19000  ? 498 ASP B O     1 
ATOM   4421  C  CB    . ASP B 1 253 ? 94.28700  110.16700 147.76300 1.000 53.19000  ? 498 ASP B CB    1 
ATOM   4422  C  CG    . ASP B 1 253 ? 95.28500  110.70400 148.76800 1.000 53.19000  ? 498 ASP B CG    1 
ATOM   4423  O  OD1   . ASP B 1 253 ? 96.49100  110.75600 148.45100 1.000 53.19000  ? 498 ASP B OD1   1 
ATOM   4424  O  OD2   . ASP B 1 253 ? 94.85900  111.07700 149.88100 1.000 53.19000  ? 498 ASP B OD2   1 
ATOM   4425  N  N     . PRO B 1 254 ? 97.14200  108.69400 146.36800 1.000 52.26000  ? 499 PRO B N     1 
ATOM   4426  C  CA    . PRO B 1 254 ? 98.06000  107.59800 146.69400 1.000 52.26000  ? 499 PRO B CA    1 
ATOM   4427  C  C     . PRO B 1 254 ? 98.39200  107.57000 148.17400 1.000 52.26000  ? 499 PRO B C     1 
ATOM   4428  O  O     . PRO B 1 254 ? 98.63800  106.50300 148.74500 1.000 52.26000  ? 499 PRO B O     1 
ATOM   4429  C  CB    . PRO B 1 254 ? 99.29900  107.91500 145.84800 1.000 52.26000  ? 499 PRO B CB    1 
ATOM   4430  C  CG    . PRO B 1 254 ? 98.81000  108.83800 144.78100 1.000 52.26000  ? 499 PRO B CG    1 
ATOM   4431  C  CD    . PRO B 1 254 ? 97.75700  109.65800 145.44800 1.000 52.26000  ? 499 PRO B CD    1 
ATOM   4432  N  N     . LYS B 1 255 ? 98.39300  108.74000 148.80900 1.000 55.23000  ? 500 LYS B N     1 
ATOM   4433  C  CA    . LYS B 1 255 ? 98.69300  108.83700 150.23100 1.000 55.23000  ? 500 LYS B CA    1 
ATOM   4434  C  C     . LYS B 1 255 ? 97.58300  108.28700 151.11000 1.000 55.23000  ? 500 LYS B C     1 
ATOM   4435  O  O     . LYS B 1 255 ? 97.76000  108.23300 152.33000 1.000 55.23000  ? 500 LYS B O     1 
ATOM   4436  C  CB    . LYS B 1 255 ? 98.97600  110.29000 150.61900 1.000 55.23000  ? 500 LYS B CB    1 
ATOM   4437  C  CG    . LYS B 1 255 ? 100.30000 110.82700 150.11300 1.000 55.23000  ? 500 LYS B CG    1 
ATOM   4438  C  CD    . LYS B 1 255 ? 100.44300 112.30400 150.43700 1.000 55.23000  ? 500 LYS B CD    1 
ATOM   4439  C  CE    . LYS B 1 255 ? 100.60300 112.52500 151.93400 1.000 55.23000  ? 500 LYS B CE    1 
ATOM   4440  N  NZ    . LYS B 1 255 ? 100.85800 113.95100 152.27600 1.000 55.23000  ? 500 LYS B NZ    1 
ATOM   4441  N  N     . MET B 1 256 ? 96.44300  107.91500 150.52500 1.000 55.81000  ? 501 MET B N     1 
ATOM   4442  C  CA    . MET B 1 256 ? 95.36000  107.24300 151.23400 1.000 55.81000  ? 501 MET B CA    1 
ATOM   4443  C  C     . MET B 1 256 ? 94.73700  108.13000 152.30300 1.000 55.81000  ? 501 MET B C     1 
ATOM   4444  O  O     . MET B 1 256 ? 93.80900  107.70700 152.99600 1.000 55.81000  ? 501 MET B O     1 
ATOM   4445  C  CB    . MET B 1 256 ? 95.86600  105.95200 151.88500 1.000 55.81000  ? 501 MET B CB    1 
ATOM   4446  C  CG    . MET B 1 256 ? 96.39800  104.90900 150.92000 1.000 55.81000  ? 501 MET B CG    1 
ATOM   4447  S  SD    . MET B 1 256 ? 96.94500  103.42100 151.77800 1.000 55.81000  ? 501 MET B SD    1 
ATOM   4448  C  CE    . MET B 1 256 ? 97.57900  102.45100 150.41300 1.000 55.81000  ? 501 MET B CE    1 
ATOM   4449  N  N     . LEU B 1 257 ? 95.22700  109.36000 152.44400 1.000 54.43000  ? 502 LEU B N     1 
ATOM   4450  C  CA    . LEU B 1 257 ? 94.99600  110.10100 153.67600 1.000 54.43000  ? 502 LEU B CA    1 
ATOM   4451  C  C     . LEU B 1 257 ? 94.49100  111.52200 153.46000 1.000 54.43000  ? 502 LEU B C     1 
ATOM   4452  O  O     . LEU B 1 257 ? 93.75400  112.05300 154.29600 1.000 54.43000  ? 502 LEU B O     1 
ATOM   4453  C  CB    . LEU B 1 257 ? 96.29100  110.11700 154.48500 1.000 54.43000  ? 502 LEU B CB    1 
ATOM   4454  C  CG    . LEU B 1 257 ? 96.28600  110.76800 155.85800 1.000 54.43000  ? 502 LEU B CG    1 
ATOM   4455  C  CD1   . LEU B 1 257 ? 95.23700  110.10800 156.71000 1.000 54.43000  ? 502 LEU B CD1   1 
ATOM   4456  C  CD2   . LEU B 1 257 ? 97.65000  110.57100 156.46900 1.000 54.43000  ? 502 LEU B CD2   1 
ATOM   4457  N  N     . GLU B 1 258 ? 94.87700  112.15100 152.35000 1.000 54.53000  ? 503 GLU B N     1 
ATOM   4458  C  CA    . GLU B 1 258 ? 94.52900  113.55200 152.14200 1.000 54.53000  ? 503 GLU B CA    1 
ATOM   4459  C  C     . GLU B 1 258 ? 93.07200  113.71000 151.72600 1.000 54.53000  ? 503 GLU B C     1 
ATOM   4460  O  O     . GLU B 1 258 ? 92.28400  114.36000 152.41900 1.000 54.53000  ? 503 GLU B O     1 
ATOM   4461  C  CB    . GLU B 1 258 ? 95.45600  114.17500 151.09500 1.000 54.53000  ? 503 GLU B CB    1 
ATOM   4462  C  CG    . GLU B 1 258 ? 96.90200  114.29800 151.53800 1.000 54.53000  ? 503 GLU B CG    1 
ATOM   4463  C  CD    . GLU B 1 258 ? 97.08500  115.28200 152.67900 1.000 54.53000  ? 503 GLU B CD    1 
ATOM   4464  O  OE1   . GLU B 1 258 ? 96.31400  116.26100 152.75500 1.000 54.53000  ? 503 GLU B OE1   1 
ATOM   4465  O  OE2   . GLU B 1 258 ? 98.00700  115.07800 153.49800 1.000 54.53000  ? 503 GLU B OE2   1 
ATOM   4466  N  N     . LEU B 1 259 ? 92.70000  113.12100 150.59500 1.000 44.89000  ? 504 LEU B N     1 
ATOM   4467  C  CA    . LEU B 1 259 ? 91.36400  113.27600 150.04000 1.000 44.89000  ? 504 LEU B CA    1 
ATOM   4468  C  C     . LEU B 1 259 ? 90.37500  112.25300 150.57900 1.000 44.89000  ? 504 LEU B C     1 
ATOM   4469  O  O     . LEU B 1 259 ? 89.21500  112.25300 150.15500 1.000 44.89000  ? 504 LEU B O     1 
ATOM   4470  C  CB    . LEU B 1 259 ? 91.42500  113.18200 148.51600 1.000 44.89000  ? 504 LEU B CB    1 
ATOM   4471  C  CG    . LEU B 1 259 ? 92.26900  114.26900 147.85400 1.000 44.89000  ? 504 LEU B CG    1 
ATOM   4472  C  CD1   . LEU B 1 259 ? 92.36400  114.03600 146.36200 1.000 44.89000  ? 504 LEU B CD1   1 
ATOM   4473  C  CD2   . LEU B 1 259 ? 91.70700  115.64400 148.15500 1.000 44.89000  ? 504 LEU B CD2   1 
ATOM   4474  N  N     . SER B 1 260 ? 90.79700  111.38900 151.49600 1.000 49.49000  ? 505 SER B N     1 
ATOM   4475  C  CA    . SER B 1 260 ? 89.93600  110.34700 152.03800 1.000 49.49000  ? 505 SER B CA    1 
ATOM   4476  C  C     . SER B 1 260 ? 88.93200  110.87300 153.05100 1.000 49.49000  ? 505 SER B C     1 
ATOM   4477  O  O     . SER B 1 260 ? 88.25200  110.06900 153.69500 1.000 49.49000  ? 505 SER B O     1 
ATOM   4478  C  CB    . SER B 1 260 ? 90.78000  109.24800 152.68500 1.000 49.49000  ? 505 SER B CB    1 
ATOM   4479  O  OG    . SER B 1 260 ? 91.59200  108.59800 151.72500 1.000 49.49000  ? 505 SER B OG    1 
ATOM   4480  N  N     . ILE B 1 261 ? 88.82300  112.19000 153.21200 1.000 51.86000  ? 506 ILE B N     1 
ATOM   4481  C  CA    . ILE B 1 261 ? 87.83300  112.77800 154.10800 1.000 51.86000  ? 506 ILE B CA    1 
ATOM   4482  C  C     . ILE B 1 261 ? 86.65600  113.38200 153.36400 1.000 51.86000  ? 506 ILE B C     1 
ATOM   4483  O  O     . ILE B 1 261 ? 85.66900  113.76700 154.01100 1.000 51.86000  ? 506 ILE B O     1 
ATOM   4484  C  CB    . ILE B 1 261 ? 88.46900  113.82500 155.04600 1.000 51.86000  ? 506 ILE B CB    1 
ATOM   4485  C  CG1   . ILE B 1 261 ? 89.15400  114.93000 154.24200 1.000 51.86000  ? 506 ILE B CG1   1 
ATOM   4486  C  CG2   . ILE B 1 261 ? 89.44300  113.15700 156.00000 1.000 51.86000  ? 506 ILE B CG2   1 
ATOM   4487  C  CD1   . ILE B 1 261 ? 89.68800  116.05100 155.09800 1.000 51.86000  ? 506 ILE B CD1   1 
ATOM   4488  N  N     . TYR B 1 262 ? 86.71900  113.47500 152.03900 1.000 51.81000  ? 507 TYR B N     1 
ATOM   4489  C  CA    . TYR B 1 262 ? 85.56400  113.85500 151.23900 1.000 51.81000  ? 507 TYR B CA    1 
ATOM   4490  C  C     . TYR B 1 262 ? 84.66800  112.67200 150.91100 1.000 51.81000  ? 507 TYR B C     1 
ATOM   4491  O  O     . TYR B 1 262 ? 83.69200  112.84000 150.17300 1.000 51.81000  ? 507 TYR B O     1 
ATOM   4492  C  CB    . TYR B 1 262 ? 86.01500  114.52200 149.94000 1.000 51.81000  ? 507 TYR B CB    1 
ATOM   4493  C  CG    . TYR B 1 262 ? 86.73300  115.83400 150.13800 1.000 51.81000  ? 507 TYR B CG    1 
ATOM   4494  C  CD1   . TYR B 1 262 ? 86.03000  117.00300 150.37700 1.000 51.81000  ? 507 TYR B CD1   1 
ATOM   4495  C  CD2   . TYR B 1 262 ? 88.11700  115.90400 150.07900 1.000 51.81000  ? 507 TYR B CD2   1 
ATOM   4496  C  CE1   . TYR B 1 262 ? 86.68300  118.20200 150.55800 1.000 51.81000  ? 507 TYR B CE1   1 
ATOM   4497  C  CE2   . TYR B 1 262 ? 88.77700  117.09900 150.25900 1.000 51.81000  ? 507 TYR B CE2   1 
ATOM   4498  C  CZ    . TYR B 1 262 ? 88.05600  118.24400 150.49700 1.000 51.81000  ? 507 TYR B CZ    1 
ATOM   4499  O  OH    . TYR B 1 262 ? 88.71000  119.43800 150.67700 1.000 51.81000  ? 507 TYR B OH    1 
ATOM   4500  N  N     . GLU B 1 263 ? 84.97400  111.48800 151.43100 1.000 59.46000  ? 508 GLU B N     1 
ATOM   4501  C  CA    . GLU B 1 263 ? 84.20600  110.29800 151.09500 1.000 59.46000  ? 508 GLU B CA    1 
ATOM   4502  C  C     . GLU B 1 263 ? 82.81100  110.38200 151.69700 1.000 59.46000  ? 508 GLU B C     1 
ATOM   4503  O  O     . GLU B 1 263 ? 82.65400  110.56800 152.90700 1.000 59.46000  ? 508 GLU B O     1 
ATOM   4504  C  CB    . GLU B 1 263 ? 84.92400  109.04900 151.59900 1.000 59.46000  ? 508 GLU B CB    1 
ATOM   4505  C  CG    . GLU B 1 263 ? 84.22500  107.74600 151.25700 1.000 59.46000  ? 508 GLU B CG    1 
ATOM   4506  C  CD    . GLU B 1 263 ? 84.22800  107.45200 149.77000 1.000 59.46000  ? 508 GLU B CD    1 
ATOM   4507  O  OE1   . GLU B 1 263 ? 85.14200  107.93000 149.06900 1.000 59.46000  ? 508 GLU B OE1   1 
ATOM   4508  O  OE2   . GLU B 1 263 ? 83.31600  106.73800 149.30300 1.000 59.46000  ? 508 GLU B OE2   1 
ATOM   4509  N  N     . GLY B 1 264 ? 81.79700  110.24600 150.84800 1.000 56.41000  ? 509 GLY B N     1 
ATOM   4510  C  CA    . GLY B 1 264 ? 80.40900  110.29400 151.26400 1.000 56.41000  ? 509 GLY B CA    1 
ATOM   4511  C  C     . GLY B 1 264 ? 79.60800  111.42500 150.65800 1.000 56.41000  ? 509 GLY B C     1 
ATOM   4512  O  O     . GLY B 1 264 ? 78.37200  111.34800 150.63600 1.000 56.41000  ? 509 GLY B O     1 
ATOM   4513  N  N     . ILE B 1 265 ? 80.26200  112.47500 150.17000 1.000 52.65000  ? 510 ILE B N     1 
ATOM   4514  C  CA    . ILE B 1 265 ? 79.56800  113.62500 149.59600 1.000 52.65000  ? 510 ILE B CA    1 
ATOM   4515  C  C     . ILE B 1 265 ? 78.84500  113.19700 148.32500 1.000 52.65000  ? 510 ILE B C     1 
ATOM   4516  O  O     . ILE B 1 265 ? 79.25900  112.22700 147.67400 1.000 52.65000  ? 510 ILE B O     1 
ATOM   4517  C  CB    . ILE B 1 265 ? 80.54200  114.78100 149.31500 1.000 52.65000  ? 510 ILE B CB    1 
ATOM   4518  C  CG1   . ILE B 1 265 ? 81.59100  114.36300 148.28500 1.000 52.65000  ? 510 ILE B CG1   1 
ATOM   4519  C  CG2   . ILE B 1 265 ? 81.20600  115.23700 150.59900 1.000 52.65000  ? 510 ILE B CG2   1 
ATOM   4520  C  CD1   . ILE B 1 265 ? 82.44900  115.50400 147.79700 1.000 52.65000  ? 510 ILE B CD1   1 
ATOM   4521  N  N     . PRO B 1 266 ? 77.76400  113.87800 147.93700 1.000 55.19000  ? 511 PRO B N     1 
ATOM   4522  C  CA    . PRO B 1 266 ? 77.05700  113.48600 146.71000 1.000 55.19000  ? 511 PRO B CA    1 
ATOM   4523  C  C     . PRO B 1 266 ? 77.79100  113.85800 145.43700 1.000 55.19000  ? 511 PRO B C     1 
ATOM   4524  O  O     . PRO B 1 266 ? 77.49000  113.28300 144.38500 1.000 55.19000  ? 511 PRO B O     1 
ATOM   4525  C  CB    . PRO B 1 266 ? 75.72400  114.23500 146.82100 1.000 55.19000  ? 511 PRO B CB    1 
ATOM   4526  C  CG    . PRO B 1 266 ? 76.03700  115.41500 147.66600 1.000 55.19000  ? 511 PRO B CG    1 
ATOM   4527  C  CD    . PRO B 1 266 ? 77.07000  114.96000 148.65400 1.000 55.19000  ? 511 PRO B CD    1 
ATOM   4528  N  N     . HIS B 1 267 ? 78.73200  114.80300 145.49300 1.000 48.59000  ? 512 HIS B N     1 
ATOM   4529  C  CA    . HIS B 1 267 ? 79.43700  115.22500 144.28600 1.000 48.59000  ? 512 HIS B CA    1 
ATOM   4530  C  C     . HIS B 1 267 ? 80.20700  114.07000 143.66200 1.000 48.59000  ? 512 HIS B C     1 
ATOM   4531  O  O     . HIS B 1 267 ? 80.18700  113.88700 142.44000 1.000 48.59000  ? 512 HIS B O     1 
ATOM   4532  C  CB    . HIS B 1 267 ? 80.37800  116.38200 144.60600 1.000 48.59000  ? 512 HIS B CB    1 
ATOM   4533  C  CG    . HIS B 1 267 ? 79.66900  117.65100 144.95400 1.000 48.59000  ? 512 HIS B CG    1 
ATOM   4534  N  ND1   . HIS B 1 267 ? 79.26300  117.95300 146.23600 1.000 48.59000  ? 512 HIS B ND1   1 
ATOM   4535  C  CD2   . HIS B 1 267 ? 79.28800  118.69400 144.18300 1.000 48.59000  ? 512 HIS B CD2   1 
ATOM   4536  C  CE1   . HIS B 1 267 ? 78.66600  119.13000 146.24000 1.000 48.59000  ? 512 HIS B CE1   1 
ATOM   4537  N  NE2   . HIS B 1 267 ? 78.66700  119.60100 145.00600 1.000 48.59000  ? 512 HIS B NE2   1 
ATOM   4538  N  N     . LEU B 1 268 ? 80.91200  113.29700 144.48500 1.000 52.18000  ? 513 LEU B N     1 
ATOM   4539  C  CA    . LEU B 1 268 ? 81.66100  112.15500 143.98400 1.000 52.18000  ? 513 LEU B CA    1 
ATOM   4540  C  C     . LEU B 1 268 ? 80.75300  111.21000 143.21500 1.000 52.18000  ? 513 LEU B C     1 
ATOM   4541  O  O     . LEU B 1 268 ? 79.57400  111.04200 143.53400 1.000 52.18000  ? 513 LEU B O     1 
ATOM   4542  C  CB    . LEU B 1 268 ? 82.32700  111.40100 145.13200 1.000 52.18000  ? 513 LEU B CB    1 
ATOM   4543  C  CG    . LEU B 1 268 ? 83.45200  112.13900 145.84700 1.000 52.18000  ? 513 LEU B CG    1 
ATOM   4544  C  CD1   . LEU B 1 268 ? 83.89800  111.35100 147.06500 1.000 52.18000  ? 513 LEU B CD1   1 
ATOM   4545  C  CD2   . LEU B 1 268 ? 84.61300  112.35900 144.89600 1.000 52.18000  ? 513 LEU B CD2   1 
ATOM   4546  N  N     . LEU B 1 269 ? 81.32500  110.58000 142.19500 1.000 56.48000  ? 514 LEU B N     1 
ATOM   4547  C  CA    . LEU B 1 269 ? 80.63400  109.55900 141.42200 1.000 56.48000  ? 514 LEU B CA    1 
ATOM   4548  C  C     . LEU B 1 269 ? 81.34200  108.21700 141.50700 1.000 56.48000  ? 514 LEU B C     1 
ATOM   4549  O  O     . LEU B 1 269 ? 81.01400  107.29800 140.74600 1.000 56.48000  ? 514 LEU B O     1 
ATOM   4550  C  CB    . LEU B 1 269 ? 80.48900  110.01000 139.96700 1.000 56.48000  ? 514 LEU B CB    1 
ATOM   4551  C  CG    . LEU B 1 269 ? 81.74600  110.46200 139.22200 1.000 56.48000  ? 514 LEU B CG    1 
ATOM   4552  C  CD1   . LEU B 1 269 ? 82.55100  109.29600 138.69000 1.000 56.48000  ? 514 LEU B CD1   1 
ATOM   4553  C  CD2   . LEU B 1 269 ? 81.34300  111.40500 138.10300 1.000 56.48000  ? 514 LEU B CD2   1 
ATOM   4554  N  N     . CYS B 1 270 ? 82.29200  108.08500 142.41700 1.000 61.85000  ? 515 CYS B N     1 
ATOM   4555  C  CA    . CYS B 1 270 ? 83.05700  106.87500 142.66600 1.000 61.85000  ? 515 CYS B CA    1 
ATOM   4556  C  C     . CYS B 1 270 ? 83.78300  107.05300 143.99200 1.000 61.85000  ? 515 CYS B C     1 
ATOM   4557  O  O     . CYS B 1 270 ? 84.09200  108.19000 144.37100 1.000 61.85000  ? 515 CYS B O     1 
ATOM   4558  C  CB    . CYS B 1 270 ? 84.04300  106.61000 141.53100 1.000 61.85000  ? 515 CYS B CB    1 
ATOM   4559  S  SG    . CYS B 1 270 ? 85.30600  107.88000 141.33700 1.000 61.85000  ? 515 CYS B SG    1 
ATOM   4560  N  N     . PRO B 1 271 ? 84.05100  105.98200 144.73800 1.000 58.54000  ? 516 PRO B N     1 
ATOM   4561  C  CA    . PRO B 1 271 ? 84.78200  106.14100 146.00000 1.000 58.54000  ? 516 PRO B CA    1 
ATOM   4562  C  C     . PRO B 1 271 ? 86.12300  106.81700 145.76500 1.000 58.54000  ? 516 PRO B C     1 
ATOM   4563  O  O     . PRO B 1 271 ? 86.69100  106.75100 144.67300 1.000 58.54000  ? 516 PRO B O     1 
ATOM   4564  C  CB    . PRO B 1 271 ? 84.95700  104.70300 146.49600 1.000 58.54000  ? 516 PRO B CB    1 
ATOM   4565  C  CG    . PRO B 1 271 ? 83.86300  103.94700 145.83400 1.000 58.54000  ? 516 PRO B CG    1 
ATOM   4566  C  CD    . PRO B 1 271 ? 83.69600  104.57600 144.48500 1.000 58.54000  ? 516 PRO B CD    1 
ATOM   4567  N  N     . VAL B 1 272 ? 86.62100  107.49100 146.80100 1.000 54.79000  ? 517 VAL B N     1 
ATOM   4568  C  CA    . VAL B 1 272 ? 87.92200  108.13900 146.70100 1.000 54.79000  ? 517 VAL B CA    1 
ATOM   4569  C  C     . VAL B 1 272 ? 88.95000  107.04500 146.47300 1.000 54.79000  ? 517 VAL B C     1 
ATOM   4570  O  O     . VAL B 1 272 ? 89.18000  106.20500 147.35000 1.000 54.79000  ? 517 VAL B O     1 
ATOM   4571  C  CB    . VAL B 1 272 ? 88.25500  108.96700 147.95600 1.000 54.79000  ? 517 VAL B CB    1 
ATOM   4572  C  CG1   . VAL B 1 272 ? 89.67100  109.51000 147.86700 1.000 54.79000  ? 517 VAL B CG1   1 
ATOM   4573  C  CG2   . VAL B 1 272 ? 87.26600  110.10100 148.12000 1.000 54.79000  ? 517 VAL B CG2   1 
ATOM   4574  N  N     . VAL B 1 273 ? 89.56000  107.03800 145.29100 1.000 53.96000  ? 518 VAL B N     1 
ATOM   4575  C  CA    . VAL B 1 273 ? 90.45200  105.95400 144.90200 1.000 53.96000  ? 518 VAL B CA    1 
ATOM   4576  C  C     . VAL B 1 273 ? 91.64200  105.93600 145.84800 1.000 53.96000  ? 518 VAL B C     1 
ATOM   4577  O  O     . VAL B 1 273 ? 92.49800  106.82700 145.81500 1.000 53.96000  ? 518 VAL B O     1 
ATOM   4578  C  CB    . VAL B 1 273 ? 90.90000  106.09100 143.43700 1.000 53.96000  ? 518 VAL B CB    1 
ATOM   4579  C  CG1   . VAL B 1 273 ? 91.88700  104.99900 143.09000 1.000 53.96000  ? 518 VAL B CG1   1 
ATOM   4580  C  CG2   . VAL B 1 273 ? 89.69500  106.03900 142.51400 1.000 53.96000  ? 518 VAL B CG2   1 
ATOM   4581  N  N     . THR B 1 274 ? 91.69400  104.91700 146.70000 1.000 58.00000  ? 519 THR B N     1 
ATOM   4582  C  CA    . THR B 1 274 ? 92.71300  104.77500 147.72900 1.000 58.00000  ? 519 THR B CA    1 
ATOM   4583  C  C     . THR B 1 274 ? 93.68100  103.64500 147.42400 1.000 58.00000  ? 519 THR B C     1 
ATOM   4584  O  O     . THR B 1 274 ? 94.89700  103.85600 147.40700 1.000 58.00000  ? 519 THR B O     1 
ATOM   4585  C  CB    . THR B 1 274 ? 92.03900  104.54000 149.08800 1.000 58.00000  ? 519 THR B CB    1 
ATOM   4586  O  OG1   . THR B 1 274 ? 91.21900  105.66800 149.41700 1.000 58.00000  ? 519 THR B OG1   1 
ATOM   4587  C  CG2   . THR B 1 274 ? 93.06800  104.34000 150.17200 1.000 58.00000  ? 519 THR B CG2   1 
ATOM   4588  N  N     . ASP B 1 275 ? 93.16800  102.44400 147.17700 1.000 66.30000  ? 520 ASP B N     1 
ATOM   4589  C  CA    . ASP B 1 275 ? 93.99800  101.36400 146.66900 1.000 66.30000  ? 520 ASP B CA    1 
ATOM   4590  C  C     . ASP B 1 275 ? 94.41500  101.68800 145.24200 1.000 66.30000  ? 520 ASP B C     1 
ATOM   4591  O  O     . ASP B 1 275 ? 93.57100  101.98800 144.39300 1.000 66.30000  ? 520 ASP B O     1 
ATOM   4592  C  CB    . ASP B 1 275 ? 93.23800  100.04000 146.72000 1.000 66.30000  ? 520 ASP B CB    1 
ATOM   4593  C  CG    . ASP B 1 275 ? 94.13200  98.84300  146.46900 1.000 66.30000  ? 520 ASP B CG    1 
ATOM   4594  O  OD1   . ASP B 1 275 ? 95.34600  99.03700  146.25000 1.000 66.30000  ? 520 ASP B OD1   1 
ATOM   4595  O  OD2   . ASP B 1 275 ? 93.61900  97.70400  146.49100 1.000 66.30000  ? 520 ASP B OD2   1 
ATOM   4596  N  N     . MET B 1 276 ? 95.71600  101.61800 144.97100 1.000 63.81000  ? 521 MET B N     1 
ATOM   4597  C  CA    . MET B 1 276 ? 96.25500  102.12000 143.71500 1.000 63.81000  ? 521 MET B CA    1 
ATOM   4598  C  C     . MET B 1 276 ? 96.18500  101.10700 142.58700 1.000 63.81000  ? 521 MET B C     1 
ATOM   4599  O  O     . MET B 1 276 ? 96.95100  101.21100 141.62500 1.000 63.81000  ? 521 MET B O     1 
ATOM   4600  C  CB    . MET B 1 276 ? 97.69700  102.59100 143.90900 1.000 63.81000  ? 521 MET B CB    1 
ATOM   4601  C  CG    . MET B 1 276 ? 97.80600  103.81500 144.79000 1.000 63.81000  ? 521 MET B CG    1 
ATOM   4602  S  SD    . MET B 1 276 ? 96.81200  105.16700 144.13700 1.000 63.81000  ? 521 MET B SD    1 
ATOM   4603  C  CE    . MET B 1 276 ? 97.68800  105.52000 142.61900 1.000 63.81000  ? 521 MET B CE    1 
ATOM   4604  N  N     . LYS B 1 277 ? 95.29400  100.12700 142.68400 1.000 65.47000  ? 522 LYS B N     1 
ATOM   4605  C  CA    . LYS B 1 277 ? 94.93900  99.30300  141.54200 1.000 65.47000  ? 522 LYS B CA    1 
ATOM   4606  C  C     . LYS B 1 277 ? 93.61500  99.71800  140.91800 1.000 65.47000  ? 522 LYS B C     1 
ATOM   4607  O  O     . LYS B 1 277 ? 93.26500  99.21100  139.84700 1.000 65.47000  ? 522 LYS B O     1 
ATOM   4608  C  CB    . LYS B 1 277 ? 94.88600  97.82600  141.94900 1.000 65.47000  ? 522 LYS B CB    1 
ATOM   4609  C  CG    . LYS B 1 277 ? 96.21900  97.29100  142.44500 1.000 65.47000  ? 522 LYS B CG    1 
ATOM   4610  C  CD    . LYS B 1 277 ? 97.25400  97.29100  141.33100 1.000 65.47000  ? 522 LYS B CD    1 
ATOM   4611  C  CE    . LYS B 1 277 ? 98.57200  96.70200  141.79700 1.000 65.47000  ? 522 LYS B CE    1 
ATOM   4612  N  NZ    . LYS B 1 277 ? 99.60000  96.74000  140.72200 1.000 65.47000  ? 522 LYS B NZ    1 
ATOM   4613  N  N     . GLU B 1 278 ? 92.88000  100.62700 141.55800 1.000 64.30000  ? 523 GLU B N     1 
ATOM   4614  C  CA    . GLU B 1 278 ? 91.61000  101.11800 141.04500 1.000 64.30000  ? 523 GLU B CA    1 
ATOM   4615  C  C     . GLU B 1 278 ? 91.72000  102.48900 140.39200 1.000 64.30000  ? 523 GLU B C     1 
ATOM   4616  O  O     . GLU B 1 278 ? 90.72900  102.97300 139.83300 1.000 64.30000  ? 523 GLU B O     1 
ATOM   4617  C  CB    . GLU B 1 278 ? 90.57600  101.17200 142.17300 1.000 64.30000  ? 523 GLU B CB    1 
ATOM   4618  C  CG    . GLU B 1 278 ? 90.20800  99.80500  142.71500 1.000 64.30000  ? 523 GLU B CG    1 
ATOM   4619  C  CD    . GLU B 1 278 ? 89.21400  99.87600  143.85400 1.000 64.30000  ? 523 GLU B CD    1 
ATOM   4620  O  OE1   . GLU B 1 278 ? 88.90200  100.99900 144.30400 1.000 64.30000  ? 523 GLU B OE1   1 
ATOM   4621  O  OE2   . GLU B 1 278 ? 88.74600  98.80800  144.30300 1.000 64.30000  ? 523 GLU B OE2   1 
ATOM   4622  N  N     . ALA B 1 279 ? 92.89100  103.12700 140.45200 1.000 58.32000  ? 524 ALA B N     1 
ATOM   4623  C  CA    . ALA B 1 279 ? 93.08400  104.37500 139.72300 1.000 58.32000  ? 524 ALA B CA    1 
ATOM   4624  C  C     . ALA B 1 279 ? 92.95100  104.15100 138.22500 1.000 58.32000  ? 524 ALA B C     1 
ATOM   4625  O  O     . ALA B 1 279 ? 92.36900  104.97800 137.51100 1.000 58.32000  ? 524 ALA B O     1 
ATOM   4626  C  CB    . ALA B 1 279 ? 94.44700  104.97600 140.05900 1.000 58.32000  ? 524 ALA B CB    1 
ATOM   4627  N  N     . ALA B 1 280 ? 93.48000  103.03100 137.73300 1.000 57.25000  ? 525 ALA B N     1 
ATOM   4628  C  CA    . ALA B 1 280 ? 93.32500  102.70300 136.32300 1.000 57.25000  ? 525 ALA B CA    1 
ATOM   4629  C  C     . ALA B 1 280 ? 91.85800  102.53100 135.95900 1.000 57.25000  ? 525 ALA B C     1 
ATOM   4630  O  O     . ALA B 1 280 ? 91.42700  102.96200 134.88800 1.000 57.25000  ? 525 ALA B O     1 
ATOM   4631  C  CB    . ALA B 1 280 ? 94.11700  101.44100 135.98700 1.000 57.25000  ? 525 ALA B CB    1 
ATOM   4632  N  N     . ASN B 1 281 ? 91.06900  101.92300 136.84800 1.000 57.65000  ? 526 ASN B N     1 
ATOM   4633  C  CA    . ASN B 1 281 ? 89.64400  101.75500 136.57500 1.000 57.65000  ? 526 ASN B CA    1 
ATOM   4634  C  C     . ASN B 1 281 ? 88.92800  103.09900 136.55600 1.000 57.65000  ? 526 ASN B C     1 
ATOM   4635  O  O     . ASN B 1 281 ? 88.10700  103.36700 135.66900 1.000 57.65000  ? 526 ASN B O     1 
ATOM   4636  C  CB    . ASN B 1 281 ? 89.01500  100.83000 137.61600 1.000 57.65000  ? 526 ASN B CB    1 
ATOM   4637  C  CG    . ASN B 1 281 ? 89.45500  99.39300  137.46000 1.000 57.65000  ? 526 ASN B CG    1 
ATOM   4638  O  OD1   . ASN B 1 281 ? 89.54900  98.87700  136.34800 1.000 57.65000  ? 526 ASN B OD1   1 
ATOM   4639  N  ND2   . ASN B 1 281 ? 89.72600  98.73400  138.58000 1.000 57.65000  ? 526 ASN B ND2   1 
ATOM   4640  N  N     . ALA B 1 282 ? 89.22500  103.95500 137.53600 1.000 52.86000  ? 527 ALA B N     1 
ATOM   4641  C  CA    . ALA B 1 282 ? 88.61500  105.28000 137.57400 1.000 52.86000  ? 527 ALA B CA    1 
ATOM   4642  C  C     . ALA B 1 282 ? 88.93700  106.07100 136.31400 1.000 52.86000  ? 527 ALA B C     1 
ATOM   4643  O  O     . ALA B 1 282 ? 88.06700  106.74800 135.75500 1.000 52.86000  ? 527 ALA B O     1 
ATOM   4644  C  CB    . ALA B 1 282 ? 89.08000  106.03900 138.81500 1.000 52.86000  ? 527 ALA B CB    1 
ATOM   4645  N  N     . LEU B 1 283 ? 90.17600  105.98500 135.83600 1.000 48.05000  ? 528 LEU B N     1 
ATOM   4646  C  CA    . LEU B 1 283 ? 90.53900  106.76300 134.65700 1.000 48.05000  ? 528 LEU B CA    1 
ATOM   4647  C  C     . LEU B 1 283 ? 90.02900  106.13200 133.36400 1.000 48.05000  ? 528 LEU B C     1 
ATOM   4648  O  O     . LEU B 1 283 ? 89.71600  106.85800 132.41100 1.000 48.05000  ? 528 LEU B O     1 
ATOM   4649  C  CB    . LEU B 1 283 ? 92.05100  106.96400 134.61900 1.000 48.05000  ? 528 LEU B CB    1 
ATOM   4650  C  CG    . LEU B 1 283 ? 92.51500  107.82300 135.79700 1.000 48.05000  ? 528 LEU B CG    1 
ATOM   4651  C  CD1   . LEU B 1 283 ? 94.02000  107.92400 135.84300 1.000 48.05000  ? 528 LEU B CD1   1 
ATOM   4652  C  CD2   . LEU B 1 283 ? 91.88300  109.20400 135.74000 1.000 48.05000  ? 528 LEU B CD2   1 
ATOM   4653  N  N     . ARG B 1 284 ? 89.92100  104.80100 133.30400 1.000 53.18000  ? 529 ARG B N     1 
ATOM   4654  C  CA    . ARG B 1 284 ? 89.20800  104.18200 132.19200 1.000 53.18000  ? 529 ARG B CA    1 
ATOM   4655  C  C     . ARG B 1 284 ? 87.77400  104.67600 132.13900 1.000 53.18000  ? 529 ARG B C     1 
ATOM   4656  O  O     . ARG B 1 284 ? 87.24300  104.95500 131.05700 1.000 53.18000  ? 529 ARG B O     1 
ATOM   4657  C  CB    . ARG B 1 284 ? 89.22500  102.65700 132.30900 1.000 53.18000  ? 529 ARG B CB    1 
ATOM   4658  C  CG    . ARG B 1 284 ? 90.56700  102.00200 132.07700 1.000 53.18000  ? 529 ARG B CG    1 
ATOM   4659  C  CD    . ARG B 1 284 ? 90.43500  100.49100 132.11400 1.000 53.18000  ? 529 ARG B CD    1 
ATOM   4660  N  NE    . ARG B 1 284 ? 91.72000  99.82600  131.92800 1.000 53.18000  ? 529 ARG B NE    1 
ATOM   4661  C  CZ    . ARG B 1 284 ? 92.49700  99.41600  132.92300 1.000 53.18000  ? 529 ARG B CZ    1 
ATOM   4662  N  NH1   . ARG B 1 284 ? 92.11200  99.58500  134.17900 1.000 53.18000  ? 529 ARG B NH1   1 
ATOM   4663  N  NH2   . ARG B 1 284 ? 93.65300  98.82200  132.66200 1.000 53.18000  ? 529 ARG B NH2   1 
ATOM   4664  N  N     . TRP B 1 285 ? 87.13100  104.80300 133.30200 1.000 55.28000  ? 530 TRP B N     1 
ATOM   4665  C  CA    . TRP B 1 285 ? 85.77300  105.32700 133.31300 1.000 55.28000  ? 530 TRP B CA    1 
ATOM   4666  C  C     . TRP B 1 285 ? 85.75100  106.78800 132.89700 1.000 55.28000  ? 530 TRP B C     1 
ATOM   4667  O  O     . TRP B 1 285 ? 84.79000  107.24200 132.27400 1.000 55.28000  ? 530 TRP B O     1 
ATOM   4668  C  CB    . TRP B 1 285 ? 85.13400  105.20000 134.68900 1.000 55.28000  ? 530 TRP B CB    1 
ATOM   4669  C  CG    . TRP B 1 285 ? 83.70400  105.61800 134.65000 1.000 55.28000  ? 530 TRP B CG    1 
ATOM   4670  C  CD1   . TRP B 1 285 ? 82.63700  104.85500 134.27000 1.000 55.28000  ? 530 TRP B CD1   1 
ATOM   4671  C  CD2   . TRP B 1 285 ? 83.19700  106.93700 134.85200 1.000 55.28000  ? 530 TRP B CD2   1 
ATOM   4672  N  NE1   . TRP B 1 285 ? 81.48700  105.60000 134.30600 1.000 55.28000  ? 530 TRP B NE1   1 
ATOM   4673  C  CE2   . TRP B 1 285 ? 81.80600  106.88500 134.65000 1.000 55.28000  ? 530 TRP B CE2   1 
ATOM   4674  C  CE3   . TRP B 1 285 ? 83.77800  108.15000 135.21200 1.000 55.28000  ? 530 TRP B CE3   1 
ATOM   4675  C  CZ2   . TRP B 1 285 ? 80.99400  107.99900 134.79800 1.000 55.28000  ? 530 TRP B CZ2   1 
ATOM   4676  C  CZ3   . TRP B 1 285 ? 82.97400  109.24300 135.35400 1.000 55.28000  ? 530 TRP B CZ3   1 
ATOM   4677  C  CH2   . TRP B 1 285 ? 81.59700  109.16400 135.15400 1.000 55.28000  ? 530 TRP B CH2   1 
ATOM   4678  N  N     . SER B 1 286 ? 86.76700  107.55400 133.29400 1.000 48.01000  ? 531 SER B N     1 
ATOM   4679  C  CA    . SER B 1 286 ? 86.82200  108.95200 132.88200 1.000 48.01000  ? 531 SER B CA    1 
ATOM   4680  C  C     . SER B 1 286 ? 86.90500  109.06300 131.36900 1.000 48.01000  ? 531 SER B C     1 
ATOM   4681  O  O     . SER B 1 286 ? 86.22000  109.89200 130.76200 1.000 48.01000  ? 531 SER B O     1 
ATOM   4682  C  CB    . SER B 1 286 ? 88.01300  109.65100 133.53200 1.000 48.01000  ? 531 SER B CB    1 
ATOM   4683  O  OG    . SER B 1 286 ? 87.86200  109.71400 134.93800 1.000 48.01000  ? 531 SER B OG    1 
ATOM   4684  N  N     . VAL B 1 287 ? 87.71400  108.20800 130.74100 1.000 47.09000  ? 532 VAL B N     1 
ATOM   4685  C  CA    . VAL B 1 287 ? 87.80400  108.21900 129.28400 1.000 47.09000  ? 532 VAL B CA    1 
ATOM   4686  C  C     . VAL B 1 287 ? 86.50000  107.73300 128.66200 1.000 47.09000  ? 532 VAL B C     1 
ATOM   4687  O  O     . VAL B 1 287 ? 86.07800  108.23300 127.61100 1.000 47.09000  ? 532 VAL B O     1 
ATOM   4688  C  CB    . VAL B 1 287 ? 89.00600  107.37900 128.81700 1.000 47.09000  ? 532 VAL B CB    1 
ATOM   4689  C  CG1   . VAL B 1 287 ? 89.05100  107.30900 127.29900 1.000 47.09000  ? 532 VAL B CG1   1 
ATOM   4690  C  CG2   . VAL B 1 287 ? 90.29200  107.96200 129.35700 1.000 47.09000  ? 532 VAL B CG2   1 
ATOM   4691  N  N     . ALA B 1 288 ? 85.82800  106.77700 129.30300 1.000 47.55000  ? 533 ALA B N     1 
ATOM   4692  C  CA    . ALA B 1 288 ? 84.54500  106.30300 128.79400 1.000 47.55000  ? 533 ALA B CA    1 
ATOM   4693  C  C     . ALA B 1 288 ? 83.49700  107.40700 128.83100 1.000 47.55000  ? 533 ALA B C     1 
ATOM   4694  O  O     . ALA B 1 288 ? 82.76200  107.61400 127.86100 1.000 47.55000  ? 533 ALA B O     1 
ATOM   4695  C  CB    . ALA B 1 288 ? 84.07700  105.09300 129.60000 1.000 47.55000  ? 533 ALA B CB    1 
ATOM   4696  N  N     . GLU B 1 289 ? 83.40100  108.11100 129.96000 1.000 48.21000  ? 534 GLU B N     1 
ATOM   4697  C  CA    . GLU B 1 289 ? 82.47500  109.23100 130.08200 1.000 48.21000  ? 534 GLU B CA    1 
ATOM   4698  C  C     . GLU B 1 289 ? 82.81400  110.32500 129.08400 1.000 48.21000  ? 534 GLU B C     1 
ATOM   4699  O  O     . GLU B 1 289 ? 81.92200  110.93000 128.47800 1.000 48.21000  ? 534 GLU B O     1 
ATOM   4700  C  CB    . GLU B 1 289 ? 82.50800  109.78200 131.50600 1.000 48.21000  ? 534 GLU B CB    1 
ATOM   4701  C  CG    . GLU B 1 289 ? 81.62200  110.98500 131.72400 1.000 48.21000  ? 534 GLU B CG    1 
ATOM   4702  C  CD    . GLU B 1 289 ? 80.15300  110.66100 131.58600 1.000 48.21000  ? 534 GLU B CD    1 
ATOM   4703  O  OE1   . GLU B 1 289 ? 79.78000  109.49200 131.80700 1.000 48.21000  ? 534 GLU B OE1   1 
ATOM   4704  O  OE2   . GLU B 1 289 ? 79.37000  111.57600 131.25700 1.000 48.21000  ? 534 GLU B OE2   1 
ATOM   4705  N  N     . MET B 1 290 ? 84.10300  110.60300 128.91300 1.000 48.55000  ? 535 MET B N     1 
ATOM   4706  C  CA    . MET B 1 290 ? 84.56500  111.53100 127.89700 1.000 48.55000  ? 535 MET B CA    1 
ATOM   4707  C  C     . MET B 1 290 ? 84.07700  111.17200 126.50800 1.000 48.55000  ? 535 MET B C     1 
ATOM   4708  O  O     . MET B 1 290 ? 83.55500  112.04900 125.81300 1.000 48.55000  ? 535 MET B O     1 
ATOM   4709  C  CB    . MET B 1 290 ? 86.08900  111.57400 127.90800 1.000 48.55000  ? 535 MET B CB    1 
ATOM   4710  C  CG    . MET B 1 290 ? 86.68900  112.50700 126.89200 1.000 48.55000  ? 535 MET B CG    1 
ATOM   4711  S  SD    . MET B 1 290 ? 88.48100  112.43700 126.95600 1.000 48.55000  ? 535 MET B SD    1 
ATOM   4712  C  CE    . MET B 1 290 ? 88.76700  110.82500 126.23900 1.000 48.55000  ? 535 MET B CE    1 
ATOM   4713  N  N     . GLU B 1 291 ? 84.22900  109.91700 126.09000 1.000 48.93000  ? 536 GLU B N     1 
ATOM   4714  C  CA    . GLU B 1 291 ? 83.76800  109.47200 124.78000 1.000 48.93000  ? 536 GLU B CA    1 
ATOM   4715  C  C     . GLU B 1 291 ? 82.25000  109.50800 124.66200 1.000 48.93000  ? 536 GLU B C     1 
ATOM   4716  O  O     . GLU B 1 291 ? 81.71200  109.89700 123.61800 1.000 48.93000  ? 536 GLU B O     1 
ATOM   4717  C  CB    . GLU B 1 291 ? 84.27600  108.05600 124.49100 1.000 48.93000  ? 536 GLU B CB    1 
ATOM   4718  C  CG    . GLU B 1 291 ? 85.78700  107.94600 124.41100 1.000 48.93000  ? 536 GLU B CG    1 
ATOM   4719  C  CD    . GLU B 1 291 ? 86.37200  108.72000 123.24900 1.000 48.93000  ? 536 GLU B CD    1 
ATOM   4720  O  OE1   . GLU B 1 291 ? 85.69200  108.84300 122.21000 1.000 48.93000  ? 536 GLU B OE1   1 
ATOM   4721  O  OE2   . GLU B 1 291 ? 87.51400  109.20600 123.37400 1.000 48.93000  ? 536 GLU B OE2   1 
ATOM   4722  N  N     . ARG B 1 292 ? 81.54500  109.10900 125.71800 1.000 46.01000  ? 537 ARG B N     1 
ATOM   4723  C  CA    . ARG B 1 292 ? 80.09100  109.13900 125.70800 1.000 46.01000  ? 537 ARG B CA    1 
ATOM   4724  C  C     . ARG B 1 292 ? 79.60500  110.55900 125.47700 1.000 46.01000  ? 537 ARG B C     1 
ATOM   4725  O  O     . ARG B 1 292 ? 78.80500  110.80900 124.57100 1.000 46.01000  ? 537 ARG B O     1 
ATOM   4726  C  CB    . ARG B 1 292 ? 79.52100  108.60900 127.01600 1.000 46.01000  ? 537 ARG B CB    1 
ATOM   4727  C  CG    . ARG B 1 292 ? 78.01500  108.50400 126.98900 1.000 46.01000  ? 537 ARG B CG    1 
ATOM   4728  C  CD    . ARG B 1 292 ? 77.46500  108.06800 128.32600 1.000 46.01000  ? 537 ARG B CD    1 
ATOM   4729  N  NE    . ARG B 1 292 ? 77.70400  109.08400 129.34300 1.000 46.01000  ? 537 ARG B NE    1 
ATOM   4730  C  CZ    . ARG B 1 292 ? 76.93600  110.15400 129.51600 1.000 46.01000  ? 537 ARG B CZ    1 
ATOM   4731  N  NH1   . ARG B 1 292 ? 75.87900  110.34600 128.74000 1.000 46.01000  ? 537 ARG B NH1   1 
ATOM   4732  N  NH2   . ARG B 1 292 ? 77.22500  111.03300 130.46300 1.000 46.01000  ? 537 ARG B NH2   1 
ATOM   4733  N  N     . ARG B 1 293 ? 80.08200  111.49300 126.29400 1.000 44.03000  ? 538 ARG B N     1 
ATOM   4734  C  CA    . ARG B 1 293 ? 79.75900  112.89100 126.07300 1.000 44.03000  ? 538 ARG B CA    1 
ATOM   4735  C  C     . ARG B 1 293 ? 80.23400  113.39800 124.72400 1.000 44.03000  ? 538 ARG B C     1 
ATOM   4736  O  O     . ARG B 1 293 ? 79.54400  114.22500 124.11700 1.000 44.03000  ? 538 ARG B O     1 
ATOM   4737  C  CB    . ARG B 1 293 ? 80.37700  113.76900 127.15600 1.000 44.03000  ? 538 ARG B CB    1 
ATOM   4738  C  CG    . ARG B 1 293 ? 79.75400  113.63400 128.52500 1.000 44.03000  ? 538 ARG B CG    1 
ATOM   4739  C  CD    . ARG B 1 293 ? 80.39100  114.62300 129.47700 1.000 44.03000  ? 538 ARG B CD    1 
ATOM   4740  N  NE    . ARG B 1 293 ? 79.79600  114.58100 130.80700 1.000 44.03000  ? 538 ARG B NE    1 
ATOM   4741  C  CZ    . ARG B 1 293 ? 80.18800  115.35600 131.81100 1.000 44.03000  ? 538 ARG B CZ    1 
ATOM   4742  N  NH1   . ARG B 1 293 ? 81.16800  116.22500 131.61900 1.000 44.03000  ? 538 ARG B NH1   1 
ATOM   4743  N  NH2   . ARG B 1 293 ? 79.60300  115.27100 132.99900 1.000 44.03000  ? 538 ARG B NH2   1 
ATOM   4744  N  N     . TYR B 1 294 ? 81.38300  112.93000 124.23700 1.000 51.05000  ? 539 TYR B N     1 
ATOM   4745  C  CA    . TYR B 1 294 ? 81.96000  113.48400 123.02200 1.000 51.05000  ? 539 TYR B CA    1 
ATOM   4746  C  C     . TYR B 1 294 ? 81.18200  113.05400 121.79400 1.000 51.05000  ? 539 TYR B C     1 
ATOM   4747  O  O     . TYR B 1 294 ? 81.20500  113.75600 120.78300 1.000 51.05000  ? 539 TYR B O     1 
ATOM   4748  C  CB    . TYR B 1 294 ? 83.42500  113.05800 122.86900 1.000 51.05000  ? 539 TYR B CB    1 
ATOM   4749  C  CG    . TYR B 1 294 ? 84.25300  113.99400 122.05000 1.000 51.05000  ? 539 TYR B CG    1 
ATOM   4750  C  CD1   . TYR B 1 294 ? 84.85400  115.10800 122.63800 1.000 51.05000  ? 539 TYR B CD1   1 
ATOM   4751  C  CD2   . TYR B 1 294 ? 84.42100  113.79600 120.68200 1.000 51.05000  ? 539 TYR B CD2   1 
ATOM   4752  C  CE1   . TYR B 1 294 ? 85.60900  115.96800 121.89100 1.000 51.05000  ? 539 TYR B CE1   1 
ATOM   4753  C  CE2   . TYR B 1 294 ? 85.17200  114.67600 119.93900 1.000 51.05000  ? 539 TYR B CE2   1 
ATOM   4754  C  CZ    . TYR B 1 294 ? 85.75600  115.75400 120.55700 1.000 51.05000  ? 539 TYR B CZ    1 
ATOM   4755  O  OH    . TYR B 1 294 ? 86.49900  116.65800 119.84500 1.000 51.05000  ? 539 TYR B OH    1 
ATOM   4756  N  N     . ARG B 1 295 ? 80.48700  111.92500 121.86600 1.000 49.13000  ? 540 ARG B N     1 
ATOM   4757  C  CA    . ARG B 1 295 ? 79.56500  111.51000 120.81600 1.000 49.13000  ? 540 ARG B CA    1 
ATOM   4758  C  C     . ARG B 1 295 ? 78.16800  112.07600 121.00200 1.000 49.13000  ? 540 ARG B C     1 
ATOM   4759  O  O     . ARG B 1 295 ? 77.50000  112.40500 120.01700 1.000 49.13000  ? 540 ARG B O     1 
ATOM   4760  C  CB    . ARG B 1 295 ? 79.48500  109.98200 120.75000 1.000 49.13000  ? 540 ARG B CB    1 
ATOM   4761  C  CG    . ARG B 1 295 ? 80.76900  109.32600 120.26600 1.000 49.13000  ? 540 ARG B CG    1 
ATOM   4762  C  CD    . ARG B 1 295 ? 80.61100  107.82500 120.08700 1.000 49.13000  ? 540 ARG B CD    1 
ATOM   4763  N  NE    . ARG B 1 295 ? 80.50200  107.13700 121.36700 1.000 49.13000  ? 540 ARG B NE    1 
ATOM   4764  C  CZ    . ARG B 1 295 ? 79.41200  106.50600 121.78500 1.000 49.13000  ? 540 ARG B CZ    1 
ATOM   4765  N  NH1   . ARG B 1 295 ? 78.32800  106.46900 121.02400 1.000 49.13000  ? 540 ARG B NH1   1 
ATOM   4766  N  NH2   . ARG B 1 295 ? 79.40600  105.91200 122.96900 1.000 49.13000  ? 540 ARG B NH2   1 
ATOM   4767  N  N     . LEU B 1 296 ? 77.70800  112.18300 122.25100 1.000 50.72000  ? 541 LEU B N     1 
ATOM   4768  C  CA    . LEU B 1 296 ? 76.43100  112.82600 122.53100 1.000 50.72000  ? 541 LEU B CA    1 
ATOM   4769  C  C     . LEU B 1 296 ? 76.41700  114.26900 122.05300 1.000 50.72000  ? 541 LEU B C     1 
ATOM   4770  O  O     . LEU B 1 296 ? 75.37100  114.77900 121.63700 1.000 50.72000  ? 541 LEU B O     1 
ATOM   4771  C  CB    . LEU B 1 296 ? 76.15200  112.75900 124.02900 1.000 50.72000  ? 541 LEU B CB    1 
ATOM   4772  C  CG    . LEU B 1 296 ? 74.83000  113.32000 124.53100 1.000 50.72000  ? 541 LEU B CG    1 
ATOM   4773  C  CD1   . LEU B 1 296 ? 73.68300  112.53100 123.94500 1.000 50.72000  ? 541 LEU B CD1   1 
ATOM   4774  C  CD2   . LEU B 1 296 ? 74.80000  113.26600 126.04100 1.000 50.72000  ? 541 LEU B CD2   1 
ATOM   4775  N  N     . MET B 1 297 ? 77.56600  114.94000 122.09500 1.000 52.13000  ? 542 MET B N     1 
ATOM   4776  C  CA    . MET B 1 297 ? 77.66500  116.26500 121.49700 1.000 52.13000  ? 542 MET B CA    1 
ATOM   4777  C  C     . MET B 1 297 ? 77.71700  116.17600 119.98000 1.000 52.13000  ? 542 MET B C     1 
ATOM   4778  O  O     . MET B 1 297 ? 77.17000  117.03900 119.28600 1.000 52.13000  ? 542 MET B O     1 
ATOM   4779  C  CB    . MET B 1 297 ? 78.90300  116.99200 122.01600 1.000 52.13000  ? 542 MET B CB    1 
ATOM   4780  C  CG    . MET B 1 297 ? 78.87800  117.31700 123.48500 1.000 52.13000  ? 542 MET B CG    1 
ATOM   4781  S  SD    . MET B 1 297 ? 80.39900  118.12500 123.99400 1.000 52.13000  ? 542 MET B SD    1 
ATOM   4782  C  CE    . MET B 1 297 ? 80.11400  118.21600 125.75300 1.000 52.13000  ? 542 MET B CE    1 
ATOM   4783  N  N     . ALA B 1 298 ? 78.39400  115.15200 119.45400 1.000 50.72000  ? 543 ALA B N     1 
ATOM   4784  C  CA    . ALA B 1 298 ? 78.48400  114.97900 118.00900 1.000 50.72000  ? 543 ALA B CA    1 
ATOM   4785  C  C     . ALA B 1 298 ? 77.10500  114.85600 117.38200 1.000 50.72000  ? 543 ALA B C     1 
ATOM   4786  O  O     . ALA B 1 298 ? 76.85600  115.39600 116.29800 1.000 50.72000  ? 543 ALA B O     1 
ATOM   4787  C  CB    . ALA B 1 298 ? 79.33100  113.75100 117.68000 1.000 50.72000  ? 543 ALA B CB    1 
ATOM   4788  N  N     . ALA B 1 299 ? 76.19100  114.16600 118.05700 1.000 51.15000  ? 544 ALA B N     1 
ATOM   4789  C  CA    . ALA B 1 299 ? 74.85300  113.95300 117.52600 1.000 51.15000  ? 544 ALA B CA    1 
ATOM   4790  C  C     . ALA B 1 299 ? 73.96500  115.18500 117.63200 1.000 51.15000  ? 544 ALA B C     1 
ATOM   4791  O  O     . ALA B 1 299 ? 72.76100  115.08000 117.38100 1.000 51.15000  ? 544 ALA B O     1 
ATOM   4792  C  CB    . ALA B 1 299 ? 74.18700  112.77400 118.23800 1.000 51.15000  ? 544 ALA B CB    1 
ATOM   4793  N  N     . MET B 1 300 ? 74.52100  116.34600 117.98800 1.000 53.48000  ? 545 MET B N     1 
ATOM   4794  C  CA    . MET B 1 300 ? 73.71000  117.54700 118.14000 1.000 53.48000  ? 545 MET B CA    1 
ATOM   4795  C  C     . MET B 1 300 ? 74.36600  118.79900 117.56800 1.000 53.48000  ? 545 MET B C     1 
ATOM   4796  O  O     . MET B 1 300 ? 73.88300  119.90500 117.83800 1.000 53.48000  ? 545 MET B O     1 
ATOM   4797  C  CB    . MET B 1 300 ? 73.36700  117.76800 119.61600 1.000 53.48000  ? 545 MET B CB    1 
ATOM   4798  C  CG    . MET B 1 300 ? 72.38200  116.75500 120.17000 1.000 53.48000  ? 545 MET B CG    1 
ATOM   4799  S  SD    . MET B 1 300 ? 72.11600  116.92700 121.93900 1.000 53.48000  ? 545 MET B SD    1 
ATOM   4800  C  CE    . MET B 1 300 ? 71.27700  118.50200 121.99600 1.000 53.48000  ? 545 MET B CE    1 
ATOM   4801  N  N     . GLY B 1 301 ? 75.43600  118.66800 116.78900 1.000 52.33000  ? 546 GLY B N     1 
ATOM   4802  C  CA    . GLY B 1 301 ? 76.02800  119.82200 116.13100 1.000 52.33000  ? 546 GLY B CA    1 
ATOM   4803  C  C     . GLY B 1 301 ? 76.67000  120.82800 117.06000 1.000 52.33000  ? 546 GLY B C     1 
ATOM   4804  O  O     . GLY B 1 301 ? 76.90100  121.97300 116.65900 1.000 52.33000  ? 546 GLY B O     1 
ATOM   4805  N  N     . VAL B 1 302 ? 76.96900  120.43200 118.29000 1.000 52.60000  ? 547 VAL B N     1 
ATOM   4806  C  CA    . VAL B 1 302 ? 77.60000  121.30700 119.26000 1.000 52.60000  ? 547 VAL B CA    1 
ATOM   4807  C  C     . VAL B 1 302 ? 79.09300  121.00000 119.25900 1.000 52.60000  ? 547 VAL B C     1 
ATOM   4808  O  O     . VAL B 1 302 ? 79.53600  119.95300 118.78200 1.000 52.60000  ? 547 VAL B O     1 
ATOM   4809  C  CB    . VAL B 1 302 ? 76.96800  121.11800 120.66200 1.000 52.60000  ? 547 VAL B CB    1 
ATOM   4810  C  CG1   . VAL B 1 302 ? 77.54100  122.09000 121.67200 1.000 52.60000  ? 547 VAL B CG1   1 
ATOM   4811  C  CG2   . VAL B 1 302 ? 75.46000  121.26100 120.58300 1.000 52.60000  ? 547 VAL B CG2   1 
ATOM   4812  N  N     . ARG B 1 303 ? 79.89300  121.92800 119.79200 1.000 54.82000  ? 548 ARG B N     1 
ATOM   4813  C  CA    . ARG B 1 303 ? 81.34100  121.75900 119.81600 1.000 54.82000  ? 548 ARG B CA    1 
ATOM   4814  C  C     . ARG B 1 303 ? 81.94100  121.87800 121.21200 1.000 54.82000  ? 548 ARG B C     1 
ATOM   4815  O  O     . ARG B 1 303 ? 83.17100  121.90700 121.33900 1.000 54.82000  ? 548 ARG B O     1 
ATOM   4816  C  CB    . ARG B 1 303 ? 82.01800  122.77500 118.89000 1.000 54.82000  ? 548 ARG B CB    1 
ATOM   4817  C  CG    . ARG B 1 303 ? 81.75700  122.55700 117.41400 1.000 54.82000  ? 548 ARG B CG    1 
ATOM   4818  C  CD    . ARG B 1 303 ? 82.52100  123.57300 116.58400 1.000 54.82000  ? 548 ARG B CD    1 
ATOM   4819  N  NE    . ARG B 1 303 ? 82.28600  123.40600 115.15600 1.000 54.82000  ? 548 ARG B NE    1 
ATOM   4820  C  CZ    . ARG B 1 303 ? 82.80200  124.19100 114.21700 1.000 54.82000  ? 548 ARG B CZ    1 
ATOM   4821  N  NH1   . ARG B 1 303 ? 83.58800  125.20500 114.55100 1.000 54.82000  ? 548 ARG B NH1   1 
ATOM   4822  N  NH2   . ARG B 1 303 ? 82.53100  123.96100 112.94100 1.000 54.82000  ? 548 ARG B NH2   1 
ATOM   4823  N  N     . ASN B 1 304 ? 81.12300  121.93700 122.25600 1.000 50.43000  ? 549 ASN B N     1 
ATOM   4824  C  CA    . ASN B 1 304 ? 81.62200  122.01000 123.62500 1.000 50.43000  ? 549 ASN B CA    1 
ATOM   4825  C  C     . ASN B 1 304 ? 80.47400  121.66900 124.56800 1.000 50.43000  ? 549 ASN B C     1 
ATOM   4826  O  O     . ASN B 1 304 ? 79.40300  121.23500 124.13600 1.000 50.43000  ? 549 ASN B O     1 
ATOM   4827  C  CB    . ASN B 1 304 ? 82.23800  123.38400 123.91300 1.000 50.43000  ? 549 ASN B CB    1 
ATOM   4828  C  CG    . ASN B 1 304 ? 81.25500  124.52200 123.72900 1.000 50.43000  ? 549 ASN B CG    1 
ATOM   4829  O  OD1   . ASN B 1 304 ? 80.06800  124.30700 123.48700 1.000 50.43000  ? 549 ASN B OD1   1 
ATOM   4830  N  ND2   . ASN B 1 304 ? 81.75000  125.74800 123.83900 1.000 50.43000  ? 549 ASN B ND2   1 
ATOM   4831  N  N     . LEU B 1 305 ? 80.70200  121.85400 125.86500 1.000 50.09000  ? 550 LEU B N     1 
ATOM   4832  C  CA    . LEU B 1 305 ? 79.66500  121.58400 126.85000 1.000 50.09000  ? 550 LEU B CA    1 
ATOM   4833  C  C     . LEU B 1 305 ? 78.80400  122.80200 127.13500 1.000 50.09000  ? 550 LEU B C     1 
ATOM   4834  O  O     . LEU B 1 305 ? 77.61200  122.65500 127.43100 1.000 50.09000  ? 550 LEU B O     1 
ATOM   4835  C  CB    . LEU B 1 305 ? 80.29000  121.08100 128.15200 1.000 50.09000  ? 550 LEU B CB    1 
ATOM   4836  C  CG    . LEU B 1 305 ? 79.31300  120.64500 129.24200 1.000 50.09000  ? 550 LEU B CG    1 
ATOM   4837  C  CD1   . LEU B 1 305 ? 78.48500  119.46900 128.76800 1.000 50.09000  ? 550 LEU B CD1   1 
ATOM   4838  C  CD2   . LEU B 1 305 ? 80.05800  120.29100 130.51100 1.000 50.09000  ? 550 LEU B CD2   1 
ATOM   4839  N  N     . ALA B 1 306 ? 79.38200  124.00200 127.05700 1.000 52.59000  ? 551 ALA B N     1 
ATOM   4840  C  CA    . ALA B 1 306 ? 78.58700  125.21100 127.23000 1.000 52.59000  ? 551 ALA B CA    1 
ATOM   4841  C  C     . ALA B 1 306 ? 77.49500  125.30100 126.17400 1.000 52.59000  ? 551 ALA B C     1 
ATOM   4842  O  O     . ALA B 1 306 ? 76.33800  125.59900 126.49100 1.000 52.59000  ? 551 ALA B O     1 
ATOM   4843  C  CB    . ALA B 1 306 ? 79.48800  126.44200 127.18600 1.000 52.59000  ? 551 ALA B CB    1 
ATOM   4844  N  N     . GLY B 1 307 ? 77.84100  125.03600 124.91300 1.000 53.65000  ? 552 GLY B N     1 
ATOM   4845  C  CA    . GLY B 1 307 ? 76.83400  125.04000 123.86500 1.000 53.65000  ? 552 GLY B CA    1 
ATOM   4846  C  C     . GLY B 1 307 ? 75.78900  123.95900 124.05600 1.000 53.65000  ? 552 GLY B C     1 
ATOM   4847  O  O     . GLY B 1 307 ? 74.60900  124.16800 123.77700 1.000 53.65000  ? 552 GLY B O     1 
ATOM   4848  N  N     . PHE B 1 308 ? 76.20900  122.79100 124.54500 1.000 53.69000  ? 553 PHE B N     1 
ATOM   4849  C  CA    . PHE B 1 308 ? 75.27300  121.70300 124.80400 1.000 53.69000  ? 553 PHE B CA    1 
ATOM   4850  C  C     . PHE B 1 308 ? 74.26100  122.09400 125.87400 1.000 53.69000  ? 553 PHE B C     1 
ATOM   4851  O  O     . PHE B 1 308 ? 73.04800  121.88900 125.71500 1.000 53.69000  ? 553 PHE B O     1 
ATOM   4852  C  CB    . PHE B 1 308 ? 76.04800  120.45700 125.22800 1.000 53.69000  ? 553 PHE B CB    1 
ATOM   4853  C  CG    . PHE B 1 308 ? 75.18500  119.26800 125.51200 1.000 53.69000  ? 553 PHE B CG    1 
ATOM   4854  C  CD1   . PHE B 1 308 ? 74.68400  118.50000 124.48200 1.000 53.69000  ? 553 PHE B CD1   1 
ATOM   4855  C  CD2   . PHE B 1 308 ? 74.87400  118.91900 126.81200 1.000 53.69000  ? 553 PHE B CD2   1 
ATOM   4856  C  CE1   . PHE B 1 308 ? 73.89600  117.40300 124.74400 1.000 53.69000  ? 553 PHE B CE1   1 
ATOM   4857  C  CE2   . PHE B 1 308 ? 74.08300  117.82500 127.07800 1.000 53.69000  ? 553 PHE B CE2   1 
ATOM   4858  C  CZ    . PHE B 1 308 ? 73.59300  117.06700 126.04300 1.000 53.69000  ? 553 PHE B CZ    1 
ATOM   4859  N  N     . ASN B 1 309 ? 74.74600  122.65300 126.98300 1.000 59.82000  ? 554 ASN B N     1 
ATOM   4860  C  CA    . ASN B 1 309 ? 73.84400  123.06200 128.05000 1.000 59.82000  ? 554 ASN B CA    1 
ATOM   4861  C  C     . ASN B 1 309 ? 72.95900  124.21900 127.61100 1.000 59.82000  ? 554 ASN B C     1 
ATOM   4862  O  O     . ASN B 1 309 ? 71.78900  124.28800 127.99600 1.000 59.82000  ? 554 ASN B O     1 
ATOM   4863  C  CB    . ASN B 1 309 ? 74.63800  123.42800 129.30100 1.000 59.82000  ? 554 ASN B CB    1 
ATOM   4864  C  CG    . ASN B 1 309 ? 75.24300  122.21900 129.97400 1.000 59.82000  ? 554 ASN B CG    1 
ATOM   4865  O  OD1   . ASN B 1 309 ? 74.60600  121.17200 130.07900 1.000 59.82000  ? 554 ASN B OD1   1 
ATOM   4866  N  ND2   . ASN B 1 309 ? 76.47900  122.35500 130.43600 1.000 59.82000  ? 554 ASN B ND2   1 
ATOM   4867  N  N     . ARG B 1 310 ? 73.48800  125.13000 126.79200 1.000 65.85000  ? 555 ARG B N     1 
ATOM   4868  C  CA    . ARG B 1 310 ? 72.65300  126.19500 126.24800 1.000 65.85000  ? 555 ARG B CA    1 
ATOM   4869  C  C     . ARG B 1 310 ? 71.55000  125.62400 125.36700 1.000 65.85000  ? 555 ARG B C     1 
ATOM   4870  O  O     . ARG B 1 310 ? 70.39900  126.07300 125.42700 1.000 65.85000  ? 555 ARG B O     1 
ATOM   4871  C  CB    . ARG B 1 310 ? 73.51600  127.18300 125.46600 1.000 65.85000  ? 555 ARG B CB    1 
ATOM   4872  C  CG    . ARG B 1 310 ? 72.76800  128.38100 124.92200 1.000 65.85000  ? 555 ARG B CG    1 
ATOM   4873  C  CD    . ARG B 1 310 ? 73.71700  129.31100 124.19100 1.000 65.85000  ? 555 ARG B CD    1 
ATOM   4874  N  NE    . ARG B 1 310 ? 74.27200  128.68600 122.99400 1.000 65.85000  ? 555 ARG B NE    1 
ATOM   4875  C  CZ    . ARG B 1 310 ? 75.26500  129.19800 122.27300 1.000 65.85000  ? 555 ARG B CZ    1 
ATOM   4876  N  NH1   . ARG B 1 310 ? 75.82100  130.34900 122.62600 1.000 65.85000  ? 555 ARG B NH1   1 
ATOM   4877  N  NH2   . ARG B 1 310 ? 75.70500  128.55700 121.19800 1.000 65.85000  ? 555 ARG B NH2   1 
ATOM   4878  N  N     . LYS B 1 311 ? 71.88500  124.62000 124.55500 1.000 67.74000  ? 556 LYS B N     1 
ATOM   4879  C  CA    . LYS B 1 311 ? 70.89500  123.96200 123.71100 1.000 67.74000  ? 556 LYS B CA    1 
ATOM   4880  C  C     . LYS B 1 311 ? 69.78500  123.34800 124.55300 1.000 67.74000  ? 556 LYS B C     1 
ATOM   4881  O  O     . LYS B 1 311 ? 68.59500  123.56100 124.28700 1.000 67.74000  ? 556 LYS B O     1 
ATOM   4882  C  CB    . LYS B 1 311 ? 71.57900  122.89000 122.86200 1.000 67.74000  ? 556 LYS B CB    1 
ATOM   4883  C  CG    . LYS B 1 311 ? 70.69300  122.23000 121.83000 1.000 67.74000  ? 556 LYS B CG    1 
ATOM   4884  C  CD    . LYS B 1 311 ? 70.29600  123.21300 120.74900 1.000 67.74000  ? 556 LYS B CD    1 
ATOM   4885  C  CE    . LYS B 1 311 ? 71.50900  123.64200 119.94500 1.000 67.74000  ? 556 LYS B CE    1 
ATOM   4886  N  NZ    . LYS B 1 311 ? 72.05600  122.51200 119.15000 1.000 67.74000  ? 556 LYS B NZ    1 
ATOM   4887  N  N     . VAL B 1 312 ? 70.15800  122.58900 125.58600 1.000 69.21000  ? 557 VAL B N     1 
ATOM   4888  C  CA    . VAL B 1 312 ? 69.13600  121.90100 126.37100 1.000 69.21000  ? 557 VAL B CA    1 
ATOM   4889  C  C     . VAL B 1 312 ? 68.32900  122.88900 127.21200 1.000 69.21000  ? 557 VAL B C     1 
ATOM   4890  O  O     . VAL B 1 312 ? 67.12600  122.69100 127.42500 1.000 69.21000  ? 557 VAL B O     1 
ATOM   4891  C  CB    . VAL B 1 312 ? 69.76400  120.78900 127.23400 1.000 69.21000  ? 557 VAL B CB    1 
ATOM   4892  C  CG1   . VAL B 1 312 ? 70.66200  121.37000 128.30100 1.000 69.21000  ? 557 VAL B CG1   1 
ATOM   4893  C  CG2   . VAL B 1 312 ? 68.68000  119.92700 127.85800 1.000 69.21000  ? 557 VAL B CG2   1 
ATOM   4894  N  N     . LYS B 1 313 ? 68.95000  123.97600 127.68000 1.000 73.52000  ? 558 LYS B N     1 
ATOM   4895  C  CA    . LYS B 1 313 ? 68.20000  124.98900 128.41500 1.000 73.52000  ? 558 LYS B CA    1 
ATOM   4896  C  C     . LYS B 1 313 ? 67.20500  125.69900 127.50900 1.000 73.52000  ? 558 LYS B C     1 
ATOM   4897  O  O     . LYS B 1 313 ? 66.06300  125.94900 127.91100 1.000 73.52000  ? 558 LYS B O     1 
ATOM   4898  C  CB    . LYS B 1 313 ? 69.15200  125.99900 129.05300 1.000 73.52000  ? 558 LYS B CB    1 
ATOM   4899  C  CG    . LYS B 1 313 ? 69.97000  125.45100 130.20600 1.000 73.52000  ? 558 LYS B CG    1 
ATOM   4900  C  CD    . LYS B 1 313 ? 70.90300  126.51400 130.76000 1.000 73.52000  ? 558 LYS B CD    1 
ATOM   4901  C  CE    . LYS B 1 313 ? 71.77000  125.96300 131.87700 1.000 73.52000  ? 558 LYS B CE    1 
ATOM   4902  N  NZ    . LYS B 1 313 ? 72.71100  126.98900 132.40200 1.000 73.52000  ? 558 LYS B NZ    1 
ATOM   4903  N  N     . ASP B 1 314 ? 67.62300  126.04600 126.28900 1.000 80.30000  ? 559 ASP B N     1 
ATOM   4904  C  CA    . ASP B 1 314 ? 66.69400  126.63700 125.33400 1.000 80.30000  ? 559 ASP B CA    1 
ATOM   4905  C  C     . ASP B 1 314 ? 65.54800  125.68400 125.02700 1.000 80.30000  ? 559 ASP B C     1 
ATOM   4906  O  O     . ASP B 1 314 ? 64.39300  126.10600 124.90900 1.000 80.30000  ? 559 ASP B O     1 
ATOM   4907  C  CB    . ASP B 1 314 ? 67.43100  127.02100 124.05200 1.000 80.30000  ? 559 ASP B CB    1 
ATOM   4908  C  CG    . ASP B 1 314 ? 68.40400  128.16000 124.26000 1.000 80.30000  ? 559 ASP B CG    1 
ATOM   4909  O  OD1   . ASP B 1 314 ? 68.16300  128.99300 125.15900 1.000 80.30000  ? 559 ASP B OD1   1 
ATOM   4910  O  OD2   . ASP B 1 314 ? 69.41100  128.22300 123.52500 1.000 80.30000  ? 559 ASP B OD2   1 
ATOM   4911  N  N     . ALA B 1 315 ? 65.85300  124.39200 124.88700 1.000 85.92000  ? 560 ALA B N     1 
ATOM   4912  C  CA    . ALA B 1 315 ? 64.80600  123.40500 124.65100 1.000 85.92000  ? 560 ALA B CA    1 
ATOM   4913  C  C     . ALA B 1 315 ? 63.81000  123.36900 125.80400 1.000 85.92000  ? 560 ALA B C     1 
ATOM   4914  O  O     . ALA B 1 315 ? 62.59300  123.38000 125.58900 1.000 85.92000  ? 560 ALA B O     1 
ATOM   4915  C  CB    . ALA B 1 315 ? 65.42800  122.02700 124.43200 1.000 85.92000  ? 560 ALA B CB    1 
ATOM   4916  N  N     . GLU B 1 316 ? 64.31100  123.32900 127.04100 1.000 88.99000  ? 561 GLU B N     1 
ATOM   4917  C  CA    . GLU B 1 316 ? 63.41900  123.24700 128.19500 1.000 88.99000  ? 561 GLU B CA    1 
ATOM   4918  C  C     . GLU B 1 316 ? 62.57300  124.50700 128.33700 1.000 88.99000  ? 561 GLU B C     1 
ATOM   4919  O  O     . GLU B 1 316 ? 61.35500  124.42600 128.53200 1.000 88.99000  ? 561 GLU B O     1 
ATOM   4920  C  CB    . GLU B 1 316 ? 64.22000  122.99000 129.47100 1.000 88.99000  ? 561 GLU B CB    1 
ATOM   4921  C  CG    . GLU B 1 316 ? 64.81200  121.59700 129.55900 1.000 88.99000  ? 561 GLU B CG    1 
ATOM   4922  C  CD    . GLU B 1 316 ? 65.57400  121.37000 130.84900 1.000 88.99000  ? 561 GLU B CD    1 
ATOM   4923  O  OE1   . GLU B 1 316 ? 65.75600  122.34200 131.61000 1.000 88.99000  ? 561 GLU B OE1   1 
ATOM   4924  O  OE2   . GLU B 1 316 ? 65.98600  120.21900 131.10400 1.000 88.99000  ? 561 GLU B OE2   1 
ATOM   4925  N  N     . GLU B 1 317 ? 63.19800  125.68300 128.24800 1.000 90.16000  ? 562 GLU B N     1 
ATOM   4926  C  CA    . GLU B 1 317 ? 62.44900  126.92200 128.42700 1.000 90.16000  ? 562 GLU B CA    1 
ATOM   4927  C  C     . GLU B 1 317 ? 61.48400  127.18700 127.28000 1.000 90.16000  ? 562 GLU B C     1 
ATOM   4928  O  O     . GLU B 1 317 ? 60.55800  127.98800 127.44100 1.000 90.16000  ? 562 GLU B O     1 
ATOM   4929  C  CB    . GLU B 1 317 ? 63.40100  128.10800 128.59100 1.000 90.16000  ? 562 GLU B CB    1 
ATOM   4930  C  CG    . GLU B 1 317 ? 64.18800  128.46900 127.34500 1.000 90.16000  ? 562 GLU B CG    1 
ATOM   4931  C  CD    . GLU B 1 317 ? 65.15400  129.61100 127.58700 1.000 90.16000  ? 562 GLU B CD    1 
ATOM   4932  O  OE1   . GLU B 1 317 ? 65.22600  130.09300 128.73700 1.000 90.16000  ? 562 GLU B OE1   1 
ATOM   4933  O  OE2   . GLU B 1 317 ? 65.83700  130.03100 126.63100 1.000 90.16000  ? 562 GLU B OE2   1 
ATOM   4934  N  N     . ALA B 1 318 ? 61.68000  126.54700 126.13000 1.000 91.52000  ? 563 ALA B N     1 
ATOM   4935  C  CA    . ALA B 1 318 ? 60.72500  126.61200 125.03400 1.000 91.52000  ? 563 ALA B CA    1 
ATOM   4936  C  C     . ALA B 1 318 ? 59.66600  125.52100 125.12000 1.000 91.52000  ? 563 ALA B C     1 
ATOM   4937  O  O     . ALA B 1 318 ? 58.96700  125.27300 124.13200 1.000 91.52000  ? 563 ALA B O     1 
ATOM   4938  C  CB    . ALA B 1 318 ? 61.45100  126.52800 123.68900 1.000 91.52000  ? 563 ALA B CB    1 
ATOM   4939  N  N     . GLY B 1 319 ? 59.53600  124.86600 126.27400 1.000 96.23000  ? 564 GLY B N     1 
ATOM   4940  C  CA    . GLY B 1 319 ? 58.52100  123.85900 126.49000 1.000 96.23000  ? 564 GLY B CA    1 
ATOM   4941  C  C     . GLY B 1 319 ? 58.79100  122.50600 125.86900 1.000 96.23000  ? 564 GLY B C     1 
ATOM   4942  O  O     . GLY B 1 319 ? 58.21900  121.51000 126.32600 1.000 96.23000  ? 564 GLY B O     1 
ATOM   4943  N  N     . THR B 1 320 ? 59.64100  122.42900 124.84500 1.000 96.87000  ? 565 THR B N     1 
ATOM   4944  C  CA    . THR B 1 320 ? 59.90700  121.17300 124.15100 1.000 96.87000  ? 565 THR B CA    1 
ATOM   4945  C  C     . THR B 1 320 ? 61.30500  120.67300 124.49000 1.000 96.87000  ? 565 THR B C     1 
ATOM   4946  O  O     . THR B 1 320 ? 62.29200  121.14600 123.90700 1.000 96.87000  ? 565 THR B O     1 
ATOM   4947  C  CB    . THR B 1 320 ? 59.75700  121.35300 122.63800 1.000 96.87000  ? 565 THR B CB    1 
ATOM   4948  O  OG1   . THR B 1 320 ? 58.42800  121.79800 122.33900 1.000 96.87000  ? 565 THR B OG1   1 
ATOM   4949  C  CG2   . THR B 1 320 ? 60.01800  120.03900 121.91600 1.000 96.87000  ? 565 THR B CG2   1 
ATOM   4950  N  N     . PRO B 1 321 ? 61.44800  119.72700 125.41200 1.000 95.17000  ? 566 PRO B N     1 
ATOM   4951  C  CA    . PRO B 1 321 ? 62.77600  119.19500 125.72500 1.000 95.17000  ? 566 PRO B CA    1 
ATOM   4952  C  C     . PRO B 1 321 ? 63.26300  118.23000 124.65800 1.000 95.17000  ? 566 PRO B C     1 
ATOM   4953  O  O     . PRO B 1 321 ? 62.49500  117.45800 124.08000 1.000 95.17000  ? 566 PRO B O     1 
ATOM   4954  C  CB    . PRO B 1 321 ? 62.55800  118.47200 127.05900 1.000 95.17000  ? 566 PRO B CB    1 
ATOM   4955  C  CG    . PRO B 1 321 ? 61.12300  118.06400 127.01700 1.000 95.17000  ? 566 PRO B CG    1 
ATOM   4956  C  CD    . PRO B 1 321 ? 60.40200  119.15600 126.27900 1.000 95.17000  ? 566 PRO B CD    1 
ATOM   4957  N  N     . LEU B 1 322 ? 64.56800  118.28300 124.40400 1.000 86.23000  ? 567 LEU B N     1 
ATOM   4958  C  CA    . LEU B 1 322 ? 65.17300  117.44600 123.38000 1.000 86.23000  ? 567 LEU B CA    1 
ATOM   4959  C  C     . LEU B 1 322 ? 65.18900  115.98500 123.82800 1.000 86.23000  ? 567 LEU B C     1 
ATOM   4960  O  O     . LEU B 1 322 ? 64.76800  115.63400 124.93300 1.000 86.23000  ? 567 LEU B O     1 
ATOM   4961  C  CB    . LEU B 1 322 ? 66.57600  117.94800 123.05500 1.000 86.23000  ? 567 LEU B CB    1 
ATOM   4962  C  CG    . LEU B 1 322 ? 66.59000  119.31400 122.36800 1.000 86.23000  ? 567 LEU B CG    1 
ATOM   4963  C  CD1   . LEU B 1 322 ? 67.99800  119.83900 122.23400 1.000 86.23000  ? 567 LEU B CD1   1 
ATOM   4964  C  CD2   . LEU B 1 322 ? 65.91900  119.24000 121.00500 1.000 86.23000  ? 567 LEU B CD2   1 
ATOM   4965  N  N     . THR B 1 323 ? 65.68600  115.12000 122.94800 1.000 84.71000  ? 568 THR B N     1 
ATOM   4966  C  CA    . THR B 1 323 ? 65.66500  113.68500 123.17400 1.000 84.71000  ? 568 THR B CA    1 
ATOM   4967  C  C     . THR B 1 323 ? 67.07100  113.11600 123.04800 1.000 84.71000  ? 568 THR B C     1 
ATOM   4968  O  O     . THR B 1 323 ? 67.90000  113.62200 122.28700 1.000 84.71000  ? 568 THR B O     1 
ATOM   4969  C  CB    . THR B 1 323 ? 64.71400  112.97400 122.19400 1.000 84.71000  ? 568 THR B CB    1 
ATOM   4970  O  OG1   . THR B 1 323 ? 64.61800  111.58600 122.53400 1.000 84.71000  ? 568 THR B OG1   1 
ATOM   4971  C  CG2   . THR B 1 323 ? 65.20300  113.11600 120.75800 1.000 84.71000  ? 568 THR B CG2   1 
ATOM   4972  N  N     . ASP B 1 324 ? 67.32900  112.07100 123.81800 1.000 79.66000  ? 569 ASP B N     1 
ATOM   4973  C  CA    . ASP B 1 324 ? 68.63700  111.42800 123.83100 1.000 79.66000  ? 569 ASP B CA    1 
ATOM   4974  C  C     . ASP B 1 324 ? 68.86600  110.67700 122.52600 1.000 79.66000  ? 569 ASP B C     1 
ATOM   4975  O  O     . ASP B 1 324 ? 68.13000  109.72700 122.23300 1.000 79.66000  ? 569 ASP B O     1 
ATOM   4976  C  CB    . ASP B 1 324 ? 68.73100  110.47500 125.02100 1.000 79.66000  ? 569 ASP B CB    1 
ATOM   4977  C  CG    . ASP B 1 324 ? 70.13400  109.94700 125.24300 1.000 79.66000  ? 569 ASP B CG    1 
ATOM   4978  O  OD1   . ASP B 1 324 ? 71.04400  110.29600 124.46300 1.000 79.66000  ? 569 ASP B OD1   1 
ATOM   4979  O  OD2   . ASP B 1 324 ? 70.32800  109.17700 126.20700 1.000 79.66000  ? 569 ASP B OD2   1 
ATOM   4980  N  N     . PRO B 1 325 ? 69.86400  111.05800 121.71700 1.000 74.99000  ? 570 PRO B N     1 
ATOM   4981  C  CA    . PRO B 1 325 ? 70.18100  110.35300 120.47100 1.000 74.99000  ? 570 PRO B CA    1 
ATOM   4982  C  C     . PRO B 1 325 ? 70.87500  109.01500 120.71300 1.000 74.99000  ? 570 PRO B C     1 
ATOM   4983  O  O     . PRO B 1 325 ? 72.06500  108.89500 120.42200 1.000 74.99000  ? 570 PRO B O     1 
ATOM   4984  C  CB    . PRO B 1 325 ? 71.11300  111.32600 119.74900 1.000 74.99000  ? 570 PRO B CB    1 
ATOM   4985  C  CG    . PRO B 1 325 ? 71.75200  112.10300 120.84200 1.000 74.99000  ? 570 PRO B CG    1 
ATOM   4986  C  CD    . PRO B 1 325 ? 70.71400  112.24300 121.91300 1.000 74.99000  ? 570 PRO B CD    1 
ATOM   4987  N  N     . PRO B 1 337 ? 65.07000  108.52200 125.87800 1.000 84.34000  ? 582 PRO B N     1 
ATOM   4988  C  CA    . PRO B 1 337 ? 64.76200  109.22900 127.12500 1.000 84.34000  ? 582 PRO B CA    1 
ATOM   4989  C  C     . PRO B 1 337 ? 64.72900  110.74600 126.94800 1.000 84.34000  ? 582 PRO B C     1 
ATOM   4990  O  O     . PRO B 1 337 ? 64.23300  111.23400 125.93400 1.000 84.34000  ? 582 PRO B O     1 
ATOM   4991  C  CB    . PRO B 1 337 ? 65.90300  108.80900 128.05600 1.000 84.34000  ? 582 PRO B CB    1 
ATOM   4992  C  CG    . PRO B 1 337 ? 66.35600  107.49400 127.51900 1.000 84.34000  ? 582 PRO B CG    1 
ATOM   4993  C  CD    . PRO B 1 337 ? 66.21500  107.61000 126.03200 1.000 84.34000  ? 582 PRO B CD    1 
ATOM   4994  N  N     . GLN B 1 338 ? 65.25900  111.47700 127.92600 1.000 81.96000  ? 583 GLN B N     1 
ATOM   4995  C  CA    . GLN B 1 338 ? 65.19900  112.93300 127.93200 1.000 81.96000  ? 583 GLN B CA    1 
ATOM   4996  C  C     . GLN B 1 338 ? 66.51000  113.48700 128.46800 1.000 81.96000  ? 583 GLN B C     1 
ATOM   4997  O  O     . GLN B 1 338 ? 66.97800  113.06500 129.52900 1.000 81.96000  ? 583 GLN B O     1 
ATOM   4998  C  CB    . GLN B 1 338 ? 64.02000  113.42400 128.77900 1.000 81.96000  ? 583 GLN B CB    1 
ATOM   4999  C  CG    . GLN B 1 338 ? 63.83400  114.93000 128.80400 1.000 81.96000  ? 583 GLN B CG    1 
ATOM   5000  C  CD    . GLN B 1 338 ? 62.60300  115.34000 129.58800 1.000 81.96000  ? 583 GLN B CD    1 
ATOM   5001  O  OE1   . GLN B 1 338 ? 61.87700  114.49300 130.10900 1.000 81.96000  ? 583 GLN B OE1   1 
ATOM   5002  N  NE2   . GLN B 1 338 ? 62.37200  116.64100 129.69100 1.000 81.96000  ? 583 GLN B NE2   1 
ATOM   5003  N  N     . LEU B 1 339 ? 67.09200  114.43400 127.73800 1.000 74.71000  ? 584 LEU B N     1 
ATOM   5004  C  CA    . LEU B 1 339 ? 68.39000  114.98200 128.09900 1.000 74.71000  ? 584 LEU B CA    1 
ATOM   5005  C  C     . LEU B 1 339 ? 68.26900  116.00500 129.21900 1.000 74.71000  ? 584 LEU B C     1 
ATOM   5006  O  O     . LEU B 1 339 ? 67.24900  116.68500 129.36700 1.000 74.71000  ? 584 LEU B O     1 
ATOM   5007  C  CB    . LEU B 1 339 ? 69.05700  115.63200 126.88600 1.000 74.71000  ? 584 LEU B CB    1 
ATOM   5008  C  CG    . LEU B 1 339 ? 69.49400  114.69900 125.76100 1.000 74.71000  ? 584 LEU B CG    1 
ATOM   5009  C  CD1   . LEU B 1 339 ? 70.00600  115.50600 124.58400 1.000 74.71000  ? 584 LEU B CD1   1 
ATOM   5010  C  CD2   . LEU B 1 339 ? 70.55900  113.74200 126.26000 1.000 74.71000  ? 584 LEU B CD2   1 
ATOM   5011  N  N     . SER B 1 340 ? 69.33200  116.10800 130.01000 1.000 66.51000  ? 585 SER B N     1 
ATOM   5012  C  CA    . SER B 1 340 ? 69.45900  117.09600 131.06900 1.000 66.51000  ? 585 SER B CA    1 
ATOM   5013  C  C     . SER B 1 340 ? 70.73500  117.89500 130.83600 1.000 66.51000  ? 585 SER B C     1 
ATOM   5014  O  O     . SER B 1 340 ? 71.40700  117.74800 129.81200 1.000 66.51000  ? 585 SER B O     1 
ATOM   5015  C  CB    . SER B 1 340 ? 69.47600  116.42900 132.45000 1.000 66.51000  ? 585 SER B CB    1 
ATOM   5016  O  OG    . SER B 1 340 ? 70.64200  115.64100 132.61200 1.000 66.51000  ? 585 SER B OG    1 
ATOM   5017  N  N     . THR B 1 341 ? 71.07200  118.75100 131.79600 1.000 57.97000  ? 586 THR B N     1 
ATOM   5018  C  CA    . THR B 1 341 ? 72.32300  119.48700 131.73300 1.000 57.97000  ? 586 THR B CA    1 
ATOM   5019  C  C     . THR B 1 341 ? 73.45500  118.62300 132.26800 1.000 57.97000  ? 586 THR B C     1 
ATOM   5020  O  O     . THR B 1 341 ? 73.28100  117.86900 133.22900 1.000 57.97000  ? 586 THR B O     1 
ATOM   5021  C  CB    . THR B 1 341 ? 72.22800  120.78100 132.53700 1.000 57.97000  ? 586 THR B CB    1 
ATOM   5022  O  OG1   . THR B 1 341 ? 71.98500  120.47000 133.91300 1.000 57.97000  ? 586 THR B OG1   1 
ATOM   5023  C  CG2   . THR B 1 341 ? 71.09200  121.64300 132.01300 1.000 57.97000  ? 586 THR B CG2   1 
ATOM   5024  N  N     . LEU B 1 342 ? 74.62000  118.74000 131.64300 1.000 49.32000  ? 587 LEU B N     1 
ATOM   5025  C  CA    . LEU B 1 342 ? 75.61900  117.80600 132.14400 1.000 49.32000  ? 587 LEU B CA    1 
ATOM   5026  C  C     . LEU B 1 342 ? 76.55800  118.49200 133.12600 1.000 49.32000  ? 587 LEU B C     1 
ATOM   5027  O  O     . LEU B 1 342 ? 76.90900  119.66100 132.93800 1.000 49.32000  ? 587 LEU B O     1 
ATOM   5028  C  CB    . LEU B 1 342 ? 76.43300  117.22100 130.99200 1.000 49.32000  ? 587 LEU B CB    1 
ATOM   5029  C  CG    . LEU B 1 342 ? 75.66300  116.30700 130.04400 1.000 49.32000  ? 587 LEU B CG    1 
ATOM   5030  C  CD1   . LEU B 1 342 ? 76.53300  115.92400 128.86500 1.000 49.32000  ? 587 LEU B CD1   1 
ATOM   5031  C  CD2   . LEU B 1 342 ? 75.18600  115.07100 130.78400 1.000 49.32000  ? 587 LEU B CD2   1 
ATOM   5032  N  N     . PRO B 1 343 ? 76.97400  117.78600 134.17100 1.000 42.37000  ? 588 PRO B N     1 
ATOM   5033  C  CA    . PRO B 1 343 ? 77.89200  118.37900 135.14400 1.000 42.37000  ? 588 PRO B CA    1 
ATOM   5034  C  C     . PRO B 1 343 ? 79.29400  118.50200 134.57100 1.000 42.37000  ? 588 PRO B C     1 
ATOM   5035  O  O     . PRO B 1 343 ? 79.62800  117.94600 133.52400 1.000 42.37000  ? 588 PRO B O     1 
ATOM   5036  C  CB    . PRO B 1 343 ? 77.84900  117.39400 136.31300 1.000 42.37000  ? 588 PRO B CB    1 
ATOM   5037  C  CG    . PRO B 1 343 ? 77.52100  116.09500 135.67700 1.000 42.37000  ? 588 PRO B CG    1 
ATOM   5038  C  CD    . PRO B 1 343 ? 76.59900  116.41000 134.53400 1.000 42.37000  ? 588 PRO B CD    1 
ATOM   5039  N  N     . THR B 1 344 ? 80.12600  119.24900 135.29000 1.000 40.00000  ? 589 THR B N     1 
ATOM   5040  C  CA    . THR B 1 344 ? 81.51500  119.47200 134.91200 1.000 40.00000  ? 589 THR B CA    1 
ATOM   5041  C  C     . THR B 1 344 ? 82.39600  118.56600 135.76100 1.000 40.00000  ? 589 THR B C     1 
ATOM   5042  O  O     . THR B 1 344 ? 82.52500  118.77300 136.97100 1.000 40.00000  ? 589 THR B O     1 
ATOM   5043  C  CB    . THR B 1 344 ? 81.89800  120.93500 135.09800 1.000 40.00000  ? 589 THR B CB    1 
ATOM   5044  O  OG1   . THR B 1 344 ? 81.05300  121.75700 134.28500 1.000 40.00000  ? 589 THR B OG1   1 
