data_6T8G
# 
_entry.id   6T8G 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6T8G         
WWPDB D_1292105055 
EMDB  EMD-10400    
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB  .                                          6T8B      unspecified            
EMDB 'Stalled FtsK motor domain bound to dsDNA' EMD-10400 'associated EM volume' 
PDB  .                                          6T8O      unspecified            
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6T8G 
_pdbx_database_status.recvd_initial_deposition_date   2019-10-24 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Jean, N.L.' 1 0000-0001-7759-4757 
'Lowe, J.'   2 0000-0002-5218-6615 
# 
loop_
_citation.abstract 
_citation.abstract_id_CAS 
_citation.book_id_ISBN 
_citation.book_publisher 
_citation.book_publisher_city 
_citation.book_title 
_citation.coordinate_linkage 
_citation.country 
_citation.database_id_Medline 
_citation.details 
_citation.id 
_citation.journal_abbrev 
_citation.journal_id_ASTM 
_citation.journal_id_CSD 
_citation.journal_id_ISSN 
_citation.journal_full 
_citation.journal_issue 
_citation.journal_volume 
_citation.language 
_citation.page_first 
_citation.page_last 
_citation.title 
_citation.year 
_citation.database_id_CSD 
_citation.pdbx_database_id_DOI 
_citation.pdbx_database_id_PubMed 
_citation.unpublished_flag 
? ? ? ? ? ? ? US ? ? primary Proc.Natl.Acad.Sci.USA PNASA6 0040 1091-6490 ? ? 117 ? 14202 14208 
'FtsK in motion reveals its mechanism for double-stranded DNA translocation.' 2020 ? 10.1073/pnas.2001324117 32513722 ? 
? ? ? ? ? ? ? US ? ? 1       Biorxiv                ?      ?    ?         ? ? ?   ? ?     ?     
'FtsK in motion reveals its mechanism for double-stranded DNA translocation'  ?    ? 10.1101/828319          ?        ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Jean, N.L.'       1 ?                   
primary 'Rutherford, T.J.' 2 ?                   
primary 'Lowe, J.'         3 ?                   
1       'Jean, N.L.'       4 0000-0001-7759-4757 
1       'Rutherford, T.J.' 5 0000-0001-7294-1668 
1       'Lowe, J.'         6 0000-0002-5218-6615 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6T8G 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.00 
_cell.length_a_esd                 ? 
_cell.length_b                     1.00 
_cell.length_b_esd                 ? 
_cell.length_c                     1.00 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6T8G 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA translocase FtsK'     54001.441 6 ? ? 'Motor domain, residues 247-728' ? 
2 polymer     syn 'dsDNA substrate'          4894.239  2 ? ? ?                                ? 
3 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE" 427.201   6 ? ? ?                                ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MVPDRREQSKAKERLLEREEALAKHMSEREKRPPPKIDPPPSPKAPEPSKRVLKEKQAPLFVDTAVEGTLPPLSLLDPAE
VKQKSYSPESLEAMSRLLEIKLKEFGVEVSVDSVHPGPVITRFEIQPAAGVKVSRISNLAKDLARSLAVISVRVVEVIPG
KTTVGIEIPNEDRQMVRFSEVLSSPEYDEHKSTVPLALGHDIGGRPIITDLAKMPHLLVAGTTGSGKSVGVNAMLLSILF
KSTPSEARLIMIDPKMLELSIYEGIPHLLCPVVTDMKEAANALRWSVAEMERRYRLMAAMGVRNLAGFNRKVKDAEEAGT
PLTDPLFRRESPDDEPPQLSTLPTIVVVVDEFADMMMIVGKKVEELIARIAQKARAAGIHLILATQRPSVDVITGLIKAN
IPTRIAFQVSSKIDSRTILDQGGAEQLLGHGDMLYLPPGTGLPIRVHGAFVSDDEVHRVVEAWKLRGAPDYIEDILAGVD
EGGKLHHHHHH
;
;MVPDRREQSKAKERLLEREEALAKHMSEREKRPPPKIDPPPSPKAPEPSKRVLKEKQAPLFVDTAVEGTLPPLSLLDPAE
VKQKSYSPESLEAMSRLLEIKLKEFGVEVSVDSVHPGPVITRFEIQPAAGVKVSRISNLAKDLARSLAVISVRVVEVIPG
KTTVGIEIPNEDRQMVRFSEVLSSPEYDEHKSTVPLALGHDIGGRPIITDLAKMPHLLVAGTTGSGKSVGVNAMLLSILF
KSTPSEARLIMIDPKMLELSIYEGIPHLLCPVVTDMKEAANALRWSVAEMERRYRLMAAMGVRNLAGFNRKVKDAEEAGT
PLTDPLFRRESPDDEPPQLSTLPTIVVVVDEFADMMMIVGKKVEELIARIAQKARAAGIHLILATQRPSVDVITGLIKAN
IPTRIAFQVSSKIDSRTILDQGGAEQLLGHGDMLYLPPGTGLPIRVHGAFVSDDEVHRVVEAWKLRGAPDYIEDILAGVD
EGGKLHHHHHH
;
A,B,C,D,E,F ? 
2 polydeoxyribonucleotide no no '(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)' ATATATATATATATAT G,H         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   VAL n 
1 3   PRO n 
1 4   ASP n 
1 5   ARG n 
1 6   ARG n 
1 7   GLU n 
1 8   GLN n 
1 9   SER n 
1 10  LYS n 
1 11  ALA n 
1 12  LYS n 
1 13  GLU n 
1 14  ARG n 
1 15  LEU n 
1 16  LEU n 
1 17  GLU n 
1 18  ARG n 
1 19  GLU n 
1 20  GLU n 
1 21  ALA n 
1 22  LEU n 
1 23  ALA n 
1 24  LYS n 
1 25  HIS n 
1 26  MET n 
1 27  SER n 
1 28  GLU n 
1 29  ARG n 
1 30  GLU n 
1 31  LYS n 
1 32  ARG n 
1 33  PRO n 
1 34  PRO n 
1 35  PRO n 
1 36  LYS n 
1 37  ILE n 
1 38  ASP n 
1 39  PRO n 
1 40  PRO n 
1 41  PRO n 
1 42  SER n 
1 43  PRO n 
1 44  LYS n 
1 45  ALA n 
1 46  PRO n 
1 47  GLU n 
1 48  PRO n 
1 49  SER n 
1 50  LYS n 
1 51  ARG n 
1 52  VAL n 
1 53  LEU n 
1 54  LYS n 
1 55  GLU n 
1 56  LYS n 
1 57  GLN n 
1 58  ALA n 
1 59  PRO n 
1 60  LEU n 
1 61  PHE n 
1 62  VAL n 
1 63  ASP n 
1 64  THR n 
1 65  ALA n 
1 66  VAL n 
1 67  GLU n 
1 68  GLY n 
1 69  THR n 
1 70  LEU n 
1 71  PRO n 
1 72  PRO n 
1 73  LEU n 
1 74  SER n 
1 75  LEU n 
1 76  LEU n 
1 77  ASP n 
1 78  PRO n 
1 79  ALA n 
1 80  GLU n 
1 81  VAL n 
1 82  LYS n 
1 83  GLN n 
1 84  LYS n 
1 85  SER n 
1 86  TYR n 
1 87  SER n 
1 88  PRO n 
1 89  GLU n 
1 90  SER n 
1 91  LEU n 
1 92  GLU n 
1 93  ALA n 
1 94  MET n 
1 95  SER n 
1 96  ARG n 
1 97  LEU n 
1 98  LEU n 
1 99  GLU n 
1 100 ILE n 
1 101 LYS n 
1 102 LEU n 
1 103 LYS n 
1 104 GLU n 
1 105 PHE n 
1 106 GLY n 
1 107 VAL n 
1 108 GLU n 
1 109 VAL n 
1 110 SER n 
1 111 VAL n 
1 112 ASP n 
1 113 SER n 
1 114 VAL n 
1 115 HIS n 
1 116 PRO n 
1 117 GLY n 
1 118 PRO n 
1 119 VAL n 
1 120 ILE n 
1 121 THR n 
1 122 ARG n 
1 123 PHE n 
1 124 GLU n 
1 125 ILE n 
1 126 GLN n 
1 127 PRO n 
1 128 ALA n 
1 129 ALA n 
1 130 GLY n 
1 131 VAL n 
1 132 LYS n 
1 133 VAL n 
1 134 SER n 
1 135 ARG n 
1 136 ILE n 
1 137 SER n 
1 138 ASN n 
1 139 LEU n 
1 140 ALA n 
1 141 LYS n 
1 142 ASP n 
1 143 LEU n 
1 144 ALA n 
1 145 ARG n 
1 146 SER n 
1 147 LEU n 
1 148 ALA n 
1 149 VAL n 
1 150 ILE n 
1 151 SER n 
1 152 VAL n 
1 153 ARG n 
1 154 VAL n 
1 155 VAL n 
1 156 GLU n 
1 157 VAL n 
1 158 ILE n 
1 159 PRO n 
1 160 GLY n 
1 161 LYS n 
1 162 THR n 
1 163 THR n 
1 164 VAL n 
1 165 GLY n 
1 166 ILE n 
1 167 GLU n 
1 168 ILE n 
1 169 PRO n 
1 170 ASN n 
1 171 GLU n 
1 172 ASP n 
1 173 ARG n 
1 174 GLN n 
1 175 MET n 
1 176 VAL n 
1 177 ARG n 
1 178 PHE n 
1 179 SER n 
1 180 GLU n 
1 181 VAL n 
1 182 LEU n 
1 183 SER n 
1 184 SER n 
1 185 PRO n 
1 186 GLU n 
1 187 TYR n 
1 188 ASP n 
1 189 GLU n 
1 190 HIS n 
1 191 LYS n 
1 192 SER n 
1 193 THR n 
1 194 VAL n 
1 195 PRO n 
1 196 LEU n 
1 197 ALA n 
1 198 LEU n 
1 199 GLY n 
1 200 HIS n 
1 201 ASP n 
1 202 ILE n 
1 203 GLY n 
1 204 GLY n 
1 205 ARG n 
1 206 PRO n 
1 207 ILE n 
1 208 ILE n 
1 209 THR n 
1 210 ASP n 
1 211 LEU n 
1 212 ALA n 
1 213 LYS n 
1 214 MET n 
1 215 PRO n 
1 216 HIS n 
1 217 LEU n 
1 218 LEU n 
1 219 VAL n 
1 220 ALA n 
1 221 GLY n 
1 222 THR n 
1 223 THR n 
1 224 GLY n 
1 225 SER n 
1 226 GLY n 
1 227 LYS n 
1 228 SER n 
1 229 VAL n 
1 230 GLY n 
1 231 VAL n 
1 232 ASN n 
1 233 ALA n 
1 234 MET n 
1 235 LEU n 
1 236 LEU n 
1 237 SER n 
1 238 ILE n 
1 239 LEU n 
1 240 PHE n 
1 241 LYS n 
1 242 SER n 
1 243 THR n 
1 244 PRO n 
1 245 SER n 
1 246 GLU n 
1 247 ALA n 
1 248 ARG n 
1 249 LEU n 
1 250 ILE n 
1 251 MET n 
1 252 ILE n 
1 253 ASP n 
1 254 PRO n 
1 255 LYS n 
1 256 MET n 
1 257 LEU n 
1 258 GLU n 
1 259 LEU n 
1 260 SER n 
1 261 ILE n 
1 262 TYR n 
1 263 GLU n 
1 264 GLY n 
1 265 ILE n 
1 266 PRO n 
1 267 HIS n 
1 268 LEU n 
1 269 LEU n 
1 270 CYS n 
1 271 PRO n 
1 272 VAL n 
1 273 VAL n 
1 274 THR n 
1 275 ASP n 
1 276 MET n 
1 277 LYS n 
1 278 GLU n 
1 279 ALA n 
1 280 ALA n 
1 281 ASN n 
1 282 ALA n 
1 283 LEU n 
1 284 ARG n 
1 285 TRP n 
1 286 SER n 
1 287 VAL n 
1 288 ALA n 
1 289 GLU n 
1 290 MET n 
1 291 GLU n 
1 292 ARG n 
1 293 ARG n 
1 294 TYR n 
1 295 ARG n 
1 296 LEU n 
1 297 MET n 
1 298 ALA n 
1 299 ALA n 
1 300 MET n 
1 301 GLY n 
1 302 VAL n 
1 303 ARG n 
1 304 ASN n 
1 305 LEU n 
1 306 ALA n 
1 307 GLY n 
1 308 PHE n 
1 309 ASN n 
1 310 ARG n 
1 311 LYS n 
1 312 VAL n 
1 313 LYS n 
1 314 ASP n 
1 315 ALA n 
1 316 GLU n 
1 317 GLU n 
1 318 ALA n 
1 319 GLY n 
1 320 THR n 
1 321 PRO n 
1 322 LEU n 
1 323 THR n 
1 324 ASP n 
1 325 PRO n 
1 326 LEU n 
1 327 PHE n 
1 328 ARG n 
1 329 ARG n 
1 330 GLU n 
1 331 SER n 
1 332 PRO n 
1 333 ASP n 
1 334 ASP n 
1 335 GLU n 
1 336 PRO n 
1 337 PRO n 
1 338 GLN n 
1 339 LEU n 
1 340 SER n 
1 341 THR n 
1 342 LEU n 
1 343 PRO n 
1 344 THR n 
1 345 ILE n 
1 346 VAL n 
1 347 VAL n 
1 348 VAL n 
1 349 VAL n 
1 350 ASP n 
1 351 GLU n 
1 352 PHE n 
1 353 ALA n 
1 354 ASP n 
1 355 MET n 
1 356 MET n 
1 357 MET n 
1 358 ILE n 
1 359 VAL n 
1 360 GLY n 
1 361 LYS n 
1 362 LYS n 
1 363 VAL n 
1 364 GLU n 
1 365 GLU n 
1 366 LEU n 
1 367 ILE n 
1 368 ALA n 
1 369 ARG n 
1 370 ILE n 
1 371 ALA n 
1 372 GLN n 
1 373 LYS n 
1 374 ALA n 
1 375 ARG n 
1 376 ALA n 
1 377 ALA n 
1 378 GLY n 
1 379 ILE n 
1 380 HIS n 
1 381 LEU n 
1 382 ILE n 
1 383 LEU n 
1 384 ALA n 
1 385 THR n 
1 386 GLN n 
1 387 ARG n 
1 388 PRO n 
1 389 SER n 
1 390 VAL n 
1 391 ASP n 
1 392 VAL n 
1 393 ILE n 
1 394 THR n 
1 395 GLY n 
1 396 LEU n 
1 397 ILE n 
1 398 LYS n 
1 399 ALA n 
1 400 ASN n 
1 401 ILE n 
1 402 PRO n 
1 403 THR n 
1 404 ARG n 
1 405 ILE n 
1 406 ALA n 
1 407 PHE n 
1 408 GLN n 
1 409 VAL n 
1 410 SER n 
1 411 SER n 
1 412 LYS n 
1 413 ILE n 
1 414 ASP n 
1 415 SER n 
1 416 ARG n 
1 417 THR n 
1 418 ILE n 
1 419 LEU n 
1 420 ASP n 
1 421 GLN n 
1 422 GLY n 
1 423 GLY n 
1 424 ALA n 
1 425 GLU n 
1 426 GLN n 
1 427 LEU n 
1 428 LEU n 
1 429 GLY n 
1 430 HIS n 
1 431 GLY n 
1 432 ASP n 
1 433 MET n 
1 434 LEU n 
1 435 TYR n 
1 436 LEU n 
1 437 PRO n 
1 438 PRO n 
1 439 GLY n 
1 440 THR n 
1 441 GLY n 
1 442 LEU n 
1 443 PRO n 
1 444 ILE n 
1 445 ARG n 
1 446 VAL n 
1 447 HIS n 
1 448 GLY n 
1 449 ALA n 
1 450 PHE n 
1 451 VAL n 
1 452 SER n 
1 453 ASP n 
1 454 ASP n 
1 455 GLU n 
1 456 VAL n 
1 457 HIS n 
1 458 ARG n 
1 459 VAL n 
1 460 VAL n 
1 461 GLU n 
1 462 ALA n 
1 463 TRP n 
1 464 LYS n 
1 465 LEU n 
1 466 ARG n 
1 467 GLY n 
1 468 ALA n 
1 469 PRO n 
1 470 ASP n 
1 471 TYR n 
1 472 ILE n 
1 473 GLU n 
1 474 ASP n 
1 475 ILE n 
1 476 LEU n 
1 477 ALA n 
1 478 GLY n 
1 479 VAL n 
1 480 ASP n 
1 481 GLU n 
1 482 GLY n 
1 483 GLY n 
1 484 LYS n 
1 485 LEU n 
1 486 HIS n 
1 487 HIS n 
1 488 HIS n 
1 489 HIS n 
1 490 HIS n 
1 491 HIS n 
2 1   DA  n 
2 2   DT  n 
2 3   DA  n 
2 4   DT  n 
2 5   DA  n 
2 6   DT  n 
2 7   DA  n 
2 8   DT  n 
2 9   DA  n 
2 10  DT  n 
2 11  DA  n 
2 12  DT  n 
2 13  DA  n 
2 14  DT  n 
2 15  DA  n 
2 16  DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   491 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ftsK, PA2615' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pseudomonas aeruginosa PAO1' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     208964 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              C41 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       16 
_pdbx_entity_src_syn.organism_scientific    'synthetic construct' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP FTSK_PSEAE Q9I0M3 ? 1 
;VPDRREQSKAKERLLEREEALAKHMSEREKRPPPKIDPPPSPKAPEPSKRVLKEKQAPLFVDTAVEGTLPPLSLLDPAEV
KQKSYSPESLEAMSRLLEIKLKEFGVEVSVDSVHPGPVITRFEIQPAAGVKVSRISNLAKDLARSLAVISVRVVEVIPGK
TTVGIEIPNEDRQMVRFSEVLSSPEYDEHKSTVPLALGHDIGGRPIITDLAKMPHLLVAGTTGSGKSVGVNAMLLSILFK
STPSEARLIMIDPKMLELSIYEGIPHLLCPVVTDMKEAANALRWSVAEMERRYRLMAAMGVRNLAGFNRKVKDAEEAGTP
LTDPLFRRESPDDEPPQLSTLPTIVVVVDEFADMMMIVGKKVEELIARIAQKARAAGIHLILATQRPSVDVITGLIKANI
PTRIAFQVSSKIDSRTILDQGGAEQLLGHGDMLYLPPGTGLPIRVHGAFVSDDEVHRVVEAWKLRGAPDYIEDILAGVDE
GG
;
247 
2 PDB 6T8G       6T8G   ? 2 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6T8G A 2 ? 483 ? Q9I0M3 247 ? 728 ? 247 728 
2 1 6T8G B 2 ? 483 ? Q9I0M3 247 ? 728 ? 247 728 
3 1 6T8G C 2 ? 483 ? Q9I0M3 247 ? 728 ? 247 728 
4 1 6T8G D 2 ? 483 ? Q9I0M3 247 ? 728 ? 247 728 
5 1 6T8G E 2 ? 483 ? Q9I0M3 247 ? 728 ? 247 728 
6 1 6T8G F 2 ? 483 ? Q9I0M3 247 ? 728 ? 247 728 
7 2 6T8G G 1 ? 16  ? 6T8G   1   ? 16  ? 1   16  
8 2 6T8G H 1 ? 16  ? 6T8G   1   ? 16  ? 1   16  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6T8G MET A 1   ? UNP Q9I0M3 ? ? 'initiating methionine' 246 1  
1 6T8G LYS A 484 ? UNP Q9I0M3 ? ? 'expression tag'        729 2  
1 6T8G LEU A 485 ? UNP Q9I0M3 ? ? 'expression tag'        730 3  
1 6T8G HIS A 486 ? UNP Q9I0M3 ? ? 'expression tag'        731 4  
1 6T8G HIS A 487 ? UNP Q9I0M3 ? ? 'expression tag'        732 5  
1 6T8G HIS A 488 ? UNP Q9I0M3 ? ? 'expression tag'        733 6  
1 6T8G HIS A 489 ? UNP Q9I0M3 ? ? 'expression tag'        734 7  
1 6T8G HIS A 490 ? UNP Q9I0M3 ? ? 'expression tag'        735 8  
1 6T8G HIS A 491 ? UNP Q9I0M3 ? ? 'expression tag'        736 9  
2 6T8G MET B 1   ? UNP Q9I0M3 ? ? 'initiating methionine' 246 10 
2 6T8G LYS B 484 ? UNP Q9I0M3 ? ? 'expression tag'        729 11 
2 6T8G LEU B 485 ? UNP Q9I0M3 ? ? 'expression tag'        730 12 
2 6T8G HIS B 486 ? UNP Q9I0M3 ? ? 'expression tag'        731 13 
2 6T8G HIS B 487 ? UNP Q9I0M3 ? ? 'expression tag'        732 14 
2 6T8G HIS B 488 ? UNP Q9I0M3 ? ? 'expression tag'        733 15 
2 6T8G HIS B 489 ? UNP Q9I0M3 ? ? 'expression tag'        734 16 
2 6T8G HIS B 490 ? UNP Q9I0M3 ? ? 'expression tag'        735 17 
2 6T8G HIS B 491 ? UNP Q9I0M3 ? ? 'expression tag'        736 18 
3 6T8G MET C 1   ? UNP Q9I0M3 ? ? 'initiating methionine' 246 19 
3 6T8G LYS C 484 ? UNP Q9I0M3 ? ? 'expression tag'        729 20 
3 6T8G LEU C 485 ? UNP Q9I0M3 ? ? 'expression tag'        730 21 
3 6T8G HIS C 486 ? UNP Q9I0M3 ? ? 'expression tag'        731 22 
3 6T8G HIS C 487 ? UNP Q9I0M3 ? ? 'expression tag'        732 23 
3 6T8G HIS C 488 ? UNP Q9I0M3 ? ? 'expression tag'        733 24 
3 6T8G HIS C 489 ? UNP Q9I0M3 ? ? 'expression tag'        734 25 
3 6T8G HIS C 490 ? UNP Q9I0M3 ? ? 'expression tag'        735 26 
3 6T8G HIS C 491 ? UNP Q9I0M3 ? ? 'expression tag'        736 27 
4 6T8G MET D 1   ? UNP Q9I0M3 ? ? 'initiating methionine' 246 28 
4 6T8G LYS D 484 ? UNP Q9I0M3 ? ? 'expression tag'        729 29 
4 6T8G LEU D 485 ? UNP Q9I0M3 ? ? 'expression tag'        730 30 
4 6T8G HIS D 486 ? UNP Q9I0M3 ? ? 'expression tag'        731 31 
4 6T8G HIS D 487 ? UNP Q9I0M3 ? ? 'expression tag'        732 32 
4 6T8G HIS D 488 ? UNP Q9I0M3 ? ? 'expression tag'        733 33 
4 6T8G HIS D 489 ? UNP Q9I0M3 ? ? 'expression tag'        734 34 
4 6T8G HIS D 490 ? UNP Q9I0M3 ? ? 'expression tag'        735 35 
4 6T8G HIS D 491 ? UNP Q9I0M3 ? ? 'expression tag'        736 36 
5 6T8G MET E 1   ? UNP Q9I0M3 ? ? 'initiating methionine' 246 37 
5 6T8G LYS E 484 ? UNP Q9I0M3 ? ? 'expression tag'        729 38 
5 6T8G LEU E 485 ? UNP Q9I0M3 ? ? 'expression tag'        730 39 
5 6T8G HIS E 486 ? UNP Q9I0M3 ? ? 'expression tag'        731 40 
5 6T8G HIS E 487 ? UNP Q9I0M3 ? ? 'expression tag'        732 41 
5 6T8G HIS E 488 ? UNP Q9I0M3 ? ? 'expression tag'        733 42 
5 6T8G HIS E 489 ? UNP Q9I0M3 ? ? 'expression tag'        734 43 
5 6T8G HIS E 490 ? UNP Q9I0M3 ? ? 'expression tag'        735 44 
5 6T8G HIS E 491 ? UNP Q9I0M3 ? ? 'expression tag'        736 45 
6 6T8G MET F 1   ? UNP Q9I0M3 ? ? 'initiating methionine' 246 46 
6 6T8G LYS F 484 ? UNP Q9I0M3 ? ? 'expression tag'        729 47 
6 6T8G LEU F 485 ? UNP Q9I0M3 ? ? 'expression tag'        730 48 
6 6T8G HIS F 486 ? UNP Q9I0M3 ? ? 'expression tag'        731 49 
6 6T8G HIS F 487 ? UNP Q9I0M3 ? ? 'expression tag'        732 50 
6 6T8G HIS F 488 ? UNP Q9I0M3 ? ? 'expression tag'        733 51 
6 6T8G HIS F 489 ? UNP Q9I0M3 ? ? 'expression tag'        734 52 
6 6T8G HIS F 490 ? UNP Q9I0M3 ? ? 'expression tag'        735 53 
6 6T8G HIS F 491 ? UNP Q9I0M3 ? ? 'expression tag'        736 54 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE"           ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6T8G 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6T8G 
_struct.title                        'Stalled FtsK motor domain bound to dsDNA' 
_struct.pdbx_descriptor              'DNA translocase FtsK/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6T8G 
_struct_keywords.text            'DNA translocation, DNA motor, RecA fold, Divisome, DNA BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
N N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 PRO A 72  ? LEU A 76  ? PRO A 317 LEU A 321 5 ? 5  
HELX_P HELX_P2  AA2 SER A 87  ? PHE A 105 ? SER A 332 PHE A 350 1 ? 19 
HELX_P HELX_P3  AA3 VAL A 133 ? ASN A 138 ? VAL A 378 ASN A 383 1 ? 6  
HELX_P HELX_P4  AA4 LEU A 139 ? LEU A 147 ? LEU A 384 LEU A 392 1 ? 9  
HELX_P HELX_P5  AA5 ARG A 177 ? SER A 183 ? ARG A 422 SER A 428 1 ? 7  
HELX_P HELX_P6  AA6 SER A 184 ? GLU A 189 ? SER A 429 GLU A 434 1 ? 6  
HELX_P HELX_P7  AA7 GLY A 226 ? PHE A 240 ? GLY A 471 PHE A 485 1 ? 15 
HELX_P HELX_P8  AA8 GLU A 258 ? GLU A 263 ? GLU A 503 GLU A 508 5 ? 6  
HELX_P HELX_P9  AA9 ASP A 275 ? GLY A 301 ? ASP A 520 GLY A 546 1 ? 27 
HELX_P HELX_P10 AB1 ASN A 304 ? ASP A 314 ? ASN A 549 ASP A 559 1 ? 11 
HELX_P HELX_P11 AB2 GLU A 351 ? GLY A 360 ? GLU A 596 GLY A 605 1 ? 10 
HELX_P HELX_P12 AB3 LYS A 361 ? GLN A 372 ? LYS A 606 GLN A 617 1 ? 12 
HELX_P HELX_P13 AB4 THR A 394 ? ALA A 399 ? THR A 639 ALA A 644 1 ? 6  
HELX_P HELX_P14 AB5 SER A 411 ? LEU A 419 ? SER A 656 LEU A 664 1 ? 9  
HELX_P HELX_P15 AB6 GLY A 423 ? LEU A 427 ? GLY A 668 LEU A 672 5 ? 5  
HELX_P HELX_P16 AB7 SER A 452 ? ARG A 466 ? SER A 697 ARG A 711 1 ? 15 
HELX_P HELX_P17 AB8 GLN B 83  ? SER B 87  ? GLN B 328 SER B 332 5 ? 5  
HELX_P HELX_P18 AB9 SER B 90  ? PHE B 105 ? SER B 335 PHE B 350 1 ? 16 
HELX_P HELX_P19 AC1 VAL B 133 ? ASN B 138 ? VAL B 378 ASN B 383 1 ? 6  
HELX_P HELX_P20 AC2 LEU B 139 ? LEU B 147 ? LEU B 384 LEU B 392 1 ? 9  
HELX_P HELX_P21 AC3 ARG B 177 ? SER B 183 ? ARG B 422 SER B 428 1 ? 7  
HELX_P HELX_P22 AC4 SER B 184 ? GLU B 189 ? SER B 429 GLU B 434 1 ? 6  
HELX_P HELX_P23 AC5 GLY B 226 ? PHE B 240 ? GLY B 471 PHE B 485 1 ? 15 
HELX_P HELX_P24 AC6 LEU B 259 ? GLU B 263 ? LEU B 504 GLU B 508 5 ? 5  
HELX_P HELX_P25 AC7 MET B 276 ? MET B 300 ? MET B 521 MET B 545 1 ? 25 
HELX_P HELX_P26 AC8 ASN B 304 ? GLU B 317 ? ASN B 549 GLU B 562 1 ? 14 
HELX_P HELX_P27 AC9 PHE B 352 ? VAL B 359 ? PHE B 597 VAL B 604 1 ? 8  
HELX_P HELX_P28 AD1 LYS B 361 ? ALA B 368 ? LYS B 606 ALA B 613 1 ? 8  
HELX_P HELX_P29 AD2 ALA B 374 ? GLY B 378 ? ALA B 619 GLY B 623 5 ? 5  
HELX_P HELX_P30 AD3 THR B 394 ? ALA B 399 ? THR B 639 ALA B 644 1 ? 6  
HELX_P HELX_P31 AD4 ILE B 413 ? ILE B 418 ? ILE B 658 ILE B 663 1 ? 6  
HELX_P HELX_P32 AD5 SER B 452 ? ARG B 466 ? SER B 697 ARG B 711 1 ? 15 
HELX_P HELX_P33 AD6 SER C 87  ? GLU C 104 ? SER C 332 GLU C 349 1 ? 18 
HELX_P HELX_P34 AD7 VAL C 133 ? ASN C 138 ? VAL C 378 ASN C 383 1 ? 6  
HELX_P HELX_P35 AD8 LEU C 139 ? ARG C 145 ? LEU C 384 ARG C 390 1 ? 7  
HELX_P HELX_P36 AD9 ARG C 177 ? SER C 183 ? ARG C 422 SER C 428 1 ? 7  
HELX_P HELX_P37 AE1 ALA C 212 ? MET C 214 ? ALA C 457 MET C 459 5 ? 3  
HELX_P HELX_P38 AE2 GLY C 230 ? PHE C 240 ? GLY C 475 PHE C 485 1 ? 11 
HELX_P HELX_P39 AE3 ASP C 275 ? ALA C 299 ? ASP C 520 ALA C 544 1 ? 25 
HELX_P HELX_P40 AE4 ASN C 304 ? GLU C 316 ? ASN C 549 GLU C 561 1 ? 13 
HELX_P HELX_P41 AE5 GLU C 351 ? VAL C 359 ? GLU C 596 VAL C 604 1 ? 9  
HELX_P HELX_P42 AE6 LYS C 361 ? ALA C 374 ? LYS C 606 ALA C 619 1 ? 14 
HELX_P HELX_P43 AE7 SER C 411 ? LEU C 419 ? SER C 656 LEU C 664 1 ? 9  
HELX_P HELX_P44 AE8 SER C 452 ? LYS C 464 ? SER C 697 LYS C 709 1 ? 13 
HELX_P HELX_P45 AE9 LEU C 465 ? GLY C 467 ? LEU C 710 GLY C 712 5 ? 3  
HELX_P HELX_P46 AF1 ILE C 472 ? LEU C 476 ? ILE C 717 LEU C 721 5 ? 5  
HELX_P HELX_P47 AF2 PRO D 72  ? LEU D 76  ? PRO D 317 LEU D 321 5 ? 5  
HELX_P HELX_P48 AF3 SER D 87  ? PHE D 105 ? SER D 332 PHE D 350 1 ? 19 
HELX_P HELX_P49 AF4 VAL D 133 ? ASN D 138 ? VAL D 378 ASN D 383 1 ? 6  
HELX_P HELX_P50 AF5 LEU D 139 ? ALA D 148 ? LEU D 384 ALA D 393 1 ? 10 
HELX_P HELX_P51 AF6 ARG D 177 ? LEU D 182 ? ARG D 422 LEU D 427 1 ? 6  
HELX_P HELX_P52 AF7 SER D 184 ? GLU D 189 ? SER D 429 GLU D 434 1 ? 6  
HELX_P HELX_P53 AF8 GLY D 226 ? PHE D 240 ? GLY D 471 PHE D 485 1 ? 15 
HELX_P HELX_P54 AF9 GLU D 258 ? GLU D 263 ? GLU D 503 GLU D 508 5 ? 6  
HELX_P HELX_P55 AG1 ASP D 275 ? GLY D 301 ? ASP D 520 GLY D 546 1 ? 27 
HELX_P HELX_P56 AG2 ASN D 304 ? GLY D 319 ? ASN D 549 GLY D 564 1 ? 16 
HELX_P HELX_P57 AG3 GLU D 351 ? VAL D 359 ? GLU D 596 VAL D 604 1 ? 9  
HELX_P HELX_P58 AG4 GLY D 360 ? LYS D 373 ? GLY D 605 LYS D 618 1 ? 14 
HELX_P HELX_P59 AG5 LEU D 396 ? ILE D 401 ? LEU D 641 ILE D 646 1 ? 6  
HELX_P HELX_P60 AG6 SER D 411 ? LEU D 419 ? SER D 656 LEU D 664 1 ? 9  
HELX_P HELX_P61 AG7 GLY D 423 ? LEU D 427 ? GLY D 668 LEU D 672 5 ? 5  
HELX_P HELX_P62 AG8 SER D 452 ? GLY D 467 ? SER D 697 GLY D 712 1 ? 16 
HELX_P HELX_P63 AG9 ILE D 472 ? LEU D 476 ? ILE D 717 LEU D 721 5 ? 5  
HELX_P HELX_P64 AH1 PRO E 72  ? LEU E 76  ? PRO E 317 LEU E 321 5 ? 5  
HELX_P HELX_P65 AH2 SER E 87  ? GLU E 104 ? SER E 332 GLU E 349 1 ? 18 
HELX_P HELX_P66 AH3 VAL E 133 ? ASN E 138 ? VAL E 378 ASN E 383 1 ? 6  
HELX_P HELX_P67 AH4 LEU E 139 ? LEU E 147 ? LEU E 384 LEU E 392 1 ? 9  
HELX_P HELX_P68 AH5 ARG E 177 ? SER E 183 ? ARG E 422 SER E 428 1 ? 7  
HELX_P HELX_P69 AH6 SER E 184 ? GLU E 189 ? SER E 429 GLU E 434 1 ? 6  
HELX_P HELX_P70 AH7 GLY E 226 ? LEU E 239 ? GLY E 471 LEU E 484 1 ? 14 
HELX_P HELX_P71 AH8 GLU E 258 ? GLU E 263 ? GLU E 503 GLU E 508 5 ? 6  
HELX_P HELX_P72 AH9 LYS E 277 ? GLY E 301 ? LYS E 522 GLY E 546 1 ? 25 
HELX_P HELX_P73 AI1 ASN E 304 ? GLY E 319 ? ASN E 549 GLY E 564 1 ? 16 
HELX_P HELX_P74 AI2 GLU E 351 ? ILE E 358 ? GLU E 596 ILE E 603 1 ? 8  
HELX_P HELX_P75 AI3 GLY E 360 ? LYS E 373 ? GLY E 605 LYS E 618 1 ? 14 
HELX_P HELX_P76 AI4 SER E 411 ? LEU E 419 ? SER E 656 LEU E 664 1 ? 9  
HELX_P HELX_P77 AI5 SER E 452 ? ARG E 466 ? SER E 697 ARG E 711 1 ? 15 
HELX_P HELX_P78 AI6 PRO F 72  ? LEU F 76  ? PRO F 317 LEU F 321 5 ? 5  
HELX_P HELX_P79 AI7 SER F 87  ? GLU F 104 ? SER F 332 GLU F 349 1 ? 18 
HELX_P HELX_P80 AI8 LYS F 132 ? ASN F 138 ? LYS F 377 ASN F 383 1 ? 7  
HELX_P HELX_P81 AI9 LEU F 139 ? LEU F 147 ? LEU F 384 LEU F 392 1 ? 9  
HELX_P HELX_P82 AJ1 PHE F 178 ? SER F 183 ? PHE F 423 SER F 428 1 ? 6  
HELX_P HELX_P83 AJ2 SER F 184 ? GLU F 189 ? SER F 429 GLU F 434 1 ? 6  
HELX_P HELX_P84 AJ3 GLY F 226 ? PHE F 240 ? GLY F 471 PHE F 485 1 ? 15 
HELX_P HELX_P85 AJ4 MET F 276 ? GLY F 301 ? MET F 521 GLY F 546 1 ? 26 
HELX_P HELX_P86 AJ5 ASN F 304 ? ALA F 318 ? ASN F 549 ALA F 563 1 ? 15 
HELX_P HELX_P87 AJ6 GLU F 351 ? ILE F 358 ? GLU F 596 ILE F 603 1 ? 8  
HELX_P HELX_P88 AJ7 LYS F 361 ? ALA F 374 ? LYS F 606 ALA F 619 1 ? 14 
HELX_P HELX_P89 AJ8 THR F 394 ? ASN F 400 ? THR F 639 ASN F 645 1 ? 7  
HELX_P HELX_P90 AJ9 SER F 411 ? LEU F 419 ? SER F 656 LEU F 664 1 ? 9  
HELX_P HELX_P91 AK1 SER F 452 ? LEU F 465 ? SER F 697 LEU F 710 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? G DA 1  N1 ? ? ? 1_555 H DT 16 N3 ? ? G DA 1  H DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? G DA 1  N6 ? ? ? 1_555 H DT 16 O4 ? ? G DA 1  H DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? G DT 2  N3 ? ? ? 1_555 H DA 15 N1 ? ? G DT 2  H DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? G DT 2  O4 ? ? ? 1_555 H DA 15 N6 ? ? G DT 2  H DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? G DA 3  N1 ? ? ? 1_555 H DT 14 N3 ? ? G DA 3  H DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? G DA 3  N6 ? ? ? 1_555 H DT 14 O4 ? ? G DA 3  H DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? G DT 4  N3 ? ? ? 1_555 H DA 13 N1 ? ? G DT 4  H DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? G DT 4  O4 ? ? ? 1_555 H DA 13 N6 ? ? G DT 4  H DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? G DA 5  N1 ? ? ? 1_555 H DT 12 N3 ? ? G DA 5  H DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? G DA 5  N6 ? ? ? 1_555 H DT 12 O4 ? ? G DA 5  H DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? G DT 6  N3 ? ? ? 1_555 H DA 11 N1 ? ? G DT 6  H DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? G DT 6  O4 ? ? ? 1_555 H DA 11 N6 ? ? G DT 6  H DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? G DA 7  N1 ? ? ? 1_555 H DT 10 N3 ? ? G DA 7  H DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? G DA 7  N6 ? ? ? 1_555 H DT 10 O4 ? ? G DA 7  H DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? G DT 8  N3 ? ? ? 1_555 H DA 9  N1 ? ? G DT 8  H DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? G DT 8  O4 ? ? ? 1_555 H DA 9  N6 ? ? G DT 8  H DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? G DA 9  N1 ? ? ? 1_555 H DT 8  N3 ? ? G DA 9  H DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? G DA 9  N6 ? ? ? 1_555 H DT 8  O4 ? ? G DA 9  H DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? G DT 10 N3 ? ? ? 1_555 H DA 7  N1 ? ? G DT 10 H DA 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? G DT 10 O4 ? ? ? 1_555 H DA 7  N6 ? ? G DT 10 H DA 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? G DA 11 N1 ? ? ? 1_555 H DT 6  N3 ? ? G DA 11 H DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? G DA 11 N6 ? ? ? 1_555 H DT 6  O4 ? ? G DA 11 H DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? G DT 12 N3 ? ? ? 1_555 H DA 5  N1 ? ? G DT 12 H DA 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? G DT 12 O4 ? ? ? 1_555 H DA 5  N6 ? ? G DT 12 H DA 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? G DA 13 N1 ? ? ? 1_555 H DT 4  N3 ? ? G DA 13 H DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? G DA 13 N6 ? ? ? 1_555 H DT 4  O4 ? ? G DA 13 H DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? G DT 14 N3 ? ? ? 1_555 H DA 3  N1 ? ? G DT 14 H DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? G DT 14 O4 ? ? ? 1_555 H DA 3  N6 ? ? G DT 14 H DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? G DA 15 N1 ? ? ? 1_555 H DT 2  N3 ? ? G DA 15 H DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? G DA 15 N6 ? ? ? 1_555 H DT 2  O4 ? ? G DA 15 H DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? G DT 16 N3 ? ? ? 1_555 H DA 1  N1 ? ? G DT 16 H DA 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? G DT 16 O4 ? ? ? 1_555 H DA 1  N6 ? ? G DT 16 H DA 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 MET 214 A . ? MET 459 A PRO 215 A ? PRO 460 A 1 -6.63  
2 MET 214 B . ? MET 459 B PRO 215 B ? PRO 460 B 1 -22.04 
3 MET 214 C . ? MET 459 C PRO 215 C ? PRO 460 C 1 -7.44  
4 MET 214 D . ? MET 459 D PRO 215 D ? PRO 460 D 1 -11.92 
5 MET 214 E . ? MET 459 E PRO 215 E ? PRO 460 E 1 -8.91  
6 MET 214 F . ? MET 459 F PRO 215 F ? PRO 460 F 1 -15.96 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 2 ? 
AA3 ? 7 ? 
AA4 ? 4 ? 
AA5 ? 2 ? 
AA6 ? 3 ? 
AA7 ? 3 ? 
AA8 ? 2 ? 
AA9 ? 4 ? 
AB1 ? 6 ? 
AB2 ? 3 ? 
AB3 ? 4 ? 
AB4 ? 2 ? 
AB5 ? 7 ? 
AB6 ? 4 ? 
AB7 ? 2 ? 
AB8 ? 7 ? 
AB9 ? 4 ? 
AC1 ? 2 ? 
AC2 ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? parallel      
AA3 3 4 ? parallel      
AA3 4 5 ? parallel      
AA3 5 6 ? anti-parallel 
AA3 6 7 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA7 1 2 ? parallel      
AA7 2 3 ? parallel      
AA8 1 2 ? parallel      
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB1 4 5 ? anti-parallel 
AB1 5 6 ? parallel      
AB2 1 2 ? parallel      
AB2 2 3 ? parallel      
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB5 1 2 ? parallel      
AB5 2 3 ? parallel      
AB5 3 4 ? parallel      
AB5 4 5 ? parallel      
AB5 5 6 ? anti-parallel 
AB5 6 7 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? parallel      
AB8 2 3 ? parallel      
AB8 3 4 ? parallel      
AB8 4 5 ? parallel      
AB8 5 6 ? anti-parallel 
AB8 6 7 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? parallel      
AC2 2 3 ? parallel      
AC2 3 4 ? parallel      
AC2 4 5 ? parallel      
AC2 5 6 ? anti-parallel 
AC2 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 109 ? HIS A 115 ? VAL A 354 HIS A 360 
AA1 2 ILE A 120 ? PRO A 127 ? ILE A 365 PRO A 372 
AA1 3 VAL A 164 ? PRO A 169 ? VAL A 409 PRO A 414 
AA1 4 ARG A 153 ? VAL A 155 ? ARG A 398 VAL A 400 
AA2 1 PRO A 195 ? HIS A 200 ? PRO A 440 HIS A 445 
AA2 2 PRO A 206 ? ASP A 210 ? PRO A 451 ASP A 455 
AA3 1 ALA A 247 ? ILE A 252 ? ALA A 492 ILE A 497 
AA3 2 THR A 344 ? VAL A 349 ? THR A 589 VAL A 594 
AA3 3 ILE A 379 ? ALA A 384 ? ILE A 624 ALA A 629 
AA3 4 HIS A 216 ? ALA A 220 ? HIS A 461 ALA A 465 
AA3 5 ARG A 404 ? ALA A 406 ? ARG A 649 ALA A 651 
AA3 6 MET A 433 ? TYR A 435 ? MET A 678 TYR A 680 
AA3 7 ILE A 444 ? VAL A 446 ? ILE A 689 VAL A 691 
AA4 1 VAL B 109 ? HIS B 115 ? VAL B 354 HIS B 360 
AA4 2 ILE B 120 ? PRO B 127 ? ILE B 365 PRO B 372 
AA4 3 VAL B 164 ? PRO B 169 ? VAL B 409 PRO B 414 
AA4 4 ARG B 153 ? VAL B 155 ? ARG B 398 VAL B 400 
AA5 1 PRO B 195 ? LEU B 196 ? PRO B 440 LEU B 441 
AA5 2 THR B 209 ? ASP B 210 ? THR B 454 ASP B 455 
AA6 1 GLY B 199 ? HIS B 200 ? GLY B 444 HIS B 445 
AA6 2 ILE B 444 ? GLY B 448 ? ILE B 689 GLY B 693 
AA6 3 ASP B 432 ? TYR B 435 ? ASP B 677 TYR B 680 
AA7 1 ILE B 382 ? ALA B 384 ? ILE B 627 ALA B 629 
AA7 2 LEU B 217 ? VAL B 219 ? LEU B 462 VAL B 464 
AA7 3 THR B 403 ? ILE B 405 ? THR B 648 ILE B 650 
AA8 1 LEU B 249 ? ILE B 250 ? LEU B 494 ILE B 495 
AA8 2 VAL B 346 ? VAL B 347 ? VAL B 591 VAL B 592 
AA9 1 VAL C 109 ? PRO C 116 ? VAL C 354 PRO C 361 
AA9 2 ILE C 120 ? PRO C 127 ? ILE C 365 PRO C 372 
AA9 3 VAL C 164 ? PRO C 169 ? VAL C 409 PRO C 414 
AA9 4 ARG C 153 ? VAL C 155 ? ARG C 398 VAL C 400 
AB1 1 PRO C 206 ? ASP C 210 ? PRO C 451 ASP C 455 
AB1 2 PRO C 195 ? ASP C 201 ? PRO C 440 ASP C 446 
AB1 3 ILE C 444 ? GLY C 448 ? ILE C 689 GLY C 693 
AB1 4 ASP C 432 ? LEU C 436 ? ASP C 677 LEU C 681 
AB1 5 ARG C 404 ? PHE C 407 ? ARG C 649 PHE C 652 
AB1 6 LEU C 218 ? VAL C 219 ? LEU C 463 VAL C 464 
AB2 1 LEU C 249 ? ILE C 252 ? LEU C 494 ILE C 497 
AB2 2 VAL C 346 ? VAL C 349 ? VAL C 591 VAL C 594 
AB2 3 HIS C 380 ? ILE C 382 ? HIS C 625 ILE C 627 
AB3 1 VAL D 111 ? PRO D 116 ? VAL D 356 PRO D 361 
AB3 2 ILE D 120 ? ILE D 125 ? ILE D 365 ILE D 370 
AB3 3 GLY D 165 ? PRO D 169 ? GLY D 410 PRO D 414 
AB3 4 ARG D 153 ? VAL D 155 ? ARG D 398 VAL D 400 
AB4 1 PRO D 195 ? HIS D 200 ? PRO D 440 HIS D 445 
AB4 2 PRO D 206 ? ASP D 210 ? PRO D 451 ASP D 455 
AB5 1 ALA D 247 ? ILE D 252 ? ALA D 492 ILE D 497 
AB5 2 THR D 344 ? VAL D 349 ? THR D 589 VAL D 594 
AB5 3 HIS D 380 ? ILE D 382 ? HIS D 625 ILE D 627 
AB5 4 HIS D 216 ? ALA D 220 ? HIS D 461 ALA D 465 
AB5 5 THR D 403 ? ALA D 406 ? THR D 648 ALA D 651 
AB5 6 ASP D 432 ? LEU D 436 ? ASP D 677 LEU D 681 
AB5 7 ILE D 444 ? HIS D 447 ? ILE D 689 HIS D 692 
AB6 1 VAL E 109 ? PRO E 116 ? VAL E 354 PRO E 361 
AB6 2 ILE E 120 ? PRO E 127 ? ILE E 365 PRO E 372 
AB6 3 VAL E 164 ? PRO E 169 ? VAL E 409 PRO E 414 
AB6 4 ARG E 153 ? VAL E 155 ? ARG E 398 VAL E 400 
AB7 1 PRO E 195 ? HIS E 200 ? PRO E 440 HIS E 445 
AB7 2 PRO E 206 ? ASP E 210 ? PRO E 451 ASP E 455 
AB8 1 ALA E 247 ? ILE E 252 ? ALA E 492 ILE E 497 
AB8 2 THR E 344 ? VAL E 349 ? THR E 589 VAL E 594 
AB8 3 HIS E 380 ? THR E 385 ? HIS E 625 THR E 630 
AB8 4 LEU E 217 ? ALA E 220 ? LEU E 462 ALA E 465 
AB8 5 ARG E 404 ? ALA E 406 ? ARG E 649 ALA E 651 
AB8 6 ASP E 432 ? LEU E 436 ? ASP E 677 LEU E 681 
AB8 7 ILE E 444 ? HIS E 447 ? ILE E 689 HIS E 692 
AB9 1 VAL F 111 ? PRO F 116 ? VAL F 356 PRO F 361 
AB9 2 ILE F 120 ? ILE F 125 ? ILE F 365 ILE F 370 
AB9 3 VAL F 164 ? PRO F 169 ? VAL F 409 PRO F 414 
AB9 4 ARG F 153 ? VAL F 155 ? ARG F 398 VAL F 400 
AC1 1 PRO F 195 ? HIS F 200 ? PRO F 440 HIS F 445 
AC1 2 PRO F 206 ? ASP F 210 ? PRO F 451 ASP F 455 
AC2 1 ALA F 247 ? ILE F 252 ? ALA F 492 ILE F 497 
AC2 2 THR F 344 ? VAL F 349 ? THR F 589 VAL F 594 
AC2 3 ILE F 379 ? THR F 385 ? ILE F 624 THR F 630 
AC2 4 HIS F 216 ? ALA F 220 ? HIS F 461 ALA F 465 
AC2 5 ARG F 404 ? ALA F 406 ? ARG F 649 ALA F 651 
AC2 6 ASP F 432 ? TYR F 435 ? ASP F 677 TYR F 680 
AC2 7 ARG F 445 ? HIS F 447 ? ARG F 690 HIS F 692 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ASP A 112 ? N ASP A 357 O GLU A 124 ? O GLU A 369 
AA1 2 3 N THR A 121 ? N THR A 366 O ILE A 168 ? O ILE A 413 
AA1 3 4 O GLY A 165 ? O GLY A 410 N VAL A 155 ? N VAL A 400 
AA2 1 2 N GLY A 199 ? N GLY A 444 O ILE A 207 ? O ILE A 452 
AA3 1 2 N ARG A 248 ? N ARG A 493 O THR A 344 ? O THR A 589 
AA3 2 3 N VAL A 347 ? N VAL A 592 O ILE A 382 ? O ILE A 627 
AA3 3 4 O LEU A 381 ? O LEU A 626 N LEU A 217 ? N LEU A 462 
AA3 4 5 N LEU A 218 ? N LEU A 463 O ILE A 405 ? O ILE A 650 
AA3 5 6 N ALA A 406 ? N ALA A 651 O LEU A 434 ? O LEU A 679 
AA3 6 7 N TYR A 435 ? N TYR A 680 O ILE A 444 ? O ILE A 689 
AA4 1 2 N SER B 110 ? N SER B 355 O GLN B 126 ? O GLN B 371 
AA4 2 3 N ILE B 125 ? N ILE B 370 O VAL B 164 ? O VAL B 409 
AA4 3 4 O GLY B 165 ? O GLY B 410 N VAL B 155 ? N VAL B 400 
AA5 1 2 N LEU B 196 ? N LEU B 441 O THR B 209 ? O THR B 454 
AA6 1 2 N HIS B 200 ? N HIS B 445 O HIS B 447 ? O HIS B 692 
AA6 2 3 O ILE B 444 ? O ILE B 689 N TYR B 435 ? N TYR B 680 
AA7 1 2 O LEU B 383 ? O LEU B 628 N VAL B 219 ? N VAL B 464 
AA7 2 3 N LEU B 218 ? N LEU B 463 O ILE B 405 ? O ILE B 650 
AA8 1 2 N ILE B 250 ? N ILE B 495 O VAL B 346 ? O VAL B 591 
AA9 1 2 N HIS C 115 ? N HIS C 360 O ARG C 122 ? O ARG C 367 
AA9 2 3 N ILE C 125 ? N ILE C 370 O VAL C 164 ? O VAL C 409 
AA9 3 4 O GLY C 165 ? O GLY C 410 N VAL C 155 ? N VAL C 400 
AB1 1 2 O ILE C 207 ? O ILE C 452 N GLY C 199 ? N GLY C 444 
AB1 2 3 N HIS C 200 ? N HIS C 445 O HIS C 447 ? O HIS C 692 
AB1 3 4 O ILE C 444 ? O ILE C 689 N TYR C 435 ? N TYR C 680 
AB1 4 5 O LEU C 434 ? O LEU C 679 N ALA C 406 ? N ALA C 651 
AB1 5 6 O ILE C 405 ? O ILE C 650 N LEU C 218 ? N LEU C 463 
AB2 1 2 N ILE C 250 ? N ILE C 495 O VAL C 346 ? O VAL C 591 
AB2 2 3 N VAL C 347 ? N VAL C 592 O ILE C 382 ? O ILE C 627 
AB3 1 2 N HIS D 115 ? N HIS D 360 O ARG D 122 ? O ARG D 367 
AB3 2 3 N PHE D 123 ? N PHE D 368 O ILE D 166 ? O ILE D 411 
AB3 3 4 O GLU D 167 ? O GLU D 412 N ARG D 153 ? N ARG D 398 
AB4 1 2 N GLY D 199 ? N GLY D 444 O ILE D 207 ? O ILE D 452 
AB5 1 2 N ARG D 248 ? N ARG D 493 O VAL D 346 ? O VAL D 591 
AB5 2 3 N VAL D 349 ? N VAL D 594 O ILE D 382 ? O ILE D 627 
AB5 3 4 O LEU D 381 ? O LEU D 626 N LEU D 217 ? N LEU D 462 
AB5 4 5 N LEU D 218 ? N LEU D 463 O ILE D 405 ? O ILE D 650 
AB5 5 6 N ALA D 406 ? N ALA D 651 O LEU D 434 ? O LEU D 679 
AB5 6 7 N MET D 433 ? N MET D 678 O VAL D 446 ? O VAL D 691 
AB6 1 2 N SER E 113 ? N SER E 358 O GLU E 124 ? O GLU E 369 
AB6 2 3 N PHE E 123 ? N PHE E 368 O ILE E 166 ? O ILE E 411 
AB6 3 4 O GLY E 165 ? O GLY E 410 N VAL E 155 ? N VAL E 400 
AB7 1 2 N LEU E 196 ? N LEU E 441 O THR E 209 ? O THR E 454 
AB8 1 2 N ILE E 252 ? N ILE E 497 O VAL E 348 ? O VAL E 593 
AB8 2 3 N VAL E 349 ? N VAL E 594 O ALA E 384 ? O ALA E 629 
AB8 3 4 O LEU E 383 ? O LEU E 628 N VAL E 219 ? N VAL E 464 
AB8 4 5 N ALA E 220 ? N ALA E 465 O ILE E 405 ? O ILE E 650 
AB8 5 6 N ARG E 404 ? N ARG E 649 O LEU E 436 ? O LEU E 681 
AB8 6 7 N TYR E 435 ? N TYR E 680 O ILE E 444 ? O ILE E 689 
AB9 1 2 N HIS F 115 ? N HIS F 360 O ARG F 122 ? O ARG F 367 
AB9 2 3 N PHE F 123 ? N PHE F 368 O ILE F 166 ? O ILE F 411 
AB9 3 4 O GLY F 165 ? O GLY F 410 N VAL F 155 ? N VAL F 400 
AC1 1 2 N LEU F 196 ? N LEU F 441 O THR F 209 ? O THR F 454 
AC2 1 2 N ILE F 250 ? N ILE F 495 O VAL F 348 ? O VAL F 593 
AC2 2 3 N VAL F 347 ? N VAL F 592 O ILE F 382 ? O ILE F 627 
AC2 3 4 O THR F 385 ? O THR F 630 N VAL F 219 ? N VAL F 464 
AC2 4 5 N LEU F 218 ? N LEU F 463 O ILE F 405 ? O ILE F 650 
AC2 5 6 N ALA F 406 ? N ALA F 651 O LEU F 434 ? O LEU F 679 
AC2 6 7 N MET F 433 ? N MET F 678 O VAL F 446 ? O VAL F 691 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ADP 801 ? 10 'binding site for residue ADP A 801' 
AC2 Software B ADP 801 ? 11 'binding site for residue ADP B 801' 
AC3 Software C ADP 801 ? 10 'binding site for residue ADP C 801' 
AC4 Software D ADP 801 ? 10 'binding site for residue ADP D 801' 
AC5 Software E ADP 801 ? 11 'binding site for residue ADP E 801' 
AC6 Software F ADP 801 ? 10 'binding site for residue ADP F 801' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 THR A 222 ? THR A 467 . ? 1_555 ? 
2  AC1 10 THR A 223 ? THR A 468 . ? 1_555 ? 
3  AC1 10 GLY A 224 ? GLY A 469 . ? 1_555 ? 
4  AC1 10 GLY A 226 ? GLY A 471 . ? 1_555 ? 
5  AC1 10 LYS A 227 ? LYS A 472 . ? 1_555 ? 
6  AC1 10 SER A 228 ? SER A 473 . ? 1_555 ? 
7  AC1 10 VAL A 229 ? VAL A 474 . ? 1_555 ? 
8  AC1 10 GLN A 386 ? GLN A 631 . ? 1_555 ? 
9  AC1 10 HIS A 430 ? HIS A 675 . ? 1_555 ? 
10 AC1 10 PHE A 450 ? PHE A 695 . ? 1_555 ? 
11 AC2 11 MET B 175 ? MET B 420 . ? 1_555 ? 
12 AC2 11 THR B 222 ? THR B 467 . ? 1_555 ? 
13 AC2 11 THR B 223 ? THR B 468 . ? 1_555 ? 
14 AC2 11 SER B 225 ? SER B 470 . ? 1_555 ? 
15 AC2 11 GLY B 226 ? GLY B 471 . ? 1_555 ? 
16 AC2 11 LYS B 227 ? LYS B 472 . ? 1_555 ? 
17 AC2 11 SER B 228 ? SER B 473 . ? 1_555 ? 
18 AC2 11 VAL B 229 ? VAL B 474 . ? 1_555 ? 
19 AC2 11 GLN B 386 ? GLN B 631 . ? 1_555 ? 
20 AC2 11 HIS B 430 ? HIS B 675 . ? 1_555 ? 
21 AC2 11 PHE B 450 ? PHE B 695 . ? 1_555 ? 
22 AC3 10 THR C 223 ? THR C 468 . ? 1_555 ? 
23 AC3 10 GLY C 224 ? GLY C 469 . ? 1_555 ? 
24 AC3 10 SER C 225 ? SER C 470 . ? 1_555 ? 
25 AC3 10 GLY C 226 ? GLY C 471 . ? 1_555 ? 
26 AC3 10 LYS C 227 ? LYS C 472 . ? 1_555 ? 
27 AC3 10 SER C 228 ? SER C 473 . ? 1_555 ? 
28 AC3 10 GLN C 386 ? GLN C 631 . ? 1_555 ? 
29 AC3 10 HIS C 430 ? HIS C 675 . ? 1_555 ? 
30 AC3 10 GLY C 431 ? GLY C 676 . ? 1_555 ? 
31 AC3 10 PHE C 450 ? PHE C 695 . ? 1_555 ? 
32 AC4 10 THR D 223 ? THR D 468 . ? 1_555 ? 
33 AC4 10 GLY D 224 ? GLY D 469 . ? 1_555 ? 
34 AC4 10 GLY D 226 ? GLY D 471 . ? 1_555 ? 
35 AC4 10 LYS D 227 ? LYS D 472 . ? 1_555 ? 
36 AC4 10 SER D 228 ? SER D 473 . ? 1_555 ? 
37 AC4 10 VAL D 229 ? VAL D 474 . ? 1_555 ? 
38 AC4 10 GLN D 386 ? GLN D 631 . ? 1_555 ? 
39 AC4 10 HIS D 430 ? HIS D 675 . ? 1_555 ? 
40 AC4 10 GLY D 431 ? GLY D 676 . ? 1_555 ? 
41 AC4 10 PHE D 450 ? PHE D 695 . ? 1_555 ? 
42 AC5 11 MET E 175 ? MET E 420 . ? 1_555 ? 
43 AC5 11 THR E 223 ? THR E 468 . ? 1_555 ? 
44 AC5 11 GLY E 224 ? GLY E 469 . ? 1_555 ? 
45 AC5 11 SER E 225 ? SER E 470 . ? 1_555 ? 
46 AC5 11 GLY E 226 ? GLY E 471 . ? 1_555 ? 
47 AC5 11 LYS E 227 ? LYS E 472 . ? 1_555 ? 
48 AC5 11 SER E 228 ? SER E 473 . ? 1_555 ? 
49 AC5 11 VAL E 229 ? VAL E 474 . ? 1_555 ? 
50 AC5 11 GLN E 386 ? GLN E 631 . ? 1_555 ? 
51 AC5 11 HIS E 430 ? HIS E 675 . ? 1_555 ? 
52 AC5 11 PHE E 450 ? PHE E 695 . ? 1_555 ? 
53 AC6 10 MET F 175 ? MET F 420 . ? 1_555 ? 
54 AC6 10 THR F 223 ? THR F 468 . ? 1_555 ? 
55 AC6 10 GLY F 224 ? GLY F 469 . ? 1_555 ? 
56 AC6 10 GLY F 226 ? GLY F 471 . ? 1_555 ? 
57 AC6 10 LYS F 227 ? LYS F 472 . ? 1_555 ? 
58 AC6 10 SER F 228 ? SER F 473 . ? 1_555 ? 
59 AC6 10 VAL F 229 ? VAL F 474 . ? 1_555 ? 
60 AC6 10 HIS F 430 ? HIS F 675 . ? 1_555 ? 
61 AC6 10 GLY F 448 ? GLY F 693 . ? 1_555 ? 
62 AC6 10 PHE F 450 ? PHE F 695 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6T8G 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . LEU A 1 70  ? 72.61300  123.81600 149.40700 1.000 118.39000 ? 315 LEU A N     1 
ATOM   2     C CA    . LEU A 1 70  ? 73.78600  124.67600 149.35900 1.000 118.39000 ? 315 LEU A CA    1 
ATOM   3     C C     . LEU A 1 70  ? 73.96700  125.35500 150.71000 1.000 118.39000 ? 315 LEU A C     1 
ATOM   4     O O     . LEU A 1 70  ? 73.09200  126.09000 151.15600 1.000 118.39000 ? 315 LEU A O     1 
ATOM   5     C CB    . LEU A 1 70  ? 73.64500  125.70100 148.23100 1.000 118.39000 ? 315 LEU A CB    1 
ATOM   6     C CG    . LEU A 1 70  ? 74.83800  126.55500 147.80000 1.000 118.39000 ? 315 LEU A CG    1 
ATOM   7     C CD1   . LEU A 1 70  ? 74.74800  126.80800 146.31400 1.000 118.39000 ? 315 LEU A CD1   1 
ATOM   8     C CD2   . LEU A 1 70  ? 74.87900  127.88600 148.52900 1.000 118.39000 ? 315 LEU A CD2   1 
ATOM   9     N N     . PRO A 1 71  ? 75.09500  125.10300 151.36400 1.000 128.44000 ? 316 PRO A N     1 
ATOM   10    C CA    . PRO A 1 71  ? 75.34500  125.69900 152.67600 1.000 128.44000 ? 316 PRO A CA    1 
ATOM   11    C C     . PRO A 1 71  ? 75.77900  127.14700 152.54900 1.000 128.44000 ? 316 PRO A C     1 
ATOM   12    O O     . PRO A 1 71  ? 76.39000  127.53800 151.54400 1.000 128.44000 ? 316 PRO A O     1 
ATOM   13    C CB    . PRO A 1 71  ? 76.47200  124.82800 153.24600 1.000 128.44000 ? 316 PRO A CB    1 
ATOM   14    C CG    . PRO A 1 71  ? 77.16200  124.30700 152.05800 1.000 128.44000 ? 316 PRO A CG    1 
ATOM   15    C CD    . PRO A 1 71  ? 76.10900  124.09900 151.01800 1.000 128.44000 ? 316 PRO A CD    1 
ATOM   16    N N     . PRO A 1 72  ? 75.48700  127.97500 153.55300 1.000 133.64000 ? 317 PRO A N     1 
ATOM   17    C CA    . PRO A 1 72  ? 75.81300  129.40000 153.44400 1.000 133.64000 ? 317 PRO A CA    1 
ATOM   18    C C     . PRO A 1 72  ? 77.26900  129.69800 153.75000 1.000 133.64000 ? 317 PRO A C     1 
ATOM   19    O O     . PRO A 1 72  ? 78.08500  128.79100 153.94200 1.000 133.64000 ? 317 PRO A O     1 
ATOM   20    C CB    . PRO A 1 72  ? 74.88600  130.04600 154.48000 1.000 133.64000 ? 317 PRO A CB    1 
ATOM   21    C CG    . PRO A 1 72  ? 74.71400  128.99600 155.51100 1.000 133.64000 ? 317 PRO A CG    1 
ATOM   22    C CD    . PRO A 1 72  ? 74.71300  127.68500 154.77300 1.000 133.64000 ? 317 PRO A CD    1 
ATOM   23    N N     . LEU A 1 73  ? 77.59100  130.98700 153.80300 1.000 126.16000 ? 318 LEU A N     1 
ATOM   24    C CA    . LEU A 1 73  ? 78.94600  131.46300 154.02800 1.000 126.16000 ? 318 LEU A CA    1 
ATOM   25    C C     . LEU A 1 73  ? 79.33600  131.48200 155.49600 1.000 126.16000 ? 318 LEU A C     1 
ATOM   26    O O     . LEU A 1 73  ? 80.48100  131.81900 155.80900 1.000 126.16000 ? 318 LEU A O     1 
ATOM   27    C CB    . LEU A 1 73  ? 79.08100  132.87200 153.46300 1.000 126.16000 ? 318 LEU A CB    1 
ATOM   28    C CG    . LEU A 1 73  ? 78.74000  132.97600 151.98200 1.000 126.16000 ? 318 LEU A CG    1 
ATOM   29    C CD1   . LEU A 1 73  ? 78.76000  134.42300 151.52200 1.000 126.16000 ? 318 LEU A CD1   1 
ATOM   30    C CD2   . LEU A 1 73  ? 79.70100  132.13400 151.17800 1.000 126.16000 ? 318 LEU A CD2   1 
ATOM   31    N N     . SER A 1 74  ? 78.42200  131.12700 156.39500 1.000 123.66000 ? 319 SER A N     1 
ATOM   32    C CA    . SER A 1 74  ? 78.58100  131.44000 157.80700 1.000 123.66000 ? 319 SER A CA    1 
ATOM   33    C C     . SER A 1 74  ? 79.60900  130.57200 158.51600 1.000 123.66000 ? 319 SER A C     1 
ATOM   34    O O     . SER A 1 74  ? 80.02200  130.92900 159.62200 1.000 123.66000 ? 319 SER A O     1 
ATOM   35    C CB    . SER A 1 74  ? 77.23500  131.31300 158.51900 1.000 123.66000 ? 319 SER A CB    1 
ATOM   36    O OG    . SER A 1 74  ? 76.31100  132.26100 158.02100 1.000 123.66000 ? 319 SER A OG    1 
ATOM   37    N N     . LEU A 1 75  ? 80.03800  129.46000 157.92500 1.000 119.76000 ? 320 LEU A N     1 
ATOM   38    C CA    . LEU A 1 75  ? 80.93800  128.56600 158.63900 1.000 119.76000 ? 320 LEU A CA    1 
ATOM   39    C C     . LEU A 1 75  ? 82.37100  129.06400 158.71000 1.000 119.76000 ? 320 LEU A C     1 
ATOM   40    O O     . LEU A 1 75  ? 83.17000  128.48100 159.44900 1.000 119.76000 ? 320 LEU A O     1 
ATOM   41    C CB    . LEU A 1 75  ? 80.92200  127.18500 158.00100 1.000 119.76000 ? 320 LEU A CB    1 
ATOM   42    C CG    . LEU A 1 75  ? 79.62400  126.44400 158.26300 1.000 119.76000 ? 320 LEU A CG    1 
ATOM   43    C CD1   . LEU A 1 75  ? 79.60600  125.13200 157.51300 1.000 119.76000 ? 320 LEU A CD1   1 
ATOM   44    C CD2   . LEU A 1 75  ? 79.49100  126.21200 159.75300 1.000 119.76000 ? 320 LEU A CD2   1 
ATOM   45    N N     . LEU A 1 76  ? 82.71500  130.11700 157.98100 1.000 123.31000 ? 321 LEU A N     1 
ATOM   46    C CA    . LEU A 1 76  ? 84.07700  130.61900 157.96200 1.000 123.31000 ? 321 LEU A CA    1 
ATOM   47    C C     . LEU A 1 76  ? 84.30500  131.61100 159.09300 1.000 123.31000 ? 321 LEU A C     1 
ATOM   48    O O     . LEU A 1 76  ? 83.37100  132.09300 159.73500 1.000 123.31000 ? 321 LEU A O     1 
ATOM   49    C CB    . LEU A 1 76  ? 84.37500  131.28000 156.62500 1.000 123.31000 ? 321 LEU A CB    1 
ATOM   50    C CG    . LEU A 1 76  ? 84.26800  130.31500 155.45500 1.000 123.31000 ? 321 LEU A CG    1 
ATOM   51    C CD1   . LEU A 1 76  ? 84.41700  131.07400 154.16800 1.000 123.31000 ? 321 LEU A CD1   1 
ATOM   52    C CD2   . LEU A 1 76  ? 85.32100  129.23900 155.57700 1.000 123.31000 ? 321 LEU A CD2   1 
ATOM   53    N N     . ASP A 1 77  ? 85.57300  131.91500 159.33200 1.000 129.71000 ? 322 ASP A N     1 
ATOM   54    C CA    . ASP A 1 77  ? 85.91100  132.94500 160.29500 1.000 129.71000 ? 322 ASP A CA    1 
ATOM   55    C C     . ASP A 1 77  ? 85.57300  134.31400 159.71500 1.000 129.71000 ? 322 ASP A C     1 
ATOM   56    O O     . ASP A 1 77  ? 85.69900  134.52100 158.50500 1.000 129.71000 ? 322 ASP A O     1 
ATOM   57    C CB    . ASP A 1 77  ? 87.39000  132.86900 160.65500 1.000 129.71000 ? 322 ASP A CB    1 
ATOM   58    C CG    . ASP A 1 77  ? 87.72000  131.63800 161.46700 1.000 129.71000 ? 322 ASP A CG    1 
ATOM   59    O OD1   . ASP A 1 77  ? 86.84500  131.19200 162.23600 1.000 129.71000 ? 322 ASP A OD1   1 
ATOM   60    O OD2   . ASP A 1 77  ? 88.84100  131.10600 161.32400 1.000 129.71000 ? 322 ASP A OD2   1 
ATOM   61    N N     . PRO A 1 78  ? 85.12300  135.26000 160.54300 1.000 133.39000 ? 323 PRO A N     1 
ATOM   62    C CA    . PRO A 1 78  ? 84.68000  136.55500 160.01000 1.000 133.39000 ? 323 PRO A CA    1 
ATOM   63    C C     . PRO A 1 78  ? 85.81100  137.42400 159.49100 1.000 133.39000 ? 323 PRO A C     1 
ATOM   64    O O     . PRO A 1 78  ? 86.99100  137.07900 159.60300 1.000 133.39000 ? 323 PRO A O     1 
ATOM   65    C CB    . PRO A 1 78  ? 84.00100  137.21400 161.21800 1.000 133.39000 ? 323 PRO A CB    1 
ATOM   66    C CG    . PRO A 1 78  ? 83.65700  136.09100 162.12900 1.000 133.39000 ? 323 PRO A CG    1 
ATOM   67    C CD    . PRO A 1 78  ? 84.76400  135.10400 161.96100 1.000 133.39000 ? 323 PRO A CD    1 
ATOM   68    N N     . ALA A 1 79  ? 85.44700  138.56000 158.91100 1.000 144.64000 ? 324 ALA A N     1 
ATOM   69    C CA    . ALA A 1 79  ? 86.41700  139.57200 158.52000 1.000 144.64000 ? 324 ALA A CA    1 
ATOM   70    C C     . ALA A 1 79  ? 86.78700  140.37900 159.75600 1.000 144.64000 ? 324 ALA A C     1 
ATOM   71    O O     . ALA A 1 79  ? 85.99700  141.20300 160.22600 1.000 144.64000 ? 324 ALA A O     1 
ATOM   72    C CB    . ALA A 1 79  ? 85.84100  140.46900 157.43000 1.000 144.64000 ? 324 ALA A CB    1 
ATOM   73    N N     . GLU A 1 80  ? 87.98600  140.15600 160.28200 1.000 143.60000 ? 325 GLU A N     1 
ATOM   74    C CA    . GLU A 1 80  ? 88.39500  140.81600 161.51300 1.000 143.60000 ? 325 GLU A CA    1 
ATOM   75    C C     . GLU A 1 80  ? 88.79300  142.26300 161.22700 1.000 143.60000 ? 325 GLU A C     1 
ATOM   76    O O     . GLU A 1 80  ? 88.67100  142.76900 160.10800 1.000 143.60000 ? 325 GLU A O     1 
ATOM   77    C CB    . GLU A 1 80  ? 89.53600  140.05300 162.18000 1.000 143.60000 ? 325 GLU A CB    1 
ATOM   78    C CG    . GLU A 1 80  ? 90.83700  140.08400 161.39900 1.000 143.60000 ? 325 GLU A CG    1 
ATOM   79    C CD    . GLU A 1 80  ? 91.97200  139.40400 162.13100 1.000 143.60000 ? 325 GLU A CD    1 
ATOM   80    O OE1   . GLU A 1 80  ? 91.74000  138.89700 163.24600 1.000 143.60000 ? 325 GLU A OE1   1 
ATOM   81    O OE2   . GLU A 1 80  ? 93.09700  139.38400 161.59300 1.000 143.60000 ? 325 GLU A OE2   1 
ATOM   82    N N     . VAL A 1 81  ? 89.27700  142.94700 162.25600 1.000 146.31000 ? 326 VAL A N     1 
ATOM   83    C CA    . VAL A 1 81  ? 89.76200  144.31400 162.14700 1.000 146.31000 ? 326 VAL A CA    1 
ATOM   84    C C     . VAL A 1 81  ? 91.24800  144.29100 162.46400 1.000 146.31000 ? 326 VAL A C     1 
ATOM   85    O O     . VAL A 1 81  ? 91.65500  143.78200 163.51600 1.000 146.31000 ? 326 VAL A O     1 
ATOM   86    C CB    . VAL A 1 81  ? 89.01000  145.26000 163.09700 1.000 146.31000 ? 326 VAL A CB    1 
ATOM   87    C CG1   . VAL A 1 81  ? 89.54600  146.67400 162.97600 1.000 146.31000 ? 326 VAL A CG1   1 
ATOM   88    C CG2   . VAL A 1 81  ? 87.51800  145.22100 162.82100 1.000 146.31000 ? 326 VAL A CG2   1 
ATOM   89    N N     . LYS A 1 82  ? 92.06000  144.81900 161.55600 1.000 144.78000 ? 327 LYS A N     1 
ATOM   90    C CA    . LYS A 1 82  ? 93.48400  144.98500 161.80100 1.000 144.78000 ? 327 LYS A CA    1 
ATOM   91    C C     . LYS A 1 82  ? 93.84300  146.44000 161.54900 1.000 144.78000 ? 327 LYS A C     1 
ATOM   92    O O     . LYS A 1 82  ? 93.68100  146.93900 160.43200 1.000 144.78000 ? 327 LYS A O     1 
ATOM   93    C CB    . LYS A 1 82  ? 94.32200  144.05700 160.92200 1.000 144.78000 ? 327 LYS A CB    1 
ATOM   94    C CG    . LYS A 1 82  ? 95.81100  144.03900 161.27600 1.000 144.78000 ? 327 LYS A CG    1 
ATOM   95    C CD    . LYS A 1 82  ? 96.03200  143.40400 162.64700 1.000 144.78000 ? 327 LYS A CD    1 
ATOM   96    C CE    . LYS A 1 82  ? 97.49700  143.37100 163.04200 1.000 144.78000 ? 327 LYS A CE    1 
ATOM   97    N NZ    . LYS A 1 82  ? 98.27700  142.46100 162.17200 1.000 144.78000 ? 327 LYS A NZ    1 
ATOM   98    N N     . GLN A 1 83  ? 94.32100  147.11200 162.59000 1.000 152.62000 ? 328 GLN A N     1 
ATOM   99    C CA    . GLN A 1 83  ? 94.69900  148.51500 162.53800 1.000 152.62000 ? 328 GLN A CA    1 
ATOM   100   C C     . GLN A 1 83  ? 96.15000  148.71900 162.12400 1.000 152.62000 ? 328 GLN A C     1 
ATOM   101   O O     . GLN A 1 83  ? 96.66000  149.83800 162.22200 1.000 152.62000 ? 328 GLN A O     1 
ATOM   102   C CB    . GLN A 1 83  ? 94.44800  149.16900 163.89900 1.000 152.62000 ? 328 GLN A CB    1 
ATOM   103   C CG    . GLN A 1 83  ? 95.34600  148.65400 165.01900 1.000 152.62000 ? 328 GLN A CG    1 
ATOM   104   C CD    . GLN A 1 83  ? 94.77800  147.43600 165.72600 1.000 152.62000 ? 328 GLN A CD    1 
ATOM   105   O OE1   . GLN A 1 83  ? 93.84400  146.79900 165.24000 1.000 152.62000 ? 328 GLN A OE1   1 
ATOM   106   N NE2   . GLN A 1 83  ? 95.35200  147.09800 166.87400 1.000 152.62000 ? 328 GLN A NE2   1 
ATOM   107   N N     . LYS A 1 84  ? 96.81600  147.66900 161.64200 1.000 147.39000 ? 329 LYS A N     1 
ATOM   108   C CA    . LYS A 1 84  ? 98.22600  147.73900 161.27900 1.000 147.39000 ? 329 LYS A CA    1 
ATOM   109   C C     . LYS A 1 84  ? 98.44600  148.49400 159.96900 1.000 147.39000 ? 329 LYS A C     1 
ATOM   110   O O     . LYS A 1 84  ? 99.59800  148.79000 159.62100 1.000 147.39000 ? 329 LYS A O     1 
ATOM   111   C CB    . LYS A 1 84  ? 98.78000  146.30700 161.23100 1.000 147.39000 ? 329 LYS A CB    1 
ATOM   112   C CG    . LYS A 1 84  ? 100.29000 146.13700 161.14800 1.000 147.39000 ? 329 LYS A CG    1 
ATOM   113   C CD    . LYS A 1 84  ? 100.98800 146.78900 162.32200 1.000 147.39000 ? 329 LYS A CD    1 
ATOM   114   C CE    . LYS A 1 84  ? 100.69200 146.06500 163.61700 1.000 147.39000 ? 329 LYS A CE    1 
ATOM   115   N NZ    . LYS A 1 84  ? 101.43500 146.67000 164.75200 1.000 147.39000 ? 329 LYS A NZ    1 
ATOM   116   N N     . SER A 1 85  ? 97.36800  148.81500 159.24900 1.000 151.39000 ? 330 SER A N     1 
ATOM   117   C CA    . SER A 1 85  ? 97.42700  149.72400 158.11200 1.000 151.39000 ? 330 SER A CA    1 
ATOM   118   C C     . SER A 1 85  ? 98.01500  151.05900 158.54200 1.000 151.39000 ? 330 SER A C     1 
ATOM   119   O O     . SER A 1 85  ? 97.48100  151.72200 159.43800 1.000 151.39000 ? 330 SER A O     1 
ATOM   120   C CB    . SER A 1 85  ? 96.03000  149.91100 157.52600 1.000 151.39000 ? 330 SER A CB    1 
ATOM   121   O OG    . SER A 1 85  ? 95.17200  150.53300 158.46500 1.000 151.39000 ? 330 SER A OG    1 
ATOM   122   N N     . TYR A 1 86  ? 99.13700  151.41700 157.92000 1.000 134.87000 ? 331 TYR A N     1 
ATOM   123   C CA    . TYR A 1 86  ? 99.99300  152.49500 158.38600 1.000 134.87000 ? 331 TYR A CA    1 
ATOM   124   C C     . TYR A 1 86  ? 99.29900  153.84900 158.30600 1.000 134.87000 ? 331 TYR A C     1 
ATOM   125   O O     . TYR A 1 86  ? 98.36000  154.05900 157.53400 1.000 134.87000 ? 331 TYR A O     1 
ATOM   126   C CB    . TYR A 1 86  ? 101.28200 152.53700 157.57100 1.000 134.87000 ? 331 TYR A CB    1 
ATOM   127   C CG    . TYR A 1 86  ? 102.31100 151.49600 157.94300 1.000 134.87000 ? 331 TYR A CG    1 
ATOM   128   C CD1   . TYR A 1 86  ? 102.21400 150.78100 159.12900 1.000 134.87000 ? 331 TYR A CD1   1 
ATOM   129   C CD2   . TYR A 1 86  ? 103.40300 151.25200 157.11500 1.000 134.87000 ? 331 TYR A CD2   1 
ATOM   130   C CE1   . TYR A 1 86  ? 103.16600 149.84000 159.47200 1.000 134.87000 ? 331 TYR A CE1   1 
ATOM   131   C CE2   . TYR A 1 86  ? 104.35800 150.31300 157.44700 1.000 134.87000 ? 331 TYR A CE2   1 
ATOM   132   C CZ    . TYR A 1 86  ? 104.23700 149.61200 158.62600 1.000 134.87000 ? 331 TYR A CZ    1 
ATOM   133   O OH    . TYR A 1 86  ? 105.19000 148.67800 158.95800 1.000 134.87000 ? 331 TYR A OH    1 
ATOM   134   N N     . SER A 1 87  ? 99.78200  154.77100 159.13500 1.000 130.93000 ? 332 SER A N     1 
ATOM   135   C CA    . SER A 1 87  ? 99.25700  156.11800 159.16300 1.000 130.93000 ? 332 SER A CA    1 
ATOM   136   C C     . SER A 1 87  ? 99.64200  156.84300 157.87900 1.000 130.93000 ? 332 SER A C     1 
ATOM   137   O O     . SER A 1 87  ? 100.59200 156.44700 157.20000 1.000 130.93000 ? 332 SER A O     1 
ATOM   138   C CB    . SER A 1 87  ? 99.79600  156.87100 160.37800 1.000 130.93000 ? 332 SER A CB    1 
ATOM   139   O OG    . SER A 1 87  ? 101.16200 157.19400 160.22400 1.000 130.93000 ? 332 SER A OG    1 
ATOM   140   N N     . PRO A 1 88  ? 98.89400  157.88600 157.50500 1.000 133.65000 ? 333 PRO A N     1 
ATOM   141   C CA    . PRO A 1 88  ? 99.32000  158.71000 156.36300 1.000 133.65000 ? 333 PRO A CA    1 
ATOM   142   C C     . PRO A 1 88  ? 100.66600 159.37400 156.56600 1.000 133.65000 ? 333 PRO A C     1 
ATOM   143   O O     . PRO A 1 88  ? 101.37800 159.61300 155.58600 1.000 133.65000 ? 333 PRO A O     1 
ATOM   144   C CB    . PRO A 1 88  ? 98.19100  159.74200 156.24000 1.000 133.65000 ? 333 PRO A CB    1 
ATOM   145   C CG    . PRO A 1 88  ? 97.00800  159.05500 156.80600 1.000 133.65000 ? 333 PRO A CG    1 
ATOM   146   C CD    . PRO A 1 88  ? 97.52300  158.22100 157.93400 1.000 133.65000 ? 333 PRO A CD    1 
ATOM   147   N N     . GLU A 1 89  ? 101.05200 159.65700 157.80900 1.000 134.06000 ? 334 GLU A N     1 
ATOM   148   C CA    . GLU A 1 89  ? 102.41700 160.09700 158.05800 1.000 134.06000 ? 334 GLU A CA    1 
ATOM   149   C C     . GLU A 1 89  ? 103.40500 158.95800 157.85600 1.000 134.06000 ? 334 GLU A C     1 
ATOM   150   O O     . GLU A 1 89  ? 104.52600 159.18600 157.39300 1.000 134.06000 ? 334 GLU A O     1 
ATOM   151   C CB    . GLU A 1 89  ? 102.54500 160.67300 159.46700 1.000 134.06000 ? 334 GLU A CB    1 
ATOM   152   C CG    . GLU A 1 89  ? 101.87200 162.01900 159.66500 1.000 134.06000 ? 334 GLU A CG    1 
ATOM   153   C CD    . GLU A 1 89  ? 100.39600 161.90200 159.97400 1.000 134.06000 ? 334 GLU A CD    1 
ATOM   154   O OE1   . GLU A 1 89  ? 99.89600  160.76400 160.09200 1.000 134.06000 ? 334 GLU A OE1   1 
ATOM   155   O OE2   . GLU A 1 89  ? 99.73400  162.95100 160.10000 1.000 134.06000 ? 334 GLU A OE2   1 
ATOM   156   N N     . SER A 1 90  ? 103.00000 157.72100 158.17300 1.000 129.58000 ? 335 SER A N     1 
ATOM   157   C CA    . SER A 1 90  ? 103.90400 156.58100 158.03600 1.000 129.58000 ? 335 SER A CA    1 
ATOM   158   C C     . SER A 1 90  ? 104.19700 156.25700 156.58700 1.000 129.58000 ? 335 SER A C     1 
ATOM   159   O O     . SER A 1 90  ? 105.21400 155.62400 156.29800 1.000 129.58000 ? 335 SER A O     1 
ATOM   160   C CB    . SER A 1 90  ? 103.32200 155.34400 158.71000 1.000 129.58000 ? 335 SER A CB    1 
ATOM   161   O OG    . SER A 1 90  ? 103.08700 155.58100 160.08500 1.000 129.58000 ? 335 SER A OG    1 
ATOM   162   N N     . LEU A 1 91  ? 103.32100 156.66200 155.68100 1.000 122.92000 ? 336 LEU A N     1 
ATOM   163   C CA    . LEU A 1 91  ? 103.60100 156.58300 154.26100 1.000 122.92000 ? 336 LEU A CA    1 
ATOM   164   C C     . LEU A 1 91  ? 104.20200 157.86800 153.73000 1.000 122.92000 ? 336 LEU A C     1 
ATOM   165   O O     . LEU A 1 91  ? 104.98900 157.82800 152.78300 1.000 122.92000 ? 336 LEU A O     1 
ATOM   166   C CB    . LEU A 1 91  ? 102.31800 156.25900 153.50200 1.000 122.92000 ? 336 LEU A CB    1 
ATOM   167   C CG    . LEU A 1 91  ? 101.77300 154.88000 153.85000 1.000 122.92000 ? 336 LEU A CG    1 
ATOM   168   C CD1   . LEU A 1 91  ? 100.37000 154.70700 153.29700 1.000 122.92000 ? 336 LEU A CD1   1 
ATOM   169   C CD2   . LEU A 1 91  ? 102.70700 153.81100 153.31300 1.000 122.92000 ? 336 LEU A CD2   1 
ATOM   170   N N     . GLU A 1 92  ? 103.87900 159.00600 154.33700 1.000 122.33000 ? 337 GLU A N     1 
ATOM   171   C CA    . GLU A 1 92  ? 104.35300 160.27700 153.81000 1.000 122.33000 ? 337 GLU A CA    1 
ATOM   172   C C     . GLU A 1 92  ? 105.83100 160.47800 154.11900 1.000 122.33000 ? 337 GLU A C     1 
ATOM   173   O O     . GLU A 1 92  ? 106.60400 160.88200 153.24200 1.000 122.33000 ? 337 GLU A O     1 
ATOM   174   C CB    . GLU A 1 92  ? 103.51300 161.41800 154.38000 1.000 122.33000 ? 337 GLU A CB    1 
ATOM   175   C CG    . GLU A 1 92  ? 103.64300 162.73800 153.63100 1.000 122.33000 ? 337 GLU A CG    1 
ATOM   176   C CD    . GLU A 1 92  ? 104.81500 163.57300 154.10000 1.000 122.33000 ? 337 GLU A CD    1 
ATOM   177   O OE1   . GLU A 1 92  ? 105.20600 163.43000 155.27800 1.000 122.33000 ? 337 GLU A OE1   1 
ATOM   178   O OE2   . GLU A 1 92  ? 105.35000 164.35900 153.29100 1.000 122.33000 ? 337 GLU A OE2   1 
ATOM   179   N N     . ALA A 1 93  ? 106.23200 160.22400 155.36800 1.000 119.37000 ? 338 ALA A N     1 
ATOM   180   C CA    . ALA A 1 93  ? 107.64400 160.26800 155.72500 1.000 119.37000 ? 338 ALA A CA    1 
ATOM   181   C C     . ALA A 1 93  ? 108.42300 159.18900 154.99600 1.000 119.37000 ? 338 ALA A C     1 
ATOM   182   O O     . ALA A 1 93  ? 109.58200 159.40300 154.62700 1.000 119.37000 ? 338 ALA A O     1 
ATOM   183   C CB    . ALA A 1 93  ? 107.80900 160.11000 157.23400 1.000 119.37000 ? 338 ALA A CB    1 
ATOM   184   N N     . MET A 1 94  ? 107.78300 158.04300 154.76000 1.000 117.37000 ? 339 MET A N     1 
ATOM   185   C CA    . MET A 1 94  ? 108.35000 157.00900 153.90600 1.000 117.37000 ? 339 MET A CA    1 
ATOM   186   C C     . MET A 1 94  ? 108.60800 157.53600 152.50600 1.000 117.37000 ? 339 MET A C     1 
ATOM   187   O O     . MET A 1 94  ? 109.68100 157.31300 151.94000 1.000 117.37000 ? 339 MET A O     1 
ATOM   188   C CB    . MET A 1 94  ? 107.39400 155.82500 153.84600 1.000 117.37000 ? 339 MET A CB    1 
ATOM   189   C CG    . MET A 1 94  ? 107.95100 154.59600 153.19700 1.000 117.37000 ? 339 MET A CG    1 
ATOM   190   S SD    . MET A 1 94  ? 109.20700 153.87300 154.24200 1.000 117.37000 ? 339 MET A SD    1 
ATOM   191   C CE    . MET A 1 94  ? 110.09200 152.94000 153.01500 1.000 117.37000 ? 339 MET A CE    1 
ATOM   192   N N     . SER A 1 95  ? 107.64600 158.27000 151.95400 1.000 114.17000 ? 340 SER A N     1 
ATOM   193   C CA    . SER A 1 95  ? 107.75200 158.74800 150.58500 1.000 114.17000 ? 340 SER A CA    1 
ATOM   194   C C     . SER A 1 95  ? 108.81200 159.82500 150.45900 1.000 114.17000 ? 340 SER A C     1 
ATOM   195   O O     . SER A 1 95  ? 109.58300 159.84100 149.49200 1.000 114.17000 ? 340 SER A O     1 
ATOM   196   C CB    . SER A 1 95  ? 106.40100 159.27600 150.13200 1.000 114.17000 ? 340 SER A CB    1 
ATOM   197   O OG    . SER A 1 95  ? 105.43800 158.24700 150.20100 1.000 114.17000 ? 340 SER A OG    1 
ATOM   198   N N     . ARG A 1 96  ? 108.87500 160.72300 151.43600 1.000 111.37000 ? 341 ARG A N     1 
ATOM   199   C CA    . ARG A 1 96  ? 109.90700 161.74700 151.40600 1.000 111.37000 ? 341 ARG A CA    1 
ATOM   200   C C     . ARG A 1 96  ? 111.27900 161.15400 151.65200 1.000 111.37000 ? 341 ARG A C     1 
ATOM   201   O O     . ARG A 1 96  ? 112.25600 161.60700 151.05100 1.000 111.37000 ? 341 ARG A O     1 
ATOM   202   C CB    . ARG A 1 96  ? 109.59600 162.84000 152.41700 1.000 111.37000 ? 341 ARG A CB    1 
ATOM   203   C CG    . ARG A 1 96  ? 108.32000 163.52600 152.06400 1.000 111.37000 ? 341 ARG A CG    1 
ATOM   204   C CD    . ARG A 1 96  ? 108.49000 164.24800 150.75400 1.000 111.37000 ? 341 ARG A CD    1 
ATOM   205   N NE    . ARG A 1 96  ? 107.22200 164.77300 150.28600 1.000 111.37000 ? 341 ARG A NE    1 
ATOM   206   C CZ    . ARG A 1 96  ? 106.40300 164.08400 149.50500 1.000 111.37000 ? 341 ARG A CZ    1 
ATOM   207   N NH1   . ARG A 1 96  ? 106.74000 162.86200 149.12100 1.000 111.37000 ? 341 ARG A NH1   1 
ATOM   208   N NH2   . ARG A 1 96  ? 105.25400 164.60900 149.10600 1.000 111.37000 ? 341 ARG A NH2   1 