ATOM   5045  C  CG2   . THR B 1 344 ? 83.33300  121.15000 134.68900 1.000 40.00000  ? 589 THR B CG2   1 
ATOM   5046  N  N     . ILE B 1 345 ? 83.00200  117.56900 135.12900 1.000 36.07000  ? 590 ILE B N     1 
ATOM   5047  C  CA    . ILE B 1 345 ? 83.81500  116.59300 135.84200 1.000 36.07000  ? 590 ILE B CA    1 
ATOM   5048  C  C     . ILE B 1 345 ? 85.18000  117.19700 136.13500 1.000 36.07000  ? 590 ILE B C     1 
ATOM   5049  O  O     . ILE B 1 345 ? 85.83600  117.74300 135.24200 1.000 36.07000  ? 590 ILE B O     1 
ATOM   5050  C  CB    . ILE B 1 345 ? 83.94600  115.29800 135.02800 1.000 36.07000  ? 590 ILE B CB    1 
ATOM   5051  C  CG1   . ILE B 1 345 ? 82.56800  114.70400 134.75100 1.000 36.07000  ? 590 ILE B CG1   1 
ATOM   5052  C  CG2   . ILE B 1 345 ? 84.81100  114.29400 135.75900 1.000 36.07000  ? 590 ILE B CG2   1 
ATOM   5053  C  CD1   . ILE B 1 345 ? 81.80800  114.35800 135.99800 1.000 36.07000  ? 590 ILE B CD1   1 
ATOM   5054  N  N     . VAL B 1 346 ? 85.61200  117.09900 137.38900 1.000 32.73000  ? 591 VAL B N     1 
ATOM   5055  C  CA    . VAL B 1 346 ? 86.91500  117.58500 137.82700 1.000 32.73000  ? 591 VAL B CA    1 
ATOM   5056  C  C     . VAL B 1 346 ? 87.66400  116.39900 138.41500 1.000 32.73000  ? 591 VAL B C     1 
ATOM   5057  O  O     . VAL B 1 346 ? 87.29900  115.89600 139.48500 1.000 32.73000  ? 591 VAL B O     1 
ATOM   5058  C  CB    . VAL B 1 346 ? 86.79300  118.72100 138.84900 1.000 32.73000  ? 591 VAL B CB    1 
ATOM   5059  C  CG1   . VAL B 1 346 ? 88.15600  119.10400 139.37700 1.000 32.73000  ? 591 VAL B CG1   1 
ATOM   5060  C  CG2   . VAL B 1 346 ? 86.10400  119.92200 138.22900 1.000 32.73000  ? 591 VAL B CG2   1 
ATOM   5061  N  N     . VAL B 1 347 ? 88.70800  115.95300 137.72700 1.000 30.56000  ? 592 VAL B N     1 
ATOM   5062  C  CA    . VAL B 1 347 ? 89.46300  114.76800 138.12400 1.000 30.56000  ? 592 VAL B CA    1 
ATOM   5063  C  C     . VAL B 1 347 ? 90.65500  115.26200 138.93500 1.000 30.56000  ? 592 VAL B C     1 
ATOM   5064  O  O     . VAL B 1 347 ? 91.72100  115.56000 138.39900 1.000 30.56000  ? 592 VAL B O     1 
ATOM   5065  C  CB    . VAL B 1 347 ? 89.88800  113.93500 136.91700 1.000 30.56000  ? 592 VAL B CB    1 
ATOM   5066  C  CG1   . VAL B 1 347 ? 90.70100  112.73500 137.35900 1.000 30.56000  ? 592 VAL B CG1   1 
ATOM   5067  C  CG2   . VAL B 1 347 ? 88.67200  113.49800 136.12500 1.000 30.56000  ? 592 VAL B CG2   1 
ATOM   5068  N  N     . VAL B 1 348 ? 90.47500  115.35100 140.25000 1.000 33.30000  ? 593 VAL B N     1 
ATOM   5069  C  CA    . VAL B 1 348 ? 91.53700  115.81500 141.13700 1.000 33.30000  ? 593 VAL B CA    1 
ATOM   5070  C  C     . VAL B 1 348 ? 92.48400  114.65100 141.39700 1.000 33.30000  ? 593 VAL B C     1 
ATOM   5071  O  O     . VAL B 1 348 ? 92.14000  113.70500 142.10700 1.000 33.30000  ? 593 VAL B O     1 
ATOM   5072  C  CB    . VAL B 1 348 ? 90.97600  116.37200 142.44900 1.000 33.30000  ? 593 VAL B CB    1 
ATOM   5073  C  CG1   . VAL B 1 348 ? 92.10800  116.72700 143.39000 1.000 33.30000  ? 593 VAL B CG1   1 
ATOM   5074  C  CG2   . VAL B 1 348 ? 90.11100  117.58800 142.17700 1.000 33.30000  ? 593 VAL B CG2   1 
ATOM   5075  N  N     . VAL B 1 349 ? 93.68000  114.71800 140.82400 1.000 36.89000  ? 594 VAL B N     1 
ATOM   5076  C  CA    . VAL B 1 349 ? 94.70000  113.69300 141.00400 1.000 36.89000  ? 594 VAL B CA    1 
ATOM   5077  C  C     . VAL B 1 349 ? 95.75000  114.26100 141.95100 1.000 36.89000  ? 594 VAL B C     1 
ATOM   5078  O  O     . VAL B 1 349 ? 96.59900  115.05900 141.55100 1.000 36.89000  ? 594 VAL B O     1 
ATOM   5079  C  CB    . VAL B 1 349 ? 95.31700  113.26600 139.67100 1.000 36.89000  ? 594 VAL B CB    1 
ATOM   5080  C  CG1   . VAL B 1 349 ? 96.47000  112.32700 139.91100 1.000 36.89000  ? 594 VAL B CG1   1 
ATOM   5081  C  CG2   . VAL B 1 349 ? 94.27200  112.61200 138.79100 1.000 36.89000  ? 594 VAL B CG2   1 
ATOM   5082  N  N     . ASP B 1 350 ? 95.69300  113.85800 143.21400 1.000 49.40000  ? 595 ASP B N     1 
ATOM   5083  C  CA    . ASP B 1 350 ? 96.71400  114.25700 144.16600 1.000 49.40000  ? 595 ASP B CA    1 
ATOM   5084  C  C     . ASP B 1 350 ? 97.91400  113.32300 144.06600 1.000 49.40000  ? 595 ASP B C     1 
ATOM   5085  O  O     . ASP B 1 350 ? 97.78300  112.15500 143.69400 1.000 49.40000  ? 595 ASP B O     1 
ATOM   5086  C  CB    . ASP B 1 350 ? 96.15200  114.24700 145.58700 1.000 49.40000  ? 595 ASP B CB    1 
ATOM   5087  C  CG    . ASP B 1 350 ? 97.09000  114.88200 146.59600 1.000 49.40000  ? 595 ASP B CG    1 
ATOM   5088  O  OD1   . ASP B 1 350 ? 98.19400  115.31600 146.20700 1.000 49.40000  ? 595 ASP B OD1   1 
ATOM   5089  O  OD2   . ASP B 1 350 ? 96.71700  114.94800 147.78600 1.000 49.40000  ? 595 ASP B OD2   1 
ATOM   5090  N  N     . GLU B 1 351 ? 99.08900  113.85900 144.39500 1.000 50.98000  ? 596 GLU B N     1 
ATOM   5091  C  CA    . GLU B 1 351 ? 100.34300 113.10400 144.44800 1.000 50.98000  ? 596 GLU B CA    1 
ATOM   5092  C  C     . GLU B 1 351 ? 100.52700 112.24300 143.19500 1.000 50.98000  ? 596 GLU B C     1 
ATOM   5093  O  O     . GLU B 1 351 ? 100.54300 111.01200 143.23800 1.000 50.98000  ? 596 GLU B O     1 
ATOM   5094  C  CB    . GLU B 1 351 ? 100.41200 112.26300 145.72400 1.000 50.98000  ? 596 GLU B CB    1 
ATOM   5095  C  CG    . GLU B 1 351 ? 101.75800 111.59500 145.95800 1.000 50.98000  ? 596 GLU B CG    1 
ATOM   5096  C  CD    . GLU B 1 351 ? 102.87400 112.59500 146.18400 1.000 50.98000  ? 596 GLU B CD    1 
ATOM   5097  O  OE1   . GLU B 1 351 ? 102.59400 113.70700 146.67500 1.000 50.98000  ? 596 GLU B OE1   1 
ATOM   5098  O  OE2   . GLU B 1 351 ? 104.03500 112.27300 145.86000 1.000 50.98000  ? 596 GLU B OE2   1 
ATOM   5099  N  N     . PHE B 1 352 ? 100.63800 112.92600 142.05500 1.000 44.06000  ? 597 PHE B N     1 
ATOM   5100  C  CA    . PHE B 1 352 ? 100.73900 112.22800 140.77800 1.000 44.06000  ? 597 PHE B CA    1 
ATOM   5101  C  C     . PHE B 1 352 ? 102.03800 111.43700 140.66600 1.000 44.06000  ? 597 PHE B C     1 
ATOM   5102  O  O     . PHE B 1 352 ? 102.08100 110.40900 139.97600 1.000 44.06000  ? 597 PHE B O     1 
ATOM   5103  C  CB    . PHE B 1 352 ? 100.61400 113.23900 139.64100 1.000 44.06000  ? 597 PHE B CB    1 
ATOM   5104  C  CG    . PHE B 1 352 ? 100.58000 112.62800 138.27700 1.000 44.06000  ? 597 PHE B CG    1 
ATOM   5105  C  CD1   . PHE B 1 352 ? 99.43500  112.01700 137.81100 1.000 44.06000  ? 597 PHE B CD1   1 
ATOM   5106  C  CD2   . PHE B 1 352 ? 101.68400 112.68300 137.45400 1.000 44.06000  ? 597 PHE B CD2   1 
ATOM   5107  C  CE1   . PHE B 1 352 ? 99.39600  111.46000 136.55400 1.000 44.06000  ? 597 PHE B CE1   1 
ATOM   5108  C  CE2   . PHE B 1 352 ? 101.65000 112.13000 136.19500 1.000 44.06000  ? 597 PHE B CE2   1 
ATOM   5109  C  CZ    . PHE B 1 352 ? 100.50500 111.51600 135.74500 1.000 44.06000  ? 597 PHE B CZ    1 
ATOM   5110  N  N     . ALA B 1 353 ? 103.09700 111.88300 141.34700 1.000 48.85000  ? 598 ALA B N     1 
ATOM   5111  C  CA    . ALA B 1 353 ? 104.39100 111.21700 141.23500 1.000 48.85000  ? 598 ALA B CA    1 
ATOM   5112  C  C     . ALA B 1 353 ? 104.34800 109.81100 141.82100 1.000 48.85000  ? 598 ALA B C     1 
ATOM   5113  O  O     . ALA B 1 353 ? 104.78900 108.84700 141.18400 1.000 48.85000  ? 598 ALA B O     1 
ATOM   5114  C  CB    . ALA B 1 353 ? 105.47000 112.05300 141.92200 1.000 48.85000  ? 598 ALA B CB    1 
ATOM   5115  N  N     . ASP B 1 354 ? 103.82400 109.67000 143.04000 1.000 52.52000  ? 599 ASP B N     1 
ATOM   5116  C  CA    . ASP B 1 354 ? 103.75600 108.34500 143.64300 1.000 52.52000  ? 599 ASP B CA    1 
ATOM   5117  C  C     . ASP B 1 354 ? 102.76800 107.45100 142.90500 1.000 52.52000  ? 599 ASP B C     1 
ATOM   5118  O  O     . ASP B 1 354 ? 102.95400 106.22800 142.85600 1.000 52.52000  ? 599 ASP B O     1 
ATOM   5119  C  CB    . ASP B 1 354 ? 103.38800 108.45800 145.11900 1.000 52.52000  ? 599 ASP B CB    1 
ATOM   5120  C  CG    . ASP B 1 354 ? 103.50200 107.13900 145.84500 1.000 52.52000  ? 599 ASP B CG    1 
ATOM   5121  O  OD1   . ASP B 1 354 ? 104.63900 106.70500 146.12100 1.000 52.52000  ? 599 ASP B OD1   1 
ATOM   5122  O  OD2   . ASP B 1 354 ? 102.45400 106.53400 146.13800 1.000 52.52000  ? 599 ASP B OD2   1 
ATOM   5123  N  N     . MET B 1 355 ? 101.71700 108.03800 142.32800 1.000 50.60000  ? 600 MET B N     1 
ATOM   5124  C  CA    . MET B 1 355 ? 100.87000 107.30000 141.39800 1.000 50.60000  ? 600 MET B CA    1 
ATOM   5125  C  C     . MET B 1 355 ? 101.69200 106.68300 140.27800 1.000 50.60000  ? 600 MET B C     1 
ATOM   5126  O  O     . MET B 1 355 ? 101.62500 105.47400 140.03400 1.000 50.60000  ? 600 MET B O     1 
ATOM   5127  C  CB    . MET B 1 355 ? 99.80500  108.21800 140.80600 1.000 50.60000  ? 600 MET B CB    1 
ATOM   5128  C  CG    . MET B 1 355 ? 98.94200  107.51900 139.77900 1.000 50.60000  ? 600 MET B CG    1 
ATOM   5129  S  SD    . MET B 1 355 ? 97.75700  108.61800 139.00000 1.000 50.60000  ? 600 MET B SD    1 
ATOM   5130  C  CE    . MET B 1 355 ? 96.64500  108.86100 140.36800 1.000 50.60000  ? 600 MET B CE    1 
ATOM   5131  N  N     . MET B 1 356 ? 102.46800 107.50900 139.57300 1.000 52.17000  ? 601 MET B N     1 
ATOM   5132  C  CA    . MET B 1 356 ? 103.27500 106.99300 138.47500 1.000 52.17000  ? 601 MET B CA    1 
ATOM   5133  C  C     . MET B 1 356 ? 104.34500 106.02200 138.95000 1.000 52.17000  ? 601 MET B C     1 
ATOM   5134  O  O     . MET B 1 356 ? 104.82500 105.20900 138.15300 1.000 52.17000  ? 601 MET B O     1 
ATOM   5135  C  CB    . MET B 1 356 ? 103.92100 108.14700 137.71500 1.000 52.17000  ? 601 MET B CB    1 
ATOM   5136  C  CG    . MET B 1 356 ? 102.91900 109.03400 137.01500 1.000 52.17000  ? 601 MET B CG    1 
ATOM   5137  S  SD    . MET B 1 356 ? 101.97400 108.13800 135.77600 1.000 52.17000  ? 601 MET B SD    1 
ATOM   5138  C  CE    . MET B 1 356 ? 103.24700 107.86400 134.55100 1.000 52.17000  ? 601 MET B CE    1 
ATOM   5139  N  N     . MET B 1 357 ? 104.72900 106.08700 140.22000 1.000 53.75000  ? 602 MET B N     1 
ATOM   5140  C  CA    . MET B 1 357 ? 105.72500 105.16200 140.74400 1.000 53.75000  ? 602 MET B CA    1 
ATOM   5141  C  C     . MET B 1 357 ? 105.12000 103.89000 141.32200 1.000 53.75000  ? 602 MET B C     1 
ATOM   5142  O  O     . MET B 1 357 ? 105.87000 102.97000 141.66300 1.000 53.75000  ? 602 MET B O     1 
ATOM   5143  C  CB    . MET B 1 357 ? 106.58400 105.85100 141.80600 1.000 53.75000  ? 602 MET B CB    1 
ATOM   5144  C  CG    . MET B 1 357 ? 107.45600 106.95800 141.24500 1.000 53.75000  ? 602 MET B CG    1 
ATOM   5145  S  SD    . MET B 1 357 ? 108.45900 107.76200 142.49800 1.000 53.75000  ? 602 MET B SD    1 
ATOM   5146  C  CE    . MET B 1 357 ? 109.63200 106.45600 142.82700 1.000 53.75000  ? 602 MET B CE    1 
ATOM   5147  N  N     . ILE B 1 358 ? 103.80000 103.80700 141.43900 1.000 52.44000  ? 603 ILE B N     1 
ATOM   5148  C  CA    . ILE B 1 358 ? 103.13100 102.56000 141.80400 1.000 52.44000  ? 603 ILE B CA    1 
ATOM   5149  C  C     . ILE B 1 358 ? 102.49400 101.89100 140.59400 1.000 52.44000  ? 603 ILE B C     1 
ATOM   5150  O  O     . ILE B 1 358 ? 102.74100 100.71600 140.32500 1.000 52.44000  ? 603 ILE B O     1 
ATOM   5151  C  CB    . ILE B 1 358 ? 102.08700 102.80000 142.91700 1.000 52.44000  ? 603 ILE B CB    1 
ATOM   5152  C  CG1   . ILE B 1 358 ? 102.76200 103.20100 144.22600 1.000 52.44000  ? 603 ILE B CG1   1 
ATOM   5153  C  CG2   . ILE B 1 358 ? 101.24000 101.55900 143.12500 1.000 52.44000  ? 603 ILE B CG2   1 
ATOM   5154  C  CD1   . ILE B 1 358 ? 101.77900 103.59100 145.30500 1.000 52.44000  ? 603 ILE B CD1   1 
ATOM   5155  N  N     . VAL B 1 359 ? 101.67400 102.62300 139.84700 1.000 55.54000  ? 604 VAL B N     1 
ATOM   5156  C  CA    . VAL B 1 359 ? 100.91100 102.02000 138.75900 1.000 55.54000  ? 604 VAL B CA    1 
ATOM   5157  C  C     . VAL B 1 359 ? 101.73600 101.92300 137.48400 1.000 55.54000  ? 604 VAL B C     1 
ATOM   5158  O  O     . VAL B 1 359 ? 101.72200 100.89300 136.80700 1.000 55.54000  ? 604 VAL B O     1 
ATOM   5159  C  CB    . VAL B 1 359 ? 99.61500  102.81500 138.52500 1.000 55.54000  ? 604 VAL B CB    1 
ATOM   5160  C  CG1   . VAL B 1 359 ? 98.79100  102.15000 137.44600 1.000 55.54000  ? 604 VAL B CG1   1 
ATOM   5161  C  CG2   . VAL B 1 359 ? 98.83400  102.94200 139.81200 1.000 55.54000  ? 604 VAL B CG2   1 
ATOM   5162  N  N     . GLY B 1 360 ? 102.46100 102.98000 137.13400 1.000 56.35000  ? 605 GLY B N     1 
ATOM   5163  C  CA    . GLY B 1 360 ? 103.29500 102.95300 135.95100 1.000 56.35000  ? 605 GLY B CA    1 
ATOM   5164  C  C     . GLY B 1 360 ? 102.59100 103.43400 134.70100 1.000 56.35000  ? 605 GLY B C     1 
ATOM   5165  O  O     . GLY B 1 360 ? 101.81000 104.38800 134.74900 1.000 56.35000  ? 605 GLY B O     1 
ATOM   5166  N  N     . LYS B 1 361 ? 102.85400 102.77500 133.57600 1.000 59.58000  ? 606 LYS B N     1 
ATOM   5167  C  CA    . LYS B 1 361 ? 102.35000 103.20200 132.27900 1.000 59.58000  ? 606 LYS B CA    1 
ATOM   5168  C  C     . LYS B 1 361 ? 100.89500 102.80200 132.05200 1.000 59.58000  ? 606 LYS B C     1 
ATOM   5169  O  O     . LYS B 1 361 ? 100.31700 103.16300 131.02100 1.000 59.58000  ? 606 LYS B O     1 
ATOM   5170  C  CB    . LYS B 1 361 ? 103.24500 102.63100 131.17000 1.000 59.58000  ? 606 LYS B CB    1 
ATOM   5171  C  CG    . LYS B 1 361 ? 103.05100 103.24100 129.79000 1.000 59.58000  ? 606 LYS B CG    1 
ATOM   5172  C  CD    . LYS B 1 361 ? 103.96100 102.57600 128.77000 1.000 59.58000  ? 606 LYS B CD    1 
ATOM   5173  C  CE    . LYS B 1 361 ? 105.41300 102.98400 128.97100 1.000 59.58000  ? 606 LYS B CE    1 
ATOM   5174  N  NZ    . LYS B 1 361 ? 106.30500 102.42000 127.91800 1.000 59.58000  ? 606 LYS B NZ    1 
ATOM   5175  N  N     . LYS B 1 362 ? 100.28500 102.07600 132.99100 1.000 59.69000  ? 607 LYS B N     1 
ATOM   5176  C  CA    . LYS B 1 362 ? 98.85700  101.79500 132.89200 1.000 59.69000  ? 607 LYS B CA    1 
ATOM   5177  C  C     . LYS B 1 362 ? 98.04100  103.08200 132.92300 1.000 59.69000  ? 607 LYS B C     1 
ATOM   5178  O  O     . LYS B 1 362 ? 97.02200  103.19600 132.23300 1.000 59.69000  ? 607 LYS B O     1 
ATOM   5179  C  CB    . LYS B 1 362 ? 98.42200  100.86700 134.02600 1.000 59.69000  ? 607 LYS B CB    1 
ATOM   5180  C  CG    . LYS B 1 362 ? 99.03800  99.48100  133.99100 1.000 59.69000  ? 607 LYS B CG    1 
ATOM   5181  C  CD    . LYS B 1 362 ? 98.52400  98.63800  135.14900 1.000 59.69000  ? 607 LYS B CD    1 
ATOM   5182  C  CE    . LYS B 1 362 ? 99.06500  97.21900  135.09600 1.000 59.69000  ? 607 LYS B CE    1 
ATOM   5183  N  NZ    . LYS B 1 362 ? 100.53100 97.17500  135.35100 1.000 59.69000  ? 607 LYS B NZ    1 
ATOM   5184  N  N     . VAL B 1 363 ? 98.48000  104.05900 133.71000 1.000 52.77000  ? 608 VAL B N     1 
ATOM   5185  C  CA    . VAL B 1 363 ? 97.73400  105.29800 133.90600 1.000 52.77000  ? 608 VAL B CA    1 
ATOM   5186  C  C     . VAL B 1 363 ? 98.18100  106.38900 132.94400 1.000 52.77000  ? 608 VAL B C     1 
ATOM   5187  O  O     . VAL B 1 363 ? 97.34600  107.14300 132.43800 1.000 52.77000  ? 608 VAL B O     1 
ATOM   5188  C  CB    . VAL B 1 363 ? 97.86700  105.74400 135.37400 1.000 52.77000  ? 608 VAL B CB    1 
ATOM   5189  C  CG1   . VAL B 1 363 ? 97.47800  107.19000 135.53000 1.000 52.77000  ? 608 VAL B CG1   1 
ATOM   5190  C  CG2   . VAL B 1 363 ? 96.97400  104.89200 136.24500 1.000 52.77000  ? 608 VAL B CG2   1 
ATOM   5191  N  N     . GLU B 1 364 ? 99.48700  106.46700 132.67500 1.000 51.53000  ? 609 GLU B N     1 
ATOM   5192  C  CA    . GLU B 1 364 ? 100.03100 107.50500 131.80300 1.000 51.53000  ? 609 GLU B CA    1 
ATOM   5193  C  C     . GLU B 1 364 ? 99.23000  107.65000 130.51400 1.000 51.53000  ? 609 GLU B C     1 
ATOM   5194  O  O     . GLU B 1 364 ? 98.96600  108.76900 130.06300 1.000 51.53000  ? 609 GLU B O     1 
ATOM   5195  C  CB    . GLU B 1 364 ? 101.49400 107.19500 131.49000 1.000 51.53000  ? 609 GLU B CB    1 
ATOM   5196  C  CG    . GLU B 1 364 ? 102.20000 108.24400 130.65900 1.000 51.53000  ? 609 GLU B CG    1 
ATOM   5197  C  CD    . GLU B 1 364 ? 103.66500 107.91400 130.44600 1.000 51.53000  ? 609 GLU B CD    1 
ATOM   5198  O  OE1   . GLU B 1 364 ? 104.11800 106.86600 130.95000 1.000 51.53000  ? 609 GLU B OE1   1 
ATOM   5199  O  OE2   . GLU B 1 364 ? 104.36300 108.69800 129.77200 1.000 51.53000  ? 609 GLU B OE2   1 
ATOM   5200  N  N     . GLU B 1 365 ? 98.82800  106.52900 129.91300 1.000 51.96000  ? 610 GLU B N     1 
ATOM   5201  C  CA    . GLU B 1 365 ? 98.01800  106.58400 128.69900 1.000 51.96000  ? 610 GLU B CA    1 
ATOM   5202  C  C     . GLU B 1 365 ? 96.72300  107.34600 128.93800 1.000 51.96000  ? 610 GLU B C     1 
ATOM   5203  O  O     . GLU B 1 365 ? 96.36400  108.24600 128.17100 1.000 51.96000  ? 610 GLU B O     1 
ATOM   5204  C  CB    . GLU B 1 365 ? 97.71300  105.17000 128.20800 1.000 51.96000  ? 610 GLU B CB    1 
ATOM   5205  C  CG    . GLU B 1 365 ? 98.91900  104.38700 127.74000 1.000 51.96000  ? 610 GLU B CG    1 
ATOM   5206  C  CD    . GLU B 1 365 ? 98.56000  102.97100 127.33200 1.000 51.96000  ? 610 GLU B CD    1 
ATOM   5207  O  OE1   . GLU B 1 365 ? 97.39600  102.56800 127.54000 1.000 51.96000  ? 610 GLU B OE1   1 
ATOM   5208  O  OE2   . GLU B 1 365 ? 99.44200  102.25900 126.80800 1.000 51.96000  ? 610 GLU B OE2   1 
ATOM   5209  N  N     . LEU B 1 366 ? 96.00500  106.99400 130.00500 1.000 46.91000  ? 611 LEU B N     1 
ATOM   5210  C  CA    . LEU B 1 366 ? 94.70000  107.59600 130.25200 1.000 46.91000  ? 611 LEU B CA    1 
ATOM   5211  C  C     . LEU B 1 366 ? 94.83000  109.06500 130.62900 1.000 46.91000  ? 611 LEU B C     1 
ATOM   5212  O  O     . LEU B 1 366 ? 93.98300  109.88500 130.25700 1.000 46.91000  ? 611 LEU B O     1 
ATOM   5213  C  CB    . LEU B 1 366 ? 93.98000  106.81500 131.34600 1.000 46.91000  ? 611 LEU B CB    1 
ATOM   5214  C  CG    . LEU B 1 366 ? 93.77300  105.34500 130.98100 1.000 46.91000  ? 611 LEU B CG    1 
ATOM   5215  C  CD1   . LEU B 1 366 ? 93.15700  104.57800 132.13300 1.000 46.91000  ? 611 LEU B CD1   1 
ATOM   5216  C  CD2   . LEU B 1 366 ? 92.93200  105.21000 129.72500 1.000 46.91000  ? 611 LEU B CD2   1 
ATOM   5217  N  N     . ILE B 1 367 ? 95.88400  109.41800 131.36500 1.000 41.14000  ? 612 ILE B N     1 
ATOM   5218  C  CA    . ILE B 1 367 ? 96.10100  110.82000 131.70800 1.000 41.14000  ? 612 ILE B CA    1 
ATOM   5219  C  C     . ILE B 1 367 ? 96.43400  111.62800 130.46300 1.000 41.14000  ? 612 ILE B C     1 
ATOM   5220  O  O     . ILE B 1 367 ? 95.91700  112.73500 130.27100 1.000 41.14000  ? 612 ILE B O     1 
ATOM   5221  C  CB    . ILE B 1 367 ? 97.18900  110.95500 132.78600 1.000 41.14000  ? 612 ILE B CB    1 
ATOM   5222  C  CG1   . ILE B 1 367 ? 96.71000  110.32400 134.08600 1.000 41.14000  ? 612 ILE B CG1   1 
ATOM   5223  C  CG2   . ILE B 1 367 ? 97.50600  112.41000 133.03500 1.000 41.14000  ? 612 ILE B CG2   1 
ATOM   5224  C  CD1   . ILE B 1 367 ? 95.48700  111.00100 134.65100 1.000 41.14000  ? 612 ILE B CD1   1 
ATOM   5225  N  N     . ALA B 1 368 ? 97.28200  111.08800 129.58500 1.000 40.59000  ? 613 ALA B N     1 
ATOM   5226  C  CA    . ALA B 1 368 ? 97.56900  111.78000 128.33500 1.000 40.59000  ? 613 ALA B CA    1 
ATOM   5227  C  C     . ALA B 1 368 ? 96.32200  111.90900 127.47600 1.000 40.59000  ? 613 ALA B C     1 
ATOM   5228  O  O     . ALA B 1 368 ? 96.15000  112.91400 126.78300 1.000 40.59000  ? 613 ALA B O     1 
ATOM   5229  C  CB    . ALA B 1 368 ? 98.66900  111.05300 127.56600 1.000 40.59000  ? 613 ALA B CB    1 
ATOM   5230  N  N     . ARG B 1 369 ? 95.43400  110.91800 127.52600 1.000 46.32000  ? 614 ARG B N     1 
ATOM   5231  C  CA    . ARG B 1 369 ? 94.19900  110.99000 126.75200 1.000 46.32000  ? 614 ARG B CA    1 
ATOM   5232  C  C     . ARG B 1 369 ? 93.28400  112.08600 127.28800 1.000 46.32000  ? 614 ARG B C     1 
ATOM   5233  O  O     . ARG B 1 369 ? 92.80600  112.94000 126.52900 1.000 46.32000  ? 614 ARG B O     1 
ATOM   5234  C  CB    . ARG B 1 369 ? 93.49500  109.63500 126.78500 1.000 46.32000  ? 614 ARG B CB    1 
ATOM   5235  C  CG    . ARG B 1 369 ? 92.27200  109.53600 125.90600 1.000 46.32000  ? 614 ARG B CG    1 
ATOM   5236  C  CD    . ARG B 1 369 ? 92.65900  109.51800 124.44200 1.000 46.32000  ? 614 ARG B CD    1 
ATOM   5237  N  NE    . ARG B 1 369 ? 91.50000  109.32300 123.57800 1.000 46.32000  ? 614 ARG B NE    1 
ATOM   5238  C  CZ    . ARG B 1 369 ? 91.54100  109.39300 122.25300 1.000 46.32000  ? 614 ARG B CZ    1 
ATOM   5239  N  NH1   . ARG B 1 369 ? 92.68700  109.65000 121.64100 1.000 46.32000  ? 614 ARG B NH1   1 
ATOM   5240  N  NH2   . ARG B 1 369 ? 90.44000  109.20400 121.54000 1.000 46.32000  ? 614 ARG B NH2   1 
ATOM   5241  N  N     . ILE B 1 370 ? 93.03100  112.07400 128.60000 1.000 39.03000  ? 615 ILE B N     1 
ATOM   5242  C  CA    . ILE B 1 370 ? 92.20900  113.10700 129.22400 1.000 39.03000  ? 615 ILE B CA    1 
ATOM   5243  C  C     . ILE B 1 370 ? 92.80900  114.48800 128.99800 1.000 39.03000  ? 615 ILE B C     1 
ATOM   5244  O  O     . ILE B 1 370 ? 92.08100  115.48300 128.92300 1.000 39.03000  ? 615 ILE B O     1 
ATOM   5245  C  CB    . ILE B 1 370 ? 92.02000  112.80800 130.72400 1.000 39.03000  ? 615 ILE B CB    1 
ATOM   5246  C  CG1   . ILE B 1 370 ? 91.29800  111.48000 130.91300 1.000 39.03000  ? 615 ILE B CG1   1 
ATOM   5247  C  CG2   . ILE B 1 370 ? 91.21300  113.89700 131.39700 1.000 39.03000  ? 615 ILE B CG2   1 
ATOM   5248  C  CD1   . ILE B 1 370 ? 91.30800  110.99700 132.33900 1.000 39.03000  ? 615 ILE B CD1   1 
ATOM   5249  N  N     . ALA B 1 371 ? 94.13400  114.58200 128.89100 1.000 38.92000  ? 616 ALA B N     1 
ATOM   5250  C  CA    . ALA B 1 371 ? 94.73800  115.86800 128.56400 1.000 38.92000  ? 616 ALA B CA    1 
ATOM   5251  C  C     . ALA B 1 371 ? 94.46400  116.25300 127.11500 1.000 38.92000  ? 616 ALA B C     1 
ATOM   5252  O  O     . ALA B 1 371 ? 93.99600  117.36200 126.83800 1.000 38.92000  ? 616 ALA B O     1 
ATOM   5253  C  CB    . ALA B 1 371 ? 96.24100  115.83000 128.83600 1.000 38.92000  ? 616 ALA B CB    1 
ATOM   5254  N  N     . GLN B 1 372 ? 94.73900  115.34300 126.17900 1.000 45.10000  ? 617 GLN B N     1 
ATOM   5255  C  CA    . GLN B 1 372 ? 94.54700  115.58600 124.75300 1.000 45.10000  ? 617 GLN B CA    1 
ATOM   5256  C  C     . GLN B 1 372 ? 93.08300  115.81100 124.39900 1.000 45.10000  ? 617 GLN B C     1 
ATOM   5257  O  O     . GLN B 1 372 ? 92.76500  116.19300 123.26900 1.000 45.10000  ? 617 GLN B O     1 
ATOM   5258  C  CB    . GLN B 1 372 ? 95.09600  114.41400 123.93800 1.000 45.10000  ? 617 GLN B CB    1 
ATOM   5259  C  CG    . GLN B 1 372 ? 96.60100  114.26400 123.99800 1.000 45.10000  ? 617 GLN B CG    1 
ATOM   5260  C  CD    . GLN B 1 372 ? 97.09200  113.05600 123.23000 1.000 45.10000  ? 617 GLN B CD    1 
ATOM   5261  O  OE1   . GLN B 1 372 ? 96.29800  112.28000 122.70000 1.000 45.10000  ? 617 GLN B OE1   1 
ATOM   5262  N  NE2   . GLN B 1 372 ? 98.40700  112.88900 123.16800 1.000 45.10000  ? 617 GLN B NE2   1 
ATOM   5263  N  N     . LYS B 1 373 ? 92.18500  115.58100 125.35300 1.000 44.47000  ? 618 LYS B N     1 
ATOM   5264  C  CA    . LYS B 1 373 ? 90.75500  115.71600 125.10300 1.000 44.47000  ? 618 LYS B CA    1 
ATOM   5265  C  C     . LYS B 1 373 ? 90.07100  116.24500 126.35400 1.000 44.47000  ? 618 LYS B C     1 
ATOM   5266  O  O     . LYS B 1 373 ? 90.71100  116.89300 127.18600 1.000 44.47000  ? 618 LYS B O     1 
ATOM   5267  C  CB    . LYS B 1 373 ? 90.13000  114.38200 124.68400 1.000 44.47000  ? 618 LYS B CB    1 
ATOM   5268  C  CG    . LYS B 1 373 ? 90.58300  113.84700 123.33400 1.000 44.47000  ? 618 LYS B CG    1 
ATOM   5269  C  CD    . LYS B 1 373 ? 89.96100  112.49400 123.01700 1.000 44.47000  ? 618 LYS B CD    1 
ATOM   5270  C  CE    . LYS B 1 373 ? 88.48800  112.63800 122.67600 1.000 44.47000  ? 618 LYS B CE    1 
ATOM   5271  N  NZ    . LYS B 1 373 ? 87.89200  111.35400 122.21900 1.000 44.47000  ? 618 LYS B NZ    1 
ATOM   5272  N  N     . ALA B 1 374 ? 88.75700  116.05500 126.44700 1.000 38.89000  ? 619 ALA B N     1 
ATOM   5273  C  CA    . ALA B 1 374 ? 88.01400  116.27500 127.68300 1.000 38.89000  ? 619 ALA B CA    1 
ATOM   5274  C  C     . ALA B 1 374 ? 87.93200  117.74300 128.07700 1.000 38.89000  ? 619 ALA B C     1 
ATOM   5275  O  O     . ALA B 1 374 ? 87.39900  118.07200 129.14100 1.000 38.89000  ? 619 ALA B O     1 
ATOM   5276  C  CB    . ALA B 1 374 ? 88.62300  115.46400 128.82700 1.000 38.89000  ? 619 ALA B CB    1 
ATOM   5277  N  N     . ARG B 1 375 ? 88.45900  118.63500 127.24100 1.000 40.59000  ? 620 ARG B N     1 
ATOM   5278  C  CA    . ARG B 1 375 ? 88.18500  120.05300 127.43700 1.000 40.59000  ? 620 ARG B CA    1 
ATOM   5279  C  C     . ARG B 1 375 ? 86.80000  120.39900 126.91000 1.000 40.59000  ? 620 ARG B C     1 
ATOM   5280  O  O     . ARG B 1 375 ? 86.04900  121.14900 127.54300 1.000 40.59000  ? 620 ARG B O     1 
ATOM   5281  C  CB    . ARG B 1 375 ? 89.26000  120.89400 126.75100 1.000 40.59000  ? 620 ARG B CB    1 
ATOM   5282  C  CG    . ARG B 1 375 ? 89.22800  122.37200 127.09300 1.000 40.59000  ? 620 ARG B CG    1 
ATOM   5283  C  CD    . ARG B 1 375 ? 88.39500  123.17000 126.11400 1.000 40.59000  ? 620 ARG B CD    1 
ATOM   5284  N  NE    . ARG B 1 375 ? 88.87600  123.00700 124.74900 1.000 40.59000  ? 620 ARG B NE    1 
ATOM   5285  C  CZ    . ARG B 1 375 ? 88.17300  123.33000 123.67100 1.000 40.59000  ? 620 ARG B CZ    1 
ATOM   5286  N  NH1   . ARG B 1 375 ? 86.95800  123.84300 123.79900 1.000 40.59000  ? 620 ARG B NH1   1 
ATOM   5287  N  NH2   . ARG B 1 375 ? 88.68600  123.14200 122.46600 1.000 40.59000  ? 620 ARG B NH2   1 
ATOM   5288  N  N     . ALA B 1 376 ? 86.44500  119.85100 125.74600 1.000 40.27000  ? 621 ALA B N     1 
ATOM   5289  C  CA    . ALA B 1 376 ? 85.10200  120.04100 125.21500 1.000 40.27000  ? 621 ALA B CA    1 
ATOM   5290  C  C     . ALA B 1 376 ? 84.07400  119.29800 126.05400 1.000 40.27000  ? 621 ALA B C     1 
ATOM   5291  O  O     . ALA B 1 376 ? 83.03000  119.85600 126.41100 1.000 40.27000  ? 621 ALA B O     1 
ATOM   5292  C  CB    . ALA B 1 376 ? 85.04300  119.58000 123.76000 1.000 40.27000  ? 621 ALA B CB    1 
ATOM   5293  N  N     . ALA B 1 377 ? 84.35200  118.03900 126.38300 1.000 39.05000  ? 622 ALA B N     1 
ATOM   5294  C  CA    . ALA B 1 377 ? 83.42400  117.24400 127.17400 1.000 39.05000  ? 622 ALA B CA    1 
ATOM   5295  C  C     . ALA B 1 377 ? 83.29700  117.72600 128.61200 1.000 39.05000  ? 622 ALA B C     1 
ATOM   5296  O  O     . ALA B 1 377 ? 82.54600  117.11500 129.37900 1.000 39.05000  ? 622 ALA B O     1 
ATOM   5297  C  CB    . ALA B 1 377 ? 83.85000  115.77700 127.16100 1.000 39.05000  ? 622 ALA B CB    1 
ATOM   5298  N  N     . GLY B 1 378 ? 83.99900  118.78600 128.99900 1.000 38.74000  ? 623 GLY B N     1 
ATOM   5299  C  CA    . GLY B 1 378 ? 83.85600  119.32300 130.33800 1.000 38.74000  ? 623 GLY B CA    1 
ATOM   5300  C  C     . GLY B 1 378 ? 84.46600  118.47800 131.43200 1.000 38.74000  ? 623 GLY B C     1 
ATOM   5301  O  O     . GLY B 1 378 ? 83.90800  118.40600 132.53100 1.000 38.74000  ? 623 GLY B O     1 
ATOM   5302  N  N     . ILE B 1 379 ? 85.59900  117.83800 131.16700 1.000 37.66000  ? 624 ILE B N     1 
ATOM   5303  C  CA    . ILE B 1 379 ? 86.30200  117.02900 132.15600 1.000 37.66000  ? 624 ILE B CA    1 
ATOM   5304  C  C     . ILE B 1 379 ? 87.64900  117.69500 132.40200 1.000 37.66000  ? 624 ILE B C     1 
ATOM   5305  O  O     . ILE B 1 379 ? 88.59400  117.52400 131.62500 1.000 37.66000  ? 624 ILE B O     1 
ATOM   5306  C  CB    . ILE B 1 379 ? 86.46600  115.57600 131.70500 1.000 37.66000  ? 624 ILE B CB    1 
ATOM   5307  C  CG1   . ILE B 1 379 ? 85.10100  114.90900 131.57400 1.000 37.66000  ? 624 ILE B CG1   1 
ATOM   5308  C  CG2   . ILE B 1 379 ? 87.32900  114.80900 132.68600 1.000 37.66000  ? 624 ILE B CG2   1 
ATOM   5309  C  CD1   . ILE B 1 379 ? 85.15600  113.56400 130.91700 1.000 37.66000  ? 624 ILE B CD1   1 
ATOM   5310  N  N     . HIS B 1 380 ? 87.74300  118.45300 133.48800 1.000 33.73000  ? 625 HIS B N     1 
ATOM   5311  C  CA    . HIS B 1 380 ? 88.93800  119.21400 133.81000 1.000 33.73000  ? 625 HIS B CA    1 
ATOM   5312  C  C     . HIS B 1 380 ? 89.78600  118.45000 134.81800 1.000 33.73000  ? 625 HIS B C     1 
ATOM   5313  O  O     . HIS B 1 380 ? 89.26900  117.71900 135.66500 1.000 33.73000  ? 625 HIS B O     1 
ATOM   5314  C  CB    . HIS B 1 380 ? 88.56200  120.58700 134.35900 1.000 33.73000  ? 625 HIS B CB    1 
ATOM   5315  C  CG    . HIS B 1 380 ? 87.71600  121.38500 133.42000 1.000 33.73000  ? 625 HIS B CG    1 
ATOM   5316  N  ND1   . HIS B 1 380 ? 86.34100  121.33300 133.43800 1.000 33.73000  ? 625 HIS B ND1   1 
ATOM   5317  C  CD2   . HIS B 1 380 ? 88.04600  122.22900 132.41600 1.000 33.73000  ? 625 HIS B CD2   1 
ATOM   5318  C  CE1   . HIS B 1 380 ? 85.85800  122.12300 132.49700 1.000 33.73000  ? 625 HIS B CE1   1 
ATOM   5319  N  NE2   . HIS B 1 380 ? 86.87300  122.67800 131.86100 1.000 33.73000  ? 625 HIS B NE2   1 
ATOM   5320  N  N     . LEU B 1 381 ? 91.09800  118.63600 134.72500 1.000 32.29000  ? 626 LEU B N     1 
ATOM   5321  C  CA    . LEU B 1 381 ? 92.06600  117.78000 135.39800 1.000 32.29000  ? 626 LEU B CA    1 
ATOM   5322  C  C     . LEU B 1 381 ? 92.97000  118.62700 136.27900 1.000 32.29000  ? 626 LEU B C     1 
ATOM   5323  O  O     . LEU B 1 381 ? 93.76000  119.42900 135.77100 1.000 32.29000  ? 626 LEU B O     1 
ATOM   5324  C  CB    . LEU B 1 381 ? 92.88800  117.00300 134.37000 1.000 32.29000  ? 626 LEU B CB    1 
ATOM   5325  C  CG    . LEU B 1 381 ? 93.90100  115.97800 134.86500 1.000 32.29000  ? 626 LEU B CG    1 
ATOM   5326  C  CD1   . LEU B 1 381 ? 93.20200  114.86600 135.60600 1.000 32.29000  ? 626 LEU B CD1   1 
ATOM   5327  C  CD2   . LEU B 1 381 ? 94.67100  115.42100 133.69000 1.000 32.29000  ? 626 LEU B CD2   1 
ATOM   5328  N  N     . ILE B 1 382 ? 92.85200  118.45100 137.59200 1.000 30.40000  ? 627 ILE B N     1 
ATOM   5329  C  CA    . ILE B 1 382 ? 93.71200  119.10700 138.57100 1.000 30.40000  ? 627 ILE B CA    1 
ATOM   5330  C  C     . ILE B 1 382 ? 94.71300  118.08000 139.07500 1.000 30.40000  ? 627 ILE B C     1 
ATOM   5331  O  O     . ILE B 1 382 ? 94.32200  117.00800 139.55200 1.000 30.40000  ? 627 ILE B O     1 
ATOM   5332  C  CB    . ILE B 1 382 ? 92.90700  119.68900 139.74100 1.000 30.40000  ? 627 ILE B CB    1 
ATOM   5333  C  CG1   . ILE B 1 382 ? 91.97500  120.79800 139.26300 1.000 30.40000  ? 627 ILE B CG1   1 
ATOM   5334  C  CG2   . ILE B 1 382 ? 93.84200  120.20200 140.82100 1.000 30.40000  ? 627 ILE B CG2   1 
ATOM   5335  C  CD1   . ILE B 1 382 ? 90.98500  121.23300 140.31300 1.000 30.40000  ? 627 ILE B CD1   1 
ATOM   5336  N  N     . LEU B 1 383 ? 95.99800  118.40500 138.98500 1.000 34.31000  ? 628 LEU B N     1 
ATOM   5337  C  CA    . LEU B 1 383 ? 97.04500  117.50400 139.43200 1.000 34.31000  ? 628 LEU B CA    1 
ATOM   5338  C  C     . LEU B 1 383 ? 97.68300  118.02400 140.71700 1.000 34.31000  ? 628 LEU B C     1 
ATOM   5339  O  O     . LEU B 1 383 ? 97.29800  119.06000 141.26200 1.000 34.31000  ? 628 LEU B O     1 
ATOM   5340  C  CB    . LEU B 1 383 ? 98.09500  117.32300 138.33700 1.000 34.31000  ? 628 LEU B CB    1 
ATOM   5341  C  CG    . LEU B 1 383 ? 97.61000  116.64400 137.06000 1.000 34.31000  ? 628 LEU B CG    1 
ATOM   5342  C  CD1   . LEU B 1 383 ? 98.71700  116.63400 136.03700 1.000 34.31000  ? 628 LEU B CD1   1 
ATOM   5343  C  CD2   . LEU B 1 383 ? 97.14800  115.23600 137.34300 1.000 34.31000  ? 628 LEU B CD2   1 
ATOM   5344  N  N     . ALA B 1 384 ? 98.66600  117.27600 141.21300 1.000 38.80000  ? 629 ALA B N     1 
ATOM   5345  C  CA    . ALA B 1 384 ? 99.46300  117.70000 142.36100 1.000 38.80000  ? 629 ALA B CA    1 
ATOM   5346  C  C     . ALA B 1 384 ? 100.73700 116.87500 142.37200 1.000 38.80000  ? 629 ALA B C     1 
ATOM   5347  O  O     . ALA B 1 384 ? 100.67300 115.65400 142.54000 1.000 38.80000  ? 629 ALA B O     1 
ATOM   5348  C  CB    . ALA B 1 384 ? 98.69000  117.52000 143.66300 1.000 38.80000  ? 629 ALA B CB    1 
ATOM   5349  N  N     . THR B 1 385 ? 101.88600 117.52100 142.19600 1.000 40.07000  ? 630 THR B N     1 
ATOM   5350  C  CA    . THR B 1 385 ? 103.15400 116.81400 142.09300 1.000 40.07000  ? 630 THR B CA    1 
ATOM   5351  C  C     . THR B 1 385 ? 104.20800 117.48700 142.95900 1.000 40.07000  ? 630 THR B C     1 
ATOM   5352  O  O     . THR B 1 385 ? 103.99600 118.56100 143.52500 1.000 40.07000  ? 630 THR B O     1 
ATOM   5353  C  CB    . THR B 1 385 ? 103.65700 116.76300 140.64400 1.000 40.07000  ? 630 THR B CB    1 
ATOM   5354  O  OG1   . THR B 1 385 ? 103.89300 118.09400 140.17600 1.000 40.07000  ? 630 THR B OG1   1 
ATOM   5355  C  CG2   . THR B 1 385 ? 102.64400 116.10300 139.74500 1.000 40.07000  ? 630 THR B CG2   1 
ATOM   5356  N  N     . GLN B 1 386 ? 105.35500 116.82600 143.05800 1.000 40.91000  ? 631 GLN B N     1 
ATOM   5357  C  CA    . GLN B 1 386 ? 106.58400 117.42000 143.56900 1.000 40.91000  ? 631 GLN B CA    1 
ATOM   5358  C  C     . GLN B 1 386 ? 107.56600 117.46200 142.40500 1.000 40.91000  ? 631 GLN B C     1 
ATOM   5359  O  O     . GLN B 1 386 ? 107.99500 116.41200 141.91500 1.000 40.91000  ? 631 GLN B O     1 
ATOM   5360  C  CB    . GLN B 1 386 ? 107.15800 116.62000 144.73700 1.000 40.91000  ? 631 GLN B CB    1 
ATOM   5361  C  CG    . GLN B 1 386 ? 106.38300 116.72100 146.03800 1.000 40.91000  ? 631 GLN B CG    1 
ATOM   5362  C  CD    . GLN B 1 386 ? 105.10100 115.91800 146.02000 1.000 40.91000  ? 631 GLN B CD    1 
ATOM   5363  O  OE1   . GLN B 1 386 ? 104.01000 116.46500 146.16700 1.000 40.91000  ? 631 GLN B OE1   1 
ATOM   5364  N  NE2   . GLN B 1 386 ? 105.22700 114.60700 145.84700 1.000 40.91000  ? 631 GLN B NE2   1 
ATOM   5365  N  N     . ARG B 1 387 ? 107.92100 118.66800 141.96900 1.000 37.97000  ? 632 ARG B N     1 
ATOM   5366  C  CA    . ARG B 1 387 ? 108.79000 118.86500 140.81400 1.000 37.97000  ? 632 ARG B CA    1 
ATOM   5367  C  C     . ARG B 1 387 ? 108.26900 118.09700 139.60500 1.000 37.97000  ? 632 ARG B C     1 
ATOM   5368  O  O     . ARG B 1 387 ? 108.81300 117.04200 139.25600 1.000 37.97000  ? 632 ARG B O     1 
ATOM   5369  C  CB    . ARG B 1 387 ? 110.22500 118.43800 141.11700 1.000 37.97000  ? 632 ARG B CB    1 
ATOM   5370  C  CG    . ARG B 1 387 ? 111.18300 118.76600 139.98900 1.000 37.97000  ? 632 ARG B CG    1 
ATOM   5371  C  CD    . ARG B 1 387 ? 112.58300 118.30800 140.28900 1.000 37.97000  ? 632 ARG B CD    1 
ATOM   5372  N  NE    . ARG B 1 387 ? 113.49600 118.66300 139.21200 1.000 37.97000  ? 632 ARG B NE    1 
ATOM   5373  C  CZ    . ARG B 1 387 ? 113.74100 117.88900 138.16400 1.000 37.97000  ? 632 ARG B CZ    1 
ATOM   5374  N  NH1   . ARG B 1 387 ? 113.14300 116.71200 138.05200 1.000 37.97000  ? 632 ARG B NH1   1 
ATOM   5375  N  NH2   . ARG B 1 387 ? 114.58600 118.29100 137.22800 1.000 37.97000  ? 632 ARG B NH2   1 
ATOM   5376  N  N     . PRO B 1 388 ? 107.20500 118.56400 138.96500 1.000 38.35000  ? 633 PRO B N     1 
ATOM   5377  C  CA    . PRO B 1 388 ? 106.71700 117.88400 137.76000 1.000 38.35000  ? 633 PRO B CA    1 
ATOM   5378  C  C     . PRO B 1 388 ? 107.73200 117.92100 136.63400 1.000 38.35000  ? 633 PRO B C     1 
ATOM   5379  O  O     . PRO B 1 388 ? 108.05900 118.98900 136.11000 1.000 38.35000  ? 633 PRO B O     1 
ATOM   5380  C  CB    . PRO B 1 388 ? 105.45300 118.67000 137.40300 1.000 38.35000  ? 633 PRO B CB    1 
ATOM   5381  C  CG    . PRO B 1 388 ? 105.67600 120.01500 137.98600 1.000 38.35000  ? 633 PRO B CG    1 
ATOM   5382  C  CD    . PRO B 1 388 ? 106.45500 119.79700 139.24500 1.000 38.35000  ? 633 PRO B CD    1 
ATOM   5383  N  N     . SER B 1 389 ? 108.24400 116.75400 136.26000 1.000 47.25000  ? 634 SER B N     1 
ATOM   5384  C  CA    . SER B 1 389 ? 109.23600 116.64100 135.20400 1.000 47.25000  ? 634 SER B CA    1 
ATOM   5385  C  C     . SER B 1 389 ? 108.92900 115.40300 134.37700 1.000 47.25000  ? 634 SER B C     1 
ATOM   5386  O  O     . SER B 1 389 ? 108.03400 114.61900 134.70400 1.000 47.25000  ? 634 SER B O     1 
ATOM   5387  C  CB    . SER B 1 389 ? 110.65300 116.56400 135.77500 1.000 47.25000  ? 634 SER B CB    1 
ATOM   5388  O  OG    . SER B 1 389 ? 110.83600 115.36300 136.50000 1.000 47.25000  ? 634 SER B OG    1 
ATOM   5389  N  N     . VAL B 1 390 ? 109.68300 115.23900 133.28800 1.000 48.83000  ? 635 VAL B N     1 
ATOM   5390  C  CA    . VAL B 1 390 ? 109.52700 114.06600 132.43300 1.000 48.83000  ? 635 VAL B CA    1 
ATOM   5391  C  C     . VAL B 1 390 ? 109.70400 112.78300 133.23300 1.000 48.83000  ? 635 VAL B C     1 
ATOM   5392  O  O     . VAL B 1 390 ? 109.12300 111.74300 132.89600 1.000 48.83000  ? 635 VAL B O     1 
ATOM   5393  C  CB    . VAL B 1 390 ? 110.51400 114.14800 131.25400 1.000 48.83000  ? 635 VAL B CB    1 
ATOM   5394  C  CG1   . VAL B 1 390 ? 110.43100 112.90300 130.38800 1.000 48.83000  ? 635 VAL B CG1   1 
ATOM   5395  C  CG2   . VAL B 1 390 ? 110.22900 115.38800 130.43500 1.000 48.83000  ? 635 VAL B CG2   1 
ATOM   5396  N  N     . ASP B 1 391 ? 110.48300 112.83600 134.31400 1.000 52.03000  ? 636 ASP B N     1 
ATOM   5397  C  CA    . ASP B 1 391 ? 110.57000 111.70500 135.22900 1.000 52.03000  ? 636 ASP B CA    1 
ATOM   5398  C  C     . ASP B 1 391 ? 109.22400 111.37400 135.85600 1.000 52.03000  ? 636 ASP B C     1 
ATOM   5399  O  O     . ASP B 1 391 ? 109.02700 110.24600 136.31800 1.000 52.03000  ? 636 ASP B O     1 
ATOM   5400  C  CB    . ASP B 1 391 ? 111.59300 112.00000 136.32600 1.000 52.03000  ? 636 ASP B CB    1 
ATOM   5401  C  CG    . ASP B 1 391 ? 113.00800 112.09500 135.79600 1.000 52.03000  ? 636 ASP B CG    1 
ATOM   5402  O  OD1   . ASP B 1 391 ? 113.30800 111.43100 134.78100 1.000 52.03000  ? 636 ASP B OD1   1 
ATOM   5403  O  OD2   . ASP B 1 391 ? 113.82000 112.83600 136.39100 1.000 52.03000  ? 636 ASP B OD2   1 
ATOM   5404  N  N     . VAL B 1 392 ? 108.29600 112.33000 135.88600 1.000 46.74000  ? 637 VAL B N     1 
ATOM   5405  C  CA    . VAL B 1 392 ? 106.99200 112.12600 136.50200 1.000 46.74000  ? 637 VAL B CA    1 
ATOM   5406  C  C     . VAL B 1 392 ? 105.89300 112.34100 135.47100 1.000 46.74000  ? 637 VAL B C     1 
ATOM   5407  O  O     . VAL B 1 392 ? 105.11400 111.42900 135.17700 1.000 46.74000  ? 637 VAL B O     1 
ATOM   5408  C  CB    . VAL B 1 392 ? 106.80100 113.06600 137.70500 1.000 46.74000  ? 637 VAL B CB    1 
ATOM   5409  C  CG1   . VAL B 1 392 ? 105.39400 112.94700 138.24600 1.000 46.74000  ? 637 VAL B CG1   1 
ATOM   5410  C  CG2   . VAL B 1 392 ? 107.82100 112.75400 138.78200 1.000 46.74000  ? 637 VAL B CG2   1 
ATOM   5411  N  N     . ILE B 1 393 ? 105.82600 113.54700 134.91600 1.000 42.87000  ? 638 ILE B N     1 
ATOM   5412  C  CA    . ILE B 1 393 ? 104.80100 113.92000 133.94900 1.000 42.87000  ? 638 ILE B CA    1 
ATOM   5413  C  C     . ILE B 1 393 ? 105.44700 113.99800 132.57500 1.000 42.87000  ? 638 ILE B C     1 
ATOM   5414  O  O     . ILE B 1 393 ? 106.37200 114.79000 132.35900 1.000 42.87000  ? 638 ILE B O     1 
ATOM   5415  C  CB    . ILE B 1 393 ? 104.13400 115.25100 134.31400 1.000 42.87000  ? 638 ILE B CB    1 
ATOM   5416  C  CG1   . ILE B 1 393 ? 103.38100 115.12100 135.62900 1.000 42.87000  ? 638 ILE B CG1   1 
ATOM   5417  C  CG2   . ILE B 1 393 ? 103.18100 115.67100 133.23200 1.000 42.87000  ? 638 ILE B CG2   1 
ATOM   5418  C  CD1   . ILE B 1 393 ? 102.86300 116.42400 136.13600 1.000 42.87000  ? 638 ILE B CD1   1 
ATOM   5419  N  N     . THR B 1 394 ? 104.95200 113.18600 131.64800 1.000 42.62000  ? 639 THR B N     1 
ATOM   5420  C  CA    . THR B 1 394 ? 105.50100 113.14800 130.30400 1.000 42.62000  ? 639 THR B CA    1 
ATOM   5421  C  C     . THR B 1 394 ? 105.30300 114.50100 129.61900 1.000 42.62000  ? 639 THR B C     1 
ATOM   5422  O  O     . THR B 1 394 ? 104.48600 115.32400 130.03600 1.000 42.62000  ? 639 THR B O     1 
ATOM   5423  C  CB    . THR B 1 394 ? 104.83100 112.02200 129.51200 1.000 42.62000  ? 639 THR B CB    1 
ATOM   5424  O  OG1   . THR B 1 394 ? 104.91700 110.81000 130.26800 1.000 42.62000  ? 639 THR B OG1   1 
ATOM   5425  C  CG2   . THR B 1 394 ? 105.51900 111.78900 128.17700 1.000 42.62000  ? 639 THR B CG2   1 
ATOM   5426  N  N     . GLY B 1 395 ? 106.07700 114.73200 128.55700 1.000 41.72000  ? 640 GLY B N     1 
ATOM   5427  C  CA    . GLY B 1 395 ? 105.96100 115.97000 127.80800 1.000 41.72000  ? 640 GLY B CA    1 
ATOM   5428  C  C     . GLY B 1 395 ? 104.63300 116.13800 127.10100 1.000 41.72000  ? 640 GLY B C     1 
ATOM   5429  O  O     . GLY B 1 395 ? 104.26800 117.26300 126.74600 1.000 41.72000  ? 640 GLY B O     1 
ATOM   5430  N  N     . LEU B 1 396 ? 103.90000 115.04600 126.88500 1.000 40.01000  ? 641 LEU B N     1 
ATOM   5431  C  CA    . LEU B 1 396 ? 102.58400 115.14200 126.26600 1.000 40.01000  ? 641 LEU B CA    1 
ATOM   5432  C  C     . LEU B 1 396 ? 101.53000 115.58100 127.27200 1.000 40.01000  ? 641 LEU B C     1 
ATOM   5433  O  O     . LEU B 1 396 ? 100.61900 116.34100 126.93100 1.000 40.01000  ? 641 LEU B O     1 
ATOM   5434  C  CB    . LEU B 1 396 ? 102.19200 113.80300 125.64500 1.000 40.01000  ? 641 LEU B CB    1 
ATOM   5435  C  CG    . LEU B 1 396 ? 102.77400 113.46400 124.27400 1.000 40.01000  ? 641 LEU B CG    1 
ATOM   5436  C  CD1   . LEU B 1 396 ? 104.25600 113.14500 124.36100 1.000 40.01000  ? 641 LEU B CD1   1 
ATOM   5437  C  CD2   . LEU B 1 396 ? 102.01200 112.30200 123.66100 1.000 40.01000  ? 641 LEU B CD2   1 
ATOM   5438  N  N     . ILE B 1 397 ? 101.63400 115.09900 128.51000 1.000 35.81000  ? 642 ILE B N     1 
ATOM   5439  C  CA    . ILE B 1 397 ? 100.69100 115.49900 129.54600 1.000 35.81000  ? 642 ILE B CA    1 
ATOM   5440  C  C     . ILE B 1 397 ? 100.96400 116.92900 129.98900 1.000 35.81000  ? 642 ILE B C     1 
ATOM   5441  O  O     . ILE B 1 397 ? 100.03600 117.72700 130.16200 1.000 35.81000  ? 642 ILE B O     1 
ATOM   5442  C  CB    . ILE B 1 397 ? 100.76100 114.52100 130.72900 1.000 35.81000  ? 642 ILE B CB    1 
ATOM   5443  C  CG1   . ILE B 1 397 ? 100.39900 113.11000 130.27400 1.000 35.81000  ? 642 ILE B CG1   1 
ATOM   5444  C  CG2   . ILE B 1 397 ? 99.84800  114.97700 131.85000 1.000 35.81000  ? 642 ILE B CG2   1 
ATOM   5445  C  CD1   . ILE B 1 397 ? 100.73100 112.05000 131.29000 1.000 35.81000  ? 642 ILE B CD1   1 
ATOM   5446  N  N     . LYS B 1 398 ? 102.23600 117.27900 130.17300 1.000 34.39000  ? 643 LYS B N     1 
ATOM   5447  C  CA    . LYS B 1 398 ? 102.59900 118.58000 130.71700 1.000 34.39000  ? 643 LYS B CA    1 
ATOM   5448  C  C     . LYS B 1 398 ? 102.44600 119.70400 129.70000 1.000 34.39000  ? 643 LYS B C     1 
ATOM   5449  O  O     . LYS B 1 398 ? 102.51800 120.87800 130.07600 1.000 34.39000  ? 643 LYS B O     1 
ATOM   5450  C  CB    . LYS B 1 398 ? 104.03800 118.53200 131.24500 1.000 34.39000  ? 643 LYS B CB    1 
ATOM   5451  C  CG    . LYS B 1 398 ? 104.47500 119.74500 132.04800 1.000 34.39000  ? 643 LYS B CG    1 
ATOM   5452  C  CD    . LYS B 1 398 ? 105.87000 119.56900 132.62000 1.000 34.39000  ? 643 LYS B CD    1 
ATOM   5453  C  CE    . LYS B 1 398 ? 106.92300 119.70500 131.53500 1.000 34.39000  ? 643 LYS B CE    1 
ATOM   5454  N  NZ    . LYS B 1 398 ? 108.30300 119.65300 132.08100 1.000 34.39000  ? 643 LYS B NZ    1 
ATOM   5455  N  N     . ALA B 1 399 ? 102.20800 119.37900 128.43300 1.000 33.93000  ? 644 ALA B N     1 
ATOM   5456  C  CA    . ALA B 1 399 ? 101.99300 120.40400 127.42100 1.000 33.93000  ? 644 ALA B CA    1 
ATOM   5457  C  C     . ALA B 1 399 ? 100.53700 120.83200 127.34400 1.000 33.93000  ? 644 ALA B C     1 
ATOM   5458  O  O     . ALA B 1 399 ? 100.24900 122.01300 127.13200 1.000 33.93000  ? 644 ALA B O     1 
ATOM   5459  C  CB    . ALA B 1 399 ? 102.45700 119.90100 126.05400 1.000 33.93000  ? 644 ALA B CB    1 
ATOM   5460  N  N     . ASN B 1 400 ? 99.61300  119.89400 127.51800 1.000 33.79000  ? 645 ASN B N     1 
ATOM   5461  C  CA    . ASN B 1 400 ? 98.18800  120.18000 127.48100 1.000 33.79000  ? 645 ASN B CA    1 
ATOM   5462  C  C     . ASN B 1 400 ? 97.65300  120.69900 128.80900 1.000 33.79000  ? 645 ASN B C     1 
ATOM   5463  O  O     . ASN B 1 400 ? 96.43500  120.69800 129.01000 1.000 33.79000  ? 645 ASN B O     1 
ATOM   5464  C  CB    . ASN B 1 400 ? 97.41400  118.93000 127.06000 1.000 33.79000  ? 645 ASN B CB    1 
ATOM   5465  C  CG    . ASN B 1 400 ? 97.64200  118.56500 125.60700 1.000 33.79000  ? 645 ASN B CG    1 
ATOM   5466  O  OD1   . ASN B 1 400 ? 97.68200  119.43200 124.73700 1.000 33.79000  ? 645 ASN B OD1   1 
ATOM   5467  N  ND2   . ASN B 1 400 ? 97.78700  117.27400 125.33700 1.000 33.79000  ? 645 ASN B ND2   1 
ATOM   5468  N  N     . ILE B 1 401 ? 98.52300  121.13300 129.71400 1.000 31.39000  ? 646 ILE B N     1 
ATOM   5469  C  CA    . ILE B 1 401 ? 98.10200  121.68200 131.00000 1.000 31.39000  ? 646 ILE B CA    1 
ATOM   5470  C  C     . ILE B 1 401 ? 98.58000  123.12600 131.07400 1.000 31.39000  ? 646 ILE B C     1 
ATOM   5471  O  O     . ILE B 1 401 ? 99.73300  123.38200 131.44900 1.000 31.39000  ? 646 ILE B O     1 
ATOM   5472  C  CB    . ILE B 1 401 ? 98.64200  120.84500 132.16700 1.000 31.39000  ? 646 ILE B CB    1 
ATOM   5473  C  CG1   . ILE B 1 401 ? 98.08200  119.43000 132.09100 1.000 31.39000  ? 646 ILE B CG1   1 
ATOM   5474  C  CG2   . ILE B 1 401 ? 98.27600  121.47400 133.49400 1.000 31.39000  ? 646 ILE B CG2   1 
ATOM   5475  C  CD1   . ILE B 1 401 ? 98.74800  118.48200 133.03000 1.000 31.39000  ? 646 ILE B CD1   1 
ATOM   5476  N  N     . PRO B 1 402 ? 97.73900  124.09500 130.71000 1.000 32.27000  ? 647 PRO B N     1 
ATOM   5477  C  CA    . PRO B 1 402 ? 98.24100  125.47100 130.58000 1.000 32.27000  ? 647 PRO B CA    1 
ATOM   5478  C  C     . PRO B 1 402 ? 98.54100  126.15300 131.90200 1.000 32.27000  ? 647 PRO B C     1 
ATOM   5479  O  O     . PRO B 1 402 ? 99.57700  126.81800 132.02300 1.000 32.27000  ? 647 PRO B O     1 
ATOM   5480  C  CB    . PRO B 1 402 ? 97.10600  126.17900 129.82600 1.000 32.27000  ? 647 PRO B CB    1 
ATOM   5481  C  CG    . PRO B 1 402 ? 96.35300  125.08200 129.14600 1.000 32.27000  ? 647 PRO B CG    1 
ATOM   5482  C  CD    . PRO B 1 402 ? 96.41800  123.92600 130.08800 1.000 32.27000  ? 647 PRO B CD    1 
ATOM   5483  N  N     . THR B 1 403 ? 97.67500  126.01200 132.89900 1.000 35.38000  ? 648 THR B N     1 
ATOM   5484  C  CA    . THR B 1 403 ? 97.74500  126.83000 134.10500 1.000 35.38000  ? 648 THR B CA    1 
ATOM   5485  C  C     . THR B 1 403 ? 98.57400  126.11500 135.16500 1.000 35.38000  ? 648 THR B C     1 
ATOM   5486  O  O     . THR B 1 403 ? 98.18100  125.05400 135.65800 1.000 35.38000  ? 648 THR B O     1 
ATOM   5487  C  CB    . THR B 1 403 ? 96.34500  127.13300 134.62600 1.000 35.38000  ? 648 THR B CB    1 
ATOM   5488  O  OG1   . THR B 1 403 ? 95.59500  127.80300 133.61000 1.000 35.38000  ? 648 THR B OG1   1 
ATOM   5489  C  CG2   . THR B 1 403 ? 96.42500  128.02600 135.84200 1.000 35.38000  ? 648 THR B CG2   1 
ATOM   5490  N  N     . ARG B 1 404 ? 99.71000  126.70500 135.52500 1.000 36.58000  ? 649 ARG B N     1 
ATOM   5491  C  CA    . ARG B 1 404 ? 100.59100 126.17200 136.55400 1.000 36.58000  ? 649 ARG B CA    1 
ATOM   5492  C  C     . ARG B 1 404 ? 100.46500 126.99900 137.82300 1.000 36.58000  ? 649 ARG B C     1 
ATOM   5493  O  O     . ARG B 1 404 ? 100.51500 128.23100 137.77100 1.000 36.58000  ? 649 ARG B O     1 
ATOM   5494  C  CB    . ARG B 1 404 ? 102.04900 126.16900 136.08900 1.000 36.58000  ? 649 ARG B CB    1 
ATOM   5495  C  CG    . ARG B 1 404 ? 102.44800 124.98600 135.23500 1.000 36.58000  ? 649 ARG B CG    1 
ATOM   5496  C  CD    . ARG B 1 404 ? 101.97200 125.12800 133.81100 1.000 36.58000  ? 649 ARG B CD    1 
ATOM   5497  N  NE    . ARG B 1 404 ? 102.44600 124.02300 132.98800 1.000 36.58000  ? 649 ARG B NE    1 
ATOM   5498  C  CZ    . ARG B 1 404 ? 103.61000 124.01700 132.35000 1.000 36.58000  ? 649 ARG B CZ    1 
ATOM   5499  N  NH1   . ARG B 1 404 ? 104.42000 125.06100 132.43400 1.000 36.58000  ? 649 ARG B NH1   1 
ATOM   5500  N  NH2   . ARG B 1 404 ? 103.96200 122.96900 131.62300 1.000 36.58000  ? 649 ARG B NH2   1 
ATOM   5501  N  N     . ILE B 1 405 ? 100.30800 126.32300 138.95600 1.000 62.18000  ? 650 ILE B N     1 
ATOM   5502  C  CA    . ILE B 1 405 ? 100.35600 126.95100 140.27000 1.000 62.18000  ? 650 ILE B CA    1 
ATOM   5503  C  C     . ILE B 1 405 ? 101.50500 126.30700 141.02500 1.000 62.18000  ? 650 ILE B C     1 
ATOM   5504  O  O     . ILE B 1 405 ? 101.45100 125.11300 141.34600 1.000 62.18000  ? 650 ILE B O     1 
ATOM   5505  C  CB    . ILE B 1 405 ? 99.04000  126.80300 141.04400 1.000 62.18000  ? 650 ILE B CB    1 
ATOM   5506  C  CG1   . ILE B 1 405 ? 97.92500  127.58500 140.36000 1.000 62.18000  ? 650 ILE B CG1   1 
ATOM   5507  C  CG2   . ILE B 1 405 ? 99.20900  127.28300 142.46300 1.000 62.18000  ? 650 ILE B CG2   1 
ATOM   5508  C  CD1   . ILE B 1 405 ? 96.56900  127.34400 140.96100 1.000 62.18000  ? 650 ILE B CD1   1 
ATOM   5509  N  N     . ALA B 1 406 ? 102.54400 127.08400 141.30100 1.000 40.89000  ? 651 ALA B N     1 
ATOM   5510  C  CA    . ALA B 1 406 ? 103.74500 126.58900 141.95800 1.000 40.89000  ? 651 ALA B CA    1 
ATOM   5511  C  C     . ALA B 1 406 ? 103.84900 127.19900 143.34600 1.000 40.89000  ? 651 ALA B C     1 
ATOM   5512  O  O     . ALA B 1 406 ? 103.88900 128.42400 143.48500 1.000 40.89000  ? 651 ALA B O     1 
ATOM   5513  C  CB    . ALA B 1 406 ? 104.99400 126.91800 141.14300 1.000 40.89000  ? 651 ALA B CB    1 
ATOM   5514  N  N     . PHE B 1 407 ? 103.89100 126.34600 144.36200 1.000 39.71000  ? 652 PHE B N     1 
ATOM   5515  C  CA    . PHE B 1 407 ? 104.25900 126.76900 145.70400 1.000 39.71000  ? 652 PHE B CA    1 
ATOM   5516  C  C     . PHE B 1 407 ? 105.78200 126.88100 145.74800 1.000 39.71000  ? 652 PHE B C     1 
ATOM   5517  O  O     . PHE B 1 407 ? 106.45300 126.78800 144.71800 1.000 39.71000  ? 652 PHE B O     1 
ATOM   5518  C  CB    . PHE B 1 407 ? 103.68400 125.79800 146.72900 1.000 39.71000  ? 652 PHE B CB    1 
ATOM   5519  C  CG    . PHE B 1 407 ? 102.18400 125.79600 146.77300 1.000 39.71000  ? 652 PHE B CG    1 
ATOM   5520  C  CD1   . PHE B 1 407 ? 101.50000 126.73000 147.52500 1.000 39.71000  ? 652 PHE B CD1   1 
ATOM   5521  C  CD2   . PHE B 1 407 ? 101.45900 124.88200 146.03500 1.000 39.71000  ? 652 PHE B CD2   1 
ATOM   5522  C  CE1   . PHE B 1 407 ? 100.12400 126.73800 147.56100 1.000 39.71000  ? 652 PHE B CE1   1 
ATOM   5523  C  CE2   . PHE B 1 407 ? 100.08200 124.88900 146.06600 1.000 39.71000  ? 652 PHE B CE2   1 
ATOM   5524  C  CZ    . PHE B 1 407 ? 99.41400  125.81800 146.82900 1.000 39.71000  ? 652 PHE B CZ    1 
ATOM   5525  N  N     . GLN B 1 408 ? 106.36100 127.09000 146.92700 1.000 40.81000  ? 653 GLN B N     1 
ATOM   5526  C  CA    . GLN B 1 408 ? 107.80900 127.21800 146.97600 1.000 40.81000  ? 653 GLN B CA    1 
ATOM   5527  C  C     . GLN B 1 408 ? 108.46100 125.89500 146.60000 1.000 40.81000  ? 653 GLN B C     1 
ATOM   5528  O  O     . GLN B 1 408 ? 107.91600 124.81600 146.84300 1.000 40.81000  ? 653 GLN B O     1 
ATOM   5529  C  CB    . GLN B 1 408 ? 108.29300 127.64600 148.36100 1.000 40.81000  ? 653 GLN B CB    1 
ATOM   5530  C  CG    . GLN B 1 408 ? 108.23200 126.56400 149.41800 1.000 40.81000  ? 653 GLN B CG    1 
ATOM   5531  C  CD    . GLN B 1 408 ? 108.83300 127.01300 150.73200 1.000 40.81000  ? 653 GLN B CD    1 
ATOM   5532  O  OE1   . GLN B 1 408 ? 109.31500 128.13800 150.85000 1.000 40.81000  ? 653 GLN B OE1   1 
ATOM   5533  N  NE2   . GLN B 1 408 ? 108.83100 126.12700 151.72000 1.000 40.81000  ? 653 GLN B NE2   1 
ATOM   5534  N  N     . VAL B 1 409 ? 109.63400 125.98500 145.98000 1.000 39.19000  ? 654 VAL B N     1 
ATOM   5535  C  CA    . VAL B 1 409 ? 110.41300 124.80700 145.64100 1.000 39.19000  ? 654 VAL B CA    1 
ATOM   5536  C  C     . VAL B 1 409 ? 111.84300 125.01900 146.11100 1.000 39.19000  ? 654 VAL B C     1 
ATOM   5537  O  O     . VAL B 1 409 ? 112.28600 126.14400 146.35100 1.000 39.19000  ? 654 VAL B O     1 
ATOM   5538  C  CB    . VAL B 1 409 ? 110.38200 124.48900 144.13400 1.000 39.19000  ? 654 VAL B CB    1 
ATOM   5539  C  CG1   . VAL B 1 409 ? 108.97800 124.12000 143.70000 1.000 39.19000  ? 654 VAL B CG1   1 
ATOM   5540  C  CG2   . VAL B 1 409 ? 110.87600 125.67500 143.35500 1.000 39.19000  ? 654 VAL B CG2   1 
ATOM   5541  N  N     . SER B 1 410 ? 112.56300 123.90800 146.24900 1.000 38.61000  ? 655 SER B N     1 
ATOM   5542  C  CA    . SER B 1 410 ? 113.90600 123.93400 146.81000 1.000 38.61000  ? 655 SER B CA    1 
ATOM   5543  C  C     . SER B 1 410 ? 114.87500 124.73700 145.95300 1.000 38.61000  ? 655 SER B C     1 
ATOM   5544  O  O     . SER B 1 410 ? 115.37300 125.78100 146.38100 1.000 38.61000  ? 655 SER B O     1 
ATOM   5545  C  CB    . SER B 1 410 ? 114.42500 122.50600 146.97700 1.000 38.61000  ? 655 SER B CB    1 
ATOM   5546  O  OG    . SER B 1 410 ? 113.62100 121.77900 147.88600 1.000 38.61000  ? 655 SER B OG    1 
ATOM   5547  N  N     . SER B 1 411 ? 115.13900 124.26500 144.74100 1.000 40.25000  ? 656 SER B N     1 
ATOM   5548  C  CA    . SER B 1 411 ? 116.15900 124.85800 143.89400 1.000 40.25000  ? 656 SER B CA    1 
ATOM   5549  C  C     . SER B 1 411 ? 115.54700 125.93500 143.00200 1.000 40.25000  ? 656 SER B C     1 
ATOM   5550  O  O     . SER B 1 411 ? 114.39500 126.34100 143.17100 1.000 40.25000  ? 656 SER B O     1 
ATOM   5551  C  CB    . SER B 1 411 ? 116.84900 123.77600 143.06700 1.000 40.25000  ? 656 SER B CB    1 
ATOM   5552  O  OG    . SER B 1 411 ? 117.52400 122.84900 143.89800 1.000 40.25000  ? 656 SER B OG    1 
ATOM   5553  N  N     . LYS B 1 412 ? 116.33500 126.41500 142.04400 1.000 43.88000  ? 657 LYS B N     1 
ATOM   5554  C  CA    . LYS B 1 412 ? 115.83700 127.21900 140.93800 1.000 43.88000  ? 657 LYS B CA    1 
ATOM   5555  C  C     . LYS B 1 412 ? 115.66900 126.40800 139.66800 1.000 43.88000  ? 657 LYS B C     1 
ATOM   5556  O  O     . LYS B 1 412 ? 114.75800 126.68300 138.88200 1.000 43.88000  ? 657 LYS B O     1 
ATOM   5557  C  CB    . LYS B 1 412 ? 116.78500 128.38800 140.65900 1.000 43.88000  ? 657 LYS B CB    1 
ATOM   5558  C  CG    . LYS B 1 412 ? 116.30200 129.33500 139.58000 1.000 43.88000  ? 657 LYS B CG    1 
ATOM   5559  C  CD    . LYS B 1 412 ? 117.32600 130.42100 139.31500 1.000 43.88000  ? 657 LYS B CD    1 
ATOM   5560  C  CE    . LYS B 1 412 ? 117.36900 131.40200 140.46600 1.000 43.88000  ? 657 LYS B CE    1 
ATOM   5561  N  NZ    . LYS B 1 412 ? 118.26100 132.56000 140.21000 1.000 43.88000  ? 657 LYS B NZ    1 
ATOM   5562  N  N     . ILE B 1 413 ? 116.52900 125.40900 139.45900 1.000 40.80000  ? 658 ILE B N     1 
ATOM   5563  C  CA    . ILE B 1 413 ? 116.34500 124.47300 138.36200 1.000 40.80000  ? 658 ILE B CA    1 
ATOM   5564  C  C     . ILE B 1 413 ? 115.03000 123.73000 138.50800 1.000 40.80000  ? 658 ILE B C     1 
ATOM   5565  O  O     . ILE B 1 413 ? 114.45300 123.28000 137.51300 1.000 40.80000  ? 658 ILE B O     1 
ATOM   5566  C  CB    . ILE B 1 413 ? 117.53300 123.49500 138.30900 1.000 40.80000  ? 658 ILE B CB    1 
ATOM   5567  C  CG1   . ILE B 1 413 ? 118.85100 124.26400 138.22900 1.000 40.80000  ? 658 ILE B CG1   1 
ATOM   5568  C  CG2   . ILE B 1 413 ? 117.41500 122.58500 137.11600 1.000 40.80000  ? 658 ILE B CG2   1 
ATOM   5569  C  CD1   . ILE B 1 413 ? 118.97800 125.12400 137.00000 1.000 40.80000  ? 658 ILE B CD1   1 
ATOM   5570  N  N     . ASP B 1 414 ? 114.52900 123.60500 139.73600 1.000 40.79000  ? 659 ASP B N     1 
ATOM   5571  C  CA    . ASP B 1 414 ? 113.25500 122.93900 139.96500 1.000 40.79000  ? 659 ASP B CA    1 
ATOM   5572  C  C     . ASP B 1 414 ? 112.08400 123.84800 139.62200 1.000 40.79000  ? 659 ASP B C     1 
ATOM   5573  O  O     . ASP B 1 414 ? 111.08800 123.39000 139.05100 1.000 40.79000  ? 659 ASP B O     1 
ATOM   5574  C  CB    . ASP B 1 414 ? 113.16200 122.47900 141.41800 1.000 40.79000  ? 659 ASP B CB    1 
ATOM   5575  C  CG    . ASP B 1 414 ? 114.19100 121.42200 141.75800 1.000 40.79000  ? 659 ASP B CG    1 
ATOM   5576  O  OD1   . ASP B 1 414 ? 114.59100 120.66500 140.85000 1.000 40.79000  ? 659 ASP B OD1   1 
ATOM   5577  O  OD2   . ASP B 1 414 ? 114.60600 121.35100 142.93300 1.000 40.79000  ? 659 ASP B OD2   1 
ATOM   5578  N  N     . SER B 1 415 ? 112.18300 125.13500 139.96400 1.000 37.32000  ? 660 SER B N     1 
ATOM   5579  C  CA    . SER B 1 415 ? 111.10900 126.07200 139.66100 1.000 37.32000  ? 660 SER B CA    1 
ATOM   5580  C  C     . SER B 1 415 ? 110.95500 126.32700 138.17300 1.000 37.32000  ? 660 SER B C     1 
ATOM   5581  O  O     . SER B 1 415 ? 109.89900 126.80200 137.74900 1.000 37.32000  ? 660 SER B O     1 
ATOM   5582  C  CB    . SER B 1 415 ? 111.34700 127.40400 140.36100 1.000 37.32000  ? 660 SER B CB    1 
ATOM   5583  O  OG    . SER B 1 415 ? 110.35800 128.34000 139.98100 1.000 37.32000  ? 660 SER B OG    1 
ATOM   5584  N  N     . ARG B 1 416 ? 111.97500 126.03800 137.37300 1.000 41.22000  ? 661 ARG B N     1 
ATOM   5585  C  CA    . ARG B 1 416 ? 111.86400 126.24100 135.93800 1.000 41.22000  ? 661 ARG B CA    1 
ATOM   5586  C  C     . ARG B 1 416 ? 111.16700 125.07800 135.24700 1.000 41.22000  ? 661 ARG B C     1 
ATOM   5587  O  O     . ARG B 1 416 ? 110.85200 125.17400 134.05700 1.000 41.22000  ? 661 ARG B O     1 
ATOM   5588  C  CB    . ARG B 1 416 ? 113.25400 126.47600 135.34100 1.000 41.22000  ? 661 ARG B CB    1 
ATOM   5589  C  CG    . ARG B 1 416 ? 113.24900 126.96200 133.90700 1.000 41.22000  ? 661 ARG B CG    1 
ATOM   5590  C  CD    . ARG B 1 416 ? 114.64000 127.31400 133.44000 1.000 41.22000  ? 661 ARG B CD    1 
ATOM   5591  N  NE    . ARG B 1 416 ? 115.51900 126.15300 133.40900 1.000 41.22000  ? 661 ARG B NE    1 
ATOM   5592  C  CZ    . ARG B 1 416 ? 116.56100 125.99500 134.21600 1.000 41.22000  ? 661 ARG B CZ    1 
ATOM   5593  N  NH1   . ARG B 1 416 ? 116.84500 126.92300 135.11900 1.000 41.22000  ? 661 ARG B NH1   1 
ATOM   5594  N  NH2   . ARG B 1 416 ? 117.31700 124.91000 134.12100 1.000 41.22000  ? 661 ARG B NH2   1 
ATOM   5595  N  N     . THR B 1 417 ? 110.89400 123.99500 135.97300 1.000 37.71000  ? 662 THR B N     1 
ATOM   5596  C  CA    . THR B 1 417 ? 110.09400 122.90700 135.43300 1.000 37.71000  ? 662 THR B CA    1 
ATOM   5597  C  C     . THR B 1 417 ? 108.60300 123.17400 135.55500 1.000 37.71000  ? 662 THR B C     1 
ATOM   5598  O  O     . THR B 1 417 ? 107.81800 122.59600 134.79700 1.000 37.71000  ? 662 THR B O     1 
ATOM   5599  C  CB    . THR B 1 417 ? 110.42800 121.59700 136.14500 1.000 37.71000  ? 662 THR B CB    1 
ATOM   5600  O  OG1   . THR B 1 417 ? 110.11700 121.71900 137.53700 1.000 37.71000  ? 662 THR B OG1   1 
ATOM   5601  C  CG2   . THR B 1 417 ? 111.89700 121.27500 135.99100 1.000 37.71000  ? 662 THR B CG2   1 
ATOM   5602  N  N     . ILE B 1 418 ? 108.19800 124.03100 136.48800 1.000 35.33000  ? 663 ILE B N     1 
ATOM   5603  C  CA    . ILE B 1 418 ? 106.78700 124.30500 136.71500 1.000 35.33000  ? 663 ILE B CA    1 
ATOM   5604  C  C     . ILE B 1 418 ? 106.38800 125.55900 135.95600 1.000 35.33000  ? 663 ILE B C     1 
ATOM   5605  O  O     . ILE B 1 418 ? 105.56300 125.51200 135.03900 1.000 35.33000  ? 663 ILE B O     1 
ATOM   5606  C  CB    . ILE B 1 418 ? 106.49200 124.47900 138.21100 1.000 35.33000  ? 663 ILE B CB    1 
ATOM   5607  C  CG1   . ILE B 1 418 ? 107.00200 123.27600 138.99300 1.000 35.33000  ? 663 ILE B CG1   1 
ATOM   5608  C  CG2   . ILE B 1 418 ? 105.00600 124.63500 138.42400 1.000 35.33000  ? 663 ILE B CG2   1 
ATOM   5609  C  CD1   . ILE B 1 418 ? 107.09000 123.52100 140.47600 1.000 35.33000  ? 663 ILE B CD1   1 
ATOM   5610  N  N     . LEU B 1 419 ? 106.98700 126.68600 136.32600 1.000 34.91000  ? 664 LEU B N     1 
ATOM   5611  C  CA    . LEU B 1 419 ? 106.59600 127.99500 135.82600 1.000 34.91000  ? 664 LEU B CA    1 
ATOM   5612  C  C     . LEU B 1 419 ? 107.35000 128.41300 134.57500 1.000 34.91000  ? 664 LEU B C     1 
ATOM   5613  O  O     . LEU B 1 419 ? 107.03700 129.46500 134.01000 1.000 34.91000  ? 664 LEU B O     1 
ATOM   5614  C  CB    . LEU B 1 419 ? 106.81400 129.05300 136.90800 1.000 34.91000  ? 664 LEU B CB    1 
ATOM   5615  C  CG    . LEU B 1 419 ? 106.01100 128.88200 138.19300 1.000 34.91000  ? 664 LEU B CG    1 
ATOM   5616  C  CD1   . LEU B 1 419 ? 106.38600 129.95100 139.19800 1.000 34.91000  ? 664 LEU B CD1   1 
ATOM   5617  C  CD2   . LEU B 1 419 ? 104.53600 128.91400 137.89600 1.000 34.91000  ? 664 LEU B CD2   1 
ATOM   5618  N  N     . ASP B 1 420 ? 108.34500 127.63800 134.14900 1.000 39.93000  ? 665 ASP B N     1 
ATOM   5619  C  CA    . ASP B 1 420 ? 109.25800 127.94800 133.05300 1.000 39.93000  ? 665 ASP B CA    1 
ATOM   5620  C  C     . ASP B 1 420 ? 110.17700 129.11600 133.40600 1.000 39.93000  ? 665 ASP B C     1 
ATOM   5621  O  O     . ASP B 1 420 ? 111.01200 129.50600 132.58500 1.000 39.93000  ? 665 ASP B O     1 
ATOM   5622  C  CB    . ASP B 1 420 ? 108.51200 128.24900 131.74400 1.000 39.93000  ? 665 ASP B CB    1 
ATOM   5623  C  CG    . ASP B 1 420 ? 109.39700 128.13000 130.52200 1.000 39.93000  ? 665 ASP B CG    1 
ATOM   5624  O  OD1   . ASP B 1 420 ? 110.57700 127.75100 130.66800 1.000 39.93000  ? 665 ASP B OD1   1 
ATOM   5625  O  OD2   . ASP B 1 420 ? 108.91200 128.42700 129.41100 1.000 39.93000  ? 665 ASP B OD2   1 
ATOM   5626  N  N     . GLN B 1 421 ? 110.05500 129.68200 134.60400 1.000 40.19000  ? 666 GLN B N     1 
ATOM   5627  C  CA    . GLN B 1 421 ? 110.89500 130.78400 135.04800 1.000 40.19000  ? 666 GLN B CA    1 
ATOM   5628  C  C     . GLN B 1 421 ? 111.08000 130.67800 136.55500 1.000 40.19000  ? 666 GLN B C     1 
ATOM   5629  O  O     . GLN B 1 421 ? 110.13400 130.36800 137.28400 1.000 40.19000  ? 666 GLN B O     1 
ATOM   5630  C  CB    . GLN B 1 421 ? 110.28800 132.13100 134.64300 1.000 40.19000  ? 666 GLN B CB    1 
ATOM   5631  C  CG    . GLN B 1 421 ? 108.87800 132.35600 135.14600 1.000 40.19000  ? 666 GLN B CG    1 
ATOM   5632  C  CD    . GLN B 1 421 ? 108.27300 133.62700 134.59800 1.000 40.19000  ? 666 GLN B CD    1 
ATOM   5633  O  OE1   . GLN B 1 421 ? 108.93700 134.39500 133.90600 1.000 40.19000  ? 666 GLN B OE1   1 
ATOM   5634  N  NE2   . GLN B 1 421 ? 107.00100 133.84800 134.88700 1.000 40.19000  ? 666 GLN B NE2   1 
ATOM   5635  N  N     . GLY B 1 422 ? 112.30200 130.93400 137.01200 1.000 37.37000  ? 667 GLY B N     1 
ATOM   5636  C  CA    . GLY B 1 422 ? 112.70100 130.59000 138.36400 1.000 37.37000  ? 667 GLY B CA    1 
ATOM   5637  C  C     . GLY B 1 422 ? 112.26000 131.53800 139.45800 1.000 37.37000  ? 667 GLY B C     1 
ATOM   5638  O  O     . GLY B 1 422 ? 113.05300 131.88700 140.33800 1.000 37.37000  ? 667 GLY B O     1 
ATOM   5639  N  N     . GLY B 1 423 ? 111.00100 131.96000 139.42700 1.000 35.14000  ? 668 GLY B N     1 
ATOM   5640  C  CA    . GLY B 1 423 ? 110.51900 132.85200 140.46200 1.000 35.14000  ? 668 GLY B CA    1 
ATOM   5641  C  C     . GLY B 1 423 ? 110.02800 132.17800 141.72200 1.000 35.14000  ? 668 GLY B C     1 
ATOM   5642  O  O     . GLY B 1 423 ? 109.92400 132.84100 142.75800 1.000 35.14000  ? 668 GLY B O     1 
ATOM   5643  N  N     . ALA B 1 424 ? 109.73100 130.88200 141.66700 1.000 38.35000  ? 669 ALA B N     1 
ATOM   5644  C  CA    . ALA B 1 424 ? 109.07900 130.18100 142.76500 1.000 38.35000  ? 669 ALA B CA    1 
ATOM   5645  C  C     . ALA B 1 424 ? 110.05000 129.69500 143.82600 1.000 38.35000  ? 669 ALA B C     1 
ATOM   5646  O  O     . ALA B 1 424 ? 109.70400 128.79500 144.59700 1.000 38.35000  ? 669 ALA B O     1 
ATOM   5647  C  CB    . ALA B 1 424 ? 108.27100 128.99800 142.23100 1.000 38.35000  ? 669 ALA B CB    1 
ATOM   5648  N  N     . GLU B 1 425 ? 111.25300 130.25600 143.88400 1.000 46.24000  ? 670 GLU B N     1 
ATOM   5649  C  CA    . GLU B 1 425 ? 112.18400 129.90300 144.94500 1.000 46.24000  ? 670 GLU B CA    1 
ATOM   5650  C  C     . GLU B 1 425 ? 112.12300 130.87600 146.11300 1.000 46.24000  ? 670 GLU B C     1 
ATOM   5651  O  O     . GLU B 1 425 ? 112.29900 130.46000 147.26300 1.000 46.24000  ? 670 GLU B O     1 
ATOM   5652  C  CB    . GLU B 1 425 ? 113.61400 129.84100 144.40300 1.000 46.24000  ? 670 GLU B CB    1 
ATOM   5653  C  CG    . GLU B 1 425 ? 114.14400 131.18500 143.96400 1.000 46.24000  ? 670 GLU B CG    1 
ATOM   5654  C  CD    . GLU B 1 425 ? 115.56000 131.13000 143.45300 1.000 46.24000  ? 670 GLU B CD    1 
ATOM   5655  O  OE1   . GLU B 1 425 ? 116.12300 130.01900 143.36800 1.000 46.24000  ? 670 GLU B OE1   1 
ATOM   5656  O  OE2   . GLU B 1 425 ? 116.11800 132.20800 143.15900 1.000 46.24000  ? 670 GLU B OE2   1 
ATOM   5657  N  N     . GLN B 1 426 ? 111.86900 132.15800 145.84900 1.000 46.55000  ? 671 GLN B N     1 
ATOM   5658  C  CA    . GLN B 1 426 ? 111.80700 133.16100 146.90200 1.000 46.55000  ? 671 GLN B CA    1 
ATOM   5659  C  C     . GLN B 1 426 ? 110.50400 133.12900 147.68300 1.000 46.55000  ? 671 GLN B C     1 
ATOM   5660  O  O     . GLN B 1 426 ? 110.29800 133.99500 148.53900 1.000 46.55000  ? 671 GLN B O     1 
ATOM   5661  C  CB    . GLN B 1 426 ? 112.00400 134.56600 146.32600 1.000 46.55000  ? 671 GLN B CB    1 
ATOM   5662  C  CG    . GLN B 1 426 ? 113.40000 134.86500 145.81400 1.000 46.55000  ? 671 GLN B CG    1 
ATOM   5663  C  CD    . GLN B 1 426 ? 113.59800 134.44700 144.37700 1.000 46.55000  ? 671 GLN B CD    1 
ATOM   5664  O  OE1   . GLN B 1 426 ? 112.63500 134.20900 143.65100 1.000 46.55000  ? 671 GLN B OE1   1 
ATOM   5665  N  NE2   . GLN B 1 426 ? 114.85200 134.36400 143.95200 1.000 46.55000  ? 671 GLN B NE2   1 
ATOM   5666  N  N     . LEU B 1 427 ? 109.62300 132.17100 147.41700 1.000 45.65000  ? 672 LEU B N     1 
ATOM   5667  C  CA    . LEU B 1 427 ? 108.37600 132.09700 148.15900 1.000 45.65000  ? 672 LEU B CA    1 
ATOM   5668  C  C     . LEU B 1 427 ? 108.63400 131.64300 149.58900 1.000 45.65000  ? 672 LEU B C     1 
ATOM   5669  O  O     . LEU B 1 427 ? 109.48800 130.79400 149.85300 1.000 45.65000  ? 672 LEU B O     1 
ATOM   5670  C  CB    . LEU B 1 427 ? 107.39800 131.15300 147.46900 1.000 45.65000  ? 672 LEU B CB    1 
ATOM   5671  C  CG    . LEU B 1 427 ? 106.88300 131.69500 146.14100 1.000 45.65000  ? 672 LEU B CG    1 
ATOM   5672  C  CD1   . LEU B 1 427 ? 106.05000 130.65500 145.43300 1.000 45.65000  ? 672 LEU B CD1   1 
ATOM   5673  C  CD2   . LEU B 1 427 ? 106.07500 132.95400 146.38700 1.000 45.65000  ? 672 LEU B CD2   1 
ATOM   5674  N  N     . LEU B 1 428 ? 107.87400 132.21800 150.51600 1.000 51.70000  ? 673 LEU B N     1 
ATOM   5675  C  CA    . LEU B 1 428 ? 108.10900 132.03700 151.93900 1.000 51.70000  ? 673 LEU B CA    1 
ATOM   5676  C  C     . LEU B 1 428 ? 107.42600 130.80000 152.50400 1.000 51.70000  ? 673 LEU B C     1 
ATOM   5677  O  O     . LEU B 1 428 ? 107.36400 130.64800 153.72900 1.000 51.70000  ? 673 LEU B O     1 
ATOM   5678  C  CB    . LEU B 1 428 ? 107.64800 133.27800 152.70000 1.000 51.70000  ? 673 LEU B CB    1 
ATOM   5679  C  CG    . LEU B 1 428 ? 108.39600 134.55600 152.32700 1.000 51.70000  ? 673 LEU B CG    1 
ATOM   5680  C  CD1   . LEU B 1 428 ? 107.82800 135.75000 153.07400 1.000 51.70000  ? 673 LEU B CD1   1 
ATOM   5681  C  CD2   . LEU B 1 428 ? 109.88400 134.39900 152.59200 1.000 51.70000  ? 673 LEU B CD2   1 
ATOM   5682  N  N     . GLY B 1 429 ? 106.92300 129.91500 151.65100 1.000 51.09000  ? 674 GLY B N     1 
ATOM   5683  C  CA    . GLY B 1 429 ? 106.24200 128.72500 152.11800 1.000 51.09000  ? 674 GLY B CA    1 
ATOM   5684  C  C     . GLY B 1 429 ? 104.99200 129.05400 152.91500 1.000 51.09000  ? 674 GLY B C     1 
ATOM   5685  O  O     . GLY B 1 429 ? 104.54800 130.19600 153.00800 1.000 51.09000  ? 674 GLY B O     1 
ATOM   5686  N  N     . HIS B 1 430 ? 104.41900 128.00400 153.50200 1.000 55.82000  ? 675 HIS B N     1 
ATOM   5687  C  CA    . HIS B 1 430 ? 103.19100 128.11000 154.28800 1.000 55.82000  ? 675 HIS B CA    1 
ATOM   5688  C  C     . HIS B 1 430 ? 102.06300 128.71900 153.45900 1.000 55.82000  ? 675 HIS B C     1 
ATOM   5689  O  O     . HIS B 1 430 ? 101.32600 129.59700 153.91300 1.000 55.82000  ? 675 HIS B O     1 
ATOM   5690  C  CB    . HIS B 1 430 ? 103.42200 128.90600 155.57500 1.000 55.82000  ? 675 HIS B CB    1 
ATOM   5691  C  CG    . HIS B 1 430 ? 104.34800 128.23800 156.54200 1.000 55.82000  ? 675 HIS B CG    1 
ATOM   5692  N  ND1   . HIS B 1 430 ? 103.96700 127.16100 157.31400 1.000 55.82000  ? 675 HIS B ND1   1 
ATOM   5693  C  CD2   . HIS B 1 430 ? 105.63800 128.49400 156.86400 1.000 55.82000  ? 675 HIS B CD2   1 
ATOM   5694  C  CE1   . HIS B 1 430 ? 104.98200 126.78300 158.06900 1.000 55.82000  ? 675 HIS B CE1   1 
ATOM   5695  N  NE2   . HIS B 1 430 ? 106.00900 127.57400 157.81500 1.000 55.82000  ? 675 HIS B NE2   1 
ATOM   5696  N  N     . GLY B 1 431 ? 101.93800 128.24800 152.22300 1.000 50.25000  ? 676 GLY B N     1 
ATOM   5697  C  CA    . GLY B 1 431 ? 100.83500 128.63900 151.37300 1.000 50.25000  ? 676 GLY B CA    1 
ATOM   5698  C  C     . GLY B 1 431 ? 101.10100 129.76500 150.40400 1.000 50.25000  ? 676 GLY B C     1 
ATOM   5699  O  O     . GLY B 1 431 ? 100.14300 130.34500 149.88400 1.000 50.25000  ? 676 GLY B O     1 
ATOM   5700  N  N     . ASP B 1 432 ? 102.35700 130.10400 150.14000 1.000 50.92000  ? 677 ASP B N     1 
ATOM   5701  C  CA    . ASP B 1 432 ? 102.66000 131.05400 149.08100 1.000 50.92000  ? 677 ASP B CA    1 
ATOM   5702  C  C     . ASP B 1 432 ? 102.75000 130.33300 147.74600 1.000 50.92000  ? 677 ASP B C     1 
ATOM   5703  O  O     . ASP B 1 432 ? 103.21200 129.19400 147.66200 1.000 50.92000  ? 677 ASP B O     1 
ATOM   5704  C  CB    . ASP B 1 432 ? 103.96600 131.80000 149.35400 1.000 50.92000  ? 677 ASP B CB    1 
ATOM   5705  C  CG    . ASP B 1 432 ? 103.80900 132.87600 150.40000 1.000 50.92000  ? 677 ASP B CG    1 
ATOM   5706  O  OD1   . ASP B 1 432 ? 102.70000 133.43400 150.51400 1.000 50.92000  ? 677 ASP B OD1   1 
ATOM   5707  O  OD2   . ASP B 1 432 ? 104.79700 133.17400 151.10100 1.000 50.92000  ? 677 ASP B OD2   1 
ATOM   5708  N  N     . MET B 1 433 ? 102.31600 131.01800 146.69400 1.000 44.62000  ? 678 MET B N     1 
ATOM   5709  C  CA    . MET B 1 433 ? 102.29200 130.42900 145.36700 1.000 44.62000  ? 678 MET B CA    1 
ATOM   5710  C  C     . MET B 1 433 ? 102.53300 131.51900 144.33900 1.000 44.62000  ? 678 MET B C     1 
ATOM   5711  O  O     . MET B 1 433 ? 102.45200 132.71200 144.63600 1.000 44.62000  ? 678 MET B O     1 
ATOM   5712  C  CB    . MET B 1 433 ? 100.96200 129.72800 145.08700 1.000 44.62000  ? 678 MET B CB    1 
ATOM   5713  C  CG    . MET B 1 433 ? 99.78500  130.68000 145.01700 1.000 44.62000  ? 678 MET B CG    1 
ATOM   5714  S  SD    . MET B 1 433 ? 98.21000  129.86200 144.70800 1.000 44.62000  ? 678 MET B SD    1 
ATOM   5715  C  CE    . MET B 1 433 ? 97.89700  129.09900 146.29200 1.000 44.62000  ? 678 MET B CE    1 
ATOM   5716  N  N     . LEU B 1 434 ? 102.83400 131.09200 143.11800 1.000 40.38000  ? 679 LEU B N     1 
ATOM   5717  C  CA    . LEU B 1 434 ? 102.93400 131.98300 141.96600 1.000 40.38000  ? 679 LEU B CA    1 
ATOM   5718  C  C     . LEU B 1 434 ? 101.96600 131.46900 140.91000 1.000 40.38000  ? 679 LEU B C     1 
ATOM   5719  O  O     . LEU B 1 434 ? 102.34000 130.67500 140.04600 1.000 40.38000  ? 679 LEU B O     1 
ATOM   5720  C  CB    . LEU B 1 434 ? 104.34900 132.05500 141.43100 1.000 40.38000  ? 679 LEU B CB    1 
ATOM   5721  C  CG    . LEU B 1 434 ? 105.37400 132.75100 142.31600 1.000 40.38000  ? 679 LEU B CG    1 
ATOM   5722  C  CD1   . LEU B 1 434 ? 106.72800 132.67200 141.66900 1.000 40.38000  ? 679 LEU B CD1   1 
ATOM   5723  C  CD2   . LEU B 1 434 ? 104.98100 134.19200 142.53500 1.000 40.38000  ? 679 LEU B CD2   1 
ATOM   5724  N  N     . TYR B 1 435 ? 100.71900 131.92300 140.98600 1.000 43.16000  ? 680 TYR B N     1 
ATOM   5725  C  CA    . TYR B 1 435 ? 99.72500  131.57900 139.98000 1.000 43.16000  ? 680 TYR B CA    1 
ATOM   5726  C  C     . TYR B 1 435 ? 100.18100 132.05700 138.61000 1.000 43.16000  ? 680 TYR B C     1 
ATOM   5727  O  O     . TYR B 1 435 ? 100.30300 133.26300 138.37800 1.000 43.16000  ? 680 TYR B O     1 
ATOM   5728  C  CB    . TYR B 1 435 ? 98.36900  132.18700 140.33800 1.000 43.16000  ? 680 TYR B CB    1 
ATOM   5729  C  CG    . TYR B 1 435 ? 97.28900  131.92100 139.32000 1.000 43.16000  ? 680 TYR B CG    1 
ATOM   5730  C  CD1   . TYR B 1 435 ? 96.70800  130.67100 139.20900 1.000 43.16000  ? 680 TYR B CD1   1 
ATOM   5731  C  CD2   . TYR B 1 435 ? 96.84500  132.92400 138.47400 1.000 43.16000  ? 680 TYR B CD2   1 
ATOM   5732  C  CE1   . TYR B 1 435 ? 95.71800  130.42400 138.28400 1.000 43.16000  ? 680 TYR B CE1   1 
ATOM   5733  C  CE2   . TYR B 1 435 ? 95.85600  132.68700 137.54400 1.000 43.16000  ? 680 TYR B CE2   1 
ATOM   5734  C  CZ    . TYR B 1 435 ? 95.29700  131.43500 137.45300 1.000 43.16000  ? 680 TYR B CZ    1 
ATOM   5735  O  OH    . TYR B 1 435 ? 94.31000  131.19400 136.52700 1.000 43.16000  ? 680 TYR B OH    1 
ATOM   5736  N  N     . LEU B 1 436 ? 100.44600 131.12300 137.70100 1.000 39.75000  ? 681 LEU B N     1 
ATOM   5737  C  CA    . LEU B 1 436 ? 100.89400 131.46200 136.35500 1.000 39.75000  ? 681 LEU B CA    1 
ATOM   5738  C  C     . LEU B 1 436 ? 99.74900  131.25500 135.37800 1.000 39.75000  ? 681 LEU B C     1 
ATOM   5739  O  O     . LEU B 1 436 ? 99.50000  130.11800 134.94800 1.000 39.75000  ? 681 LEU B O     1 
ATOM   5740  C  CB    . LEU B 1 436 ? 102.09800 130.61000 135.95000 1.000 39.75000  ? 681 LEU B CB    1 
ATOM   5741  C  CG    . LEU B 1 436 ? 102.70300 130.94500 134.58800 1.000 39.75000  ? 681 LEU B CG    1 
ATOM   5742  C  CD1   . LEU B 1 436 ? 103.28800 132.33500 134.61000 1.000 39.75000  ? 681 LEU B CD1   1 
ATOM   5743  C  CD2   . LEU B 1 436 ? 103.75700 129.93300 134.20100 1.000 39.75000  ? 681 LEU B CD2   1 
ATOM   5744  N  N     . PRO B 1 437 ? 99.02300  132.30100 135.00100 1.000 40.69000  ? 682 PRO B N     1 
ATOM   5745  C  CA    . PRO B 1 437 ? 97.93000  132.14400 134.04200 1.000 40.69000  ? 682 PRO B CA    1 
ATOM   5746  C  C     . PRO B 1 437 ? 98.44800  131.62100 132.71400 1.000 40.69000  ? 682 PRO B C     1 
ATOM   5747  O  O     . PRO B 1 437 ? 99.66300  131.61800 132.47000 1.000 40.69000  ? 682 PRO B O     1 
ATOM   5748  C  CB    . PRO B 1 437 ? 97.36900  133.56900 133.91500 1.000 40.69000  ? 682 PRO B CB    1 
ATOM   5749  C  CG    . PRO B 1 437 ? 98.49300  134.45300 134.29400 1.000 40.69000  ? 682 PRO B CG    1 
ATOM   5750  C  CD    . PRO B 1 437 ? 99.25600  133.71100 135.34900 1.000 40.69000  ? 682 PRO B CD    1 
ATOM   5751  N  N     . PRO B 1 438 ? 97.56500  131.17200 131.82700 1.000 40.68000  ? 683 PRO B N     1 
ATOM   5752  C  CA    . PRO B 1 438 ? 98.03100  130.52300 130.59700 1.000 40.68000  ? 683 PRO B CA    1 
ATOM   5753  C  C     . PRO B 1 438 ? 98.61200  131.49500 129.58400 1.000 40.68000  ? 683 PRO B C     1 
ATOM   5754  O  O     . PRO B 1 438 ? 97.90200  131.97400 128.69600 1.000 40.68000  ? 683 PRO B O     1 
ATOM   5755  C  CB    . PRO B 1 438 ? 96.76600  129.84500 130.05900 1.000 40.68000  ? 683 PRO B CB    1 
ATOM   5756  C  CG    . PRO B 1 438 ? 95.64700  130.64400 130.61500 1.000 40.68000  ? 683 PRO B CG    1 
ATOM   5757  C  CD    . PRO B 1 438 ? 96.10000  131.09200 131.96900 1.000 40.68000  ? 683 PRO B CD    1 
ATOM   5758  N  N     . GLY B 1 439 ? 99.89800  131.80700 129.71800 1.000 45.58000  ? 684 GLY B N     1 
ATOM   5759  C  CA    . GLY B 1 439 ? 100.57100 132.63200 128.73500 1.000 45.58000  ? 684 GLY B CA    1 
ATOM   5760  C  C     . GLY B 1 439 ? 100.79200 134.07100 129.14800 1.000 45.58000  ? 684 GLY B C     1 
ATOM   5761  O  O     . GLY B 1 439 ? 100.49900 134.99700 128.38600 1.000 45.58000  ? 684 GLY B O     1 
ATOM   5762  N  N     . THR B 1 440 ? 101.31100 134.27300 130.35600 1.000 49.25000  ? 685 THR B N     1 
ATOM   5763  C  CA    . THR B 1 440 ? 101.68600 135.60000 130.82900 1.000 49.25000  ? 685 THR B CA    1 
ATOM   5764  C  C     . THR B 1 440 ? 103.02100 135.48800 131.54500 1.000 49.25000  ? 685 THR B C     1 
ATOM   5765  O  O     . THR B 1 440 ? 103.15600 134.70200 132.48600 1.000 49.25000  ? 685 THR B O     1 
ATOM   5766  C  CB    . THR B 1 440 ? 100.62000 136.18500 131.75800 1.000 49.25000  ? 685 THR B CB    1 
ATOM   5767  O  OG1   . THR B 1 440 ? 99.37700  136.28700 131.05200 1.000 49.25000  ? 685 THR B OG1   1 
ATOM   5768  C  CG2   . THR B 1 440 ? 101.03400 137.56600 132.23600 1.000 49.25000  ? 685 THR B CG2   1 
ATOM   5769  N  N     . GLY B 1 441 ? 104.00400 136.27100 131.09600 1.000 48.25000  ? 686 GLY B N     1 
ATOM   5770  C  CA    . GLY B 1 441 ? 105.34400 136.18600 131.65100 1.000 48.25000  ? 686 GLY B CA    1 
ATOM   5771  C  C     . GLY B 1 441 ? 105.43800 136.53500 133.12200 1.000 48.25000  ? 686 GLY B C     1 
ATOM   5772  O  O     . GLY B 1 441 ? 106.45200 136.22700 133.75800 1.000 48.25000  ? 686 GLY B O     1 
ATOM   5773  N  N     . LEU B 1 442 ? 104.41000 137.17000 133.68100 1.000 45.41000  ? 687 LEU B N     1 
ATOM   5774  C  CA    . LEU B 1 442 ? 104.43200 137.58500 135.07500 1.000 45.41000  ? 687 LEU B CA    1 
ATOM   5775  C  C     . LEU B 1 442 ? 103.45100 136.74900 135.87900 1.000 45.41000  ? 687 LEU B C     1 
ATOM   5776  O  O     . LEU B 1 442 ? 102.23700 136.82300 135.63500 1.000 45.41000  ? 687 LEU B O     1 
ATOM   5777  C  CB    . LEU B 1 442 ? 104.09800 139.06900 135.20200 1.000 45.41000  ? 687 LEU B CB    1 
ATOM   5778  C  CG    . LEU B 1 442 ? 105.12700 140.03000 134.60200 1.000 45.41000  ? 687 LEU B CG    1 
ATOM   5779  C  CD1   . LEU B 1 442 ? 104.63200 141.46400 134.67900 1.000 45.41000  ? 687 LEU B CD1   1 
ATOM   5780  C  CD2   . LEU B 1 442 ? 106.47200 139.88200 135.30000 1.000 45.41000  ? 687 LEU B CD2   1 
ATOM   5781  N  N     . PRO B 1 443 ? 103.92000 135.94700 136.83500 1.000 39.53000  ? 688 PRO B N     1 
ATOM   5782  C  CA    . PRO B 1 443 ? 103.00200 135.14500 137.65300 1.000 39.53000  ? 688 PRO B CA    1 
ATOM   5783  C  C     . PRO B 1 443 ? 102.29600 136.01700 138.68100 1.000 39.53000  ? 688 PRO B C     1 
ATOM   5784  O  O     . PRO B 1 443 ? 102.92300 136.83800 139.35300 1.000 39.53000  ? 688 PRO B O     1 
ATOM   5785  C  CB    . PRO B 1 443 ? 103.92800 134.13200 138.33500 1.000 39.53000  ? 688 PRO B CB    1 
ATOM   5786  C  CG    . PRO B 1 443 ? 105.17000 134.13000 137.51800 1.000 39.53000  ? 688 PRO B CG    1 
ATOM   5787  C  CD    . PRO B 1 443 ? 105.31700 135.53600 137.03300 1.000 39.53000  ? 688 PRO B CD    1 
ATOM   5788  N  N     . ILE B 1 444 ? 100.98600 135.82800 138.80500 1.000 41.64000  ? 689 ILE B N     1 
ATOM   5789  C  CA    . ILE B 1 444 ? 100.20900 136.52500 139.82200 1.000 41.64000  ? 689 ILE B CA    1 
ATOM   5790  C  C     . ILE B 1 444 ? 100.51200 135.89200 141.17200 1.000 41.64000  ? 689 ILE B C     1 
ATOM   5791  O  O     . ILE B 1 444 ? 100.03200 134.79400 141.47100 1.000 41.64000  ? 689 ILE B O     1 
ATOM   5792  C  CB    . ILE B 1 444 ? 98.70300  136.46900 139.51000 1.000 41.64000  ? 689 ILE B CB    1 
ATOM   5793  C  CG1   . ILE B 1 444 ? 98.42100  137.05900 138.13000 1.000 41.64000  ? 689 ILE B CG1   1 
ATOM   5794  C  CG2   . ILE B 1 444 ? 97.91200  137.21500 140.56700 1.000 41.64000  ? 689 ILE B CG2   1 
ATOM   5795  C  CD1   . ILE B 1 444 ? 98.79700  138.51500 138.00200 1.000 41.64000  ? 689 ILE B CD1   1 
ATOM   5796  N  N     . ARG B 1 445 ? 101.31200 136.56700 141.99200 1.000 46.67000  ? 690 ARG B N     1 
ATOM   5797  C  CA    . ARG B 1 445 ? 101.66800 136.01600 143.29400 1.000 46.67000  ? 690 ARG B CA    1 
ATOM   5798  C  C     . ARG B 1 445 ? 100.46400 136.04700 144.22500 1.000 46.67000  ? 690 ARG B C     1 
ATOM   5799  O  O     . ARG B 1 445 ? 99.91200  137.11600 144.50300 1.000 46.67000  ? 690 ARG B O     1 
ATOM   5800  C  CB    . ARG B 1 445 ? 102.83400 136.78400 143.90900 1.000 46.67000  ? 690 ARG B CB    1 
ATOM   5801  C  CG    . ARG B 1 445 ? 103.28100 136.20100 145.23800 1.000 46.67000  ? 690 ARG B CG    1 
ATOM   5802  C  CD    . ARG B 1 445 ? 104.53600 136.86600 145.76500 1.000 46.67000  ? 690 ARG B CD    1 
ATOM   5803  N  NE    . ARG B 1 445 ? 104.93800 136.30600 147.05100 1.000 46.67000  ? 690 ARG B NE    1 
ATOM   5804  C  CZ    . ARG B 1 445 ? 106.03200 136.66500 147.71200 1.000 46.67000  ? 690 ARG B CZ    1 
ATOM   5805  N  NH1   . ARG B 1 445 ? 106.84300 137.58200 147.20500 1.000 46.67000  ? 690 ARG B NH1   1 
ATOM   5806  N  NH2   . ARG B 1 445 ? 106.32000 136.10200 148.87600 1.000 46.67000  ? 690 ARG B NH2   1 
ATOM   5807  N  N     . VAL B 1 446 ? 100.06500 134.87500 144.71000 1.000 46.32000  ? 691 VAL B N     1 
ATOM   5808  C  CA    . VAL B 1 446 ? 98.92500  134.72300 145.60300 1.000 46.32000  ? 691 VAL B CA    1 
ATOM   5809  C  C     . VAL B 1 446 ? 99.42600  134.10600 146.90000 1.000 46.32000  ? 691 VAL B C     1 
ATOM   5810  O  O     . VAL B 1 446 ? 100.34500 133.28000 146.88600 1.000 46.32000  ? 691 VAL B O     1 
ATOM   5811  C  CB    . VAL B 1 446 ? 97.82500  133.85000 144.96200 1.000 46.32000  ? 691 VAL B CB    1 
ATOM   5812  C  CG1   . VAL B 1 446 ? 96.64800  133.67300 145.90600 1.000 46.32000  ? 691 VAL B CG1   1 
ATOM   5813  C  CG2   . VAL B 1 446 ? 97.37400  134.44900 143.64400 1.000 46.32000  ? 691 VAL B CG2   1 
ATOM   5814  N  N     . HIS B 1 447 ? 98.82300  134.50300 148.02100 1.000 50.51000  ? 692 HIS B N     1 
ATOM   5815  C  CA    . HIS B 1 447 ? 99.25600  134.04900 149.33600 1.000 50.51000  ? 692 HIS B CA    1 
ATOM   5816  C  C     . HIS B 1 447 ? 98.39200  132.91300 149.87400 1.000 50.51000  ? 692 HIS B C     1 
ATOM   5817  O  O     . HIS B 1 447 ? 98.22200  132.78900 151.09100 1.000 50.51000  ? 692 HIS B O     1 
ATOM   5818  C  CB    . HIS B 1 447 ? 99.27100  135.21600 150.32100 1.000 50.51000  ? 692 HIS B CB    1 
ATOM   5819  C  CG    . HIS B 1 447 ? 100.23000 136.30300 149.95200 1.000 50.51000  ? 692 HIS B CG    1 
ATOM   5820  N  ND1   . HIS B 1 447 ? 101.59600 136.14500 150.03000 1.000 50.51000  ? 692 HIS B ND1   1 
ATOM   5821  C  CD2   . HIS B 1 447 ? 100.02100 137.56800 149.52100 1.000 50.51000  ? 692 HIS B CD2   1 
ATOM   5822  C  CE1   . HIS B 1 447 ? 102.18900 137.26200 149.64800 1.000 50.51000  ? 692 HIS B CE1   1 
ATOM   5823  N  NE2   . HIS B 1 447 ? 101.25500 138.14300 149.33600 1.000 50.51000  ? 692 HIS B NE2   1 
ATOM   5824  N  N     . GLY B 1 448 ? 97.85000  132.08000 148.99100 1.000 51.88000  ? 693 GLY B N     1 
ATOM   5825  C  CA    . GLY B 1 448 ? 97.10000  130.90600 149.38800 1.000 51.88000  ? 693 GLY B CA    1 
ATOM   5826  C  C     . GLY B 1 448 ? 95.91500  131.20700 150.29400 1.000 51.88000  ? 693 GLY B C     1 
ATOM   5827  O  O     . GLY B 1 448 ? 95.46900  132.34000 150.45200 1.000 51.88000  ? 693 GLY B O     1 
ATOM   5828  N  N     . ALA B 1 449 ? 95.41000  130.13500 150.89700 1.000 51.33000  ? 694 ALA B N     1 
ATOM   5829  C  CA    . ALA B 1 449 ? 94.28900  130.23600 151.82600 1.000 51.33000  ? 694 ALA B CA    1 
ATOM   5830  C  C     . ALA B 1 449 ? 94.31700  129.01900 152.73200 1.000 51.33000  ? 694 ALA B C     1 
ATOM   5831  O  O     . ALA B 1 449 ? 94.26700  127.88600 152.24500 1.000 51.33000  ? 694 ALA B O     1 
ATOM   5832  C  CB    . ALA B 1 449 ? 92.95900  130.32900 151.08000 1.000 51.33000  ? 694 ALA B CB    1 
ATOM   5833  N  N     . PHE B 1 450 ? 94.40000  129.24900 154.03700 1.000 59.23000  ? 695 PHE B N     1 
ATOM   5834  C  CA    . PHE B 1 450 ? 94.46800  128.15900 154.99600 1.000 59.23000  ? 695 PHE B CA    1 
ATOM   5835  C  C     . PHE B 1 450 ? 93.07100  127.62900 155.27700 1.000 59.23000  ? 695 PHE B C     1 
ATOM   5836  O  O     . PHE B 1 450 ? 92.16700  128.39400 155.62400 1.000 59.23000  ? 695 PHE B O     1 
ATOM   5837  C  CB    . PHE B 1 450 ? 95.12900  128.62800 156.29000 1.000 59.23000  ? 695 PHE B CB    1 
ATOM   5838  C  CG    . PHE B 1 450 ? 95.28700  127.54500 157.31400 1.000 59.23000  ? 695 PHE B CG    1 
ATOM   5839  C  CD1   . PHE B 1 450 ? 96.25800  126.57200 157.16500 1.000 59.23000  ? 695 PHE B CD1   1 
ATOM   5840  C  CD2   . PHE B 1 450 ? 94.47000  127.50300 158.42800 1.000 59.23000  ? 695 PHE B CD2   1 
ATOM   5841  C  CE1   . PHE B 1 450 ? 96.40700  125.57400 158.10400 1.000 59.23000  ? 695 PHE B CE1   1 
ATOM   5842  C  CE2   . PHE B 1 450 ? 94.61600  126.50900 159.37100 1.000 59.23000  ? 695 PHE B CE2   1 
ATOM   5843  C  CZ    . PHE B 1 450 ? 95.58600  125.54300 159.20900 1.000 59.23000  ? 695 PHE B CZ    1 
ATOM   5844  N  N     . VAL B 1 451 ? 92.89700  126.32100 155.12500 1.000 59.07000  ? 696 VAL B N     1 
ATOM   5845  C  CA    . VAL B 1 451 ? 91.62100  125.65700 155.35600 1.000 59.07000  ? 696 VAL B CA    1 
ATOM   5846  C  C     . VAL B 1 451 ? 91.87900  124.55400 156.37300 1.000 59.07000  ? 696 VAL B C     1 
ATOM   5847  O  O     . VAL B 1 451 ? 92.29800  123.44800 156.01100 1.000 59.07000  ? 696 VAL B O     1 
ATOM   5848  C  CB    . VAL B 1 451 ? 91.01400  125.09800 154.06600 1.000 59.07000  ? 696 VAL B CB    1 
ATOM   5849  C  CG1   . VAL B 1 451 ? 89.71300  124.38000 154.36500 1.000 59.07000  ? 696 VAL B CG1   1 
ATOM   5850  C  CG2   . VAL B 1 451 ? 90.79200  126.21300 153.06200 1.000 59.07000  ? 696 VAL B CG2   1 
ATOM   5851  N  N     . SER B 1 452 ? 91.63800  124.84900 157.64700 1.000 65.93000  ? 697 SER B N     1 
ATOM   5852  C  CA    . SER B 1 452 ? 91.85900  123.86300 158.69300 1.000 65.93000  ? 697 SER B CA    1 
ATOM   5853  C  C     . SER B 1 452 ? 90.90500  122.68800 158.52500 1.000 65.93000  ? 697 SER B C     1 
ATOM   5854  O  O     . SER B 1 452 ? 89.81300  122.82100 157.96600 1.000 65.93000  ? 697 SER B O     1 
ATOM   5855  C  CB    . SER B 1 452 ? 91.67700  124.49900 160.07000 1.000 65.93000  ? 697 SER B CB    1 
ATOM   5856  O  OG    . SER B 1 452 ? 90.33500  124.90700 160.26500 1.000 65.93000  ? 697 SER B OG    1 
ATOM   5857  N  N     . ASP B 1 453 ? 91.33000  121.52300 159.02000 1.000 66.67000  ? 698 ASP B N     1 
ATOM   5858  C  CA    . ASP B 1 453 ? 90.55800  120.30400 158.80000 1.000 66.67000  ? 698 ASP B CA    1 
ATOM   5859  C  C     . ASP B 1 453 ? 89.19500  120.36100 159.47200 1.000 66.67000  ? 698 ASP B C     1 
ATOM   5860  O  O     . ASP B 1 453 ? 88.27500  119.64600 159.06200 1.000 66.67000  ? 698 ASP B O     1 
ATOM   5861  C  CB    . ASP B 1 453 ? 91.34000  119.08900 159.29200 1.000 66.67000  ? 698 ASP B CB    1 
ATOM   5862  C  CG    . ASP B 1 453 ? 92.54900  118.79700 158.43600 1.000 66.67000  ? 698 ASP B CG    1 
ATOM   5863  O  OD1   . ASP B 1 453 ? 92.52100  119.14600 157.23800 1.000 66.67000  ? 698 ASP B OD1   1 
ATOM   5864  O  OD2   . ASP B 1 453 ? 93.52200  118.21400 158.95700 1.000 66.67000  ? 698 ASP B OD2   1 
ATOM   5865  N  N     . ASP B 1 454 ? 89.04100  121.19300 160.50400 1.000 72.52000  ? 699 ASP B N     1 
ATOM   5866  C  CA    . ASP B 1 454 ? 87.71800  121.41200 161.07600 1.000 72.52000  ? 699 ASP B CA    1 
ATOM   5867  C  C     . ASP B 1 454 ? 86.73800  121.86000 160.00200 1.000 72.52000  ? 699 ASP B C     1 
ATOM   5868  O  O     . ASP B 1 454 ? 85.61800  121.34200 159.90300 1.000 72.52000  ? 699 ASP B O     1 
ATOM   5869  C  CB    . ASP B 1 454 ? 87.79600  122.44900 162.19700 1.000 72.52000  ? 699 ASP B CB    1 
ATOM   5870  C  CG    . ASP B 1 454 ? 88.53600  121.93900 163.41400 1.000 72.52000  ? 699 ASP B CG    1 
ATOM   5871  O  OD1   . ASP B 1 454 ? 88.50900  120.71500 163.65800 1.000 72.52000  ? 699 ASP B OD1   1 
ATOM   5872  O  OD2   . ASP B 1 454 ? 89.14400  122.76300 164.12700 1.000 72.52000  ? 699 ASP B OD2   1 
ATOM   5873  N  N     . GLU B 1 455 ? 87.16100  122.81100 159.16900 1.000 69.08000  ? 700 GLU B N     1 
ATOM   5874  C  CA    . GLU B 1 455 ? 86.28900  123.33600 158.12700 1.000 69.08000  ? 700 GLU B CA    1 
ATOM   5875  C  C     . GLU B 1 455 ? 85.90600  122.25300 157.12900 1.000 69.08000  ? 700 GLU B C     1 
ATOM   5876  O  O     . GLU B 1 455 ? 84.73600  122.13500 156.75000 1.000 69.08000  ? 700 GLU B O     1 
ATOM   5877  C  CB    . GLU B 1 455 ? 86.98200  124.49900 157.42000 1.000 69.08000  ? 700 GLU B CB    1 
ATOM   5878  C  CG    . GLU B 1 455 ? 87.20700  125.70700 158.31100 1.000 69.08000  ? 700 GLU B CG    1 
ATOM   5879  C  CD    . GLU B 1 455 ? 87.96100  126.82200 157.61500 1.000 69.08000  ? 700 GLU B CD    1 
ATOM   5880  O  OE1   . GLU B 1 455 ? 88.45400  126.60300 156.48800 1.000 69.08000  ? 700 GLU B OE1   1 
ATOM   5881  O  OE2   . GLU B 1 455 ? 88.05800  127.92300 158.19500 1.000 69.08000  ? 700 GLU B OE2   1 
ATOM   5882  N  N     . VAL B 1 456 ? 86.87500  121.44000 156.70500 1.000 62.10000  ? 701 VAL B N     1 
ATOM   5883  C  CA    . VAL B 1 456 ? 86.59100  120.42300 155.69900 1.000 62.10000  ? 701 VAL B CA    1 
ATOM   5884  C  C     . VAL B 1 456 ? 85.68200  119.34400 156.26800 1.000 62.10000  ? 701 VAL B C     1 
ATOM   5885  O  O     . VAL B 1 456 ? 84.75000  118.88400 155.59700 1.000 62.10000  ? 701 VAL B O     1 
ATOM   5886  C  CB    . VAL B 1 456 ? 87.89700  119.82700 155.15200 1.000 62.10000  ? 701 VAL B CB    1 
ATOM   5887  C  CG1   . VAL B 1 456 ? 87.58700  118.74200 154.14200 1.000 62.10000  ? 701 VAL B CG1   1 
ATOM   5888  C  CG2   . VAL B 1 456 ? 88.74700  120.91000 154.52600 1.000 62.10000  ? 701 VAL B CG2   1 
ATOM   5889  N  N     . HIS B 1 457 ? 85.93800  118.91300 157.50600 1.000 65.15000  ? 702 HIS B N     1 
ATOM   5890  C  CA    . HIS B 1 457 ? 85.05200  117.93600 158.13000 1.000 65.15000  ? 702 HIS B CA    1 
ATOM   5891  C  C     . HIS B 1 457 ? 83.63700  118.47900 158.25600 1.000 65.15000  ? 702 HIS B C     1 
ATOM   5892  O  O     . HIS B 1 457 ? 82.66800  117.76300 157.98500 1.000 65.15000  ? 702 HIS B O     1 
ATOM   5893  C  CB    . HIS B 1 457 ? 85.58800  117.51400 159.49800 1.000 65.15000  ? 702 HIS B CB    1 
ATOM   5894  C  CG    . HIS B 1 457 ? 86.79100  116.62600 159.43000 1.000 65.15000  ? 702 HIS B CG    1 
ATOM   5895  N  ND1   . HIS B 1 457 ? 86.71700  115.31000 159.03100 1.000 65.15000  ? 702 HIS B ND1   1 
ATOM   5896  C  CD2   . HIS B 1 457 ? 88.09000  116.85400 159.73400 1.000 65.15000  ? 702 HIS B CD2   1 
ATOM   5897  C  CE1   . HIS B 1 457 ? 87.92200  114.76900 159.07500 1.000 65.15000  ? 702 HIS B CE1   1 
ATOM   5898  N  NE2   . HIS B 1 457 ? 88.77300  115.68600 159.49800 1.000 65.15000  ? 702 HIS B NE2   1 
ATOM   5899  N  N     . ARG B 1 458 ? 83.49100  119.74600 158.65200 1.000 66.39000  ? 703 ARG B N     1 
ATOM   5900  C  CA    . ARG B 1 458 ? 82.15100  120.30600 158.78500 1.000 66.39000  ? 703 ARG B CA    1 
ATOM   5901  C  C     . ARG B 1 458 ? 81.45400  120.40200 157.43300 1.000 66.39000  ? 703 ARG B C     1 
ATOM   5902  O  O     . ARG B 1 458 ? 80.25300  120.12600 157.32800 1.000 66.39000  ? 703 ARG B O     1 
ATOM   5903  C  CB    . ARG B 1 458 ? 82.21500  121.67200 159.46800 1.000 66.39000  ? 703 ARG B CB    1 
ATOM   5904  C  CG    . ARG B 1 458 ? 82.60300  121.59500 160.93600 1.000 66.39000  ? 703 ARG B CG    1 
ATOM   5905  C  CD    . ARG B 1 458 ? 82.66700  122.96700 161.58100 1.000 66.39000  ? 703 ARG B CD    1 
ATOM   5906  N  NE    . ARG B 1 458 ? 83.78100  123.76100 161.07300 1.000 66.39000  ? 703 ARG B NE    1 
ATOM   5907  C  CZ    . ARG B 1 458 ? 83.98800  125.03600 161.38200 1.000 66.39000  ? 703 ARG B CZ    1 
ATOM   5908  N  NH1   . ARG B 1 458 ? 83.15600  125.66600 162.19800 1.000 66.39000  ? 703 ARG B NH1   1 
ATOM   5909  N  NH2   . ARG B 1 458 ? 85.02900  125.68200 160.87500 1.000 66.39000  ? 703 ARG B NH2   1 
ATOM   5910  N  N     . VAL B 1 459 ? 82.19100  120.76600 156.38200 1.000 59.05000  ? 704 VAL B N     1 
ATOM   5911  C  CA    . VAL B 1 459 ? 81.59100  120.85100 155.05400 1.000 59.05000  ? 704 VAL B CA    1 
ATOM   5912  C  C     . VAL B 1 459 ? 81.15700  119.47400 154.56700 1.000 59.05000  ? 704 VAL B C     1 
ATOM   5913  O  O     . VAL B 1 459 ? 80.07200  119.31600 153.99200 1.000 59.05000  ? 704 VAL B O     1 
ATOM   5914  C  CB    . VAL B 1 459 ? 82.56700  121.51900 154.07200 1.000 59.05000  ? 704 VAL B CB    1 
ATOM   5915  C  CG1   . VAL B 1 459 ? 82.01700  121.45900 152.66400 1.000 59.05000  ? 704 VAL B CG1   1 
ATOM   5916  C  CG2   . VAL B 1 459 ? 82.80600  122.95400 154.47600 1.000 59.05000  ? 704 VAL B CG2   1 
ATOM   5917  N  N     . VAL B 1 460 ? 81.98800  118.45600 154.79000 1.000 59.52000  ? 705 VAL B N     1 
ATOM   5918  C  CA    . VAL B 1 460 ? 81.62800  117.11100 154.35600 1.000 59.52000  ? 705 VAL B CA    1 
ATOM   5919  C  C     . VAL B 1 460 ? 80.43500  116.59100 155.14900 1.000 59.52000  ? 705 VAL B C     1 
ATOM   5920  O  O     . VAL B 1 460 ? 79.56900  115.89500 154.60700 1.000 59.52000  ? 705 VAL B O     1 
ATOM   5921  C  CB    . VAL B 1 460 ? 82.84300  116.17400 154.46500 1.000 59.52000  ? 705 VAL B CB    1 
ATOM   5922  C  CG1   . VAL B 1 460 ? 82.43700  114.74200 154.17700 1.000 59.52000  ? 705 VAL B CG1   1 
ATOM   5923  C  CG2   . VAL B 1 460 ? 83.92500  116.61400 153.49700 1.000 59.52000  ? 705 VAL B CG2   1 
ATOM   5924  N  N     . GLU B 1 461 ? 80.36200  116.92200 156.44100 1.000 63.75000  ? 706 GLU B N     1 
ATOM   5925  C  CA    . GLU B 1 461 ? 79.19500  116.52600 157.22100 1.000 63.75000  ? 706 GLU B CA    1 
ATOM   5926  C  C     . GLU B 1 461 ? 77.94300  117.24700 156.74800 1.000 63.75000  ? 706 GLU B C     1 
ATOM   5927  O  O     . GLU B 1 461 ? 76.84600  116.68100 156.80000 1.000 63.75000  ? 706 GLU B O     1 
ATOM   5928  C  CB    . GLU B 1 461 ? 79.43200  116.79100 158.70600 1.000 63.75000  ? 706 GLU B CB    1 
ATOM   5929  C  CG    . GLU B 1 461 ? 80.51700  115.93100 159.32900 1.000 63.75000  ? 706 GLU B CG    1 
ATOM   5930  C  CD    . GLU B 1 461 ? 80.15100  114.46400 159.37500 1.000 63.75000  ? 706 GLU B CD    1 
ATOM   5931  O  OE1   . GLU B 1 461 ? 78.94900  114.15100 159.49200 1.000 63.75000  ? 706 GLU B OE1   1 
ATOM   5932  O  OE2   . GLU B 1 461 ? 81.06900  113.62000 159.30100 1.000 63.75000  ? 706 GLU B OE2   1 
ATOM   5933  N  N     . ALA B 1 462 ? 78.08500  118.49200 156.29000 1.000 60.10000  ? 707 ALA B N     1 
ATOM   5934  C  CA    . ALA B 1 462 ? 76.94400  119.20300 155.72600 1.000 60.10000  ? 707 ALA B CA    1 
ATOM   5935  C  C     . ALA B 1 462 ? 76.50300  118.59500 154.40100 1.000 60.10000  ? 707 ALA B C     1 
ATOM   5936  O  O     . ALA B 1 462 ? 75.30700  118.58800 154.09300 1.000 60.10000  ? 707 ALA B O     1 
ATOM   5937  C  CB    . ALA B 1 462 ? 77.28100  120.68200 155.54700 1.000 60.10000  ? 707 ALA B CB    1 
ATOM   5938  N  N     . TRP B 1 463 ? 77.44400  118.07900 153.60900 1.000 56.39000  ? 708 TRP B N     1 
ATOM   5939  C  CA    . TRP B 1 463 ? 77.06000  117.49100 152.32800 1.000 56.39000  ? 708 TRP B CA    1 
ATOM   5940  C  C     . TRP B 1 463 ? 76.46700  116.09900 152.48300 1.000 56.39000  ? 708 TRP B C     1 
ATOM   5941  O  O     . TRP B 1 463 ? 75.52600  115.74500 151.76500 1.000 56.39000  ? 708 TRP B O     1 
ATOM   5942  C  CB    . TRP B 1 463 ? 78.24400  117.44200 151.36600 1.000 56.39000  ? 708 TRP B CB    1 
ATOM   5943  C  CG    . TRP B 1 463 ? 78.51400  118.74500 150.73400 1.000 56.39000  ? 708 TRP B CG    1 
ATOM   5944  C  CD1   . TRP B 1 463 ? 79.55000  119.58600 150.98700 1.000 56.39000  ? 708 TRP B CD1   1 
ATOM   5945  C  CD2   . TRP B 1 463 ? 77.69100  119.39600 149.76600 1.000 56.39000  ? 708 TRP B CD2   1 
ATOM   5946  N  NE1   . TRP B 1 463 ? 79.44300  120.71200 150.20800 1.000 56.39000  ? 708 TRP B NE1   1 
ATOM   5947  C  CE2   . TRP B 1 463 ? 78.30400  120.61800 149.45300 1.000 56.39000  ? 708 TRP B CE2   1 
ATOM   5948  C  CE3   . TRP B 1 463 ? 76.49900  119.05400 149.12300 1.000 56.39000  ? 708 TRP B CE3   1 
ATOM   5949  C  CZ2   . TRP B 1 463 ? 77.77100  121.49800 148.52400 1.000 56.39000  ? 708 TRP B CZ2   1 
ATOM   5950  C  CZ3   . TRP B 1 463 ? 75.96900  119.93200 148.20500 1.000 56.39000  ? 708 TRP B CZ3   1 
ATOM   5951  C  CH2   . TRP B 1 463 ? 76.60200  121.14100 147.91500 1.000 56.39000  ? 708 TRP B CH2   1 
ATOM   5952  N  N     . LYS B 1 464 ? 77.00000  115.29100 153.40100 1.000 57.91000  ? 709 LYS B N     1 
ATOM   5953  C  CA    . LYS B 1 464 ? 76.46900  113.94600 153.59000 1.000 57.91000  ? 709 LYS B CA    1 
ATOM   5954  C  C     . LYS B 1 464 ? 75.01000  113.94700 154.02300 1.000 57.91000  ? 709 LYS B C     1 
ATOM   5955  O  O     . LYS B 1 464 ? 74.39300  112.87700 154.06700 1.000 57.91000  ? 709 LYS B O     1 
ATOM   5956  C  CB    . LYS B 1 464 ? 77.31600  113.18600 154.60800 1.000 57.91000  ? 709 LYS B CB    1 
ATOM   5957  C  CG    . LYS B 1 464 ? 78.69600  112.82900 154.09700 1.000 57.91000  ? 709 LYS B CG    1 
ATOM   5958  C  CD    . LYS B 1 464 ? 79.53900  112.20000 155.18500 1.000 57.91000  ? 709 LYS B CD    1 
ATOM   5959  C  CE    . LYS B 1 464 ? 79.05900  110.80000 155.50600 1.000 57.91000  ? 709 LYS B CE    1 
ATOM   5960  N  NZ    . LYS B 1 464 ? 79.94700  110.14100 156.50000 1.000 57.91000  ? 709 LYS B NZ    1 
ATOM   5961  N  N     . LEU B 1 465 ? 74.44700  115.11400 154.33500 1.000 62.77000  ? 710 LEU B N     1 
ATOM   5962  C  CA    . LEU B 1 465 ? 73.04800  115.24500 154.71200 1.000 62.77000  ? 710 LEU B CA    1 
ATOM   5963  C  C     . LEU B 1 465 ? 72.20700  115.96300 153.67000 1.000 62.77000  ? 710 LEU B C     1 
ATOM   5964  O  O     . LEU B 1 465 ? 71.02900  115.63600 153.51500 1.000 62.77000  ? 710 LEU B O     1 
ATOM   5965  C  CB    . LEU B 1 465 ? 72.93100  115.99500 156.04300 1.000 62.77000  ? 710 LEU B CB    1 
ATOM   5966  C  CG    . LEU B 1 465 ? 73.59900  115.29200 157.22200 1.000 62.77000  ? 710 LEU B CG    1 
ATOM   5967  C  CD1   . LEU B 1 465 ? 73.52700  116.15800 158.46500 1.000 62.77000  ? 710 LEU B CD1   1 
ATOM   5968  C  CD2   . LEU B 1 465 ? 72.96700  113.93400 157.46500 1.000 62.77000  ? 710 LEU B CD2   1 
ATOM   5969  N  N     . ARG B 1 466 ? 72.78200  116.92700 152.95400 1.000 64.09000  ? 711 ARG B N     1 
ATOM   5970  C  CA    . ARG B 1 466 ? 72.07300  117.66600 151.91800 1.000 64.09000  ? 711 ARG B CA    1 
ATOM   5971  C  C     . ARG B 1 466 ? 71.91200  116.87700 150.62700 1.000 64.09000  ? 711 ARG B C     1 
ATOM   5972  O  O     . ARG B 1 466 ? 71.31200  117.39200 149.67800 1.000 64.09000  ? 711 ARG B O     1 
ATOM   5973  C  CB    . ARG B 1 466 ? 72.80200  118.97700 151.62100 1.000 64.09000  ? 711 ARG B CB    1 
ATOM   5974  C  CG    . ARG B 1 466 ? 72.75500  119.99600 152.74600 1.000 64.09000  ? 711 ARG B CG    1 
ATOM   5975  C  CD    . ARG B 1 466 ? 73.57900  121.22100 152.39200 1.000 64.09000  ? 711 ARG B CD    1 
ATOM   5976  N  NE    . ARG B 1 466 ? 73.61400  122.19900 153.47200 1.000 64.09000  ? 711 ARG B NE    1 
ATOM   5977  C  CZ    . ARG B 1 466 ? 72.76400  123.21200 153.58400 1.000 64.09000  ? 711 ARG B CZ    1 
ATOM   5978  N  NH1   . ARG B 1 466 ? 71.81800  123.38400 152.67200 1.000 64.09000  ? 711 ARG B NH1   1 
ATOM   5979  N  NH2   . ARG B 1 466 ? 72.86400  124.05800 154.59900 1.000 64.09000  ? 711 ARG B NH2   1 
ATOM   5980  N  N     . GLY B 1 467 ? 72.42700  115.65600 150.56400 1.000 63.67000  ? 712 GLY B N     1 
ATOM   5981  C  CA    . GLY B 1 467 ? 72.33500  114.86200 149.35600 1.000 63.67000  ? 712 GLY B CA    1 
ATOM   5982  C  C     . GLY B 1 467 ? 72.75700  113.43700 149.62200 1.000 63.67000  ? 712 GLY B C     1 
ATOM   5983  O  O     . GLY B 1 467 ? 73.50400  113.15400 150.56400 1.000 63.67000  ? 712 GLY B O     1 
ATOM   5984  N  N     . ALA B 1 468 ? 72.27200  112.54300 148.77300 1.000 66.72000  ? 713 ALA B N     1 
ATOM   5985  C  CA    . ALA B 1 468 ? 72.57900  111.14700 149.03600 1.000 66.72000  ? 713 ALA B CA    1 
ATOM   5986  C  C     . ALA B 1 468 ? 73.95000  110.78000 148.48000 1.000 66.72000  ? 713 ALA B C     1 
ATOM   5987  O  O     . ALA B 1 468 ? 74.41600  111.38200 147.50800 1.000 66.72000  ? 713 ALA B O     1 
ATOM   5988  C  CB    . ALA B 1 468 ? 71.51800  110.24300 148.41300 1.000 66.72000  ? 713 ALA B CB    1 
ATOM   5989  N  N     . PRO B 1 469 ? 74.61800  109.79400 149.08000 1.000 69.20000  ? 714 PRO B N     1 
ATOM   5990  C  CA    . PRO B 1 469 ? 75.91400  109.35600 148.54700 1.000 69.20000  ? 714 PRO B CA    1 
ATOM   5991  C  C     . PRO B 1 469 ? 75.76600  108.62900 147.22100 1.000 69.20000  ? 714 PRO B C     1 
ATOM   5992  O  O     . PRO B 1 469 ? 75.30000  107.48600 147.17800 1.000 69.20000  ? 714 PRO B O     1 
ATOM   5993  C  CB    . PRO B 1 469 ? 76.44800  108.42400 149.64200 1.000 69.20000  ? 714 PRO B CB    1 
ATOM   5994  C  CG    . PRO B 1 469 ? 75.71700  108.83300 150.88000 1.000 69.20000  ? 714 PRO B CG    1 
ATOM   5995  C  CD    . PRO B 1 469 ? 74.35100  109.22500 150.41100 1.000 69.20000  ? 714 PRO B CD    1 
ATOM   5996  N  N     . ASP B 1 470 ? 76.16700  109.28200 146.13400 1.000 68.87000  ? 715 ASP B N     1 
ATOM   5997  C  CA    . ASP B 1 470 ? 76.02300  108.72200 144.79900 1.000 68.87000  ? 715 ASP B CA    1 
ATOM   5998  C  C     . ASP B 1 470 ? 77.30500  108.01800 144.37600 1.000 68.87000  ? 715 ASP B C     1 
ATOM   5999  O  O     . ASP B 1 470 ? 78.41000  108.45900 144.70500 1.000 68.87000  ? 715 ASP B O     1 
ATOM   6000  C  CB    . ASP B 1 470 ? 75.67500  109.82000 143.79200 1.000 68.87000  ? 715 ASP B CB    1 
ATOM   6001  C  CG    . ASP B 1 470 ? 75.29300  109.26800 142.43100 1.000 68.87000  ? 715 ASP B CG    1 
ATOM   6002  O  OD1   . ASP B 1 470 ? 75.29600  108.03100 142.25700 1.000 68.87000  ? 715 ASP B OD1   1 
ATOM   6003  O  OD2   . ASP B 1 470 ? 74.99600  110.07500 141.52700 1.000 68.87000  ? 715 ASP B OD2   1 
ATOM   6004  N  N     . TYR B 1 471 ? 77.14400  106.92300 143.63700 1.000 73.65000  ? 716 TYR B N     1 
ATOM   6005  C  CA    . TYR B 1 471 ? 78.26500  106.17100 143.08700 1.000 73.65000  ? 716 TYR B CA    1 
ATOM   6006  C  C     . TYR B 1 471 ? 77.78400  105.44200 141.84400 1.000 73.65000  ? 716 TYR B C     1 
ATOM   6007  O  O     . TYR B 1 471 ? 76.96200  104.52800 141.94500 1.000 73.65000  ? 716 TYR B O     1 
ATOM   6008  C  CB    . TYR B 1 471 ? 78.82400  105.15900 144.09500 1.000 73.65000  ? 716 TYR B CB    1 
ATOM   6009  C  CG    . TYR B 1 471 ? 79.47200  105.77000 145.31500 1.000 73.65000  ? 716 TYR B CG    1 
ATOM   6010  C  CD1   . TYR B 1 471 ? 80.74700  106.30600 145.25200 1.000 73.65000  ? 716 TYR B CD1   1 
ATOM   6011  C  CD2   . TYR B 1 471 ? 78.81300  105.79200 146.53600 1.000 73.65000  ? 716 TYR B CD2   1 
ATOM   6012  C  CE1   . TYR B 1 471 ? 81.34400  106.86100 146.36500 1.000 73.65000  ? 716 TYR B CE1   1 
ATOM   6013  C  CE2   . TYR B 1 471 ? 79.40300  106.34300 147.65600 1.000 73.65000  ? 716 TYR B CE2   1 
ATOM   6014  C  CZ    . TYR B 1 471 ? 80.66900  106.87500 147.56500 1.000 73.65000  ? 716 TYR B CZ    1 
ATOM   6015  O  OH    . TYR B 1 471 ? 81.26200  107.42500 148.67700 1.000 73.65000  ? 716 TYR B OH    1 
ATOM   6016  N  N     . ILE B 1 472 ? 78.29400  105.83900 140.68300 1.000 80.62000  ? 717 ILE B N     1 
ATOM   6017  C  CA    . ILE B 1 472 ? 77.96700  105.14400 139.44400 1.000 80.62000  ? 717 ILE B CA    1 
ATOM   6018  C  C     . ILE B 1 472 ? 78.63400  103.77700 139.48000 1.000 80.62000  ? 717 ILE B C     1 
ATOM   6019  O  O     . ILE B 1 472 ? 79.85500  103.66500 139.33300 1.000 80.62000  ? 717 ILE B O     1 
ATOM   6020  C  CB    . ILE B 1 472 ? 78.42300  105.96000 138.22500 1.000 80.62000  ? 717 ILE B CB    1 
ATOM   6021  C  CG1   . ILE B 1 472 ? 77.83200  107.36900 138.28000 1.000 80.62000  ? 717 ILE B CG1   1 
ATOM   6022  C  CG2   . ILE B 1 472 ? 77.99300  105.27600 136.94400 1.000 80.62000  ? 717 ILE B CG2   1 
ATOM   6023  C  CD1   . ILE B 1 472 ? 76.32400  107.39900 138.26300 1.000 80.62000  ? 717 ILE B CD1   1 
ATOM   6024  N  N     . GLU B 1 473 ? 77.83100  102.73100 139.66900 1.000 95.72000  ? 718 GLU B N     1 
ATOM   6025  C  CA    . GLU B 1 473 ? 78.34300  101.43300 140.09200 1.000 95.72000  ? 718 GLU B CA    1 
ATOM   6026  C  C     . GLU B 1 473 ? 79.07200  100.66700 138.99500 1.000 95.72000  ? 718 GLU B C     1 
ATOM   6027  O  O     . GLU B 1 473 ? 79.90800  99.81300  139.30800 1.000 95.72000  ? 718 GLU B O     1 
ATOM   6028  C  CB    . GLU B 1 473 ? 77.19700  100.57500 140.64200 1.000 95.72000  ? 718 GLU B CB    1 
ATOM   6029  C  CG    . GLU B 1 473 ? 77.63300  99.27400  141.29400 1.000 95.72000  ? 718 GLU B CG    1 
ATOM   6030  C  CD    . GLU B 1 473 ? 76.47500  98.51400  141.90500 1.000 95.72000  ? 718 GLU B CD    1 
ATOM   6031  O  OE1   . GLU B 1 473 ? 75.32600  98.99000  141.79100 1.000 95.72000  ? 718 GLU B OE1   1 
ATOM   6032  O  OE2   . GLU B 1 473 ? 76.71400  97.44400  142.50400 1.000 95.72000  ? 718 GLU B OE2   1 
ATOM   6033  N  N     . ASP B 1 474 ? 78.80700  100.95800 137.72200 1.000 97.64000  ? 719 ASP B N     1 
ATOM   6034  C  CA    . ASP B 1 474 ? 79.45800  100.22000 136.64400 1.000 97.64000  ? 719 ASP B CA    1 
ATOM   6035  C  C     . ASP B 1 474 ? 80.89900  100.68100 136.44700 1.000 97.64000  ? 719 ASP B C     1 
ATOM   6036  O  O     . ASP B 1 474 ? 81.55100  100.30200 135.46900 1.000 97.64000  ? 719 ASP B O     1 
ATOM   6037  C  CB    . ASP B 1 474 ? 78.66700  100.35600 135.33800 1.000 97.64000  ? 719 ASP B CB    1 
ATOM   6038  C  CG    . ASP B 1 474 ? 78.60200  101.78700 134.82700 1.000 97.64000  ? 719 ASP B CG    1 
ATOM   6039  O  OD1   . ASP B 1 474 ? 79.11900  102.70200 135.50000 1.000 97.64000  ? 719 ASP B OD1   1 
ATOM   6040  O  OD2   . ASP B 1 474 ? 78.02900  101.99700 133.73700 1.000 97.64000  ? 719 ASP B OD2   1 
ATOM   6041  N  N     . ILE B 1 475 ? 81.39700  101.50000 137.36700 1.000 86.16000  ? 720 ILE B N     1 
ATOM   6042  C  CA    . ILE B 1 475 ? 82.74600  102.04000 137.28100 1.000 86.16000  ? 720 ILE B CA    1 
ATOM   6043  C  C     . ILE B 1 475 ? 83.76400  100.99500 137.71700 1.000 86.16000  ? 720 ILE B C     1 
ATOM   6044  O  O     . ILE B 1 475 ? 84.87500  100.93800 137.19200 1.000 86.16000  ? 720 ILE B O     1 
ATOM   6045  C  CB    . ILE B 1 475 ? 82.87900  103.31000 138.12600 1.000 86.16000  ? 720 ILE B CB    1 
ATOM   6046  C  CG1   . ILE B 1 475 ? 84.16500  104.04800 137.77200 1.000 86.16000  ? 720 ILE B CG1   1 
ATOM   6047  C  CG2   . ILE B 1 475 ? 82.88900  102.95600 139.60200 1.000 86.16000  ? 720 ILE B CG2   1 
ATOM   6048  C  CD1   . ILE B 1 475 ? 84.19800  105.47400 138.24700 1.000 86.16000  ? 720 ILE B CD1   1 
ATOM   6049  N  N     . THR C 1 69  ? 77.07200  132.72100 92.24400  1.000 63.28000  ? 314 THR C N     1 
ATOM   6050  C  CA    . THR C 1 69  ? 77.04800  131.33700 92.70000  1.000 63.28000  ? 314 THR C CA    1 
ATOM   6051  C  C     . THR C 1 69  ? 77.54500  131.23000 94.13500  1.000 63.28000  ? 314 THR C C     1 
ATOM   6052  O  O     . THR C 1 69  ? 76.92000  130.57900 94.97200  1.000 63.28000  ? 314 THR C O     1 
ATOM   6053  C  CB    . THR C 1 69  ? 77.90800  130.43200 91.80400  1.000 63.28000  ? 314 THR C CB    1 
ATOM   6054  O  OG1   . THR C 1 69  ? 77.41300  130.47800 90.46000  1.000 63.28000  ? 314 THR C OG1   1 
ATOM   6055  C  CG2   . THR C 1 69  ? 77.86900  128.99900 92.30300  1.000 63.28000  ? 314 THR C CG2   1 
ATOM   6056  N  N     . LEU C 1 70  ? 78.67700  131.87100 94.40600  1.000 62.98000  ? 315 LEU C N     1 
ATOM   6057  C  CA    . LEU C 1 70  ? 79.23100  131.86800 95.75000  1.000 62.98000  ? 315 LEU C CA    1 
ATOM   6058  C  C     . LEU C 1 70  ? 78.25400  132.54500 96.70900  1.000 62.98000  ? 315 LEU C C     1 
ATOM   6059  O  O     . LEU C 1 70  ? 77.62100  133.54500 96.34600  1.000 62.98000  ? 315 LEU C O     1 
ATOM   6060  C  CB    . LEU C 1 70  ? 80.58000  132.58800 95.78200  1.000 62.98000  ? 315 LEU C CB    1 
ATOM   6061  C  CG    . LEU C 1 70  ? 81.82300  131.81100 95.34100  1.000 62.98000  ? 315 LEU C CG    1 
ATOM   6062  C  CD1   . LEU C 1 70  ? 82.01600  130.58300 96.21300  1.000 62.98000  ? 315 LEU C CD1   1 
ATOM   6063  C  CD2   . LEU C 1 70  ? 81.77700  131.43200 93.86600  1.000 62.98000  ? 315 LEU C CD2   1 
ATOM   6064  N  N     . PRO C 1 71  ? 78.09800  132.03200 97.93000  1.000 59.46000  ? 316 PRO C N     1 
ATOM   6065  C  CA    . PRO C 1 71  ? 77.10600  132.60100 98.83300  1.000 59.46000  ? 316 PRO C CA    1 
ATOM   6066  C  C     . PRO C 1 71  ? 77.49900  134.01000 99.23900  1.000 59.46000  ? 316 PRO C C     1 
ATOM   6067  O  O     . PRO C 1 71  ? 78.69200  134.35600 99.25500  1.000 59.46000  ? 316 PRO C O     1 
ATOM   6068  C  CB    . PRO C 1 71  ? 77.13000  131.64000 100.03400 1.000 59.46000  ? 316 PRO C CB    1 
ATOM   6069  C  CG    . PRO C 1 71  ? 78.49800  131.09100 100.02700 1.000 59.46000  ? 316 PRO C CG    1 
ATOM   6070  C  CD    . PRO C 1 71  ? 78.90500  130.98900 98.58500  1.000 59.46000  ? 316 PRO C CD    1 
ATOM   6071  N  N     . PRO C 1 72  ? 76.52900  134.85900 99.56200  1.000 67.13000  ? 317 PRO C N     1 
ATOM   6072  C  CA    . PRO C 1 72  ? 76.85900  136.23800 99.93100  1.000 67.13000  ? 317 PRO C CA    1 
ATOM   6073  C  C     . PRO C 1 72  ? 77.55200  136.30100 101.28000 1.000 67.13000  ? 317 PRO C C     1 
ATOM   6074  O  O     . PRO C 1 72  ? 77.29800  135.49500 102.17700 1.000 67.13000  ? 317 PRO C O     1 
ATOM   6075  C  CB    . PRO C 1 72  ? 75.49100  136.92700 99.97900  1.000 67.13000  ? 317 PRO C CB    1 
ATOM   6076  C  CG    . PRO C 1 72  ? 74.53800  135.82400 100.29500 1.000 67.13000  ? 317 PRO C CG    1 
ATOM   6077  C  CD    . PRO C 1 72  ? 75.07900  134.60200 99.61000  1.000 67.13000  ? 317 PRO C CD    1 
ATOM   6078  N  N     . LEU C 1 73  ? 78.44100  137.28400 101.41700 1.000 69.06000  ? 318 LEU C N     1 
ATOM   6079  C  CA    . LEU C 1 73  ? 79.12800  137.49100 102.68500 1.000 69.06000  ? 318 LEU C CA    1 
ATOM   6080  C  C     . LEU C 1 73  ? 78.20400  138.01300 103.77400 1.000 69.06000  ? 318 LEU C C     1 
ATOM   6081  O  O     . LEU C 1 73  ? 78.65600  138.18700 104.91100 1.000 69.06000  ? 318 LEU C O     1 
ATOM   6082  C  CB    . LEU C 1 73  ? 80.30200  138.45000 102.49200 1.000 69.06000  ? 318 LEU C CB    1 
ATOM   6083  C  CG    . LEU C 1 73  ? 81.41000  137.92700 101.57600 1.000 69.06000  ? 318 LEU C CG    1 
ATOM   6084  C  CD1   . LEU C 1 73  ? 82.47100  138.98800 101.34800 1.000 69.06000  ? 318 LEU C CD1   1 
ATOM   6085  C  CD2   . LEU C 1 73  ? 82.02400  136.66400 102.14800 1.000 69.06000  ? 318 LEU C CD2   1 
ATOM   6086  N  N     . SER C 1 74  ? 76.93300  138.27100 103.45700 1.000 68.54000  ? 319 SER C N     1 
ATOM   6087  C  CA    . SER C 1 74  ? 75.96200  138.64400 104.47700 1.000 68.54000  ? 319 SER C CA    1 
ATOM   6088  C  C     . SER C 1 74  ? 75.63300  137.48400 105.40500 1.000 68.54000  ? 319 SER C C     1 
ATOM   6089  O  O     . SER C 1 74  ? 75.02200  137.70100 106.45600 1.000 68.54000  ? 319 SER C O     1 
ATOM   6090  C  CB    . SER C 1 74  ? 74.68100  139.16100 103.82200 1.000 68.54000  ? 319 SER C CB    1 
ATOM   6091  O  OG    . SER C 1 74  ? 74.92700  140.34800 103.09000 1.000 68.54000  ? 319 SER C OG    1 
ATOM   6092  N  N     . LEU C 1 75  ? 76.02200  136.26100 105.03900 1.000 67.00000  ? 320 LEU C N     1 
ATOM   6093  C  CA    . LEU C 1 75  ? 75.78600  135.10900 105.89800 1.000 67.00000  ? 320 LEU C CA    1 
ATOM   6094  C  C     . LEU C 1 75  ? 76.67200  135.12100 107.13400 1.000 67.00000  ? 320 LEU C C     1 
ATOM   6095  O  O     . LEU C 1 75  ? 76.44200  134.33000 108.05300 1.000 67.00000  ? 320 LEU C O     1 
ATOM   6096  C  CB    . LEU C 1 75  ? 76.00800  133.81800 105.11500 1.000 67.00000  ? 320 LEU C CB    1 
ATOM   6097  C  CG    . LEU C 1 75  ? 75.02200  133.56000 103.97800 1.000 67.00000  ? 320 LEU C CG    1 
ATOM   6098  C  CD1   . LEU C 1 75  ? 75.44800  132.34500 103.18500 1.000 67.00000  ? 320 LEU C CD1   1 
ATOM   6099  C  CD2   . LEU C 1 75  ? 73.61800  133.37800 104.52500 1.000 67.00000  ? 320 LEU C CD2   1 
ATOM   6100  N  N     . LEU C 1 76  ? 77.67800  135.98600 107.17400 1.000 69.44000  ? 321 LEU C N     1 
ATOM   6101  C  CA    . LEU C 1 76  ? 78.53400  136.12100 108.34000 1.000 69.44000  ? 321 LEU C CA    1 
ATOM   6102  C  C     . LEU C 1 76  ? 77.96600  137.16900 109.28600 1.000 69.44000  ? 321 LEU C C     1 
ATOM   6103  O  O     . LEU C 1 76  ? 77.31600  138.12800 108.86200 1.000 69.44000  ? 321 LEU C O     1 
ATOM   6104  C  CB    . LEU C 1 76  ? 79.95100  136.51500 107.92700 1.000 69.44000  ? 321 LEU C CB    1 
ATOM   6105  C  CG    . LEU C 1 76  ? 80.70400  135.48900 107.08500 1.000 69.44000  ? 321 LEU C CG    1 
ATOM   6106  C  CD1   . LEU C 1 76  ? 82.03100  136.06200 106.62700 1.000 69.44000  ? 321 LEU C CD1   1 
ATOM   6107  C  CD2   . LEU C 1 76  ? 80.90800  134.20800 107.87100 1.000 69.44000  ? 321 LEU C CD2   1 
ATOM   6108  N  N     . ASP C 1 77  ? 78.20700  136.97300 110.57500 1.000 75.06000  ? 322 ASP C N     1 
ATOM   6109  C  CA    . ASP C 1 77  ? 77.79000  137.96400 111.55400 1.000 75.06000  ? 322 ASP C CA    1 
ATOM   6110  C  C     . ASP C 1 77  ? 78.56400  139.25700 111.32200 1.000 75.06000  ? 322 ASP C C     1 
ATOM   6111  O  O     . ASP C 1 77  ? 79.79600  139.22200 111.20500 1.000 75.06000  ? 322 ASP C O     1 
ATOM   6112  C  CB    . ASP C 1 77  ? 78.01900  137.45000 112.97300 1.000 75.06000  ? 322 ASP C CB    1 
ATOM   6113  C  CG    . ASP C 1 77  ? 77.07600  136.32300 113.34000 1.000 75.06000  ? 322 ASP C CG    1 
ATOM   6114  O  OD1   . ASP C 1 77  ? 75.95200  136.29100 112.79800 1.000 75.06000  ? 322 ASP C OD1   1 
ATOM   6115  O  OD2   . ASP C 1 77  ? 77.45700  135.47100 114.17000 1.000 75.06000  ? 322 ASP C OD2   1 
ATOM   6116  N  N     . PRO C 1 78  ? 77.89300  140.40800 111.25200 1.000 84.53000  ? 323 PRO C N     1 
ATOM   6117  C  CA    . PRO C 1 78  ? 78.59100  141.64600 110.88100 1.000 84.53000  ? 323 PRO C CA    1 
ATOM   6118  C  C     . PRO C 1 78  ? 79.58700  142.10100 111.93300 1.000 84.53000  ? 323 PRO C C     1 
ATOM   6119  O  O     . PRO C 1 78  ? 79.71400  141.48000 112.99300 1.000 84.53000  ? 323 PRO C O     1 
ATOM   6120  C  CB    . PRO C 1 78  ? 77.44800  142.65500 110.72100 1.000 84.53000  ? 323 PRO C CB    1 
ATOM   6121  C  CG    . PRO C 1 78  ? 76.37200  142.13900 111.61400 1.000 84.53000  ? 323 PRO C CG    1 
ATOM   6122  C  CD    . PRO C 1 78  ? 76.47100  140.64000 111.55500 1.000 84.53000  ? 323 PRO C CD    1 
ATOM   6123  N  N     . ALA C 1 79  ? 80.30700  143.18000 111.63800 1.000 91.92000  ? 324 ALA C N     1 
ATOM   6124  C  CA    . ALA C 1 79  ? 81.23000  143.74500 112.61000 1.000 91.92000  ? 324 ALA C CA    1 
ATOM   6125  C  C     . ALA C 1 79  ? 80.47700  144.16400 113.86500 1.000 91.92000  ? 324 ALA C C     1 
ATOM   6126  O  O     . ALA C 1 79  ? 79.29500  144.51600 113.82100 1.000 91.92000  ? 324 ALA C O     1 
ATOM   6127  C  CB    . ALA C 1 79  ? 81.96900  144.94300 112.01300 1.000 91.92000  ? 324 ALA C CB    1 
ATOM   6128  N  N     . GLU C 1 80  ? 81.17100  144.12400 114.99200 1.000 95.55000  ? 325 GLU C N     1 
ATOM   6129  C  CA    . GLU C 1 80  ? 80.56000  144.43300 116.27300 1.000 95.55000  ? 325 GLU C CA    1 
ATOM   6130  C  C     . GLU C 1 80  ? 80.84500  145.87600 116.66700 1.000 95.55000  ? 325 GLU C C     1 
ATOM   6131  O  O     . GLU C 1 80  ? 81.79300  146.50300 116.19000 1.000 95.55000  ? 325 GLU C O     1 
ATOM   6132  C  CB    . GLU C 1 80  ? 81.07100  143.48500 117.35900 1.000 95.55000  ? 325 GLU C CB    1 
ATOM   6133  C  CG    . GLU C 1 80  ? 82.54700  143.64200 117.66800 1.000 95.55000  ? 325 GLU C CG    1 
ATOM   6134  C  CD    . GLU C 1 80  ? 83.02500  142.66200 118.71500 1.000 95.55000  ? 325 GLU C CD    1 
ATOM   6135  O  OE1   . GLU C 1 80  ? 82.20600  141.84000 119.17600 1.000 95.55000  ? 325 GLU C OE1   1 
ATOM   6136  O  OE2   . GLU C 1 80  ? 84.21700  142.71600 119.08000 1.000 95.55000  ? 325 GLU C OE2   1 
ATOM   6137  N  N     . VAL C 1 81  ? 80.00100  146.39700 117.54900 1.000 101.93000 ? 326 VAL C N     1 
ATOM   6138  C  CA    . VAL C 1 81  ? 80.21300  147.71000 118.14100 1.000 101.93000 ? 326 VAL C CA    1 
ATOM   6139  C  C     . VAL C 1 81  ? 81.02800  147.51600 119.41100 1.000 101.93000 ? 326 VAL C C     1 
ATOM   6140  O  O     . VAL C 1 81  ? 80.64500  146.74100 120.29400 1.000 101.93000 ? 326 VAL C O     1 
ATOM   6141  C  CB    . VAL C 1 81  ? 78.88200  148.41500 118.43800 1.000 101.93000 ? 326 VAL C CB    1 
ATOM   6142  C  CG1   . VAL C 1 81  ? 79.13400  149.73400 119.14800 1.000 101.93000 ? 326 VAL C CG1   1 
ATOM   6143  C  CG2   . VAL C 1 81  ? 78.10300  148.63500 117.15100 1.000 101.93000 ? 326 VAL C CG2   1 
ATOM   6144  N  N     . LYS C 1 82  ? 82.15200  148.21500 119.50300 1.000 101.99000 ? 327 LYS C N     1 
ATOM   6145  C  CA    . LYS C 1 82  ? 83.08800  148.04400 120.60000 1.000 101.99000 ? 327 LYS C CA    1 
ATOM   6146  C  C     . LYS C 1 82  ? 83.20800  149.34200 121.38500 1.000 101.99000 ? 327 LYS C C     1 
ATOM   6147  O  O     . LYS C 1 82  ? 82.75500  150.40700 120.95600 1.000 101.99000 ? 327 LYS C O     1 
ATOM   6148  C  CB    . LYS C 1 82  ? 84.46500  147.59800 120.08800 1.000 101.99000 ? 327 LYS C CB    1 
ATOM   6149  C  CG    . LYS C 1 82  ? 85.32600  148.72100 119.52300 1.000 101.99000 ? 327 LYS C CG    1 
ATOM   6150  C  CD    . LYS C 1 82  ? 84.85100  149.17600 118.15000 1.000 101.99000 ? 327 LYS C CD    1 
ATOM   6151  C  CE    . LYS C 1 82  ? 85.14000  148.13200 117.08500 1.000 101.99000 ? 327 LYS C CE    1 
ATOM   6152  N  NZ    . LYS C 1 82  ? 84.65700  148.56800 115.74600 1.000 101.99000 ? 327 LYS C NZ    1 
ATOM   6153  N  N     . GLN C 1 83  ? 83.83200  149.23600 122.55900 1.000 104.40000 ? 328 GLN C N     1 
ATOM   6154  C  CA    . GLN C 1 83  ? 84.03100  150.40300 123.40900 1.000 104.40000 ? 328 GLN C CA    1 
ATOM   6155  C  C     . GLN C 1 83  ? 85.05700  151.36900 122.83500 1.000 104.40000 ? 328 GLN C C     1 
ATOM   6156  O  O     . GLN C 1 83  ? 85.02300  152.55700 123.17600 1.000 104.40000 ? 328 GLN C O     1 
ATOM   6157  C  CB    . GLN C 1 83  ? 84.44500  149.95800 124.81200 1.000 104.40000 ? 328 GLN C CB    1 
ATOM   6158  C  CG    . GLN C 1 83  ? 85.79100  149.26300 124.87100 1.000 104.40000 ? 328 GLN C CG    1 
ATOM   6159  C  CD    . GLN C 1 83  ? 85.69000  147.77500 124.58700 1.000 104.40000 ? 328 GLN C CD    1 
ATOM   6160  O  OE1   . GLN C 1 83  ? 84.68300  147.29600 124.06400 1.000 104.40000 ? 328 GLN C OE1   1 
ATOM   6161  N  NE2   . GLN C 1 83  ? 86.73500  147.03600 124.92800 1.000 104.40000 ? 328 GLN C NE2   1 
ATOM   6162  N  N     . LYS C 1 84  ? 85.94600  150.89400 121.96400 1.000 102.59000 ? 329 LYS C N     1 
ATOM   6163  C  CA    . LYS C 1 84  ? 86.95700  151.72200 121.30600 1.000 102.59000 ? 329 LYS C CA    1 
ATOM   6164  C  C     . LYS C 1 84  ? 87.72300  152.55700 122.33700 1.000 102.59000 ? 329 LYS C C     1 
ATOM   6165  O  O     . LYS C 1 84  ? 87.61100  153.78100 122.41200 1.000 102.59000 ? 329 LYS C O     1 
ATOM   6166  C  CB    . LYS C 1 84  ? 86.31500  152.59800 120.22500 1.000 102.59000 ? 329 LYS C CB    1 
ATOM   6167  C  CG    . LYS C 1 84  ? 87.31200  153.37900 119.38100 1.000 102.59000 ? 329 LYS C CG    1 
ATOM   6168  C  CD    . LYS C 1 84  ? 88.14100  152.44400 118.51400 1.000 102.59000 ? 329 LYS C CD    1 
ATOM   6169  C  CE    . LYS C 1 84  ? 89.06100  153.21900 117.58600 1.000 102.59000 ? 329 LYS C CE    1 
ATOM   6170  N  NZ    . LYS C 1 84  ? 90.11900  153.94900 118.33700 1.000 102.59000 ? 329 LYS C NZ    1 
ATOM   6171  N  N     . SER C 1 85  ? 88.47100  151.83000 123.17100 1.000 98.88000  ? 330 SER C N     1 
ATOM   6172  C  CA    . SER C 1 85  ? 89.20100  152.44000 124.27800 1.000 98.88000  ? 330 SER C CA    1 
ATOM   6173  C  C     . SER C 1 85  ? 90.04400  153.62300 123.81400 1.000 98.88000  ? 330 SER C C     1 
ATOM   6174  O  O     . SER C 1 85  ? 89.88000  154.74800 124.29800 1.000 98.88000  ? 330 SER C O     1 
ATOM   6175  C  CB    . SER C 1 85  ? 90.07800  151.38700 124.95900 1.000 98.88000  ? 330 SER C CB    1 
ATOM   6176  O  OG    . SER C 1 85  ? 90.82400  151.95300 126.02100 1.000 98.88000  ? 330 SER C OG    1 
ATOM   6177  N  N     . TYR C 1 86  ? 90.95100  153.38800 122.86900 1.000 92.35000  ? 331 TYR C N     1 
ATOM   6178  C  CA    . TYR C 1 86  ? 91.83100  154.45600 122.40900 1.000 92.35000  ? 331 TYR C CA    1 
ATOM   6179  C  C     . TYR C 1 86  ? 91.16600  155.34900 121.37000 1.000 92.35000  ? 331 TYR C C     1 
ATOM   6180  O  O     . TYR C 1 86  ? 91.29600  155.11800 120.16400 1.000 92.35000  ? 331 TYR C O     1 
ATOM   6181  C  CB    . TYR C 1 86  ? 93.13200  153.87600 121.85100 1.000 92.35000  ? 331 TYR C CB    1 
ATOM   6182  C  CG    . TYR C 1 86  ? 94.07000  153.36600 122.91800 1.000 92.35000  ? 331 TYR C CG    1 
ATOM   6183  C  CD1   . TYR C 1 86  ? 93.86400  153.67700 124.25500 1.000 92.35000  ? 331 TYR C CD1   1 
ATOM   6184  C  CD2   . TYR C 1 86  ? 95.17500  152.59400 122.58900 1.000 92.35000  ? 331 TYR C CD2   1 
ATOM   6185  C  CE1   . TYR C 1 86  ? 94.72200  153.22100 125.23500 1.000 92.35000  ? 331 TYR C CE1   1 
ATOM   6186  C  CE2   . TYR C 1 86  ? 96.04000  152.13300 123.56400 1.000 92.35000  ? 331 TYR C CE2   1 
ATOM   6187  C  CZ    . TYR C 1 86  ? 95.80900  152.44800 124.88400 1.000 92.35000  ? 331 TYR C CZ    1 
ATOM   6188  O  OH    . TYR C 1 86  ? 96.66800  151.99100 125.85700 1.000 92.35000  ? 331 TYR C OH    1 
ATOM   6189  N  N     . SER C 1 87  ? 90.45000  156.36800 121.83300 1.000 98.11000  ? 332 SER C N     1 
ATOM   6190  C  CA    . SER C 1 87  ? 89.97500  157.40800 120.93500 1.000 98.11000  ? 332 SER C CA    1 
ATOM   6191  C  C     . SER C 1 87  ? 91.16900  158.18600 120.38500 1.000 98.11000  ? 332 SER C C     1 
ATOM   6192  O  O     . SER C 1 87  ? 92.22500  158.22900 121.02800 1.000 98.11000  ? 332 SER C O     1 
ATOM   6193  C  CB    . SER C 1 87  ? 89.01600  158.34900 121.66700 1.000 98.11000  ? 332 SER C CB    1 
ATOM   6194  O  OG    . SER C 1 87  ? 87.84900  157.66300 122.08200 1.000 98.11000  ? 332 SER C OG    1 
ATOM   6195  N  N     . PRO C 1 88  ? 91.04800  158.79500 119.20200 1.000 97.65000  ? 333 PRO C N     1 
ATOM   6196  C  CA    . PRO C 1 88  ? 92.20800  159.48200 118.60600 1.000 97.65000  ? 333 PRO C CA    1 
ATOM   6197  C  C     . PRO C 1 88  ? 92.84000  160.52900 119.50600 1.000 97.65000  ? 333 PRO C C     1 
ATOM   6198  O  O     . PRO C 1 88  ? 94.06000  160.73100 119.44400 1.000 97.65000  ? 333 PRO C O     1 
ATOM   6199  C  CB    . PRO C 1 88  ? 91.62000  160.11200 117.33600 1.000 97.65000  ? 333 PRO C CB    1 
ATOM   6200  C  CG    . PRO C 1 88  ? 90.45200  159.25300 117.00200 1.000 97.65000  ? 333 PRO C CG    1 
ATOM   6201  C  CD    . PRO C 1 88  ? 89.87100  158.83300 118.31700 1.000 97.65000  ? 333 PRO C CD    1 
ATOM   6202  N  N     . GLU C 1 89  ? 92.05600  161.19700 120.35300 1.000 97.29000  ? 334 GLU C N     1 
ATOM   6203  C  CA    . GLU C 1 89  ? 92.65100  162.12700 121.30500 1.000 97.29000  ? 334 GLU C CA    1 
ATOM   6204  C  C     . GLU C 1 89  ? 93.41700  161.39100 122.39500 1.000 97.29000  ? 334 GLU C C     1 
ATOM   6205  O  O     . GLU C 1 89  ? 94.46400  161.86900 122.84600 1.000 97.29000  ? 334 GLU C O     1 
ATOM   6206  C  CB    . GLU C 1 89  ? 91.57300  163.01800 121.91700 1.000 97.29000  ? 334 GLU C CB    1 
ATOM   6207  C  CG    . GLU C 1 89  ? 90.93100  163.96000 120.91800 1.000 97.29000  ? 334 GLU C CG    1 
ATOM   6208  C  CD    . GLU C 1 89  ? 91.90700  164.98800 120.38700 1.000 97.29000  ? 334 GLU C CD    1 
ATOM   6209  O  OE1   . GLU C 1 89  ? 92.81900  165.38900 121.14100 1.000 97.29000  ? 334 GLU C OE1   1 
ATOM   6210  O  OE2   . GLU C 1 89  ? 91.76600  165.39200 119.21400 1.000 97.29000  ? 334 GLU C OE2   1 
ATOM   6211  N  N     . SER C 1 90  ? 92.92500  160.22600 122.81500 1.000 94.10000  ? 335 SER C N     1 
ATOM   6212  C  CA    . SER C 1 90  ? 93.64400  159.41000 123.78200 1.000 94.10000  ? 335 SER C CA    1 
ATOM   6213  C  C     . SER C 1 90  ? 94.89300  158.77300 123.19300 1.000 94.10000  ? 335 SER C C     1 
ATOM   6214  O  O     . SER C 1 90  ? 95.76000  158.33100 123.95400 1.000 94.10000  ? 335 SER C O     1 
ATOM   6215  C  CB    . SER C 1 90  ? 92.72300  158.32300 124.33900 1.000 94.10000  ? 335 SER C CB    1 
ATOM   6216  O  OG    . SER C 1 90  ? 91.64300  158.89400 125.05800 1.000 94.10000  ? 335 SER C OG    1 
ATOM   6217  N  N     . LEU C 1 91  ? 95.00300  158.71000 121.86600 1.000 85.51000  ? 336 LEU C N     1 
ATOM   6218  C  CA    . LEU C 1 91  ? 96.24700  158.32600 121.21600 1.000 85.51000  ? 336 LEU C CA    1 
ATOM   6219  C  C     . LEU C 1 91  ? 97.19300  159.49900 121.02900 1.000 85.51000  ? 336 LEU C C     1 
ATOM   6220  O  O     . LEU C 1 91  ? 98.40800  159.32400 121.15700 1.000 85.51000  ? 336 LEU C O     1 
ATOM   6221  C  CB    . LEU C 1 91  ? 95.96500  157.68900 119.85400 1.000 85.51000  ? 336 LEU C CB    1 
ATOM   6222  C  CG    . LEU C 1 91  ? 95.28600  156.32300 119.87400 1.000 85.51000  ? 336 LEU C CG    1 
ATOM   6223  C  CD1   . LEU C 1 91  ? 94.90600  155.89700 118.46800 1.000 85.51000  ? 336 LEU C CD1   1 
ATOM   6224  C  CD2   . LEU C 1 91  ? 96.20900  155.30200 120.51000 1.000 85.51000  ? 336 LEU C CD2   1 
ATOM   6225  N  N     . GLU C 1 92  ? 96.66500  160.68900 120.74400 1.000 83.71000  ? 337 GLU C N     1 
ATOM   6226  C  CA    . GLU C 1 92  ? 97.50700  161.87300 120.61600 1.000 83.71000  ? 337 GLU C CA    1 
ATOM   6227  C  C     . GLU C 1 92  ? 98.14500  162.24300 121.95200 1.000 83.71000  ? 337 GLU C C     1 
ATOM   6228  O  O     . GLU C 1 92  ? 99.34300  162.54800 122.02100 1.000 83.71000  ? 337 GLU C O     1 
ATOM   6229  C  CB    . GLU C 1 92  ? 96.68100  163.03900 120.06900 1.000 83.71000  ? 337 GLU C CB    1 
ATOM   6230  C  CG    . GLU C 1 92  ? 97.47500  164.30500 119.84800 1.000 83.71000  ? 337 GLU C CG    1 
ATOM   6231  C  CD    . GLU C 1 92  ? 98.51800  164.15100 118.76400 1.000 83.71000  ? 337 GLU C CD    1 
ATOM   6232  O  OE1   . GLU C 1 92  ? 98.33600  163.29300 117.87600 1.000 83.71000  ? 337 GLU C OE1   1 
ATOM   6233  O  OE2   . GLU C 1 92  ? 99.52000  164.89300 118.79800 1.000 83.71000  ? 337 GLU C OE2   1 
ATOM   6234  N  N     . ALA C 1 93  ? 97.35100  162.22400 123.02300 1.000 81.75000  ? 338 ALA C N     1 
ATOM   6235  C  CA    . ALA C 1 93  ? 97.86100  162.49500 124.36000 1.000 81.75000  ? 338 ALA C CA    1 
ATOM   6236  C  C     . ALA C 1 93  ? 98.95600  161.50200 124.71900 1.000 81.75000  ? 338 ALA C C     1 
ATOM   6237  O  O     . ALA C 1 93  ? 99.97100  161.87600 125.31400 1.000 81.75000  ? 338 ALA C O     1 
ATOM   6238  C  CB    . ALA C 1 93  ? 96.73200  162.44200 125.38900 1.000 81.75000  ? 338 ALA C CB    1 
ATOM   6239  N  N     . MET C 1 94  ? 98.77000  160.23600 124.33900 1.000 76.18000  ? 339 MET C N     1 
ATOM   6240  C  CA    . MET C 1 94  ? 99.76600  159.22200 124.66400 1.000 76.18000  ? 339 MET C CA    1 
ATOM   6241  C  C     . MET C 1 94  ? 101.02600 159.38400 123.82600 1.000 76.18000  ? 339 MET C C     1 
ATOM   6242  O  O     . MET C 1 94  ? 102.13100 159.17500 124.33200 1.000 76.18000  ? 339 MET C O     1 
ATOM   6243  C  CB    . MET C 1 94  ? 99.17500  157.82500 124.48500 1.000 76.18000  ? 339 MET C CB    1 
ATOM   6244  C  CG    . MET C 1 94  ? 100.10000 156.70500 124.91400 1.000 76.18000  ? 339 MET C CG    1 
ATOM   6245  S  SD    . MET C 1 94  ? 99.32900  155.08200 124.78200 1.000 76.18000  ? 339 MET C SD    1 
ATOM   6246  C  CE    . MET C 1 94  ? 98.19000  155.14100 126.16200 1.000 76.18000  ? 339 MET C CE    1 
ATOM   6247  N  N     . SER C 1 95  ? 100.88900 159.76900 122.55600 1.000 71.18000  ? 340 SER C N     1 
ATOM   6248  C  CA    . SER C 1 95  ? 102.06800 160.04500 121.74100 1.000 71.18000  ? 340 SER C CA    1 
ATOM   6249  C  C     . SER C 1 95  ? 102.87200 161.20400 122.31700 1.000 71.18000  ? 340 SER C C     1 
ATOM   6250  O  O     . SER C 1 95  ? 104.11000 161.16700 122.33800 1.000 71.18000  ? 340 SER C O     1 
ATOM   6251  C  CB    . SER C 1 95  ? 101.65300 160.34400 120.30100 1.000 71.18000  ? 340 SER C CB    1 
ATOM   6252  O  OG    . SER C 1 95  ? 101.03400 159.22000 119.70300 1.000 71.18000  ? 340 SER C OG    1 
ATOM   6253  N  N     . ARG C 1 96  ? 102.18600 162.23800 122.80500 1.000 73.61000  ? 341 ARG C N     1 
ATOM   6254  C  CA    . ARG C 1 96  ? 102.90200 163.36500 123.39400 1.000 73.61000  ? 341 ARG C CA    1 
ATOM   6255  C  C     . ARG C 1 96  ? 103.54200 162.98200 124.72400 1.000 73.61000  ? 341 ARG C C     1 
ATOM   6256  O  O     . ARG C 1 96  ? 104.68500 163.36800 125.00200 1.000 73.61000  ? 341 ARG C O     1 
ATOM   6257  C  CB    . ARG C 1 96  ? 101.96100 164.55600 123.55600 1.000 73.61000  ? 341 ARG C CB    1 
ATOM   6258  C  CG    . ARG C 1 96  ? 101.50500 165.11200 122.22400 1.000 73.61000  ? 341 ARG C CG    1 
ATOM   6259  C  CD    . ARG C 1 96  ? 102.67000 165.76400 121.49700 1.000 73.61000  ? 341 ARG C CD    1 
ATOM   6260  N  NE    . ARG C 1 96  ? 102.28000 166.31400 120.20400 1.000 73.61000  ? 341 ARG C NE    1 
ATOM   6261  C  CZ    . ARG C 1 96  ? 102.38800 165.65800 119.05300 1.000 73.61000  ? 341 ARG C CZ    1 
ATOM   6262  N  NH1   . ARG C 1 96  ? 102.88300 164.42800 119.03400 1.000 73.61000  ? 341 ARG C NH1   1 
ATOM   6263  N  NH2   . ARG C 1 96  ? 102.00600 166.23100 117.92100 1.000 73.61000  ? 341 ARG C NH2   1 
ATOM   6264  N  N     . LEU C 1 97  ? 102.82800 162.22300 125.55700 1.000 66.15000  ? 342 LEU C N     1 
ATOM   6265  C  CA    . LEU C 1 97  ? 103.39200 161.70100 126.79800 1.000 66.15000  ? 342 LEU C CA    1 
ATOM   6266  C  C     . LEU C 1 97  ? 104.54500 160.75700 126.55600 1.000 66.15000  ? 342 LEU C C     1 
ATOM   6267  O  O     . LEU C 1 97  ? 105.38800 160.58100 127.43000 1.000 66.15000  ? 342 LEU C O     1 
ATOM   6268  C  CB    . LEU C 1 97  ? 102.29800 161.00300 127.60900 1.000 66.15000  ? 342 LEU C CB    1 
ATOM   6269  C  CG    . LEU C 1 97  ? 102.66800 160.43100 128.98000 1.000 66.15000  ? 342 LEU C CG    1 
ATOM   6270  C  CD1   . LEU C 1 97  ? 103.13600 161.52900 129.91500 1.000 66.15000  ? 342 LEU C CD1   1 
ATOM   6271  C  CD2   . LEU C 1 97  ? 101.49100 159.68500 129.58400 1.000 66.15000  ? 342 LEU C CD2   1 
ATOM   6272  N  N     . LEU C 1 98  ? 104.61400 160.16000 125.37000 1.000 62.66000  ? 343 LEU C N     1 
ATOM   6273  C  CA    . LEU C 1 98  ? 105.74100 159.33500 124.96200 1.000 62.66000  ? 343 LEU C CA    1 
ATOM   6274  C  C     . LEU C 1 98  ? 106.94100 160.16800 124.54300 1.000 62.66000  ? 343 LEU C C     1 
ATOM   6275  O  O     . LEU C 1 98  ? 108.06800 159.88800 124.96400 1.000 62.66000  ? 343 LEU C O     1 
ATOM   6276  C  CB    . LEU C 1 98  ? 105.32200 158.41500 123.80800 1.000 62.66000  ? 343 LEU C CB    1 
ATOM   6277  C  CG    . LEU C 1 98  ? 106.38300 157.46300 123.26200 1.000 62.66000  ? 343 LEU C CG    1 
ATOM   6278  C  CD1   . LEU C 1 98  ? 106.80900 156.47300 124.32600 1.000 62.66000  ? 343 LEU C CD1   1 
ATOM   6279  C  CD2   . LEU C 1 98  ? 105.85600 156.74600 122.03400 1.000 62.66000  ? 343 LEU C CD2   1 
ATOM   6280  N  N     . GLU C 1 99  ? 106.71900 161.18700 123.71000 1.000 64.92000  ? 344 GLU C N     1 
ATOM   6281  C  CA    . GLU C 1 99  ? 107.81600 162.06800 123.32000 1.000 64.92000  ? 344 GLU C CA    1 
ATOM   6282  C  C     . GLU C 1 99  ? 108.43000 162.75500 124.53200 1.000 64.92000  ? 344 GLU C C     1 
ATOM   6283  O  O     . GLU C 1 99  ? 109.65900 162.84900 124.64500 1.000 64.92000  ? 344 GLU C O     1 
ATOM   6284  C  CB    . GLU C 1 99  ? 107.33400 163.10900 122.31300 1.000 64.92000  ? 344 GLU C CB    1 
ATOM   6285  C  CG    . GLU C 1 99  ? 106.98000 162.54800 120.95600 1.000 64.92000  ? 344 GLU C CG    1 
ATOM   6286  C  CD    . GLU C 1 99  ? 106.51900 163.62200 119.99200 1.000 64.92000  ? 344 GLU C CD    1 
ATOM   6287  O  OE1   . GLU C 1 99  ? 106.36700 164.78400 120.42300 1.000 64.92000  ? 344 GLU C OE1   1 
ATOM   6288  O  OE2   . GLU C 1 99  ? 106.30700 163.30400 118.80300 1.000 64.92000  ? 344 GLU C OE2   1 
ATOM   6289  N  N     . ILE C 1 100 ? 107.59300 163.23900 125.45300 1.000 62.41000  ? 345 ILE C N     1 
ATOM   6290  C  CA    . ILE C 1 100 ? 108.10900 163.92700 126.63400 1.000 62.41000  ? 345 ILE C CA    1 
ATOM   6291  C  C     . ILE C 1 100 ? 108.98000 162.99000 127.46200 1.000 62.41000  ? 345 ILE C C     1 