ATOM   209   N N     . LEU A 1 97  ? 111.36500 160.11200 152.48300 1.000 107.28000 ? 342 LEU A N     1 
ATOM   210   C CA    . LEU A 1 97  ? 112.62900 159.42000 152.66000 1.000 107.28000 ? 342 LEU A CA    1 
ATOM   211   C C     . LEU A 1 97  ? 113.03700 158.70500 151.38400 1.000 107.28000 ? 342 LEU A C     1 
ATOM   212   O O     . LEU A 1 97  ? 114.22300 158.66800 151.05300 1.000 107.28000 ? 342 LEU A O     1 
ATOM   213   C CB    . LEU A 1 97  ? 112.52300 158.44100 153.82300 1.000 107.28000 ? 342 LEU A CB    1 
ATOM   214   C CG    . LEU A 1 97  ? 113.84500 157.80800 154.23800 1.000 107.28000 ? 342 LEU A CG    1 
ATOM   215   C CD1   . LEU A 1 97  ? 114.81100 158.88600 154.67500 1.000 107.28000 ? 342 LEU A CD1   1 
ATOM   216   C CD2   . LEU A 1 97  ? 113.63500 156.81300 155.35600 1.000 107.28000 ? 342 LEU A CD2   1 
ATOM   217   N N     . LEU A 1 98  ? 112.06300 158.19500 150.63200 1.000 99.29000  ? 343 LEU A N     1 
ATOM   218   C CA    . LEU A 1 98  ? 112.34800 157.58100 149.34300 1.000 99.29000  ? 343 LEU A CA    1 
ATOM   219   C C     . LEU A 1 98  ? 112.87000 158.60500 148.34800 1.000 99.29000  ? 343 LEU A C     1 
ATOM   220   O O     . LEU A 1 98  ? 113.82900 158.33500 147.61500 1.000 99.29000  ? 343 LEU A O     1 
ATOM   221   C CB    . LEU A 1 98  ? 111.08900 156.89700 148.81500 1.000 99.29000  ? 343 LEU A CB    1 
ATOM   222   C CG    . LEU A 1 98  ? 111.15400 156.06800 147.53800 1.000 99.29000  ? 343 LEU A CG    1 
ATOM   223   C CD1   . LEU A 1 98  ? 110.27200 154.86800 147.69800 1.000 99.29000  ? 343 LEU A CD1   1 
ATOM   224   C CD2   . LEU A 1 98  ? 110.66800 156.86100 146.34700 1.000 99.29000  ? 343 LEU A CD2   1 
ATOM   225   N N     . GLU A 1 99  ? 112.25800 159.78600 148.31600 1.000 106.34000 ? 344 GLU A N     1 
ATOM   226   C CA    . GLU A 1 99  ? 112.71300 160.82400 147.40000 1.000 106.34000 ? 344 GLU A CA    1 
ATOM   227   C C     . GLU A 1 99  ? 114.09600 161.33200 147.77900 1.000 106.34000 ? 344 GLU A C     1 
ATOM   228   O O     . GLU A 1 99  ? 114.92000 161.60500 146.89900 1.000 106.34000 ? 344 GLU A O     1 
ATOM   229   C CB    . GLU A 1 99  ? 111.70400 161.96500 147.36400 1.000 106.34000 ? 344 GLU A CB    1 
ATOM   230   C CG    . GLU A 1 99  ? 110.42100 161.59000 146.65100 1.000 106.34000 ? 344 GLU A CG    1 
ATOM   231   C CD    . GLU A 1 99  ? 109.36300 162.67300 146.71100 1.000 106.34000 ? 344 GLU A CD    1 
ATOM   232   O OE1   . GLU A 1 99  ? 109.55600 163.65800 147.45400 1.000 106.34000 ? 344 GLU A OE1   1 
ATOM   233   O OE2   . GLU A 1 99  ? 108.33500 162.53400 146.01500 1.000 106.34000 ? 344 GLU A OE2   1 
ATOM   234   N N     . ILE A 1 100 ? 114.38200 161.42200 149.07900 1.000 102.21000 ? 345 ILE A N     1 
ATOM   235   C CA    . ILE A 1 100 ? 115.70900 161.84100 149.52100 1.000 102.21000 ? 345 ILE A CA    1 
ATOM   236   C C     . ILE A 1 100 ? 116.75200 160.78900 149.16700 1.000 102.21000 ? 345 ILE A C     1 
ATOM   237   O O     . ILE A 1 100 ? 117.81900 161.11700 148.63300 1.000 102.21000 ? 345 ILE A O     1 
ATOM   238   C CB    . ILE A 1 100 ? 115.70700 162.15900 151.02800 1.000 102.21000 ? 345 ILE A CB    1 
ATOM   239   C CG1   . ILE A 1 100 ? 114.88000 163.41200 151.30300 1.000 102.21000 ? 345 ILE A CG1   1 
ATOM   240   C CG2   . ILE A 1 100 ? 117.11500 162.35200 151.55500 1.000 102.21000 ? 345 ILE A CG2   1 
ATOM   241   C CD1   . ILE A 1 100 ? 115.38300 164.64500 150.59100 1.000 102.21000 ? 345 ILE A CD1   1 
ATOM   242   N N     . LYS A 1 101 ? 116.44900 159.51100 149.42000 1.000 98.95000  ? 346 LYS A N     1 
ATOM   243   C CA    . LYS A 1 101 ? 117.43800 158.46800 149.17100 1.000 98.95000  ? 346 LYS A CA    1 
ATOM   244   C C     . LYS A 1 101 ? 117.68300 158.26600 147.68500 1.000 98.95000  ? 346 LYS A C     1 
ATOM   245   O O     . LYS A 1 101 ? 118.82500 158.03900 147.27600 1.000 98.95000  ? 346 LYS A O     1 
ATOM   246   C CB    . LYS A 1 101 ? 117.02800 157.15400 149.82700 1.000 98.95000  ? 346 LYS A CB    1 
ATOM   247   C CG    . LYS A 1 101 ? 117.05400 157.19800 151.33200 1.000 98.95000  ? 346 LYS A CG    1 
ATOM   248   C CD    . LYS A 1 101 ? 118.45000 157.43200 151.86200 1.000 98.95000  ? 346 LYS A CD    1 
ATOM   249   C CE    . LYS A 1 101 ? 118.44600 157.45800 153.38200 1.000 98.95000  ? 346 LYS A CE    1 
ATOM   250   N NZ    . LYS A 1 101 ? 119.78700 157.77100 153.93900 1.000 98.95000  ? 346 LYS A NZ    1 
ATOM   251   N N     . LEU A 1 102 ? 116.64500 158.37400 146.85400 1.000 91.49000  ? 347 LEU A N     1 
ATOM   252   C CA    . LEU A 1 102 ? 116.90400 158.29800 145.42300 1.000 91.49000  ? 347 LEU A CA    1 
ATOM   253   C C     . LEU A 1 102 ? 117.58000 159.55500 144.90600 1.000 91.49000  ? 347 LEU A C     1 
ATOM   254   O O     . LEU A 1 102 ? 118.34900 159.48300 143.94400 1.000 91.49000  ? 347 LEU A O     1 
ATOM   255   C CB    . LEU A 1 102 ? 115.62600 158.02300 144.64300 1.000 91.49000  ? 347 LEU A CB    1 
ATOM   256   C CG    . LEU A 1 102 ? 115.17400 156.57500 144.74300 1.000 91.49000  ? 347 LEU A CG    1 
ATOM   257   C CD1   . LEU A 1 102 ? 113.93600 156.36000 143.92900 1.000 91.49000  ? 347 LEU A CD1   1 
ATOM   258   C CD2   . LEU A 1 102 ? 116.26500 155.66500 144.26400 1.000 91.49000  ? 347 LEU A CD2   1 
ATOM   259   N N     . LYS A 1 103 ? 117.34300 160.70000 145.54400 1.000 99.60000  ? 348 LYS A N     1 
ATOM   260   C CA    . LYS A 1 103 ? 118.04700 161.90400 145.13000 1.000 99.60000  ? 348 LYS A CA    1 
ATOM   261   C C     . LYS A 1 103 ? 119.52200 161.83100 145.49900 1.000 99.60000  ? 348 LYS A C     1 
ATOM   262   O O     . LYS A 1 103 ? 120.36200 162.42900 144.81700 1.000 99.60000  ? 348 LYS A O     1 
ATOM   263   C CB    . LYS A 1 103 ? 117.37200 163.13200 145.74200 1.000 99.60000  ? 348 LYS A CB    1 
ATOM   264   C CG    . LYS A 1 103 ? 117.98400 164.46700 145.34600 1.000 99.60000  ? 348 LYS A CG    1 
ATOM   265   C CD    . LYS A 1 103 ? 117.85000 164.71300 143.85700 1.000 99.60000  ? 348 LYS A CD    1 
ATOM   266   C CE    . LYS A 1 103 ? 118.40200 166.07300 143.47700 1.000 99.60000  ? 348 LYS A CE    1 
ATOM   267   N NZ    . LYS A 1 103 ? 119.87300 166.12400 143.67000 1.000 99.60000  ? 348 LYS A NZ    1 
ATOM   268   N N     . GLU A 1 104 ? 119.86500 161.06000 146.53200 1.000 104.48000 ? 349 GLU A N     1 
ATOM   269   C CA    . GLU A 1 104 ? 121.27000 160.88000 146.87300 1.000 104.48000 ? 349 GLU A CA    1 
ATOM   270   C C     . GLU A 1 104 ? 122.01100 160.07400 145.81900 1.000 104.48000 ? 349 GLU A C     1 
ATOM   271   O O     . GLU A 1 104 ? 123.22400 160.23700 145.66100 1.000 104.48000 ? 349 GLU A O     1 
ATOM   272   C CB    . GLU A 1 104 ? 121.40900 160.21200 148.23500 1.000 104.48000 ? 349 GLU A CB    1 
ATOM   273   C CG    . GLU A 1 104 ? 121.04700 161.10800 149.40000 1.000 104.48000 ? 349 GLU A CG    1 
ATOM   274   C CD    . GLU A 1 104 ? 121.26400 160.43300 150.73700 1.000 104.48000 ? 349 GLU A CD    1 
ATOM   275   O OE1   . GLU A 1 104 ? 121.56300 159.22100 150.75100 1.000 104.48000 ? 349 GLU A OE1   1 
ATOM   276   O OE2   . GLU A 1 104 ? 121.14800 161.11700 151.77500 1.000 104.48000 ? 349 GLU A OE2   1 
ATOM   277   N N     . PHE A 1 105 ? 121.31500 159.21500 145.08900 1.000 89.43000  ? 350 PHE A N     1 
ATOM   278   C CA    . PHE A 1 105 ? 121.92000 158.55300 143.94800 1.000 89.43000  ? 350 PHE A CA    1 
ATOM   279   C C     . PHE A 1 105 ? 121.75000 159.43300 142.71500 1.000 89.43000  ? 350 PHE A C     1 
ATOM   280   O O     . PHE A 1 105 ? 121.37100 160.60200 142.80700 1.000 89.43000  ? 350 PHE A O     1 
ATOM   281   C CB    . PHE A 1 105 ? 121.31900 157.17200 143.74100 1.000 89.43000  ? 350 PHE A CB    1 
ATOM   282   C CG    . PHE A 1 105 ? 121.57600 156.24600 144.86500 1.000 89.43000  ? 350 PHE A CG    1 
ATOM   283   C CD1   . PHE A 1 105 ? 122.82600 155.70100 145.04800 1.000 89.43000  ? 350 PHE A CD1   1 
ATOM   284   C CD2   . PHE A 1 105 ? 120.57000 155.91100 145.73600 1.000 89.43000  ? 350 PHE A CD2   1 
ATOM   285   C CE1   . PHE A 1 105 ? 123.06500 154.85000 146.09300 1.000 89.43000  ? 350 PHE A CE1   1 
ATOM   286   C CE2   . PHE A 1 105 ? 120.80300 155.05900 146.78000 1.000 89.43000  ? 350 PHE A CE2   1 
ATOM   287   C CZ    . PHE A 1 105 ? 122.04900 154.52800 146.96000 1.000 89.43000  ? 350 PHE A CZ    1 
ATOM   288   N N     . GLY A 1 106 ? 122.01600 158.87400 141.53900 1.000 89.81000  ? 351 GLY A N     1 
ATOM   289   C CA    . GLY A 1 106 ? 121.98000 159.66900 140.32900 1.000 89.81000  ? 351 GLY A CA    1 
ATOM   290   C C     . GLY A 1 106 ? 120.59400 160.01600 139.83300 1.000 89.81000  ? 351 GLY A C     1 
ATOM   291   O O     . GLY A 1 106 ? 120.47600 160.84500 138.92700 1.000 89.81000  ? 351 GLY A O     1 
ATOM   292   N N     . VAL A 1 107 ? 119.55200 159.43100 140.40400 1.000 87.04000  ? 352 VAL A N     1 
ATOM   293   C CA    . VAL A 1 107 ? 118.22500 159.56200 139.86300 1.000 87.04000  ? 352 VAL A CA    1 
ATOM   294   C C     . VAL A 1 107 ? 117.47800 160.65000 140.61800 1.000 87.04000  ? 352 VAL A C     1 
ATOM   295   O O     . VAL A 1 107 ? 117.91900 161.13700 141.65300 1.000 87.04000  ? 352 VAL A O     1 
ATOM   296   C CB    . VAL A 1 107 ? 117.45600 158.23600 139.91500 1.000 87.04000  ? 352 VAL A CB    1 
ATOM   297   C CG1   . VAL A 1 107 ? 118.20300 157.17600 139.14100 1.000 87.04000  ? 352 VAL A CG1   1 
ATOM   298   C CG2   . VAL A 1 107 ? 117.26800 157.81700 141.33500 1.000 87.04000  ? 352 VAL A CG2   1 
ATOM   299   N N     . GLU A 1 108 ? 116.33100 161.04600 140.08200 1.000 95.11000  ? 353 GLU A N     1 
ATOM   300   C CA    . GLU A 1 108 ? 115.50900 162.08300 140.68100 1.000 95.11000  ? 353 GLU A CA    1 
ATOM   301   C C     . GLU A 1 108 ? 114.06500 161.76400 140.35100 1.000 95.11000  ? 353 GLU A C     1 
ATOM   302   O O     . GLU A 1 108 ? 113.74100 161.51600 139.18900 1.000 95.11000  ? 353 GLU A O     1 
ATOM   303   C CB    . GLU A 1 108 ? 115.89300 163.46000 140.14800 1.000 95.11000  ? 353 GLU A CB    1 
ATOM   304   C CG    . GLU A 1 108 ? 115.14400 164.60400 140.77800 1.000 95.11000  ? 353 GLU A CG    1 
ATOM   305   C CD    . GLU A 1 108 ? 115.63700 165.94200 140.27100 1.000 95.11000  ? 353 GLU A CD    1 
ATOM   306   O OE1   . GLU A 1 108 ? 116.55000 165.95000 139.41900 1.000 95.11000  ? 353 GLU A OE1   1 
ATOM   307   O OE2   . GLU A 1 108 ? 115.11600 166.98300 140.72000 1.000 95.11000  ? 353 GLU A OE2   1 
ATOM   308   N N     . VAL A 1 109 ? 113.20200 161.76500 141.36200 1.000 98.07000  ? 354 VAL A N     1 
ATOM   309   C CA    . VAL A 1 109 ? 111.86800 161.20900 141.20500 1.000 98.07000  ? 354 VAL A CA    1 
ATOM   310   C C     . VAL A 1 109 ? 110.93000 161.89300 142.18800 1.000 98.07000  ? 354 VAL A C     1 
ATOM   311   O O     . VAL A 1 109 ? 111.35800 162.49600 143.17300 1.000 98.07000  ? 354 VAL A O     1 
ATOM   312   C CB    . VAL A 1 109 ? 111.91600 159.67800 141.41400 1.000 98.07000  ? 354 VAL A CB    1 
ATOM   313   C CG1   . VAL A 1 109 ? 112.05600 159.34300 142.87600 1.000 98.07000  ? 354 VAL A CG1   1 
ATOM   314   C CG2   . VAL A 1 109 ? 110.74100 158.97200 140.76900 1.000 98.07000  ? 354 VAL A CG2   1 
ATOM   315   N N     . SER A 1 110 ? 109.63500 161.82700 141.89200 1.000 100.72000 ? 355 SER A N     1 
ATOM   316   C CA    . SER A 1 110 ? 108.59500 162.41700 142.71600 1.000 100.72000 ? 355 SER A CA    1 
ATOM   317   C C     . SER A 1 110 ? 107.54500 161.36000 143.00700 1.000 100.72000 ? 355 SER A C     1 
ATOM   318   O O     . SER A 1 110 ? 107.08800 160.67200 142.09100 1.000 100.72000 ? 355 SER A O     1 
ATOM   319   C CB    . SER A 1 110 ? 107.96800 163.61500 142.00800 1.000 100.72000 ? 355 SER A CB    1 
ATOM   320   O OG    . SER A 1 110 ? 107.34400 163.20600 140.80500 1.000 100.72000 ? 355 SER A OG    1 
ATOM   321   N N     . VAL A 1 111 ? 107.17300 161.22500 144.27500 1.000 103.78000 ? 356 VAL A N     1 
ATOM   322   C CA    . VAL A 1 111 ? 106.12200 160.28500 144.64500 1.000 103.78000 ? 356 VAL A CA    1 
ATOM   323   C C     . VAL A 1 111 ? 104.78000 160.84500 144.20400 1.000 103.78000 ? 356 VAL A C     1 
ATOM   324   O O     . VAL A 1 111 ? 104.36900 161.92300 144.64400 1.000 103.78000 ? 356 VAL A O     1 
ATOM   325   C CB    . VAL A 1 111 ? 106.13100 160.01600 146.15000 1.000 103.78000 ? 356 VAL A CB    1 
ATOM   326   C CG1   . VAL A 1 111 ? 104.93000 159.18900 146.53200 1.000 103.78000 ? 356 VAL A CG1   1 
ATOM   327   C CG2   . VAL A 1 111 ? 107.39400 159.30400 146.53000 1.000 103.78000 ? 356 VAL A CG2   1 
ATOM   328   N N     . ASP A 1 112 ? 104.08500 160.10900 143.34200 1.000 111.55000 ? 357 ASP A N     1 
ATOM   329   C CA    . ASP A 1 112 ? 102.82600 160.58300 142.78500 1.000 111.55000 ? 357 ASP A CA    1 
ATOM   330   C C     . ASP A 1 112 ? 101.61500 160.00500 143.50200 1.000 111.55000 ? 357 ASP A C     1 
ATOM   331   O O     . ASP A 1 112 ? 100.63100 160.72000 143.70600 1.000 111.55000 ? 357 ASP A O     1 
ATOM   332   C CB    . ASP A 1 112 ? 102.76200 160.25200 141.29300 1.000 111.55000 ? 357 ASP A CB    1 
ATOM   333   C CG    . ASP A 1 112 ? 101.75900 161.10500 140.54000 1.000 111.55000 ? 357 ASP A CG    1 
ATOM   334   O OD1   . ASP A 1 112 ? 101.08500 161.94800 141.16300 1.000 111.55000 ? 357 ASP A OD1   1 
ATOM   335   O OD2   . ASP A 1 112 ? 101.65900 160.94800 139.30600 1.000 111.55000 ? 357 ASP A OD2   1 
ATOM   336   N N     . SER A 1 113 ? 101.66200 158.73800 143.90900 1.000 112.44000 ? 358 SER A N     1 
ATOM   337   C CA    . SER A 1 113 ? 100.58600 158.17900 144.71700 1.000 112.44000 ? 358 SER A CA    1 
ATOM   338   C C     . SER A 1 113 ? 101.10500 157.00100 145.52200 1.000 112.44000 ? 358 SER A C     1 
ATOM   339   O O     . SER A 1 113 ? 102.11900 156.38600 145.18500 1.000 112.44000 ? 358 SER A O     1 
ATOM   340   C CB    . SER A 1 113 ? 99.39400  157.73600 143.88000 1.000 112.44000 ? 358 SER A CB    1 
ATOM   341   O OG    . SER A 1 113 ? 98.42900  157.10100 144.70000 1.000 112.44000 ? 358 SER A OG    1 
ATOM   342   N N     . VAL A 1 114 ? 100.37600 156.68900 146.59000 1.000 102.75000 ? 359 VAL A N     1 
ATOM   343   C CA    . VAL A 1 114 ? 100.67100 155.55900 147.45800 1.000 102.75000 ? 359 VAL A CA    1 
ATOM   344   C C     . VAL A 1 114 ? 99.45500  154.64800 147.46000 1.000 102.75000 ? 359 VAL A C     1 
ATOM   345   O O     . VAL A 1 114 ? 98.31900  155.11900 147.56900 1.000 102.75000 ? 359 VAL A O     1 
ATOM   346   C CB    . VAL A 1 114 ? 101.00400 156.01600 148.89200 1.000 102.75000 ? 359 VAL A CB    1 
ATOM   347   C CG1   . VAL A 1 114 ? 101.41500 154.84000 149.74500 1.000 102.75000 ? 359 VAL A CG1   1 
ATOM   348   C CG2   . VAL A 1 114 ? 102.07700 157.07200 148.88400 1.000 102.75000 ? 359 VAL A CG2   1 
ATOM   349   N N     . HIS A 1 115 ? 99.68900  153.35300 147.32500 1.000 103.23000 ? 360 HIS A N     1 
ATOM   350   C CA    . HIS A 1 115 ? 98.63000  152.36000 147.46800 1.000 103.23000 ? 360 HIS A CA    1 
ATOM   351   C C     . HIS A 1 115 ? 99.02900  151.38300 148.55600 1.000 103.23000 ? 360 HIS A C     1 
ATOM   352   O O     . HIS A 1 115 ? 99.96000  150.58300 148.34800 1.000 103.23000 ? 360 HIS A O     1 
ATOM   353   C CB    . HIS A 1 115 ? 98.39000  151.61600 146.15800 1.000 103.23000 ? 360 HIS A CB    1 
ATOM   354   C CG    . HIS A 1 115 ? 97.94400  152.49300 145.03400 1.000 103.23000 ? 360 HIS A CG    1 
ATOM   355   N ND1   . HIS A 1 115 ? 96.68800  153.05500 144.98400 1.000 103.23000 ? 360 HIS A ND1   1 
ATOM   356   C CD2   . HIS A 1 115 ? 98.57500  152.88100 143.90200 1.000 103.23000 ? 360 HIS A CD2   1 
ATOM   357   C CE1   . HIS A 1 115 ? 96.57100  153.76500 143.87700 1.000 103.23000 ? 360 HIS A CE1   1 
ATOM   358   N NE2   . HIS A 1 115 ? 97.70100  153.67400 143.20200 1.000 103.23000 ? 360 HIS A NE2   1 
ATOM   359   N N     . PRO A 1 116 ? 98.38900  151.40200 149.71700 1.000 100.58000 ? 361 PRO A N     1 
ATOM   360   C CA    . PRO A 1 116 ? 98.70400  150.41000 150.74500 1.000 100.58000 ? 361 PRO A CA    1 
ATOM   361   C C     . PRO A 1 116 ? 98.17000  149.04900 150.34800 1.000 100.58000 ? 361 PRO A C     1 
ATOM   362   O O     . PRO A 1 116 ? 97.24700  148.92400 149.54300 1.000 100.58000 ? 361 PRO A O     1 
ATOM   363   C CB    . PRO A 1 116 ? 97.98900  150.94400 151.98500 1.000 100.58000 ? 361 PRO A CB    1 
ATOM   364   C CG    . PRO A 1 116 ? 96.84800  151.71400 151.42800 1.000 100.58000 ? 361 PRO A CG    1 
ATOM   365   C CD    . PRO A 1 116 ? 97.33100  152.32700 150.14700 1.000 100.58000 ? 361 PRO A CD    1 
ATOM   366   N N     . GLY A 1 117 ? 98.77000  148.01600 150.92300 1.000 100.67000 ? 362 GLY A N     1 
ATOM   367   C CA    . GLY A 1 117 ? 98.42700  146.66600 150.55500 1.000 100.67000 ? 362 GLY A CA    1 
ATOM   368   C C     . GLY A 1 117 ? 98.37900  145.71700 151.72900 1.000 100.67000 ? 362 GLY A C     1 
ATOM   369   O O     . GLY A 1 117 ? 98.62200  146.09800 152.87600 1.000 100.67000 ? 362 GLY A O     1 
ATOM   370   N N     . PRO A 1 118 ? 98.03700  144.46300 151.46100 1.000 102.19000 ? 363 PRO A N     1 
ATOM   371   C CA    . PRO A 1 118 ? 97.97100  143.46400 152.52900 1.000 102.19000 ? 363 PRO A CA    1 
ATOM   372   C C     . PRO A 1 118 ? 99.33800  143.13200 153.08200 1.000 102.19000 ? 363 PRO A C     1 
ATOM   373   O O     . PRO A 1 118 ? 99.54500  143.11600 154.29700 1.000 102.19000 ? 363 PRO A O     1 
ATOM   374   C CB    . PRO A 1 118 ? 97.36400  142.24600 151.83100 1.000 102.19000 ? 363 PRO A CB    1 
ATOM   375   C CG    . PRO A 1 118 ? 96.70800  142.78400 150.62900 1.000 102.19000 ? 363 PRO A CG    1 
ATOM   376   C CD    . PRO A 1 118 ? 97.55200  143.92100 150.18800 1.000 102.19000 ? 363 PRO A CD    1 
ATOM   377   N N     . VAL A 1 119 ? 100.27600 142.83500 152.19200 1.000 103.14000 ? 364 VAL A N     1 
ATOM   378   C CA    . VAL A 1 119 ? 101.64600 142.51900 152.56900 1.000 103.14000 ? 364 VAL A CA    1 
ATOM   379   C C     . VAL A 1 119 ? 102.63300 143.47000 151.91000 1.000 103.14000 ? 364 VAL A C     1 
ATOM   380   O O     . VAL A 1 119 ? 103.42600 144.12700 152.58600 1.000 103.14000 ? 364 VAL A O     1 
ATOM   381   C CB    . VAL A 1 119 ? 101.99900 141.06000 152.23100 1.000 103.14000 ? 364 VAL A CB    1 
ATOM   382   C CG1   . VAL A 1 119 ? 103.41100 140.78600 152.63800 1.000 103.14000 ? 364 VAL A CG1   1 
ATOM   383   C CG2   . VAL A 1 119 ? 101.05800 140.10500 152.91900 1.000 103.14000 ? 364 VAL A CG2   1 
ATOM   384   N N     . ILE A 1 120 ? 102.60400 143.55100 150.59100 1.000 103.07000 ? 365 ILE A N     1 
ATOM   385   C CA    . ILE A 1 120 ? 103.46600 144.45700 149.86600 1.000 103.07000 ? 365 ILE A CA    1 
ATOM   386   C C     . ILE A 1 120 ? 102.69900 145.74100 149.59500 1.000 103.07000 ? 365 ILE A C     1 
ATOM   387   O O     . ILE A 1 120 ? 101.47300 145.79700 149.68700 1.000 103.07000 ? 365 ILE A O     1 
ATOM   388   C CB    . ILE A 1 120 ? 104.01900 143.81000 148.57500 1.000 103.07000 ? 365 ILE A CB    1 
ATOM   389   C CG1   . ILE A 1 120 ? 102.90700 143.27600 147.67500 1.000 103.07000 ? 365 ILE A CG1   1 
ATOM   390   C CG2   . ILE A 1 120 ? 104.96600 142.68700 148.92000 1.000 103.07000 ? 365 ILE A CG2   1 
ATOM   391   C CD1   . ILE A 1 120 ? 102.53900 144.17600 146.54300 1.000 103.07000 ? 365 ILE A CD1   1 
ATOM   392   N N     . THR A 1 121 ? 103.43300 146.79600 149.26800 1.000 103.37000 ? 366 THR A N     1 
ATOM   393   C CA    . THR A 1 121 ? 102.85800 148.12800 149.19200 1.000 103.37000 ? 366 THR A CA    1 
ATOM   394   C C     . THR A 1 121 ? 103.51900 148.88900 148.05800 1.000 103.37000 ? 366 THR A C     1 
ATOM   395   O O     . THR A 1 121 ? 104.74900 148.94200 147.98200 1.000 103.37000 ? 366 THR A O     1 
ATOM   396   C CB    . THR A 1 121 ? 103.04400 148.86100 150.52300 1.000 103.37000 ? 366 THR A CB    1 
ATOM   397   O OG1   . THR A 1 121 ? 102.37800 148.13400 151.56100 1.000 103.37000 ? 366 THR A OG1   1 
ATOM   398   C CG2   . THR A 1 121 ? 102.47600 150.25200 150.45800 1.000 103.37000 ? 366 THR A CG2   1 
ATOM   399   N N     . ARG A 1 122 ? 102.70700 149.46900 147.17900 1.000 97.22000  ? 367 ARG A N     1 
ATOM   400   C CA    . ARG A 1 122 ? 103.24200 150.15000 146.01600 1.000 97.22000  ? 367 ARG A CA    1 
ATOM   401   C C     . ARG A 1 122 ? 103.67500 151.56600 146.35900 1.000 97.22000  ? 367 ARG A C     1 
ATOM   402   O O     . ARG A 1 122 ? 103.38600 152.10000 147.43000 1.000 97.22000  ? 367 ARG A O     1 
ATOM   403   C CB    . ARG A 1 122 ? 102.21100 150.22300 144.90200 1.000 97.22000  ? 367 ARG A CB    1 
ATOM   404   C CG    . ARG A 1 122 ? 101.76400 148.90200 144.40400 1.000 97.22000  ? 367 ARG A CG    1 
ATOM   405   C CD    . ARG A 1 122 ? 100.77500 149.07000 143.28500 1.000 97.22000  ? 367 ARG A CD    1 
ATOM   406   N NE    . ARG A 1 122 ? 101.43100 149.58100 142.09400 1.000 97.22000  ? 367 ARG A NE    1 
ATOM   407   C CZ    . ARG A 1 122 ? 102.02100 148.80300 141.19500 1.000 97.22000  ? 367 ARG A CZ    1 
ATOM   408   N NH1   . ARG A 1 122 ? 102.03200 147.48900 141.35800 1.000 97.22000  ? 367 ARG A NH1   1 
ATOM   409   N NH2   . ARG A 1 122 ? 102.60300 149.33700 140.13400 1.000 97.22000  ? 367 ARG A NH2   1 
ATOM   410   N N     . PHE A 1 123 ? 104.36200 152.17900 145.40500 1.000 100.33000 ? 368 PHE A N     1 
ATOM   411   C CA    . PHE A 1 123 ? 104.65000 153.60700 145.42200 1.000 100.33000 ? 368 PHE A CA    1 
ATOM   412   C C     . PHE A 1 123 ? 104.60000 154.06500 143.97200 1.000 100.33000 ? 368 PHE A C     1 
ATOM   413   O O     . PHE A 1 123 ? 105.51400 153.77000 143.19800 1.000 100.33000 ? 368 PHE A O     1 
ATOM   414   C CB    . PHE A 1 123 ? 106.00300 153.90300 146.04300 1.000 100.33000 ? 368 PHE A CB    1 
ATOM   415   C CG    . PHE A 1 123 ? 106.03600 153.73100 147.51700 1.000 100.33000 ? 368 PHE A CG    1 
ATOM   416   C CD1   . PHE A 1 123 ? 105.60000 154.74300 148.34200 1.000 100.33000 ? 368 PHE A CD1   1 
ATOM   417   C CD2   . PHE A 1 123 ? 106.49600 152.56500 148.07800 1.000 100.33000 ? 368 PHE A CD2   1 
ATOM   418   C CE1   . PHE A 1 123 ? 105.62800 154.59700 149.70800 1.000 100.33000 ? 368 PHE A CE1   1 
ATOM   419   C CE2   . PHE A 1 123 ? 106.52200 152.41200 149.44500 1.000 100.33000 ? 368 PHE A CE2   1 
ATOM   420   C CZ    . PHE A 1 123 ? 106.09000 153.43000 150.25800 1.000 100.33000 ? 368 PHE A CZ    1 
ATOM   421   N N     . GLU A 1 124 ? 103.53000 154.75700 143.59900 1.000 111.88000 ? 369 GLU A N     1 
ATOM   422   C CA    . GLU A 1 124 ? 103.48300 155.35100 142.27100 1.000 111.88000 ? 369 GLU A CA    1 
ATOM   423   C C     . GLU A 1 124 ? 104.46800 156.50600 142.24100 1.000 111.88000 ? 369 GLU A C     1 
ATOM   424   O O     . GLU A 1 124 ? 104.21700 157.55800 142.83500 1.000 111.88000 ? 369 GLU A O     1 
ATOM   425   C CB    . GLU A 1 124 ? 102.08000 155.83600 141.92200 1.000 111.88000 ? 369 GLU A CB    1 
ATOM   426   C CG    . GLU A 1 124 ? 101.02100 154.75400 141.85300 1.000 111.88000 ? 369 GLU A CG    1 
ATOM   427   C CD    . GLU A 1 124 ? 99.71100  155.25900 141.26700 1.000 111.88000 ? 369 GLU A CD    1 
ATOM   428   O OE1   . GLU A 1 124 ? 99.63800  156.44600 140.89400 1.000 111.88000 ? 369 GLU A OE1   1 
ATOM   429   O OE2   . GLU A 1 124 ? 98.74400  154.47000 141.19500 1.000 111.88000 ? 369 GLU A OE2   1 
ATOM   430   N N     . ILE A 1 125 ? 105.60600 156.30800 141.58700 1.000 102.41000 ? 370 ILE A N     1 
ATOM   431   C CA    . ILE A 1 125 ? 106.59600 157.36200 141.44400 1.000 102.41000 ? 370 ILE A CA    1 
ATOM   432   C C     . ILE A 1 125 ? 106.79100 157.65800 139.96700 1.000 102.41000 ? 370 ILE A C     1 
ATOM   433   O O     . ILE A 1 125 ? 106.76300 156.75500 139.12500 1.000 102.41000 ? 370 ILE A O     1 
ATOM   434   C CB    . ILE A 1 125 ? 107.92900 157.00100 142.12200 1.000 102.41000 ? 370 ILE A CB    1 
ATOM   435   C CG1   . ILE A 1 125 ? 108.50600 155.71800 141.54800 1.000 102.41000 ? 370 ILE A CG1   1 
ATOM   436   C CG2   . ILE A 1 125 ? 107.73200 156.87400 143.61200 1.000 102.41000 ? 370 ILE A CG2   1 
ATOM   437   C CD1   . ILE A 1 125 ? 109.92500 155.52400 141.89000 1.000 102.41000 ? 370 ILE A CD1   1 
ATOM   438   N N     . GLN A 1 126 ? 106.95100 158.93200 139.65300 1.000 95.62000  ? 371 GLN A N     1 
ATOM   439   C CA    . GLN A 1 126 ? 107.14400 159.36900 138.27600 1.000 95.62000  ? 371 GLN A CA    1 
ATOM   440   C C     . GLN A 1 126 ? 108.51300 160.00300 138.15100 1.000 95.62000  ? 371 GLN A C     1 
ATOM   441   O O     . GLN A 1 126 ? 108.73900 161.09300 138.70900 1.000 95.62000  ? 371 GLN A O     1 
ATOM   442   C CB    . GLN A 1 126 ? 106.05700 160.35500 137.85400 1.000 95.62000  ? 371 GLN A CB    1 
ATOM   443   C CG    . GLN A 1 126 ? 106.22300 160.87700 136.43700 1.000 95.62000  ? 371 GLN A CG    1 
ATOM   444   C CD    . GLN A 1 126 ? 106.13300 159.78800 135.38500 1.000 95.62000  ? 371 GLN A CD    1 
ATOM   445   O OE1   . GLN A 1 126 ? 107.15100 159.30800 134.89300 1.000 95.62000  ? 371 GLN A OE1   1 
ATOM   446   N NE2   . GLN A 1 126 ? 104.91400 159.42100 135.00600 1.000 95.62000  ? 371 GLN A NE2   1 
ATOM   447   N N     . PRO A 1 127 ? 109.45500 159.36400 137.47300 1.000 86.27000  ? 372 PRO A N     1 
ATOM   448   C CA    . PRO A 1 127 ? 110.74400 160.00400 137.22500 1.000 86.27000  ? 372 PRO A CA    1 
ATOM   449   C C     . PRO A 1 127 ? 110.59700 161.15600 136.25300 1.000 86.27000  ? 372 PRO A C     1 
ATOM   450   O O     . PRO A 1 127 ? 109.65700 161.21100 135.45800 1.000 86.27000  ? 372 PRO A O     1 
ATOM   451   C CB    . PRO A 1 127 ? 111.58800 158.87500 136.63800 1.000 86.27000  ? 372 PRO A CB    1 
ATOM   452   C CG    . PRO A 1 127 ? 110.60700 157.95100 136.06700 1.000 86.27000  ? 372 PRO A CG    1 
ATOM   453   C CD    . PRO A 1 127 ? 109.40700 158.00000 136.93500 1.000 86.27000  ? 372 PRO A CD    1 
ATOM   454   N N     . ALA A 1 128 ? 111.54100 162.09100 136.33100 1.000 92.26000  ? 373 ALA A N     1 
ATOM   455   C CA    . ALA A 1 128 ? 111.32600 163.39100 135.70800 1.000 92.26000  ? 373 ALA A CA    1 
ATOM   456   C C     . ALA A 1 128 ? 111.57300 163.35500 134.20800 1.000 92.26000  ? 373 ALA A C     1 
ATOM   457   O O     . ALA A 1 128 ? 110.63500 163.46200 133.41300 1.000 92.26000  ? 373 ALA A O     1 
ATOM   458   C CB    . ALA A 1 128 ? 112.22800 164.43500 136.36600 1.000 92.26000  ? 373 ALA A CB    1 
ATOM   459   N N     . ALA A 1 129 ? 112.82400 163.15700 133.80400 1.000 93.37000  ? 374 ALA A N     1 
ATOM   460   C CA    . ALA A 1 129 ? 113.19000 163.28700 132.40100 1.000 93.37000  ? 374 ALA A CA    1 
ATOM   461   C C     . ALA A 1 129 ? 114.53200 162.61700 132.19000 1.000 93.37000  ? 374 ALA A C     1 
ATOM   462   O O     . ALA A 1 129 ? 115.48700 162.90900 132.91600 1.000 93.37000  ? 374 ALA A O     1 
ATOM   463   C CB    . ALA A 1 129 ? 113.27000 164.75600 131.97500 1.000 93.37000  ? 374 ALA A CB    1 
ATOM   464   N N     . GLY A 1 130 ? 114.60200 161.73800 131.19500 1.000 94.87000  ? 375 GLY A N     1 
ATOM   465   C CA    . GLY A 1 130 ? 115.83800 161.04000 130.91100 1.000 94.87000  ? 375 GLY A CA    1 
ATOM   466   C C     . GLY A 1 130 ? 116.25500 160.08300 131.99800 1.000 94.87000  ? 375 GLY A C     1 
ATOM   467   O O     . GLY A 1 130 ? 117.44800 159.83200 132.17100 1.000 94.87000  ? 375 GLY A O     1 
ATOM   468   N N     . VAL A 1 131 ? 115.30500 159.55900 132.75100 1.000 84.72000  ? 376 VAL A N     1 
ATOM   469   C CA    . VAL A 1 131 ? 115.59200 158.65700 133.84900 1.000 84.72000  ? 376 VAL A CA    1 
ATOM   470   C C     . VAL A 1 131 ? 115.04800 157.30200 133.43700 1.000 84.72000  ? 376 VAL A C     1 
ATOM   471   O O     . VAL A 1 131 ? 113.84600 157.04500 133.52600 1.000 84.72000  ? 376 VAL A O     1 
ATOM   472   C CB    . VAL A 1 131 ? 114.97500 159.13900 135.16000 1.000 84.72000  ? 376 VAL A CB    1 
ATOM   473   C CG1   . VAL A 1 131 ? 115.27700 158.16000 136.27400 1.000 84.72000  ? 376 VAL A CG1   1 
ATOM   474   C CG2   . VAL A 1 131 ? 115.49000 160.51900 135.49300 1.000 84.72000  ? 376 VAL A CG2   1 
ATOM   475   N N     . LYS A 1 132 ? 115.92900 156.44300 132.96300 1.000 74.59000  ? 377 LYS A N     1 
ATOM   476   C CA    . LYS A 1 132 ? 115.51400 155.13500 132.50600 1.000 74.59000  ? 377 LYS A CA    1 
ATOM   477   C C     . LYS A 1 132 ? 115.27900 154.21000 133.69200 1.000 74.59000  ? 377 LYS A C     1 
ATOM   478   O O     . LYS A 1 132 ? 115.83500 154.39100 134.77600 1.000 74.59000  ? 377 LYS A O     1 
ATOM   479   C CB    . LYS A 1 132 ? 116.56600 154.57400 131.56000 1.000 74.59000  ? 377 LYS A CB    1 
ATOM   480   C CG    . LYS A 1 132 ? 116.61900 155.33300 130.25900 1.000 74.59000  ? 377 LYS A CG    1 
ATOM   481   C CD    . LYS A 1 132 ? 117.62900 154.75000 129.31700 1.000 74.59000  ? 377 LYS A CD    1 
ATOM   482   C CE    . LYS A 1 132 ? 119.02000 155.12400 129.76100 1.000 74.59000  ? 377 LYS A CE    1 
ATOM   483   N NZ    . LYS A 1 132 ? 120.03100 154.70100 128.76600 1.000 74.59000  ? 377 LYS A NZ    1 
ATOM   484   N N     . VAL A 1 133 ? 114.43400 153.20400 133.47100 1.000 72.34000  ? 378 VAL A N     1 
ATOM   485   C CA    . VAL A 1 133 ? 113.99900 152.33200 134.55100 1.000 72.34000  ? 378 VAL A CA    1 
ATOM   486   C C     . VAL A 1 133 ? 115.12100 151.40600 135.00200 1.000 72.34000  ? 378 VAL A C     1 
ATOM   487   O O     . VAL A 1 133 ? 115.14100 150.96000 136.16100 1.000 72.34000  ? 378 VAL A O     1 
ATOM   488   C CB    . VAL A 1 133 ? 112.73900 151.59600 134.06100 1.000 72.34000  ? 378 VAL A CB    1 
ATOM   489   C CG1   . VAL A 1 133 ? 112.16000 150.65400 135.10200 1.000 72.34000  ? 378 VAL A CG1   1 
ATOM   490   C CG2   . VAL A 1 133 ? 111.70100 152.61400 133.66100 1.000 72.34000  ? 378 VAL A CG2   1 
ATOM   491   N N     . SER A 1 134 ? 116.09800 151.15800 134.12600 1.000 73.12000  ? 379 SER A N     1 
ATOM   492   C CA    . SER A 1 134 ? 117.25700 150.36200 134.50800 1.000 73.12000  ? 379 SER A CA    1 
ATOM   493   C C     . SER A 1 134 ? 118.07400 151.05100 135.58900 1.000 73.12000  ? 379 SER A C     1 
ATOM   494   O O     . SER A 1 134 ? 118.66200 150.38200 136.44200 1.000 73.12000  ? 379 SER A O     1 
ATOM   495   C CB    . SER A 1 134 ? 118.12800 150.07700 133.28800 1.000 73.12000  ? 379 SER A CB    1 
ATOM   496   O OG    . SER A 1 134 ? 118.72000 151.26500 132.80600 1.000 73.12000  ? 379 SER A OG    1 
ATOM   497   N N     . ARG A 1 135 ? 118.05300 152.37700 135.62900 1.000 71.04000  ? 380 ARG A N     1 
ATOM   498   C CA    . ARG A 1 135 ? 118.70800 153.08500 136.71400 1.000 71.04000  ? 380 ARG A CA    1 
ATOM   499   C C     . ARG A 1 135 ? 117.92100 153.04900 138.01700 1.000 71.04000  ? 380 ARG A C     1 
ATOM   500   O O     . ARG A 1 135 ? 118.36700 153.64100 139.00000 1.000 71.04000  ? 380 ARG A O     1 
ATOM   501   C CB    . ARG A 1 135 ? 118.97100 154.52900 136.31000 1.000 71.04000  ? 380 ARG A CB    1 
ATOM   502   C CG    . ARG A 1 135 ? 119.95200 154.65600 135.17800 1.000 71.04000  ? 380 ARG A CG    1 
ATOM   503   C CD    . ARG A 1 135 ? 120.16100 156.10000 134.83900 1.000 71.04000  ? 380 ARG A CD    1 
ATOM   504   N NE    . ARG A 1 135 ? 120.81500 156.78700 135.93800 1.000 71.04000  ? 380 ARG A NE    1 
ATOM   505   C CZ    . ARG A 1 135 ? 120.95000 158.10300 136.01300 1.000 71.04000  ? 380 ARG A CZ    1 
ATOM   506   N NH1   . ARG A 1 135 ? 120.46700 158.87700 135.05400 1.000 71.04000  ? 380 ARG A NH1   1 
ATOM   507   N NH2   . ARG A 1 135 ? 121.56400 158.64300 137.05400 1.000 71.04000  ? 380 ARG A NH2   1 
ATOM   508   N N     . ILE A 1 136 ? 116.76300 152.39900 138.05100 1.000 68.40000  ? 381 ILE A N     1 
ATOM   509   C CA    . ILE A 1 136 ? 116.10400 152.04000 139.29700 1.000 68.40000  ? 381 ILE A CA    1 
ATOM   510   C C     . ILE A 1 136 ? 116.33000 150.57400 139.63600 1.000 68.40000  ? 381 ILE A C     1 
ATOM   511   O O     . ILE A 1 136 ? 116.63800 150.23000 140.78100 1.000 68.40000  ? 381 ILE A O     1 
ATOM   512   C CB    . ILE A 1 136 ? 114.59900 152.36900 139.20600 1.000 68.40000  ? 381 ILE A CB    1 
ATOM   513   C CG1   . ILE A 1 136 ? 114.39900 153.86600 139.00400 1.000 68.40000  ? 381 ILE A CG1   1 
ATOM   514   C CG2   . ILE A 1 136 ? 113.85800 151.90200 140.43200 1.000 68.40000  ? 381 ILE A CG2   1 
ATOM   515   C CD1   . ILE A 1 136 ? 114.95300 154.69800 140.12200 1.000 68.40000  ? 381 ILE A CD1   1 
ATOM   516   N N     . SER A 1 137 ? 116.21200 149.70800 138.63000 1.000 73.11000  ? 382 SER A N     1 
ATOM   517   C CA    . SER A 1 137 ? 116.39800 148.28200 138.84800 1.000 73.11000  ? 382 SER A CA    1 
ATOM   518   C C     . SER A 1 137 ? 117.84700 147.90100 139.10700 1.000 73.11000  ? 382 SER A C     1 
ATOM   519   O O     . SER A 1 137 ? 118.09800 146.77400 139.53600 1.000 73.11000  ? 382 SER A O     1 
ATOM   520   C CB    . SER A 1 137 ? 115.87000 147.49600 137.65400 1.000 73.11000  ? 382 SER A CB    1 
ATOM   521   O OG    . SER A 1 137 ? 114.47100 147.65300 137.53600 1.000 73.11000  ? 382 SER A OG    1 
ATOM   522   N N     . ASN A 1 138 ? 118.80100 148.78800 138.85300 1.000 75.18000  ? 383 ASN A N     1 
ATOM   523   C CA    . ASN A 1 138 ? 120.15500 148.54700 139.31300 1.000 75.18000  ? 383 ASN A CA    1 
ATOM   524   C C     . ASN A 1 138 ? 120.46600 149.25100 140.62200 1.000 75.18000  ? 383 ASN A C     1 
ATOM   525   O O     . ASN A 1 138 ? 121.54700 149.04200 141.17800 1.000 75.18000  ? 383 ASN A O     1 
ATOM   526   C CB    . ASN A 1 138 ? 121.16900 148.96500 138.25200 1.000 75.18000  ? 383 ASN A CB    1 
ATOM   527   C CG    . ASN A 1 138 ? 121.05800 148.13500 137.00600 1.000 75.18000  ? 383 ASN A CG    1 
ATOM   528   O OD1   . ASN A 1 138 ? 120.87100 148.65400 135.91200 1.000 75.18000  ? 383 ASN A OD1   1 
ATOM   529   N ND2   . ASN A 1 138 ? 121.12300 146.82500 137.17100 1.000 75.18000  ? 383 ASN A ND2   1 
ATOM   530   N N     . LEU A 1 139 ? 119.55700 150.07200 141.13000 1.000 74.05000  ? 384 LEU A N     1 
ATOM   531   C CA    . LEU A 1 139 ? 119.71600 150.60700 142.46800 1.000 74.05000  ? 384 LEU A CA    1 
ATOM   532   C C     . LEU A 1 139 ? 118.94200 149.82600 143.50800 1.000 74.05000  ? 384 LEU A C     1 
ATOM   533   O O     . LEU A 1 139 ? 119.18200 150.04500 144.69600 1.000 74.05000  ? 384 LEU A O     1 
ATOM   534   C CB    . LEU A 1 139 ? 119.27400 152.06400 142.52600 1.000 74.05000  ? 384 LEU A CB    1 
ATOM   535   C CG    . LEU A 1 139 ? 120.15800 153.04300 141.78100 1.000 74.05000  ? 384 LEU A CG    1 
ATOM   536   C CD1   . LEU A 1 139 ? 119.59100 154.42700 141.94200 1.000 74.05000  ? 384 LEU A CD1   1 
ATOM   537   C CD2   . LEU A 1 139 ? 121.55400 152.97300 142.32800 1.000 74.05000  ? 384 LEU A CD2   1 
ATOM   538   N N     . ALA A 1 140 ? 118.05000 148.93000 143.06000 1.000 77.73000  ? 385 ALA A N     1 
ATOM   539   C CA    . ALA A 1 140 ? 117.06600 148.21300 143.88000 1.000 77.73000  ? 385 ALA A CA    1 
ATOM   540   C C     . ALA A 1 140 ? 117.53100 147.71900 145.24800 1.000 77.73000  ? 385 ALA A C     1 
ATOM   541   O O     . ALA A 1 140 ? 116.92500 148.05000 146.27200 1.000 77.73000  ? 385 ALA A O     1 
ATOM   542   C CB    . ALA A 1 140 ? 116.54700 147.02200 143.07700 1.000 77.73000  ? 385 ALA A CB    1 
ATOM   543   N N     . LYS A 1 141 ? 118.62000 146.95400 145.29000 1.000 82.23000  ? 386 LYS A N     1 
ATOM   544   C CA    . LYS A 1 141 ? 119.05900 146.37200 146.55600 1.000 82.23000  ? 386 LYS A CA    1 
ATOM   545   C C     . LYS A 1 141 ? 119.61100 147.43000 147.50400 1.000 82.23000  ? 386 LYS A C     1 
ATOM   546   O O     . LYS A 1 141 ? 119.35300 147.38600 148.71600 1.000 82.23000  ? 386 LYS A O     1 
ATOM   547   C CB    . LYS A 1 141 ? 120.10500 145.29200 146.29500 1.000 82.23000  ? 386 LYS A CB    1 
ATOM   548   C CG    . LYS A 1 141 ? 120.60600 144.59000 147.53900 1.000 82.23000  ? 386 LYS A CG    1 
ATOM   549   C CD    . LYS A 1 141 ? 119.48800 143.84500 148.23200 1.000 82.23000  ? 386 LYS A CD    1 
ATOM   550   C CE    . LYS A 1 141 ? 118.96400 142.71700 147.35800 1.000 82.23000  ? 386 LYS A CE    1 
ATOM   551   N NZ    . LYS A 1 141 ? 119.97300 141.64400 147.15600 1.000 82.23000  ? 386 LYS A NZ    1 
ATOM   552   N N     . ASP A 1 142 ? 120.35300 148.40000 146.97100 1.000 80.31000  ? 387 ASP A N     1 
ATOM   553   C CA    . ASP A 1 142 ? 120.88500 149.45600 147.82000 1.000 80.31000  ? 387 ASP A CA    1 
ATOM   554   C C     . ASP A 1 142 ? 119.78200 150.38400 148.29600 1.000 80.31000  ? 387 ASP A C     1 
ATOM   555   O O     . ASP A 1 142 ? 119.83500 150.89000 149.42100 1.000 80.31000  ? 387 ASP A O     1 
ATOM   556   C CB    . ASP A 1 142 ? 121.93900 150.24400 147.06500 1.000 80.31000  ? 387 ASP A CB    1 
ATOM   557   C CG    . ASP A 1 142 ? 122.80500 151.07700 147.97600 1.000 80.31000  ? 387 ASP A CG    1 
ATOM   558   O OD1   . ASP A 1 142 ? 122.65200 151.00200 149.20700 1.000 80.31000  ? 387 ASP A OD1   1 
ATOM   559   O OD2   . ASP A 1 142 ? 123.65000 151.82400 147.45700 1.000 80.31000  ? 387 ASP A OD2   1 
ATOM   560   N N     . LEU A 1 143 ? 118.77300 150.60100 147.45900 1.000 81.57000  ? 388 LEU A N     1 
ATOM   561   C CA    . LEU A 1 143 ? 117.59600 151.34100 147.88600 1.000 81.57000  ? 388 LEU A CA    1 
ATOM   562   C C     . LEU A 1 143 ? 116.87300 150.60300 148.99800 1.000 81.57000  ? 388 LEU A C     1 
ATOM   563   O O     . LEU A 1 143 ? 116.37100 151.22200 149.94300 1.000 81.57000  ? 388 LEU A O     1 
ATOM   564   C CB    . LEU A 1 143 ? 116.67400 151.56500 146.69300 1.000 81.57000  ? 388 LEU A CB    1 
ATOM   565   C CG    . LEU A 1 143 ? 115.42200 152.37200 146.98100 1.000 81.57000  ? 388 LEU A CG    1 
ATOM   566   C CD1   . LEU A 1 143 ? 115.82700 153.73200 147.45900 1.000 81.57000  ? 388 LEU A CD1   1 
ATOM   567   C CD2   . LEU A 1 143 ? 114.60400 152.47700 145.73400 1.000 81.57000  ? 388 LEU A CD2   1 
ATOM   568   N N     . ALA A 1 144 ? 116.85300 149.27300 148.91800 1.000 81.76000  ? 389 ALA A N     1 
ATOM   569   C CA    . ALA A 1 144 ? 116.22000 148.46800 149.95100 1.000 81.76000  ? 389 ALA A CA    1 
ATOM   570   C C     . ALA A 1 144 ? 116.96200 148.57400 151.26900 1.000 81.76000  ? 389 ALA A C     1 
ATOM   571   O O     . ALA A 1 144 ? 116.33800 148.67400 152.32900 1.000 81.76000  ? 389 ALA A O     1 
ATOM   572   C CB    . ALA A 1 144 ? 116.14700 147.01500 149.50600 1.000 81.76000  ? 389 ALA A CB    1 
ATOM   573   N N     . ARG A 1 145 ? 118.28900 148.56300 151.23100 1.000 85.12000  ? 390 ARG A N     1 
ATOM   574   C CA    . ARG A 1 145 ? 118.99000 148.75000 152.49400 1.000 85.12000  ? 390 ARG A CA    1 
ATOM   575   C C     . ARG A 1 145 ? 118.99900 150.20900 152.92800 1.000 85.12000  ? 390 ARG A C     1 
ATOM   576   O O     . ARG A 1 145 ? 119.36000 150.49100 154.07300 1.000 85.12000  ? 390 ARG A O     1 
ATOM   577   C CB    . ARG A 1 145 ? 120.42500 148.19600 152.42900 1.000 85.12000  ? 390 ARG A CB    1 
ATOM   578   C CG    . ARG A 1 145 ? 121.41700 148.93800 151.54500 1.000 85.12000  ? 390 ARG A CG    1 
ATOM   579   C CD    . ARG A 1 145 ? 122.30400 149.87900 152.34700 1.000 85.12000  ? 390 ARG A CD    1 
ATOM   580   N NE    . ARG A 1 145 ? 123.23700 150.60300 151.50500 1.000 85.12000  ? 390 ARG A NE    1 
ATOM   581   C CZ    . ARG A 1 145 ? 123.93600 151.64700 151.92200 1.000 85.12000  ? 390 ARG A CZ    1 
ATOM   582   N NH1   . ARG A 1 145 ? 123.78600 152.08800 153.15900 1.000 85.12000  ? 390 ARG A NH1   1 
ATOM   583   N NH2   . ARG A 1 145 ? 124.76500 152.26000 151.09500 1.000 85.12000  ? 390 ARG A NH2   1 
ATOM   584   N N     . SER A 1 146 ? 118.64300 151.13900 152.04200 1.000 80.50000  ? 391 SER A N     1 
ATOM   585   C CA    . SER A 1 146 ? 118.59100 152.54000 152.43500 1.000 80.50000  ? 391 SER A CA    1 
ATOM   586   C C     . SER A 1 146 ? 117.38400 152.81000 153.31400 1.000 80.50000  ? 391 SER A C     1 
ATOM   587   O O     . SER A 1 146 ? 117.48900 153.48600 154.34200 1.000 80.50000  ? 391 SER A O     1 
ATOM   588   C CB    . SER A 1 146 ? 118.53400 153.42400 151.20300 1.000 80.50000  ? 391 SER A CB    1 
ATOM   589   O OG    . SER A 1 146 ? 117.28200 153.26300 150.57200 1.000 80.50000  ? 391 SER A OG    1 
ATOM   590   N N     . LEU A 1 147 ? 116.22800 152.28400 152.92400 1.000 85.20000  ? 392 LEU A N     1 
ATOM   591   C CA    . LEU A 1 147 ? 114.98400 152.48300 153.65100 1.000 85.20000  ? 392 LEU A CA    1 
ATOM   592   C C     . LEU A 1 147 ? 114.83200 151.54000 154.82700 1.000 85.20000  ? 392 LEU A C     1 
ATOM   593   O O     . LEU A 1 147 ? 113.80400 151.60300 155.50600 1.000 85.20000  ? 392 LEU A O     1 
ATOM   594   C CB    . LEU A 1 147 ? 113.80900 152.30100 152.70300 1.000 85.20000  ? 392 LEU A CB    1 
ATOM   595   C CG    . LEU A 1 147 ? 113.84100 153.33300 151.58700 1.000 85.20000  ? 392 LEU A CG    1 
ATOM   596   C CD1   . LEU A 1 147 ? 112.82200 153.02400 150.51200 1.000 85.20000  ? 392 LEU A CD1   1 
ATOM   597   C CD2   . LEU A 1 147 ? 113.59500 154.69900 152.17000 1.000 85.20000  ? 392 LEU A CD2   1 
ATOM   598   N N     . ALA A 1 148 ? 115.83000 150.68000 155.05400 1.000 88.82000  ? 393 ALA A N     1 
ATOM   599   C CA    . ALA A 1 148 ? 115.85400 149.67500 156.11800 1.000 88.82000  ? 393 ALA A CA    1 
ATOM   600   C C     . ALA A 1 148 ? 114.65700 148.73500 156.03300 1.000 88.82000  ? 393 ALA A C     1 
ATOM   601   O O     . ALA A 1 148 ? 114.03800 148.39600 157.04100 1.000 88.82000  ? 393 ALA A O     1 
ATOM   602   C CB    . ALA A 1 148 ? 115.95300 150.31700 157.50400 1.000 88.82000  ? 393 ALA A CB    1 
ATOM   603   N N     . VAL A 1 149 ? 114.31400 148.32200 154.81500 1.000 87.40000  ? 394 VAL A N     1 
ATOM   604   C CA    . VAL A 1 149 ? 113.26900 147.32700 154.60900 1.000 87.40000  ? 394 VAL A CA    1 
ATOM   605   C C     . VAL A 1 149 ? 114.00900 146.12100 154.03200 1.000 87.40000  ? 394 VAL A C     1 
ATOM   606   O O     . VAL A 1 149 ? 115.22800 146.18300 153.84200 1.000 87.40000  ? 394 VAL A O     1 
ATOM   607   C CB    . VAL A 1 149 ? 112.15300 147.86700 153.69200 1.000 87.40000  ? 394 VAL A CB    1 
ATOM   608   C CG1   . VAL A 1 149 ? 110.85300 147.09200 153.86800 1.000 87.40000  ? 394 VAL A CG1   1 
ATOM   609   C CG2   . VAL A 1 149 ? 111.91800 149.33100 153.94800 1.000 87.40000  ? 394 VAL A CG2   1 
ATOM   610   N N     . ILE A 1 150 ? 113.31400 145.01300 153.76500 1.000 89.08000  ? 395 ILE A N     1 
ATOM   611   C CA    . ILE A 1 150 ? 114.00700 143.75900 153.49800 1.000 89.08000  ? 395 ILE A CA    1 
ATOM   612   C C     . ILE A 1 150 ? 114.48200 143.67200 152.04500 1.000 89.08000  ? 395 ILE A C     1 
ATOM   613   O O     . ILE A 1 150 ? 115.65700 143.38100 151.79900 1.000 89.08000  ? 395 ILE A O     1 
ATOM   614   C CB    . ILE A 1 150 ? 113.13000 142.56300 153.93100 1.000 89.08000  ? 395 ILE A CB    1 
ATOM   615   C CG1   . ILE A 1 150 ? 113.85600 141.24000 153.68700 1.000 89.08000  ? 395 ILE A CG1   1 
ATOM   616   C CG2   . ILE A 1 150 ? 111.71400 142.61200 153.36100 1.000 89.08000  ? 395 ILE A CG2   1 
ATOM   617   C CD1   . ILE A 1 150 ? 113.21800 140.07100 154.39200 1.000 89.08000  ? 395 ILE A CD1   1 
ATOM   618   N N     . SER A 1 151 ? 113.61500 143.94500 151.06800 1.000 84.36000  ? 396 SER A N     1 
ATOM   619   C CA    . SER A 1 151 ? 114.01500 144.00300 149.66500 1.000 84.36000  ? 396 SER A CA    1 
ATOM   620   C C     . SER A 1 151 ? 112.93900 144.75100 148.90000 1.000 84.36000  ? 396 SER A C     1 
ATOM   621   O O     . SER A 1 151 ? 111.88800 145.08400 149.44600 1.000 84.36000  ? 396 SER A O     1 
ATOM   622   C CB    . SER A 1 151 ? 114.21700 142.62100 149.04700 1.000 84.36000  ? 396 SER A CB    1 
ATOM   623   O OG    . SER A 1 151 ? 112.97700 141.97400 148.88800 1.000 84.36000  ? 396 SER A OG    1 
ATOM   624   N N     . VAL A 1 152 ? 113.21200 145.01700 147.62200 1.000 81.06000  ? 397 VAL A N     1 
ATOM   625   C CA    . VAL A 1 152 ? 112.32200 145.79300 146.75900 1.000 81.06000  ? 397 VAL A CA    1 
ATOM   626   C C     . VAL A 1 152 ? 112.31200 145.17100 145.37100 1.000 81.06000  ? 397 VAL A C     1 
ATOM   627   O O     . VAL A 1 152 ? 113.35900 145.07700 144.72600 1.000 81.06000  ? 397 VAL A O     1 
ATOM   628   C CB    . VAL A 1 152 ? 112.75000 147.26600 146.64500 1.000 81.06000  ? 397 VAL A CB    1 
ATOM   629   C CG1   . VAL A 1 152 ? 111.98700 147.94200 145.54000 1.000 81.06000  ? 397 VAL A CG1   1 
ATOM   630   C CG2   . VAL A 1 152 ? 112.51100 148.01500 147.93200 1.000 81.06000  ? 397 VAL A CG2   1 
ATOM   631   N N     . ARG A 1 153 ? 111.14200 144.76700 144.89900 1.000 90.17000  ? 398 ARG A N     1 
ATOM   632   C CA    . ARG A 1 153 ? 110.96600 144.49600 143.48300 1.000 90.17000  ? 398 ARG A CA    1 
ATOM   633   C C     . ARG A 1 153 ? 110.43700 145.76500 142.83200 1.000 90.17000  ? 398 ARG A C     1 
ATOM   634   O O     . ARG A 1 153 ? 109.72500 146.54700 143.46400 1.000 90.17000  ? 398 ARG A O     1 
ATOM   635   C CB    . ARG A 1 153 ? 110.00400 143.32700 143.25000 1.000 90.17000  ? 398 ARG A CB    1 
ATOM   636   C CG    . ARG A 1 153 ? 109.96000 142.81700 141.81300 1.000 90.17000  ? 398 ARG A CG    1 
ATOM   637   C CD    . ARG A 1 153 ? 108.99600 141.66100 141.64400 1.000 90.17000  ? 398 ARG A CD    1 
ATOM   638   N NE    . ARG A 1 153 ? 107.60100 142.05800 141.80600 1.000 90.17000  ? 398 ARG A NE    1 
ATOM   639   C CZ    . ARG A 1 153 ? 106.83300 142.52400 140.82400 1.000 90.17000  ? 398 ARG A CZ    1 
ATOM   640   N NH1   . ARG A 1 153 ? 107.32000 142.64600 139.59700 1.000 90.17000  ? 398 ARG A NH1   1 
ATOM   641   N NH2   . ARG A 1 153 ? 105.57200 142.85600 141.06400 1.000 90.17000  ? 398 ARG A NH2   1 
ATOM   642   N N     . VAL A 1 154 ? 110.79800 145.98100 141.57300 1.000 81.65000  ? 399 VAL A N     1 
ATOM   643   C CA    . VAL A 1 154 ? 110.45900 147.20400 140.86200 1.000 81.65000  ? 399 VAL A CA    1 
ATOM   644   C C     . VAL A 1 154 ? 109.48200 146.87300 139.74800 1.000 81.65000  ? 399 VAL A C     1 
ATOM   645   O O     . VAL A 1 154 ? 109.77800 146.04600 138.87900 1.000 81.65000  ? 399 VAL A O     1 
ATOM   646   C CB    . VAL A 1 154 ? 111.70800 147.88700 140.30300 1.000 81.65000  ? 399 VAL A CB    1 
ATOM   647   C CG1   . VAL A 1 154 ? 111.31300 149.07900 139.49300 1.000 81.65000  ? 399 VAL A CG1   1 
ATOM   648   C CG2   . VAL A 1 154 ? 112.60300 148.29800 141.43100 1.000 81.65000  ? 399 VAL A CG2   1 
ATOM   649   N N     . VAL A 1 155 ? 108.32200 147.52700 139.77200 1.000 95.92000  ? 400 VAL A N     1 
ATOM   650   C CA    . VAL A 1 155 ? 107.34600 147.36900 138.70300 1.000 95.92000  ? 400 VAL A CA    1 
ATOM   651   C C     . VAL A 1 155 ? 107.88300 148.01700 137.43900 1.000 95.92000  ? 400 VAL A C     1 
ATOM   652   O O     . VAL A 1 155 ? 108.24400 149.20000 137.43100 1.000 95.92000  ? 400 VAL A O     1 
ATOM   653   C CB    . VAL A 1 155 ? 105.99500 147.98000 139.10300 1.000 95.92000  ? 400 VAL A CB    1 
ATOM   654   C CG1   . VAL A 1 155 ? 105.01700 147.90000 137.95300 1.000 95.92000  ? 400 VAL A CG1   1 
ATOM   655   C CG2   . VAL A 1 155 ? 105.42900 147.27900 140.30900 1.000 95.92000  ? 400 VAL A CG2   1 
ATOM   656   N N     . GLU A 1 156 ? 107.94100 147.24400 136.36200 1.000 103.35000 ? 401 GLU A N     1 
ATOM   657   C CA    . GLU A 1 156 ? 108.43700 147.78800 135.11000 1.000 103.35000 ? 401 GLU A CA    1 
ATOM   658   C C     . GLU A 1 156 ? 107.41300 148.69800 134.44800 1.000 103.35000 ? 401 GLU A C     1 
ATOM   659   O O     . GLU A 1 156 ? 107.78500 149.71400 133.85400 1.000 103.35000 ? 401 GLU A O     1 
ATOM   660   C CB    . GLU A 1 156 ? 108.81700 146.65500 134.16900 1.000 103.35000 ? 401 GLU A CB    1 
ATOM   661   C CG    . GLU A 1 156 ? 109.91200 145.76600 134.70300 1.000 103.35000 ? 401 GLU A CG    1 
ATOM   662   C CD    . GLU A 1 156 ? 110.29800 144.69000 133.71800 1.000 103.35000 ? 401 GLU A CD    1 
ATOM   663   O OE1   . GLU A 1 156 ? 109.65100 144.60700 132.65200 1.000 103.35000 ? 401 GLU A OE1   1 
ATOM   664   O OE2   . GLU A 1 156 ? 111.24100 143.92600 134.00800 1.000 103.35000 ? 401 GLU A OE2   1 
ATOM   665   N N     . VAL A 1 157 ? 106.12900 148.35800 134.54200 1.000 102.29000 ? 402 VAL A N     1 
ATOM   666   C CA    . VAL A 1 157 ? 105.08600 149.11600 133.86100 1.000 102.29000 ? 402 VAL A CA    1 
ATOM   667   C C     . VAL A 1 157 ? 103.75700 148.87400 134.56700 1.000 102.29000 ? 402 VAL A C     1 
ATOM   668   O O     . VAL A 1 157 ? 103.47100 147.76900 135.03300 1.000 102.29000 ? 402 VAL A O     1 
ATOM   669   C CB    . VAL A 1 157 ? 105.03700 148.75700 132.35300 1.000 102.29000 ? 402 VAL A CB    1 
ATOM   670   C CG1   . VAL A 1 157 ? 104.73200 147.28600 132.13200 1.000 102.29000 ? 402 VAL A CG1   1 
ATOM   671   C CG2   . VAL A 1 157 ? 104.05100 149.63300 131.60000 1.000 102.29000 ? 402 VAL A CG2   1 
ATOM   672   N N     . ILE A 1 158 ? 102.97900 149.94300 134.70200 1.000 101.57000 ? 403 ILE A N     1 
ATOM   673   C CA    . ILE A 1 158 ? 101.57200 149.87300 135.08000 1.000 101.57000 ? 403 ILE A CA    1 
ATOM   674   C C     . ILE A 1 158 ? 100.78700 149.88000 133.77600 1.000 101.57000 ? 403 ILE A C     1 
ATOM   675   O O     . ILE A 1 158 ? 101.11400 150.66700 132.87800 1.000 101.57000 ? 403 ILE A O     1 
ATOM   676   C CB    . ILE A 1 158 ? 101.17800 151.04800 135.98600 1.000 101.57000 ? 403 ILE A CB    1 
ATOM   677   C CG1   . ILE A 1 158 ? 101.95900 150.99100 137.28600 1.000 101.57000 ? 403 ILE A CG1   1 
ATOM   678   C CG2   . ILE A 1 158 ? 99.70700  151.03200 136.30700 1.000 101.57000 ? 403 ILE A CG2   1 
ATOM   679   C CD1   . ILE A 1 158 ? 101.77900 152.20500 138.13600 1.000 101.57000 ? 403 ILE A CD1   1 
ATOM   680   N N     . PRO A 1 159 ? 99.78200  149.02000 133.60500 1.000 106.42000 ? 404 PRO A N     1 
ATOM   681   C CA    . PRO A 1 159 ? 98.99000  149.06000 132.37100 1.000 106.42000 ? 404 PRO A CA    1 
ATOM   682   C C     . PRO A 1 159 ? 98.15200  150.32400 132.24100 1.000 106.42000 ? 404 PRO A C     1 
ATOM   683   O O     . PRO A 1 159 ? 97.20000  150.54000 132.99600 1.000 106.42000 ? 404 PRO A O     1 
ATOM   684   C CB    . PRO A 1 159 ? 98.11200  147.81000 132.48200 1.000 106.42000 ? 404 PRO A CB    1 
ATOM   685   C CG    . PRO A 1 159 ? 98.05400  147.51400 133.93000 1.000 106.42000 ? 404 PRO A CG    1 
ATOM   686   C CD    . PRO A 1 159 ? 99.38300  147.90500 134.47700 1.000 106.42000 ? 404 PRO A CD    1 
ATOM   687   N N     . GLY A 1 160 ? 98.51700  151.17400 131.28400 1.000 108.19000 ? 405 GLY A N     1 
ATOM   688   C CA    . GLY A 1 160 ? 97.79600  152.38800 130.99800 1.000 108.19000 ? 405 GLY A CA    1 
ATOM   689   C C     . GLY A 1 160 ? 98.35600  153.63100 131.65700 1.000 108.19000 ? 405 GLY A C     1 
ATOM   690   O O     . GLY A 1 160 ? 98.02300  154.73900 131.22900 1.000 108.19000 ? 405 GLY A O     1 
ATOM   691   N N     . LYS A 1 161 ? 99.20000  153.48200 132.67200 1.000 104.85000 ? 406 LYS A N     1 
ATOM   692   C CA    . LYS A 1 161 ? 99.66700  154.60700 133.46500 1.000 104.85000 ? 406 LYS A CA    1 
ATOM   693   C C     . LYS A 1 161 ? 101.18100 154.73900 133.34300 1.000 104.85000 ? 406 LYS A C     1 
ATOM   694   O O     . LYS A 1 161 ? 101.90100 153.74000 133.29500 1.000 104.85000 ? 406 LYS A O     1 
ATOM   695   C CB    . LYS A 1 161 ? 99.25200  154.42700 134.92500 1.000 104.85000 ? 406 LYS A CB    1 
ATOM   696   C CG    . LYS A 1 161 ? 99.53600  155.60200 135.82100 1.000 104.85000 ? 406 LYS A CG    1 
ATOM   697   C CD    . LYS A 1 161 ? 98.67300  156.77800 135.43900 1.000 104.85000 ? 406 LYS A CD    1 
ATOM   698   C CE    . LYS A 1 161 ? 98.85300  157.90300 136.42600 1.000 104.85000 ? 406 LYS A CE    1 
ATOM   699   N NZ    . LYS A 1 161 ? 100.23600 158.43700 136.36300 1.000 104.85000 ? 406 LYS A NZ    1 
ATOM   700   N N     . THR A 1 162 ? 101.66100 155.98400 133.31000 1.000 100.75000 ? 407 THR A N     1 
ATOM   701   C CA    . THR A 1 162 ? 103.02900 156.30300 132.91500 1.000 100.75000 ? 407 THR A CA    1 
ATOM   702   C C     . THR A 1 162 ? 104.06400 156.04800 133.99900 1.000 100.75000 ? 407 THR A C     1 
ATOM   703   O O     . THR A 1 162 ? 105.26300 156.11400 133.71500 1.000 100.75000 ? 407 THR A O     1 
ATOM   704   C CB    . THR A 1 162 ? 103.13400 157.77200 132.51500 1.000 100.75000 ? 407 THR A CB    1 
ATOM   705   O OG1   . THR A 1 162 ? 102.99100 158.58500 133.68400 1.000 100.75000 ? 407 THR A OG1   1 
ATOM   706   C CG2   . THR A 1 162 ? 102.04100 158.13100 131.54900 1.000 100.75000 ? 407 THR A CG2   1 
ATOM   707   N N     . THR A 1 163 ? 103.65000 155.76600 135.22100 1.000 101.45000 ? 408 THR A N     1 
ATOM   708   C CA    . THR A 1 163 ? 104.58100 155.72500 136.33300 1.000 101.45000 ? 408 THR A CA    1 
ATOM   709   C C     . THR A 1 163 ? 105.10300 154.31300 136.54500 1.000 101.45000 ? 408 THR A C     1 
ATOM   710   O O     . THR A 1 163 ? 104.44200 153.32500 136.22400 1.000 101.45000 ? 408 THR A O     1 
ATOM   711   C CB    . THR A 1 163 ? 103.91900 156.22700 137.61900 1.000 101.45000 ? 408 THR A CB    1 
ATOM   712   O OG1   . THR A 1 163 ? 102.81600 155.37900 137.95400 1.000 101.45000 ? 408 THR A OG1   1 
ATOM   713   C CG2   . THR A 1 163 ? 103.42500 157.64600 137.44500 1.000 101.45000 ? 408 THR A CG2   1 
ATOM   714   N N     . VAL A 1 164 ? 106.30800 154.23400 137.09300 1.000 95.22000  ? 409 VAL A N     1 
ATOM   715   C CA    . VAL A 1 164 ? 106.88200 152.97100 137.52000 1.000 95.22000  ? 409 VAL A CA    1 
ATOM   716   C C     . VAL A 1 164 ? 106.61500 152.81500 139.00400 1.000 95.22000  ? 409 VAL A C     1 
ATOM   717   O O     . VAL A 1 164 ? 106.36500 153.78200 139.72800 1.000 95.22000  ? 409 VAL A O     1 
ATOM   718   C CB    . VAL A 1 164 ? 108.38600 152.87500 137.22500 1.000 95.22000  ? 409 VAL A CB    1 
ATOM   719   C CG1   . VAL A 1 164 ? 108.62100 152.99800 135.74800 1.000 95.22000  ? 409 VAL A CG1   1 
ATOM   720   C CG2   . VAL A 1 164 ? 109.14100 153.94900 137.97300 1.000 95.22000  ? 409 VAL A CG2   1 
ATOM   721   N N     . GLY A 1 165 ? 106.66900 151.57400 139.45800 1.000 96.22000  ? 410 GLY A N     1 
ATOM   722   C CA    . GLY A 1 165 ? 106.26100 151.29300 140.81400 1.000 96.22000  ? 410 GLY A CA    1 
ATOM   723   C C     . GLY A 1 165 ? 107.32000 150.62800 141.65600 1.000 96.22000  ? 410 GLY A C     1 
ATOM   724   O O     . GLY A 1 165 ? 107.93900 149.64500 141.24600 1.000 96.22000  ? 410 GLY A O     1 
ATOM   725   N N     . ILE A 1 166 ? 107.53900 151.16500 142.84300 1.000 94.81000  ? 411 ILE A N     1 
ATOM   726   C CA    . ILE A 1 166 ? 108.37000 150.50900 143.83500 1.000 94.81000  ? 411 ILE A CA    1 
ATOM   727   C C     . ILE A 1 166 ? 107.46400 149.72700 144.77100 1.000 94.81000  ? 411 ILE A C     1 
ATOM   728   O O     . ILE A 1 166 ? 106.58600 150.30000 145.42400 1.000 94.81000  ? 411 ILE A O     1 
ATOM   729   C CB    . ILE A 1 166 ? 109.22300 151.52300 144.60400 1.000 94.81000  ? 411 ILE A CB    1 
ATOM   730   C CG1   . ILE A 1 166 ? 110.32900 152.05700 143.71200 1.000 94.81000  ? 411 ILE A CG1   1 
ATOM   731   C CG2   . ILE A 1 166 ? 109.80800 150.90700 145.83300 1.000 94.81000  ? 411 ILE A CG2   1 
ATOM   732   C CD1   . ILE A 1 166 ? 111.13200 153.12000 144.38500 1.000 94.81000  ? 411 ILE A CD1   1 
ATOM   733   N N     . GLU A 1 167 ? 107.66600 148.41500 144.82400 1.000 96.16000  ? 412 GLU A N     1 
ATOM   734   C CA    . GLU A 1 167 ? 106.92200 147.54600 145.72000 1.000 96.16000  ? 412 GLU A CA    1 
ATOM   735   C C     . GLU A 1 167 ? 107.76600 147.27500 146.95500 1.000 96.16000  ? 412 GLU A C     1 
ATOM   736   O O     . GLU A 1 167 ? 108.87100 146.73300 146.85500 1.000 96.16000  ? 412 GLU A O     1 
ATOM   737   C CB    . GLU A 1 167 ? 106.53400 146.24200 145.02800 1.000 96.16000  ? 412 GLU A CB    1 
ATOM   738   C CG    . GLU A 1 167 ? 105.48100 146.42300 143.94800 1.000 96.16000  ? 412 GLU A CG    1 
ATOM   739   C CD    . GLU A 1 167 ? 105.06800 145.11600 143.29100 1.000 96.16000  ? 412 GLU A CD    1 
ATOM   740   O OE1   . GLU A 1 167 ? 105.69600 144.07900 143.58200 1.000 96.16000  ? 412 GLU A OE1   1 
ATOM   741   O OE2   . GLU A 1 167 ? 104.11300 145.12200 142.48700 1.000 96.16000  ? 412 GLU A OE2   1 
ATOM   742   N N     . ILE A 1 168 ? 107.24100 147.66100 148.11000 1.000 101.80000 ? 413 ILE A N     1 
ATOM   743   C CA    . ILE A 1 168 ? 107.91300 147.51100 149.39100 1.000 101.80000 ? 413 ILE A CA    1 
ATOM   744   C C     . ILE A 1 168 ? 107.02000 146.69700 150.31600 1.000 101.80000 ? 413 ILE A C     1 
ATOM   745   O O     . ILE A 1 168 ? 105.87600 147.08300 150.57000 1.000 101.80000 ? 413 ILE A O     1 
ATOM   746   C CB    . ILE A 1 168 ? 108.24900 148.87000 150.02100 1.000 101.80000 ? 413 ILE A CB    1 
ATOM   747   C CG1   . ILE A 1 168 ? 109.39100 149.50900 149.25200 1.000 101.80000 ? 413 ILE A CG1   1 
ATOM   748   C CG2   . ILE A 1 168 ? 108.59900 148.72100 151.46900 1.000 101.80000 ? 413 ILE A CG2   1 
ATOM   749   C CD1   . ILE A 1 168 ? 109.73000 150.88400 149.71700 1.000 101.80000 ? 413 ILE A CD1   1 
ATOM   750   N N     . PRO A 1 169 ? 107.49100 145.57200 150.83800 1.000 99.31000  ? 414 PRO A N     1 
ATOM   751   C CA    . PRO A 1 169 ? 106.64900 144.75100 151.70500 1.000 99.31000  ? 414 PRO A CA    1 
ATOM   752   C C     . PRO A 1 169 ? 106.53900 145.33600 153.09800 1.000 99.31000  ? 414 PRO A C     1 
ATOM   753   O O     . PRO A 1 169 ? 107.51000 145.84800 153.65600 1.000 99.31000  ? 414 PRO A O     1 
ATOM   754   C CB    . PRO A 1 169 ? 107.38000 143.40700 151.72500 1.000 99.31000  ? 414 PRO A CB    1 
ATOM   755   C CG    . PRO A 1 169 ? 108.78400 143.75700 151.46100 1.000 99.31000  ? 414 PRO A CG    1 
ATOM   756   C CD    . PRO A 1 169 ? 108.77600 144.92700 150.54400 1.000 99.31000  ? 414 PRO A CD    1 
ATOM   757   N N     . ASN A 1 170 ? 105.33100 145.27800 153.64800 1.000 107.82000 ? 415 ASN A N     1 
ATOM   758   C CA    . ASN A 1 170 ? 105.15600 145.59200 155.05400 1.000 107.82000 ? 415 ASN A CA    1 
ATOM   759   C C     . ASN A 1 170 ? 105.84700 144.53500 155.89200 1.000 107.82000 ? 415 ASN A C     1 
ATOM   760   O O     . ASN A 1 170 ? 105.95700 143.37400 155.49800 1.000 107.82000 ? 415 ASN A O     1 
ATOM   761   C CB    . ASN A 1 170 ? 103.67900 145.64300 155.43100 1.000 107.82000 ? 415 ASN A CB    1 
ATOM   762   C CG    . ASN A 1 170 ? 102.92900 146.71600 154.69200 1.000 107.82000 ? 415 ASN A CG    1 
ATOM   763   O OD1   . ASN A 1 170 ? 102.06500 146.42700 153.86500 1.000 107.82000 ? 415 ASN A OD1   1 
ATOM   764   N ND2   . ASN A 1 170 ? 103.24400 147.96700 154.99200 1.000 107.82000 ? 415 ASN A ND2   1 
ATOM   765   N N     . GLU A 1 171 ? 106.32900 144.94700 157.05700 1.000 121.17000 ? 416 GLU A N     1 
ATOM   766   C CA    . GLU A 1 171 ? 106.94100 143.98400 157.95700 1.000 121.17000 ? 416 GLU A CA    1 
ATOM   767   C C     . GLU A 1 171 ? 105.88000 143.12600 158.62600 1.000 121.17000 ? 416 GLU A C     1 
ATOM   768   O O     . GLU A 1 171 ? 105.91800 141.89300 158.54200 1.000 121.17000 ? 416 GLU A O     1 
ATOM   769   C CB    . GLU A 1 171 ? 107.79500 144.71200 158.98700 1.000 121.17000 ? 416 GLU A CB    1 
ATOM   770   C CG    . GLU A 1 171 ? 109.00400 145.38200 158.37400 1.000 121.17000 ? 416 GLU A CG    1 
ATOM   771   C CD    . GLU A 1 171 ? 109.84600 146.09900 159.39600 1.000 121.17000 ? 416 GLU A CD    1 
ATOM   772   O OE1   . GLU A 1 171 ? 109.41700 146.18400 160.56400 1.000 121.17000 ? 416 GLU A OE1   1 
ATOM   773   O OE2   . GLU A 1 171 ? 110.94000 146.57400 159.02900 1.000 121.17000 ? 416 GLU A OE2   1 
ATOM   774   N N     . ASP A 1 172 ? 104.91600 143.76000 159.28100 1.000 125.50000 ? 417 ASP A N     1 
ATOM   775   C CA    . ASP A 1 172 ? 103.78800 143.04800 159.87100 1.000 125.50000 ? 417 ASP A CA    1 
ATOM   776   C C     . ASP A 1 172 ? 102.80700 142.73200 158.75700 1.000 125.50000 ? 417 ASP A C     1 
ATOM   777   O O     . ASP A 1 172 ? 101.90000 143.50800 158.45800 1.000 125.50000 ? 417 ASP A O     1 
ATOM   778   C CB    . ASP A 1 172 ? 103.13700 143.88100 160.95900 1.000 125.50000 ? 417 ASP A CB    1 
ATOM   779   C CG    . ASP A 1 172 ? 104.00300 144.01400 162.17900 1.000 125.50000 ? 417 ASP A CG    1 
ATOM   780   O OD1   . ASP A 1 172 ? 104.76800 143.07100 162.46900 1.000 125.50000 ? 417 ASP A OD1   1 
ATOM   781   O OD2   . ASP A 1 172 ? 103.92000 145.06400 162.84700 1.000 125.50000 ? 417 ASP A OD2   1 
ATOM   782   N N     . ARG A 1 173 ? 102.99700 141.57800 158.12800 1.000 112.02000 ? 418 ARG A N     1 
ATOM   783   C CA    . ARG A 1 173 ? 102.12400 141.18500 157.03600 1.000 112.02000 ? 418 ARG A CA    1 
ATOM   784   C C     . ARG A 1 173 ? 100.77200 140.74000 157.57100 1.000 112.02000 ? 418 ARG A C     1 
ATOM   785   O O     . ARG A 1 173 ? 100.67000 140.16200 158.65500 1.000 112.02000 ? 418 ARG A O     1 
ATOM   786   C CB    . ARG A 1 173 ? 102.76800 140.07700 156.20900 1.000 112.02000 ? 418 ARG A CB    1 
ATOM   787   C CG    . ARG A 1 173 ? 103.12800 138.82000 156.96100 1.000 112.02000 ? 418 ARG A CG    1 
ATOM   788   C CD    . ARG A 1 173 ? 103.64900 137.79200 155.98900 1.000 112.02000 ? 418 ARG A CD    1 
ATOM   789   N NE    . ARG A 1 173 ? 102.58100 137.35500 155.09800 1.000 112.02000 ? 418 ARG A NE    1 