ATOM   6292  O  O     . ILE C 1 100 ? 110.09900 163.34000 127.85800 1.000 62.41000  ? 345 ILE C O     1 
ATOM   6293  C  CB    . ILE C 1 100 ? 106.95400 164.51000 127.46700 1.000 62.41000  ? 345 ILE C CB    1 
ATOM   6294  C  CG1   . ILE C 1 100 ? 106.18400 165.55500 126.65800 1.000 62.41000  ? 345 ILE C CG1   1 
ATOM   6295  C  CG2   . ILE C 1 100 ? 107.48100 165.11400 128.75700 1.000 62.41000  ? 345 ILE C CG2   1 
ATOM   6296  C  CD1   . ILE C 1 100 ? 107.02100 166.73900 126.23400 1.000 62.41000  ? 345 ILE C CD1   1 
ATOM   6297  N  N     . LYS C 1 101 ? 108.48300 161.78000 127.73300 1.000 61.78000  ? 346 LYS C N     1 
ATOM   6298  C  CA    . LYS C 1 101 ? 109.23700 160.85600 128.57300 1.000 61.78000  ? 346 LYS C CA    1 
ATOM   6299  C  C     . LYS C 1 101 ? 110.52200 160.40300 127.89300 1.000 61.78000  ? 346 LYS C C     1 
ATOM   6300  O  O     . LYS C 1 101 ? 111.55200 160.24700 128.55600 1.000 61.78000  ? 346 LYS C O     1 
ATOM   6301  C  CB    . LYS C 1 101 ? 108.37500 159.65600 128.95600 1.000 61.78000  ? 346 LYS C CB    1 
ATOM   6302  C  CG    . LYS C 1 101 ? 107.17900 160.01800 129.81200 1.000 61.78000  ? 346 LYS C CG    1 
ATOM   6303  C  CD    . LYS C 1 101 ? 107.59400 160.54700 131.16900 1.000 61.78000  ? 346 LYS C CD    1 
ATOM   6304  C  CE    . LYS C 1 101 ? 106.37700 160.84600 132.02300 1.000 61.78000  ? 346 LYS C CE    1 
ATOM   6305  N  NZ    . LYS C 1 101 ? 106.75200 161.40800 133.34600 1.000 61.78000  ? 346 LYS C NZ    1 
ATOM   6306  N  N     . LEU C 1 102 ? 110.49300 160.19000 126.57500 1.000 59.74000  ? 347 LEU C N     1 
ATOM   6307  C  CA    . LEU C 1 102 ? 111.73300 159.87600 125.87300 1.000 59.74000  ? 347 LEU C CA    1 
ATOM   6308  C  C     . LEU C 1 102 ? 112.72500 161.02600 125.97200 1.000 59.74000  ? 347 LEU C C     1 
ATOM   6309  O  O     . LEU C 1 102 ? 113.92800 160.80200 126.15300 1.000 59.74000  ? 347 LEU C O     1 
ATOM   6310  C  CB    . LEU C 1 102 ? 111.45100 159.53800 124.41000 1.000 59.74000  ? 347 LEU C CB    1 
ATOM   6311  C  CG    . LEU C 1 102 ? 110.78100 158.19200 124.15900 1.000 59.74000  ? 347 LEU C CG    1 
ATOM   6312  C  CD1   . LEU C 1 102 ? 110.41700 158.03800 122.69500 1.000 59.74000  ? 347 LEU C CD1   1 
ATOM   6313  C  CD2   . LEU C 1 102 ? 111.71000 157.08000 124.60100 1.000 59.74000  ? 347 LEU C CD2   1 
ATOM   6314  N  N     . LYS C 1 103 ? 112.24200 162.26500 125.87100 1.000 66.45000  ? 348 LYS C N     1 
ATOM   6315  C  CA    . LYS C 1 103 ? 113.13400 163.40600 126.03600 1.000 66.45000  ? 348 LYS C CA    1 
ATOM   6316  C  C     . LYS C 1 103 ? 113.71500 163.46200 127.44200 1.000 66.45000  ? 348 LYS C C     1 
ATOM   6317  O  O     . LYS C 1 103 ? 114.86400 163.88100 127.62100 1.000 66.45000  ? 348 LYS C O     1 
ATOM   6318  C  CB    . LYS C 1 103 ? 112.39700 164.70500 125.71000 1.000 66.45000  ? 348 LYS C CB    1 
ATOM   6319  C  CG    . LYS C 1 103 ? 113.27100 165.94100 125.81400 1.000 66.45000  ? 348 LYS C CG    1 
ATOM   6320  C  CD    . LYS C 1 103 ? 114.37200 165.91900 124.76800 1.000 66.45000  ? 348 LYS C CD    1 
ATOM   6321  C  CE    . LYS C 1 103 ? 115.28600 167.12600 124.89500 1.000 66.45000  ? 348 LYS C CE    1 
ATOM   6322  N  NZ    . LYS C 1 103 ? 114.57700 168.39700 124.58700 1.000 66.45000  ? 348 LYS C NZ    1 
ATOM   6323  N  N     . GLU C 1 104 ? 112.94400 163.04000 128.44800 1.000 62.86000  ? 349 GLU C N     1 
ATOM   6324  C  CA    . GLU C 1 104 ? 113.44000 163.07400 129.82100 1.000 62.86000  ? 349 GLU C CA    1 
ATOM   6325  C  C     . GLU C 1 104 ? 114.65000 162.16900 130.01700 1.000 62.86000  ? 349 GLU C C     1 
ATOM   6326  O  O     . GLU C 1 104 ? 115.48500 162.43500 130.88800 1.000 62.86000  ? 349 GLU C O     1 
ATOM   6327  C  CB    . GLU C 1 104 ? 112.33200 162.67900 130.79500 1.000 62.86000  ? 349 GLU C CB    1 
ATOM   6328  C  CG    . GLU C 1 104 ? 111.21000 163.69100 130.89700 1.000 62.86000  ? 349 GLU C CG    1 
ATOM   6329  C  CD    . GLU C 1 104 ? 110.12700 163.25800 131.86400 1.000 62.86000  ? 349 GLU C CD    1 
ATOM   6330  O  OE1   . GLU C 1 104 ? 110.18900 162.11000 132.35100 1.000 62.86000  ? 349 GLU C OE1   1 
ATOM   6331  O  OE2   . GLU C 1 104 ? 109.21400 164.06600 132.13800 1.000 62.86000  ? 349 GLU C OE2   1 
ATOM   6332  N  N     . PHE C 1 105 ? 114.76800 161.10400 129.22800 1.000 59.81000  ? 350 PHE C N     1 
ATOM   6333  C  CA    . PHE C 1 105 ? 115.86700 160.16000 129.38200 1.000 59.81000  ? 350 PHE C CA    1 
ATOM   6334  C  C     . PHE C 1 105 ? 117.04300 160.44500 128.45700 1.000 59.81000  ? 350 PHE C C     1 
ATOM   6335  O  O     . PHE C 1 105 ? 118.03700 159.71500 128.50600 1.000 59.81000  ? 350 PHE C O     1 
ATOM   6336  C  CB    . PHE C 1 105 ? 115.38000 158.72500 129.15300 1.000 59.81000  ? 350 PHE C CB    1 
ATOM   6337  C  CG    . PHE C 1 105 ? 114.47400 158.21200 130.23500 1.000 59.81000  ? 350 PHE C CG    1 
ATOM   6338  C  CD1   . PHE C 1 105 ? 114.99200 157.78400 131.44200 1.000 59.81000  ? 350 PHE C CD1   1 
ATOM   6339  C  CD2   . PHE C 1 105 ? 113.10900 158.13500 130.03700 1.000 59.81000  ? 350 PHE C CD2   1 
ATOM   6340  C  CE1   . PHE C 1 105 ? 114.16400 157.30800 132.43500 1.000 59.81000  ? 350 PHE C CE1   1 
ATOM   6341  C  CE2   . PHE C 1 105 ? 112.27600 157.65900 131.02600 1.000 59.81000  ? 350 PHE C CE2   1 
ATOM   6342  C  CZ    . PHE C 1 105 ? 112.80400 157.24400 132.22500 1.000 59.81000  ? 350 PHE C CZ    1 
ATOM   6343  N  N     . GLY C 1 106 ? 116.96000 161.47300 127.61700 1.000 62.40000  ? 351 GLY C N     1 
ATOM   6344  C  CA    . GLY C 1 106 ? 118.08400 161.89500 126.80600 1.000 62.40000  ? 351 GLY C CA    1 
ATOM   6345  C  C     . GLY C 1 106 ? 117.97100 161.59700 125.32700 1.000 62.40000  ? 351 GLY C C     1 
ATOM   6346  O  O     . GLY C 1 106 ? 118.89300 161.94000 124.57700 1.000 62.40000  ? 351 GLY C O     1 
ATOM   6347  N  N     . VAL C 1 107 ? 116.89000 160.96800 124.87500 1.000 65.56000  ? 352 VAL C N     1 
ATOM   6348  C  CA    . VAL C 1 107 ? 116.66900 160.72200 123.45500 1.000 65.56000  ? 352 VAL C CA    1 
ATOM   6349  C  C     . VAL C 1 107 ? 115.58000 161.66500 122.95900 1.000 65.56000  ? 352 VAL C C     1 
ATOM   6350  O  O     . VAL C 1 107 ? 114.48700 161.73100 123.53600 1.000 65.56000  ? 352 VAL C O     1 
ATOM   6351  C  CB    . VAL C 1 107 ? 116.31600 159.24700 123.18500 1.000 65.56000  ? 352 VAL C CB    1 
ATOM   6352  C  CG1   . VAL C 1 107 ? 117.50000 158.36000 123.51400 1.000 65.56000  ? 352 VAL C CG1   1 
ATOM   6353  C  CG2   . VAL C 1 107 ? 115.11700 158.80900 124.00200 1.000 65.56000  ? 352 VAL C CG2   1 
ATOM   6354  N  N     . GLU C 1 108 ? 115.88800 162.42200 121.90900 1.000 69.61000  ? 353 GLU C N     1 
ATOM   6355  C  CA    . GLU C 1 108 ? 114.95500 163.37900 121.32600 1.000 69.61000  ? 353 GLU C CA    1 
ATOM   6356  C  C     . GLU C 1 108 ? 114.23600 162.69100 120.17300 1.000 69.61000  ? 353 GLU C C     1 
ATOM   6357  O  O     . GLU C 1 108 ? 114.83400 162.43900 119.12200 1.000 69.61000  ? 353 GLU C O     1 
ATOM   6358  C  CB    . GLU C 1 108 ? 115.68500 164.63700 120.86200 1.000 69.61000  ? 353 GLU C CB    1 
ATOM   6359  C  CG    . GLU C 1 108 ? 114.77000 165.73600 120.35600 1.000 69.61000  ? 353 GLU C CG    1 
ATOM   6360  C  CD    . GLU C 1 108 ? 115.52400 166.99900 119.99000 1.000 69.61000  ? 353 GLU C CD    1 
ATOM   6361  O  OE1   . GLU C 1 108 ? 116.76800 167.00500 120.10300 1.000 69.61000  ? 353 GLU C OE1   1 
ATOM   6362  O  OE2   . GLU C 1 108 ? 114.87200 167.98800 119.59400 1.000 69.61000  ? 353 GLU C OE2   1 
ATOM   6363  N  N     . VAL C 1 109 ? 112.95600 162.38900 120.37100 1.000 64.30000  ? 354 VAL C N     1 
ATOM   6364  C  CA    . VAL C 1 109 ? 112.18700 161.55500 119.45800 1.000 64.30000  ? 354 VAL C CA    1 
ATOM   6365  C  C     . VAL C 1 109 ? 110.86500 162.24300 119.14800 1.000 64.30000  ? 354 VAL C C     1 
ATOM   6366  O  O     . VAL C 1 109 ? 110.20600 162.77400 120.04800 1.000 64.30000  ? 354 VAL C O     1 
ATOM   6367  C  CB    . VAL C 1 109 ? 111.94700 160.15400 120.05800 1.000 64.30000  ? 354 VAL C CB    1 
ATOM   6368  C  CG1   . VAL C 1 109 ? 111.02900 159.35300 119.17700 1.000 64.30000  ? 354 VAL C CG1   1 
ATOM   6369  C  CG2   . VAL C 1 109 ? 113.26600 159.42400 120.24600 1.000 64.30000  ? 354 VAL C CG2   1 
ATOM   6370  N  N     . SER C 1 110 ? 110.47700 162.23100 117.87300 1.000 61.47000  ? 355 SER C N     1 
ATOM   6371  C  CA    . SER C 1 110 ? 109.24600 162.86500 117.41100 1.000 61.47000  ? 355 SER C CA    1 
ATOM   6372  C  C     . SER C 1 110 ? 108.33700 161.80500 116.80200 1.000 61.47000  ? 355 SER C C     1 
ATOM   6373  O  O     . SER C 1 110 ? 108.63100 161.27700 115.72400 1.000 61.47000  ? 355 SER C O     1 
ATOM   6374  C  CB    . SER C 1 110 ? 109.54800 163.96600 116.39700 1.000 61.47000  ? 355 SER C CB    1 
ATOM   6375  O  OG    . SER C 1 110 ? 110.09200 163.42200 115.20800 1.000 61.47000  ? 355 SER C OG    1 
ATOM   6376  N  N     . VAL C 1 111 ? 107.23700 161.49300 117.49300 1.000 61.67000  ? 356 VAL C N     1 
ATOM   6377  C  CA    . VAL C 1 111 ? 106.24000 160.58300 116.94400 1.000 61.67000  ? 356 VAL C CA    1 
ATOM   6378  C  C     . VAL C 1 111 ? 105.67700 161.16300 115.65500 1.000 61.67000  ? 356 VAL C C     1 
ATOM   6379  O  O     . VAL C 1 111 ? 105.44400 162.37300 115.54500 1.000 61.67000  ? 356 VAL C O     1 
ATOM   6380  C  CB    . VAL C 1 111 ? 105.12700 160.32700 117.97300 1.000 61.67000  ? 356 VAL C CB    1 
ATOM   6381  C  CG1   . VAL C 1 111 ? 104.02300 159.47700 117.37200 1.000 61.67000  ? 356 VAL C CG1   1 
ATOM   6382  C  CG2   . VAL C 1 111 ? 105.69400 159.66000 119.21000 1.000 61.67000  ? 356 VAL C CG2   1 
ATOM   6383  N  N     . ASP C 1 112 ? 105.45600 160.29800 114.66600 1.000 62.66000  ? 357 ASP C N     1 
ATOM   6384  C  CA    . ASP C 1 112 ? 104.92000 160.73200 113.38200 1.000 62.66000  ? 357 ASP C CA    1 
ATOM   6385  C  C     . ASP C 1 112 ? 103.68800 159.97000 112.91700 1.000 62.66000  ? 357 ASP C C     1 
ATOM   6386  O  O     . ASP C 1 112 ? 103.00200 160.45600 112.01000 1.000 62.66000  ? 357 ASP C O     1 
ATOM   6387  C  CB    . ASP C 1 112 ? 105.99800 160.64000 112.29000 1.000 62.66000  ? 357 ASP C CB    1 
ATOM   6388  C  CG    . ASP C 1 112 ? 106.53000 159.23300 112.10400 1.000 62.66000  ? 357 ASP C CG    1 
ATOM   6389  O  OD1   . ASP C 1 112 ? 106.12000 158.32900 112.86100 1.000 62.66000  ? 357 ASP C OD1   1 
ATOM   6390  O  OD2   . ASP C 1 112 ? 107.36200 159.03000 111.19600 1.000 62.66000  ? 357 ASP C OD2   1 
ATOM   6391  N  N     . SER C 1 113 ? 103.37500 158.81400 113.49600 1.000 62.79000  ? 358 SER C N     1 
ATOM   6392  C  CA    . SER C 1 113 ? 102.18600 158.07400 113.09900 1.000 62.79000  ? 358 SER C CA    1 
ATOM   6393  C  C     . SER C 1 113 ? 101.84300 157.06400 114.18100 1.000 62.79000  ? 358 SER C C     1 
ATOM   6394  O  O     . SER C 1 113 ? 102.66500 156.74400 115.04300 1.000 62.79000  ? 358 SER C O     1 
ATOM   6395  C  CB    . SER C 1 113 ? 102.38100 157.37000 111.75200 1.000 62.79000  ? 358 SER C CB    1 
ATOM   6396  O  OG    . SER C 1 113 ? 103.35800 156.35000 111.84800 1.000 62.79000  ? 358 SER C OG    1 
ATOM   6397  N  N     . VAL C 1 114 ? 100.60900 156.56500 114.12100 1.000 59.77000  ? 359 VAL C N     1 
ATOM   6398  C  CA    . VAL C 1 114 ? 100.10400 155.57300 115.06000 1.000 59.77000  ? 359 VAL C CA    1 
ATOM   6399  C  C     . VAL C 1 114 ? 99.37200  154.50600 114.25800 1.000 59.77000  ? 359 VAL C C     1 
ATOM   6400  O  O     . VAL C 1 114 ? 98.84000  154.77400 113.17600 1.000 59.77000  ? 359 VAL C O     1 
ATOM   6401  C  CB    . VAL C 1 114 ? 99.17700  156.21900 116.12100 1.000 59.77000  ? 359 VAL C CB    1 
ATOM   6402  C  CG1   . VAL C 1 114 ? 98.60600  155.18000 117.07400 1.000 59.77000  ? 359 VAL C CG1   1 
ATOM   6403  C  CG2   . VAL C 1 114 ? 99.92000  157.29300 116.89700 1.000 59.77000  ? 359 VAL C CG2   1 
ATOM   6404  N  N     . HIS C 1 115 ? 99.35300  153.28400 114.78600 1.000 60.08000  ? 360 HIS C N     1 
ATOM   6405  C  CA    . HIS C 1 115 ? 98.63800  152.16700 114.16700 1.000 60.08000  ? 360 HIS C CA    1 
ATOM   6406  C  C     . HIS C 1 115 ? 97.89800  151.40400 115.25200 1.000 60.08000  ? 360 HIS C C     1 
ATOM   6407  O  O     . HIS C 1 115 ? 98.39000  150.39700 115.77600 1.000 60.08000  ? 360 HIS C O     1 
ATOM   6408  C  CB    . HIS C 1 115 ? 99.59400  151.24500 113.40800 1.000 60.08000  ? 360 HIS C CB    1 
ATOM   6409  C  CG    . HIS C 1 115 ? 100.25700 151.89000 112.23300 1.000 60.08000  ? 360 HIS C CG    1 
ATOM   6410  N  ND1   . HIS C 1 115 ? 99.59700  152.13800 111.04900 1.000 60.08000  ? 360 HIS C ND1   1 
ATOM   6411  C  CD2   . HIS C 1 115 ? 101.52700 152.32500 112.05300 1.000 60.08000  ? 360 HIS C CD2   1 
ATOM   6412  C  CE1   . HIS C 1 115 ? 100.43000 152.70400 110.19300 1.000 60.08000  ? 360 HIS C CE1   1 
ATOM   6413  N  NE2   . HIS C 1 115 ? 101.60700 152.82800 110.77800 1.000 60.08000  ? 360 HIS C NE2   1 
ATOM   6414  N  N     . PRO C 1 116 ? 96.70300  151.85600 115.61900 1.000 59.55000  ? 361 PRO C N     1 
ATOM   6415  C  CA    . PRO C 1 116 ? 95.93400  151.13900 116.64200 1.000 59.55000  ? 361 PRO C CA    1 
ATOM   6416  C  C     . PRO C 1 116 ? 95.40400  149.81300 116.12600 1.000 59.55000  ? 361 PRO C C     1 
ATOM   6417  O  O     . PRO C 1 116 ? 94.44500  149.77600 115.35000 1.000 59.55000  ? 361 PRO C O     1 
ATOM   6418  C  CB    . PRO C 1 116 ? 94.79700  152.11200 116.97200 1.000 59.55000  ? 361 PRO C CB    1 
ATOM   6419  C  CG    . PRO C 1 116 ? 94.63200  152.92000 115.73000 1.000 59.55000  ? 361 PRO C CG    1 
ATOM   6420  C  CD    . PRO C 1 116 ? 96.00600  153.06200 115.14200 1.000 59.55000  ? 361 PRO C CD    1 
ATOM   6421  N  N     . GLY C 1 117 ? 96.02300  148.71700 116.55100 1.000 53.00000  ? 362 GLY C N     1 
ATOM   6422  C  CA    . GLY C 1 117 ? 95.58900  147.40200 116.15200 1.000 53.00000  ? 362 GLY C CA    1 
ATOM   6423  C  C     . GLY C 1 117 ? 94.47200  146.89100 117.03300 1.000 53.00000  ? 362 GLY C C     1 
ATOM   6424  O  O     . GLY C 1 117 ? 93.82400  147.65000 117.76000 1.000 53.00000  ? 362 GLY C O     1 
ATOM   6425  N  N     . PRO C 1 118 ? 94.21800  145.58900 116.98100 1.000 52.48000  ? 363 PRO C N     1 
ATOM   6426  C  CA    . PRO C 1 118 ? 93.16700  145.01500 117.82700 1.000 52.48000  ? 363 PRO C CA    1 
ATOM   6427  C  C     . PRO C 1 118 ? 93.63800  144.72800 119.24400 1.000 52.48000  ? 363 PRO C C     1 
ATOM   6428  O  O     . PRO C 1 118 ? 92.83900  144.77900 120.18300 1.000 52.48000  ? 363 PRO C O     1 
ATOM   6429  C  CB    . PRO C 1 118 ? 92.79400  143.72500 117.08900 1.000 52.48000  ? 363 PRO C CB    1 
ATOM   6430  C  CG    . PRO C 1 118 ? 94.03900  143.34300 116.38000 1.000 52.48000  ? 363 PRO C CG    1 
ATOM   6431  C  CD    . PRO C 1 118 ? 94.71500  144.62500 115.98500 1.000 52.48000  ? 363 PRO C CD    1 
ATOM   6432  N  N     . VAL C 1 119 ? 94.92400  144.42400 119.42000 1.000 49.95000  ? 364 VAL C N     1 
ATOM   6433  C  CA    . VAL C 1 119 ? 95.42200  144.03300 120.73400 1.000 49.95000  ? 364 VAL C CA    1 
ATOM   6434  C  C     . VAL C 1 119 ? 96.59100  144.90900 121.16600 1.000 49.95000  ? 364 VAL C C     1 
ATOM   6435  O  O     . VAL C 1 119 ? 96.80500  145.13200 122.36400 1.000 49.95000  ? 364 VAL C O     1 
ATOM   6436  C  CB    . VAL C 1 119 ? 95.82000  142.54700 120.73300 1.000 49.95000  ? 364 VAL C CB    1 
ATOM   6437  C  CG1   . VAL C 1 119 ? 96.42200  142.14900 122.06000 1.000 49.95000  ? 364 VAL C CG1   1 
ATOM   6438  C  CG2   . VAL C 1 119 ? 94.61400  141.69200 120.42400 1.000 49.95000  ? 364 VAL C CG2   1 
ATOM   6439  N  N     . ILE C 1 120 ? 97.33900  145.44300 120.20500 1.000 49.93000  ? 365 ILE C N     1 
ATOM   6440  C  CA    . ILE C 1 120 ? 98.48400  146.29000 120.48800 1.000 49.93000  ? 365 ILE C CA    1 
ATOM   6441  C  C     . ILE C 1 120 ? 98.40600  147.53200 119.60600 1.000 49.93000  ? 365 ILE C C     1 
ATOM   6442  O  O     . ILE C 1 120 ? 97.50100  147.67900 118.78600 1.000 49.93000  ? 365 ILE C O     1 
ATOM   6443  C  CB    . ILE C 1 120 ? 99.82400  145.55200 120.29700 1.000 49.93000  ? 365 ILE C CB    1 
ATOM   6444  C  CG1   . ILE C 1 120 ? 100.00800 145.12400 118.84700 1.000 49.93000  ? 365 ILE C CG1   1 
ATOM   6445  C  CG2   . ILE C 1 120 ? 99.90500  144.33700 121.20600 1.000 49.93000  ? 365 ILE C CG2   1 
ATOM   6446  C  CD1   . ILE C 1 120 ? 101.38700 144.58700 118.57200 1.000 49.93000  ? 365 ILE C CD1   1 
ATOM   6447  N  N     . THR C 1 121 ? 99.37300  148.43200 119.78800 1.000 52.44000  ? 366 THR C N     1 
ATOM   6448  C  CA    . THR C 1 121 ? 99.33800  149.74200 119.13700 1.000 52.44000  ? 366 THR C CA    1 
ATOM   6449  C  C     . THR C 1 121 ? 100.77800 150.17100 118.87700 1.000 52.44000  ? 366 THR C C     1 
ATOM   6450  O  O     . THR C 1 121 ? 101.48700 150.56200 119.80800 1.000 52.44000  ? 366 THR C O     1 
ATOM   6451  C  CB    . THR C 1 121 ? 98.60300  150.76000 119.99600 1.000 52.44000  ? 366 THR C CB    1 
ATOM   6452  O  OG1   . THR C 1 121 ? 97.25800  150.31900 120.22200 1.000 52.44000  ? 366 THR C OG1   1 
ATOM   6453  C  CG2   . THR C 1 121 ? 98.57900  152.11500 119.31000 1.000 52.44000  ? 366 THR C CG2   1 
ATOM   6454  N  N     . ARG C 1 122 ? 101.19800 150.10300 117.61900 1.000 52.40000  ? 367 ARG C N     1 
ATOM   6455  C  CA    . ARG C 1 122 ? 102.57500 150.41300 117.24200 1.000 52.40000  ? 367 ARG C CA    1 
ATOM   6456  C  C     . ARG C 1 122 ? 102.72300 151.91400 117.03300 1.000 52.40000  ? 367 ARG C C     1 
ATOM   6457  O  O     . ARG C 1 122 ? 102.34400 152.44800 115.98900 1.000 52.40000  ? 367 ARG C O     1 
ATOM   6458  C  CB    . ARG C 1 122 ? 102.96800 149.65100 115.98200 1.000 52.40000  ? 367 ARG C CB    1 
ATOM   6459  C  CG    . ARG C 1 122 ? 104.37900 149.94300 115.51400 1.000 52.40000  ? 367 ARG C CG    1 
ATOM   6460  C  CD    . ARG C 1 122 ? 104.73400 149.16100 114.26400 1.000 52.40000  ? 367 ARG C CD    1 
ATOM   6461  N  NE    . ARG C 1 122 ? 104.90400 147.73700 114.52300 1.000 52.40000  ? 367 ARG C NE    1 
ATOM   6462  C  CZ    . ARG C 1 122 ? 105.07200 146.82500 113.57200 1.000 52.40000  ? 367 ARG C CZ    1 
ATOM   6463  N  NH1   . ARG C 1 122 ? 105.08700 147.18900 112.29800 1.000 52.40000  ? 367 ARG C NH1   1 
ATOM   6464  N  NH2   . ARG C 1 122 ? 105.22700 145.54900 113.89100 1.000 52.40000  ? 367 ARG C NH2   1 
ATOM   6465  N  N     . PHE C 1 123 ? 103.28300 152.60500 118.02400 1.000 52.08000  ? 368 PHE C N     1 
ATOM   6466  C  CA    . PHE C 1 123 ? 103.63600 154.01500 117.87000 1.000 52.08000  ? 368 PHE C CA    1 
ATOM   6467  C  C     . PHE C 1 123 ? 104.91600 154.10500 117.05300 1.000 52.08000  ? 368 PHE C C     1 
ATOM   6468  O  O     . PHE C 1 123 ? 106.01300 153.89500 117.57300 1.000 52.08000  ? 368 PHE C O     1 
ATOM   6469  C  CB    . PHE C 1 123 ? 103.81800 154.68900 119.22400 1.000 52.08000  ? 368 PHE C CB    1 
ATOM   6470  C  CG    . PHE C 1 123 ? 102.54700 154.86800 119.98900 1.000 52.08000  ? 368 PHE C CG    1 
ATOM   6471  C  CD1   . PHE C 1 123 ? 101.67500 155.89100 119.67300 1.000 52.08000  ? 368 PHE C CD1   1 
ATOM   6472  C  CD2   . PHE C 1 123 ? 102.23200 154.03000 121.04000 1.000 52.08000  ? 368 PHE C CD2   1 
ATOM   6473  C  CE1   . PHE C 1 123 ? 100.50600 156.06300 120.37900 1.000 52.08000  ? 368 PHE C CE1   1 
ATOM   6474  C  CE2   . PHE C 1 123 ? 101.06600 154.19800 121.75000 1.000 52.08000  ? 368 PHE C CE2   1 
ATOM   6475  C  CZ    . PHE C 1 123 ? 100.20200 155.21400 121.42000 1.000 52.08000  ? 368 PHE C CZ    1 
ATOM   6476  N  N     . GLU C 1 124 ? 104.79000 154.42000 115.76800 1.000 58.56000  ? 369 GLU C N     1 
ATOM   6477  C  CA    . GLU C 1 124 ? 105.97400 154.66400 114.95800 1.000 58.56000  ? 369 GLU C CA    1 
ATOM   6478  C  C     . GLU C 1 124 ? 106.61600 155.97400 115.38700 1.000 58.56000  ? 369 GLU C C     1 
ATOM   6479  O  O     . GLU C 1 124 ? 105.92900 156.98400 115.56400 1.000 58.56000  ? 369 GLU C O     1 
ATOM   6480  C  CB    . GLU C 1 124 ? 105.61600 154.70600 113.47500 1.000 58.56000  ? 369 GLU C CB    1 
ATOM   6481  C  CG    . GLU C 1 124 ? 105.16600 153.37400 112.90400 1.000 58.56000  ? 369 GLU C CG    1 
ATOM   6482  C  CD    . GLU C 1 124 ? 104.84600 153.45000 111.42300 1.000 58.56000  ? 369 GLU C CD    1 
ATOM   6483  O  OE1   . GLU C 1 124 ? 104.85300 154.56900 110.86700 1.000 58.56000  ? 369 GLU C OE1   1 
ATOM   6484  O  OE2   . GLU C 1 124 ? 104.59300 152.39000 110.81400 1.000 58.56000  ? 369 GLU C OE2   1 
ATOM   6485  N  N     . ILE C 1 125 ? 107.93400 155.95800 115.56600 1.000 53.75000  ? 370 ILE C N     1 
ATOM   6486  C  CA    . ILE C 1 125 ? 108.67300 157.11700 116.04800 1.000 53.75000  ? 370 ILE C CA    1 
ATOM   6487  C  C     . ILE C 1 125 ? 109.88400 157.34100 115.15500 1.000 53.75000  ? 370 ILE C C     1 
ATOM   6488  O  O     . ILE C 1 125 ? 110.54800 156.38600 114.73800 1.000 53.75000  ? 370 ILE C O     1 
ATOM   6489  C  CB    . ILE C 1 125 ? 109.10700 156.94700 117.52000 1.000 53.75000  ? 370 ILE C CB    1 
ATOM   6490  C  CG1   . ILE C 1 125 ? 110.01200 155.72800 117.68500 1.000 53.75000  ? 370 ILE C CG1   1 
ATOM   6491  C  CG2   . ILE C 1 125 ? 107.90200 156.83500 118.42900 1.000 53.75000  ? 370 ILE C CG2   1 
ATOM   6492  C  CD1   . ILE C 1 125 ? 110.66100 155.63600 119.04200 1.000 53.75000  ? 370 ILE C CD1   1 
ATOM   6493  N  N     . GLN C 1 126 ? 110.15600 158.60800 114.84200 1.000 59.31000  ? 371 GLN C N     1 
ATOM   6494  C  CA    . GLN C 1 126 ? 111.33900 158.99100 114.08500 1.000 59.31000  ? 371 GLN C CA    1 
ATOM   6495  C  C     . GLN C 1 126 ? 112.36600 159.56900 115.04500 1.000 59.31000  ? 371 GLN C C     1 
ATOM   6496  O  O     . GLN C 1 126 ? 112.28500 160.75700 115.39100 1.000 59.31000  ? 371 GLN C O     1 
ATOM   6497  C  CB    . GLN C 1 126 ? 110.98300 160.01100 113.00000 1.000 59.31000  ? 371 GLN C CB    1 
ATOM   6498  C  CG    . GLN C 1 126 ? 112.16100 160.45100 112.13900 1.000 59.31000  ? 371 GLN C CG    1 
ATOM   6499  C  CD    . GLN C 1 126 ? 112.69400 159.34400 111.25000 1.000 59.31000  ? 371 GLN C CD    1 
ATOM   6500  O  OE1   . GLN C 1 126 ? 111.92700 158.59300 110.64900 1.000 59.31000  ? 371 GLN C OE1   1 
ATOM   6501  N  NE2   . GLN C 1 126 ? 114.01500 159.23900 111.16200 1.000 59.31000  ? 371 GLN C NE2   1 
ATOM   6502  N  N     . PRO C 1 127 ? 113.34000 158.78900 115.50800 1.000 59.40000  ? 372 PRO C N     1 
ATOM   6503  C  CA    . PRO C 1 127 ? 114.34500 159.34300 116.42000 1.000 59.40000  ? 372 PRO C CA    1 
ATOM   6504  C  C     . PRO C 1 127 ? 115.27900 160.29200 115.68900 1.000 59.40000  ? 372 PRO C C     1 
ATOM   6505  O  O     . PRO C 1 127 ? 115.66700 160.05000 114.54400 1.000 59.40000  ? 372 PRO C O     1 
ATOM   6506  C  CB    . PRO C 1 127 ? 115.08600 158.10100 116.92600 1.000 59.40000  ? 372 PRO C CB    1 
ATOM   6507  C  CG    . PRO C 1 127 ? 114.92500 157.10900 115.83200 1.000 59.40000  ? 372 PRO C CG    1 
ATOM   6508  C  CD    . PRO C 1 127 ? 113.56600 157.36000 115.24000 1.000 59.40000  ? 372 PRO C CD    1 
ATOM   6509  N  N     . ALA C 1 128 ? 115.62800 161.38600 116.36100 1.000 59.74000  ? 373 ALA C N     1 
ATOM   6510  C  CA    . ALA C 1 128 ? 116.52600 162.36900 115.77700 1.000 59.74000  ? 373 ALA C CA    1 
ATOM   6511  C  C     . ALA C 1 128 ? 117.86000 161.72500 115.41300 1.000 59.74000  ? 373 ALA C C     1 
ATOM   6512  O  O     . ALA C 1 128 ? 118.26500 160.70600 115.97800 1.000 59.74000  ? 373 ALA C O     1 
ATOM   6513  C  CB    . ALA C 1 128 ? 116.74900 163.53300 116.74100 1.000 59.74000  ? 373 ALA C CB    1 
ATOM   6514  N  N     . ALA C 1 129 ? 118.53900 162.33000 114.44100 1.000 58.24000  ? 374 ALA C N     1 
ATOM   6515  C  CA    . ALA C 1 129 ? 119.80800 161.79300 113.97200 1.000 58.24000  ? 374 ALA C CA    1 
ATOM   6516  C  C     . ALA C 1 129 ? 120.81600 161.72700 115.11100 1.000 58.24000  ? 374 ALA C C     1 
ATOM   6517  O  O     . ALA C 1 129 ? 120.96200 162.67200 115.89100 1.000 58.24000  ? 374 ALA C O     1 
ATOM   6518  C  CB    . ALA C 1 129 ? 120.35300 162.64800 112.83000 1.000 58.24000  ? 374 ALA C CB    1 
ATOM   6519  N  N     . GLY C 1 130 ? 121.51400 160.59800 115.20200 1.000 57.98000  ? 375 GLY C N     1 
ATOM   6520  C  CA    . GLY C 1 130 ? 122.45500 160.35500 116.27200 1.000 57.98000  ? 375 GLY C CA    1 
ATOM   6521  C  C     . GLY C 1 130 ? 121.90100 159.57400 117.44100 1.000 57.98000  ? 375 GLY C C     1 
ATOM   6522  O  O     . GLY C 1 130 ? 122.64100 159.31800 118.39800 1.000 57.98000  ? 375 GLY C O     1 
ATOM   6523  N  N     . VAL C 1 131 ? 120.63100 159.19000 117.39700 1.000 59.30000  ? 376 VAL C N     1 
ATOM   6524  C  CA    . VAL C 1 131 ? 119.98900 158.45000 118.47600 1.000 59.30000  ? 376 VAL C CA    1 
ATOM   6525  C  C     . VAL C 1 131 ? 119.92300 156.99000 118.04500 1.000 59.30000  ? 376 VAL C C     1 
ATOM   6526  O  O     . VAL C 1 131 ? 119.07000 156.60300 117.24300 1.000 59.30000  ? 376 VAL C O     1 
ATOM   6527  C  CB    . VAL C 1 131 ? 118.60200 159.00900 118.80000 1.000 59.30000  ? 376 VAL C CB    1 
ATOM   6528  C  CG1   . VAL C 1 131 ? 117.91700 158.14500 119.84100 1.000 59.30000  ? 376 VAL C CG1   1 
ATOM   6529  C  CG2   . VAL C 1 131 ? 118.71500 160.44400 119.28600 1.000 59.30000  ? 376 VAL C CG2   1 
ATOM   6530  N  N     . LYS C 1 132 ? 120.83800 156.17900 118.56700 1.000 60.05000  ? 377 LYS C N     1 
ATOM   6531  C  CA    . LYS C 1 132 ? 120.82100 154.75300 118.28400 1.000 60.05000  ? 377 LYS C CA    1 
ATOM   6532  C  C     . LYS C 1 132 ? 119.58100 154.10300 118.88500 1.000 60.05000  ? 377 LYS C C     1 
ATOM   6533  O  O     . LYS C 1 132 ? 119.02500 154.57300 119.88000 1.000 60.05000  ? 377 LYS C O     1 
ATOM   6534  C  CB    . LYS C 1 132 ? 122.08000 154.08300 118.82900 1.000 60.05000  ? 377 LYS C CB    1 
ATOM   6535  C  CG    . LYS C 1 132 ? 123.35500 154.48900 118.11300 1.000 60.05000  ? 377 LYS C CG    1 
ATOM   6536  C  CD    . LYS C 1 132 ? 124.53400 153.63800 118.55300 1.000 60.05000  ? 377 LYS C CD    1 
ATOM   6537  C  CE    . LYS C 1 132 ? 125.02200 154.03000 119.93200 1.000 60.05000  ? 377 LYS C CE    1 
ATOM   6538  N  NZ    . LYS C 1 132 ? 126.24800 153.27600 120.30600 1.000 60.05000  ? 377 LYS C NZ    1 
ATOM   6539  N  N     . VAL C 1 133 ? 119.14700 153.00600 118.26300 1.000 59.15000  ? 378 VAL C N     1 
ATOM   6540  C  CA    . VAL C 1 133 ? 117.94200 152.32200 118.72400 1.000 59.15000  ? 378 VAL C CA    1 
ATOM   6541  C  C     . VAL C 1 133 ? 118.15600 151.74000 120.11400 1.000 59.15000  ? 378 VAL C C     1 
ATOM   6542  O  O     . VAL C 1 133 ? 117.23900 151.72900 120.94500 1.000 59.15000  ? 378 VAL C O     1 
ATOM   6543  C  CB    . VAL C 1 133 ? 117.52500 151.23800 117.71600 1.000 59.15000  ? 378 VAL C CB    1 
ATOM   6544  C  CG1   . VAL C 1 133 ? 116.31200 150.48300 118.22300 1.000 59.15000  ? 378 VAL C CG1   1 
ATOM   6545  C  CG2   . VAL C 1 133 ? 117.23600 151.86200 116.37500 1.000 59.15000  ? 378 VAL C CG2   1 
ATOM   6546  N  N     . SER C 1 134 ? 119.36800 151.25000 120.39000 1.000 61.73000  ? 379 SER C N     1 
ATOM   6547  C  CA    . SER C 1 134 ? 119.64100 150.64700 121.69000 1.000 61.73000  ? 379 SER C CA    1 
ATOM   6548  C  C     . SER C 1 134 ? 119.38500 151.62500 122.82900 1.000 61.73000  ? 379 SER C C     1 
ATOM   6549  O  O     . SER C 1 134 ? 118.96700 151.21100 123.91600 1.000 61.73000  ? 379 SER C O     1 
ATOM   6550  C  CB    . SER C 1 134 ? 121.08100 150.14000 121.74100 1.000 61.73000  ? 379 SER C CB    1 
ATOM   6551  O  OG    . SER C 1 134 ? 121.99400 151.21900 121.68200 1.000 61.73000  ? 379 SER C OG    1 
ATOM   6552  N  N     . ARG C 1 135 ? 119.61000 152.92100 122.59800 1.000 61.34000  ? 380 ARG C N     1 
ATOM   6553  C  CA    . ARG C 1 135 ? 119.25000 153.91500 123.60300 1.000 61.34000  ? 380 ARG C CA    1 
ATOM   6554  C  C     . ARG C 1 135 ? 117.75200 153.90200 123.86900 1.000 61.34000  ? 380 ARG C C     1 
ATOM   6555  O  O     . ARG C 1 135 ? 117.31400 154.06800 125.01300 1.000 61.34000  ? 380 ARG C O     1 
ATOM   6556  C  CB    . ARG C 1 135 ? 119.69900 155.30600 123.16000 1.000 61.34000  ? 380 ARG C CB    1 
ATOM   6557  C  CG    . ARG C 1 135 ? 121.20100 155.49400 123.11000 1.000 61.34000  ? 380 ARG C CG    1 
ATOM   6558  C  CD    . ARG C 1 135 ? 121.54700 156.90400 122.67700 1.000 61.34000  ? 380 ARG C CD    1 
ATOM   6559  N  NE    . ARG C 1 135 ? 121.10800 157.88500 123.66300 1.000 61.34000  ? 380 ARG C NE    1 
ATOM   6560  C  CZ    . ARG C 1 135 ? 121.13600 159.19900 123.47300 1.000 61.34000  ? 380 ARG C CZ    1 
ATOM   6561  N  NH1   . ARG C 1 135 ? 121.58700 159.69500 122.33100 1.000 61.34000  ? 380 ARG C NH1   1 
ATOM   6562  N  NH2   . ARG C 1 135 ? 120.71400 160.01700 124.42700 1.000 61.34000  ? 380 ARG C NH2   1 
ATOM   6563  N  N     . ILE C 1 136 ? 116.94900 153.70900 122.82300 1.000 58.34000  ? 381 ILE C N     1 
ATOM   6564  C  CA    . ILE C 1 136 ? 115.50900 153.59300 123.01200 1.000 58.34000  ? 381 ILE C CA    1 
ATOM   6565  C  C     . ILE C 1 136 ? 115.14600 152.20300 123.52000 1.000 58.34000  ? 381 ILE C C     1 
ATOM   6566  O  O     . ILE C 1 136 ? 114.20400 152.05100 124.30700 1.000 58.34000  ? 381 ILE C O     1 
ATOM   6567  C  CB    . ILE C 1 136 ? 114.77100 153.92300 121.70300 1.000 58.34000  ? 381 ILE C CB    1 
ATOM   6568  C  CG1   . ILE C 1 136 ? 115.06800 155.35600 121.26600 1.000 58.34000  ? 381 ILE C CG1   1 
ATOM   6569  C  CG2   . ILE C 1 136 ? 113.27500 153.74500 121.86800 1.000 58.34000  ? 381 ILE C CG2   1 
ATOM   6570  C  CD1   . ILE C 1 136 ? 114.58500 155.67200 119.86900 1.000 58.34000  ? 381 ILE C CD1   1 
ATOM   6571  N  N     . SER C 1 137 ? 115.88800 151.17600 123.09900 1.000 57.33000  ? 382 SER C N     1 
ATOM   6572  C  CA    . SER C 1 137 ? 115.54900 149.80800 123.47800 1.000 57.33000  ? 382 SER C CA    1 
ATOM   6573  C  C     . SER C 1 137 ? 115.73100 149.57900 124.97300 1.000 57.33000  ? 382 SER C C     1 
ATOM   6574  O  O     . SER C 1 137 ? 114.86000 148.99400 125.62500 1.000 57.33000  ? 382 SER C O     1 
ATOM   6575  C  CB    . SER C 1 137 ? 116.39500 148.81900 122.67800 1.000 57.33000  ? 382 SER C CB    1 
ATOM   6576  O  OG    . SER C 1 137 ? 116.10400 147.48500 123.05200 1.000 57.33000  ? 382 SER C OG    1 
ATOM   6577  N  N     . ASN C 1 138 ? 116.85300 150.03300 125.53500 1.000 58.76000  ? 383 ASN C N     1 
ATOM   6578  C  CA    . ASN C 1 138 ? 117.12000 149.83000 126.95600 1.000 58.76000  ? 383 ASN C CA    1 
ATOM   6579  C  C     . ASN C 1 138 ? 116.17800 150.60900 127.86500 1.000 58.76000  ? 383 ASN C C     1 
ATOM   6580  O  O     . ASN C 1 138 ? 116.29100 150.47700 129.08800 1.000 58.76000  ? 383 ASN C O     1 
ATOM   6581  C  CB    . ASN C 1 138 ? 118.56600 150.20600 127.28300 1.000 58.76000  ? 383 ASN C CB    1 
ATOM   6582  C  CG    . ASN C 1 138 ? 119.57200 149.28200 126.62400 1.000 58.76000  ? 383 ASN C CG    1 
ATOM   6583  O  OD1   . ASN C 1 138 ? 120.35900 149.70400 125.77700 1.000 58.76000  ? 383 ASN C OD1   1 
ATOM   6584  N  ND2   . ASN C 1 138 ? 119.55400 148.01400 127.01400 1.000 58.76000  ? 383 ASN C ND2   1 
ATOM   6585  N  N     . LEU C 1 139 ? 115.26400 151.40900 127.31700 1.000 56.81000  ? 384 LEU C N     1 
ATOM   6586  C  CA    . LEU C 1 139 ? 114.30500 152.17100 128.10500 1.000 56.81000  ? 384 LEU C CA    1 
ATOM   6587  C  C     . LEU C 1 139 ? 112.91200 151.55200 128.08400 1.000 56.81000  ? 384 LEU C C     1 
ATOM   6588  O  O     . LEU C 1 139 ? 111.92600 152.25200 128.33800 1.000 56.81000  ? 384 LEU C O     1 
ATOM   6589  C  CB    . LEU C 1 139 ? 114.24500 153.61300 127.60700 1.000 56.81000  ? 384 LEU C CB    1 
ATOM   6590  C  CG    . LEU C 1 139 ? 115.52600 154.42400 127.78500 1.000 56.81000  ? 384 LEU C CG    1 
ATOM   6591  C  CD1   . LEU C 1 139 ? 115.39900 155.76800 127.09900 1.000 56.81000  ? 384 LEU C CD1   1 
ATOM   6592  C  CD2   . LEU C 1 139 ? 115.83500 154.60000 129.25700 1.000 56.81000  ? 384 LEU C CD2   1 
ATOM   6593  N  N     . ALA C 1 140 ? 112.81300 150.25900 127.77500 1.000 53.68000  ? 385 ALA C N     1 
ATOM   6594  C  CA    . ALA C 1 140 ? 111.50800 149.61300 127.69100 1.000 53.68000  ? 385 ALA C CA    1 
ATOM   6595  C  C     . ALA C 1 140 ? 110.83300 149.55100 129.05400 1.000 53.68000  ? 385 ALA C C     1 
ATOM   6596  O  O     . ALA C 1 140 ? 109.67400 149.95700 129.20400 1.000 53.68000  ? 385 ALA C O     1 
ATOM   6597  C  CB    . ALA C 1 140 ? 111.65600 148.21300 127.09700 1.000 53.68000  ? 385 ALA C CB    1 
ATOM   6598  N  N     . LYS C 1 141 ? 111.53900 149.03300 130.05900 1.000 54.40000  ? 386 LYS C N     1 
ATOM   6599  C  CA    . LYS C 1 141 ? 111.00000 148.89600 131.40600 1.000 54.40000  ? 386 LYS C CA    1 
ATOM   6600  C  C     . LYS C 1 141 ? 110.74300 150.23800 132.07700 1.000 54.40000  ? 386 LYS C C     1 
ATOM   6601  O  O     . LYS C 1 141 ? 110.18300 150.26700 133.17800 1.000 54.40000  ? 386 LYS C O     1 
ATOM   6602  C  CB    . LYS C 1 141 ? 111.94800 148.06000 132.26900 1.000 54.40000  ? 386 LYS C CB    1 
ATOM   6603  C  CG    . LYS C 1 141 ? 112.20800 146.66000 131.73500 1.000 54.40000  ? 386 LYS C CG    1 
ATOM   6604  C  CD    . LYS C 1 141 ? 110.93300 145.84100 131.66000 1.000 54.40000  ? 386 LYS C CD    1 
ATOM   6605  C  CE    . LYS C 1 141 ? 110.39900 145.51800 133.04200 1.000 54.40000  ? 386 LYS C CE    1 
ATOM   6606  N  NZ    . LYS C 1 141 ? 111.32300 144.63500 133.80000 1.000 54.40000  ? 386 LYS C NZ    1 
ATOM   6607  N  N     . ASP C 1 142 ? 111.13700 151.34200 131.44500 1.000 56.25000  ? 387 ASP C N     1 
ATOM   6608  C  CA    . ASP C 1 142 ? 110.87100 152.68300 131.94900 1.000 56.25000  ? 387 ASP C CA    1 
ATOM   6609  C  C     . ASP C 1 142 ? 109.70400 153.33900 131.22700 1.000 56.25000  ? 387 ASP C C     1 
ATOM   6610  O  O     . ASP C 1 142 ? 108.82900 153.92900 131.86900 1.000 56.25000  ? 387 ASP C O     1 
ATOM   6611  C  CB    . ASP C 1 142 ? 112.12500 153.55100 131.81600 1.000 56.25000  ? 387 ASP C CB    1 
ATOM   6612  C  CG    . ASP C 1 142 ? 113.24000 153.09200 132.72300 1.000 56.25000  ? 387 ASP C CG    1 
ATOM   6613  O  OD1   . ASP C 1 142 ? 112.93400 152.52400 133.78900 1.000 56.25000  ? 387 ASP C OD1   1 
ATOM   6614  O  OD2   . ASP C 1 142 ? 114.42000 153.29200 132.36900 1.000 56.25000  ? 387 ASP C OD2   1 
ATOM   6615  N  N     . LEU C 1 143 ? 109.67700 153.25200 129.89600 1.000 52.30000  ? 388 LEU C N     1 
ATOM   6616  C  CA    . LEU C 1 143 ? 108.49400 153.67100 129.15400 1.000 52.30000  ? 388 LEU C CA    1 
ATOM   6617  C  C     . LEU C 1 143 ? 107.26800 152.89000 129.59800 1.000 52.30000  ? 388 LEU C C     1 
ATOM   6618  O  O     . LEU C 1 143 ? 106.13800 153.37800 129.49100 1.000 52.30000  ? 388 LEU C O     1 
ATOM   6619  C  CB    . LEU C 1 143 ? 108.72100 153.49700 127.65300 1.000 52.30000  ? 388 LEU C CB    1 
ATOM   6620  C  CG    . LEU C 1 143 ? 109.75700 154.41200 127.01100 1.000 52.30000  ? 388 LEU C CG    1 
ATOM   6621  C  CD1   . LEU C 1 143 ? 109.98300 154.01000 125.56800 1.000 52.30000  ? 388 LEU C CD1   1 
ATOM   6622  C  CD2   . LEU C 1 143 ? 109.30400 155.85300 127.09900 1.000 52.30000  ? 388 LEU C CD2   1 
ATOM   6623  N  N     . ALA C 1 144 ? 107.47000 151.66700 130.09000 1.000 51.71000  ? 389 ALA C N     1 
ATOM   6624  C  CA    . ALA C 1 144 ? 106.35900 150.87400 130.59900 1.000 51.71000  ? 389 ALA C CA    1 
ATOM   6625  C  C     . ALA C 1 144 ? 105.63200 151.60700 131.71800 1.000 51.71000  ? 389 ALA C C     1 
ATOM   6626  O  O     . ALA C 1 144 ? 104.42100 151.84200 131.64200 1.000 51.71000  ? 389 ALA C O     1 
ATOM   6627  C  CB    . ALA C 1 144 ? 106.86700 149.51500 131.07900 1.000 51.71000  ? 389 ALA C CB    1 
ATOM   6628  N  N     . ARG C 1 145 ? 106.36000 151.98500 132.76900 1.000 55.21000  ? 390 ARG C N     1 
ATOM   6629  C  CA    . ARG C 1 145 ? 105.72100 152.69300 133.87000 1.000 55.21000  ? 390 ARG C CA    1 
ATOM   6630  C  C     . ARG C 1 145 ? 105.39600 154.13600 133.51400 1.000 55.21000  ? 390 ARG C C     1 
ATOM   6631  O  O     . ARG C 1 145 ? 104.45400 154.70000 134.07800 1.000 55.21000  ? 390 ARG C O     1 
ATOM   6632  C  CB    . ARG C 1 145 ? 106.60300 152.66200 135.11700 1.000 55.21000  ? 390 ARG C CB    1 
ATOM   6633  C  CG    . ARG C 1 145 ? 107.88000 153.46100 134.98600 1.000 55.21000  ? 390 ARG C CG    1 
ATOM   6634  C  CD    . ARG C 1 145 ? 108.65800 153.47200 136.28200 1.000 55.21000  ? 390 ARG C CD    1 
ATOM   6635  N  NE    . ARG C 1 145 ? 109.90600 154.21100 136.14300 1.000 55.21000  ? 390 ARG C NE    1 
ATOM   6636  C  CZ    . ARG C 1 145 ? 110.01200 155.52500 136.29400 1.000 55.21000  ? 390 ARG C CZ    1 
ATOM   6637  N  NH1   . ARG C 1 145 ? 108.94000 156.24700 136.58700 1.000 55.21000  ? 390 ARG C NH1   1 
ATOM   6638  N  NH2   . ARG C 1 145 ? 111.18700 156.12000 136.14900 1.000 55.21000  ? 390 ARG C NH2   1 
ATOM   6639  N  N     . SER C 1 146 ? 106.13800 154.74300 132.58800 1.000 55.97000  ? 391 SER C N     1 
ATOM   6640  C  CA    . SER C 1 146 ? 105.85000 156.12100 132.20600 1.000 55.97000  ? 391 SER C CA    1 
ATOM   6641  C  C     . SER C 1 146 ? 104.48900 156.22400 131.53200 1.000 55.97000  ? 391 SER C C     1 
ATOM   6642  O  O     . SER C 1 146 ? 103.67900 157.09200 131.87500 1.000 55.97000  ? 391 SER C O     1 
ATOM   6643  C  CB    . SER C 1 146 ? 106.95400 156.65200 131.29200 1.000 55.97000  ? 391 SER C CB    1 
ATOM   6644  O  OG    . SER C 1 146 ? 108.19300 156.69500 131.97600 1.000 55.97000  ? 391 SER C OG    1 
ATOM   6645  N  N     . LEU C 1 147 ? 104.21800 155.34200 130.57700 1.000 52.17000  ? 392 LEU C N     1 
ATOM   6646  C  CA    . LEU C 1 147 ? 102.93700 155.32000 129.88600 1.000 52.17000  ? 392 LEU C CA    1 
ATOM   6647  C  C     . LEU C 1 147 ? 101.87400 154.52600 130.63400 1.000 52.17000  ? 392 LEU C C     1 
ATOM   6648  O  O     . LEU C 1 147 ? 100.78900 154.31300 130.08500 1.000 52.17000  ? 392 LEU C O     1 
ATOM   6649  C  CB    . LEU C 1 147 ? 103.11300 154.74700 128.47700 1.000 52.17000  ? 392 LEU C CB    1 
ATOM   6650  C  CG    . LEU C 1 147 ? 103.69300 155.66500 127.39900 1.000 52.17000  ? 392 LEU C CG    1 
ATOM   6651  C  CD1   . LEU C 1 147 ? 105.17100 155.91900 127.61900 1.000 52.17000  ? 392 LEU C CD1   1 
ATOM   6652  C  CD2   . LEU C 1 147 ? 103.46500 155.06300 126.02800 1.000 52.17000  ? 392 LEU C CD2   1 
ATOM   6653  N  N     . ALA C 1 148 ? 102.17500 154.06700 131.85100 1.000 50.66000  ? 393 ALA C N     1 
ATOM   6654  C  CA    . ALA C 1 148 ? 101.21900 153.39100 132.72400 1.000 50.66000  ? 393 ALA C CA    1 
ATOM   6655  C  C     . ALA C 1 148 ? 100.73500 152.06200 132.15400 1.000 50.66000  ? 393 ALA C C     1 
ATOM   6656  O  O     . ALA C 1 148 ? 99.89300  151.39400 132.76000 1.000 50.66000  ? 393 ALA C O     1 
ATOM   6657  C  CB    . ALA C 1 148 ? 100.02500 154.30200 133.01600 1.000 50.66000  ? 393 ALA C CB    1 
ATOM   6658  N  N     . VAL C 1 149 ? 101.25700 151.67100 130.99400 1.000 48.88000  ? 394 VAL C N     1 
ATOM   6659  C  CA    . VAL C 1 149 ? 100.85700 150.43600 130.33000 1.000 48.88000  ? 394 VAL C CA    1 
ATOM   6660  C  C     . VAL C 1 149 ? 101.61900 149.25200 130.90900 1.000 48.88000  ? 394 VAL C C     1 
ATOM   6661  O  O     . VAL C 1 149 ? 102.58500 149.42600 131.65900 1.000 48.88000  ? 394 VAL C O     1 
ATOM   6662  C  CB    . VAL C 1 149 ? 101.06500 150.53900 128.81400 1.000 48.88000  ? 394 VAL C CB    1 
ATOM   6663  C  CG1   . VAL C 1 149 ? 100.21500 151.66100 128.26500 1.000 48.88000  ? 394 VAL C CG1   1 
ATOM   6664  C  CG2   . VAL C 1 149 ? 102.52800 150.77300 128.50700 1.000 48.88000  ? 394 VAL C CG2   1 
ATOM   6665  N  N     . ILE C 1 150 ? 101.17800 148.04000 130.56800 1.000 46.59000  ? 395 ILE C N     1 
ATOM   6666  C  CA    . ILE C 1 150 ? 101.77400 146.83000 131.13100 1.000 46.59000  ? 395 ILE C CA    1 
ATOM   6667  C  C     . ILE C 1 150 ? 103.24700 146.73100 130.75600 1.000 46.59000  ? 395 ILE C C     1 
ATOM   6668  O  O     . ILE C 1 150 ? 104.12500 146.67400 131.62400 1.000 46.59000  ? 395 ILE C O     1 
ATOM   6669  C  CB    . ILE C 1 150 ? 100.99700 145.58500 130.67200 1.000 46.59000  ? 395 ILE C CB    1 
ATOM   6670  C  CG1   . ILE C 1 150 ? 99.56500  145.62800 131.20300 1.000 46.59000  ? 395 ILE C CG1   1 
ATOM   6671  C  CG2   . ILE C 1 150 ? 101.70900 144.32200 131.12400 1.000 46.59000  ? 395 ILE C CG2   1 
ATOM   6672  C  CD1   . ILE C 1 150 ? 98.65500  144.59700 130.57900 1.000 46.59000  ? 395 ILE C CD1   1 
ATOM   6673  N  N     . SER C 1 151 ? 103.54200 146.70600 129.45800 1.000 44.31000  ? 396 SER C N     1 
ATOM   6674  C  CA    . SER C 1 151 ? 104.91100 146.48100 129.01300 1.000 44.31000  ? 396 SER C CA    1 
ATOM   6675  C  C     . SER C 1 151 ? 105.09800 147.03600 127.61200 1.000 44.31000  ? 396 SER C C     1 
ATOM   6676  O  O     . SER C 1 151 ? 104.33700 146.69600 126.70200 1.000 44.31000  ? 396 SER C O     1 
ATOM   6677  C  CB    . SER C 1 151 ? 105.25200 144.99100 129.03000 1.000 44.31000  ? 396 SER C CB    1 
ATOM   6678  O  OG    . SER C 1 151 ? 104.49200 144.29700 128.05700 1.000 44.31000  ? 396 SER C OG    1 
ATOM   6679  N  N     . VAL C 1 152 ? 106.10900 147.87700 127.44700 1.000 43.62000  ? 397 VAL C N     1 
ATOM   6680  C  CA    . VAL C 1 152 ? 106.49500 148.39500 126.14100 1.000 43.62000  ? 397 VAL C CA    1 
ATOM   6681  C  C     . VAL C 1 152 ? 107.37700 147.37000 125.44000 1.000 43.62000  ? 397 VAL C C     1 
ATOM   6682  O  O     . VAL C 1 152 ? 108.06900 146.57400 126.08200 1.000 43.62000  ? 397 VAL C O     1 
ATOM   6683  C  CB    . VAL C 1 152 ? 107.20900 149.75100 126.31300 1.000 43.62000  ? 397 VAL C CB    1 
ATOM   6684  C  CG1   . VAL C 1 152 ? 107.72300 150.28400 124.99400 1.000 43.62000  ? 397 VAL C CG1   1 
ATOM   6685  C  CG2   . VAL C 1 152 ? 106.27400 150.75200 126.95900 1.000 43.62000  ? 397 VAL C CG2   1 
ATOM   6686  N  N     . ARG C 1 153 ? 107.35700 147.37900 124.10700 1.000 44.63000  ? 398 ARG C N     1 
ATOM   6687  C  CA    . ARG C 1 153 ? 108.17900 146.45200 123.33100 1.000 44.63000  ? 398 ARG C CA    1 
ATOM   6688  C  C     . ARG C 1 153 ? 108.64700 147.17900 122.07400 1.000 44.63000  ? 398 ARG C C     1 
ATOM   6689  O  O     . ARG C 1 153 ? 107.88400 147.31500 121.11500 1.000 44.63000  ? 398 ARG C O     1 
ATOM   6690  C  CB    . ARG C 1 153 ? 107.41200 145.18600 122.98600 1.000 44.63000  ? 398 ARG C CB    1 
ATOM   6691  C  CG    . ARG C 1 153 ? 108.25700 144.17000 122.24900 1.000 44.63000  ? 398 ARG C CG    1 
ATOM   6692  C  CD    . ARG C 1 153 ? 107.48400 142.90900 121.92800 1.000 44.63000  ? 398 ARG C CD    1 
ATOM   6693  N  NE    . ARG C 1 153 ? 108.33600 141.91700 121.28200 1.000 44.63000  ? 398 ARG C NE    1 
ATOM   6694  C  CZ    . ARG C 1 153 ? 108.53100 141.84000 119.97000 1.000 44.63000  ? 398 ARG C CZ    1 
ATOM   6695  N  NH1   . ARG C 1 153 ? 107.93400 142.70000 119.15800 1.000 44.63000  ? 398 ARG C NH1   1 
ATOM   6696  N  NH2   . ARG C 1 153 ? 109.32500 140.90300 119.47100 1.000 44.63000  ? 398 ARG C NH2   1 
ATOM   6697  N  N     . VAL C 1 154 ? 109.90000 147.63000 122.08600 1.000 47.20000  ? 399 VAL C N     1 
ATOM   6698  C  CA    . VAL C 1 154 ? 110.44700 148.36500 120.95300 1.000 47.20000  ? 399 VAL C CA    1 
ATOM   6699  C  C     . VAL C 1 154 ? 110.76800 147.40200 119.82000 1.000 47.20000  ? 399 VAL C C     1 
ATOM   6700  O  O     . VAL C 1 154 ? 111.39900 146.35900 120.02800 1.000 47.20000  ? 399 VAL C O     1 
ATOM   6701  C  CB    . VAL C 1 154 ? 111.69300 149.15200 121.38100 1.000 47.20000  ? 399 VAL C CB    1 
ATOM   6702  C  CG1   . VAL C 1 154 ? 112.33800 149.81400 120.18500 1.000 47.20000  ? 399 VAL C CG1   1 
ATOM   6703  C  CG2   . VAL C 1 154 ? 111.32800 150.18700 122.42800 1.000 47.20000  ? 399 VAL C CG2   1 
ATOM   6704  N  N     . VAL C 1 155 ? 110.33700 147.75100 118.61100 1.000 52.74000  ? 400 VAL C N     1 
ATOM   6705  C  CA    . VAL C 1 155 ? 110.64900 146.99800 117.40100 1.000 52.74000  ? 400 VAL C CA    1 
ATOM   6706  C  C     . VAL C 1 155 ? 111.68300 147.79200 116.61800 1.000 52.74000  ? 400 VAL C C     1 
ATOM   6707  O  O     . VAL C 1 155 ? 111.41400 148.91900 116.18800 1.000 52.74000  ? 400 VAL C O     1 
ATOM   6708  C  CB    . VAL C 1 155 ? 109.39600 146.73400 116.55500 1.000 52.74000  ? 400 VAL C CB    1 
ATOM   6709  C  CG1   . VAL C 1 155 ? 109.77800 146.06700 115.24800 1.000 52.74000  ? 400 VAL C CG1   1 
ATOM   6710  C  CG2   . VAL C 1 155 ? 108.41400 145.87600 117.32800 1.000 52.74000  ? 400 VAL C CG2   1 
ATOM   6711  N  N     . GLU C 1 156 ? 112.86200 147.19900 116.42200 1.000 61.93000  ? 401 GLU C N     1 
ATOM   6712  C  CA    . GLU C 1 156 ? 113.99600 147.95800 115.90700 1.000 61.93000  ? 401 GLU C CA    1 
ATOM   6713  C  C     . GLU C 1 156 ? 113.82800 148.33900 114.44100 1.000 61.93000  ? 401 GLU C C     1 
ATOM   6714  O  O     . GLU C 1 156 ? 114.31100 149.39800 114.02500 1.000 61.93000  ? 401 GLU C O     1 
ATOM   6715  C  CB    . GLU C 1 156 ? 115.29000 147.16300 116.08800 1.000 61.93000  ? 401 GLU C CB    1 
ATOM   6716  C  CG    . GLU C 1 156 ? 115.73000 146.97700 117.53200 1.000 61.93000  ? 401 GLU C CG    1 
ATOM   6717  C  CD    . GLU C 1 156 ? 115.07000 145.79000 118.20200 1.000 61.93000  ? 401 GLU C CD    1 
ATOM   6718  O  OE1   . GLU C 1 156 ? 114.31900 145.06100 117.52000 1.000 61.93000  ? 401 GLU C OE1   1 
ATOM   6719  O  OE2   . GLU C 1 156 ? 115.30400 145.58300 119.41100 1.000 61.93000  ? 401 GLU C OE2   1 
ATOM   6720  N  N     . VAL C 1 157 ? 113.16400 147.50800 113.64400 1.000 63.25000  ? 402 VAL C N     1 
ATOM   6721  C  CA    . VAL C 1 157 ? 113.12400 147.69800 112.19800 1.000 63.25000  ? 402 VAL C CA    1 
ATOM   6722  C  C     . VAL C 1 157 ? 111.68100 147.61800 111.72200 1.000 63.25000  ? 402 VAL C C     1 
ATOM   6723  O  O     . VAL C 1 157 ? 111.00100 146.61100 111.95200 1.000 63.25000  ? 402 VAL C O     1 
ATOM   6724  C  CB    . VAL C 1 157 ? 113.98700 146.66300 111.45600 1.000 63.25000  ? 402 VAL C CB    1 
ATOM   6725  C  CG1   . VAL C 1 157 ? 113.82700 146.81900 109.95200 1.000 63.25000  ? 402 VAL C CG1   1 
ATOM   6726  C  CG2   . VAL C 1 157 ? 115.44600 146.80500 111.85000 1.000 63.25000  ? 402 VAL C CG2   1 
ATOM   6727  N  N     . ILE C 1 158 ? 111.22000 148.67300 111.06100 1.000 62.91000  ? 403 ILE C N     1 
ATOM   6728  C  CA    . ILE C 1 158 ? 109.99000 148.66800 110.28100 1.000 62.91000  ? 403 ILE C CA    1 
ATOM   6729  C  C     . ILE C 1 158 ? 110.39300 148.68900 108.80800 1.000 62.91000  ? 403 ILE C C     1 
ATOM   6730  O  O     . ILE C 1 158 ? 110.92300 149.70200 108.32900 1.000 62.91000  ? 403 ILE C O     1 
ATOM   6731  C  CB    . ILE C 1 158 ? 109.08400 149.85500 110.63200 1.000 62.91000  ? 403 ILE C CB    1 
ATOM   6732  C  CG1   . ILE C 1 158 ? 108.60700 149.74100 112.07900 1.000 62.91000  ? 403 ILE C CG1   1 
ATOM   6733  C  CG2   . ILE C 1 158 ? 107.90100 149.92200 109.68200 1.000 62.91000  ? 403 ILE C CG2   1 
ATOM   6734  C  CD1   . ILE C 1 158 ? 107.92000 150.97800 112.59200 1.000 62.91000  ? 403 ILE C CD1   1 
ATOM   6735  N  N     . PRO C 1 159 ? 110.16900 147.61100 108.05800 1.000 64.15000  ? 404 PRO C N     1 
ATOM   6736  C  CA    . PRO C 1 159 ? 110.79700 147.48400 106.73600 1.000 64.15000  ? 404 PRO C CA    1 
ATOM   6737  C  C     . PRO C 1 159 ? 110.31000 148.54500 105.76200 1.000 64.15000  ? 404 PRO C C     1 
ATOM   6738  O  O     . PRO C 1 159 ? 109.11000 148.80200 105.64100 1.000 64.15000  ? 404 PRO C O     1 
ATOM   6739  C  CB    . PRO C 1 159 ? 110.39000 146.07600 106.28900 1.000 64.15000  ? 404 PRO C CB    1 
ATOM   6740  C  CG    . PRO C 1 159 ? 109.12600 145.80200 107.02500 1.000 64.15000  ? 404 PRO C CG    1 
ATOM   6741  C  CD    . PRO C 1 159 ? 109.26800 146.48500 108.35600 1.000 64.15000  ? 404 PRO C CD    1 
ATOM   6742  N  N     . GLY C 1 160 ? 111.26100 149.16300 105.06500 1.000 63.48000  ? 405 GLY C N     1 
ATOM   6743  C  CA    . GLY C 1 160 ? 110.97300 150.14900 104.04800 1.000 63.48000  ? 405 GLY C CA    1 
ATOM   6744  C  C     . GLY C 1 160 ? 110.92700 151.58100 104.53600 1.000 63.48000  ? 405 GLY C C     1 
ATOM   6745  O  O     . GLY C 1 160 ? 110.76000 152.48900 103.71300 1.000 63.48000  ? 405 GLY C O     1 
ATOM   6746  N  N     . LYS C 1 161 ? 111.06900 151.81200 105.84000 1.000 62.47000  ? 406 LYS C N     1 
ATOM   6747  C  CA    . LYS C 1 161 ? 110.99500 153.16400 106.37800 1.000 62.47000  ? 406 LYS C CA    1 
ATOM   6748  C  C     . LYS C 1 161 ? 112.17500 153.45700 107.29400 1.000 62.47000  ? 406 LYS C C     1 
ATOM   6749  O  O     . LYS C 1 161 ? 113.09400 152.64000 107.41300 1.000 62.47000  ? 406 LYS C O     1 
ATOM   6750  C  CB    . LYS C 1 161 ? 109.68100 153.36700 107.13000 1.000 62.47000  ? 406 LYS C CB    1 
ATOM   6751  C  CG    . LYS C 1 161 ? 108.45700 153.39400 106.23800 1.000 62.47000  ? 406 LYS C CG    1 
ATOM   6752  C  CD    . LYS C 1 161 ? 107.18300 153.44800 107.05900 1.000 62.47000  ? 406 LYS C CD    1 
ATOM   6753  C  CE    . LYS C 1 161 ? 107.02500 154.79700 107.73900 1.000 62.47000  ? 406 LYS C CE    1 
ATOM   6754  N  NZ    . LYS C 1 161 ? 105.72300 154.91600 108.45000 1.000 62.47000  ? 406 LYS C NZ    1 
ATOM   6755  N  N     . THR C 1 162 ? 112.15400 154.61800 107.94900 1.000 58.05000  ? 407 THR C N     1 
ATOM   6756  C  CA    . THR C 1 162 ? 113.21800 155.03800 108.85300 1.000 58.05000  ? 407 THR C CA    1 
ATOM   6757  C  C     . THR C 1 162 ? 112.68800 155.28900 110.25900 1.000 58.05000  ? 407 THR C C     1 
ATOM   6758  O  O     . THR C 1 162 ? 113.21800 156.12900 110.98700 1.000 58.05000  ? 407 THR C O     1 
ATOM   6759  C  CB    . THR C 1 162 ? 113.91600 156.29100 108.32800 1.000 58.05000  ? 407 THR C CB    1 
ATOM   6760  O  OG1   . THR C 1 162 ? 112.98100 157.37600 108.28800 1.000 58.05000  ? 407 THR C OG1   1 
ATOM   6761  C  CG2   . THR C 1 162 ? 114.45800 156.05400 106.93100 1.000 58.05000  ? 407 THR C CG2   1 
ATOM   6762  N  N     . THR C 1 163 ? 111.64900 154.56400 110.65800 1.000 56.80000  ? 408 THR C N     1 
ATOM   6763  C  CA    . THR C 1 163 ? 110.96800 154.80600 111.92100 1.000 56.80000  ? 408 THR C CA    1 
ATOM   6764  C  C     . THR C 1 163 ? 111.06700 153.57500 112.80800 1.000 56.80000  ? 408 THR C C     1 
ATOM   6765  O  O     . THR C 1 163 ? 110.98100 152.44400 112.32100 1.000 56.80000  ? 408 THR C O     1 
ATOM   6766  C  CB    . THR C 1 163 ? 109.49800 155.16300 111.69200 1.000 56.80000  ? 408 THR C CB    1 
ATOM   6767  O  OG1   . THR C 1 163 ? 108.83600 154.06600 111.05300 1.000 56.80000  ? 408 THR C OG1   1 
ATOM   6768  C  CG2   . THR C 1 163 ? 109.38200 156.39300 110.81200 1.000 56.80000  ? 408 THR C CG2   1 
ATOM   6769  N  N     . VAL C 1 164 ? 111.24700 153.80300 114.10400 1.000 52.35000  ? 409 VAL C N     1 
ATOM   6770  C  CA    . VAL C 1 164 ? 111.24100 152.71700 115.07100 1.000 52.35000  ? 409 VAL C CA    1 
ATOM   6771  C  C     . VAL C 1 164 ? 109.82700 152.54100 115.61800 1.000 52.35000  ? 409 VAL C C     1 
ATOM   6772  O  O     . VAL C 1 164 ? 109.02400 153.47500 115.65000 1.000 52.35000  ? 409 VAL C O     1 
ATOM   6773  C  CB    . VAL C 1 164 ? 112.25700 153.00200 116.19300 1.000 52.35000  ? 409 VAL C CB    1 
ATOM   6774  C  CG1   . VAL C 1 164 ? 112.29800 151.88300 117.21300 1.000 52.35000  ? 409 VAL C CG1   1 
ATOM   6775  C  CG2   . VAL C 1 164 ? 113.63500 153.23400 115.60300 1.000 52.35000  ? 409 VAL C CG2   1 
ATOM   6776  N  N     . GLY C 1 165 ? 109.51100 151.32100 116.04300 1.000 49.19000  ? 410 GLY C N     1 
ATOM   6777  C  CA    . GLY C 1 165 ? 108.18900 151.05200 116.57400 1.000 49.19000  ? 410 GLY C CA    1 
ATOM   6778  C  C     . GLY C 1 165 ? 108.15000 150.93200 118.08300 1.000 49.19000  ? 410 GLY C C     1 
ATOM   6779  O  O     . GLY C 1 165 ? 109.17100 150.65800 118.71800 1.000 49.19000  ? 410 GLY C O     1 
ATOM   6780  N  N     . ILE C 1 166 ? 106.97200 151.14400 118.66700 1.000 47.72000  ? 411 ILE C N     1 
ATOM   6781  C  CA    . ILE C 1 166 ? 106.73100 150.95900 120.09500 1.000 47.72000  ? 411 ILE C CA    1 
ATOM   6782  C  C     . ILE C 1 166 ? 105.34000 150.35800 120.23300 1.000 47.72000  ? 411 ILE C C     1 
ATOM   6783  O  O     . ILE C 1 166 ? 104.34100 151.03700 119.96900 1.000 47.72000  ? 411 ILE C O     1 
ATOM   6784  C  CB    . ILE C 1 166 ? 106.83500 152.26800 120.89000 1.000 47.72000  ? 411 ILE C CB    1 
ATOM   6785  C  CG1   . ILE C 1 166 ? 108.28000 152.76900 120.92200 1.000 47.72000  ? 411 ILE C CG1   1 
ATOM   6786  C  CG2   . ILE C 1 166 ? 106.29100 152.08700 122.29300 1.000 47.72000  ? 411 ILE C CG2   1 
ATOM   6787  C  CD1   . ILE C 1 166 ? 108.42600 154.15100 121.49500 1.000 47.72000  ? 411 ILE C CD1   1 
ATOM   6788  N  N     . GLU C 1 167 ? 105.26600 149.09900 120.64600 1.000 49.28000  ? 412 GLU C N     1 
ATOM   6789  C  CA    . GLU C 1 167 ? 104.02100 148.33600 120.60900 1.000 49.28000  ? 412 GLU C CA    1 
ATOM   6790  C  C     . GLU C 1 167 ? 103.38300 148.34700 121.99300 1.000 49.28000  ? 412 GLU C C     1 
ATOM   6791  O  O     . GLU C 1 167 ? 103.72600 147.53900 122.85800 1.000 49.28000  ? 412 GLU C O     1 
ATOM   6792  C  CB    . GLU C 1 167 ? 104.28400 146.91800 120.11400 1.000 49.28000  ? 412 GLU C CB    1 
ATOM   6793  C  CG    . GLU C 1 167 ? 104.72600 146.87300 118.66100 1.000 49.28000  ? 412 GLU C CG    1 
ATOM   6794  C  CD    . GLU C 1 167 ? 104.99300 145.47000 118.16800 1.000 49.28000  ? 412 GLU C CD    1 
ATOM   6795  O  OE1   . GLU C 1 167 ? 104.96000 144.53100 118.99000 1.000 49.28000  ? 412 GLU C OE1   1 
ATOM   6796  O  OE2   . GLU C 1 167 ? 105.23500 145.30600 116.95600 1.000 49.28000  ? 412 GLU C OE2   1 
ATOM   6797  N  N     . ILE C 1 168 ? 102.44300 149.26500 122.18900 1.000 51.58000  ? 413 ILE C N     1 
ATOM   6798  C  CA    . ILE C 1 168 ? 101.73800 149.41600 123.45700 1.000 51.58000  ? 413 ILE C CA    1 
ATOM   6799  C  C     . ILE C 1 168 ? 100.54600 148.46300 123.45900 1.000 51.58000  ? 413 ILE C C     1 
ATOM   6800  O  O     . ILE C 1 168 ? 99.69900  148.55300 122.55800 1.000 51.58000  ? 413 ILE C O     1 
ATOM   6801  C  CB    . ILE C 1 168 ? 101.27400 150.86200 123.66300 1.000 51.58000  ? 413 ILE C CB    1 
ATOM   6802  C  CG1   . ILE C 1 168 ? 102.47400 151.80100 123.79600 1.000 51.58000  ? 413 ILE C CG1   1 
ATOM   6803  C  CG2   . ILE C 1 168 ? 100.35000 150.96100 124.85400 1.000 51.58000  ? 413 ILE C CG2   1 
ATOM   6804  C  CD1   . ILE C 1 168 ? 103.35000 151.49900 124.97800 1.000 51.58000  ? 413 ILE C CD1   1 
ATOM   6805  N  N     . PRO C 1 169 ? 100.43700 147.56000 124.43000 1.000 53.08000  ? 414 PRO C N     1 
ATOM   6806  C  CA    . PRO C 1 169 ? 99.23100  146.73100 124.52900 1.000 53.08000  ? 414 PRO C CA    1 
ATOM   6807  C  C     . PRO C 1 169 ? 98.01600  147.57300 124.88400 1.000 53.08000  ? 414 PRO C C     1 
ATOM   6808  O  O     . PRO C 1 169 ? 98.12600  148.62900 125.50900 1.000 53.08000  ? 414 PRO C O     1 
ATOM   6809  C  CB    . PRO C 1 169 ? 99.57200  145.74400 125.65100 1.000 53.08000  ? 414 PRO C CB    1 
ATOM   6810  C  CG    . PRO C 1 169 ? 101.05800 145.73200 125.70700 1.000 53.08000  ? 414 PRO C CG    1 
ATOM   6811  C  CD    . PRO C 1 169 ? 101.47600 147.12900 125.37500 1.000 53.08000  ? 414 PRO C CD    1 
ATOM   6812  N  N     . ASN C 1 170 ? 96.84400  147.09300 124.47900 1.000 64.31000  ? 415 ASN C N     1 
ATOM   6813  C  CA    . ASN C 1 170 ? 95.61100  147.77400 124.83500 1.000 64.31000  ? 415 ASN C CA    1 
ATOM   6814  C  C     . ASN C 1 170 ? 95.12900  147.32300 126.21000 1.000 64.31000  ? 415 ASN C C     1 
ATOM   6815  O  O     . ASN C 1 170 ? 95.57400  146.31200 126.75700 1.000 64.31000  ? 415 ASN C O     1 
ATOM   6816  C  CB    . ASN C 1 170 ? 94.51600  147.50900 123.79900 1.000 64.31000  ? 415 ASN C CB    1 
ATOM   6817  C  CG    . ASN C 1 170 ? 94.83000  148.11700 122.44800 1.000 64.31000  ? 415 ASN C CG    1 
ATOM   6818  O  OD1   . ASN C 1 170 ? 95.00900  147.40700 121.46100 1.000 64.31000  ? 415 ASN C OD1   1 
ATOM   6819  N  ND2   . ASN C 1 170 ? 94.88600  149.43800 122.39400 1.000 64.31000  ? 415 ASN C ND2   1 
ATOM   6820  N  N     . GLU C 1 171 ? 94.20200  148.09800 126.76800 1.000 79.63000  ? 416 GLU C N     1 
ATOM   6821  C  CA    . GLU C 1 171 ? 93.52600  147.71600 128.00000 1.000 79.63000  ? 416 GLU C CA    1 
ATOM   6822  C  C     . GLU C 1 171 ? 92.39500  146.73200 127.75300 1.000 79.63000  ? 416 GLU C C     1 
ATOM   6823  O  O     . GLU C 1 171 ? 91.80100  146.23500 128.71500 1.000 79.63000  ? 416 GLU C O     1 
ATOM   6824  C  CB    . GLU C 1 171 ? 92.97400  148.95500 128.71200 1.000 79.63000  ? 416 GLU C CB    1 
ATOM   6825  C  CG    . GLU C 1 171 ? 94.03100  149.93900 129.17800 1.000 79.63000  ? 416 GLU C CG    1 
ATOM   6826  C  CD    . GLU C 1 171 ? 94.42000  150.92400 128.09600 1.000 79.63000  ? 416 GLU C CD    1 
ATOM   6827  O  OE1   . GLU C 1 171 ? 93.80300  150.88500 127.01200 1.000 79.63000  ? 416 GLU C OE1   1 
ATOM   6828  O  OE2   . GLU C 1 171 ? 95.33900  151.73600 128.33000 1.000 79.63000  ? 416 GLU C OE2   1 
ATOM   6829  N  N     . ASP C 1 172 ? 92.08900  146.44500 126.49000 1.000 80.09000  ? 417 ASP C N     1 
ATOM   6830  C  CA    . ASP C 1 172 ? 90.96300  145.58600 126.13900 1.000 80.09000  ? 417 ASP C CA    1 
ATOM   6831  C  C     . ASP C 1 172 ? 91.27000  144.88100 124.82900 1.000 80.09000  ? 417 ASP C C     1 
ATOM   6832  O  O     . ASP C 1 172 ? 91.63600  145.52700 123.84300 1.000 80.09000  ? 417 ASP C O     1 
ATOM   6833  C  CB    . ASP C 1 172 ? 89.67300  146.39800 126.04200 1.000 80.09000  ? 417 ASP C CB    1 
ATOM   6834  C  CG    . ASP C 1 172 ? 89.80100  147.60300 125.12500 1.000 80.09000  ? 417 ASP C CG    1 
ATOM   6835  O  OD1   . ASP C 1 172 ? 90.92300  147.90700 124.66900 1.000 80.09000  ? 417 ASP C OD1   1 
ATOM   6836  O  OD2   . ASP C 1 172 ? 88.77000  148.24900 124.85600 1.000 80.09000  ? 417 ASP C OD2   1 
ATOM   6837  N  N     . ARG C 1 173 ? 91.13600  143.56100 124.82100 1.000 63.30000  ? 418 ARG C N     1 
ATOM   6838  C  CA    . ARG C 1 173 ? 91.40100  142.77600 123.62300 1.000 63.30000  ? 418 ARG C CA    1 
ATOM   6839  C  C     . ARG C 1 173 ? 90.13000  142.71700 122.78700 1.000 63.30000  ? 418 ARG C C     1 
ATOM   6840  O  O     . ARG C 1 173 ? 89.14800  142.08100 123.18100 1.000 63.30000  ? 418 ARG C O     1 
ATOM   6841  C  CB    . ARG C 1 173 ? 91.88200  141.38000 124.00100 1.000 63.30000  ? 418 ARG C CB    1 
ATOM   6842  C  CG    . ARG C 1 173 ? 92.29900  140.54300 122.81700 1.000 63.30000  ? 418 ARG C CG    1 
ATOM   6843  C  CD    . ARG C 1 173 ? 92.82200  139.18900 123.24100 1.000 63.30000  ? 418 ARG C CD    1 
ATOM   6844  N  NE    . ARG C 1 173 ? 93.28600  138.43700 122.08300 1.000 63.30000  ? 418 ARG C NE    1 
ATOM   6845  C  CZ    . ARG C 1 173 ? 92.50300  137.67400 121.32900 1.000 63.30000  ? 418 ARG C CZ    1 
ATOM   6846  N  NH1   . ARG C 1 173 ? 91.21400  137.55800 121.61500 1.000 63.30000  ? 418 ARG C NH1   1 
ATOM   6847  N  NH2   . ARG C 1 173 ? 93.00700  137.02500 120.28900 1.000 63.30000  ? 418 ARG C NH2   1 
ATOM   6848  N  N     . GLN C 1 174 ? 90.14100  143.38500 121.63800 1.000 67.96000  ? 419 GLN C N     1 
ATOM   6849  C  CA    . GLN C 1 174 ? 88.97800  143.37600 120.76600 1.000 67.96000  ? 419 GLN C CA    1 
ATOM   6850  C  C     . GLN C 1 174 ? 88.86400  142.04700 120.03000 1.000 67.96000  ? 419 GLN C C     1 
ATOM   6851  O  O     . GLN C 1 174 ? 89.85600  141.47500 119.57100 1.000 67.96000  ? 419 GLN C O     1 
ATOM   6852  C  CB    . GLN C 1 174 ? 89.05200  144.51500 119.75200 1.000 67.96000  ? 419 GLN C CB    1 
ATOM   6853  C  CG    . GLN C 1 174 ? 88.93800  145.90500 120.34300 1.000 67.96000  ? 419 GLN C CG    1 
ATOM   6854  C  CD    . GLN C 1 174 ? 88.99200  146.98000 119.27700 1.000 67.96000  ? 419 GLN C CD    1 
ATOM   6855  O  OE1   . GLN C 1 174 ? 89.17300  146.68700 118.09600 1.000 67.96000  ? 419 GLN C OE1   1 
ATOM   6856  N  NE2   . GLN C 1 174 ? 88.83100  148.23300 119.68700 1.000 67.96000  ? 419 GLN C NE2   1 
ATOM   6857  N  N     . MET C 1 175 ? 87.63400  141.55800 119.92100 1.000 63.40000  ? 420 MET C N     1 
ATOM   6858  C  CA    . MET C 1 175 ? 87.38000  140.34600 119.16600 1.000 63.40000  ? 420 MET C CA    1 
ATOM   6859  C  C     . MET C 1 175 ? 87.49000  140.62100 117.67000 1.000 63.40000  ? 420 MET C C     1 
ATOM   6860  O  O     . MET C 1 175 ? 87.06600  141.66500 117.16900 1.000 63.40000  ? 420 MET C O     1 
ATOM   6861  C  CB    . MET C 1 175 ? 85.99500  139.78700 119.49500 1.000 63.40000  ? 420 MET C CB    1 
ATOM   6862  C  CG    . MET C 1 175 ? 85.68700  138.46200 118.82200 1.000 63.40000  ? 420 MET C CG    1 
ATOM   6863  S  SD    . MET C 1 175 ? 84.04400  137.83600 119.20900 1.000 63.40000  ? 420 MET C SD    1 
ATOM   6864  C  CE    . MET C 1 175 ? 84.27300  137.32900 120.90900 1.000 63.40000  ? 420 MET C CE    1 
ATOM   6865  N  N     . VAL C 1 176 ? 88.07200  139.66200 116.95500 1.000 54.01000  ? 421 VAL C N     1 
ATOM   6866  C  CA    . VAL C 1 176 ? 88.16000  139.73900 115.50300 1.000 54.01000  ? 421 VAL C CA    1 
ATOM   6867  C  C     . VAL C 1 176 ? 87.11200  138.81600 114.90000 1.000 54.01000  ? 421 VAL C C     1 
ATOM   6868  O  O     . VAL C 1 176 ? 87.29700  137.59500 114.84800 1.000 54.01000  ? 421 VAL C O     1 
ATOM   6869  C  CB    . VAL C 1 176 ? 89.57200  139.38100 115.00500 1.000 54.01000  ? 421 VAL C CB    1 
ATOM   6870  C  CG1   . VAL C 1 176 ? 89.57600  139.26700 113.50200 1.000 54.01000  ? 421 VAL C CG1   1 
ATOM   6871  C  CG2   . VAL C 1 176 ? 90.56700  140.43200 115.45200 1.000 54.01000  ? 421 VAL C CG2   1 
ATOM   6872  N  N     . ARG C 1 177 ? 85.99600  139.38800 114.45800 1.000 62.87000  ? 422 ARG C N     1 
ATOM   6873  C  CA    . ARG C 1 177 ? 84.95400  138.57900 113.84700 1.000 62.87000  ? 422 ARG C CA    1 
ATOM   6874  C  C     . ARG C 1 177 ? 85.22300  138.43100 112.35400 1.000 62.87000  ? 422 ARG C C     1 
ATOM   6875  O  O     . ARG C 1 177 ? 85.86400  139.27900 111.72700 1.000 62.87000  ? 422 ARG C O     1 
ATOM   6876  C  CB    . ARG C 1 177 ? 83.57800  139.19200 114.10500 1.000 62.87000  ? 422 ARG C CB    1 
ATOM   6877  C  CG    . ARG C 1 177 ? 83.24600  139.27800 115.59000 1.000 62.87000  ? 422 ARG C CG    1 
ATOM   6878  C  CD    . ARG C 1 177 ? 81.82300  139.73200 115.85300 1.000 62.87000  ? 422 ARG C CD    1 
ATOM   6879  N  NE    . ARG C 1 177 ? 80.86200  138.69300 115.49900 1.000 62.87000  ? 422 ARG C NE    1 
ATOM   6880  C  CZ    . ARG C 1 177 ? 80.49500  137.71300 116.32100 1.000 62.87000  ? 422 ARG C CZ    1 
ATOM   6881  N  NH1   . ARG C 1 177 ? 81.01300  137.64300 117.53900 1.000 62.87000  ? 422 ARG C NH1   1 
ATOM   6882  N  NH2   . ARG C 1 177 ? 79.61500  136.80200 115.92700 1.000 62.87000  ? 422 ARG C NH2   1 
ATOM   6883  N  N     . PHE C 1 178 ? 84.72500  137.33400 111.78300 1.000 57.15000  ? 423 PHE C N     1 
ATOM   6884  C  CA    . PHE C 1 178 ? 85.22700  136.87900 110.49300 1.000 57.15000  ? 423 PHE C CA    1 
ATOM   6885  C  C     . PHE C 1 178 ? 84.69600  137.69800 109.32600 1.000 57.15000  ? 423 PHE C C     1 
ATOM   6886  O  O     . PHE C 1 178 ? 85.31300  137.69200 108.25600 1.000 57.15000  ? 423 PHE C O     1 
ATOM   6887  C  CB    . PHE C 1 178 ? 84.89200  135.40000 110.31400 1.000 57.15000  ? 423 PHE C CB    1 
ATOM   6888  C  CG    . PHE C 1 178 ? 85.52700  134.77000 109.11100 1.000 57.15000  ? 423 PHE C CG    1 
ATOM   6889  C  CD1   . PHE C 1 178 ? 86.89600  134.58500 109.05600 1.000 57.15000  ? 423 PHE C CD1   1 
ATOM   6890  C  CD2   . PHE C 1 178 ? 84.75500  134.31200 108.06200 1.000 57.15000  ? 423 PHE C CD2   1 
ATOM   6891  C  CE1   . PHE C 1 178 ? 87.48600  133.99500 107.96000 1.000 57.15000  ? 423 PHE C CE1   1 
ATOM   6892  C  CE2   . PHE C 1 178 ? 85.34000  133.71500 106.96800 1.000 57.15000  ? 423 PHE C CE2   1 
ATOM   6893  C  CZ    . PHE C 1 178 ? 86.70700  133.55900 106.91600 1.000 57.15000  ? 423 PHE C CZ    1 
ATOM   6894  N  N     . SER C 1 179 ? 83.57600  138.40100 109.49800 1.000 65.42000  ? 424 SER C N     1 
ATOM   6895  C  CA    . SER C 1 179 ? 83.10100  139.27900 108.43500 1.000 65.42000  ? 424 SER C CA    1 
ATOM   6896  C  C     . SER C 1 179 ? 84.06100  140.43600 108.19700 1.000 65.42000  ? 424 SER C C     1 
ATOM   6897  O  O     . SER C 1 179 ? 84.13400  140.96300 107.08200 1.000 65.42000  ? 424 SER C O     1 
ATOM   6898  C  CB    . SER C 1 179 ? 81.71100  139.81100 108.77100 1.000 65.42000  ? 424 SER C CB    1 
ATOM   6899  O  OG    . SER C 1 179 ? 81.76000  140.66500 109.90000 1.000 65.42000  ? 424 SER C OG    1 
ATOM   6900  N  N     . GLU C 1 180 ? 84.80100  140.84400 109.22900 1.000 66.41000  ? 425 GLU C N     1 
ATOM   6901  C  CA    . GLU C 1 180 ? 85.73400  141.95500 109.10100 1.000 66.41000  ? 425 GLU C CA    1 
ATOM   6902  C  C     . GLU C 1 180 ? 86.96000  141.59800 108.27600 1.000 66.41000  ? 425 GLU C C     1 
ATOM   6903  O  O     . GLU C 1 180 ? 87.62300  142.50100 107.75400 1.000 66.41000  ? 425 GLU C O     1 
ATOM   6904  C  CB    . GLU C 1 180 ? 86.18200  142.42600 110.48500 1.000 66.41000  ? 425 GLU C CB    1 
ATOM   6905  C  CG    . GLU C 1 180 ? 85.06800  142.99300 111.34300 1.000 66.41000  ? 425 GLU C CG    1 
ATOM   6906  C  CD    . GLU C 1 180 ? 85.55600  143.41800 112.71200 1.000 66.41000  ? 425 GLU C CD    1 
ATOM   6907  O  OE1   . GLU C 1 180 ? 86.74100  143.18100 113.02100 1.000 66.41000  ? 425 GLU C OE1   1 
ATOM   6908  O  OE2   . GLU C 1 180 ? 84.75200  143.98100 113.48300 1.000 66.41000  ? 425 GLU C OE2   1 
ATOM   6909  N  N     . VAL C 1 181 ? 87.27300  140.31200 108.14300 1.000 61.71000  ? 426 VAL C N     1 
ATOM   6910  C  CA    . VAL C 1 181 ? 88.47500  139.91300 107.42600 1.000 61.71000  ? 426 VAL C CA    1 
ATOM   6911  C  C     . VAL C 1 181 ? 88.23300  139.80900 105.92400 1.000 61.71000  ? 426 VAL C C     1 
ATOM   6912  O  O     . VAL C 1 181 ? 89.10000  140.19100 105.13200 1.000 61.71000  ? 426 VAL C O     1 
ATOM   6913  C  CB    . VAL C 1 181 ? 89.01100  138.58500 107.98500 1.000 61.71000  ? 426 VAL C CB    1 
ATOM   6914  C  CG1   . VAL C 1 181 ? 90.27400  138.17900 107.25300 1.000 61.71000  ? 426 VAL C CG1   1 
ATOM   6915  C  CG2   . VAL C 1 181 ? 89.25800  138.69700 109.47700 1.000 61.71000  ? 426 VAL C CG2   1 