ATOM   790   C CZ    . ARG A 1 173 ? 102.77300 136.70600 153.95900 1.000 112.02000 ? 418 ARG A CZ    1 
ATOM   791   N NH1   . ARG A 1 173 ? 104.00100 136.42000 153.56100 1.000 112.02000 ? 418 ARG A NH1   1 
ATOM   792   N NH2   . ARG A 1 173 ? 101.73800 136.34700 153.21500 1.000 112.02000 ? 418 ARG A NH2   1 
ATOM   793   N N     . GLN A 1 174 ? 99.72800  141.03100 156.81200 1.000 107.44000 ? 419 GLN A N     1 
ATOM   794   C CA    . GLN A 1 174 ? 98.36500  140.79700 157.25700 1.000 107.44000 ? 419 GLN A CA    1 
ATOM   795   C C     . GLN A 1 174 ? 97.79100  139.58700 156.53500 1.000 107.44000 ? 419 GLN A C     1 
ATOM   796   O O     . GLN A 1 174 ? 97.68800  139.58100 155.30500 1.000 107.44000 ? 419 GLN A O     1 
ATOM   797   C CB    . GLN A 1 174 ? 97.50400  142.03400 157.02400 1.000 107.44000 ? 419 GLN A CB    1 
ATOM   798   C CG    . GLN A 1 174 ? 96.07900  141.88500 157.49900 1.000 107.44000 ? 419 GLN A CG    1 
ATOM   799   C CD    . GLN A 1 174 ? 95.30900  143.17400 157.38700 1.000 107.44000 ? 419 GLN A CD    1 
ATOM   800   O OE1   . GLN A 1 174 ? 95.85900  144.20300 157.00300 1.000 107.44000 ? 419 GLN A OE1   1 
ATOM   801   N NE2   . GLN A 1 174 ? 94.02000  143.12300 157.69400 1.000 107.44000 ? 419 GLN A NE2   1 
ATOM   802   N N     . MET A 1 175 ? 97.43200  138.56800 157.30800 1.000 112.10000 ? 420 MET A N     1 
ATOM   803   C CA    . MET A 1 175 ? 96.79800  137.37800 156.76500 1.000 112.10000 ? 420 MET A CA    1 
ATOM   804   C C     . MET A 1 175 ? 95.41100  137.70700 156.23200 1.000 112.10000 ? 420 MET A C     1 
ATOM   805   O O     . MET A 1 175 ? 94.63800  138.42400 156.87300 1.000 112.10000 ? 420 MET A O     1 
ATOM   806   C CB    . MET A 1 175 ? 96.70400  136.30700 157.84600 1.000 112.10000 ? 420 MET A CB    1 
ATOM   807   C CG    . MET A 1 175 ? 96.11000  135.00000 157.38700 1.000 112.10000 ? 420 MET A CG    1 
ATOM   808   S SD    . MET A 1 175 ? 96.01900  133.82900 158.74200 1.000 112.10000 ? 420 MET A SD    1 
ATOM   809   C CE    . MET A 1 175 ? 97.74800  133.41100 158.92400 1.000 112.10000 ? 420 MET A CE    1 
ATOM   810   N N     . VAL A 1 176 ? 95.09700  137.18300 155.05200 1.000 102.02000 ? 421 VAL A N     1 
ATOM   811   C CA    . VAL A 1 176 ? 93.82800  137.44500 154.38700 1.000 102.02000 ? 421 VAL A CA    1 
ATOM   812   C C     . VAL A 1 176 ? 92.93000  136.23300 154.56800 1.000 102.02000 ? 421 VAL A C     1 
ATOM   813   O O     . VAL A 1 176 ? 93.20200  135.16000 154.02200 1.000 102.02000 ? 421 VAL A O     1 
ATOM   814   C CB    . VAL A 1 176 ? 94.02800  137.76400 152.90600 1.000 102.02000 ? 421 VAL A CB    1 
ATOM   815   C CG1   . VAL A 1 176 ? 92.69200  137.90000 152.23300 1.000 102.02000 ? 421 VAL A CG1   1 
ATOM   816   C CG2   . VAL A 1 176 ? 94.81300  139.04000 152.76700 1.000 102.02000 ? 421 VAL A CG2   1 
ATOM   817   N N     . ARG A 1 177 ? 91.85200  136.40800 155.32700 1.000 116.19000 ? 422 ARG A N     1 
ATOM   818   C CA    . ARG A 1 177 ? 90.90800  135.32900 155.55600 1.000 116.19000 ? 422 ARG A CA    1 
ATOM   819   C C     . ARG A 1 177 ? 90.09100  135.06500 154.29800 1.000 116.19000 ? 422 ARG A C     1 
ATOM   820   O O     . ARG A 1 177 ? 89.90800  135.93300 153.44500 1.000 116.19000 ? 422 ARG A O     1 
ATOM   821   C CB    . ARG A 1 177 ? 89.97400  135.66500 156.71700 1.000 116.19000 ? 422 ARG A CB    1 
ATOM   822   C CG    . ARG A 1 177 ? 90.67400  135.89200 158.04500 1.000 116.19000 ? 422 ARG A CG    1 
ATOM   823   C CD    . ARG A 1 177 ? 91.25100  134.60900 158.59900 1.000 116.19000 ? 422 ARG A CD    1 
ATOM   824   N NE    . ARG A 1 177 ? 91.87400  134.81800 159.90100 1.000 116.19000 ? 422 ARG A NE    1 
ATOM   825   C CZ    . ARG A 1 177 ? 92.52100  133.87500 160.57800 1.000 116.19000 ? 422 ARG A CZ    1 
ATOM   826   N NH1   . ARG A 1 177 ? 92.62900  132.65300 160.07800 1.000 116.19000 ? 422 ARG A NH1   1 
ATOM   827   N NH2   . ARG A 1 177 ? 93.05900  134.15200 161.75700 1.000 116.19000 ? 422 ARG A NH2   1 
ATOM   828   N N     . PHE A 1 178 ? 89.59200  133.84100 154.19400 1.000 109.30000 ? 423 PHE A N     1 
ATOM   829   C CA    . PHE A 1 178 ? 88.94000  133.42500 152.96400 1.000 109.30000 ? 423 PHE A CA    1 
ATOM   830   C C     . PHE A 1 178 ? 87.52700  133.97200 152.85000 1.000 109.30000 ? 423 PHE A C     1 
ATOM   831   O O     . PHE A 1 178 ? 87.04200  134.21400 151.73600 1.000 109.30000 ? 423 PHE A O     1 
ATOM   832   C CB    . PHE A 1 178 ? 88.94500  131.90500 152.88400 1.000 109.30000 ? 423 PHE A CB    1 
ATOM   833   C CG    . PHE A 1 178 ? 88.28100  131.36800 151.67200 1.000 109.30000 ? 423 PHE A CG    1 
ATOM   834   C CD1   . PHE A 1 178 ? 88.85300  131.53200 150.43200 1.000 109.30000 ? 423 PHE A CD1   1 
ATOM   835   C CD2   . PHE A 1 178 ? 87.09200  130.67800 151.77400 1.000 109.30000 ? 423 PHE A CD2   1 
ATOM   836   C CE1   . PHE A 1 178 ? 88.24300  131.03100 149.31300 1.000 109.30000 ? 423 PHE A CE1   1 
ATOM   837   C CE2   . PHE A 1 178 ? 86.47900  130.16900 150.66200 1.000 109.30000 ? 423 PHE A CE2   1 
ATOM   838   C CZ    . PHE A 1 178 ? 87.04800  130.35000 149.42900 1.000 109.30000 ? 423 PHE A CZ    1 
ATOM   839   N N     . SER A 1 179 ? 86.85700  134.19600 153.97900 1.000 111.61000 ? 424 SER A N     1 
ATOM   840   C CA    . SER A 1 179 ? 85.53900  134.81200 153.92700 1.000 111.61000 ? 424 SER A CA    1 
ATOM   841   C C     . SER A 1 179 ? 85.61200  136.26100 153.47700 1.000 111.61000 ? 424 SER A C     1 
ATOM   842   O O     . SER A 1 179 ? 84.62000  136.78700 152.96500 1.000 111.61000 ? 424 SER A O     1 
ATOM   843   C CB    . SER A 1 179 ? 84.85700  134.71100 155.28400 1.000 111.61000 ? 424 SER A CB    1 
ATOM   844   O OG    . SER A 1 179 ? 85.56400  135.45500 156.25600 1.000 111.61000 ? 424 SER A OG    1 
ATOM   845   N N     . GLU A 1 180 ? 86.77000  136.90500 153.64500 1.000 114.73000 ? 425 GLU A N     1 
ATOM   846   C CA    . GLU A 1 180 ? 87.00500  138.19400 153.01100 1.000 114.73000 ? 425 GLU A CA    1 
ATOM   847   C C     . GLU A 1 180 ? 87.03700  138.06900 151.50000 1.000 114.73000 ? 425 GLU A C     1 
ATOM   848   O O     . GLU A 1 180 ? 86.66700  139.01300 150.79600 1.000 114.73000 ? 425 GLU A O     1 
ATOM   849   C CB    . GLU A 1 180 ? 88.31600  138.79600 153.50300 1.000 114.73000 ? 425 GLU A CB    1 
ATOM   850   C CG    . GLU A 1 180 ? 88.28400  139.24100 154.94100 1.000 114.73000 ? 425 GLU A CG    1 
ATOM   851   C CD    . GLU A 1 180 ? 89.62900  139.72400 155.42800 1.000 114.73000 ? 425 GLU A CD    1 
ATOM   852   O OE1   . GLU A 1 180 ? 90.62400  139.52600 154.70400 1.000 114.73000 ? 425 GLU A OE1   1 
ATOM   853   O OE2   . GLU A 1 180 ? 89.69100  140.31000 156.52800 1.000 114.73000 ? 425 GLU A OE2   1 
ATOM   854   N N     . VAL A 1 181 ? 87.48300  136.92500 150.98400 1.000 109.18000 ? 426 VAL A N     1 
ATOM   855   C CA    . VAL A 1 181 ? 87.47700  136.74000 149.54100 1.000 109.18000 ? 426 VAL A CA    1 
ATOM   856   C C     . VAL A 1 181 ? 86.06500  136.47000 149.06400 1.000 109.18000 ? 426 VAL A C     1 
ATOM   857   O O     . VAL A 1 181 ? 85.65800  136.92100 147.98900 1.000 109.18000 ? 426 VAL A O     1 
ATOM   858   C CB    . VAL A 1 181 ? 88.42700  135.60300 149.14200 1.000 109.18000 ? 426 VAL A CB    1 
ATOM   859   C CG1   . VAL A 1 181 ? 88.62600  135.58300 147.64500 1.000 109.18000 ? 426 VAL A CG1   1 
ATOM   860   C CG2   . VAL A 1 181 ? 89.72100  135.72400 149.89200 1.000 109.18000 ? 426 VAL A CG2   1 
ATOM   861   N N     . LEU A 1 182 ? 85.28400  135.75600 149.86600 1.000 110.27000 ? 427 LEU A N     1 
ATOM   862   C CA    . LEU A 1 182 ? 83.90400  135.51600 149.47500 1.000 110.27000 ? 427 LEU A CA    1 
ATOM   863   C C     . LEU A 1 182 ? 82.99400  136.70000 149.73800 1.000 110.27000 ? 427 LEU A C     1 
ATOM   864   O O     . LEU A 1 182 ? 81.83900  136.67900 149.30800 1.000 110.27000 ? 427 LEU A O     1 
ATOM   865   C CB    . LEU A 1 182 ? 83.34400  134.31000 150.20400 1.000 110.27000 ? 427 LEU A CB    1 
ATOM   866   C CG    . LEU A 1 182 ? 84.06600  133.01600 149.88100 1.000 110.27000 ? 427 LEU A CG    1 
ATOM   867   C CD1   . LEU A 1 182 ? 83.40800  131.93800 150.67400 1.000 110.27000 ? 427 LEU A CD1   1 
ATOM   868   C CD2   . LEU A 1 182 ? 84.02400  132.71500 148.40400 1.000 110.27000 ? 427 LEU A CD2   1 
ATOM   869   N N     . SER A 1 183 ? 83.47800  137.73200 150.41200 1.000 114.53000 ? 428 SER A N     1 
ATOM   870   C CA    . SER A 1 183 ? 82.63000  138.85200 150.78000 1.000 114.53000 ? 428 SER A CA    1 
ATOM   871   C C     . SER A 1 183 ? 82.34200  139.80000 149.62600 1.000 114.53000 ? 428 SER A C     1 
ATOM   872   O O     . SER A 1 183 ? 81.63700  140.79100 149.83300 1.000 114.53000 ? 428 SER A O     1 
ATOM   873   C CB    . SER A 1 183 ? 83.27100  139.62700 151.92900 1.000 114.53000 ? 428 SER A CB    1 
ATOM   874   O OG    . SER A 1 183 ? 84.50000  140.19600 151.52200 1.000 114.53000 ? 428 SER A OG    1 
ATOM   875   N N     . SER A 1 184 ? 82.84900  139.53800 148.43900 1.000 118.33000 ? 429 SER A N     1 
ATOM   876   C CA    . SER A 1 184 ? 82.61500  140.48500 147.36800 1.000 118.33000 ? 429 SER A CA    1 
ATOM   877   C C     . SER A 1 184 ? 81.25500  140.23800 146.72500 1.000 118.33000 ? 429 SER A C     1 
ATOM   878   O O     . SER A 1 184 ? 80.72400  139.12700 146.78500 1.000 118.33000 ? 429 SER A O     1 
ATOM   879   C CB    . SER A 1 184 ? 83.69500  140.36800 146.30100 1.000 118.33000 ? 429 SER A CB    1 
ATOM   880   O OG    . SER A 1 184 ? 83.52400  139.18500 145.54400 1.000 118.33000 ? 429 SER A OG    1 
ATOM   881   N N     . PRO A 1 185 ? 80.67100  141.26100 146.09400 1.000 128.12000 ? 430 PRO A N     1 
ATOM   882   C CA    . PRO A 1 185 ? 79.57500  141.00600 145.15200 1.000 128.12000 ? 430 PRO A CA    1 
ATOM   883   C C     . PRO A 1 185 ? 80.04700  140.39500 143.85000 1.000 128.12000 ? 430 PRO A C     1 
ATOM   884   O O     . PRO A 1 185 ? 79.21000  139.95800 143.05000 1.000 128.12000 ? 430 PRO A O     1 
ATOM   885   C CB    . PRO A 1 185 ? 78.98000  142.39600 144.92100 1.000 128.12000 ? 430 PRO A CB    1 
ATOM   886   C CG    . PRO A 1 185 ? 80.10700  143.32100 145.17200 1.000 128.12000 ? 430 PRO A CG    1 
ATOM   887   C CD    . PRO A 1 185 ? 80.90400  142.70300 146.28000 1.000 128.12000 ? 430 PRO A CD    1 
ATOM   888   N N     . GLU A 1 186 ? 81.35700  140.35800 143.61200 1.000 125.04000 ? 431 GLU A N     1 
ATOM   889   C CA    . GLU A 1 186 ? 81.89400  139.75000 142.40600 1.000 125.04000 ? 431 GLU A CA    1 
ATOM   890   C C     . GLU A 1 186 ? 81.81700  138.23200 142.45300 1.000 125.04000 ? 431 GLU A C     1 
ATOM   891   O O     . GLU A 1 186 ? 81.59000  137.60000 141.41900 1.000 125.04000 ? 431 GLU A O     1 
ATOM   892   C CB    . GLU A 1 186 ? 83.33600  140.20500 142.21000 1.000 125.04000 ? 431 GLU A CB    1 
ATOM   893   C CG    . GLU A 1 186 ? 83.95400  139.78400 140.90700 1.000 125.04000 ? 431 GLU A CG    1 
ATOM   894   C CD    . GLU A 1 186 ? 85.33200  140.36400 140.73000 1.000 125.04000 ? 431 GLU A CD    1 
ATOM   895   O OE1   . GLU A 1 186 ? 85.79800  141.06200 141.65200 1.000 125.04000 ? 431 GLU A OE1   1 
ATOM   896   O OE2   . GLU A 1 186 ? 85.94900  140.13400 139.67000 1.000 125.04000 ? 431 GLU A OE2   1 
ATOM   897   N N     . TYR A 1 187 ? 81.98700  137.63600 143.63500 1.000 116.75000 ? 432 TYR A N     1 
ATOM   898   C CA    . TYR A 1 187 ? 81.91800  136.18400 143.75600 1.000 116.75000 ? 432 TYR A CA    1 
ATOM   899   C C     . TYR A 1 187 ? 80.50200  135.67000 143.55300 1.000 116.75000 ? 432 TYR A C     1 
ATOM   900   O O     . TYR A 1 187 ? 80.23600  134.90400 142.62200 1.000 116.75000 ? 432 TYR A O     1 
ATOM   901   C CB    . TYR A 1 187 ? 82.42300  135.74100 145.12700 1.000 116.75000 ? 432 TYR A CB    1 
ATOM   902   C CG    . TYR A 1 187 ? 82.28900  134.25500 145.33700 1.000 116.75000 ? 432 TYR A CG    1 
ATOM   903   C CD1   . TYR A 1 187 ? 83.16500  133.37700 144.73000 1.000 116.75000 ? 432 TYR A CD1   1 
ATOM   904   C CD2   . TYR A 1 187 ? 81.27700  133.72800 146.13300 1.000 116.75000 ? 432 TYR A CD2   1 
ATOM   905   C CE1   . TYR A 1 187 ? 83.04600  132.01700 144.91000 1.000 116.75000 ? 432 TYR A CE1   1 
ATOM   906   C CE2   . TYR A 1 187 ? 81.14200  132.37000 146.30700 1.000 116.75000 ? 432 TYR A CE2   1 
ATOM   907   C CZ    . TYR A 1 187 ? 82.03300  131.52000 145.69700 1.000 116.75000 ? 432 TYR A CZ    1 
ATOM   908   O OH    . TYR A 1 187 ? 81.91100  130.16300 145.87500 1.000 116.75000 ? 432 TYR A OH    1 
ATOM   909   N N     . ASP A 1 188 ? 79.58700  136.06000 144.44600 1.000 119.01000 ? 433 ASP A N     1 
ATOM   910   C CA    . ASP A 1 188 ? 78.27100  135.43200 144.49900 1.000 119.01000 ? 433 ASP A CA    1 
ATOM   911   C C     . ASP A 1 188 ? 77.42600  135.78000 143.28500 1.000 119.01000 ? 433 ASP A C     1 
ATOM   912   O O     . ASP A 1 188 ? 76.57900  134.98400 142.86800 1.000 119.01000 ? 433 ASP A O     1 
ATOM   913   C CB    . ASP A 1 188 ? 77.55400  135.82300 145.79400 1.000 119.01000 ? 433 ASP A CB    1 
ATOM   914   C CG    . ASP A 1 188 ? 77.42300  137.33100 145.97600 1.000 119.01000 ? 433 ASP A CG    1 
ATOM   915   O OD1   . ASP A 1 188 ? 77.96800  138.10600 145.16500 1.000 119.01000 ? 433 ASP A OD1   1 
ATOM   916   O OD2   . ASP A 1 188 ? 76.76200  137.74600 146.94900 1.000 119.01000 ? 433 ASP A OD2   1 
ATOM   917   N N     . GLU A 1 189 ? 77.65700  136.94800 142.69700 1.000 120.63000 ? 434 GLU A N     1 
ATOM   918   C CA    . GLU A 1 189 ? 77.03500  137.31400 141.43400 1.000 120.63000 ? 434 GLU A CA    1 
ATOM   919   C C     . GLU A 1 189 ? 78.00700  137.16800 140.28100 1.000 120.63000 ? 434 GLU A C     1 
ATOM   920   O O     . GLU A 1 189 ? 78.07700  138.02300 139.39500 1.000 120.63000 ? 434 GLU A O     1 
ATOM   921   C CB    . GLU A 1 189 ? 76.46200  138.72200 141.49900 1.000 120.63000 ? 434 GLU A CB    1 
ATOM   922   C CG    . GLU A 1 189 ? 75.24700  138.80100 142.40300 1.000 120.63000 ? 434 GLU A CG    1 
ATOM   923   C CD    . GLU A 1 189 ? 74.56700  140.14900 142.35900 1.000 120.63000 ? 434 GLU A CD    1 
ATOM   924   O OE1   . GLU A 1 189 ? 75.11800  141.07100 141.72600 1.000 120.63000 ? 434 GLU A OE1   1 
ATOM   925   O OE2   . GLU A 1 189 ? 73.47200  140.28300 142.94500 1.000 120.63000 ? 434 GLU A OE2   1 
ATOM   926   N N     . HIS A 1 190 ? 78.79900  136.10100 140.30200 1.000 121.37000 ? 435 HIS A N     1 
ATOM   927   C CA    . HIS A 1 190 ? 79.50100  135.65100 139.11200 1.000 121.37000 ? 435 HIS A CA    1 
ATOM   928   C C     . HIS A 1 190 ? 78.67300  134.56000 138.45100 1.000 121.37000 ? 435 HIS A C     1 
ATOM   929   O O     . HIS A 1 190 ? 78.28200  133.59200 139.10800 1.000 121.37000 ? 435 HIS A O     1 
ATOM   930   C CB    . HIS A 1 190 ? 80.88800  135.11900 139.44400 1.000 121.37000 ? 435 HIS A CB    1 
ATOM   931   C CG    . HIS A 1 190 ? 81.76500  134.97700 138.24800 1.000 121.37000 ? 435 HIS A CG    1 
ATOM   932   N ND1   . HIS A 1 190 ? 81.73900  133.86700 137.43600 1.000 121.37000 ? 435 HIS A ND1   1 
ATOM   933   C CD2   . HIS A 1 190 ? 82.68000  135.81700 137.71400 1.000 121.37000 ? 435 HIS A CD2   1 
ATOM   934   C CE1   . HIS A 1 190 ? 82.61100  134.02500 136.45600 1.000 121.37000 ? 435 HIS A CE1   1 
ATOM   935   N NE2   . HIS A 1 190 ? 83.19500  135.20100 136.60200 1.000 121.37000 ? 435 HIS A NE2   1 
ATOM   936   N N     . LYS A 1 191 ? 78.42000  134.71700 137.15100 1.000 123.56000 ? 436 LYS A N     1 
ATOM   937   C CA    . LYS A 1 191 ? 77.42300  133.90200 136.46900 1.000 123.56000 ? 436 LYS A CA    1 
ATOM   938   C C     . LYS A 1 191 ? 77.86600  132.45400 136.29600 1.000 123.56000 ? 436 LYS A C     1 
ATOM   939   O O     . LYS A 1 191 ? 77.01500  131.56700 136.18100 1.000 123.56000 ? 436 LYS A O     1 
ATOM   940   C CB    . LYS A 1 191 ? 77.10300  134.53200 135.11100 1.000 123.56000 ? 436 LYS A CB    1 
ATOM   941   C CG    . LYS A 1 191 ? 75.89100  133.95500 134.39000 1.000 123.56000 ? 436 LYS A CG    1 
ATOM   942   C CD    . LYS A 1 191 ? 75.64800  134.65300 133.06600 1.000 123.56000 ? 436 LYS A CD    1 
ATOM   943   C CE    . LYS A 1 191 ? 74.45300  134.06100 132.34300 1.000 123.56000 ? 436 LYS A CE    1 
ATOM   944   N NZ    . LYS A 1 191 ? 74.22400  134.73500 131.03800 1.000 123.56000 ? 436 LYS A NZ    1 
ATOM   945   N N     . SER A 1 192 ? 79.16600  132.18600 136.33200 1.000 114.84000 ? 437 SER A N     1 
ATOM   946   C CA    . SER A 1 192 ? 79.67200  130.85600 136.03100 1.000 114.84000 ? 437 SER A CA    1 
ATOM   947   C C     . SER A 1 192 ? 79.37400  129.87700 137.16400 1.000 114.84000 ? 437 SER A C     1 
ATOM   948   O O     . SER A 1 192 ? 78.79500  130.22000 138.19700 1.000 114.84000 ? 437 SER A O     1 
ATOM   949   C CB    . SER A 1 192 ? 81.16900  130.91000 135.77000 1.000 114.84000 ? 437 SER A CB    1 
ATOM   950   O OG    . SER A 1 192 ? 81.69700  129.60900 135.56800 1.000 114.84000 ? 437 SER A OG    1 
ATOM   951   N N     . THR A 1 193 ? 79.77900  128.63000 136.95100 1.000 107.47000 ? 438 THR A N     1 
ATOM   952   C CA    . THR A 1 193 ? 79.59600  127.57600 137.93200 1.000 107.47000 ? 438 THR A CA    1 
ATOM   953   C C     . THR A 1 193 ? 80.90900  127.07500 138.49800 1.000 107.47000 ? 438 THR A C     1 
ATOM   954   O O     . THR A 1 193 ? 80.89600  126.22800 139.39100 1.000 107.47000 ? 438 THR A O     1 
ATOM   955   C CB    . THR A 1 193 ? 78.83900  126.40300 137.31700 1.000 107.47000 ? 438 THR A CB    1 
ATOM   956   O OG1   . THR A 1 193 ? 79.63200  125.82600 136.27700 1.000 107.47000 ? 438 THR A OG1   1 
ATOM   957   C CG2   . THR A 1 193 ? 77.52900  126.87700 136.73300 1.000 107.47000 ? 438 THR A CG2   1 
ATOM   958   N N     . VAL A 1 194 ? 82.03800  127.55300 137.99300 1.000 102.23000 ? 439 VAL A N     1 
ATOM   959   C CA    . VAL A 1 194 ? 83.32900  127.17000 138.55300 1.000 102.23000 ? 439 VAL A CA    1 
ATOM   960   C C     . VAL A 1 194 ? 84.18000  128.39400 138.87300 1.000 102.23000 ? 439 VAL A C     1 
ATOM   961   O O     . VAL A 1 194 ? 85.17800  128.65600 138.19000 1.000 102.23000 ? 439 VAL A O     1 
ATOM   962   C CB    . VAL A 1 194 ? 84.06400  126.19800 137.61900 1.000 102.23000 ? 439 VAL A CB    1 
ATOM   963   C CG1   . VAL A 1 194 ? 83.52300  124.81000 137.80400 1.000 102.23000 ? 439 VAL A CG1   1 
ATOM   964   C CG2   . VAL A 1 194 ? 83.85300  126.59200 136.15500 1.000 102.23000 ? 439 VAL A CG2   1 
ATOM   965   N N     . PRO A 1 195 ? 83.85700  129.15300 139.91200 1.000 100.94000 ? 440 PRO A N     1 
ATOM   966   C CA    . PRO A 1 195 ? 84.72300  130.26500 140.29200 1.000 100.94000 ? 440 PRO A CA    1 
ATOM   967   C C     . PRO A 1 195 ? 85.96600  129.75600 140.99500 1.000 100.94000 ? 440 PRO A C     1 
ATOM   968   O O     . PRO A 1 195 ? 85.98000  128.67900 141.59200 1.000 100.94000 ? 440 PRO A O     1 
ATOM   969   C CB    . PRO A 1 195 ? 83.84800  131.07200 141.25100 1.000 100.94000 ? 440 PRO A CB    1 
ATOM   970   C CG    . PRO A 1 195 ? 83.01500  130.03700 141.88600 1.000 100.94000 ? 440 PRO A CG    1 
ATOM   971   C CD    . PRO A 1 195 ? 82.72800  129.01000 140.84300 1.000 100.94000 ? 440 PRO A CD    1 
ATOM   972   N N     . LEU A 1 196 ? 87.03200  130.54000 140.89800 1.000 105.79000 ? 441 LEU A N     1 
ATOM   973   C CA    . LEU A 1 196 ? 88.29300  130.22800 141.56400 1.000 105.79000 ? 441 LEU A CA    1 
ATOM   974   C C     . LEU A 1 196 ? 88.68300  131.43000 142.40700 1.000 105.79000 ? 441 LEU A C     1 
ATOM   975   O O     . LEU A 1 196 ? 89.42500  132.30600 141.95600 1.000 105.79000 ? 441 LEU A O     1 
ATOM   976   C CB    . LEU A 1 196 ? 89.36500  129.87900 140.56600 1.000 105.79000 ? 441 LEU A CB    1 
ATOM   977   C CG    . LEU A 1 196 ? 89.08000  128.54900 139.89300 1.000 105.79000 ? 441 LEU A CG    1 
ATOM   978   C CD1   . LEU A 1 196 ? 90.11000  128.27900 138.82900 1.000 105.79000 ? 441 LEU A CD1   1 
ATOM   979   C CD2   . LEU A 1 196 ? 89.06700  127.45700 140.94100 1.000 105.79000 ? 441 LEU A CD2   1 
ATOM   980   N N     . ALA A 1 197 ? 88.17900  131.46700 143.63100 1.000 104.47000 ? 442 ALA A N     1 
ATOM   981   C CA    . ALA A 1 197 ? 88.51500  132.55300 144.53200 1.000 104.47000 ? 442 ALA A CA    1 
ATOM   982   C C     . ALA A 1 197 ? 89.92800  132.35900 145.05100 1.000 104.47000 ? 442 ALA A C     1 
ATOM   983   O O     . ALA A 1 197 ? 90.22300  131.36300 145.71700 1.000 104.47000 ? 442 ALA A O     1 
ATOM   984   C CB    . ALA A 1 197 ? 87.51300  132.61800 145.67500 1.000 104.47000 ? 442 ALA A CB    1 
ATOM   985   N N     . LEU A 1 198 ? 90.80300  133.30200 144.72900 1.000 94.78000  ? 443 LEU A N     1 
ATOM   986   C CA    . LEU A 1 198 ? 92.20500  133.22800 145.10400 1.000 94.78000  ? 443 LEU A CA    1 
ATOM   987   C C     . LEU A 1 198 ? 92.57500  134.16600 146.23400 1.000 94.78000  ? 443 LEU A C     1 
ATOM   988   O O     . LEU A 1 198 ? 93.34800  133.78500 147.11300 1.000 94.78000  ? 443 LEU A O     1 
ATOM   989   C CB    . LEU A 1 198 ? 93.07600  133.52600 143.89000 1.000 94.78000  ? 443 LEU A CB    1 
ATOM   990   C CG    . LEU A 1 198 ? 92.83600  132.46400 142.83100 1.000 94.78000  ? 443 LEU A CG    1 
ATOM   991   C CD1   . LEU A 1 198 ? 93.56700  132.80900 141.56600 1.000 94.78000  ? 443 LEU A CD1   1 
ATOM   992   C CD2   . LEU A 1 198 ? 93.28100  131.12500 143.35000 1.000 94.78000  ? 443 LEU A CD2   1 
ATOM   993   N N     . GLY A 1 199 ? 92.04600  135.37400 146.24600 1.000 93.71000  ? 444 GLY A N     1 
ATOM   994   C CA    . GLY A 1 199 ? 92.29800  136.28900 147.33400 1.000 93.71000  ? 444 GLY A CA    1 
ATOM   995   C C     . GLY A 1 199 ? 92.41500  137.70900 146.82900 1.000 93.71000  ? 444 GLY A C     1 
ATOM   996   O O     . GLY A 1 199 ? 92.22200  137.99200 145.65100 1.000 93.71000  ? 444 GLY A O     1 
ATOM   997   N N     . HIS A 1 200 ? 92.73600  138.59800 147.75700 1.000 97.66000  ? 445 HIS A N     1 
ATOM   998   C CA    . HIS A 1 200 ? 92.89000  139.99500 147.41100 1.000 97.66000  ? 445 HIS A CA    1 
ATOM   999   C C     . HIS A 1 200 ? 94.22400  140.23000 146.72700 1.000 97.66000  ? 445 HIS A C     1 
ATOM   1000  O O     . HIS A 1 200 ? 95.20700  139.52700 146.97000 1.000 97.66000  ? 445 HIS A O     1 
ATOM   1001  C CB    . HIS A 1 200 ? 92.76500  140.86900 148.65100 1.000 97.66000  ? 445 HIS A CB    1 
ATOM   1002  C CG    . HIS A 1 200 ? 91.38700  140.88300 149.22400 1.000 97.66000  ? 445 HIS A CG    1 
ATOM   1003  N ND1   . HIS A 1 200 ? 90.34100  141.53900 148.61300 1.000 97.66000  ? 445 HIS A ND1   1 
ATOM   1004  C CD2   . HIS A 1 200 ? 90.87800  140.32400 150.34500 1.000 97.66000  ? 445 HIS A CD2   1 
ATOM   1005  C CE1   . HIS A 1 200 ? 89.24600  141.38100 149.33300 1.000 97.66000  ? 445 HIS A CE1   1 
ATOM   1006  N NE2   . HIS A 1 200 ? 89.54400  140.64700 150.39000 1.000 97.66000  ? 445 HIS A NE2   1 
ATOM   1007  N N     . ASP A 1 201 ? 94.24600  141.23300 145.86300 1.000 102.22000 ? 446 ASP A N     1 
ATOM   1008  C CA    . ASP A 1 201 ? 95.40800  141.52600 145.04200 1.000 102.22000 ? 446 ASP A CA    1 
ATOM   1009  C C     . ASP A 1 201 ? 96.36200  142.45200 145.79600 1.000 102.22000 ? 446 ASP A C     1 
ATOM   1010  O O     . ASP A 1 201 ? 96.31800  142.55300 147.02500 1.000 102.22000 ? 446 ASP A O     1 
ATOM   1011  C CB    . ASP A 1 201 ? 94.97500  142.10500 143.69100 1.000 102.22000 ? 446 ASP A CB    1 
ATOM   1012  C CG    . ASP A 1 201 ? 94.18700  143.40400 143.81300 1.000 102.22000 ? 446 ASP A CG    1 
ATOM   1013  O OD1   . ASP A 1 201 ? 93.84600  143.83700 144.93200 1.000 102.22000 ? 446 ASP A OD1   1 
ATOM   1014  O OD2   . ASP A 1 201 ? 93.90500  144.00700 142.75700 1.000 102.22000 ? 446 ASP A OD2   1 
ATOM   1015  N N     . ILE A 1 202 ? 97.27000  143.07600 145.04400 1.000 94.53000  ? 447 ILE A N     1 
ATOM   1016  C CA    . ILE A 1 202 ? 98.16000  144.11200 145.56000 1.000 94.53000  ? 447 ILE A CA    1 
ATOM   1017  C C     . ILE A 1 202 ? 97.37000  145.23600 146.21400 1.000 94.53000  ? 447 ILE A C     1 
ATOM   1018  O O     . ILE A 1 202 ? 97.60100  145.59200 147.37300 1.000 94.53000  ? 447 ILE A O     1 
ATOM   1019  C CB    . ILE A 1 202 ? 99.03100  144.64700 144.41500 1.000 94.53000  ? 447 ILE A CB    1 
ATOM   1020  C CG1   . ILE A 1 202 ? 99.96800  143.55500 143.91300 1.000 94.53000  ? 447 ILE A CG1   1 
ATOM   1021  C CG2   . ILE A 1 202 ? 99.76200  145.86900 144.84400 1.000 94.53000  ? 447 ILE A CG2   1 
ATOM   1022  C CD1   . ILE A 1 202 ? 100.65700 143.91000 142.62600 1.000 94.53000  ? 447 ILE A CD1   1 
ATOM   1023  N N     . GLY A 1 203 ? 96.42200  145.81100 145.47600 1.000 100.04000 ? 448 GLY A N     1 
ATOM   1024  C CA    . GLY A 1 203 ? 95.62700  146.89400 146.02000 1.000 100.04000 ? 448 GLY A CA    1 
ATOM   1025  C C     . GLY A 1 203 ? 94.60600  146.45800 147.04700 1.000 100.04000 ? 448 GLY A C     1 
ATOM   1026  O O     . GLY A 1 203 ? 94.10900  147.29700 147.80300 1.000 100.04000 ? 448 GLY A O     1 
ATOM   1027  N N     . GLY A 1 204 ? 94.28200  145.17000 147.09700 1.000 95.29000  ? 449 GLY A N     1 
ATOM   1028  C CA    . GLY A 1 204 ? 93.30400  144.66900 148.03900 1.000 95.29000  ? 449 GLY A CA    1 
ATOM   1029  C C     . GLY A 1 204 ? 91.98000  144.28600 147.42700 1.000 95.29000  ? 449 GLY A C     1 
ATOM   1030  O O     . GLY A 1 204 ? 91.10800  143.79200 148.14800 1.000 95.29000  ? 449 GLY A O     1 
ATOM   1031  N N     . ARG A 1 205 ? 91.79300  144.49900 146.14000 1.000 97.23000  ? 450 ARG A N     1 
ATOM   1032  C CA    . ARG A 1 205 ? 90.55400  144.05700 145.52400 1.000 97.23000  ? 450 ARG A CA    1 
ATOM   1033  C C     . ARG A 1 205 ? 90.59200  142.54700 145.31300 1.000 97.23000  ? 450 ARG A C     1 
ATOM   1034  O O     . ARG A 1 205 ? 91.65400  141.98800 145.03900 1.000 97.23000  ? 450 ARG A O     1 
ATOM   1035  C CB    . ARG A 1 205 ? 90.33300  144.75800 144.18900 1.000 97.23000  ? 450 ARG A CB    1 
ATOM   1036  C CG    . ARG A 1 205 ? 90.14300  146.26600 144.26900 1.000 97.23000  ? 450 ARG A CG    1 
ATOM   1037  C CD    . ARG A 1 205 ? 88.85500  146.65300 144.97500 1.000 97.23000  ? 450 ARG A CD    1 
ATOM   1038  N NE    . ARG A 1 205 ? 89.04800  146.90000 146.40100 1.000 97.23000  ? 450 ARG A NE    1 
ATOM   1039  C CZ    . ARG A 1 205 ? 88.06100  146.94800 147.28800 1.000 97.23000  ? 450 ARG A CZ    1 
ATOM   1040  N NH1   . ARG A 1 205 ? 86.80800  146.75500 146.90000 1.000 97.23000  ? 450 ARG A NH1   1 
ATOM   1041  N NH2   . ARG A 1 205 ? 88.32500  147.18100 148.56800 1.000 97.23000  ? 450 ARG A NH2   1 
ATOM   1042  N N     . PRO A 1 206 ? 89.46500  141.86200 145.45300 1.000 93.89000  ? 451 PRO A N     1 
ATOM   1043  C CA    . PRO A 1 206 ? 89.45100  140.43000 145.16500 1.000 93.89000  ? 451 PRO A CA    1 
ATOM   1044  C C     . PRO A 1 206 ? 89.54100  140.18100 143.67100 1.000 93.89000  ? 451 PRO A C     1 
ATOM   1045  O O     . PRO A 1 206 ? 88.93700  140.89200 142.86700 1.000 93.89000  ? 451 PRO A O     1 
ATOM   1046  C CB    . PRO A 1 206 ? 88.10800  139.96800 145.73300 1.000 93.89000  ? 451 PRO A CB    1 
ATOM   1047  C CG    . PRO A 1 206 ? 87.26500  141.16600 145.70200 1.000 93.89000  ? 451 PRO A CG    1 
ATOM   1048  C CD    . PRO A 1 206 ? 88.17000  142.32600 145.96900 1.000 93.89000  ? 451 PRO A CD    1 
ATOM   1049  N N     . ILE A 1 207 ? 90.33200  139.18100 143.30300 1.000 91.64000  ? 452 ILE A N     1 
ATOM   1050  C CA    . ILE A 1 207 ? 90.41700  138.71500 141.92700 1.000 91.64000  ? 452 ILE A CA    1 
ATOM   1051  C C     . ILE A 1 207 ? 89.97700  137.26400 141.90900 1.000 91.64000  ? 452 ILE A C     1 
ATOM   1052  O O     . ILE A 1 207 ? 90.64500  136.39400 142.48000 1.000 91.64000  ? 452 ILE A O     1 
ATOM   1053  C CB    . ILE A 1 207 ? 91.81900  138.88000 141.33500 1.000 91.64000  ? 452 ILE A CB    1 
ATOM   1054  C CG1   . ILE A 1 207 ? 92.11600  140.35900 141.13700 1.000 91.64000  ? 452 ILE A CG1   1 
ATOM   1055  C CG2   . ILE A 1 207 ? 91.92200  138.17500 140.00700 1.000 91.64000  ? 452 ILE A CG2   1 
ATOM   1056  C CD1   . ILE A 1 207 ? 93.50400  140.63500 140.62900 1.000 91.64000  ? 452 ILE A CD1   1 
ATOM   1057  N N     . ILE A 1 208 ? 88.83900  137.00900 141.27700 1.000 94.59000  ? 453 ILE A N     1 
ATOM   1058  C CA    . ILE A 1 208 ? 88.27600  135.67700 141.15200 1.000 94.59000  ? 453 ILE A CA    1 
ATOM   1059  C C     . ILE A 1 208 ? 88.02400  135.44000 139.67900 1.000 94.59000  ? 453 ILE A C     1 
ATOM   1060  O O     . ILE A 1 208 ? 87.31700  136.22100 139.03400 1.000 94.59000  ? 453 ILE A O     1 
ATOM   1061  C CB    . ILE A 1 208 ? 86.97700  135.52900 141.94900 1.000 94.59000  ? 453 ILE A CB    1 
ATOM   1062  C CG1   . ILE A 1 208 ? 87.22900  135.80000 143.42300 1.000 94.59000  ? 453 ILE A CG1   1 
ATOM   1063  C CG2   . ILE A 1 208 ? 86.41500  134.14600 141.77300 1.000 94.59000  ? 453 ILE A CG2   1 
ATOM   1064  C CD1   . ILE A 1 208 ? 85.98600  135.88400 144.22900 1.000 94.59000  ? 453 ILE A CD1   1 
ATOM   1065  N N     . THR A 1 209 ? 88.59200  134.37400 139.14800 1.000 100.94000 ? 454 THR A N     1 
ATOM   1066  C CA    . THR A 1 209 ? 88.54100  134.09600 137.72500 1.000 100.94000 ? 454 THR A CA    1 
ATOM   1067  C C     . THR A 1 209 ? 87.83800  132.77500 137.45800 1.000 100.94000 ? 454 THR A C     1 
ATOM   1068  O O     . THR A 1 209 ? 87.75000  131.89800 138.31700 1.000 100.94000 ? 454 THR A O     1 
ATOM   1069  C CB    . THR A 1 209 ? 89.94700  134.09300 137.14500 1.000 100.94000 ? 454 THR A CB    1 
ATOM   1070  O OG1   . THR A 1 209 ? 90.77200  133.22800 137.93100 1.000 100.94000 ? 454 THR A OG1   1 
ATOM   1071  C CG2   . THR A 1 209 ? 90.52400  135.49400 137.14300 1.000 100.94000 ? 454 THR A CG2   1 
ATOM   1072  N N     . ASP A 1 210 ? 87.35600  132.63400 136.23100 1.000 105.33000 ? 455 ASP A N     1 
ATOM   1073  C CA    . ASP A 1 210 ? 86.49300  131.53200 135.84200 1.000 105.33000 ? 455 ASP A CA    1 
ATOM   1074  C C     . ASP A 1 210 ? 87.34500  130.38100 135.34700 1.000 105.33000 ? 455 ASP A C     1 
ATOM   1075  O O     . ASP A 1 210 ? 88.17100  130.55200 134.44600 1.000 105.33000 ? 455 ASP A O     1 
ATOM   1076  C CB    . ASP A 1 210 ? 85.51200  131.96100 134.75600 1.000 105.33000 ? 455 ASP A CB    1 
ATOM   1077  C CG    . ASP A 1 210 ? 84.41600  130.93600 134.51100 1.000 105.33000 ? 455 ASP A CG    1 
ATOM   1078  O OD1   . ASP A 1 210 ? 84.36400  129.89500 135.20300 1.000 105.33000 ? 455 ASP A OD1   1 
ATOM   1079  O OD2   . ASP A 1 210 ? 83.58900  131.17700 133.60900 1.000 105.33000 ? 455 ASP A OD2   1 
ATOM   1080  N N     . LEU A 1 211 ? 87.10900  129.20500 135.91600 1.000 100.15000 ? 456 LEU A N     1 
ATOM   1081  C CA    . LEU A 1 211 ? 87.79700  128.00600 135.47100 1.000 100.15000 ? 456 LEU A CA    1 
ATOM   1082  C C     . LEU A 1 211 ? 87.31400  127.56600 134.10100 1.000 100.15000 ? 456 LEU A C     1 
ATOM   1083  O O     . LEU A 1 211 ? 88.08600  126.98600 133.32900 1.000 100.15000 ? 456 LEU A O     1 
ATOM   1084  C CB    . LEU A 1 211 ? 87.59300  126.90300 136.50200 1.000 100.15000 ? 456 LEU A CB    1 
ATOM   1085  C CG    . LEU A 1 211 ? 88.24900  125.55900 136.26500 1.000 100.15000 ? 456 LEU A CG    1 
ATOM   1086  C CD1   . LEU A 1 211 ? 89.71200  125.75100 136.08500 1.000 100.15000 ? 456 LEU A CD1   1 
ATOM   1087  C CD2   . LEU A 1 211 ? 87.99700  124.70200 137.46400 1.000 100.15000 ? 456 LEU A CD2   1 
ATOM   1088  N N     . ALA A 1 212 ? 86.05300  127.84500 133.77700 1.000 97.14000  ? 457 ALA A N     1 
ATOM   1089  C CA    . ALA A 1 212 ? 85.52400  127.44300 132.48200 1.000 97.14000  ? 457 ALA A CA    1 
ATOM   1090  C C     . ALA A 1 212 ? 86.15600  128.23600 131.35100 1.000 97.14000  ? 457 ALA A C     1 
ATOM   1091  O O     . ALA A 1 212 ? 86.34500  127.70400 130.25300 1.000 97.14000  ? 457 ALA A O     1 
ATOM   1092  C CB    . ALA A 1 212 ? 84.00600  127.60100 132.46200 1.000 97.14000  ? 457 ALA A CB    1 
ATOM   1093  N N     . LYS A 1 213 ? 86.50600  129.49300 131.59800 1.000 99.48000  ? 458 LYS A N     1 
ATOM   1094  C CA    . LYS A 1 213 ? 87.23300  130.28600 130.62300 1.000 99.48000  ? 458 LYS A CA    1 
ATOM   1095  C C     . LYS A 1 213 ? 88.72300  130.30900 130.90600 1.000 99.48000  ? 458 LYS A C     1 
ATOM   1096  O O     . LYS A 1 213 ? 89.43000  131.18100 130.39100 1.000 99.48000  ? 458 LYS A O     1 
ATOM   1097  C CB    . LYS A 1 213 ? 86.69500  131.71400 130.58200 1.000 99.48000  ? 458 LYS A CB    1 
ATOM   1098  C CG    . LYS A 1 213 ? 85.26200  131.83000 130.12600 1.000 99.48000  ? 458 LYS A CG    1 
ATOM   1099  C CD    . LYS A 1 213 ? 84.86000  133.28600 129.99600 1.000 99.48000  ? 458 LYS A CD    1 
ATOM   1100  C CE    . LYS A 1 213 ? 84.77600  133.96800 131.34800 1.000 99.48000  ? 458 LYS A CE    1 
ATOM   1101  N NZ    . LYS A 1 213 ? 83.66400  133.42800 132.16500 1.000 99.48000  ? 458 LYS A NZ    1 
ATOM   1102  N N     . MET A 1 214 ? 89.21500  129.39000 131.72500 1.000 105.08000 ? 459 MET A N     1 
ATOM   1103  C CA    . MET A 1 214 ? 90.60900  129.52000 132.11900 1.000 105.08000 ? 459 MET A CA    1 
ATOM   1104  C C     . MET A 1 214 ? 91.57100  129.00200 131.05100 1.000 105.08000 ? 459 MET A C     1 
ATOM   1105  O O     . MET A 1 214 ? 92.46800  129.75500 130.65600 1.000 105.08000 ? 459 MET A O     1 
ATOM   1106  C CB    . MET A 1 214 ? 90.87200  128.83800 133.45700 1.000 105.08000 ? 459 MET A CB    1 
ATOM   1107  C CG    . MET A 1 214 ? 92.21100  129.17800 133.96600 1.000 105.08000 ? 459 MET A CG    1 
ATOM   1108  S SD    . MET A 1 214 ? 92.14900  130.87200 134.51300 1.000 105.08000 ? 459 MET A SD    1 
ATOM   1109  C CE    . MET A 1 214 ? 91.16300  130.62900 135.98300 1.000 105.08000 ? 459 MET A CE    1 
ATOM   1110  N N     . PRO A 1 215 ? 91.45500  127.75100 130.55000 1.000 100.55000 ? 460 PRO A N     1 
ATOM   1111  C CA    . PRO A 1 215 ? 90.66700  126.53600 130.79600 1.000 100.55000 ? 460 PRO A CA    1 
ATOM   1112  C C     . PRO A 1 215 ? 91.35900  125.53900 131.71400 1.000 100.55000 ? 460 PRO A C     1 
ATOM   1113  O O     . PRO A 1 215 ? 90.73400  124.54800 132.06800 1.000 100.55000 ? 460 PRO A O     1 
ATOM   1114  C CB    . PRO A 1 215 ? 90.51400  125.94200 129.40900 1.000 100.55000 ? 460 PRO A CB    1 
ATOM   1115  C CG    . PRO A 1 215 ? 91.75100  126.30900 128.74800 1.000 100.55000 ? 460 PRO A CG    1 
ATOM   1116  C CD    . PRO A 1 215 ? 92.12800  127.66400 129.24600 1.000 100.55000 ? 460 PRO A CD    1 
ATOM   1117  N N     . HIS A 1 216 ? 92.62900  125.74900 132.06400 1.000 104.03000 ? 461 HIS A N     1 
ATOM   1118  C CA    . HIS A 1 216 ? 93.36100  124.78400 132.88100 1.000 104.03000 ? 461 HIS A CA    1 
ATOM   1119  C C     . HIS A 1 216 ? 94.32800  125.51100 133.80400 1.000 104.03000 ? 461 HIS A C     1 
ATOM   1120  O O     . HIS A 1 216 ? 94.69700  126.66000 133.55700 1.000 104.03000 ? 461 HIS A O     1 
ATOM   1121  C CB    . HIS A 1 216 ? 94.13300  123.78800 132.01600 1.000 104.03000 ? 461 HIS A CB    1 
ATOM   1122  C CG    . HIS A 1 216 ? 93.27200  123.03700 131.05700 1.000 104.03000 ? 461 HIS A CG    1 
ATOM   1123  N ND1   . HIS A 1 216 ? 92.35800  122.09300 131.46500 1.000 104.03000 ? 461 HIS A ND1   1 
ATOM   1124  C CD2   . HIS A 1 216 ? 93.15700  123.11700 129.71200 1.000 104.03000 ? 461 HIS A CD2   1 
ATOM   1125  C CE1   . HIS A 1 216 ? 91.73100  121.60700 130.41000 1.000 104.03000 ? 461 HIS A CE1   1 
ATOM   1126  N NE2   . HIS A 1 216 ? 92.19800  122.21100 129.33300 1.000 104.03000 ? 461 HIS A NE2   1 
ATOM   1127  N N     . LEU A 1 217 ? 94.74800  124.83300 134.87700 1.000 93.28000  ? 462 LEU A N     1 
ATOM   1128  C CA    . LEU A 1 217 ? 95.69100  125.41400 135.82600 1.000 93.28000  ? 462 LEU A CA    1 
ATOM   1129  C C     . LEU A 1 217 ? 96.84700  124.48600 136.12600 1.000 93.28000  ? 462 LEU A C     1 
ATOM   1130  O O     . LEU A 1 217 ? 96.68200  123.26800 136.21100 1.000 93.28000  ? 462 LEU A O     1 
ATOM   1131  C CB    . LEU A 1 217 ? 95.06800  125.75800 137.16800 1.000 93.28000  ? 462 LEU A CB    1 
ATOM   1132  C CG    . LEU A 1 217 ? 94.40200  127.10800 137.36300 1.000 93.28000  ? 462 LEU A CG    1 
ATOM   1133  C CD1   . LEU A 1 217 ? 93.05100  127.08900 136.77200 1.000 93.28000  ? 462 LEU A CD1   1 
ATOM   1134  C CD2   . LEU A 1 217 ? 94.31400  127.41300 138.82200 1.000 93.28000  ? 462 LEU A CD2   1 
ATOM   1135  N N     . LEU A 1 218 ? 98.00900  125.08500 136.32600 1.000 97.55000  ? 463 LEU A N     1 
ATOM   1136  C CA    . LEU A 1 218 ? 99.12900  124.44300 136.98200 1.000 97.55000  ? 463 LEU A CA    1 
ATOM   1137  C C     . LEU A 1 218 ? 99.37200  125.11200 138.32500 1.000 97.55000  ? 463 LEU A C     1 
ATOM   1138  O O     . LEU A 1 218 ? 99.14300  126.31300 138.49200 1.000 97.55000  ? 463 LEU A O     1 
ATOM   1139  C CB    . LEU A 1 218 ? 100.39600 124.53400 136.14400 1.000 97.55000  ? 463 LEU A CB    1 
ATOM   1140  C CG    . LEU A 1 218 ? 100.35800 123.75700 134.84900 1.000 97.55000  ? 463 LEU A CG    1 
ATOM   1141  C CD1   . LEU A 1 218 ? 101.63300 123.99800 134.10300 1.000 97.55000  ? 463 LEU A CD1   1 
ATOM   1142  C CD2   . LEU A 1 218 ? 100.21000 122.31400 135.16700 1.000 97.55000  ? 463 LEU A CD2   1 
ATOM   1143  N N     . VAL A 1 219 ? 99.82300  124.32100 139.29100 1.000 99.85000  ? 464 VAL A N     1 
ATOM   1144  C CA    . VAL A 1 219 ? 100.28200 124.83400 140.57100 1.000 99.85000  ? 464 VAL A CA    1 
ATOM   1145  C C     . VAL A 1 219 ? 101.68000 124.28000 140.80200 1.000 99.85000  ? 464 VAL A C     1 
ATOM   1146  O O     . VAL A 1 219 ? 101.92400 123.09500 140.56500 1.000 99.85000  ? 464 VAL A O     1 
ATOM   1147  C CB    . VAL A 1 219 ? 99.32900  124.45200 141.72000 1.000 99.85000  ? 464 VAL A CB    1 
ATOM   1148  C CG1   . VAL A 1 219 ? 99.83300  124.97300 143.03400 1.000 99.85000  ? 464 VAL A CG1   1 
ATOM   1149  C CG2   . VAL A 1 219 ? 97.94900  124.99900 141.47500 1.000 99.85000  ? 464 VAL A CG2   1 
ATOM   1150  N N     . ALA A 1 220 ? 102.60800 125.13600 141.21500 1.000 103.00000 ? 465 ALA A N     1 
ATOM   1151  C CA    . ALA A 1 220 ? 103.92800 124.65400 141.58700 1.000 103.00000 ? 465 ALA A CA    1 
ATOM   1152  C C     . ALA A 1 220 ? 104.46400 125.48600 142.73700 1.000 103.00000 ? 465 ALA A C     1 
ATOM   1153  O O     . ALA A 1 220 ? 104.09500 126.65000 142.90500 1.000 103.00000 ? 465 ALA A O     1 
ATOM   1154  C CB    . ALA A 1 220 ? 104.90700 124.70000 140.41800 1.000 103.00000 ? 465 ALA A CB    1 
ATOM   1155  N N     . GLY A 1 221 ? 105.34200 124.87800 143.51900 1.000 103.54000 ? 466 GLY A N     1 
ATOM   1156  C CA    . GLY A 1 221 ? 105.95300 125.55700 144.64200 1.000 103.54000 ? 466 GLY A CA    1 
ATOM   1157  C C     . GLY A 1 221 ? 106.77100 124.57000 145.42900 1.000 103.54000 ? 466 GLY A C     1 
ATOM   1158  O O     . GLY A 1 221 ? 106.75500 123.36700 145.16700 1.000 103.54000 ? 466 GLY A O     1 
ATOM   1159  N N     . THR A 1 222 ? 107.50200 125.09400 146.40300 1.000 105.78000 ? 467 THR A N     1 
ATOM   1160  C CA    . THR A 1 222 ? 108.29000 124.18800 147.21500 1.000 105.78000 ? 467 THR A CA    1 
ATOM   1161  C C     . THR A 1 222 ? 107.41800 123.52800 148.26500 1.000 105.78000 ? 467 THR A C     1 
ATOM   1162  O O     . THR A 1 222 ? 106.23200 123.82700 148.41200 1.000 105.78000 ? 467 THR A O     1 
ATOM   1163  C CB    . THR A 1 222 ? 109.43000 124.90600 147.91800 1.000 105.78000 ? 467 THR A CB    1 
ATOM   1164  O OG1   . THR A 1 222 ? 108.88200 125.85900 148.83300 1.000 105.78000 ? 467 THR A OG1   1 
ATOM   1165  C CG2   . THR A 1 222 ? 110.31600 125.60200 146.91600 1.000 105.78000 ? 467 THR A CG2   1 
ATOM   1166  N N     . THR A 1 223 ? 108.03200 122.60800 148.99800 1.000 101.57000 ? 468 THR A N     1 
ATOM   1167  C CA    . THR A 1 223 ? 107.38100 122.01500 150.14900 1.000 101.57000 ? 468 THR A CA    1 
ATOM   1168  C C     . THR A 1 223 ? 107.15000 123.08200 151.20600 1.000 101.57000 ? 468 THR A C     1 
ATOM   1169  O O     . THR A 1 223 ? 107.98600 123.96200 151.42000 1.000 101.57000 ? 468 THR A O     1 
ATOM   1170  C CB    . THR A 1 223 ? 108.23000 120.88000 150.70600 1.000 101.57000 ? 468 THR A CB    1 
ATOM   1171  O OG1   . THR A 1 223 ? 109.52100 121.38600 151.05800 1.000 101.57000 ? 468 THR A OG1   1 
ATOM   1172  C CG2   . THR A 1 223 ? 108.39300 119.80100 149.66500 1.000 101.57000 ? 468 THR A CG2   1 
ATOM   1173  N N     . GLY A 1 224 ? 105.97400 123.04000 151.82300 1.000 101.97000 ? 469 GLY A N     1 
ATOM   1174  C CA    . GLY A 1 224 ? 105.59800 124.04200 152.78800 1.000 101.97000 ? 469 GLY A CA    1 
ATOM   1175  C C     . GLY A 1 224 ? 105.08600 125.33600 152.20500 1.000 101.97000 ? 469 GLY A C     1 
ATOM   1176  O O     . GLY A 1 224 ? 104.46100 126.11600 152.93200 1.000 101.97000 ? 469 GLY A O     1 
ATOM   1177  N N     . SER A 1 225 ? 105.29000 125.58100 150.91400 1.000 95.95000  ? 470 SER A N     1 
ATOM   1178  C CA    . SER A 1 225 ? 104.94300 126.86200 150.32200 1.000 95.95000  ? 470 SER A CA    1 
ATOM   1179  C C     . SER A 1 225 ? 103.44900 127.05700 150.11900 1.000 95.95000  ? 470 SER A C     1 
ATOM   1180  O O     . SER A 1 225 ? 103.05400 128.13200 149.66400 1.000 95.95000  ? 470 SER A O     1 
ATOM   1181  C CB    . SER A 1 225 ? 105.69200 127.02500 149.00400 1.000 95.95000  ? 470 SER A CB    1 
ATOM   1182  O OG    . SER A 1 225 ? 105.38000 125.97300 148.11300 1.000 95.95000  ? 470 SER A OG    1 
ATOM   1183  N N     . GLY A 1 226 ? 102.61500 126.07800 150.43300 1.000 93.50000  ? 471 GLY A N     1 
ATOM   1184  C CA    . GLY A 1 226 ? 101.20100 126.30500 150.61000 1.000 93.50000  ? 471 GLY A CA    1 
ATOM   1185  C C     . GLY A 1 226 ? 100.26300 125.73800 149.56900 1.000 93.50000  ? 471 GLY A C     1 
ATOM   1186  O O     . GLY A 1 226 ? 99.11300  126.19200 149.49600 1.000 93.50000  ? 471 GLY A O     1 
ATOM   1187  N N     . LYS A 1 227 ? 100.70000 124.75300 148.78400 1.000 95.93000  ? 472 LYS A N     1 
ATOM   1188  C CA    . LYS A 1 227 ? 99.89800  124.27300 147.66500 1.000 95.93000  ? 472 LYS A CA    1 
ATOM   1189  C C     . LYS A 1 227 ? 98.66100  123.52700 148.12500 1.000 95.93000  ? 472 LYS A C     1 
ATOM   1190  O O     . LYS A 1 227 ? 97.63300  123.56300 147.43800 1.000 95.93000  ? 472 LYS A O     1 
ATOM   1191  C CB    . LYS A 1 227 ? 100.76200 123.40500 146.77000 1.000 95.93000  ? 472 LYS A CB    1 
ATOM   1192  C CG    . LYS A 1 227 ? 101.78800 124.23700 146.08100 1.000 95.93000  ? 472 LYS A CG    1 
ATOM   1193  C CD    . LYS A 1 227 ? 102.69600 123.42400 145.22900 1.000 95.93000  ? 472 LYS A CD    1 
ATOM   1194  C CE    . LYS A 1 227 ? 103.67200 122.70500 146.10800 1.000 95.93000  ? 472 LYS A CE    1 
ATOM   1195  N NZ    . LYS A 1 227 ? 104.71300 122.07700 145.28300 1.000 95.93000  ? 472 LYS A NZ    1 
ATOM   1196  N N     . SER A 1 228 ? 98.73900  122.86500 149.28000 1.000 93.71000  ? 473 SER A N     1 
ATOM   1197  C CA    . SER A 1 228 ? 97.55500  122.26700 149.87800 1.000 93.71000  ? 473 SER A CA    1 
ATOM   1198  C C     . SER A 1 228 ? 96.51700  123.32800 150.18600 1.000 93.71000  ? 473 SER A C     1 
ATOM   1199  O O     . SER A 1 228 ? 95.32200  123.13500 149.93600 1.000 93.71000  ? 473 SER A O     1 
ATOM   1200  C CB    . SER A 1 228 ? 97.94000  121.53100 151.15300 1.000 93.71000  ? 473 SER A CB    1 
ATOM   1201  O OG    . SER A 1 228 ? 98.85800  120.49100 150.87600 1.000 93.71000  ? 473 SER A OG    1 
ATOM   1202  N N     . VAL A 1 229 ? 96.97300  124.47800 150.67600 1.000 92.80000  ? 474 VAL A N     1 
ATOM   1203  C CA    . VAL A 1 229 ? 96.06500  125.55100 151.03600 1.000 92.80000  ? 474 VAL A CA    1 
ATOM   1204  C C     . VAL A 1 229 ? 95.45400  126.16500 149.78900 1.000 92.80000  ? 474 VAL A C     1 
ATOM   1205  O O     . VAL A 1 229 ? 94.25900  126.47900 149.75800 1.000 92.80000  ? 474 VAL A O     1 
ATOM   1206  C CB    . VAL A 1 229 ? 96.81200  126.58300 151.89400 1.000 92.80000  ? 474 VAL A CB    1 
ATOM   1207  C CG1   . VAL A 1 229 ? 95.90800  127.73600 152.27200 1.000 92.80000  ? 474 VAL A CG1   1 
ATOM   1208  C CG2   . VAL A 1 229 ? 97.35700  125.90300 153.13400 1.000 92.80000  ? 474 VAL A CG2   1 
ATOM   1209  N N     . GLY A 1 230 ? 96.24100  126.28100 148.72200 1.000 91.77000  ? 475 GLY A N     1 
ATOM   1210  C CA    . GLY A 1 230 ? 95.70400  126.81400 147.48300 1.000 91.77000  ? 475 GLY A CA    1 
ATOM   1211  C C     . GLY A 1 230 ? 94.69100  125.89000 146.83700 1.000 91.77000  ? 475 GLY A C     1 
ATOM   1212  O O     . GLY A 1 230 ? 93.66100  126.34300 146.32800 1.000 91.77000  ? 475 GLY A O     1 
ATOM   1213  N N     . VAL A 1 231 ? 94.95000  124.58400 146.87700 1.000 94.46000  ? 476 VAL A N     1 
ATOM   1214  C CA    . VAL A 1 231 ? 94.01500  123.63500 146.28600 1.000 94.46000  ? 476 VAL A CA    1 
ATOM   1215  C C     . VAL A 1 231 ? 92.74100  123.55700 147.11500 1.000 94.46000  ? 476 VAL A C     1 
ATOM   1216  O O     . VAL A 1 231 ? 91.63400  123.48600 146.56600 1.000 94.46000  ? 476 VAL A O     1 
ATOM   1217  C CB    . VAL A 1 231 ? 94.69700  122.26800 146.11300 1.000 94.46000  ? 476 VAL A CB    1 
ATOM   1218  C CG1   . VAL A 1 231 ? 93.71100  121.20500 145.70600 1.000 94.46000  ? 476 VAL A CG1   1 
ATOM   1219  C CG2   . VAL A 1 231 ? 95.74300  122.37700 145.04200 1.000 94.46000  ? 476 VAL A CG2   1 
ATOM   1220  N N     . ASN A 1 232 ? 92.86900  123.64000 148.44100 1.000 99.30000  ? 477 ASN A N     1 
ATOM   1221  C CA    . ASN A 1 232 ? 91.68500  123.70600 149.28900 1.000 99.30000  ? 477 ASN A CA    1 
ATOM   1222  C C     . ASN A 1 232 ? 90.89700  124.98200 149.03900 1.000 99.30000  ? 477 ASN A C     1 
ATOM   1223  O O     . ASN A 1 232 ? 89.66200  124.96700 149.06200 1.000 99.30000  ? 477 ASN A O     1 
ATOM   1224  C CB    . ASN A 1 232 ? 92.08300  123.60400 150.75700 1.000 99.30000  ? 477 ASN A CB    1 
ATOM   1225  C CG    . ASN A 1 232 ? 92.49300  122.21000 151.14400 1.000 99.30000  ? 477 ASN A CG    1 
ATOM   1226  O OD1   . ASN A 1 232 ? 91.86500  121.23700 150.73800 1.000 99.30000  ? 477 ASN A OD1   1 
ATOM   1227  N ND2   . ASN A 1 232 ? 93.54900  122.09900 151.93700 1.000 99.30000  ? 477 ASN A ND2   1 
ATOM   1228  N N     . ALA A 1 233 ? 91.59500  126.08200 148.75000 1.000 98.11000  ? 478 ALA A N     1 
ATOM   1229  C CA    . ALA A 1 233 ? 90.91500  127.33100 148.43900 1.000 98.11000  ? 478 ALA A CA    1 
ATOM   1230  C C     . ALA A 1 233 ? 90.13700  127.22700 147.13900 1.000 98.11000  ? 478 ALA A C     1 
ATOM   1231  O O     . ALA A 1 233 ? 88.98300  127.66000 147.06600 1.000 98.11000  ? 478 ALA A O     1 
ATOM   1232  C CB    . ALA A 1 233 ? 91.92500  128.46800 148.36000 1.000 98.11000  ? 478 ALA A CB    1 
ATOM   1233  N N     . MET A 1 234 ? 90.73600  126.61500 146.12200 1.000 96.88000  ? 479 MET A N     1 
ATOM   1234  C CA    . MET A 1 234 ? 90.04600  126.47200 144.84600 1.000 96.88000  ? 479 MET A CA    1 
ATOM   1235  C C     . MET A 1 234 ? 88.87700  125.51200 144.96000 1.000 96.88000  ? 479 MET A C     1 
ATOM   1236  O O     . MET A 1 234 ? 87.81700  125.73800 144.36800 1.000 96.88000  ? 479 MET A O     1 
ATOM   1237  C CB    . MET A 1 234 ? 91.01700  125.99200 143.77900 1.000 96.88000  ? 479 MET A CB    1 
ATOM   1238  C CG    . MET A 1 234 ? 92.10600  126.97900 143.50600 1.000 96.88000  ? 479 MET A CG    1 
ATOM   1239  S SD    . MET A 1 234 ? 93.31800  126.37000 142.34700 1.000 96.88000  ? 479 MET A SD    1 
ATOM   1240  C CE    . MET A 1 234 ? 94.52600  127.66900 142.52000 1.000 96.88000  ? 479 MET A CE    1 
ATOM   1241  N N     . LEU A 1 235 ? 89.03100  124.46100 145.75400 1.000 100.87000 ? 480 LEU A N     1 
ATOM   1242  C CA    . LEU A 1 235 ? 87.94900  123.49800 145.85600 1.000 100.87000 ? 480 LEU A CA    1 
ATOM   1243  C C     . LEU A 1 235 ? 86.78600  124.04600 146.67000 1.000 100.87000 ? 480 LEU A C     1 
ATOM   1244  O O     . LEU A 1 235 ? 85.62800  123.87800 146.28000 1.000 100.87000 ? 480 LEU A O     1 
ATOM   1245  C CB    . LEU A 1 235 ? 88.47800  122.18500 146.41400 1.000 100.87000 ? 480 LEU A CB    1 
ATOM   1246  C CG    . LEU A 1 235 ? 89.31000  121.55300 145.30000 1.000 100.87000 ? 480 LEU A CG    1 
ATOM   1247  C CD1   . LEU A 1 235 ? 90.02900  120.32600 145.76000 1.000 100.87000 ? 480 LEU A CD1   1 
ATOM   1248  C CD2   . LEU A 1 235 ? 88.43100  121.21600 144.11200 1.000 100.87000 ? 480 LEU A CD2   1 
ATOM   1249  N N     . LEU A 1 236 ? 87.06300  124.76600 147.75700 1.000 103.31000 ? 481 LEU A N     1 
ATOM   1250  C CA    . LEU A 1 236 ? 85.96700  125.41600 148.46000 1.000 103.31000 ? 481 LEU A CA    1 
ATOM   1251  C C     . LEU A 1 236 ? 85.40700  126.59000 147.68200 1.000 103.31000 ? 481 LEU A C     1 
ATOM   1252  O O     . LEU A 1 236 ? 84.28100  127.01000 147.95400 1.000 103.31000 ? 481 LEU A O     1 
ATOM   1253  C CB    . LEU A 1 236 ? 86.39900  125.87800 149.84200 1.000 103.31000 ? 481 LEU A CB    1 
ATOM   1254  C CG    . LEU A 1 236 ? 86.20600  124.86500 150.96600 1.000 103.31000 ? 481 LEU A CG    1 
ATOM   1255  C CD1   . LEU A 1 236 ? 87.20200  123.73100 150.91400 1.000 103.31000 ? 481 LEU A CD1   1 
ATOM   1256  C CD2   . LEU A 1 236 ? 86.28100  125.56900 152.30000 1.000 103.31000 ? 481 LEU A CD2   1 
ATOM   1257  N N     . SER A 1 237 ? 86.15800  127.12500 146.72400 1.000 107.87000 ? 482 SER A N     1 
ATOM   1258  C CA    . SER A 1 237 ? 85.56400  128.06000 145.78400 1.000 107.87000 ? 482 SER A CA    1 
ATOM   1259  C C     . SER A 1 237 ? 84.56800  127.35000 144.88500 1.000 107.87000 ? 482 SER A C     1 
ATOM   1260  O O     . SER A 1 237 ? 83.53100  127.91800 144.52900 1.000 107.87000 ? 482 SER A O     1 
ATOM   1261  C CB    . SER A 1 237 ? 86.65500  128.72100 144.94800 1.000 107.87000 ? 482 SER A CB    1 
ATOM   1262  O OG    . SER A 1 237 ? 87.61300  129.35700 145.77300 1.000 107.87000 ? 482 SER A OG    1 
ATOM   1263  N N     . ILE A 1 238 ? 84.87800  126.11300 144.49700 1.000 106.19000 ? 483 ILE A N     1 
ATOM   1264  C CA    . ILE A 1 238 ? 83.95100  125.34000 143.67600 1.000 106.19000 ? 483 ILE A CA    1 
ATOM   1265  C C     . ILE A 1 238 ? 82.69900  124.98500 144.46500 1.000 106.19000 ? 483 ILE A C     1 
ATOM   1266  O O     . ILE A 1 238 ? 81.57900  125.07300 143.94800 1.000 106.19000 ? 483 ILE A O     1 
ATOM   1267  C CB    . ILE A 1 238 ? 84.64300  124.08000 143.12600 1.000 106.19000 ? 483 ILE A CB    1 
ATOM   1268  C CG1   . ILE A 1 238 ? 85.79500  124.46100 142.21300 1.000 106.19000 ? 483 ILE A CG1   1 
ATOM   1269  C CG2   . ILE A 1 238 ? 83.67800  123.21700 142.34700 1.000 106.19000 ? 483 ILE A CG2   1 
ATOM   1270  C CD1   . ILE A 1 238 ? 85.36400  125.27200 141.03200 1.000 106.19000 ? 483 ILE A CD1   1 
ATOM   1271  N N     . LEU A 1 239 ? 82.86500  124.62700 145.73800 1.000 107.49000 ? 484 LEU A N     1 
ATOM   1272  C CA    . LEU A 1 239 ? 81.79600  123.95300 146.46700 1.000 107.49000 ? 484 LEU A CA    1 
ATOM   1273  C C     . LEU A 1 239 ? 80.62800  124.87900 146.77800 1.000 107.49000 ? 484 LEU A C     1 
ATOM   1274  O O     . LEU A 1 239 ? 79.47300  124.49700 146.57800 1.000 107.49000 ? 484 LEU A O     1 
ATOM   1275  C CB    . LEU A 1 239 ? 82.34600  123.33800 147.74800 1.000 107.49000 ? 484 LEU A CB    1 
ATOM   1276  C CG    . LEU A 1 239 ? 83.22700  122.12200 147.49000 1.000 107.49000 ? 484 LEU A CG    1 
ATOM   1277  C CD1   . LEU A 1 239 ? 83.91600  121.68000 148.75600 1.000 107.49000 ? 484 LEU A CD1   1 
ATOM   1278  C CD2   . LEU A 1 239 ? 82.41600  120.99500 146.88700 1.000 107.49000 ? 484 LEU A CD2   1 
ATOM   1279  N N     . PHE A 1 240 ? 80.89900  126.11100 147.20500 1.000 109.75000 ? 485 PHE A N     1 
ATOM   1280  C CA    . PHE A 1 240 ? 79.82400  126.96700 147.69400 1.000 109.75000 ? 485 PHE A CA    1 
ATOM   1281  C C     . PHE A 1 240 ? 78.86900  127.45600 146.62100 1.000 109.75000 ? 485 PHE A C     1 
ATOM   1282  O O     . PHE A 1 240 ? 77.85100  128.05800 146.96800 1.000 109.75000 ? 485 PHE A O     1 
ATOM   1283  C CB    . PHE A 1 240 ? 80.37500  128.19500 148.39900 1.000 109.75000 ? 485 PHE A CB    1 
ATOM   1284  C CG    . PHE A 1 240 ? 80.86900  127.93400 149.77100 1.000 109.75000 ? 485 PHE A CG    1 
ATOM   1285  C CD1   . PHE A 1 240 ? 80.62300  126.73400 150.40300 1.000 109.75000 ? 485 PHE A CD1   1 
ATOM   1286  C CD2   . PHE A 1 240 ? 81.54900  128.91600 150.45200 1.000 109.75000 ? 485 PHE A CD2   1 
ATOM   1287  C CE1   . PHE A 1 240 ? 81.08200  126.51300 151.68200 1.000 109.75000 ? 485 PHE A CE1   1 
ATOM   1288  C CE2   . PHE A 1 240 ? 82.00800  128.70600 151.73000 1.000 109.75000 ? 485 PHE A CE2   1 
ATOM   1289  C CZ    . PHE A 1 240 ? 81.77300  127.50600 152.34600 1.000 109.75000 ? 485 PHE A CZ    1 
ATOM   1290  N N     . LYS A 1 241 ? 79.14500  127.22500 145.34600 1.000 113.09000 ? 486 LYS A N     1 
ATOM   1291  C CA    . LYS A 1 241 ? 78.31300  127.82300 144.31500 1.000 113.09000 ? 486 LYS A CA    1 
ATOM   1292  C C     . LYS A 1 241 ? 77.45700  126.82500 143.55100 1.000 113.09000 ? 486 LYS A C     1 
ATOM   1293  O O     . LYS A 1 241 ? 76.28900  127.11000 143.28400 1.000 113.09000 ? 486 LYS A O     1 
ATOM   1294  C CB    . LYS A 1 241 ? 79.18800  128.62000 143.34600 1.000 113.09000 ? 486 LYS A CB    1 
ATOM   1295  C CG    . LYS A 1 241 ? 78.40500  129.42500 142.34800 1.000 113.09000 ? 486 LYS A CG    1 
ATOM   1296  C CD    . LYS A 1 241 ? 79.31000  130.34300 141.58400 1.000 113.09000 ? 486 LYS A CD    1 
ATOM   1297  C CE    . LYS A 1 241 ? 79.73200  131.49600 142.46900 1.000 113.09000 ? 486 LYS A CE    1 
ATOM   1298  N NZ    . LYS A 1 241 ? 78.59100  132.39600 142.78600 1.000 113.09000 ? 486 LYS A NZ    1 
ATOM   1299  N N     . SER A 1 242 ? 77.97200  125.65100 143.21500 1.000 114.50000 ? 487 SER A N     1 
ATOM   1300  C CA    . SER A 1 242 ? 77.26000  124.76200 142.31200 1.000 114.50000 ? 487 SER A CA    1 
ATOM   1301  C C     . SER A 1 242 ? 76.53700  123.64900 143.05500 1.000 114.50000 ? 487 SER A C     1 
ATOM   1302  O O     . SER A 1 242 ? 76.93300  123.23200 144.14500 1.000 114.50000 ? 487 SER A O     1 
ATOM   1303  C CB    . SER A 1 242 ? 78.21200  124.15500 141.28300 1.000 114.50000 ? 487 SER A CB    1 
ATOM   1304  O OG    . SER A 1 242 ? 78.70500  125.14600 140.39900 1.000 114.50000 ? 487 SER A OG    1 
ATOM   1305  N N     . THR A 1 243 ? 75.46800  123.17100 142.43500 1.000 111.50000 ? 488 THR A N     1 
ATOM   1306  C CA    . THR A 1 243 ? 74.70900  122.03000 142.91300 1.000 111.50000 ? 488 THR A CA    1 
ATOM   1307  C C     . THR A 1 243 ? 75.43700  120.76100 142.47300 1.000 111.50000 ? 488 THR A C     1 
ATOM   1308  O O     . THR A 1 243 ? 76.38500  120.83600 141.68900 1.000 111.50000 ? 488 THR A O     1 
ATOM   1309  C CB    . THR A 1 243 ? 73.28000  122.13500 142.36800 1.000 111.50000 ? 488 THR A CB    1 
ATOM   1310  O OG1   . THR A 1 243 ? 72.38100  121.29900 143.10200 1.000 111.50000 ? 488 THR A OG1   1 
ATOM   1311  C CG2   . THR A 1 243 ? 73.23100  121.71700 140.93300 1.000 111.50000 ? 488 THR A CG2   1 
ATOM   1312  N N     . PRO A 1 244 ? 75.08100  119.59200 143.03400 1.000 114.44000 ? 489 PRO A N     1 
ATOM   1313  C CA    . PRO A 1 244 ? 75.58100  118.31900 142.47700 1.000 114.44000 ? 489 PRO A CA    1 
ATOM   1314  C C     . PRO A 1 244 ? 75.38500  118.12900 140.99000 1.000 114.44000 ? 489 PRO A C     1 
ATOM   1315  O O     . PRO A 1 244 ? 76.28700  117.61600 140.32300 1.000 114.44000 ? 489 PRO A O     1 
ATOM   1316  C CB    . PRO A 1 244 ? 74.78900  117.28300 143.27400 1.000 114.44000 ? 489 PRO A CB    1 
ATOM   1317  C CG    . PRO A 1 244 ? 74.69000  117.90500 144.60200 1.000 114.44000 ? 489 PRO A CG    1 
ATOM   1318  C CD    . PRO A 1 244 ? 74.53500  119.38300 144.38900 1.000 114.44000 ? 489 PRO A CD    1 
ATOM   1319  N N     . SER A 1 245 ? 74.25100  118.53800 140.44200 1.000 128.91000 ? 490 SER A N     1 
ATOM   1320  C CA    . SER A 1 245 ? 74.07900  118.43200 138.99800 1.000 128.91000 ? 490 SER A CA    1 
ATOM   1321  C C     . SER A 1 245 ? 74.50500  119.71100 138.28200 1.000 128.91000 ? 490 SER A C     1 
ATOM   1322  O O     . SER A 1 245 ? 73.80900  120.20900 137.40200 1.000 128.91000 ? 490 SER A O     1 
ATOM   1323  C CB    . SER A 1 245 ? 72.62900  118.08600 138.67900 1.000 128.91000 ? 490 SER A CB    1 
ATOM   1324  O OG    . SER A 1 245 ? 71.76000  119.14000 139.05800 1.000 128.91000 ? 490 SER A OG    1 
ATOM   1325  N N     . GLU A 1 246 ? 75.65000  120.25100 138.64700 1.000 119.76000 ? 491 GLU A N     1 
ATOM   1326  C CA    . GLU A 1 246 ? 76.30700  121.22700 137.79000 1.000 119.76000 ? 491 GLU A CA    1 
ATOM   1327  C C     . GLU A 1 246 ? 77.77800  120.93900 137.58400 1.000 119.76000 ? 491 GLU A C     1 
ATOM   1328  O O     . GLU A 1 246 ? 78.28000  121.12500 136.47800 1.000 119.76000 ? 491 GLU A O     1 
ATOM   1329  C CB    . GLU A 1 246 ? 76.16000  122.65200 138.33000 1.000 119.76000 ? 491 GLU A CB    1 
ATOM   1330  C CG    . GLU A 1 246 ? 74.81500  123.30300 138.07300 1.000 119.76000 ? 491 GLU A CG    1 
ATOM   1331  C CD    . GLU A 1 246 ? 74.57000  123.58700 136.60500 1.000 119.76000 ? 491 GLU A CD    1 
ATOM   1332  O OE1   . GLU A 1 246 ? 75.54800  123.82900 135.86900 1.000 119.76000 ? 491 GLU A OE1   1 
ATOM   1333  O OE2   . GLU A 1 246 ? 73.39500  123.59000 136.18700 1.000 119.76000 ? 491 GLU A OE2   1 
ATOM   1334  N N     . ALA A 1 247 ? 78.48100  120.48400 138.61400 1.000 109.62000 ? 492 ALA A N     1 
ATOM   1335  C CA    . ALA A 1 247 ? 79.93800  120.45400 138.55200 1.000 109.62000 ? 492 ALA A CA    1 
ATOM   1336  C C     . ALA A 1 247 ? 80.44300  119.29200 139.39800 1.000 109.62000 ? 492 ALA A C     1 
ATOM   1337  O O     . ALA A 1 247 ? 80.64600  119.44400 140.60400 1.000 109.62000 ? 492 ALA A O     1 
ATOM   1338  C CB    . ALA A 1 247 ? 80.51700  121.77800 139.02500 1.000 109.62000 ? 492 ALA A CB    1 
ATOM   1339  N N     . ARG A 1 248 ? 80.66800  118.15100 138.76200 1.000 111.38000 ? 493 ARG A N     1 
ATOM   1340  C CA    . ARG A 1 248 ? 81.28100  117.04200 139.46500 1.000 111.38000 ? 493 ARG A CA    1 
ATOM   1341  C C     . ARG A 1 248 ? 82.79500  117.18900 139.42000 1.000 111.38000 ? 493 ARG A C     1 
ATOM   1342  O O     . ARG A 1 248 ? 83.34500  117.95800 138.63300 1.000 111.38000 ? 493 ARG A O     1 
ATOM   1343  C CB    . ARG A 1 248 ? 80.85300  115.71000 138.86100 1.000 111.38000 ? 493 ARG A CB    1 
ATOM   1344  C CG    . ARG A 1 248 ? 79.35900  115.50500 138.84400 1.000 111.38000 ? 493 ARG A CG    1 
ATOM   1345  C CD    . ARG A 1 248 ? 78.79100  115.41600 140.23900 1.000 111.38000 ? 493 ARG A CD    1 
ATOM   1346  N NE    . ARG A 1 248 ? 79.25700  114.24400 140.96200 1.000 111.38000 ? 493 ARG A NE    1 
ATOM   1347  C CZ    . ARG A 1 248 ? 78.65200  113.06500 140.94000 1.000 111.38000 ? 493 ARG A CZ    1 
ATOM   1348  N NH1   . ARG A 1 248 ? 77.55600  112.89200 140.21800 1.000 111.38000 ? 493 ARG A NH1   1 
ATOM   1349  N NH2   . ARG A 1 248 ? 79.14700  112.05500 141.64000 1.000 111.38000 ? 493 ARG A NH2   1 
ATOM   1350  N N     . LEU A 1 249 ? 83.47900  116.43500 140.27100 1.000 107.81000 ? 494 LEU A N     1 
ATOM   1351  C CA    . LEU A 1 249 ? 84.92600  116.55000 140.31300 1.000 107.81000 ? 494 LEU A CA    1 
ATOM   1352  C C     . LEU A 1 249 ? 85.54000  115.19100 140.59700 1.000 107.81000 ? 494 LEU A C     1 
ATOM   1353  O O     . LEU A 1 249 ? 84.90800  114.30900 141.18100 1.000 107.81000 ? 494 LEU A O     1 
ATOM   1354  C CB    . LEU A 1 249 ? 85.38900  117.56800 141.35700 1.000 107.81000 ? 494 LEU A CB    1 
ATOM   1355  C CG    . LEU A 1 249 ? 85.45600  117.14800 142.82400 1.000 107.81000 ? 494 LEU A CG    1 
ATOM   1356  C CD1   . LEU A 1 249 ? 86.31700  118.12100 143.59000 1.000 107.81000 ? 494 LEU A CD1   1 
ATOM   1357  C CD2   . LEU A 1 249 ? 84.09800  117.07500 143.46300 1.000 107.81000 ? 494 LEU A CD2   1 
ATOM   1358  N N     . ILE A 1 250 ? 86.78700  115.03200 140.16400 1.000 105.46000 ? 495 ILE A N     1 
ATOM   1359  C CA    . ILE A 1 250 ? 87.55200  113.80800 140.36100 1.000 105.46000 ? 495 ILE A CA    1 
ATOM   1360  C C     . ILE A 1 250 ? 88.87300  114.17700 141.00600 1.000 105.46000 ? 495 ILE A C     1 
ATOM   1361  O O     . ILE A 1 250 ? 89.65200  114.94300 140.43100 1.000 105.46000 ? 495 ILE A O     1 
ATOM   1362  C CB    . ILE A 1 250 ? 87.81000  113.06700 139.04600 1.000 105.46000 ? 495 ILE A CB    1 
ATOM   1363  C CG1   . ILE A 1 250 ? 86.50300  112.58600 138.44200 1.000 105.46000 ? 495 ILE A CG1   1 
ATOM   1364  C CG2   . ILE A 1 250 ? 88.73200  111.90000 139.28000 1.000 105.46000 ? 495 ILE A CG2   1 
ATOM   1365  C CD1   . ILE A 1 250 ? 86.66200  112.06900 137.04700 1.000 105.46000 ? 495 ILE A CD1   1 
ATOM   1366  N N     . MET A 1 251 ? 89.13800  113.62100 142.17800 1.000 114.56000 ? 496 MET A N     1 
ATOM   1367  C CA    . MET A 1 251 ? 90.33900  113.94900 142.92300 1.000 114.56000 ? 496 MET A CA    1 
ATOM   1368  C C     . MET A 1 251 ? 91.34700  112.82800 142.78400 1.000 114.56000 ? 496 MET A C     1 
ATOM   1369  O O     . MET A 1 251 ? 90.98200  111.65100 142.82200 1.000 114.56000 ? 496 MET A O     1 
ATOM   1370  C CB    . MET A 1 251 ? 90.03800  114.16200 144.39700 1.000 114.56000 ? 496 MET A CB    1 