ATOM   6916  N  N     . LEU C 1 182 ? 87.07400  139.30800 105.51000 1.000 63.16000  ? 427 LEU C N     1 
ATOM   6917  C  CA    . LEU C 1 182 ? 86.79600  139.08600 104.09800 1.000 63.16000  ? 427 LEU C CA    1 
ATOM   6918  C  C     . LEU C 1 182 ? 86.38800  140.35400 103.36300 1.000 63.16000  ? 427 LEU C C     1 
ATOM   6919  O  O     . LEU C 1 182 ? 86.24100  140.32100 102.13700 1.000 63.16000  ? 427 LEU C O     1 
ATOM   6920  C  CB    . LEU C 1 182 ? 85.70200  138.03400 103.93600 1.000 63.16000  ? 427 LEU C CB    1 
ATOM   6921  C  CG    . LEU C 1 182 ? 86.04200  136.65900 104.49500 1.000 63.16000  ? 427 LEU C CG    1 
ATOM   6922  C  CD1   . LEU C 1 182 ? 84.87900  135.72700 104.27000 1.000 63.16000  ? 427 LEU C CD1   1 
ATOM   6923  C  CD2   . LEU C 1 182 ? 87.31200  136.11700 103.87400 1.000 63.16000  ? 427 LEU C CD2   1 
ATOM   6924  N  N     . SER C 1 183 ? 86.20600  141.46700 104.07100 1.000 67.37000  ? 428 SER C N     1 
ATOM   6925  C  CA    . SER C 1 183 ? 85.80200  142.72200 103.45300 1.000 67.37000  ? 428 SER C CA    1 
ATOM   6926  C  C     . SER C 1 183 ? 86.99400  143.56600 103.02200 1.000 67.37000  ? 428 SER C C     1 
ATOM   6927  O  O     . SER C 1 183 ? 86.88000  144.79500 102.92400 1.000 67.37000  ? 428 SER C O     1 
ATOM   6928  C  CB    . SER C 1 183 ? 84.90500  143.51000 104.40800 1.000 67.37000  ? 428 SER C CB    1 
ATOM   6929  O  OG    . SER C 1 183 ? 83.69700  142.81400 104.65700 1.000 67.37000  ? 428 SER C OG    1 
ATOM   6930  N  N     . SER C 1 184 ? 88.12900  142.93800 102.76300 1.000 67.46000  ? 429 SER C N     1 
ATOM   6931  C  CA    . SER C 1 184 ? 89.35300  143.60900 102.36700 1.000 67.46000  ? 429 SER C CA    1 
ATOM   6932  C  C     . SER C 1 184 ? 89.54400  143.53000 100.86300 1.000 67.46000  ? 429 SER C C     1 
ATOM   6933  O  O     . SER C 1 184 ? 88.94100  142.68800 100.19100 1.000 67.46000  ? 429 SER C O     1 
ATOM   6934  C  CB    . SER C 1 184 ? 90.55400  142.97100 103.07200 1.000 67.46000  ? 429 SER C CB    1 
ATOM   6935  O  OG    . SER C 1 184 ? 90.75500  141.64200 102.62200 1.000 67.46000  ? 429 SER C OG    1 
ATOM   6936  N  N     . PRO C 1 185 ? 90.38100  144.39900 100.29200 1.000 69.50000  ? 430 PRO C N     1 
ATOM   6937  C  CA    . PRO C 1 185 ? 90.71000  144.24700 98.86900  1.000 69.50000  ? 430 PRO C CA    1 
ATOM   6938  C  C     . PRO C 1 185 ? 91.68100  143.11300 98.60600  1.000 69.50000  ? 430 PRO C C     1 
ATOM   6939  O  O     . PRO C 1 185 ? 91.68100  142.56300 97.49800  1.000 69.50000  ? 430 PRO C O     1 
ATOM   6940  C  CB    . PRO C 1 185 ? 91.31600  145.60700 98.50200  1.000 69.50000  ? 430 PRO C CB    1 
ATOM   6941  C  CG    . PRO C 1 185 ? 91.86900  146.12000 99.78200  1.000 69.50000  ? 430 PRO C CG    1 
ATOM   6942  C  CD    . PRO C 1 185 ? 90.93400  145.64200 100.85700 1.000 69.50000  ? 430 PRO C CD    1 
ATOM   6943  N  N     . GLU C 1 186 ? 92.51800  142.75500 99.58400  1.000 67.58000  ? 431 GLU C N     1 
ATOM   6944  C  CA    . GLU C 1 186 ? 93.44200  141.64000 99.40000  1.000 67.58000  ? 431 GLU C CA    1 
ATOM   6945  C  C     . GLU C 1 186 ? 92.69200  140.34400 99.12300  1.000 67.58000  ? 431 GLU C C     1 
ATOM   6946  O  O     . GLU C 1 186 ? 93.09700  139.54900 98.26800  1.000 67.58000  ? 431 GLU C O     1 
ATOM   6947  C  CB    . GLU C 1 186 ? 94.34000  141.47900 100.62900 1.000 67.58000  ? 431 GLU C CB    1 
ATOM   6948  C  CG    . GLU C 1 186 ? 95.33800  142.60300 100.85400 1.000 67.58000  ? 431 GLU C CG    1 
ATOM   6949  C  CD    . GLU C 1 186 ? 94.75500  143.75500 101.64700 1.000 67.58000  ? 431 GLU C CD    1 
ATOM   6950  O  OE1   . GLU C 1 186 ? 93.58900  143.64900 102.07900 1.000 67.58000  ? 431 GLU C OE1   1 
ATOM   6951  O  OE2   . GLU C 1 186 ? 95.46600  144.76300 101.84700 1.000 67.58000  ? 431 GLU C OE2   1 
ATOM   6952  N  N     . TYR C 1 187 ? 91.59000  140.11300 99.84000  1.000 65.10000  ? 432 TYR C N     1 
ATOM   6953  C  CA    . TYR C 1 187 ? 90.87100  138.85100 99.70300  1.000 65.10000  ? 432 TYR C CA    1 
ATOM   6954  C  C     . TYR C 1 187 ? 90.12900  138.77200 98.37600  1.000 65.10000  ? 432 TYR C C     1 
ATOM   6955  O  O     . TYR C 1 187 ? 90.19700  137.75600 97.67500  1.000 65.10000  ? 432 TYR C O     1 
ATOM   6956  C  CB    . TYR C 1 187 ? 89.89900  138.66400 100.86600 1.000 65.10000  ? 432 TYR C CB    1 
ATOM   6957  C  CG    . TYR C 1 187 ? 89.13500  137.36300 100.79200 1.000 65.10000  ? 432 TYR C CG    1 
ATOM   6958  C  CD1   . TYR C 1 187 ? 89.75000  136.16000 101.10000 1.000 65.10000  ? 432 TYR C CD1   1 
ATOM   6959  C  CD2   . TYR C 1 187 ? 87.80300  137.33700 100.40800 1.000 65.10000  ? 432 TYR C CD2   1 
ATOM   6960  C  CE1   . TYR C 1 187 ? 89.06300  134.96900 101.03000 1.000 65.10000  ? 432 TYR C CE1   1 
ATOM   6961  C  CE2   . TYR C 1 187 ? 87.10600  136.14800 100.33700 1.000 65.10000  ? 432 TYR C CE2   1 
ATOM   6962  C  CZ    . TYR C 1 187 ? 87.74200  134.96700 100.64900 1.000 65.10000  ? 432 TYR C CZ    1 
ATOM   6963  O  OH    . TYR C 1 187 ? 87.05300  133.78000 100.58100 1.000 65.10000  ? 432 TYR C OH    1 
ATOM   6964  N  N     . ASP C 1 188 ? 89.39800  139.82800 98.01700  1.000 72.20000  ? 433 ASP C N     1 
ATOM   6965  C  CA    . ASP C 1 188 ? 88.55900  139.75600 96.82800  1.000 72.20000  ? 433 ASP C CA    1 
ATOM   6966  C  C     . ASP C 1 188 ? 89.40000  139.76500 95.55700  1.000 72.20000  ? 433 ASP C C     1 
ATOM   6967  O  O     . ASP C 1 188 ? 89.08800  139.05300 94.59500  1.000 72.20000  ? 433 ASP C O     1 
ATOM   6968  C  CB    . ASP C 1 188 ? 87.55400  140.90600 96.82700  1.000 72.20000  ? 433 ASP C CB    1 
ATOM   6969  C  CG    . ASP C 1 188 ? 86.42300  140.69200 95.84300  1.000 72.20000  ? 433 ASP C CG    1 
ATOM   6970  O  OD1   . ASP C 1 188 ? 86.41900  139.65100 95.15200  1.000 72.20000  ? 433 ASP C OD1   1 
ATOM   6971  O  OD2   . ASP C 1 188 ? 85.53000  141.56200 95.76300  1.000 72.20000  ? 433 ASP C OD2   1 
ATOM   6972  N  N     . GLU C 1 189 ? 90.47500  140.55800 95.53200  1.000 73.12000  ? 434 GLU C N     1 
ATOM   6973  C  CA    . GLU C 1 189 ? 91.38400  140.53100 94.39100  1.000 73.12000  ? 434 GLU C CA    1 
ATOM   6974  C  C     . GLU C 1 189 ? 92.19100  139.24300 94.32100  1.000 73.12000  ? 434 GLU C C     1 
ATOM   6975  O  O     . GLU C 1 189 ? 92.69500  138.90400 93.24600  1.000 73.12000  ? 434 GLU C O     1 
ATOM   6976  C  CB    . GLU C 1 189 ? 92.34300  141.72200 94.43600  1.000 73.12000  ? 434 GLU C CB    1 
ATOM   6977  C  CG    . GLU C 1 189 ? 91.69800  143.07000 94.17900  1.000 73.12000  ? 434 GLU C CG    1 
ATOM   6978  C  CD    . GLU C 1 189 ? 92.70700  144.20300 94.20000  1.000 73.12000  ? 434 GLU C CD    1 
ATOM   6979  O  OE1   . GLU C 1 189 ? 93.87900  143.94700 94.54500  1.000 73.12000  ? 434 GLU C OE1   1 
ATOM   6980  O  OE2   . GLU C 1 189 ? 92.33100  145.34600 93.86600  1.000 73.12000  ? 434 GLU C OE2   1 
ATOM   6981  N  N     . HIS C 1 190 ? 92.32800  138.53100 95.43800  1.000 65.96000  ? 435 HIS C N     1 
ATOM   6982  C  CA    . HIS C 1 190 ? 93.18500  137.35300 95.50500  1.000 65.96000  ? 435 HIS C CA    1 
ATOM   6983  C  C     . HIS C 1 190 ? 92.76100  136.34200 94.45000  1.000 65.96000  ? 435 HIS C C     1 
ATOM   6984  O  O     . HIS C 1 190 ? 91.60400  135.92000 94.41600  1.000 65.96000  ? 435 HIS C O     1 
ATOM   6985  C  CB    . HIS C 1 190 ? 93.10200  136.74100 96.90300  1.000 65.96000  ? 435 HIS C CB    1 
ATOM   6986  C  CG    . HIS C 1 190 ? 94.22700  135.81200 97.23000  1.000 65.96000  ? 435 HIS C CG    1 
ATOM   6987  N  ND1   . HIS C 1 190 ? 94.21500  134.47400 96.90100  1.000 65.96000  ? 435 HIS C ND1   1 
ATOM   6988  C  CD2   . HIS C 1 190 ? 95.39800  136.03000 97.87200  1.000 65.96000  ? 435 HIS C CD2   1 
ATOM   6989  C  CE1   . HIS C 1 190 ? 95.33300  133.91000 97.32100  1.000 65.96000  ? 435 HIS C CE1   1 
ATOM   6990  N  NE2   . HIS C 1 190 ? 96.06800  134.83300 97.91300  1.000 65.96000  ? 435 HIS C NE2   1 
ATOM   6991  N  N     . LYS C 1 191 ? 93.67900  135.98800 93.55600  1.000 68.38000  ? 436 LYS C N     1 
ATOM   6992  C  CA    . LYS C 1 191 ? 93.37900  135.05700 92.46900  1.000 68.38000  ? 436 LYS C CA    1 
ATOM   6993  C  C     . LYS C 1 191 ? 94.02800  133.71300 92.78500  1.000 68.38000  ? 436 LYS C C     1 
ATOM   6994  O  O     . LYS C 1 191 ? 95.13100  133.41100 92.33000  1.000 68.38000  ? 436 LYS C O     1 
ATOM   6995  C  CB    . LYS C 1 191 ? 93.84300  135.61600 91.13000  1.000 68.38000  ? 436 LYS C CB    1 
ATOM   6996  C  CG    . LYS C 1 191 ? 93.04000  136.82000 90.67100  1.000 68.38000  ? 436 LYS C CG    1 
ATOM   6997  C  CD    . LYS C 1 191 ? 93.48200  137.30700 89.30500  1.000 68.38000  ? 436 LYS C CD    1 
ATOM   6998  C  CE    . LYS C 1 191 ? 92.67800  138.52200 88.87500  1.000 68.38000  ? 436 LYS C CE    1 
ATOM   6999  N  NZ    . LYS C 1 191 ? 93.09000  139.02000 87.53400  1.000 68.38000  ? 436 LYS C NZ    1 
ATOM   7000  N  N     . SER C 1 192 ? 93.32600  132.90100 93.57100  1.000 60.77000  ? 437 SER C N     1 
ATOM   7001  C  CA    . SER C 1 192 ? 93.78300  131.55700 93.88900  1.000 60.77000  ? 437 SER C CA    1 
ATOM   7002  C  C     . SER C 1 192 ? 92.58900  130.71400 94.30300  1.000 60.77000  ? 437 SER C C     1 
ATOM   7003  O  O     . SER C 1 192 ? 91.64200  131.21300 94.91500  1.000 60.77000  ? 437 SER C O     1 
ATOM   7004  C  CB    . SER C 1 192 ? 94.83300  131.55700 95.00100  1.000 60.77000  ? 437 SER C CB    1 
ATOM   7005  O  OG    . SER C 1 192 ? 95.22600  130.23500 95.32000  1.000 60.77000  ? 437 SER C OG    1 
ATOM   7006  N  N     . THR C 1 193 ? 92.65100  129.42600 93.96400  1.000 57.01000  ? 438 THR C N     1 
ATOM   7007  C  CA    . THR C 1 193 ? 91.57200  128.51500 94.31800  1.000 57.01000  ? 438 THR C CA    1 
ATOM   7008  C  C     . THR C 1 193 ? 91.45500  128.30500 95.82300  1.000 57.01000  ? 438 THR C C     1 
ATOM   7009  O  O     . THR C 1 193 ? 90.36900  127.96500 96.30300  1.000 57.01000  ? 438 THR C O     1 
ATOM   7010  C  CB    . THR C 1 193 ? 91.77200  127.16900 93.62500  1.000 57.01000  ? 438 THR C CB    1 
ATOM   7011  O  OG1   . THR C 1 193 ? 93.02100  126.60000 94.03400  1.000 57.01000  ? 438 THR C OG1   1 
ATOM   7012  C  CG2   . THR C 1 193 ? 91.77600  127.34800 92.11900  1.000 57.01000  ? 438 THR C CG2   1 
ATOM   7013  N  N     . VAL C 1 194 ? 92.53500  128.50300 96.57600  1.000 53.68000  ? 439 VAL C N     1 
ATOM   7014  C  CA    . VAL C 1 194 ? 92.52300  128.25100 98.01500  1.000 53.68000  ? 439 VAL C CA    1 
ATOM   7015  C  C     . VAL C 1 194 ? 93.21000  129.38200 98.77200  1.000 53.68000  ? 439 VAL C C     1 
ATOM   7016  O  O     . VAL C 1 194 ? 94.40500  129.29900 99.07800  1.000 53.68000  ? 439 VAL C O     1 
ATOM   7017  C  CB    . VAL C 1 194 ? 93.16100  126.88700 98.33800  1.000 53.68000  ? 439 VAL C CB    1 
ATOM   7018  C  CG1   . VAL C 1 194 ? 92.24300  125.75900 97.90300  1.000 53.68000  ? 439 VAL C CG1   1 
ATOM   7019  C  CG2   . VAL C 1 194 ? 94.49400  126.72700 97.62300  1.000 53.68000  ? 439 VAL C CG2   1 
ATOM   7020  N  N     . PRO C 1 195 ? 92.50000  130.45700 99.09700  1.000 49.30000  ? 440 PRO C N     1 
ATOM   7021  C  CA    . PRO C 1 195 ? 93.04300  131.45800 100.01800 1.000 49.30000  ? 440 PRO C CA    1 
ATOM   7022  C  C     . PRO C 1 195 ? 92.69100  131.12700 101.45500 1.000 49.30000  ? 440 PRO C C     1 
ATOM   7023  O  O     . PRO C 1 195 ? 91.71500  130.43500 101.74100 1.000 49.30000  ? 440 PRO C O     1 
ATOM   7024  C  CB    . PRO C 1 195 ? 92.34000  132.74900 99.57600  1.000 49.30000  ? 440 PRO C CB    1 
ATOM   7025  C  CG    . PRO C 1 195 ? 91.02900  132.26600 99.10600  1.000 49.30000  ? 440 PRO C CG    1 
ATOM   7026  C  CD    . PRO C 1 195 ? 91.27000  130.93700 98.44100  1.000 49.30000  ? 440 PRO C CD    1 
ATOM   7027  N  N     . LEU C 1 196 ? 93.50400  131.64000 102.37000 1.000 44.82000  ? 441 LEU C N     1 
ATOM   7028  C  CA    . LEU C 1 196 ? 93.26100  131.47700 103.79600 1.000 44.82000  ? 441 LEU C CA    1 
ATOM   7029  C  C     . LEU C 1 196 ? 93.23100  132.84900 104.44900 1.000 44.82000  ? 441 LEU C C     1 
ATOM   7030  O  O     . LEU C 1 196 ? 94.19500  133.61300 104.34000 1.000 44.82000  ? 441 LEU C O     1 
ATOM   7031  C  CB    . LEU C 1 196 ? 94.32900  130.59400 104.44000 1.000 44.82000  ? 441 LEU C CB    1 
ATOM   7032  C  CG    . LEU C 1 196 ? 94.39700  129.16700 103.89600 1.000 44.82000  ? 441 LEU C CG    1 
ATOM   7033  C  CD1   . LEU C 1 196 ? 95.47700  128.37700 104.60700 1.000 44.82000  ? 441 LEU C CD1   1 
ATOM   7034  C  CD2   . LEU C 1 196 ? 93.05500  128.47400 103.99500 1.000 44.82000  ? 441 LEU C CD2   1 
ATOM   7035  N  N     . ALA C 1 197 ? 92.12500  133.16100 105.12000 1.000 43.88000  ? 442 ALA C N     1 
ATOM   7036  C  CA    . ALA C 1 197 ? 91.96800  134.41800 105.84800 1.000 43.88000  ? 442 ALA C CA    1 
ATOM   7037  C  C     . ALA C 1 197 ? 92.29000  134.13500 107.30900 1.000 43.88000  ? 442 ALA C C     1 
ATOM   7038  O  O     . ALA C 1 197 ? 91.40400  133.88400 108.12500 1.000 43.88000  ? 442 ALA C O     1 
ATOM   7039  C  CB    . ALA C 1 197 ? 90.56300  134.97900 105.67400 1.000 43.88000  ? 442 ALA C CB    1 
ATOM   7040  N  N     . LEU C 1 198 ? 93.58200  134.17400 107.63700 1.000 40.54000  ? 443 LEU C N     1 
ATOM   7041  C  CA    . LEU C 1 198 ? 94.01200  133.82100 108.98500 1.000 40.54000  ? 443 LEU C CA    1 
ATOM   7042  C  C     . LEU C 1 198 ? 93.45000  134.79200 110.01500 1.000 40.54000  ? 443 LEU C C     1 
ATOM   7043  O  O     . LEU C 1 198 ? 92.94400  134.37500 111.06200 1.000 40.54000  ? 443 LEU C O     1 
ATOM   7044  C  CB    . LEU C 1 198 ? 95.53700  133.78800 109.04600 1.000 40.54000  ? 443 LEU C CB    1 
ATOM   7045  C  CG    . LEU C 1 198 ? 96.20700  132.75800 108.13600 1.000 40.54000  ? 443 LEU C CG    1 
ATOM   7046  C  CD1   . LEU C 1 198 ? 97.70900  132.92800 108.16100 1.000 40.54000  ? 443 LEU C CD1   1 
ATOM   7047  C  CD2   . LEU C 1 198 ? 95.82500  131.35200 108.53800 1.000 40.54000  ? 443 LEU C CD2   1 
ATOM   7048  N  N     . GLY C 1 199 ? 93.51900  136.08600 109.73200 1.000 42.58000  ? 444 GLY C N     1 
ATOM   7049  C  CA    . GLY C 1 199 ? 93.00800  137.08300 110.65300 1.000 42.58000  ? 444 GLY C CA    1 
ATOM   7050  C  C     . GLY C 1 199 ? 93.67300  138.42400 110.39900 1.000 42.58000  ? 444 GLY C C     1 
ATOM   7051  O  O     . GLY C 1 199 ? 94.29000  138.63700 109.35900 1.000 42.58000  ? 444 GLY C O     1 
ATOM   7052  N  N     . HIS C 1 200 ? 93.52700  139.31500 111.37500 1.000 46.91000  ? 445 HIS C N     1 
ATOM   7053  C  CA    . HIS C 1 200 ? 94.16200  140.62200 111.30500 1.000 46.91000  ? 445 HIS C CA    1 
ATOM   7054  C  C     . HIS C 1 200 ? 95.58600  140.57000 111.83400 1.000 46.91000  ? 445 HIS C C     1 
ATOM   7055  O  O     . HIS C 1 200 ? 95.86200  139.94900 112.86300 1.000 46.91000  ? 445 HIS C O     1 
ATOM   7056  C  CB    . HIS C 1 200 ? 93.36900  141.66100 112.09800 1.000 46.91000  ? 445 HIS C CB    1 
ATOM   7057  C  CG    . HIS C 1 200 ? 92.08900  142.07900 111.44700 1.000 46.91000  ? 445 HIS C CG    1 
ATOM   7058  N  ND1   . HIS C 1 200 ? 92.05300  142.89500 110.34000 1.000 46.91000  ? 445 HIS C ND1   1 
ATOM   7059  C  CD2   . HIS C 1 200 ? 90.80100  141.81800 111.76400 1.000 46.91000  ? 445 HIS C CD2   1 
ATOM   7060  C  CE1   . HIS C 1 200 ? 90.79600  143.10500 109.99300 1.000 46.91000  ? 445 HIS C CE1   1 
ATOM   7061  N  NE2   . HIS C 1 200 ? 90.01600  142.46300 110.84100 1.000 46.91000  ? 445 HIS C NE2   1 
ATOM   7062  N  N     . ASP C 1 201 ? 96.48900  141.23400 111.12000 1.000 46.94000  ? 446 ASP C N     1 
ATOM   7063  C  CA    . ASP C 1 201 ? 97.82000  141.48400 111.63700 1.000 46.94000  ? 446 ASP C CA    1 
ATOM   7064  C  C     . ASP C 1 201 ? 97.73300  142.41500 112.84700 1.000 46.94000  ? 446 ASP C C     1 
ATOM   7065  O  O     . ASP C 1 201 ? 96.67500  142.95900 113.17300 1.000 46.94000  ? 446 ASP C O     1 
ATOM   7066  C  CB    . ASP C 1 201 ? 98.70300  142.08600 110.54300 1.000 46.94000  ? 446 ASP C CB    1 
ATOM   7067  C  CG    . ASP C 1 201 ? 100.17000 142.12000 110.92100 1.000 46.94000  ? 446 ASP C CG    1 
ATOM   7068  O  OD1   . ASP C 1 201 ? 100.51000 141.69200 112.04300 1.000 46.94000  ? 446 ASP C OD1   1 
ATOM   7069  O  OD2   . ASP C 1 201 ? 100.98400 142.58100 110.09500 1.000 46.94000  ? 446 ASP C OD2   1 
ATOM   7070  N  N     . ILE C 1 202 ? 98.87000  142.59800 113.52200 1.000 45.51000  ? 447 ILE C N     1 
ATOM   7071  C  CA    . ILE C 1 202 ? 98.90300  143.48500 114.68100 1.000 45.51000  ? 447 ILE C CA    1 
ATOM   7072  C  C     . ILE C 1 202 ? 98.60700  144.92000 114.27400 1.000 45.51000  ? 447 ILE C C     1 
ATOM   7073  O  O     . ILE C 1 202 ? 98.16100  145.72800 115.09700 1.000 45.51000  ? 447 ILE C O     1 
ATOM   7074  C  CB    . ILE C 1 202 ? 100.25800 143.37000 115.40500 1.000 45.51000  ? 447 ILE C CB    1 
ATOM   7075  C  CG1   . ILE C 1 202 ? 101.40100 143.80400 114.49000 1.000 45.51000  ? 447 ILE C CG1   1 
ATOM   7076  C  CG2   . ILE C 1 202 ? 100.48300 141.95200 115.89300 1.000 45.51000  ? 447 ILE C CG2   1 
ATOM   7077  C  CD1   . ILE C 1 202 ? 102.72900 143.90700 115.19800 1.000 45.51000  ? 447 ILE C CD1   1 
ATOM   7078  N  N     . GLY C 1 203 ? 98.84700  145.26500 113.01300 1.000 46.20000  ? 448 GLY C N     1 
ATOM   7079  C  CA    . GLY C 1 203 ? 98.51300  146.58500 112.52000 1.000 46.20000  ? 448 GLY C CA    1 
ATOM   7080  C  C     . GLY C 1 203 ? 97.11900  146.66400 111.93500 1.000 46.20000  ? 448 GLY C C     1 
ATOM   7081  O  O     . GLY C 1 203 ? 96.81000  147.58600 111.17500 1.000 46.20000  ? 448 GLY C O     1 
ATOM   7082  N  N     . GLY C 1 204 ? 96.26800  145.70000 112.27500 1.000 46.67000  ? 449 GLY C N     1 
ATOM   7083  C  CA    . GLY C 1 204 ? 94.89900  145.69000 111.79500 1.000 46.67000  ? 449 GLY C CA    1 
ATOM   7084  C  C     . GLY C 1 204 ? 94.74500  145.23600 110.35800 1.000 46.67000  ? 449 GLY C C     1 
ATOM   7085  O  O     . GLY C 1 204 ? 93.63500  144.91800 109.92000 1.000 46.67000  ? 449 GLY C O     1 
ATOM   7086  N  N     . ARG C 1 205 ? 95.84500  145.20200 109.61700 1.000 48.58000  ? 450 ARG C N     1 
ATOM   7087  C  CA    . ARG C 1 205 ? 95.78400  144.81800 108.21700 1.000 48.58000  ? 450 ARG C CA    1 
ATOM   7088  C  C     . ARG C 1 205 ? 95.38100  143.35000 108.09700 1.000 48.58000  ? 450 ARG C C     1 
ATOM   7089  O  O     . ARG C 1 205 ? 95.91500  142.49900 108.81600 1.000 48.58000  ? 450 ARG C O     1 
ATOM   7090  C  CB    . ARG C 1 205 ? 97.14000  145.04600 107.54800 1.000 48.58000  ? 450 ARG C CB    1 
ATOM   7091  C  CG    . ARG C 1 205 ? 97.15700  144.79800 106.05000 1.000 48.58000  ? 450 ARG C CG    1 
ATOM   7092  C  CD    . ARG C 1 205 ? 96.33000  145.83900 105.31300 1.000 48.58000  ? 450 ARG C CD    1 
ATOM   7093  N  NE    . ARG C 1 205 ? 96.82800  147.18900 105.55600 1.000 48.58000  ? 450 ARG C NE    1 
ATOM   7094  C  CZ    . ARG C 1 205 ? 97.82900  147.74600 104.88500 1.000 48.58000  ? 450 ARG C CZ    1 
ATOM   7095  N  NH1   . ARG C 1 205 ? 98.44300  147.07000 103.92300 1.000 48.58000  ? 450 ARG C NH1   1 
ATOM   7096  N  NH2   . ARG C 1 205 ? 98.21800  148.98000 105.17400 1.000 48.58000  ? 450 ARG C NH2   1 
ATOM   7097  N  N     . PRO C 1 206 ? 94.44100  143.01800 107.21400 1.000 45.44000  ? 451 PRO C N     1 
ATOM   7098  C  CA    . PRO C 1 206 ? 94.06400  141.61100 107.03800 1.000 45.44000  ? 451 PRO C CA    1 
ATOM   7099  C  C     . PRO C 1 206 ? 95.19600  140.80000 106.43100 1.000 45.44000  ? 451 PRO C C     1 
ATOM   7100  O  O     . PRO C 1 206 ? 95.91100  141.26500 105.54100 1.000 45.44000  ? 451 PRO C O     1 
ATOM   7101  C  CB    . PRO C 1 206 ? 92.86000  141.68300 106.09100 1.000 45.44000  ? 451 PRO C CB    1 
ATOM   7102  C  CG    . PRO C 1 206 ? 92.32400  143.05900 106.27000 1.000 45.44000  ? 451 PRO C CG    1 
ATOM   7103  C  CD    . PRO C 1 206 ? 93.52400  143.92400 106.50500 1.000 45.44000  ? 451 PRO C CD    1 
ATOM   7104  N  N     . ILE C 1 207 ? 95.34900  139.57500 106.92100 1.000 44.80000  ? 452 ILE C N     1 
ATOM   7105  C  CA    . ILE C 1 207 ? 96.35700  138.64100 106.43500 1.000 44.80000  ? 452 ILE C CA    1 
ATOM   7106  C  C     . ILE C 1 207 ? 95.65500  137.62000 105.55200 1.000 44.80000  ? 452 ILE C C     1 
ATOM   7107  O  O     . ILE C 1 207 ? 94.81400  136.85000 106.02700 1.000 44.80000  ? 452 ILE C O     1 
ATOM   7108  C  CB    . ILE C 1 207 ? 97.09800  137.95700 107.58900 1.000 44.80000  ? 452 ILE C CB    1 
ATOM   7109  C  CG1   . ILE C 1 207 ? 97.81300  138.99300 108.45300 1.000 44.80000  ? 452 ILE C CG1   1 
ATOM   7110  C  CG2   . ILE C 1 207 ? 98.08700  136.94200 107.05300 1.000 44.80000  ? 452 ILE C CG2   1 
ATOM   7111  C  CD1   . ILE C 1 207 ? 98.86400  139.77000 107.70700 1.000 44.80000  ? 452 ILE C CD1   1 
ATOM   7112  N  N     . ILE C 1 208 ? 95.99800  137.60200 104.26900 1.000 49.93000  ? 453 ILE C N     1 
ATOM   7113  C  CA    . ILE C 1 208 ? 95.41200  136.67500 103.30700 1.000 49.93000  ? 453 ILE C CA    1 
ATOM   7114  C  C     . ILE C 1 208 ? 96.55500  135.85100 102.73200 1.000 49.93000  ? 453 ILE C C     1 
ATOM   7115  O  O     . ILE C 1 208 ? 97.28800  136.31800 101.85200 1.000 49.93000  ? 453 ILE C O     1 
ATOM   7116  C  CB    . ILE C 1 208 ? 94.63400  137.39500 102.20300 1.000 49.93000  ? 453 ILE C CB    1 
ATOM   7117  C  CG1   . ILE C 1 208 ? 93.49100  138.20300 102.81000 1.000 49.93000  ? 453 ILE C CG1   1 
ATOM   7118  C  CG2   . ILE C 1 208 ? 94.08800  136.39500 101.20500 1.000 49.93000  ? 453 ILE C CG2   1 
ATOM   7119  C  CD1   . ILE C 1 208 ? 92.49800  137.35400 103.55900 1.000 49.93000  ? 453 ILE C CD1   1 
ATOM   7120  N  N     . THR C 1 209 ? 96.71200  134.62500 103.21900 1.000 48.55000  ? 454 THR C N     1 
ATOM   7121  C  CA    . THR C 1 209 ? 97.77700  133.74400 102.76700 1.000 48.55000  ? 454 THR C CA    1 
ATOM   7122  C  C     . THR C 1 209 ? 97.22600  132.68600 101.82300 1.000 48.55000  ? 454 THR C C     1 
ATOM   7123  O  O     . THR C 1 209 ? 96.14100  132.14000 102.04500 1.000 48.55000  ? 454 THR C O     1 
ATOM   7124  C  CB    . THR C 1 209 ? 98.47700  133.07200 103.94800 1.000 48.55000  ? 454 THR C CB    1 
ATOM   7125  O  OG1   . THR C 1 209 ? 97.53100  132.29100 104.68500 1.000 48.55000  ? 454 THR C OG1   1 
ATOM   7126  C  CG2   . THR C 1 209 ? 99.08800  134.11800 104.85900 1.000 48.55000  ? 454 THR C CG2   1 
ATOM   7127  N  N     . ASP C 1 210 ? 97.98800  132.39900 100.77400 1.000 55.70000  ? 455 ASP C N     1 
ATOM   7128  C  CA    . ASP C 1 210 ? 97.57800  131.46500 99.73600  1.000 55.70000  ? 455 ASP C CA    1 
ATOM   7129  C  C     . ASP C 1 210 ? 98.02700  130.06000 100.12100 1.000 55.70000  ? 455 ASP C C     1 
ATOM   7130  O  O     . ASP C 1 210 ? 99.22900  129.77800 100.16700 1.000 55.70000  ? 455 ASP C O     1 
ATOM   7131  C  CB    . ASP C 1 210 ? 98.17500  131.87900 98.39300  1.000 55.70000  ? 455 ASP C CB    1 
ATOM   7132  C  CG    . ASP C 1 210 ? 97.56100  131.13900 97.22600  1.000 55.70000  ? 455 ASP C CG    1 
ATOM   7133  O  OD1   . ASP C 1 210 ? 96.66300  130.30200 97.45000  1.000 55.70000  ? 455 ASP C OD1   1 
ATOM   7134  O  OD2   . ASP C 1 210 ? 97.98200  131.39600 96.07800  1.000 55.70000  ? 455 ASP C OD2   1 
ATOM   7135  N  N     . LEU C 1 211 ? 97.05700  129.18800 100.41100 1.000 47.68000  ? 456 LEU C N     1 
ATOM   7136  C  CA    . LEU C 1 211 ? 97.36800  127.80300 100.75200 1.000 47.68000  ? 456 LEU C CA    1 
ATOM   7137  C  C     . LEU C 1 211 ? 98.18100  127.11500 99.66400  1.000 47.68000  ? 456 LEU C C     1 
ATOM   7138  O  O     . LEU C 1 211 ? 99.11700  126.37000 99.96900  1.000 47.68000  ? 456 LEU C O     1 
ATOM   7139  C  CB    . LEU C 1 211 ? 96.07600  127.03000 101.01100 1.000 47.68000  ? 456 LEU C CB    1 
ATOM   7140  C  CG    . LEU C 1 211 ? 96.19700  125.54300 101.34000 1.000 47.68000  ? 456 LEU C CG    1 
ATOM   7141  C  CD1   . LEU C 1 211 ? 96.95800  125.30700 102.62700 1.000 47.68000  ? 456 LEU C CD1   1 
ATOM   7142  C  CD2   . LEU C 1 211 ? 94.81500  124.92200 101.41200 1.000 47.68000  ? 456 LEU C CD2   1 
ATOM   7143  N  N     . ALA C 1 212 ? 97.84900  127.35500 98.39700  1.000 52.67000  ? 457 ALA C N     1 
ATOM   7144  C  CA    . ALA C 1 212 ? 98.49400  126.65200 97.29300  1.000 52.67000  ? 457 ALA C CA    1 
ATOM   7145  C  C     . ALA C 1 212 ? 99.96800  126.99000 97.13700  1.000 52.67000  ? 457 ALA C C     1 
ATOM   7146  O  O     . ALA C 1 212 ? 100.61500 126.42900 96.24600  1.000 52.67000  ? 457 ALA C O     1 
ATOM   7147  C  CB    . ALA C 1 212 ? 97.76200  126.95300 95.98400  1.000 52.67000  ? 457 ALA C CB    1 
ATOM   7148  N  N     . LYS C 1 213 ? 100.52000 127.88000 97.96000  1.000 53.66000  ? 458 LYS C N     1 
ATOM   7149  C  CA    . LYS C 1 213 ? 101.91800 128.25400 97.84300  1.000 53.66000  ? 458 LYS C CA    1 
ATOM   7150  C  C     . LYS C 1 213 ? 102.67600 128.18200 99.16000  1.000 53.66000  ? 458 LYS C C     1 
ATOM   7151  O  O     . LYS C 1 213 ? 103.81500 128.65900 99.22200  1.000 53.66000  ? 458 LYS C O     1 
ATOM   7152  C  CB    . LYS C 1 213 ? 102.04600 129.67200 97.26100  1.000 53.66000  ? 458 LYS C CB    1 
ATOM   7153  C  CG    . LYS C 1 213 ? 101.61400 129.78100 95.80600  1.000 53.66000  ? 458 LYS C CG    1 
ATOM   7154  C  CD    . LYS C 1 213 ? 101.61600 131.22200 95.31900  1.000 53.66000  ? 458 LYS C CD    1 
ATOM   7155  C  CE    . LYS C 1 213 ? 103.03100 131.75200 95.15400  1.000 53.66000  ? 458 LYS C CE    1 
ATOM   7156  N  NZ    . LYS C 1 213 ? 103.05000 133.12100 94.56900  1.000 53.66000  ? 458 LYS C NZ    1 
ATOM   7157  N  N     . MET C 1 214 ? 102.08600 127.61200 100.21100 1.000 47.79000  ? 459 MET C N     1 
ATOM   7158  C  CA    . MET C 1 214 ? 102.82600 127.44100 101.46000 1.000 47.79000  ? 459 MET C CA    1 
ATOM   7159  C  C     . MET C 1 214 ? 103.76900 126.23500 101.45300 1.000 47.79000  ? 459 MET C C     1 
ATOM   7160  O  O     . MET C 1 214 ? 104.88800 126.36800 101.97500 1.000 47.79000  ? 459 MET C O     1 
ATOM   7161  C  CB    . MET C 1 214 ? 101.85900 127.41600 102.64800 1.000 47.79000  ? 459 MET C CB    1 
ATOM   7162  C  CG    . MET C 1 214 ? 101.14500 128.74100 102.85300 1.000 47.79000  ? 459 MET C CG    1 
ATOM   7163  S  SD    . MET C 1 214 ? 100.28100 128.89100 104.43700 1.000 47.79000  ? 459 MET C SD    1 
ATOM   7164  C  CE    . MET C 1 214 ? 98.93600  127.74300 104.21900 1.000 47.79000  ? 459 MET C CE    1 
ATOM   7165  N  N     . PRO C 1 215 ? 103.41700 125.03700 100.89900 1.000 48.01000  ? 460 PRO C N     1 
ATOM   7166  C  CA    . PRO C 1 215 ? 102.03300 124.70400 100.53300 1.000 48.01000  ? 460 PRO C CA    1 
ATOM   7167  C  C     . PRO C 1 215 ? 101.26100 124.07600 101.67600 1.000 48.01000  ? 460 PRO C C     1 
ATOM   7168  O  O     . PRO C 1 215 ? 100.04000 124.22400 101.77500 1.000 48.01000  ? 460 PRO C O     1 
ATOM   7169  C  CB    . PRO C 1 215 ? 102.20700 123.69100 99.39200  1.000 48.01000  ? 460 PRO C CB    1 
ATOM   7170  C  CG    . PRO C 1 215 ? 103.61800 123.83300 98.95700  1.000 48.01000  ? 460 PRO C CG    1 
ATOM   7171  C  CD    . PRO C 1 215 ? 104.37600 124.18400 100.18600 1.000 48.01000  ? 460 PRO C CD    1 
ATOM   7172  N  N     . HIS C 1 216 ? 101.97200 123.36600 102.54600 1.000 45.13000  ? 461 HIS C N     1 
ATOM   7173  C  CA    . HIS C 1 216 ? 101.32400 122.56700 103.57500 1.000 45.13000  ? 461 HIS C CA    1 
ATOM   7174  C  C     . HIS C 1 216 ? 101.36700 123.34700 104.87500 1.000 45.13000  ? 461 HIS C C     1 
ATOM   7175  O  O     . HIS C 1 216 ? 102.19500 124.24900 105.03000 1.000 45.13000  ? 461 HIS C O     1 
ATOM   7176  C  CB    . HIS C 1 216 ? 102.01200 121.20800 103.72600 1.000 45.13000  ? 461 HIS C CB    1 
ATOM   7177  C  CG    . HIS C 1 216 ? 101.92500 120.34800 102.50400 1.000 45.13000  ? 461 HIS C CG    1 
ATOM   7178  N  ND1   . HIS C 1 216 ? 100.78000 119.66900 102.15000 1.000 45.13000  ? 461 HIS C ND1   1 
ATOM   7179  C  CD2   . HIS C 1 216 ? 102.84300 120.06100 101.55100 1.000 45.13000  ? 461 HIS C CD2   1 
ATOM   7180  C  CE1   . HIS C 1 216 ? 100.99700 118.99800 101.03200 1.000 45.13000  ? 461 HIS C CE1   1 
ATOM   7181  N  NE2   . HIS C 1 216 ? 102.24100 119.21900 100.64900 1.000 45.13000  ? 461 HIS C NE2   1 
ATOM   7182  N  N     . LEU C 1 217 ? 100.48200 123.00500 105.79900 1.000 40.84000  ? 462 LEU C N     1 
ATOM   7183  C  CA    . LEU C 1 217 ? 100.31200 123.78400 107.01200 1.000 40.84000  ? 462 LEU C CA    1 
ATOM   7184  C  C     . LEU C 1 217 ? 100.25300 122.85000 108.20800 1.000 40.84000  ? 462 LEU C C     1 
ATOM   7185  O  O     . LEU C 1 217 ? 99.66200  121.77000 108.13200 1.000 40.84000  ? 462 LEU C O     1 
ATOM   7186  C  CB    . LEU C 1 217 ? 99.05000  124.63600 106.92200 1.000 40.84000  ? 462 LEU C CB    1 
ATOM   7187  C  CG    . LEU C 1 217 ? 98.81500  125.67000 108.01200 1.000 40.84000  ? 462 LEU C CG    1 
ATOM   7188  C  CD1   . LEU C 1 217 ? 99.94700  126.66700 108.01400 1.000 40.84000  ? 462 LEU C CD1   1 
ATOM   7189  C  CD2   . LEU C 1 217 ? 97.51800  126.36900 107.74000 1.000 40.84000  ? 462 LEU C CD2   1 
ATOM   7190  N  N     . LEU C 1 218 ? 100.87000 123.26500 109.30900 1.000 39.20000  ? 463 LEU C N     1 
ATOM   7191  C  CA    . LEU C 1 218 ? 100.93900 122.46400 110.52900 1.000 39.20000  ? 463 LEU C CA    1 
ATOM   7192  C  C     . LEU C 1 218 ? 100.43200 123.31900 111.68600 1.000 39.20000  ? 463 LEU C C     1 
ATOM   7193  O  O     . LEU C 1 218 ? 101.21300 123.97200 112.38000 1.000 39.20000  ? 463 LEU C O     1 
ATOM   7194  C  CB    . LEU C 1 218 ? 102.35800 121.96100 110.77400 1.000 39.20000  ? 463 LEU C CB    1 
ATOM   7195  C  CG    . LEU C 1 218 ? 102.58700 121.07000 111.99700 1.000 39.20000  ? 463 LEU C CG    1 
ATOM   7196  C  CD1   . LEU C 1 218 ? 101.78700 119.78700 111.89500 1.000 39.20000  ? 463 LEU C CD1   1 
ATOM   7197  C  CD2   . LEU C 1 218 ? 104.06300 120.76400 112.15100 1.000 39.20000  ? 463 LEU C CD2   1 
ATOM   7198  N  N     . VAL C 1 219 ? 99.12000  123.31400 111.88500 1.000 37.31000  ? 464 VAL C N     1 
ATOM   7199  C  CA    . VAL C 1 219 ? 98.50800  123.99200 113.02100 1.000 37.31000  ? 464 VAL C CA    1 
ATOM   7200  C  C     . VAL C 1 219 ? 98.76900  123.17900 114.28100 1.000 37.31000  ? 464 VAL C C     1 
ATOM   7201  O  O     . VAL C 1 219 ? 98.68500  121.94500 114.26500 1.000 37.31000  ? 464 VAL C O     1 
ATOM   7202  C  CB    . VAL C 1 219 ? 97.00000  124.18300 112.77800 1.000 37.31000  ? 464 VAL C CB    1 
ATOM   7203  C  CG1   . VAL C 1 219 ? 96.33200  124.78300 113.99600 1.000 37.31000  ? 464 VAL C CG1   1 
ATOM   7204  C  CG2   . VAL C 1 219 ? 96.76400  125.05200 111.55800 1.000 37.31000  ? 464 VAL C CG2   1 
ATOM   7205  N  N     . ALA C 1 220 ? 99.08800  123.86100 115.37900 1.000 34.64000  ? 465 ALA C N     1 
ATOM   7206  C  CA    . ALA C 1 220 ? 99.35500  123.16900 116.63100 1.000 34.64000  ? 465 ALA C CA    1 
ATOM   7207  C  C     . ALA C 1 220 ? 99.28600  124.15700 117.78700 1.000 34.64000  ? 465 ALA C C     1 
ATOM   7208  O  O     . ALA C 1 220 ? 99.57100  125.34400 117.62200 1.000 34.64000  ? 465 ALA C O     1 
ATOM   7209  C  CB    . ALA C 1 220 ? 100.71300 122.46800 116.59300 1.000 34.64000  ? 465 ALA C CB    1 
ATOM   7210  N  N     . GLY C 1 221 ? 98.89900  123.65100 118.95200 1.000 33.80000  ? 466 GLY C N     1 
ATOM   7211  C  CA    . GLY C 1 221 ? 98.69100  124.49500 120.11300 1.000 33.80000  ? 466 GLY C CA    1 
ATOM   7212  C  C     . GLY C 1 221 ? 97.96800  123.73000 121.19700 1.000 33.80000  ? 466 GLY C C     1 
ATOM   7213  O  O     . GLY C 1 221 ? 97.31800  122.71200 120.94900 1.000 33.80000  ? 466 GLY C O     1 
ATOM   7214  N  N     . THR C 1 222 ? 98.09400  124.24200 122.42000 1.000 34.46000  ? 467 THR C N     1 
ATOM   7215  C  CA    . THR C 1 222 ? 97.55100  123.56300 123.58700 1.000 34.46000  ? 467 THR C CA    1 
ATOM   7216  C  C     . THR C 1 222 ? 96.02700  123.51900 123.53700 1.000 34.46000  ? 467 THR C C     1 
ATOM   7217  O  O     . THR C 1 222 ? 95.38400  124.13000 122.68100 1.000 34.46000  ? 467 THR C O     1 
ATOM   7218  C  CB    . THR C 1 222 ? 98.00000  124.24800 124.87400 1.000 34.46000  ? 467 THR C CB    1 
ATOM   7219  O  OG1   . THR C 1 222 ? 97.51000  125.59300 124.89900 1.000 34.46000  ? 467 THR C OG1   1 
ATOM   7220  C  CG2   . THR C 1 222 ? 99.50600  124.26400 124.96100 1.000 34.46000  ? 467 THR C CG2   1 
ATOM   7221  N  N     . THR C 1 223 ? 95.45000  122.78300 124.48300 1.000 36.97000  ? 468 THR C N     1 
ATOM   7222  C  CA    . THR C 1 223 ? 94.00200  122.61900 124.55100 1.000 36.97000  ? 468 THR C CA    1 
ATOM   7223  C  C     . THR C 1 223 ? 93.35700  123.93500 124.95700 1.000 36.97000  ? 468 THR C C     1 
ATOM   7224  O  O     . THR C 1 223 ? 93.65400  124.47800 126.02500 1.000 36.97000  ? 468 THR C O     1 
ATOM   7225  C  CB    . THR C 1 223 ? 93.63800  121.51700 125.53900 1.000 36.97000  ? 468 THR C CB    1 
ATOM   7226  O  OG1   . THR C 1 223 ? 94.08500  121.88200 126.85000 1.000 36.97000  ? 468 THR C OG1   1 
ATOM   7227  C  CG2   . THR C 1 223 ? 94.29000  120.21300 125.13500 1.000 36.97000  ? 468 THR C CG2   1 
ATOM   7228  N  N     . GLY C 1 224 ? 92.47000  124.44900 124.11100 1.000 35.68000  ? 469 GLY C N     1 
ATOM   7229  C  CA    . GLY C 1 224 ? 91.76400  125.67500 124.41800 1.000 35.68000  ? 469 GLY C CA    1 
ATOM   7230  C  C     . GLY C 1 224 ? 92.47000  126.89900 123.88200 1.000 35.68000  ? 469 GLY C C     1 
ATOM   7231  O  O     . GLY C 1 224 ? 92.31200  128.00000 124.41500 1.000 35.68000  ? 469 GLY C O     1 
ATOM   7232  N  N     . SER C 1 225 ? 93.25600  126.71800 122.82500 1.000 32.76000  ? 470 SER C N     1 
ATOM   7233  C  CA    . SER C 1 225 ? 94.03900  127.79900 122.25300 1.000 32.76000  ? 470 SER C CA    1 
ATOM   7234  C  C     . SER C 1 225 ? 93.56600  128.22300 120.87300 1.000 32.76000  ? 470 SER C C     1 
ATOM   7235  O  O     . SER C 1 225 ? 94.26500  128.99200 120.20800 1.000 32.76000  ? 470 SER C O     1 
ATOM   7236  C  CB    . SER C 1 225 ? 95.51300  127.39800 122.17900 1.000 32.76000  ? 470 SER C CB    1 
ATOM   7237  O  OG    . SER C 1 225 ? 95.69200  126.33000 121.27200 1.000 32.76000  ? 470 SER C OG    1 
ATOM   7238  N  N     . GLY C 1 226 ? 92.41500  127.74100 120.41900 1.000 35.62000  ? 471 GLY C N     1 
ATOM   7239  C  CA    . GLY C 1 226 ? 91.83800  128.22900 119.18500 1.000 35.62000  ? 471 GLY C CA    1 
ATOM   7240  C  C     . GLY C 1 226 ? 92.45900  127.66000 117.92900 1.000 35.62000  ? 471 GLY C C     1 
ATOM   7241  O  O     . GLY C 1 226 ? 92.93000  128.41100 117.07200 1.000 35.62000  ? 471 GLY C O     1 
ATOM   7242  N  N     . LYS C 1 227 ? 92.47300  126.33600 117.80200 1.000 36.73000  ? 472 LYS C N     1 
ATOM   7243  C  CA    . LYS C 1 227 ? 92.89700  125.70600 116.56000 1.000 36.73000  ? 472 LYS C CA    1 
ATOM   7244  C  C     . LYS C 1 227 ? 91.72700  125.37500 115.65100 1.000 36.73000  ? 472 LYS C C     1 
ATOM   7245  O  O     . LYS C 1 227 ? 91.72600  125.77600 114.48400 1.000 36.73000  ? 472 LYS C O     1 
ATOM   7246  C  CB    . LYS C 1 227 ? 93.68900  124.43000 116.84200 1.000 36.73000  ? 472 LYS C CB    1 
ATOM   7247  C  CG    . LYS C 1 227 ? 94.98800  124.65900 117.57000 1.000 36.73000  ? 472 LYS C CG    1 
ATOM   7248  C  CD    . LYS C 1 227 ? 95.73400  123.36000 117.73100 1.000 36.73000  ? 472 LYS C CD    1 
ATOM   7249  C  CE    . LYS C 1 227 ? 95.00900  122.44700 118.69000 1.000 36.73000  ? 472 LYS C CE    1 
ATOM   7250  N  NZ    . LYS C 1 227 ? 95.00100  123.01900 120.05800 1.000 36.73000  ? 472 LYS C NZ    1 
ATOM   7251  N  N     . SER C 1 228 ? 90.72300  124.66300 116.15100 1.000 41.37000  ? 473 SER C N     1 
ATOM   7252  C  CA    . SER C 1 228 ? 89.53600  124.40700 115.34100 1.000 41.37000  ? 473 SER C CA    1 
ATOM   7253  C  C     . SER C 1 228 ? 88.51500  125.52600 115.49500 1.000 41.37000  ? 473 SER C C     1 
ATOM   7254  O  O     . SER C 1 228 ? 87.32400  125.30600 115.69500 1.000 41.37000  ? 473 SER C O     1 
ATOM   7255  C  CB    . SER C 1 228 ? 88.93500  123.06100 115.71600 1.000 41.37000  ? 473 SER C CB    1 
ATOM   7256  O  OG    . SER C 1 228 ? 89.84500  122.01000 115.44200 1.000 41.37000  ? 473 SER C OG    1 
ATOM   7257  N  N     . VAL C 1 229 ? 89.01700  126.75400 115.41800 1.000 42.01000  ? 474 VAL C N     1 
ATOM   7258  C  CA    . VAL C 1 229 ? 88.24700  127.94500 115.09200 1.000 42.01000  ? 474 VAL C CA    1 
ATOM   7259  C  C     . VAL C 1 229 ? 89.11400  128.65900 114.06800 1.000 42.01000  ? 474 VAL C C     1 
ATOM   7260  O  O     . VAL C 1 229 ? 88.67400  129.58200 113.37400 1.000 42.01000  ? 474 VAL C O     1 
ATOM   7261  C  CB    . VAL C 1 229 ? 87.95400  128.80800 116.33200 1.000 42.01000  ? 474 VAL C CB    1 
ATOM   7262  C  CG1   . VAL C 1 229 ? 87.24600  130.09100 115.95100 1.000 42.01000  ? 474 VAL C CG1   1 
ATOM   7263  C  CG2   . VAL C 1 229 ? 87.10400  128.03500 117.31800 1.000 42.01000  ? 474 VAL C CG2   1 
ATOM   7264  N  N     . GLY C 1 230 ? 90.35200  128.19100 113.95000 1.000 38.91000  ? 475 GLY C N     1 
ATOM   7265  C  CA    . GLY C 1 230 ? 91.29000  128.70700 112.98100 1.000 38.91000  ? 475 GLY C CA    1 
ATOM   7266  C  C     . GLY C 1 230 ? 91.47900  127.71400 111.86000 1.000 38.91000  ? 475 GLY C C     1 
ATOM   7267  O  O     . GLY C 1 230 ? 92.24200  127.95900 110.92600 1.000 38.91000  ? 475 GLY C O     1 
ATOM   7268  N  N     . VAL C 1 231 ? 90.79100  126.58100 111.95100 1.000 37.67000  ? 476 VAL C N     1 
ATOM   7269  C  CA    . VAL C 1 231 ? 90.63800  125.67000 110.82700 1.000 37.67000  ? 476 VAL C CA    1 
ATOM   7270  C  C     . VAL C 1 231 ? 89.28000  125.84600 110.16300 1.000 37.67000  ? 476 VAL C C     1 
ATOM   7271  O  O     . VAL C 1 231 ? 89.16500  125.76700 108.93900 1.000 37.67000  ? 476 VAL C O     1 
ATOM   7272  C  CB    . VAL C 1 231 ? 90.85400  124.21100 111.28300 1.000 37.67000  ? 476 VAL C CB    1 
ATOM   7273  C  CG1   . VAL C 1 231 ? 90.57100  123.24800 110.14700 1.000 37.67000  ? 476 VAL C CG1   1 
ATOM   7274  C  CG2   . VAL C 1 231 ? 92.27000  124.02200 111.78800 1.000 37.67000  ? 476 VAL C CG2   1 
ATOM   7275  N  N     . ASN C 1 232 ? 88.24500  126.11100 110.96200 1.000 42.54000  ? 477 ASN C N     1 
ATOM   7276  C  CA    . ASN C 1 232 ? 86.97300  126.52800 110.38900 1.000 42.54000  ? 477 ASN C CA    1 
ATOM   7277  C  C     . ASN C 1 232 ? 87.12400  127.83500 109.62300 1.000 42.54000  ? 477 ASN C C     1 
ATOM   7278  O  O     . ASN C 1 232 ? 86.50200  128.01800 108.57500 1.000 42.54000  ? 477 ASN C O     1 
ATOM   7279  C  CB    . ASN C 1 232 ? 85.91500  126.66400 111.48100 1.000 42.54000  ? 477 ASN C CB    1 
ATOM   7280  C  CG    . ASN C 1 232 ? 85.56400  125.34400 112.12000 1.000 42.54000  ? 477 ASN C CG    1 
ATOM   7281  O  OD1   . ASN C 1 232 ? 85.78200  125.14100 113.31100 1.000 42.54000  ? 477 ASN C OD1   1 
ATOM   7282  N  ND2   . ASN C 1 232 ? 85.01500  124.43300 111.32900 1.000 42.54000  ? 477 ASN C ND2   1 
ATOM   7283  N  N     . ALA C 1 233 ? 87.95000  128.75600 110.12400 1.000 42.40000  ? 478 ALA C N     1 
ATOM   7284  C  CA    . ALA C 1 233 ? 88.18900  129.99400 109.39100 1.000 42.40000  ? 478 ALA C CA    1 
ATOM   7285  C  C     . ALA C 1 233 ? 88.82200  129.71200 108.03600 1.000 42.40000  ? 478 ALA C C     1 
ATOM   7286  O  O     . ALA C 1 233 ? 88.44000  130.30900 107.02300 1.000 42.40000  ? 478 ALA C O     1 
ATOM   7287  C  CB    . ALA C 1 233 ? 89.07200  130.93200 110.21000 1.000 42.40000  ? 478 ALA C CB    1 
ATOM   7288  N  N     . MET C 1 234 ? 89.76300  128.77000 107.99000 1.000 41.07000  ? 479 MET C N     1 
ATOM   7289  C  CA    . MET C 1 234 ? 90.40400  128.42000 106.72800 1.000 41.07000  ? 479 MET C CA    1 
ATOM   7290  C  C     . MET C 1 234 ? 89.41500  127.76500 105.77400 1.000 41.07000  ? 479 MET C C     1 
ATOM   7291  O  O     . MET C 1 234 ? 89.37300  128.09300 104.58100 1.000 41.07000  ? 479 MET C O     1 
ATOM   7292  C  CB    . MET C 1 234 ? 91.58200  127.48900 107.00100 1.000 41.07000  ? 479 MET C CB    1 
ATOM   7293  C  CG    . MET C 1 234 ? 92.67200  128.12500 107.83700 1.000 41.07000  ? 479 MET C CG    1 
ATOM   7294  S  SD    . MET C 1 234 ? 93.99600  126.98300 108.26100 1.000 41.07000  ? 479 MET C SD    1 
ATOM   7295  C  CE    . MET C 1 234 ? 94.92900  127.98700 109.41200 1.000 41.07000  ? 479 MET C CE    1 
ATOM   7296  N  N     . LEU C 1 235 ? 88.59900  126.84400 106.28300 1.000 40.79000  ? 480 LEU C N     1 
ATOM   7297  C  CA    . LEU C 1 235 ? 87.65100  126.15600 105.41500 1.000 40.79000  ? 480 LEU C CA    1 
ATOM   7298  C  C     . LEU C 1 235 ? 86.56500  127.09900 104.91300 1.000 40.79000  ? 480 LEU C C     1 
ATOM   7299  O  O     . LEU C 1 235 ? 86.12500  126.98000 103.76800 1.000 40.79000  ? 480 LEU C O     1 
ATOM   7300  C  CB    . LEU C 1 235 ? 87.06000  124.95000 106.13900 1.000 40.79000  ? 480 LEU C CB    1 
ATOM   7301  C  CG    . LEU C 1 235 ? 88.13500  123.87600 106.31500 1.000 40.79000  ? 480 LEU C CG    1 
ATOM   7302  C  CD1   . LEU C 1 235 ? 87.65400  122.70800 107.14400 1.000 40.79000  ? 480 LEU C CD1   1 
ATOM   7303  C  CD2   . LEU C 1 235 ? 88.61400  123.40100 104.95600 1.000 40.79000  ? 480 LEU C CD2   1 
ATOM   7304  N  N     . LEU C 1 236 ? 86.13000  128.05500 105.73700 1.000 43.12000  ? 481 LEU C N     1 
ATOM   7305  C  CA    . LEU C 1 236 ? 85.20000  129.06600 105.24600 1.000 43.12000  ? 481 LEU C CA    1 
ATOM   7306  C  C     . LEU C 1 236 ? 85.86300  130.01100 104.25600 1.000 43.12000  ? 481 LEU C C     1 
ATOM   7307  O  O     . LEU C 1 236 ? 85.19500  130.51500 103.34700 1.000 43.12000  ? 481 LEU C O     1 
ATOM   7308  C  CB    . LEU C 1 236 ? 84.59600  129.85600 106.40400 1.000 43.12000  ? 481 LEU C CB    1 
ATOM   7309  C  CG    . LEU C 1 236 ? 83.30500  129.30700 107.01300 1.000 43.12000  ? 481 LEU C CG    1 
ATOM   7310  C  CD1   . LEU C 1 236 ? 83.52500  128.02000 107.77400 1.000 43.12000  ? 481 LEU C CD1   1 
ATOM   7311  C  CD2   . LEU C 1 236 ? 82.67300  130.35500 107.91100 1.000 43.12000  ? 481 LEU C CD2   1 
ATOM   7312  N  N     . SER C 1 237 ? 87.16100  130.27300 104.41100 1.000 44.01000  ? 482 SER C N     1 
ATOM   7313  C  CA    . SER C 1 237 ? 87.87300  131.00500 103.37100 1.000 44.01000  ? 482 SER C CA    1 
ATOM   7314  C  C     . SER C 1 237 ? 87.87800  130.22700 102.06600 1.000 44.01000  ? 482 SER C C     1 
ATOM   7315  O  O     . SER C 1 237 ? 87.86700  130.82200 100.98400 1.000 44.01000  ? 482 SER C O     1 
ATOM   7316  C  CB    . SER C 1 237 ? 89.30200  131.30300 103.81800 1.000 44.01000  ? 482 SER C CB    1 
ATOM   7317  O  OG    . SER C 1 237 ? 89.31000  132.16900 104.93700 1.000 44.01000  ? 482 SER C OG    1 
ATOM   7318  N  N     . ILE C 1 238 ? 87.89300  128.89700 102.15400 1.000 45.17000  ? 483 ILE C N     1 
ATOM   7319  C  CA    . ILE C 1 238 ? 87.81200  128.06900 100.95400 1.000 45.17000  ? 483 ILE C CA    1 
ATOM   7320  C  C     . ILE C 1 238 ? 86.40700  128.11100 100.36100 1.000 45.17000  ? 483 ILE C C     1 
ATOM   7321  O  O     . ILE C 1 238 ? 86.23800  128.19400 99.13900  1.000 45.17000  ? 483 ILE C O     1 
ATOM   7322  C  CB    . ILE C 1 238 ? 88.23900  126.62500 101.27000 1.000 45.17000  ? 483 ILE C CB    1 
ATOM   7323  C  CG1   . ILE C 1 238 ? 89.64700  126.59600 101.85800 1.000 45.17000  ? 483 ILE C CG1   1 
ATOM   7324  C  CG2   . ILE C 1 238 ? 88.16800  125.76200 100.02400 1.000 45.17000  ? 483 ILE C CG2   1 
ATOM   7325  C  CD1   . ILE C 1 238 ? 90.69100  127.15600 100.94700 1.000 45.17000  ? 483 ILE C CD1   1 
ATOM   7326  N  N     . LEU C 1 239 ? 85.37900  128.05200 101.21100 1.000 49.80000  ? 484 LEU C N     1 
ATOM   7327  C  CA    . LEU C 1 239 ? 84.01200  127.88400 100.72300 1.000 49.80000  ? 484 LEU C CA    1 
ATOM   7328  C  C     . LEU C 1 239 ? 83.50700  129.14500 100.03500 1.000 49.80000  ? 484 LEU C C     1 
ATOM   7329  O  O     . LEU C 1 239 ? 82.88400  129.07500 98.97000  1.000 49.80000  ? 484 LEU C O     1 
ATOM   7330  C  CB    . LEU C 1 239 ? 83.07900  127.51100 101.87600 1.000 49.80000  ? 484 LEU C CB    1 
ATOM   7331  C  CG    . LEU C 1 239 ? 83.35400  126.23200 102.67000 1.000 49.80000  ? 484 LEU C CG    1 
ATOM   7332  C  CD1   . LEU C 1 239 ? 82.34200  126.05200 103.79300 1.000 49.80000  ? 484 LEU C CD1   1 
ATOM   7333  C  CD2   . LEU C 1 239 ? 83.40600  125.01600 101.77800 1.000 49.80000  ? 484 LEU C CD2   1 
ATOM   7334  N  N     . PHE C 1 240 ? 83.75900  130.30900 100.63100 1.000 54.04000  ? 485 PHE C N     1 
ATOM   7335  C  CA    . PHE C 1 240 ? 83.21200  131.56300 100.12600 1.000 54.04000  ? 485 PHE C CA    1 
ATOM   7336  C  C     . PHE C 1 240 ? 83.82300  132.01800 98.81500  1.000 54.04000  ? 485 PHE C C     1 
ATOM   7337  O  O     . PHE C 1 240 ? 83.39300  133.05300 98.29600  1.000 54.04000  ? 485 PHE C O     1 
ATOM   7338  C  CB    . PHE C 1 240 ? 83.40000  132.67000 101.16000 1.000 54.04000  ? 485 PHE C CB    1 
ATOM   7339  C  CG    . PHE C 1 240 ? 82.41100  132.63100 102.27500 1.000 54.04000  ? 485 PHE C CG    1 
ATOM   7340  C  CD1   . PHE C 1 240 ? 81.21300  131.96500 102.13100 1.000 54.04000  ? 485 PHE C CD1   1 
ATOM   7341  C  CD2   . PHE C 1 240 ? 82.68400  133.25400 103.47400 1.000 54.04000  ? 485 PHE C CD2   1 
ATOM   7342  C  CE1   . PHE C 1 240 ? 80.30100  131.93700 103.16000 1.000 54.04000  ? 485 PHE C CE1   1 
ATOM   7343  C  CE2   . PHE C 1 240 ? 81.78000  133.22400 104.50500 1.000 54.04000  ? 485 PHE C CE2   1 
ATOM   7344  C  CZ    . PHE C 1 240 ? 80.58800  132.56600 104.34800 1.000 54.04000  ? 485 PHE C CZ    1 
ATOM   7345  N  N     . LYS C 1 241 ? 84.79500  131.30300 98.25800  1.000 58.47000  ? 486 LYS C N     1 
ATOM   7346  C  CA    . LYS C 1 241 ? 85.47000  131.82800 97.08100  1.000 58.47000  ? 486 LYS C CA    1 
ATOM   7347  C  C     . LYS C 1 241 ? 85.61900  130.78900 95.97800  1.000 58.47000  ? 486 LYS C C     1 
ATOM   7348  O  O     . LYS C 1 241 ? 85.75400  131.14100 94.80200  1.000 58.47000  ? 486 LYS C O     1 
ATOM   7349  C  CB    . LYS C 1 241 ? 86.83300  132.38100 97.48500  1.000 58.47000  ? 486 LYS C CB    1 
ATOM   7350  C  CG    . LYS C 1 241 ? 87.59700  133.01500 96.36100  1.000 58.47000  ? 486 LYS C CG    1 
ATOM   7351  C  CD    . LYS C 1 241 ? 88.84300  133.65900 96.88400  1.000 58.47000  ? 486 LYS C CD    1 
ATOM   7352  C  CE    . LYS C 1 241 ? 89.72600  134.08200 95.75300  1.000 58.47000  ? 486 LYS C CE    1 
ATOM   7353  N  NZ    . LYS C 1 241 ? 89.11100  135.18200 94.96500  1.000 58.47000  ? 486 LYS C NZ    1 
ATOM   7354  N  N     . SER C 1 242 ? 85.57400  129.51000 96.33200  1.000 59.16000  ? 487 SER C N     1 
ATOM   7355  C  CA    . SER C 1 242 ? 85.80300  128.44100 95.37500  1.000 59.16000  ? 487 SER C CA    1 
ATOM   7356  C  C     . SER C 1 242 ? 84.58800  127.53100 95.29900  1.000 59.16000  ? 487 SER C C     1 
ATOM   7357  O  O     . SER C 1 242 ? 83.99900  127.17300 96.32300  1.000 59.16000  ? 487 SER C O     1 
ATOM   7358  C  CB    . SER C 1 242 ? 87.04400  127.62800 95.74500  1.000 59.16000  ? 487 SER C CB    1 
ATOM   7359  O  OG    . SER C 1 242 ? 88.21300  128.42500 95.66500  1.000 59.16000  ? 487 SER C OG    1 
ATOM   7360  N  N     . THR C 1 243 ? 84.22000  127.17200 94.08300  1.000 61.39000  ? 488 THR C N     1 
ATOM   7361  C  CA    . THR C 1 243 ? 83.15000  126.24300 93.77000  1.000 61.39000  ? 488 THR C CA    1 
ATOM   7362  C  C     . THR C 1 243 ? 83.67700  124.81400 93.80100  1.000 61.39000  ? 488 THR C C     1 
ATOM   7363  O  O     . THR C 1 243 ? 84.89100  124.59200 93.75600  1.000 61.39000  ? 488 THR C O     1 
ATOM   7364  C  CB    . THR C 1 243 ? 82.57300  126.56700 92.39500  1.000 61.39000  ? 488 THR C CB    1 
ATOM   7365  O  OG1   . THR C 1 243 ? 83.59200  126.41600 91.40100  1.000 61.39000  ? 488 THR C OG1   1 
ATOM   7366  C  CG2   . THR C 1 243 ? 82.05600  127.99600 92.36500  1.000 61.39000  ? 488 THR C CG2   1 
ATOM   7367  N  N     . PRO C 1 244 ? 82.79200  123.81500 93.89500  1.000 61.93000  ? 489 PRO C N     1 
ATOM   7368  C  CA    . PRO C 1 244 ? 83.27200  122.42300 93.93300  1.000 61.93000  ? 489 PRO C CA    1 
ATOM   7369  C  C     . PRO C 1 244 ? 84.14000  122.04100 92.75000  1.000 61.93000  ? 489 PRO C C     1 
ATOM   7370  O  O     . PRO C 1 244 ? 85.00900  121.17200 92.88700  1.000 61.93000  ? 489 PRO C O     1 
ATOM   7371  C  CB    . PRO C 1 244 ? 81.97200  121.61000 93.95800  1.000 61.93000  ? 489 PRO C CB    1 
ATOM   7372  C  CG    . PRO C 1 244 ? 80.97700  122.52700 94.54700  1.000 61.93000  ? 489 PRO C CG    1 
ATOM   7373  C  CD    . PRO C 1 244 ? 81.33000  123.88800 94.05000  1.000 61.93000  ? 489 PRO C CD    1 
ATOM   7374  N  N     . SER C 1 245 ? 83.94000  122.66200 91.59300  1.000 64.16000  ? 490 SER C N     1 
ATOM   7375  C  CA    . SER C 1 245 ? 84.80000  122.42300 90.44400  1.000 64.16000  ? 490 SER C CA    1 
ATOM   7376  C  C     . SER C 1 245 ? 86.08900  123.22700 90.50300  1.000 64.16000  ? 490 SER C C     1 
ATOM   7377  O  O     . SER C 1 245 ? 86.79900  123.31200 89.49500  1.000 64.16000  ? 490 SER C O     1 
ATOM   7378  C  CB    . SER C 1 245 ? 84.04700  122.74100 89.15000  1.000 64.16000  ? 490 SER C CB    1 
ATOM   7379  O  OG    . SER C 1 245 ? 83.74700  124.12200 89.06700  1.000 64.16000  ? 490 SER C OG    1 
ATOM   7380  N  N     . GLU C 1 246 ? 86.40200  123.81700 91.65300  1.000 63.30000  ? 491 GLU C N     1 
ATOM   7381  C  CA    . GLU C 1 246 ? 87.63100  124.57100 91.84300  1.000 63.30000  ? 491 GLU C CA    1 
ATOM   7382  C  C     . GLU C 1 246 ? 88.46900  124.08700 93.01400  1.000 63.30000  ? 491 GLU C C     1 
ATOM   7383  O  O     . GLU C 1 246 ? 89.69200  124.22100 92.96900  1.000 63.30000  ? 491 GLU C O     1 
ATOM   7384  C  CB    . GLU C 1 246 ? 87.31700  126.06200 92.04100  1.000 63.30000  ? 491 GLU C CB    1 
ATOM   7385  C  CG    . GLU C 1 246 ? 86.74900  126.73900 90.80700  1.000 63.30000  ? 491 GLU C CG    1 
ATOM   7386  C  CD    . GLU C 1 246 ? 86.43300  128.20200 91.03900  1.000 63.30000  ? 491 GLU C CD    1 
ATOM   7387  O  OE1   . GLU C 1 246 ? 86.54100  128.65800 92.19600  1.000 63.30000  ? 491 GLU C OE1   1 
ATOM   7388  O  OE2   . GLU C 1 246 ? 86.07600  128.89700 90.06600  1.000 63.30000  ? 491 GLU C OE2   1 
ATOM   7389  N  N     . ALA C 1 247 ? 87.85100  123.53000 94.05500  1.000 62.05000  ? 492 ALA C N     1 
ATOM   7390  C  CA    . ALA C 1 247 ? 88.59100  123.01700 95.20600  1.000 62.05000  ? 492 ALA C CA    1 
ATOM   7391  C  C     . ALA C 1 247 ? 87.70700  122.03600 95.95700  1.000 62.05000  ? 492 ALA C C     1 
ATOM   7392  O  O     . ALA C 1 247 ? 86.66300  122.42800 96.48600  1.000 62.05000  ? 492 ALA C O     1 
ATOM   7393  C  CB    . ALA C 1 247 ? 89.03400  124.15500 96.12400  1.000 62.05000  ? 492 ALA C CB    1 
ATOM   7394  N  N     . ARG C 1 248 ? 88.11800  120.77100 96.00500  1.000 59.56000  ? 493 ARG C N     1 
ATOM   7395  C  CA    . ARG C 1 248 ? 87.40200  119.75900 96.76200  1.000 59.56000  ? 493 ARG C CA    1 
ATOM   7396  C  C     . ARG C 1 248 ? 87.94700  119.73200 98.18800  1.000 59.56000  ? 493 ARG C C     1 
ATOM   7397  O  O     . ARG C 1 248 ? 88.86500  120.47500 98.53900  1.000 59.56000  ? 493 ARG C O     1 
ATOM   7398  C  CB    . ARG C 1 248 ? 87.53700  118.39600 96.08700  1.000 59.56000  ? 493 ARG C CB    1 
ATOM   7399  C  CG    . ARG C 1 248 ? 87.10200  118.37000 94.63100  1.000 59.56000  ? 493 ARG C CG    1 
ATOM   7400  C  CD    . ARG C 1 248 ? 85.60100  118.48800 94.44700  1.000 59.56000  ? 493 ARG C CD    1 
ATOM   7401  N  NE    . ARG C 1 248 ? 84.89900  117.29300 94.89500  1.000 59.56000  ? 493 ARG C NE    1 
ATOM   7402  C  CZ    . ARG C 1 248 ? 83.58700  117.22300 95.08500  1.000 59.56000  ? 493 ARG C CZ    1 
ATOM   7403  N  NH1   . ARG C 1 248 ? 82.82600  118.28300 94.85400  1.000 59.56000  ? 493 ARG C NH1   1 
ATOM   7404  N  NH2   . ARG C 1 248 ? 83.03500  116.09000 95.49500  1.000 59.56000  ? 493 ARG C NH2   1 
ATOM   7405  N  N     . LEU C 1 249 ? 87.39200  118.86100 99.02700  1.000 52.20000  ? 494 LEU C N     1 
ATOM   7406  C  CA    . LEU C 1 249 ? 87.79100  118.82400 100.42700 1.000 52.20000  ? 494 LEU C CA    1 
ATOM   7407  C  C     . LEU C 1 249 ? 87.72300  117.39900 100.95100 1.000 52.20000  ? 494 LEU C C     1 
ATOM   7408  O  O     . LEU C 1 249 ? 86.68500  116.74400 100.83600 1.000 52.20000  ? 494 LEU C O     1 
ATOM   7409  C  CB    . LEU C 1 249 ? 86.89500  119.73300 101.27600 1.000 52.20000  ? 494 LEU C CB    1 
ATOM   7410  C  CG    . LEU C 1 249 ? 86.99600  121.24400 101.06700 1.000 52.20000  ? 494 LEU C CG    1 
ATOM   7411  C  CD1   . LEU C 1 249 ? 85.90700  121.97000 101.82900 1.000 52.20000  ? 494 LEU C CD1   1 
ATOM   7412  C  CD2   . LEU C 1 249 ? 88.35700  121.74000 101.50100 1.000 52.20000  ? 494 LEU C CD2   1 
ATOM   7413  N  N     . ILE C 1 250 ? 88.82700  116.92700 101.52300 1.000 49.58000  ? 495 ILE C N     1 
ATOM   7414  C  CA    . ILE C 1 250 ? 88.85700  115.70000 102.31000 1.000 49.58000  ? 495 ILE C CA    1 
ATOM   7415  C  C     . ILE C 1 250 ? 88.99000  116.09700 103.77100 1.000 49.58000  ? 495 ILE C C     1 
ATOM   7416  O  O     . ILE C 1 250 ? 89.83000  116.93700 104.11500 1.000 49.58000  ? 495 ILE C O     1 
ATOM   7417  C  CB    . ILE C 1 250 ? 90.00900  114.77300 101.88700 1.000 49.58000  ? 495 ILE C CB    1 
ATOM   7418  C  CG1   . ILE C 1 250 ? 89.80000  114.27100 100.46200 1.000 49.58000  ? 495 ILE C CG1   1 
ATOM   7419  C  CG2   . ILE C 1 250 ? 90.13000  113.60300 102.84000 1.000 49.58000  ? 495 ILE C CG2   1 
ATOM   7420  C  CD1   . ILE C 1 250 ? 90.99000  113.53700 99.90900  1.000 49.58000  ? 495 ILE C CD1   1 
ATOM   7421  N  N     . MET C 1 251 ? 88.16800  115.50200 104.63000 1.000 48.74000  ? 496 MET C N     1 
ATOM   7422  C  CA    . MET C 1 251 ? 88.13100  115.87700 106.03600 1.000 48.74000  ? 496 MET C CA    1 
ATOM   7423  C  C     . MET C 1 251 ? 88.27500  114.63600 106.90100 1.000 48.74000  ? 496 MET C C     1 
ATOM   7424  O  O     . MET C 1 251 ? 87.45900  113.71300 106.81500 1.000 48.74000  ? 496 MET C O     1 
ATOM   7425  C  CB    . MET C 1 251 ? 86.83700  116.62100 106.36400 1.000 48.74000  ? 496 MET C CB    1 
ATOM   7426  C  CG    . MET C 1 251 ? 86.72600  117.94700 105.64700 1.000 48.74000  ? 496 MET C CG    1 
ATOM   7427  S  SD    . MET C 1 251 ? 85.19800  118.81200 106.00400 1.000 48.74000  ? 496 MET C SD    1 
ATOM   7428  C  CE    . MET C 1 251 ? 85.37800  120.19900 104.89600 1.000 48.74000  ? 496 MET C CE    1 
ATOM   7429  N  N     . ILE C 1 252 ? 89.30700  114.62300 107.73700 1.000 53.57000  ? 497 ILE C N     1 
ATOM   7430  C  CA    . ILE C 1 252 ? 89.60600  113.50400 108.62100 1.000 53.57000  ? 497 ILE C CA    1 
ATOM   7431  C  C     . ILE C 1 252 ? 89.59200  114.06700 110.03400 1.000 53.57000  ? 497 ILE C C     1 
ATOM   7432  O  O     . ILE C 1 252 ? 90.58200  114.65400 110.48400 1.000 53.57000  ? 497 ILE C O     1 
ATOM   7433  C  CB    . ILE C 1 252 ? 90.95100  112.84900 108.30200 1.000 53.57000  ? 497 ILE C CB    1 
ATOM   7434  C  CG1   . ILE C 1 252 ? 90.96200  112.32000 106.86800 1.000 53.57000  ? 497 ILE C CG1   1 
ATOM   7435  C  CG2   . ILE C 1 252 ? 91.22700  111.72100 109.27200 1.000 53.57000  ? 497 ILE C CG2   1 
ATOM   7436  C  CD1   . ILE C 1 252 ? 92.33600  111.93200 106.37600 1.000 53.57000  ? 497 ILE C CD1   1 
ATOM   7437  N  N     . ASP C 1 253 ? 88.47200  113.90600 110.73600 1.000 56.36000  ? 498 ASP C N     1 
ATOM   7438  C  CA    . ASP C 1 253 ? 88.29700  114.45000 112.08100 1.000 56.36000  ? 498 ASP C CA    1 
ATOM   7439  C  C     . ASP C 1 253 ? 88.07400  113.29700 113.05100 1.000 56.36000  ? 498 ASP C C     1 
ATOM   7440  O  O     . ASP C 1 253 ? 86.92400  112.93100 113.33500 1.000 56.36000  ? 498 ASP C O     1 
ATOM   7441  C  CB    . ASP C 1 253 ? 87.13100  115.43700 112.11700 1.000 56.36000  ? 498 ASP C CB    1 
ATOM   7442  C  CG    . ASP C 1 253 ? 87.11700  116.27700 113.37900 1.000 56.36000  ? 498 ASP C CG    1 
ATOM   7443  O  OD1   . ASP C 1 253 ? 88.03400  116.11200 114.20900 1.000 56.36000  ? 498 ASP C OD1   1 
ATOM   7444  O  OD2   . ASP C 1 253 ? 86.18500  117.09200 113.55300 1.000 56.36000  ? 498 ASP C OD2   1 
ATOM   7445  N  N     . PRO C 1 254 ? 89.14500  112.68300 113.56700 1.000 54.62000  ? 499 PRO C N     1 
ATOM   7446  C  CA    . PRO C 1 254 ? 88.97500  111.64200 114.60000 1.000 54.62000  ? 499 PRO C CA    1 
ATOM   7447  C  C     . PRO C 1 254 ? 88.09400  112.07100 115.76100 1.000 54.62000  ? 499 PRO C C     1 
ATOM   7448  O  O     . PRO C 1 254 ? 87.16000  111.35100 116.13300 1.000 54.62000  ? 499 PRO C O     1 
ATOM   7449  C  CB    . PRO C 1 254 ? 90.41700  111.36700 115.04200 1.000 54.62000  ? 499 PRO C CB    1 
ATOM   7450  C  CG    . PRO C 1 254 ? 91.23900  111.72200 113.85300 1.000 54.62000  ? 499 PRO C CG    1 
ATOM   7451  C  CD    . PRO C 1 254 ? 90.55800  112.88000 113.20700 1.000 54.62000  ? 499 PRO C CD    1 
ATOM   7452  N  N     . LYS C 1 255 ? 88.38500  113.22300 116.35500 1.000 53.27000  ? 500 LYS C N     1 
ATOM   7453  C  CA    . LYS C 1 255 ? 87.53400  113.79600 117.38700 1.000 53.27000  ? 500 LYS C CA    1 
ATOM   7454  C  C     . LYS C 1 255 ? 86.28000  114.32200 116.69800 1.000 53.27000  ? 500 LYS C C     1 
ATOM   7455  O  O     . LYS C 1 255 ? 86.29600  115.40300 116.10500 1.000 53.27000  ? 500 LYS C O     1 
ATOM   7456  C  CB    . LYS C 1 255 ? 88.26700  114.91100 118.12100 1.000 53.27000  ? 500 LYS C CB    1 
ATOM   7457  C  CG    . LYS C 1 255 ? 89.50500  114.48300 118.86400 1.000 53.27000  ? 500 LYS C CG    1 
ATOM   7458  C  CD    . LYS C 1 255 ? 90.07800  115.65300 119.63200 1.000 53.27000  ? 500 LYS C CD    1 
ATOM   7459  C  CE    . LYS C 1 255 ? 91.40300  115.31100 120.27300 1.000 53.27000  ? 500 LYS C CE    1 
ATOM   7460  N  NZ    . LYS C 1 255 ? 91.94100  116.48200 121.01100 1.000 53.27000  ? 500 LYS C NZ    1 
ATOM   7461  N  N     . MET C 1 256 ? 85.18400  113.57300 116.78800 1.000 55.73000  ? 501 MET C N     1 
ATOM   7462  C  CA    . MET C 1 256 ? 84.06600  113.78200 115.89000 1.000 55.73000  ? 501 MET C CA    1 
ATOM   7463  C  C     . MET C 1 256 ? 83.18900  114.96400 116.29100 1.000 55.73000  ? 501 MET C C     1 
ATOM   7464  O  O     . MET C 1 256 ? 81.96600  114.82700 116.38700 1.000 55.73000  ? 501 MET C O     1 
ATOM   7465  C  CB    . MET C 1 256 ? 83.23700  112.49100 115.82100 1.000 55.73000  ? 501 MET C CB    1 
ATOM   7466  C  CG    . MET C 1 256 ? 82.63400  112.04500 117.15500 1.000 55.73000  ? 501 MET C CG    1 
ATOM   7467  S  SD    . MET C 1 256 ? 81.75300  110.47500 117.08300 1.000 55.73000  ? 501 MET C SD    1 
ATOM   7468  C  CE    . MET C 1 256 ? 83.10400  109.31200 117.22400 1.000 55.73000  ? 501 MET C CE    1 
ATOM   7469  N  N     . LEU C 1 257 ? 83.77800  116.14300 116.48400 1.000 53.84000  ? 502 LEU C N     1 
ATOM   7470  C  CA    . LEU C 1 257 ? 82.98500  117.33700 116.76300 1.000 53.84000  ? 502 LEU C CA    1 
ATOM   7471  C  C     . LEU C 1 257 ? 83.25200  118.48100 115.80400 1.000 53.84000  ? 502 LEU C C     1 
ATOM   7472  O  O     . LEU C 1 257 ? 82.31100  119.17100 115.39800 1.000 53.84000  ? 502 LEU C O     1 
ATOM   7473  C  CB    . LEU C 1 257 ? 83.21500  117.85000 118.19200 1.000 53.84000  ? 502 LEU C CB    1 
ATOM   7474  C  CG    . LEU C 1 257 ? 82.65600  117.06800 119.37100 1.000 53.84000  ? 502 LEU C CG    1 
ATOM   7475  C  CD1   . LEU C 1 257 ? 82.98900  117.77200 120.67000 1.000 53.84000  ? 502 LEU C CD1   1 
ATOM   7476  C  CD2   . LEU C 1 257 ? 81.16900  116.92300 119.21400 1.000 53.84000  ? 502 LEU C CD2   1 
ATOM   7477  N  N     . GLU C 1 258 ? 84.50900  118.71300 115.44500 1.000 54.32000  ? 503 GLU C N     1 
ATOM   7478  C  CA    . GLU C 1 258 ? 84.91400  120.01000 114.92400 1.000 54.32000  ? 503 GLU C CA    1 
ATOM   7479  C  C     . GLU C 1 258 ? 84.96100  120.05700 113.40400 1.000 54.32000  ? 503 GLU C C     1 
ATOM   7480  O  O     . GLU C 1 258 ? 85.25100  121.11300 112.83200 1.000 54.32000  ? 503 GLU C O     1 
ATOM   7481  C  CB    . GLU C 1 258 ? 86.26600  120.37600 115.54200 1.000 54.32000  ? 503 GLU C CB    1 
ATOM   7482  C  CG    . GLU C 1 258 ? 86.13800  120.57800 117.05300 1.000 54.32000  ? 503 GLU C CG    1 
ATOM   7483  C  CD    . GLU C 1 258 ? 87.46300  120.64000 117.78100 1.000 54.32000  ? 503 GLU C CD    1 
ATOM   7484  O  OE1   . GLU C 1 258 ? 88.50400  120.35900 117.15500 1.000 54.32000  ? 503 GLU C OE1   1 
ATOM   7485  O  OE2   . GLU C 1 258 ? 87.45800  120.95500 118.98900 1.000 54.32000  ? 503 GLU C OE2   1 
ATOM   7486  N  N     . LEU C 1 259 ? 84.66000  118.94500 112.73700 1.000 51.55000  ? 504 LEU C N     1 
ATOM   7487  C  CA    . LEU C 1 259 ? 84.47100  118.92900 111.29500 1.000 51.55000  ? 504 LEU C CA    1 
ATOM   7488  C  C     . LEU C 1 259 ? 83.24700  118.14000 110.86300 1.000 51.55000  ? 504 LEU C C     1 
ATOM   7489  O  O     . LEU C 1 259 ? 82.85200  118.23400 109.69600 1.000 51.55000  ? 504 LEU C O     1 
ATOM   7490  C  CB    . LEU C 1 259 ? 85.70700  118.35700 110.59100 1.000 51.55000  ? 504 LEU C CB    1 
ATOM   7491  C  CG    . LEU C 1 259 ? 86.98600  119.18300 110.68000 1.000 51.55000  ? 504 LEU C CG    1 
ATOM   7492  C  CD1   . LEU C 1 259 ? 88.13500  118.42000 110.06400 1.000 51.55000  ? 504 LEU C CD1   1 
ATOM   7493  C  CD2   . LEU C 1 259 ? 86.81200  120.52000 109.99400 1.000 51.55000  ? 504 LEU C CD2   1 
ATOM   7494  N  N     . SER C 1 260 ? 82.64500  117.36100 111.76400 1.000 50.55000  ? 505 SER C N     1 
ATOM   7495  C  CA    . SER C 1 260 ? 81.43300  116.62000 111.44300 1.000 50.55000  ? 505 SER C CA    1 
ATOM   7496  C  C     . SER C 1 260 ? 80.27500  117.52600 111.05300 1.000 50.55000  ? 505 SER C C     1 
ATOM   7497  O  O     . SER C 1 260 ? 79.27700  117.03200 110.51900 1.000 50.55000  ? 505 SER C O     1 
ATOM   7498  C  CB    . SER C 1 260 ? 81.02300  115.74700 112.62900 1.000 50.55000  ? 505 SER C CB    1 
ATOM   7499  O  OG    . SER C 1 260 ? 81.99200  114.74700 112.88500 1.000 50.55000  ? 505 SER C OG    1 
ATOM   7500  N  N     . ILE C 1 261 ? 80.38000  118.83500 111.29900 1.000 51.78000  ? 506 ILE C N     1 
ATOM   7501  C  CA    . ILE C 1 261 ? 79.31800  119.75500 110.90500 1.000 51.78000  ? 506 ILE C CA    1 
ATOM   7502  C  C     . ILE C 1 261 ? 79.38400  120.09900 109.42800 1.000 51.78000  ? 506 ILE C C     1 
ATOM   7503  O  O     . ILE C 1 261 ? 78.44700  120.70600 108.89500 1.000 51.78000  ? 506 ILE C O     1 
ATOM   7504  C  CB    . ILE C 1 261 ? 79.37800  121.03900 111.74900 1.000 51.78000  ? 506 ILE C CB    1 
ATOM   7505  C  CG1   . ILE C 1 261 ? 78.03800  121.76200 111.70000 1.000 51.78000  ? 506 ILE C CG1   1 
ATOM   7506  C  CG2   . ILE C 1 261 ? 80.46700  121.95700 111.24000 1.000 51.78000  ? 506 ILE C CG2   1 
ATOM   7507  C  CD1   . ILE C 1 261 ? 76.91400  120.98600 112.33600 1.000 51.78000  ? 506 ILE C CD1   1 
ATOM   7508  N  N     . TYR C 1 262 ? 80.45800  119.72000 108.74600 1.000 52.56000  ? 507 TYR C N     1 
ATOM   7509  C  CA    . TYR C 1 262 ? 80.55200  119.88000 107.29800 1.000 52.56000  ? 507 TYR C CA    1 
ATOM   7510  C  C     . TYR C 1 262 ? 80.00400  118.65400 106.58000 1.000 52.56000  ? 507 TYR C C     1 
ATOM   7511  O  O     . TYR C 1 262 ? 80.66200  118.07800 105.71800 1.000 52.56000  ? 507 TYR C O     1 
ATOM   7512  C  CB    . TYR C 1 262 ? 82.00100  120.13200 106.90700 1.000 52.56000  ? 507 TYR C CB    1 
ATOM   7513  C  CG    . TYR C 1 262 ? 82.54300  121.45400 107.37900 1.000 52.56000  ? 507 TYR C CG    1 
ATOM   7514  C  CD1   . TYR C 1 262 ? 81.70100  122.51400 107.64600 1.000 52.56000  ? 507 TYR C CD1   1 
ATOM   7515  C  CD2   . TYR C 1 262 ? 83.89600  121.62200 107.61200 1.000 52.56000  ? 507 TYR C CD2   1 
ATOM   7516  C  CE1   . TYR C 1 262 ? 82.19600  123.71600 108.08600 1.000 52.56000  ? 507 TYR C CE1   1 
ATOM   7517  C  CE2   . TYR C 1 262 ? 84.39600  122.81800 108.05800 1.000 52.56000  ? 507 TYR C CE2   1 
ATOM   7518  C  CZ    . TYR C 1 262 ? 83.54400  123.86100 108.29600 1.000 52.56000  ? 507 TYR C CZ    1 
ATOM   7519  O  OH    . TYR C 1 262 ? 84.04600  125.05600 108.74400 1.000 52.56000  ? 507 TYR C OH    1 
ATOM   7520  N  N     . GLU C 1 263 ? 78.78900  118.23800 106.92700 1.000 59.31000  ? 508 GLU C N     1 
ATOM   7521  C  CA    . GLU C 1 263 ? 78.22600  117.03500 106.33400 1.000 59.31000  ? 508 GLU C CA    1 
ATOM   7522  C  C     . GLU C 1 263 ? 77.59100  117.36400 104.99000 1.000 59.31000  ? 508 GLU C C     1 
ATOM   7523  O  O     . GLU C 1 263 ? 76.90300  118.37900 104.84700 1.000 59.31000  ? 508 GLU C O     1 
ATOM   7524  C  CB    . GLU C 1 263 ? 77.20300  116.38000 107.26600 1.000 59.31000  ? 508 GLU C CB    1 
ATOM   7525  C  CG    . GLU C 1 263 ? 75.88600  117.12600 107.43000 1.000 59.31000  ? 508 GLU C CG    1 
ATOM   7526  C  CD    . GLU C 1 263 ? 75.89700  118.09500 108.59100 1.000 59.31000  ? 508 GLU C CD    1 
ATOM   7527  O  OE1   . GLU C 1 263 ? 76.99000  118.37500 109.11800 1.000 59.31000  ? 508 GLU C OE1   1 
ATOM   7528  O  OE2   . GLU C 1 263 ? 74.81100  118.57600 108.97500 1.000 59.31000  ? 508 GLU C OE2   1 
ATOM   7529  N  N     . GLY C 1 264 ? 77.85200  116.51200 104.00400 1.000 64.12000  ? 509 GLY C N     1 
ATOM   7530  C  CA    . GLY C 1 264 ? 77.23800  116.60500 102.69500 1.000 64.12000  ? 509 GLY C CA    1 
ATOM   7531  C  C     . GLY C 1 264 ? 77.23900  117.98000 102.06200 1.000 64.12000  ? 509 GLY C C     1 
ATOM   7532  O  O     . GLY C 1 264 ? 76.17500  118.51800 101.74600 1.000 64.12000  ? 509 GLY C O     1 
ATOM   7533  N  N     . ILE C 1 265 ? 78.41700  118.56200 101.87100 1.000 58.78000  ? 510 ILE C N     1 
ATOM   7534  C  CA    . ILE C 1 265 ? 78.51700  119.80300 101.11200 1.000 58.78000  ? 510 ILE C CA    1 
ATOM   7535  C  C     . ILE C 1 265 ? 79.02800  119.43300 99.72600  1.000 58.78000  ? 510 ILE C C     1 
ATOM   7536  O  O     . ILE C 1 265 ? 79.68400  118.39400 99.56700  1.000 58.78000  ? 510 ILE C O     1 
ATOM   7537  C  CB    . ILE C 1 265 ? 79.42400  120.83300 101.80500 1.000 58.78000  ? 510 ILE C CB    1 
ATOM   7538  C  CG1   . ILE C 1 265 ? 80.86500  120.33500 101.87500 1.000 58.78000  ? 510 ILE C CG1   1 
ATOM   7539  C  CG2   . ILE C 1 265 ? 78.91600  121.13500 103.19800 1.000 58.78000  ? 510 ILE C CG2   1 
ATOM   7540  C  CD1   . ILE C 1 265 ? 81.83900  121.39800 102.31900 1.000 58.78000  ? 510 ILE C CD1   1 
ATOM   7541  N  N     . PRO C 1 266 ? 78.74500  120.22900 98.70200  1.000 60.95000  ? 511 PRO C N     1 
ATOM   7542  C  CA    . PRO C 1 266 ? 79.15100  119.85700 97.34000  1.000 60.95000  ? 511 PRO C CA    1 
ATOM   7543  C  C     . PRO C 1 266 ? 80.65700  119.77000 97.13900  1.000 60.95000  ? 511 PRO C C     1 
ATOM   7544  O  O     . PRO C 1 266 ? 81.11400  119.37800 96.06100  1.000 60.95000  ? 511 PRO C O     1 
ATOM   7545  C  CB    . PRO C 1 266 ? 78.54000  120.97100 96.48400  1.000 60.95000  ? 511 PRO C CB    1 
ATOM   7546  C  CG    . PRO C 1 266 ? 77.40000  121.47900 97.29000  1.000 60.95000  ? 511 PRO C CG    1 
ATOM   7547  C  CD    . PRO C 1 266 ? 77.84200  121.39000 98.71000  1.000 60.95000  ? 511 PRO C CD    1 
ATOM   7548  N  N     . HIS C 1 267 ? 81.44000  120.11900 98.15800  1.000 56.71000  ? 512 HIS C N     1 
ATOM   7549  C  CA    . HIS C 1 267 ? 82.89400  120.08900 98.04300  1.000 56.71000  ? 512 HIS C CA    1 
ATOM   7550  C  C     . HIS C 1 267 ? 83.49300  118.73500 98.39000  1.000 56.71000  ? 512 HIS C C     1 
ATOM   7551  O  O     . HIS C 1 267 ? 84.49100  118.33400 97.78300  1.000 56.71000  ? 512 HIS C O     1 
ATOM   7552  C  CB    . HIS C 1 267 ? 83.52300  121.14800 98.94600  1.000 56.71000  ? 512 HIS C CB    1 
ATOM   7553  C  CG    . HIS C 1 267 ? 83.27400  122.55000 98.50000  1.000 56.71000  ? 512 HIS C CG    1 
ATOM   7554  N  ND1   . HIS C 1 267 ? 83.93000  123.11700 97.43000  1.000 56.71000  ? 512 HIS C ND1   1 
ATOM   7555  C  CD2   . HIS C 1 267 ? 82.45200  123.50600 98.98800  1.000 56.71000  ? 512 HIS C CD2   1 
ATOM   7556  C  CE1   . HIS C 1 267 ? 83.51700  124.36200 97.27400  1.000 56.71000  ? 512 HIS C CE1   1 
ATOM   7557  N  NE2   . HIS C 1 267 ? 82.62200  124.62400 98.20900  1.000 56.71000  ? 512 HIS C NE2   1 
ATOM   7558  N  N     . LEU C 1 268 ? 82.92200  118.04300 99.37200  1.000 58.29000  ? 513 LEU C N     1 
ATOM   7559  C  CA    . LEU C 1 268 ? 83.55100  116.84700 99.91400  1.000 58.29000  ? 513 LEU C CA    1 
ATOM   7560  C  C     . LEU C 1 268 ? 83.76600  115.78800 98.84300  1.000 58.29000  ? 513 LEU C C     1 
ATOM   7561  O  O     . LEU C 1 268 ? 82.92700  115.58800 97.96200  1.000 58.29000  ? 513 LEU C O     1 
ATOM   7562  C  CB    . LEU C 1 268 ? 82.70000  116.26500 101.03700 1.000 58.29000  ? 513 LEU C CB    1 
ATOM   7563  C  CG    . LEU C 1 268 ? 82.57500  117.08700 102.31100 1.000 58.29000  ? 513 LEU C CG    1 
ATOM   7564  C  CD1   . LEU C 1 268 ? 81.63500  116.37700 103.25500 1.000 58.29000  ? 513 LEU C CD1   1 
ATOM   7565  C  CD2   . LEU C 1 268 ? 83.93300  117.27200 102.93900 1.000 58.29000  ? 513 LEU C CD2   1 
ATOM   7566  N  N     . LEU C 1 269 ? 84.90600  115.10900 98.92600  1.000 60.76000  ? 514 LEU C N     1 
ATOM   7567  C  CA    . LEU C 1 269 ? 85.15600  113.92500 98.11800  1.000 60.76000  ? 514 LEU C CA    1 
ATOM   7568  C  C     . LEU C 1 269 ? 84.63800  112.66900 98.79900  1.000 60.76000  ? 514 LEU C C     1 
ATOM   7569  O  O     . LEU C 1 269 ? 84.04000  111.80600 98.14700  1.000 60.76000  ? 514 LEU C O     1 
ATOM   7570  C  CB    . LEU C 1 269 ? 86.65100  113.78300 97.84100  1.000 60.76000  ? 514 LEU C CB    1 
ATOM   7571  C  CG    . LEU C 1 269 ? 87.29500  114.84700 96.95700  1.000 60.76000  ? 514 LEU C CG    1 
ATOM   7572  C  CD1   . LEU C 1 269 ? 88.79700  114.68300 96.96500  1.000 60.76000  ? 514 LEU C CD1   1 
ATOM   7573  C  CD2   . LEU C 1 269 ? 86.76200  114.74000 95.54700  1.000 60.76000  ? 514 LEU C CD2   1 
ATOM   7574  N  N     . CYS C 1 270 ? 84.85700  112.55900 100.09900 1.000 67.21000  ? 515 CYS C N     1 
ATOM   7575  C  CA    . CYS C 1 270 ? 84.40400  111.46100 100.93400 1.000 67.21000  ? 515 CYS C CA    1 
ATOM   7576  C  C     . CYS C 1 270 ? 83.79600  112.05000 102.19400 1.000 67.21000  ? 515 CYS C C     1 
ATOM   7577  O  O     . CYS C 1 270 ? 84.11800  113.18100 102.57300 1.000 67.21000  ? 515 CYS C O     1 
ATOM   7578  C  CB    . CYS C 1 270 ? 85.56500  110.52100 101.29000 1.000 67.21000  ? 515 CYS C CB    1 
ATOM   7579  S  SG    . CYS C 1 270 ? 86.86300  111.29200 102.28100 1.000 67.21000  ? 515 CYS C SG    1 
ATOM   7580  N  N     . PRO C 1 271 ? 82.89700  111.32200 102.85600 1.000 62.14000  ? 516 PRO C N     1 
ATOM   7581  C  CA    . PRO C 1 271 ? 82.26300  111.85300 104.06900 1.000 62.14000  ? 516 PRO C CA    1 
ATOM   7582  C  C     . PRO C 1 271 ? 83.28900  112.21400 105.13100 1.000 62.14000  ? 516 PRO C C     1 
ATOM   7583  O  O     . PRO C 1 271 ? 84.47100  111.87200 105.05200 1.000 62.14000  ? 516 PRO C O     1 
ATOM   7584  C  CB    . PRO C 1 271 ? 81.36100  110.70500 104.53100 1.000 62.14000  ? 516 PRO C CB    1 
ATOM   7585  C  CG    . PRO C 1 271 ? 81.09300  109.92700 103.29500 1.000 62.14000  ? 516 PRO C CG    1 
ATOM   7586  C  CD    . PRO C 1 271 ? 82.35300  110.00400 102.49000 1.000 62.14000  ? 516 PRO C CD    1 
ATOM   7587  N  N     . VAL C 1 272 ? 82.81200  112.91900 106.15300 1.000 58.09000  ? 517 VAL C N     1 
ATOM   7588  C  CA    . VAL C 1 272 ? 83.68600  113.36300 107.23300 1.000 58.09000  ? 517 VAL C CA    1 
ATOM   7589  C  C     . VAL C 1 272 ? 84.15500  112.12200 107.98200 1.000 58.09000  ? 517 VAL C C     1 
ATOM   7590  O  O     . VAL C 1 272 ? 83.39400  111.51400 108.73900 1.000 58.09000  ? 517 VAL C O     1 
ATOM   7591  C  CB    . VAL C 1 272 ? 82.97200  114.34300 108.16800 1.000 58.09000  ? 517 VAL C CB    1 
ATOM   7592  C  CG1   . VAL C 1 272 ? 83.88100  114.72600 109.31900 1.000 58.09000  ? 517 VAL C CG1   1 
ATOM   7593  C  CG2   . VAL C 1 272 ? 82.52700  115.57200 107.39800 1.000 58.09000  ? 517 VAL C CG2   1 
ATOM   7594  N  N     . VAL C 1 273 ? 85.41600  111.74900 107.77400 1.000 61.02000  ? 518 VAL C N     1 
ATOM   7595  C  CA    . VAL C 1 273 ? 85.90300  110.45300 108.22400 1.000 61.02000  ? 518 VAL C CA    1 
ATOM   7596  C  C     . VAL C 1 273 ? 86.01600  110.43700 109.74100 1.000 61.02000  ? 518 VAL C C     1 
ATOM   7597  O  O     . VAL C 1 273 ? 86.52300  111.38400 110.35400 1.000 61.02000  ? 518 VAL C O     1 
ATOM   7598  C  CB    . VAL C 1 273 ? 87.25100  110.13500 107.56400 1.000 61.02000  ? 518 VAL C CB    1 
ATOM   7599  C  CG1   . VAL C 1 273 ? 87.78900  108.82000 108.08000 1.000 61.02000  ? 518 VAL C CG1   1 
ATOM   7600  C  CG2   . VAL C 1 273 ? 87.10200  110.10300 106.05200 1.000 61.02000  ? 518 VAL C CG2   1 
ATOM   7601  N  N     . THR C 1 274 ? 85.53900  109.35700 110.35500 1.000 70.04000  ? 519 THR C N     1 
ATOM   7602  C  CA    . THR C 1 274 ? 85.72100  109.15300 111.78400 1.000 70.04000  ? 519 THR C CA    1 
ATOM   7603  C  C     . THR C 1 274 ? 86.27000  107.75200 112.03400 1.000 70.04000  ? 519 THR C C     1 
ATOM   7604  O  O     . THR C 1 274 ? 86.95900  107.51100 113.03100 1.000 70.04000  ? 519 THR C O     1 
ATOM   7605  C  CB    . THR C 1 274 ? 84.40200  109.37100 112.52500 1.000 70.04000  ? 519 THR C CB    1 
ATOM   7606  O  OG1   . THR C 1 274 ? 83.90500  110.68100 112.22900 1.000 70.04000  ? 519 THR C OG1   1 
ATOM   7607  C  CG2   . THR C 1 274 ? 84.60900  109.26000 114.01800 1.000 70.04000  ? 519 THR C CG2   1 
ATOM   7608  N  N     . ASP C 1 275 ? 85.98100  106.82700 111.12100 1.000 79.49000  ? 520 ASP C N     1 
ATOM   7609  C  CA    . ASP C 1 275 ? 86.58500  105.49800 111.15200 1.000 79.49000  ? 520 ASP C CA    1 
ATOM   7610  C  C     . ASP C 1 275 ? 88.01700  105.59500 110.64300 1.000 79.49000  ? 520 ASP C C     1 
ATOM   7611  O  O     . ASP C 1 275 ? 88.24300  105.82100 109.45000 1.000 79.49000  ? 520 ASP C O     1 
ATOM   7612  C  CB    . ASP C 1 275 ? 85.76800  104.52300 110.31000 1.000 79.49000  ? 520 ASP C CB    1 
ATOM   7613  C  CG    . ASP C 1 275 ? 84.41600  104.20800 110.92400 1.000 79.49000  ? 520 ASP C CG    1 
ATOM   7614  O  OD1   . ASP C 1 275 ? 84.30000  104.24100 112.16600 1.000 79.49000  ? 520 ASP C OD1   1 
ATOM   7615  O  OD2   . ASP C 1 275 ? 83.46800  103.92700 110.16100 1.000 79.49000  ? 520 ASP C OD2   1 
ATOM   7616  N  N     . MET C 1 276 ? 88.98900  105.43000 111.54300 1.000 80.17000  ? 521 MET C N     1 
ATOM   7617  C  CA    . MET C 1 276 ? 90.38600  105.62300 111.16500 1.000 80.17000  ? 521 MET C CA    1 
ATOM   7618  C  C     . MET C 1 276 ? 90.84700  104.61500 110.12100 1.000 80.17000  ? 521 MET C C     1 
ATOM   7619  O  O     . MET C 1 276 ? 91.78700  104.89200 109.36800 1.000 80.17000  ? 521 MET C O     1 
ATOM   7620  C  CB    . MET C 1 276 ? 91.27600  105.56700 112.40400 1.000 80.17000  ? 521 MET C CB    1 
ATOM   7621  C  CG    . MET C 1 276 ? 91.05400  106.73100 113.35100 1.000 80.17000  ? 521 MET C CG    1 
ATOM   7622  S  SD    . MET C 1 276 ? 91.41700  108.32100 112.58200 1.000 80.17000  ? 521 MET C SD    1 
ATOM   7623  C  CE    . MET C 1 276 ? 89.76900  108.91800 112.21800 1.000 80.17000  ? 521 MET C CE    1 
ATOM   7624  N  N     . LYS C 1 277 ? 90.21600  103.44100 110.06200 1.000 84.11000  ? 522 LYS C N     1 
ATOM   7625  C  CA    . LYS C 1 277 ? 90.44200  102.55700 108.92500 1.000 84.11000  ? 522 LYS C CA    1 
ATOM   7626  C  C     . LYS C 1 277 ? 90.06800  103.26200 107.62700 1.000 84.11000  ? 522 LYS C C     1 
ATOM   7627  O  O     . LYS C 1 277 ? 90.83700  103.26900 106.65600 1.000 84.11000  ? 522 LYS C O     1 
ATOM   7628  C  CB    . LYS C 1 277 ? 89.64200  101.26700 109.09600 1.000 84.11000  ? 522 LYS C CB    1 
ATOM   7629  C  CG    . LYS C 1 277 ? 89.95200  100.50800 110.37400 1.000 84.11000  ? 522 LYS C CG    1 
ATOM   7630  C  CD    . LYS C 1 277 ? 91.38200  99.99800  110.39400 1.000 84.11000  ? 522 LYS C CD    1 
ATOM   7631  C  CE    . LYS C 1 277 ? 91.62300  99.10400  111.59900 1.000 84.11000  ? 522 LYS C CE    1 
ATOM   7632  N  NZ    . LYS C 1 277 ? 91.56800  99.87400  112.87200 1.000 84.11000  ? 522 LYS C NZ    1 
ATOM   7633  N  N     . GLU C 1 278 ? 88.88600  103.88200 107.60300 1.000 81.31000  ? 523 GLU C N     1 
ATOM   7634  C  CA    . GLU C 1 278 ? 88.49500  104.67300 106.44400 1.000 81.31000  ? 523 GLU C CA    1 
ATOM   7635  C  C     . GLU C 1 278 ? 89.39900  105.88500 106.26300 1.000 81.31000  ? 523 GLU C C     1 
ATOM   7636  O  O     . GLU C 1 278 ? 89.55000  106.37600 105.14400 1.000 81.31000  ? 523 GLU C O     1 
ATOM   7637  C  CB    . GLU C 1 278 ? 87.03300  105.10100 106.56900 1.000 81.31000  ? 523 GLU C CB    1 
ATOM   7638  C  CG    . GLU C 1 278 ? 86.04800  103.94800 106.48200 1.000 81.31000  ? 523 GLU C CG    1 
ATOM   7639  C  CD    . GLU C 1 278 ? 84.60500  104.40000 106.58700 1.000 81.31000  ? 523 GLU C CD    1 
ATOM   7640  O  OE1   . GLU C 1 278 ? 84.37300  105.59500 106.86700 1.000 81.31000  ? 523 GLU C OE1   1 
ATOM   7641  O  OE2   . GLU C 1 278 ? 83.70300  103.56300 106.38000 1.000 81.31000  ? 523 GLU C OE2   1 
ATOM   7642  N  N     . ALA C 1 279 ? 90.02900  106.36800 107.33500 1.000 78.21000  ? 524 ALA C N     1 
ATOM   7643  C  CA    . ALA C 1 279 ? 90.97900  107.46800 107.18800 1.000 78.21000  ? 524 ALA C CA    1 
ATOM   7644  C  C     . ALA C 1 279 ? 92.22500  107.01400 106.43900 1.000 78.21000  ? 524 ALA C C     1 
ATOM   7645  O  O     . ALA C 1 279 ? 92.71300  107.70900 105.53600 1.000 78.21000  ? 524 ALA C O     1 
ATOM   7646  C  CB    . ALA C 1 279 ? 91.34800  108.03200 108.55900 1.000 78.21000  ? 524 ALA C CB    1 
ATOM   7647  N  N     . ALA C 1 280 ? 92.76200  105.85300 106.81300 1.000 78.92000  ? 525 ALA C N     1 
ATOM   7648  C  CA    . ALA C 1 280 ? 93.86500  105.27400 106.05700 1.000 78.92000  ? 525 ALA C CA    1 
ATOM   7649  C  C     . ALA C 1 280 ? 93.46300  105.03200 104.61000 1.000 78.92000  ? 525 ALA C C     1 
ATOM   7650  O  O     . ALA C 1 280 ? 94.25000  105.27900 103.68900 1.000 78.92000  ? 525 ALA C O     1 
ATOM   7651  C  CB    . ALA C 1 280 ? 94.32900  103.97500 106.71400 1.000 78.92000  ? 525 ALA C CB    1 
ATOM   7652  N  N     . ASN C 1 281 ? 92.23600  104.55000 104.39000 1.000 79.21000  ? 526 ASN C N     1 
ATOM   7653  C  CA    . ASN C 1 281 ? 91.75100  104.35800 103.02400 1.000 79.21000  ? 526 ASN C CA    1 
ATOM   7654  C  C     . ASN C 1 281 ? 91.72200  105.67400 102.25400 1.000 79.21000  ? 526 ASN C C     1 
ATOM   7655  O  O     . ASN C 1 281 ? 92.12100  105.73000 101.08300 1.000 79.21000  ? 526 ASN C O     1 
ATOM   7656  C  CB    . ASN C 1 281 ? 90.36100  103.72500 103.04500 1.000 79.21000  ? 526 ASN C CB    1 
ATOM   7657  C  CG    . ASN C 1 281 ? 90.38700  102.28000 103.49000 1.000 79.21000  ? 526 ASN C CG    1 
ATOM   7658  O  OD1   . ASN C 1 281 ? 91.26600  101.51500 103.09700 1.000 79.21000  ? 526 ASN C OD1   1 
ATOM   7659  N  ND2   . ASN C 1 281 ? 89.41900  101.89700 104.31300 1.000 79.21000  ? 526 ASN C ND2   1 
ATOM   7660  N  N     . ALA C 1 282 ? 91.23900  106.74000 102.89400 1.000 74.95000  ? 527 ALA C N     1 
ATOM   7661  C  CA    . ALA C 1 282 ? 91.16100  108.04000 102.23900 1.000 74.95000  ? 527 ALA C CA    1 
ATOM   7662  C  C     . ALA C 1 282 ? 92.54200  108.55700 101.87500 1.000 74.95000  ? 527 ALA C C     1 
ATOM   7663  O  O     . ALA C 1 282 ? 92.73800  109.11100 100.79000 1.000 74.95000  ? 527 ALA C O     1 
ATOM   7664  C  CB    . ALA C 1 282 ? 90.43500  109.03800 103.14000 1.000 74.95000  ? 527 ALA C CB    1 
ATOM   7665  N  N     . LEU C 1 283 ? 93.51600  108.38600 102.76800 1.000 75.09000  ? 528 LEU C N     1 
ATOM   7666  C  CA    . LEU C 1 283 ? 94.86200  108.85400 102.45300 1.000 75.09000  ? 528 LEU C CA    1 
ATOM   7667  C  C     . LEU C 1 283 ? 95.52500  107.99800 101.37700 1.000 75.09000  ? 528 LEU C C     1 
ATOM   7668  O  O     . LEU C 1 283 ? 96.28000  108.52400 100.54800 1.000 75.09000  ? 528 LEU C O     1 
ATOM   7669  C  CB    . LEU C 1 283 ? 95.70400  108.91000 103.72400 1.000 75.09000  ? 528 LEU C CB    1 
ATOM   7670  C  CG    . LEU C 1 283 ? 95.21700  110.04400 104.62900 1.000 75.09000  ? 528 LEU C CG    1 
ATOM   7671  C  CD1   . LEU C 1 283 ? 95.89500  110.02100 105.97500 1.000 75.09000  ? 528 LEU C CD1   1 
ATOM   7672  C  CD2   . LEU C 1 283 ? 95.44200  111.38300 103.94700 1.000 75.09000  ? 528 LEU C CD2   1 
ATOM   7673  N  N     . ARG C 1 284 ? 95.24600  106.69200 101.35800 1.000 78.71000  ? 529 ARG C N     1 
ATOM   7674  C  CA    . ARG C 1 284 ? 95.69600  105.85700 100.24800 1.000 78.71000  ? 529 ARG C CA    1 
ATOM   7675  C  C     . ARG C 1 284 ? 95.13700  106.36900 98.92700  1.000 78.71000  ? 529 ARG C C     1 
ATOM   7676  O  O     . ARG C 1 284 ? 95.87000  106.51900 97.93900  1.000 78.71000  ? 529 ARG C O     1 
ATOM   7677  C  CB    . ARG C 1 284 ? 95.27300  104.40400 100.47000 1.000 78.71000  ? 529 ARG C CB    1 
ATOM   7678  C  CG    . ARG C 1 284 ? 95.96900  103.69900 101.61600 1.000 78.71000  ? 529 ARG C CG    1 
ATOM   7679  C  CD    . ARG C 1 284 ? 95.48000  102.26700 101.74400 1.000 78.71000  ? 529 ARG C CD    1 
ATOM   7680  N  NE    . ARG C 1 284 ? 96.03200  101.60500 102.92000 1.000 78.71000  ? 529 ARG C NE    1 
ATOM   7681  C  CZ    . ARG C 1 284 ? 97.18200  100.94000 102.93200 1.000 78.71000  ? 529 ARG C CZ    1 
ATOM   7682  N  NH1   . ARG C 1 284 ? 97.90700  100.84600 101.82700 1.000 78.71000  ? 529 ARG C NH1   1 
ATOM   7683  N  NH2   . ARG C 1 284 ? 97.60700  100.36800 104.05000 1.000 78.71000  ? 529 ARG C NH2   1 
ATOM   7684  N  N     . TRP C 1 285 ? 93.82900  106.63300 98.89000  1.000 77.11000  ? 530 TRP C N     1 
ATOM   7685  C  CA    . TRP C 1 285 ? 93.22900  107.16800 97.67400  1.000 77.11000  ? 530 TRP C CA    1 
ATOM   7686  C  C     . TRP C 1 285 ? 93.81500  108.52600 97.31900  1.000 77.11000  ? 530 TRP C C     1 
ATOM   7687  O  O     . TRP C 1 285 ? 93.91800  108.87200 96.14100  1.000 77.11000  ? 530 TRP C O     1 
ATOM   7688  C  CB    . TRP C 1 285 ? 91.71600  107.29600 97.81000  1.000 77.11000  ? 530 TRP C CB    1 
ATOM   7689  C  CG    . TRP C 1 285 ? 91.12600  107.81500 96.54200  1.000 77.11000  ? 530 TRP C CG    1 
ATOM   7690  C  CD1   . TRP C 1 285 ? 90.92300  107.11900 95.38900  1.000 77.11000  ? 530 TRP C CD1   1 
ATOM   7691  C  CD2   . TRP C 1 285 ? 90.77400  109.17200 96.25600  1.000 77.11000  ? 530 TRP C CD2   1 
ATOM   7692  N  NE1   . TRP C 1 285 ? 90.40600  107.94400 94.42200  1.000 77.11000  ? 530 TRP C NE1   1 
ATOM   7693  C  CE2   . TRP C 1 285 ? 90.31000  109.21300 94.92900  1.000 77.11000  ? 530 TRP C CE2   1 
ATOM   7694  C  CE3   . TRP C 1 285 ? 90.77900  110.35200 97.00400  1.000 77.11000  ? 530 TRP C CE3   1 
ATOM   7695  C  CZ2   . TRP C 1 285 ? 89.85800  110.38400 94.33300  1.000 77.11000  ? 530 TRP C CZ2   1 
ATOM   7696  C  CZ3   . TRP C 1 285 ? 90.32900  111.51300 96.41100  1.000 77.11000  ? 530 TRP C CZ3   1 
ATOM   7697  C  CH2   . TRP C 1 285 ? 89.87500  111.52200 95.08900  1.000 77.11000  ? 530 TRP C CH2   1 
ATOM   7698  N  N     . SER C 1 286 ? 94.16400  109.32800 98.32500  1.000 73.28000  ? 531 SER C N     1 
ATOM   7699  C  CA    . SER C 1 286 ? 94.75600  110.63000 98.04300  1.000 73.28000  ? 531 SER C CA    1 
ATOM   7700  C  C     . SER C 1 286 ? 96.11200  110.47500 97.37100  1.000 73.28000  ? 531 SER C C     1 
ATOM   7701  O  O     . SER C 1 286 ? 96.41800  111.18800 96.41200  1.000 73.28000  ? 531 SER C O     1 
ATOM   7702  C  CB    . SER C 1 286 ? 94.88300  111.44400 99.32800  1.000 73.28000  ? 531 SER C CB    1 
ATOM   7703  O  OG    . SER C 1 286 ? 95.83600  110.86700 100.20100 1.000 73.28000  ? 531 SER C OG    1 
ATOM   7704  N  N     . VAL C 1 287 ? 96.93100  109.53900 97.85300  1.000 75.99000  ? 532 VAL C N     1 
ATOM   7705  C  CA    . VAL C 1 287 ? 98.20500  109.26400 97.19000  1.000 75.99000  ? 532 VAL C CA    1 
ATOM   7706  C  C     . VAL C 1 287 ? 97.96900  108.78200 95.76300  1.000 75.99000  ? 532 VAL C C     1 
ATOM   7707  O  O     . VAL C 1 287 ? 98.67500  109.18300 94.82500  1.000 75.99000  ? 532 VAL C O     1 
ATOM   7708  C  CB    . VAL C 1 287 ? 99.02300  108.24100 97.99700  1.000 75.99000  ? 532 VAL C CB    1 
ATOM   7709  C  CG1   . VAL C 1 287 ? 100.30300 107.90200 97.25900  1.000 75.99000  ? 532 VAL C CG1   1 
ATOM   7710  C  CG2   . VAL C 1 287 ? 99.33000  108.77600 99.37700  1.000 75.99000  ? 532 VAL C CG2   1 
ATOM   7711  N  N     . ALA C 1 288 ? 96.98000  107.90500 95.57900  1.000 77.66000  ? 533 ALA C N     1 
ATOM   7712  C  CA    . ALA C 1 288 ? 96.70100  107.37900 94.24600  1.000 77.66000  ? 533 ALA C CA    1 
ATOM   7713  C  C     . ALA C 1 288 ? 96.25400  108.48300 93.29300  1.000 77.66000  ? 533 ALA C C     1 
ATOM   7714  O  O     . ALA C 1 288 ? 96.73300  108.56300 92.15700  1.000 77.66000  ? 533 ALA C O     1 
ATOM   7715  C  CB    . ALA C 1 288 ? 95.64700  106.27700 94.32900  1.000 77.66000  ? 533 ALA C CB    1 
ATOM   7716  N  N     . GLU C 1 289 ? 95.32200  109.33000 93.73700  1.000 77.66000  ? 534 GLU C N     1 
ATOM   7717  C  CA    . GLU C 1 289 ? 94.88300  110.47600 92.94600  1.000 77.66000  ? 534 GLU C CA    1 
ATOM   7718  C  C     . GLU C 1 289 ? 96.04200  111.41200 92.63800  1.000 77.66000  ? 534 GLU C C     1 
ATOM   7719  O  O     . GLU C 1 289 ? 96.14000  111.95100 91.53000  1.000 77.66000  ? 534 GLU C O     1 
ATOM   7720  C  CB    . GLU C 1 289 ? 93.77800  111.22200 93.69300  1.000 77.66000  ? 534 GLU C CB    1 
ATOM   7721  C  CG    . GLU C 1 289 ? 93.24800  112.45800 92.99000  1.000 77.66000  ? 534 GLU C CG    1 
ATOM   7722  C  CD    . GLU C 1 289 ? 92.48500  112.13700 91.72500  1.000 77.66000  ? 534 GLU C CD    1 
ATOM   7723  O  OE1   . GLU C 1 289 ? 91.92800  111.02500 91.62800  1.000 77.66000  ? 534 GLU C OE1   1 
ATOM   7724  O  OE2   . GLU C 1 289 ? 92.44100  113.00000 90.82400  1.000 77.66000  ? 534 GLU C OE2   1 
ATOM   7725  N  N     . MET C 1 290 ? 96.91800  111.63400 93.61900  1.000 74.61000  ? 535 MET C N     1 
ATOM   7726  C  CA    . MET C 1 290 ? 98.12000  112.43000 93.40900  1.000 74.61000  ? 535 MET C CA    1 
ATOM   7727  C  C     . MET C 1 290 ? 98.93800  111.89300 92.24400  1.000 74.61000  ? 535 MET C C     1 
ATOM   7728  O  O     . MET C 1 290 ? 99.25600  112.62100 91.29400  1.000 74.61000  ? 535 MET C O     1 
ATOM   7729  C  CB    . MET C 1 290 ? 98.95100  112.42400 94.69100  1.000 74.61000  ? 535 MET C CB    1 
ATOM   7730  C  CG    . MET C 1 290 ? 100.23000 113.20800 94.61500  1.000 74.61000  ? 535 MET C CG    1 
ATOM   7731  S  SD    . MET C 1 290 ? 101.23900 113.02100 96.09600  1.000 74.61000  ? 535 MET C SD    1 
ATOM   7732  C  CE    . MET C 1 290 ? 101.85500 111.35300 95.87800  1.000 74.61000  ? 535 MET C CE    1 
ATOM   7733  N  N     . GLU C 1 291 ? 99.28700  110.60900 92.30200  1.000 80.13000  ? 536 GLU C N     1 
ATOM   7734  C  CA    . GLU C 1 291 ? 100.14100 110.04000 91.26500  1.000 80.13000  ? 536 GLU C CA    1 
ATOM   7735  C  C     . GLU C 1 291 ? 99.41800  109.95400 89.92500  1.000 80.13000  ? 536 GLU C C     1 
ATOM   7736  O  O     . GLU C 1 291 ? 100.05600 110.05100 88.87000  1.000 80.13000  ? 536 GLU C O     1 
ATOM   7737  C  CB    . GLU C 1 291 ? 100.65700 108.67500 91.71400  1.000 80.13000  ? 536 GLU C CB    1 
ATOM   7738  C  CG    . GLU C 1 291 ? 101.60500 108.77700 92.90200  1.000 80.13000  ? 536 GLU C CG    1 
ATOM   7739  C  CD    . GLU C 1 291 ? 102.11700 107.43300 93.37700  1.000 80.13000  ? 536 GLU C CD    1 
ATOM   7740  O  OE1   . GLU C 1 291 ? 101.65800 106.39800 92.85300  1.000 80.13000  ? 536 GLU C OE1   1 
ATOM   7741  O  OE2   . GLU C 1 291 ? 102.97700 107.41400 94.28300  1.000 80.13000  ? 536 GLU C OE2   1 
ATOM   7742  N  N     . ARG C 1 292 ? 98.09100  109.81000 89.94100  1.000 78.83000  ? 537 ARG C N     1 
ATOM   7743  C  CA    . ARG C 1 292 ? 97.33200  109.85700 88.69700  1.000 78.83000  ? 537 ARG C CA    1 
ATOM   7744  C  C     . ARG C 1 292 ? 97.40100  111.24800 88.07900  1.000 78.83000  ? 537 ARG C C     1 
ATOM   7745  O  O     . ARG C 1 292 ? 97.52200  111.39200 86.85700  1.000 78.83000  ? 537 ARG C O     1 
ATOM   7746  C  CB    . ARG C 1 292 ? 95.88000  109.44500 88.95200  1.000 78.83000  ? 537 ARG C CB    1 
ATOM   7747  C  CG    . ARG C 1 292 ? 95.09300  109.09400 87.69400  1.000 78.83000  ? 537 ARG C CG    1 
ATOM   7748  C  CD    . ARG C 1 292 ? 94.37400  110.28800 87.08100  1.000 78.83000  ? 537 ARG C CD    1 
ATOM   7749  N  NE    . ARG C 1 292 ? 93.36700  110.86100 87.96700  1.000 78.83000  ? 537 ARG C NE    1 
ATOM   7750  C  CZ    . ARG C 1 292 ? 92.80300  112.05000 87.77900  1.000 78.83000  ? 537 ARG C CZ    1 
ATOM   7751  N  NH1   . ARG C 1 292 ? 93.14200  112.79000 86.73300  1.000 78.83000  ? 537 ARG C NH1   1 
ATOM   7752  N  NH2   . ARG C 1 292 ? 91.89400  112.49700 88.63200  1.000 78.83000  ? 537 ARG C NH2   1 
ATOM   7753  N  N     . ARG C 1 293 ? 97.32300  112.28900 88.91200  1.000 74.84000  ? 538 ARG C N     1 
ATOM   7754  C  CA    . ARG C 1 293 ? 97.47400  113.64700 88.40100  1.000 74.84000  ? 538 ARG C CA    1 
ATOM   7755  C  C     . ARG C 1 293 ? 98.87800  113.87900 87.86400  1.000 74.84000  ? 538 ARG C C     1 
ATOM   7756  O  O     . ARG C 1 293 ? 99.05900  114.60400 86.88000  1.000 74.84000  ? 538 ARG C O     1 
ATOM   7757  C  CB    . ARG C 1 293 ? 97.13900  114.66800 89.48800  1.000 74.84000  ? 538 ARG C CB    1 
ATOM   7758  C  CG    . ARG C 1 293 ? 95.66300  114.76700 89.81300  1.000 74.84000  ? 538 ARG C CG    1 
ATOM   7759  C  CD    . ARG C 1 293 ? 95.39800  115.84200 90.84900  1.000 74.84000  ? 538 ARG C CD    1 
ATOM   7760  N  NE    . ARG C 1 293 ? 93.97500  115.97800 91.13700  1.000 74.84000  ? 538 ARG C NE    1 
ATOM   7761  C  CZ    . ARG C 1 293 ? 93.47400  116.81300 92.03900  1.000 74.84000  ? 538 ARG C CZ    1 
ATOM   7762  N  NH1   . ARG C 1 293 ? 94.28400  117.58900 92.74400  1.000 74.84000  ? 538 ARG C NH1   1 
ATOM   7763  N  NH2   . ARG C 1 293 ? 92.16500  116.87500 92.23700  1.000 74.84000  ? 538 ARG C NH2   1 
ATOM   7764  N  N     . TYR C 1 294 ? 99.88700  113.27500 88.49400  1.000 79.96000  ? 539 TYR C N     1 
ATOM   7765  C  CA    . TYR C 1 294 ? 101.23800 113.37900 87.94500  1.000 79.96000  ? 539 TYR C CA    1 
ATOM   7766  C  C     . TYR C 1 294 ? 101.33500 112.70700 86.58200  1.000 79.96000  ? 539 TYR C C     1 
ATOM   7767  O  O     . TYR C 1 294 ? 101.96700 113.24300 85.66500  1.000 79.96000  ? 539 TYR C O     1 
ATOM   7768  C  CB    . TYR C 1 294 ? 102.27400 112.78800 88.89800  1.000 79.96000  ? 539 TYR C CB    1 
ATOM   7769  C  CG    . TYR C 1 294 ? 102.61000 113.67700 90.07300  1.000 79.96000  ? 539 TYR C CG    1 
ATOM   7770  C  CD1   . TYR C 1 294 ? 103.41000 114.79700 89.90900  1.000 79.96000  ? 539 TYR C CD1   1 
ATOM   7771  C  CD2   . TYR C 1 294 ? 102.16300 113.37900 91.34500  1.000 79.96000  ? 539 TYR C CD2   1 
ATOM   7772  C  CE1   . TYR C 1 294 ? 103.73100 115.60900 90.97400  1.000 79.96000  ? 539 TYR C CE1   1 
ATOM   7773  C  CE2   . TYR C 1 294 ? 102.48400 114.17900 92.41400  1.000 79.96000  ? 539 TYR C CE2   1 
ATOM   7774  C  CZ    . TYR C 1 294 ? 103.26400 115.29200 92.22600  1.000 79.96000  ? 539 TYR C CZ    1 
ATOM   7775  O  OH    . TYR C 1 294 ? 103.57800 116.08900 93.29900  1.000 79.96000  ? 539 TYR C OH    1 
ATOM   7776  N  N     . ARG C 1 295 ? 100.72900 111.52700 86.43200  1.000 84.17000  ? 540 ARG C N     1 
ATOM   7777  C  CA    . ARG C 1 295 ? 100.69100 110.88800 85.11800  1.000 84.17000  ? 540 ARG C CA    1 
ATOM   7778  C  C     . ARG C 1 295 ? 99.98900  111.77600 84.09800  1.000 84.17000  ? 540 ARG C C     1 
ATOM   7779  O  O     . ARG C 1 295 ? 100.46500 111.94000 82.96900  1.000 84.17000  ? 540 ARG C O     1 
ATOM   7780  C  CB    . ARG C 1 295 ? 99.98900  109.53200 85.19600  1.000 84.17000  ? 540 ARG C CB    1 
ATOM   7781  C  CG    . ARG C 1 295 ? 100.74200 108.45700 85.95200  1.000 84.17000  ? 540 ARG C CG    1 
ATOM   7782  C  CD    . ARG C 1 295 ? 99.97000  107.14800 85.91400  1.000 84.17000  ? 540 ARG C CD    1 
ATOM   7783  N  NE    . ARG C 1 295 ? 100.66100 106.07600 86.62200  1.000 84.17000  ? 540 ARG C NE    1 
ATOM   7784  C  CZ    . ARG C 1 295 ? 100.45800 105.77700 87.90000  1.000 84.17000  ? 540 ARG C CZ    1 
ATOM   7785  N  NH1   . ARG C 1 295 ? 99.57700  106.46600 88.61200  1.000 84.17000  ? 540 ARG C NH1   1 
ATOM   7786  N  NH2   . ARG C 1 295 ? 101.13200 104.78500 88.46700  1.000 84.17000  ? 540 ARG C NH2   1 
ATOM   7787  N  N     . LEU C 1 296 ? 98.85200  112.35500 84.48400  1.000 87.48000  ? 541 LEU C N     1 
ATOM   7788  C  CA    . LEU C 1 296 ? 98.08100  113.19600 83.57500  1.000 87.48000  ? 541 LEU C CA    1 
ATOM   7789  C  C     . LEU C 1 296 ? 98.87500  114.42200 83.14200  1.000 87.48000  ? 541 LEU C C     1 
ATOM   7790  O  O     . LEU C 1 296 ? 98.85700  114.80400 81.96700  1.000 87.48000  ? 541 LEU C O     1 
ATOM   7791  C  CB    . LEU C 1 296 ? 96.76900  113.60500 84.24200  1.000 87.48000  ? 541 LEU C CB    1 
ATOM   7792  C  CG    . LEU C 1 296 ? 95.82300  114.50500 83.45200  1.000 87.48000  ? 541 LEU C CG    1 
ATOM   7793  C  CD1   . LEU C 1 296 ? 95.43500  113.84700 82.14900  1.000 87.48000  ? 541 LEU C CD1   1 
ATOM   7794  C  CD2   . LEU C 1 296 ? 94.58800  114.79400 84.28500  1.000 87.48000  ? 541 LEU C CD2   1 
ATOM   7795  N  N     . MET C 1 297 ? 99.57700  115.05700 84.08100  1.000 85.05000  ? 542 MET C N     1 
ATOM   7796  C  CA    . MET C 1 297 ? 100.32600 116.26400 83.74700  1.000 85.05000  ? 542 MET C CA    1 
ATOM   7797  C  C     . MET C 1 297 ? 101.57100 115.93800 82.93400  1.000 85.05000  ? 542 MET C C     1 
ATOM   7798  O  O     . MET C 1 297 ? 101.91100 116.66500 81.99400  1.000 85.05000  ? 542 MET C O     1 
ATOM   7799  C  CB    . MET C 1 297 ? 100.69600 117.02000 85.02100  1.000 85.05000  ? 542 MET C CB    1 
ATOM   7800  C  CG    . MET C 1 297 ? 99.50900  117.60400 85.76300  1.000 85.05000  ? 542 MET C CG    1 
ATOM   7801  S  SD    . MET C 1 297 ? 100.02200 118.53700 87.21200  1.000 85.05000  ? 542 MET C SD    1 
ATOM   7802  C  CE    . MET C 1 297 ? 100.50400 117.20000 88.29700  1.000 85.05000  ? 542 MET C CE    1 
ATOM   7803  N  N     . ALA C 1 298 ? 102.26600 114.85300 83.28100  1.000 85.59000  ? 543 ALA C N     1 
ATOM   7804  C  CA    . ALA C 1 298 ? 103.45400 114.46500 82.53000  1.000 85.59000  ? 543 ALA C CA    1 
ATOM   7805  C  C     . ALA C 1 298 ? 103.10000 114.08000 81.10000  1.000 85.59000  ? 543 ALA C C     1 
ATOM   7806  O  O     . ALA C 1 298 ? 103.85400 114.37300 80.16400  1.000 85.59000  ? 543 ALA C O     1 
ATOM   7807  C  CB    . ALA C 1 298 ? 104.17000 113.31300 83.23600  1.000 85.59000  ? 543 ALA C CB    1 
ATOM   7808  N  N     . ALA C 1 299 ? 101.95300 113.42700 80.90800  1.000 90.83000  ? 544 ALA C N     1 
ATOM   7809  C  CA    . ALA C 1 299 ? 101.53300 113.02600 79.57200  1.000 90.83000  ? 544 ALA C CA    1 
ATOM   7810  C  C     . ALA C 1 299 ? 100.99700 114.18500 78.74400  1.000 90.83000  ? 544 ALA C C     1 
ATOM   7811  O  O     . ALA C 1 299 ? 100.44900 113.94600 77.66400  1.000 90.83000  ? 544 ALA C O     1 
ATOM   7812  C  CB    . ALA C 1 299 ? 100.47600 111.92500 79.66000  1.000 90.83000  ? 544 ALA C CB    1 
ATOM   7813  N  N     . MET C 1 300 ? 101.13200 115.42500 79.21900  1.000 91.46000  ? 545 MET C N     1 
ATOM   7814  C  CA    . MET C 1 300 ? 100.74200 116.59400 78.44500  1.000 91.46000  ? 545 MET C CA    1 
ATOM   7815  C  C     . MET C 1 300 ? 101.85900 117.61500 78.28200  1.000 91.46000  ? 545 MET C C     1 
ATOM   7816  O  O     . MET C 1 300 ? 101.84800 118.36700 77.30200  1.000 91.46000  ? 545 MET C O     1 
ATOM   7817  C  CB    . MET C 1 300 ? 99.52500  117.27500 79.08800  1.000 91.46000  ? 545 MET C CB    1 
ATOM   7818  C  CG    . MET C 1 300 ? 98.95800  118.42500 78.27700  1.000 91.46000  ? 545 MET C CG    1 
ATOM   7819  S  SD    . MET C 1 300 ? 97.49900  119.15000 79.03400  1.000 91.46000  ? 545 MET C SD    1 
ATOM   7820  C  CE    . MET C 1 300 ? 96.31100  117.84800 78.73200  1.000 91.46000  ? 545 MET C CE    1 
ATOM   7821  N  N     . GLY C 1 301 ? 102.82600 117.64800 79.19500  1.000 86.47000  ? 546 GLY C N     1 
ATOM   7822  C  CA    . GLY C 1 301 ? 103.95100 118.55700 79.10800  1.000 86.47000  ? 546 GLY C CA    1 
ATOM   7823  C  C     . GLY C 1 301 ? 103.92600 119.69400 80.10400  1.000 86.47000  ? 546 GLY C C     1 
ATOM   7824  O  O     . GLY C 1 301 ? 104.94500 120.38000 80.25700  1.000 86.47000  ? 546 GLY C O     1 
ATOM   7825  N  N     . VAL C 1 302 ? 102.80600 119.91700 80.78900  1.000 87.06000  ? 547 VAL C N     1 
ATOM   7826  C  CA    . VAL C 1 302 ? 102.69000 121.00800 81.75000  1.000 87.06000  ? 547 VAL C CA    1 
ATOM   7827  C  C     . VAL C 1 302 ? 103.60300 120.74600 82.93800  1.000 87.06000  ? 547 VAL C C     1 
ATOM   7828  O  O     . VAL C 1 302 ? 104.07800 119.62200 83.13800  1.000 87.06000  ? 547 VAL C O     1 
ATOM   7829  C  CB    . VAL C 1 302 ? 101.23400 121.19300 82.21000  1.000 87.06000  ? 547 VAL C CB    1 
ATOM   7830  C  CG1   . VAL C 1 302 ? 100.36300 121.58700 81.03900  1.000 87.06000  ? 547 VAL C CG1   1 
ATOM   7831  C  CG2   . VAL C 1 302 ? 100.72400 119.91800 82.84700  1.000 87.06000  ? 547 VAL C CG2   1 
ATOM   7832  N  N     . ARG C 1 303 ? 103.84700 121.78200 83.73700  1.000 86.30000  ? 548 ARG C N     1 
ATOM   7833  C  CA    . ARG C 1 303 ? 104.77000 121.68100 84.86000  1.000 86.30000  ? 548 ARG C CA    1 
ATOM   7834  C  C     . ARG C 1 303 ? 104.04300 121.41800 86.17600  1.000 86.30000  ? 548 ARG C C     1 
ATOM   7835  O  O     . ARG C 1 303 ? 104.51100 120.62200 86.99400  1.000 86.30000  ? 548 ARG C O     1 
ATOM   7836  C  CB    . ARG C 1 303 ? 105.61400 122.95700 84.95100  1.000 86.30000  ? 548 ARG C CB    1 
ATOM   7837  C  CG    . ARG C 1 303 ? 106.71900 122.91000 85.99000  1.000 86.30000  ? 548 ARG C CG    1 
ATOM   7838  C  CD    . ARG C 1 303 ? 107.60100 124.14900 85.90700  1.000 86.30000  ? 548 ARG C CD    1 
ATOM   7839  N  NE    . ARG C 1 303 ? 108.66900 124.13500 86.90300  1.000 86.30000  ? 548 ARG C NE    1 
ATOM   7840  C  CZ    . ARG C 1 303 ? 109.60100 125.07700 87.01300  1.000 86.30000  ? 548 ARG C CZ    1 
ATOM   7841  N  NH1   . ARG C 1 303 ? 109.60100 126.11200 86.18500  1.000 86.30000  ? 548 ARG C NH1   1 
ATOM   7842  N  NH2   . ARG C 1 303 ? 110.53500 124.98300 87.94800  1.000 86.30000  ? 548 ARG C NH2   1 
ATOM   7843  N  N     . ASN C 1 304 ? 102.90200 122.06900 86.39400  1.000 82.68000  ? 549 ASN C N     1 
ATOM   7844  C  CA    . ASN C 1 304 ? 102.11500 121.85300 87.60000  1.000 82.68000  ? 549 ASN C CA    1 
ATOM   7845  C  C     . ASN C 1 304 ? 100.63600 121.98700 87.26100  1.000 82.68000  ? 549 ASN C C     1 
ATOM   7846  O  O     . ASN C 1 304 ? 100.25400 122.11600 86.09500  1.000 82.68000  ? 549 ASN C O     1 
ATOM   7847  C  CB    . ASN C 1 304 ? 102.53600 122.81600 88.71600  1.000 82.68000  ? 549 ASN C CB    1 
ATOM   7848  C  CG    . ASN C 1 304 ? 102.36400 124.27300 88.33300  1.000 82.68000  ? 549 ASN C CG    1 
ATOM   7849  O  OD1   . ASN C 1 304 ? 101.85400 124.59400 87.26000  1.000 82.68000  ? 549 ASN C OD1   1 
ATOM   7850  N  ND2   . ASN C 1 304 ? 102.78800 125.16600 89.21800  1.000 82.68000  ? 549 ASN C ND2   1 
ATOM   7851  N  N     . LEU C 1 305 ? 99.79800  121.95600 88.30100  1.000 81.44000  ? 550 LEU C N     1 
ATOM   7852  C  CA    . LEU C 1 305 ? 98.35300  121.96300 88.09400  1.000 81.44000  ? 550 LEU C CA    1 
ATOM   7853  C  C     . LEU C 1 305 ? 97.86400  123.27800 87.50200  1.000 81.44000  ? 550 LEU C C     1 
ATOM   7854  O  O     . LEU C 1 305 ? 96.87200  123.29200 86.76700  1.000 81.44000  ? 550 LEU C O     1 
ATOM   7855  C  CB    . LEU C 1 305 ? 97.63500  121.68100 89.41300  1.000 81.44000  ? 550 LEU C CB    1 
ATOM   7856  C  CG    . LEU C 1 305 ? 96.11200  121.56400 89.34500  1.000 81.44000  ? 550 LEU C CG    1 
ATOM   7857  C  CD1   . LEU C 1 305 ? 95.71300  120.39000 88.47100  1.000 81.44000  ? 550 LEU C CD1   1 
ATOM   7858  C  CD2   . LEU C 1 305 ? 95.52300  121.42100 90.73600  1.000 81.44000  ? 550 LEU C CD2   1 
ATOM   7859  N  N     . ALA C 1 306 ? 98.53000  124.38900 87.81500  1.000 85.20000  ? 551 ALA C N     1 
ATOM   7860  C  CA    . ALA C 1 306 ? 98.09800  125.68100 87.28900  1.000 85.20000  ? 551 ALA C CA    1 
ATOM   7861  C  C     . ALA C 1 306 ? 98.23700  125.73100 85.77300  1.000 85.20000  ? 551 ALA C C     1 
ATOM   7862  O  O     . ALA C 1 306 ? 97.28800  126.09100 85.06100  1.000 85.20000  ? 551 ALA C O     1 
ATOM   7863  C  CB    . ALA C 1 306 ? 98.90000  126.80600 87.94200  1.000 85.20000  ? 551 ALA C CB    1 
ATOM   7864  N  N     . GLY C 1 307 ? 99.42400  125.39800 85.26400  1.000 87.24000  ? 552 GLY C N     1 
ATOM   7865  C  CA    . GLY C 1 307 ? 99.61300  125.35000 83.82500  1.000 87.24000  ? 552 GLY C CA    1 
ATOM   7866  C  C     . GLY C 1 307 ? 98.69400  124.34900 83.15600  1.000 87.24000  ? 552 GLY C C     1 
ATOM   7867  O  O     . GLY C 1 307 ? 98.19500  124.59100 82.05700  1.000 87.24000  ? 552 GLY C O     1 
ATOM   7868  N  N     . PHE C 1 308 ? 98.44200  123.22000 83.82100  1.000 88.07000  ? 553 PHE C N     1 
ATOM   7869  C  CA    . PHE C 1 308 ? 97.52800  122.22100 83.27600  1.000 88.07000  ? 553 PHE C CA    1 
ATOM   7870  C  C     . PHE C 1 308 ? 96.11800  122.78000 83.13900  1.000 88.07000  ? 553 PHE C C     1 
ATOM   7871  O  O     . PHE C 1 308 ? 95.45700  122.58800 82.11100  1.000 88.07000  ? 553 PHE C O     1 
ATOM   7872  C  CB    . PHE C 1 308 ? 97.52100  120.98000 84.16400  1.000 88.07000  ? 553 PHE C CB    1 
ATOM   7873  C  CG    . PHE C 1 308 ? 96.58200  119.91500 83.69500  1.000 88.07000  ? 553 PHE C CG    1 
ATOM   7874  C  CD1   . PHE C 1 308 ? 96.91100  119.11100 82.62200  1.000 88.07000  ? 553 PHE C CD1   1 
ATOM   7875  C  CD2   . PHE C 1 308 ? 95.36200  119.72800 84.31800  1.000 88.07000  ? 553 PHE C CD2   1 
ATOM   7876  C  CE1   . PHE C 1 308 ? 96.04600  118.13200 82.18500  1.000 88.07000  ? 553 PHE C CE1   1 
ATOM   7877  C  CE2   . PHE C 1 308 ? 94.49300  118.75200 83.88400  1.000 88.07000  ? 553 PHE C CE2   1 
ATOM   7878  C  CZ    . PHE C 1 308 ? 94.83500  117.95400 82.81500  1.000 88.07000  ? 553 PHE C CZ    1 
ATOM   7879  N  N     . ASN C 1 309 ? 95.63300  123.45900 84.18000  1.000 88.59000  ? 554 ASN C N     1 
ATOM   7880  C  CA    . ASN C 1 309 ? 94.29600  124.03700 84.12500  1.000 88.59000  ? 554 ASN C CA    1 
ATOM   7881  C  C     . ASN C 1 309 ? 94.20500  125.10700 83.04800  1.000 88.59000  ? 554 ASN C C     1 
ATOM   7882  O  O     . ASN C 1 309 ? 93.23300  125.14400 82.28500  1.000 88.59000  ? 554 ASN C O     1 
ATOM   7883  C  CB    . ASN C 1 309 ? 93.91000  124.60900 85.48700  1.000 88.59000  ? 554 ASN C CB    1 
ATOM   7884  C  CG    . ASN C 1 309 ? 93.59600  123.53100 86.50100  1.000 88.59000  ? 554 ASN C CG    1 
ATOM   7885  O  OD1   . ASN C 1 309 ? 92.93500  122.54100 86.18700  1.000 88.59000  ? 554 ASN C OD1   1 
ATOM   7886  N  ND2   . ASN C 1 309 ? 94.06800  123.71700 87.72700  1.000 88.59000  ? 554 ASN C ND2   1 
ATOM   7887  N  N     . ARG C 1 310 ? 95.20900  125.98300 82.96100  1.000 89.97000  ? 555 ARG C N     1 
ATOM   7888  C  CA    . ARG C 1 310 ? 95.17100  127.00500 81.91900  1.000 89.97000  ? 555 ARG C CA    1 
ATOM   7889  C  C     . ARG C 1 310 ? 95.20900  126.37700 80.53100  1.000 89.97000  ? 555 ARG C C     1 
ATOM   7890  O  O     . ARG C 1 310 ? 94.51200  126.83200 79.61600  1.000 89.97000  ? 555 ARG C O     1 
ATOM   7891  C  CB    . ARG C 1 310 ? 96.32100  127.99700 82.08200  1.000 89.97000  ? 555 ARG C CB    1 
ATOM   7892  C  CG    . ARG C 1 310 ? 96.25900  129.10700 81.04700  1.000 89.97000  ? 555 ARG C CG    1 
ATOM   7893  C  CD    . ARG C 1 310 ? 97.33100  130.16100 81.22900  1.000 89.97000  ? 555 ARG C CD    1 
ATOM   7894  N  NE    . ARG C 1 310 ? 97.25600  131.16200 80.16800  1.000 89.97000  ? 555 ARG C NE    1 
ATOM   7895  C  CZ    . ARG C 1 310 ? 98.05600  132.21900 80.07200  1.000 89.97000  ? 555 ARG C CZ    1 
ATOM   7896  N  NH1   . ARG C 1 310 ? 99.00000  132.42400 80.98000  1.000 89.97000  ? 555 ARG C NH1   1 
ATOM   7897  N  NH2   . ARG C 1 310 ? 97.91000  133.07200 79.06700  1.000 89.97000  ? 555 ARG C NH2   1 
ATOM   7898  N  N     . LYS C 1 311 ? 95.99700  125.31400 80.36000  1.000 92.07000  ? 556 LYS C N     1 
ATOM   7899  C  CA    . LYS C 1 311 ? 96.12100  124.68600 79.05100  1.000 92.07000  ? 556 LYS C CA    1 
ATOM   7900  C  C     . LYS C 1 311 ? 94.82500  123.99800 78.64400  1.000 92.07000  ? 556 LYS C C     1 
ATOM   7901  O  O     . LYS C 1 311 ? 94.38400  124.12900 77.49600  1.000 92.07000  ? 556 LYS C O     1 
ATOM   7902  C  CB    . LYS C 1 311 ? 97.28500  123.69600 79.06200  1.000 92.07000  ? 556 LYS C CB    1 
ATOM   7903  C  CG    . LYS C 1 311 ? 97.63000  123.10500 77.70900  1.000 92.07000  ? 556 LYS C CG    1 
ATOM   7904  C  CD    . LYS C 1 311 ? 98.89300  122.26300 77.80200  1.000 92.07000  ? 556 LYS C CD    1 
ATOM   7905  C  CE    . LYS C 1 311 ? 99.28300  121.68100 76.45500  1.000 92.07000  ? 556 LYS C CE    1 
ATOM   7906  N  NZ    . LYS C 1 311 ? 100.53200 120.87100 76.54100  1.000 92.07000  ? 556 LYS C NZ    1 
ATOM   7907  N  N     . VAL C 1 312 ? 94.19500  123.26900 79.56800  1.000 94.28000  ? 557 VAL C N     1 
ATOM   7908  C  CA    . VAL C 1 312 ? 92.93500  122.61700 79.22800  1.000 94.28000  ? 557 VAL C CA    1 
ATOM   7909  C  C     . VAL C 1 312 ? 91.83800  123.65200 79.00600  1.000 94.28000  ? 557 VAL C C     1 
ATOM   7910  O  O     . VAL C 1 312 ? 90.97300  123.47000 78.14100  1.000 94.28000  ? 557 VAL C O     1 
ATOM   7911  C  CB    . VAL C 1 312 ? 92.53900  121.58100 80.29900  1.000 94.28000  ? 557 VAL C CB    1 
ATOM   7912  C  CG1   . VAL C 1 312 ? 92.26600  122.24300 81.63200  1.000 94.28000  ? 557 VAL C CG1   1 
ATOM   7913  C  CG2   . VAL C 1 312 ? 91.32200  120.79400 79.84600  1.000 94.28000  ? 557 VAL C CG2   1 
ATOM   7914  N  N     . LYS C 1 313 ? 91.86900  124.76600 79.74200  1.000 98.95000  ? 558 LYS C N     1 
ATOM   7915  C  CA    . LYS C 1 313 ? 90.88700  125.82100 79.52200  1.000 98.95000  ? 558 LYS C CA    1 
ATOM   7916  C  C     . LYS C 1 313 ? 91.05100  126.43700 78.14000  1.000 98.95000  ? 558 LYS C C     1 
ATOM   7917  O  O     . LYS C 1 313 ? 90.06600  126.65600 77.42500  1.000 98.95000  ? 558 LYS C O     1 
ATOM   7918  C  CB    . LYS C 1 313 ? 91.01800  126.88700 80.60800  1.000 98.95000  ? 558 LYS C CB    1 
ATOM   7919  C  CG    . LYS C 1 313 ? 89.95200  127.96200 80.56500  1.000 98.95000  ? 558 LYS C CG    1 
ATOM   7920  C  CD    . LYS C 1 313 ? 90.18200  128.99400 81.65600  1.000 98.95000  ? 558 LYS C CD    1 
ATOM   7921  C  CE    . LYS C 1 313 ? 89.37500  128.67200 82.90300  1.000 98.95000  ? 558 LYS C CE    1 
ATOM   7922  N  NZ    . LYS C 1 313 ? 89.98800  127.57300 83.69900  1.000 98.95000  ? 558 LYS C NZ    1 
ATOM   7923  N  N     . ASP C 1 314 ? 92.29500  126.71800 77.74400  1.000 100.59000 ? 559 ASP C N     1 
ATOM   7924  C  CA    . ASP C 1 314 ? 92.53800  127.30000 76.42900  1.000 100.59000 ? 559 ASP C CA    1 
ATOM   7925  C  C     . ASP C 1 314 ? 92.17900  126.32100 75.31900  1.000 100.59000 ? 559 ASP C C     1 
ATOM   7926  O  O     . ASP C 1 314 ? 91.64000  126.72100 74.28000  1.000 100.59000 ? 559 ASP C O     1 
ATOM   7927  C  CB    . ASP C 1 314 ? 93.99700  127.73600 76.31000  1.000 100.59000 ? 559 ASP C CB    1 
ATOM   7928  C  CG    . ASP C 1 314 ? 94.32700  128.90400 77.21200  1.000 100.59000 ? 559 ASP C CG    1 
ATOM   7929  O  OD1   . ASP C 1 314 ? 93.41700  129.70700 77.50400  1.000 100.59000 ? 559 ASP C OD1   1 
ATOM   7930  O  OD2   . ASP C 1 314 ? 95.49800  129.02000 77.62900  1.000 100.59000 ? 559 ASP C OD2   1 
ATOM   7931  N  N     . ALA C 1 315 ? 92.45600  125.03200 75.52300  1.000 104.07000 ? 560 ALA C N     1 
ATOM   7932  C  CA    . ALA C 1 315 ? 92.10700  124.03900 74.51400  1.000 104.07000 ? 560 ALA C CA    1 
ATOM   7933  C  C     . ALA C 1 315 ? 90.59600  123.90600 74.37000  1.000 104.07000 ? 560 ALA C C     1 
ATOM   7934  O  O     . ALA C 1 315 ? 90.08000  123.82600 73.24900  1.000 104.07000 ? 560 ALA C O     1 
ATOM   7935  C  CB    . ALA C 1 315 ? 92.73600  122.69000 74.86200  1.000 104.07000 ? 560 ALA C CB    1 
ATOM   7936  N  N     . GLU C 1 316 ? 89.86700  123.89700 75.48800  1.000 106.70000 ? 561 GLU C N     1 
ATOM   7937  C  CA    . GLU C 1 316 ? 88.41600  123.77900 75.43100  1.000 106.70000 ? 561 GLU C CA    1 
ATOM   7938  C  C     . GLU C 1 316 ? 87.75000  125.02400 74.86400  1.000 106.70000 ? 561 GLU C C     1 
ATOM   7939  O  O     . GLU C 1 316 ? 86.76900  124.90100 74.12400  1.000 106.70000 ? 561 GLU C O     1 
ATOM   7940  C  CB    . GLU C 1 316 ? 87.85700  123.48400 76.82500  1.000 106.70000 ? 561 GLU C CB    1 
ATOM   7941  C  CG    . GLU C 1 316 ? 86.35900  123.23300 76.85200  1.000 106.70000 ? 561 GLU C CG    1 
ATOM   7942  C  CD    . GLU C 1 316 ? 85.85500  122.88100 78.23600  1.000 106.70000 ? 561 GLU C CD    1 
ATOM   7943  O  OE1   . GLU C 1 316 ? 86.67500  122.85500 79.17700  1.000 106.70000 ? 561 GLU C OE1   1 
ATOM   7944  O  OE2   . GLU C 1 316 ? 84.64100  122.63100 78.38300  1.000 106.70000 ? 561 GLU C OE2   1 
ATOM   7945  N  N     . GLU C 1 317 ? 88.25600  126.21300 75.18900  1.000 109.71000 ? 562 GLU C N     1 
ATOM   7946  C  CA    . GLU C 1 317 ? 87.69900  127.44500 74.65000  1.000 109.71000 ? 562 GLU C CA    1 
ATOM   7947  C  C     . GLU C 1 317 ? 88.12400  127.70900 73.21400  1.000 109.71000 ? 562 GLU C C     1 
ATOM   7948  O  O     . GLU C 1 317 ? 87.46100  128.48800 72.52000  1.000 109.71000 ? 562 GLU C O     1 
ATOM   7949  C  CB    . GLU C 1 317 ? 88.10100  128.63100 75.53200  1.000 109.71000 ? 562 GLU C CB    1 
ATOM   7950  C  CG    . GLU C 1 317 ? 87.47500  128.60100 76.91700  1.000 109.71000 ? 562 GLU C CG    1 
ATOM   7951  C  CD    . GLU C 1 317 ? 87.93500  129.75000 77.79100  1.000 109.71000 ? 562 GLU C CD    1 
ATOM   7952  O  OE1   . GLU C 1 317 ? 88.83600  130.50000 77.36200  1.000 109.71000 ? 562 GLU C OE1   1 
ATOM   7953  O  OE2   . GLU C 1 317 ? 87.39700  129.90100 78.90800  1.000 109.71000 ? 562 GLU C OE2   1 
ATOM   7954  N  N     . ALA C 1 318 ? 89.20800  127.08500 72.75200  1.000 113.38000 ? 563 ALA C N     1 
ATOM   7955  C  CA    . ALA C 1 318 ? 89.67600  127.23200 71.38200  1.000 113.38000 ? 563 ALA C CA    1 
ATOM   7956  C  C     . ALA C 1 318 ? 89.08900  126.18100 70.44600  1.000 113.38000 ? 563 ALA C C     1 
ATOM   7957  O  O     . ALA C 1 318 ? 89.66100  125.92400 69.38000  1.000 113.38000 ? 563 ALA C O     1 
ATOM   7958  C  CB    . ALA C 1 318 ? 91.20500  127.17900 71.33900  1.000 113.38000 ? 563 ALA C CB    1 
ATOM   7959  N  N     . GLY C 1 319 ? 87.96800  125.57000 70.82000  1.000 115.41000 ? 564 GLY C N     1 
ATOM   7960  C  CA    . GLY C 1 319 ? 87.31400  124.59500 69.97400  1.000 115.41000 ? 564 GLY C CA    1 
ATOM   7961  C  C     . GLY C 1 319 ? 88.00900  123.25800 69.86000  1.000 115.41000 ? 564 GLY C C     1 
ATOM   7962  O  O     . GLY C 1 319 ? 87.67800  122.48600 68.95300  1.000 115.41000 ? 564 GLY C O     1 
ATOM   7963  N  N     . THR C 1 320 ? 88.96300  122.95400 70.74200  1.000 110.21000 ? 565 THR C N     1 
ATOM   7964  C  CA    . THR C 1 320 ? 89.68500  121.68300 70.72900  1.000 110.21000 ? 565 THR C CA    1 
ATOM   7965  C  C     . THR C 1 320 ? 89.55000  121.03700 72.10400  1.000 110.21000 ? 565 THR C C     1 
ATOM   7966  O  O     . THR C 1 320 ? 90.48400  121.08400 72.92000  1.000 110.21000 ? 565 THR C O     1 
ATOM   7967  C  CB    . THR C 1 320 ? 91.15200  121.88000 70.34700  1.000 110.21000 ? 565 THR C CB    1 
ATOM   7968  O  OG1   . THR C 1 320 ? 91.22800  122.56400 69.09100  1.000 110.21000 ? 565 THR C OG1   1 
ATOM   7969  C  CG2   . THR C 1 320 ? 91.85300  120.53400 70.20400  1.000 110.21000 ? 565 THR C CG2   1 
ATOM   7970  N  N     . PRO C 1 321 ? 88.39600  120.43400 72.40600  1.000 106.94000 ? 566 PRO C N     1 
ATOM   7971  C  CA    . PRO C 1 321 ? 88.26100  119.71500 73.68000  1.000 106.94000 ? 566 PRO C CA    1 
ATOM   7972  C  C     . PRO C 1 321 ? 89.09100  118.44300 73.68500  1.000 106.94000 ? 566 PRO C C     1 
ATOM   7973  O  O     . PRO C 1 321 ? 88.75900  117.46700 73.00500  1.000 106.94000 ? 566 PRO C O     1 
ATOM   7974  C  CB    . PRO C 1 321 ? 86.75800  119.42200 73.76000  1.000 106.94000 ? 566 PRO C CB    1 
ATOM   7975  C  CG    . PRO C 1 321 ? 86.31100  119.39000 72.34000  1.000 106.94000 ? 566 PRO C CG    1 
ATOM   7976  C  CD    . PRO C 1 321 ? 87.15600  120.39800 71.61300  1.000 106.94000 ? 566 PRO C CD    1 
ATOM   7977  N  N     . LEU C 1 322 ? 90.17600  118.44700 74.45300  1.000 101.90000 ? 567 LEU C N     1 
ATOM   7978  C  CA    . LEU C 1 322 ? 91.13700  117.35700 74.40500  1.000 101.90000 ? 567 LEU C CA    1 
ATOM   7979  C  C     . LEU C 1 322 ? 90.58500  116.10800 75.08600  1.000 101.90000 ? 567 LEU C C     1 
ATOM   7980  O  O     . LEU C 1 322 ? 89.55900  116.13700 75.77100  1.000 101.90000 ? 567 LEU C O     1 
ATOM   7981  C  CB    . LEU C 1 322 ? 92.44800  117.77700 75.06700  1.000 101.90000 ? 567 LEU C CB    1 
ATOM   7982  C  CG    . LEU C 1 322 ? 93.19300  118.92000 74.37900  1.000 101.90000 ? 567 LEU C CG    1 
ATOM   7983  C  CD1   . LEU C 1 322 ? 94.40800  119.33500 75.19200  1.000 101.90000 ? 567 LEU C CD1   1 
ATOM   7984  C  CD2   . LEU C 1 322 ? 93.59500  118.52200 72.97000  1.000 101.90000 ? 567 LEU C CD2   1 
ATOM   7985  N  N     . THR C 1 323 ? 91.28700  114.99900 74.88400  1.000 102.05000 ? 568 THR C N     1 
ATOM   7986  C  CA    . THR C 1 323 ? 90.97800  113.73700 75.53700  1.000 102.05000 ? 568 THR C CA    1 
ATOM   7987  C  C     . THR C 1 323 ? 92.17700  113.27900 76.35600  1.000 102.05000 ? 568 THR C C     1 
ATOM   7988  O  O     . THR C 1 323 ? 93.31200  113.70500 76.12800  1.000 102.05000 ? 568 THR C O     1 
ATOM   7989  C  CB    . THR C 1 323 ? 90.59000  112.66100 74.51500  1.000 102.05000 ? 568 THR C CB    1 
ATOM   7990  O  OG1   . THR C 1 323 ? 90.13000  111.49100 75.20300  1.000 102.05000 ? 568 THR C OG1   1 
ATOM   7991  C  CG2   . THR C 1 323 ? 91.77900  112.29600 73.63900  1.000 102.05000 ? 568 THR C CG2   1 
ATOM   7992  N  N     . ASP C 1 324 ? 91.90800  112.40600 77.32400  1.000 105.62000 ? 569 ASP C N     1 
ATOM   7993  C  CA    . ASP C 1 324 ? 92.91400  111.96100 78.28100  1.000 105.62000 ? 569 ASP C CA    1 
ATOM   7994  C  C     . ASP C 1 324 ? 93.89100  110.98100 77.64000  1.000 105.62000 ? 569 ASP C C     1 
ATOM   7995  O  O     . ASP C 1 324 ? 93.49500  109.87600 77.24700  1.000 105.62000 ? 569 ASP C O     1 
ATOM   7996  C  CB    . ASP C 1 324 ? 92.24000  111.32000 79.49600  1.000 105.62000 ? 569 ASP C CB    1 
ATOM   7997  C  CG    . ASP C 1 324 ? 93.21100  111.04400 80.63100  1.000 105.62000 ? 569 ASP C CG    1 
ATOM   7998  O  OD1   . ASP C 1 324 ? 94.41700  111.32600 80.47400  1.000 105.62000 ? 569 ASP C OD1   1 
ATOM   7999  O  OD2   . ASP C 1 324 ? 92.76700  110.54400 81.68500  1.000 105.62000 ? 569 ASP C OD2   1 
ATOM   8000  N  N     . PRO C 1 325 ? 95.17900  111.34200 77.52500  1.000 103.49000 ? 570 PRO C N     1 
ATOM   8001  C  CA    . PRO C 1 325 ? 96.19300  110.43100 76.98800  1.000 103.49000 ? 570 PRO C CA    1 
ATOM   8002  C  C     . PRO C 1 325 ? 96.47400  109.26200 77.92800  1.000 103.49000 ? 570 PRO C C     1 
ATOM   8003  O  O     . PRO C 1 325 ? 96.00800  109.27900 79.06900  1.000 103.49000 ? 570 PRO C O     1 
ATOM   8004  C  CB    . PRO C 1 325 ? 97.43000  111.32700 76.84800  1.000 103.49000 ? 570 PRO C CB    1 
ATOM   8005  C  CG    . PRO C 1 325 ? 96.89600  112.72300 76.81700  1.000 103.49000 ? 570 PRO C CG    1 
ATOM   8006  C  CD    . PRO C 1 325 ? 95.72500  112.69100 77.74600  1.000 103.49000 ? 570 PRO C CD    1 
ATOM   8007  N  N     . GLN C 1 338 ? 86.17500  113.17000 77.09400  1.000 98.10000  ? 583 GLN C N     1 
ATOM   8008  C  CA    . GLN C 1 338 ? 87.08000  114.29600 76.89600  1.000 98.10000  ? 583 GLN C CA    1 
ATOM   8009  C  C     . GLN C 1 338 ? 87.89100  114.58500 78.15700  1.000 98.10000  ? 583 GLN C C     1 
ATOM   8010  O  O     . GLN C 1 338 ? 88.15900  113.68300 78.94900  1.000 98.10000  ? 583 GLN C O     1 
ATOM   8011  C  CB    . GLN C 1 338 ? 86.30000  115.54200 76.46300  1.000 98.10000  ? 583 GLN C CB    1 
ATOM   8012  C  CG    . GLN C 1 338 ? 85.27000  116.03300 77.47300  1.000 98.10000  ? 583 GLN C CG    1 
ATOM   8013  C  CD    . GLN C 1 338 ? 84.52600  117.26100 76.99100  1.000 98.10000  ? 583 GLN C CD    1 
ATOM   8014  O  OE1   . GLN C 1 338 ? 84.81800  117.79800 75.92300  1.000 98.10000  ? 583 GLN C OE1   1 
ATOM   8015  N  NE2   . GLN C 1 338 ? 83.55900  117.71300 77.77900  1.000 98.10000  ? 583 GLN C NE2   1 
ATOM   8016  N  N     . LEU C 1 339 ? 88.27700  115.84700 78.33900  1.000 97.32000  ? 584 LEU C N     1 
ATOM   8017  C  CA    . LEU C 1 339 ? 89.09300  116.25900 79.46900  1.000 97.32000  ? 584 LEU C CA    1 
ATOM   8018  C  C     . LEU C 1 339 ? 88.38800  117.39800 80.19600  1.000 97.32000  ? 584 LEU C C     1 
ATOM   8019  O  O     . LEU C 1 339 ? 87.54300  118.09600 79.63000  1.000 97.32000  ? 584 LEU C O     1 
ATOM   8020  C  CB    . LEU C 1 339 ? 90.49600  116.67400 79.00800  1.000 97.32000  ? 584 LEU C CB    1 
ATOM   8021  C  CG    . LEU C 1 339 ? 91.55100  117.00800 80.06100  1.000 97.32000  ? 584 LEU C CG    1 
ATOM   8022  C  CD1   . LEU C 1 339 ? 91.83700  115.79700 80.93100  1.000 97.32000  ? 584 LEU C CD1   1 
ATOM   8023  C  CD2   . LEU C 1 339 ? 92.81600  117.49500 79.38600  1.000 97.32000  ? 584 LEU C CD2   1 
ATOM   8024  N  N     . SER C 1 340 ? 88.74400  117.58500 81.46600  1.000 94.26000  ? 585 SER C N     1 
ATOM   8025  C  CA    . SER C 1 340 ? 88.07800  118.56800 82.30600  1.000 94.26000  ? 585 SER C CA    1 
ATOM   8026  C  C     . SER C 1 340 ? 89.08800  119.21400 83.24200  1.000 94.26000  ? 585 SER C C     1 
ATOM   8027  O  O     . SER C 1 340 ? 90.14400  118.64000 83.52000  1.000 94.26000  ? 585 SER C O     1 
ATOM   8028  C  CB    . SER C 1 340 ? 86.94700  117.92700 83.11800  1.000 94.26000  ? 585 SER C CB    1 
ATOM   8029  O  OG    . SER C 1 340 ? 87.46000  116.99600 84.05500  1.000 94.26000  ? 585 SER C OG    1 
ATOM   8030  N  N     . THR C 1 341 ? 88.75300  120.41100 83.72000  1.000 89.49000  ? 586 THR C N     1 
ATOM   8031  C  CA    . THR C 1 341 ? 89.61600  121.15200 84.63500  1.000 89.49000  ? 586 THR C CA    1 
ATOM   8032  C  C     . THR C 1 341 ? 89.61600  120.47300 85.99800  1.000 89.49000  ? 586 THR C C     1 
ATOM   8033  O  O     . THR C 1 341 ? 88.55400  120.16300 86.54700  1.000 89.49000  ? 586 THR C O     1 
ATOM   8034  C  CB    . THR C 1 341 ? 89.14400  122.59700 84.75000  1.000 89.49000  ? 586 THR C CB    1 
ATOM   8035  O  OG1   . THR C 1 341 ? 87.81700  122.62000 85.28900  1.000 89.49000  ? 586 THR C OG1   1 
ATOM   8036  C  CG2   . THR C 1 341 ? 89.14000  123.26400 83.38500  1.000 89.49000  ? 586 THR C CG2   1 
ATOM   8037  N  N     . LEU C 1 342 ? 90.80500  120.24500 86.54700  1.000 80.33000  ? 587 LEU C N     1 
ATOM   8038  C  CA    . LEU C 1 342 ? 90.91600  119.54500 87.81400  1.000 80.33000  ? 587 LEU C CA    1 
ATOM   8039  C  C     . LEU C 1 342 ? 90.76200  120.51200 88.98600  1.000 80.33000  ? 587 LEU C C     1 
ATOM   8040  O  O     . LEU C 1 342 ? 91.09600  121.69500 88.87900  1.000 80.33000  ? 587 LEU C O     1 
ATOM   8041  C  CB    . LEU C 1 342 ? 92.26100  118.83500 87.91000  1.000 80.33000  ? 587 LEU C CB    1 
ATOM   8042  C  CG    . LEU C 1 342 ? 92.48100  117.69300 86.92200  1.000 80.33000  ? 587 LEU C CG    1 
ATOM   8043  C  CD1   . LEU C 1 342 ? 93.90800  117.19100 87.02600  1.000 80.33000  ? 587 LEU C CD1   1 
ATOM   8044  C  CD2   . LEU C 1 342 ? 91.48800  116.57500 87.18800  1.000 80.33000  ? 587 LEU C CD2   1 
ATOM   8045  N  N     . PRO C 1 343 ? 90.25300  120.03100 90.11600  1.000 68.62000  ? 588 PRO C N     1 
ATOM   8046  C  CA    . PRO C 1 343 ? 90.18900  120.86900 91.31900  1.000 68.62000  ? 588 PRO C CA    1 
ATOM   8047  C  C     . PRO C 1 343 ? 91.49500  120.86400 92.09600  1.000 68.62000  ? 588 PRO C C     1 
ATOM   8048  O  O     . PRO C 1 343 ? 92.48800  120.28200 91.65100  1.000 68.62000  ? 588 PRO C O     1 
ATOM   8049  C  CB    . PRO C 1 343 ? 89.06000  120.22300 92.12600  1.000 68.62000  ? 588 PRO C CB    1 
ATOM   8050  C  CG    . PRO C 1 343 ? 89.11800  118.79000 91.72700  1.000 68.62000  ? 588 PRO C CG    1 
ATOM   8051  C  CD    . PRO C 1 343 ? 89.51700  118.76800 90.28000  1.000 68.62000  ? 588 PRO C CD    1 
ATOM   8052  N  N     . THR C 1 344 ? 91.50300  121.51200 93.25900  1.000 59.61000  ? 589 THR C N     1 
ATOM   8053  C  CA    . THR C 1 344 ? 92.64200  121.50900 94.17000  1.000 59.61000  ? 589 THR C CA    1 
ATOM   8054  C  C     . THR C 1 344 ? 92.19100  120.92800 95.50100  1.000 59.61000  ? 589 THR C C     1 
ATOM   8055  O  O     . THR C 1 344 ? 91.35300  121.52200 96.18800  1.000 59.61000  ? 589 THR C O     1 
ATOM   8056  C  CB    . THR C 1 344 ? 93.20400  122.91600 94.36000  1.000 59.61000  ? 589 THR C CB    1 
ATOM   8057  O  OG1   . THR C 1 344 ? 93.66900  123.41700 93.10100  1.000 59.61000  ? 589 THR C OG1   1 
ATOM   8058  C  CG2   . THR C 1 344 ? 94.35600  122.89700 95.34500  1.000 59.61000  ? 589 THR C CG2   1 
ATOM   8059  N  N     . ILE C 1 345 ? 92.74800  119.77700 95.86500  1.000 57.60000  ? 590 ILE C N     1 
ATOM   8060  C  CA    . ILE C 1 345 ? 92.30300  119.05200 97.05000  1.000 57.60000  ? 590 ILE C CA    1 
ATOM   8061  C  C     . ILE C 1 345 ? 92.92000  119.69200 98.28400  1.000 57.60000  ? 590 ILE C C     1 
ATOM   8062  O  O     . ILE C 1 345 ? 94.05200  120.18700 98.24500  1.000 57.60000  ? 590 ILE C O     1 
ATOM   8063  C  CB    . ILE C 1 345 ? 92.68500  117.56500 96.94300  1.000 57.60000  ? 590 ILE C CB    1 
ATOM   8064  C  CG1   . ILE C 1 345 ? 92.24500  117.00600 95.59400  1.000 57.60000  ? 590 ILE C CG1   1 
ATOM   8065  C  CG2   . ILE C 1 345 ? 92.03200  116.76000 98.05300  1.000 57.60000  ? 590 ILE C CG2   1 
ATOM   8066  C  CD1   . ILE C 1 345 ? 90.78000  117.14200 95.34000  1.000 57.60000  ? 590 ILE C CD1   1 
ATOM   8067  N  N     . VAL C 1 346 ? 92.17600  119.68500 99.38700  1.000 49.23000  ? 591 VAL C N     1 
ATOM   8068  C  CA    . VAL C 1 346 ? 92.62900  120.23400 100.66200 1.000 49.23000  ? 591 VAL C CA    1 
ATOM   8069  C  C     . VAL C 1 346 ? 92.35400  119.16700 101.71300 1.000 49.23000  ? 591 VAL C C     1 
ATOM   8070  O  O     . VAL C 1 346 ? 91.23300  119.06000 102.22100 1.000 49.23000  ? 591 VAL C O     1 
ATOM   8071  C  CB    . VAL C 1 346 ? 91.93200  121.55100 101.01600 1.000 49.23000  ? 591 VAL C CB    1 
ATOM   8072  C  CG1   . VAL C 1 346 ? 92.35800  122.02500 102.39500 1.000 49.23000  ? 591 VAL C CG1   1 
ATOM   8073  C  CG2   . VAL C 1 346 ? 92.23500  122.60900 99.97300  1.000 49.23000  ? 591 VAL C CG2   1 
ATOM   8074  N  N     . VAL C 1 347 ? 93.37000  118.37300 102.04000 1.000 46.02000  ? 592 VAL C N     1 
ATOM   8075  C  CA    . VAL C 1 347 ? 93.21600  117.28300 102.99600 1.000 46.02000  ? 592 VAL C CA    1 
ATOM   8076  C  C     . VAL C 1 347 ? 93.32300  117.83700 104.41000 1.000 46.02000  ? 592 VAL C C     1 
ATOM   8077  O  O     . VAL C 1 347 ? 94.42700  118.03400 104.92800 1.000 46.02000  ? 592 VAL C O     1 
ATOM   8078  C  CB    . VAL C 1 347 ? 94.26100  116.17900 102.75500 1.000 46.02000  ? 592 VAL C CB    1 
ATOM   8079  C  CG1   . VAL C 1 347 ? 94.11500  115.07400 103.78700 1.000 46.02000  ? 592 VAL C CG1   1 
ATOM   8080  C  CG2   . VAL C 1 347 ? 94.13600  115.62700 101.34700 1.000 46.02000  ? 592 VAL C CG2   1 
ATOM   8081  N  N     . VAL C 1 348 ? 92.18400  118.10300 105.03600 1.000 43.22000  ? 593 VAL C N     1 
ATOM   8082  C  CA    . VAL C 1 348 ? 92.16700  118.60100 106.40500 1.000 43.22000  ? 593 VAL C CA    1 
ATOM   8083  C  C     . VAL C 1 348 ? 92.25000  117.42500 107.36300 1.000 43.22000  ? 593 VAL C C     1 
ATOM   8084  O  O     . VAL C 1 348 ? 91.59200  116.39800 107.16800 1.000 43.22000  ? 593 VAL C O     1 
ATOM   8085  C  CB    . VAL C 1 348 ? 90.90300  119.44100 106.65600 1.000 43.22000  ? 593 VAL C CB    1 
ATOM   8086  C  CG1   . VAL C 1 348 ? 90.84700  119.90300 108.09800 1.000 43.22000  ? 593 VAL C CG1   1 
ATOM   8087  C  CG2   . VAL C 1 348 ? 90.86500  120.62600 105.71500 1.000 43.22000  ? 593 VAL C CG2   1 
ATOM   8088  N  N     . VAL C 1 349 ? 93.06400  117.56700 108.40700 1.000 45.28000  ? 594 VAL C N     1 
ATOM   8089  C  CA    . VAL C 1 349 ? 93.23100  116.53800 109.42800 1.000 45.28000  ? 594 VAL C CA    1 
ATOM   8090  C  C     . VAL C 1 349 ? 93.15700  117.23500 110.77900 1.000 45.28000  ? 594 VAL C C     1 
ATOM   8091  O  O     . VAL C 1 349 ? 94.12900  117.85500 111.22100 1.000 45.28000  ? 594 VAL C O     1 
ATOM   8092  C  CB    . VAL C 1 349 ? 94.54400  115.76600 109.27800 1.000 45.28000  ? 594 VAL C CB    1 
ATOM   8093  C  CG1   . VAL C 1 349 ? 94.70100  114.77300 110.41500 1.000 45.28000  ? 594 VAL C CG1   1 
ATOM   8094  C  CG2   . VAL C 1 349 ? 94.59200  115.05100 107.93900 1.000 45.28000  ? 594 VAL C CG2   1 
ATOM   8095  N  N     . ASP C 1 350 ? 92.00500  117.14600 111.43100 1.000 50.77000  ? 595 ASP C N     1 
ATOM   8096  C  CA    . ASP C 1 350 ? 91.83900  117.71300 112.75800 1.000 50.77000  ? 595 ASP C CA    1 
ATOM   8097  C  C     . ASP C 1 350 ? 92.29200  116.71600 113.81500 1.000 50.77000  ? 595 ASP C C     1 
ATOM   8098  O  O     . ASP C 1 350 ? 91.82300  115.57600 113.85000 1.000 50.77000  ? 595 ASP C O     1 
ATOM   8099  C  CB    . ASP C 1 350 ? 90.37900  118.09000 112.99000 1.000 50.77000  ? 595 ASP C CB    1 
ATOM   8100  C  CG    . ASP C 1 350 ? 90.18000  118.91800 114.23700 1.000 50.77000  ? 595 ASP C CG    1 
ATOM   8101  O  OD1   . ASP C 1 350 ? 91.17700  119.23800 114.91700 1.000 50.77000  ? 595 ASP C OD1   1 
ATOM   8102  O  OD2   . ASP C 1 350 ? 89.01600  119.23900 114.54500 1.000 50.77000  ? 595 ASP C OD2   1 
ATOM   8103  N  N     . GLU C 1 351 ? 93.20000  117.15400 114.68300 1.000 53.35000  ? 596 GLU C N     1 
ATOM   8104  C  CA    . GLU C 1 351 ? 93.71100  116.33300 115.77800 1.000 53.35000  ? 596 GLU C CA    1 
ATOM   8105  C  C     . GLU C 1 351 ? 94.35000  115.04800 115.24300 1.000 53.35000  ? 596 GLU C C     1 
ATOM   8106  O  O     . GLU C 1 351 ? 93.91300  113.92600 115.49200 1.000 53.35000  ? 596 GLU C O     1 
ATOM   8107  C  CB    . GLU C 1 351 ? 92.59800  116.05400 116.78700 1.000 53.35000  ? 596 GLU C CB    1 
ATOM   8108  C  CG    . GLU C 1 351 ? 92.10600  117.32400 117.45100 1.000 53.35000  ? 596 GLU C CG    1 
ATOM   8109  C  CD    . GLU C 1 351 ? 93.15200  117.95100 118.34400 1.000 53.35000  ? 596 GLU C CD    1 
ATOM   8110  O  OE1   . GLU C 1 351 ? 93.95500  117.19700 118.93100 1.000 53.35000  ? 596 GLU C OE1   1 
ATOM   8111  O  OE2   . GLU C 1 351 ? 93.17600  119.19400 118.45800 1.000 53.35000  ? 596 GLU C OE2   1 
ATOM   8112  N  N     . PHE C 1 352 ? 95.41000  115.28100 114.47300 1.000 60.35000  ? 597 PHE C N     1 
ATOM   8113  C  CA    . PHE C 1 352 ? 96.26200  114.26500 113.87300 1.000 60.35000  ? 597 PHE C CA    1 
ATOM   8114  C  C     . PHE C 1 352 ? 96.84100  113.28600 114.88900 1.000 60.35000  ? 597 PHE C C     1 
ATOM   8115  O  O     . PHE C 1 352 ? 97.14600  112.13900 114.52500 1.000 60.35000  ? 597 PHE C O     1 
ATOM   8116  C  CB    . PHE C 1 352 ? 97.36100  115.00800 113.12000 1.000 60.35000  ? 597 PHE C CB    1 
ATOM   8117  C  CG    . PHE C 1 352 ? 98.38400  114.13600 112.49700 1.000 60.35000  ? 597 PHE C CG    1 
ATOM   8118  C  CD1   . PHE C 1 352 ? 98.08300  113.38700 111.38600 1.000 60.35000  ? 597 PHE C CD1   1 
ATOM   8119  C  CD2   . PHE C 1 352 ? 99.67300  114.11400 112.98600 1.000 60.35000  ? 597 PHE C CD2   1 
ATOM   8120  C  CE1   . PHE C 1 352 ? 99.03600  112.59600 110.80000 1.000 60.35000  ? 597 PHE C CE1   1 
ATOM   8121  C  CE2   . PHE C 1 352 ? 100.63100 113.32700 112.39800 1.000 60.35000  ? 597 PHE C CE2   1 
ATOM   8122  C  CZ    . PHE C 1 352 ? 100.31300 112.57100 111.29900 1.000 60.35000  ? 597 PHE C CZ    1 
ATOM   8123  N  N     . ALA C 1 353 ? 96.97900  113.70600 116.14900 1.000 65.89000  ? 598 ALA C N     1 
ATOM   8124  C  CA    . ALA C 1 353 ? 97.55000  112.84500 117.17800 1.000 65.89000  ? 598 ALA C CA    1 
ATOM   8125  C  C     . ALA C 1 353 ? 96.75800  111.55500 117.33600 1.000 65.89000  ? 598 ALA C C     1 
ATOM   8126  O  O     . ALA C 1 353 ? 97.34300  110.47300 117.44000 1.000 65.89000  ? 598 ALA C O     1 
ATOM   8127  C  CB    . ALA C 1 353 ? 97.61700  113.59600 118.50600 1.000 65.89000  ? 598 ALA C CB    1 
ATOM   8128  N  N     . ASP C 1 354 ? 95.42700  111.64400 117.34300 1.000 69.25000  ? 599 ASP C N     1 
ATOM   8129  C  CA    . ASP C 1 354 ? 94.61800  110.44600 117.53900 1.000 69.25000  ? 599 ASP C CA    1 
ATOM   8130  C  C     . ASP C 1 354 ? 94.67800  109.52600 116.32700 1.000 69.25000  ? 599 ASP C C     1 
ATOM   8131  O  O     . ASP C 1 354 ? 94.71400  108.29600 116.48100 1.000 69.25000  ? 599 ASP C O     1 
ATOM   8132  C  CB    . ASP C 1 354 ? 93.17500  110.84000 117.83900 1.000 69.25000  ? 599 ASP C CB    1 
ATOM   8133  C  CG    . ASP C 1 354 ? 93.04000  111.59600 119.14300 1.000 69.25000  ? 599 ASP C CG    1 
ATOM   8134  O  OD1   . ASP C 1 354 ? 93.86600  111.37400 120.05300 1.000 69.25000  ? 599 ASP C OD1   1 
ATOM   8135  O  OD2   . ASP C 1 354 ? 92.11000  112.41800 119.25700 1.000 69.25000  ? 599 ASP C OD2   1 
ATOM   8136  N  N     . MET C 1 355 ? 94.70300  110.09900 115.12200 1.000 72.19000  ? 600 MET C N     1 
ATOM   8137  C  CA    . MET C 1 355 ? 94.82900  109.27900 113.92400 1.000 72.19000  ? 600 MET C CA    1 
ATOM   8138  C  C     . MET C 1 355 ? 96.15500  108.53300 113.91300 1.000 72.19000  ? 600 MET C C     1 
ATOM   8139  O  O     . MET C 1 355 ? 96.23400  107.40200 113.42100 1.000 72.19000  ? 600 MET C O     1 
ATOM   8140  C  CB    . MET C 1 355 ? 94.68500  110.14000 112.67100 1.000 72.19000  ? 600 MET C CB    1 
ATOM   8141  C  CG    . MET C 1 355 ? 94.69300  109.33000 111.38800 1.000 72.19000  ? 600 MET C CG    1 
ATOM   8142  S  SD    . MET C 1 355 ? 94.45500  110.31000 109.89800 1.000 72.19000  ? 600 MET C SD    1 
ATOM   8143  C  CE    . MET C 1 355 ? 96.04800  111.10300 109.75500 1.000 72.19000  ? 600 MET C CE    1 
ATOM   8144  N  N     . MET C 1 356 ? 97.21200  109.14300 114.45600 1.000 71.64000  ? 601 MET C N     1 
ATOM   8145  C  CA    . MET C 1 356 ? 98.45900  108.39500 114.59600 1.000 71.64000  ? 601 MET C CA    1 
ATOM   8146  C  C     . MET C 1 356 ? 98.36600  107.36000 115.71100 1.000 71.64000  ? 601 MET C C     1 
ATOM   8147  O  O     . MET C 1 356 ? 98.93600  106.27000 115.60100 1.000 71.64000  ? 601 MET C O     1 
ATOM   8148  C  CB    . MET C 1 356 ? 99.62900  109.34200 114.84300 1.000 71.64000  ? 601 MET C CB    1 
ATOM   8149  C  CG    . MET C 1 356 ? 99.96000  110.19900 113.65000 1.000 71.64000  ? 601 MET C CG    1 
ATOM   8150  S  SD    . MET C 1 356 ? 100.38400 109.22600 112.19100 1.000 71.64000  ? 601 MET C SD    1 
ATOM   8151  C  CE    . MET C 1 356 ? 101.97300 108.56000 112.67100 1.000 71.64000  ? 601 MET C CE    1 
ATOM   8152  N  N     . MET C 1 357 ? 97.65800  107.68300 116.79500 1.000 76.88000  ? 602 MET C N     1 
ATOM   8153  C  CA    . MET C 1 357 ? 97.52900  106.73700 117.89900 1.000 76.88000  ? 602 MET C CA    1 
ATOM   8154  C  C     . MET C 1 357 ? 96.73300  105.50000 117.51500 1.000 76.88000  ? 602 MET C C     1 
ATOM   8155  O  O     . MET C 1 357 ? 96.87300  104.46200 118.17000 1.000 76.88000  ? 602 MET C O     1 
ATOM   8156  C  CB    . MET C 1 357 ? 96.87500  107.40700 119.10900 1.000 76.88000  ? 602 MET C CB    1 
ATOM   8157  C  CG    . MET C 1 357 ? 97.74800  108.43700 119.80500 1.000 76.88000  ? 602 MET C CG    1 
ATOM   8158  S  SD    . MET C 1 357 ? 96.90100  109.26600 121.16500 1.000 76.88000  ? 602 MET C SD    1 
ATOM   8159  C  CE    . MET C 1 357 ? 96.78400  107.93400 122.35500 1.000 76.88000  ? 602 MET C CE    1 
ATOM   8160  N  N     . ILE C 1 358 ? 95.90400  105.57700 116.47500 1.000 78.76000  ? 603 ILE C N     1 
ATOM   8161  C  CA    . ILE C 1 358 ? 95.10800  104.41700 116.08800 1.000 78.76000  ? 603 ILE C CA    1 
ATOM   8162  C  C     . ILE C 1 358 ? 95.72500  103.70400 114.88900 1.000 78.76000  ? 603 ILE C C     1 