ATOM   1371  C CG    . MET A 1 251 ? 89.00500  115.21200 144.65100 1.000 114.56000 ? 496 MET A CG    1 
ATOM   1372  S SD    . MET A 1 251 ? 88.99800  115.65500 146.37900 1.000 114.56000 ? 496 MET A SD    1 
ATOM   1373  C CE    . MET A 1 251 ? 90.53600  116.55500 146.40100 1.000 114.56000 ? 496 MET A CE    1 
ATOM   1374  N N     . ILE A 1 252 ? 92.61500  113.18800 142.61800 1.000 113.50000 ? 497 ILE A N     1 
ATOM   1375  C CA    . ILE A 1 252 ? 93.70100  112.21700 142.58800 1.000 113.50000 ? 497 ILE A CA    1 
ATOM   1376  C C     . ILE A 1 252 ? 94.82800  112.71300 143.48400 1.000 113.50000 ? 497 ILE A C     1 
ATOM   1377  O O     . ILE A 1 252 ? 95.30600  113.84100 143.31900 1.000 113.50000 ? 497 ILE A O     1 
ATOM   1378  C CB    . ILE A 1 252 ? 94.21500  111.96100 141.16000 1.000 113.50000 ? 497 ILE A CB    1 
ATOM   1379  C CG1   . ILE A 1 252 ? 93.13400  111.31400 140.29900 1.000 113.50000 ? 497 ILE A CG1   1 
ATOM   1380  C CG2   . ILE A 1 252 ? 95.38800  111.03100 141.19800 1.000 113.50000 ? 497 ILE A CG2   1 
ATOM   1381  C CD1   . ILE A 1 252 ? 93.46700  111.26700 138.84200 1.000 113.50000 ? 497 ILE A CD1   1 
ATOM   1382  N N     . ASP A 1 253 ? 95.25100  111.86800 144.43300 1.000 124.68000 ? 498 ASP A N     1 
ATOM   1383  C CA    . ASP A 1 253 ? 96.31800  112.20800 145.36600 1.000 124.68000 ? 498 ASP A CA    1 
ATOM   1384  C C     . ASP A 1 253 ? 97.29800  111.05900 145.59200 1.000 124.68000 ? 498 ASP A C     1 
ATOM   1385  O O     . ASP A 1 253 ? 96.96400  110.05200 146.22800 1.000 124.68000 ? 498 ASP A O     1 
ATOM   1386  C CB    . ASP A 1 253 ? 95.72600  112.68800 146.69500 1.000 124.68000 ? 498 ASP A CB    1 
ATOM   1387  C CG    . ASP A 1 253 ? 94.64600  111.77100 147.22300 1.000 124.68000 ? 498 ASP A CG    1 
ATOM   1388  O OD1   . ASP A 1 253 ? 94.24000  110.85500 146.48400 1.000 124.68000 ? 498 ASP A OD1   1 
ATOM   1389  O OD2   . ASP A 1 253 ? 94.21200  111.95700 148.37700 1.000 124.68000 ? 498 ASP A OD2   1 
ATOM   1390  N N     . PRO A 1 254 ? 98.50600  111.16500 145.06700 1.000 124.35000 ? 499 PRO A N     1 
ATOM   1391  C CA    . PRO A 1 254 ? 99.52700  110.15900 145.37100 1.000 124.35000 ? 499 PRO A CA    1 
ATOM   1392  C C     . PRO A 1 254 ? 100.10000 110.37700 146.75700 1.000 124.35000 ? 499 PRO A C     1 
ATOM   1393  O O     . PRO A 1 254 ? 100.49300 109.42900 147.44000 1.000 124.35000 ? 499 PRO A O     1 
ATOM   1394  C CB    . PRO A 1 254 ? 100.57900 110.38400 144.28100 1.000 124.35000 ? 499 PRO A CB    1 
ATOM   1395  C CG    . PRO A 1 254 ? 99.85500  111.09800 143.21200 1.000 124.35000 ? 499 PRO A CG    1 
ATOM   1396  C CD    . PRO A 1 254 ? 98.89300  111.99100 143.91900 1.000 124.35000 ? 499 PRO A CD    1 
ATOM   1397  N N     . LYS A 1 255 ? 100.16700 111.63300 147.17500 1.000 121.60000 ? 500 LYS A N     1 
ATOM   1398  C CA    . LYS A 1 255 ? 100.46800 111.95000 148.56500 1.000 121.60000 ? 500 LYS A CA    1 
ATOM   1399  C C     . LYS A 1 255 ? 99.16300  111.76300 149.31800 1.000 121.60000 ? 500 LYS A C     1 
ATOM   1400  O O     . LYS A 1 255 ? 98.35100  112.67600 149.45000 1.000 121.60000 ? 500 LYS A O     1 
ATOM   1401  C CB    . LYS A 1 255 ? 101.03500 113.35400 148.68700 1.000 121.60000 ? 500 LYS A CB    1 
ATOM   1402  C CG    . LYS A 1 255 ? 101.43000 113.75000 150.08300 1.000 121.60000 ? 500 LYS A CG    1 
ATOM   1403  C CD    . LYS A 1 255 ? 102.31800 114.99000 150.08100 1.000 121.60000 ? 500 LYS A CD    1 
ATOM   1404  C CE    . LYS A 1 255 ? 101.53700 116.28900 150.06100 1.000 121.60000 ? 500 LYS A CE    1 
ATOM   1405  N NZ    . LYS A 1 255 ? 101.25600 116.74500 148.67800 1.000 121.60000 ? 500 LYS A NZ    1 
ATOM   1406  N N     . MET A 1 256 ? 98.96600  110.55100 149.82700 1.000 117.61000 ? 501 MET A N     1 
ATOM   1407  C CA    . MET A 1 256 ? 97.65300  110.05500 150.21500 1.000 117.61000 ? 501 MET A CA    1 
ATOM   1408  C C     . MET A 1 256 ? 97.20800  110.56000 151.57600 1.000 117.61000 ? 501 MET A C     1 
ATOM   1409  O O     . MET A 1 256 ? 96.77500  109.76700 152.41600 1.000 117.61000 ? 501 MET A O     1 
ATOM   1410  C CB    . MET A 1 256 ? 97.69800  108.53400 150.25100 1.000 117.61000 ? 501 MET A CB    1 
ATOM   1411  C CG    . MET A 1 256 ? 98.05200  107.91100 148.94100 1.000 117.61000 ? 501 MET A CG    1 
ATOM   1412  S SD    . MET A 1 256 ? 98.26700  106.13900 149.10400 1.000 117.61000 ? 501 MET A SD    1 
ATOM   1413  C CE    . MET A 1 256 ? 99.86400  106.07600 149.89400 1.000 117.61000 ? 501 MET A CE    1 
ATOM   1414  N N     . LEU A 1 257 ? 97.28200  111.84500 151.80500 1.000 116.48000 ? 502 LEU A N     1 
ATOM   1415  C CA    . LEU A 1 257 ? 97.17100  112.24600 153.19500 1.000 116.48000 ? 502 LEU A CA    1 
ATOM   1416  C C     . LEU A 1 257 ? 96.16300  113.35500 153.43200 1.000 116.48000 ? 502 LEU A C     1 
ATOM   1417  O O     . LEU A 1 257 ? 95.40600  113.29200 154.40200 1.000 116.48000 ? 502 LEU A O     1 
ATOM   1418  C CB    . LEU A 1 257 ? 98.58200  112.65900 153.65000 1.000 116.48000 ? 502 LEU A CB    1 
ATOM   1419  C CG    . LEU A 1 257 ? 98.99100  112.83300 155.11100 1.000 116.48000 ? 502 LEU A CG    1 
ATOM   1420  C CD1   . LEU A 1 257 ? 98.62300  114.18600 155.65400 1.000 116.48000 ? 502 LEU A CD1   1 
ATOM   1421  C CD2   . LEU A 1 257 ? 98.37500  111.73400 155.95400 1.000 116.48000 ? 502 LEU A CD2   1 
ATOM   1422  N N     . GLU A 1 258 ? 96.11800  114.35500 152.56200 1.000 111.12000 ? 503 GLU A N     1 
ATOM   1423  C CA    . GLU A 1 258 ? 95.41600  115.59400 152.85800 1.000 111.12000 ? 503 GLU A CA    1 
ATOM   1424  C C     . GLU A 1 258 ? 94.10300  115.73000 152.12000 1.000 111.12000 ? 503 GLU A C     1 
ATOM   1425  O O     . GLU A 1 258 ? 93.13500  116.25100 152.67800 1.000 111.12000 ? 503 GLU A O     1 
ATOM   1426  C CB    . GLU A 1 258 ? 96.31500  116.78200 152.52500 1.000 111.12000 ? 503 GLU A CB    1 
ATOM   1427  C CG    . GLU A 1 258 ? 97.44400  116.95500 153.51600 1.000 111.12000 ? 503 GLU A CG    1 
ATOM   1428  C CD    . GLU A 1 258 ? 98.42700  118.01500 153.10400 1.000 111.12000 ? 503 GLU A CD    1 
ATOM   1429  O OE1   . GLU A 1 258 ? 98.37000  118.43500 151.93400 1.000 111.12000 ? 503 GLU A OE1   1 
ATOM   1430  O OE2   . GLU A 1 258 ? 99.24200  118.43900 153.94900 1.000 111.12000 ? 503 GLU A OE2   1 
ATOM   1431  N N     . LEU A 1 259 ? 94.04200  115.26500 150.88300 1.000 102.43000 ? 504 LEU A N     1 
ATOM   1432  C CA    . LEU A 1 259 ? 92.84400  115.42800 150.08200 1.000 102.43000 ? 504 LEU A CA    1 
ATOM   1433  C C     . LEU A 1 259 ? 91.83800  114.31300 150.27300 1.000 102.43000 ? 504 LEU A C     1 
ATOM   1434  O O     . LEU A 1 259 ? 90.83900  114.27300 149.55300 1.000 102.43000 ? 504 LEU A O     1 
ATOM   1435  C CB    . LEU A 1 259 ? 93.22000  115.55500 148.61500 1.000 102.43000 ? 504 LEU A CB    1 
ATOM   1436  C CG    . LEU A 1 259 ? 93.92800  116.87400 148.34800 1.000 102.43000 ? 504 LEU A CG    1 
ATOM   1437  C CD1   . LEU A 1 259 ? 94.27000  116.96700 146.89700 1.000 102.43000 ? 504 LEU A CD1   1 
ATOM   1438  C CD2   . LEU A 1 259 ? 93.05500  118.03500 148.76400 1.000 102.43000 ? 504 LEU A CD2   1 
ATOM   1439  N N     . SER A 1 260 ? 92.05200  113.42600 151.24200 1.000 102.08000 ? 505 SER A N     1 
ATOM   1440  C CA    . SER A 1 260 ? 91.00400  112.49400 151.62300 1.000 102.08000 ? 505 SER A CA    1 
ATOM   1441  C C     . SER A 1 260 ? 89.88700  113.15800 152.40400 1.000 102.08000 ? 505 SER A C     1 
ATOM   1442  O O     . SER A 1 260 ? 88.85900  112.51800 152.63700 1.000 102.08000 ? 505 SER A O     1 
ATOM   1443  C CB    . SER A 1 260 ? 91.57700  111.36200 152.46200 1.000 102.08000 ? 505 SER A CB    1 
ATOM   1444  O OG    . SER A 1 260 ? 90.53000  110.53500 152.93800 1.000 102.08000 ? 505 SER A OG    1 
ATOM   1445  N N     . ILE A 1 261 ? 90.06900  114.41700 152.80800 1.000 101.98000 ? 506 ILE A N     1 
ATOM   1446  C CA    . ILE A 1 261 ? 89.13200  115.10200 153.68100 1.000 101.98000 ? 506 ILE A CA    1 
ATOM   1447  C C     . ILE A 1 261 ? 87.79500  115.35500 152.99600 1.000 101.98000 ? 506 ILE A C     1 
ATOM   1448  O O     . ILE A 1 261 ? 86.76600  115.46200 153.66900 1.000 101.98000 ? 506 ILE A O     1 
ATOM   1449  C CB    . ILE A 1 261 ? 89.81500  116.39300 154.17700 1.000 101.98000 ? 506 ILE A CB    1 
ATOM   1450  C CG1   . ILE A 1 261 ? 89.06500  117.01600 155.35100 1.000 101.98000 ? 506 ILE A CG1   1 
ATOM   1451  C CG2   . ILE A 1 261 ? 90.01000  117.38400 153.05000 1.000 101.98000 ? 506 ILE A CG2   1 
ATOM   1452  C CD1   . ILE A 1 261 ? 89.11200  116.18400 156.60000 1.000 101.98000 ? 506 ILE A CD1   1 
ATOM   1453  N N     . TYR A 1 262 ? 87.76700  115.37800 151.67200 1.000 105.68000 ? 507 TYR A N     1 
ATOM   1454  C CA    . TYR A 1 262 ? 86.56800  115.72000 150.93000 1.000 105.68000 ? 507 TYR A CA    1 
ATOM   1455  C C     . TYR A 1 262 ? 85.68300  114.52300 150.65000 1.000 105.68000 ? 507 TYR A C     1 
ATOM   1456  O O     . TYR A 1 262 ? 84.68300  114.66700 149.94200 1.000 105.68000 ? 507 TYR A O     1 
ATOM   1457  C CB    . TYR A 1 262 ? 86.96000  116.37400 149.61300 1.000 105.68000 ? 507 TYR A CB    1 
ATOM   1458  C CG    . TYR A 1 262 ? 87.61600  117.70800 149.79000 1.000 105.68000 ? 507 TYR A CG    1 
ATOM   1459  C CD1   . TYR A 1 262 ? 87.33200  118.50300 150.88000 1.000 105.68000 ? 507 TYR A CD1   1 
ATOM   1460  C CD2   . TYR A 1 262 ? 88.57300  118.14200 148.90100 1.000 105.68000 ? 507 TYR A CD2   1 
ATOM   1461  C CE1   . TYR A 1 262 ? 87.94900  119.71600 151.04400 1.000 105.68000 ? 507 TYR A CE1   1 
ATOM   1462  C CE2   . TYR A 1 262 ? 89.19900  119.34200 149.06300 1.000 105.68000 ? 507 TYR A CE2   1 
ATOM   1463  C CZ    . TYR A 1 262 ? 88.88700  120.12900 150.13300 1.000 105.68000 ? 507 TYR A CZ    1 
ATOM   1464  O OH    . TYR A 1 262 ? 89.52000  121.33800 150.29100 1.000 105.68000 ? 507 TYR A OH    1 
ATOM   1465  N N     . GLU A 1 263 ? 86.02500  113.35200 151.16900 1.000 117.03000 ? 508 GLU A N     1 
ATOM   1466  C CA    . GLU A 1 263 ? 85.28300  112.15000 150.82800 1.000 117.03000 ? 508 GLU A CA    1 
ATOM   1467  C C     . GLU A 1 263 ? 83.94900  112.14300 151.55400 1.000 117.03000 ? 508 GLU A C     1 
ATOM   1468  O O     . GLU A 1 263 ? 83.90500  112.18800 152.78700 1.000 117.03000 ? 508 GLU A O     1 
ATOM   1469  C CB    . GLU A 1 263 ? 86.08600  110.90700 151.18600 1.000 117.03000 ? 508 GLU A CB    1 
ATOM   1470  C CG    . GLU A 1 263 ? 85.40600  109.61000 150.77800 1.000 117.03000 ? 508 GLU A CG    1 
ATOM   1471  C CD    . GLU A 1 263 ? 85.36400  109.40400 149.27000 1.000 117.03000 ? 508 GLU A CD    1 
ATOM   1472  O OE1   . GLU A 1 263 ? 86.27000  109.89900 148.56600 1.000 117.03000 ? 508 GLU A OE1   1 
ATOM   1473  O OE2   . GLU A 1 263 ? 84.42200  108.74100 148.78800 1.000 117.03000 ? 508 GLU A OE2   1 
ATOM   1474  N N     . GLY A 1 264 ? 82.86600  112.09500 150.79100 1.000 118.54000 ? 509 GLY A N     1 
ATOM   1475  C CA    . GLY A 1 264 ? 81.54600  112.04900 151.37800 1.000 118.54000 ? 509 GLY A CA    1 
ATOM   1476  C C     . GLY A 1 264 ? 80.61100  113.08800 150.80800 1.000 118.54000 ? 509 GLY A C     1 
ATOM   1477  O O     . GLY A 1 264 ? 79.42100  113.11500 151.13300 1.000 118.54000 ? 509 GLY A O     1 
ATOM   1478  N N     . ILE A 1 265 ? 81.13600  113.94900 149.94800 1.000 117.35000 ? 510 ILE A N     1 
ATOM   1479  C CA    . ILE A 1 265 ? 80.32400  114.99300 149.34000 1.000 117.35000 ? 510 ILE A CA    1 
ATOM   1480  C C     . ILE A 1 265 ? 79.47800  114.36800 148.23900 1.000 117.35000 ? 510 ILE A C     1 
ATOM   1481  O O     . ILE A 1 265 ? 79.82400  113.29700 147.72300 1.000 117.35000 ? 510 ILE A O     1 
ATOM   1482  C CB    . ILE A 1 265 ? 81.20200  116.12600 148.79200 1.000 117.35000 ? 510 ILE A CB    1 
ATOM   1483  C CG1   . ILE A 1 265 ? 82.10100  115.60700 147.68100 1.000 117.35000 ? 510 ILE A CG1   1 
ATOM   1484  C CG2   . ILE A 1 265 ? 82.05100  116.70800 149.89300 1.000 117.35000 ? 510 ILE A CG2   1 
ATOM   1485  C CD1   . ILE A 1 265 ? 82.83100  116.68900 146.96800 1.000 117.35000 ? 510 ILE A CD1   1 
ATOM   1486  N N     . PRO A 1 266 ? 78.35500  114.96300 147.87700 1.000 116.90000 ? 511 PRO A N     1 
ATOM   1487  C CA    . PRO A 1 266 ? 77.63800  114.56100 146.66400 1.000 116.90000 ? 511 PRO A CA    1 
ATOM   1488  C C     . PRO A 1 266 ? 78.12400  115.31400 145.43100 1.000 116.90000 ? 511 PRO A C     1 
ATOM   1489  O O     . PRO A 1 266 ? 77.34400  115.93700 144.71300 1.000 116.90000 ? 511 PRO A O     1 
ATOM   1490  C CB    . PRO A 1 266 ? 76.18600  114.91200 146.99900 1.000 116.90000 ? 511 PRO A CB    1 
ATOM   1491  C CG    . PRO A 1 266 ? 76.30300  116.05500 147.90600 1.000 116.90000 ? 511 PRO A CG    1 
ATOM   1492  C CD    . PRO A 1 266 ? 77.52600  115.82200 148.73500 1.000 116.90000 ? 511 PRO A CD    1 
ATOM   1493  N N     . HIS A 1 267 ? 79.43000  115.29900 145.19800 1.000 110.01000 ? 512 HIS A N     1 
ATOM   1494  C CA    . HIS A 1 267 ? 79.95900  115.86900 143.97000 1.000 110.01000 ? 512 HIS A CA    1 
ATOM   1495  C C     . HIS A 1 267 ? 81.06900  115.05400 143.34800 1.000 110.01000 ? 512 HIS A C     1 
ATOM   1496  O O     . HIS A 1 267 ? 81.47600  115.36300 142.22900 1.000 110.01000 ? 512 HIS A O     1 
ATOM   1497  C CB    . HIS A 1 267 ? 80.48100  117.28500 144.21600 1.000 110.01000 ? 512 HIS A CB    1 
ATOM   1498  C CG    . HIS A 1 267 ? 79.41100  118.29200 144.47100 1.000 110.01000 ? 512 HIS A CG    1 
ATOM   1499  N ND1   . HIS A 1 267 ? 78.87400  118.50300 145.71900 1.000 110.01000 ? 512 HIS A ND1   1 
ATOM   1500  C CD2   . HIS A 1 267 ? 78.79800  119.16600 143.64100 1.000 110.01000 ? 512 HIS A CD2   1 
ATOM   1501  C CE1   . HIS A 1 267 ? 77.96200  119.45500 145.64500 1.000 110.01000 ? 512 HIS A CE1   1 
ATOM   1502  N NE2   . HIS A 1 267 ? 77.89900  119.87700 144.39600 1.000 110.01000 ? 512 HIS A NE2   1 
ATOM   1503  N N     . LEU A 1 268 ? 81.54700  114.01400 143.99700 1.000 112.99000 ? 513 LEU A N     1 
ATOM   1504  C CA    . LEU A 1 268 ? 82.87700  113.48800 143.74200 1.000 112.99000 ? 513 LEU A CA    1 
ATOM   1505  C C     . LEU A 1 268 ? 82.75500  112.08300 143.16400 1.000 112.99000 ? 513 LEU A C     1 
ATOM   1506  O O     . LEU A 1 268 ? 82.29400  111.16700 143.85200 1.000 112.99000 ? 513 LEU A O     1 
ATOM   1507  C CB    . LEU A 1 268 ? 83.65700  113.56200 145.04700 1.000 112.99000 ? 513 LEU A CB    1 
ATOM   1508  C CG    . LEU A 1 268 ? 85.09600  113.21000 145.32000 1.000 112.99000 ? 513 LEU A CG    1 
ATOM   1509  C CD1   . LEU A 1 268 ? 85.64600  114.31700 146.15100 1.000 112.99000 ? 513 LEU A CD1   1 
ATOM   1510  C CD2   . LEU A 1 268 ? 85.04500  111.99700 146.18100 1.000 112.99000 ? 513 LEU A CD2   1 
ATOM   1511  N N     . LEU A 1 269 ? 83.17200  111.92900 141.89800 1.000 114.73000 ? 514 LEU A N     1 
ATOM   1512  C CA    . LEU A 1 269 ? 82.76900  110.78000 141.08500 1.000 114.73000 ? 514 LEU A CA    1 
ATOM   1513  C C     . LEU A 1 269 ? 83.36600  109.47700 141.58800 1.000 114.73000 ? 514 LEU A C     1 
ATOM   1514  O O     . LEU A 1 269 ? 82.63600  108.56800 141.98900 1.000 114.73000 ? 514 LEU A O     1 
ATOM   1515  C CB    . LEU A 1 269 ? 83.16800  110.99600 139.62900 1.000 114.73000 ? 514 LEU A CB    1 
ATOM   1516  C CG    . LEU A 1 269 ? 82.34700  112.00400 138.84100 1.000 114.73000 ? 514 LEU A CG    1 
ATOM   1517  C CD1   . LEU A 1 269 ? 82.92100  112.18800 137.45300 1.000 114.73000 ? 514 LEU A CD1   1 
ATOM   1518  C CD2   . LEU A 1 269 ? 80.93500  111.50000 138.75900 1.000 114.73000 ? 514 LEU A CD2   1 
ATOM   1519  N N     . CYS A 1 270 ? 84.65000  109.35300 141.54500 1.000 126.65000 ? 515 CYS A N     1 
ATOM   1520  C CA    . CYS A 1 270 ? 85.25700  108.19500 142.16500 1.000 126.65000 ? 515 CYS A CA    1 
ATOM   1521  C C     . CYS A 1 270 ? 85.47000  108.48000 143.63300 1.000 126.65000 ? 515 CYS A C     1 
ATOM   1522  O O     . CYS A 1 270 ? 85.38800  109.63200 144.05400 1.000 126.65000 ? 515 CYS A O     1 
ATOM   1523  C CB    . CYS A 1 270 ? 86.59300  107.87400 141.49500 1.000 126.65000 ? 515 CYS A CB    1 
ATOM   1524  S SG    . CYS A 1 270 ? 87.81100  109.18300 141.64800 1.000 126.65000 ? 515 CYS A SG    1 
ATOM   1525  N N     . PRO A 1 271 ? 85.70700  107.46500 144.46200 1.000 124.62000 ? 516 PRO A N     1 
ATOM   1526  C CA    . PRO A 1 271 ? 86.31200  107.73900 145.76800 1.000 124.62000 ? 516 PRO A CA    1 
ATOM   1527  C C     . PRO A 1 271 ? 87.70200  108.31300 145.57200 1.000 124.62000 ? 516 PRO A C     1 
ATOM   1528  O O     . PRO A 1 271 ? 88.36900  108.02700 144.57500 1.000 124.62000 ? 516 PRO A O     1 
ATOM   1529  C CB    . PRO A 1 271 ? 86.35300  106.36400 146.44100 1.000 124.62000 ? 516 PRO A CB    1 
ATOM   1530  C CG    . PRO A 1 271 ? 85.24900  105.61500 145.79600 1.000 124.62000 ? 516 PRO A CG    1 
ATOM   1531  C CD    . PRO A 1 271 ? 85.22500  106.07700 144.36900 1.000 124.62000 ? 516 PRO A CD    1 
ATOM   1532  N N     . VAL A 1 272 ? 88.11400  109.16000 146.51700 1.000 121.92000 ? 517 VAL A N     1 
ATOM   1533  C CA    . VAL A 1 272 ? 89.40900  109.82500 146.41700 1.000 121.92000 ? 517 VAL A CA    1 
ATOM   1534  C C     . VAL A 1 272 ? 90.50700  108.78000 146.48000 1.000 121.92000 ? 517 VAL A C     1 
ATOM   1535  O O     . VAL A 1 272 ? 90.61300  108.02200 147.45100 1.000 121.92000 ? 517 VAL A O     1 
ATOM   1536  C CB    . VAL A 1 272 ? 89.56500  110.87700 147.51100 1.000 121.92000 ? 517 VAL A CB    1 
ATOM   1537  C CG1   . VAL A 1 272 ? 90.97800  111.42500 147.50400 1.000 121.92000 ? 517 VAL A CG1   1 
ATOM   1538  C CG2   . VAL A 1 272 ? 88.58300  111.99200 147.28000 1.000 121.92000 ? 517 VAL A CG2   1 
ATOM   1539  N N     . VAL A 1 273 ? 91.31300  108.73000 145.43200 1.000 119.15000 ? 518 VAL A N     1 
ATOM   1540  C CA    . VAL A 1 273 ? 91.99100  107.50400 145.06200 1.000 119.15000 ? 518 VAL A CA    1 
ATOM   1541  C C     . VAL A 1 273 ? 93.17500  107.24700 145.98300 1.000 119.15000 ? 518 VAL A C     1 
ATOM   1542  O O     . VAL A 1 273 ? 93.61100  108.10900 146.74300 1.000 119.15000 ? 518 VAL A O     1 
ATOM   1543  C CB    . VAL A 1 273 ? 92.42800  107.57200 143.59700 1.000 119.15000 ? 518 VAL A CB    1 
ATOM   1544  C CG1   . VAL A 1 273 ? 91.22700  107.83000 142.72000 1.000 119.15000 ? 518 VAL A CG1   1 
ATOM   1545  C CG2   . VAL A 1 273 ? 93.45000  108.65300 143.43300 1.000 119.15000 ? 518 VAL A CG2   1 
ATOM   1546  N N     . THR A 1 274 ? 93.67400  106.01500 145.92900 1.000 132.19000 ? 519 THR A N     1 
ATOM   1547  C CA    . THR A 1 274 ? 94.84100  105.61200 146.70300 1.000 132.19000 ? 519 THR A CA    1 
ATOM   1548  C C     . THR A 1 274 ? 96.11600  105.72700 145.87100 1.000 132.19000 ? 519 THR A C     1 
ATOM   1549  O O     . THR A 1 274 ? 96.98200  106.55800 146.15500 1.000 132.19000 ? 519 THR A O     1 
ATOM   1550  C CB    . THR A 1 274 ? 94.63700  104.18100 147.21800 1.000 132.19000 ? 519 THR A CB    1 
ATOM   1551  O OG1   . THR A 1 274 ? 93.51400  104.15300 148.10600 1.000 132.19000 ? 519 THR A OG1   1 
ATOM   1552  C CG2   . THR A 1 274 ? 95.85600  103.67400 147.94900 1.000 132.19000 ? 519 THR A CG2   1 
ATOM   1553  N N     . ASP A 1 275 ? 96.21100  104.94900 144.80600 1.000 141.32000 ? 520 ASP A N     1 
ATOM   1554  C CA    . ASP A 1 275 ? 97.41300  104.89300 144.00000 1.000 141.32000 ? 520 ASP A CA    1 
ATOM   1555  C C     . ASP A 1 275 ? 97.08300  105.39900 142.60700 1.000 141.32000 ? 520 ASP A C     1 
ATOM   1556  O O     . ASP A 1 275 ? 95.92100  105.44600 142.20200 1.000 141.32000 ? 520 ASP A O     1 
ATOM   1557  C CB    . ASP A 1 275 ? 97.95600  103.45700 143.93700 1.000 141.32000 ? 520 ASP A CB    1 
ATOM   1558  C CG    . ASP A 1 275 ? 99.40100  103.38400 143.47100 1.000 141.32000 ? 520 ASP A CG    1 
ATOM   1559  O OD1   . ASP A 1 275 ? 100.00000 104.44400 143.20000 1.000 141.32000 ? 520 ASP A OD1   1 
ATOM   1560  O OD2   . ASP A 1 275 ? 99.93800  102.26100 143.37500 1.000 141.32000 ? 520 ASP A OD2   1 
ATOM   1561  N N     . MET A 1 276 ? 98.12700  105.76100 141.86200 1.000 141.90000 ? 521 MET A N     1 
ATOM   1562  C CA    . MET A 1 276 ? 97.98500  105.98500 140.42900 1.000 141.90000 ? 521 MET A CA    1 
ATOM   1563  C C     . MET A 1 276 ? 97.56100  104.72600 139.68400 1.000 141.90000 ? 521 MET A C     1 
ATOM   1564  O O     . MET A 1 276 ? 97.03900  104.83000 138.56800 1.000 141.90000 ? 521 MET A O     1 
ATOM   1565  C CB    . MET A 1 276 ? 99.30300  106.51400 139.86700 1.000 141.90000 ? 521 MET A CB    1 
ATOM   1566  C CG    . MET A 1 276 ? 100.51000 105.64600 140.19800 1.000 141.90000 ? 521 MET A CG    1 
ATOM   1567  S SD    . MET A 1 276 ? 100.86500 104.24800 139.11300 1.000 141.90000 ? 521 MET A SD    1 
ATOM   1568  C CE    . MET A 1 276 ? 101.66100 103.12400 140.25400 1.000 141.90000 ? 521 MET A CE    1 
ATOM   1569  N N     . LYS A 1 277 ? 97.80000  103.55000 140.27800 1.000 147.76000 ? 522 LYS A N     1 
ATOM   1570  C CA    . LYS A 1 277 ? 97.45600  102.27000 139.67400 1.000 147.76000 ? 522 LYS A CA    1 
ATOM   1571  C C     . LYS A 1 277 ? 95.96000  102.14300 139.42500 1.000 147.76000 ? 522 LYS A C     1 
ATOM   1572  O O     . LYS A 1 277 ? 95.54600  101.54300 138.42900 1.000 147.76000 ? 522 LYS A O     1 
ATOM   1573  C CB    . LYS A 1 277 ? 97.94500  101.14300 140.58300 1.000 147.76000 ? 522 LYS A CB    1 
ATOM   1574  C CG    . LYS A 1 277 ? 97.83700  99.76700  139.99000 1.000 147.76000 ? 522 LYS A CG    1 
ATOM   1575  C CD    . LYS A 1 277 ? 98.74800  99.65700  138.79400 1.000 147.76000 ? 522 LYS A CD    1 
ATOM   1576  C CE    . LYS A 1 277 ? 100.19500 99.71000  139.22900 1.000 147.76000 ? 522 LYS A CE    1 
ATOM   1577  N NZ    . LYS A 1 277 ? 101.10500 99.54800  138.06900 1.000 147.76000 ? 522 LYS A NZ    1 
ATOM   1578  N N     . GLU A 1 278 ? 95.13800  102.70600 140.29900 1.000 140.81000 ? 523 GLU A N     1 
ATOM   1579  C CA    . GLU A 1 278 ? 93.71400  102.76300 140.02000 1.000 140.81000 ? 523 GLU A CA    1 
ATOM   1580  C C     . GLU A 1 278 ? 93.30000  104.05400 139.33000 1.000 140.81000 ? 523 GLU A C     1 
ATOM   1581  O O     . GLU A 1 278 ? 92.30600  104.05600 138.59600 1.000 140.81000 ? 523 GLU A O     1 
ATOM   1582  C CB    . GLU A 1 278 ? 92.91800  102.57700 141.31400 1.000 140.81000 ? 523 GLU A CB    1 
ATOM   1583  C CG    . GLU A 1 278 ? 93.15800  103.63800 142.36700 1.000 140.81000 ? 523 GLU A CG    1 
ATOM   1584  C CD    . GLU A 1 278 ? 92.41300  103.35600 143.65300 1.000 140.81000 ? 523 GLU A CD    1 
ATOM   1585  O OE1   . GLU A 1 278 ? 91.72000  102.32300 143.72100 1.000 140.81000 ? 523 GLU A OE1   1 
ATOM   1586  O OE2   . GLU A 1 278 ? 92.52000  104.16300 144.59800 1.000 140.81000 ? 523 GLU A OE2   1 
ATOM   1587  N N     . ALA A 1 279 ? 94.05600  105.13400 139.50600 1.000 134.99000 ? 524 ALA A N     1 
ATOM   1588  C CA    . ALA A 1 279 ? 93.62800  106.44200 139.03400 1.000 134.99000 ? 524 ALA A CA    1 
ATOM   1589  C C     . ALA A 1 279 ? 93.91600  106.67700 137.56200 1.000 134.99000 ? 524 ALA A C     1 
ATOM   1590  O O     . ALA A 1 279 ? 93.21900  107.48300 136.93000 1.000 134.99000 ? 524 ALA A O     1 
ATOM   1591  C CB    . ALA A 1 279 ? 94.30200  107.54100 139.85600 1.000 134.99000 ? 524 ALA A CB    1 
ATOM   1592  N N     . ALA A 1 280 ? 94.92100  106.00200 137.00500 1.000 136.09000 ? 525 ALA A N     1 
ATOM   1593  C CA    . ALA A 1 280 ? 95.17800  106.12000 135.57700 1.000 136.09000 ? 525 ALA A CA    1 
ATOM   1594  C C     . ALA A 1 280 ? 94.01200  105.56100 134.77400 1.000 136.09000 ? 525 ALA A C     1 
ATOM   1595  O O     . ALA A 1 280 ? 93.64500  106.11000 133.72800 1.000 136.09000 ? 525 ALA A O     1 
ATOM   1596  C CB    . ALA A 1 280 ? 96.47800  105.40500 135.21900 1.000 136.09000 ? 525 ALA A CB    1 
ATOM   1597  N N     . ASN A 1 281 ? 93.37500  104.50400 135.28300 1.000 137.68000 ? 526 ASN A N     1 
ATOM   1598  C CA    . ASN A 1 281 ? 92.22000  103.94500 134.59500 1.000 137.68000 ? 526 ASN A CA    1 
ATOM   1599  C C     . ASN A 1 281 ? 91.01500  104.87300 134.70200 1.000 137.68000 ? 526 ASN A C     1 
ATOM   1600  O O     . ASN A 1 281 ? 90.22400  104.97500 133.75900 1.000 137.68000 ? 526 ASN A O     1 
ATOM   1601  C CB    . ASN A 1 281 ? 91.90600  102.56000 135.15600 1.000 137.68000 ? 526 ASN A CB    1 
ATOM   1602  C CG    . ASN A 1 281 ? 91.07200  101.72100 134.20900 1.000 137.68000 ? 526 ASN A CG    1 
ATOM   1603  O OD1   . ASN A 1 281 ? 90.72300  102.15900 133.11300 1.000 137.68000 ? 526 ASN A OD1   1 
ATOM   1604  N ND2   . ASN A 1 281 ? 90.76000  100.50100 134.62300 1.000 137.68000 ? 526 ASN A ND2   1 
ATOM   1605  N N     . ALA A 1 282 ? 90.88200  105.59800 135.81300 1.000 130.69000 ? 527 ALA A N     1 
ATOM   1606  C CA    . ALA A 1 282 ? 89.82900  106.60200 135.88900 1.000 130.69000 ? 527 ALA A CA    1 
ATOM   1607  C C     . ALA A 1 282 ? 90.13300  107.79400 134.99300 1.000 130.69000 ? 527 ALA A C     1 
ATOM   1608  O O     . ALA A 1 282 ? 89.21700  108.47500 134.52300 1.000 130.69000 ? 527 ALA A O     1 
ATOM   1609  C CB    . ALA A 1 282 ? 89.63400  107.05500 137.33200 1.000 130.69000 ? 527 ALA A CB    1 
ATOM   1610  N N     . LEU A 1 283 ? 91.40600  108.04700 134.71300 1.000 127.60000 ? 528 LEU A N     1 
ATOM   1611  C CA    . LEU A 1 283 ? 91.71100  109.11000 133.76700 1.000 127.60000 ? 528 LEU A CA    1 
ATOM   1612  C C     . LEU A 1 283 ? 91.41500  108.66500 132.33300 1.000 127.60000 ? 528 LEU A C     1 
ATOM   1613  O O     . LEU A 1 283 ? 91.00400  109.47900 131.49800 1.000 127.60000 ? 528 LEU A O     1 
ATOM   1614  C CB    . LEU A 1 283 ? 93.16200  109.53800 133.94200 1.000 127.60000 ? 528 LEU A CB    1 
ATOM   1615  C CG    . LEU A 1 283 ? 93.51200  110.96400 133.52800 1.000 127.60000 ? 528 LEU A CG    1 
ATOM   1616  C CD1   . LEU A 1 283 ? 94.65700  111.43900 134.39600 1.000 127.60000 ? 528 LEU A CD1   1 
ATOM   1617  C CD2   . LEU A 1 283 ? 93.87900  111.09100 132.06400 1.000 127.60000 ? 528 LEU A CD2   1 
ATOM   1618  N N     . ARG A 1 284 ? 91.59900  107.37600 132.03100 1.000 132.89000 ? 529 ARG A N     1 
ATOM   1619  C CA    . ARG A 1 284 ? 91.08100  106.85300 130.76600 1.000 132.89000 ? 529 ARG A CA    1 
ATOM   1620  C C     . ARG A 1 284 ? 89.56000  106.90200 130.71900 1.000 132.89000 ? 529 ARG A C     1 
ATOM   1621  O O     . ARG A 1 284 ? 88.98000  107.06200 129.63800 1.000 132.89000 ? 529 ARG A O     1 
ATOM   1622  C CB    . ARG A 1 284 ? 91.54900  105.42200 130.51000 1.000 132.89000 ? 529 ARG A CB    1 
ATOM   1623  C CG    . ARG A 1 284 ? 92.83900  105.30200 129.72800 1.000 132.89000 ? 529 ARG A CG    1 
ATOM   1624  C CD    . ARG A 1 284 ? 94.03800  105.34500 130.61400 1.000 132.89000 ? 529 ARG A CD    1 
ATOM   1625  N NE    . ARG A 1 284 ? 94.00800  104.28600 131.61500 1.000 132.89000 ? 529 ARG A NE    1 
ATOM   1626  C CZ    . ARG A 1 284 ? 94.47800  103.06000 131.41900 1.000 132.89000 ? 529 ARG A CZ    1 
ATOM   1627  N NH1   . ARG A 1 284 ? 95.02900  102.73400 130.25900 1.000 132.89000 ? 529 ARG A NH1   1 
ATOM   1628  N NH2   . ARG A 1 284 ? 94.40500  102.16100 132.39100 1.000 132.89000 ? 529 ARG A NH2   1 
ATOM   1629  N N     . TRP A 1 285 ? 88.89900  106.75800 131.87100 1.000 123.93000 ? 530 TRP A N     1 
ATOM   1630  C CA    . TRP A 1 285 ? 87.46200  107.00700 131.91100 1.000 123.93000 ? 530 TRP A CA    1 
ATOM   1631  C C     . TRP A 1 285 ? 87.15600  108.45900 131.58500 1.000 123.93000 ? 530 TRP A C     1 
ATOM   1632  O O     . TRP A 1 285 ? 86.12700  108.75800 130.97700 1.000 123.93000 ? 530 TRP A O     1 
ATOM   1633  C CB    . TRP A 1 285 ? 86.86600  106.66900 133.27200 1.000 123.93000 ? 530 TRP A CB    1 
ATOM   1634  C CG    . TRP A 1 285 ? 85.39300  106.84900 133.25300 1.000 123.93000 ? 530 TRP A CG    1 
ATOM   1635  C CD1   . TRP A 1 285 ? 84.47800  105.97900 132.76000 1.000 123.93000 ? 530 TRP A CD1   1 
ATOM   1636  C CD2   . TRP A 1 285 ? 84.66900  108.02600 133.61800 1.000 123.93000 ? 530 TRP A CD2   1 
ATOM   1637  N NE1   . TRP A 1 285 ? 83.21800  106.50800 132.85900 1.000 123.93000 ? 530 TRP A NE1   1 
ATOM   1638  C CE2   . TRP A 1 285 ? 83.31200  107.77400 133.36800 1.000 123.93000 ? 530 TRP A CE2   1 
ATOM   1639  C CE3   . TRP A 1 285 ? 85.04000  109.26500 134.13200 1.000 123.93000 ? 530 TRP A CE3   1 
ATOM   1640  C CZ2   . TRP A 1 285 ? 82.32200  108.70300 133.63800 1.000 123.93000 ? 530 TRP A CZ2   1 
ATOM   1641  C CZ3   . TRP A 1 285 ? 84.05900  110.18300 134.40200 1.000 123.93000 ? 530 TRP A CZ3   1 
ATOM   1642  C CH2   . TRP A 1 285 ? 82.71500  109.90100 134.15200 1.000 123.93000 ? 530 TRP A CH2   1 
ATOM   1643  N N     . SER A 1 286 ? 88.01600  109.37600 132.02600 1.000 125.41000 ? 531 SER A N     1 
ATOM   1644  C CA    . SER A 1 286 ? 87.84100  110.78000 131.66300 1.000 125.41000 ? 531 SER A CA    1 
ATOM   1645  C C     . SER A 1 286 ? 88.00000  110.97900 130.16100 1.000 125.41000 ? 531 SER A C     1 
ATOM   1646  O O     . SER A 1 286 ? 87.29000  111.79200 129.55500 1.000 125.41000 ? 531 SER A O     1 
ATOM   1647  C CB    . SER A 1 286 ? 88.83600  111.65200 132.42300 1.000 125.41000 ? 531 SER A CB    1 
ATOM   1648  O OG    . SER A 1 286 ? 88.65000  111.52700 133.81700 1.000 125.41000 ? 531 SER A OG    1 
ATOM   1649  N N     . VAL A 1 287 ? 88.91600  110.22500 129.54900 1.000 126.35000 ? 532 VAL A N     1 
ATOM   1650  C CA    . VAL A 1 287 ? 89.06500  110.23400 128.09300 1.000 126.35000 ? 532 VAL A CA    1 
ATOM   1651  C C     . VAL A 1 287 ? 87.78300  109.75900 127.41700 1.000 126.35000 ? 532 VAL A C     1 
ATOM   1652  O O     . VAL A 1 287 ? 87.28100  110.38600 126.47400 1.000 126.35000 ? 532 VAL A O     1 
ATOM   1653  C CB    . VAL A 1 287 ? 90.25900  109.36200 127.67700 1.000 126.35000 ? 532 VAL A CB    1 
ATOM   1654  C CG1   . VAL A 1 287 ? 90.35100  109.27000 126.17300 1.000 126.35000 ? 532 VAL A CG1   1 
ATOM   1655  C CG2   . VAL A 1 287 ? 91.52800  109.91000 128.25100 1.000 126.35000 ? 532 VAL A CG2   1 
ATOM   1656  N N     . ALA A 1 288 ? 87.23000  108.64900 127.90300 1.000 127.12000 ? 533 ALA A N     1 
ATOM   1657  C CA    . ALA A 1 288 ? 86.00500  108.11300 127.31700 1.000 127.12000 ? 533 ALA A CA    1 
ATOM   1658  C C     . ALA A 1 288 ? 84.80900  109.02200 127.56600 1.000 127.12000 ? 533 ALA A C     1 
ATOM   1659  O O     . ALA A 1 288 ? 83.90100  109.09300 126.73300 1.000 127.12000 ? 533 ALA A O     1 
ATOM   1660  C CB    . ALA A 1 288 ? 85.72800  106.71700 127.86600 1.000 127.12000 ? 533 ALA A CB    1 
ATOM   1661  N N     . GLU A 1 289 ? 84.80100  109.73200 128.69200 1.000 127.55000 ? 534 GLU A N     1 
ATOM   1662  C CA    . GLU A 1 289 ? 83.74700  110.70200 128.95300 1.000 127.55000 ? 534 GLU A CA    1 
ATOM   1663  C C     . GLU A 1 289 ? 83.86600  111.88700 128.01200 1.000 127.55000 ? 534 GLU A C     1 
ATOM   1664  O O     . GLU A 1 289 ? 82.85300  112.41900 127.54200 1.000 127.55000 ? 534 GLU A O     1 
ATOM   1665  C CB    . GLU A 1 289 ? 83.81200  111.15800 130.40900 1.000 127.55000 ? 534 GLU A CB    1 
ATOM   1666  C CG    . GLU A 1 289 ? 82.72900  112.13900 130.80400 1.000 127.55000 ? 534 GLU A CG    1 
ATOM   1667  C CD    . GLU A 1 289 ? 81.34300  111.52500 130.80700 1.000 127.55000 ? 534 GLU A CD    1 
ATOM   1668  O OE1   . GLU A 1 289 ? 81.22000  110.30300 131.03700 1.000 127.55000 ? 534 GLU A OE1   1 
ATOM   1669  O OE2   . GLU A 1 289 ? 80.37100  112.27400 130.57700 1.000 127.55000 ? 534 GLU A OE2   1 
ATOM   1670  N N     . MET A 1 290 ? 85.10100  112.28900 127.70900 1.000 126.23000 ? 535 MET A N     1 
ATOM   1671  C CA    . MET A 1 290 ? 85.33400  113.30100 126.68900 1.000 126.23000 ? 535 MET A CA    1 
ATOM   1672  C C     . MET A 1 290 ? 84.83400  112.84100 125.32600 1.000 126.23000 ? 535 MET A C     1 
ATOM   1673  O O     . MET A 1 290 ? 84.26700  113.63200 124.56400 1.000 126.23000 ? 535 MET A O     1 
ATOM   1674  C CB    . MET A 1 290 ? 86.81900  113.63200 126.62800 1.000 126.23000 ? 535 MET A CB    1 
ATOM   1675  C CG    . MET A 1 290 ? 87.16600  114.70600 125.63700 1.000 126.23000 ? 535 MET A CG    1 
ATOM   1676  S SD    . MET A 1 290 ? 88.94100  114.95300 125.56200 1.000 126.23000 ? 535 MET A SD    1 
ATOM   1677  C CE    . MET A 1 290 ? 89.22500  115.79900 127.11000 1.000 126.23000 ? 535 MET A CE    1 
ATOM   1678  N N     . GLU A 1 291 ? 85.00400  111.55500 125.01200 1.000 136.77000 ? 536 GLU A N     1 
ATOM   1679  C CA    . GLU A 1 291 ? 84.51200  111.06200 123.72700 1.000 136.77000 ? 536 GLU A CA    1 
ATOM   1680  C C     . GLU A 1 291 ? 82.99100  110.97300 123.69700 1.000 136.77000 ? 536 GLU A C     1 
ATOM   1681  O O     . GLU A 1 291 ? 82.38300  111.20200 122.64600 1.000 136.77000 ? 536 GLU A O     1 
ATOM   1682  C CB    . GLU A 1 291 ? 85.12000  109.70600 123.38100 1.000 136.77000 ? 536 GLU A CB    1 
ATOM   1683  C CG    . GLU A 1 291 ? 86.56700  109.75700 122.95200 1.000 136.77000 ? 536 GLU A CG    1 
ATOM   1684  C CD    . GLU A 1 291 ? 87.05400  108.41500 122.46200 1.000 136.77000 ? 536 GLU A CD    1 
ATOM   1685  O OE1   . GLU A 1 291 ? 86.27600  107.44300 122.53200 1.000 136.77000 ? 536 GLU A OE1   1 
ATOM   1686  O OE2   . GLU A 1 291 ? 88.21100  108.32700 122.00600 1.000 136.77000 ? 536 GLU A OE2   1 
ATOM   1687  N N     . ARG A 1 292 ? 82.36500  110.62000 124.82600 1.000 128.50000 ? 537 ARG A N     1 
ATOM   1688  C CA    . ARG A 1 292 ? 80.90800  110.67500 124.92300 1.000 128.50000 ? 537 ARG A CA    1 
ATOM   1689  C C     . ARG A 1 292 ? 80.41100  112.08700 124.70600 1.000 128.50000 ? 537 ARG A C     1 
ATOM   1690  O O     . ARG A 1 292 ? 79.41300  112.31300 124.00700 1.000 128.50000 ? 537 ARG A O     1 
ATOM   1691  C CB    . ARG A 1 292 ? 80.43500  110.20500 126.29200 1.000 128.50000 ? 537 ARG A CB    1 
ATOM   1692  C CG    . ARG A 1 292 ? 80.58700  108.74800 126.58000 1.000 128.50000 ? 537 ARG A CG    1 
ATOM   1693  C CD    . ARG A 1 292 ? 80.03100  108.48500 127.95300 1.000 128.50000 ? 537 ARG A CD    1 
ATOM   1694  N NE    . ARG A 1 292 ? 78.61800  108.83800 127.99700 1.000 128.50000 ? 537 ARG A NE    1 
ATOM   1695  C CZ    . ARG A 1 292 ? 77.89900  108.88900 129.11100 1.000 128.50000 ? 537 ARG A CZ    1 
ATOM   1696  N NH1   . ARG A 1 292 ? 78.46500  108.60500 130.27300 1.000 128.50000 ? 537 ARG A NH1   1 
ATOM   1697  N NH2   . ARG A 1 292 ? 76.61800  109.22200 129.06400 1.000 128.50000 ? 537 ARG A NH2   1 
ATOM   1698  N N     . ARG A 1 293 ? 81.11600  113.04400 125.29700 1.000 126.60000 ? 538 ARG A N     1 
ATOM   1699  C CA    . ARG A 1 293 ? 80.76200  114.44500 125.18400 1.000 126.60000 ? 538 ARG A CA    1 
ATOM   1700  C C     . ARG A 1 293 ? 80.89400  114.91700 123.74500 1.000 126.60000 ? 538 ARG A C     1 
ATOM   1701  O O     . ARG A 1 293 ? 80.00800  115.60400 123.22400 1.000 126.60000 ? 538 ARG A O     1 
ATOM   1702  C CB    . ARG A 1 293 ? 81.67200  115.24400 126.11000 1.000 126.60000 ? 538 ARG A CB    1 
ATOM   1703  C CG    . ARG A 1 293 ? 81.19200  116.61800 126.45600 1.000 126.60000 ? 538 ARG A CG    1 
ATOM   1704  C CD    . ARG A 1 293 ? 80.00700  116.54200 127.39900 1.000 126.60000 ? 538 ARG A CD    1 
ATOM   1705  N NE    . ARG A 1 293 ? 80.31100  115.80100 128.62100 1.000 126.60000 ? 538 ARG A NE    1 
ATOM   1706  C CZ    . ARG A 1 293 ? 80.90100  116.31600 129.69400 1.000 126.60000 ? 538 ARG A CZ    1 
ATOM   1707  N NH1   . ARG A 1 293 ? 81.27500  117.58700 129.72000 1.000 126.60000 ? 538 ARG A NH1   1 
ATOM   1708  N NH2   . ARG A 1 293 ? 81.11900  115.54900 130.74700 1.000 126.60000 ? 538 ARG A NH2   1 
ATOM   1709  N N     . TYR A 1 294 ? 81.96900  114.50000 123.07500 1.000 132.14000 ? 539 TYR A N     1 
ATOM   1710  C CA    . TYR A 1 294 ? 82.18600  114.86600 121.68200 1.000 132.14000 ? 539 TYR A CA    1 
ATOM   1711  C C     . TYR A 1 294 ? 81.17300  114.22200 120.75200 1.000 132.14000 ? 539 TYR A C     1 
ATOM   1712  O O     . TYR A 1 294 ? 80.69900  114.87500 119.81700 1.000 132.14000 ? 539 TYR A O     1 
ATOM   1713  C CB    . TYR A 1 294 ? 83.60300  114.50100 121.26600 1.000 132.14000 ? 539 TYR A CB    1 
ATOM   1714  C CG    . TYR A 1 294 ? 84.59000  115.60200 121.52100 1.000 132.14000 ? 539 TYR A CG    1 
ATOM   1715  C CD1   . TYR A 1 294 ? 84.18200  116.93000 121.55500 1.000 132.14000 ? 539 TYR A CD1   1 
ATOM   1716  C CD2   . TYR A 1 294 ? 85.92400  115.32300 121.74100 1.000 132.14000 ? 539 TYR A CD2   1 
ATOM   1717  C CE1   . TYR A 1 294 ? 85.08700  117.94600 121.77900 1.000 132.14000 ? 539 TYR A CE1   1 
ATOM   1718  C CE2   . TYR A 1 294 ? 86.82800  116.33400 121.97600 1.000 132.14000 ? 539 TYR A CE2   1 
ATOM   1719  C CZ    . TYR A 1 294 ? 86.40800  117.63500 121.99100 1.000 132.14000 ? 539 TYR A CZ    1 
ATOM   1720  O OH    . TYR A 1 294 ? 87.32900  118.63100 122.22500 1.000 132.14000 ? 539 TYR A OH    1 
ATOM   1721  N N     . ARG A 1 295 ? 80.83600  112.95100 120.98700 1.000 139.03000 ? 540 ARG A N     1 
ATOM   1722  C CA    . ARG A 1 295 ? 79.81800  112.28100 120.18300 1.000 139.03000 ? 540 ARG A CA    1 
ATOM   1723  C C     . ARG A 1 295 ? 78.47500  112.97900 120.32400 1.000 139.03000 ? 540 ARG A C     1 
ATOM   1724  O O     . ARG A 1 295 ? 77.80900  113.27700 119.32500 1.000 139.03000 ? 540 ARG A O     1 
ATOM   1725  C CB    . ARG A 1 295 ? 79.71700  110.80200 120.58600 1.000 139.03000 ? 540 ARG A CB    1 
ATOM   1726  C CG    . ARG A 1 295 ? 78.66800  109.96000 119.82000 1.000 139.03000 ? 540 ARG A CG    1 
ATOM   1727  C CD    . ARG A 1 295 ? 77.35900  109.77300 120.61400 1.000 139.03000 ? 540 ARG A CD    1 
ATOM   1728  N NE    . ARG A 1 295 ? 76.32600  109.03600 119.89000 1.000 139.03000 ? 540 ARG A NE    1 
ATOM   1729  C CZ    . ARG A 1 295 ? 76.13400  107.72300 119.97400 1.000 139.03000 ? 540 ARG A CZ    1 
ATOM   1730  N NH1   . ARG A 1 295 ? 76.89800  106.98600 120.76700 1.000 139.03000 ? 540 ARG A NH1   1 
ATOM   1731  N NH2   . ARG A 1 295 ? 75.16300  107.14800 119.27700 1.000 139.03000 ? 540 ARG A NH2   1 
ATOM   1732  N N     . LEU A 1 296 ? 78.08100  113.29100 121.55800 1.000 134.58000 ? 541 LEU A N     1 
ATOM   1733  C CA    . LEU A 1 296 ? 76.75100  113.84200 121.75000 1.000 134.58000 ? 541 LEU A CA    1 
ATOM   1734  C C     . LEU A 1 296 ? 76.67800  115.29800 121.31300 1.000 134.58000 ? 541 LEU A C     1 
ATOM   1735  O O     . LEU A 1 296 ? 75.62300  115.73800 120.84500 1.000 134.58000 ? 541 LEU A O     1 
ATOM   1736  C CB    . LEU A 1 296 ? 76.32900  113.67000 123.20700 1.000 134.58000 ? 541 LEU A CB    1 
ATOM   1737  C CG    . LEU A 1 296 ? 74.83400  113.74200 123.51100 1.000 134.58000 ? 541 LEU A CG    1 
ATOM   1738  C CD1   . LEU A 1 296 ? 74.51900  112.79100 124.64300 1.000 134.58000 ? 541 LEU A CD1   1 
ATOM   1739  C CD2   . LEU A 1 296 ? 74.39300  115.13000 123.89200 1.000 134.58000 ? 541 LEU A CD2   1 
ATOM   1740  N N     . MET A 1 297 ? 77.77800  116.04900 121.40300 1.000 140.90000 ? 542 MET A N     1 
ATOM   1741  C CA    . MET A 1 297 ? 77.72800  117.42300 120.91900 1.000 140.90000 ? 542 MET A CA    1 
ATOM   1742  C C     . MET A 1 297 ? 77.91300  117.51100 119.41200 1.000 140.90000 ? 542 MET A C     1 
ATOM   1743  O O     . MET A 1 297 ? 77.44800  118.47700 118.79700 1.000 140.90000 ? 542 MET A O     1 
ATOM   1744  C CB    . MET A 1 297 ? 78.77100  118.29000 121.61600 1.000 140.90000 ? 542 MET A CB    1 
ATOM   1745  C CG    . MET A 1 297 ? 78.50800  118.51400 123.08500 1.000 140.90000 ? 542 MET A CG    1 
ATOM   1746  S SD    . MET A 1 297 ? 79.60400  119.77800 123.74000 1.000 140.90000 ? 542 MET A SD    1 
ATOM   1747  C CE    . MET A 1 297 ? 81.18300  118.94900 123.60900 1.000 140.90000 ? 542 MET A CE    1 
ATOM   1748  N N     . ALA A 1 298 ? 78.58500  116.53500 118.79800 1.000 138.64000 ? 543 ALA A N     1 
ATOM   1749  C CA    . ALA A 1 298 ? 78.61000  116.48500 117.34500 1.000 138.64000 ? 543 ALA A CA    1 
ATOM   1750  C C     . ALA A 1 298 ? 77.26100  116.06200 116.79300 1.000 138.64000 ? 543 ALA A C     1 
ATOM   1751  O O     . ALA A 1 298 ? 76.86500  116.51100 115.71200 1.000 138.64000 ? 543 ALA A O     1 
ATOM   1752  C CB    . ALA A 1 298 ? 79.70500  115.53300 116.87100 1.000 138.64000 ? 543 ALA A CB    1 
ATOM   1753  N N     . ALA A 1 299 ? 76.53800  115.21400 117.52400 1.000 143.88000 ? 544 ALA A N     1 
ATOM   1754  C CA    . ALA A 1 299 ? 75.20700  114.81100 117.08800 1.000 143.88000 ? 544 ALA A CA    1 
ATOM   1755  C C     . ALA A 1 299 ? 74.20700  115.94800 117.25500 1.000 143.88000 ? 544 ALA A C     1 
ATOM   1756  O O     . ALA A 1 299 ? 73.56800  116.37600 116.28800 1.000 143.88000 ? 544 ALA A O     1 
ATOM   1757  C CB    . ALA A 1 299 ? 74.75600  113.57200 117.86300 1.000 143.88000 ? 544 ALA A CB    1 
ATOM   1758  N N     . MET A 1 300 ? 74.07100  116.46700 118.47600 1.000 146.37000 ? 545 MET A N     1 
ATOM   1759  C CA    . MET A 1 300 ? 73.01100  117.42800 118.74800 1.000 146.37000 ? 545 MET A CA    1 
ATOM   1760  C C     . MET A 1 300 ? 73.33600  118.82600 118.24200 1.000 146.37000 ? 545 MET A C     1 
ATOM   1761  O O     . MET A 1 300 ? 72.44300  119.67700 118.21000 1.000 146.37000 ? 545 MET A O     1 
ATOM   1762  C CB    . MET A 1 300 ? 72.71800  117.46700 120.24200 1.000 146.37000 ? 545 MET A CB    1 
ATOM   1763  C CG    . MET A 1 300 ? 72.34500  116.11000 120.81700 1.000 146.37000 ? 545 MET A CG    1 
ATOM   1764  S SD    . MET A 1 300 ? 70.93500  115.31100 120.03500 1.000 146.37000 ? 545 MET A SD    1 
ATOM   1765  C CE    . MET A 1 300 ? 69.59200  116.32700 120.62600 1.000 146.37000 ? 545 MET A CE    1 
ATOM   1766  N N     . GLY A 1 301 ? 74.58600  119.08700 117.86700 1.000 137.64000 ? 546 GLY A N     1 
ATOM   1767  C CA    . GLY A 1 301 ? 74.88800  120.22100 117.01700 1.000 137.64000 ? 546 GLY A CA    1 
ATOM   1768  C C     . GLY A 1 301 ? 75.77500  121.31600 117.57000 1.000 137.64000 ? 546 GLY A C     1 
ATOM   1769  O O     . GLY A 1 301 ? 76.67600  121.78500 116.86800 1.000 137.64000 ? 546 GLY A O     1 
ATOM   1770  N N     . VAL A 1 302 ? 75.54600  121.74000 118.80900 1.000 134.48000 ? 547 VAL A N     1 
ATOM   1771  C CA    . VAL A 1 302 ? 76.25700  122.89700 119.34400 1.000 134.48000 ? 547 VAL A CA    1 
ATOM   1772  C C     . VAL A 1 302 ? 77.62300  122.48100 119.86800 1.000 134.48000 ? 547 VAL A C     1 
ATOM   1773  O O     . VAL A 1 302 ? 77.92000  121.28700 119.98700 1.000 134.48000 ? 547 VAL A O     1 
ATOM   1774  C CB    . VAL A 1 302 ? 75.44300  123.60600 120.43700 1.000 134.48000 ? 547 VAL A CB    1 
ATOM   1775  C CG1   . VAL A 1 302 ? 74.16200  124.17100 119.85300 1.000 134.48000 ? 547 VAL A CG1   1 
ATOM   1776  C CG2   . VAL A 1 302 ? 75.14000  122.64700 121.54200 1.000 134.48000 ? 547 VAL A CG2   1 
ATOM   1777  N N     . ARG A 1 303 ? 78.45700  123.46700 120.18600 1.000 131.03000 ? 548 ARG A N     1 
ATOM   1778  C CA    . ARG A 1 303 ? 79.87200  123.25400 120.45100 1.000 131.03000 ? 548 ARG A CA    1 
ATOM   1779  C C     . ARG A 1 303 ? 80.25300  123.38200 121.91600 1.000 131.03000 ? 548 ARG A C     1 
ATOM   1780  O O     . ARG A 1 303 ? 80.95400  122.51800 122.44500 1.000 131.03000 ? 548 ARG A O     1 
ATOM   1781  C CB    . ARG A 1 303 ? 80.69500  124.23700 119.61800 1.000 131.03000 ? 548 ARG A CB    1 
ATOM   1782  C CG    . ARG A 1 303 ? 80.61700  123.95400 118.14200 1.000 131.03000 ? 548 ARG A CG    1 
ATOM   1783  C CD    . ARG A 1 303 ? 81.48900  124.89700 117.35900 1.000 131.03000 ? 548 ARG A CD    1 
ATOM   1784  N NE    . ARG A 1 303 ? 81.44200  124.59600 115.93600 1.000 131.03000 ? 548 ARG A NE    1 
ATOM   1785  C CZ    . ARG A 1 303 ? 82.09100  125.28900 115.01100 1.000 131.03000 ? 548 ARG A CZ    1 
ATOM   1786  N NH1   . ARG A 1 303 ? 82.83700  126.32500 115.36700 1.000 131.03000 ? 548 ARG A NH1   1 
ATOM   1787  N NH2   . ARG A 1 303 ? 81.99600  124.94900 113.73400 1.000 131.03000 ? 548 ARG A NH2   1 
ATOM   1788  N N     . ASN A 1 304 ? 79.83300  124.44600 122.58600 1.000 127.62000 ? 549 ASN A N     1 
ATOM   1789  C CA    . ASN A 1 304 ? 80.17600  124.61200 123.98800 1.000 127.62000 ? 549 ASN A CA    1 
ATOM   1790  C C     . ASN A 1 304 ? 79.35800  123.66900 124.85700 1.000 127.62000 ? 549 ASN A C     1 
ATOM   1791  O O     . ASN A 1 304 ? 78.26200  123.24200 124.48600 1.000 127.62000 ? 549 ASN A O     1 
ATOM   1792  C CB    . ASN A 1 304 ? 79.93800  126.05000 124.43500 1.000 127.62000 ? 549 ASN A CB    1 
ATOM   1793  C CG    . ASN A 1 304 ? 80.88900  127.01800 123.79100 1.000 127.62000 ? 549 ASN A CG    1 
ATOM   1794  O OD1   . ASN A 1 304 ? 82.06700  126.72400 123.61600 1.000 127.62000 ? 549 ASN A OD1   1 
ATOM   1795  N ND2   . ASN A 1 304 ? 80.38800  128.19100 123.44300 1.000 127.62000 ? 549 ASN A ND2   1 
ATOM   1796  N N     . LEU A 1 305 ? 79.91100  123.33800 126.02500 1.000 124.85000 ? 550 LEU A N     1 
ATOM   1797  C CA    . LEU A 1 305 ? 79.16200  122.53500 126.98200 1.000 124.85000 ? 550 LEU A CA    1 
ATOM   1798  C C     . LEU A 1 305 ? 77.99800  123.32300 127.55200 1.000 124.85000 ? 550 LEU A C     1 
ATOM   1799  O O     . LEU A 1 305 ? 76.85600  122.85000 127.54900 1.000 124.85000 ? 550 LEU A O     1 
ATOM   1800  C CB    . LEU A 1 305 ? 80.06300  122.05100 128.11400 1.000 124.85000 ? 550 LEU A CB    1 
ATOM   1801  C CG    . LEU A 1 305 ? 79.24400  121.22100 129.11000 1.000 124.85000 ? 550 LEU A CG    1 
ATOM   1802  C CD1   . LEU A 1 305 ? 78.70700  119.96800 128.45200 1.000 124.85000 ? 550 LEU A CD1   1 
ATOM   1803  C CD2   . LEU A 1 305 ? 80.00800  120.86000 130.35700 1.000 124.85000 ? 550 LEU A CD2   1 
ATOM   1804  N N     . ALA A 1 306 ? 78.27300  124.53200 128.04300 1.000 128.68000 ? 551 ALA A N     1 
ATOM   1805  C CA    . ALA A 1 306 ? 77.22300  125.36200 128.61800 1.000 128.68000 ? 551 ALA A CA    1 
ATOM   1806  C C     . ALA A 1 306 ? 76.22000  125.80000 127.56700 1.000 128.68000 ? 551 ALA A C     1 
ATOM   1807  O O     . ALA A 1 306 ? 75.05000  126.02000 127.89100 1.000 128.68000 ? 551 ALA A O     1 
ATOM   1808  C CB    . ALA A 1 306 ? 77.82700  126.58100 129.30800 1.000 128.68000 ? 551 ALA A CB    1 
ATOM   1809  N N     . GLY A 1 307 ? 76.65400  125.90400 126.30900 1.000 135.20000 ? 552 GLY A N     1 
ATOM   1810  C CA    . GLY A 1 307 ? 75.71000  126.09800 125.22400 1.000 135.20000 ? 552 GLY A CA    1 
ATOM   1811  C C     . GLY A 1 307 ? 74.73600  124.94500 125.10100 1.000 135.20000 ? 552 GLY A C     1 
ATOM   1812  O O     . GLY A 1 307 ? 73.53100  125.15200 124.94000 1.000 135.20000 ? 552 GLY A O     1 
ATOM   1813  N N     . PHE A 1 308 ? 75.22800  123.71500 125.25000 1.000 142.79000 ? 553 PHE A N     1 
ATOM   1814  C CA    . PHE A 1 308 ? 74.31400  122.58600 125.18400 1.000 142.79000 ? 553 PHE A CA    1 
ATOM   1815  C C     . PHE A 1 308 ? 73.46000  122.47400 126.43600 1.000 142.79000 ? 553 PHE A C     1 
ATOM   1816  O O     . PHE A 1 308 ? 72.31700  122.00400 126.37100 1.000 142.79000 ? 553 PHE A O     1 
ATOM   1817  C CB    . PHE A 1 308 ? 75.06300  121.28000 124.95800 1.000 142.79000 ? 553 PHE A CB    1 
ATOM   1818  C CG    . PHE A 1 308 ? 74.14500  120.12500 124.76400 1.000 142.79000 ? 553 PHE A CG    1 
ATOM   1819  C CD1   . PHE A 1 308 ? 73.39200  120.03600 123.61000 1.000 142.79000 ? 553 PHE A CD1   1 
ATOM   1820  C CD2   . PHE A 1 308 ? 73.98700  119.16100 125.74200 1.000 142.79000 ? 553 PHE A CD2   1 
ATOM   1821  C CE1   . PHE A 1 308 ? 72.51500  119.00000 123.42200 1.000 142.79000 ? 553 PHE A CE1   1 
ATOM   1822  C CE2   . PHE A 1 308 ? 73.10700  118.11500 125.55300 1.000 142.79000 ? 553 PHE A CE2   1 
ATOM   1823  C CZ    . PHE A 1 308 ? 72.37300  118.03700 124.39200 1.000 142.79000 ? 553 PHE A CZ    1 
ATOM   1824  N N     . ASN A 1 309 ? 73.98700  122.89500 127.58000 1.000 145.21000 ? 554 ASN A N     1 
ATOM   1825  C CA    . ASN A 1 309 ? 73.19200  122.79400 128.79100 1.000 145.21000 ? 554 ASN A CA    1 
ATOM   1826  C C     . ASN A 1 309 ? 72.12500  123.88000 128.82100 1.000 145.21000 ? 554 ASN A C     1 
ATOM   1827  O O     . ASN A 1 309 ? 71.08300  123.70600 129.46000 1.000 145.21000 ? 554 ASN A O     1 
ATOM   1828  C CB    . ASN A 1 309 ? 74.09000  122.85000 130.02000 1.000 145.21000 ? 554 ASN A CB    1 
ATOM   1829  C CG    . ASN A 1 309 ? 73.44400  122.22400 131.23900 1.000 145.21000 ? 554 ASN A CG    1 
ATOM   1830  O OD1   . ASN A 1 309 ? 72.31200  121.74600 131.18000 1.000 145.21000 ? 554 ASN A OD1   1 
ATOM   1831  N ND2   . ASN A 1 309 ? 74.17200  122.20200 132.34700 1.000 145.21000 ? 554 ASN A ND2   1 
ATOM   1832  N N     . ARG A 1 310 ? 72.35900  124.99500 128.12600 1.000 151.23000 ? 555 ARG A N     1 
ATOM   1833  C CA    . ARG A 1 310 ? 71.25900  125.88900 127.78800 1.000 151.23000 ? 555 ARG A CA    1 
ATOM   1834  C C     . ARG A 1 310 ? 70.28700  125.19900 126.85000 1.000 151.23000 ? 555 ARG A C     1 
ATOM   1835  O O     . ARG A 1 310 ? 69.06900  125.27800 127.03400 1.000 151.23000 ? 555 ARG A O     1 
ATOM   1836  C CB    . ARG A 1 310 ? 71.77600  127.16500 127.13000 1.000 151.23000 ? 555 ARG A CB    1 
ATOM   1837  C CG    . ARG A 1 310 ? 72.51700  128.10900 128.03400 1.000 151.23000 ? 555 ARG A CG    1 
ATOM   1838  C CD    . ARG A 1 310 ? 72.95900  129.32100 127.24400 1.000 151.23000 ? 555 ARG A CD    1 
ATOM   1839  N NE    . ARG A 1 310 ? 73.70700  130.26700 128.06100 1.000 151.23000 ? 555 ARG A NE    1 
ATOM   1840  C CZ    . ARG A 1 310 ? 74.23100  131.39200 127.59600 1.000 151.23000 ? 555 ARG A CZ    1 
ATOM   1841  N NH1   . ARG A 1 310 ? 74.08300  131.70900 126.31900 1.000 151.23000 ? 555 ARG A NH1   1 
ATOM   1842  N NH2   . ARG A 1 310 ? 74.89900  132.20200 128.40400 1.000 151.23000 ? 555 ARG A NH2   1 
ATOM   1843  N N     . LYS A 1 311 ? 70.82200  124.51700 125.83200 1.000 153.41000 ? 556 LYS A N     1 
ATOM   1844  C CA    . LYS A 1 311 ? 70.01500  123.93800 124.76700 1.000 153.41000 ? 556 LYS A CA    1 
ATOM   1845  C C     . LYS A 1 311 ? 69.06300  122.86200 125.26700 1.000 153.41000 ? 556 LYS A C     1 
ATOM   1846  O O     . LYS A 1 311 ? 67.99400  122.68300 124.67900 1.000 153.41000 ? 556 LYS A O     1 
ATOM   1847  C CB    . LYS A 1 311 ? 70.94300  123.37900 123.68000 1.000 153.41000 ? 556 LYS A CB    1 
ATOM   1848  C CG    . LYS A 1 311 ? 70.27500  122.95800 122.37000 1.000 153.41000 ? 556 LYS A CG    1 
ATOM   1849  C CD    . LYS A 1 311 ? 70.02100  121.45600 122.30900 1.000 153.41000 ? 556 LYS A CD    1 
ATOM   1850  C CE    . LYS A 1 311 ? 69.33700  121.05600 121.02500 1.000 153.41000 ? 556 LYS A CE    1 
ATOM   1851  N NZ    . LYS A 1 311 ? 68.98200  119.61900 121.06100 1.000 153.41000 ? 556 LYS A NZ    1 
ATOM   1852  N N     . VAL A 1 312 ? 69.41100  122.15000 126.33300 1.000 159.27000 ? 557 VAL A N     1 
ATOM   1853  C CA    . VAL A 1 312 ? 68.51700  121.09700 126.80700 1.000 159.27000 ? 557 VAL A CA    1 
ATOM   1854  C C     . VAL A 1 312 ? 67.32800  121.68600 127.56800 1.000 159.27000 ? 557 VAL A C     1 
ATOM   1855  O O     . VAL A 1 312 ? 66.18000  121.53200 127.13900 1.000 159.27000 ? 557 VAL A O     1 
ATOM   1856  C CB    . VAL A 1 312 ? 69.28600  120.02100 127.60500 1.000 159.27000 ? 557 VAL A CB    1 
ATOM   1857  C CG1   . VAL A 1 312 ? 70.24400  120.59500 128.63500 1.000 159.27000 ? 557 VAL A CG1   1 
ATOM   1858  C CG2   . VAL A 1 312 ? 68.30200  119.09400 128.28900 1.000 159.27000 ? 557 VAL A CG2   1 
ATOM   1859  N N     . LYS A 1 313 ? 67.57700  122.41900 128.65600 1.000 167.46000 ? 558 LYS A N     1 
ATOM   1860  C CA    . LYS A 1 313 ? 66.49000  122.90500 129.50000 1.000 167.46000 ? 558 LYS A CA    1 
ATOM   1861  C C     . LYS A 1 313 ? 65.72200  124.03600 128.83100 1.000 167.46000 ? 558 LYS A C     1 
ATOM   1862  O O     . LYS A 1 313 ? 64.48600  124.09100 128.91200 1.000 167.46000 ? 558 LYS A O     1 
ATOM   1863  C CB    . LYS A 1 313 ? 67.04000  123.35500 130.85500 1.000 167.46000 ? 558 LYS A CB    1 
ATOM   1864  C CG    . LYS A 1 313 ? 66.00400  123.96700 131.79800 1.000 167.46000 ? 558 LYS A CG    1 
ATOM   1865  C CD    . LYS A 1 313 ? 64.97100  122.94300 132.25200 1.000 167.46000 ? 558 LYS A CD    1 
ATOM   1866  C CE    . LYS A 1 313 ? 64.01900  123.52100 133.29600 1.000 167.46000 ? 558 LYS A CE    1 
ATOM   1867  N NZ    . LYS A 1 313 ? 63.11000  124.56300 132.74500 1.000 167.46000 ? 558 LYS A NZ    1 
ATOM   1868  N N     . ASP A 1 314 ? 66.42200  124.92300 128.12800 1.000 169.84000 ? 559 ASP A N     1 
ATOM   1869  C CA    . ASP A 1 314 ? 65.78200  126.00900 127.41300 1.000 169.84000 ? 559 ASP A CA    1 
ATOM   1870  C C     . ASP A 1 314 ? 65.08000  125.54800 126.14100 1.000 169.84000 ? 559 ASP A C     1 
ATOM   1871  O O     . ASP A 1 314 ? 64.51500  126.38400 125.42800 1.000 169.84000 ? 559 ASP A O     1 
ATOM   1872  C CB    . ASP A 1 314 ? 66.82900  127.07000 127.09100 1.000 169.84000 ? 559 ASP A CB    1 
ATOM   1873  C CG    . ASP A 1 314 ? 67.48300  127.62400 128.33600 1.000 169.84000 ? 559 ASP A CG    1 
ATOM   1874  O OD1   . ASP A 1 314 ? 66.82500  127.63900 129.39700 1.000 169.84000 ? 559 ASP A OD1   1 
ATOM   1875  O OD2   . ASP A 1 314 ? 68.66300  128.01900 128.25600 1.000 169.84000 ? 559 ASP A OD2   1 
ATOM   1876  N N     . ALA A 1 315 ? 65.14100  124.25800 125.81400 1.000 174.30000 ? 560 ALA A N     1 
ATOM   1877  C CA    . ALA A 1 315 ? 64.15800  123.65700 124.92800 1.000 174.30000 ? 560 ALA A CA    1 
ATOM   1878  C C     . ALA A 1 315 ? 63.04400  122.98100 125.71300 1.000 174.30000 ? 560 ALA A C     1 
ATOM   1879  O O     . ALA A 1 315 ? 61.87000  123.10400 125.34800 1.000 174.30000 ? 560 ALA A O     1 
ATOM   1880  C CB    . ALA A 1 315 ? 64.81300  122.64300 123.99000 1.000 174.30000 ? 560 ALA A CB    1 
ATOM   1881  N N     . GLU A 1 316 ? 63.37500  122.26400 126.78300 1.000 178.81000 ? 561 GLU A N     1 
ATOM   1882  C CA    . GLU A 1 316 ? 62.33300  121.61800 127.57900 1.000 178.81000 ? 561 GLU A CA    1 
ATOM   1883  C C     . GLU A 1 316 ? 61.95900  122.47300 128.79500 1.000 178.81000 ? 561 GLU A C     1 
ATOM   1884  O O     . GLU A 1 316 ? 62.00200  122.05600 129.95400 1.000 178.81000 ? 561 GLU A O     1 
ATOM   1885  C CB    . GLU A 1 316 ? 62.72900  120.17200 127.93300 1.000 178.81000 ? 561 GLU A CB    1 
ATOM   1886  C CG    . GLU A 1 316 ? 63.98600  119.86900 128.75600 1.000 178.81000 ? 561 GLU A CG    1 
ATOM   1887  C CD    . GLU A 1 316 ? 63.68900  119.54800 130.20600 1.000 178.81000 ? 561 GLU A CD    1 
ATOM   1888  O OE1   . GLU A 1 316 ? 62.53600  119.17200 130.50500 1.000 178.81000 ? 561 GLU A OE1   1 
ATOM   1889  O OE2   . GLU A 1 316 ? 64.60400  119.67400 131.04400 1.000 178.81000 ? 561 GLU A OE2   1 
ATOM   1890  N N     . GLU A 1 317 ? 61.57800  123.72100 128.50400 1.000 177.69000 ? 562 GLU A N     1 
ATOM   1891  C CA    . GLU A 1 317 ? 60.65400  124.41800 129.39400 1.000 177.69000 ? 562 GLU A CA    1 
ATOM   1892  C C     . GLU A 1 317 ? 59.40700  123.57100 129.61400 1.000 177.69000 ? 562 GLU A C     1 
ATOM   1893  O O     . GLU A 1 317 ? 59.05900  123.22800 130.74900 1.000 177.69000 ? 562 GLU A O     1 
ATOM   1894  C CB    . GLU A 1 317 ? 60.25500  125.77900 128.81900 1.000 177.69000 ? 562 GLU A CB    1 
ATOM   1895  C CG    . GLU A 1 317 ? 61.30500  126.86300 128.82900 1.000 177.69000 ? 562 GLU A CG    1 
ATOM   1896  C CD    . GLU A 1 317 ? 62.17300  126.84200 127.60200 1.000 177.69000 ? 562 GLU A CD    1 
ATOM   1897  O OE1   . GLU A 1 317 ? 61.99900  125.93000 126.76800 1.000 177.69000 ? 562 GLU A OE1   1 
ATOM   1898  O OE2   . GLU A 1 317 ? 62.99400  127.76800 127.44900 1.000 177.69000 ? 562 GLU A OE2   1 
ATOM   1899  N N     . ALA A 1 318 ? 58.72800  123.22300 128.52300 1.000 188.06000 ? 563 ALA A N     1 
ATOM   1900  C CA    . ALA A 1 318 ? 57.66100  122.23400 128.58100 1.000 188.06000 ? 563 ALA A CA    1 
ATOM   1901  C C     . ALA A 1 318 ? 58.26400  120.86700 128.86000 1.000 188.06000 ? 563 ALA A C     1 
ATOM   1902  O O     . ALA A 1 318 ? 59.32700  120.53300 128.33100 1.000 188.06000 ? 563 ALA A O     1 
ATOM   1903  C CB    . ALA A 1 318 ? 56.87700  122.21300 127.27100 1.000 188.06000 ? 563 ALA A CB    1 
ATOM   1904  N N     . GLY A 1 319 ? 57.59100  120.08300 129.69500 1.000 195.48000 ? 564 GLY A N     1 
ATOM   1905  C CA    . GLY A 1 319 ? 58.14600  118.83000 130.16500 1.000 195.48000 ? 564 GLY A CA    1 
ATOM   1906  C C     . GLY A 1 319 ? 58.34700  117.76800 129.10500 1.000 195.48000 ? 564 GLY A C     1 
ATOM   1907  O O     . GLY A 1 319 ? 57.38200  117.17800 128.61000 1.000 195.48000 ? 564 GLY A O     1 
ATOM   1908  N N     . THR A 1 320 ? 59.60500  117.52900 128.74200 1.000 193.39000 ? 565 THR A N     1 
ATOM   1909  C CA    . THR A 1 320 ? 59.99100  116.40100 127.90800 1.000 193.39000 ? 565 THR A CA    1 
ATOM   1910  C C     . THR A 1 320 ? 61.42500  116.02600 128.25500 1.000 193.39000 ? 565 THR A C     1 
ATOM   1911  O O     . THR A 1 320 ? 62.22000  116.90000 128.62600 1.000 193.39000 ? 565 THR A O     1 
ATOM   1912  C CB    . THR A 1 320 ? 59.83500  116.69700 126.40000 1.000 193.39000 ? 565 THR A CB    1 
ATOM   1913  O OG1   . THR A 1 320 ? 60.12200  115.51700 125.63900 1.000 193.39000 ? 565 THR A OG1   1 
ATOM   1914  C CG2   . THR A 1 320 ? 60.72800  117.83500 125.92400 1.000 193.39000 ? 565 THR A CG2   1 
ATOM   1915  N N     . PRO A 1 321 ? 61.76400  114.73300 128.21900 1.000 186.90000 ? 566 PRO A N     1 
ATOM   1916  C CA    . PRO A 1 321 ? 63.14600  114.32600 128.51400 1.000 186.90000 ? 566 PRO A CA    1 
ATOM   1917  C C     . PRO A 1 321 ? 64.13000  114.61000 127.39600 1.000 186.90000 ? 566 PRO A C     1 
ATOM   1918  O O     . PRO A 1 321 ? 65.34000  114.50700 127.64700 1.000 186.90000 ? 566 PRO A O     1 
ATOM   1919  C CB    . PRO A 1 321 ? 63.02200  112.81900 128.75700 1.000 186.90000 ? 566 PRO A CB    1 
ATOM   1920  C CG    . PRO A 1 321 ? 61.59600  112.60700 129.11200 1.000 186.90000 ? 566 PRO A CG    1 
ATOM   1921  C CD    . PRO A 1 321 ? 60.83800  113.59300 128.28600 1.000 186.90000 ? 566 PRO A CD    1 
ATOM   1922  N N     . LEU A 1 322 ? 63.64900  114.95200 126.19300 1.000 185.81000 ? 567 LEU A N     1 
ATOM   1923  C CA    . LEU A 1 322 ? 64.45900  115.24900 125.00600 1.000 185.81000 ? 567 LEU A CA    1 
ATOM   1924  C C     . LEU A 1 322 ? 65.35800  114.05400 124.66800 1.000 185.81000 ? 567 LEU A C     1 
ATOM   1925  O O     . LEU A 1 322 ? 66.56500  114.05300 124.91400 1.000 185.81000 ? 567 LEU A O     1 
ATOM   1926  C CB    . LEU A 1 322 ? 65.25900  116.55200 125.17700 1.000 185.81000 ? 567 LEU A CB    1 
ATOM   1927  C CG    . LEU A 1 322 ? 65.78800  117.31100 123.94600 1.000 185.81000 ? 567 LEU A CG    1 
ATOM   1928  C CD1   . LEU A 1 322 ? 65.82100  118.79100 124.25700 1.000 185.81000 ? 567 LEU A CD1   1 
ATOM   1929  C CD2   . LEU A 1 322 ? 67.16400  116.88500 123.47500 1.000 185.81000 ? 567 LEU A CD2   1 
ATOM   1930  N N     . THR A 1 323 ? 64.70100  112.98800 124.21300 1.000 184.65000 ? 568 THR A N     1 
ATOM   1931  C CA    . THR A 1 323 ? 65.40900  111.76100 123.87400 1.000 184.65000 ? 568 THR A CA    1 
ATOM   1932  C C     . THR A 1 323 ? 66.39500  111.99500 122.73200 1.000 184.65000 ? 568 THR A C     1 
ATOM   1933  O O     . THR A 1 323 ? 66.19300  112.85800 121.87400 1.000 184.65000 ? 568 THR A O     1 
ATOM   1934  C CB    . THR A 1 323 ? 64.41500  110.64900 123.52700 1.000 184.65000 ? 568 THR A CB    1 
ATOM   1935  O OG1   . THR A 1 323 ? 65.12500  109.42700 123.29100 1.000 184.65000 ? 568 THR A OG1   1 
ATOM   1936  C CG2   . THR A 1 323 ? 63.57100  111.00700 122.31100 1.000 184.65000 ? 568 THR A CG2   1 
ATOM   1937  N N     . ASP A 1 324 ? 67.48800  111.24900 122.75600 1.000 174.43000 ? 569 ASP A N     1 
ATOM   1938  C CA    . ASP A 1 324 ? 68.71600  111.62500 122.07700 1.000 174.43000 ? 569 ASP A CA    1 
ATOM   1939  C C     . ASP A 1 324 ? 69.57000  110.40300 121.77800 1.000 174.43000 ? 569 ASP A C     1 
ATOM   1940  O O     . ASP A 1 324 ? 69.42200  109.36300 122.42800 1.000 174.43000 ? 569 ASP A O     1 
ATOM   1941  C CB    . ASP A 1 324 ? 69.48800  112.61000 122.96300 1.000 174.43000 ? 569 ASP A CB    1 
ATOM   1942  C CG    . ASP A 1 324 ? 69.64500  112.10500 124.37300 1.000 174.43000 ? 569 ASP A CG    1 
ATOM   1943  O OD1   . ASP A 1 324 ? 68.99400  111.09800 124.72000 1.000 174.43000 ? 569 ASP A OD1   1 
ATOM   1944  O OD2   . ASP A 1 324 ? 70.43600  112.69500 125.12600 1.000 174.43000 ? 569 ASP A OD2   1 
ATOM   1945  N N     . PRO A 1 325 ? 70.47700  110.48900 120.78600 1.000 155.48000 ? 570 PRO A N     1 
ATOM   1946  C CA    . PRO A 1 325 ? 71.37400  109.35200 120.56500 1.000 155.48000 ? 570 PRO A CA    1 
ATOM   1947  C C     . PRO A 1 325 ? 72.44200  109.22500 121.63900 1.000 155.48000 ? 570 PRO A C     1 
ATOM   1948  O O     . PRO A 1 325 ? 73.60900  109.10900 121.27200 1.000 155.48000 ? 570 PRO A O     1 
ATOM   1949  C CB    . PRO A 1 325 ? 72.01500  109.66700 119.21300 1.000 155.48000 ? 570 PRO A CB    1 
ATOM   1950  C CG    . PRO A 1 325 ? 71.94100  111.13700 119.09500 1.000 155.48000 ? 570 PRO A CG    1 
ATOM   1951  C CD    . PRO A 1 325 ? 70.65400  111.52700 119.75300 1.000 155.48000 ? 570 PRO A CD    1 
ATOM   1952  N N     . PRO A 1 336 ? 66.12900  104.48500 122.86400 1.000 187.61000 ? 581 PRO A N     1 