ATOM   8163  O  O     . ILE C 1 358 ? 96.10800  102.53300 114.98400 1.000 78.76000  ? 603 ILE C O     1 
ATOM   8164  C  CB    . ILE C 1 358 ? 93.65000  104.81700 115.80200 1.000 78.76000  ? 603 ILE C CB    1 
ATOM   8165  C  CG1   . ILE C 1 358 ? 92.99500  105.35200 117.07500 1.000 78.76000  ? 603 ILE C CG1   1 
ATOM   8166  C  CG2   . ILE C 1 358 ? 92.87100  103.62900 115.27300 1.000 78.76000  ? 603 ILE C CG2   1 
ATOM   8167  C  CD1   . ILE C 1 358 ? 91.65000  105.99400 116.84600 1.000 78.76000  ? 603 ILE C CD1   1 
ATOM   8168  N  N     . VAL C 1 359 ? 95.83100  104.39800 113.75600 1.000 81.70000  ? 604 VAL C N     1 
ATOM   8169  C  CA    . VAL C 1 359 ? 96.27300  103.76900 112.51400 1.000 81.70000  ? 604 VAL C CA    1 
ATOM   8170  C  C     . VAL C 1 359 ? 97.58800  104.37200 112.03800 1.000 81.70000  ? 604 VAL C C     1 
ATOM   8171  O  O     . VAL C 1 359 ? 97.84500  104.45200 110.83200 1.000 81.70000  ? 604 VAL C O     1 
ATOM   8172  C  CB    . VAL C 1 359 ? 95.19500  103.89000 111.42100 1.000 81.70000  ? 604 VAL C CB    1 
ATOM   8173  C  CG1   . VAL C 1 359 ? 93.95200  103.11500 111.81800 1.000 81.70000  ? 604 VAL C CG1   1 
ATOM   8174  C  CG2   . VAL C 1 359 ? 94.85300  105.34900 111.17500 1.000 81.70000  ? 604 VAL C CG2   1 
ATOM   8175  N  N     . GLY C 1 360 ? 98.43000  104.78900 112.97900 1.000 84.70000  ? 605 GLY C N     1 
ATOM   8176  C  CA    . GLY C 1 360 ? 99.67400  105.46600 112.66300 1.000 84.70000  ? 605 GLY C CA    1 
ATOM   8177  C  C     . GLY C 1 360 ? 100.57600 104.78400 111.65500 1.000 84.70000  ? 605 GLY C C     1 
ATOM   8178  O  O     . GLY C 1 360 ? 100.91500 105.37600 110.62700 1.000 84.70000  ? 605 GLY C O     1 
ATOM   8179  N  N     . LYS C 1 361 ? 100.97200 103.54000 111.93100 1.000 86.89000  ? 606 LYS C N     1 
ATOM   8180  C  CA    . LYS C 1 361 ? 101.96800 102.87200 111.10200 1.000 86.89000  ? 606 LYS C CA    1 
ATOM   8181  C  C     . LYS C 1 361 ? 101.47000 102.55600 109.69500 1.000 86.89000  ? 606 LYS C C     1 
ATOM   8182  O  O     . LYS C 1 361 ? 102.28200 102.17100 108.84700 1.000 86.89000  ? 606 LYS C O     1 
ATOM   8183  C  CB    . LYS C 1 361 ? 102.44700 101.59500 111.79400 1.000 86.89000  ? 606 LYS C CB    1 
ATOM   8184  C  CG    . LYS C 1 361 ? 103.25100 101.86500 113.06100 1.000 86.89000  ? 606 LYS C CG    1 
ATOM   8185  C  CD    . LYS C 1 361 ? 103.62700 100.58500 113.79500 1.000 86.89000  ? 606 LYS C CD    1 
ATOM   8186  C  CE    . LYS C 1 361 ? 104.71500 99.81800  113.05700 1.000 86.89000  ? 606 LYS C CE    1 
ATOM   8187  N  NZ    . LYS C 1 361 ? 105.19700 98.64000  113.83100 1.000 86.89000  ? 606 LYS C NZ    1 
ATOM   8188  N  N     . LYS C 1 362 ? 100.17400 102.70500 109.42400 1.000 83.55000  ? 607 LYS C N     1 
ATOM   8189  C  CA    . LYS C 1 362 ? 99.65800  102.61100 108.06500 1.000 83.55000  ? 607 LYS C CA    1 
ATOM   8190  C  C     . LYS C 1 362 ? 99.59200  103.96300 107.36800 1.000 83.55000  ? 607 LYS C C     1 
ATOM   8191  O  O     . LYS C 1 362 ? 99.38700  104.00900 106.15000 1.000 83.55000  ? 607 LYS C O     1 
ATOM   8192  C  CB    . LYS C 1 362 ? 98.26100  101.98300 108.06400 1.000 83.55000  ? 607 LYS C CB    1 
ATOM   8193  C  CG    . LYS C 1 362 ? 98.21900  100.53300 108.50000 1.000 83.55000  ? 607 LYS C CG    1 
ATOM   8194  C  CD    . LYS C 1 362 ? 96.83700  99.94700  108.26900 1.000 83.55000  ? 607 LYS C CD    1 
ATOM   8195  C  CE    . LYS C 1 362 ? 95.83500  100.49400 109.26900 1.000 83.55000  ? 607 LYS C CE    1 
ATOM   8196  N  NZ    . LYS C 1 362 ? 94.49700  99.86500  109.11200 1.000 83.55000  ? 607 LYS C NZ    1 
ATOM   8197  N  N     . VAL C 1 363 ? 99.76700  105.05000 108.11200 1.000 79.63000  ? 608 VAL C N     1 
ATOM   8198  C  CA    . VAL C 1 363 ? 99.59400  106.39800 107.58900 1.000 79.63000  ? 608 VAL C CA    1 
ATOM   8199  C  C     . VAL C 1 363 ? 100.89800 107.18600 107.55600 1.000 79.63000  ? 608 VAL C C     1 
ATOM   8200  O  O     . VAL C 1 363 ? 100.98500 108.19900 106.83700 1.000 79.63000  ? 608 VAL C O     1 
ATOM   8201  C  CB    . VAL C 1 363 ? 98.52500  107.14500 108.41900 1.000 79.63000  ? 608 VAL C CB    1 
ATOM   8202  C  CG1   . VAL C 1 363 ? 98.33900  108.56900 107.96600 1.000 79.63000  ? 608 VAL C CG1   1 
ATOM   8203  C  CG2   . VAL C 1 363 ? 97.20100  106.39800 108.36100 1.000 79.63000  ? 608 VAL C CG2   1 
ATOM   8204  N  N     . GLU C 1 364 ? 101.91600 106.75300 108.30400 1.000 78.10000  ? 609 GLU C N     1 
ATOM   8205  C  CA    . GLU C 1 364 ? 103.20700 107.43200 108.31500 1.000 78.10000  ? 609 GLU C CA    1 
ATOM   8206  C  C     . GLU C 1 364 ? 103.72400 107.66200 106.90200 1.000 78.10000  ? 609 GLU C C     1 
ATOM   8207  O  O     . GLU C 1 364 ? 103.96600 108.80300 106.49500 1.000 78.10000  ? 609 GLU C O     1 
ATOM   8208  C  CB    . GLU C 1 364 ? 104.20900 106.61000 109.12100 1.000 78.10000  ? 609 GLU C CB    1 
ATOM   8209  C  CG    . GLU C 1 364 ? 105.58300 107.23400 109.24100 1.000 78.10000  ? 609 GLU C CG    1 
ATOM   8210  C  CD    . GLU C 1 364 ? 106.54600 106.35700 110.01500 1.000 78.10000  ? 609 GLU C CD    1 
ATOM   8211  O  OE1   . GLU C 1 364 ? 106.14100 105.25000 110.42700 1.000 78.10000  ? 609 GLU C OE1   1 
ATOM   8212  O  OE2   . GLU C 1 364 ? 107.70800 106.77200 110.20600 1.000 78.10000  ? 609 GLU C OE2   1 
ATOM   8213  N  N     . GLU C 1 365 ? 103.89900 106.58300 106.13800 1.000 76.77000  ? 610 GLU C N     1 
ATOM   8214  C  CA    . GLU C 1 365 ? 104.46400 106.69900 104.80100 1.000 76.77000  ? 610 GLU C CA    1 
ATOM   8215  C  C     . GLU C 1 365 ? 103.53100 107.42500 103.84300 1.000 76.77000  ? 610 GLU C C     1 
ATOM   8216  O  O     . GLU C 1 365 ? 104.00700 108.16800 102.98100 1.000 76.77000  ? 610 GLU C O     1 
ATOM   8217  C  CB    . GLU C 1 365 ? 104.79900 105.31300 104.25400 1.000 76.77000  ? 610 GLU C CB    1 
ATOM   8218  C  CG    . GLU C 1 365 ? 105.54500 105.33700 102.93600 1.000 76.77000  ? 610 GLU C CG    1 
ATOM   8219  C  CD    . GLU C 1 365 ? 106.94900 105.88900 103.07800 1.000 76.77000  ? 610 GLU C CD    1 
ATOM   8220  O  OE1   . GLU C 1 365 ? 107.52600 105.77100 104.18000 1.000 76.77000  ? 610 GLU C OE1   1 
ATOM   8221  O  OE2   . GLU C 1 365 ? 107.47800 106.44100 102.09000 1.000 76.77000  ? 610 GLU C OE2   1 
ATOM   8222  N  N     . LEU C 1 366 ? 102.21700 107.24300 103.98600 1.000 73.79000  ? 611 LEU C N     1 
ATOM   8223  C  CA    . LEU C 1 366 ? 101.27000 107.94700 103.12900 1.000 73.79000  ? 611 LEU C CA    1 
ATOM   8224  C  C     . LEU C 1 366 ? 101.40400 109.45600 103.26900 1.000 73.79000  ? 611 LEU C C     1 
ATOM   8225  O  O     . LEU C 1 366 ? 101.50500 110.17100 102.26600 1.000 73.79000  ? 611 LEU C O     1 
ATOM   8226  C  CB    . LEU C 1 366 ? 99.84400  107.51600 103.45900 1.000 73.79000  ? 611 LEU C CB    1 
ATOM   8227  C  CG    . LEU C 1 366 ? 99.50200  106.05700 103.17900 1.000 73.79000  ? 611 LEU C CG    1 
ATOM   8228  C  CD1   . LEU C 1 366 ? 98.11000  105.75000 103.69400 1.000 73.79000  ? 611 LEU C CD1   1 
ATOM   8229  C  CD2   . LEU C 1 366 ? 99.61000  105.76300 101.69400 1.000 73.79000  ? 611 LEU C CD2   1 
ATOM   8230  N  N     . ILE C 1 367 ? 101.42700 109.96400 104.50300 1.000 64.77000  ? 612 ILE C N     1 
ATOM   8231  C  CA    . ILE C 1 367 ? 101.59800 111.40500 104.67800 1.000 64.77000  ? 612 ILE C CA    1 
ATOM   8232  C  C     . ILE C 1 367 ? 103.01800 111.86400 104.38900 1.000 64.77000  ? 612 ILE C C     1 
ATOM   8233  O  O     . ILE C 1 367 ? 103.20500 112.97400 103.87800 1.000 64.77000  ? 612 ILE C O     1 
ATOM   8234  C  CB    . ILE C 1 367 ? 101.13400 111.83700 106.08200 1.000 64.77000  ? 612 ILE C CB    1 
ATOM   8235  C  CG1   . ILE C 1 367 ? 99.61700  111.72100 106.16700 1.000 64.77000  ? 612 ILE C CG1   1 
ATOM   8236  C  CG2   . ILE C 1 367 ? 101.55700 113.25500 106.39900 1.000 64.77000  ? 612 ILE C CG2   1 
ATOM   8237  C  CD1   . ILE C 1 367 ? 99.07000  111.99200 107.52300 1.000 64.77000  ? 612 ILE C CD1   1 
ATOM   8238  N  N     . ALA C 1 368 ? 104.02600 111.04200 104.66400 1.000 66.90000  ? 613 ALA C N     1 
ATOM   8239  C  CA    . ALA C 1 368 ? 105.39200 111.38700 104.30100 1.000 66.90000  ? 613 ALA C CA    1 
ATOM   8240  C  C     . ALA C 1 368 ? 105.62200 111.37400 102.79700 1.000 66.90000  ? 613 ALA C C     1 
ATOM   8241  O  O     . ALA C 1 368 ? 106.66000 111.86200 102.34200 1.000 66.90000  ? 613 ALA C O     1 
ATOM   8242  C  CB    . ALA C 1 368 ? 106.37800 110.43500 104.98300 1.000 66.90000  ? 613 ALA C CB    1 
ATOM   8243  N  N     . ARG C 1 369 ? 104.69400 110.81100 102.02300 1.000 68.51000  ? 614 ARG C N     1 
ATOM   8244  C  CA    . ARG C 1 369 ? 104.75800 110.86700 100.56800 1.000 68.51000  ? 614 ARG C CA    1 
ATOM   8245  C  C     . ARG C 1 369 ? 103.76700 111.86200 99.97800  1.000 68.51000  ? 614 ARG C C     1 
ATOM   8246  O  O     . ARG C 1 369 ? 103.88800 112.21400 98.80000  1.000 68.51000  ? 614 ARG C O     1 
ATOM   8247  C  CB    . ARG C 1 369 ? 104.53100 109.47500 99.97000  1.000 68.51000  ? 614 ARG C CB    1 
ATOM   8248  C  CG    . ARG C 1 369 ? 105.65900 108.50300 100.26100 1.000 68.51000  ? 614 ARG C CG    1 
ATOM   8249  C  CD    . ARG C 1 369 ? 105.38200 107.11400 99.71000  1.000 68.51000  ? 614 ARG C CD    1 
ATOM   8250  N  NE    . ARG C 1 369 ? 105.30900 107.09800 98.25300  1.000 68.51000  ? 614 ARG C NE    1 
ATOM   8251  C  CZ    . ARG C 1 369 ? 104.19900 106.84200 97.57100  1.000 68.51000  ? 614 ARG C CZ    1 
ATOM   8252  N  NH1   . ARG C 1 369 ? 103.07800 106.56700 98.22000  1.000 68.51000  ? 614 ARG C NH1   1 
ATOM   8253  N  NH2   . ARG C 1 369 ? 104.21200 106.84800 96.24500  1.000 68.51000  ? 614 ARG C NH2   1 
ATOM   8254  N  N     . ILE C 1 370 ? 102.78400 112.31400 100.75300 1.000 63.79000  ? 615 ILE C N     1 
ATOM   8255  C  CA    . ILE C 1 370 ? 101.94700 113.45500 100.38000 1.000 63.79000  ? 615 ILE C CA    1 
ATOM   8256  C  C     . ILE C 1 370 ? 102.67700 114.77200 100.61800 1.000 63.79000  ? 615 ILE C C     1 
ATOM   8257  O  O     . ILE C 1 370 ? 102.90500 115.54300 99.68500  1.000 63.79000  ? 615 ILE C O     1 
ATOM   8258  C  CB    . ILE C 1 370 ? 100.59100 113.43000 101.11900 1.000 63.79000  ? 615 ILE C CB    1 
ATOM   8259  C  CG1   . ILE C 1 370 ? 99.74800  112.24800 100.65700 1.000 63.79000  ? 615 ILE C CG1   1 
ATOM   8260  C  CG2   . ILE C 1 370 ? 99.83400  114.71700 100.86900 1.000 63.79000  ? 615 ILE C CG2   1 
ATOM   8261  C  CD1   . ILE C 1 370 ? 99.37800  112.32800 99.20000  1.000 63.79000  ? 615 ILE C CD1   1 
ATOM   8262  N  N     . ALA C 1 371 ? 103.05200 115.04900 101.86800 1.000 61.94000  ? 616 ALA C N     1 
ATOM   8263  C  CA    . ALA C 1 371 ? 103.73300 116.29800 102.19000 1.000 61.94000  ? 616 ALA C CA    1 
ATOM   8264  C  C     . ALA C 1 371 ? 105.03700 116.46000 101.42600 1.000 61.94000  ? 616 ALA C C     1 
ATOM   8265  O  O     . ALA C 1 371 ? 105.47800 117.59100 101.19700 1.000 61.94000  ? 616 ALA C O     1 
ATOM   8266  C  CB    . ALA C 1 371 ? 103.99800 116.37500 103.69400 1.000 61.94000  ? 616 ALA C CB    1 
ATOM   8267  N  N     . GLN C 1 372 ? 105.65900 115.35400 101.02500 1.000 73.35000  ? 617 GLN C N     1 
ATOM   8268  C  CA    . GLN C 1 372 ? 106.96200 115.42100 100.37700 1.000 73.35000  ? 617 GLN C CA    1 
ATOM   8269  C  C     . GLN C 1 372 ? 106.86700 115.98600 98.96600  1.000 73.35000  ? 617 GLN C C     1 
ATOM   8270  O  O     . GLN C 1 372 ? 107.72600 116.76900 98.54900  1.000 73.35000  ? 617 GLN C O     1 
ATOM   8271  C  CB    . GLN C 1 372 ? 107.58600 114.02900 100.35400 1.000 73.35000  ? 617 GLN C CB    1 
ATOM   8272  C  CG    . GLN C 1 372 ? 108.92100 113.92300 99.66100  1.000 73.35000  ? 617 GLN C CG    1 
ATOM   8273  C  CD    . GLN C 1 372 ? 109.48600 112.52400 99.75800  1.000 73.35000  ? 617 GLN C CD    1 
ATOM   8274  O  OE1   . GLN C 1 372 ? 108.89900 111.65300 100.39700 1.000 73.35000  ? 617 GLN C OE1   1 
ATOM   8275  N  NE2   . GLN C 1 372 ? 110.61000 112.28900 99.09600  1.000 73.35000  ? 617 GLN C NE2   1 
ATOM   8276  N  N     . LYS C 1 373 ? 105.83200 115.60900 98.21700  1.000 69.98000  ? 618 LYS C N     1 
ATOM   8277  C  CA    . LYS C 1 373 ? 105.80600 115.87300 96.78600  1.000 69.98000  ? 618 LYS C CA    1 
ATOM   8278  C  C     . LYS C 1 373 ? 104.49600 116.43600 96.25300  1.000 69.98000  ? 618 LYS C C     1 
ATOM   8279  O  O     . LYS C 1 373 ? 104.47300 116.87600 95.10000  1.000 69.98000  ? 618 LYS C O     1 
ATOM   8280  C  CB    . LYS C 1 373 ? 106.14100 114.58900 96.01200  1.000 69.98000  ? 618 LYS C CB    1 
ATOM   8281  C  CG    . LYS C 1 373 ? 105.12500 113.48200 96.20800  1.000 69.98000  ? 618 LYS C CG    1 
ATOM   8282  C  CD    . LYS C 1 373 ? 105.53400 112.20500 95.49800  1.000 69.98000  ? 618 LYS C CD    1 
ATOM   8283  C  CE    . LYS C 1 373 ? 106.66400 111.50400 96.23000  1.000 69.98000  ? 618 LYS C CE    1 
ATOM   8284  N  NZ    . LYS C 1 373 ? 106.96300 110.17000 95.64200  1.000 69.98000  ? 618 LYS C NZ    1 
ATOM   8285  N  N     . ALA C 1 374 ? 103.41900 116.45200 97.03700  1.000 64.42000  ? 619 ALA C N     1 
ATOM   8286  C  CA    . ALA C 1 374 ? 102.11300 116.81700 96.49900  1.000 64.42000  ? 619 ALA C CA    1 
ATOM   8287  C  C     . ALA C 1 374 ? 101.89800 118.32100 96.42100  1.000 64.42000  ? 619 ALA C C     1 
ATOM   8288  O  O     . ALA C 1 374 ? 100.89700 118.83200 96.93300  1.000 64.42000  ? 619 ALA C O     1 
ATOM   8289  C  CB    . ALA C 1 374 ? 100.99500 116.20100 97.34000  1.000 64.42000  ? 619 ALA C CB    1 
ATOM   8290  N  N     . ARG C 1 375 ? 102.81400 119.04100 95.77800  1.000 62.87000  ? 620 ARG C N     1 
ATOM   8291  C  CA    . ARG C 1 375 ? 102.61800 120.45800 95.49900  1.000 62.87000  ? 620 ARG C CA    1 
ATOM   8292  C  C     . ARG C 1 375 ? 102.12500 120.70400 94.08100  1.000 62.87000  ? 620 ARG C C     1 
ATOM   8293  O  O     . ARG C 1 375 ? 101.10300 121.36700 93.88300  1.000 62.87000  ? 620 ARG C O     1 
ATOM   8294  C  CB    . ARG C 1 375 ? 103.91300 121.24200 95.72500  1.000 62.87000  ? 620 ARG C CB    1 
ATOM   8295  C  CG    . ARG C 1 375 ? 103.73500 122.73000 95.49300  1.000 62.87000  ? 620 ARG C CG    1 
ATOM   8296  C  CD    . ARG C 1 375 ? 104.99200 123.51500 95.80000  1.000 62.87000  ? 620 ARG C CD    1 
ATOM   8297  N  NE    . ARG C 1 375 ? 104.76700 124.94800 95.64200  1.000 62.87000  ? 620 ARG C NE    1 
ATOM   8298  C  CZ    . ARG C 1 375 ? 105.65900 125.88200 95.95100  1.000 62.87000  ? 620 ARG C CZ    1 
ATOM   8299  N  NH1   . ARG C 1 375 ? 106.84000 125.53500 96.44300  1.000 62.87000  ? 620 ARG C NH1   1 
ATOM   8300  N  NH2   . ARG C 1 375 ? 105.36600 127.16300 95.77800  1.000 62.87000  ? 620 ARG C NH2   1 
ATOM   8301  N  N     . ALA C 1 376 ? 102.85100 120.19000 93.08800  1.000 66.77000  ? 621 ALA C N     1 
ATOM   8302  C  CA    . ALA C 1 376 ? 102.45900 120.38600 91.69900  1.000 66.77000  ? 621 ALA C CA    1 
ATOM   8303  C  C     . ALA C 1 376 ? 101.10500 119.75900 91.40200  1.000 66.77000  ? 621 ALA C C     1 
ATOM   8304  O  O     . ALA C 1 376 ? 100.33500 120.29700 90.59900  1.000 66.77000  ? 621 ALA C O     1 
ATOM   8305  C  CB    . ALA C 1 376 ? 103.52700 119.81100 90.77000  1.000 66.77000  ? 621 ALA C CB    1 
ATOM   8306  N  N     . ALA C 1 377 ? 100.79100 118.63200 92.04000  1.000 67.39000  ? 622 ALA C N     1 
ATOM   8307  C  CA    . ALA C 1 377 ? 99.52900  117.95700 91.77700  1.000 67.39000  ? 622 ALA C CA    1 
ATOM   8308  C  C     . ALA C 1 377 ? 98.34200  118.64900 92.43000  1.000 67.39000  ? 622 ALA C C     1 
ATOM   8309  O  O     . ALA C 1 377 ? 97.21400  118.49400 91.95100  1.000 67.39000  ? 622 ALA C O     1 
ATOM   8310  C  CB    . ALA C 1 377 ? 99.60100  116.50500 92.24700  1.000 67.39000  ? 622 ALA C CB    1 
ATOM   8311  N  N     . GLY C 1 378 ? 98.56300  119.40400 93.50300  1.000 59.81000  ? 623 GLY C N     1 
ATOM   8312  C  CA    . GLY C 1 378 ? 97.49200  120.15500 94.12800  1.000 59.81000  ? 623 GLY C CA    1 
ATOM   8313  C  C     . GLY C 1 378 ? 96.72900  119.40100 95.19700  1.000 59.81000  ? 623 GLY C C     1 
ATOM   8314  O  O     . GLY C 1 378 ? 95.50500  119.52000 95.29200  1.000 59.81000  ? 623 GLY C O     1 
ATOM   8315  N  N     . ILE C 1 379 ? 97.43600  118.62200 96.00800  1.000 59.08000  ? 624 ILE C N     1 
ATOM   8316  C  CA    . ILE C 1 379 ? 96.85500  117.94200 97.16200  1.000 59.08000  ? 624 ILE C CA    1 
ATOM   8317  C  C     . ILE C 1 379 ? 97.55600  118.50500 98.39000  1.000 59.08000  ? 624 ILE C C     1 
ATOM   8318  O  O     . ILE C 1 379 ? 98.71400  118.17000 98.66600  1.000 59.08000  ? 624 ILE C O     1 
ATOM   8319  C  CB    . ILE C 1 379 ? 96.99500  116.41800 97.08500  1.000 59.08000  ? 624 ILE C CB    1 
ATOM   8320  C  CG1   . ILE C 1 379 ? 96.17900  115.85800 95.92100  1.000 59.08000  ? 624 ILE C CG1   1 
ATOM   8321  C  CG2   . ILE C 1 379 ? 96.53800  115.77600 98.38300  1.000 59.08000  ? 624 ILE C CG2   1 
ATOM   8322  C  CD1   . ILE C 1 379 ? 96.94200  115.75000 94.63200  1.000 59.08000  ? 624 ILE C CD1   1 
ATOM   8323  N  N     . HIS C 1 380 ? 96.86300  119.36000 99.13000  1.000 49.95000  ? 625 HIS C N     1 
ATOM   8324  C  CA    . HIS C 1 380 ? 97.44100  120.05300 100.26900 1.000 49.95000  ? 625 HIS C CA    1 
ATOM   8325  C  C     . HIS C 1 380 ? 96.94900  119.44700 101.57600 1.000 49.95000  ? 625 HIS C C     1 
ATOM   8326  O  O     . HIS C 1 380 ? 95.89100  118.81800 101.64000 1.000 49.95000  ? 625 HIS C O     1 
ATOM   8327  C  CB    . HIS C 1 380 ? 97.10100  121.54200 100.21700 1.000 49.95000  ? 625 HIS C CB    1 
ATOM   8328  C  CG    . HIS C 1 380 ? 97.68400  122.24900 99.03500  1.000 49.95000  ? 625 HIS C CG    1 
ATOM   8329  N  ND1   . HIS C 1 380 ? 97.02700  122.34400 97.82800  1.000 49.95000  ? 625 HIS C ND1   1 
ATOM   8330  C  CD2   . HIS C 1 380 ? 98.86600  122.88700 98.87200  1.000 49.95000  ? 625 HIS C CD2   1 
ATOM   8331  C  CE1   . HIS C 1 380 ? 97.77700  123.01600 96.97300  1.000 49.95000  ? 625 HIS C CE1   1 
ATOM   8332  N  NE2   . HIS C 1 380 ? 98.89800  123.35600 97.58100  1.000 49.95000  ? 625 HIS C NE2   1 
ATOM   8333  N  N     . LEU C 1 381 ? 97.73600  119.65500 102.62700 1.000 45.71000  ? 626 LEU C N     1 
ATOM   8334  C  CA    . LEU C 1 381 ? 97.46400  119.10400 103.94500 1.000 45.71000  ? 626 LEU C CA    1 
ATOM   8335  C  C     . LEU C 1 381 ? 97.24700  120.22700 104.94700 1.000 45.71000  ? 626 LEU C C     1 
ATOM   8336  O  O     . LEU C 1 381 ? 97.90400  121.26900 104.87800 1.000 45.71000  ? 626 LEU C O     1 
ATOM   8337  C  CB    . LEU C 1 381 ? 98.62000  118.22300 104.42400 1.000 45.71000  ? 626 LEU C CB    1 
ATOM   8338  C  CG    . LEU C 1 381 ? 98.90500  116.91900 103.68500 1.000 45.71000  ? 626 LEU C CG    1 
ATOM   8339  C  CD1   . LEU C 1 381 ? 100.18600 116.30400 104.20500 1.000 45.71000  ? 626 LEU C CD1   1 
ATOM   8340  C  CD2   . LEU C 1 381 ? 97.75300  115.95500 103.85500 1.000 45.71000  ? 626 LEU C CD2   1 
ATOM   8341  N  N     . ILE C 1 382 ? 96.33000  120.00100 105.88300 1.000 41.71000  ? 627 ILE C N     1 
ATOM   8342  C  CA    . ILE C 1 382 ? 96.14700  120.86900 107.04600 1.000 41.71000  ? 627 ILE C CA    1 
ATOM   8343  C  C     . ILE C 1 382 ? 96.22200  119.94700 108.26000 1.000 41.71000  ? 627 ILE C C     1 
ATOM   8344  O  O     . ILE C 1 382 ? 95.21400  119.38500 108.69700 1.000 41.71000  ? 627 ILE C O     1 
ATOM   8345  C  CB    . ILE C 1 382 ? 94.82000  121.63400 107.01600 1.000 41.71000  ? 627 ILE C CB    1 
ATOM   8346  C  CG1   . ILE C 1 382 ? 94.70100  122.47700 105.74600 1.000 41.71000  ? 627 ILE C CG1   1 
ATOM   8347  C  CG2   . ILE C 1 382 ? 94.69300  122.52000 108.24300 1.000 41.71000  ? 627 ILE C CG2   1 
ATOM   8348  C  CD1   . ILE C 1 382 ? 95.73600  123.56000 105.62900 1.000 41.71000  ? 627 ILE C CD1   1 
ATOM   8349  N  N     . LEU C 1 383 ? 97.41800  119.78900 108.81700 1.000 41.31000  ? 628 LEU C N     1 
ATOM   8350  C  CA    . LEU C 1 383 ? 97.64800  118.86900 109.92700 1.000 41.31000  ? 628 LEU C CA    1 
ATOM   8351  C  C     . LEU C 1 383 ? 97.58000  119.66400 111.22400 1.000 41.31000  ? 628 LEU C C     1 
ATOM   8352  O  O     . LEU C 1 383 ? 98.53200  120.35500 111.59000 1.000 41.31000  ? 628 LEU C O     1 
ATOM   8353  C  CB    . LEU C 1 383 ? 98.98800  118.16100 109.77400 1.000 41.31000  ? 628 LEU C CB    1 
ATOM   8354  C  CG    . LEU C 1 383 ? 99.11500  117.26900 108.54200 1.000 41.31000  ? 628 LEU C CG    1 
ATOM   8355  C  CD1   . LEU C 1 383 ? 100.49900 116.66100 108.46900 1.000 41.31000  ? 628 LEU C CD1   1 
ATOM   8356  C  CD2   . LEU C 1 383 ? 98.05600  116.18800 108.54500 1.000 41.31000  ? 628 LEU C CD2   1 
ATOM   8357  N  N     . ALA C 1 384 ? 96.45700  119.55900 111.92300 1.000 39.60000  ? 629 ALA C N     1 
ATOM   8358  C  CA    . ALA C 1 384 ? 96.20700  120.33600 113.13300 1.000 39.60000  ? 629 ALA C CA    1 
ATOM   8359  C  C     . ALA C 1 384 ? 96.39200  119.42200 114.33900 1.000 39.60000  ? 629 ALA C C     1 
ATOM   8360  O  O     . ALA C 1 384 ? 95.46800  118.72600 114.75400 1.000 39.60000  ? 629 ALA C O     1 
ATOM   8361  C  CB    . ALA C 1 384 ? 94.81500  120.94800 113.10500 1.000 39.60000  ? 629 ALA C CB    1 
ATOM   8362  N  N     . THR C 1 385 ? 97.59300  119.43800 114.90500 1.000 41.74000  ? 630 THR C N     1 
ATOM   8363  C  CA    . THR C 1 385 ? 97.93700  118.62400 116.05600 1.000 41.74000  ? 630 THR C CA    1 
ATOM   8364  C  C     . THR C 1 385 ? 97.78600  119.44200 117.33500 1.000 41.74000  ? 630 THR C C     1 
ATOM   8365  O  O     . THR C 1 385 ? 97.28300  120.56700 117.32600 1.000 41.74000  ? 630 THR C O     1 
ATOM   8366  C  CB    . THR C 1 385 ? 99.35900  118.08900 115.91200 1.000 41.74000  ? 630 THR C CB    1 
ATOM   8367  O  OG1   . THR C 1 385 ? 100.28000 119.18600 115.93400 1.000 41.74000  ? 630 THR C OG1   1 
ATOM   8368  C  CG2   . THR C 1 385 ? 99.51000  117.35900 114.60000 1.000 41.74000  ? 630 THR C CG2   1 
ATOM   8369  N  N     . GLN C 1 386 ? 98.22600  118.87100 118.45700 1.000 41.93000  ? 631 GLN C N     1 
ATOM   8370  C  CA    . GLN C 1 386 ? 98.39000  119.62600 119.68800 1.000 41.93000  ? 631 GLN C CA    1 
ATOM   8371  C  C     . GLN C 1 386 ? 99.83900  119.80400 120.09700 1.000 41.93000  ? 631 GLN C C     1 
ATOM   8372  O  O     . GLN C 1 386 ? 100.14800 120.77000 120.80200 1.000 41.93000  ? 631 GLN C O     1 
ATOM   8373  C  CB    . GLN C 1 386 ? 97.64100  118.95600 120.84900 1.000 41.93000  ? 631 GLN C CB    1 
ATOM   8374  C  CG    . GLN C 1 386 ? 96.14000  118.98400 120.72100 1.000 41.93000  ? 631 GLN C CG    1 
ATOM   8375  C  CD    . GLN C 1 386 ? 95.45900  118.35500 121.91200 1.000 41.93000  ? 631 GLN C CD    1 
ATOM   8376  O  OE1   . GLN C 1 386 ? 96.11800  117.85700 122.82400 1.000 41.93000  ? 631 GLN C OE1   1 
ATOM   8377  N  NE2   . GLN C 1 386 ? 94.13300  118.37100 121.91400 1.000 41.93000  ? 631 GLN C NE2   1 
ATOM   8378  N  N     . ARG C 1 387 ? 100.72500 118.90600 119.69200 1.000 46.65000  ? 632 ARG C N     1 
ATOM   8379  C  CA    . ARG C 1 387 ? 102.14900 119.05900 119.93300 1.000 46.65000  ? 632 ARG C CA    1 
ATOM   8380  C  C     . ARG C 1 387 ? 102.90300 118.27400 118.87000 1.000 46.65000  ? 632 ARG C C     1 
ATOM   8381  O  O     . ARG C 1 387 ? 102.83700 117.03900 118.84500 1.000 46.65000  ? 632 ARG C O     1 
ATOM   8382  C  CB    . ARG C 1 387 ? 102.50100 118.58400 121.34200 1.000 46.65000  ? 632 ARG C CB    1 
ATOM   8383  C  CG    . ARG C 1 387 ? 103.94400 118.79500 121.74500 1.000 46.65000  ? 632 ARG C CG    1 
ATOM   8384  C  CD    . ARG C 1 387 ? 104.13700 118.42800 123.20400 1.000 46.65000  ? 632 ARG C CD    1 
ATOM   8385  N  NE    . ARG C 1 387 ? 105.50900 118.63200 123.65100 1.000 46.65000  ? 632 ARG C NE    1 
ATOM   8386  C  CZ    . ARG C 1 387 ? 106.44100 117.68700 123.64000 1.000 46.65000  ? 632 ARG C CZ    1 
ATOM   8387  N  NH1   . ARG C 1 387 ? 106.14300 116.46800 123.21700 1.000 46.65000  ? 632 ARG C NH1   1 
ATOM   8388  N  NH2   . ARG C 1 387 ? 107.66800 117.95700 124.06400 1.000 46.65000  ? 632 ARG C NH2   1 
ATOM   8389  N  N     . PRO C 1 388 ? 103.62000 118.94400 117.97800 1.000 47.48000  ? 633 PRO C N     1 
ATOM   8390  C  CA    . PRO C 1 388 ? 104.29400 118.23400 116.88500 1.000 47.48000  ? 633 PRO C CA    1 
ATOM   8391  C  C     . PRO C 1 388 ? 105.56300 117.52500 117.31800 1.000 47.48000  ? 633 PRO C C     1 
ATOM   8392  O  O     . PRO C 1 388 ? 106.61000 117.68900 116.68400 1.000 47.48000  ? 633 PRO C O     1 
ATOM   8393  C  CB    . PRO C 1 388 ? 104.61000 119.35200 115.88400 1.000 47.48000  ? 633 PRO C CB    1 
ATOM   8394  C  CG    . PRO C 1 388 ? 103.67000 120.44500 116.22200 1.000 47.48000  ? 633 PRO C CG    1 
ATOM   8395  C  CD    . PRO C 1 388 ? 103.51600 120.38200 117.70800 1.000 47.48000  ? 633 PRO C CD    1 
ATOM   8396  N  N     . SER C 1 389 ? 105.49200 116.73700 118.38400 1.000 56.32000  ? 634 SER C N     1 
ATOM   8397  C  CA    . SER C 1 389 ? 106.64400 115.95100 118.78600 1.000 56.32000  ? 634 SER C CA    1 
ATOM   8398  C  C     . SER C 1 389 ? 106.85500 114.79600 117.81400 1.000 56.32000  ? 634 SER C C     1 
ATOM   8399  O  O     . SER C 1 389 ? 105.97200 114.43900 117.02900 1.000 56.32000  ? 634 SER C O     1 
ATOM   8400  C  CB    . SER C 1 389 ? 106.46500 115.42500 120.20600 1.000 56.32000  ? 634 SER C CB    1 
ATOM   8401  O  OG    . SER C 1 389 ? 105.36600 114.53700 120.28000 1.000 56.32000  ? 634 SER C OG    1 
ATOM   8402  N  N     . VAL C 1 390 ? 108.05100 114.20800 117.87400 1.000 62.50000  ? 635 VAL C N     1 
ATOM   8403  C  CA    . VAL C 1 390 ? 108.42600 113.18100 116.90700 1.000 62.50000  ? 635 VAL C CA    1 
ATOM   8404  C  C     . VAL C 1 390 ? 107.55300 111.94200 117.04400 1.000 62.50000  ? 635 VAL C C     1 
ATOM   8405  O  O     . VAL C 1 390 ? 107.25700 111.27100 116.04800 1.000 62.50000  ? 635 VAL C O     1 
ATOM   8406  C  CB    . VAL C 1 390 ? 109.92200 112.85200 117.05100 1.000 62.50000  ? 635 VAL C CB    1 
ATOM   8407  C  CG1   . VAL C 1 390 ? 110.30200 111.66500 116.18500 1.000 62.50000  ? 635 VAL C CG1   1 
ATOM   8408  C  CG2   . VAL C 1 390 ? 110.74000 114.06100 116.65800 1.000 62.50000  ? 635 VAL C CG2   1 
ATOM   8409  N  N     . ASP C 1 391 ? 107.11500 111.62200 118.26400 1.000 56.92000  ? 636 ASP C N     1 
ATOM   8410  C  CA    . ASP C 1 391 ? 106.25000 110.46200 118.45300 1.000 56.92000  ? 636 ASP C CA    1 
ATOM   8411  C  C     . ASP C 1 391 ? 104.97200 110.58000 117.63000 1.000 56.92000  ? 636 ASP C C     1 
ATOM   8412  O  O     . ASP C 1 391 ? 104.48200 109.58400 117.08400 1.000 56.92000  ? 636 ASP C O     1 
ATOM   8413  C  CB    . ASP C 1 391 ? 105.92500 110.28300 119.93500 1.000 56.92000  ? 636 ASP C CB    1 
ATOM   8414  C  CG    . ASP C 1 391 ? 105.20200 111.47800 120.52400 1.000 56.92000  ? 636 ASP C CG    1 
ATOM   8415  O  OD1   . ASP C 1 391 ? 105.01600 112.48200 119.80700 1.000 56.92000  ? 636 ASP C OD1   1 
ATOM   8416  O  OD2   . ASP C 1 391 ? 104.81400 111.41100 121.70700 1.000 56.92000  ? 636 ASP C OD2   1 
ATOM   8417  N  N     . VAL C 1 392 ? 104.42100 111.78600 117.52400 1.000 57.79000  ? 637 VAL C N     1 
ATOM   8418  C  CA    . VAL C 1 392 ? 103.18900 111.98800 116.76900 1.000 57.79000  ? 637 VAL C CA    1 
ATOM   8419  C  C     . VAL C 1 392 ? 103.47700 112.28800 115.30300 1.000 57.79000  ? 637 VAL C C     1 
ATOM   8420  O  O     . VAL C 1 392 ? 102.83300 111.72700 114.41500 1.000 57.79000  ? 637 VAL C O     1 
ATOM   8421  C  CB    . VAL C 1 392 ? 102.34900 113.10300 117.42300 1.000 57.79000  ? 637 VAL C CB    1 
ATOM   8422  C  CG1   . VAL C 1 392 ? 101.10000 113.36700 116.61200 1.000 57.79000  ? 637 VAL C CG1   1 
ATOM   8423  C  CG2   . VAL C 1 392 ? 101.98100 112.72300 118.84600 1.000 57.79000  ? 637 VAL C CG2   1 
ATOM   8424  N  N     . ILE C 1 393 ? 104.44300 113.16000 115.02200 1.000 56.14000  ? 638 ILE C N     1 
ATOM   8425  C  CA    . ILE C 1 393 ? 104.83000 113.50500 113.65600 1.000 56.14000  ? 638 ILE C CA    1 
ATOM   8426  C  C     . ILE C 1 393 ? 106.29800 113.13400 113.50600 1.000 56.14000  ? 638 ILE C C     1 
ATOM   8427  O  O     . ILE C 1 393 ? 107.17200 113.79300 114.07900 1.000 56.14000  ? 638 ILE C O     1 
ATOM   8428  C  CB    . ILE C 1 393 ? 104.61200 114.98500 113.32800 1.000 56.14000  ? 638 ILE C CB    1 
ATOM   8429  C  CG1   . ILE C 1 393 ? 103.13700 115.35600 113.41800 1.000 56.14000  ? 638 ILE C CG1   1 
ATOM   8430  C  CG2   . ILE C 1 393 ? 105.11800 115.29200 111.93800 1.000 56.14000  ? 638 ILE C CG2   1 
ATOM   8431  C  CD1   . ILE C 1 393 ? 102.73100 115.87000 114.76000 1.000 56.14000  ? 638 ILE C CD1   1 
ATOM   8432  N  N     . THR C 1 394 ? 106.57600 112.08900 112.73300 1.000 60.85000  ? 639 THR C N     1 
ATOM   8433  C  CA    . THR C 1 394 ? 107.95500 111.72000 112.45000 1.000 60.85000  ? 639 THR C CA    1 
ATOM   8434  C  C     . THR C 1 394 ? 108.68600 112.88400 111.79200 1.000 60.85000  ? 639 THR C C     1 
ATOM   8435  O  O     . THR C 1 394 ? 108.11000 113.64500 111.01200 1.000 60.85000  ? 639 THR C O     1 
ATOM   8436  C  CB    . THR C 1 394 ? 108.00200 110.49200 111.54600 1.000 60.85000  ? 639 THR C CB    1 
ATOM   8437  O  OG1   . THR C 1 394 ? 107.36900 110.79700 110.29700 1.000 60.85000  ? 639 THR C OG1   1 
ATOM   8438  C  CG2   . THR C 1 394 ? 107.27400 109.32900 112.20200 1.000 60.85000  ? 639 THR C CG2   1 
ATOM   8439  N  N     . GLY C 1 395 ? 109.97100 113.02400 112.13100 1.000 59.63000  ? 640 GLY C N     1 
ATOM   8440  C  CA    . GLY C 1 395 ? 110.75500 114.14000 111.62300 1.000 59.63000  ? 640 GLY C CA    1 
ATOM   8441  C  C     . GLY C 1 395 ? 110.72100 114.27500 110.11400 1.000 59.63000  ? 640 GLY C C     1 
ATOM   8442  O  O     . GLY C 1 395 ? 110.84000 115.38300 109.58200 1.000 59.63000  ? 640 GLY C O     1 
ATOM   8443  N  N     . LEU C 1 396 ? 110.54100 113.15900 109.40200 1.000 63.21000  ? 641 LEU C N     1 
ATOM   8444  C  CA    . LEU C 1 396 ? 110.43200 113.21500 107.94900 1.000 63.21000  ? 641 LEU C CA    1 
ATOM   8445  C  C     . LEU C 1 396 ? 109.19800 113.99400 107.51400 1.000 63.21000  ? 641 LEU C C     1 
ATOM   8446  O  O     . LEU C 1 396 ? 109.24900 114.76200 106.54700 1.000 63.21000  ? 641 LEU C O     1 
ATOM   8447  C  CB    . LEU C 1 396 ? 110.39900 111.80000 107.37600 1.000 63.21000  ? 641 LEU C CB    1 
ATOM   8448  C  CG    . LEU C 1 396 ? 110.25200 111.69200 105.86000 1.000 63.21000  ? 641 LEU C CG    1 
ATOM   8449  C  CD1   . LEU C 1 396 ? 111.42400 112.35700 105.16400 1.000 63.21000  ? 641 LEU C CD1   1 
ATOM   8450  C  CD2   . LEU C 1 396 ? 110.12700 110.23400 105.44800 1.000 63.21000  ? 641 LEU C CD2   1 
ATOM   8451  N  N     . ILE C 1 397 ? 108.07800 113.80700 108.21100 1.000 55.93000  ? 642 ILE C N     1 
ATOM   8452  C  CA    . ILE C 1 397 ? 106.86100 114.53500 107.87000 1.000 55.93000  ? 642 ILE C CA    1 
ATOM   8453  C  C     . ILE C 1 397 ? 107.00100 116.00500 108.24200 1.000 55.93000  ? 642 ILE C C     1 
ATOM   8454  O  O     . ILE C 1 397 ? 106.70400 116.89700 107.44100 1.000 55.93000  ? 642 ILE C O     1 
ATOM   8455  C  CB    . ILE C 1 397 ? 105.64200 113.89500 108.55500 1.000 55.93000  ? 642 ILE C CB    1 
ATOM   8456  C  CG1   . ILE C 1 397 ? 105.45100 112.45700 108.07300 1.000 55.93000  ? 642 ILE C CG1   1 
ATOM   8457  C  CG2   . ILE C 1 397 ? 104.39400 114.71400 108.28900 1.000 55.93000  ? 642 ILE C CG2   1 
ATOM   8458  C  CD1   . ILE C 1 397 ? 104.44900 111.67000 108.88800 1.000 55.93000  ? 642 ILE C CD1   1 
ATOM   8459  N  N     . LYS C 1 398 ? 107.46100 116.27700 109.46300 1.000 51.67000  ? 643 LYS C N     1 
ATOM   8460  C  CA    . LYS C 1 398 ? 107.56200 117.64100 109.96200 1.000 51.67000  ? 643 LYS C CA    1 
ATOM   8461  C  C     . LYS C 1 398 ? 108.66700 118.43900 109.27900 1.000 51.67000  ? 643 LYS C C     1 
ATOM   8462  O  O     . LYS C 1 398 ? 108.68500 119.66700 109.39900 1.000 51.67000  ? 643 LYS C O     1 
ATOM   8463  C  CB    . LYS C 1 398 ? 107.77900 117.60000 111.47800 1.000 51.67000  ? 643 LYS C CB    1 
ATOM   8464  C  CG    . LYS C 1 398 ? 107.74500 118.93900 112.18500 1.000 51.67000  ? 643 LYS C CG    1 
ATOM   8465  C  CD    . LYS C 1 398 ? 107.77300 118.75500 113.69300 1.000 51.67000  ? 643 LYS C CD    1 
ATOM   8466  C  CE    . LYS C 1 398 ? 109.14100 118.30700 114.17000 1.000 51.67000  ? 643 LYS C CE    1 
ATOM   8467  N  NZ    . LYS C 1 398 ? 109.20600 118.23000 115.65400 1.000 51.67000  ? 643 LYS C NZ    1 
ATOM   8468  N  N     . ALA C 1 399 ? 109.56600 117.78800 108.54400 1.000 55.44000  ? 644 ALA C N     1 
ATOM   8469  C  CA    . ALA C 1 399 ? 110.61600 118.50900 107.83800 1.000 55.44000  ? 644 ALA C CA    1 
ATOM   8470  C  C     . ALA C 1 399 ? 110.19000 118.98300 106.45700 1.000 55.44000  ? 644 ALA C C     1 
ATOM   8471  O  O     . ALA C 1 399 ? 110.87000 119.83400 105.87200 1.000 55.44000  ? 644 ALA C O     1 
ATOM   8472  C  CB    . ALA C 1 399 ? 111.86300 117.63400 107.70500 1.000 55.44000  ? 644 ALA C CB    1 
ATOM   8473  N  N     . ASN C 1 400 ? 109.09300 118.45400 105.92200 1.000 54.21000  ? 645 ASN C N     1 
ATOM   8474  C  CA    . ASN C 1 400 ? 108.57400 118.86600 104.62600 1.000 54.21000  ? 645 ASN C CA    1 
ATOM   8475  C  C     . ASN C 1 400 ? 107.38500 119.80800 104.73900 1.000 54.21000  ? 645 ASN C C     1 
ATOM   8476  O  O     . ASN C 1 400 ? 106.83800 120.21900 103.71200 1.000 54.21000  ? 645 ASN C O     1 
ATOM   8477  C  CB    . ASN C 1 400 ? 108.18500 117.64000 103.79800 1.000 54.21000  ? 645 ASN C CB    1 
ATOM   8478  C  CG    . ASN C 1 400 ? 109.37900 116.78100 103.43900 1.000 54.21000  ? 645 ASN C CG    1 
ATOM   8479  O  OD1   . ASN C 1 400 ? 109.49000 115.63700 103.87700 1.000 54.21000  ? 645 ASN C OD1   1 
ATOM   8480  N  ND2   . ASN C 1 400 ? 110.28100 117.33100 102.63500 1.000 54.21000  ? 645 ASN C ND2   1 
ATOM   8481  N  N     . ILE C 1 401 ? 106.96800 120.15100 105.95400 1.000 46.79000  ? 646 ILE C N     1 
ATOM   8482  C  CA    . ILE C 1 401 ? 105.89400 121.11500 106.17300 1.000 46.79000  ? 646 ILE C CA    1 
ATOM   8483  C  C     . ILE C 1 401 ? 106.51900 122.36400 106.78000 1.000 46.79000  ? 646 ILE C C     1 
ATOM   8484  O  O     . ILE C 1 401 ? 106.57800 122.49400 108.01100 1.000 46.79000  ? 646 ILE C O     1 
ATOM   8485  C  CB    . ILE C 1 401 ? 104.79500 120.52900 107.07100 1.000 46.79000  ? 646 ILE C CB    1 
ATOM   8486  C  CG1   . ILE C 1 401 ? 104.19700 119.28600 106.42400 1.000 46.79000  ? 646 ILE C CG1   1 
ATOM   8487  C  CG2   . ILE C 1 401 ? 103.69400 121.54200 107.31200 1.000 46.79000  ? 646 ILE C CG2   1 
ATOM   8488  C  CD1   . ILE C 1 401 ? 103.29000 118.52400 107.33800 1.000 46.79000  ? 646 ILE C CD1   1 
ATOM   8489  N  N     . PRO C 1 402 ? 107.01600 123.29900 105.96500 1.000 48.31000  ? 647 PRO C N     1 
ATOM   8490  C  CA    . PRO C 1 402 ? 107.78000 124.42500 106.51600 1.000 48.31000  ? 647 PRO C CA    1 
ATOM   8491  C  C     . PRO C 1 402 ? 106.92800 125.58200 107.00100 1.000 48.31000  ? 647 PRO C C     1 
ATOM   8492  O  O     . PRO C 1 402 ? 107.47500 126.51000 107.61000 1.000 48.31000  ? 647 PRO C O     1 
ATOM   8493  C  CB    . PRO C 1 402 ? 108.64700 124.85800 105.33200 1.000 48.31000  ? 647 PRO C CB    1 
ATOM   8494  C  CG    . PRO C 1 402 ? 107.80800 124.53200 104.15000 1.000 48.31000  ? 647 PRO C CG    1 
ATOM   8495  C  CD    . PRO C 1 402 ? 107.04900 123.28100 104.49300 1.000 48.31000  ? 647 PRO C CD    1 
ATOM   8496  N  N     . THR C 1 403 ? 105.62100 125.56700 106.75400 1.000 45.11000  ? 648 THR C N     1 
ATOM   8497  C  CA    . THR C 1 403 ? 104.73700 126.66700 107.12300 1.000 45.11000  ? 648 THR C CA    1 
ATOM   8498  C  C     . THR C 1 403 ? 103.86500 126.21700 108.28400 1.000 45.11000  ? 648 THR C C     1 
ATOM   8499  O  O     . THR C 1 403 ? 102.98700 125.36600 108.11100 1.000 45.11000  ? 648 THR C O     1 
ATOM   8500  C  CB    . THR C 1 403 ? 103.87400 127.09700 105.94600 1.000 45.11000  ? 648 THR C CB    1 
ATOM   8501  O  OG1   . THR C 1 403 ? 104.71600 127.46700 104.85200 1.000 45.11000  ? 648 THR C OG1   1 
ATOM   8502  C  CG2   . THR C 1 403 ? 103.04400 128.28500 106.34600 1.000 45.11000  ? 648 THR C CG2   1 
ATOM   8503  N  N     . ARG C 1 404 ? 104.09600 126.79200 109.45700 1.000 41.87000  ? 649 ARG C N     1 
ATOM   8504  C  CA    . ARG C 1 404 ? 103.44700 126.33000 110.67000 1.000 41.87000  ? 649 ARG C CA    1 
ATOM   8505  C  C     . ARG C 1 404 ? 102.76100 127.49300 111.37000 1.000 41.87000  ? 649 ARG C C     1 
ATOM   8506  O  O     . ARG C 1 404 ? 103.10300 128.65900 111.16300 1.000 41.87000  ? 649 ARG C O     1 
ATOM   8507  C  CB    . ARG C 1 404 ? 104.45600 125.66900 111.60600 1.000 41.87000  ? 649 ARG C CB    1 
ATOM   8508  C  CG    . ARG C 1 404 ? 105.13900 124.46300 110.99100 1.000 41.87000  ? 649 ARG C CG    1 
ATOM   8509  C  CD    . ARG C 1 404 ? 106.06100 123.80800 111.98200 1.000 41.87000  ? 649 ARG C CD    1 
ATOM   8510  N  NE    . ARG C 1 404 ? 106.79500 122.68800 111.41000 1.000 41.87000  ? 649 ARG C NE    1 
ATOM   8511  C  CZ    . ARG C 1 404 ? 107.99900 122.80000 110.86500 1.000 41.87000  ? 649 ARG C CZ    1 
ATOM   8512  N  NH1   . ARG C 1 404 ? 108.59700 123.98200 110.82500 1.000 41.87000  ? 649 ARG C NH1   1 
ATOM   8513  N  NH2   . ARG C 1 404 ? 108.60700 121.73600 110.36400 1.000 41.87000  ? 649 ARG C NH2   1 
ATOM   8514  N  N     . ILE C 1 405 ? 101.78000 127.15600 112.20400 1.000 36.19000  ? 650 ILE C N     1 
ATOM   8515  C  CA    . ILE C 1 405 ? 101.00900 128.13500 112.96200 1.000 36.19000  ? 650 ILE C CA    1 
ATOM   8516  C  C     . ILE C 1 405 ? 100.89600 127.64000 114.39700 1.000 36.19000  ? 650 ILE C C     1 
ATOM   8517  O  O     . ILE C 1 405 ? 100.36300 126.55200 114.63800 1.000 36.19000  ? 650 ILE C O     1 
ATOM   8518  C  CB    . ILE C 1 405 ? 99.60800  128.35800 112.37000 1.000 36.19000  ? 650 ILE C CB    1 
ATOM   8519  C  CG1   . ILE C 1 405 ? 99.70100  128.98100 110.98000 1.000 36.19000  ? 650 ILE C CG1   1 
ATOM   8520  C  CG2   . ILE C 1 405 ? 98.78800  129.23100 113.27800 1.000 36.19000  ? 650 ILE C CG2   1 
ATOM   8521  C  CD1   . ILE C 1 405 ? 98.38400  129.02000 110.25800 1.000 36.19000  ? 650 ILE C CD1   1 
ATOM   8522  N  N     . ALA C 1 406 ? 101.38500 128.43200 115.34600 1.000 32.35000  ? 651 ALA C N     1 
ATOM   8523  C  CA    . ALA C 1 406 ? 101.39300 128.05700 116.75300 1.000 32.35000  ? 651 ALA C CA    1 
ATOM   8524  C  C     . ALA C 1 406 ? 100.34700 128.86000 117.51100 1.000 32.35000  ? 651 ALA C C     1 
ATOM   8525  O  O     . ALA C 1 406 ? 100.27900 130.08400 117.37200 1.000 32.35000  ? 651 ALA C O     1 
ATOM   8526  C  CB    . ALA C 1 406 ? 102.77300 128.27900 117.37400 1.000 32.35000  ? 651 ALA C CB    1 
ATOM   8527  N  N     . PHE C 1 407 ? 99.54800  128.16900 118.31900 1.000 33.62000  ? 652 PHE C N     1 
ATOM   8528  C  CA    . PHE C 1 407 ? 98.49000  128.76900 119.13000 1.000 33.62000  ? 652 PHE C CA    1 
ATOM   8529  C  C     . PHE C 1 407 ? 98.81200  128.55200 120.60700 1.000 33.62000  ? 652 PHE C C     1 
ATOM   8530  O  O     . PHE C 1 407 ? 98.44000  127.52200 121.17200 1.000 33.62000  ? 652 PHE C O     1 
ATOM   8531  C  CB    . PHE C 1 407 ? 97.12500  128.16400 118.80200 1.000 33.62000  ? 652 PHE C CB    1 
ATOM   8532  C  CG    . PHE C 1 407 ? 96.57800  128.54500 117.46000 1.000 33.62000  ? 652 PHE C CG    1 
ATOM   8533  C  CD1   . PHE C 1 407 ? 95.92000  129.74500 117.28200 1.000 33.62000  ? 652 PHE C CD1   1 
ATOM   8534  C  CD2   . PHE C 1 407 ? 96.68100  127.68200 116.38900 1.000 33.62000  ? 652 PHE C CD2   1 
ATOM   8535  C  CE1   . PHE C 1 407 ? 95.39900  130.08700 116.05300 1.000 33.62000  ? 652 PHE C CE1   1 
ATOM   8536  C  CE2   . PHE C 1 407 ? 96.16100  128.02100 115.16300 1.000 33.62000  ? 652 PHE C CE2   1 
ATOM   8537  C  CZ    . PHE C 1 407 ? 95.52100  129.22300 114.99400 1.000 33.62000  ? 652 PHE C CZ    1 
ATOM   8538  N  N     . GLN C 1 408 ? 99.49100  129.51500 121.22500 1.000 35.02000  ? 653 GLN C N     1 
ATOM   8539  C  CA    . GLN C 1 408 ? 99.62700  129.59000 122.68200 1.000 35.02000  ? 653 GLN C CA    1 
ATOM   8540  C  C     . GLN C 1 408 ? 100.08400 128.26200 123.29200 1.000 35.02000  ? 653 GLN C C     1 
ATOM   8541  O  O     . GLN C 1 408 ? 99.33400  127.57900 123.98700 1.000 35.02000  ? 653 GLN C O     1 
ATOM   8542  C  CB    . GLN C 1 408 ? 98.31700  129.99800 123.35600 1.000 35.02000  ? 653 GLN C CB    1 
ATOM   8543  C  CG    . GLN C 1 408 ? 98.51500  130.34200 124.82800 1.000 35.02000  ? 653 GLN C CG    1 
ATOM   8544  C  CD    . GLN C 1 408 ? 97.23400  130.32500 125.62000 1.000 35.02000  ? 653 GLN C CD    1 
ATOM   8545  O  OE1   . GLN C 1 408 ? 96.20500  129.86600 125.13800 1.000 35.02000  ? 653 GLN C OE1   1 
ATOM   8546  N  NE2   . GLN C 1 408 ? 97.28100  130.84900 126.83400 1.000 35.02000  ? 653 GLN C NE2   1 
ATOM   8547  N  N     . VAL C 1 409 ? 101.32000 127.87800 122.99300 1.000 35.11000  ? 654 VAL C N     1 
ATOM   8548  C  CA    . VAL C 1 409 ? 101.88000 126.73900 123.70400 1.000 35.11000  ? 654 VAL C CA    1 
ATOM   8549  C  C     . VAL C 1 409 ? 102.23500 127.16000 125.12200 1.000 35.11000  ? 654 VAL C C     1 
ATOM   8550  O  O     . VAL C 1 409 ? 102.66600 128.29500 125.36500 1.000 35.11000  ? 654 VAL C O     1 
ATOM   8551  C  CB    . VAL C 1 409 ? 103.09800 126.17400 122.96300 1.000 35.11000  ? 654 VAL C CB    1 
ATOM   8552  C  CG1   . VAL C 1 409 ? 102.65800 125.57100 121.67100 1.000 35.11000  ? 654 VAL C CG1   1 
ATOM   8553  C  CG2   . VAL C 1 409 ? 104.10400 127.26800 122.70800 1.000 35.11000  ? 654 VAL C CG2   1 
ATOM   8554  N  N     . SER C 1 410 ? 102.04400 126.24600 126.07300 1.000 33.86000  ? 655 SER C N     1 
ATOM   8555  C  CA    . SER C 1 410 ? 102.17400 126.60500 127.48000 1.000 33.86000  ? 655 SER C CA    1 
ATOM   8556  C  C     . SER C 1 410 ? 103.62900 126.84400 127.85600 1.000 33.86000  ? 655 SER C C     1 
ATOM   8557  O  O     . SER C 1 410 ? 104.00400 127.94100 128.28400 1.000 33.86000  ? 655 SER C O     1 
ATOM   8558  C  CB    . SER C 1 410 ? 101.56300 125.51100 128.35300 1.000 33.86000  ? 655 SER C CB    1 
ATOM   8559  O  OG    . SER C 1 410 ? 100.18000 125.37600 128.09000 1.000 33.86000  ? 655 SER C OG    1 
ATOM   8560  N  N     . SER C 1 411 ? 104.46600 125.82700 127.70400 1.000 42.37000  ? 656 SER C N     1 
ATOM   8561  C  CA    . SER C 1 411 ? 105.87900 125.95500 128.02000 1.000 42.37000  ? 656 SER C CA    1 
ATOM   8562  C  C     . SER C 1 411 ? 106.59900 126.59000 126.83300 1.000 42.37000  ? 656 SER C C     1 
ATOM   8563  O  O     . SER C 1 411 ? 105.97700 127.04400 125.87000 1.000 42.37000  ? 656 SER C O     1 
ATOM   8564  C  CB    . SER C 1 411 ? 106.45400 124.59500 128.40400 1.000 42.37000  ? 656 SER C CB    1 
ATOM   8565  O  OG    . SER C 1 411 ? 106.39700 123.69200 127.31400 1.000 42.37000  ? 656 SER C OG    1 
ATOM   8566  N  N     . LYS C 1 412 ? 107.92700 126.63500 126.88900 1.000 47.34000  ? 657 LYS C N     1 
ATOM   8567  C  CA    . LYS C 1 412 ? 108.71100 127.16200 125.78100 1.000 47.34000  ? 657 LYS C CA    1 
ATOM   8568  C  C     . LYS C 1 412 ? 109.26700 126.07300 124.88100 1.000 47.34000  ? 657 LYS C C     1 
ATOM   8569  O  O     . LYS C 1 412 ? 109.52400 126.33200 123.70200 1.000 47.34000  ? 657 LYS C O     1 
ATOM   8570  C  CB    . LYS C 1 412 ? 109.85900 128.02900 126.31000 1.000 47.34000  ? 657 LYS C CB    1 
ATOM   8571  C  CG    . LYS C 1 412 ? 110.67900 128.72200 125.23500 1.000 47.34000  ? 657 LYS C CG    1 
ATOM   8572  C  CD    . LYS C 1 412 ? 111.61300 129.76300 125.83700 1.000 47.34000  ? 657 LYS C CD    1 
ATOM   8573  C  CE    . LYS C 1 412 ? 112.76100 129.11800 126.59100 1.000 47.34000  ? 657 LYS C CE    1 
ATOM   8574  N  NZ    . LYS C 1 412 ? 113.73600 130.12700 127.09200 1.000 47.34000  ? 657 LYS C NZ    1 
ATOM   8575  N  N     . ILE C 1 413 ? 109.44300 124.85700 125.40000 1.000 46.95000  ? 658 ILE C N     1 
ATOM   8576  C  CA    . ILE C 1 413 ? 109.92300 123.76800 124.55900 1.000 46.95000  ? 658 ILE C CA    1 
ATOM   8577  C  C     . ILE C 1 413 ? 108.87800 123.41200 123.51000 1.000 46.95000  ? 658 ILE C C     1 
ATOM   8578  O  O     . ILE C 1 413 ? 109.21800 122.98200 122.40200 1.000 46.95000  ? 658 ILE C O     1 
ATOM   8579  C  CB    . ILE C 1 413 ? 110.30100 122.54400 125.41400 1.000 46.95000  ? 658 ILE C CB    1 
ATOM   8580  C  CG1   . ILE C 1 413 ? 111.41900 122.89400 126.39300 1.000 46.95000  ? 658 ILE C CG1   1 
ATOM   8581  C  CG2   . ILE C 1 413 ? 110.76000 121.40100 124.53600 1.000 46.95000  ? 658 ILE C CG2   1 
ATOM   8582  C  CD1   . ILE C 1 413 ? 110.93300 123.34500 127.74800 1.000 46.95000  ? 658 ILE C CD1   1 
ATOM   8583  N  N     . ASP C 1 414 ? 107.59700 123.59900 123.82600 1.000 43.94000  ? 659 ASP C N     1 
ATOM   8584  C  CA    . ASP C 1 414 ? 106.55500 123.33500 122.84200 1.000 43.94000  ? 659 ASP C CA    1 
ATOM   8585  C  C     . ASP C 1 414 ? 106.64800 124.31100 121.67500 1.000 43.94000  ? 659 ASP C C     1 
ATOM   8586  O  O     . ASP C 1 414 ? 106.42800 123.93100 120.51700 1.000 43.94000  ? 659 ASP C O     1 
ATOM   8587  C  CB    . ASP C 1 414 ? 105.18600 123.40800 123.50800 1.000 43.94000  ? 659 ASP C CB    1 
ATOM   8588  C  CG    . ASP C 1 414 ? 104.98700 122.32100 124.53800 1.000 43.94000  ? 659 ASP C CG    1 
ATOM   8589  O  OD1   . ASP C 1 414 ? 105.58400 121.23600 124.38000 1.000 43.94000  ? 659 ASP C OD1   1 
ATOM   8590  O  OD2   . ASP C 1 414 ? 104.24200 122.55300 125.51200 1.000 43.94000  ? 659 ASP C OD2   1 
ATOM   8591  N  N     . SER C 1 415 ? 106.96400 125.57500 121.96400 1.000 44.69000  ? 660 SER C N     1 
ATOM   8592  C  CA    . SER C 1 415 ? 107.27100 126.51900 120.89800 1.000 44.69000  ? 660 SER C CA    1 
ATOM   8593  C  C     . SER C 1 415 ? 108.45200 126.03800 120.06900 1.000 44.69000  ? 660 SER C C     1 
ATOM   8594  O  O     . SER C 1 415 ? 108.49900 126.25800 118.85400 1.000 44.69000  ? 660 SER C O     1 
ATOM   8595  C  CB    . SER C 1 415 ? 107.55800 127.89900 121.48400 1.000 44.69000  ? 660 SER C CB    1 
ATOM   8596  O  OG    . SER C 1 415 ? 107.91200 128.81600 120.46500 1.000 44.69000  ? 660 SER C OG    1 
ATOM   8597  N  N     . ARG C 1 416 ? 109.42300 125.38700 120.71000 1.000 48.53000  ? 661 ARG C N     1 
ATOM   8598  C  CA    . ARG C 1 416 ? 110.53600 124.80200 119.97500 1.000 48.53000  ? 661 ARG C CA    1 
ATOM   8599  C  C     . ARG C 1 416 ? 110.10400 123.59700 119.15500 1.000 48.53000  ? 661 ARG C C     1 
ATOM   8600  O  O     . ARG C 1 416 ? 110.80700 123.21900 118.21300 1.000 48.53000  ? 661 ARG C O     1 
ATOM   8601  C  CB    . ARG C 1 416 ? 111.64900 124.38900 120.93600 1.000 48.53000  ? 661 ARG C CB    1 
ATOM   8602  C  CG    . ARG C 1 416 ? 112.17800 125.51200 121.79600 1.000 48.53000  ? 661 ARG C CG    1 
ATOM   8603  C  CD    . ARG C 1 416 ? 112.90900 126.53500 120.96400 1.000 48.53000  ? 661 ARG C CD    1 
ATOM   8604  N  NE    . ARG C 1 416 ? 113.45100 127.60500 121.79000 1.000 48.53000  ? 661 ARG C NE    1 
ATOM   8605  C  CZ    . ARG C 1 416 ? 114.66500 127.57800 122.32400 1.000 48.53000  ? 661 ARG C CZ    1 
ATOM   8606  N  NH1   . ARG C 1 416 ? 115.44900 126.53500 122.10600 1.000 48.53000  ? 661 ARG C NH1   1 
ATOM   8607  N  NH2   . ARG C 1 416 ? 115.09700 128.58800 123.06700 1.000 48.53000  ? 661 ARG C NH2   1 
ATOM   8608  N  N     . THR C 1 417 ? 108.98300 122.97100 119.51000 1.000 44.13000  ? 662 THR C N     1 
ATOM   8609  C  CA    . THR C 1 417 ? 108.47700 121.86000 118.71500 1.000 44.13000  ? 662 THR C CA    1 
ATOM   8610  C  C     . THR C 1 417 ? 107.72600 122.35700 117.48700 1.000 44.13000  ? 662 THR C C     1 
ATOM   8611  O  O     . THR C 1 417 ? 107.96000 121.87200 116.37600 1.000 44.13000  ? 662 THR C O     1 
ATOM   8612  C  CB    . THR C 1 417 ? 107.57000 120.96000 119.55400 1.000 44.13000  ? 662 THR C CB    1 
ATOM   8613  O  OG1   . THR C 1 417 ? 106.44500 121.71300 120.02000 1.000 44.13000  ? 662 THR C OG1   1 
ATOM   8614  C  CG2   . THR C 1 417 ? 108.32700 120.39200 120.73600 1.000 44.13000  ? 662 THR C CG2   1 
ATOM   8615  N  N     . ILE C 1 418 ? 106.82000 123.32200 117.66100 1.000 40.54000  ? 663 ILE C N     1 
ATOM   8616  C  CA    . ILE C 1 418 ? 106.06400 123.80000 116.50800 1.000 40.54000  ? 663 ILE C CA    1 
ATOM   8617  C  C     . ILE C 1 418 ? 106.97300 124.69300 115.68600 1.000 40.54000  ? 663 ILE C C     1 
ATOM   8618  O  O     . ILE C 1 418 ? 107.40600 124.32800 114.59100 1.000 40.54000  ? 663 ILE C O     1 
ATOM   8619  C  CB    . ILE C 1 418 ? 104.81000 124.58900 116.91500 1.000 40.54000  ? 663 ILE C CB    1 
ATOM   8620  C  CG1   . ILE C 1 418 ? 103.90300 123.76300 117.80800 1.000 40.54000  ? 663 ILE C CG1   1 
ATOM   8621  C  CG2   . ILE C 1 418 ? 104.04600 125.01500 115.68200 1.000 40.54000  ? 663 ILE C CG2   1 
ATOM   8622  C  CD1   . ILE C 1 418 ? 102.78900 124.56700 118.38900 1.000 40.54000  ? 663 ILE C CD1   1 
ATOM   8623  N  N     . LEU C 1 419 ? 107.31400 125.84700 116.24300 1.000 42.31000  ? 664 LEU C N     1 
ATOM   8624  C  CA    . LEU C 1 419 ? 108.30400 126.72200 115.65000 1.000 42.31000  ? 664 LEU C CA    1 
ATOM   8625  C  C     . LEU C 1 419 ? 109.68900 126.17800 115.97900 1.000 42.31000  ? 664 LEU C C     1 
ATOM   8626  O  O     . LEU C 1 419 ? 109.84000 125.08800 116.53100 1.000 42.31000  ? 664 LEU C O     1 
ATOM   8627  C  CB    . LEU C 1 419 ? 108.11400 128.14400 116.16400 1.000 42.31000  ? 664 LEU C CB    1 
ATOM   8628  C  CG    . LEU C 1 419 ? 106.74200 128.75100 115.86700 1.000 42.31000  ? 664 LEU C CG    1 
ATOM   8629  C  CD1   . LEU C 1 419 ? 106.58100 130.10200 116.53500 1.000 42.31000  ? 664 LEU C CD1   1 
ATOM   8630  C  CD2   . LEU C 1 419 ? 106.52600 128.86400 114.37800 1.000 42.31000  ? 664 LEU C CD2   1 
ATOM   8631  N  N     . ASP C 1 420 ? 110.71900 126.93400 115.63800 1.000 47.79000  ? 665 ASP C N     1 
ATOM   8632  C  CA    . ASP C 1 420 ? 112.05600 126.68200 116.15600 1.000 47.79000  ? 665 ASP C CA    1 
ATOM   8633  C  C     . ASP C 1 420 ? 112.56700 127.92600 116.86200 1.000 47.79000  ? 665 ASP C C     1 
ATOM   8634  O  O     . ASP C 1 420 ? 113.72700 128.31900 116.73000 1.000 47.79000  ? 665 ASP C O     1 
ATOM   8635  C  CB    . ASP C 1 420 ? 113.00100 126.23300 115.04700 1.000 47.79000  ? 665 ASP C CB    1 
ATOM   8636  C  CG    . ASP C 1 420 ? 112.69200 124.83100 114.55900 1.000 47.79000  ? 665 ASP C CG    1 
ATOM   8637  O  OD1   . ASP C 1 420 ? 112.20000 124.01800 115.36800 1.000 47.79000  ? 665 ASP C OD1   1 
ATOM   8638  O  OD2   . ASP C 1 420 ? 112.93400 124.54200 113.36900 1.000 47.79000  ? 665 ASP C OD2   1 
ATOM   8639  N  N     . GLN C 1 421 ? 111.67600 128.55200 117.62500 1.000 47.49000  ? 666 GLN C N     1 
ATOM   8640  C  CA    . GLN C 1 421 ? 111.93100 129.82400 118.27700 1.000 47.49000  ? 666 GLN C CA    1 
ATOM   8641  C  C     . GLN C 1 421 ? 111.16700 129.84500 119.59200 1.000 47.49000  ? 666 GLN C C     1 
ATOM   8642  O  O     . GLN C 1 421 ? 110.56400 128.84900 120.00000 1.000 47.49000  ? 666 GLN C O     1 
ATOM   8643  C  CB    . GLN C 1 421 ? 111.49900 130.99400 117.39200 1.000 47.49000  ? 666 GLN C CB    1 
ATOM   8644  C  CG    . GLN C 1 421 ? 112.25200 131.11400 116.09100 1.000 47.49000  ? 666 GLN C CG    1 
ATOM   8645  C  CD    . GLN C 1 421 ? 111.72000 132.23300 115.23400 1.000 47.49000  ? 666 GLN C CD    1 
ATOM   8646  O  OE1   . GLN C 1 421 ? 110.74900 132.89300 115.59700 1.000 47.49000  ? 666 GLN C OE1   1 
ATOM   8647  N  NE2   . GLN C 1 421 ? 112.34400 132.44800 114.08300 1.000 47.49000  ? 666 GLN C NE2   1 
ATOM   8648  N  N     . GLY C 1 422 ? 111.18800 130.99500 120.25200 1.000 44.84000  ? 667 GLY C N     1 
ATOM   8649  C  CA    . GLY C 1 422 ? 110.32100 131.19500 121.39300 1.000 44.84000  ? 667 GLY C CA    1 
ATOM   8650  C  C     . GLY C 1 422 ? 109.00400 131.78200 120.94100 1.000 44.84000  ? 667 GLY C C     1 
ATOM   8651  O  O     . GLY C 1 422 ? 108.33000 131.20800 120.08300 1.000 44.84000  ? 667 GLY C O     1 
ATOM   8652  N  N     . GLY C 1 423 ? 108.62400 132.91900 121.49800 1.000 41.01000  ? 668 GLY C N     1 
ATOM   8653  C  CA    . GLY C 1 423 ? 107.46200 133.63300 120.98300 1.000 41.01000  ? 668 GLY C CA    1 
ATOM   8654  C  C     . GLY C 1 423 ? 106.11300 133.02000 121.25700 1.000 41.01000  ? 668 GLY C C     1 
ATOM   8655  O  O     . GLY C 1 423 ? 105.24800 133.67100 121.84900 1.000 41.01000  ? 668 GLY C O     1 
ATOM   8656  N  N     . ALA C 1 424 ? 105.90600 131.76900 120.83600 1.000 38.77000  ? 669 ALA C N     1 
ATOM   8657  C  CA    . ALA C 1 424 ? 104.60000 131.13500 120.96800 1.000 38.77000  ? 669 ALA C CA    1 
ATOM   8658  C  C     . ALA C 1 424 ? 104.20000 130.92600 122.41900 1.000 38.77000  ? 669 ALA C C     1 
ATOM   8659  O  O     . ALA C 1 424 ? 103.01600 130.71400 122.69800 1.000 38.77000  ? 669 ALA C O     1 
ATOM   8660  C  CB    . ALA C 1 424 ? 104.58800 129.80300 120.22300 1.000 38.77000  ? 669 ALA C CB    1 
ATOM   8661  N  N     . GLU C 1 425 ? 105.15800 130.97000 123.34400 1.000 40.66000  ? 670 GLU C N     1 
ATOM   8662  C  CA    . GLU C 1 425 ? 104.82200 130.89100 124.76000 1.000 40.66000  ? 670 GLU C CA    1 
ATOM   8663  C  C     . GLU C 1 425 ? 103.99200 132.09000 125.20400 1.000 40.66000  ? 670 GLU C C     1 
ATOM   8664  O  O     . GLU C 1 425 ? 102.99600 131.93200 125.91700 1.000 40.66000  ? 670 GLU C O     1 
ATOM   8665  C  CB    . GLU C 1 425 ? 106.10500 130.77500 125.58300 1.000 40.66000  ? 670 GLU C CB    1 
ATOM   8666  C  CG    . GLU C 1 425 ? 107.07300 131.92800 125.36900 1.000 40.66000  ? 670 GLU C CG    1 
ATOM   8667  C  CD    . GLU C 1 425 ? 108.35500 131.78000 126.15000 1.000 40.66000  ? 670 GLU C CD    1 
ATOM   8668  O  OE1   . GLU C 1 425 ? 108.48900 130.78500 126.88800 1.000 40.66000  ? 670 GLU C OE1   1 
ATOM   8669  O  OE2   . GLU C 1 425 ? 109.23300 132.65700 126.01800 1.000 40.66000  ? 670 GLU C OE2   1 
ATOM   8670  N  N     . GLN C 1 426 ? 104.38300 133.29100 124.79200 1.000 40.72000  ? 671 GLN C N     1 
ATOM   8671  C  CA    . GLN C 1 426 ? 103.74300 134.52400 125.24400 1.000 40.72000  ? 671 GLN C CA    1 
ATOM   8672  C  C     . GLN C 1 426 ? 102.72100 135.02500 124.22200 1.000 40.72000  ? 671 GLN C C     1 
ATOM   8673  O  O     . GLN C 1 426 ? 102.84500 136.10000 123.63600 1.000 40.72000  ? 671 GLN C O     1 
ATOM   8674  C  CB    . GLN C 1 426 ? 104.80800 135.57100 125.56100 1.000 40.72000  ? 671 GLN C CB    1 
ATOM   8675  C  CG    . GLN C 1 426 ? 105.77700 135.86000 124.42600 1.000 40.72000  ? 671 GLN C CG    1 
ATOM   8676  C  CD    . GLN C 1 426 ? 106.90900 136.77400 124.85000 1.000 40.72000  ? 671 GLN C CD    1 
ATOM   8677  O  OE1   . GLN C 1 426 ? 106.94100 137.25200 125.98300 1.000 40.72000  ? 671 GLN C OE1   1 
ATOM   8678  N  NE2   . GLN C 1 426 ? 107.85200 137.01000 123.94700 1.000 40.72000  ? 671 GLN C NE2   1 
ATOM   8679  N  N     . LEU C 1 427 ? 101.67900 134.21800 124.03100 1.000 38.23000  ? 672 LEU C N     1 
ATOM   8680  C  CA    . LEU C 1 427 ? 100.53000 134.57300 123.21000 1.000 38.23000  ? 672 LEU C CA    1 
ATOM   8681  C  C     . LEU C 1 427 ? 99.29200  134.61800 124.09100 1.000 38.23000  ? 672 LEU C C     1 
ATOM   8682  O  O     . LEU C 1 427 ? 99.11600  133.77200 124.97200 1.000 38.23000  ? 672 LEU C O     1 
ATOM   8683  C  CB    . LEU C 1 427 ? 100.32900 133.57700 122.07100 1.000 38.23000  ? 672 LEU C CB    1 
ATOM   8684  C  CG    . LEU C 1 427 ? 101.45300 133.55200 121.04200 1.000 38.23000  ? 672 LEU C CG    1 
ATOM   8685  C  CD1   . LEU C 1 427 ? 101.20500 132.47000 120.01500 1.000 38.23000  ? 672 LEU C CD1   1 
ATOM   8686  C  CD2   . LEU C 1 427 ? 101.57800 134.90800 120.38500 1.000 38.23000  ? 672 LEU C CD2   1 
ATOM   8687  N  N     . LEU C 1 428 ? 98.42800  135.59800 123.84800 1.000 42.15000  ? 673 LEU C N     1 
ATOM   8688  C  CA    . LEU C 1 428 ? 97.32800  135.87500 124.76300 1.000 42.15000  ? 673 LEU C CA    1 
ATOM   8689  C  C     . LEU C 1 428 ? 96.19300  134.86300 124.66600 1.000 42.15000  ? 673 LEU C C     1 
ATOM   8690  O  O     . LEU C 1 428 ? 95.13300  135.08200 125.26400 1.000 42.15000  ? 673 LEU C O     1 
ATOM   8691  C  CB    . LEU C 1 428 ? 96.79700  137.29000 124.53400 1.000 42.15000  ? 673 LEU C CB    1 
ATOM   8692  C  CG    . LEU C 1 428 ? 97.78900  138.39500 124.89600 1.000 42.15000  ? 673 LEU C CG    1 
ATOM   8693  C  CD1   . LEU C 1 428 ? 97.20600  139.74500 124.55200 1.000 42.15000  ? 673 LEU C CD1   1 
ATOM   8694  C  CD2   . LEU C 1 428 ? 98.16100  138.32200 126.37000 1.000 42.15000  ? 673 LEU C CD2   1 
ATOM   8695  N  N     . GLY C 1 429 ? 96.38800  133.76400 123.94600 1.000 41.10000  ? 674 GLY C N     1 
ATOM   8696  C  CA    . GLY C 1 429 ? 95.44300  132.66900 124.00800 1.000 41.10000  ? 674 GLY C CA    1 
ATOM   8697  C  C     . GLY C 1 429 ? 94.41200  132.58900 122.90400 1.000 41.10000  ? 674 GLY C C     1 
ATOM   8698  O  O     . GLY C 1 429 ? 94.70000  132.08900 121.81200 1.000 41.10000  ? 674 GLY C O     1 
ATOM   8699  N  N     . HIS C 1 430 ? 93.20000  133.04800 123.19400 1.000 46.91000  ? 675 HIS C N     1 
ATOM   8700  C  CA    . HIS C 1 430 ? 92.08900  132.89500 122.26900 1.000 46.91000  ? 675 HIS C CA    1 
ATOM   8701  C  C     . HIS C 1 430 ? 92.40800  133.56600 120.94600 1.000 46.91000  ? 675 HIS C C     1 
ATOM   8702  O  O     . HIS C 1 430 ? 92.54200  134.79000 120.87900 1.000 46.91000  ? 675 HIS C O     1 
ATOM   8703  C  CB    . HIS C 1 430 ? 90.82900  133.51000 122.87600 1.000 46.91000  ? 675 HIS C CB    1 
ATOM   8704  C  CG    . HIS C 1 430 ? 90.42500  132.90600 124.18400 1.000 46.91000  ? 675 HIS C CG    1 
ATOM   8705  N  ND1   . HIS C 1 430 ? 89.86300  131.65200 124.28700 1.000 46.91000  ? 675 HIS C ND1   1 
ATOM   8706  C  CD2   . HIS C 1 430 ? 90.47100  133.40300 125.44200 1.000 46.91000  ? 675 HIS C CD2   1 
ATOM   8707  C  CE1   . HIS C 1 430 ? 89.59300  131.39600 125.55500 1.000 46.91000  ? 675 HIS C CE1   1 
ATOM   8708  N  NE2   . HIS C 1 430 ? 89.95300  132.44200 126.27700 1.000 46.91000  ? 675 HIS C NE2   1 
ATOM   8709  N  N     . GLY C 1 431 ? 92.52400  132.76700 119.89100 1.000 41.78000  ? 676 GLY C N     1 
ATOM   8710  C  CA    . GLY C 1 431 ? 92.74400  133.32500 118.57200 1.000 41.78000  ? 676 GLY C CA    1 
ATOM   8711  C  C     . GLY C 1 431 ? 94.19400  133.48800 118.16500 1.000 41.78000  ? 676 GLY C C     1 
ATOM   8712  O  O     . GLY C 1 431 ? 94.58500  133.03300 117.08600 1.000 41.78000  ? 676 GLY C O     1 
ATOM   8713  N  N     . ASP C 1 432 ? 94.99300  134.14300 119.01200 1.000 42.23000  ? 677 ASP C N     1 
ATOM   8714  C  CA    . ASP C 1 432 ? 96.32300  134.60000 118.62100 1.000 42.23000  ? 677 ASP C CA    1 
ATOM   8715  C  C     . ASP C 1 432 ? 97.16400  133.46000 118.07100 1.000 42.23000  ? 677 ASP C C     1 
ATOM   8716  O  O     . ASP C 1 432 ? 97.05600  132.31200 118.50700 1.000 42.23000  ? 677 ASP C O     1 
ATOM   8717  C  CB    . ASP C 1 432 ? 97.04600  135.23100 119.80800 1.000 42.23000  ? 677 ASP C CB    1 
ATOM   8718  C  CG    . ASP C 1 432 ? 96.40700  136.51700 120.25400 1.000 42.23000  ? 677 ASP C CG    1 
ATOM   8719  O  OD1   . ASP C 1 432 ? 95.75800  137.17500 119.42100 1.000 42.23000  ? 677 ASP C OD1   1 
ATOM   8720  O  OD2   . ASP C 1 432 ? 96.56300  136.88000 121.43600 1.000 42.23000  ? 677 ASP C OD2   1 
ATOM   8721  N  N     . MET C 1 433 ? 98.02100  133.79200 117.11100 1.000 37.54000  ? 678 MET C N     1 
ATOM   8722  C  CA    . MET C 1 433 ? 98.89400  132.81100 116.49100 1.000 37.54000  ? 678 MET C CA    1 
ATOM   8723  C  C     . MET C 1 433 ? 100.20600 133.48600 116.11700 1.000 37.54000  ? 678 MET C C     1 
ATOM   8724  O  O     . MET C 1 433 ? 100.38400 134.69200 116.30000 1.000 37.54000  ? 678 MET C O     1 
ATOM   8725  C  CB    . MET C 1 433 ? 98.23000  132.17500 115.26800 1.000 37.54000  ? 678 MET C CB    1 
ATOM   8726  C  CG    . MET C 1 433 ? 98.02900  133.12500 114.10600 1.000 37.54000  ? 678 MET C CG    1 
ATOM   8727  S  SD    . MET C 1 433 ? 97.14000  132.39100 112.72200 1.000 37.54000  ? 678 MET C SD    1 
ATOM   8728  C  CE    . MET C 1 433 ? 95.47000  132.36700 113.35900 1.000 37.54000  ? 678 MET C CE    1 
ATOM   8729  N  N     . LEU C 1 434 ? 101.13000 132.68900 115.59500 1.000 37.01000  ? 679 LEU C N     1 
ATOM   8730  C  CA    . LEU C 1 434 ? 102.42600 133.14600 115.10700 1.000 37.01000  ? 679 LEU C CA    1 
ATOM   8731  C  C     . LEU C 1 434 ? 102.72500 132.53700 113.75100 1.000 37.01000  ? 679 LEU C C     1 
ATOM   8732  O  O     . LEU C 1 434 ? 103.75600 131.89200 113.55300 1.000 37.01000  ? 679 LEU C O     1 
ATOM   8733  C  CB    . LEU C 1 434 ? 103.56300 132.83900 116.07000 1.000 37.01000  ? 679 LEU C CB    1 
ATOM   8734  C  CG    . LEU C 1 434 ? 103.64400 133.72400 117.30400 1.000 37.01000  ? 679 LEU C CG    1 
ATOM   8735  C  CD1   . LEU C 1 434 ? 104.78500 133.27100 118.16600 1.000 37.01000  ? 679 LEU C CD1   1 
ATOM   8736  C  CD2   . LEU C 1 434 ? 103.84700 135.15700 116.88100 1.000 37.01000  ? 679 LEU C CD2   1 
ATOM   8737  N  N     . TYR C 1 435 ? 101.79100 132.69000 112.81500 1.000 43.31000  ? 680 TYR C N     1 
ATOM   8738  C  CA    . TYR C 1 435 ? 101.95500 132.18300 111.45900 1.000 43.31000  ? 680 TYR C CA    1 
ATOM   8739  C  C     . TYR C 1 435 ? 103.36000 132.43400 110.93600 1.000 43.31000  ? 680 TYR C C     1 
ATOM   8740  O  O     . TYR C 1 435 ? 103.80700 133.58000 110.84100 1.000 43.31000  ? 680 TYR C O     1 
ATOM   8741  C  CB    . TYR C 1 435 ? 100.93300 132.85100 110.54100 1.000 43.31000  ? 680 TYR C CB    1 
ATOM   8742  C  CG    . TYR C 1 435 ? 101.12500 132.52100 109.08300 1.000 43.31000  ? 680 TYR C CG    1 
ATOM   8743  C  CD1   . TYR C 1 435 ? 100.76000 131.28600 108.57400 1.000 43.31000  ? 680 TYR C CD1   1 
ATOM   8744  C  CD2   . TYR C 1 435 ? 101.67400 133.45100 108.21400 1.000 43.31000  ? 680 TYR C CD2   1 
ATOM   8745  C  CE1   . TYR C 1 435 ? 100.93500 130.98800 107.24200 1.000 43.31000  ? 680 TYR C CE1   1 
ATOM   8746  C  CE2   . TYR C 1 435 ? 101.85400 133.16000 106.88300 1.000 43.31000  ? 680 TYR C CE2   1 
ATOM   8747  C  CZ    . TYR C 1 435 ? 101.48300 131.92900 106.40100 1.000 43.31000  ? 680 TYR C CZ    1 
ATOM   8748  O  OH    . TYR C 1 435 ? 101.66100 131.63800 105.07000 1.000 43.31000  ? 680 TYR C OH    1 
ATOM   8749  N  N     . LEU C 1 436 ? 104.05500 131.34900 110.59300 1.000 45.47000  ? 681 LEU C N     1 
ATOM   8750  C  CA    . LEU C 1 436 ? 105.44900 131.38300 110.18100 1.000 45.47000  ? 681 LEU C CA    1 
ATOM   8751  C  C     . LEU C 1 436 ? 105.52300 131.23400 108.67000 1.000 45.47000  ? 681 LEU C C     1 
ATOM   8752  O  O     . LEU C 1 436 ? 105.40600 130.11100 108.16000 1.000 45.47000  ? 681 LEU C O     1 
ATOM   8753  C  CB    . LEU C 1 436 ? 106.23700 130.26800 110.87200 1.000 45.47000  ? 681 LEU C CB    1 
ATOM   8754  C  CG    . LEU C 1 436 ? 107.74700 130.22800 110.63500 1.000 45.47000  ? 681 LEU C CG    1 
ATOM   8755  C  CD1   . LEU C 1 436 ? 108.39900 131.46300 111.22000 1.000 45.47000  ? 681 LEU C CD1   1 
ATOM   8756  C  CD2   . LEU C 1 436 ? 108.36300 128.96900 111.22000 1.000 45.47000  ? 681 LEU C CD2   1 
ATOM   8757  N  N     . PRO C 1 437 ? 105.70300 132.31200 107.91400 1.000 50.18000  ? 682 PRO C N     1 
ATOM   8758  C  CA    . PRO C 1 437 ? 105.76200 132.19800 106.45400 1.000 50.18000  ? 682 PRO C CA    1 
ATOM   8759  C  C     . PRO C 1 437 ? 106.89800 131.28900 106.02200 1.000 50.18000  ? 682 PRO C C     1 
ATOM   8760  O  O     . PRO C 1 437 ? 107.87600 131.10800 106.76200 1.000 50.18000  ? 682 PRO C O     1 
ATOM   8761  C  CB    . PRO C 1 437 ? 105.98800 133.64800 105.99600 1.000 50.18000  ? 682 PRO C CB    1 
ATOM   8762  C  CG    . PRO C 1 437 ? 106.58800 134.32700 107.17100 1.000 50.18000  ? 682 PRO C CG    1 
ATOM   8763  C  CD    . PRO C 1 437 ? 105.97700 133.68100 108.37700 1.000 50.18000  ? 682 PRO C CD    1 
ATOM   8764  N  N     . PRO C 1 438 ? 106.79700 130.68700 104.83200 1.000 52.73000  ? 683 PRO C N     1 
ATOM   8765  C  CA    . PRO C 1 438 ? 107.75100 129.63900 104.44000 1.000 52.73000  ? 683 PRO C CA    1 
ATOM   8766  C  C     . PRO C 1 438 ? 109.20600 130.08000 104.41200 1.000 52.73000  ? 683 PRO C C     1 
ATOM   8767  O  O     . PRO C 1 438 ? 110.05300 129.49000 105.08900 1.000 52.73000  ? 683 PRO C O     1 
ATOM   8768  C  CB    . PRO C 1 438 ? 107.27900 129.25200 103.03200 1.000 52.73000  ? 683 PRO C CB    1 
ATOM   8769  C  CG    . PRO C 1 438 ? 105.85400 129.66200 102.97900 1.000 52.73000  ? 683 PRO C CG    1 
ATOM   8770  C  CD    . PRO C 1 438 ? 105.75900 130.89700 103.81000 1.000 52.73000  ? 683 PRO C CD    1 
ATOM   8771  N  N     . GLY C 1 439 ? 109.50100 131.12300 103.63600 1.000 60.98000  ? 684 GLY C N     1 
ATOM   8772  C  CA    . GLY C 1 439 ? 110.88700 131.42300 103.31600 1.000 60.98000  ? 684 GLY C CA    1 
ATOM   8773  C  C     . GLY C 1 439 ? 111.67000 132.01100 104.47400 1.000 60.98000  ? 684 GLY C C     1 
ATOM   8774  O  O     . GLY C 1 439 ? 112.88500 131.82100 104.56900 1.000 60.98000  ? 684 GLY C O     1 
ATOM   8775  N  N     . THR C 1 440 ? 110.99800 132.72900 105.36600 1.000 60.87000  ? 685 THR C N     1 
ATOM   8776  C  CA    . THR C 1 440 ? 111.67700 133.46000 106.42100 1.000 60.87000  ? 685 THR C CA    1 
ATOM   8777  C  C     . THR C 1 440 ? 111.61900 132.68700 107.73600 1.000 60.87000  ? 685 THR C C     1 
ATOM   8778  O  O     . THR C 1 440 ? 111.12900 131.55800 107.81200 1.000 60.87000  ? 685 THR C O     1 
ATOM   8779  C  CB    . THR C 1 440 ? 111.06800 134.85200 106.59200 1.000 60.87000  ? 685 THR C CB    1 
ATOM   8780  O  OG1   . THR C 1 440 ? 109.70500 134.72700 107.01000 1.000 60.87000  ? 685 THR C OG1   1 
ATOM   8781  C  CG2   . THR C 1 440 ? 111.12000 135.61800 105.28100 1.000 60.87000  ? 685 THR C CG2   1 
ATOM   8782  N  N     . GLY C 1 441 ? 112.13200 133.31800 108.78600 1.000 59.10000  ? 686 GLY C N     1 
ATOM   8783  C  CA    . GLY C 1 441 ? 112.10800 132.74700 110.11600 1.000 59.10000  ? 686 GLY C CA    1 
ATOM   8784  C  C     . GLY C 1 441 ? 111.37900 133.64500 111.08900 1.000 59.10000  ? 686 GLY C C     1 
ATOM   8785  O  O     . GLY C 1 441 ? 111.00700 133.21600 112.18500 1.000 59.10000  ? 686 GLY C O     1 
ATOM   8786  N  N     . LEU C 1 442 ? 111.18200 134.89700 110.70400 1.000 56.07000  ? 687 LEU C N     1 