ATOM   1953  C CA    . PRO A 1 336 ? 66.00700  105.94400 122.94500 1.000 187.61000 ? 581 PRO A CA    1 
ATOM   1954  C C     . PRO A 1 336 ? 65.94200  106.44500 124.38400 1.000 187.61000 ? 581 PRO A C     1 
ATOM   1955  O O     . PRO A 1 336 ? 64.84900  106.66900 124.89800 1.000 187.61000 ? 581 PRO A O     1 
ATOM   1956  C CB    . PRO A 1 336 ? 64.69600  106.22600 122.21100 1.000 187.61000 ? 581 PRO A CB    1 
ATOM   1957  C CG    . PRO A 1 336 ? 64.53400  105.07300 121.28400 1.000 187.61000 ? 581 PRO A CG    1 
ATOM   1958  C CD    . PRO A 1 336 ? 65.08000  103.89000 122.02100 1.000 187.61000 ? 581 PRO A CD    1 
ATOM   1959  N N     . PRO A 1 337 ? 67.09300  106.62300 125.02000 1.000 186.36000 ? 582 PRO A N     1 
ATOM   1960  C CA    . PRO A 1 337 ? 67.12200  107.03700 126.42500 1.000 186.36000 ? 582 PRO A CA    1 
ATOM   1961  C C     . PRO A 1 337 ? 66.83900  108.52800 126.57000 1.000 186.36000 ? 582 PRO A C     1 
ATOM   1962  O O     . PRO A 1 337 ? 66.72200  109.26600 125.59600 1.000 186.36000 ? 582 PRO A O     1 
ATOM   1963  C CB    . PRO A 1 337 ? 68.55000  106.70100 126.85300 1.000 186.36000 ? 582 PRO A CB    1 
ATOM   1964  C CG    . PRO A 1 337 ? 69.34100  106.82400 125.60900 1.000 186.36000 ? 582 PRO A CG    1 
ATOM   1965  C CD    . PRO A 1 337 ? 68.44600  106.35400 124.50100 1.000 186.36000 ? 582 PRO A CD    1 
ATOM   1966  N N     . GLN A 1 338 ? 66.75800  108.96300 127.82500 1.000 185.15000 ? 583 GLN A N     1 
ATOM   1967  C CA    . GLN A 1 338 ? 66.45000  110.34300 128.16000 1.000 185.15000 ? 583 GLN A CA    1 
ATOM   1968  C C     . GLN A 1 338 ? 67.69300  111.22200 128.03700 1.000 185.15000 ? 583 GLN A C     1 
ATOM   1969  O O     . GLN A 1 338 ? 68.75000  110.79800 127.56400 1.000 185.15000 ? 583 GLN A O     1 
ATOM   1970  C CB    . GLN A 1 338 ? 65.89800  110.43200 129.57700 1.000 185.15000 ? 583 GLN A CB    1 
ATOM   1971  C CG    . GLN A 1 338 ? 64.61400  109.68500 129.80100 1.000 185.15000 ? 583 GLN A CG    1 
ATOM   1972  C CD    . GLN A 1 338 ? 64.11500  109.85700 131.21500 1.000 185.15000 ? 583 GLN A CD    1 
ATOM   1973  O OE1   . GLN A 1 338 ? 64.76900  110.49900 132.03600 1.000 185.15000 ? 583 GLN A OE1   1 
ATOM   1974  N NE2   . GLN A 1 338 ? 62.95400  109.28700 131.51000 1.000 185.15000 ? 583 GLN A NE2   1 
ATOM   1975  N N     . LEU A 1 339 ? 67.56300  112.46800 128.48800 1.000 176.05000 ? 584 LEU A N     1 
ATOM   1976  C CA    . LEU A 1 339 ? 68.67800  113.40400 128.56500 1.000 176.05000 ? 584 LEU A CA    1 
ATOM   1977  C C     . LEU A 1 339 ? 68.59000  114.18900 129.86300 1.000 176.05000 ? 584 LEU A C     1 
ATOM   1978  O O     . LEU A 1 339 ? 67.61800  114.91700 130.09000 1.000 176.05000 ? 584 LEU A O     1 
ATOM   1979  C CB    . LEU A 1 339 ? 68.69300  114.35400 127.36800 1.000 176.05000 ? 584 LEU A CB    1 
ATOM   1980  C CG    . LEU A 1 339 ? 69.78500  115.42200 127.40800 1.000 176.05000 ? 584 LEU A CG    1 
ATOM   1981  C CD1   . LEU A 1 339 ? 71.17000  114.80300 127.51000 1.000 176.05000 ? 584 LEU A CD1   1 
ATOM   1982  C CD2   . LEU A 1 339 ? 69.68800  116.31000 126.18400 1.000 176.05000 ? 584 LEU A CD2   1 
ATOM   1983  N N     . SER A 1 340 ? 69.60500  114.04400 130.70500 1.000 164.42000 ? 585 SER A N     1 
ATOM   1984  C CA    . SER A 1 340 ? 69.73200  114.82300 131.92300 1.000 164.42000 ? 585 SER A CA    1 
ATOM   1985  C C     . SER A 1 340 ? 70.46400  116.12600 131.60800 1.000 164.42000 ? 585 SER A C     1 
ATOM   1986  O O     . SER A 1 340 ? 70.72700  116.44900 130.44800 1.000 164.42000 ? 585 SER A O     1 
ATOM   1987  C CB    . SER A 1 340 ? 70.45400  114.00400 132.98900 1.000 164.42000 ? 585 SER A CB    1 
ATOM   1988  O OG    . SER A 1 340 ? 70.65200  114.76400 134.16400 1.000 164.42000 ? 585 SER A OG    1 
ATOM   1989  N N     . THR A 1 341 ? 70.80800  116.89300 132.63700 1.000 149.81000 ? 586 THR A N     1 
ATOM   1990  C CA    . THR A 1 341 ? 71.66600  118.04200 132.41400 1.000 149.81000 ? 586 THR A CA    1 
ATOM   1991  C C     . THR A 1 341 ? 73.10200  117.57600 132.19800 1.000 149.81000 ? 586 THR A C     1 
ATOM   1992  O O     . THR A 1 341 ? 73.44800  116.41500 132.42000 1.000 149.81000 ? 586 THR A O     1 
ATOM   1993  C CB    . THR A 1 341 ? 71.59400  119.01300 133.58700 1.000 149.81000 ? 586 THR A CB    1 
ATOM   1994  O OG1   . THR A 1 341 ? 72.12100  118.38400 134.75900 1.000 149.81000 ? 586 THR A OG1   1 
ATOM   1995  C CG2   . THR A 1 341 ? 70.15600  119.40600 133.84900 1.000 149.81000 ? 586 THR A CG2   1 
ATOM   1996  N N     . LEU A 1 342 ? 73.94800  118.49700 131.75600 1.000 140.86000 ? 587 LEU A N     1 
ATOM   1997  C CA    . LEU A 1 342 ? 75.31600  118.14000 131.39500 1.000 140.86000 ? 587 LEU A CA    1 
ATOM   1998  C C     . LEU A 1 342 ? 76.29300  118.75000 132.38700 1.000 140.86000 ? 587 LEU A C     1 
ATOM   1999  O O     . LEU A 1 342 ? 76.65800  119.92800 132.25400 1.000 140.86000 ? 587 LEU A O     1 
ATOM   2000  C CB    . LEU A 1 342 ? 75.63800  118.59200 129.96800 1.000 140.86000 ? 587 LEU A CB    1 
ATOM   2001  C CG    . LEU A 1 342 ? 75.43500  117.57300 128.84000 1.000 140.86000 ? 587 LEU A CG    1 
ATOM   2002  C CD1   . LEU A 1 342 ? 76.43900  116.44700 128.97800 1.000 140.86000 ? 587 LEU A CD1   1 
ATOM   2003  C CD2   . LEU A 1 342 ? 74.03300  117.00000 128.81400 1.000 140.86000 ? 587 LEU A CD2   1 
ATOM   2004  N N     . PRO A 1 343 ? 76.75500  117.99600 133.37900 1.000 124.39000 ? 588 PRO A N     1 
ATOM   2005  C CA    . PRO A 1 343 ? 77.54000  118.58900 134.46100 1.000 124.39000 ? 588 PRO A CA    1 
ATOM   2006  C C     . PRO A 1 343 ? 78.97000  118.88700 134.04300 1.000 124.39000 ? 588 PRO A C     1 
ATOM   2007  O O     . PRO A 1 343 ? 79.49100  118.35800 133.06100 1.000 124.39000 ? 588 PRO A O     1 
ATOM   2008  C CB    . PRO A 1 343 ? 77.50600  117.50800 135.54400 1.000 124.39000 ? 588 PRO A CB    1 
ATOM   2009  C CG    . PRO A 1 343 ? 77.37400  116.24600 134.78000 1.000 124.39000 ? 588 PRO A CG    1 
ATOM   2010  C CD    . PRO A 1 343 ? 76.52000  116.55900 133.59500 1.000 124.39000 ? 588 PRO A CD    1 
ATOM   2011  N N     . THR A 1 344 ? 79.59600  119.76600 134.81700 1.000 109.59000 ? 589 THR A N     1 
ATOM   2012  C CA    . THR A 1 344 ? 80.99300  120.10100 134.61100 1.000 109.59000 ? 589 THR A CA    1 
ATOM   2013  C C     . THR A 1 344 ? 81.85200  119.05900 135.31200 1.000 109.59000 ? 589 THR A C     1 
ATOM   2014  O O     . THR A 1 344 ? 81.49500  118.55800 136.38000 1.000 109.59000 ? 589 THR A O     1 
ATOM   2015  C CB    . THR A 1 344 ? 81.28400  121.50300 135.15300 1.000 109.59000 ? 589 THR A CB    1 
ATOM   2016  O OG1   . THR A 1 344 ? 80.34500  122.42400 134.59400 1.000 109.59000 ? 589 THR A OG1   1 
ATOM   2017  C CG2   . THR A 1 344 ? 82.66800  121.97700 134.76900 1.000 109.59000 ? 589 THR A CG2   1 
ATOM   2018  N N     . ILE A 1 345 ? 82.96500  118.69700 134.68900 1.000 107.99000 ? 590 ILE A N     1 
ATOM   2019  C CA    . ILE A 1 345 ? 83.92300  117.77200 135.27200 1.000 107.99000 ? 590 ILE A CA    1 
ATOM   2020  C C     . ILE A 1 345 ? 85.21200  118.52900 135.53000 1.000 107.99000 ? 590 ILE A C     1 
ATOM   2021  O O     . ILE A 1 345 ? 85.69900  119.25400 134.65900 1.000 107.99000 ? 590 ILE A O     1 
ATOM   2022  C CB    . ILE A 1 345 ? 84.15200  116.56400 134.35500 1.000 107.99000 ? 590 ILE A CB    1 
ATOM   2023  C CG1   . ILE A 1 345 ? 82.83600  115.82900 134.15300 1.000 107.99000 ? 590 ILE A CG1   1 
ATOM   2024  C CG2   . ILE A 1 345 ? 85.17900  115.63100 134.94300 1.000 107.99000 ? 590 ILE A CG2   1 
ATOM   2025  C CD1   . ILE A 1 345 ? 82.24000  115.31600 135.43600 1.000 107.99000 ? 590 ILE A CD1   1 
ATOM   2026  N N     . VAL A 1 346 ? 85.74500  118.39600 136.73800 1.000 102.15000 ? 591 VAL A N     1 
ATOM   2027  C CA    . VAL A 1 346 ? 86.99100  119.04500 137.10400 1.000 102.15000 ? 591 VAL A CA    1 
ATOM   2028  C C     . VAL A 1 346 ? 87.93100  117.98600 137.64600 1.000 102.15000 ? 591 VAL A C     1 
ATOM   2029  O O     . VAL A 1 346 ? 87.64500  117.36300 138.67300 1.000 102.15000 ? 591 VAL A O     1 
ATOM   2030  C CB    . VAL A 1 346 ? 86.77900  120.15500 138.13700 1.000 102.15000 ? 591 VAL A CB    1 
ATOM   2031  C CG1   . VAL A 1 346 ? 88.10800  120.68400 138.58800 1.000 102.15000 ? 591 VAL A CG1   1 
ATOM   2032  C CG2   . VAL A 1 346 ? 85.95500  121.26900 137.54200 1.000 102.15000 ? 591 VAL A CG2   1 
ATOM   2033  N N     . VAL A 1 347 ? 89.04400  117.78000 136.96100 1.000 98.76000  ? 592 VAL A N     1 
ATOM   2034  C CA    . VAL A 1 347 ? 90.05600  116.83600 137.40800 1.000 98.76000  ? 592 VAL A CA    1 
ATOM   2035  C C     . VAL A 1 347 ? 91.04900  117.60200 138.26300 1.000 98.76000  ? 592 VAL A C     1 
ATOM   2036  O O     . VAL A 1 347 ? 91.82900  118.40800 137.75300 1.000 98.76000  ? 592 VAL A O     1 
ATOM   2037  C CB    . VAL A 1 347 ? 90.75600  116.16200 136.22900 1.000 98.76000  ? 592 VAL A CB    1 
ATOM   2038  C CG1   . VAL A 1 347 ? 91.84900  115.25900 136.73700 1.000 98.76000  ? 592 VAL A CG1   1 
ATOM   2039  C CG2   . VAL A 1 347 ? 89.75700  115.38100 135.42600 1.000 98.76000  ? 592 VAL A CG2   1 
ATOM   2040  N N     . VAL A 1 348 ? 91.01800  117.36100 139.56200 1.000 104.70000 ? 593 VAL A N     1 
ATOM   2041  C CA    . VAL A 1 348 ? 91.97800  117.95300 140.47700 1.000 104.70000 ? 593 VAL A CA    1 
ATOM   2042  C C     . VAL A 1 348 ? 92.98900  116.88500 140.87000 1.000 104.70000 ? 593 VAL A C     1 
ATOM   2043  O O     . VAL A 1 348 ? 92.62700  115.80700 141.35700 1.000 104.70000 ? 593 VAL A O     1 
ATOM   2044  C CB    . VAL A 1 348 ? 91.28100  118.57900 141.69400 1.000 104.70000 ? 593 VAL A CB    1 
ATOM   2045  C CG1   . VAL A 1 348 ? 90.62700  119.86000 141.27800 1.000 104.70000 ? 593 VAL A CG1   1 
ATOM   2046  C CG2   . VAL A 1 348 ? 90.19200  117.68200 142.21500 1.000 104.70000 ? 593 VAL A CG2   1 
ATOM   2047  N N     . VAL A 1 349 ? 94.26100  117.15900 140.61400 1.000 107.02000 ? 594 VAL A N     1 
ATOM   2048  C CA    . VAL A 1 349 ? 95.33100  116.21200 140.88200 1.000 107.02000 ? 594 VAL A CA    1 
ATOM   2049  C C     . VAL A 1 349 ? 96.25100  116.83200 141.91600 1.000 107.02000 ? 594 VAL A C     1 
ATOM   2050  O O     . VAL A 1 349 ? 96.67500  117.98200 141.76200 1.000 107.02000 ? 594 VAL A O     1 
ATOM   2051  C CB    . VAL A 1 349 ? 96.10600  115.85400 139.60400 1.000 107.02000 ? 594 VAL A CB    1 
ATOM   2052  C CG1   . VAL A 1 349 ? 97.20200  114.87700 139.91300 1.000 107.02000 ? 594 VAL A CG1   1 
ATOM   2053  C CG2   . VAL A 1 349 ? 95.17700  115.28100 138.56900 1.000 107.02000 ? 594 VAL A CG2   1 
ATOM   2054  N N     . ASP A 1 350 ? 96.55200  116.07400 142.96900 1.000 119.28000 ? 595 ASP A N     1 
ATOM   2055  C CA    . ASP A 1 350 ? 97.39700  116.59600 144.03600 1.000 119.28000 ? 595 ASP A CA    1 
ATOM   2056  C C     . ASP A 1 350 ? 98.85000  116.70600 143.60300 1.000 119.28000 ? 595 ASP A C     1 
ATOM   2057  O O     . ASP A 1 350 ? 99.43700  117.78900 143.63900 1.000 119.28000 ? 595 ASP A O     1 
ATOM   2058  C CB    . ASP A 1 350 ? 97.29700  115.71400 145.27100 1.000 119.28000 ? 595 ASP A CB    1 
ATOM   2059  C CG    . ASP A 1 350 ? 98.15700  116.21300 146.40300 1.000 119.28000 ? 595 ASP A CG    1 
ATOM   2060  O OD1   . ASP A 1 350 ? 97.78900  117.22400 147.03700 1.000 119.28000 ? 595 ASP A OD1   1 
ATOM   2061  O OD2   . ASP A 1 350 ? 99.21300  115.59600 146.65200 1.000 119.28000 ? 595 ASP A OD2   1 
ATOM   2062  N N     . GLU A 1 351 ? 99.47100  115.58800 143.24600 1.000 123.49000 ? 596 GLU A N     1 
ATOM   2063  C CA    . GLU A 1 351 ? 100.90700 115.60400 142.98000 1.000 123.49000 ? 596 GLU A CA    1 
ATOM   2064  C C     . GLU A 1 351 ? 101.18500 114.69400 141.78800 1.000 123.49000 ? 596 GLU A C     1 
ATOM   2065  O O     . GLU A 1 351 ? 101.56600 113.53600 141.95600 1.000 123.49000 ? 596 GLU A O     1 
ATOM   2066  C CB    . GLU A 1 351 ? 101.65500 115.17500 144.23300 1.000 123.49000 ? 596 GLU A CB    1 
ATOM   2067  C CG    . GLU A 1 351 ? 103.14900 115.38300 144.21200 1.000 123.49000 ? 596 GLU A CG    1 
ATOM   2068  C CD    . GLU A 1 351 ? 103.77600 115.11300 145.56900 1.000 123.49000 ? 596 GLU A CD    1 
ATOM   2069  O OE1   . GLU A 1 351 ? 103.03900 114.73000 146.50000 1.000 123.49000 ? 596 GLU A OE1   1 
ATOM   2070  O OE2   . GLU A 1 351 ? 105.00200 115.29600 145.71000 1.000 123.49000 ? 596 GLU A OE2   1 
ATOM   2071  N N     . PHE A 1 352 ? 101.06000 115.23900 140.58100 1.000 119.54000 ? 597 PHE A N     1 
ATOM   2072  C CA    . PHE A 1 352 ? 101.16200 114.38000 139.41200 1.000 119.54000 ? 597 PHE A CA    1 
ATOM   2073  C C     . PHE A 1 352 ? 102.59900 114.08000 139.03700 1.000 119.54000 ? 597 PHE A C     1 
ATOM   2074  O O     . PHE A 1 352 ? 102.82100 113.30300 138.10200 1.000 119.54000 ? 597 PHE A O     1 
ATOM   2075  C CB    . PHE A 1 352 ? 100.44100 114.99900 138.21100 1.000 119.54000 ? 597 PHE A CB    1 
ATOM   2076  C CG    . PHE A 1 352 ? 101.20500 116.08800 137.52700 1.000 119.54000 ? 597 PHE A CG    1 
ATOM   2077  C CD1   . PHE A 1 352 ? 101.24700 117.36000 138.06100 1.000 119.54000 ? 597 PHE A CD1   1 
ATOM   2078  C CD2   . PHE A 1 352 ? 101.81300 115.85600 136.30000 1.000 119.54000 ? 597 PHE A CD2   1 
ATOM   2079  C CE1   . PHE A 1 352 ? 101.93800 118.36900 137.42200 1.000 119.54000 ? 597 PHE A CE1   1 
ATOM   2080  C CE2   . PHE A 1 352 ? 102.50100 116.85500 135.65500 1.000 119.54000 ? 597 PHE A CE2   1 
ATOM   2081  C CZ    . PHE A 1 352 ? 102.56200 118.11600 136.21600 1.000 119.54000 ? 597 PHE A CZ    1 
ATOM   2082  N N     . ALA A 1 353 ? 103.56700 114.69800 139.71900 1.000 128.23000 ? 598 ALA A N     1 
ATOM   2083  C CA    . ALA A 1 353 ? 104.96500 114.36100 139.49400 1.000 128.23000 ? 598 ALA A CA    1 
ATOM   2084  C C     . ALA A 1 353 ? 105.23700 112.91700 139.87200 1.000 128.23000 ? 598 ALA A C     1 
ATOM   2085  O O     . ALA A 1 353 ? 105.95500 112.20800 139.15800 1.000 128.23000 ? 598 ALA A O     1 
ATOM   2086  C CB    . ALA A 1 353 ? 105.86900 115.30100 140.28700 1.000 128.23000 ? 598 ALA A CB    1 
ATOM   2087  N N     . ASP A 1 354 ? 104.62800 112.46100 140.97000 1.000 135.43000 ? 599 ASP A N     1 
ATOM   2088  C CA    . ASP A 1 354 ? 104.71700 111.06300 141.37400 1.000 135.43000 ? 599 ASP A CA    1 
ATOM   2089  C C     . ASP A 1 354 ? 104.13500 110.14400 140.30700 1.000 135.43000 ? 599 ASP A C     1 
ATOM   2090  O O     . ASP A 1 354 ? 104.73500 109.11400 139.97300 1.000 135.43000 ? 599 ASP A O     1 
ATOM   2091  C CB    . ASP A 1 354 ? 103.98500 110.87800 142.70300 1.000 135.43000 ? 599 ASP A CB    1 
ATOM   2092  C CG    . ASP A 1 354 ? 104.28600 109.55400 143.36800 1.000 135.43000 ? 599 ASP A CG    1 
ATOM   2093  O OD1   . ASP A 1 354 ? 105.10700 108.77600 142.84600 1.000 135.43000 ? 599 ASP A OD1   1 
ATOM   2094  O OD2   . ASP A 1 354 ? 103.68600 109.28100 144.42600 1.000 135.43000 ? 599 ASP A OD2   1 
ATOM   2095  N N     . MET A 1 355 ? 102.99300 110.52700 139.73000 1.000 135.32000 ? 600 MET A N     1 
ATOM   2096  C CA    . MET A 1 355 ? 102.33600 109.68600 138.73700 1.000 135.32000 ? 600 MET A CA    1 
ATOM   2097  C C     . MET A 1 355 ? 103.13100 109.61800 137.44500 1.000 135.32000 ? 600 MET A C     1 
ATOM   2098  O O     . MET A 1 355 ? 103.27800 108.54000 136.86100 1.000 135.32000 ? 600 MET A O     1 
ATOM   2099  C CB    . MET A 1 355 ? 100.93600 110.20700 138.45400 1.000 135.32000 ? 600 MET A CB    1 
ATOM   2100  C CG    . MET A 1 355 ? 100.01100 110.11600 139.62200 1.000 135.32000 ? 600 MET A CG    1 
ATOM   2101  S SD    . MET A 1 355 ? 98.41000  110.77400 139.17200 1.000 135.32000 ? 600 MET A SD    1 
ATOM   2102  C CE    . MET A 1 355 ? 97.82900  109.48700 138.07800 1.000 135.32000 ? 600 MET A CE    1 
ATOM   2103  N N     . MET A 1 356 ? 103.65200 110.75600 136.98500 1.000 138.92000 ? 601 MET A N     1 
ATOM   2104  C CA    . MET A 1 356 ? 104.43100 110.75100 135.75400 1.000 138.92000 ? 601 MET A CA    1 
ATOM   2105  C C     . MET A 1 356 ? 105.76400 110.03700 135.94300 1.000 138.92000 ? 601 MET A C     1 
ATOM   2106  O O     . MET A 1 356 ? 106.26300 109.40900 135.00100 1.000 138.92000 ? 601 MET A O     1 
ATOM   2107  C CB    . MET A 1 356 ? 104.63200 112.18600 135.25800 1.000 138.92000 ? 601 MET A CB    1 
ATOM   2108  C CG    . MET A 1 356 ? 105.33800 112.32900 133.90700 1.000 138.92000 ? 601 MET A CG    1 
ATOM   2109  S SD    . MET A 1 356 ? 107.13800 112.47700 134.01000 1.000 138.92000 ? 601 MET A SD    1 
ATOM   2110  C CE    . MET A 1 356 ? 107.59800 112.38700 132.28400 1.000 138.92000 ? 601 MET A CE    1 
ATOM   2111  N N     . MET A 1 357 ? 106.34300 110.09300 137.14400 1.000 140.20000 ? 602 MET A N     1 
ATOM   2112  C CA    . MET A 1 357 ? 107.58300 109.36100 137.37800 1.000 140.20000 ? 602 MET A CA    1 
ATOM   2113  C C     . MET A 1 357 ? 107.34100 107.85800 137.42600 1.000 140.20000 ? 602 MET A C     1 
ATOM   2114  O O     . MET A 1 357 ? 108.00600 107.09300 136.71900 1.000 140.20000 ? 602 MET A O     1 
ATOM   2115  C CB    . MET A 1 357 ? 108.25300 109.84400 138.66300 1.000 140.20000 ? 602 MET A CB    1 
ATOM   2116  C CG    . MET A 1 357 ? 108.95100 111.18000 138.51400 1.000 140.20000 ? 602 MET A CG    1 
ATOM   2117  S SD    . MET A 1 357 ? 109.57300 111.82300 140.07300 1.000 140.20000 ? 602 MET A SD    1 
ATOM   2118  C CE    . MET A 1 357 ? 110.92800 110.70400 140.38200 1.000 140.20000 ? 602 MET A CE    1 
ATOM   2119  N N     . ILE A 1 358 ? 106.37500 107.41300 138.23500 1.000 135.49000 ? 603 ILE A N     1 
ATOM   2120  C CA    . ILE A 1 358 ? 106.27000 105.98300 138.51800 1.000 135.49000 ? 603 ILE A CA    1 
ATOM   2121  C C     . ILE A 1 358 ? 105.53400 105.22400 137.42300 1.000 135.49000 ? 603 ILE A C     1 
ATOM   2122  O O     . ILE A 1 358 ? 105.52700 103.98600 137.43600 1.000 135.49000 ? 603 ILE A O     1 
ATOM   2123  C CB    . ILE A 1 358 ? 105.62800 105.82000 139.91200 1.000 135.49000 ? 603 ILE A CB    1 
ATOM   2124  C CG1   . ILE A 1 358 ? 106.01500 104.49100 140.56000 1.000 135.49000 ? 603 ILE A CG1   1 
ATOM   2125  C CG2   . ILE A 1 358 ? 104.13400 105.89200 139.80800 1.000 135.49000 ? 603 ILE A CG2   1 
ATOM   2126  C CD1   . ILE A 1 358 ? 105.71500 104.43600 142.03200 1.000 135.49000 ? 603 ILE A CD1   1 
ATOM   2127  N N     . VAL A 1 359 ? 104.94100 105.91500 136.45100 1.000 134.80000 ? 604 VAL A N     1 
ATOM   2128  C CA    . VAL A 1 359 ? 104.35300 105.22000 135.31000 1.000 134.80000 ? 604 VAL A CA    1 
ATOM   2129  C C     . VAL A 1 359 ? 105.32300 105.25000 134.14300 1.000 134.80000 ? 604 VAL A C     1 
ATOM   2130  O O     . VAL A 1 359 ? 105.68500 104.20400 133.59100 1.000 134.80000 ? 604 VAL A O     1 
ATOM   2131  C CB    . VAL A 1 359 ? 103.00400 105.82500 134.88900 1.000 134.80000 ? 604 VAL A CB    1 
ATOM   2132  C CG1   . VAL A 1 359 ? 102.51700 105.15700 133.61300 1.000 134.80000 ? 604 VAL A CG1   1 
ATOM   2133  C CG2   . VAL A 1 359 ? 101.99100 105.64400 135.97900 1.000 134.80000 ? 604 VAL A CG2   1 
ATOM   2134  N N     . GLY A 1 360 ? 105.75100 106.44600 133.76000 1.000 135.13000 ? 605 GLY A N     1 
ATOM   2135  C CA    . GLY A 1 360 ? 106.55100 106.60000 132.56300 1.000 135.13000 ? 605 GLY A CA    1 
ATOM   2136  C C     . GLY A 1 360 ? 106.03500 107.69400 131.65500 1.000 135.13000 ? 605 GLY A C     1 
ATOM   2137  O O     . GLY A 1 360 ? 106.03900 108.86900 132.02900 1.000 135.13000 ? 605 GLY A O     1 
ATOM   2138  N N     . LYS A 1 361 ? 105.59600 107.33000 130.45500 1.000 132.77000 ? 606 LYS A N     1 
ATOM   2139  C CA    . LYS A 1 361 ? 105.10900 108.30500 129.49600 1.000 132.77000 ? 606 LYS A CA    1 
ATOM   2140  C C     . LYS A 1 361 ? 103.66100 108.08500 129.09700 1.000 132.77000 ? 606 LYS A C     1 
ATOM   2141  O O     . LYS A 1 361 ? 103.10800 108.91300 128.36700 1.000 132.77000 ? 606 LYS A O     1 
ATOM   2142  C CB    . LYS A 1 361 ? 105.99500 108.29800 128.24700 1.000 132.77000 ? 606 LYS A CB    1 
ATOM   2143  C CG    . LYS A 1 361 ? 107.41100 108.77800 128.51200 1.000 132.77000 ? 606 LYS A CG    1 
ATOM   2144  C CD    . LYS A 1 361 ? 108.26400 108.73000 127.25400 1.000 132.77000 ? 606 LYS A CD    1 
ATOM   2145  C CE    . LYS A 1 361 ? 109.70000 109.15100 127.53600 1.000 132.77000 ? 606 LYS A CE    1 
ATOM   2146  N NZ    . LYS A 1 361 ? 110.56300 109.06900 126.32200 1.000 132.77000 ? 606 LYS A NZ    1 
ATOM   2147  N N     . LYS A 1 362 ? 103.02900 107.00700 129.57000 1.000 133.26000 ? 607 LYS A N     1 
ATOM   2148  C CA    . LYS A 1 362 ? 101.63300 106.72800 129.23500 1.000 133.26000 ? 607 LYS A CA    1 
ATOM   2149  C C     . LYS A 1 362 ? 100.70100 107.78800 129.81000 1.000 133.26000 ? 607 LYS A C     1 
ATOM   2150  O O     . LYS A 1 362 ? 99.87500  108.36600 129.09200 1.000 133.26000 ? 607 LYS A O     1 
ATOM   2151  C CB    . LYS A 1 362 ? 101.24700 105.34600 129.75700 1.000 133.26000 ? 607 LYS A CB    1 
ATOM   2152  C CG    . LYS A 1 362 ? 99.82000  104.95300 129.47900 1.000 133.26000 ? 607 LYS A CG    1 
ATOM   2153  C CD    . LYS A 1 362 ? 99.61800  104.68100 128.01200 1.000 133.26000 ? 607 LYS A CD    1 
ATOM   2154  C CE    . LYS A 1 362 ? 98.23700  104.12000 127.76600 1.000 133.26000 ? 607 LYS A CE    1 
ATOM   2155  N NZ    . LYS A 1 362 ? 97.99700  103.85800 126.32500 1.000 133.26000 ? 607 LYS A NZ    1 
ATOM   2156  N N     . VAL A 1 363 ? 100.83900 108.06900 131.10600 1.000 130.61000 ? 608 VAL A N     1 
ATOM   2157  C CA    . VAL A 1 363 ? 100.03000 109.09800 131.74400 1.000 130.61000 ? 608 VAL A CA    1 
ATOM   2158  C C     . VAL A 1 363 ? 100.41300 110.47800 131.22300 1.000 130.61000 ? 608 VAL A C     1 
ATOM   2159  O O     . VAL A 1 363 ? 99.55500  111.36300 131.09900 1.000 130.61000 ? 608 VAL A O     1 
ATOM   2160  C CB    . VAL A 1 363 ? 100.18100 108.97000 133.26900 1.000 130.61000 ? 608 VAL A CB    1 
ATOM   2161  C CG1   . VAL A 1 363 ? 99.38700  110.03000 134.01000 1.000 130.61000 ? 608 VAL A CG1   1 
ATOM   2162  C CG2   . VAL A 1 363 ? 99.73100  107.59800 133.69300 1.000 130.61000 ? 608 VAL A CG2   1 
ATOM   2163  N N     . GLU A 1 364 ? 101.68700 110.66700 130.86600 1.000 132.94000 ? 609 GLU A N     1 
ATOM   2164  C CA    . GLU A 1 364 ? 102.12500 111.90200 130.22000 1.000 132.94000 ? 609 GLU A CA    1 
ATOM   2165  C C     . GLU A 1 364 ? 101.41200 112.12000 128.89100 1.000 132.94000 ? 609 GLU A C     1 
ATOM   2166  O O     . GLU A 1 364 ? 101.02800 113.24700 128.56100 1.000 132.94000 ? 609 GLU A O     1 
ATOM   2167  C CB    . GLU A 1 364 ? 103.63800 111.85800 130.02200 1.000 132.94000 ? 609 GLU A CB    1 
ATOM   2168  C CG    . GLU A 1 364 ? 104.25100 113.01400 129.23500 1.000 132.94000 ? 609 GLU A CG    1 
ATOM   2169  C CD    . GLU A 1 364 ? 104.21000 114.34700 129.94900 1.000 132.94000 ? 609 GLU A CD    1 
ATOM   2170  O OE1   . GLU A 1 364 ? 104.11600 114.36900 131.19300 1.000 132.94000 ? 609 GLU A OE1   1 
ATOM   2171  O OE2   . GLU A 1 364 ? 104.31100 115.37900 129.25600 1.000 132.94000 ? 609 GLU A OE2   1 
ATOM   2172  N N     . GLU A 1 365 ? 101.19900 111.04600 128.13500 1.000 134.75000 ? 610 GLU A N     1 
ATOM   2173  C CA    . GLU A 1 365 ? 100.42100 111.13700 126.90700 1.000 134.75000 ? 610 GLU A CA    1 
ATOM   2174  C C     . GLU A 1 365 ? 98.95200  111.41200 127.20900 1.000 134.75000 ? 610 GLU A C     1 
ATOM   2175  O O     . GLU A 1 365 ? 98.29300  112.17100 126.48400 1.000 134.75000 ? 610 GLU A O     1 
ATOM   2176  C CB    . GLU A 1 365 ? 100.60000 109.84500 126.11000 1.000 134.75000 ? 610 GLU A CB    1 
ATOM   2177  C CG    . GLU A 1 365 ? 100.04800 109.84900 124.69600 1.000 134.75000 ? 610 GLU A CG    1 
ATOM   2178  C CD    . GLU A 1 365 ? 98.63400  109.32000 124.61800 1.000 134.75000 ? 610 GLU A CD    1 
ATOM   2179  O OE1   . GLU A 1 365 ? 98.26000  108.50600 125.48700 1.000 134.75000 ? 610 GLU A OE1   1 
ATOM   2180  O OE2   . GLU A 1 365 ? 97.90400  109.69900 123.67800 1.000 134.75000 ? 610 GLU A OE2   1 
ATOM   2181  N N     . LEU A 1 366 ? 98.43800  110.81700 128.29200 1.000 123.55000 ? 611 LEU A N     1 
ATOM   2182  C CA    . LEU A 1 366 ? 97.04100  111.00600 128.68300 1.000 123.55000 ? 611 LEU A CA    1 
ATOM   2183  C C     . LEU A 1 366 ? 96.73700  112.45100 129.04800 1.000 123.55000 ? 611 LEU A C     1 
ATOM   2184  O O     . LEU A 1 366 ? 95.64200  112.95000 128.76200 1.000 123.55000 ? 611 LEU A O     1 
ATOM   2185  C CB    . LEU A 1 366 ? 96.70500  110.11600 129.87100 1.000 123.55000 ? 611 LEU A CB    1 
ATOM   2186  C CG    . LEU A 1 366 ? 96.61400  108.61900 129.66900 1.000 123.55000 ? 611 LEU A CG    1 
ATOM   2187  C CD1   . LEU A 1 366 ? 96.52100  107.98000 131.02600 1.000 123.55000 ? 611 LEU A CD1   1 
ATOM   2188  C CD2   . LEU A 1 366 ? 95.39400  108.31400 128.84600 1.000 123.55000 ? 611 LEU A CD2   1 
ATOM   2189  N N     . ILE A 1 367 ? 97.68500  113.12300 129.70300 1.000 120.85000 ? 612 ILE A N     1 
ATOM   2190  C CA    . ILE A 1 367 ? 97.46400  114.49800 130.14800 1.000 120.85000 ? 612 ILE A CA    1 
ATOM   2191  C C     . ILE A 1 367 ? 97.30800  115.43600 128.96000 1.000 120.85000 ? 612 ILE A C     1 
ATOM   2192  O O     . ILE A 1 367 ? 96.38100  116.25500 128.91500 1.000 120.85000 ? 612 ILE A O     1 
ATOM   2193  C CB    . ILE A 1 367 ? 98.59700  114.94800 131.08500 1.000 120.85000 ? 612 ILE A CB    1 
ATOM   2194  C CG1   . ILE A 1 367 ? 98.56300  114.13500 132.37500 1.000 120.85000 ? 612 ILE A CG1   1 
ATOM   2195  C CG2   . ILE A 1 367 ? 98.48800  116.42100 131.40100 1.000 120.85000 ? 612 ILE A CG2   1 
ATOM   2196  C CD1   . ILE A 1 367 ? 97.25900  114.23600 133.11800 1.000 120.85000 ? 612 ILE A CD1   1 
ATOM   2197  N N     . ALA A 1 368 ? 98.18000  115.30800 127.96300 1.000 123.07000 ? 613 ALA A N     1 
ATOM   2198  C CA    . ALA A 1 368 ? 98.02900  116.11700 126.76200 1.000 123.07000 ? 613 ALA A CA    1 
ATOM   2199  C C     . ALA A 1 368 ? 96.81200  115.70600 125.95700 1.000 123.07000 ? 613 ALA A C     1 
ATOM   2200  O O     . ALA A 1 368 ? 96.18500  116.55800 125.32300 1.000 123.07000 ? 613 ALA A O     1 
ATOM   2201  C CB    . ALA A 1 368 ? 99.27100  116.01500 125.88800 1.000 123.07000 ? 613 ALA A CB    1 
ATOM   2202  N N     . ARG A 1 369 ? 96.45800  114.41700 125.97800 1.000 125.20000 ? 614 ARG A N     1 
ATOM   2203  C CA    . ARG A 1 369 ? 95.29000  113.97600 125.23100 1.000 125.20000 ? 614 ARG A CA    1 
ATOM   2204  C C     . ARG A 1 369 ? 94.00900  114.52600 125.84200 1.000 125.20000 ? 614 ARG A C     1 
ATOM   2205  O O     . ARG A 1 369 ? 93.04000  114.78300 125.11900 1.000 125.20000 ? 614 ARG A O     1 
ATOM   2206  C CB    . ARG A 1 369 ? 95.27000  112.45100 125.16500 1.000 125.20000 ? 614 ARG A CB    1 
ATOM   2207  C CG    . ARG A 1 369 ? 94.33700  111.86800 124.11600 1.000 125.20000 ? 614 ARG A CG    1 
ATOM   2208  C CD    . ARG A 1 369 ? 93.01300  111.41100 124.69500 1.000 125.20000 ? 614 ARG A CD    1 
ATOM   2209  N NE    . ARG A 1 369 ? 92.15600  110.81100 123.67700 1.000 125.20000 ? 614 ARG A NE    1 
ATOM   2210  C CZ    . ARG A 1 369 ? 91.35200  111.50300 122.87800 1.000 125.20000 ? 614 ARG A CZ    1 
ATOM   2211  N NH1   . ARG A 1 369 ? 91.29200  112.82100 122.97800 1.000 125.20000 ? 614 ARG A NH1   1 
ATOM   2212  N NH2   . ARG A 1 369 ? 90.60300  110.87800 121.98000 1.000 125.20000 ? 614 ARG A NH2   1 
ATOM   2213  N N     . ILE A 1 370 ? 93.98800  114.73000 127.15800 1.000 117.52000 ? 615 ILE A N     1 
ATOM   2214  C CA    . ILE A 1 370 ? 92.90100  115.49300 127.76100 1.000 117.52000 ? 615 ILE A CA    1 
ATOM   2215  C C     . ILE A 1 370 ? 93.00100  116.95400 127.36000 1.000 117.52000 ? 615 ILE A C     1 
ATOM   2216  O O     . ILE A 1 370 ? 92.08800  117.51300 126.74500 1.000 117.52000 ? 615 ILE A O     1 
ATOM   2217  C CB    . ILE A 1 370 ? 92.90200  115.34200 129.28900 1.000 117.52000 ? 615 ILE A CB    1 
ATOM   2218  C CG1   . ILE A 1 370 ? 92.59300  113.90400 129.68100 1.000 117.52000 ? 615 ILE A CG1   1 
ATOM   2219  C CG2   . ILE A 1 370 ? 91.88700  116.28300 129.89700 1.000 117.52000 ? 615 ILE A CG2   1 
ATOM   2220  C CD1   . ILE A 1 370 ? 91.22300  113.45700 129.25000 1.000 117.52000 ? 615 ILE A CD1   1 
ATOM   2221  N N     . ALA A 1 371 ? 94.13800  117.57700 127.65500 1.000 118.52000 ? 616 ALA A N     1 
ATOM   2222  C CA    . ALA A 1 371 ? 94.29000  119.02300 127.59000 1.000 118.52000 ? 616 ALA A CA    1 
ATOM   2223  C C     . ALA A 1 371 ? 94.37900  119.57400 126.17500 1.000 118.52000 ? 616 ALA A C     1 
ATOM   2224  O O     . ALA A 1 371 ? 94.53200  120.78900 126.01400 1.000 118.52000 ? 616 ALA A O     1 
ATOM   2225  C CB    . ALA A 1 371 ? 95.53000  119.44100 128.37300 1.000 118.52000 ? 616 ALA A CB    1 
ATOM   2226  N N     . GLN A 1 372 ? 94.31900  118.72600 125.15800 1.000 131.24000 ? 617 GLN A N     1 
ATOM   2227  C CA    . GLN A 1 372 ? 94.27500  119.18900 123.78300 1.000 131.24000 ? 617 GLN A CA    1 
ATOM   2228  C C     . GLN A 1 372 ? 92.85000  119.28400 123.24900 1.000 131.24000 ? 617 GLN A C     1 
ATOM   2229  O O     . GLN A 1 372 ? 92.60500  120.02700 122.29400 1.000 131.24000 ? 617 GLN A O     1 
ATOM   2230  C CB    . GLN A 1 372 ? 95.14800  118.25500 122.92900 1.000 131.24000 ? 617 GLN A CB    1 
ATOM   2231  C CG    . GLN A 1 372 ? 95.41100  118.66100 121.48900 1.000 131.24000 ? 617 GLN A CG    1 
ATOM   2232  C CD    . GLN A 1 372 ? 94.50600  117.94900 120.50600 1.000 131.24000 ? 617 GLN A CD    1 
ATOM   2233  O OE1   . GLN A 1 372 ? 94.13900  116.79500 120.71100 1.000 131.24000 ? 617 GLN A OE1   1 
ATOM   2234  N NE2   . GLN A 1 372 ? 94.14800  118.63000 119.43100 1.000 131.24000 ? 617 GLN A NE2   1 
ATOM   2235  N N     . LYS A 1 373 ? 91.89700  118.60600 123.88100 1.000 131.04000 ? 618 LYS A N     1 
ATOM   2236  C CA    . LYS A 1 373 ? 90.51700  118.51200 123.41100 1.000 131.04000 ? 618 LYS A CA    1 
ATOM   2237  C C     . LYS A 1 373 ? 89.53600  118.77100 124.54400 1.000 131.04000 ? 618 LYS A C     1 
ATOM   2238  O O     . LYS A 1 373 ? 88.57200  118.03100 124.73900 1.000 131.04000 ? 618 LYS A O     1 
ATOM   2239  C CB    . LYS A 1 373 ? 90.28400  117.14000 122.79100 1.000 131.04000 ? 618 LYS A CB    1 
ATOM   2240  C CG    . LYS A 1 373 ? 90.93700  116.97900 121.42900 1.000 131.04000 ? 618 LYS A CG    1 
ATOM   2241  C CD    . LYS A 1 373 ? 91.06400  115.52400 120.99300 1.000 131.04000 ? 618 LYS A CD    1 
ATOM   2242  C CE    . LYS A 1 373 ? 89.74300  114.87800 120.65100 1.000 131.04000 ? 618 LYS A CE    1 
ATOM   2243  N NZ    . LYS A 1 373 ? 89.12700  115.47600 119.44300 1.000 131.04000 ? 618 LYS A NZ    1 
ATOM   2244  N N     . ALA A 1 374 ? 89.74300  119.84900 125.29500 1.000 124.39000 ? 619 ALA A N     1 
ATOM   2245  C CA    . ALA A 1 374 ? 89.08500  119.97100 126.58800 1.000 124.39000 ? 619 ALA A CA    1 
ATOM   2246  C C     . ALA A 1 374 ? 88.18500  121.18500 126.76800 1.000 124.39000 ? 619 ALA A C     1 
ATOM   2247  O O     . ALA A 1 374 ? 87.21800  121.08200 127.52400 1.000 124.39000 ? 619 ALA A O     1 
ATOM   2248  C CB    . ALA A 1 374 ? 90.13100  119.99000 127.70600 1.000 124.39000 ? 619 ALA A CB    1 
ATOM   2249  N N     . ARG A 1 375 ? 88.48200  122.32300 126.12400 1.000 122.55000 ? 620 ARG A N     1 
ATOM   2250  C CA    . ARG A 1 375 ? 87.84900  123.59500 126.48900 1.000 122.55000 ? 620 ARG A CA    1 
ATOM   2251  C C     . ARG A 1 375 ? 86.35300  123.58900 126.20400 1.000 122.55000 ? 620 ARG A C     1 
ATOM   2252  O O     . ARG A 1 375 ? 85.56900  124.16400 126.96500 1.000 122.55000 ? 620 ARG A O     1 
ATOM   2253  C CB    . ARG A 1 375 ? 88.54100  124.75500 125.75900 1.000 122.55000 ? 620 ARG A CB    1 
ATOM   2254  C CG    . ARG A 1 375 ? 87.99000  126.16800 126.04700 1.000 122.55000 ? 620 ARG A CG    1 
ATOM   2255  C CD    . ARG A 1 375 ? 87.07200  126.68100 124.92300 1.000 122.55000 ? 620 ARG A CD    1 
ATOM   2256  N NE    . ARG A 1 375 ? 86.51800  128.01300 125.16800 1.000 122.55000 ? 620 ARG A NE    1 
ATOM   2257  C CZ    . ARG A 1 375 ? 87.08200  129.15200 124.77800 1.000 122.55000 ? 620 ARG A CZ    1 
ATOM   2258  N NH1   . ARG A 1 375 ? 88.22700  129.13800 124.11300 1.000 122.55000 ? 620 ARG A NH1   1 
ATOM   2259  N NH2   . ARG A 1 375 ? 86.49500  130.31100 125.04800 1.000 122.55000 ? 620 ARG A NH2   1 
ATOM   2260  N N     . ALA A 1 376 ? 85.93500  122.93600 125.13300 1.000 119.34000 ? 621 ALA A N     1 
ATOM   2261  C CA    . ALA A 1 376 ? 84.51700  122.74800 124.89900 1.000 119.34000 ? 621 ALA A CA    1 
ATOM   2262  C C     . ALA A 1 376 ? 84.00600  121.45200 125.49100 1.000 119.34000 ? 621 ALA A C     1 
ATOM   2263  O O     . ALA A 1 376 ? 82.79200  121.23200 125.50900 1.000 119.34000 ? 621 ALA A O     1 
ATOM   2264  C CB    . ALA A 1 376 ? 84.21500  122.77900 123.40200 1.000 119.34000 ? 621 ALA A CB    1 
ATOM   2265  N N     . ALA A 1 377 ? 84.89800  120.59600 125.97700 1.000 120.73000 ? 622 ALA A N     1 
ATOM   2266  C CA    . ALA A 1 377 ? 84.47900  119.30900 126.50100 1.000 120.73000 ? 622 ALA A CA    1 
ATOM   2267  C C     . ALA A 1 377 ? 83.85400  119.41300 127.88100 1.000 120.73000 ? 622 ALA A C     1 
ATOM   2268  O O     . ALA A 1 377 ? 83.11800  118.50900 128.28400 1.000 120.73000 ? 622 ALA A O     1 
ATOM   2269  C CB    . ALA A 1 377 ? 85.66600  118.34800 126.54600 1.000 120.73000 ? 622 ALA A CB    1 
ATOM   2270  N N     . GLY A 1 378 ? 84.11400  120.48800 128.61100 1.000 115.51000 ? 623 GLY A N     1 
ATOM   2271  C CA    . GLY A 1 378 ? 83.63000  120.54600 129.97500 1.000 115.51000 ? 623 GLY A CA    1 
ATOM   2272  C C     . GLY A 1 378 ? 84.38700  119.62900 130.90700 1.000 115.51000 ? 623 GLY A C     1 
ATOM   2273  O O     . GLY A 1 378 ? 83.80000  119.07900 131.84700 1.000 115.51000 ? 623 GLY A O     1 
ATOM   2274  N N     . ILE A 1 379 ? 85.67200  119.42600 130.64800 1.000 112.53000 ? 624 ILE A N     1 
ATOM   2275  C CA    . ILE A 1 379 ? 86.56800  118.73200 131.55700 1.000 112.53000 ? 624 ILE A CA    1 
ATOM   2276  C C     . ILE A 1 379 ? 87.77000  119.63600 131.73700 1.000 112.53000 ? 624 ILE A C     1 
ATOM   2277  O O     . ILE A 1 379 ? 88.52600  119.86700 130.78700 1.000 112.53000 ? 624 ILE A O     1 
ATOM   2278  C CB    . ILE A 1 379 ? 86.99300  117.35200 131.05100 1.000 112.53000 ? 624 ILE A CB    1 
ATOM   2279  C CG1   . ILE A 1 379 ? 85.81300  116.38700 131.07200 1.000 112.53000 ? 624 ILE A CG1   1 
ATOM   2280  C CG2   . ILE A 1 379 ? 88.09400  116.79800 131.91500 1.000 112.53000 ? 624 ILE A CG2   1 
ATOM   2281  C CD1   . ILE A 1 379 ? 85.05700  116.27900 129.77400 1.000 112.53000 ? 624 ILE A CD1   1 
ATOM   2282  N N     . HIS A 1 380 ? 87.93800  120.16400 132.93600 1.000 104.40000 ? 625 HIS A N     1 
ATOM   2283  C CA    . HIS A 1 380 ? 89.00700  121.10000 133.21700 1.000 104.40000 ? 625 HIS A CA    1 
ATOM   2284  C C     . HIS A 1 380 ? 90.00100  120.47000 134.17400 1.000 104.40000 ? 625 HIS A C     1 
ATOM   2285  O O     . HIS A 1 380 ? 89.64400  119.65800 135.03100 1.000 104.40000 ? 625 HIS A O     1 
ATOM   2286  C CB    . HIS A 1 380 ? 88.43700  122.38200 133.80000 1.000 104.40000 ? 625 HIS A CB    1 
ATOM   2287  C CG    . HIS A 1 380 ? 87.49000  123.07200 132.87800 1.000 104.40000 ? 625 HIS A CG    1 
ATOM   2288  N ND1   . HIS A 1 380 ? 86.16800  122.70400 132.76800 1.000 104.40000 ? 625 HIS A ND1   1 
ATOM   2289  C CD2   . HIS A 1 380 ? 87.66600  124.10700 132.02600 1.000 104.40000 ? 625 HIS A CD2   1 
ATOM   2290  C CE1   . HIS A 1 380 ? 85.57000  123.48100 131.88500 1.000 104.40000 ? 625 HIS A CE1   1 
ATOM   2291  N NE2   . HIS A 1 380 ? 86.45700  124.34100 131.42000 1.000 104.40000 ? 625 HIS A NE2   1 
ATOM   2292  N N     . LEU A 1 381 ? 91.25700  120.85100 134.01900 1.000 98.10000  ? 626 LEU A N     1 
ATOM   2293  C CA    . LEU A 1 381 ? 92.36000  120.17200 134.66700 1.000 98.10000  ? 626 LEU A CA    1 
ATOM   2294  C C     . LEU A 1 381 ? 93.02600  121.10500 135.65900 1.000 98.10000  ? 626 LEU A C     1 
ATOM   2295  O O     . LEU A 1 381 ? 93.38000  122.23600 135.31500 1.000 98.10000  ? 626 LEU A O     1 
ATOM   2296  C CB    . LEU A 1 381 ? 93.36600  119.69500 133.63000 1.000 98.10000  ? 626 LEU A CB    1 
ATOM   2297  C CG    . LEU A 1 381 ? 94.53400  118.90000 134.17700 1.000 98.10000  ? 626 LEU A CG    1 
ATOM   2298  C CD1   . LEU A 1 381 ? 94.00100  117.65500 134.81700 1.000 98.10000  ? 626 LEU A CD1   1 
ATOM   2299  C CD2   . LEU A 1 381 ? 95.48900  118.55500 133.06200 1.000 98.10000  ? 626 LEU A CD2   1 
ATOM   2300  N N     . ILE A 1 382 ? 93.18400  120.63400 136.88800 1.000 97.68000  ? 627 ILE A N     1 
ATOM   2301  C CA    . ILE A 1 382 ? 93.95300  121.32500 137.91000 1.000 97.68000  ? 627 ILE A CA    1 
ATOM   2302  C C     . ILE A 1 382 ? 95.11500  120.42000 138.26100 1.000 97.68000  ? 627 ILE A C     1 
ATOM   2303  O O     . ILE A 1 382 ? 94.91100  119.25900 138.63300 1.000 97.68000  ? 627 ILE A O     1 
ATOM   2304  C CB    . ILE A 1 382 ? 93.11600  121.63100 139.15700 1.000 97.68000  ? 627 ILE A CB    1 
ATOM   2305  C CG1   . ILE A 1 382 ? 91.85200  122.39200 138.78600 1.000 97.68000  ? 627 ILE A CG1   1 
ATOM   2306  C CG2   . ILE A 1 382 ? 93.92200  122.44200 140.13900 1.000 97.68000  ? 627 ILE A CG2   1 
ATOM   2307  C CD1   . ILE A 1 382 ? 92.11700  123.70800 138.14900 1.000 97.68000  ? 627 ILE A CD1   1 
ATOM   2308  N N     . LEU A 1 383 ? 96.32700  120.93400 138.13700 1.000 97.62000  ? 628 LEU A N     1 
ATOM   2309  C CA    . LEU A 1 383 ? 97.50600  120.15500 138.45500 1.000 97.62000  ? 628 LEU A CA    1 
ATOM   2310  C C     . LEU A 1 383 ? 98.34700  120.86700 139.49800 1.000 97.62000  ? 628 LEU A C     1 
ATOM   2311  O O     . LEU A 1 383 ? 98.42000  122.09700 139.53300 1.000 97.62000  ? 628 LEU A O     1 
ATOM   2312  C CB    . LEU A 1 383 ? 98.36000  119.90000 137.22700 1.000 97.62000  ? 628 LEU A CB    1 
ATOM   2313  C CG    . LEU A 1 383 ? 97.71100  119.07500 136.13000 1.000 97.62000  ? 628 LEU A CG    1 
ATOM   2314  C CD1   . LEU A 1 383 ? 98.66300  118.91500 134.97200 1.000 97.62000  ? 628 LEU A CD1   1 
ATOM   2315  C CD2   . LEU A 1 383 ? 97.30700  117.73700 136.66000 1.000 97.62000  ? 628 LEU A CD2   1 
ATOM   2316  N N     . ALA A 1 384 ? 98.98900  120.07300 140.34100 1.000 105.04000 ? 629 ALA A N     1 
ATOM   2317  C CA    . ALA A 1 384 ? 99.97600  120.58600 141.26800 1.000 105.04000 ? 629 ALA A CA    1 
ATOM   2318  C C     . ALA A 1 384 ? 101.12200 119.59400 141.34600 1.000 105.04000 ? 629 ALA A C     1 
ATOM   2319  O O     . ALA A 1 384 ? 100.92300 118.38600 141.21800 1.000 105.04000 ? 629 ALA A O     1 
ATOM   2320  C CB    . ALA A 1 384 ? 99.37500  120.83900 142.64600 1.000 105.04000 ? 629 ALA A CB    1 
ATOM   2321  N N     . THR A 1 385 ? 102.32700 120.11700 141.53600 1.000 110.23000 ? 630 THR A N     1 
ATOM   2322  C CA    . THR A 1 385 ? 103.53400 119.30500 141.56500 1.000 110.23000 ? 630 THR A CA    1 
ATOM   2323  C C     . THR A 1 385 ? 104.42100 119.80300 142.69100 1.000 110.23000 ? 630 THR A C     1 
ATOM   2324  O O     . THR A 1 385 ? 104.01100 120.62400 143.51400 1.000 110.23000 ? 630 THR A O     1 
ATOM   2325  C CB    . THR A 1 385 ? 104.26000 119.35700 140.21700 1.000 110.23000 ? 630 THR A CB    1 
ATOM   2326  O OG1   . THR A 1 385 ? 105.46700 118.59200 140.29600 1.000 110.23000 ? 630 THR A OG1   1 
ATOM   2327  C CG2   . THR A 1 385 ? 104.59400 120.77800 139.85900 1.000 110.23000 ? 630 THR A CG2   1 
ATOM   2328  N N     . GLN A 1 386 ? 105.63300 119.29100 142.74400 1.000 119.85000 ? 631 GLN A N     1 
ATOM   2329  C CA    . GLN A 1 386 ? 106.63000 119.90700 143.60800 1.000 119.85000 ? 631 GLN A CA    1 
ATOM   2330  C C     . GLN A 1 386 ? 107.89400 120.29800 142.86800 1.000 119.85000 ? 631 GLN A C     1 
ATOM   2331  O O     . GLN A 1 386 ? 108.43100 121.37800 143.11800 1.000 119.85000 ? 631 GLN A O     1 
ATOM   2332  C CB    . GLN A 1 386 ? 106.96900 119.00000 144.77800 1.000 119.85000 ? 631 GLN A CB    1 
ATOM   2333  C CG    . GLN A 1 386 ? 105.83400 118.88500 145.75200 1.000 119.85000 ? 631 GLN A CG    1 
ATOM   2334  C CD    . GLN A 1 386 ? 106.21000 118.09700 146.96600 1.000 119.85000 ? 631 GLN A CD    1 
ATOM   2335  O OE1   . GLN A 1 386 ? 107.31900 117.58300 147.05800 1.000 119.85000 ? 631 GLN A OE1   1 
ATOM   2336  N NE2   . GLN A 1 386 ? 105.29100 117.99900 147.91800 1.000 119.85000 ? 631 GLN A NE2   1 
ATOM   2337  N N     . ARG A 1 387 ? 108.38600 119.45900 141.96100 1.000 123.47000 ? 632 ARG A N     1 
ATOM   2338  C CA    . ARG A 1 387 ? 109.37600 119.93700 141.02000 1.000 123.47000 ? 632 ARG A CA    1 
ATOM   2339  C C     . ARG A 1 387 ? 108.65600 120.30700 139.73400 1.000 123.47000 ? 632 ARG A C     1 
ATOM   2340  O O     . ARG A 1 387 ? 107.89800 119.49000 139.19100 1.000 123.47000 ? 632 ARG A O     1 
ATOM   2341  C CB    . ARG A 1 387 ? 110.49800 118.91300 140.78300 1.000 123.47000 ? 632 ARG A CB    1 
ATOM   2342  C CG    . ARG A 1 387 ? 110.17400 117.53000 140.21400 1.000 123.47000 ? 632 ARG A CG    1 
ATOM   2343  C CD    . ARG A 1 387 ? 110.44400 117.47600 138.71400 1.000 123.47000 ? 632 ARG A CD    1 
ATOM   2344  N NE    . ARG A 1 387 ? 110.15500 116.17000 138.12400 1.000 123.47000 ? 632 ARG A NE    1 
ATOM   2345  C CZ    . ARG A 1 387 ? 111.06600 115.24600 137.83000 1.000 123.47000 ? 632 ARG A CZ    1 
ATOM   2346  N NH1   . ARG A 1 387 ? 112.34900 115.48000 138.04400 1.000 123.47000 ? 632 ARG A NH1   1 
ATOM   2347  N NH2   . ARG A 1 387 ? 110.69300 114.09200 137.29700 1.000 123.47000 ? 632 ARG A NH2   1 
ATOM   2348  N N     . PRO A 1 388 ? 108.73900 121.56000 139.29900 1.000 118.49000 ? 633 PRO A N     1 
ATOM   2349  C CA    . PRO A 1 388 ? 108.10800 121.96500 138.03900 1.000 118.49000 ? 633 PRO A CA    1 
ATOM   2350  C C     . PRO A 1 388 ? 108.99400 121.82600 136.81500 1.000 118.49000 ? 633 PRO A C     1 
ATOM   2351  O O     . PRO A 1 388 ? 108.65400 122.39400 135.77500 1.000 118.49000 ? 633 PRO A O     1 
ATOM   2352  C CB    . PRO A 1 388 ? 107.79400 123.44300 138.29300 1.000 118.49000 ? 633 PRO A CB    1 
ATOM   2353  C CG    . PRO A 1 388 ? 108.84200 123.88200 139.23200 1.000 118.49000 ? 633 PRO A CG    1 
ATOM   2354  C CD    . PRO A 1 388 ? 109.12700 122.71800 140.12200 1.000 118.49000 ? 633 PRO A CD    1 
ATOM   2355  N N     . SER A 1 389 ? 110.10400 121.10200 136.91700 1.000 130.87000 ? 634 SER A N     1 
ATOM   2356  C CA    . SER A 1 389 ? 111.09900 121.09500 135.86000 1.000 130.87000 ? 634 SER A CA    1 
ATOM   2357  C C     . SER A 1 389 ? 110.60000 120.31600 134.65100 1.000 130.87000 ? 634 SER A C     1 
ATOM   2358  O O     . SER A 1 389 ? 109.58200 119.62300 134.69200 1.000 130.87000 ? 634 SER A O     1 
ATOM   2359  C CB    . SER A 1 389 ? 112.41300 120.49600 136.35500 1.000 130.87000 ? 634 SER A CB    1 
ATOM   2360  O OG    . SER A 1 389 ? 113.36700 120.45100 135.31000 1.000 130.87000 ? 634 SER A OG    1 
ATOM   2361  N N     . VAL A 1 390 ? 111.37300 120.40000 133.57000 1.000 133.54000 ? 635 VAL A N     1 
ATOM   2362  C CA    . VAL A 1 390 ? 110.95700 119.87900 132.27400 1.000 133.54000 ? 635 VAL A CA    1 
ATOM   2363  C C     . VAL A 1 390 ? 111.10300 118.36500 132.22700 1.000 133.54000 ? 635 VAL A C     1 
ATOM   2364  O O     . VAL A 1 390 ? 110.76200 117.73100 131.22400 1.000 133.54000 ? 635 VAL A O     1 
ATOM   2365  C CB    . VAL A 1 390 ? 111.75400 120.53900 131.13800 1.000 133.54000 ? 635 VAL A CB    1 
ATOM   2366  C CG1   . VAL A 1 390 ? 111.55500 122.03600 131.17000 1.000 133.54000 ? 635 VAL A CG1   1 
ATOM   2367  C CG2   . VAL A 1 390 ? 113.21300 120.19300 131.25500 1.000 133.54000 ? 635 VAL A CG2   1 
ATOM   2368  N N     . ASP A 1 391 ? 111.62500 117.77500 133.30200 1.000 125.66000 ? 636 ASP A N     1 
ATOM   2369  C CA    . ASP A 1 391 ? 111.59200 116.32900 133.43200 1.000 125.66000 ? 636 ASP A CA    1 
ATOM   2370  C C     . ASP A 1 391 ? 110.17200 115.81800 133.61000 1.000 125.66000 ? 636 ASP A C     1 
ATOM   2371  O O     . ASP A 1 391 ? 109.87500 114.68300 133.22600 1.000 125.66000 ? 636 ASP A O     1 
ATOM   2372  C CB    . ASP A 1 391 ? 112.46200 115.89300 134.60400 1.000 125.66000 ? 636 ASP A CB    1 
ATOM   2373  C CG    . ASP A 1 391 ? 113.93200 116.11000 134.33900 1.000 125.66000 ? 636 ASP A CG    1 
ATOM   2374  O OD1   . ASP A 1 391 ? 114.33400 116.06500 133.15800 1.000 125.66000 ? 636 ASP A OD1   1 
ATOM   2375  O OD2   . ASP A 1 391 ? 114.68600 116.32500 135.31000 1.000 125.66000 ? 636 ASP A OD2   1 
ATOM   2376  N N     . VAL A 1 392 ? 109.28100 116.62900 134.17600 1.000 127.23000 ? 637 VAL A N     1 
ATOM   2377  C CA    . VAL A 1 392 ? 107.90900 116.20800 134.38400 1.000 127.23000 ? 637 VAL A CA    1 
ATOM   2378  C C     . VAL A 1 392 ? 106.90500 117.06700 133.61300 1.000 127.23000 ? 637 VAL A C     1 
ATOM   2379  O O     . VAL A 1 392 ? 105.83500 116.56800 133.24600 1.000 127.23000 ? 637 VAL A O     1 
ATOM   2380  C CB    . VAL A 1 392 ? 107.58100 116.17600 135.89500 1.000 127.23000 ? 637 VAL A CB    1 
ATOM   2381  C CG1   . VAL A 1 392 ? 107.48900 117.56800 136.48700 1.000 127.23000 ? 637 VAL A CG1   1 
ATOM   2382  C CG2   . VAL A 1 392 ? 106.34000 115.36100 136.18700 1.000 127.23000 ? 637 VAL A CG2   1 
ATOM   2383  N N     . ILE A 1 393 ? 107.23400 118.32000 133.30000 1.000 126.50000 ? 638 ILE A N     1 
ATOM   2384  C CA    . ILE A 1 393 ? 106.34800 119.14600 132.48900 1.000 126.50000 ? 638 ILE A CA    1 
ATOM   2385  C C     . ILE A 1 393 ? 107.08200 119.47400 131.20000 1.000 126.50000 ? 638 ILE A C     1 
ATOM   2386  O O     . ILE A 1 393 ? 107.84100 120.44600 131.12100 1.000 126.50000 ? 638 ILE A O     1 
ATOM   2387  C CB    . ILE A 1 393 ? 105.90900 120.41700 133.23400 1.000 126.50000 ? 638 ILE A CB    1 
ATOM   2388  C CG1   . ILE A 1 393 ? 105.18000 120.03500 134.51500 1.000 126.50000 ? 638 ILE A CG1   1 
ATOM   2389  C CG2   . ILE A 1 393 ? 104.96900 121.24300 132.37900 1.000 126.50000 ? 638 ILE A CG2   1 
ATOM   2390  C CD1   . ILE A 1 393 ? 104.94000 121.19400 135.42700 1.000 126.50000 ? 638 ILE A CD1   1 
ATOM   2391  N N     . THR A 1 394 ? 106.87800 118.64600 130.19000 1.000 126.10000 ? 639 THR A N     1 
ATOM   2392  C CA    . THR A 1 394 ? 107.56100 118.82600 128.92800 1.000 126.10000 ? 639 THR A CA    1 
ATOM   2393  C C     . THR A 1 394 ? 106.78900 119.81100 128.06500 1.000 126.10000 ? 639 THR A C     1 
ATOM   2394  O O     . THR A 1 394 ? 105.75800 120.35200 128.46300 1.000 126.10000 ? 639 THR A O     1 
ATOM   2395  C CB    . THR A 1 394 ? 107.70500 117.48600 128.22200 1.000 126.10000 ? 639 THR A CB    1 
ATOM   2396  O OG1   . THR A 1 394 ? 106.40200 116.97500 127.92300 1.000 126.10000 ? 639 THR A OG1   1 
ATOM   2397  C CG2   . THR A 1 394 ? 108.41300 116.50100 129.12800 1.000 126.10000 ? 639 THR A CG2   1 
ATOM   2398  N N     . GLY A 1 395 ? 107.28200 120.02600 126.84600 1.000 128.51000 ? 640 GLY A N     1 
ATOM   2399  C CA    . GLY A 1 395 ? 106.54200 120.81300 125.88100 1.000 128.51000 ? 640 GLY A CA    1 
ATOM   2400  C C     . GLY A 1 395 ? 105.31500 120.11100 125.35000 1.000 128.51000 ? 640 GLY A C     1 
ATOM   2401  O O     . GLY A 1 395 ? 104.45300 120.75800 124.75000 1.000 128.51000 ? 640 GLY A O     1 
ATOM   2402  N N     . LEU A 1 396 ? 105.22200 118.79900 125.56200 1.000 133.26000 ? 641 LEU A N     1 
ATOM   2403  C CA    . LEU A 1 396 ? 104.02500 118.03800 125.23600 1.000 133.26000 ? 641 LEU A CA    1 
ATOM   2404  C C     . LEU A 1 396 ? 102.82300 118.44400 126.08600 1.000 133.26000 ? 641 LEU A C     1 
ATOM   2405  O O     . LEU A 1 396 ? 101.68400 118.24500 125.65800 1.000 133.26000 ? 641 LEU A O     1 
ATOM   2406  C CB    . LEU A 1 396 ? 104.35200 116.54800 125.38000 1.000 133.26000 ? 641 LEU A CB    1 
ATOM   2407  C CG    . LEU A 1 396 ? 103.38600 115.41400 125.05600 1.000 133.26000 ? 641 LEU A CG    1 
ATOM   2408  C CD1   . LEU A 1 396 ? 104.15700 114.27100 124.42900 1.000 133.26000 ? 641 LEU A CD1   1 
ATOM   2409  C CD2   . LEU A 1 396 ? 102.75100 114.93000 126.33300 1.000 133.26000 ? 641 LEU A CD2   1 
ATOM   2410  N N     . ILE A 1 397 ? 103.04400 119.01700 127.26400 1.000 122.05000 ? 642 ILE A N     1 
ATOM   2411  C CA    . ILE A 1 397 ? 101.97500 119.59400 128.06300 1.000 122.05000 ? 642 ILE A CA    1 
ATOM   2412  C C     . ILE A 1 397 ? 101.94800 121.11200 127.94500 1.000 122.05000 ? 642 ILE A C     1 
ATOM   2413  O O     . ILE A 1 397 ? 100.87300 121.70800 127.85900 1.000 122.05000 ? 642 ILE A O     1 
ATOM   2414  C CB    . ILE A 1 397 ? 102.12900 119.14800 129.53400 1.000 122.05000 ? 642 ILE A CB    1 
ATOM   2415  C CG1   . ILE A 1 397 ? 101.88500 117.65000 129.66600 1.000 122.05000 ? 642 ILE A CG1   1 
ATOM   2416  C CG2   . ILE A 1 397 ? 101.19500 119.88400 130.46200 1.000 122.05000 ? 642 ILE A CG2   1 
ATOM   2417  C CD1   . ILE A 1 397 ? 102.17400 117.12400 131.05300 1.000 122.05000 ? 642 ILE A CD1   1 
ATOM   2418  N N     . LYS A 1 398 ? 103.13600 121.71700 127.82900 1.000 120.36000 ? 643 LYS A N     1 
ATOM   2419  C CA    . LYS A 1 398 ? 103.36200 123.12700 128.13400 1.000 120.36000 ? 643 LYS A CA    1 
ATOM   2420  C C     . LYS A 1 398 ? 102.56900 124.07100 127.24500 1.000 120.36000 ? 643 LYS A C     1 
ATOM   2421  O O     . LYS A 1 398 ? 102.27900 125.19300 127.66100 1.000 120.36000 ? 643 LYS A O     1 
ATOM   2422  C CB    . LYS A 1 398 ? 104.85700 123.42500 128.01900 1.000 120.36000 ? 643 LYS A CB    1 
ATOM   2423  C CG    . LYS A 1 398 ? 105.35000 124.66600 128.74400 1.000 120.36000 ? 643 LYS A CG    1 
ATOM   2424  C CD    . LYS A 1 398 ? 105.47600 125.88000 127.84400 1.000 120.36000 ? 643 LYS A CD    1 
ATOM   2425  C CE    . LYS A 1 398 ? 106.16700 127.02300 128.57300 1.000 120.36000 ? 643 LYS A CE    1 
ATOM   2426  N NZ    . LYS A 1 398 ? 105.37200 127.54300 129.72100 1.000 120.36000 ? 643 LYS A NZ    1 
ATOM   2427  N N     . ALA A 1 399 ? 102.18300 123.64700 126.05200 1.000 120.33000 ? 644 ALA A N     1 
ATOM   2428  C CA    . ALA A 1 399 ? 101.33200 124.48700 125.22600 1.000 120.33000 ? 644 ALA A CA    1 
ATOM   2429  C C     . ALA A 1 399 ? 99.85500  124.18000 125.39500 1.000 120.33000 ? 644 ALA A C     1 
ATOM   2430  O O     . ALA A 1 399 ? 99.02400  124.92300 124.86700 1.000 120.33000 ? 644 ALA A O     1 
ATOM   2431  C CB    . ALA A 1 399 ? 101.70900 124.34300 123.75100 1.000 120.33000 ? 644 ALA A CB    1 
ATOM   2432  N N     . ASN A 1 400 ? 99.50800  123.11600 126.10800 1.000 115.81000 ? 645 ASN A N     1 
ATOM   2433  C CA    . ASN A 1 400 ? 98.11600  122.74800 126.29600 1.000 115.81000 ? 645 ASN A CA    1 
ATOM   2434  C C     . ASN A 1 400 ? 97.53900  123.22300 127.62000 1.000 115.81000 ? 645 ASN A C     1 
ATOM   2435  O O     . ASN A 1 400 ? 96.34700  123.02300 127.86200 1.000 115.81000 ? 645 ASN A O     1 
ATOM   2436  C CB    . ASN A 1 400 ? 97.95100  121.23700 126.17500 1.000 115.81000 ? 645 ASN A CB    1 
ATOM   2437  C CG    . ASN A 1 400 ? 97.98500  120.76900 124.74400 1.000 115.81000 ? 645 ASN A CG    1 
ATOM   2438  O OD1   . ASN A 1 400 ? 97.38300  121.38800 123.87100 1.000 115.81000 ? 645 ASN A OD1   1 
ATOM   2439  N ND2   . ASN A 1 400 ? 98.68800  119.67300 124.49000 1.000 115.81000 ? 645 ASN A ND2   1 
ATOM   2440  N N     . ILE A 1 401 ? 98.34500  123.82700 128.48600 1.000 100.11000 ? 646 ILE A N     1 
ATOM   2441  C CA    . ILE A 1 401 ? 97.82600  124.46400 129.69300 1.000 100.11000 ? 646 ILE A CA    1 
ATOM   2442  C C     . ILE A 1 401 ? 98.32000  125.90400 129.70100 1.000 100.11000 ? 646 ILE A C     1 
ATOM   2443  O O     . ILE A 1 401 ? 99.48500  126.16000 130.03000 1.000 100.11000 ? 646 ILE A O     1 
ATOM   2444  C CB    . ILE A 1 401 ? 98.24400  123.71400 130.96400 1.000 100.11000 ? 646 ILE A CB    1 
ATOM   2445  C CG1   . ILE A 1 401 ? 97.63700  122.31800 130.97900 1.000 100.11000 ? 646 ILE A CG1   1 
ATOM   2446  C CG2   . ILE A 1 401 ? 97.76300  124.44600 132.19100 1.000 100.11000 ? 646 ILE A CG2   1 
ATOM   2447  C CD1   . ILE A 1 401 ? 98.17900  121.45000 132.06800 1.000 100.11000 ? 646 ILE A CD1   1 
ATOM   2448  N N     . PRO A 1 402 ? 97.50300  126.84900 129.28700 1.000 93.96000  ? 647 PRO A N     1 
ATOM   2449  C CA    . PRO A 1 402 ? 97.95000  128.24100 129.24100 1.000 93.96000  ? 647 PRO A CA    1 
ATOM   2450  C C     . PRO A 1 402 ? 98.17300  128.83900 130.61300 1.000 93.96000  ? 647 PRO A C     1 
ATOM   2451  O O     . PRO A 1 402 ? 99.27400  129.30600 130.90800 1.000 93.96000  ? 647 PRO A O     1 
ATOM   2452  C CB    . PRO A 1 402 ? 96.80200  128.95000 128.51800 1.000 93.96000  ? 647 PRO A CB    1 
ATOM   2453  C CG    . PRO A 1 402 ? 96.10500  127.87800 127.77700 1.000 93.96000  ? 647 PRO A CG    1 
ATOM   2454  C CD    . PRO A 1 402 ? 96.19600  126.67700 128.64600 1.000 93.96000  ? 647 PRO A CD    1 
ATOM   2455  N N     . THR A 1 403 ? 97.15400  128.79700 131.46700 1.000 99.66000  ? 648 THR A N     1 
ATOM   2456  C CA    . THR A 1 403 ? 97.15600  129.54900 132.71600 1.000 99.66000  ? 648 THR A CA    1 
ATOM   2457  C C     . THR A 1 403 ? 97.89000  128.78700 133.80600 1.000 99.66000  ? 648 THR A C     1 
ATOM   2458  O O     . THR A 1 403 ? 97.55300  127.64200 134.10900 1.000 99.66000  ? 648 THR A O     1 
ATOM   2459  C CB    . THR A 1 403 ? 95.73200  129.84400 133.17000 1.000 99.66000  ? 648 THR A CB    1 
ATOM   2460  O OG1   . THR A 1 403 ? 95.08500  130.68600 132.21100 1.000 99.66000  ? 648 THR A OG1   1 
ATOM   2461  C CG2   . THR A 1 403 ? 95.73800  130.52500 134.51100 1.000 99.66000  ? 648 THR A CG2   1 
ATOM   2462  N N     . ARG A 1 404 ? 98.88100  129.42700 134.40100 1.000 100.78000 ? 649 ARG A N     1 
ATOM   2463  C CA    . ARG A 1 404 ? 99.72000  128.77800 135.38300 1.000 100.78000 ? 649 ARG A CA    1 
ATOM   2464  C C     . ARG A 1 404 ? 99.75500  129.59600 136.65900 1.000 100.78000 ? 649 ARG A C     1 
ATOM   2465  O O     . ARG A 1 404 ? 99.56800  130.81200 136.64100 1.000 100.78000 ? 649 ARG A O     1 
ATOM   2466  C CB    . ARG A 1 404 ? 101.11900 128.60600 134.84800 1.000 100.78000 ? 649 ARG A CB    1 
ATOM   2467  C CG    . ARG A 1 404 ? 101.17900 127.66300 133.68700 1.000 100.78000 ? 649 ARG A CG    1 
ATOM   2468  C CD    . ARG A 1 404 ? 102.56700 127.58000 133.11900 1.000 100.78000 ? 649 ARG A CD    1 
ATOM   2469  N NE    . ARG A 1 404 ? 102.62800 126.60700 132.04400 1.000 100.78000 ? 649 ARG A NE    1 
ATOM   2470  C CZ    . ARG A 1 404 ? 102.40100 126.89400 130.77200 1.000 100.78000 ? 649 ARG A CZ    1 
ATOM   2471  N NH1   . ARG A 1 404 ? 102.09800 128.13000 130.40700 1.000 100.78000 ? 649 ARG A NH1   1 
ATOM   2472  N NH2   . ARG A 1 404 ? 102.47100 125.93900 129.86800 1.000 100.78000 ? 649 ARG A NH2   1 
ATOM   2473  N N     . ILE A 1 405 ? 99.98500  128.90700 137.76900 1.000 97.13000  ? 650 ILE A N     1 
ATOM   2474  C CA    . ILE A 1 405 ? 100.21500 129.53000 139.06400 1.000 97.13000  ? 650 ILE A CA    1 
ATOM   2475  C C     . ILE A 1 405 ? 101.44900 128.88700 139.66600 1.000 97.13000  ? 650 ILE A C     1 
ATOM   2476  O O     . ILE A 1 405 ? 101.56300 127.66000 139.68300 1.000 97.13000  ? 650 ILE A O     1 
ATOM   2477  C CB    . ILE A 1 405 ? 99.00800  129.36500 140.00500 1.000 97.13000  ? 650 ILE A CB    1 
ATOM   2478  C CG1   . ILE A 1 405 ? 97.82200  130.15800 139.49200 1.000 97.13000  ? 650 ILE A CG1   1 
ATOM   2479  C CG2   . ILE A 1 405 ? 99.32400  129.83400 141.40100 1.000 97.13000  ? 650 ILE A CG2   1 
ATOM   2480  C CD1   . ILE A 1 405 ? 96.57500  129.95400 140.29000 1.000 97.13000  ? 650 ILE A CD1   1 
ATOM   2481  N N     . ALA A 1 406 ? 102.37800 129.70100 140.14400 1.000 95.73000  ? 651 ALA A N     1 
ATOM   2482  C CA    . ALA A 1 406 ? 103.54600 129.19300 140.84000 1.000 95.73000  ? 651 ALA A CA    1 
ATOM   2483  C C     . ALA A 1 406 ? 103.60500 129.80800 142.22600 1.000 95.73000  ? 651 ALA A C     1 
ATOM   2484  O O     . ALA A 1 406 ? 103.44100 131.02100 142.37400 1.000 95.73000  ? 651 ALA A O     1 
ATOM   2485  C CB    . ALA A 1 406 ? 104.82100 129.51000 140.07100 1.000 95.73000  ? 651 ALA A CB    1 
ATOM   2486  N N     . PHE A 1 407 ? 103.84400 128.98300 143.23300 1.000 94.82000  ? 652 PHE A N     1 
ATOM   2487  C CA    . PHE A 1 407 ? 104.04400 129.50400 144.57700 1.000 94.82000  ? 652 PHE A CA    1 
ATOM   2488  C C     . PHE A 1 407 ? 105.53300 129.79800 144.74700 1.000 94.82000  ? 652 PHE A C     1 
ATOM   2489  O O     . PHE A 1 407 ? 106.26200 129.90000 143.75900 1.000 94.82000  ? 652 PHE A O     1 
ATOM   2490  C CB    . PHE A 1 407 ? 103.51000 128.54200 145.64300 1.000 94.82000  ? 652 PHE A CB    1 
ATOM   2491  C CG    . PHE A 1 407 ? 102.00300 128.48500 145.74000 1.000 94.82000  ? 652 PHE A CG    1 
ATOM   2492  C CD1   . PHE A 1 407 ? 101.20300 129.23600 144.91500 1.000 94.82000  ? 652 PHE A CD1   1 
ATOM   2493  C CD2   . PHE A 1 407 ? 101.39300 127.73700 146.72500 1.000 94.82000  ? 652 PHE A CD2   1 
ATOM   2494  C CE1   . PHE A 1 407 ? 99.83100  129.20300 145.01100 1.000 94.82000  ? 652 PHE A CE1   1 
ATOM   2495  C CE2   . PHE A 1 407 ? 100.01900 127.71100 146.82800 1.000 94.82000  ? 652 PHE A CE2   1 
ATOM   2496  C CZ    . PHE A 1 407 ? 99.24100  128.44600 145.96700 1.000 94.82000  ? 652 PHE A CZ    1 
ATOM   2497  N N     . GLN A 1 408 ? 105.98800 129.98800 145.98400 1.000 105.35000 ? 653 GLN A N     1 
ATOM   2498  C CA    . GLN A 1 408 ? 107.39200 130.29200 146.23600 1.000 105.35000 ? 653 GLN A CA    1 
ATOM   2499  C C     . GLN A 1 408 ? 108.27500 129.11200 145.84000 1.000 105.35000 ? 653 GLN A C     1 
ATOM   2500  O O     . GLN A 1 408 ? 108.04900 127.97800 146.26900 1.000 105.35000 ? 653 GLN A O     1 
ATOM   2501  C CB    . GLN A 1 408 ? 107.59000 130.65800 147.70600 1.000 105.35000 ? 653 GLN A CB    1 
ATOM   2502  C CG    . GLN A 1 408 ? 108.95300 131.24600 148.04500 1.000 105.35000 ? 653 GLN A CG    1 
ATOM   2503  C CD    . GLN A 1 408 ? 109.95300 130.21700 148.53400 1.000 105.35000 ? 653 GLN A CD    1 
ATOM   2504  O OE1   . GLN A 1 408 ? 109.59000 129.24700 149.19000 1.000 105.35000 ? 653 GLN A OE1   1 
ATOM   2505  N NE2   . GLN A 1 408 ? 111.21900 130.42700 148.21300 1.000 105.35000 ? 653 GLN A NE2   1 
ATOM   2506  N N     . VAL A 1 409 ? 109.25900 129.38200 144.98800 1.000 99.19000  ? 654 VAL A N     1 
ATOM   2507  C CA    . VAL A 1 409 ? 110.09800 128.34900 144.39700 1.000 99.19000  ? 654 VAL A CA    1 
ATOM   2508  C C     . VAL A 1 409 ? 111.54700 128.61500 144.76000 1.000 99.19000  ? 654 VAL A C     1 
ATOM   2509  O O     . VAL A 1 409 ? 111.84300 129.51400 145.55300 1.000 99.19000  ? 654 VAL A O     1 
ATOM   2510  C CB    . VAL A 1 409 ? 109.92500 128.28400 142.87400 1.000 99.19000  ? 654 VAL A CB    1 
ATOM   2511  C CG1   . VAL A 1 409 ? 108.54500 127.80800 142.52600 1.000 99.19000  ? 654 VAL A CG1   1 
ATOM   2512  C CG2   . VAL A 1 409 ? 110.15800 129.64700 142.28600 1.000 99.19000  ? 654 VAL A CG2   1 
ATOM   2513  N N     . SER A 1 410 ? 112.45900 127.82900 144.19300 1.000 102.69000 ? 655 SER A N     1 
ATOM   2514  C CA    . SER A 1 410 ? 113.85900 127.87600 144.57600 1.000 102.69000 ? 655 SER A CA    1 
ATOM   2515  C C     . SER A 1 410 ? 114.78100 128.47000 143.52300 1.000 102.69000 ? 655 SER A C     1 
ATOM   2516  O O     . SER A 1 410 ? 115.91900 128.80900 143.85500 1.000 102.69000 ? 655 SER A O     1 
ATOM   2517  C CB    . SER A 1 410 ? 114.35700 126.46800 144.92300 1.000 102.69000 ? 655 SER A CB    1 
ATOM   2518  O OG    . SER A 1 410 ? 113.66800 125.95100 146.04400 1.000 102.69000 ? 655 SER A OG    1 
ATOM   2519  N N     . SER A 1 411 ? 114.34300 128.60900 142.27700 1.000 109.57000 ? 656 SER A N     1 
ATOM   2520  C CA    . SER A 1 411 ? 115.27000 129.03300 141.24000 1.000 109.57000 ? 656 SER A CA    1 
ATOM   2521  C C     . SER A 1 411 ? 114.54800 129.84900 140.18400 1.000 109.57000 ? 656 SER A C     1 
ATOM   2522  O O     . SER A 1 411 ? 113.37700 129.60600 139.88800 1.000 109.57000 ? 656 SER A O     1 
ATOM   2523  C CB    . SER A 1 411 ? 115.93600 127.83900 140.56800 1.000 109.57000 ? 656 SER A CB    1 
ATOM   2524  O OG    . SER A 1 411 ? 114.98400 127.12900 139.79900 1.000 109.57000 ? 656 SER A OG    1 
ATOM   2525  N N     . LYS A 1 412 ? 115.28000 130.79400 139.58200 1.000 112.21000 ? 657 LYS A N     1 
ATOM   2526  C CA    . LYS A 1 412 ? 114.81100 131.42200 138.35000 1.000 112.21000 ? 657 LYS A CA    1 
ATOM   2527  C C     . LYS A 1 412 ? 114.72700 130.43500 137.20000 1.000 112.21000 ? 657 LYS A C     1 
ATOM   2528  O O     . LYS A 1 412 ? 113.99300 130.69300 136.24100 1.000 112.21000 ? 657 LYS A O     1 
ATOM   2529  C CB    . LYS A 1 412 ? 115.70200 132.59600 137.94400 1.000 112.21000 ? 657 LYS A CB    1 
ATOM   2530  C CG    . LYS A 1 412 ? 115.47800 133.84900 138.75700 1.000 112.21000 ? 657 LYS A CG    1 
ATOM   2531  C CD    . LYS A 1 412 ? 116.34000 134.98600 138.27600 1.000 112.21000 ? 657 LYS A CD    1 
ATOM   2532  C CE    . LYS A 1 412 ? 116.17600 136.20400 139.16800 1.000 112.21000 ? 657 LYS A CE    1 
ATOM   2533  N NZ    . LYS A 1 412 ? 114.82800 136.81000 139.04300 1.000 112.21000 ? 657 LYS A NZ    1 
ATOM   2534  N N     . ILE A 1 413 ? 115.48200 129.33600 137.27800 1.000 118.14000 ? 658 ILE A N     1 
ATOM   2535  C CA    . ILE A 1 413 ? 115.33500 128.22000 136.34900 1.000 118.14000 ? 658 ILE A CA    1 
ATOM   2536  C C     . ILE A 1 413 ? 113.90300 127.70200 136.37300 1.000 118.14000 ? 658 ILE A C     1 
ATOM   2537  O O     . ILE A 1 413 ? 113.18400 127.74300 135.36600 1.000 118.14000 ? 658 ILE A O     1 
ATOM   2538  C CB    . ILE A 1 413 ? 116.32900 127.10400 136.71100 1.000 118.14000 ? 658 ILE A CB    1 
ATOM   2539  C CG1   . ILE A 1 413 ? 117.74900 127.66000 136.81300 1.000 118.14000 ? 658 ILE A CG1   1 
ATOM   2540  C CG2   . ILE A 1 413 ? 116.24900 125.97800 135.70500 1.000 118.14000 ? 658 ILE A CG2   1 
ATOM   2541  C CD1   . ILE A 1 413 ? 118.25100 128.28200 135.54200 1.000 118.14000 ? 658 ILE A CD1   1 
ATOM   2542  N N     . ASP A 1 414 ? 113.45700 127.25200 137.54700 1.000 120.17000 ? 659 ASP A N     1 
ATOM   2543  C CA    . ASP A 1 414 ? 112.10000 126.74200 137.68300 1.000 120.17000 ? 659 ASP A CA    1 
ATOM   2544  C C     . ASP A 1 414 ? 111.06700 127.85200 137.55000 1.000 120.17000 ? 659 ASP A C     1 
ATOM   2545  O O     . ASP A 1 414 ? 109.93400 127.59100 137.11100 1.000 120.17000 ? 659 ASP A O     1 
ATOM   2546  C CB    . ASP A 1 414 ? 111.94700 126.02200 139.02000 1.000 120.17000 ? 659 ASP A CB    1 
ATOM   2547  C CG    . ASP A 1 414 ? 112.81100 124.77600 139.11100 1.000 120.17000 ? 659 ASP A CG    1 
ATOM   2548  O OD1   . ASP A 1 414 ? 113.14700 124.21000 138.05100 1.000 120.17000 ? 659 ASP A OD1   1 
ATOM   2549  O OD2   . ASP A 1 414 ? 113.14200 124.35300 140.24000 1.000 120.17000 ? 659 ASP A OD2   1 
ATOM   2550  N N     . SER A 1 415 ? 111.45200 129.08700 137.90100 1.000 117.82000 ? 660 SER A N     1 
ATOM   2551  C CA    . SER A 1 415 ? 110.56400 130.23500 137.74400 1.000 117.82000 ? 660 SER A CA    1 
ATOM   2552  C C     . SER A 1 415 ? 110.20200 130.44300 136.28600 1.000 117.82000 ? 660 SER A C     1 
ATOM   2553  O O     . SER A 1 415 ? 109.02500 130.40000 135.93200 1.000 117.82000 ? 660 SER A O     1 
ATOM   2554  C CB    . SER A 1 415 ? 111.19400 131.50000 138.31600 1.000 117.82000 ? 660 SER A CB    1 
ATOM   2555  O OG    . SER A 1 415 ? 110.37300 132.62600 138.07100 1.000 117.82000 ? 660 SER A OG    1 
ATOM   2556  N N     . ARG A 1 416 ? 111.21300 130.60500 135.41800 1.000 119.08000 ? 661 ARG A N     1 
ATOM   2557  C CA    . ARG A 1 416 ? 110.97300 130.65800 133.97600 1.000 119.08000 ? 661 ARG A CA    1 
ATOM   2558  C C     . ARG A 1 416 ? 110.31400 129.39200 133.45600 1.000 119.08000 ? 661 ARG A C     1 
ATOM   2559  O O     . ARG A 1 416 ? 109.56900 129.45200 132.47400 1.000 119.08000 ? 661 ARG A O     1 
ATOM   2560  C CB    . ARG A 1 416 ? 112.27600 130.86500 133.20300 1.000 119.08000 ? 661 ARG A CB    1 
ATOM   2561  C CG    . ARG A 1 416 ? 112.91300 132.22800 133.30000 1.000 119.08000 ? 661 ARG A CG    1 
ATOM   2562  C CD    . ARG A 1 416 ? 114.12700 132.27800 132.38100 1.000 119.08000 ? 661 ARG A CD    1 
ATOM   2563  N NE    . ARG A 1 416 ? 114.89400 133.51000 132.53400 1.000 119.08000 ? 661 ARG A NE    1 
ATOM   2564  C CZ    . ARG A 1 416 ? 114.68300 134.61900 131.83700 1.000 119.08000 ? 661 ARG A CZ    1 
ATOM   2565  N NH1   . ARG A 1 416 ? 113.72200 134.66300 130.92700 1.000 119.08000 ? 661 ARG A NH1   1 
ATOM   2566  N NH2   . ARG A 1 416 ? 115.43700 135.68600 132.05100 1.000 119.08000 ? 661 ARG A NH2   1 
ATOM   2567  N N     . THR A 1 417 ? 110.57600 128.24800 134.10100 1.000 119.19000 ? 662 THR A N     1 
ATOM   2568  C CA    . THR A 1 417 ? 110.05100 126.97700 133.62000 1.000 119.19000 ? 662 THR A CA    1 
ATOM   2569  C C     . THR A 1 417 ? 108.53500 126.92800 133.70900 1.000 119.19000 ? 662 THR A C     1 
ATOM   2570  O O     . THR A 1 417 ? 107.86600 126.52200 132.75300 1.000 119.19000 ? 662 THR A O     1 
ATOM   2571  C CB    . THR A 1 417 ? 110.66000 125.82900 134.41000 1.000 119.19000 ? 662 THR A CB    1 
ATOM   2572  O OG1   . THR A 1 417 ? 112.08500 125.94400 134.38700 1.000 119.19000 ? 662 THR A OG1   1 
ATOM   2573  C CG2   . THR A 1 417 ? 110.26100 124.50900 133.79400 1.000 119.19000 ? 662 THR A CG2   1 
ATOM   2574  N N     . ILE A 1 418 ? 107.96400 127.35500 134.83300 1.000 107.09000 ? 663 ILE A N     1 
ATOM   2575  C CA    . ILE A 1 418 ? 106.51000 127.32800 134.95200 1.000 107.09000 ? 663 ILE A CA    1 
ATOM   2576  C C     . ILE A 1 418 ? 105.91300 128.73300 135.01400 1.000 107.09000 ? 663 ILE A C     1 
ATOM   2577  O O     . ILE A 1 418 ? 104.69400 128.88900 135.16100 1.000 107.09000 ? 663 ILE A O     1 
ATOM   2578  C CB    . ILE A 1 418 ? 106.07100 126.44700 136.14100 1.000 107.09000 ? 663 ILE A CB    1 
ATOM   2579  C CG1   . ILE A 1 418 ? 104.66500 125.86900 135.91600 1.000 107.09000 ? 663 ILE A CG1   1 
ATOM   2580  C CG2   . ILE A 1 418 ? 106.19900 127.19000 137.45300 1.000 107.09000 ? 663 ILE A CG2   1 
ATOM   2581  C CD1   . ILE A 1 418 ? 104.31300 124.72300 136.77800 1.000 107.09000 ? 663 ILE A CD1   1 
ATOM   2582  N N     . LEU A 1 419 ? 106.72100 129.76300 134.82500 1.000 119.64000 ? 664 LEU A N     1 
ATOM   2583  C CA    . LEU A 1 419 ? 106.18400 131.10600 134.62400 1.000 119.64000 ? 664 LEU A CA    1 
ATOM   2584  C C     . LEU A 1 419 ? 107.19300 131.82200 133.73100 1.000 119.64000 ? 664 LEU A C     1 
ATOM   2585  O O     . LEU A 1 419 ? 108.16400 132.40200 134.22500 1.000 119.64000 ? 664 LEU A O     1 
ATOM   2586  C CB    . LEU A 1 419 ? 105.96600 131.80800 135.96100 1.000 119.64000 ? 664 LEU A CB    1 
ATOM   2587  C CG    . LEU A 1 419 ? 105.06500 133.04000 136.07000 1.000 119.64000 ? 664 LEU A CG    1 
ATOM   2588  C CD1   . LEU A 1 419 ? 105.75300 134.33100 135.68900 1.000 119.64000 ? 664 LEU A CD1   1 
ATOM   2589  C CD2   . LEU A 1 419 ? 103.84600 132.83300 135.20200 1.000 119.64000 ? 664 LEU A CD2   1 
ATOM   2590  N N     . ASP A 1 420 ? 106.92400 131.81500 132.42000 1.000 124.27000 ? 665 ASP A N     1 
ATOM   2591  C CA    . ASP A 1 420 ? 107.91000 132.17500 131.40400 1.000 124.27000 ? 665 ASP A CA    1 
ATOM   2592  C C     . ASP A 1 420 ? 108.39800 133.61100 131.51700 1.000 124.27000 ? 665 ASP A C     1 
ATOM   2593  O O     . ASP A 1 420 ? 109.47500 133.92400 131.00100 1.000 124.27000 ? 665 ASP A O     1 
ATOM   2594  C CB    . ASP A 1 420 ? 107.31400 131.95500 130.02000 1.000 124.27000 ? 665 ASP A CB    1 
ATOM   2595  C CG    . ASP A 1 420 ? 106.93500 130.51500 129.78200 1.000 124.27000 ? 665 ASP A CG    1 
ATOM   2596  O OD1   . ASP A 1 420 ? 107.55400 129.62700 130.39800 1.000 124.27000 ? 665 ASP A OD1   1 
ATOM   2597  O OD2   . ASP A 1 420 ? 106.01100 130.27200 128.98100 1.000 124.27000 ? 665 ASP A OD2   1 
ATOM   2598  N N     . GLN A 1 421 ? 107.63100 134.48700 132.16900 1.000 116.59000 ? 666 GLN A N     1 
ATOM   2599  C CA    . GLN A 1 421 ? 108.15000 135.79900 132.52800 1.000 116.59000 ? 666 GLN A CA    1 
ATOM   2600  C C     . GLN A 1 421 ? 109.31700 135.68100 133.49800 1.000 116.59000 ? 666 GLN A C     1 
ATOM   2601  O O     . GLN A 1 421 ? 110.34600 136.34200 133.32500 1.000 116.59000 ? 666 GLN A O     1 
ATOM   2602  C CB    . GLN A 1 421 ? 107.03900 136.65500 133.13000 1.000 116.59000 ? 666 GLN A CB    1 
ATOM   2603  C CG    . GLN A 1 421 ? 107.48600 138.03700 133.56200 1.000 116.59000 ? 666 GLN A CG    1 
ATOM   2604  C CD    . GLN A 1 421 ? 107.89500 138.90700 132.39800 1.000 116.59000 ? 666 GLN A CD    1 
ATOM   2605  O OE1   . GLN A 1 421 ? 107.23700 138.92500 131.36000 1.000 116.59000 ? 666 GLN A OE1   1 
ATOM   2606  N NE2   . GLN A 1 421 ? 108.99200 139.63300 132.56100 1.000 116.59000 ? 666 GLN A NE2   1 
ATOM   2607  N N     . GLY A 1 422 ? 109.18500 134.84000 134.51500 1.000 111.98000 ? 667 GLY A N     1 
ATOM   2608  C CA    . GLY A 1 422 ? 110.23400 134.71200 135.50400 1.000 111.98000 ? 667 GLY A CA    1 
ATOM   2609  C C     . GLY A 1 422 ? 110.19800 135.81400 136.54200 1.000 111.98000 ? 667 GLY A C     1 
ATOM   2610  O O     . GLY A 1 422 ? 109.95300 136.97900 136.21800 1.000 111.98000 ? 667 GLY A O     1 
ATOM   2611  N N     . GLY A 1 423 ? 110.46100 135.46400 137.79400 1.000 110.82000 ? 668 GLY A N     1 
ATOM   2612  C CA    . GLY A 1 423 ? 110.35200 136.41900 138.87800 1.000 110.82000 ? 668 GLY A CA    1 
ATOM   2613  C C     . GLY A 1 423 ? 109.74300 135.78200 140.10600 1.000 110.82000 ? 668 GLY A C     1 
ATOM   2614  O O     . GLY A 1 423 ? 109.54700 136.43600 141.13400 1.000 110.82000 ? 668 GLY A O     1 
ATOM   2615  N N     . ALA A 1 424 ? 109.44600 134.48800 139.99800 1.000 109.89000 ? 669 ALA A N     1 
ATOM   2616  C CA    . ALA A 1 424 ? 108.81500 133.74400 141.07600 1.000 109.89000 ? 669 ALA A CA    1 
ATOM   2617  C C     . ALA A 1 424 ? 109.78600 133.31700 142.16300 1.000 109.89000 ? 669 ALA A C     1 
ATOM   2618  O O     . ALA A 1 424 ? 109.34700 132.78200 143.18400 1.000 109.89000 ? 669 ALA A O     1 
ATOM   2619  C CB    . ALA A 1 424 ? 108.11400 132.50700 140.51900 1.000 109.89000 ? 669 ALA A CB    1 
ATOM   2620  N N     . GLU A 1 425 ? 111.08400 133.52500 141.98000 1.000 110.03000 ? 670 GLU A N     1 
ATOM   2621  C CA    . GLU A 1 425 ? 112.00900 133.20400 143.05000 1.000 110.03000 ? 670 GLU A CA    1 
ATOM   2622  C C     . GLU A 1 425 ? 111.97800 134.26200 144.14400 1.000 110.03000 ? 670 GLU A C     1 
ATOM   2623  O O     . GLU A 1 425 ? 112.37800 133.98500 145.27800 1.000 110.03000 ? 670 GLU A O     1 
ATOM   2624  C CB    . GLU A 1 425 ? 113.41500 133.02800 142.47400 1.000 110.03000 ? 670 GLU A CB    1 
ATOM   2625  C CG    . GLU A 1 425 ? 114.42100 132.40600 143.43100 1.000 110.03000 ? 670 GLU A CG    1 
ATOM   2626  C CD    . GLU A 1 425 ? 115.76000 132.10900 142.79100 1.000 110.03000 ? 670 GLU A CD    1 
ATOM   2627  O OE1   . GLU A 1 425 ? 115.90800 132.34700 141.57800 1.000 110.03000 ? 670 GLU A OE1   1 
ATOM   2628  O OE2   . GLU A 1 425 ? 116.66800 131.62600 143.50000 1.000 110.03000 ? 670 GLU A OE2   1 
ATOM   2629  N N     . GLN A 1 426 ? 111.42600 135.43900 143.85800 1.000 105.07000 ? 671 GLN A N     1 
ATOM   2630  C CA    . GLN A 1 426 ? 111.36300 136.53600 144.82100 1.000 105.07000 ? 671 GLN A CA    1 
ATOM   2631  C C     . GLN A 1 426 ? 110.05500 136.55300 145.59700 1.000 105.07000 ? 671 GLN A C     1 
ATOM   2632  O O     . GLN A 1 426 ? 109.53200 137.62400 145.91100 1.000 105.07000 ? 671 GLN A O     1 
ATOM   2633  C CB    . GLN A 1 426 ? 111.57200 137.87300 144.12300 1.000 105.07000 ? 671 GLN A CB    1 
ATOM   2634  C CG    . GLN A 1 426 ? 112.96500 138.07800 143.59300 1.000 105.07000 ? 671 GLN A CG    1 
ATOM   2635  C CD    . GLN A 1 426 ? 113.14300 139.45500 143.00700 1.000 105.07000 ? 671 GLN A CD    1 
ATOM   2636  O OE1   . GLN A 1 426 ? 112.19800 140.24000 142.94300 1.000 105.07000 ? 671 GLN A OE1   1 
ATOM   2637  N NE2   . GLN A 1 426 ? 114.35900 139.76400 142.58200 1.000 105.07000 ? 671 GLN A NE2   1 
ATOM   2638  N N     . LEU A 1 427 ? 109.49800 135.39300 145.91400 1.000 100.26000 ? 672 LEU A N     1 
ATOM   2639  C CA    . LEU A 1 427 ? 108.25300 135.36800 146.66000 1.000 100.26000 ? 672 LEU A CA    1 
ATOM   2640  C C     . LEU A 1 427 ? 108.49700 135.34300 148.15600 1.000 100.26000 ? 672 LEU A C     1 
ATOM   2641  O O     . LEU A 1 427 ? 109.55100 134.93300 148.64000 1.000 100.26000 ? 672 LEU A O     1 
ATOM   2642  C CB    . LEU A 1 427 ? 107.40000 134.17800 146.25500 1.000 100.26000 ? 672 LEU A CB    1 
ATOM   2643  C CG    . LEU A 1 427 ? 106.93500 134.38300 144.82300 1.000 100.26000 ? 672 LEU A CG    1 
ATOM   2644  C CD1   . LEU A 1 427 ? 106.05500 133.24600 144.38300 1.000 100.26000 ? 672 LEU A CD1   1 
ATOM   2645  C CD2   . LEU A 1 427 ? 106.22700 135.72500 144.67900 1.000 100.26000 ? 672 LEU A CD2   1 
ATOM   2646  N N     . LEU A 1 428 ? 107.48400 135.78600 148.89000 1.000 95.36000  ? 673 LEU A N     1 
ATOM   2647  C CA    . LEU A 1 428 ? 107.61800 135.95700 150.32500 1.000 95.36000  ? 673 LEU A CA    1 
ATOM   2648  C C     . LEU A 1 428 ? 107.43400 134.65100 151.06900 1.000 95.36000  ? 673 LEU A C     1 
ATOM   2649  O O     . LEU A 1 428 ? 107.84800 134.53800 152.22600 1.000 95.36000  ? 673 LEU A O     1 
ATOM   2650  C CB    . LEU A 1 428 ? 106.60100 136.98300 150.79600 1.000 95.36000  ? 673 LEU A CB    1 
ATOM   2651  C CG    . LEU A 1 428 ? 106.89200 138.29600 150.08200 1.000 95.36000  ? 673 LEU A CG    1 
ATOM   2652  C CD1   . LEU A 1 428 ? 105.78200 139.27100 150.28000 1.000 95.36000  ? 673 LEU A CD1   1 
ATOM   2653  C CD2   . LEU A 1 428 ? 108.19100 138.88100 150.58700 1.000 95.36000  ? 673 LEU A CD2   1 
ATOM   2654  N N     . GLY A 1 429 ? 106.84100 133.66100 150.42400 1.000 96.88000  ? 674 GLY A N     1 
ATOM   2655  C CA    . GLY A 1 429 ? 106.38200 132.47300 151.10300 1.000 96.88000  ? 674 GLY A CA    1 
ATOM   2656  C C     . GLY A 1 429 ? 104.96100 132.64300 151.60500 1.000 96.88000  ? 674 GLY A C     1 
ATOM   2657  O O     . GLY A 1 429 ? 104.43700 133.75600 151.71400 1.000 96.88000  ? 674 GLY A O     1 
ATOM   2658  N N     . HIS A 1 430 ? 104.33200 131.50100 151.89600 1.000 102.88000 ? 675 HIS A N     1 
ATOM   2659  C CA    . HIS A 1 430 ? 102.97600 131.41500 152.44100 1.000 102.88000 ? 675 HIS A CA    1 
ATOM   2660  C C     . HIS A 1 430 ? 101.95700 132.09700 151.53000 1.000 102.88000 ? 675 HIS A C     1 
ATOM   2661  O O     . HIS A 1 430 ? 101.36200 133.11900 151.86800 1.000 102.88000 ? 675 HIS A O     1 
ATOM   2662  C CB    . HIS A 1 430 ? 102.91200 131.98100 153.86100 1.000 102.88000 ? 675 HIS A CB    1 
ATOM   2663  C CG    . HIS A 1 430 ? 103.56700 131.11300 154.88000 1.000 102.88000 ? 675 HIS A CG    1 
ATOM   2664  N ND1   . HIS A 1 430 ? 103.75900 131.51300 156.18300 1.000 102.88000 ? 675 HIS A ND1   1 
ATOM   2665  C CD2   . HIS A 1 430 ? 104.07000 129.86000 154.79100 1.000 102.88000 ? 675 HIS A CD2   1 
ATOM   2666  C CE1   . HIS A 1 430 ? 104.35400 130.54300 156.85300 1.000 102.88000 ? 675 HIS A CE1   1 
ATOM   2667  N NE2   . HIS A 1 430 ? 104.55300 129.52900 156.03200 1.000 102.88000 ? 675 HIS A NE2   1 
ATOM   2668  N N     . GLY A 1 431 ? 101.77700 131.52100 150.35200 1.000 102.11000 ? 676 GLY A N     1 
ATOM   2669  C CA    . GLY A 1 431 ? 100.92300 132.15400 149.37700 1.000 102.11000 ? 676 GLY A CA    1 
ATOM   2670  C C     . GLY A 1 431 ? 101.71600 133.21200 148.65500 1.000 102.11000 ? 676 GLY A C     1 
ATOM   2671  O O     . GLY A 1 431 ? 102.92600 133.05000 148.49600 1.000 102.11000 ? 676 GLY A O     1 
ATOM   2672  N N     . ASP A 1 432 ? 101.05200 134.30100 148.26000 1.000 107.55000 ? 677 ASP A N     1 
ATOM   2673  C CA    . ASP A 1 432 ? 101.61000 135.36400 147.42300 1.000 107.55000 ? 677 ASP A CA    1 
ATOM   2674  C C     . ASP A 1 432 ? 102.17700 134.78100 146.12700 1.000 107.55000 ? 677 ASP A C     1 
ATOM   2675  O O     . ASP A 1 432 ? 103.38000 134.71400 145.90100 1.000 107.55000 ? 677 ASP A O     1 
ATOM   2676  C CB    . ASP A 1 432 ? 102.66200 136.19600 148.16400 1.000 107.55000 ? 677 ASP A CB    1 
ATOM   2677  C CG    . ASP A 1 432 ? 103.07000 137.42700 147.38600 1.000 107.55000 ? 677 ASP A CG    1 
ATOM   2678  O OD1   . ASP A 1 432 ? 102.27800 138.38800 147.36400 1.000 107.55000 ? 677 ASP A OD1   1 
ATOM   2679  O OD2   . ASP A 1 432 ? 104.16300 137.42600 146.78300 1.000 107.55000 ? 677 ASP A OD2   1 
ATOM   2680  N N     . MET A 1 433 ? 101.26100 134.30600 145.30700 1.000 99.66000  ? 678 MET A N     1 
ATOM   2681  C CA    . MET A 1 433 ? 101.62400 133.57800 144.10900 1.000 99.66000  ? 678 MET A CA    1 
ATOM   2682  C C     . MET A 1 433 ? 101.69300 134.46200 142.87500 1.000 99.66000  ? 678 MET A C     1 
ATOM   2683  O O     . MET A 1 433 ? 101.26600 135.61400 142.86900 1.000 99.66000  ? 678 MET A O     1 
ATOM   2684  C CB    . MET A 1 433 ? 100.63600 132.45300 143.88700 1.000 99.66000  ? 678 MET A CB    1 
ATOM   2685  C CG    . MET A 1 433 ? 99.16100  132.79000 143.93300 1.000 99.66000  ? 678 MET A CG    1 
ATOM   2686  S SD    . MET A 1 433 ? 98.43900  133.29200 142.37300 1.000 99.66000  ? 678 MET A SD    1 
ATOM   2687  C CE    . MET A 1 433 ? 96.88500  133.96600 142.94400 1.000 99.66000  ? 678 MET A CE    1 
ATOM   2688  N N     . LEU A 1 434 ? 102.24600 133.89400 141.81400 1.000 92.13000  ? 679 LEU A N     1 
ATOM   2689  C CA    . LEU A 1 434 ? 102.14400 134.47800 140.49100 1.000 92.13000  ? 679 LEU A CA    1 
ATOM   2690  C C     . LEU A 1 434 ? 100.99800 133.82600 139.73700 1.000 92.13000  ? 679 LEU A C     1 
ATOM   2691  O O     . LEU A 1 434 ? 100.60200 132.69300 140.01300 1.000 92.13000  ? 679 LEU A O     1 
ATOM   2692  C CB    . LEU A 1 434 ? 103.43300 134.31300 139.69100 1.000 92.13000  ? 679 LEU A CB    1 
ATOM   2693  C CG    . LEU A 1 434 ? 104.55200 135.33000 139.90000 1.000 92.13000  ? 679 LEU A CG    1 
ATOM   2694  C CD1   . LEU A 1 434 ? 104.01700 136.75100 139.78000 1.000 92.13000  ? 679 LEU A CD1   1 
ATOM   2695  C CD2   . LEU A 1 434 ? 105.29000 135.11800 141.18900 1.000 92.13000  ? 679 LEU A CD2   1 
ATOM   2696  N N     . TYR A 1 435 ? 100.48900 134.55100 138.75200 1.000 86.62000  ? 680 TYR A N     1 
ATOM   2697  C CA    . TYR A 1 435 ? 99.26000  134.15700 138.07800 1.000 86.62000  ? 680 TYR A CA    1 
ATOM   2698  C C     . TYR A 1 435 ? 99.24400  134.81000 136.71400 1.000 86.62000  ? 680 TYR A C     1 
ATOM   2699  O O     . TYR A 1 435 ? 99.28400  136.04100 136.63300 1.000 86.62000  ? 680 TYR A O     1 
ATOM   2700  C CB    . TYR A 1 435 ? 98.06600  134.60000 138.89300 1.000 86.62000  ? 680 TYR A CB    1 
ATOM   2701  C CG    . TYR A 1 435 ? 96.74500  134.32500 138.25300 1.000 86.62000  ? 680 TYR A CG    1 
ATOM   2702  C CD1   . TYR A 1 435 ? 96.23000  133.05300 138.22700 1.000 86.62000  ? 680 TYR A CD1   1 
ATOM   2703  C CD2   . TYR A 1 435 ? 96.00200  135.34600 137.69200 1.000 86.62000  ? 680 TYR A CD2   1 
ATOM   2704  C CE1   . TYR A 1 435 ? 95.02300  132.79400 137.65300 1.000 86.62000  ? 680 TYR A CE1   1 
ATOM   2705  C CE2   . TYR A 1 435 ? 94.78800  135.09500 137.11200 1.000 86.62000  ? 680 TYR A CE2   1 
ATOM   2706  C CZ    . TYR A 1 435 ? 94.30900  133.81700 137.09800 1.000 86.62000  ? 680 TYR A CZ    1 
ATOM   2707  O OH    . TYR A 1 435 ? 93.10500  133.54800 136.52200 1.000 86.62000  ? 680 TYR A OH    1 
ATOM   2708  N N     . LEU A 1 436 ? 99.21100  134.00200 135.65500 1.000 90.62000  ? 681 LEU A N     1 
ATOM   2709  C CA    . LEU A 1 436 ? 98.97200  134.79400 134.46100 1.000 90.62000  ? 681 LEU A CA    1 
ATOM   2710  C C     . LEU A 1 436 ? 97.54000  134.60200 133.98700 1.000 90.62000  ? 681 LEU A C     1 
ATOM   2711  O O     . LEU A 1 436 ? 97.03100  133.48100 133.99000 1.000 90.62000  ? 681 LEU A O     1 
ATOM   2712  C CB    . LEU A 1 436 ? 99.95700  134.44500 133.34300 1.000 90.62000  ? 681 LEU A CB    1 
ATOM   2713  C CG    . LEU A 1 436 ? 100.04900 133.10100 132.62600 1.000 90.62000  ? 681 LEU A CG    1 
ATOM   2714  C CD1   . LEU A 1 436 ? 99.19800  133.04900 131.36300 1.000 90.62000  ? 681 LEU A CD1   1 
ATOM   2715  C CD2   . LEU A 1 436 ? 101.49400 132.82000 132.28900 1.000 90.62000  ? 681 LEU A CD2   1 
ATOM   2716  N N     . PRO A 1 437 ? 96.88300  135.68500 133.58400 1.000 97.48000  ? 682 PRO A N     1 
ATOM   2717  C CA    . PRO A 1 437 ? 95.46900  135.61800 133.19800 1.000 97.48000  ? 682 PRO A CA    1 
ATOM   2718  C C     . PRO A 1 437 ? 95.29700  134.92800 131.85300 1.000 97.48000  ? 682 PRO A C     1 
ATOM   2719  O O     . PRO A 1 437 ? 96.28500  134.51000 131.23300 1.000 97.48000  ? 682 PRO A O     1 
ATOM   2720  C CB    . PRO A 1 437 ? 95.07000  137.10600 133.13800 1.000 97.48000  ? 682 PRO A CB    1 
ATOM   2721  C CG    . PRO A 1 437 ? 96.31600  137.82700 132.87300 1.000 97.48000  ? 682 PRO A CG    1 
ATOM   2722  C CD    . PRO A 1 437 ? 97.38700  137.07100 133.57800 1.000 97.48000  ? 682 PRO A CD    1 
ATOM   2723  N N     . PRO A 1 438 ? 94.07100  134.78800 131.34200 1.000 108.30000 ? 683 PRO A N     1 
ATOM   2724  C CA    . PRO A 1 438 ? 93.90600  134.35100 129.95100 1.000 108.30000 ? 683 PRO A CA    1 
ATOM   2725  C C     . PRO A 1 438 ? 94.24900  135.39300 128.89600 1.000 108.30000 ? 683 PRO A C     1 
ATOM   2726  O O     . PRO A 1 438 ? 93.92000  135.18400 127.72700 1.000 108.30000 ? 683 PRO A O     1 
ATOM   2727  C CB    . PRO A 1 438 ? 92.41800  133.97000 129.88100 1.000 108.30000 ? 683 PRO A CB    1 
ATOM   2728  C CG    . PRO A 1 438 ? 91.78300  134.63400 131.02200 1.000 108.30000 ? 683 PRO A CG    1 
ATOM   2729  C CD    . PRO A 1 438 ? 92.81100  134.61600 132.09100 1.000 108.30000 ? 683 PRO A CD    1 
ATOM   2730  N N     . GLY A 1 439 ? 94.90200  136.49600 129.25100 1.000 111.79000 ? 684 GLY A N     1 
ATOM   2731  C CA    . GLY A 1 439 ? 95.64600  137.27900 128.28600 1.000 111.79000 ? 684 GLY A CA    1 
ATOM   2732  C C     . GLY A 1 439 ? 96.99800  136.63700 128.04900 1.000 111.79000 ? 684 GLY A C     1 
ATOM   2733  O O     . GLY A 1 439 ? 97.07200  135.42800 127.80400 1.000 111.79000 ? 684 GLY A O     1 
ATOM   2734  N N     . THR A 1 440 ? 98.08000  137.40600 128.12000 1.000 125.73000 ? 685 THR A N     1 
ATOM   2735  C CA    . THR A 1 440 ? 99.40000  136.81700 127.95600 1.000 125.73000 ? 685 THR A CA    1 
ATOM   2736  C C     . THR A 1 440 ? 100.44100 137.66700 128.66200 1.000 125.73000 ? 685 THR A C     1 
ATOM   2737  O O     . THR A 1 440 ? 100.16900 138.78900 129.09500 1.000 125.73000 ? 685 THR A O     1 
ATOM   2738  C CB    . THR A 1 440 ? 99.78800  136.66700 126.48100 1.000 125.73000 ? 685 THR A CB    1 
ATOM   2739  O OG1   . THR A 1 440 ? 101.00700 135.91900 126.38600 1.000 125.73000 ? 685 THR A OG1   1 
ATOM   2740  C CG2   . THR A 1 440 ? 99.98500  138.03500 125.83700 1.000 125.73000 ? 685 THR A CG2   1 
ATOM   2741  N N     . GLY A 1 441 ? 101.63300 137.07700 128.80400 1.000 117.72000 ? 686 GLY A N     1 
ATOM   2742  C CA    . GLY A 1 441 ? 102.89800 137.73200 129.10100 1.000 117.72000 ? 686 GLY A CA    1 
ATOM   2743  C C     . GLY A 1 441 ? 102.97500 138.73300 130.23400 1.000 117.72000 ? 686 GLY A C     1 
ATOM   2744  O O     . GLY A 1 441 ? 103.89200 139.55700 130.27100 1.000 117.72000 ? 686 GLY A O     1 
ATOM   2745  N N     . LEU A 1 442 ? 102.03400 138.67800 131.16100 1.000 102.55000 ? 687 LEU A N     1 
ATOM   2746  C CA    . LEU A 1 442 ? 102.00000 139.65800 132.23100 1.000 102.55000 ? 687 LEU A CA    1 
ATOM   2747  C C     . LEU A 1 442 ? 101.56500 138.94000 133.49800 1.000 102.55000 ? 687 LEU A C     1 
ATOM   2748  O O     . LEU A 1 442 ? 100.38200 138.61900 133.65700 1.000 102.55000 ? 687 LEU A O     1 
ATOM   2749  C CB    . LEU A 1 442 ? 101.05500 140.81100 131.87400 1.000 102.55000 ? 687 LEU A CB    1 
ATOM   2750  C CG    . LEU A 1 442 ? 101.13000 142.15700 132.60800 1.000 102.55000 ? 687 LEU A CG    1 
ATOM   2751  C CD1   . LEU A 1 442 ? 100.65900 143.25100 131.67000 1.000 102.55000 ? 687 LEU A CD1   1 
ATOM   2752  C CD2   . LEU A 1 442 ? 100.31900 142.19300 133.88800 1.000 102.55000 ? 687 LEU A CD2   1 
ATOM   2753  N N     . PRO A 1 443 ? 102.48700 138.64800 134.40200 1.000 97.68000  ? 688 PRO A N     1 
ATOM   2754  C CA    . PRO A 1 443 ? 102.11400 137.94100 135.62500 1.000 97.68000  ? 688 PRO A CA    1 
ATOM   2755  C C     . PRO A 1 443 ? 101.36400 138.85400 136.57600 1.000 97.68000  ? 688 PRO A C     1 
ATOM   2756  O O     . PRO A 1 443 ? 101.50700 140.07700 136.54200 1.000 97.68000  ? 688 PRO A O     1 
ATOM   2757  C CB    . PRO A 1 443 ? 103.46300 137.52100 136.20700 1.000 97.68000  ? 688 PRO A CB    1 
ATOM   2758  C CG    . PRO A 1 443 ? 104.40100 138.54800 135.71200 1.000 97.68000  ? 688 PRO A CG    1 
ATOM   2759  C CD    . PRO A 1 443 ? 103.92900 138.92700 134.34500 1.000 97.68000  ? 688 PRO A CD    1 
ATOM   2760  N N     . ILE A 1 444 ? 100.54000 138.24200 137.42300 1.000 92.37000  ? 689 ILE A N     1 
ATOM   2761  C CA    . ILE A 1 444 ? 99.77200  138.94600 138.44100 1.000 92.37000  ? 689 ILE A CA    1 
ATOM   2762  C C     . ILE A 1 444 ? 100.13400 138.35900 139.79500 1.000 92.37000  ? 689 ILE A C     1 
ATOM   2763  O O     . ILE A 1 444 ? 100.08100 137.13900 139.97900 1.000 92.37000  ? 689 ILE A O     1 
ATOM   2764  C CB    . ILE A 1 444 ? 98.25900  138.83200 138.19500 1.000 92.37000  ? 689 ILE A CB    1 
ATOM   2765  C CG1   . ILE A 1 444 ? 97.89600  139.38300 136.82500 1.000 92.37000  ? 689 ILE A CG1   1 
ATOM   2766  C CG2   . ILE A 1 444 ? 97.50700  139.60900 139.22500 1.000 92.37000  ? 689 ILE A CG2   1 
ATOM   2767  C CD1   . ILE A 1 444 ? 98.22100  140.83400 136.66700 1.000 92.37000  ? 689 ILE A CD1   1 
ATOM   2768  N N     . ARG A 1 445 ? 100.51100 139.22100 140.73400 1.000 95.73000  ? 690 ARG A N     1 
ATOM   2769  C CA    . ARG A 1 445 ? 100.78000 138.80200 142.10300 1.000 95.73000  ? 690 ARG A CA    1 
ATOM   2770  C C     . ARG A 1 445 ? 99.52800  139.01300 142.94100 1.000 95.73000  ? 690 ARG A C     1 
ATOM   2771  O O     . ARG A 1 445 ? 99.12900  140.15100 143.19700 1.000 95.73000  ? 690 ARG A O     1 
ATOM   2772  C CB    . ARG A 1 445 ? 101.95500 139.57000 142.69400 1.000 95.73000  ? 690 ARG A CB    1 
ATOM   2773  C CG    . ARG A 1 445 ? 102.17200 139.24600 144.15100 1.000 95.73000  ? 690 ARG A CG    1 
ATOM   2774  C CD    . ARG A 1 445 ? 103.39700 139.91700 144.71700 1.000 95.73000  ? 690 ARG A CD    1 
ATOM   2775  N NE    . ARG A 1 445 ? 104.62300 139.28500 144.26100 1.000 95.73000  ? 690 ARG A NE    1 
ATOM   2776  C CZ    . ARG A 1 445 ? 105.83500 139.75100 144.52500 1.000 95.73000  ? 690 ARG A CZ    1 
ATOM   2777  N NH1   . ARG A 1 445 ? 105.97000 140.85000 145.24700 1.000 95.73000  ? 690 ARG A NH1   1 
ATOM   2778  N NH2   . ARG A 1 445 ? 106.90700 139.11900 144.07500 1.000 95.73000  ? 690 ARG A NH2   1 
ATOM   2779  N N     . VAL A 1 446 ? 98.90400  137.92000 143.36400 1.000 92.49000  ? 691 VAL A N     1 
ATOM   2780  C CA    . VAL A 1 446 ? 97.72500  137.96200 144.21600 1.000 92.49000  ? 691 VAL A CA    1 
ATOM   2781  C C     . VAL A 1 446 ? 97.94600  137.01300 145.38000 1.000 92.49000  ? 691 VAL A C     1 
ATOM   2782  O O     . VAL A 1 446 ? 98.32700  135.85600 145.17900 1.000 92.49000  ? 691 VAL A O     1 
ATOM   2783  C CB    . VAL A 1 446 ? 96.44500  137.59500 143.44300 1.000 92.49000  ? 691 VAL A CB    1 
ATOM   2784  C CG1   . VAL A 1 446 ? 95.28000  137.39300 144.37900 1.000 92.49000  ? 691 VAL A CG1   1 
ATOM   2785  C CG2   . VAL A 1 446 ? 96.09100  138.68900 142.49300 1.000 92.49000  ? 691 VAL A CG2   1 
ATOM   2786  N N     . HIS A 1 447 ? 97.73400  137.51200 146.59400 1.000 97.12000  ? 692 HIS A N     1 
ATOM   2787  C CA    . HIS A 1 447 ? 97.89500  136.70100 147.78500 1.000 97.12000  ? 692 HIS A CA    1 
ATOM   2788  C C     . HIS A 1 447 ? 96.80800  135.64600 147.87100 1.000 97.12000  ? 692 HIS A C     1 
ATOM   2789  O O     . HIS A 1 447 ? 95.71200  135.80300 147.33300 1.000 97.12000  ? 692 HIS A O     1 
ATOM   2790  C CB    . HIS A 1 447 ? 97.83600  137.57400 149.02200 1.000 97.12000  ? 692 HIS A CB    1 
ATOM   2791  C CG    . HIS A 1 447 ? 98.89300  138.62300 149.05900 1.000 97.12000  ? 692 HIS A CG    1 
ATOM   2792  N ND1   . HIS A 1 447 ? 98.71900  139.86700 148.49800 1.000 97.12000  ? 692 HIS A ND1   1 
ATOM   2793  C CD2   . HIS A 1 447 ? 100.13500 138.61700 149.59100 1.000 97.12000  ? 692 HIS A CD2   1 
ATOM   2794  C CE1   . HIS A 1 447 ? 99.81100  140.58400 148.68400 1.000 97.12000  ? 692 HIS A CE1   1 
ATOM   2795  N NE2   . HIS A 1 447 ? 100.68600 139.84800 149.34200 1.000 97.12000  ? 692 HIS A NE2   1 
ATOM   2796  N N     . GLY A 1 448 ? 97.11400  134.56700 148.57500 1.000 96.58000  ? 693 GLY A N     1 
ATOM   2797  C CA    . GLY A 1 448 ? 96.16300  133.50100 148.77400 1.000 96.58000  ? 693 GLY A CA    1 
ATOM   2798  C C     . GLY A 1 448 ? 95.22000  133.80400 149.91500 1.000 96.58000  ? 693 GLY A C     1 
ATOM   2799  O O     . GLY A 1 448 ? 95.11800  134.92600 150.41000 1.000 96.58000  ? 693 GLY A O     1 
ATOM   2800  N N     . ALA A 1 449 ? 94.51300  132.76500 150.33800 1.000 99.02000  ? 694 ALA A N     1 
ATOM   2801  C CA    . ALA A 1 449 ? 93.64000  132.84300 151.49800 1.000 99.02000  ? 694 ALA A CA    1 
ATOM   2802  C C     . ALA A 1 449 ? 93.97700  131.69100 152.42800 1.000 99.02000  ? 694 ALA A C     1 
ATOM   2803  O O     . ALA A 1 449 ? 93.85500  130.52500 152.04400 1.000 99.02000  ? 694 ALA A O     1 
ATOM   2804  C CB    . ALA A 1 449 ? 92.17000  132.79600 151.08700 1.000 99.02000  ? 694 ALA A CB    1 
ATOM   2805  N N     . PHE A 1 450 ? 94.40200  132.01700 153.64100 1.000 104.15000 ? 695 PHE A N     1 
ATOM   2806  C CA    . PHE A 1 450 ? 94.77600  131.01000 154.62300 1.000 104.15000 ? 695 PHE A CA    1 
ATOM   2807  C C     . PHE A 1 450 ? 93.51700  130.30200 155.08800 1.000 104.15000 ? 695 PHE A C     1 
ATOM   2808  O O     . PHE A 1 450 ? 92.78600  130.80700 155.93900 1.000 104.15000 ? 695 PHE A O     1 
ATOM   2809  C CB    . PHE A 1 450 ? 95.49500  131.66000 155.79400 1.000 104.15000 ? 695 PHE A CB    1 
ATOM   2810  C CG    . PHE A 1 450 ? 95.99100  130.68600 156.80600 1.000 104.15000 ? 695 PHE A CG    1 
ATOM   2811  C CD1   . PHE A 1 450 ? 97.15300  129.97100 156.57800 1.000 104.15000 ? 695 PHE A CD1   1 
ATOM   2812  C CD2   . PHE A 1 450 ? 95.29400  130.46800 157.97900 1.000 104.15000 ? 695 PHE A CD2   1 
ATOM   2813  C CE1   . PHE A 1 450 ? 97.62100  129.06700 157.51000 1.000 104.15000 ? 695 PHE A CE1   1 
ATOM   2814  C CE2   . PHE A 1 450 ? 95.75200  129.56500 158.91200 1.000 104.15000 ? 695 PHE A CE2   1 
ATOM   2815  C CZ    . PHE A 1 450 ? 96.91700  128.86300 158.67700 1.000 104.15000 ? 695 PHE A CZ    1 
ATOM   2816  N N     . VAL A 1 451 ? 93.25800  129.12800 154.53300 1.000 111.62000 ? 696 VAL A N     1 
ATOM   2817  C CA    . VAL A 1 451 ? 92.05500  128.36800 154.84000 1.000 111.62000 ? 696 VAL A CA    1 
ATOM   2818  C C     . VAL A 1 451 ? 92.40000  127.32200 155.88500 1.000 111.62000 ? 696 VAL A C     1 
ATOM   2819  O O     . VAL A 1 451 ? 93.27700  126.48000 155.66400 1.000 111.62000 ? 696 VAL A O     1 
ATOM   2820  C CB    . VAL A 1 451 ? 91.47400  127.71300 153.58200 1.000 111.62000 ? 696 VAL A CB    1 
ATOM   2821  C CG1   . VAL A 1 451 ? 90.30600  126.82600 153.94500 1.000 111.62000 ? 696 VAL A CG1   1 
ATOM   2822  C CG2   . VAL A 1 451 ? 91.04500  128.77500 152.60600 1.000 111.62000 ? 696 VAL A CG2   1 
ATOM   2823  N N     . SER A 1 452 ? 91.71800  127.37000 157.02200 1.000 115.57000 ? 697 SER A N     1 
ATOM   2824  C CA    . SER A 1 452 ? 91.95200  126.37700 158.05500 1.000 115.57000 ? 697 SER A CA    1 
ATOM   2825  C C     . SER A 1 452 ? 91.35300  125.03900 157.66300 1.000 115.57000 ? 697 SER A C     1 
ATOM   2826  O O     . SER A 1 452 ? 90.40400  124.96000 156.88000 1.000 115.57000 ? 697 SER A O     1 
ATOM   2827  C CB    . SER A 1 452 ? 91.35300  126.82100 159.38100 1.000 115.57000 ? 697 SER A CB    1 
ATOM   2828  O OG    . SER A 1 452 ? 91.46800  125.78200 160.33300 1.000 115.57000 ? 697 SER A OG    1 
ATOM   2829  N N     . ASP A 1 453 ? 91.92000  123.97700 158.22900 1.000 120.73000 ? 698 ASP A N     1 
ATOM   2830  C CA    . ASP A 1 453 ? 91.37300  122.64400 158.02000 1.000 120.73000 ? 698 ASP A CA    1 
ATOM   2831  C C     . ASP A 1 453 ? 90.01900  122.47900 158.69300 1.000 120.73000 ? 698 ASP A C     1 
ATOM   2832  O O     . ASP A 1 453 ? 89.19100  121.67900 158.24300 1.000 120.73000 ? 698 ASP A O     1 
ATOM   2833  C CB    . ASP A 1 453 ? 92.35500  121.59900 158.53800 1.000 120.73000 ? 698 ASP A CB    1 
ATOM   2834  C CG    . ASP A 1 453 ? 92.74500  121.83100 159.98800 1.000 120.73000 ? 698 ASP A CG    1 
ATOM   2835  O OD1   . ASP A 1 453 ? 92.38200  122.88100 160.56100 1.000 120.73000 ? 698 ASP A OD1   1 
ATOM   2836  O OD2   . ASP A 1 453 ? 93.41200  120.94800 160.56500 1.000 120.73000 ? 698 ASP A OD2   1 
ATOM   2837  N N     . ASP A 1 454 ? 89.78000  123.21600 159.77300 1.000 127.12000 ? 699 ASP A N     1 
ATOM   2838  C CA    . ASP A 1 454 ? 88.50600  123.09500 160.45900 1.000 127.12000 ? 699 ASP A CA    1 
ATOM   2839  C C     . ASP A 1 454 ? 87.38900  123.77300 159.68900 1.000 127.12000 ? 699 ASP A C     1 
ATOM   2840  O O     . ASP A 1 454 ? 86.24400  123.32000 159.75500 1.000 127.12000 ? 699 ASP A O     1 
ATOM   2841  C CB    . ASP A 1 454 ? 88.61700  123.67000 161.86100 1.000 127.12000 ? 699 ASP A CB    1 
ATOM   2842  C CG    . ASP A 1 454 ? 89.52300  122.85000 162.73400 1.000 127.12000 ? 699 ASP A CG    1 
ATOM   2843  O OD1   . ASP A 1 454 ? 89.65400  121.63900 162.46100 1.000 127.12000 ? 699 ASP A OD1   1 
ATOM   2844  O OD2   . ASP A 1 454 ? 90.10300  123.40800 163.68700 1.000 127.12000 ? 699 ASP A OD2   1 
ATOM   2845  N N     . GLU A 1 455 ? 87.70900  124.84400 158.96400 1.000 123.87000 ? 700 GLU A N     1 
ATOM   2846  C CA    . GLU A 1 455 ? 86.76200  125.44800 158.03400 1.000 123.87000 ? 700 GLU A CA    1 
ATOM   2847  C C     . GLU A 1 455 ? 86.31500  124.43000 156.99700 1.000 123.87000 ? 700 GLU A C     1 
ATOM   2848  O O     . GLU A 1 455 ? 85.11500  124.26400 156.73300 1.000 123.87000 ? 700 GLU A O     1 
ATOM   2849  C CB    . GLU A 1 455 ? 87.43700  126.63500 157.35900 1.000 123.87000 ? 700 GLU A CB    1 
ATOM   2850  C CG    . GLU A 1 455 ? 87.91100  127.68200 158.34800 1.000 123.87000 ? 700 GLU A CG    1 
ATOM   2851  C CD    . GLU A 1 455 ? 88.81100  128.72400 157.71200 1.000 123.87000 ? 700 GLU A CD    1 
ATOM   2852  O OE1   . GLU A 1 455 ? 89.16000  128.56200 156.52400 1.000 123.87000 ? 700 GLU A OE1   1 
ATOM   2853  O OE2   . GLU A 1 455 ? 89.18400  129.69200 158.40600 1.000 123.87000 ? 700 GLU A OE2   1 
ATOM   2854  N N     . VAL A 1 456 ? 87.28900  123.70700 156.44100 1.000 119.71000 ? 701 VAL A N     1 
ATOM   2855  C CA    . VAL A 1 456 ? 87.04100  122.59500 155.53200 1.000 119.71000 ? 701 VAL A CA    1 
ATOM   2856  C C     . VAL A 1 456 ? 86.16600  121.53700 156.18800 1.000 119.71000 ? 701 VAL A C     1 
ATOM   2857  O O     . VAL A 1 456 ? 85.22500  121.03200 155.57200 1.000 119.71000 ? 701 VAL A O     1 
ATOM   2858  C CB    . VAL A 1 456 ? 88.38700  122.01600 155.07300 1.000 119.71000 ? 701 VAL A CB    1 
ATOM   2859  C CG1   . VAL A 1 456 ? 88.21700  120.67300 154.43800 1.000 119.71000 ? 701 VAL A CG1   1 
ATOM   2860  C CG2   . VAL A 1 456 ? 89.02800  122.96500 154.10000 1.000 119.71000 ? 701 VAL A CG2   1 
ATOM   2861  N N     . HIS A 1 457 ? 86.43200  121.21900 157.45700 1.000 122.07000 ? 702 HIS A N     1 
ATOM   2862  C CA    . HIS A 1 457 ? 85.69400  120.15400 158.12700 1.000 122.07000 ? 702 HIS A CA    1 
ATOM   2863  C C     . HIS A 1 457 ? 84.23900  120.55100 158.37500 1.000 122.07000 ? 702 HIS A C     1 
ATOM   2864  O O     . HIS A 1 457 ? 83.33200  119.72000 158.23900 1.000 122.07000 ? 702 HIS A O     1 
ATOM   2865  C CB    . HIS A 1 457 ? 86.39500  119.80000 159.42900 1.000 122.07000 ? 702 HIS A CB    1 
ATOM   2866  C CG    . HIS A 1 457 ? 85.86400  118.56500 160.07400 1.000 122.07000 ? 702 HIS A CG    1 
ATOM   2867  N ND1   . HIS A 1 457 ? 86.17000  117.30100 159.61900 1.000 122.07000 ? 702 HIS A ND1   1 
ATOM   2868  C CD2   . HIS A 1 457 ? 85.04600  118.39400 161.13900 1.000 122.07000 ? 702 HIS A CD2   1 
ATOM   2869  C CE1   . HIS A 1 457 ? 85.56700  116.40500 160.38000 1.000 122.07000 ? 702 HIS A CE1   1 
ATOM   2870  N NE2   . HIS A 1 457 ? 84.87900  117.04100 161.31000 1.000 122.07000 ? 702 HIS A NE2   1 
ATOM   2871  N N     . ARG A 1 458 ? 84.00300  121.82800 158.70900 1.000 121.30000 ? 703 ARG A N     1 
ATOM   2872  C CA    . ARG A 1 458 ? 82.64200  122.36100 158.77800 1.000 121.30000 ? 703 ARG A CA    1 
ATOM   2873  C C     . ARG A 1 458 ? 81.93000  122.27400 157.43500 1.000 121.30000 ? 703 ARG A C     1 
ATOM   2874  O O     . ARG A 1 458 ? 80.75800  121.88300 157.37500 1.000 121.30000 ? 703 ARG A O     1 
ATOM   2875  C CB    . ARG A 1 458 ? 82.64000  123.81400 159.26000 1.000 121.30000 ? 703 ARG A CB    1 
ATOM   2876  C CG    . ARG A 1 458 ? 82.43900  124.03300 160.76100 1.000 121.30000 ? 703 ARG A CG    1 
ATOM   2877  C CD    . ARG A 1 458 ? 83.71900  123.99800 161.56700 1.000 121.30000 ? 703 ARG A CD    1 
ATOM   2878  N NE    . ARG A 1 458 ? 84.70500  124.96900 161.08600 1.000 121.30000 ? 703 ARG A NE    1 
ATOM   2879  C CZ    . ARG A 1 458 ? 84.76100  126.24100 161.46900 1.000 121.30000 ? 703 ARG A CZ    1 
ATOM   2880  N NH1   . ARG A 1 458 ? 83.88900  126.71500 162.34500 1.000 121.30000 ? 703 ARG A NH1   1 
ATOM   2881  N NH2   . ARG A 1 458 ? 85.69500  127.04200 160.97700 1.000 121.30000 ? 703 ARG A NH2   1 
ATOM   2882  N N     . VAL A 1 459 ? 82.62000  122.63600 156.34900 1.000 119.27000 ? 704 VAL A N     1 
ATOM   2883  C CA    . VAL A 1 459 ? 81.99100  122.59700 155.02900 1.000 119.27000 ? 704 VAL A CA    1 
ATOM   2884  C C     . VAL A 1 459 ? 81.69400  121.15800 154.61100 1.000 119.27000 ? 704 VAL A C     1 
ATOM   2885  O O     . VAL A 1 459 ? 80.63700  120.86700 154.03200 1.000 119.27000 ? 704 VAL A O     1 
ATOM   2886  C CB    . VAL A 1 459 ? 82.87800  123.32900 154.00900 1.000 119.27000 ? 704 VAL A CB    1 
ATOM   2887  C CG1   . VAL A 1 459 ? 82.32900  123.19100 152.60900 1.000 119.27000 ? 704 VAL A CG1   1 
ATOM   2888  C CG2   . VAL A 1 459 ? 82.95300  124.78500 154.36400 1.000 119.27000 ? 704 VAL A CG2   1 
ATOM   2889  N N     . VAL A 1 460 ? 82.59200  120.23500 154.95200 1.000 118.20000 ? 705 VAL A N     1 
ATOM   2890  C CA    . VAL A 1 460 ? 82.39700  118.82300 154.64800 1.000 118.20000 ? 705 VAL A CA    1 
ATOM   2891  C C     . VAL A 1 460 ? 81.20200  118.26400 155.40900 1.000 118.20000 ? 705 VAL A C     1 
ATOM   2892  O O     . VAL A 1 460 ? 80.38000  117.53600 154.83800 1.000 118.20000 ? 705 VAL A O     1 
ATOM   2893  C CB    . VAL A 1 460 ? 83.69600  118.05100 154.94000 1.000 118.20000 ? 705 VAL A CB    1 
ATOM   2894  C CG1   . VAL A 1 460 ? 83.45900  116.56000 154.99900 1.000 118.20000 ? 705 VAL A CG1   1 
ATOM   2895  C CG2   . VAL A 1 460 ? 84.68500  118.32900 153.84300 1.000 118.20000 ? 705 VAL A CG2   1 
ATOM   2896  N N     . GLU A 1 461 ? 81.05600  118.63100 156.68700 1.000 126.01000 ? 706 GLU A N     1 
ATOM   2897  C CA    . GLU A 1 461 ? 79.88700  118.18900 157.44500 1.000 126.01000 ? 706 GLU A CA    1 
ATOM   2898  C C     . GLU A 1 461 ? 78.60600  118.80000 156.89900 1.000 126.01000 ? 706 GLU A C     1 
ATOM   2899  O O     . GLU A 1 461 ? 77.56800  118.12700 156.84000 1.000 126.01000 ? 706 GLU A O     1 
ATOM   2900  C CB    . GLU A 1 461 ? 80.05000  118.52900 158.92400 1.000 126.01000 ? 706 GLU A CB    1 
ATOM   2901  C CG    . GLU A 1 461 ? 81.09900  117.70200 159.62300 1.000 126.01000 ? 706 GLU A CG    1 
ATOM   2902  C CD    . GLU A 1 461 ? 80.71900  116.23900 159.70500 1.000 126.01000 ? 706 GLU A CD    1 
ATOM   2903  O OE1   . GLU A 1 461 ? 79.51600  115.93600 159.82500 1.000 126.01000 ? 706 GLU A OE1   1 
ATOM   2904  O OE2   . GLU A 1 461 ? 81.62600  115.38500 159.64400 1.000 126.01000 ? 706 GLU A OE2   1 
ATOM   2905  N N     . ALA A 1 462 ? 78.67100  120.05700 156.46100 1.000 122.23000 ? 707 ALA A N     1 
ATOM   2906  C CA    . ALA A 1 462 ? 77.49400  120.69700 155.89500 1.000 122.23000 ? 707 ALA A CA    1 
ATOM   2907  C C     . ALA A 1 462 ? 77.08000  120.05800 154.57800 1.000 122.23000 ? 707 ALA A C     1 
ATOM   2908  O O     . ALA A 1 462 ? 75.88800  119.99700 154.27500 1.000 122.23000 ? 707 ALA A O     1 
ATOM   2909  C CB    . ALA A 1 462 ? 77.74900  122.18800 155.70400 1.000 122.23000 ? 707 ALA A CB    1 
ATOM   2910  N N     . TRP A 1 463 ? 78.03200  119.55600 153.79600 1.000 123.42000 ? 708 TRP A N     1 
ATOM   2911  C CA    . TRP A 1 463 ? 77.63500  118.84500 152.58500 1.000 123.42000 ? 708 TRP A CA    1 
ATOM   2912  C C     . TRP A 1 463 ? 77.16800  117.43000 152.87000 1.000 123.42000 ? 708 TRP A C     1 
ATOM   2913  O O     . TRP A 1 463 ? 76.24000  116.94700 152.21300 1.000 123.42000 ? 708 TRP A O     1 
ATOM   2914  C CB    . TRP A 1 463 ? 78.76700  118.80800 151.56800 1.000 123.42000 ? 708 TRP A CB    1 
ATOM   2915  C CG    . TRP A 1 463 ? 78.89500  120.06900 150.82400 1.000 123.42000 ? 708 TRP A CG    1 
ATOM   2916  C CD1   . TRP A 1 463 ? 79.84100  121.03100 150.98700 1.000 123.42000 ? 708 TRP A CD1   1 
ATOM   2917  C CD2   . TRP A 1 463 ? 78.00900  120.54300 149.81200 1.000 123.42000 ? 708 TRP A CD2   1 
ATOM   2918  N NE1   . TRP A 1 463 ? 79.61600  122.06500 150.11400 1.000 123.42000 ? 708 TRP A NE1   1 
ATOM   2919  C CE2   . TRP A 1 463 ? 78.49100  121.78700 149.38500 1.000 123.42000 ? 708 TRP A CE2   1 
ATOM   2920  C CE3   . TRP A 1 463 ? 76.85900  120.02700 149.21700 1.000 123.42000 ? 708 TRP A CE3   1 
ATOM   2921  C CZ2   . TRP A 1 463 ? 77.86500  122.52200 148.39300 1.000 123.42000 ? 708 TRP A CZ2   1 
ATOM   2922  C CZ3   . TRP A 1 463 ? 76.23600  120.76300 148.23700 1.000 123.42000 ? 708 TRP A CZ3   1 
ATOM   2923  C CH2   . TRP A 1 463 ? 76.74000  121.99500 147.83200 1.000 123.42000 ? 708 TRP A CH2   1 
ATOM   2924  N N     . LYS A 1 464 ? 77.78000  116.75700 153.84000 1.000 122.14000 ? 709 LYS A N     1 
ATOM   2925  C CA    . LYS A 1 464 ? 77.37800  115.39500 154.15100 1.000 122.14000 ? 709 LYS A CA    1 
ATOM   2926  C C     . LYS A 1 464 ? 76.04000  115.33800 154.87500 1.000 122.14000 ? 709 LYS A C     1 
ATOM   2927  O O     . LYS A 1 464 ? 75.44000  114.26200 154.94800 1.000 122.14000 ? 709 LYS A O     1 
ATOM   2928  C CB    . LYS A 1 464 ? 78.46900  114.71200 154.97100 1.000 122.14000 ? 709 LYS A CB    1 
ATOM   2929  C CG    . LYS A 1 464 ? 79.71700  114.38900 154.16500 1.000 122.14000 ? 709 LYS A CG    1 
ATOM   2930  C CD    . LYS A 1 464 ? 80.84400  113.89400 155.05000 1.000 122.14000 ? 709 LYS A CD    1 
ATOM   2931  C CE    . LYS A 1 464 ? 80.58100  112.50700 155.59400 1.000 122.14000 ? 709 LYS A CE    1 
ATOM   2932  N NZ    . LYS A 1 464 ? 80.65600  111.46400 154.54400 1.000 122.14000 ? 709 LYS A NZ    1 
ATOM   2933  N N     . LEU A 1 465 ? 75.55800  116.46000 155.41100 1.000 134.62000 ? 710 LEU A N     1 
ATOM   2934  C CA    . LEU A 1 465 ? 74.17500  116.51000 155.87300 1.000 134.62000 ? 710 LEU A CA    1 
ATOM   2935  C C     . LEU A 1 465 ? 73.19700  116.89100 154.77000 1.000 134.62000 ? 710 LEU A C     1 
ATOM   2936  O O     . LEU A 1 465 ? 72.06300  116.39900 154.76200 1.000 134.62000 ? 710 LEU A O     1 
ATOM   2937  C CB    . LEU A 1 465 ? 74.02100  117.50200 157.02600 1.000 134.62000 ? 710 LEU A CB    1 
ATOM   2938  C CG    . LEU A 1 465 ? 74.75900  117.17400 158.31900 1.000 134.62000 ? 710 LEU A CG    1 
ATOM   2939  C CD1   . LEU A 1 465 ? 74.50900  118.25900 159.36300 1.000 134.62000 ? 710 LEU A CD1   1 
ATOM   2940  C CD2   . LEU A 1 465 ? 74.37800  115.79700 158.83200 1.000 134.62000 ? 710 LEU A CD2   1 
ATOM   2941  N N     . ARG A 1 466 ? 73.60400  117.75400 153.83800 1.000 139.01000 ? 711 ARG A N     1 
ATOM   2942  C CA    . ARG A 1 466 ? 72.73300  118.22000 152.76700 1.000 139.01000 ? 711 ARG A CA    1 
ATOM   2943  C C     . ARG A 1 466 ? 72.74200  117.30400 151.55100 1.000 139.01000 ? 711 ARG A C     1 
ATOM   2944  O O     . ARG A 1 466 ? 72.31200  117.72600 150.47300 1.000 139.01000 ? 711 ARG A O     1 
ATOM   2945  C CB    . ARG A 1 466 ? 73.12700  119.63300 152.32900 1.000 139.01000 ? 711 ARG A CB    1 
ATOM   2946  C CG    . ARG A 1 466 ? 72.91000  120.74200 153.34900 1.000 139.01000 ? 711 ARG A CG    1 
ATOM   2947  C CD    . ARG A 1 466 ? 71.45300  121.08300 153.55800 1.000 139.01000 ? 711 ARG A CD    1 
ATOM   2948  N NE    . ARG A 1 466 ? 71.31100  122.27900 154.38300 1.000 139.01000 ? 711 ARG A NE    1 
ATOM   2949  C CZ    . ARG A 1 466 ? 71.23900  122.26900 155.70900 1.000 139.01000 ? 711 ARG A CZ    1 
ATOM   2950  N NH1   . ARG A 1 466 ? 71.29900  121.12200 156.37100 1.000 139.01000 ? 711 ARG A NH1   1 
ATOM   2951  N NH2   . ARG A 1 466 ? 71.11200  123.40700 156.37700 1.000 139.01000 ? 711 ARG A NH2   1 
ATOM   2952  N N     . GLY A 1 467 ? 73.22100  116.07200 151.68600 1.000 141.92000 ? 712 GLY A N     1 
ATOM   2953  C CA    . GLY A 1 467 ? 73.30900  115.21600 150.52100 1.000 141.92000 ? 712 GLY A CA    1 
ATOM   2954  C C     . GLY A 1 467 ? 73.40300  113.72900 150.78900 1.000 141.92000 ? 712 GLY A C     1 
ATOM   2955  O O     . GLY A 1 467 ? 72.76400  113.20800 151.70700 1.000 141.92000 ? 712 GLY A O     1 
ATOM   2956  N N     . ALA A 1 468 ? 74.20900  113.04400 149.98700 1.000 139.90000 ? 713 ALA A N     1 
ATOM   2957  C CA    . ALA A 1 468 ? 74.26700  111.59000 149.96300 1.000 139.90000 ? 713 ALA A CA    1 
ATOM   2958  C C     . ALA A 1 468 ? 75.53800  111.17400 149.22400 1.000 139.90000 ? 713 ALA A C     1 
ATOM   2959  O O     . ALA A 1 468 ? 76.09900  111.96600 148.46500 1.000 139.90000 ? 713 ALA A O     1 
ATOM   2960  C CB    . ALA A 1 468 ? 73.02500  110.99300 149.27700 1.000 139.90000 ? 713 ALA A CB    1 
ATOM   2961  N N     . PRO A 1 469 ? 76.01600  109.94900 149.44800 1.000 145.74000 ? 714 PRO A N     1 
ATOM   2962  C CA    . PRO A 1 469 ? 77.12600  109.43200 148.63600 1.000 145.74000 ? 714 PRO A CA    1 
ATOM   2963  C C     . PRO A 1 469 ? 76.73700  109.08500 147.20500 1.000 145.74000 ? 714 PRO A C     1 
ATOM   2964  O O     . PRO A 1 469 ? 76.47300  107.92000 146.89100 1.000 145.74000 ? 714 PRO A O     1 
ATOM   2965  C CB    . PRO A 1 469 ? 77.56200  108.18000 149.40800 1.000 145.74000 ? 714 PRO A CB    1 
ATOM   2966  C CG    . PRO A 1 469 ? 77.15100  108.44000 150.80100 1.000 145.74000 ? 714 PRO A CG    1 
ATOM   2967  C CD    . PRO A 1 469 ? 75.86000  109.18400 150.69800 1.000 145.74000 ? 714 PRO A CD    1 
ATOM   2968  N N     . ASP A 1 470 ? 76.70400  110.08900 146.33100 1.000 135.47000 ? 715 ASP A N     1 
ATOM   2969  C CA    . ASP A 1 470 ? 76.42500  109.87600 144.91700 1.000 135.47000 ? 715 ASP A CA    1 
ATOM   2970  C C     . ASP A 1 470 ? 77.70500  109.45900 144.20000 1.000 135.47000 ? 715 ASP A C     1 
ATOM   2971  O O     . ASP A 1 470 ? 78.76900  110.04000 144.42800 1.000 135.47000 ? 715 ASP A O     1 
ATOM   2972  C CB    . ASP A 1 470 ? 75.85200  111.15400 144.30200 1.000 135.47000 ? 715 ASP A CB    1 
ATOM   2973  C CG    . ASP A 1 470 ? 75.20400  110.92400 142.94800 1.000 135.47000 ? 715 ASP A CG    1 
ATOM   2974  O OD1   . ASP A 1 470 ? 75.19900  109.77800 142.45700 1.000 135.47000 ? 715 ASP A OD1   1 
ATOM   2975  O OD2   . ASP A 1 470 ? 74.68400  111.90100 142.37200 1.000 135.47000 ? 715 ASP A OD2   1 
ATOM   2976  N N     . TYR A 1 471 ? 77.60200  108.45200 143.33200 1.000 133.71000 ? 716 TYR A N     1 
ATOM   2977  C CA    . TYR A 1 471 ? 78.77200  107.87500 142.68200 1.000 133.71000 ? 716 TYR A CA    1 
ATOM   2978  C C     . TYR A 1 471 ? 78.42500  107.34300 141.29700 1.000 133.71000 ? 716 TYR A C     1 
ATOM   2979  O O     . TYR A 1 471 ? 77.32400  106.83400 141.07500 1.000 133.71000 ? 716 TYR A O     1 
ATOM   2980  C CB    . TYR A 1 471 ? 79.36600  106.73300 143.51500 1.000 133.71000 ? 716 TYR A CB    1 
ATOM   2981  C CG    . TYR A 1 471 ? 80.12700  107.15300 144.75200 1.000 133.71000 ? 716 TYR A CG    1 
ATOM   2982  C CD1   . TYR A 1 471 ? 81.46400  107.51300 144.67700 1.000 133.71000 ? 716 TYR A CD1   1 
ATOM   2983  C CD2   . TYR A 1 471 ? 79.51600  107.17600 145.99300 1.000 133.71000 ? 716 TYR A CD2   1 
ATOM   2984  C CE1   . TYR A 1 471 ? 82.16800  107.88800 145.79300 1.000 133.71000 ? 716 TYR A CE1   1 
ATOM   2985  C CE2   . TYR A 1 471 ? 80.21300  107.55200 147.11800 1.000 133.71000 ? 716 TYR A CE2   1 
ATOM   2986  C CZ    . TYR A 1 471 ? 81.53600  107.90700 147.01100 1.000 133.71000 ? 716 TYR A CZ    1 
ATOM   2987  O OH    . TYR A 1 471 ? 82.23000  108.28200 148.13400 1.000 133.71000 ? 716 TYR A OH    1 
ATOM   2988  N N     . ILE A 1 472 ? 79.37700  107.46900 140.37600 1.000 140.28000 ? 717 ILE A N     1 
ATOM   2989  C CA    . ILE A 1 472 ? 79.39100  106.71300 139.12700 1.000 140.28000 ? 717 ILE A CA    1 
ATOM   2990  C C     . ILE A 1 472 ? 80.50700  105.68300 139.26800 1.000 140.28000 ? 717 ILE A C     1 
ATOM   2991  O O     . ILE A 1 472 ? 81.69400  106.01200 139.18000 1.000 140.28000 ? 717 ILE A O     1 
ATOM   2992  C CB    . ILE A 1 472 ? 79.59800  107.60900 137.90100 1.000 140.28000 ? 717 ILE A CB    1 
ATOM   2993  C CG1   . ILE A 1 472 ? 78.42000  108.55900 137.71900 1.000 140.28000 ? 717 ILE A CG1   1 
ATOM   2994  C CG2   . ILE A 1 472 ? 79.77100  106.77500 136.63500 1.000 140.28000 ? 717 ILE A CG2   1 
ATOM   2995  C CD1   . ILE A 1 472 ? 78.61500  109.54800 136.58900 1.000 140.28000 ? 717 ILE A CD1   1 
ATOM   2996  N N     . GLU A 1 473 ? 80.13200  104.43200 139.50500 1.000 147.87000 ? 718 GLU A N     1 
ATOM   2997  C CA    . GLU A 1 473 ? 81.12700  103.40800 139.76100 1.000 147.87000 ? 718 GLU A CA    1 
ATOM   2998  C C     . GLU A 1 473 ? 81.49400  102.68100 138.47100 1.000 147.87000 ? 718 GLU A C     1 
ATOM   2999  O O     . GLU A 1 473 ? 81.02000  103.01700 137.38100 1.000 147.87000 ? 718 GLU A O     1 
ATOM   3000  C CB    . GLU A 1 473 ? 80.63000  102.44900 140.83500 1.000 147.87000 ? 718 GLU A CB    1 
ATOM   3001  C CG    . GLU A 1 473 ? 80.49100  103.10600 142.19800 1.000 147.87000 ? 718 GLU A CG    1 
ATOM   3002  C CD    . GLU A 1 473 ? 81.82800  103.53800 142.78000 1.000 147.87000 ? 718 GLU A CD    1 
ATOM   3003  O OE1   . GLU A 1 473 ? 82.84900  102.86900 142.50700 1.000 147.87000 ? 718 GLU A OE1   1 
ATOM   3004  O OE2   . GLU A 1 473 ? 81.86200  104.54400 143.52000 1.000 147.87000 ? 718 GLU A OE2   1 
ATOM   3005  N N     . ASP A 1 474 ? 82.36300  101.67100 138.61900 1.000 156.92000 ? 719 ASP A N     1 
ATOM   3006  C CA    . ASP A 1 474 ? 83.13800  101.06000 137.52700 1.000 156.92000 ? 719 ASP A CA    1 
ATOM   3007  C C     . ASP A 1 474 ? 83.91400  102.10200 136.72600 1.000 156.92000 ? 719 ASP A C     1 
ATOM   3008  O O     . ASP A 1 474 ? 84.11900  101.96100 135.51800 1.000 156.92000 ? 719 ASP A O     1 
ATOM   3009  C CB    . ASP A 1 474 ? 82.27100  100.20100 136.60300 1.000 156.92000 ? 719 ASP A CB    1 
ATOM   3010  C CG    . ASP A 1 474 ? 81.90900  98.87400  137.22100 1.000 156.92000 ? 719 ASP A CG    1 
ATOM   3011  O OD1   . ASP A 1 474 ? 82.69400  98.38600  138.06000 1.000 156.92000 ? 719 ASP A OD1   1 
ATOM   3012  O OD2   . ASP A 1 474 ? 80.85500  98.31100  136.85800 1.000 156.92000 ? 719 ASP A OD2   1 
ATOM   3013  N N     . ILE A 1 475 ? 84.36000  103.15600 137.40700 1.000 136.20000 ? 720 ILE A N     1 
ATOM   3014  C CA    . ILE A 1 475 ? 85.25300  104.12800 136.80200 1.000 136.20000 ? 720 ILE A CA    1 
ATOM   3015  C C     . ILE A 1 475 ? 86.68600  103.61600 136.82300 1.000 136.20000 ? 720 ILE A C     1 
ATOM   3016  O O     . ILE A 1 475 ? 87.50700  104.03600 136.00000 1.000 136.20000 ? 720 ILE A O     1 
ATOM   3017  C CB    . ILE A 1 475 ? 85.06900  105.46900 137.53700 1.000 136.20000 ? 720 ILE A CB    1 
ATOM   3018  C CG1   . ILE A 1 475 ? 85.78500  106.61400 136.83500 1.000 136.20000 ? 720 ILE A CG1   1 
ATOM   3019  C CG2   . ILE A 1 475 ? 85.50400  105.36800 138.98300 1.000 136.20000 ? 720 ILE A CG2   1 
ATOM   3020  C CD1   . ILE A 1 475 ? 85.42600  107.93800 137.40900 1.000 136.20000 ? 720 ILE A CD1   1 
ATOM   3021  N N     . LEU A 1 476 ? 86.98900  102.66900 137.70200 1.000 131.10000 ? 721 LEU A N     1 
ATOM   3022  C CA    . LEU A 1 476 ? 88.33500  102.15600 137.84500 1.000 131.10000 ? 721 LEU A CA    1 
ATOM   3023  C C     . LEU A 1 476 ? 88.53600  100.98800 136.89800 1.000 131.10000 ? 721 LEU A C     1 
ATOM   3024  O O     . LEU A 1 476 ? 87.65700  100.68100 136.09500 1.000 131.10000 ? 721 LEU A O     1 
ATOM   3025  C CB    . LEU A 1 476 ? 88.58700  101.72500 139.28400 1.000 131.10000 ? 721 LEU A CB    1 
ATOM   3026  C CG    . LEU A 1 476 ? 88.39800  102.84500 140.30200 1.000 131.10000 ? 721 LEU A CG    1 
ATOM   3027  C CD1   . LEU A 1 476 ? 88.57900  102.32000 141.70900 1.000 131.10000 ? 721 LEU A CD1   1 
ATOM   3028  C CD2   . LEU A 1 476 ? 89.34300  103.98900 140.02300 1.000 131.10000 ? 721 LEU A CD2   1 
ATOM   3029  N N     . LEU B 1 70  ? 76.04600  130.64900 91.50100  1.000 152.19000 ? 315 LEU B N     1 
ATOM   3030  C CA    . LEU B 1 70  ? 76.00500  132.08100 91.75600  1.000 152.19000 ? 315 LEU B CA    1 
ATOM   3031  C C     . LEU B 1 70  ? 76.13400  132.35700 93.25400  1.000 152.19000 ? 315 LEU B C     1 
ATOM   3032  O O     . LEU B 1 70  ? 75.14400  132.31900 93.98100  1.000 152.19000 ? 315 LEU B O     1 
ATOM   3033  C CB    . LEU B 1 70  ? 74.71500  132.67900 91.18700  1.000 152.19000 ? 315 LEU B CB    1 
ATOM   3034  C CG    . LEU B 1 70  ? 74.52900  134.19800 91.10000  1.000 152.19000 ? 315 LEU B CG    1 
ATOM   3035  C CD1   . LEU B 1 70  ? 73.76900  134.51900 89.83100  1.000 152.19000 ? 315 LEU B CD1   1 
ATOM   3036  C CD2   . LEU B 1 70  ? 73.76300  134.76200 92.29000  1.000 152.19000 ? 315 LEU B CD2   1 
ATOM   3037  N N     . PRO B 1 71  ? 77.35300  132.61800 93.71800  1.000 156.14000 ? 316 PRO B N     1 
ATOM   3038  C CA    . PRO B 1 71  ? 77.55500  132.93900 95.13200  1.000 156.14000 ? 316 PRO B CA    1 
ATOM   3039  C C     . PRO B 1 71  ? 77.27600  134.40600 95.40900  1.000 156.14000 ? 316 PRO B C     1 
ATOM   3040  O O     . PRO B 1 71  ? 77.62900  135.28100 94.60500  1.000 156.14000 ? 316 PRO B O     1 
ATOM   3041  C CB    . PRO B 1 71  ? 79.03400  132.60100 95.35800  1.000 156.14000 ? 316 PRO B CB    1 
ATOM   3042  C CG    . PRO B 1 71  ? 79.66200  132.78600 94.02800  1.000 156.14000 ? 316 PRO B CG    1 
ATOM   3043  C CD    . PRO B 1 71  ? 78.62900  132.39200 93.01500  1.000 156.14000 ? 316 PRO B CD    1 
ATOM   3044  N N     . PRO B 1 72  ? 76.62200  134.71700 96.52400  1.000 148.88000 ? 317 PRO B N     1 
ATOM   3045  C CA    . PRO B 1 72  ? 76.44300  136.11400 96.92200  1.000 148.88000 ? 317 PRO B CA    1 
ATOM   3046  C C     . PRO B 1 72  ? 77.56800  136.58300 97.83300  1.000 148.88000 ? 317 PRO B C     1 
ATOM   3047  O O     . PRO B 1 72  ? 78.23400  135.79500 98.50500  1.000 148.88000 ? 317 PRO B O     1 
ATOM   3048  C CB    . PRO B 1 72  ? 75.11400  136.08300 97.68400  1.000 148.88000 ? 317 PRO B CB    1 
ATOM   3049  C CG    . PRO B 1 72  ? 75.10100  134.72600 98.29800  1.000 148.88000 ? 317 PRO B CG    1 
ATOM   3050  C CD    . PRO B 1 72  ? 75.77600  133.80700 97.31500  1.000 148.88000 ? 317 PRO B CD    1 
ATOM   3051  N N     . LEU B 1 73  ? 77.76300  137.89900 97.85400  1.000 144.34000 ? 318 LEU B N     1 
ATOM   3052  C CA    . LEU B 1 73  ? 78.80600  138.49000 98.68200  1.000 144.34000 ? 318 LEU B CA    1 
ATOM   3053  C C     . LEU B 1 73  ? 78.28000  139.28400 99.86200  1.000 144.34000 ? 318 LEU B C     1 
ATOM   3054  O O     . LEU B 1 73  ? 78.97100  139.38400 100.87600 1.000 144.34000 ? 318 LEU B O     1 
ATOM   3055  C CB    . LEU B 1 73  ? 79.71100  139.39900 97.84500  1.000 144.34000 ? 318 LEU B CB    1 
ATOM   3056  C CG    . LEU B 1 73  ? 80.59100  138.68300 96.82200  1.000 144.34000 ? 318 LEU B CG    1 
ATOM   3057  C CD1   . LEU B 1 73  ? 81.36300  139.68500 95.98400  1.000 144.34000 ? 318 LEU B CD1   1 
ATOM   3058  C CD2   . LEU B 1 73  ? 81.53500  137.72700 97.52400  1.000 144.34000 ? 318 LEU B CD2   1 
ATOM   3059  N N     . SER B 1 74  ? 77.07500  139.84100 99.76600  1.000 144.39000 ? 319 SER B N     1 
ATOM   3060  C CA    . SER B 1 74  ? 76.48800  140.61800 100.84700 1.000 144.39000 ? 319 SER B CA    1 
ATOM   3061  C C     . SER B 1 74  ? 75.70700  139.75600 101.82700 1.000 144.39000 ? 319 SER B C     1 
ATOM   3062  O O     . SER B 1 74  ? 74.84700  140.27500 102.54500 1.000 144.39000 ? 319 SER B O     1 
ATOM   3063  C CB    . SER B 1 74  ? 75.58400  141.71500 100.28000 1.000 144.39000 ? 319 SER B CB    1 
ATOM   3064  O OG    . SER B 1 74  ? 76.33000  142.65300 99.52500  1.000 144.39000 ? 319 SER B OG    1 
ATOM   3065  N N     . LEU B 1 75  ? 75.99100  138.45400 101.86900 1.000 142.30000 ? 320 LEU B N     1 
ATOM   3066  C CA    . LEU B 1 75  ? 75.25400  137.54600 102.73500 1.000 142.30000 ? 320 LEU B CA    1 
ATOM   3067  C C     . LEU B 1 75  ? 75.56200  137.79600 104.20600 1.000 142.30000 ? 320 LEU B C     1 
ATOM   3068  O O     . LEU B 1 75  ? 74.71800  137.53700 105.07100 1.000 142.30000 ? 320 LEU B O     1 
ATOM   3069  C CB    . LEU B 1 75  ? 75.58800  136.10800 102.35200 1.000 142.30000 ? 320 LEU B CB    1 
ATOM   3070  C CG    . LEU B 1 75  ? 74.85100  134.96800 103.04500 1.000 142.30000 ? 320 LEU B CG    1 
ATOM   3071  C CD1   . LEU B 1 75  ? 73.38400  134.98100 102.66700 1.000 142.30000 ? 320 LEU B CD1   1 
ATOM   3072  C CD2   . LEU B 1 75  ? 75.49800  133.64800 102.70600 1.000 142.30000 ? 320 LEU B CD2   1 
ATOM   3073  N N     . LEU B 1 76  ? 76.74400  138.31500 104.50700 1.000 147.70000 ? 321 LEU B N     1 
ATOM   3074  C CA    . LEU B 1 76  ? 77.16300  138.55900 105.87500 1.000 147.70000 ? 321 LEU B CA    1 
ATOM   3075  C C     . LEU B 1 76  ? 77.09300  140.05300 106.19200 1.000 147.70000 ? 321 LEU B C     1 
ATOM   3076  O O     . LEU B 1 76  ? 76.66700  140.86900 105.37200 1.000 147.70000 ? 321 LEU B O     1 
ATOM   3077  C CB    . LEU B 1 76  ? 78.56300  137.98900 106.11900 1.000 147.70000 ? 321 LEU B CB    1 
ATOM   3078  C CG    . LEU B 1 76  ? 79.79800  138.68100 105.54100 1.000 147.70000 ? 321 LEU B CG    1 
ATOM   3079  C CD1   . LEU B 1 76  ? 81.01200  138.23400 106.32700 1.000 147.70000 ? 321 LEU B CD1   1 
ATOM   3080  C CD2   . LEU B 1 76  ? 80.01000  138.38600 104.06100 1.000 147.70000 ? 321 LEU B CD2   1 
ATOM   3081  N N     . ASP B 1 77  ? 77.51800  140.41200 107.40300 1.000 154.19000 ? 322 ASP B N     1 
ATOM   3082  C CA    . ASP B 1 77  ? 77.24600  141.74100 107.93400 1.000 154.19000 ? 322 ASP B CA    1 
ATOM   3083  C C     . ASP B 1 77  ? 78.17800  142.79600 107.32500 1.000 154.19000 ? 322 ASP B C     1 
ATOM   3084  O O     . ASP B 1 77  ? 79.30400  142.48800 106.93000 1.000 154.19000 ? 322 ASP B O     1 
ATOM   3085  C CB    . ASP B 1 77  ? 77.34400  141.72000 109.46200 1.000 154.19000 ? 322 ASP B CB    1 
ATOM   3086  C CG    . ASP B 1 77  ? 78.63000  141.11600 109.96300 1.000 154.19000 ? 322 ASP B CG    1 
ATOM   3087  O OD1   . ASP B 1 77  ? 79.42300  140.62600 109.13900 1.000 154.19000 ? 322 ASP B OD1   1 
ATOM   3088  O OD2   . ASP B 1 77  ? 78.84200  141.12500 111.19400 1.000 154.19000 ? 322 ASP B OD2   1 
ATOM   3089  N N     . PRO B 1 78  ? 77.71000  144.05700 107.20500 1.000 154.49000 ? 323 PRO B N     1 
ATOM   3090  C CA    . PRO B 1 78  ? 78.50800  145.07900 106.51400 1.000 154.49000 ? 323 PRO B CA    1 
ATOM   3091  C C     . PRO B 1 78  ? 79.52100  145.77400 107.40300 1.000 154.49000 ? 323 PRO B C     1 
ATOM   3092  O O     . PRO B 1 78  ? 79.72600  145.38900 108.55600 1.000 154.49000 ? 323 PRO B O     1 
ATOM   3093  C CB    . PRO B 1 78  ? 77.45000  146.07600 106.03600 1.000 154.49000 ? 323 PRO B CB    1 
ATOM   3094  C CG    . PRO B 1 78  ? 76.39900  145.98900 107.07200 1.000 154.49000 ? 323 PRO B CG    1 
ATOM   3095  C CD    . PRO B 1 78  ? 76.34700  144.54800 107.49100 1.000 154.49000 ? 323 PRO B CD    1 
ATOM   3096  N N     . ALA B 1 79  ? 80.15400  146.81400 106.86600 1.000 156.41000 ? 324 ALA B N     1 
ATOM   3097  C CA    . ALA B 1 79  ? 81.10500  147.62900 107.61800 1.000 156.41000 ? 324 ALA B CA    1 
ATOM   3098  C C     . ALA B 1 79  ? 80.32100  148.62400 108.46100 1.000 156.41000 ? 324 ALA B C     1 
ATOM   3099  O O     . ALA B 1 79  ? 79.93300  149.69200 107.98000 1.000 156.41000 ? 324 ALA B O     1 
ATOM   3100  C CB    . ALA B 1 79  ? 82.06700  148.34300 106.67800 1.000 156.41000 ? 324 ALA B CB    1 
ATOM   3101  N N     . GLU B 1 80  ? 80.06900  148.26300 109.71900 1.000 168.76000 ? 325 GLU B N     1 
ATOM   3102  C CA    . GLU B 1 80  ? 79.33300  149.11800 110.64200 1.000 168.76000 ? 325 GLU B CA    1 
ATOM   3103  C C     . GLU B 1 80  ? 80.07400  150.41000 110.95800 1.000 168.76000 ? 325 GLU B C     1 
ATOM   3104  O O     . GLU B 1 80  ? 79.64700  151.49500 110.54800 1.000 168.76000 ? 325 GLU B O     1 
ATOM   3105  C CB    . GLU B 1 80  ? 79.04500  148.36100 111.94000 1.000 168.76000 ? 325 GLU B CB    1 
ATOM   3106  C CG    . GLU B 1 80  ? 78.29600  149.16200 112.99400 1.000 168.76000 ? 325 GLU B CG    1 
ATOM   3107  C CD    . GLU B 1 80  ? 76.86700  149.47100 112.60200 1.000 168.76000 ? 325 GLU B CD    1 
ATOM   3108  O OE1   . GLU B 1 80  ? 76.28100  148.69700 111.81800 1.000 168.76000 ? 325 GLU B OE1   1 
ATOM   3109  O OE2   . GLU B 1 80  ? 76.32500  150.48600 113.08500 1.000 168.76000 ? 325 GLU B OE2   1 
ATOM   3110  N N     . VAL B 1 81  ? 81.19800  150.30400 111.66400 1.000 165.83000 ? 326 VAL B N     1 
ATOM   3111  C CA    . VAL B 1 81  ? 81.95000  151.46800 112.12000 1.000 165.83000 ? 326 VAL B CA    1 
ATOM   3112  C C     . VAL B 1 81  ? 83.43000  151.23100 111.86500 1.000 165.83000 ? 326 VAL B C     1 
ATOM   3113  O O     . VAL B 1 81  ? 83.82700  150.15700 111.40300 1.000 165.83000 ? 326 VAL B O     1 
ATOM   3114  C CB    . VAL B 1 81  ? 81.70100  151.76300 113.61300 1.000 165.83000 ? 326 VAL B CB    1 