ATOM   8787  C  CA    . LEU C 1 442 ? 110.38000 135.81400 111.50100 1.000 56.07000  ? 687 LEU C CA    1 
ATOM   8788  C  C     . LEU C 1 442 ? 108.92900 135.36100 111.50000 1.000 56.07000  ? 687 LEU C C     1 
ATOM   8789  O  O     . LEU C 1 442 ? 108.32900 135.24500 110.42500 1.000 56.07000  ? 687 LEU C O     1 
ATOM   8790  C  CB    . LEU C 1 442 ? 110.48400 137.23200 110.95700 1.000 56.07000  ? 687 LEU C CB    1 
ATOM   8791  C  CG    . LEU C 1 442 ? 111.81600 137.95800 111.11400 1.000 56.07000  ? 687 LEU C CG    1 
ATOM   8792  C  CD1   . LEU C 1 442 ? 111.77800 139.26600 110.34900 1.000 56.07000  ? 687 LEU C CD1   1 
ATOM   8793  C  CD2   . LEU C 1 442 ? 112.10000 138.20600 112.58500 1.000 56.07000  ? 687 LEU C CD2   1 
ATOM   8794  N  N     . PRO C 1 443 ? 108.32700 135.09400 112.66000 1.000 47.94000  ? 688 PRO C N     1 
ATOM   8795  C  CA    . PRO C 1 443 ? 106.90500 134.73200 112.69400 1.000 47.94000  ? 688 PRO C CA    1 
ATOM   8796  C  C     . PRO C 1 443 ? 106.04300 135.98400 112.61600 1.000 47.94000  ? 688 PRO C C     1 
ATOM   8797  O  O     . PRO C 1 443 ? 106.08400 136.83900 113.50300 1.000 47.94000  ? 688 PRO C O     1 
ATOM   8798  C  CB    . PRO C 1 443 ? 106.75500 134.02500 114.04500 1.000 47.94000  ? 688 PRO C CB    1 
ATOM   8799  C  CG    . PRO C 1 443 ? 107.81500 134.63500 114.89000 1.000 47.94000  ? 688 PRO C CG    1 
ATOM   8800  C  CD    . PRO C 1 443 ? 108.96700 134.94600 113.97600 1.000 47.94000  ? 688 PRO C CD    1 
ATOM   8801  N  N     . ILE C 1 444 ? 105.26100 136.09200 111.54500 1.000 43.74000  ? 689 ILE C N     1 
ATOM   8802  C  CA    . ILE C 1 444 ? 104.36000 137.22400 111.34900 1.000 43.74000  ? 689 ILE C CA    1 
ATOM   8803  C  C     . ILE C 1 444 ? 103.16500 136.99800 112.26800 1.000 43.74000  ? 689 ILE C C     1 
ATOM   8804  O  O     . ILE C 1 444 ? 102.27300 136.21300 111.95000 1.000 43.74000  ? 689 ILE C O     1 
ATOM   8805  C  CB    . ILE C 1 444 ? 103.93100 137.36400 109.88700 1.000 43.74000  ? 689 ILE C CB    1 
ATOM   8806  C  CG1   . ILE C 1 444 ? 105.15500 137.51000 108.98200 1.000 43.74000  ? 689 ILE C CG1   1 
ATOM   8807  C  CG2   . ILE C 1 444 ? 102.99400 138.54800 109.71700 1.000 43.74000  ? 689 ILE C CG2   1 
ATOM   8808  C  CD1   . ILE C 1 444 ? 105.99800 138.72900 109.28400 1.000 43.74000  ? 689 ILE C CD1   1 
ATOM   8809  N  N     . ARG C 1 445 ? 103.15200 137.66600 113.41800 1.000 31.86000  ? 690 ARG C N     1 
ATOM   8810  C  CA    . ARG C 1 445 ? 102.07300 137.45200 114.37200 1.000 31.86000  ? 690 ARG C CA    1 
ATOM   8811  C  C     . ARG C 1 445 ? 100.74300 137.88000 113.77200 1.000 31.86000  ? 690 ARG C C     1 
ATOM   8812  O  O     . ARG C 1 445 ? 100.64500 138.91100 113.10400 1.000 31.86000  ? 690 ARG C O     1 
ATOM   8813  C  CB    . ARG C 1 445 ? 102.33000 138.21400 115.67000 1.000 31.86000  ? 690 ARG C CB    1 
ATOM   8814  C  CG    . ARG C 1 445 ? 101.27300 137.94700 116.72800 1.000 31.86000  ? 690 ARG C CG    1 
ATOM   8815  C  CD    . ARG C 1 445 ? 101.59800 138.60900 118.04800 1.000 31.86000  ? 690 ARG C CD    1 
ATOM   8816  N  NE    . ARG C 1 445 ? 100.54600 138.36800 119.02700 1.000 31.86000  ? 690 ARG C NE    1 
ATOM   8817  C  CZ    . ARG C 1 445 ? 100.56600 138.81900 120.27500 1.000 31.86000  ? 690 ARG C CZ    1 
ATOM   8818  N  NH1   . ARG C 1 445 ? 101.59000 139.54100 120.70700 1.000 31.86000  ? 690 ARG C NH1   1 
ATOM   8819  N  NH2   . ARG C 1 445 ? 99.55900  138.55000 121.09400 1.000 31.86000  ? 690 ARG C NH2   1 
ATOM   8820  N  N     . VAL C 1 446 ? 99.71600  137.07500 114.01800 1.000 34.99000  ? 691 VAL C N     1 
ATOM   8821  C  CA    . VAL C 1 446 ? 98.39700  137.26500 113.43100 1.000 34.99000  ? 691 VAL C CA    1 
ATOM   8822  C  C     . VAL C 1 446 ? 97.35900  136.99700 114.50800 1.000 34.99000  ? 691 VAL C C     1 
ATOM   8823  O  O     . VAL C 1 446 ? 97.43800  135.98700 115.21200 1.000 34.99000  ? 691 VAL C O     1 
ATOM   8824  C  CB    . VAL C 1 446 ? 98.16600  136.33500 112.22400 1.000 34.99000  ? 691 VAL C CB    1 
ATOM   8825  C  CG1   . VAL C 1 446 ? 96.73300  136.42400 111.75400 1.000 34.99000  ? 691 VAL C CG1   1 
ATOM   8826  C  CG2   . VAL C 1 446 ? 99.11200  136.68400 111.09100 1.000 34.99000  ? 691 VAL C CG2   1 
ATOM   8827  N  N     . HIS C 1 447 ? 96.39800  137.90100 114.64900 1.000 42.06000  ? 692 HIS C N     1 
ATOM   8828  C  CA    . HIS C 1 447 ? 95.28800  137.68000 115.55800 1.000 42.06000  ? 692 HIS C CA    1 
ATOM   8829  C  C     . HIS C 1 447 ? 94.19200  136.93400 114.81700 1.000 42.06000  ? 692 HIS C C     1 
ATOM   8830  O  O     . HIS C 1 447 ? 93.69900  137.39700 113.78600 1.000 42.06000  ? 692 HIS C O     1 
ATOM   8831  C  CB    . HIS C 1 447 ? 94.75600  139.00400 116.10100 1.000 42.06000  ? 692 HIS C CB    1 
ATOM   8832  C  CG    . HIS C 1 447 ? 95.77400  139.79700 116.85700 1.000 42.06000  ? 692 HIS C CG    1 
ATOM   8833  N  ND1   . HIS C 1 447 ? 96.56600  140.75200 116.25800 1.000 42.06000  ? 692 HIS C ND1   1 
ATOM   8834  C  CD2   . HIS C 1 447 ? 96.14400  139.76300 118.15700 1.000 42.06000  ? 692 HIS C CD2   1 
ATOM   8835  C  CE1   . HIS C 1 447 ? 97.37000  141.28300 117.16100 1.000 42.06000  ? 692 HIS C CE1   1 
ATOM   8836  N  NE2   . HIS C 1 447 ? 97.13600  140.69800 118.32100 1.000 42.06000  ? 692 HIS C NE2   1 
ATOM   8837  N  N     . GLY C 1 448 ? 93.81000  135.77400 115.34700 1.000 43.85000  ? 693 GLY C N     1 
ATOM   8838  C  CA    . GLY C 1 448 ? 92.91400  134.88200 114.64700 1.000 43.85000  ? 693 GLY C CA    1 
ATOM   8839  C  C     . GLY C 1 448 ? 91.51700  135.45100 114.50000 1.000 43.85000  ? 693 GLY C C     1 
ATOM   8840  O  O     . GLY C 1 448 ? 91.13700  136.43400 115.13100 1.000 43.85000  ? 693 GLY C O     1 
ATOM   8841  N  N     . ALA C 1 449 ? 90.74300  134.80300 113.63600 1.000 45.18000  ? 694 ALA C N     1 
ATOM   8842  C  CA    . ALA C 1 449 ? 89.35100  135.16000 113.42500 1.000 45.18000  ? 694 ALA C CA    1 
ATOM   8843  C  C     . ALA C 1 449 ? 88.48500  134.38600 114.41600 1.000 45.18000  ? 694 ALA C C     1 
ATOM   8844  O  O     . ALA C 1 449 ? 88.98700  133.75400 115.34800 1.000 45.18000  ? 694 ALA C O     1 
ATOM   8845  C  CB    . ALA C 1 449 ? 88.95000  134.89400 111.97700 1.000 45.18000  ? 694 ALA C CB    1 
ATOM   8846  N  N     . PHE C 1 450 ? 87.16600  134.43300 114.23400 1.000 46.59000  ? 695 PHE C N     1 
ATOM   8847  C  CA    . PHE C 1 450 ? 86.25900  133.71400 115.12500 1.000 46.59000  ? 695 PHE C CA    1 
ATOM   8848  C  C     . PHE C 1 450 ? 84.98000  133.40800 114.35300 1.000 46.59000  ? 695 PHE C C     1 
ATOM   8849  O  O     . PHE C 1 450 ? 84.14600  134.29500 114.15100 1.000 46.59000  ? 695 PHE C O     1 
ATOM   8850  C  CB    . PHE C 1 450 ? 85.97100  134.51700 116.38500 1.000 46.59000  ? 695 PHE C CB    1 
ATOM   8851  C  CG    . PHE C 1 450 ? 85.06300  133.81900 117.35200 1.000 46.59000  ? 695 PHE C CG    1 
ATOM   8852  C  CD1   . PHE C 1 450 ? 85.52300  132.76300 118.11500 1.000 46.59000  ? 695 PHE C CD1   1 
ATOM   8853  C  CD2   . PHE C 1 450 ? 83.75100  134.22200 117.50200 1.000 46.59000  ? 695 PHE C CD2   1 
ATOM   8854  C  CE1   . PHE C 1 450 ? 84.68900  132.11900 119.00500 1.000 46.59000  ? 695 PHE C CE1   1 
ATOM   8855  C  CE2   . PHE C 1 450 ? 82.91400  133.58200 118.39200 1.000 46.59000  ? 695 PHE C CE2   1 
ATOM   8856  C  CZ    . PHE C 1 450 ? 83.38500  132.53000 119.14400 1.000 46.59000  ? 695 PHE C CZ    1 
ATOM   8857  N  N     . VAL C 1 451 ? 84.83600  132.15800 113.92800 1.000 53.49000  ? 696 VAL C N     1 
ATOM   8858  C  CA    . VAL C 1 451 ? 83.62600  131.67800 113.27200 1.000 53.49000  ? 696 VAL C CA    1 
ATOM   8859  C  C     . VAL C 1 451 ? 82.88700  130.77800 114.25300 1.000 53.49000  ? 696 VAL C C     1 
ATOM   8860  O  O     . VAL C 1 451 ? 83.32100  129.65900 114.54600 1.000 53.49000  ? 696 VAL C O     1 
ATOM   8861  C  CB    . VAL C 1 451 ? 83.94400  130.95900 111.95500 1.000 53.49000  ? 696 VAL C CB    1 
ATOM   8862  C  CG1   . VAL C 1 451 ? 84.35600  131.96300 110.91000 1.000 53.49000  ? 696 VAL C CG1   1 
ATOM   8863  C  CG2   . VAL C 1 451 ? 85.07500  129.97800 112.15000 1.000 53.49000  ? 696 VAL C CG2   1 
ATOM   8864  N  N     . SER C 1 452 ? 81.76900  131.27000 114.77600 1.000 59.80000  ? 697 SER C N     1 
ATOM   8865  C  CA    . SER C 1 452 ? 81.02700  130.53300 115.78300 1.000 59.80000  ? 697 SER C CA    1 
ATOM   8866  C  C     . SER C 1 452 ? 80.31300  129.34100 115.14900 1.000 59.80000  ? 697 SER C C     1 
ATOM   8867  O  O     . SER C 1 452 ? 80.44300  129.05900 113.95600 1.000 59.80000  ? 697 SER C O     1 
ATOM   8868  C  CB    . SER C 1 452 ? 80.03700  131.45400 116.48800 1.000 59.80000  ? 697 SER C CB    1 
ATOM   8869  O  OG    . SER C 1 452 ? 79.04000  131.90100 115.58900 1.000 59.80000  ? 697 SER C OG    1 
ATOM   8870  N  N     . ASP C 1 453 ? 79.55100  128.62500 115.97600 1.000 62.88000  ? 698 ASP C N     1 
ATOM   8871  C  CA    . ASP C 1 453 ? 78.85500  127.43200 115.50700 1.000 62.88000  ? 698 ASP C CA    1 
ATOM   8872  C  C     . ASP C 1 453 ? 77.82400  127.77900 114.43900 1.000 62.88000  ? 698 ASP C C     1 
ATOM   8873  O  O     . ASP C 1 453 ? 77.89900  127.29800 113.30400 1.000 62.88000  ? 698 ASP C O     1 
ATOM   8874  C  CB    . ASP C 1 453 ? 78.19600  126.72100 116.68900 1.000 62.88000  ? 698 ASP C CB    1 
ATOM   8875  C  CG    . ASP C 1 453 ? 79.20800  126.11700 117.64000 1.000 62.88000  ? 698 ASP C CG    1 
ATOM   8876  O  OD1   . ASP C 1 453 ? 80.31000  125.75600 117.17800 1.000 62.88000  ? 698 ASP C OD1   1 
ATOM   8877  O  OD2   . ASP C 1 453 ? 78.90400  126.00300 118.84600 1.000 62.88000  ? 698 ASP C OD2   1 
ATOM   8878  N  N     . ASP C 1 454 ? 76.84200  128.61300 114.79200 1.000 65.72000  ? 699 ASP C N     1 
ATOM   8879  C  CA    . ASP C 1 454 ? 75.77600  128.95300 113.85500 1.000 65.72000  ? 699 ASP C CA    1 
ATOM   8880  C  C     . ASP C 1 454 ? 76.29100  129.74100 112.65700 1.000 65.72000  ? 699 ASP C C     1 
ATOM   8881  O  O     . ASP C 1 454 ? 75.75500  129.60500 111.54900 1.000 65.72000  ? 699 ASP C O     1 
ATOM   8882  C  CB    . ASP C 1 454 ? 74.68100  129.73300 114.57900 1.000 65.72000  ? 699 ASP C CB    1 
ATOM   8883  C  CG    . ASP C 1 454 ? 75.20400  130.99000 115.24600 1.000 65.72000  ? 699 ASP C CG    1 
ATOM   8884  O  OD1   . ASP C 1 454 ? 76.42900  131.23000 115.20100 1.000 65.72000  ? 699 ASP C OD1   1 
ATOM   8885  O  OD2   . ASP C 1 454 ? 74.38900  131.73700 115.82400 1.000 65.72000  ? 699 ASP C OD2   1 
ATOM   8886  N  N     . GLU C 1 455 ? 77.31800  130.57000 112.85800 1.000 62.52000  ? 700 GLU C N     1 
ATOM   8887  C  CA    . GLU C 1 455 ? 77.91200  131.30700 111.74900 1.000 62.52000  ? 700 GLU C CA    1 
ATOM   8888  C  C     . GLU C 1 455 ? 78.50400  130.36900 110.70600 1.000 62.52000  ? 700 GLU C C     1 
ATOM   8889  O  O     . GLU C 1 455 ? 78.74700  130.78900 109.57100 1.000 62.52000  ? 700 GLU C O     1 
ATOM   8890  C  CB    . GLU C 1 455 ? 78.98000  132.26500 112.28400 1.000 62.52000  ? 700 GLU C CB    1 
ATOM   8891  C  CG    . GLU C 1 455 ? 79.56900  133.21900 111.25900 1.000 62.52000  ? 700 GLU C CG    1 
ATOM   8892  C  CD    . GLU C 1 455 ? 80.57500  134.17700 111.86700 1.000 62.52000  ? 700 GLU C CD    1 
ATOM   8893  O  OE1   . GLU C 1 455 ? 80.84100  134.06900 113.08200 1.000 62.52000  ? 700 GLU C OE1   1 
ATOM   8894  O  OE2   . GLU C 1 455 ? 81.09300  135.04400 111.13300 1.000 62.52000  ? 700 GLU C OE2   1 
ATOM   8895  N  N     . VAL C 1 456 ? 78.72300  129.10900 111.06500 1.000 57.44000  ? 701 VAL C N     1 
ATOM   8896  C  CA    . VAL C 1 456 ? 79.16100  128.08600 110.12800 1.000 57.44000  ? 701 VAL C CA    1 
ATOM   8897  C  C     . VAL C 1 456 ? 77.99800  127.21500 109.67000 1.000 57.44000  ? 701 VAL C C     1 
ATOM   8898  O  O     . VAL C 1 456 ? 77.96700  126.76900 108.52200 1.000 57.44000  ? 701 VAL C O     1 
ATOM   8899  C  CB    . VAL C 1 456 ? 80.27900  127.23500 110.76800 1.000 57.44000  ? 701 VAL C CB    1 
ATOM   8900  C  CG1   . VAL C 1 456 ? 80.64500  126.08200 109.87600 1.000 57.44000  ? 701 VAL C CG1   1 
ATOM   8901  C  CG2   . VAL C 1 456 ? 81.49900  128.09100 111.04200 1.000 57.44000  ? 701 VAL C CG2   1 
ATOM   8902  N  N     . HIS C 1 457 ? 77.04300  126.95400 110.56700 1.000 62.29000  ? 702 HIS C N     1 
ATOM   8903  C  CA    . HIS C 1 457 ? 75.84700  126.21200 110.18400 1.000 62.29000  ? 702 HIS C CA    1 
ATOM   8904  C  C     . HIS C 1 457 ? 75.13900  126.88400 109.02000 1.000 62.29000  ? 702 HIS C C     1 
ATOM   8905  O  O     . HIS C 1 457 ? 74.70700  126.21500 108.07600 1.000 62.29000  ? 702 HIS C O     1 
ATOM   8906  C  CB    . HIS C 1 457 ? 74.88900  126.09100 111.36800 1.000 62.29000  ? 702 HIS C CB    1 
ATOM   8907  C  CG    . HIS C 1 457 ? 75.41100  125.25000 112.48700 1.000 62.29000  ? 702 HIS C CG    1 
ATOM   8908  N  ND1   . HIS C 1 457 ? 74.75500  125.12400 113.69200 1.000 62.29000  ? 702 HIS C ND1   1 
ATOM   8909  C  CD2   . HIS C 1 457 ? 76.53500  124.50500 112.59100 1.000 62.29000  ? 702 HIS C CD2   1 
ATOM   8910  C  CE1   . HIS C 1 457 ? 75.44600  124.32600 114.48600 1.000 62.29000  ? 702 HIS C CE1   1 
ATOM   8911  N  NE2   . HIS C 1 457 ? 76.53100  123.93700 113.84200 1.000 62.29000  ? 702 HIS C NE2   1 
ATOM   8912  N  N     . ARG C 1 458 ? 75.01800  128.21000 109.06700 1.000 60.30000  ? 703 ARG C N     1 
ATOM   8913  C  CA    . ARG C 1 458 ? 74.29800  128.91100 108.01000 1.000 60.30000  ? 703 ARG C CA    1 
ATOM   8914  C  C     . ARG C 1 458 ? 75.06400  128.86500 106.69500 1.000 60.30000  ? 703 ARG C C     1 
ATOM   8915  O  O     . ARG C 1 458 ? 74.46000  128.74200 105.62400 1.000 60.30000  ? 703 ARG C O     1 
ATOM   8916  C  CB    . ARG C 1 458 ? 74.01800  130.35000 108.43300 1.000 60.30000  ? 703 ARG C CB    1 
ATOM   8917  C  CG    . ARG C 1 458 ? 72.98000  130.44900 109.53400 1.000 60.30000  ? 703 ARG C CG    1 
ATOM   8918  C  CD    . ARG C 1 458 ? 72.67800  131.88700 109.88900 1.000 60.30000  ? 703 ARG C CD    1 
ATOM   8919  N  NE    . ARG C 1 458 ? 73.78500  132.51700 110.59900 1.000 60.30000  ? 703 ARG C NE    1 
ATOM   8920  C  CZ    . ARG C 1 458 ? 74.52700  133.49700 110.09900 1.000 60.30000  ? 703 ARG C CZ    1 
ATOM   8921  N  NH1   . ARG C 1 458 ? 74.28400  133.95600 108.88000 1.000 60.30000  ? 703 ARG C NH1   1 
ATOM   8922  N  NH2   . ARG C 1 458 ? 75.51500  134.01500 110.81300 1.000 60.30000  ? 703 ARG C NH2   1 
ATOM   8923  N  N     . VAL C 1 459 ? 76.39300  128.94700 106.75400 1.000 57.67000  ? 704 VAL C N     1 
ATOM   8924  C  CA    . VAL C 1 459 ? 77.19600  128.83200 105.54000 1.000 57.67000  ? 704 VAL C CA    1 
ATOM   8925  C  C     . VAL C 1 459 ? 77.01800  127.45400 104.92200 1.000 57.67000  ? 704 VAL C C     1 
ATOM   8926  O  O     . VAL C 1 459 ? 76.78500  127.31600 103.71500 1.000 57.67000  ? 704 VAL C O     1 
ATOM   8927  C  CB    . VAL C 1 459 ? 78.67500  129.12000 105.84800 1.000 57.67000  ? 704 VAL C CB    1 
ATOM   8928  C  CG1   . VAL C 1 459 ? 79.52400  128.90500 104.61000 1.000 57.67000  ? 704 VAL C CG1   1 
ATOM   8929  C  CG2   . VAL C 1 459 ? 78.83200  130.52400 106.38000 1.000 57.67000  ? 704 VAL C CG2   1 
ATOM   8930  N  N     . VAL C 1 460 ? 77.11700  126.41100 105.74800 1.000 59.09000  ? 705 VAL C N     1 
ATOM   8931  C  CA    . VAL C 1 460 ? 76.96500  125.04700 105.25200 1.000 59.09000  ? 705 VAL C CA    1 
ATOM   8932  C  C     . VAL C 1 460 ? 75.57700  124.84600 104.65900 1.000 59.09000  ? 705 VAL C C     1 
ATOM   8933  O  O     . VAL C 1 460 ? 75.42500  124.22500 103.60300 1.000 59.09000  ? 705 VAL C O     1 
ATOM   8934  C  CB    . VAL C 1 460 ? 77.25900  124.03900 106.37700 1.000 59.09000  ? 705 VAL C CB    1 
ATOM   8935  C  CG1   . VAL C 1 460 ? 76.94500  122.62600 105.92500 1.000 59.09000  ? 705 VAL C CG1   1 
ATOM   8936  C  CG2   . VAL C 1 460 ? 78.71000  124.14600 106.80200 1.000 59.09000  ? 705 VAL C CG2   1 
ATOM   8937  N  N     . GLU C 1 461 ? 74.54700  125.38000 105.31600 1.000 63.19000  ? 706 GLU C N     1 
ATOM   8938  C  CA    . GLU C 1 461 ? 73.18500  125.27800 104.79800 1.000 63.19000  ? 706 GLU C CA    1 
ATOM   8939  C  C     . GLU C 1 461 ? 73.05800  125.95300 103.43600 1.000 63.19000  ? 706 GLU C C     1 
ATOM   8940  O  O     . GLU C 1 461 ? 72.68000  125.31900 102.44100 1.000 63.19000  ? 706 GLU C O     1 
ATOM   8941  C  CB    . GLU C 1 461 ? 72.20700  125.89300 105.80000 1.000 63.19000  ? 706 GLU C CB    1 
ATOM   8942  C  CG    . GLU C 1 461 ? 70.74600  125.80300 105.39800 1.000 63.19000  ? 706 GLU C CG    1 
ATOM   8943  C  CD    . GLU C 1 461 ? 70.22700  124.38000 105.38700 1.000 63.19000  ? 706 GLU C CD    1 
ATOM   8944  O  OE1   . GLU C 1 461 ? 70.78200  123.53600 106.12300 1.000 63.19000  ? 706 GLU C OE1   1 
ATOM   8945  O  OE2   . GLU C 1 461 ? 69.25900  124.10500 104.64800 1.000 63.19000  ? 706 GLU C OE2   1 
ATOM   8946  N  N     . ALA C 1 462 ? 73.35300  127.25500 103.38100 1.000 60.68000  ? 707 ALA C N     1 
ATOM   8947  C  CA    . ALA C 1 462 ? 73.17100  128.01500 102.15100 1.000 60.68000  ? 707 ALA C CA    1 
ATOM   8948  C  C     . ALA C 1 462 ? 74.09500  127.55400 101.03400 1.000 60.68000  ? 707 ALA C C     1 
ATOM   8949  O  O     . ALA C 1 462 ? 73.85500  127.89400 99.87100  1.000 60.68000  ? 707 ALA C O     1 
ATOM   8950  C  CB    . ALA C 1 462 ? 73.38300  129.50400 102.41800 1.000 60.68000  ? 707 ALA C CB    1 
ATOM   8951  N  N     . TRP C 1 463 ? 75.14200  126.79500 101.34900 1.000 61.95000  ? 708 TRP C N     1 
ATOM   8952  C  CA    . TRP C 1 463 ? 75.96600  126.21000 100.30300 1.000 61.95000  ? 708 TRP C CA    1 
ATOM   8953  C  C     . TRP C 1 463 ? 75.51200  124.81200 99.91500  1.000 61.95000  ? 708 TRP C C     1 
ATOM   8954  O  O     . TRP C 1 463 ? 75.78400  124.37300 98.79200  1.000 61.95000  ? 708 TRP C O     1 
ATOM   8955  C  CB    . TRP C 1 463 ? 77.42900  126.17500 100.74500 1.000 61.95000  ? 708 TRP C CB    1 
ATOM   8956  C  CG    . TRP C 1 463 ? 78.33000  125.66400 99.69200  1.000 61.95000  ? 708 TRP C CG    1 
ATOM   8957  C  CD1   . TRP C 1 463 ? 78.87300  124.42400 99.62100  1.000 61.95000  ? 708 TRP C CD1   1 
ATOM   8958  C  CD2   . TRP C 1 463 ? 78.79100  126.37300 98.53900  1.000 61.95000  ? 708 TRP C CD2   1 
ATOM   8959  N  NE1   . TRP C 1 463 ? 79.64600  124.31100 98.49400  1.000 61.95000  ? 708 TRP C NE1   1 
ATOM   8960  C  CE2   . TRP C 1 463 ? 79.61600  125.49800 97.81500  1.000 61.95000  ? 708 TRP C CE2   1 
ATOM   8961  C  CE3   . TRP C 1 463 ? 78.58800  127.66300 98.05100  1.000 61.95000  ? 708 TRP C CE3   1 
ATOM   8962  C  CZ2   . TRP C 1 463 ? 80.23700  125.87000 96.63100  1.000 61.95000  ? 708 TRP C CZ2   1 
ATOM   8963  C  CZ3   . TRP C 1 463 ? 79.20700  128.03100 96.87500  1.000 61.95000  ? 708 TRP C CZ3   1 
ATOM   8964  C  CH2   . TRP C 1 463 ? 80.02200  127.13900 96.17800  1.000 61.95000  ? 708 TRP C CH2   1 
ATOM   8965  N  N     . LYS C 1 464 ? 74.82600  124.11000 100.81500 1.000 66.25000  ? 709 LYS C N     1 
ATOM   8966  C  CA    . LYS C 1 464 ? 74.22400  122.82800 100.48500 1.000 66.25000  ? 709 LYS C CA    1 
ATOM   8967  C  C     . LYS C 1 464 ? 72.97800  123.00200 99.63000  1.000 66.25000  ? 709 LYS C C     1 
ATOM   8968  O  O     . LYS C 1 464 ? 72.63200  122.10500 98.85400  1.000 66.25000  ? 709 LYS C O     1 
ATOM   8969  C  CB    . LYS C 1 464 ? 73.88400  122.07800 101.77300 1.000 66.25000  ? 709 LYS C CB    1 
ATOM   8970  C  CG    . LYS C 1 464 ? 73.41800  120.65300 101.58300 1.000 66.25000  ? 709 LYS C CG    1 
ATOM   8971  C  CD    . LYS C 1 464 ? 72.96600  120.06600 102.90700 1.000 66.25000  ? 709 LYS C CD    1 
ATOM   8972  C  CE    . LYS C 1 464 ? 74.14000  119.79200 103.82600 1.000 66.25000  ? 709 LYS C CE    1 
ATOM   8973  N  NZ    . LYS C 1 464 ? 73.69400  119.14200 105.08800 1.000 66.25000  ? 709 LYS C NZ    1 
ATOM   8974  N  N     . LEU C 1 465 ? 72.29700  124.14400 99.75500  1.000 66.52000  ? 710 LEU C N     1 
ATOM   8975  C  CA    . LEU C 1 465 ? 71.11600  124.39200 98.93400  1.000 66.52000  ? 710 LEU C CA    1 
ATOM   8976  C  C     . LEU C 1 465 ? 71.44700  124.51200 97.45300  1.000 66.52000  ? 710 LEU C C     1 
ATOM   8977  O  O     . LEU C 1 465 ? 70.54300  124.39800 96.61900  1.000 66.52000  ? 710 LEU C O     1 
ATOM   8978  C  CB    . LEU C 1 465 ? 70.39900  125.65900 99.39900  1.000 66.52000  ? 710 LEU C CB    1 
ATOM   8979  C  CG    . LEU C 1 465 ? 69.75200  125.59500 100.78100 1.000 66.52000  ? 710 LEU C CG    1 
ATOM   8980  C  CD1   . LEU C 1 465 ? 69.16600  126.94600 101.15800 1.000 66.52000  ? 710 LEU C CD1   1 
ATOM   8981  C  CD2   . LEU C 1 465 ? 68.69000  124.51000 100.82000 1.000 66.52000  ? 710 LEU C CD2   1 
ATOM   8982  N  N     . ARG C 1 466 ? 72.70900  124.74000 97.10300  1.000 66.18000  ? 711 ARG C N     1 
ATOM   8983  C  CA    . ARG C 1 466 ? 73.12400  124.92200 95.71600  1.000 66.18000  ? 711 ARG C CA    1 
ATOM   8984  C  C     . ARG C 1 466 ? 74.07000  123.81800 95.25400  1.000 66.18000  ? 711 ARG C C     1 
ATOM   8985  O  O     . ARG C 1 466 ? 75.05300  124.06900 94.55500  1.000 66.18000  ? 711 ARG C O     1 
ATOM   8986  C  CB    . ARG C 1 466 ? 73.75800  126.29800 95.52000  1.000 66.18000  ? 711 ARG C CB    1 
ATOM   8987  C  CG    . ARG C 1 466 ? 74.97600  126.56600 96.38500  1.000 66.18000  ? 711 ARG C CG    1 
ATOM   8988  C  CD    . ARG C 1 466 ? 75.58300  127.91400 96.05100  1.000 66.18000  ? 711 ARG C CD    1 
ATOM   8989  N  NE    . ARG C 1 466 ? 74.64200  129.00800 96.27000  1.000 66.18000  ? 711 ARG C NE    1 
ATOM   8990  C  CZ    . ARG C 1 466 ? 74.47600  129.63700 97.42800  1.000 66.18000  ? 711 ARG C CZ    1 
ATOM   8991  N  NH1   . ARG C 1 466 ? 75.19000  129.28400 98.48600  1.000 66.18000  ? 711 ARG C NH1   1 
ATOM   8992  N  NH2   . ARG C 1 466 ? 73.59400  130.62100 97.52800  1.000 66.18000  ? 711 ARG C NH2   1 
ATOM   8993  N  N     . GLY C 1 467 ? 73.77400  122.58100 95.62500  1.000 70.40000  ? 712 GLY C N     1 
ATOM   8994  C  CA    . GLY C 1 467 ? 74.57700  121.46300 95.17400  1.000 70.40000  ? 712 GLY C CA    1 
ATOM   8995  C  C     . GLY C 1 467 ? 74.22700  120.20900 95.93700  1.000 70.40000  ? 712 GLY C C     1 
ATOM   8996  O  O     . GLY C 1 467 ? 73.59800  120.24400 96.99800  1.000 70.40000  ? 712 GLY C O     1 
ATOM   8997  N  N     . ALA C 1 468 ? 74.65300  119.08300 95.37000  1.000 73.66000  ? 713 ALA C N     1 
ATOM   8998  C  CA    . ALA C 1 468 ? 74.39900  117.78700 95.96500  1.000 73.66000  ? 713 ALA C CA    1 
ATOM   8999  C  C     . ALA C 1 468 ? 75.70400  117.15300 96.42600  1.000 73.66000  ? 713 ALA C C     1 
ATOM   9000  O  O     . ALA C 1 468 ? 76.74300  117.33900 95.78400  1.000 73.66000  ? 713 ALA C O     1 
ATOM   9001  C  CB    . ALA C 1 468 ? 73.69600  116.85200 94.97200  1.000 73.66000  ? 713 ALA C CB    1 
ATOM   9002  N  N     . PRO C 1 469 ? 75.68400  116.39700 97.52200  1.000 75.65000  ? 714 PRO C N     1 
ATOM   9003  C  CA    . PRO C 1 469 ? 76.92600  115.79800 98.02500  1.000 75.65000  ? 714 PRO C CA    1 
ATOM   9004  C  C     . PRO C 1 469 ? 77.43300  114.67900 97.13200  1.000 75.65000  ? 714 PRO C C     1 
ATOM   9005  O  O     . PRO C 1 469 ? 77.29000  113.49800 97.45800  1.000 75.65000  ? 714 PRO C O     1 
ATOM   9006  C  CB    . PRO C 1 469 ? 76.52500  115.27300 99.40900  1.000 75.65000  ? 714 PRO C CB    1 
ATOM   9007  C  CG    . PRO C 1 469 ? 75.05800  115.03800 99.30700  1.000 75.65000  ? 714 PRO C CG    1 
ATOM   9008  C  CD    . PRO C 1 469 ? 74.53300  116.10600 98.39400  1.000 75.65000  ? 714 PRO C CD    1 
ATOM   9009  N  N     . ASP C 1 470 ? 78.02700  115.04600 95.99600  1.000 79.57000  ? 715 ASP C N     1 
ATOM   9010  C  CA    . ASP C 1 470 ? 78.54600  114.07200 95.03800  1.000 79.57000  ? 715 ASP C CA    1 
ATOM   9011  C  C     . ASP C 1 470 ? 79.85400  113.50400 95.58200  1.000 79.57000  ? 715 ASP C C     1 
ATOM   9012  O  O     . ASP C 1 470 ? 80.95600  113.94200 95.24200  1.000 79.57000  ? 715 ASP C O     1 
ATOM   9013  C  CB    . ASP C 1 470 ? 78.73400  114.71400 93.66900  1.000 79.57000  ? 715 ASP C CB    1 
ATOM   9014  C  CG    . ASP C 1 470 ? 79.03400  113.69800 92.58300  1.000 79.57000  ? 715 ASP C CG    1 
ATOM   9015  O  OD1   . ASP C 1 470 ? 79.12000  112.49200 92.89500  1.000 79.57000  ? 715 ASP C OD1   1 
ATOM   9016  O  OD2   . ASP C 1 470 ? 79.18200  114.10600 91.41200  1.000 79.57000  ? 715 ASP C OD2   1 
ATOM   9017  N  N     . TYR C 1 471 ? 79.72100  112.50400 96.44800  1.000 74.29000  ? 716 TYR C N     1 
ATOM   9018  C  CA    . TYR C 1 471 ? 80.88700  111.83900 97.00300  1.000 74.29000  ? 716 TYR C CA    1 
ATOM   9019  C  C     . TYR C 1 471 ? 81.60500  111.02300 95.93200  1.000 74.29000  ? 716 TYR C C     1 
ATOM   9020  O  O     . TYR C 1 471 ? 81.15100  110.89900 94.79100  1.000 74.29000  ? 716 TYR C O     1 
ATOM   9021  C  CB    . TYR C 1 471 ? 80.49300  110.91900 98.15800  1.000 74.29000  ? 716 TYR C CB    1 
ATOM   9022  C  CG    . TYR C 1 471 ? 79.95500  111.62900 99.37600  1.000 74.29000  ? 716 TYR C CG    1 
ATOM   9023  C  CD1   . TYR C 1 471 ? 80.80800  112.26400 100.26500 1.000 74.29000  ? 716 TYR C CD1   1 
ATOM   9024  C  CD2   . TYR C 1 471 ? 78.59600  111.64000 99.65300  1.000 74.29000  ? 716 TYR C CD2   1 
ATOM   9025  C  CE1   . TYR C 1 471 ? 80.32200  112.90700 101.38400 1.000 74.29000  ? 716 TYR C CE1   1 
ATOM   9026  C  CE2   . TYR C 1 471 ? 78.10000  112.27900 100.77200 1.000 74.29000  ? 716 TYR C CE2   1 
ATOM   9027  C  CZ    . TYR C 1 471 ? 78.96800  112.91100 101.63400 1.000 74.29000  ? 716 TYR C CZ    1 
ATOM   9028  O  OH    . TYR C 1 471 ? 78.48300  113.54900 102.75000 1.000 74.29000  ? 716 TYR C OH    1 
ATOM   9029  N  N     . ILE C 1 472 ? 82.74400  110.46000 96.31900  1.000 77.41000  ? 717 ILE C N     1 
ATOM   9030  C  CA    . ILE C 1 472 ? 83.47700  109.49300 95.51100  1.000 77.41000  ? 717 ILE C CA    1 
ATOM   9031  C  C     . ILE C 1 472 ? 83.58100  108.22500 96.34700  1.000 77.41000  ? 717 ILE C C     1 
ATOM   9032  O  O     . ILE C 1 472 ? 84.38200  108.15400 97.28700  1.000 77.41000  ? 717 ILE C O     1 
ATOM   9033  C  CB    . ILE C 1 472 ? 84.85800  110.01700 95.09900  1.000 77.41000  ? 717 ILE C CB    1 
ATOM   9034  C  CG1   . ILE C 1 472 ? 84.72400  111.33500 94.33700  1.000 77.41000  ? 717 ILE C CG1   1 
ATOM   9035  C  CG2   . ILE C 1 472 ? 85.57200  109.00200 94.23200  1.000 77.41000  ? 717 ILE C CG2   1 
ATOM   9036  C  CD1   . ILE C 1 472 ? 83.93700  111.21700 93.05400  1.000 77.41000  ? 717 ILE C CD1   1 
ATOM   9037  N  N     . GLU C 1 473 ? 82.77000  107.22200 96.00400  1.000 83.73000  ? 718 GLU C N     1 
ATOM   9038  C  CA    . GLU C 1 473 ? 82.53100  106.11000 96.92000  1.000 83.73000  ? 718 GLU C CA    1 
ATOM   9039  C  C     . GLU C 1 473 ? 83.76300  105.23300 97.11200  1.000 83.73000  ? 718 GLU C C     1 
ATOM   9040  O  O     . GLU C 1 473 ? 83.98100  104.71500 98.21300  1.000 83.73000  ? 718 GLU C O     1 
ATOM   9041  C  CB    . GLU C 1 473 ? 81.35100  105.27000 96.42600  1.000 83.73000  ? 718 GLU C CB    1 
ATOM   9042  C  CG    . GLU C 1 473 ? 81.62300  104.45600 95.16900  1.000 83.73000  ? 718 GLU C CG    1 
ATOM   9043  C  CD    . GLU C 1 473 ? 81.42000  105.25000 93.89500  1.000 83.73000  ? 718 GLU C CD    1 
ATOM   9044  O  OE1   . GLU C 1 473 ? 81.35500  106.49500 93.96900  1.000 83.73000  ? 718 GLU C OE1   1 
ATOM   9045  O  OE2   . GLU C 1 473 ? 81.32700  104.62700 92.81700  1.000 83.73000  ? 718 GLU C OE2   1 
ATOM   9046  N  N     . ASP C 1 474 ? 84.57900  105.05600 96.07500  1.000 85.07000  ? 719 ASP C N     1 
ATOM   9047  C  CA    . ASP C 1 474 ? 85.69000  104.11600 96.15700  1.000 85.07000  ? 719 ASP C CA    1 
ATOM   9048  C  C     . ASP C 1 474 ? 86.86900  104.64500 96.96400  1.000 85.07000  ? 719 ASP C C     1 
ATOM   9049  O  O     . ASP C 1 474 ? 87.88900  103.95400 97.06100  1.000 85.07000  ? 719 ASP C O     1 
ATOM   9050  C  CB    . ASP C 1 474 ? 86.15000  103.71900 94.75000  1.000 85.07000  ? 719 ASP C CB    1 
ATOM   9051  C  CG    . ASP C 1 474 ? 86.64100  104.89900 93.93600  1.000 85.07000  ? 719 ASP C CG    1 
ATOM   9052  O  OD1   . ASP C 1 474 ? 86.58000  106.04100 94.43200  1.000 85.07000  ? 719 ASP C OD1   1 
ATOM   9053  O  OD2   . ASP C 1 474 ? 87.09000  104.68300 92.79100  1.000 85.07000  ? 719 ASP C OD2   1 
ATOM   9054  N  N     . ILE C 1 475 ? 86.76200  105.84400 97.53900  1.000 79.09000  ? 720 ILE C N     1 
ATOM   9055  C  CA    . ILE C 1 475 ? 87.83100  106.34500 98.39400  1.000 79.09000  ? 720 ILE C CA    1 
ATOM   9056  C  C     . ILE C 1 475 ? 87.94600  105.51000 99.66000  1.000 79.09000  ? 720 ILE C C     1 
ATOM   9057  O  O     . ILE C 1 475 ? 89.05500  105.23000 100.13000 1.000 79.09000  ? 720 ILE C O     1 
ATOM   9058  C  CB    . ILE C 1 475 ? 87.59900  107.83100 98.72700  1.000 79.09000  ? 720 ILE C CB    1 
ATOM   9059  C  CG1   . ILE C 1 475 ? 87.68600  108.68700 97.46800  1.000 79.09000  ? 720 ILE C CG1   1 
ATOM   9060  C  CG2   . ILE C 1 475 ? 88.59100  108.31600 99.76000  1.000 79.09000  ? 720 ILE C CG2   1 
ATOM   9061  C  CD1   . ILE C 1 475 ? 87.29300  110.12300 97.70100  1.000 79.09000  ? 720 ILE C CD1   1 
ATOM   9062  N  N     . LEU C 1 476 ? 86.82100  105.08300 100.21900 1.000 81.03000  ? 721 LEU C N     1 
ATOM   9063  C  CA    . LEU C 1 476 ? 86.82100  104.41500 101.51200 1.000 81.03000  ? 721 LEU C CA    1 
ATOM   9064  C  C     . LEU C 1 476 ? 86.72000  102.90100 101.36100 1.000 81.03000  ? 721 LEU C C     1 
ATOM   9065  O  O     . LEU C 1 476 ? 87.10500  102.15100 102.25800 1.000 81.03000  ? 721 LEU C O     1 
ATOM   9066  C  CB    . LEU C 1 476 ? 85.67100  104.94200 102.36700 1.000 81.03000  ? 721 LEU C CB    1 
ATOM   9067  C  CG    . LEU C 1 476 ? 85.72900  106.45000 102.62000 1.000 81.03000  ? 721 LEU C CG    1 
ATOM   9068  C  CD1   . LEU C 1 476 ? 84.52000  106.91900 103.41000 1.000 81.03000  ? 721 LEU C CD1   1 
ATOM   9069  C  CD2   . LEU C 1 476 ? 87.01800  106.83100 103.31700 1.000 81.03000  ? 721 LEU C CD2   1 
ATOM   9070  N  N     . LEU D 1 70  ? 124.08100 123.48500 68.37400  1.000 88.75000  ? 315 LEU D N     1 
ATOM   9071  C  CA    . LEU D 1 70  ? 124.06700 124.59900 69.31200  1.000 88.75000  ? 315 LEU D CA    1 
ATOM   9072  C  C     . LEU D 1 70  ? 123.05000 125.65800 68.90300  1.000 88.75000  ? 315 LEU D C     1 
ATOM   9073  O  O     . LEU D 1 70  ? 123.31800 126.46400 68.01100  1.000 88.75000  ? 315 LEU D O     1 
ATOM   9074  C  CB    . LEU D 1 70  ? 125.45500 125.22600 69.42200  1.000 88.75000  ? 315 LEU D CB    1 
ATOM   9075  C  CG    . LEU D 1 70  ? 126.52400 124.32300 70.03400  1.000 88.75000  ? 315 LEU D CG    1 
ATOM   9076  C  CD1   . LEU D 1 70  ? 127.88300 125.00000 69.99400  1.000 88.75000  ? 315 LEU D CD1   1 
ATOM   9077  C  CD2   . LEU D 1 70  ? 126.14500 123.94300 71.45500  1.000 88.75000  ? 315 LEU D CD2   1 
ATOM   9078  N  N     . PRO D 1 71  ? 121.88900 125.65400 69.55400  1.000 91.98000  ? 316 PRO D N     1 
ATOM   9079  C  CA    . PRO D 1 71  ? 120.87200 126.64200 69.22300  1.000 91.98000  ? 316 PRO D CA    1 
ATOM   9080  C  C     . PRO D 1 71  ? 121.35700 128.03500 69.54800  1.000 91.98000  ? 316 PRO D C     1 
ATOM   9081  O  O     . PRO D 1 71  ? 122.10900 128.24500 70.52000  1.000 91.98000  ? 316 PRO D O     1 
ATOM   9082  C  CB    . PRO D 1 71  ? 119.68500 126.23300 70.10700  1.000 91.98000  ? 316 PRO D CB    1 
ATOM   9083  C  CG    . PRO D 1 71  ? 120.29600 125.50300 71.24100  1.000 91.98000  ? 316 PRO D CG    1 
ATOM   9084  C  CD    . PRO D 1 71  ? 121.48000 124.78500 70.67000  1.000 91.98000  ? 316 PRO D CD    1 
ATOM   9085  N  N     . PRO D 1 72  ? 120.96200 129.02900 68.76000  1.000 92.62000  ? 317 PRO D N     1 
ATOM   9086  C  CA    . PRO D 1 72  ? 121.48100 130.38300 68.95400  1.000 92.62000  ? 317 PRO D CA    1 
ATOM   9087  C  C     . PRO D 1 72  ? 120.80700 131.09400 70.11400  1.000 92.62000  ? 317 PRO D C     1 
ATOM   9088  O  O     . PRO D 1 72  ? 119.67600 130.78800 70.49700  1.000 92.62000  ? 317 PRO D O     1 
ATOM   9089  C  CB    . PRO D 1 72  ? 121.15500 131.07500 67.62400  1.000 92.62000  ? 317 PRO D CB    1 
ATOM   9090  C  CG    . PRO D 1 72  ? 119.94000 130.36200 67.13800  1.000 92.62000  ? 317 PRO D CG    1 
ATOM   9091  C  CD    . PRO D 1 72  ? 120.09100 128.93100 67.57400  1.000 92.62000  ? 317 PRO D CD    1 
ATOM   9092  N  N     . LEU D 1 73  ? 121.53300 132.06200 70.67400  1.000 93.13000  ? 318 LEU D N     1 
ATOM   9093  C  CA    . LEU D 1 73  ? 120.99200 132.88300 71.74900  1.000 93.13000  ? 318 LEU D CA    1 
ATOM   9094  C  C     . LEU D 1 73  ? 119.85000 133.77600 71.28900  1.000 93.13000  ? 318 LEU D C     1 
ATOM   9095  O  O     . LEU D 1 73  ? 119.17200 134.36800 72.13500  1.000 93.13000  ? 318 LEU D O     1 
ATOM   9096  C  CB    . LEU D 1 73  ? 122.09900 133.73400 72.36500  1.000 93.13000  ? 318 LEU D CB    1 
ATOM   9097  C  CG    . LEU D 1 73  ? 123.19700 132.91400 73.03500  1.000 93.13000  ? 318 LEU D CG    1 
ATOM   9098  C  CD1   . LEU D 1 73  ? 124.29100 133.81300 73.58200  1.000 93.13000  ? 318 LEU D CD1   1 
ATOM   9099  C  CD2   . LEU D 1 73  ? 122.60600 132.04000 74.12000  1.000 93.13000  ? 318 LEU D CD2   1 
ATOM   9100  N  N     . SER D 1 74  ? 119.63200 133.90400 69.97800  1.000 98.11000  ? 319 SER D N     1 
ATOM   9101  C  CA    . SER D 1 74  ? 118.46700 134.63400 69.49500  1.000 98.11000  ? 319 SER D CA    1 
ATOM   9102  C  C     . SER D 1 74  ? 117.17600 134.00900 70.00100  1.000 98.11000  ? 319 SER D C     1 
ATOM   9103  O  O     . SER D 1 74  ? 116.17500 134.71000 70.18300  1.000 98.11000  ? 319 SER D O     1 
ATOM   9104  C  CB    . SER D 1 74  ? 118.47800 134.68300 67.96800  1.000 98.11000  ? 319 SER D CB    1 
ATOM   9105  O  OG    . SER D 1 74  ? 119.60600 135.39800 67.49400  1.000 98.11000  ? 319 SER D OG    1 
ATOM   9106  N  N     . LEU D 1 75  ? 117.18100 132.69400 70.23700  1.000 96.46000  ? 320 LEU D N     1 
ATOM   9107  C  CA    . LEU D 1 75  ? 116.05000 132.05200 70.89600  1.000 96.46000  ? 320 LEU D CA    1 
ATOM   9108  C  C     . LEU D 1 75  ? 115.86400 132.57800 72.31100  1.000 96.46000  ? 320 LEU D C     1 
ATOM   9109  O  O     . LEU D 1 75  ? 114.74600 132.56600 72.83900  1.000 96.46000  ? 320 LEU D O     1 
ATOM   9110  C  CB    . LEU D 1 75  ? 116.25000 130.53800 70.92000  1.000 96.46000  ? 320 LEU D CB    1 
ATOM   9111  C  CG    . LEU D 1 75  ? 116.27600 129.83300 69.56400  1.000 96.46000  ? 320 LEU D CG    1 
ATOM   9112  C  CD1   . LEU D 1 75  ? 116.66100 128.37500 69.73300  1.000 96.46000  ? 320 LEU D CD1   1 
ATOM   9113  C  CD2   . LEU D 1 75  ? 114.93000 129.95600 68.86900  1.000 96.46000  ? 320 LEU D CD2   1 
ATOM   9114  N  N     . LEU D 1 76  ? 116.94100 133.04700 72.93300  1.000 93.86000  ? 321 LEU D N     1 
ATOM   9115  C  CA    . LEU D 1 76  ? 116.89000 133.53600 74.30200  1.000 93.86000  ? 321 LEU D CA    1 
ATOM   9116  C  C     . LEU D 1 76  ? 116.47300 135.00000 74.32500  1.000 93.86000  ? 321 LEU D C     1 
ATOM   9117  O  O     . LEU D 1 76  ? 116.80400 135.76800 73.41700  1.000 93.86000  ? 321 LEU D O     1 
ATOM   9118  C  CB    . LEU D 1 76  ? 118.25300 133.34300 74.96600  1.000 93.86000  ? 321 LEU D CB    1 
ATOM   9119  C  CG    . LEU D 1 76  ? 118.49300 133.76300 76.41000  1.000 93.86000  ? 321 LEU D CG    1 
ATOM   9120  C  CD1   . LEU D 1 76  ? 117.52500 133.07300 77.33000  1.000 93.86000  ? 321 LEU D CD1   1 
ATOM   9121  C  CD2   . LEU D 1 76  ? 119.91200 133.38900 76.78300  1.000 93.86000  ? 321 LEU D CD2   1 
ATOM   9122  N  N     . ASP D 1 77  ? 115.73400 135.37700 75.36300  1.000 98.50000  ? 322 ASP D N     1 
ATOM   9123  C  CA    . ASP D 1 77  ? 115.15100 136.71100 75.46300  1.000 98.50000  ? 322 ASP D CA    1 
ATOM   9124  C  C     . ASP D 1 77  ? 116.23400 137.78100 75.39600  1.000 98.50000  ? 322 ASP D C     1 
ATOM   9125  O  O     . ASP D 1 77  ? 117.11600 137.81200 76.26700  1.000 98.50000  ? 322 ASP D O     1 
ATOM   9126  C  CB    . ASP D 1 77  ? 114.36300 136.84600 76.76200  1.000 98.50000  ? 322 ASP D CB    1 
ATOM   9127  C  CG    . ASP D 1 77  ? 113.12300 135.97800 76.78300  1.000 98.50000  ? 322 ASP D CG    1 
ATOM   9128  O  OD1   . ASP D 1 77  ? 112.57900 135.69400 75.69600  1.000 98.50000  ? 322 ASP D OD1   1 
ATOM   9129  O  OD2   . ASP D 1 77  ? 112.68900 135.58400 77.88500  1.000 98.50000  ? 322 ASP D OD2   1 
ATOM   9130  N  N     . PRO D 1 78  ? 116.20400 138.67200 74.40500  1.000 105.44000 ? 323 PRO D N     1 
ATOM   9131  C  CA    . PRO D 1 78  ? 117.29400 139.64000 74.24600  1.000 105.44000 ? 323 PRO D CA    1 
ATOM   9132  C  C     . PRO D 1 78  ? 117.37200 140.60500 75.41900  1.000 105.44000 ? 323 PRO D C     1 
ATOM   9133  O  O     . PRO D 1 78  ? 116.44800 140.72900 76.22700  1.000 105.44000 ? 323 PRO D O     1 
ATOM   9134  C  CB    . PRO D 1 78  ? 116.93400 140.37200 72.94800  1.000 105.44000 ? 323 PRO D CB    1 
ATOM   9135  C  CG    . PRO D 1 78  ? 115.45100 140.24300 72.85000  1.000 105.44000 ? 323 PRO D CG    1 
ATOM   9136  C  CD    . PRO D 1 78  ? 115.11800 138.89500 73.43500  1.000 105.44000 ? 323 PRO D CD    1 
ATOM   9137  N  N     . ALA D 1 79  ? 118.50800 141.29300 75.50600  1.000 111.28000 ? 324 ALA D N     1 
ATOM   9138  C  CA    . ALA D 1 79  ? 118.70200 142.28700 76.55000  1.000 111.28000 ? 324 ALA D CA    1 
ATOM   9139  C  C     . ALA D 1 79  ? 117.71800 143.43400 76.36000  1.000 111.28000 ? 324 ALA D C     1 
ATOM   9140  O  O     . ALA D 1 79  ? 117.50800 143.90700 75.23900  1.000 111.28000 ? 324 ALA D O     1 
ATOM   9141  C  CB    . ALA D 1 79  ? 120.13900 142.80500 76.53300  1.000 111.28000 ? 324 ALA D CB    1 
ATOM   9142  N  N     . GLU D 1 80  ? 117.11400 143.87800 77.45400  1.000 113.35000 ? 325 GLU D N     1 
ATOM   9143  C  CA    . GLU D 1 80  ? 116.09700 144.91500 77.41000  1.000 113.35000 ? 325 GLU D CA    1 
ATOM   9144  C  C     . GLU D 1 80  ? 116.70000 146.27200 77.75500  1.000 113.35000 ? 325 GLU D C     1 
ATOM   9145  O  O     . GLU D 1 80  ? 117.83800 146.37800 78.22000  1.000 113.35000 ? 325 GLU D O     1 
ATOM   9146  C  CB    . GLU D 1 80  ? 114.94700 144.58000 78.36400  1.000 113.35000 ? 325 GLU D CB    1 
ATOM   9147  C  CG    . GLU D 1 80  ? 115.33700 144.58400 79.83300  1.000 113.35000 ? 325 GLU D CG    1 
ATOM   9148  C  CD    . GLU D 1 80  ? 114.19100 144.17900 80.73900  1.000 113.35000 ? 325 GLU D CD    1 
ATOM   9149  O  OE1   . GLU D 1 80  ? 113.10000 143.86700 80.21800  1.000 113.35000 ? 325 GLU D OE1   1 
ATOM   9150  O  OE2   . GLU D 1 80  ? 114.38100 144.17200 81.97300  1.000 113.35000 ? 325 GLU D OE2   1 
ATOM   9151  N  N     . VAL D 1 81  ? 115.91300 147.32200 77.50600  1.000 115.40000 ? 326 VAL D N     1 
ATOM   9152  C  CA    . VAL D 1 81  ? 116.34800 148.67500 77.82000  1.000 115.40000 ? 326 VAL D CA    1 
ATOM   9153  C  C     . VAL D 1 81  ? 116.63500 148.78000 79.31600  1.000 115.40000 ? 326 VAL D C     1 
ATOM   9154  O  O     . VAL D 1 81  ? 115.97700 148.14300 80.14700  1.000 115.40000 ? 326 VAL D O     1 
ATOM   9155  C  CB    . VAL D 1 81  ? 115.28200 149.69500 77.38200  1.000 115.40000 ? 326 VAL D CB    1 
ATOM   9156  C  CG1   . VAL D 1 81  ? 115.70500 151.11800 77.73000  1.000 115.40000 ? 326 VAL D CG1   1 
ATOM   9157  C  CG2   . VAL D 1 81  ? 115.00500 149.56500 75.89200  1.000 115.40000 ? 326 VAL D CG2   1 
ATOM   9158  N  N     . LYS D 1 82  ? 117.63900 149.58200 79.66000  1.000 112.28000 ? 327 LYS D N     1 
ATOM   9159  C  CA    . LYS D 1 82  ? 118.08000 149.72100 81.04300  1.000 112.28000 ? 327 LYS D CA    1 
ATOM   9160  C  C     . LYS D 1 82  ? 117.18800 150.72200 81.76700  1.000 112.28000 ? 327 LYS D C     1 
ATOM   9161  O  O     . LYS D 1 82  ? 117.32900 151.93500 81.58000  1.000 112.28000 ? 327 LYS D O     1 
ATOM   9162  C  CB    . LYS D 1 82  ? 119.53900 150.16800 81.09600  1.000 112.28000 ? 327 LYS D CB    1 
ATOM   9163  C  CG    . LYS D 1 82  ? 120.55800 149.08900 80.77400  1.000 112.28000 ? 327 LYS D CG    1 
ATOM   9164  C  CD    . LYS D 1 82  ? 120.85000 149.02300 79.28500  1.000 112.28000 ? 327 LYS D CD    1 
ATOM   9165  C  CE    . LYS D 1 82  ? 122.03500 148.11700 79.00200  1.000 112.28000 ? 327 LYS D CE    1 
ATOM   9166  N  NZ    . LYS D 1 82  ? 121.75600 146.70200 79.36900  1.000 112.28000 ? 327 LYS D NZ    1 
ATOM   9167  N  N     . GLN D 1 83  ? 116.26900 150.22600 82.59500  1.000 113.69000 ? 328 GLN D N     1 
ATOM   9168  C  CA    . GLN D 1 83  ? 115.55200 151.06600 83.54900  1.000 113.69000 ? 328 GLN D CA    1 
ATOM   9169  C  C     . GLN D 1 83  ? 116.31300 150.99600 84.87200  1.000 113.69000 ? 328 GLN D C     1 
ATOM   9170  O  O     . GLN D 1 83  ? 116.39200 149.93600 85.50200  1.000 113.69000 ? 328 GLN D O     1 
ATOM   9171  C  CB    . GLN D 1 83  ? 114.08400 150.65200 83.69200  1.000 113.69000 ? 328 GLN D CB    1 
ATOM   9172  C  CG    . GLN D 1 83  ? 113.80000 149.28400 84.31000  1.000 113.69000 ? 328 GLN D CG    1 
ATOM   9173  C  CD    . GLN D 1 83  ? 113.72500 148.17400 83.28400  1.000 113.69000 ? 328 GLN D CD    1 
ATOM   9174  O  OE1   . GLN D 1 83  ? 114.14000 148.34200 82.14000  1.000 113.69000 ? 328 GLN D OE1   1 
ATOM   9175  N  NE2   . GLN D 1 83  ? 113.19300 147.02700 83.69000  1.000 113.69000 ? 328 GLN D NE2   1 
ATOM   9176  N  N     . LYS D 1 84  ? 116.90700 152.11500 85.26900  1.000 111.12000 ? 329 LYS D N     1 
ATOM   9177  C  CA    . LYS D 1 84  ? 117.82100 152.13000 86.40400  1.000 111.12000 ? 329 LYS D CA    1 
ATOM   9178  C  C     . LYS D 1 84  ? 117.96800 153.56900 86.88800  1.000 111.12000 ? 329 LYS D C     1 
ATOM   9179  O  O     . LYS D 1 84  ? 117.20000 154.45700 86.50100  1.000 111.12000 ? 329 LYS D O     1 
ATOM   9180  C  CB    . LYS D 1 84  ? 119.17200 151.50400 86.03000  1.000 111.12000 ? 329 LYS D CB    1 
ATOM   9181  C  CG    . LYS D 1 84  ? 120.10900 152.39700 85.21600  1.000 111.12000 ? 329 LYS D CG    1 
ATOM   9182  C  CD    . LYS D 1 84  ? 119.68100 152.53800 83.76800  1.000 111.12000 ? 329 LYS D CD    1 
ATOM   9183  C  CE    . LYS D 1 84  ? 120.77900 153.17900 82.93700  1.000 111.12000 ? 329 LYS D CE    1 
ATOM   9184  N  NZ    . LYS D 1 84  ? 120.33800 153.44900 81.54200  1.000 111.12000 ? 329 LYS D NZ    1 
ATOM   9185  N  N     . SER D 1 85  ? 118.95800 153.79500 87.74200  1.000 107.19000 ? 330 SER D N     1 
ATOM   9186  C  CA    . SER D 1 85  ? 119.21900 155.09500 88.34300  1.000 107.19000 ? 330 SER D CA    1 
ATOM   9187  C  C     . SER D 1 85  ? 120.72600 155.21500 88.54400  1.000 107.19000 ? 330 SER D C     1 
ATOM   9188  O  O     . SER D 1 85  ? 121.50700 154.52100 87.88400  1.000 107.19000 ? 330 SER D O     1 
ATOM   9189  C  CB    . SER D 1 85  ? 118.41700 155.26200 89.64500  1.000 107.19000 ? 330 SER D CB    1 
ATOM   9190  O  OG    . SER D 1 85  ? 118.68200 156.52000 90.24100  1.000 107.19000 ? 330 SER D OG    1 
ATOM   9191  N  N     . TYR D 1 86  ? 121.13300 156.12300 89.43300  1.000 100.17000 ? 331 TYR D N     1 
ATOM   9192  C  CA    . TYR D 1 86  ? 122.54200 156.36300 89.75600  1.000 100.17000 ? 331 TYR D CA    1 
ATOM   9193  C  C     . TYR D 1 86  ? 123.30200 156.97400 88.57800  1.000 100.17000 ? 331 TYR D C     1 
ATOM   9194  O  O     . TYR D 1 86  ? 124.34400 156.47400 88.15300  1.000 100.17000 ? 331 TYR D O     1 
ATOM   9195  C  CB    . TYR D 1 86  ? 123.23000 155.08700 90.24700  1.000 100.17000 ? 331 TYR D CB    1 
ATOM   9196  C  CG    . TYR D 1 86  ? 122.79600 154.65500 91.62600  1.000 100.17000 ? 331 TYR D CG    1 
ATOM   9197  C  CD1   . TYR D 1 86  ? 122.09500 155.51800 92.45600  1.000 100.17000 ? 331 TYR D CD1   1 
ATOM   9198  C  CD2   . TYR D 1 86  ? 123.09500 153.38700 92.10200  1.000 100.17000 ? 331 TYR D CD2   1 
ATOM   9199  C  CE1   . TYR D 1 86  ? 121.69800 155.13000 93.71700  1.000 100.17000 ? 331 TYR D CE1   1 
ATOM   9200  C  CE2   . TYR D 1 86  ? 122.70500 152.99100 93.36200  1.000 100.17000 ? 331 TYR D CE2   1 
ATOM   9201  C  CZ    . TYR D 1 86  ? 122.00600 153.86400 94.16500  1.000 100.17000 ? 331 TYR D CZ    1 
ATOM   9202  O  OH    . TYR D 1 86  ? 121.61500 153.47000 95.42300  1.000 100.17000 ? 331 TYR D OH    1 
ATOM   9203  N  N     . SER D 1 87  ? 122.75900 158.06600 88.05100  1.000 103.31000 ? 332 SER D N     1 
ATOM   9204  C  CA    . SER D 1 87  ? 123.55200 158.99600 87.27400  1.000 103.31000 ? 332 SER D CA    1 
ATOM   9205  C  C     . SER D 1 87  ? 124.54400 159.68000 88.21400  1.000 103.31000 ? 332 SER D C     1 
ATOM   9206  O  O     . SER D 1 87  ? 124.28900 159.78500 89.41600  1.000 103.31000 ? 332 SER D O     1 
ATOM   9207  C  CB    . SER D 1 87  ? 122.63700 160.01500 86.59500  1.000 103.31000 ? 332 SER D CB    1 
ATOM   9208  O  OG    . SER D 1 87  ? 123.35300 160.96400 85.82500  1.000 103.31000 ? 332 SER D OG    1 
ATOM   9209  N  N     . PRO D 1 88  ? 125.68700 160.14800 87.69900  1.000 101.66000 ? 333 PRO D N     1 
ATOM   9210  C  CA    . PRO D 1 88  ? 126.72700 160.69400 88.59200  1.000 101.66000 ? 333 PRO D CA    1 
ATOM   9211  C  C     . PRO D 1 88  ? 126.25400 161.79300 89.53700  1.000 101.66000 ? 333 PRO D C     1 
ATOM   9212  O  O     . PRO D 1 88  ? 127.02800 162.19700 90.41400  1.000 101.66000 ? 333 PRO D O     1 
ATOM   9213  C  CB    . PRO D 1 88  ? 127.78500 161.22200 87.61300  1.000 101.66000 ? 333 PRO D CB    1 
ATOM   9214  C  CG    . PRO D 1 88  ? 127.63000 160.35400 86.42200  1.000 101.66000 ? 333 PRO D CG    1 
ATOM   9215  C  CD    . PRO D 1 88  ? 126.16100 160.06500 86.30500  1.000 101.66000 ? 333 PRO D CD    1 
ATOM   9216  N  N     . GLU D 1 89  ? 125.02400 162.28900 89.39800  1.000 99.65000  ? 334 GLU D N     1 
ATOM   9217  C  CA    . GLU D 1 89  ? 124.47200 163.17300 90.41800  1.000 99.65000  ? 334 GLU D CA    1 
ATOM   9218  C  C     . GLU D 1 89  ? 123.98300 162.37700 91.62100  1.000 99.65000  ? 334 GLU D C     1 
ATOM   9219  O  O     . GLU D 1 89  ? 124.33600 162.68500 92.76700  1.000 99.65000  ? 334 GLU D O     1 
ATOM   9220  C  CB    . GLU D 1 89  ? 123.33300 164.01300 89.83600  1.000 99.65000  ? 334 GLU D CB    1 
ATOM   9221  C  CG    . GLU D 1 89  ? 123.76500 165.02000 88.78300  1.000 99.65000  ? 334 GLU D CG    1 
ATOM   9222  C  CD    . GLU D 1 89  ? 123.83700 164.42000 87.39300  1.000 99.65000  ? 334 GLU D CD    1 
ATOM   9223  O  OE1   . GLU D 1 89  ? 123.47200 163.23600 87.23400  1.000 99.65000  ? 334 GLU D OE1   1 
ATOM   9224  O  OE2   . GLU D 1 89  ? 124.25800 165.13400 86.45900  1.000 99.65000  ? 334 GLU D OE2   1 
ATOM   9225  N  N     . SER D 1 90  ? 123.16400 161.35000 91.37300  1.000 96.31000  ? 335 SER D N     1 
ATOM   9226  C  CA    . SER D 1 90  ? 122.62500 160.53900 92.45800  1.000 96.31000  ? 335 SER D CA    1 
ATOM   9227  C  C     . SER D 1 90  ? 123.72400 159.81900 93.22500  1.000 96.31000  ? 335 SER D C     1 
ATOM   9228  O  O     . SER D 1 90  ? 123.61200 159.64300 94.44100  1.000 96.31000  ? 335 SER D O     1 
ATOM   9229  C  CB    . SER D 1 90  ? 121.61600 159.53000 91.91000  1.000 96.31000  ? 335 SER D CB    1 
ATOM   9230  O  OG    . SER D 1 90  ? 121.10200 158.71100 92.94600  1.000 96.31000  ? 335 SER D OG    1 
ATOM   9231  N  N     . LEU D 1 91  ? 124.79000 159.40000 92.54000  1.000 93.38000  ? 336 LEU D N     1 
ATOM   9232  C  CA    . LEU D 1 91  ? 125.88500 158.71200 93.21700  1.000 93.38000  ? 336 LEU D CA    1 
ATOM   9233  C  C     . LEU D 1 91  ? 126.54100 159.60900 94.25800  1.000 93.38000  ? 336 LEU D C     1 
ATOM   9234  O  O     . LEU D 1 91  ? 126.67700 159.22700 95.42700  1.000 93.38000  ? 336 LEU D O     1 
ATOM   9235  C  CB    . LEU D 1 91  ? 126.91600 158.23600 92.19500  1.000 93.38000  ? 336 LEU D CB    1 
ATOM   9236  C  CG    . LEU D 1 91  ? 126.46500 157.11600 91.26300  1.000 93.38000  ? 336 LEU D CG    1 
ATOM   9237  C  CD1   . LEU D 1 91  ? 127.51100 156.86400 90.19000  1.000 93.38000  ? 336 LEU D CD1   1 
ATOM   9238  C  CD2   . LEU D 1 91  ? 126.20400 155.85600 92.06800  1.000 93.38000  ? 336 LEU D CD2   1 
ATOM   9239  N  N     . GLU D 1 92  ? 126.96400 160.80600 93.85000  1.000 90.16000  ? 337 GLU D N     1 
ATOM   9240  C  CA    . GLU D 1 92  ? 127.59100 161.71900 94.79500  1.000 90.16000  ? 337 GLU D CA    1 
ATOM   9241  C  C     . GLU D 1 92  ? 126.61100 162.20300 95.85400  1.000 90.16000  ? 337 GLU D C     1 
ATOM   9242  O  O     . GLU D 1 92  ? 127.01600 162.41200 97.00300  1.000 90.16000  ? 337 GLU D O     1 
ATOM   9243  C  CB    . GLU D 1 92  ? 128.20500 162.90700 94.05500  1.000 90.16000  ? 337 GLU D CB    1 
ATOM   9244  C  CG    . GLU D 1 92  ? 129.00700 163.84100 94.94200  1.000 90.16000  ? 337 GLU D CG    1 
ATOM   9245  C  CD    . GLU D 1 92  ? 129.67900 164.94800 94.15700  1.000 90.16000  ? 337 GLU D CD    1 
ATOM   9246  O  OE1   . GLU D 1 92  ? 129.48900 165.00100 92.92500  1.000 90.16000  ? 337 GLU D OE1   1 
ATOM   9247  O  OE2   . GLU D 1 92  ? 130.40300 165.75900 94.77100  1.000 90.16000  ? 337 GLU D OE2   1 
ATOM   9248  N  N     . ALA D 1 93  ? 125.33200 162.36000 95.50500  1.000 87.17000  ? 338 ALA D N     1 
ATOM   9249  C  CA    . ALA D 1 93  ? 124.33800 162.71600 96.51100  1.000 87.17000  ? 338 ALA D CA    1 
ATOM   9250  C  C     . ALA D 1 93  ? 124.22900 161.63100 97.57600  1.000 87.17000  ? 338 ALA D C     1 
ATOM   9251  O  O     . ALA D 1 93  ? 124.21000 161.92500 98.77600  1.000 87.17000  ? 338 ALA D O     1 
ATOM   9252  C  CB    . ALA D 1 93  ? 122.98400 162.96300 95.84700  1.000 87.17000  ? 338 ALA D CB    1 
ATOM   9253  N  N     . MET D 1 94  ? 124.17200 160.36600 97.15300  1.000 82.25000  ? 339 MET D N     1 
ATOM   9254  C  CA    . MET D 1 94  ? 124.08300 159.26500 98.10400  1.000 82.25000  ? 339 MET D CA    1 
ATOM   9255  C  C     . MET D 1 94  ? 125.35400 159.14600 98.93400  1.000 82.25000  ? 339 MET D C     1 
ATOM   9256  O  O     . MET D 1 94  ? 125.29500 158.81300 100.12100 1.000 82.25000  ? 339 MET D O     1 
ATOM   9257  C  CB    . MET D 1 94  ? 123.79800 157.95900 97.36400  1.000 82.25000  ? 339 MET D CB    1 
ATOM   9258  C  CG    . MET D 1 94  ? 123.50400 156.77700 98.27100  1.000 82.25000  ? 339 MET D CG    1 
ATOM   9259  S  SD    . MET D 1 94  ? 121.96000 156.95700 99.18300  1.000 82.25000  ? 339 MET D SD    1 
ATOM   9260  C  CE    . MET D 1 94  ? 122.25100 155.85800 100.56500 1.000 82.25000  ? 339 MET D CE    1 
ATOM   9261  N  N     . SER D 1 95  ? 126.51400 159.42400 98.33500  1.000 80.38000  ? 340 SER D N     1 
ATOM   9262  C  CA    . SER D 1 95  ? 127.75700 159.32200 99.09400  1.000 80.38000  ? 340 SER D CA    1 
ATOM   9263  C  C     . SER D 1 95  ? 127.85500 160.42500 100.14200 1.000 80.38000  ? 340 SER D C     1 
ATOM   9264  O  O     . SER D 1 95  ? 128.26100 160.17200 101.28400 1.000 80.38000  ? 340 SER D O     1 
ATOM   9265  C  CB    . SER D 1 95  ? 128.95800 159.36700 98.15000  1.000 80.38000  ? 340 SER D CB    1 
ATOM   9266  O  OG    . SER D 1 95  ? 129.07200 160.63500 97.53200  1.000 80.38000  ? 340 SER D OG    1 
ATOM   9267  N  N     . ARG D 1 96  ? 127.47000 161.65200 99.78300  1.000 80.66000  ? 341 ARG D N     1 
ATOM   9268  C  CA    . ARG D 1 96  ? 127.45600 162.72100 100.77400 1.000 80.66000  ? 341 ARG D CA    1 
ATOM   9269  C  C     . ARG D 1 96  ? 126.38700 162.48600 101.83100 1.000 80.66000  ? 341 ARG D C     1 
ATOM   9270  O  O     . ARG D 1 96  ? 126.57300 162.86800 102.99100 1.000 80.66000  ? 341 ARG D O     1 
ATOM   9271  C  CB    . ARG D 1 96  ? 127.24800 164.07300 100.09500 1.000 80.66000  ? 341 ARG D CB    1 
ATOM   9272  C  CG    . ARG D 1 96  ? 128.42500 164.52200 99.25600  1.000 80.66000  ? 341 ARG D CG    1 
ATOM   9273  C  CD    . ARG D 1 96  ? 128.16400 165.88100 98.63800  1.000 80.66000  ? 341 ARG D CD    1 
ATOM   9274  N  NE    . ARG D 1 96  ? 129.28500 166.32900 97.81800  1.000 80.66000  ? 341 ARG D NE    1 
ATOM   9275  C  CZ    . ARG D 1 96  ? 129.30500 167.46900 97.13600  1.000 80.66000  ? 341 ARG D CZ    1 
ATOM   9276  N  NH1   . ARG D 1 96  ? 128.26200 168.28700 97.17400  1.000 80.66000  ? 341 ARG D NH1   1 
ATOM   9277  N  NH2   . ARG D 1 96  ? 130.37100 167.79300 96.41700  1.000 80.66000  ? 341 ARG D NH2   1 
ATOM   9278  N  N     . LEU D 1 97  ? 125.27100 161.85600 101.45500 1.000 75.63000  ? 342 LEU D N     1 
ATOM   9279  C  CA    . LEU D 1 97  ? 124.26300 161.48400 102.44000 1.000 75.63000  ? 342 LEU D CA    1 
ATOM   9280  C  C     . LEU D 1 97  ? 124.81600 160.45800 103.41800 1.000 75.63000  ? 342 LEU D C     1 
ATOM   9281  O  O     . LEU D 1 97  ? 124.59100 160.55700 104.62900 1.000 75.63000  ? 342 LEU D O     1 
ATOM   9282  C  CB    . LEU D 1 97  ? 123.02500 160.93500 101.73500 1.000 75.63000  ? 342 LEU D CB    1 
ATOM   9283  C  CG    . LEU D 1 97  ? 121.82500 160.63000 102.62700 1.000 75.63000  ? 342 LEU D CG    1 
ATOM   9284  C  CD1   . LEU D 1 97  ? 121.30200 161.92200 103.22600 1.000 75.63000  ? 342 LEU D CD1   1 
ATOM   9285  C  CD2   . LEU D 1 97  ? 120.73600 159.91200 101.84600 1.000 75.63000  ? 342 LEU D CD2   1 
ATOM   9286  N  N     . LEU D 1 98  ? 125.54000 159.46300 102.90500 1.000 72.80000  ? 343 LEU D N     1 
ATOM   9287  C  CA    . LEU D 1 98  ? 126.20700 158.49400 103.76700 1.000 72.80000  ? 343 LEU D CA    1 
ATOM   9288  C  C     . LEU D 1 98  ? 127.15500 159.19000 104.73400 1.000 72.80000  ? 343 LEU D C     1 
ATOM   9289  O  O     . LEU D 1 98  ? 127.15400 158.90400 105.93600 1.000 72.80000  ? 343 LEU D O     1 
ATOM   9290  C  CB    . LEU D 1 98  ? 126.96100 157.47400 102.91600 1.000 72.80000  ? 343 LEU D CB    1 
ATOM   9291  C  CG    . LEU D 1 98  ? 127.66600 156.35400 103.67700 1.000 72.80000  ? 343 LEU D CG    1 
ATOM   9292  C  CD1   . LEU D 1 98  ? 126.65100 155.49600 104.40100 1.000 72.80000  ? 343 LEU D CD1   1 
ATOM   9293  C  CD2   . LEU D 1 98  ? 128.50100 155.51600 102.73000 1.000 72.80000  ? 343 LEU D CD2   1 
ATOM   9294  N  N     . GLU D 1 99  ? 127.98100 160.10400 104.22100 1.000 73.71000  ? 344 GLU D N     1 
ATOM   9295  C  CA    . GLU D 1 99  ? 128.89700 160.84000 105.08700 1.000 73.71000  ? 344 GLU D CA    1 
ATOM   9296  C  C     . GLU D 1 99  ? 128.14500 161.58600 106.18300 1.000 73.71000  ? 344 GLU D C     1 
ATOM   9297  O  O     . GLU D 1 99  ? 128.39200 161.37900 107.37600 1.000 73.71000  ? 344 GLU D O     1 
ATOM   9298  C  CB    . GLU D 1 99  ? 129.74800 161.80900 104.26600 1.000 73.71000  ? 344 GLU D CB    1 
ATOM   9299  C  CG    . GLU D 1 99  ? 130.78500 161.14400 103.38600 1.000 73.71000  ? 344 GLU D CG    1 
ATOM   9300  C  CD    . GLU D 1 99  ? 131.63600 162.14900 102.63700 1.000 73.71000  ? 344 GLU D CD    1 
ATOM   9301  O  OE1   . GLU D 1 99  ? 131.32700 163.35700 102.70100 1.000 73.71000  ? 344 GLU D OE1   1 
ATOM   9302  O  OE2   . GLU D 1 99  ? 132.62000 161.73300 101.99200 1.000 73.71000  ? 344 GLU D OE2   1 
ATOM   9303  N  N     . ILE D 1 100 ? 127.20900 162.46100 105.79700 1.000 69.87000  ? 345 ILE D N     1 
ATOM   9304  C  CA    . ILE D 1 100 ? 126.55800 163.33800 106.77000 1.000 69.87000  ? 345 ILE D CA    1 
ATOM   9305  C  C     . ILE D 1 100 ? 125.47500 162.64400 107.57700 1.000 69.87000  ? 345 ILE D C     1 
ATOM   9306  O  O     . ILE D 1 100 ? 124.85200 163.28800 108.43000 1.000 69.87000  ? 345 ILE D O     1 
ATOM   9307  C  CB    . ILE D 1 100 ? 125.93400 164.58100 106.10600 1.000 69.87000  ? 345 ILE D CB    1 
ATOM   9308  C  CG1   . ILE D 1 100 ? 124.78400 164.17700 105.18600 1.000 69.87000  ? 345 ILE D CG1   1 
ATOM   9309  C  CG2   . ILE D 1 100 ? 126.99000 165.35900 105.33600 1.000 69.87000  ? 345 ILE D CG2   1 
ATOM   9310  C  CD1   . ILE D 1 100 ? 123.97700 165.34900 104.67800 1.000 69.87000  ? 345 ILE D CD1   1 
ATOM   9311  N  N     . LYS D 1 101 ? 125.21300 161.35900 107.33200 1.000 66.13000  ? 346 LYS D N     1 
ATOM   9312  C  CA    . LYS D 1 101 ? 124.38400 160.57400 108.23400 1.000 66.13000  ? 346 LYS D CA    1 
ATOM   9313  C  C     . LYS D 1 101 ? 125.17900 159.54900 109.02200 1.000 66.13000  ? 346 LYS D C     1 
ATOM   9314  O  O     . LYS D 1 101 ? 124.61900 158.91100 109.92000 1.000 66.13000  ? 346 LYS D O     1 
ATOM   9315  C  CB    . LYS D 1 101 ? 123.26200 159.86300 107.46500 1.000 66.13000  ? 346 LYS D CB    1 
ATOM   9316  C  CG    . LYS D 1 101 ? 122.21000 160.80400 106.91600 1.000 66.13000  ? 346 LYS D CG    1 
ATOM   9317  C  CD    . LYS D 1 101 ? 121.11200 160.04300 106.20800 1.000 66.13000  ? 346 LYS D CD    1 
ATOM   9318  C  CE    . LYS D 1 101 ? 120.23800 159.31500 107.20700 1.000 66.13000  ? 346 LYS D CE    1 
ATOM   9319  N  NZ    . LYS D 1 101 ? 119.45600 160.26700 108.04300 1.000 66.13000  ? 346 LYS D NZ    1 
ATOM   9320  N  N     . LEU D 1 102 ? 126.46000 159.37500 108.71100 1.000 63.02000  ? 347 LEU D N     1 
ATOM   9321  C  CA    . LEU D 1 102 ? 127.36600 158.60200 109.54200 1.000 63.02000  ? 347 LEU D CA    1 
ATOM   9322  C  C     . LEU D 1 102 ? 128.24100 159.49800 110.40700 1.000 63.02000  ? 347 LEU D C     1 
ATOM   9323  O  O     . LEU D 1 102 ? 128.86900 159.00900 111.35100 1.000 63.02000  ? 347 LEU D O     1 
ATOM   9324  C  CB    . LEU D 1 102 ? 128.23500 157.69500 108.66400 1.000 63.02000  ? 347 LEU D CB    1 
ATOM   9325  C  CG    . LEU D 1 102 ? 129.13500 156.65700 109.32800 1.000 63.02000  ? 347 LEU D CG    1 
ATOM   9326  C  CD1   . LEU D 1 102 ? 128.30700 155.67400 110.12600 1.000 63.02000  ? 347 LEU D CD1   1 
ATOM   9327  C  CD2   . LEU D 1 102 ? 129.92800 155.93300 108.27100 1.000 63.02000  ? 347 LEU D CD2   1 
ATOM   9328  N  N     . LYS D 1 103 ? 128.28200 160.79700 110.11100 1.000 62.04000  ? 348 LYS D N     1 
ATOM   9329  C  CA    . LYS D 1 103 ? 128.84100 161.77600 111.03100 1.000 62.04000  ? 348 LYS D CA    1 
ATOM   9330  C  C     . LYS D 1 103 ? 127.85300 162.13800 112.13100 1.000 62.04000  ? 348 LYS D C     1 
ATOM   9331  O  O     . LYS D 1 103 ? 128.26700 162.62700 113.18700 1.000 62.04000  ? 348 LYS D O     1 
ATOM   9332  C  CB    . LYS D 1 103 ? 129.26300 163.02900 110.25900 1.000 62.04000  ? 348 LYS D CB    1 
ATOM   9333  C  CG    . LYS D 1 103 ? 129.94000 164.10300 111.08900 1.000 62.04000  ? 348 LYS D CG    1 
ATOM   9334  C  CD    . LYS D 1 103 ? 130.43900 165.23800 110.21100 1.000 62.04000  ? 348 LYS D CD    1 
ATOM   9335  C  CE    . LYS D 1 103 ? 129.28800 166.08800 109.70000 1.000 62.04000  ? 348 LYS D CE    1 
ATOM   9336  N  NZ    . LYS D 1 103 ? 129.76700 167.26200 108.92000 1.000 62.04000  ? 348 LYS D NZ    1 
ATOM   9337  N  N     . GLU D 1 104 ? 126.56000 161.88900 111.90800 1.000 62.58000  ? 349 GLU D N     1 
ATOM   9338  C  CA    . GLU D 1 104 ? 125.57200 162.08200 112.96200 1.000 62.58000  ? 349 GLU D CA    1 
ATOM   9339  C  C     . GLU D 1 104 ? 125.84400 161.17300 114.15000 1.000 62.58000  ? 349 GLU D C     1 
ATOM   9340  O  O     . GLU D 1 104 ? 125.55100 161.54000 115.29300 1.000 62.58000  ? 349 GLU D O     1 
ATOM   9341  C  CB    . GLU D 1 104 ? 124.16700 161.82200 112.42200 1.000 62.58000  ? 349 GLU D CB    1 
ATOM   9342  C  CG    . GLU D 1 104 ? 123.71100 162.79700 111.35500 1.000 62.58000  ? 349 GLU D CG    1 
ATOM   9343  C  CD    . GLU D 1 104 ? 123.52500 164.20100 111.88600 1.000 62.58000  ? 349 GLU D CD    1 
ATOM   9344  O  OE1   . GLU D 1 104 ? 123.16600 164.34800 113.07400 1.000 62.58000  ? 349 GLU D OE1   1 
ATOM   9345  O  OE2   . GLU D 1 104 ? 123.73500 165.16000 111.11400 1.000 62.58000  ? 349 GLU D OE2   1 
ATOM   9346  N  N     . PHE D 1 105 ? 126.39500 159.99000 113.90300 1.000 56.39000  ? 350 PHE D N     1 
ATOM   9347  C  CA    . PHE D 1 105 ? 126.70300 159.04200 114.96100 1.000 56.39000  ? 350 PHE D CA    1 
ATOM   9348  C  C     . PHE D 1 105 ? 128.06200 159.29300 115.59700 1.000 56.39000  ? 350 PHE D C     1 
ATOM   9349  O  O     . PHE D 1 105 ? 128.46600 158.53400 116.48200 1.000 56.39000  ? 350 PHE D O     1 
ATOM   9350  C  CB    . PHE D 1 105 ? 126.64200 157.61200 114.41800 1.000 56.39000  ? 350 PHE D CB    1 
ATOM   9351  C  CG    . PHE D 1 105 ? 125.26900 157.19000 113.97900 1.000 56.39000  ? 350 PHE D CG    1 
ATOM   9352  C  CD1   . PHE D 1 105 ? 124.32800 156.77400 114.90500 1.000 56.39000  ? 350 PHE D CD1   1 
ATOM   9353  C  CD2   . PHE D 1 105 ? 124.92000 157.20900 112.64100 1.000 56.39000  ? 350 PHE D CD2   1 
ATOM   9354  C  CE1   . PHE D 1 105 ? 123.06500 156.38700 114.50300 1.000 56.39000  ? 350 PHE D CE1   1 
ATOM   9355  C  CE2   . PHE D 1 105 ? 123.66100 156.82300 112.23400 1.000 56.39000  ? 350 PHE D CE2   1 
ATOM   9356  C  CZ    . PHE D 1 105 ? 122.73300 156.41200 113.16600 1.000 56.39000  ? 350 PHE D CZ    1 
ATOM   9357  N  N     . GLY D 1 106 ? 128.77200 160.33500 115.17100 1.000 62.19000  ? 351 GLY D N     1 
ATOM   9358  C  CA    . GLY D 1 106 ? 130.03700 160.70700 115.76600 1.000 62.19000  ? 351 GLY D CA    1 
ATOM   9359  C  C     . GLY D 1 106 ? 131.26900 160.18200 115.06600 1.000 62.19000  ? 351 GLY D C     1 
ATOM   9360  O  O     . GLY D 1 106 ? 132.38100 160.58700 115.42600 1.000 62.19000  ? 351 GLY D O     1 
ATOM   9361  N  N     . VAL D 1 107 ? 131.11700 159.30400 114.08100 1.000 61.38000  ? 352 VAL D N     1 
ATOM   9362  C  CA    . VAL D 1 107 ? 132.24400 158.67700 113.40200 1.000 61.38000  ? 352 VAL D CA    1 
ATOM   9363  C  C     . VAL D 1 107 ? 132.54800 159.49800 112.15400 1.000 61.38000  ? 352 VAL D C     1 
ATOM   9364  O  O     . VAL D 1 107 ? 131.84700 159.40000 111.14300 1.000 61.38000  ? 352 VAL D O     1 
ATOM   9365  C  CB    . VAL D 1 107 ? 131.95700 157.21500 113.06000 1.000 61.38000  ? 352 VAL D CB    1 
ATOM   9366  C  CG1   . VAL D 1 107 ? 133.11000 156.63000 112.27200 1.000 61.38000  ? 352 VAL D CG1   1 
ATOM   9367  C  CG2   . VAL D 1 107 ? 131.72300 156.42100 114.32700 1.000 61.38000  ? 352 VAL D CG2   1 
ATOM   9368  N  N     . GLU D 1 108 ? 133.59600 160.31400 112.22600 1.000 67.35000  ? 353 GLU D N     1 
ATOM   9369  C  CA    . GLU D 1 108 ? 134.06400 161.04200 111.05500 1.000 67.35000  ? 353 GLU D CA    1 
ATOM   9370  C  C     . GLU D 1 108 ? 134.56300 160.06600 110.00100 1.000 67.35000  ? 353 GLU D C     1 
ATOM   9371  O  O     . GLU D 1 108 ? 135.38600 159.19400 110.29300 1.000 67.35000  ? 353 GLU D O     1 
ATOM   9372  C  CB    . GLU D 1 108 ? 135.17700 162.00900 111.44900 1.000 67.35000  ? 353 GLU D CB    1 
ATOM   9373  C  CG    . GLU D 1 108 ? 135.69800 162.84700 110.29600 1.000 67.35000  ? 353 GLU D CG    1 
ATOM   9374  C  CD    . GLU D 1 108 ? 136.79900 163.79800 110.71800 1.000 67.35000  ? 353 GLU D CD    1 
ATOM   9375  O  OE1   . GLU D 1 108 ? 137.17600 163.78500 111.90900 1.000 67.35000  ? 353 GLU D OE1   1 
ATOM   9376  O  OE2   . GLU D 1 108 ? 137.29000 164.55700 109.85700 1.000 67.35000  ? 353 GLU D OE2   1 
ATOM   9377  N  N     . VAL D 1 109 ? 134.06200 160.20700 108.77600 1.000 68.06000  ? 354 VAL D N     1 
ATOM   9378  C  CA    . VAL D 1 109 ? 134.44700 159.35700 107.66300 1.000 68.06000  ? 354 VAL D CA    1 
ATOM   9379  C  C     . VAL D 1 109 ? 134.66000 160.22400 106.42700 1.000 68.06000  ? 354 VAL D C     1 
ATOM   9380  O  O     . VAL D 1 109 ? 134.53300 161.44600 106.46900 1.000 68.06000  ? 354 VAL D O     1 
ATOM   9381  C  CB    . VAL D 1 109 ? 133.40900 158.25200 107.38400 1.000 68.06000  ? 354 VAL D CB    1 
ATOM   9382  C  CG1   . VAL D 1 109 ? 133.29500 157.31200 108.57100 1.000 68.06000  ? 354 VAL D CG1   1 
ATOM   9383  C  CG2   . VAL D 1 109 ? 132.06200 158.86600 107.05100 1.000 68.06000  ? 354 VAL D CG2   1 
ATOM   9384  N  N     . SER D 1 110 ? 134.99100 159.56700 105.31900 1.000 71.38000  ? 355 SER D N     1 
ATOM   9385  C  CA    . SER D 1 110 ? 135.18300 160.25200 104.04400 1.000 71.38000  ? 355 SER D CA    1 
ATOM   9386  C  C     . SER D 1 110 ? 135.06100 159.22700 102.93000 1.000 71.38000  ? 355 SER D C     1 
ATOM   9387  O  O     . SER D 1 110 ? 135.87500 158.30100 102.85400 1.000 71.38000  ? 355 SER D O     1 
ATOM   9388  C  CB    . SER D 1 110 ? 136.54300 160.94600 103.99300 1.000 71.38000  ? 355 SER D CB    1 
ATOM   9389  O  OG    . SER D 1 110 ? 136.74900 161.56900 102.73700 1.000 71.38000  ? 355 SER D OG    1 
ATOM   9390  N  N     . VAL D 1 111 ? 134.05700 159.38500 102.07400 1.000 73.58000  ? 356 VAL D N     1 
ATOM   9391  C  CA    . VAL D 1 111 ? 133.86600 158.47500 100.95100 1.000 73.58000  ? 356 VAL D CA    1 
ATOM   9392  C  C     . VAL D 1 111 ? 134.88400 158.80000 99.86800  1.000 73.58000  ? 356 VAL D C     1 
ATOM   9393  O  O     . VAL D 1 111 ? 134.99200 159.94900 99.42300  1.000 73.58000  ? 356 VAL D O     1 
ATOM   9394  C  CB    . VAL D 1 111 ? 132.43100 158.56400 100.41000 1.000 73.58000  ? 356 VAL D CB    1 
ATOM   9395  C  CG1   . VAL D 1 111 ? 132.28800 157.71500 99.15900  1.000 73.58000  ? 356 VAL D CG1   1 
ATOM   9396  C  CG2   . VAL D 1 111 ? 131.44400 158.11600 101.47100 1.000 73.58000  ? 356 VAL D CG2   1 
ATOM   9397  N  N     . ASP D 1 112 ? 135.63600 157.78600 99.44400  1.000 77.41000  ? 357 ASP D N     1 
ATOM   9398  C  CA    . ASP D 1 112 ? 136.68000 157.95900 98.44400  1.000 77.41000  ? 357 ASP D CA    1 
ATOM   9399  C  C     . ASP D 1 112 ? 136.13500 157.80700 97.02800  1.000 77.41000  ? 357 ASP D C     1 
ATOM   9400  O  O     . ASP D 1 112 ? 136.36200 158.67300 96.17700  1.000 77.41000  ? 357 ASP D O     1 
ATOM   9401  C  CB    . ASP D 1 112 ? 137.81000 156.95500 98.69300  1.000 77.41000  ? 357 ASP D CB    1 
ATOM   9402  C  CG    . ASP D 1 112 ? 139.05300 157.25600 97.88400  1.000 77.41000  ? 357 ASP D CG    1 
ATOM   9403  O  OD1   . ASP D 1 112 ? 139.05100 158.24500 97.12100  1.000 77.41000  ? 357 ASP D OD1   1 
ATOM   9404  O  OD2   . ASP D 1 112 ? 140.03700 156.49800 98.01100  1.000 77.41000  ? 357 ASP D OD2   1 
ATOM   9405  N  N     . SER D 1 113 ? 135.41800 156.71900 96.76100  1.000 76.73000  ? 358 SER D N     1 
ATOM   9406  C  CA    . SER D 1 113 ? 134.83800 156.49000 95.44600  1.000 76.73000  ? 358 SER D CA    1 
ATOM   9407  C  C     . SER D 1 113 ? 133.62100 155.59000 95.59300  1.000 76.73000  ? 358 SER D C     1 
ATOM   9408  O  O     . SER D 1 113 ? 133.32000 155.08800 96.67800  1.000 76.73000  ? 358 SER D O     1 
ATOM   9409  C  CB    . SER D 1 113 ? 135.85800 155.87800 94.48100  1.000 76.73000  ? 358 SER D CB    1 
ATOM   9410  O  OG    . SER D 1 113 ? 136.23400 154.57700 94.89400  1.000 76.73000  ? 358 SER D