ATOM   3115  C CG1   . VAL B 1 81  ? 80.29100  152.29400 113.86300 1.000 165.83000 ? 326 VAL B CG1   1 
ATOM   3116  C CG2   . VAL B 1 81  ? 81.94200  150.51000 114.43400 1.000 165.83000 ? 326 VAL B CG2   1 
ATOM   3117  N N     . LYS B 1 82  ? 84.25600  152.23600 112.16100 1.000 163.45000 ? 327 LYS B N     1 
ATOM   3118  C CA    . LYS B 1 82  ? 85.70200  152.08900 112.09800 1.000 163.45000 ? 327 LYS B CA    1 
ATOM   3119  C C     . LYS B 1 82  ? 86.42500  152.64700 113.31800 1.000 163.45000 ? 327 LYS B C     1 
ATOM   3120  O O     . LYS B 1 82  ? 87.65800  152.73400 113.29400 1.000 163.45000 ? 327 LYS B O     1 
ATOM   3121  C CB    . LYS B 1 82  ? 86.26300  152.74400 110.82400 1.000 163.45000 ? 327 LYS B CB    1 
ATOM   3122  C CG    . LYS B 1 82  ? 85.95000  151.97800 109.53800 1.000 163.45000 ? 327 LYS B CG    1 
ATOM   3123  C CD    . LYS B 1 82  ? 86.58700  152.62300 108.31500 1.000 163.45000 ? 327 LYS B CD    1 
ATOM   3124  C CE    . LYS B 1 82  ? 86.25100  151.84600 107.05300 1.000 163.45000 ? 327 LYS B CE    1 
ATOM   3125  N NZ    . LYS B 1 82  ? 86.85200  152.45600 105.83900 1.000 163.45000 ? 327 LYS B NZ    1 
ATOM   3126  N N     . GLN B 1 83  ? 85.69600  153.07000 114.35400 1.000 169.04000 ? 328 GLN B N     1 
ATOM   3127  C CA    . GLN B 1 83  ? 86.12000  153.36500 115.72200 1.000 169.04000 ? 328 GLN B CA    1 
ATOM   3128  C C     . GLN B 1 83  ? 86.94400  154.64800 115.85800 1.000 169.04000 ? 328 GLN B C     1 
ATOM   3129  O O     . GLN B 1 83  ? 87.27900  155.01600 116.98800 1.000 169.04000 ? 328 GLN B O     1 
ATOM   3130  C CB    . GLN B 1 83  ? 86.91200  152.21200 116.37000 1.000 169.04000 ? 328 GLN B CB    1 
ATOM   3131  C CG    . GLN B 1 83  ? 86.10600  150.96300 116.66200 1.000 169.04000 ? 328 GLN B CG    1 
ATOM   3132  C CD    . GLN B 1 83  ? 85.04500  151.18900 117.71700 1.000 169.04000 ? 328 GLN B CD    1 
ATOM   3133  O OE1   . GLN B 1 83  ? 83.85000  151.17300 117.42700 1.000 169.04000 ? 328 GLN B OE1   1 
ATOM   3134  N NE2   . GLN B 1 83  ? 85.47800  151.40600 118.95100 1.000 169.04000 ? 328 GLN B NE2   1 
ATOM   3135  N N     . LYS B 1 84  ? 87.34500  155.29800 114.75700 1.000 163.54000 ? 329 LYS B N     1 
ATOM   3136  C CA    . LYS B 1 84  ? 87.98000  156.61800 114.65600 1.000 163.54000 ? 329 LYS B CA    1 
ATOM   3137  C C     . LYS B 1 84  ? 89.41500  156.66000 115.22600 1.000 163.54000 ? 329 LYS B C     1 
ATOM   3138  O O     . LYS B 1 84  ? 90.15300  157.61900 114.95200 1.000 163.54000 ? 329 LYS B O     1 
ATOM   3139  C CB    . LYS B 1 84  ? 87.07700  157.69900 115.29800 1.000 163.54000 ? 329 LYS B CB    1 
ATOM   3140  C CG    . LYS B 1 84  ? 87.41500  159.16200 115.03500 1.000 163.54000 ? 329 LYS B CG    1 
ATOM   3141  C CD    . LYS B 1 84  ? 87.32200  159.49600 113.55900 1.000 163.54000 ? 329 LYS B CD    1 
ATOM   3142  C CE    . LYS B 1 84  ? 85.88300  159.51300 113.08400 1.000 163.54000 ? 329 LYS B CE    1 
ATOM   3143  N NZ    . LYS B 1 84  ? 85.78500  159.94700 111.66300 1.000 163.54000 ? 329 LYS B NZ    1 
ATOM   3144  N N     . SER B 1 85  ? 89.85700  155.59500 115.90800 1.000 158.76000 ? 330 SER B N     1 
ATOM   3145  C CA    . SER B 1 85  ? 91.22800  155.39500 116.40400 1.000 158.76000 ? 330 SER B CA    1 
ATOM   3146  C C     . SER B 1 85  ? 91.72200  156.56000 117.25800 1.000 158.76000 ? 330 SER B C     1 
ATOM   3147  O O     . SER B 1 85  ? 92.75200  157.17600 116.97100 1.000 158.76000 ? 330 SER B O     1 
ATOM   3148  C CB    . SER B 1 85  ? 92.19300  155.12400 115.25400 1.000 158.76000 ? 330 SER B CB    1 
ATOM   3149  O OG    . SER B 1 85  ? 93.51800  155.00800 115.73800 1.000 158.76000 ? 330 SER B OG    1 
ATOM   3150  N N     . TYR B 1 86  ? 90.90100  156.91800 118.25400 1.000 152.85000 ? 331 TYR B N     1 
ATOM   3151  C CA    . TYR B 1 86  ? 91.14300  157.86500 119.34900 1.000 152.85000 ? 331 TYR B CA    1 
ATOM   3152  C C     . TYR B 1 86  ? 91.17800  159.33000 118.91700 1.000 152.85000 ? 331 TYR B C     1 
ATOM   3153  O O     . TYR B 1 86  ? 91.00500  160.21500 119.76300 1.000 152.85000 ? 331 TYR B O     1 
ATOM   3154  C CB    . TYR B 1 86  ? 92.45900  157.54500 120.07500 1.000 152.85000 ? 331 TYR B CB    1 
ATOM   3155  C CG    . TYR B 1 86  ? 92.47300  156.24400 120.82900 1.000 152.85000 ? 331 TYR B CG    1 
ATOM   3156  C CD1   . TYR B 1 86  ? 91.30300  155.69600 121.32500 1.000 152.85000 ? 331 TYR B CD1   1 
ATOM   3157  C CD2   . TYR B 1 86  ? 93.65600  155.53300 120.99200 1.000 152.85000 ? 331 TYR B CD2   1 
ATOM   3158  C CE1   . TYR B 1 86  ? 91.31600  154.50500 122.01100 1.000 152.85000 ? 331 TYR B CE1   1 
ATOM   3159  C CE2   . TYR B 1 86  ? 93.67600  154.32800 121.66300 1.000 152.85000 ? 331 TYR B CE2   1 
ATOM   3160  C CZ    . TYR B 1 86  ? 92.50100  153.81800 122.16700 1.000 152.85000 ? 331 TYR B CZ    1 
ATOM   3161  O OH    . TYR B 1 86  ? 92.51300  152.62000 122.83800 1.000 152.85000 ? 331 TYR B OH    1 
ATOM   3162  N N     . SER B 1 87  ? 91.33100  159.58800 117.60400 1.000 150.37000 ? 332 SER B N     1 
ATOM   3163  C CA    . SER B 1 87  ? 91.30900  160.87900 116.92200 1.000 150.37000 ? 332 SER B CA    1 
ATOM   3164  C C     . SER B 1 87  ? 91.51900  160.67400 115.43100 1.000 150.37000 ? 332 SER B C     1 
ATOM   3165  O O     . SER B 1 87  ? 92.18300  159.71400 115.02500 1.000 150.37000 ? 332 SER B O     1 
ATOM   3166  C CB    . SER B 1 87  ? 92.39600  161.82600 117.42600 1.000 150.37000 ? 332 SER B CB    1 
ATOM   3167  O OG    . SER B 1 87  ? 92.35000  163.03900 116.70300 1.000 150.37000 ? 332 SER B OG    1 
ATOM   3168  N N     . PRO B 1 88  ? 90.99300  161.54200 114.59500 1.000 155.31000 ? 333 PRO B N     1 
ATOM   3169  C CA    . PRO B 1 88  ? 91.49800  161.62800 113.22300 1.000 155.31000 ? 333 PRO B CA    1 
ATOM   3170  C C     . PRO B 1 88  ? 92.51200  162.74700 113.05700 1.000 155.31000 ? 333 PRO B C     1 
ATOM   3171  O O     . PRO B 1 88  ? 93.18000  162.83600 112.02300 1.000 155.31000 ? 333 PRO B O     1 
ATOM   3172  C CB    . PRO B 1 88  ? 90.23400  161.91100 112.41200 1.000 155.31000 ? 333 PRO B CB    1 
ATOM   3173  C CG    . PRO B 1 88  ? 89.39800  162.71400 113.35600 1.000 155.31000 ? 333 PRO B CG    1 
ATOM   3174  C CD    . PRO B 1 88  ? 89.66800  162.16300 114.73600 1.000 155.31000 ? 333 PRO B CD    1 
ATOM   3175  N N     . GLU B 1 89  ? 92.62700  163.61700 114.06200 1.000 148.20000 ? 334 GLU B N     1 
ATOM   3176  C CA    . GLU B 1 89  ? 93.42100  164.83000 113.91100 1.000 148.20000 ? 334 GLU B CA    1 
ATOM   3177  C C     . GLU B 1 89  ? 94.41000  165.03700 115.05200 1.000 148.20000 ? 334 GLU B C     1 
ATOM   3178  O O     . GLU B 1 89  ? 95.55200  165.44600 114.82300 1.000 148.20000 ? 334 GLU B O     1 
ATOM   3179  C CB    . GLU B 1 89  ? 92.49000  166.03500 113.79500 1.000 148.20000 ? 334 GLU B CB    1 
ATOM   3180  C CG    . GLU B 1 89  ? 93.18500  167.35000 113.55000 1.000 148.20000 ? 334 GLU B CG    1 
ATOM   3181  C CD    . GLU B 1 89  ? 92.20200  168.48600 113.37800 1.000 148.20000 ? 334 GLU B CD    1 
ATOM   3182  O OE1   . GLU B 1 89  ? 90.98200  168.23300 113.44400 1.000 148.20000 ? 334 GLU B OE1   1 
ATOM   3183  O OE2   . GLU B 1 89  ? 92.64700  169.63500 113.18500 1.000 148.20000 ? 334 GLU B OE2   1 
ATOM   3184  N N     . SER B 1 90  ? 94.00000  164.72800 116.27900 1.000 137.32000 ? 335 SER B N     1 
ATOM   3185  C CA    . SER B 1 90  ? 94.82400  165.01400 117.44500 1.000 137.32000 ? 335 SER B CA    1 
ATOM   3186  C C     . SER B 1 90  ? 95.80600  163.90100 117.77900 1.000 137.32000 ? 335 SER B C     1 
ATOM   3187  O O     . SER B 1 90  ? 96.31000  163.86100 118.90500 1.000 137.32000 ? 335 SER B O     1 
ATOM   3188  C CB    . SER B 1 90  ? 93.93900  165.29500 118.66100 1.000 137.32000 ? 335 SER B CB    1 
ATOM   3189  O OG    . SER B 1 90  ? 93.18300  166.47400 118.46300 1.000 137.32000 ? 335 SER B OG    1 
ATOM   3190  N N     . LEU B 1 91  ? 96.08600  162.99600 116.84100 1.000 124.96000 ? 336 LEU B N     1 
ATOM   3191  C CA    . LEU B 1 91  ? 97.27800  162.17300 116.97300 1.000 124.96000 ? 336 LEU B CA    1 
ATOM   3192  C C     . LEU B 1 91  ? 98.52500  162.93400 116.55500 1.000 124.96000 ? 336 LEU B C     1 
ATOM   3193  O O     . LEU B 1 91  ? 99.64200  162.46900 116.80500 1.000 124.96000 ? 336 LEU B O     1 
ATOM   3194  C CB    . LEU B 1 91  ? 97.12300  160.89000 116.16500 1.000 124.96000 ? 336 LEU B CB    1 
ATOM   3195  C CG    . LEU B 1 91  ? 96.01600  159.98900 116.70500 1.000 124.96000 ? 336 LEU B CG    1 
ATOM   3196  C CD1   . LEU B 1 91  ? 95.86300  158.75100 115.84800 1.000 124.96000 ? 336 LEU B CD1   1 
ATOM   3197  C CD2   . LEU B 1 91  ? 96.29500  159.61600 118.14500 1.000 124.96000 ? 336 LEU B CD2   1 
ATOM   3198  N N     . GLU B 1 92  ? 98.35200  164.10900 115.94800 1.000 119.55000 ? 337 GLU B N     1 
ATOM   3199  C CA    . GLU B 1 92  ? 99.44300  165.06400 115.83500 1.000 119.55000 ? 337 GLU B CA    1 
ATOM   3200  C C     . GLU B 1 92  ? 99.94600  165.47200 117.21300 1.000 119.55000 ? 337 GLU B C     1 
ATOM   3201  O O     . GLU B 1 92  ? 101.14700 165.69700 117.40300 1.000 119.55000 ? 337 GLU B O     1 
ATOM   3202  C CB    . GLU B 1 92  ? 98.97000  166.27700 115.03700 1.000 119.55000 ? 337 GLU B CB    1 
ATOM   3203  C CG    . GLU B 1 92  ? 100.06300 167.21000 114.54800 1.000 119.55000 ? 337 GLU B CG    1 
ATOM   3204  C CD    . GLU B 1 92  ? 100.40300 168.29400 115.54100 1.000 119.55000 ? 337 GLU B CD    1 
ATOM   3205  O OE1   . GLU B 1 92  ? 99.52300  168.64400 116.35300 1.000 119.55000 ? 337 GLU B OE1   1 
ATOM   3206  O OE2   . GLU B 1 92  ? 101.54000 168.80300 115.50000 1.000 119.55000 ? 337 GLU B OE2   1 
ATOM   3207  N N     . ALA B 1 93  ? 99.04200  165.55400 118.19300 1.000 113.84000 ? 338 ALA B N     1 
ATOM   3208  C CA    . ALA B 1 93  ? 99.45900  165.80400 119.56800 1.000 113.84000 ? 338 ALA B CA    1 
ATOM   3209  C C     . ALA B 1 93  ? 100.25800 164.63400 120.12600 1.000 113.84000 ? 338 ALA B C     1 
ATOM   3210  O O     . ALA B 1 93  ? 101.22500 164.83900 120.87000 1.000 113.84000 ? 338 ALA B O     1 
ATOM   3211  C CB    . ALA B 1 93  ? 98.24200  166.08400 120.44400 1.000 113.84000 ? 338 ALA B CB    1 
ATOM   3212  N N     . MET B 1 94  ? 99.87700  163.40500 119.76400 1.000 110.47000 ? 339 MET B N     1 
ATOM   3213  C CA    . MET B 1 94  ? 100.66700 162.23500 120.13700 1.000 110.47000 ? 339 MET B CA    1 
ATOM   3214  C C     . MET B 1 94  ? 102.04900 162.29900 119.51400 1.000 110.47000 ? 339 MET B C     1 
ATOM   3215  O O     . MET B 1 94  ? 103.04600 161.94700 120.15200 1.000 110.47000 ? 339 MET B O     1 
ATOM   3216  C CB    . MET B 1 94  ? 99.95700  160.95800 119.69800 1.000 110.47000 ? 339 MET B CB    1 
ATOM   3217  C CG    . MET B 1 94  ? 100.59000 159.69200 120.21700 1.000 110.47000 ? 339 MET B CG    1 
ATOM   3218  S SD    . MET B 1 94  ? 100.35400 159.55400 121.99300 1.000 110.47000 ? 339 MET B SD    1 
ATOM   3219  C CE    . MET B 1 94  ? 101.71900 158.49400 122.43900 1.000 110.47000 ? 339 MET B CE    1 
ATOM   3220  N N     . SER B 1 95  ? 102.12100 162.78600 118.27800 1.000 113.15000 ? 340 SER B N     1 
ATOM   3221  C CA    . SER B 1 95  ? 103.40000 162.91800 117.59300 1.000 113.15000 ? 340 SER B CA    1 
ATOM   3222  C C     . SER B 1 95  ? 104.28600 163.96900 118.25300 1.000 113.15000 ? 340 SER B C     1 
ATOM   3223  O O     . SER B 1 95  ? 105.49700 163.76200 118.40500 1.000 113.15000 ? 340 SER B O     1 
ATOM   3224  C CB    . SER B 1 95  ? 103.15900 163.25900 116.12800 1.000 113.15000 ? 340 SER B CB    1 
ATOM   3225  O OG    . SER B 1 95  ? 102.45400 162.21200 115.49500 1.000 113.15000 ? 340 SER B OG    1 
ATOM   3226  N N     . ARG B 1 96  ? 103.70100 165.09400 118.66400 1.000 108.68000 ? 341 ARG B N     1 
ATOM   3227  C CA    . ARG B 1 96  ? 104.49400 166.10700 119.35100 1.000 108.68000 ? 341 ARG B CA    1 
ATOM   3228  C C     . ARG B 1 96  ? 104.93600 165.61900 120.71800 1.000 108.68000 ? 341 ARG B C     1 
ATOM   3229  O O     . ARG B 1 96  ? 106.05100 165.92700 121.16000 1.000 108.68000 ? 341 ARG B O     1 
ATOM   3230  C CB    . ARG B 1 96  ? 103.71300 167.40700 119.49200 1.000 108.68000 ? 341 ARG B CB    1 
ATOM   3231  C CG    . ARG B 1 96  ? 103.29600 168.06100 118.19800 1.000 108.68000 ? 341 ARG B CG    1 
ATOM   3232  C CD    . ARG B 1 96  ? 104.43900 168.73900 117.44900 1.000 108.68000 ? 341 ARG B CD    1 
ATOM   3233  N NE    . ARG B 1 96  ? 105.22700 167.82100 116.63000 1.000 108.68000 ? 341 ARG B NE    1 
ATOM   3234  C CZ    . ARG B 1 96  ? 104.84700 167.35300 115.44500 1.000 108.68000 ? 341 ARG B CZ    1 
ATOM   3235  N NH1   . ARG B 1 96  ? 103.68600 167.71200 114.91700 1.000 108.68000 ? 341 ARG B NH1   1 
ATOM   3236  N NH2   . ARG B 1 96  ? 105.63500 166.52300 114.78000 1.000 108.68000 ? 341 ARG B NH2   1 
ATOM   3237  N N     . LEU B 1 97  ? 104.08800 164.83700 121.38700 1.000 105.39000 ? 342 LEU B N     1 
ATOM   3238  C CA    . LEU B 1 97  ? 104.46900 164.28600 122.67900 1.000 105.39000 ? 342 LEU B CA    1 
ATOM   3239  C C     . LEU B 1 97  ? 105.61000 163.29300 122.51300 1.000 105.39000 ? 342 LEU B C     1 
ATOM   3240  O O     . LEU B 1 97  ? 106.52800 163.25700 123.33600 1.000 105.39000 ? 342 LEU B O     1 
ATOM   3241  C CB    . LEU B 1 97  ? 103.25400 163.63600 123.34100 1.000 105.39000 ? 342 LEU B CB    1 
ATOM   3242  C CG    . LEU B 1 97  ? 103.22600 163.45200 124.86200 1.000 105.39000 ? 342 LEU B CG    1 
ATOM   3243  C CD1   . LEU B 1 97  ? 101.79000 163.48900 125.34800 1.000 105.39000 ? 342 LEU B CD1   1 
ATOM   3244  C CD2   . LEU B 1 97  ? 103.87700 162.17900 125.33400 1.000 105.39000 ? 342 LEU B CD2   1 
ATOM   3245  N N     . LEU B 1 98  ? 105.59200 162.53100 121.41600 1.000 104.59000 ? 343 LEU B N     1 
ATOM   3246  C CA    . LEU B 1 98  ? 106.69000 161.62300 121.09900 1.000 104.59000 ? 343 LEU B CA    1 
ATOM   3247  C C     . LEU B 1 98  ? 107.97800 162.38100 120.82800 1.000 104.59000 ? 343 LEU B C     1 
ATOM   3248  O O     . LEU B 1 98  ? 109.06000 161.94000 121.23400 1.000 104.59000 ? 343 LEU B O     1 
ATOM   3249  C CB    . LEU B 1 98  ? 106.30900 160.77300 119.89400 1.000 104.59000 ? 343 LEU B CB    1 
ATOM   3250  C CG    . LEU B 1 98  ? 107.20000 159.63200 119.42700 1.000 104.59000 ? 343 LEU B CG    1 
ATOM   3251  C CD1   . LEU B 1 98  ? 106.28800 158.56600 118.88800 1.000 104.59000 ? 343 LEU B CD1   1 
ATOM   3252  C CD2   . LEU B 1 98  ? 108.16400 160.05700 118.33200 1.000 104.59000 ? 343 LEU B CD2   1 
ATOM   3253  N N     . GLU B 1 99  ? 107.87800 163.49800 120.10400 1.000 102.62000 ? 344 GLU B N     1 
ATOM   3254  C CA    . GLU B 1 99  ? 109.04000 164.34100 119.84500 1.000 102.62000 ? 344 GLU B CA    1 
ATOM   3255  C C     . GLU B 1 99  ? 109.65500 164.85100 121.14000 1.000 102.62000 ? 344 GLU B C     1 
ATOM   3256  O O     . GLU B 1 99  ? 110.87800 164.79000 121.32400 1.000 102.62000 ? 344 GLU B O     1 
ATOM   3257  C CB    . GLU B 1 99  ? 108.63800 165.51500 118.95900 1.000 102.62000 ? 344 GLU B CB    1 
ATOM   3258  C CG    . GLU B 1 99  ? 109.76700 166.46900 118.62900 1.000 102.62000 ? 344 GLU B CG    1 
ATOM   3259  C CD    . GLU B 1 99  ? 109.30500 167.63500 117.77400 1.000 102.62000 ? 344 GLU B CD    1 
ATOM   3260  O OE1   . GLU B 1 99  ? 108.09900 167.69900 117.45500 1.000 102.62000 ? 344 GLU B OE1   1 
ATOM   3261  O OE2   . GLU B 1 99  ? 110.14100 168.49300 117.42600 1.000 102.62000 ? 344 GLU B OE2   1 
ATOM   3262  N N     . ILE B 1 100 ? 108.81300 165.31200 122.06300 1.000 97.97000  ? 345 ILE B N     1 
ATOM   3263  C CA    . ILE B 1 100 ? 109.32100 165.82000 123.33100 1.000 97.97000  ? 345 ILE B CA    1 
ATOM   3264  C C     . ILE B 1 100 ? 109.92300 164.69500 124.16600 1.000 97.97000  ? 345 ILE B C     1 
ATOM   3265  O O     . ILE B 1 100 ? 110.98600 164.86900 124.77300 1.000 97.97000  ? 345 ILE B O     1 
ATOM   3266  C CB    . ILE B 1 100 ? 108.21400 166.57200 124.08600 1.000 97.97000  ? 345 ILE B CB    1 
ATOM   3267  C CG1   . ILE B 1 100 ? 107.74500 167.76100 123.25800 1.000 97.97000  ? 345 ILE B CG1   1 
ATOM   3268  C CG2   . ILE B 1 100 ? 108.71300 167.07300 125.42600 1.000 97.97000  ? 345 ILE B CG2   1 
ATOM   3269  C CD1   . ILE B 1 100 ? 108.84300 168.74900 122.94700 1.000 97.97000  ? 345 ILE B CD1   1 
ATOM   3270  N N     . LYS B 1 101 ? 109.29200 163.51200 124.16700 1.000 94.90000  ? 346 LYS B N     1 
ATOM   3271  C CA    . LYS B 1 101 ? 109.82000 162.40400 124.96300 1.000 94.90000  ? 346 LYS B CA    1 
ATOM   3272  C C     . LYS B 1 101 ? 111.14800 161.89800 124.42100 1.000 94.90000  ? 346 LYS B C     1 
ATOM   3273  O O     . LYS B 1 101 ? 112.03100 161.52200 125.19800 1.000 94.90000  ? 346 LYS B O     1 
ATOM   3274  C CB    . LYS B 1 101 ? 108.82800 161.24600 125.03600 1.000 94.90000  ? 346 LYS B CB    1 
ATOM   3275  C CG    . LYS B 1 101 ? 107.52400 161.47700 125.78700 1.000 94.90000  ? 346 LYS B CG    1 
ATOM   3276  C CD    . LYS B 1 101 ? 107.69200 161.61200 127.28100 1.000 94.90000  ? 346 LYS B CD    1 
ATOM   3277  C CE    . LYS B 1 101 ? 107.53500 163.05000 127.72400 1.000 94.90000  ? 346 LYS B CE    1 
ATOM   3278  N NZ    . LYS B 1 101 ? 107.62600 163.17400 129.19500 1.000 94.90000  ? 346 LYS B NZ    1 
ATOM   3279  N N     . LEU B 1 102 ? 111.31800 161.88300 123.10100 1.000 95.68000  ? 347 LEU B N     1 
ATOM   3280  C CA    . LEU B 1 102 ? 112.62300 161.49800 122.58300 1.000 95.68000  ? 347 LEU B CA    1 
ATOM   3281  C C     . LEU B 1 102 ? 113.66300 162.58000 122.81000 1.000 95.68000  ? 347 LEU B C     1 
ATOM   3282  O O     . LEU B 1 102 ? 114.83800 162.26200 123.01500 1.000 95.68000  ? 347 LEU B O     1 
ATOM   3283  C CB    . LEU B 1 102 ? 112.54800 161.13500 121.10600 1.000 95.68000  ? 347 LEU B CB    1 
ATOM   3284  C CG    . LEU B 1 102 ? 111.99400 159.73700 120.86800 1.000 95.68000  ? 347 LEU B CG    1 
ATOM   3285  C CD1   . LEU B 1 102 ? 111.84900 159.44500 119.38900 1.000 95.68000  ? 347 LEU B CD1   1 
ATOM   3286  C CD2   . LEU B 1 102 ? 112.92100 158.73800 121.51300 1.000 95.68000  ? 347 LEU B CD2   1 
ATOM   3287  N N     . LYS B 1 103 ? 113.26800 163.85300 122.81300 1.000 93.39000  ? 348 LYS B N     1 
ATOM   3288  C CA    . LYS B 1 103 ? 114.26800 164.86600 123.11800 1.000 93.39000  ? 348 LYS B CA    1 
ATOM   3289  C C     . LYS B 1 103 ? 114.62800 164.86800 124.60000 1.000 93.39000  ? 348 LYS B C     1 
ATOM   3290  O O     . LYS B 1 103 ? 115.71500 165.33200 124.95800 1.000 93.39000  ? 348 LYS B O     1 
ATOM   3291  C CB    . LYS B 1 103 ? 113.78700 166.24400 122.64600 1.000 93.39000  ? 348 LYS B CB    1 
ATOM   3292  C CG    . LYS B 1 103 ? 114.88600 167.31000 122.54700 1.000 93.39000  ? 348 LYS B CG    1 
ATOM   3293  C CD    . LYS B 1 103 ? 114.91400 168.22400 123.76000 1.000 93.39000  ? 348 LYS B CD    1 
ATOM   3294  C CE    . LYS B 1 103 ? 116.03900 169.21600 123.66100 1.000 93.39000  ? 348 LYS B CE    1 
ATOM   3295  N NZ    . LYS B 1 103 ? 117.34100 168.50600 123.73300 1.000 93.39000  ? 348 LYS B NZ    1 
ATOM   3296  N N     . GLU B 1 104 ? 113.76300 164.32400 125.46100 1.000 98.80000  ? 349 GLU B N     1 
ATOM   3297  C CA    . GLU B 1 104 ? 114.12700 164.16900 126.86600 1.000 98.80000  ? 349 GLU B CA    1 
ATOM   3298  C C     . GLU B 1 104 ? 115.28400 163.20200 127.04500 1.000 98.80000  ? 349 GLU B C     1 
ATOM   3299  O O     . GLU B 1 104 ? 116.08600 163.36000 127.96900 1.000 98.80000  ? 349 GLU B O     1 
ATOM   3300  C CB    . GLU B 1 104 ? 112.93600 163.69200 127.68700 1.000 98.80000  ? 349 GLU B CB    1 
ATOM   3301  C CG    . GLU B 1 104 ? 111.86900 164.73100 127.90000 1.000 98.80000  ? 349 GLU B CG    1 
ATOM   3302  C CD    . GLU B 1 104 ? 110.71900 164.21100 128.73300 1.000 98.80000  ? 349 GLU B CD    1 
ATOM   3303  O OE1   . GLU B 1 104 ? 110.70600 163.00400 129.05400 1.000 98.80000  ? 349 GLU B OE1   1 
ATOM   3304  O OE2   . GLU B 1 104 ? 109.82300 165.01300 129.06800 1.000 98.80000  ? 349 GLU B OE2   1 
ATOM   3305  N N     . PHE B 1 105 ? 115.39700 162.20900 126.18400 1.000 89.83000  ? 350 PHE B N     1 
ATOM   3306  C CA    . PHE B 1 105 ? 116.56800 161.35800 126.21700 1.000 89.83000  ? 350 PHE B CA    1 
ATOM   3307  C C     . PHE B 1 105 ? 117.61500 161.94200 125.28200 1.000 89.83000  ? 350 PHE B C     1 
ATOM   3308  O O     . PHE B 1 105 ? 117.46800 163.04700 124.75800 1.000 89.83000  ? 350 PHE B O     1 
ATOM   3309  C CB    . PHE B 1 105 ? 116.20500 159.93300 125.84400 1.000 89.83000  ? 350 PHE B CB    1 
ATOM   3310  C CG    . PHE B 1 105 ? 115.23500 159.30500 126.77500 1.000 89.83000  ? 350 PHE B CG    1 
ATOM   3311  C CD1   . PHE B 1 105 ? 115.63900 158.84500 128.00500 1.000 89.83000  ? 350 PHE B CD1   1 
ATOM   3312  C CD2   . PHE B 1 105 ? 113.91200 159.17300 126.41700 1.000 89.83000  ? 350 PHE B CD2   1 
ATOM   3313  C CE1   . PHE B 1 105 ? 114.73500 158.26400 128.86500 1.000 89.83000  ? 350 PHE B CE1   1 
ATOM   3314  C CE2   . PHE B 1 105 ? 113.00600 158.59100 127.26800 1.000 89.83000  ? 350 PHE B CE2   1 
ATOM   3315  C CZ    . PHE B 1 105 ? 113.41600 158.13800 128.49300 1.000 89.83000  ? 350 PHE B CZ    1 
ATOM   3316  N N     . GLY B 1 106 ? 118.67300 161.19000 125.03400 1.000 89.48000  ? 351 GLY B N     1 
ATOM   3317  C CA    . GLY B 1 106 ? 119.80100 161.73700 124.31900 1.000 89.48000  ? 351 GLY B CA    1 
ATOM   3318  C C     . GLY B 1 106 ? 119.70100 161.69700 122.81200 1.000 89.48000  ? 351 GLY B C     1 
ATOM   3319  O O     . GLY B 1 106 ? 120.73000 161.62200 122.13900 1.000 89.48000  ? 351 GLY B O     1 
ATOM   3320  N N     . VAL B 1 107 ? 118.49500 161.73800 122.25700 1.000 96.90000  ? 352 VAL B N     1 
ATOM   3321  C CA    . VAL B 1 107 ? 118.34400 161.83700 120.81400 1.000 96.90000  ? 352 VAL B CA    1 
ATOM   3322  C C     . VAL B 1 107 ? 117.56100 163.09700 120.49500 1.000 96.90000  ? 352 VAL B C     1 
ATOM   3323  O O     . VAL B 1 107 ? 116.79400 163.60500 121.31800 1.000 96.90000  ? 352 VAL B O     1 
ATOM   3324  C CB    . VAL B 1 107 ? 117.65700 160.60300 120.19100 1.000 96.90000  ? 352 VAL B CB    1 
ATOM   3325  C CG1   . VAL B 1 107 ? 118.42400 159.35400 120.52100 1.000 96.90000  ? 352 VAL B CG1   1 
ATOM   3326  C CG2   . VAL B 1 107 ? 116.22800 160.47600 120.64700 1.000 96.90000  ? 352 VAL B CG2   1 
ATOM   3327  N N     . GLU B 1 108 ? 117.79800 163.62800 119.30400 1.000 114.54000 ? 353 GLU B N     1 
ATOM   3328  C CA    . GLU B 1 108 ? 116.94900 164.64700 118.71200 1.000 114.54000 ? 353 GLU B CA    1 
ATOM   3329  C C     . GLU B 1 108 ? 116.38300 164.07800 117.42500 1.000 114.54000 ? 353 GLU B C     1 
ATOM   3330  O O     . GLU B 1 108 ? 117.11100 163.47500 116.63300 1.000 114.54000 ? 353 GLU B O     1 
ATOM   3331  C CB    . GLU B 1 108 ? 117.70200 165.94600 118.42200 1.000 114.54000 ? 353 GLU B CB    1 
ATOM   3332  C CG    . GLU B 1 108 ? 116.79500 167.03400 117.85400 1.000 114.54000 ? 353 GLU B CG    1 
ATOM   3333  C CD    . GLU B 1 108 ? 117.51300 168.33300 117.57000 1.000 114.54000 ? 353 GLU B CD    1 
ATOM   3334  O OE1   . GLU B 1 108 ? 118.72700 168.41900 117.84300 1.000 114.54000 ? 353 GLU B OE1   1 
ATOM   3335  O OE2   . GLU B 1 108 ? 116.86000 169.26500 117.05500 1.000 114.54000 ? 353 GLU B OE2   1 
ATOM   3336  N N     . VAL B 1 109 ? 115.08500 164.26000 117.21600 1.000 107.86000 ? 354 VAL B N     1 
ATOM   3337  C CA    . VAL B 1 109 ? 114.38600 163.51200 116.18900 1.000 107.86000 ? 354 VAL B CA    1 
ATOM   3338  C C     . VAL B 1 109 ? 113.35100 164.41700 115.53500 1.000 107.86000 ? 354 VAL B C     1 
ATOM   3339  O O     . VAL B 1 109 ? 112.96300 165.45100 116.07800 1.000 107.86000 ? 354 VAL B O     1 
ATOM   3340  C CB    . VAL B 1 109 ? 113.74600 162.25700 116.81000 1.000 107.86000 ? 354 VAL B CB    1 
ATOM   3341  C CG1   . VAL B 1 109 ? 112.45900 162.59500 117.52500 1.000 107.86000 ? 354 VAL B CG1   1 
ATOM   3342  C CG2   . VAL B 1 109 ? 113.59600 161.17200 115.80700 1.000 107.86000 ? 354 VAL B CG2   1 
ATOM   3343  N N     . SER B 1 110 ? 112.94100 164.04000 114.33000 1.000 116.30000 ? 355 SER B N     1 
ATOM   3344  C CA    . SER B 1 110 ? 111.88700 164.73000 113.60500 1.000 116.30000 ? 355 SER B CA    1 
ATOM   3345  C C     . SER B 1 110 ? 110.87600 163.70600 113.11500 1.000 116.30000 ? 355 SER B C     1 
ATOM   3346  O O     . SER B 1 110 ? 111.24800 162.64200 112.61300 1.000 116.30000 ? 355 SER B O     1 
ATOM   3347  C CB    . SER B 1 110 ? 112.45300 165.52900 112.43400 1.000 116.30000 ? 355 SER B CB    1 
ATOM   3348  O OG    . SER B 1 110 ? 113.04800 164.67000 111.48200 1.000 116.30000 ? 355 SER B OG    1 
ATOM   3349  N N     . VAL B 1 111 ? 109.59700 164.02900 113.26300 1.000 112.20000 ? 356 VAL B N     1 
ATOM   3350  C CA    . VAL B 1 111 ? 108.51000 163.09100 113.02300 1.000 112.20000 ? 356 VAL B CA    1 
ATOM   3351  C C     . VAL B 1 111 ? 107.77100 163.52500 111.76700 1.000 112.20000 ? 356 VAL B C     1 
ATOM   3352  O O     . VAL B 1 111 ? 107.39900 164.69600 111.63400 1.000 112.20000 ? 356 VAL B O     1 
ATOM   3353  C CB    . VAL B 1 111 ? 107.55700 163.03800 114.22800 1.000 112.20000 ? 356 VAL B CB    1 
ATOM   3354  C CG1   . VAL B 1 111 ? 106.45800 162.02200 114.00600 1.000 112.20000 ? 356 VAL B CG1   1 
ATOM   3355  C CG2   . VAL B 1 111 ? 108.32400 162.74500 115.49400 1.000 112.20000 ? 356 VAL B CG2   1 
ATOM   3356  N N     . ASP B 1 112 ? 107.57800 162.59700 110.84100 1.000 115.70000 ? 357 ASP B N     1 
ATOM   3357  C CA    . ASP B 1 112 ? 106.71800 162.82900 109.69500 1.000 115.70000 ? 357 ASP B CA    1 
ATOM   3358  C C     . ASP B 1 112 ? 105.39400 162.09300 109.90700 1.000 115.70000 ? 357 ASP B C     1 
ATOM   3359  O O     . ASP B 1 112 ? 105.11800 161.59800 111.00100 1.000 115.70000 ? 357 ASP B O     1 
ATOM   3360  C CB    . ASP B 1 112 ? 107.44800 162.44700 108.41600 1.000 115.70000 ? 357 ASP B CB    1 
ATOM   3361  C CG    . ASP B 1 112 ? 108.62000 163.35700 108.14500 1.000 115.70000 ? 357 ASP B CG    1 
ATOM   3362  O OD1   . ASP B 1 112 ? 108.59300 164.50600 108.62900 1.000 115.70000 ? 357 ASP B OD1   1 
ATOM   3363  O OD2   . ASP B 1 112 ? 109.56500 162.93500 107.45100 1.000 115.70000 ? 357 ASP B OD2   1 
ATOM   3364  N N     . SER B 1 113 ? 104.56700 162.03500 108.86000 1.000 117.14000 ? 358 SER B N     1 
ATOM   3365  C CA    . SER B 1 113 ? 103.14100 161.74400 108.99000 1.000 117.14000 ? 358 SER B CA    1 
ATOM   3366  C C     . SER B 1 113 ? 102.85900 160.34200 109.51900 1.000 117.14000 ? 358 SER B C     1 
ATOM   3367  O O     . SER B 1 113 ? 103.64400 159.41000 109.33900 1.000 117.14000 ? 358 SER B O     1 
ATOM   3368  C CB    . SER B 1 113 ? 102.44300 161.89400 107.64600 1.000 117.14000 ? 358 SER B CB    1 
ATOM   3369  O OG    . SER B 1 113 ? 102.83400 160.85100 106.77500 1.000 117.14000 ? 358 SER B OG    1 
ATOM   3370  N N     . VAL B 1 114 ? 101.70600 160.21000 110.16300 1.000 116.40000 ? 359 VAL B N     1 
ATOM   3371  C CA    . VAL B 1 114 ? 101.30700 159.02000 110.90600 1.000 116.40000 ? 359 VAL B CA    1 
ATOM   3372  C C     . VAL B 1 114 ? 100.51400 158.11100 109.98000 1.000 116.40000 ? 359 VAL B C     1 
ATOM   3373  O O     . VAL B 1 114 ? 99.78200  158.59000 109.10600 1.000 116.40000 ? 359 VAL B O     1 
ATOM   3374  C CB    . VAL B 1 114 ? 100.48800 159.43900 112.14600 1.000 116.40000 ? 359 VAL B CB    1 
ATOM   3375  C CG1   . VAL B 1 114 ? 99.99000  158.25900 112.95600 1.000 116.40000 ? 359 VAL B CG1   1 
ATOM   3376  C CG2   . VAL B 1 114 ? 101.32100 160.34200 113.02000 1.000 116.40000 ? 359 VAL B CG2   1 
ATOM   3377  N N     . HIS B 1 115 ? 100.69100 156.79700 110.13900 1.000 114.58000 ? 360 HIS B N     1 
ATOM   3378  C CA    . HIS B 1 115 ? 99.91800  155.78200 109.43300 1.000 114.58000 ? 360 HIS B CA    1 
ATOM   3379  C C     . HIS B 1 115 ? 98.94300  155.14800 110.41600 1.000 114.58000 ? 360 HIS B C     1 
ATOM   3380  O O     . HIS B 1 115 ? 99.24700  154.10200 111.00800 1.000 114.58000 ? 360 HIS B O     1 
ATOM   3381  C CB    . HIS B 1 115 ? 100.85500 154.73200 108.84200 1.000 114.58000 ? 360 HIS B CB    1 
ATOM   3382  C CG    . HIS B 1 115 ? 101.87300 155.30600 107.91400 1.000 114.58000 ? 360 HIS B CG    1 
ATOM   3383  N ND1   . HIS B 1 115 ? 101.58500 155.64500 106.61000 1.000 114.58000 ? 360 HIS B ND1   1 
ATOM   3384  C CD2   . HIS B 1 115 ? 103.16900 155.63800 108.11200 1.000 114.58000 ? 360 HIS B CD2   1 
ATOM   3385  C CE1   . HIS B 1 115 ? 102.66700 156.13800 106.03700 1.000 114.58000 ? 360 HIS B CE1   1 
ATOM   3386  N NE2   . HIS B 1 115 ? 103.64200 156.14500 106.92700 1.000 114.58000 ? 360 HIS B NE2   1 
ATOM   3387  N N     . PRO B 1 116 ? 97.75200  155.72900 110.61700 1.000 117.34000 ? 361 PRO B N     1 
ATOM   3388  C CA    . PRO B 1 116 ? 96.89000  155.29600 111.72800 1.000 117.34000 ? 361 PRO B CA    1 
ATOM   3389  C C     . PRO B 1 116 ? 96.24200  153.94600 111.48100 1.000 117.34000 ? 361 PRO B C     1 
ATOM   3390  O O     . PRO B 1 116 ? 95.09600  153.85900 111.03000 1.000 117.34000 ? 361 PRO B O     1 
ATOM   3391  C CB    . PRO B 1 116 ? 95.84700  156.41500 111.81300 1.000 117.34000 ? 361 PRO B CB    1 
ATOM   3392  C CG    . PRO B 1 116 ? 95.78000  156.96500 110.42900 1.000 117.34000 ? 361 PRO B CG    1 
ATOM   3393  C CD    . PRO B 1 116 ? 97.15600  156.83700 109.85100 1.000 117.34000 ? 361 PRO B CD    1 
ATOM   3394  N N     . GLY B 1 117 ? 96.97800  152.88400 111.79100 1.000 128.03000 ? 362 GLY B N     1 
ATOM   3395  C CA    . GLY B 1 117 ? 96.58400  151.54200 111.43800 1.000 128.03000 ? 362 GLY B CA    1 
ATOM   3396  C C     . GLY B 1 117 ? 95.37800  151.01100 112.18800 1.000 128.03000 ? 362 GLY B C     1 
ATOM   3397  O O     . GLY B 1 117 ? 94.73500  151.72000 112.96700 1.000 128.03000 ? 362 GLY B O     1 
ATOM   3398  N N     . PRO B 1 118 ? 95.03600  149.74000 111.93500 1.000 127.25000 ? 363 PRO B N     1 
ATOM   3399  C CA    . PRO B 1 118 ? 93.87000  149.13000 112.58600 1.000 127.25000 ? 363 PRO B CA    1 
ATOM   3400  C C     . PRO B 1 118 ? 94.00900  149.01100 114.09200 1.000 127.25000 ? 363 PRO B C     1 
ATOM   3401  O O     . PRO B 1 118 ? 93.19800  149.55600 114.84600 1.000 127.25000 ? 363 PRO B O     1 
ATOM   3402  C CB    . PRO B 1 118 ? 93.80400  147.74300 111.94100 1.000 127.25000 ? 363 PRO B CB    1 
ATOM   3403  C CG    . PRO B 1 118 ? 94.54000  147.88300 110.66500 1.000 127.25000 ? 363 PRO B CG    1 
ATOM   3404  C CD    . PRO B 1 118 ? 95.63700  148.84200 110.93900 1.000 127.25000 ? 363 PRO B CD    1 
ATOM   3405  N N     . VAL B 1 119 ? 95.04500  148.31400 114.53800 1.000 127.88000 ? 364 VAL B N     1 
ATOM   3406  C CA    . VAL B 1 119 ? 95.34500  148.16400 115.95600 1.000 127.88000 ? 364 VAL B CA    1 
ATOM   3407  C C     . VAL B 1 119 ? 96.63700  148.88000 116.31000 1.000 127.88000 ? 364 VAL B C     1 
ATOM   3408  O O     . VAL B 1 119 ? 96.63900  149.83000 117.09300 1.000 127.88000 ? 364 VAL B O     1 
ATOM   3409  C CB    . VAL B 1 119 ? 95.40200  146.67300 116.35500 1.000 127.88000 ? 364 VAL B CB    1 
ATOM   3410  C CG1   . VAL B 1 119 ? 95.88300  146.52300 117.78200 1.000 127.88000 ? 364 VAL B CG1   1 
ATOM   3411  C CG2   . VAL B 1 119 ? 94.04300  146.03500 116.18700 1.000 127.88000 ? 364 VAL B CG2   1 
ATOM   3412  N N     . ILE B 1 120 ? 97.74800  148.45200 115.72100 1.000 131.72000 ? 365 ILE B N     1 
ATOM   3413  C CA    . ILE B 1 120 ? 99.03800  149.10400 115.88300 1.000 131.72000 ? 365 ILE B CA    1 
ATOM   3414  C C     . ILE B 1 120 ? 99.09500  150.33100 114.98300 1.000 131.72000 ? 365 ILE B C     1 
ATOM   3415  O O     . ILE B 1 120 ? 98.20100  150.54800 114.15900 1.000 131.72000 ? 365 ILE B O     1 
ATOM   3416  C CB    . ILE B 1 120 ? 100.18100 148.10600 115.61100 1.000 131.72000 ? 365 ILE B CB    1 
ATOM   3417  C CG1   . ILE B 1 120 ? 99.87500  147.23300 114.39000 1.000 131.72000 ? 365 ILE B CG1   1 
ATOM   3418  C CG2   . ILE B 1 120 ? 100.40500 147.21400 116.81800 1.000 131.72000 ? 365 ILE B CG2   1 
ATOM   3419  C CD1   . ILE B 1 120 ? 100.34100 147.76600 113.07600 1.000 131.72000 ? 365 ILE B CD1   1 
ATOM   3420  N N     . THR B 1 121 ? 100.11900 151.16000 115.15200 1.000 122.33000 ? 366 THR B N     1 
ATOM   3421  C CA    . THR B 1 121 ? 100.23900 152.36600 114.34200 1.000 122.33000 ? 366 THR B CA    1 
ATOM   3422  C C     . THR B 1 121 ? 101.70600 152.71200 114.14600 1.000 122.33000 ? 366 THR B C     1 
ATOM   3423  O O     . THR B 1 121 ? 102.41200 153.01600 115.11000 1.000 122.33000 ? 366 THR B O     1 
ATOM   3424  C CB    . THR B 1 121 ? 99.48600  153.52700 114.98200 1.000 122.33000 ? 366 THR B CB    1 
ATOM   3425  O OG1   . THR B 1 121 ? 98.08300  153.24300 114.96600 1.000 122.33000 ? 366 THR B OG1   1 
ATOM   3426  C CG2   . THR B 1 121 ? 99.73700  154.79300 114.22300 1.000 122.33000 ? 366 THR B CG2   1 
ATOM   3427  N N     . ARG B 1 122 ? 102.14300 152.67500 112.88900 1.000 112.11000 ? 367 ARG B N     1 
ATOM   3428  C CA    . ARG B 1 122 ? 103.51200 152.96700 112.49000 1.000 112.11000 ? 367 ARG B CA    1 
ATOM   3429  C C     . ARG B 1 122 ? 103.70500 154.46900 112.30100 1.000 112.11000 ? 367 ARG B C     1 
ATOM   3430  O O     . ARG B 1 122 ? 102.83500 155.15700 111.76000 1.000 112.11000 ? 367 ARG B O     1 
ATOM   3431  C CB    . ARG B 1 122 ? 103.83100 152.22100 111.19200 1.000 112.11000 ? 367 ARG B CB    1 
ATOM   3432  C CG    . ARG B 1 122 ? 105.24100 152.38400 110.66900 1.000 112.11000 ? 367 ARG B CG    1 
ATOM   3433  C CD    . ARG B 1 122 ? 105.43100 151.65300 109.35000 1.000 112.11000 ? 367 ARG B CD    1 
ATOM   3434  N NE    . ARG B 1 122 ? 105.37800 150.21000 109.51700 1.000 112.11000 ? 367 ARG B NE    1 
ATOM   3435  C CZ    . ARG B 1 122 ? 106.42500 149.47100 109.85800 1.000 112.11000 ? 367 ARG B CZ    1 
ATOM   3436  N NH1   . ARG B 1 122 ? 107.59800 150.04500 110.06200 1.000 112.11000 ? 367 ARG B NH1   1 
ATOM   3437  N NH2   . ARG B 1 122 ? 106.30400 148.16100 109.99300 1.000 112.11000 ? 367 ARG B NH2   1 
ATOM   3438  N N     . PHE B 1 123 ? 104.85700 154.96900 112.73800 1.000 115.17000 ? 368 PHE B N     1 
ATOM   3439  C CA    . PHE B 1 123 ? 105.16700 156.39000 112.70900 1.000 115.17000 ? 368 PHE B CA    1 
ATOM   3440  C C     . PHE B 1 123 ? 106.37800 156.65200 111.83200 1.000 115.17000 ? 368 PHE B C     1 
ATOM   3441  O O     . PHE B 1 123 ? 107.43100 156.03700 112.02200 1.000 115.17000 ? 368 PHE B O     1 
ATOM   3442  C CB    . PHE B 1 123 ? 105.44500 156.90300 114.11300 1.000 115.17000 ? 368 PHE B CB    1 
ATOM   3443  C CG    . PHE B 1 123 ? 104.24400 156.94800 114.97200 1.000 115.17000 ? 368 PHE B CG    1 
ATOM   3444  C CD1   . PHE B 1 123 ? 103.43500 158.06200 114.97000 1.000 115.17000 ? 368 PHE B CD1   1 
ATOM   3445  C CD2   . PHE B 1 123 ? 103.89700 155.86600 115.74700 1.000 115.17000 ? 368 PHE B CD2   1 
ATOM   3446  C CE1   . PHE B 1 123 ? 102.31300 158.10500 115.76000 1.000 115.17000 ? 368 PHE B CE1   1 
ATOM   3447  C CE2   . PHE B 1 123 ? 102.77000 155.89900 116.52500 1.000 115.17000 ? 368 PHE B CE2   1 
ATOM   3448  C CZ    . PHE B 1 123 ? 101.98200 157.01900 116.53900 1.000 115.17000 ? 368 PHE B CZ    1 
ATOM   3449  N N     . GLU B 1 124 ? 106.23400 157.57600 110.89100 1.000 117.28000 ? 369 GLU B N     1 
ATOM   3450  C CA    . GLU B 1 124 ? 107.37900 158.06000 110.13300 1.000 117.28000 ? 369 GLU B CA    1 
ATOM   3451  C C     . GLU B 1 124 ? 108.24700 158.91000 111.04600 1.000 117.28000 ? 369 GLU B C     1 
ATOM   3452  O O     . GLU B 1 124 ? 107.91000 160.05800 111.35000 1.000 117.28000 ? 369 GLU B O     1 
ATOM   3453  C CB    . GLU B 1 124 ? 106.91500 158.86100 108.92500 1.000 117.28000 ? 369 GLU B CB    1 
ATOM   3454  C CG    . GLU B 1 124 ? 106.27600 158.03500 107.84200 1.000 117.28000 ? 369 GLU B CG    1 
ATOM   3455  C CD    . GLU B 1 124 ? 105.74200 158.88500 106.71000 1.000 117.28000 ? 369 GLU B CD    1 
ATOM   3456  O OE1   . GLU B 1 124 ? 105.72300 160.12500 106.85600 1.000 117.28000 ? 369 GLU B OE1   1 
ATOM   3457  O OE2   . GLU B 1 124 ? 105.34700 158.31200 105.67200 1.000 117.28000 ? 369 GLU B OE2   1 
ATOM   3458  N N     . ILE B 1 125 ? 109.36600 158.35100 111.48400 1.000 111.36000 ? 370 ILE B N     1 
ATOM   3459  C CA    . ILE B 1 125 ? 110.22200 158.97600 112.47800 1.000 111.36000 ? 370 ILE B CA    1 
ATOM   3460  C C     . ILE B 1 125 ? 111.61200 159.10700 111.88900 1.000 111.36000 ? 370 ILE B C     1 
ATOM   3461  O O     . ILE B 1 125 ? 112.26200 158.09900 111.58900 1.000 111.36000 ? 370 ILE B O     1 
ATOM   3462  C CB    . ILE B 1 125 ? 110.24000 158.16600 113.77800 1.000 111.36000 ? 370 ILE B CB    1 
ATOM   3463  C CG1   . ILE B 1 125 ? 108.89000 158.28000 114.46300 1.000 111.36000 ? 370 ILE B CG1   1 
ATOM   3464  C CG2   . ILE B 1 125 ? 111.30900 158.62400 114.68900 1.000 111.36000 ? 370 ILE B CG2   1 
ATOM   3465  C CD1   . ILE B 1 125 ? 108.76900 157.42500 115.65800 1.000 111.36000 ? 370 ILE B CD1   1 
ATOM   3466  N N     . GLN B 1 126 ? 112.05700 160.34100 111.70400 1.000 107.18000 ? 371 GLN B N     1 
ATOM   3467  C CA    . GLN B 1 126 ? 113.35100 160.59800 111.08900 1.000 107.18000 ? 371 GLN B CA    1 
ATOM   3468  C C     . GLN B 1 126 ? 114.34400 161.05200 112.14200 1.000 107.18000 ? 371 GLN B C     1 
ATOM   3469  O O     . GLN B 1 126 ? 114.19500 162.15300 112.69300 1.000 107.18000 ? 371 GLN B O     1 
ATOM   3470  C CB    . GLN B 1 126 ? 113.22900 161.64900 109.98800 1.000 107.18000 ? 371 GLN B CB    1 
ATOM   3471  C CG    . GLN B 1 126 ? 114.56200 162.07000 109.41400 1.000 107.18000 ? 371 GLN B CG    1 
ATOM   3472  C CD    . GLN B 1 126 ? 115.29100 160.93100 108.75900 1.000 107.18000 ? 371 GLN B CD    1 
ATOM   3473  O OE1   . GLN B 1 126 ? 114.70100 160.13800 108.02800 1.000 107.18000 ? 371 GLN B OE1   1 
ATOM   3474  N NE2   . GLN B 1 126 ? 116.58500 160.82800 109.03000 1.000 107.18000 ? 371 GLN B NE2   1 
ATOM   3475  N N     . PRO B 1 127 ? 115.34600 160.24800 112.46700 1.000 102.27000 ? 372 PRO B N     1 
ATOM   3476  C CA    . PRO B 1 127 ? 116.38500 160.70500 113.38300 1.000 102.27000 ? 372 PRO B CA    1 
ATOM   3477  C C     . PRO B 1 127 ? 117.29600 161.70900 112.71000 1.000 102.27000 ? 372 PRO B C     1 
ATOM   3478  O O     . PRO B 1 127 ? 117.43100 161.75200 111.48600 1.000 102.27000 ? 372 PRO B O     1 
ATOM   3479  C CB    . PRO B 1 127 ? 117.14300 159.42300 113.72600 1.000 102.27000 ? 372 PRO B CB    1 
ATOM   3480  C CG    . PRO B 1 127 ? 116.19100 158.34000 113.43100 1.000 102.27000 ? 372 PRO B CG    1 
ATOM   3481  C CD    . PRO B 1 127 ? 115.42400 158.80200 112.24300 1.000 102.27000 ? 372 PRO B CD    1 
ATOM   3482  N N     . ALA B 1 128 ? 117.93700 162.52200 113.53900 1.000 96.25000  ? 373 ALA B N     1 
ATOM   3483  C CA    . ALA B 1 128 ? 118.91800 163.47100 113.05200 1.000 96.25000  ? 373 ALA B CA    1 
ATOM   3484  C C     . ALA B 1 128 ? 120.22700 162.75200 112.75300 1.000 96.25000  ? 373 ALA B C     1 
ATOM   3485  O O     . ALA B 1 128 ? 120.34300 161.53100 112.87100 1.000 96.25000  ? 373 ALA B O     1 
ATOM   3486  C CB    . ALA B 1 128 ? 119.12700 164.59100 114.06500 1.000 96.25000  ? 373 ALA B CB    1 
ATOM   3487  N N     . ALA B 1 129 ? 121.23200 163.51800 112.36300 1.000 94.01000  ? 374 ALA B N     1 
ATOM   3488  C CA    . ALA B 1 129 ? 122.50400 162.92200 112.00800 1.000 94.01000  ? 374 ALA B CA    1 
ATOM   3489  C C     . ALA B 1 129 ? 123.27300 162.51600 113.25500 1.000 94.01000  ? 374 ALA B C     1 
ATOM   3490  O O     . ALA B 1 129 ? 122.99700 162.97000 114.36600 1.000 94.01000  ? 374 ALA B O     1 
ATOM   3491  C CB    . ALA B 1 129 ? 123.33500 163.89300 111.18500 1.000 94.01000  ? 374 ALA B CB    1 
ATOM   3492  N N     . GLY B 1 130 ? 124.24100 161.63400 113.05900 1.000 96.11000  ? 375 GLY B N     1 
ATOM   3493  C CA    . GLY B 1 130 ? 125.12000 161.19300 114.12500 1.000 96.11000  ? 375 GLY B CA    1 
ATOM   3494  C C     . GLY B 1 130 ? 124.58800 160.09400 115.01900 1.000 96.11000  ? 375 GLY B C     1 
ATOM   3495  O O     . GLY B 1 130 ? 125.36300 159.27900 115.52100 1.000 96.11000  ? 375 GLY B O     1 
ATOM   3496  N N     . VAL B 1 131 ? 123.28300 160.04800 115.22700 1.000 92.75000  ? 376 VAL B N     1 
ATOM   3497  C CA    . VAL B 1 131 ? 122.71100 159.07900 116.14700 1.000 92.75000  ? 376 VAL B CA    1 
ATOM   3498  C C     . VAL B 1 131 ? 122.60400 157.73000 115.45000 1.000 92.75000  ? 376 VAL B C     1 
ATOM   3499  O O     . VAL B 1 131 ? 122.36600 157.64700 114.24100 1.000 92.75000  ? 376 VAL B O     1 
ATOM   3500  C CB    . VAL B 1 131 ? 121.35600 159.58600 116.67900 1.000 92.75000  ? 376 VAL B CB    1 
ATOM   3501  C CG1   . VAL B 1 131 ? 120.32700 159.70600 115.58500 1.000 92.75000  ? 376 VAL B CG1   1 
ATOM   3502  C CG2   . VAL B 1 131 ? 120.84700 158.71400 117.80000 1.000 92.75000  ? 376 VAL B CG2   1 
ATOM   3503  N N     . LYS B 1 132 ? 122.86400 156.66900 116.19600 1.000 89.52000  ? 377 LYS B N     1 
ATOM   3504  C CA    . LYS B 1 132 ? 122.64100 155.32500 115.70400 1.000 89.52000  ? 377 LYS B CA    1 
ATOM   3505  C C     . LYS B 1 132 ? 121.23000 154.87400 116.05800 1.000 89.52000  ? 377 LYS B C     1 
ATOM   3506  O O     . LYS B 1 132 ? 120.51900 155.51600 116.82900 1.000 89.52000  ? 377 LYS B O     1 
ATOM   3507  C CB    . LYS B 1 132 ? 123.67400 154.36900 116.28500 1.000 89.52000  ? 377 LYS B CB    1 
ATOM   3508  C CG    . LYS B 1 132 ? 125.09100 154.71200 115.90300 1.000 89.52000  ? 377 LYS B CG    1 
ATOM   3509  C CD    . LYS B 1 132 ? 126.05900 153.66600 116.41700 1.000 89.52000  ? 377 LYS B CD    1 
ATOM   3510  C CE    . LYS B 1 132 ? 126.20100 153.74300 117.92500 1.000 89.52000  ? 377 LYS B CE    1 
ATOM   3511  N NZ    . LYS B 1 132 ? 126.84600 155.01300 118.35900 1.000 89.52000  ? 377 LYS B NZ    1 
ATOM   3512  N N     . VAL B 1 133 ? 120.82400 153.74700 115.48300 1.000 83.54000  ? 378 VAL B N     1 
ATOM   3513  C CA    . VAL B 1 133 ? 119.47200 153.26200 115.71100 1.000 83.54000  ? 378 VAL B CA    1 
ATOM   3514  C C     . VAL B 1 133 ? 119.40400 152.44300 116.99300 1.000 83.54000  ? 378 VAL B C     1 
ATOM   3515  O O     . VAL B 1 133 ? 118.33300 152.32200 117.60900 1.000 83.54000  ? 378 VAL B O     1 
ATOM   3516  C CB    . VAL B 1 133 ? 119.04100 152.49200 114.45500 1.000 83.54000  ? 378 VAL B CB    1 
ATOM   3517  C CG1   . VAL B 1 133 ? 117.59200 152.10100 114.50900 1.000 83.54000  ? 378 VAL B CG1   1 
ATOM   3518  C CG2   . VAL B 1 133 ? 119.30100 153.33600 113.23000 1.000 83.54000  ? 378 VAL B CG2   1 
ATOM   3519  N N     . SER B 1 134 ? 120.54300 151.93100 117.45200 1.000 90.51000  ? 379 SER B N     1 
ATOM   3520  C CA    . SER B 1 134 ? 120.58600 151.21600 118.71800 1.000 90.51000  ? 379 SER B CA    1 
ATOM   3521  C C     . SER B 1 134 ? 120.27200 152.11300 119.90500 1.000 90.51000  ? 379 SER B C     1 
ATOM   3522  O O     . SER B 1 134 ? 119.82700 151.61100 120.93900 1.000 90.51000  ? 379 SER B O     1 
ATOM   3523  C CB    . SER B 1 134 ? 121.95500 150.58300 118.90900 1.000 90.51000  ? 379 SER B CB    1 
ATOM   3524  O OG    . SER B 1 134 ? 122.93500 151.58800 119.07700 1.000 90.51000  ? 379 SER B OG    1 
ATOM   3525  N N     . ARG B 1 135 ? 120.45500 153.42800 119.77300 1.000 94.90000  ? 380 ARG B N     1 
ATOM   3526  C CA    . ARG B 1 135 ? 120.01500 154.35100 120.80900 1.000 94.90000  ? 380 ARG B CA    1 
ATOM   3527  C C     . ARG B 1 135 ? 118.50400 154.53800 120.82200 1.000 94.90000  ? 380 ARG B C     1 
ATOM   3528  O O     . ARG B 1 135 ? 117.98700 155.17200 121.74400 1.000 94.90000  ? 380 ARG B O     1 
ATOM   3529  C CB    . ARG B 1 135 ? 120.71700 155.69700 120.64100 1.000 94.90000  ? 380 ARG B CB    1 
ATOM   3530  C CG    . ARG B 1 135 ? 122.21500 155.61300 120.88600 1.000 94.90000  ? 380 ARG B CG    1 
ATOM   3531  C CD    . ARG B 1 135 ? 122.92400 156.92100 120.59900 1.000 94.90000  ? 380 ARG B CD    1 
ATOM   3532  N NE    . ARG B 1 135 ? 122.57200 157.96300 121.55300 1.000 94.90000  ? 380 ARG B NE    1 
ATOM   3533  C CZ    . ARG B 1 135 ? 122.93800 159.23200 121.42900 1.000 94.90000  ? 380 ARG B CZ    1 
ATOM   3534  N NH1   . ARG B 1 135 ? 123.66400 159.61100 120.39000 1.000 94.90000  ? 380 ARG B NH1   1 
ATOM   3535  N NH2   . ARG B 1 135 ? 122.58000 160.12300 122.34100 1.000 94.90000  ? 380 ARG B NH2   1 
ATOM   3536  N N     . ILE B 1 136 ? 117.79200 154.01900 119.82700 1.000 86.39000  ? 381 ILE B N     1 
ATOM   3537  C CA    . ILE B 1 136 ? 116.34700 153.86500 119.92600 1.000 86.39000  ? 381 ILE B CA    1 
ATOM   3538  C C     . ILE B 1 136 ? 115.99000 152.47800 120.43700 1.000 86.39000  ? 381 ILE B C     1 
ATOM   3539  O O     . ILE B 1 136 ? 115.03600 152.31100 121.20300 1.000 86.39000  ? 381 ILE B O     1 
ATOM   3540  C CB    . ILE B 1 136 ? 115.70600 154.14200 118.55500 1.000 86.39000  ? 381 ILE B CB    1 
ATOM   3541  C CG1   . ILE B 1 136 ? 116.15100 155.49900 118.03500 1.000 86.39000  ? 381 ILE B CG1   1 
ATOM   3542  C CG2   . ILE B 1 136 ? 114.20800 154.12800 118.64800 1.000 86.39000  ? 381 ILE B CG2   1 
ATOM   3543  C CD1   . ILE B 1 136 ? 115.75500 156.63100 118.92200 1.000 86.39000  ? 381 ILE B CD1   1 
ATOM   3544  N N     . SER B 1 137 ? 116.76900 151.47500 120.02600 1.000 97.35000  ? 382 SER B N     1 
ATOM   3545  C CA    . SER B 1 137 ? 116.45200 150.09800 120.39200 1.000 97.35000  ? 382 SER B CA    1 
ATOM   3546  C C     . SER B 1 137 ? 116.69800 149.81300 121.86700 1.000 97.35000  ? 382 SER B C     1 
ATOM   3547  O O     . SER B 1 137 ? 115.97000 149.02100 122.47200 1.000 97.35000  ? 382 SER B O     1 
ATOM   3548  C CB    . SER B 1 137 ? 117.25500 149.13200 119.53300 1.000 97.35000  ? 382 SER B CB    1 
ATOM   3549  O OG    . SER B 1 137 ? 116.85900 149.23000 118.17900 1.000 97.35000  ? 382 SER B OG    1 
ATOM   3550  N N     . ASN B 1 138 ? 117.69900 150.44300 122.46800 1.000 103.63000 ? 383 ASN B N     1 
ATOM   3551  C CA    . ASN B 1 138 ? 117.92500 150.30200 123.89900 1.000 103.63000 ? 383 ASN B CA    1 
ATOM   3552  C C     . ASN B 1 138 ? 117.06200 151.23800 124.72300 1.000 103.63000 ? 383 ASN B C     1 
ATOM   3553  O O     . ASN B 1 138 ? 117.24400 151.31600 125.94000 1.000 103.63000 ? 383 ASN B O     1 
ATOM   3554  C CB    . ASN B 1 138 ? 119.39200 150.56000 124.23200 1.000 103.63000 ? 383 ASN B CB    1 
ATOM   3555  C CG    . ASN B 1 138 ? 120.30200 149.47600 123.71600 1.000 103.63000 ? 383 ASN B CG    1 
ATOM   3556  O OD1   . ASN B 1 138 ? 119.96900 148.29400 123.77000 1.000 103.63000 ? 383 ASN B OD1   1 
ATOM   3557  N ND2   . ASN B 1 138 ? 121.46800 149.87000 123.22100 1.000 103.63000 ? 383 ASN B ND2   1 
ATOM   3558  N N     . LEU B 1 139 ? 116.13800 151.94900 124.09200 1.000 88.23000  ? 384 LEU B N     1 
ATOM   3559  C CA    . LEU B 1 139 ? 115.38200 153.00500 124.73700 1.000 88.23000  ? 384 LEU B CA    1 
ATOM   3560  C C     . LEU B 1 139 ? 113.89200 152.82800 124.49700 1.000 88.23000  ? 384 LEU B C     1 
ATOM   3561  O O     . LEU B 1 139 ? 113.08500 153.59800 125.03500 1.000 88.23000  ? 384 LEU B O     1 
ATOM   3562  C CB    . LEU B 1 139 ? 115.89800 154.34500 124.21400 1.000 88.23000  ? 384 LEU B CB    1 
ATOM   3563  C CG    . LEU B 1 139 ? 115.62000 155.70300 124.83600 1.000 88.23000  ? 384 LEU B CG    1 
ATOM   3564  C CD1   . LEU B 1 139 ? 116.86400 156.52200 124.67100 1.000 88.23000  ? 384 LEU B CD1   1 
ATOM   3565  C CD2   . LEU B 1 139 ? 114.49500 156.38400 124.11700 1.000 88.23000  ? 384 LEU B CD2   1 
ATOM   3566  N N     . ALA B 1 140 ? 113.53200 151.82200 123.69300 1.000 87.47000  ? 385 ALA B N     1 
ATOM   3567  C CA    . ALA B 1 140 ? 112.14500 151.55600 123.31500 1.000 87.47000  ? 385 ALA B CA    1 
ATOM   3568  C C     . ALA B 1 140 ? 111.22700 151.33300 124.51000 1.000 87.47000  ? 385 ALA B C     1 
ATOM   3569  O O     . ALA B 1 140 ? 110.10600 151.84800 124.52600 1.000 87.47000  ? 385 ALA B O     1 
ATOM   3570  C CB    . ALA B 1 140 ? 112.08800 150.34300 122.39200 1.000 87.47000  ? 385 ALA B CB    1 
ATOM   3571  N N     . LYS B 1 141 ? 111.67000 150.57900 125.51800 1.000 82.29000  ? 386 LYS B N     1 
ATOM   3572  C CA    . LYS B 1 141 ? 110.75900 150.24800 126.61000 1.000 82.29000  ? 386 LYS B CA    1 
ATOM   3573  C C     . LYS B 1 141 ? 110.45700 151.45800 127.48400 1.000 82.29000  ? 386 LYS B C     1 
ATOM   3574  O O     . LYS B 1 141 ? 109.33000 151.60900 127.97300 1.000 82.29000  ? 386 LYS B O     1 
ATOM   3575  C CB    . LYS B 1 141 ? 111.31700 149.09400 127.44600 1.000 82.29000  ? 386 LYS B CB    1 
ATOM   3576  C CG    . LYS B 1 141 ? 112.59400 149.38400 128.21400 1.000 82.29000  ? 386 LYS B CG    1 
ATOM   3577  C CD    . LYS B 1 141 ? 113.07600 148.15400 128.95600 1.000 82.29000  ? 386 LYS B CD    1 
ATOM   3578  C CE    . LYS B 1 141 ? 112.15200 147.82600 130.11600 1.000 82.29000  ? 386 LYS B CE    1 
ATOM   3579  N NZ    . LYS B 1 141 ? 112.65400 146.69400 130.94200 1.000 82.29000  ? 386 LYS B NZ    1 
ATOM   3580  N N     . ASP B 1 142 ? 111.40100 152.37200 127.62500 1.000 85.84000  ? 387 ASP B N     1 
ATOM   3581  C CA    . ASP B 1 142 ? 111.11800 153.51800 128.46300 1.000 85.84000  ? 387 ASP B CA    1 
ATOM   3582  C C     . ASP B 1 142 ? 110.48000 154.63800 127.67800 1.000 85.84000  ? 387 ASP B C     1 
ATOM   3583  O O     . ASP B 1 142 ? 109.75500 155.45800 128.25700 1.000 85.84000  ? 387 ASP B O     1 
ATOM   3584  C CB    . ASP B 1 142 ? 112.39000 153.96600 129.15600 1.000 85.84000  ? 387 ASP B CB    1 
ATOM   3585  C CG    . ASP B 1 142 ? 112.92000 152.89400 130.05600 1.000 85.84000  ? 387 ASP B CG    1 
ATOM   3586  O OD1   . ASP B 1 142 ? 112.10600 152.04400 130.46500 1.000 85.84000  ? 387 ASP B OD1   1 
ATOM   3587  O OD2   . ASP B 1 142 ? 114.12700 152.87800 130.34500 1.000 85.84000  ? 387 ASP B OD2   1 
ATOM   3588  N N     . LEU B 1 143 ? 110.69500 154.65100 126.36400 1.000 85.45000  ? 388 LEU B N     1 
ATOM   3589  C CA    . LEU B 1 143 ? 109.82000 155.41000 125.48700 1.000 85.45000  ? 388 LEU B CA    1 
ATOM   3590  C C     . LEU B 1 143 ? 108.38200 154.93600 125.62300 1.000 85.45000  ? 388 LEU B C     1 
ATOM   3591  O O     . LEU B 1 143 ? 107.45400 155.74900 125.66500 1.000 85.45000  ? 388 LEU B O     1 
ATOM   3592  C CB    . LEU B 1 143 ? 110.29100 155.26800 124.04600 1.000 85.45000  ? 388 LEU B CB    1 
ATOM   3593  C CG    . LEU B 1 143 ? 109.46600 156.04700 123.03700 1.000 85.45000  ? 388 LEU B CG    1 
ATOM   3594  C CD1   . LEU B 1 143 ? 109.58500 157.51000 123.34400 1.000 85.45000  ? 388 LEU B CD1   1 
ATOM   3595  C CD2   . LEU B 1 143 ? 109.93000 155.75200 121.63500 1.000 85.45000  ? 388 LEU B CD2   1 
ATOM   3596  N N     . ALA B 1 144 ? 108.19000 153.62100 125.74200 1.000 94.85000  ? 389 ALA B N     1 
ATOM   3597  C CA    . ALA B 1 144 ? 106.84900 153.05600 125.81800 1.000 94.85000  ? 389 ALA B CA    1 
ATOM   3598  C C     . ALA B 1 144 ? 106.17200 153.40600 127.13200 1.000 94.85000  ? 389 ALA B C     1 
ATOM   3599  O O     . ALA B 1 144 ? 104.99900 153.79200 127.14900 1.000 94.85000  ? 389 ALA B O     1 
ATOM   3600  C CB    . ALA B 1 144 ? 106.90600 151.54200 125.63800 1.000 94.85000  ? 389 ALA B CB    1 
ATOM   3601  N N     . ARG B 1 145 ? 106.88800 153.27600 128.24900 1.000 88.28000  ? 390 ARG B N     1 
ATOM   3602  C CA    . ARG B 1 145 ? 106.25700 153.64200 129.51000 1.000 88.28000  ? 390 ARG B CA    1 
ATOM   3603  C C     . ARG B 1 145 ? 106.09800 155.15300 129.63800 1.000 88.28000  ? 390 ARG B C     1 
ATOM   3604  O O     . ARG B 1 145 ? 105.24100 155.61000 130.39700 1.000 88.28000  ? 390 ARG B O     1 
ATOM   3605  C CB    . ARG B 1 145 ? 107.02900 153.05800 130.70200 1.000 88.28000  ? 390 ARG B CB    1 
ATOM   3606  C CG    . ARG B 1 145 ? 108.41600 153.61000 130.94100 1.000 88.28000  ? 390 ARG B CG    1 
ATOM   3607  C CD    . ARG B 1 145 ? 108.42200 154.67700 132.02000 1.000 88.28000  ? 390 ARG B CD    1 
ATOM   3608  N NE    . ARG B 1 145 ? 109.72600 155.29000 132.17100 1.000 88.28000  ? 390 ARG B NE    1 
ATOM   3609  C CZ    . ARG B 1 145 ? 109.91700 156.43400 132.80900 1.000 88.28000  ? 390 ARG B CZ    1 
ATOM   3610  N NH1   . ARG B 1 145 ? 108.88100 157.07200 133.32600 1.000 88.28000  ? 390 ARG B NH1   1 
ATOM   3611  N NH2   . ARG B 1 145 ? 111.13100 156.95200 132.90400 1.000 88.28000  ? 390 ARG B NH2   1 
ATOM   3612  N N     . SER B 1 146 ? 106.90500 155.93400 128.91900 1.000 87.71000  ? 391 SER B N     1 
ATOM   3613  C CA    . SER B 1 146 ? 106.71900 157.37700 128.94000 1.000 87.71000  ? 391 SER B CA    1 
ATOM   3614  C C     . SER B 1 146 ? 105.48700 157.78500 128.15400 1.000 87.71000  ? 391 SER B C     1 
ATOM   3615  O O     . SER B 1 146 ? 104.71500 158.63900 128.59900 1.000 87.71000  ? 391 SER B O     1 
ATOM   3616  C CB    . SER B 1 146 ? 107.93900 158.06700 128.35800 1.000 87.71000  ? 391 SER B CB    1 
ATOM   3617  O OG    . SER B 1 146 ? 108.00700 157.80100 126.97000 1.000 87.71000  ? 391 SER B OG    1 
ATOM   3618  N N     . LEU B 1 147 ? 105.27700 157.17900 126.99100 1.000 93.94000  ? 392 LEU B N     1 
ATOM   3619  C CA    . LEU B 1 147 ? 104.21000 157.57900 126.08200 1.000 93.94000  ? 392 LEU B CA    1 
ATOM   3620  C C     . LEU B 1 147 ? 102.84200 157.03800 126.45900 1.000 93.94000  ? 392 LEU B C     1 
ATOM   3621  O O     . LEU B 1 147 ? 101.94200 157.11300 125.61400 1.000 93.94000  ? 392 LEU B O     1 
ATOM   3622  C CB    . LEU B 1 147 ? 104.52900 157.13200 124.65800 1.000 93.94000  ? 392 LEU B CB    1 
ATOM   3623  C CG    . LEU B 1 147 ? 105.65400 157.83000 123.91000 1.000 93.94000  ? 392 LEU B CG    1 
ATOM   3624  C CD1   . LEU B 1 147 ? 105.90300 157.11500 122.61500 1.000 93.94000  ? 392 LEU B CD1   1 
ATOM   3625  C CD2   . LEU B 1 147 ? 105.27500 159.24400 123.63300 1.000 93.94000  ? 392 LEU B CD2   1 
ATOM   3626  N N     . ALA B 1 148 ? 102.68700 156.48700 127.67000 1.000 106.24000 ? 393 ALA B N     1 
ATOM   3627  C CA    . ALA B 1 148 ? 101.41700 155.97800 128.20100 1.000 106.24000 ? 393 ALA B CA    1 
ATOM   3628  C C     . ALA B 1 148 ? 100.82100 154.88900 127.31600 1.000 106.24000 ? 393 ALA B C     1 
ATOM   3629  O O     . ALA B 1 148 ? 99.60600  154.80600 127.14000 1.000 106.24000 ? 393 ALA B O     1 
ATOM   3630  C CB    . ALA B 1 148 ? 100.40100 157.10200 128.42100 1.000 106.24000 ? 393 ALA B CB    1 
ATOM   3631  N N     . VAL B 1 149 ? 101.67600 154.05300 126.74200 1.000 102.88000 ? 394 VAL B N     1 
ATOM   3632  C CA    . VAL B 1 149 ? 101.20200 152.99300 125.86400 1.000 102.88000 ? 394 VAL B CA    1 
ATOM   3633  C C     . VAL B 1 149 ? 101.62900 151.65700 126.44300 1.000 102.88000 ? 394 VAL B C     1 
ATOM   3634  O O     . VAL B 1 149 ? 102.20500 151.60000 127.53400 1.000 102.88000 ? 394 VAL B O     1 
ATOM   3635  C CB    . VAL B 1 149 ? 101.71900 153.17600 124.43100 1.000 102.88000 ? 394 VAL B CB    1 
ATOM   3636  C CG1   . VAL B 1 149 ? 101.13400 154.42400 123.82400 1.000 102.88000 ? 394 VAL B CG1   1 
ATOM   3637  C CG2   . VAL B 1 149 ? 103.21000 153.27800 124.44400 1.000 102.88000 ? 394 VAL B CG2   1 
ATOM   3638  N N     . ILE B 1 150 ? 101.33700 150.57400 125.72900 1.000 113.95000 ? 395 ILE B N     1 
ATOM   3639  C CA    . ILE B 1 150 ? 101.49900 149.23900 126.28900 1.000 113.95000 ? 395 ILE B CA    1 
ATOM   3640  C C     . ILE B 1 150 ? 102.89700 148.70400 126.03400 1.000 113.95000 ? 395 ILE B C     1 
ATOM   3641  O O     . ILE B 1 150 ? 103.66500 148.46300 126.97300 1.000 113.95000 ? 395 ILE B O     1 
ATOM   3642  C CB    . ILE B 1 150 ? 100.45000 148.27800 125.71000 1.000 113.95000 ? 395 ILE B CB    1 
ATOM   3643  C CG1   . ILE B 1 150 ? 99.04800  148.77300 126.04600 1.000 113.95000 ? 395 ILE B CG1   1 
ATOM   3644  C CG2   . ILE B 1 150 ? 100.65600 146.88200 126.25800 1.000 113.95000 ? 395 ILE B CG2   1 
ATOM   3645  C CD1   . ILE B 1 150 ? 97.95800  148.03100 125.32500 1.000 113.95000 ? 395 ILE B CD1   1 
ATOM   3646  N N     . SER B 1 151 ? 103.23500 148.52100 124.76200 1.000 112.92000 ? 396 SER B N     1 
ATOM   3647  C CA    . SER B 1 151 ? 104.46400 147.82600 124.39800 1.000 112.92000 ? 396 SER B CA    1 
ATOM   3648  C C     . SER B 1 151 ? 104.77100 148.15300 122.94700 1.000 112.92000 ? 396 SER B C     1 
ATOM   3649  O O     . SER B 1 151 ? 104.06100 147.68900 122.05400 1.000 112.92000 ? 396 SER B O     1 
ATOM   3650  C CB    . SER B 1 151 ? 104.30000 146.33000 124.59000 1.000 112.92000 ? 396 SER B CB    1 
ATOM   3651  O OG    . SER B 1 151 ? 103.30900 145.83800 123.70500 1.000 112.92000 ? 396 SER B OG    1 
ATOM   3652  N N     . VAL B 1 152 ? 105.83300 148.90800 122.70500 1.000 107.70000 ? 397 VAL B N     1 
ATOM   3653  C CA    . VAL B 1 152 ? 106.18300 149.32100 121.36100 1.000 107.70000 ? 397 VAL B CA    1 
ATOM   3654  C C     . VAL B 1 152 ? 107.41100 148.54600 120.91400 1.000 107.70000 ? 397 VAL B C     1 
ATOM   3655  O O     . VAL B 1 152 ? 108.05300 147.84700 121.69500 1.000 107.70000 ? 397 VAL B O     1 
ATOM   3656  C CB    . VAL B 1 152 ? 106.43300 150.82700 121.27700 1.000 107.70000 ? 397 VAL B CB    1 
ATOM   3657  C CG1   . VAL B 1 152 ? 105.27300 151.54300 121.87300 1.000 107.70000 ? 397 VAL B CG1   1 
ATOM   3658  C CG2   . VAL B 1 152 ? 107.70200 151.17400 122.00000 1.000 107.70000 ? 397 VAL B CG2   1 
ATOM   3659  N N     . ARG B 1 153 ? 107.73200 148.67700 119.63200 1.000 106.24000 ? 398 ARG B N     1 
ATOM   3660  C CA    . ARG B 1 153 ? 108.96400 148.13300 119.09000 1.000 106.24000 ? 398 ARG B CA    1 
ATOM   3661  C C     . ARG B 1 153 ? 109.33300 148.93600 117.85500 1.000 106.24000 ? 398 ARG B C     1 
ATOM   3662  O O     . ARG B 1 153 ? 108.54900 149.74400 117.35400 1.000 106.24000 ? 398 ARG B O     1 
ATOM   3663  C CB    . ARG B 1 153 ? 108.83800 146.63600 118.78600 1.000 106.24000 ? 398 ARG B CB    1 
ATOM   3664  C CG    . ARG B 1 153 ? 107.81900 146.28200 117.72900 1.000 106.24000 ? 398 ARG B CG    1 
ATOM   3665  C CD    . ARG B 1 153 ? 107.65200 144.76600 117.61400 1.000 106.24000 ? 398 ARG B CD    1 
ATOM   3666  N NE    . ARG B 1 153 ? 108.81900 144.08500 117.05600 1.000 106.24000 ? 398 ARG B NE    1 
ATOM   3667  C CZ    . ARG B 1 153 ? 109.01400 143.88500 115.75700 1.000 106.24000 ? 398 ARG B CZ    1 
ATOM   3668  N NH1   . ARG B 1 153 ? 108.11800 144.30800 114.87800 1.000 106.24000 ? 398 ARG B NH1   1 
ATOM   3669  N NH2   . ARG B 1 153 ? 110.10200 143.25700 115.33900 1.000 106.24000 ? 398 ARG B NH2   1 
ATOM   3670  N N     . VAL B 1 154 ? 110.54800 148.70900 117.37500 1.000 100.32000 ? 399 VAL B N     1 
ATOM   3671  C CA    . VAL B 1 154 ? 111.17000 149.54100 116.35600 1.000 100.32000 ? 399 VAL B CA    1 
ATOM   3672  C C     . VAL B 1 154 ? 111.42300 148.69100 115.12300 1.000 100.32000 ? 399 VAL B C     1 
ATOM   3673  O O     . VAL B 1 154 ? 111.96500 147.58700 115.22800 1.000 100.32000 ? 399 VAL B O     1 
ATOM   3674  C CB    . VAL B 1 154 ? 112.48400 150.14800 116.87400 1.000 100.32000 ? 399 VAL B CB    1 
ATOM   3675  C CG1   . VAL B 1 154 ? 113.17400 150.95500 115.79500 1.000 100.32000 ? 399 VAL B CG1   1 
ATOM   3676  C CG2   . VAL B 1 154 ? 112.21700 150.99700 118.08900 1.000 100.32000 ? 399 VAL B CG2   1 
ATOM   3677  N N     . VAL B 1 155 ? 111.03200 149.20000 113.96300 1.000 104.69000 ? 400 VAL B N     1 
ATOM   3678  C CA    . VAL B 1 155 ? 111.38900 148.60100 112.68600 1.000 104.69000 ? 400 VAL B CA    1 
ATOM   3679  C C     . VAL B 1 155 ? 112.54800 149.40500 112.12100 1.000 104.69000 ? 400 VAL B C     1 
ATOM   3680  O O     . VAL B 1 155 ? 112.38300 150.57100 111.74800 1.000 104.69000 ? 400 VAL B O     1 
ATOM   3681  C CB    . VAL B 1 155 ? 110.20500 148.57900 111.72000 1.000 104.69000 ? 400 VAL B CB    1 
ATOM   3682  C CG1   . VAL B 1 155 ? 110.64800 148.02300 110.38800 1.000 104.69000 ? 400 VAL B CG1   1 
ATOM   3683  C CG2   . VAL B 1 155 ? 109.07800 147.75600 112.30200 1.000 104.69000 ? 400 VAL B CG2   1 
ATOM   3684  N N     . GLU B 1 156 ? 113.71700 148.78100 112.03700 1.000 93.97000  ? 401 GLU B N     1 
ATOM   3685  C CA    . GLU B 1 156 ? 114.96100 149.49400 111.78600 1.000 93.97000  ? 401 GLU B CA    1 
ATOM   3686  C C     . GLU B 1 156 ? 115.22900 149.77000 110.31700 1.000 93.97000  ? 401 GLU B C     1 
ATOM   3687  O O     . GLU B 1 156 ? 116.32600 150.23100 109.99000 1.000 93.97000  ? 401 GLU B O     1 
ATOM   3688  C CB    . GLU B 1 156 ? 116.13800 148.71900 112.38200 1.000 93.97000  ? 401 GLU B CB    1 
ATOM   3689  C CG    . GLU B 1 156 ? 116.21500 148.76900 113.89600 1.000 93.97000  ? 401 GLU B CG    1 
ATOM   3690  C CD    . GLU B 1 156 ? 115.35100 147.74000 114.57300 1.000 93.97000  ? 401 GLU B CD    1 
ATOM   3691  O OE1   . GLU B 1 156 ? 114.74300 146.91200 113.86600 1.000 93.97000  ? 401 GLU B OE1   1 
ATOM   3692  O OE2   . GLU B 1 156 ? 115.27700 147.76400 115.81800 1.000 93.97000  ? 401 GLU B OE2   1 
ATOM   3693  N N     . VAL B 1 157 ? 114.27900 149.51900 109.42600 1.000 85.78000  ? 402 VAL B N     1 
ATOM   3694  C CA    . VAL B 1 157 ? 114.50100 149.79900 108.01600 1.000 85.78000  ? 402 VAL B CA    1 
ATOM   3695  C C     . VAL B 1 157 ? 113.15900 150.11000 107.37000 1.000 85.78000  ? 402 VAL B C     1 
ATOM   3696  O O     . VAL B 1 157 ? 112.11600 149.59500 107.77900 1.000 85.78000  ? 402 VAL B O     1 
ATOM   3697  C CB    . VAL B 1 157 ? 115.24500 148.62700 107.32500 1.000 85.78000  ? 402 VAL B CB    1 
ATOM   3698  C CG1   . VAL B 1 157 ? 114.38400 147.37700 107.22600 1.000 85.78000  ? 402 VAL B CG1   1 
ATOM   3699  C CG2   . VAL B 1 157 ? 115.79800 149.02900 105.96600 1.000 85.78000  ? 402 VAL B CG2   1 
ATOM   3700  N N     . ILE B 1 158 ? 113.18300 151.02900 106.41500 1.000 90.23000  ? 403 ILE B N     1 
ATOM   3701  C CA    . ILE B 1 158 ? 112.11700 151.20300 105.44200 1.000 90.23000  ? 403 ILE B CA    1 
ATOM   3702  C C     . ILE B 1 158 ? 112.76100 151.17700 104.06000 1.000 90.23000  ? 403 ILE B C     1 
ATOM   3703  O O     . ILE B 1 158 ? 113.71200 151.92200 103.80100 1.000 90.23000  ? 403 ILE B O     1 
ATOM   3704  C CB    . ILE B 1 158 ? 111.29900 152.48700 105.67200 1.000 90.23000  ? 403 ILE B CB    1 
ATOM   3705  C CG1   . ILE B 1 158 ? 110.25700 152.67700 104.56900 1.000 90.23000  ? 403 ILE B CG1   1 
ATOM   3706  C CG2   . ILE B 1 158 ? 112.16400 153.71900 105.89500 1.000 90.23000  ? 403 ILE B CG2   1 
ATOM   3707  C CD1   . ILE B 1 158 ? 109.22800 153.72700 104.89400 1.000 90.23000  ? 403 ILE B CD1   1 
ATOM   3708  N N     . PRO B 1 159 ? 112.36100 150.26500 103.17500 1.000 90.23000  ? 404 PRO B N     1 
ATOM   3709  C CA    . PRO B 1 159 ? 112.93300 150.24800 101.82400 1.000 90.23000  ? 404 PRO B CA    1 
ATOM   3710  C C     . PRO B 1 159 ? 112.46000 151.47100 101.06000 1.000 90.23000  ? 404 PRO B C     1 
ATOM   3711  O O     . PRO B 1 159 ? 111.26000 151.67900 100.88000 1.000 90.23000  ? 404 PRO B O     1 
ATOM   3712  C CB    . PRO B 1 159 ? 112.38600 148.95100 101.22200 1.000 90.23000  ? 404 PRO B CB    1 
ATOM   3713  C CG    . PRO B 1 159 ? 112.04400 148.11200 102.40000 1.000 90.23000  ? 404 PRO B CG    1 
ATOM   3714  C CD    . PRO B 1 159 ? 111.55400 149.06600 103.44200 1.000 90.23000  ? 404 PRO B CD    1 
ATOM   3715  N N     . GLY B 1 160 ? 113.40800 152.29500 100.64300 1.000 97.49000  ? 405 GLY B N     1 
ATOM   3716  C CA    . GLY B 1 160 ? 113.05600 153.57000 100.06400 1.000 97.49000  ? 405 GLY B CA    1 
ATOM   3717  C C     . GLY B 1 160 ? 113.66800 154.71800 100.83000 1.000 97.49000  ? 405 GLY B C     1 
ATOM   3718  O O     . GLY B 1 160 ? 114.88500 154.91000 100.80500 1.000 97.49000  ? 405 GLY B O     1 
ATOM   3719  N N     . LYS B 1 161 ? 112.83200 155.48300 101.52500 1.000 100.94000 ? 406 LYS B N     1 
ATOM   3720  C CA    . LYS B 1 161 ? 113.27000 156.70200 102.18000 1.000 100.94000 ? 406 LYS B CA    1 
ATOM   3721  C C     . LYS B 1 161 ? 114.08200 156.39000 103.43900 1.000 100.94000 ? 406 LYS B C     1 
ATOM   3722  O O     . LYS B 1 161 ? 114.27800 155.23400 103.82400 1.000 100.94000 ? 406 LYS B O     1 
ATOM   3723  C CB    . LYS B 1 161 ? 112.06600 157.58200 102.48700 1.000 100.94000 ? 406 LYS B CB    1 
ATOM   3724  C CG    . LYS B 1 161 ? 111.39900 158.08800 101.23500 1.000 100.94000 ? 406 LYS B CG    1 
ATOM   3725  C CD    . LYS B 1 161 ? 110.24800 159.01200 101.54200 1.000 100.94000 ? 406 LYS B CD    1 
ATOM   3726  C CE    . LYS B 1 161 ? 109.60000 159.48900 100.25500 1.000 100.94000 ? 406 LYS B CE    1 
ATOM   3727  N NZ    . LYS B 1 161 ? 108.47000 160.42400 100.49500 1.000 100.94000 ? 406 LYS B NZ    1 
ATOM   3728  N N     . THR B 1 162 ? 114.55300 157.44600 104.09200 1.000 108.06000 ? 407 THR B N     1 
ATOM   3729  C CA    . THR B 1 162 ? 115.59200 157.34500 105.10500 1.000 108.06000 ? 407 THR B CA    1 
ATOM   3730  C C     . THR B 1 162 ? 115.05300 157.20400 106.51700 1.000 108.06000 ? 407 THR B C     1 
ATOM   3731  O O     . THR B 1 162 ? 115.84300 157.22900 107.46400 1.000 108.06000 ? 407 THR B O     1 
ATOM   3732  C CB    . THR B 1 162 ? 116.48500 158.58100 105.05200 1.000 108.06000 ? 407 THR B CB    1 
ATOM   3733  O OG1   . THR B 1 162 ? 115.74100 159.71100 105.51100 1.000 108.06000 ? 407 THR B OG1   1 
ATOM   3734  C CG2   . THR B 1 162 ? 116.91500 158.85000 103.62800 1.000 108.06000 ? 407 THR B CG2   1 
ATOM   3735  N N     . THR B 1 163 ? 113.74500 157.06000 106.69000 1.000 104.38000 ? 408 THR B N     1 
ATOM   3736  C CA    . THR B 1 163 ? 113.17300 157.16900 108.02000 1.000 104.38000 ? 408 THR B CA    1 
ATOM   3737  C C     . THR B 1 163 ? 113.38300 155.88300 108.81600 1.000 104.38000 ? 408 THR B C     1 
ATOM   3738  O O     . THR B 1 163 ? 113.98600 154.91600 108.35300 1.000 104.38000 ? 408 THR B O     1 
ATOM   3739  C CB    . THR B 1 163 ? 111.68600 157.51200 107.93600 1.000 104.38000 ? 408 THR B CB    1 
ATOM   3740  O OG1   . THR B 1 163 ? 110.98700 156.47100 107.24900 1.000 104.38000 ? 408 THR B OG1   1 
ATOM   3741  C CG2   . THR B 1 163 ? 111.48600 158.82200 107.19000 1.000 104.38000 ? 408 THR B CG2   1 
ATOM   3742  N N     . VAL B 1 164 ? 112.90600 155.90200 110.05400 1.000 104.69000 ? 409 VAL B N     1 
ATOM   3743  C CA    . VAL B 1 164 ? 112.99900 154.77300 110.96600 1.000 104.69000 ? 409 VAL B CA    1 
ATOM   3744  C C     . VAL B 1 164 ? 111.61100 154.52100 111.52600 1.000 104.69000 ? 409 VAL B C     1 
ATOM   3745  O O     . VAL B 1 164 ? 110.96400 155.44700 112.02100 1.000 104.69000 ? 409 VAL B O     1 
ATOM   3746  C CB    . VAL B 1 164 ? 114.00100 155.04100 112.10000 1.000 104.69000 ? 409 VAL B CB    1 
ATOM   3747  C CG1   . VAL B 1 164 ? 113.93100 153.95400 113.14000 1.000 104.69000 ? 409 VAL B CG1   1 
ATOM   3748  C CG2   . VAL B 1 164 ? 115.39600 155.11400 111.54800 1.000 104.69000 ? 409 VAL B CG2   1 
ATOM   3749  N N     . GLY B 1 165 ? 111.15100 153.27500 111.44300 1.000 109.41000 ? 410 GLY B N     1 
ATOM   3750  C CA    . GLY B 1 165 ? 109.79700 152.94200 111.84100 1.000 109.41000 ? 410 GLY B CA    1 
ATOM   3751  C C     . GLY B 1 165 ? 109.67500 152.57400 113.30500 1.000 109.41000 ? 410 GLY B C     1 
ATOM   3752  O O     . GLY B 1 165 ? 110.41900 151.72700 113.80800 1.000 109.41000 ? 410 GLY B O     1 
ATOM   3753  N N     . ILE B 1 166 ? 108.72800 153.21500 113.98700 1.000 106.69000 ? 411 ILE B N     1 
ATOM   3754  C CA    . ILE B 1 166 ? 108.29400 152.80400 115.31400 1.000 106.69000 ? 411 ILE B CA    1 
ATOM   3755  C C     . ILE B 1 166 ? 106.78800 152.60200 115.28100 1.000 106.69000 ? 411 ILE B C     1 
ATOM   3756  O O     . ILE B 1 166 ? 106.04200 153.50800 114.89400 1.000 106.69000 ? 411 ILE B O     1 
ATOM   3757  C CB    . ILE B 1 166 ? 108.68500 153.82000 116.39800 1.000 106.69000 ? 411 ILE B CB    1 
ATOM   3758  C CG1   . ILE B 1 166 ? 110.19800 153.86400 116.53900 1.000 106.69000 ? 411 ILE B CG1   1 
ATOM   3759  C CG2   . ILE B 1 166 ? 108.05900 153.46100 117.72500 1.000 106.69000 ? 411 ILE B CG2   1 
ATOM   3760  C CD1   . ILE B 1 166 ? 110.68400 154.90900 117.49100 1.000 106.69000 ? 411 ILE B CD1   1 
ATOM   3761  N N     . GLU B 1 167 ? 106.34900 151.41500 115.68100 1.000 119.06000 ? 412 GLU B N     1 
ATOM   3762  C CA    . GLU B 1 167 ? 104.95200 151.01900 115.64700 1.000 119.06000 ? 412 GLU B CA    1 
ATOM   3763  C C     . GLU B 1 167 ? 104.39000 150.94900 117.06300 1.000 119.06000 ? 412 GLU B C     1 
ATOM   3764  O O     . GLU B 1 167 ? 105.03500 150.41900 117.97400 1.000 119.06000 ? 412 GLU B O     1 
ATOM   3765  C CB    . GLU B 1 167 ? 104.81100 149.68700 114.89800 1.000 119.06000 ? 412 GLU B CB    1 
ATOM   3766  C CG    . GLU B 1 167 ? 105.70600 148.54400 115.39700 1.000 119.06000 ? 412 GLU B CG    1 
ATOM   3767  C CD    . GLU B 1 167 ? 105.71100 147.33800 114.45500 1.000 119.06000 ? 412 GLU B CD    1 
ATOM   3768  O OE1   . GLU B 1 167 ? 105.04000 147.39000 113.40300 1.000 119.06000 ? 412 GLU B OE1   1 
ATOM   3769  O OE2   . GLU B 1 167 ? 106.39600 146.34000 114.75700 1.000 119.06000 ? 412 GLU B OE2   1 
ATOM   3770  N N     . ILE B 1 168 ? 103.20400 151.52800 117.25300 1.000 128.03000 ? 413 ILE B N     1 
ATOM   3771  C CA    . ILE B 1 168 ? 102.61000 151.69700 118.58100 1.000 128.03000 ? 413 ILE B CA    1 
ATOM   3772  C C     . ILE B 1 168 ? 101.20100 151.11600 118.63600 1.000 128.03000 ? 413 ILE B C     1 
ATOM   3773  O O     . ILE B 1 168 ? 100.33800 151.49000 117.83000 1.000 128.03000 ? 413 ILE B O     1 
ATOM   3774  C CB    . ILE B 1 168 ? 102.60200 153.17500 119.01000 1.000 128.03000 ? 413 ILE B CB    1 
ATOM   3775  C CG1   . ILE B 1 168 ? 104.03400 153.67300 119.21800 1.000 128.03000 ? 413 ILE B CG1   1 
ATOM   3776  C CG2   . ILE B 1 168 ? 101.75400 153.38500 120.26100 1.000 128.03000 ? 413 ILE B CG2   1 
ATOM   3777  C CD1   . ILE B 1 168 ? 104.15000 155.10500 119.64600 1.000 128.03000 ? 413 ILE B CD1   1 
ATOM   3778  N N     . PRO B 1 169 ? 100.92400 150.22300 119.58300 1.000 133.52000 ? 414 PRO B N     1 
ATOM   3779  C CA    . PRO B 1 169 ? 99.61400  149.56300 119.65100 1.000 133.52000 ? 414 PRO B CA    1 
ATOM   3780  C C     . PRO B 1 169 ? 98.51300  150.38100 120.30800 1.000 133.52000 ? 414 PRO B C     1 
ATOM   3781  O O     . PRO B 1 169 ? 98.37100  150.34200 121.53500 1.000 133.52000 ? 414 PRO B O     1 
ATOM   3782  C CB    . PRO B 1 169 ? 99.91300  148.29800 120.46200 1.000 133.52000 ? 414 PRO B CB    1 
ATOM   3783  C CG    . PRO B 1 169 ? 101.07200 148.66800 121.31000 1.000 133.52000 ? 414 PRO B CG    1 
ATOM   3784  C CD    . PRO B 1 169 ? 101.89500 149.62600 120.51400 1.000 133.52000 ? 414 PRO B CD    1 
ATOM   3785  N N     . ASN B 1 170 ? 97.77600  151.17200 119.52400 1.000 143.47000 ? 415 ASN B N     1 
ATOM   3786  C CA    . ASN B 1 170 ? 96.51200  151.72500 120.00300 1.000 143.47000 ? 415 ASN B CA    1 
ATOM   3787  C C     . ASN B 1 170 ? 95.58800  150.60900 120.47300 1.000 143.47000 ? 415 ASN B C     1 
ATOM   3788  O O     . ASN B 1 170 ? 95.35900  149.62800 119.76300 1.000 143.47000 ? 415 ASN B O     1 
ATOM   3789  C CB    . ASN B 1 170 ? 95.82700  152.54700 118.91300 1.000 143.47000 ? 415 ASN B CB    1 
ATOM   3790  C CG    . ASN B 1 170 ? 96.54700  153.83600 118.62700 1.000 143.47000 ? 415 ASN B CG    1 
ATOM   3791  O OD1   . ASN B 1 170 ? 97.08200  154.03200 117.54100 1.000 143.47000 ? 415 ASN B OD1   1 
ATOM   3792  N ND2   . ASN B 1 170 ? 96.56800  154.72900 119.60600 1.000 143.47000 ? 415 ASN B ND2   1 
ATOM   3793  N N     . GLU B 1 171 ? 95.07200  150.76700 121.69000 1.000 150.99000 ? 416 GLU B N     1 
ATOM   3794  C CA    . GLU B 1 171 ? 94.42800  149.68300 122.41800 1.000 150.99000 ? 416 GLU B CA    1 
ATOM   3795  C C     . GLU B 1 171 ? 93.02500  149.36900 121.91200 1.000 150.99000 ? 416 GLU B C     1 
ATOM   3796  O O     . GLU B 1 171 ? 92.59100  148.21500 122.00800 1.000 150.99000 ? 416 GLU B O     1 
ATOM   3797  C CB    . GLU B 1 171 ? 94.40200  150.04200 123.90600 1.000 150.99000 ? 416 GLU B CB    1 
ATOM   3798  C CG    . GLU B 1 171 ? 93.95900  148.94200 124.84100 1.000 150.99000 ? 416 GLU B CG    1 
ATOM   3799  C CD    . GLU B 1 171 ? 94.12000  149.33300 126.29200 1.000 150.99000 ? 416 GLU B CD    1 
ATOM   3800  O OE1   . GLU B 1 171 ? 94.56400  150.47100 126.55400 1.000 150.99000 ? 416 GLU B OE1   1 
ATOM   3801  O OE2   . GLU B 1 171 ? 93.81300  148.50200 127.17100 1.000 150.99000 ? 416 GLU B OE2   1 
ATOM   3802  N N     . ASP B 1 172 ? 92.32400  150.34800 121.34200 1.000 151.11000 ? 417 ASP B N     1 
ATOM   3803  C CA    . ASP B 1 172 ? 90.97200  150.13900 120.81900 1.000 151.11000 ? 417 ASP B CA    1 
ATOM   3804  C C     . ASP B 1 172 ? 91.05200  149.34600 119.51300 1.000 151.11000 ? 417 ASP B C     1 
ATOM   3805  O O     . ASP B 1 172 ? 91.05800  149.88900 118.40600 1.000 151.11000 ? 417 ASP B O     1 
ATOM   3806  C CB    . ASP B 1 172 ? 90.27500  151.47800 120.62500 1.000 151.11000 ? 417 ASP B CB    1 
ATOM   3807  C CG    . ASP B 1 172 ? 88.80400  151.34000 120.32800 1.000 151.11000 ? 417 ASP B CG    1 
ATOM   3808  O OD1   . ASP B 1 172 ? 88.02900  151.04000 121.26000 1.000 151.11000 ? 417 ASP B OD1   1 
ATOM   3809  O OD2   . ASP B 1 172 ? 88.42100  151.54800 119.16400 1.000 151.11000 ? 417 ASP B OD2   1 
ATOM   3810  N N     . ARG B 1 173 ? 91.12200  148.02500 119.67200 1.000 137.02000 ? 418 ARG B N     1 
ATOM   3811  C CA    . ARG B 1 173 ? 91.26100  147.11900 118.54300 1.000 137.02000 ? 418 ARG B CA    1 
ATOM   3812  C C     . ARG B 1 173 ? 89.99000  147.10100 117.71500 1.000 137.02000 ? 418 ARG B C     1 
ATOM   3813  O O     . ARG B 1 173 ? 88.99000  146.50400 118.12400 1.000 137.02000 ? 418 ARG B O     1 
ATOM   3814  C CB    . ARG B 1 173 ? 91.57800  145.70500 119.02000 1.000 137.02000 ? 418 ARG B CB    1 
ATOM   3815  C CG    . ARG B 1 173 ? 92.88300  145.58900 119.75800 1.000 137.02000 ? 418 ARG B CG    1 
ATOM   3816  C CD    . ARG B 1 173 ? 93.15100  144.16900 120.21200 1.000 137.02000 ? 418 ARG B CD    1 
ATOM   3817  N NE    . ARG B 1 173 ? 93.40800  143.27200 119.09400 1.000 137.02000 ? 418 ARG B NE    1 
ATOM   3818  C CZ    . ARG B 1 173 ? 93.54800  141.95900 119.22000 1.000 137.02000 ? 418 ARG B CZ    1 
ATOM   3819  N NH1   . ARG B 1 173 ? 93.45800  141.39600 120.41200 1.000 137.02000 ? 418 ARG B NH1   1 
ATOM   3820  N NH2   . ARG B 1 173 ? 93.78200  141.20700 118.15700 1.000 137.02000 ? 418 ARG B NH2   1 
ATOM   3821  N N     . GLN B 1 174 ? 90.01400  147.77500 116.56700 1.000 141.39000 ? 419 GLN B N     1 
ATOM   3822  C CA    . GLN B 1 174 ? 88.92800  147.67900 115.60300 1.000 141.39000 ? 419 GLN B CA    1 
ATOM   3823  C C     . GLN B 1 174 ? 88.79000  146.25200 115.10000 1.000 141.39000 ? 419 GLN B C     1 
ATOM   3824  O O     . GLN B 1 174 ? 89.67600  145.75000 114.40400 1.000 141.39000 ? 419 GLN B O     1 
ATOM   3825  C CB    . GLN B 1 174 ? 89.16900  148.62000 114.42800 1.000 141.39000 ? 419 GLN B CB    1 
ATOM   3826  C CG    . GLN B 1 174 ? 88.13600  148.48700 113.33900 1.000 141.39000 ? 419 GLN B CG    1 
ATOM   3827  C CD    . GLN B 1 174 ? 88.39100  149.42800 112.19100 1.000 141.39000 ? 419 GLN B CD    1 
ATOM   3828  O OE1   . GLN B 1 174 ? 89.33300  150.21900 112.22000 1.000 141.39000 ? 419 GLN B OE1   1 
ATOM   3829  N NE2   . GLN B 1 174 ? 87.56700  149.33300 111.15600 1.000 141.39000 ? 419 GLN B NE2   1 
ATOM   3830  N N     . MET B 1 175 ? 87.69900  145.58500 115.46800 1.000 138.95000 ? 420 MET B N     1 
ATOM   3831  C CA    . MET B 1 175 ? 87.49300  144.20700 115.04900 1.000 138.95000 ? 420 MET B CA    1 
ATOM   3832  C C     . MET B 1 175 ? 87.21400  144.15800 113.55500 1.000 138.95000 ? 420 MET B C     1 
ATOM   3833  O O     . MET B 1 175 ? 86.34400  144.86600 113.04600 1.000 138.95000 ? 420 MET B O     1 
ATOM   3834  C CB    . MET B 1 175 ? 86.34000  143.58500 115.83300 1.000 138.95000 ? 420 MET B CB    1 
ATOM   3835  C CG    . MET B 1 175 ? 86.20200  142.09300 115.62500 1.000 138.95000 ? 420 MET B CG    1 
ATOM   3836  S SD    . MET B 1 175 ? 84.84800  141.34200 116.54100 1.000 138.95000 ? 420 MET B SD    1 
ATOM   3837  C CE    . MET B 1 175 ? 85.49900  141.35600 118.21300 1.000 138.95000 ? 420 MET B CE    1 
ATOM   3838  N N     . VAL B 1 176 ? 87.97100  143.32000 112.85500 1.000 130.25000 ? 421 VAL B N     1 
ATOM   3839  C CA    . VAL B 1 176 ? 88.11600  143.42600 111.40900 1.000 130.25000 ? 421 VAL B CA    1 
ATOM   3840  C C     . VAL B 1 176 ? 86.88900  142.82600 110.73600 1.000 130.25000 ? 421 VAL B C     1 
ATOM   3841  O O     . VAL B 1 176 ? 86.66600  141.61400 110.78800 1.000 130.25000 ? 421 VAL B O     1 
ATOM   3842  C CB    . VAL B 1 176 ? 89.40000  142.75100 110.92800 1.000 130.25000 ? 421 VAL B CB    1 
ATOM   3843  C CG1   . VAL B 1 176 ? 89.49500  142.86300 109.44400 1.000 130.25000 ? 421 VAL B CG1   1 
ATOM   3844  C CG2   . VAL B 1 176 ? 90.59100  143.41200 111.56600 1.000 130.25000 ? 421 VAL B CG2   1 
ATOM   3845  N N     . ARG B 1 177 ? 86.11000  143.68500 110.08400 1.000 134.04000 ? 422 ARG B N     1 
ATOM   3846  C CA    . ARG B 1 177 ? 84.87800  143.28400 109.41900 1.000 134.04000 ? 422 ARG B CA    1 
ATOM   3847  C C     . ARG B 1 177 ? 85.21800  142.46300 108.18400 1.000 134.04000 ? 422 ARG B C     1 
ATOM   3848  O O     . ARG B 1 177 ? 85.91200  142.94700 107.28500 1.000 134.04000 ? 422 ARG B O     1 
ATOM   3849  C CB    . ARG B 1 177 ? 84.08200  144.52600 109.03200 1.000 134.04000 ? 422 ARG B CB    1 
ATOM   3850  C CG    . ARG B 1 177 ? 83.86100  145.50900 110.17700 1.000 134.04000 ? 422 ARG B CG    1 
ATOM   3851  C CD    . ARG B 1 177 ? 82.91400  144.98800 111.22900 1.000 134.04000 ? 422 ARG B CD    1 
ATOM   3852  N NE    . ARG B 1 177 ? 81.55500  144.89400 110.72400 1.000 134.04000 ? 422 ARG B NE    1 
ATOM   3853  C CZ    . ARG B 1 177 ? 80.59500  144.18500 111.30200 1.000 134.04000 ? 422 ARG B CZ    1 
ATOM   3854  N NH1   . ARG B 1 177 ? 80.84600  143.50100 112.40800 1.000 134.04000 ? 422 ARG B NH1   1 
ATOM   3855  N NH2   . ARG B 1 177 ? 79.38400  144.15600 110.76900 1.000 134.04000 ? 422 ARG B NH2   1 
ATOM   3856  N N     . PHE B 1 178 ? 84.72900  141.22400 108.14300 1.000 130.34000 ? 423 PHE B N     1 
ATOM   3857  C CA    . PHE B 1 178 ? 85.19600  140.28100 107.13500 1.000 130.34000 ? 423 PHE B CA    1 
ATOM   3858  C C     . PHE B 1 178 ? 84.69000  140.64600 105.75000 1.000 130.34000 ? 423 PHE B C     1 
ATOM   3859  O O     . PHE B 1 178 ? 85.40800  140.48000 104.75600 1.000 130.34000 ? 423 PHE B O     1 
ATOM   3860  C CB    . PHE B 1 178 ? 84.76100  138.86600 107.49600 1.000 130.34000 ? 423 PHE B CB    1 
ATOM   3861  C CG    . PHE B 1 178 ? 85.33400  137.81200 106.59600 1.000 130.34000 ? 423 PHE B CG    1 
ATOM   3862  C CD1   . PHE B 1 178 ? 86.64300  137.40200 106.74600 1.000 130.34000 ? 423 PHE B CD1   1 
ATOM   3863  C CD2   . PHE B 1 178 ? 84.57000  137.23700 105.59800 1.000 130.34000 ? 423 PHE B CD2   1 
ATOM   3864  C CE1   . PHE B 1 178 ? 87.17800  136.43900 105.92900 1.000 130.34000 ? 423 PHE B CE1   1 
ATOM   3865  C CE2   . PHE B 1 178 ? 85.10400  136.26800 104.77800 1.000 130.34000 ? 423 PHE B CE2   1 
ATOM   3866  C CZ    . PHE B 1 178 ? 86.40800  135.87400 104.94300 1.000 130.34000 ? 423 PHE B CZ    1 
ATOM   3867  N N     . SER B 1 179 ? 83.45900  141.14800 105.66300 1.000 142.06000 ? 424 SER B N     1 
ATOM   3868  C CA    . SER B 1 179 ? 82.94100  141.58000 104.37400 1.000 142.06000 ? 424 SER B CA    1 
ATOM   3869  C C     . SER B 1 179 ? 83.65100  142.82300 103.87000 1.000 142.06000 ? 424 SER B C     1 
ATOM   3870  O O     . SER B 1 179 ? 83.67800  143.05900 102.65800 1.000 142.06000 ? 424 SER B O     1 
ATOM   3871  C CB    . SER B 1 179 ? 81.43400  141.83500 104.45600 1.000 142.06000 ? 424 SER B CB    1 
ATOM   3872  O OG    . SER B 1 179 ? 81.12800  142.91700 105.31400 1.000 142.06000 ? 424 SER B OG    1 
ATOM   3873  N N     . GLU B 1 180 ? 84.23700  143.61000 104.77000 1.000 143.18000 ? 425 GLU B N     1 
ATOM   3874  C CA    . GLU B 1 180 ? 85.06000  144.71900 104.32100 1.000 143.18000 ? 425 GLU B CA    1 
ATOM   3875  C C     . GLU B 1 180 ? 86.36400  144.22200 103.71400 1.000 143.18000 ? 425 GLU B C     1 
ATOM   3876  O O     . GLU B 1 180 ? 86.86600  144.81800 102.75300 1.000 143.18000 ? 425 GLU B O     1 
ATOM   3877  C CB    . GLU B 1 180 ? 85.31500  145.68500 105.47800 1.000 143.18000 ? 425 GLU B CB    1 
ATOM   3878  C CG    . GLU B 1 180 ? 86.08900  146.92100 105.08000 1.000 143.18000 ? 425 GLU B CG    1 
ATOM   3879  C CD    . GLU B 1 180 ? 85.35300  147.76900 104.05700 1.000 143.18000 ? 425 GLU B CD    1 
ATOM   3880  O OE1   . GLU B 1 180 ? 84.10400  147.79500 104.06800 1.000 143.18000 ? 425 GLU B OE1   1 
ATOM   3881  O OE2   . GLU B 1 180 ? 86.03200  148.39900 103.22100 1.000 143.18000 ? 425 GLU B OE2   1 
ATOM   3882  N N     . VAL B 1 181 ? 86.90700  143.12200 104.24200 1.000 137.95000 ? 426 VAL B N     1 
ATOM   3883  C CA    . VAL B 1 181 ? 88.05300  142.47900 103.61000 1.000 137.95000 ? 426 VAL B CA    1 
ATOM   3884  C C     . VAL B 1 181 ? 87.65800  141.93300 102.25100 1.000 137.95000 ? 426 VAL B C     1 
ATOM   3885  O O     . VAL B 1 181 ? 88.39700  142.06700 101.27000 1.000 137.95000 ? 426 VAL B O     1 
ATOM   3886  C CB    . VAL B 1 181 ? 88.60500  141.37200 104.52100 1.000 137.95000 ? 426 VAL B CB    1 
ATOM   3887  C CG1   . VAL B 1 181 ? 89.78200  140.68000 103.87500 1.000 137.95000 ? 426 VAL B CG1   1 
ATOM   3888  C CG2   . VAL B 1 181 ? 88.98600  141.94900 105.85200 1.000 137.95000 ? 426 VAL B CG2   1 
ATOM   3889  N N     . LEU B 1 182 ? 86.46200  141.35600 102.16100 1.000 134.77000 ? 427 LEU B N     1 
ATOM   3890  C CA    . LEU B 1 182 ? 85.97300  140.86500 100.88300 1.000 134.77000 ? 427 LEU B CA    1 
ATOM   3891  C C     . LEU B 1 182 ? 85.64300  141.98700 99.91200  1.000 134.77000 ? 427 LEU B C     1 
ATOM   3892  O O     . LEU B 1 182 ? 85.59500  141.74600 98.70300  1.000 134.77000 ? 427 LEU B O     1 
ATOM   3893  C CB    . LEU B 1 182 ? 84.73700  140.00400 101.09400 1.000 134.77000 ? 427 LEU B CB    1 
ATOM   3894  C CG    . LEU B 1 182 ? 84.94100  138.74400 101.92400 1.000 134.77000 ? 427 LEU B CG    1 
ATOM   3895  C CD1   . LEU B 1 182 ? 83.60900  138.05100 102.09100 1.000 134.77000 ? 427 LEU B CD1   1 
ATOM   3896  C CD2   . LEU B 1 182 ? 85.95300  137.83500 101.26800 1.000 134.77000 ? 427 LEU B CD2   1 
ATOM   3897  N N     . SER B 1 183 ? 85.44300  143.20800 100.39800 1.000 134.14000 ? 428 SER B N     1 
ATOM   3898  C CA    . SER B 1 183 ? 85.10000  144.32800 99.53200  1.000 134.14000 ? 428 SER B CA    1 
ATOM   3899  C C     . SER B 1 183 ? 86.30900  144.94900 98.85500  1.000 134.14000 ? 428 SER B C     1 
ATOM   3900  O O     . SER B 1 183 ? 86.19700  146.04600 98.30400  1.000 134.14000 ? 428 SER B O     1 
ATOM   3901  C CB    . SER B 1 183 ? 84.35500  145.39900 100.32700 1.000 134.14000 ? 428 SER B CB    1 
ATOM   3902  O OG    . SER B 1 183 ? 85.20500  146.00600 101.28000 1.000 134.14000 ? 428 SER B OG    1 
ATOM   3903  N N     . SER B 1 184 ? 87.45100  144.28300 98.89600  1.000 136.62000 ? 429 SER B N     1 
ATOM   3904  C CA    . SER B 1 184 ? 88.64500  144.78700 98.25600  1.000 136.62000 ? 429 SER B CA    1 
ATOM   3905  C C     . SER B 1 184 ? 88.51400  144.70300 96.73700  1.000 136.62000 ? 429 SER B C     1 
ATOM   3906  O O     . SER B 1 184 ? 87.88800  143.77900 96.21500  1.000 136.62000 ? 429 SER B O     1 
ATOM   3907  C CB    . SER B 1 184 ? 89.84800  143.98300 98.71700  1.000 136.62000 ? 429 SER B CB    1 
ATOM   3908  O OG    . SER B 1 184 ? 91.01300  144.38700 98.03900  1.000 136.62000 ? 429 SER B OG    1 
ATOM   3909  N N     . PRO B 1 185 ? 89.08800  145.66600 96.00800  1.000 140.79000 ? 430 PRO B N     1 
ATOM   3910  C CA    . PRO B 1 185 ? 88.96600  145.62700 94.54300  1.000 140.79000 ? 430 PRO B CA    1 
ATOM   3911  C C     . PRO B 1 185 ? 89.73800  144.49700 93.89300  1.000 140.79000 ? 430 PRO B C     1 
ATOM   3912  O O     . PRO B 1 185 ? 89.23300  143.89300 92.94000  1.000 140.79000 ? 430 PRO B O     1 
ATOM   3913  C CB    . PRO B 1 185 ? 89.49700  146.99800 94.11100  1.000 140.79000 ? 430 PRO B CB    1 
ATOM   3914  C CG    . PRO B 1 185 ? 90.37700  147.42600 95.22000  1.000 140.79000 ? 430 PRO B CG    1 
ATOM   3915  C CD    . PRO B 1 185 ? 89.73500  146.90500 96.46500  1.000 140.79000 ? 430 PRO B CD    1 
ATOM   3916  N N     . GLU B 1 186 ? 90.93900  144.17900 94.37100  1.000 143.05000 ? 431 GLU B N     1 
ATOM   3917  C CA    . GLU B 1 186 ? 91.66100  143.07900 93.75000  1.000 143.05000 ? 431 GLU B CA    1 
ATOM   3918  C C     . GLU B 1 186 ? 91.14200  141.72200 94.18700  1.000 143.05000 ? 431 GLU B C     1 
ATOM   3919  O O     . GLU B 1 186 ? 91.49700  140.71800 93.56500  1.000 143.05000 ? 431 GLU B O     1 
ATOM   3920  C CB    . GLU B 1 186 ? 93.15800  143.15400 94.05000  1.000 143.05000 ? 431 GLU B CB    1 
ATOM   3921  C CG    . GLU B 1 186 ? 93.55500  142.71000 95.44200  1.000 143.05000 ? 431 GLU B CG    1 
ATOM   3922  C CD    . GLU B 1 186 ? 93.53400  143.83100 96.45400  1.000 143.05000 ? 431 GLU B CD    1 
ATOM   3923  O OE1   . GLU B 1 186 ? 92.90900  144.88100 96.18800  1.000 143.05000 ? 431 GLU B OE1   1 
ATOM   3924  O OE2   . GLU B 1 186 ? 94.14100  143.66100 97.53100  1.000 143.05000 ? 431 GLU B OE2   1 
ATOM   3925  N N     . TYR B 1 187 ? 90.32900  141.66400 95.24300  1.000 138.27000 ? 432 TYR B N     1 
ATOM   3926  C CA    . TYR B 1 187 ? 89.66000  140.41300 95.57300  1.000 138.27000 ? 432 TYR B CA    1 
ATOM   3927  C C     . TYR B 1 187 ? 88.62000  140.06900 94.52200  1.000 138.27000 ? 432 TYR B C     1 
ATOM   3928  O O     . TYR B 1 187 ? 88.52400  138.92000 94.08100  1.000 138.27000 ? 432 TYR B O     1 
ATOM   3929  C CB    . TYR B 1 187 ? 89.01100  140.49500 96.94800  1.000 138.27000 ? 432 TYR B CB    1 
ATOM   3930  C CG    . TYR B 1 187 ? 88.29500  139.22300 97.29600  1.000 138.27000 ? 432 TYR B CG    1 
ATOM   3931  C CD1   . TYR B 1 187 ? 89.00800  138.07400 97.58500  1.000 138.27000 ? 432 TYR B CD1   1 
ATOM   3932  C CD2   . TYR B 1 187 ? 86.91200  139.16400 97.32900  1.000 138.27000 ? 432 TYR B CD2   1 
ATOM   3933  C CE1   . TYR B 1 187 ? 88.36900  136.90200 97.89700  1.000 138.27000 ? 432 TYR B CE1   1 
ATOM   3934  C CE2   . TYR B 1 187 ? 86.26300  137.99600 97.64700  1.000 138.27000 ? 432 TYR B CE2   1 
ATOM   3935  C CZ    . TYR B 1 187 ? 87.00000  136.86700 97.92700  1.000 138.27000 ? 432 TYR B CZ    1 
ATOM   3936  O OH    . TYR B 1 187 ? 86.37300  135.68800 98.24300  1.000 138.27000 ? 432 TYR B OH    1 
ATOM   3937  N N     . ASP B 1 188 ? 87.82400  141.05600 94.12100  1.000 147.47000 ? 433 ASP B N     1 
ATOM   3938  C CA    . ASP B 1 188 ? 86.90900  140.86000 93.00800  1.000 147.47000 ? 433 ASP B CA    1 
ATOM   3939  C C     . ASP B 1 188 ? 87.68000  140.66900 91.71100  1.000 147.47000 ? 433 ASP B C     1 
ATOM   3940  O O     . ASP B 1 188 ? 87.29200  139.86100 90.86000  1.000 147.47000 ? 433 ASP B O     1 
ATOM   3941  C CB    . ASP B 1 188 ? 85.96200  142.05600 92.91600  1.000 147.47000 ? 433 ASP B CB    1 
ATOM   3942  C CG    . ASP B 1 188 ? 84.74400  141.79000 92.04300  1.000 147.47000 ? 433 ASP B CG    1 
ATOM   3943  O OD1   . ASP B 1 188 ? 84.60000  140.67100 91.50500  1.000 147.47000 ? 433 ASP B OD1   1 
ATOM   3944  O OD2   . ASP B 1 188 ? 83.91800  142.71700 91.89800  1.000 147.47000 ? 433 ASP B OD2   1 
ATOM   3945  N N     . GLU B 1 189 ? 88.79600  141.37700 91.55800  1.000 148.31000 ? 434 GLU B N     1 
ATOM   3946  C CA    . GLU B 1 189 ? 89.62400  141.28200 90.36600  1.000 148.31000 ? 434 GLU B CA    1 
ATOM   3947  C C     . GLU B 1 189 ? 90.71300  140.22800 90.49100  1.000 148.31000 ? 434 GLU B C     1 
ATOM   3948  O O     . GLU B 1 189 ? 91.76100  140.35700 89.84900  1.000 148.31000 ? 434 GLU B O     1 
ATOM   3949  C CB    . GLU B 1 189 ? 90.25400  142.63900 90.04600  1.000 148.31000 ? 434 GLU B CB    1 
ATOM   3950  C CG    . GLU B 1 189 ? 89.26300  143.71300 89.61300  1.000 148.31000 ? 434 GLU B CG    1 
ATOM   3951  C CD    . GLU B 1 189 ? 88.64100  143.43800 88.25300  1.000 148.31000 ? 434 GLU B CD    1 
ATOM   3952  O OE1   . GLU B 1 189 ? 89.31600  142.83400 87.39300  1.000 148.31000 ? 434 GLU B OE1   1 
ATOM   3953  O OE2   . GLU B 1 189 ? 87.47500  143.83500 88.04200  1.000 148.31000 ? 434 GLU B OE2   1 
ATOM   3954  N N     . HIS B 1 190 ? 90.50000  139.19500 91.29600  1.000 141.37000 ? 435 HIS B N     1 
ATOM   3955  C CA    . HIS B 1 190 ? 91.52400  138.17800 91.45600  1.000 141.37000 ? 435 HIS B CA    1 
ATOM   3956  C C     . HIS B 1 190 ? 91.45500  137.16600 90.32400  1.000 141.37000 ? 435 HIS B C     1 
ATOM   3957  O O     . HIS B 1 190 ? 90.37200  136.74600 89.90700  1.000 141.37000 ? 435 HIS B O     1 
ATOM   3958  C CB    . HIS B 1 190 ? 91.39200  137.46500 92.79500  1.000 141.37000 ? 435 HIS B CB    1 
ATOM   3959  C CG    . HIS B 1 190 ? 92.57500  136.61700 93.11700  1.000 141.37000 ? 435 HIS B CG    1 
ATOM   3960  N ND1   . HIS B 1 190 ? 92.69800  135.31700 92.68100  1.000 141.37000 ? 435 HIS B ND1   1 
ATOM   3961  C CD2   . HIS B 1 190 ? 93.71200  136.90000 93.79200  1.000 141.37000 ? 435 HIS B CD2   1 
ATOM   3962  C CE1   . HIS B 1 190 ? 93.85300  134.82700 93.09300  1.000 141.37000 ? 435 HIS B CE1   1 
ATOM   3963  N NE2   . HIS B 1 190 ? 94.48700  135.76700 93.76900  1.000 141.37000 ? 435 HIS B NE2   1 
ATOM   3964  N N     . LYS B 1 191 ? 92.63300  136.76900 89.83700  1.000 144.09000 ? 436 LYS B N     1 
ATOM   3965  C CA    . LYS B 1 191 ? 92.71200  135.89700 88.67000  1.000 144.09000 ? 436 LYS B CA    1 
ATOM   3966  C C     . LYS B 1 191 ? 92.30800  134.47000 89.01300  1.000 144.09000 ? 436 LYS B C     1 
ATOM   3967  O O     . LYS B 1 191 ? 91.38100  133.91300 88.41400  1.000 144.09000 ? 436 LYS B O     1 
ATOM   3968  C CB    . LYS B 1 191 ? 94.12500  135.92600 88.08800  1.000 144.09000 ? 436 LYS B CB    1 
ATOM   3969  C CG    . LYS B 1 191 ? 94.26800  135.11300 86.81800  1.000 144.09000 ? 436 LYS B CG    1 
ATOM   3970  C CD    . LYS B 1 191 ? 95.65400  135.24100 86.22800  1.000 144.09000 ? 436 LYS B CD    1 
ATOM   3971  C CE    . LYS B 1 191 ? 95.77200  134.44400 84.94200  1.000 144.09000 ? 436 LYS B CE    1 
ATOM   3972  N NZ    . LYS B 1 191 ? 97.12600  134.56000 84.33000  1.000 144.09000 ? 436 LYS B NZ    1 
ATOM   3973  N N     . SER B 1 192 ? 92.99300  133.86400 89.98000  1.000 138.80000 ? 437 SER B N     1 
ATOM   3974  C CA    . SER B 1 192 ? 92.77900  132.46000 90.28600  1.000 138.80000 ? 437 SER B CA    1 
ATOM   3975  C C     . SER B 1 192 ? 91.44000  132.25300 90.98400  1.000 138.80000 ? 437 SER B C     1 
ATOM   3976  O O     . SER B 1 192 ? 90.72700  133.19700 91.33400  1.000 138.80000 ? 437 SER B O     1 
ATOM   3977  C CB    . SER B 1 192 ? 93.91100  131.91900 91.15300  1.000 138.80000 ? 437 SER B CB    1 
ATOM   3978  O OG    . SER B 1 192 ? 93.68200  130.56700 91.50200  1.000 138.80000 ? 437 SER B OG    1 
ATOM   3979  N N     . THR B 1 193 ? 91.10100  130.98300 91.17900  1.000 132.49000 ? 438 THR B N     1 
ATOM   3980  C CA    . THR B 1 193 ? 89.81500  130.59900 91.73300  1.000 132.49000 ? 438 THR B CA    1 
ATOM   3981  C C     . THR B 1 193 ? 89.88500  130.21100 93.19900  1.000 132.49000 ? 438 THR B C     1 
ATOM   3982  O O     . THR B 1 193 ? 88.84000  130.08400 93.84000  1.000 132.49000 ? 438 THR B O     1 
ATOM   3983  C CB    . THR B 1 193 ? 89.23900  129.43900 90.93200  1.000 132.49000 ? 438 THR B CB    1 
ATOM   3984  O OG1   . THR B 1 193 ? 90.12300  128.31700 91.02500  1.000 132.49000 ? 438 THR B OG1   1 
ATOM   3985  C CG2   . THR B 1 193 ? 89.09800  129.84600 89.48200  1.000 132.49000 ? 438 THR B CG2   1 
ATOM   3986  N N     . VAL B 1 194 ? 91.07600  130.01200 93.74200  1.000 125.75000 ? 439 VAL B N     1 
ATOM   3987  C CA    . VAL B 1 194 ? 91.20700  129.74000 95.16500  1.000 125.75000 ? 439 VAL B CA    1 
ATOM   3988  C C     . VAL B 1 194 ? 92.12800  130.78500 95.78900  1.000 125.75000 ? 439 VAL B C     1 
ATOM   3989  O O     . VAL B 1 194 ? 93.35000  130.60500 95.84100  1.000 125.75000 ? 439 VAL B O     1 
ATOM   3990  C CB    . VAL B 1 194 ? 91.65900  128.29000 95.40000  1.000 125.75000 ? 439 VAL B CB    1 
ATOM   3991  C CG1   . VAL B 1 194 ? 90.48400  127.36900 95.22100  1.000 125.75000 ? 439 VAL B CG1   1 
ATOM   3992  C CG2   . VAL B 1 194 ? 92.70700  127.86500 94.38200  1.000 125.75000 ? 439 VAL B CG2   1 
ATOM   3993  N N     . PRO B 1 195 ? 91.59700  131.91600 96.22800  1.000 123.92000 ? 440 PRO B N     1 
ATOM   3994  C CA    . PRO B 1 195 ? 92.41000  132.89100 96.95300  1.000 123.92000 ? 440 PRO B CA    1 
ATOM   3995  C C     . PRO B 1 195 ? 92.28600  132.68600 98.45600  1.000 123.92000 ? 440 PRO B C     1 
ATOM   3996  O O     . PRO B 1 195 ? 91.40100  131.98900 98.94300  1.000 123.92000 ? 440 PRO B O     1 
ATOM   3997  C CB    . PRO B 1 195 ? 91.78100  134.22500 96.54500  1.000 123.92000 ? 440 PRO B CB    1 
ATOM   3998  C CG    . PRO B 1 195 ? 90.35300  133.88400 96.38100  1.000 123.92000 ? 440 PRO B CG    1 
ATOM   3999  C CD    . PRO B 1 195 ? 90.30000  132.48700 95.82900  1.000 123.92000 ? 440 PRO B CD    1 
ATOM   4000  N N     . LEU B 1 196 ? 93.18700  133.33300 99.18600  1.000 129.92000 ? 441 LEU B N     1 
ATOM   4001  C CA    . LEU B 1 196 ? 93.08300  133.41500 100.63700 1.000 129.92000 ? 441 LEU B CA    1 
ATOM   4002  C C     . LEU B 1 196 ? 93.14000  134.87300 101.05800 1.000 129.92000 ? 441 LEU B C     1 
ATOM   4003  O O     . LEU B 1 196 ? 94.20200  135.50100 101.00200 1.000 129.92000 ? 441 LEU B O     1 
ATOM   4004  C CB    . LEU B 1 196 ? 94.17500  132.61600 101.33100 1.000 129.92000 ? 441 LEU B CB    1 
ATOM   4005  C CG    . LEU B 1 196 ? 94.02400  131.11900 101.14100 1.000 129.92000 ? 441 LEU B CG    1 
ATOM   4006  C CD1   . LEU B 1 196 ? 95.12400  130.39300 101.86600 1.000 129.92000 ? 441 LEU B CD1   1 
ATOM   4007  C CD2   . LEU B 1 196 ? 92.68100  130.66100 101.62400 1.000 129.92000 ? 441 LEU B CD2   1 
ATOM   4008  N N     . ALA B 1 197 ? 91.99900  135.40100 101.47800 1.000 133.07000 ? 442 ALA B N     1 
ATOM   4009  C CA    . ALA B 1 197 ? 91.92200  136.71000 102.09900 1.000 133.07000 ? 442 ALA B CA    1 
ATOM   4010  C C     . ALA B 1 197 ? 92.10400  136.54700 103.59600 1.000 133.07000 ? 442 ALA B C     1 
ATOM   4011  O O     . ALA B 1 197 ? 91.56200  135.61800 104.20000 1.000 133.07000 ? 442 ALA B O     1 
ATOM   4012  C CB    . ALA B 1 197 ? 90.58300  137.38100 101.80100 1.000 133.07000 ? 442 ALA B CB    1 
ATOM   4013  N N     . LEU B 1 198 ? 92.88000  137.43600 104.18800 1.000 126.18000 ? 443 LEU B N     1 
ATOM   4014  C CA    . LEU B 1 198 ? 93.11300  137.38000 105.62100 1.000 126.18000 ? 443 LEU B CA    1 
ATOM   4015  C C     . LEU B 1 198 ? 92.73300  138.65700 106.34900 1.000 126.18000 ? 443 LEU B C     1 
ATOM   4016  O O     . LEU B 1 198 ? 92.22800  138.58700 107.47000 1.000 126.18000 ? 443 LEU B O     1 
ATOM   4017  C CB    . LEU B 1 198 ? 94.57400  137.04400 105.89300 1.000 126.18000 ? 443 LEU B CB    1 
ATOM   4018  C CG    . LEU B 1 198 ? 94.95800  135.64200 105.44500 1.000 126.18000 ? 443 LEU B CG    1 
ATOM   4019  C CD1   . LEU B 1 198 ? 96.42200  135.39500 105.69800 1.000 126.18000 ? 443 LEU B CD1   1 
ATOM   4020  C CD2   . LEU B 1 198 ? 94.10600  134.62600 106.16400 1.000 126.18000 ? 443 LEU B CD2   1 
ATOM   4021  N N     . GLY B 1 199 ? 92.95100  139.82400 105.74700 1.000 126.68000 ? 444 GLY B N     1 
ATOM   4022  C CA    . GLY B 1 199 ? 92.52300  141.05800 106.37300 1.000 126.68000 ? 444 GLY B CA    1 
ATOM   4023  C C     . GLY B 1 199 ? 93.35800  142.28500 106.08200 1.000 126.68000 ? 444 GLY B C     1 
ATOM   4024  O O     . GLY B 1 199 ? 93.66700  142.59100 104.92800 1.000 126.68000 ? 444 GLY B O     1 
ATOM   4025  N N     . HIS B 1 200 ? 93.70000  143.01500 107.13200 1.000 137.00000 ? 445 HIS B N     1 
ATOM   4026  C CA    . HIS B 1 200 ? 94.49400  144.22200 107.00800 1.000 137.00000 ? 445 HIS B CA    1 
ATOM   4027  C C     . HIS B 1 200 ? 95.94000  143.94500 107.38100 1.000 137.00000 ? 445 HIS B C     1 
ATOM   4028  O O     . HIS B 1 200 ? 96.26100  142.96000 108.05100 1.000 137.00000 ? 445 HIS B O     1 
ATOM   4029  C CB    . HIS B 1 200 ? 93.94500  145.33500 107.89300 1.000 137.00000 ? 445 HIS B CB    1 
ATOM   4030  C CG    . HIS B 1 200 ? 92.57600  145.79100 107.51100 1.000 137.00000 ? 445 HIS B CG    1 
ATOM   4031  N ND1   . HIS B 1 200 ? 91.43600  145.25000 108.05900 1.000 137.00000 ? 445 HIS B ND1   1 
ATOM   4032  C CD2   . HIS B 1 200 ? 92.16300  146.73600 106.63600 1.000 137.00000 ? 445 HIS B CD2   1 
ATOM   4033  C CE1   . HIS B 1 200 ? 90.37600  145.84500 107.54200 1.000 137.00000 ? 445 HIS B CE1   1 
ATOM   4034  N NE2   . HIS B 1 200 ? 90.79000  146.74900 106.67400 1.000 137.00000 ? 445 HIS B NE2   1 
ATOM   4035  N N     . ASP B 1 201 ? 96.81200  144.83800 106.94300 1.000 136.11000 ? 446 ASP B N     1 
ATOM   4036  C CA    . ASP B 1 201 ? 98.22900  144.74700 107.22300 1.000 136.11000 ? 446 ASP B CA    1 
ATOM   4037  C C     . ASP B 1 201 ? 98.61200  145.70600 108.33800 1.000 136.11000 ? 446 ASP B C     1 
ATOM   4038  O O     . ASP B 1 201 ? 97.75600  146.28400 109.01400 1.000 136.11000 ? 446 ASP B O     1 
ATOM   4039  C CB    . ASP B 1 201 ? 99.03500  145.02900 105.96100 1.000 136.11000 ? 446 ASP B CB    1 
ATOM   4040  C CG    . ASP B 1 201 ? 98.95100  143.90800 104.96700 1.000 136.11000 ? 446 ASP B CG    1 
ATOM   4041  O OD1   . ASP B 1 201 ? 98.76800  142.75500 105.40200 1.000 136.11000 ? 446 ASP B OD1   1 
ATOM   4042  O OD2   . ASP B 1 201 ? 99.07200  144.17600 103.75500 1.000 136.11000 ? 446 ASP B OD2   1 
ATOM   4043  N N     . ILE B 1 202 ? 99.92500  145.83500 108.54400 1.000 131.99000 ? 447 ILE B N     1 
ATOM   4044  C CA    . ILE B 1 202 ? 100.48900 146.83300 109.44900 1.000 131.99000 ? 447 ILE B CA    1 
ATOM   4045  C C     . ILE B 1 202 ? 100.01100 148.22900 109.06800 1.000 131.99000 ? 447 ILE B C     1 
ATOM   4046  O O     . ILE B 1 202 ? 99.56600  149.00900 109.91700 1.000 131.99000 ? 447 ILE B O     1 
ATOM   4047  C CB    . ILE B 1 202 ? 102.02500 146.73700 109.42700 1.000 131.99000 ? 447 ILE B CB    1 
ATOM   4048  C CG1   . ILE B 1 202 ? 102.49600 145.35100 109.88600 1.000 131.99000 ? 447 ILE B CG1   1 
ATOM   4049  C CG2   . ILE B 1 202 ? 102.66100 147.85900 110.22400 1.000 131.99000 ? 447 ILE B CG2   1 
ATOM   4050  C CD1   . ILE B 1 202 ? 102.12800 145.01200 111.29600 1.000 131.99000 ? 447 ILE B CD1   1 
ATOM   4051  N N     . GLY B 1 203 ? 100.07300 148.55400 107.77700 1.000 129.31000 ? 448 GLY B N     1 
ATOM   4052  C CA    . GLY B 1 203 ? 99.45600  149.77600 107.30200 1.000 129.31000 ? 448 GLY B CA    1 
ATOM   4053  C C     . GLY B 1 203 ? 97.97200  149.63100 107.05500 1.000 129.31000 ? 448 GLY B C     1 
ATOM   4054  O O     . GLY B 1 203 ? 97.26200  150.63400 106.95100 1.000 129.31000 ? 448 GLY B O     1 
ATOM   4055  N N     . GLY B 1 204 ? 97.48700  148.40400 106.94900 1.000 129.64000 ? 449 GLY B N     1 
ATOM   4056  C CA    . GLY B 1 204 ? 96.08000  148.13900 106.76800 1.000 129.64000 ? 449 GLY B CA    1 
ATOM   4057  C C     . GLY B 1 204 ? 95.64100  147.76200 105.36500 1.000 129.64000 ? 449 GLY B C     1 
ATOM   4058  O O     . GLY B 1 204 ? 94.47600  147.98900 105.02300 1.000 129.64000 ? 449 GLY B O     1 
ATOM   4059  N N     . ARG B 1 205 ? 96.51300  147.20800 104.55900 1.000 129.21000 ? 450 ARG B N     1 
ATOM   4060  C CA    . ARG B 1 205 ? 96.13800  146.94100 103.18400 1.000 129.21000 ? 450 ARG B CA    1 
ATOM   4061  C C     . ARG B 1 205 ? 95.38600  145.61800 103.08200 1.000 129.21000 ? 450 ARG B C     1 
ATOM   4062  O O     . ARG B 1 205 ? 95.50100  144.76200 103.96000 1.000 129.21000 ? 450 ARG B O     1 
ATOM   4063  C CB    . ARG B 1 205 ? 97.38000  146.89700 102.30200 1.000 129.21000 ? 450 ARG B CB    1 
ATOM   4064  C CG    . ARG B 1 205 ? 98.17100  148.18900 102.29400 1.000 129.21000 ? 450 ARG B CG    1 
ATOM   4065  C CD    . ARG B 1 205 ? 97.37700  149.30500 101.64500 1.000 129.21000 ? 450 ARG B CD    1 
ATOM   4066  N NE    . ARG B 1 205 ? 97.03400  148.99400 100.26200 1.000 129.21000 ? 450 ARG B NE    1 
ATOM   4067  C CZ    . ARG B 1 205 ? 97.82900  149.23100 99.22500  1.000 129.21000 ? 450 ARG B CZ    1 
ATOM   4068  N NH1   . ARG B 1 205 ? 99.01900  149.78200 99.41100  1.000 129.21000 ? 450 ARG B NH1   1 
ATOM   4069  N NH2   . ARG B 1 205 ? 97.43400  148.91700 97.99900  1.000 129.21000 ? 450 ARG B NH2   1 
ATOM   4070  N N     . PRO B 1 206 ? 94.58900  145.43600 102.03400 1.000 125.73000 ? 451 PRO B N     1 
ATOM   4071  C CA    . PRO B 1 206 ? 94.05200  144.10200 101.75000 1.000 125.73000 ? 451 PRO B CA    1 
ATOM   4072  C C     . PRO B 1 206 ? 95.15700  143.14000 101.33800 1.000 125.73000 ? 451 PRO B C     1 
ATOM   4073  O O     . PRO B 1 206 ? 96.01700  143.46500 100.51700 1.000 125.73000 ? 451 PRO B O     1 
ATOM   4074  C CB    . PRO B 1 206 ? 93.07000  144.35700 100.60700 1.000 125.73000 ? 451 PRO B CB    1 
ATOM   4075  C CG    . PRO B 1 206 ? 92.68100  145.77500 100.77000 1.000 125.73000 ? 451 PRO B CG    1 
ATOM   4076  C CD    . PRO B 1 206 ? 93.90600  146.47700 101.25200 1.000 125.73000 ? 451 PRO B CD    1 
ATOM   4077  N N     . ILE B 1 207 ? 95.12100  141.94200 101.92100 1.000 124.86000 ? 452 ILE B N     1 
ATOM   4078  C CA    . ILE B 1 207 ? 96.24300  141.00900 101.87900 1.000 124.86000 ? 452 ILE B CA    1 
ATOM   4079  C C     . ILE B 1 207 ? 95.78700  139.67600 101.26700 1.000 124.86000 ? 452 ILE B C     1 
ATOM   4080  O O     . ILE B 1 207 ? 96.16300  138.58500 101.71500 1.000 124.86000 ? 452 ILE B O     1 
ATOM   4081  C CB    . ILE B 1 207 ? 96.88100  140.91300 103.28900 1.000 124.86000 ? 452 ILE B CB    1 
ATOM   4082  C CG1   . ILE B 1 207 ? 98.28300  140.28600 103.26300 1.000 124.86000 ? 452 ILE B CG1   1 
ATOM   4083  C CG2   . ILE B 1 207 ? 95.93500  140.32700 104.33600 1.000 124.86000 ? 452 ILE B CG2   1 
ATOM   4084  C CD1   . ILE B 1 207 ? 99.27600  141.09800 102.48900 1.000 124.86000 ? 452 ILE B CD1   1 
ATOM   4085  N N     . ILE B 1 208 ? 94.93600  139.75900 100.24500 1.000 130.88000 ? 453 ILE B N     1 
ATOM   4086  C CA    . ILE B 1 208 ? 94.40900  138.57300 99.56900  1.000 130.88000 ? 453 ILE B CA    1 
ATOM   4087  C C     . ILE B 1 208 ? 95.56300  137.84100 98.89000  1.000 130.88000 ? 453 ILE B C     1 
ATOM   4088  O O     . ILE B 1 208 ? 96.12600  138.32200 97.90400  1.000 130.88000 ? 453 ILE B O     1 
ATOM   4089  C CB    . ILE B 1 208 ? 93.32500  138.93000 98.54700  1.000 130.88000 ? 453 ILE B CB    1 
ATOM   4090  C CG1   . ILE B 1 208 ? 92.12000  139.59800 99.20600  1.000 130.88000 ? 453 ILE B CG1   1 
ATOM   4091  C CG2   . ILE B 1 208 ? 92.88700  137.68600 97.79500  1.000 130.88000 ? 453 ILE B CG2   1 
ATOM   4092  C CD1   . ILE B 1 208 ? 92.12400  141.10000 99.11000  1.000 130.88000 ? 453 ILE B CD1   1 
ATOM   4093  N N     . THR B 1 209 ? 95.92300  136.68600 99.42700  1.000 137.86000 ? 454 THR B N     1 
ATOM   4094  C CA    . THR B 1 209 ? 96.96800  135.84700 98.87300  1.000 137.86000 ? 454 THR B CA    1 
ATOM   4095  C C     . THR B 1 209 ? 96.33300  134.79900 97.97100  1.000 137.86000 ? 454 THR B C     1 
ATOM   4096  O O     . THR B 1 209 ? 95.14600  134.87000 97.64600  1.000 137.86000 ? 454 THR B O     1 
ATOM   4097  C CB    . THR B 1 209 ? 97.79300  135.21700 99.99100  1.000 137.86000 ? 454 THR B CB    1 
ATOM   4098  O OG1   . THR B 1 209 ? 96.95400  134.37500 100.78800 1.000 137.86000 ? 454 THR B OG1   1 
ATOM   4099  C CG2   . THR B 1 209 ? 98.37700  136.29800 100.86600 1.000 137.86000 ? 454 THR B CG2   1 
ATOM   4100  N N     . ASP B 1 210 ? 97.11800  133.80500 97.56000  1.000 143.04000 ? 455 ASP B N     1 
ATOM   4101  C CA    . ASP B 1 210 ? 96.65700  132.84500 96.55700  1.000 143.04000 ? 455 ASP B CA    1 
ATOM   4102  C C     . ASP B 1 210 ? 97.30700  131.49100 96.83400  1.000 143.04000 ? 455 ASP B C     1 
ATOM   4103  O O     . ASP B 1 210 ? 98.48000  131.28500 96.52000  1.000 143.04000 ? 455 ASP B O     1 
ATOM   4104  C CB    . ASP B 1 210 ? 96.99000  133.36300 95.16700  1.000 143.04000 ? 455 ASP B CB    1 
ATOM   4105  C CG    . ASP B 1 210 ? 96.27400  132.61300 94.06600  1.000 143.04000 ? 455 ASP B CG    1 
ATOM   4106  O OD1   . ASP B 1 210 ? 95.52000  131.66200 94.34700  1.000 143.04000 ? 455 ASP B OD1   1 
ATOM   4107  O OD2   . ASP B 1 210 ? 96.46800  132.99300 92.89600  1.000 143.04000 ? 455 ASP B OD2   1 
ATOM   4108  N N     . LEU B 1 211 ? 96.52000  130.54400 97.36100  1.000 140.21000 ? 456 LEU B N     1 
ATOM   4109  C CA    . LEU B 1 211 ? 97.06700  129.21600 97.61400  1.000 140.21000 ? 456 LEU B CA    1 
ATOM   4110  C C     . LEU B 1 211 ? 97.13500  128.37300 96.35100  1.000 140.21000 ? 456 LEU B C     1 
ATOM   4111  O O     . LEU B 1 211 ? 97.56800  127.22000 96.41100  1.000 140.21000 ? 456 LEU B O     1 
ATOM   4112  C CB    . LEU B 1 211 ? 96.28200  128.46400 98.69600  1.000 140.21000 ? 456 LEU B CB    1 
ATOM   4113  C CG    . LEU B 1 211 ? 94.97800  127.71900 98.40800  1.000 140.21000 ? 456 LEU B CG    1 
ATOM   4114  C CD1   . LEU B 1 211 ? 94.73000  126.70500 99.49600  1.000 140.21000 ? 456 LEU B CD1   1 
ATOM   4115  C CD2   . LEU B 1 211 ? 93.83200  128.65700 98.36800  1.000 140.21000 ? 456 LEU B CD2   1 
ATOM   4116  N N     . ALA B 1 212 ? 96.73300  128.91800 95.20100  1.000 139.29000 ? 457 ALA B N     1 
ATOM   4117  C CA    . ALA B 1 212 ? 97.17000  128.34200 93.93800  1.000 139.29000 ? 457 ALA B CA    1 
ATOM   4118  C C     . ALA B 1 212 ? 98.63000  128.67000 93.65300  1.000 139.29000 ? 457 ALA B C     1 
ATOM   4119  O O     . ALA B 1 212 ? 99.22200  128.08700 92.74000  1.000 139.29000 ? 457 ALA B O     1 
ATOM   4120  C CB    . ALA B 1 212 ? 96.28300  128.83400 92.79500  1.000 139.29000 ? 457 ALA B CB    1 
ATOM   4121  N N     . LYS B 1 213 ? 99.21800  129.59800 94.40900  1.000 140.97000 ? 458 LYS B N     1 
ATOM   4122  C CA    . LYS B 1 213 ? 100.63300 129.90800 94.32400  1.000 140.97000 ? 458 LYS B CA    1 
ATOM   4123  C C     . LYS B 1 213 ? 101.39200 129.70000 95.62200  1.000 140.97000 ? 458 LYS B C     1 
ATOM   4124  O O     . LYS B 1 213 ? 102.62200 129.80900 95.61300  1.000 140.97000 ? 458 LYS B O     1 
ATOM   4125  C CB    . LYS B 1 213 ? 100.83900 131.36100 93.87200  1.000 140.97000 ? 458 LYS B CB    1 
ATOM   4126  C CG    . LYS B 1 213 ? 100.51300 131.61800 92.42200  1.000 140.97000 ? 458 LYS B CG    1 
ATOM   4127  C CD    . LYS B 1 213 ? 101.52700 130.92000 91.53600  1.000 140.97000 ? 458 LYS B CD    1 
ATOM   4128  C CE    . LYS B 1 213 ? 102.90300 131.57900 91.65100  1.000 140.97000 ? 458 LYS B CE    1 
ATOM   4129  N NZ    . LYS B 1 213 ? 103.92100 130.96800 90.74700  1.000 140.97000 ? 458 LYS B NZ    1 
ATOM   4130  N N     . MET B 1 214 ? 100.71500 129.43100 96.72900  1.000 138.18000 ? 459 MET B N     1 
ATOM   4131  C CA    . MET B 1 214 ? 101.41100 129.32400 98.00500  1.000 138.18000 ? 459 MET B CA    1 
ATOM   4132  C C     . MET B 1 214 ? 102.26600 128.06200 98.10400  1.000 138.18000 ? 459 MET B C     1 
ATOM   4133  O O     . MET B 1 214 ? 103.40200 128.14700 98.57900  1.000 138.18000 ? 459 MET B O     1 
ATOM   4134  C CB    . MET B 1 214 ? 100.41500 129.42000 99.15800  1.000 138.18000 ? 459 MET B CB    1 
ATOM   4135  C CG    . MET B 1 214 ? 99.89400  130.81900 99.37200  1.000 138.18000 ? 459 MET B CG    1 
ATOM   4136  S SD    . MET B 1 214 ? 98.54100  130.87100 100.54700 1.000 138.18000 ? 459 MET B SD    1 
ATOM   4137  C CE    . MET B 1 214 ? 99.41400  130.48200 102.05000 1.000 138.18000 ? 459 MET B CE    1 
ATOM   4138  N N     . PRO B 1 215 ? 101.79100 126.87500 97.70000  1.000 141.54000 ? 460 PRO B N     1 
ATOM   4139  C CA    . PRO B 1 215 ? 100.50300 126.22600 97.47200  1.000 141.54000 ? 460 PRO B CA    1 
ATOM   4140  C C     . PRO B 1 215 ? 100.31000 125.11500 98.48000  1.000 141.54000 ? 460 PRO B C     1 
ATOM   4141  O O     . PRO B 1 215 ? 99.57800  124.16700 98.24100  1.000 141.54000 ? 460 PRO B O     1 
ATOM   4142  C CB    . PRO B 1 215 ? 100.64100 125.67200 96.07200  1.000 141.54000 ? 460 PRO B CB    1 
ATOM   4143  C CG    . PRO B 1 215 ? 102.03300 125.28800 96.02200  1.000 141.54000 ? 460 PRO B CG    1 
ATOM   4144  C CD    . PRO B 1 215 ? 102.81500 126.27500 96.83500  1.000 141.54000 ? 460 PRO B CD    1 
ATOM   4145  N N     . HIS B 1 216 ? 101.02200 125.21800 99.58900  1.000 146.96000 ? 461 HIS B N     1 
ATOM   4146  C CA    . HIS B 1 216 ? 100.81000 124.36600 100.75200 1.000 146.96000 ? 461 HIS B CA    1 
ATOM   4147  C C     . HIS B 1 216 ? 100.91600 125.27200 101.96700 1.000 146.96000 ? 461 HIS B C     1 
ATOM   4148  O O     . HIS B 1 216 ? 101.67400 126.24300 101.96800 1.000 146.96000 ? 461 HIS B O     1 
ATOM   4149  C CB    . HIS B 1 216 ? 101.80100 123.22700 100.80700 1.000 146.96000 ? 461 HIS B CB    1 
ATOM   4150  C CG    . HIS B 1 216 ? 101.60400 122.20300 99.73600  1.000 146.96000 ? 461 HIS B CG    1 
ATOM   4151  N ND1   . HIS B 1 216 ? 100.57100 121.29200 99.76200  1.000 146.96000 ? 461 HIS B ND1   1 
ATOM   4152  C CD2   . HIS B 1 216 ? 102.31600 121.93000 98.61900  1.000 146.96000 ? 461 HIS B CD2   1 
ATOM   4153  C CE1   . HIS B 1 216 ? 100.64900 120.50800 98.70300  1.000 146.96000 ? 461 HIS B CE1   1 
ATOM   4154  N NE2   . HIS B 1 216 ? 101.70000 120.87200 97.99500  1.000 146.96000 ? 461 HIS B NE2   1 
ATOM   4155  N N     . LEU B 1 217 ? 100.15600 124.94800 103.00700 1.000 140.62000 ? 462 LEU B N     1 
ATOM   4156  C CA    . LEU B 1 217 ? 100.03100 125.83400 104.15700 1.000 140.62000 ? 462 LEU B CA    1 
ATOM   4157  C C     . LEU B 1 217 ? 99.99400  125.01600 105.44000 1.000 140.62000 ? 462 LEU B C     1 
ATOM   4158  O O     . LEU B 1 217 ? 99.41800  123.92800 105.47900 1.000 140.62000 ? 462 LEU B O     1 
ATOM   4159  C CB    . LEU B 1 217 ? 98.78700  126.69900 104.00300 1.000 140.62000 ? 462 LEU B CB    1 
ATOM   4160  C CG    . LEU B 1 217 ? 98.53700  127.73700 105.08200 1.000 140.62000 ? 462 LEU B CG    1 
ATOM   4161  C CD1   . LEU B 1 217 ? 99.75500  128.61400 105.22100 1.000 140.62000 ? 462 LEU B CD1   1 
ATOM   4162  C CD2   . LEU B 1 217 ? 97.36100  128.55900 104.66600 1.000 140.62000 ? 462 LEU B CD2   1 
ATOM   4163  N N     . LEU B 1 218 ? 100.61600 125.53300 106.48600 1.000 141.07000 ? 463 LEU B N     1 
ATOM   4164  C CA    . LEU B 1 218 ? 100.67800 124.86600 107.77400 1.000 141.07000 ? 463 LEU B CA    1 
ATOM   4165  C C     . LEU B 1 218 ? 100.28100 125.86600 108.84900 1.000 141.07000 ? 463 LEU B C     1 
ATOM   4166  O O     . LEU B 1 218 ? 100.73600 127.01000 108.81700 1.000 141.07000 ? 463 LEU B O     1 
ATOM   4167  C CB    . LEU B 1 218 ? 102.09100 124.34500 108.00700 1.000 141.07000 ? 463 LEU B CB    1 
ATOM   4168  C CG    . LEU B 1 218 ? 102.42300 123.49400 109.22300 1.000 141.07000 ? 463 LEU B CG    1 
ATOM   4169  C CD1   . LEU B 1 218 ? 101.75900 122.14800 109.15500 1.000 141.07000 ? 463 LEU B CD1   1 
ATOM   4170  C CD2   . LEU B 1 218 ? 103.92600 123.36000 109.34300 1.000 141.07000 ? 463 LEU B CD2   1 
ATOM   4171  N N     . VAL B 1 219 ? 99.42500  125.44900 109.78400 1.000 141.37000 ? 464 VAL B N     1 
ATOM   4172  C CA    . VAL B 1 219 ? 98.96500  126.31000 110.87000 1.000 141.37000 ? 464 VAL B CA    1 
ATOM   4173  C C     . VAL B 1 219 ? 99.39400  125.69200 112.19400 1.000 141.37000 ? 464 VAL B C     1 
ATOM   4174  O O     . VAL B 1 219 ? 99.23000  124.48700 112.40700 1.000 141.37000 ? 464 VAL B O     1 
ATOM   4175  C CB    . VAL B 1 219 ? 97.43300  126.50700 110.85600 1.000 141.37000 ? 464 VAL B CB    1 
ATOM   4176  C CG1   . VAL B 1 219 ? 96.99900  127.52000 111.90100 1.000 141.37000 ? 464 VAL B CG1   1 
ATOM   4177  C CG2   . VAL B 1 219 ? 96.91900  126.88500 109.48900 1.000 141.37000 ? 464 VAL B CG2   1 
ATOM   4178  N N     . ALA B 1 220 ? 99.92800  126.51600 113.08800 1.000 139.27000 ? 465 ALA B N     1 
ATOM   4179  C CA    . ALA B 1 220 ? 100.27500 126.05400 114.42400 1.000 139.27000 ? 465 ALA B CA    1 
ATOM   4180  C C     . ALA B 1 220 ? 99.04500  126.13300 115.32000 1.000 139.27000 ? 465 ALA B C     1 
ATOM   4181  O O     . ALA B 1 220 ? 97.91900  126.32200 114.85500 1.000 139.27000 ? 465 ALA B O     1 
ATOM   4182  C CB    . ALA B 1 220 ? 101.43500 126.86400 114.99000 1.000 139.27000 ? 465 ALA B CB    1 
ATOM   4183  N N     . GLY B 1 221 ? 99.24600  126.00200 116.62700 1.000 144.90000 ? 466 GLY B N     1 
ATOM   4184  C CA    . GLY B 1 221 ? 98.12100  125.97700 117.53800 1.000 144.90000 ? 466 GLY B CA    1 
ATOM   4185  C C     . GLY B 1 221 ? 98.17400  126.94100 118.70200 1.000 144.90000 ? 466 GLY B C     1 
ATOM   4186  O O     . GLY B 1 221 ? 99.13500  126.95900 119.47600 1.000 144.90000 ? 466 GLY B O     1 
ATOM   4187  N N     . THR B 1 222 ? 97.12200  127.74400 118.82800 1.000 139.28000 ? 467 THR B N     1 
ATOM   4188  C CA    . THR B 1 222 ? 96.92100  128.63700 119.95700 1.000 139.28000 ? 467 THR B CA    1 
ATOM   4189  C C     . THR B 1 222 ? 95.45100  128.62200 120.33300 1.000 139.28000 ? 467 THR B C     1 
ATOM   4190  O O     . THR B 1 222 ? 94.59300  128.91000 119.49300 1.000 139.28000 ? 467 THR B O     1 
ATOM   4191  C CB    . THR B 1 222 ? 97.34400  130.05700 119.63100 1.000 139.28000 ? 467 THR B CB    1 
ATOM   4192  O OG1   . THR B 1 222 ? 98.74300  130.08800 119.32800 1.000 139.28000 ? 467 THR B OG1   1 
ATOM   4193  C CG2   . THR B 1 222 ? 97.06100  130.94900 120.80200 1.000 139.28000 ? 467 THR B CG2   1 
ATOM   4194  N N     . THR B 1 223 ? 95.17200  128.31200 121.60000 1.000 138.96000 ? 468 THR B N     1 
ATOM   4195  C CA    . THR B 1 223 ? 93.80900  128.07800 122.05600 1.000 138.96000 ? 468 THR B CA    1 
ATOM   4196  C C     . THR B 1 223 ? 92.92200  129.31400 121.97300 1.000 138.96000 ? 468 THR B C     1 
ATOM   4197  O O     . THR B 1 223 ? 91.70300  129.17500 121.84000 1.000 138.96000 ? 468 THR B O     1 
ATOM   4198  C CB    . THR B 1 223 ? 93.84000  127.56300 123.49200 1.000 138.96000 ? 468 THR B CB    1 
ATOM   4199  O OG1   . THR B 1 223 ? 94.47800  128.53500 124.32400 1.000 138.96000 ? 468 THR B OG1   1 
ATOM   4200  C CG2   . THR B 1 223 ? 94.62000  126.27000 123.57400 1.000 138.96000 ? 468 THR B CG2   1 
ATOM   4201  N N     . GLY B 1 224 ? 93.49500  130.51200 122.02400 1.000 135.73000 ? 469 GLY B N     1 
ATOM   4202  C CA    . GLY B 1 224 ? 92.68300  131.71100 122.05500 1.000 135.73000 ? 469 GLY B CA    1 
ATOM   4203  C C     . GLY B 1 224 ? 93.05400  132.74200 121.01300 1.000 135.73000 ? 469 GLY B C     1 
ATOM   4204  O O     . GLY B 1 224 ? 93.01600  133.94500 121.28200 1.000 135.73000 ? 469 GLY B O     1 
ATOM   4205  N N     . SER B 1 225 ? 93.41200  132.28900 119.81500 1.000 137.15000 ? 470 SER B N     1 
ATOM   4206  C CA    . SER B 1 225 ? 93.80200  133.19100 118.74400 1.000 137.15000 ? 470 SER B CA    1 
ATOM   4207  C C     . SER B 1 225 ? 92.90400  133.11200 117.52700 1.000 137.15000 ? 470 SER B C     1 
ATOM   4208  O O     . SER B 1 225 ? 92.89200  134.05000 116.72200 1.000 137.15000 ? 470 SER B O     1 
ATOM   4209  C CB    . SER B 1 225 ? 95.22700  132.89800 118.29200 1.000 137.15000 ? 470 SER B CB    1 
ATOM   4210  O OG    . SER B 1 225 ? 95.24400  131.64000 117.64700 1.000 137.15000 ? 470 SER B OG    1 
ATOM   4211  N N     . GLY B 1 226 ? 92.17800  132.01800 117.35100 1.000 134.28000 ? 471 GLY B N     1 
ATOM   4212  C CA    . GLY B 1 226 ? 91.35100  131.87300 116.17900 1.000 134.28000 ? 471 GLY B CA    1 
ATOM   4213  C C     . GLY B 1 226 ? 91.96800  130.97800 115.13800 1.000 134.28000 ? 471 GLY B C     1 
ATOM   4214  O O     . GLY B 1 226 ? 91.89300  131.25800 113.93900 1.000 134.28000 ? 471 GLY B O     1 
ATOM   4215  N N     . LYS B 1 227 ? 92.61200  129.91200 115.60900 1.000 133.60000 ? 472 LYS B N     1 
ATOM   4216  C CA    . LYS B 1 227 ? 93.00000  128.81900 114.72800 1.000 133.60000 ? 472 LYS B CA    1 
ATOM   4217  C C     . LYS B 1 227 ? 91.78600  128.24300 114.02000 1.000 133.60000 ? 472 LYS B C     1 
ATOM   4218  O O     . LYS B 1 227 ? 91.84300  127.93300 112.82800 1.000 133.60000 ? 472 LYS B O     1 
ATOM   4219  C CB    . LYS B 1 227 ? 93.70700  127.74500 115.54300 1.000 133.60000 ? 472 LYS B CB    1 
ATOM   4220  C CG    . LYS B 1 227 ? 94.08800  126.51200 114.78400 1.000 133.60000 ? 472 LYS B CG    1 
ATOM   4221  C CD    . LYS B 1 227 ? 94.84400  125.58900 115.70200 1.000 133.60000 ? 472 LYS B CD    1 
ATOM   4222  C CE    . LYS B 1 227 ? 93.93600  124.96600 116.74500 1.000 133.60000 ? 472 LYS B CE    1 
ATOM   4223  N NZ    . LYS B 1 227 ? 94.66900  123.98700 117.58800 1.000 133.60000 ? 472 LYS B NZ    1 
ATOM   4224  N N     . SER B 1 228 ? 90.66900  128.11900 114.73500 1.000 129.71000 ? 473 SER B N     1 
ATOM   4225  C CA    . SER B 1 228 ? 89.41600  127.76900 114.08300 1.000 129.71000 ? 473 SER B CA    1 
ATOM   4226  C C     . SER B 1 228 ? 88.91900  128.91100 113.20400 1.000 129.71000 ? 473 SER B C     1 
ATOM   4227  O O     . SER B 1 228 ? 88.42400  128.67900 112.09300 1.000 129.71000 ? 473 SER B O     1 
ATOM   4228  C CB    . SER B 1 228 ? 88.37000  127.40800 115.13500 1.000 129.71000 ? 473 SER B CB    1 
ATOM   4229  O OG    . SER B 1 228 ? 88.78000  126.28500 115.89200 1.000 129.71000 ? 473 SER B OG    1 
ATOM   4230  N N     . VAL B 1 229 ? 89.06500  130.15000 113.68300 1.000 131.05000 ? 474 VAL B N     1 
ATOM   4231  C CA    . VAL B 1 229 ? 88.53700  131.30900 112.97000 1.000 131.05000 ? 474 VAL B CA    1 
ATOM   4232  C C     . VAL B 1 229 ? 89.30200  131.53200 111.67600 1.000 131.05000 ? 474 VAL B C     1 
ATOM   4233  O O     . VAL B 1 229 ? 88.71300  131.86100 110.64400 1.000 131.05000 ? 474 VAL B O     1 
ATOM   4234  C CB    . VAL B 1 229 ? 88.58000  132.54700 113.88300 1.000 131.05000 ? 474 VAL B CB    1 
ATOM   4235  C CG1   . VAL B 1 229 ? 88.10100  133.79100 113.16400 1.000 131.05000 ? 474 VAL B CG1   1 
ATOM   4236  C CG2   . VAL B 1 229 ? 87.75300  132.30500 115.12800 1.000 131.05000 ? 474 VAL B CG2   1 
ATOM   4237  N N     . GLY B 1 230 ? 90.61500  131.31100 111.69800 1.000 132.21000 ? 475 GLY B N     1 
ATOM   4238  C CA    . GLY B 1 230 ? 91.39600  131.44900 110.48100 1.000 132.21000 ? 475 GLY B CA    1 
ATOM   4239  C C     . GLY B 1 230 ? 91.07800  130.37600 109.45900 1.000 132.21000 ? 475 GLY B C     1 
ATOM   4240  O O     . GLY B 1 230 ? 91.05600  130.64700 108.25500 1.000 132.21000 ? 475 GLY B O     1 
ATOM   4241  N N     . VAL B 1 231 ? 90.79900  129.15600 109.92600 1.000 128.32000 ? 476 VAL B N     1 
ATOM   4242  C CA    . VAL B 1 231 ? 90.37700  128.08500 109.02900 1.000 128.32000 ? 476 VAL B CA    1 
ATOM   4243  C C     . VAL B 1 231 ? 89.04700  128.42100 108.38400 1.000 128.32000 ? 476 VAL B C     1 
ATOM   4244  O O     . VAL B 1 231 ? 88.89100  128.30300 107.16400 1.000 128.32000 ? 476 VAL B O     1 
ATOM   4245  C CB    . VAL B 1 231 ? 90.32100  126.74700 109.78200 1.000 128.32000 ? 476 VAL B CB    1 
ATOM   4246  C CG1   . VAL B 1 231 ? 89.58800  125.70600 108.96800 1.000 128.32000 ? 476 VAL B CG1   1 
ATOM   4247  C CG2   . VAL B 1 231 ? 91.71800  126.26100 110.03900 1.000 128.32000 ? 476 VAL B CG2   1 
ATOM   4248  N N     . ASN B 1 232 ? 88.08500  128.88800 109.17600 1.000 134.36000 ? 477 ASN B N     1 
ATOM   4249  C CA    . ASN B 1 232 ? 86.79400  129.23300 108.59500 1.000 134.36000 ? 477 ASN B CA    1 
ATOM   4250  C C     . ASN B 1 232 ? 86.88300  130.47700 107.71500 1.000 134.36000 ? 477 ASN B C     1 
ATOM   4251  O O     . ASN B 1 232 ? 86.13700  130.59200 106.73800 1.000 134.36000 ? 477 ASN B O     1 
ATOM   4252  C CB    . ASN B 1 232 ? 85.75500  129.40000 109.69900 1.000 134.36000 ? 477 ASN B CB    1 
ATOM   4253  C CG    . ASN B 1 232 ? 85.44600  128.08500 110.40500 1.000 134.36000 ? 477 ASN B CG    1 
ATOM   4254  O OD1   . ASN B 1 232 ? 85.68000  127.93400 111.60200 1.000 134.36000 ? 477 ASN B OD1   1 
ATOM   4255  N ND2   . ASN B 1 232 ? 84.92200  127.12300 109.65500 1.000 134.36000 ? 477 ASN B ND2   1 
ATOM   4256  N N     . ALA B 1 233 ? 87.82800  131.37400 108.00100 1.000 130.51000 ? 478 ALA B N     1 
ATOM   4257  C CA    . ALA B 1 233 ? 88.05500  132.52300 107.13300 1.000 130.51000 ? 478 ALA B CA    1 
ATOM   4258  C C     . ALA B 1 233 ? 88.60200  132.08900 105.78700 1.000 130.51000 ? 478 ALA B C     1 
ATOM   4259  O O     . ALA B 1 233 ? 88.13800  132.55500 104.74100 1.000 130.51000 ? 478 ALA B O     1 
ATOM   4260  C CB    . ALA B 1 233 ? 89.02100  133.49800 107.79800 1.000 130.51000 ? 478 ALA B CB    1 
ATOM   4261  N N     . MET B 1 234 ? 89.57300  131.17700 105.80300 1.000 128.13000 ? 479 MET B N     1 
ATOM   4262  C CA    . MET B 1 234 ? 90.10800  130.62600 104.56600 1.000 128.13000 ? 479 MET B CA    1 
ATOM   4263  C C     . MET B 1 234 ? 89.04400  129.86400 103.79500 1.000 128.13000 ? 479 MET B C     1 
ATOM   4264  O O     . MET B 1 234 ? 88.97800  129.94900 102.56500 1.000 128.13000 ? 479 MET B O     1 
ATOM   4265  C CB    . MET B 1 234 ? 91.29700  129.72200 104.87300 1.000 128.13000 ? 479 MET B CB    1 
ATOM   4266  C CG    . MET B 1 234 ? 92.53200  130.47200 105.30200 1.000 128.13000 ? 479 MET B CG    1 
ATOM   4267  S SD    . MET B 1 234 ? 93.92000  129.37000 105.53500 1.000 128.13000 ? 479 MET B SD    1 
ATOM   4268  C CE    . MET B 1 234 ? 93.49700  128.64300 107.10600 1.000 128.13000 ? 479 MET B CE    1 
ATOM   4269  N N     . LEU B 1 235 ? 88.17000  129.15900 104.50200 1.000 135.95000 ? 480 LEU B N     1 
ATOM   4270  C CA    . LEU B 1 235 ? 87.18100  128.35200 103.80500 1.000 135.95000 ? 480 LEU B CA    1 
ATOM   4271  C C     . LEU B 1 235 ? 86.08900  129.21500 103.19100 1.000 135.95000 ? 480 LEU B C     1 
ATOM   4272  O O     . LEU B 1 235 ? 85.66500  128.96000 102.06100 1.000 135.95000 ? 480 LEU B O     1 
ATOM   4273  C CB    . LEU B 1 235 ? 86.60300  127.29400 104.73800 1.000 135.95000 ? 480 LEU B CB    1 
ATOM   4274  C CG    . LEU B 1 235 ? 87.28700  125.92400 104.62500 1.000 135.95000 ? 480 LEU B CG    1 
ATOM   4275  C CD1   . LEU B 1 235 ? 87.06700  125.38100 103.22700 1.000 135.95000 ? 480 LEU B CD1   1 
ATOM   4276  C CD2   . LEU B 1 235 ? 88.77400  125.91900 104.95000 1.000 135.95000 ? 480 LEU B CD2   1 
ATOM   4277  N N     . LEU B 1 236 ? 85.65200  130.26500 103.88800 1.000 136.89000 ? 481 LEU B N     1 
ATOM   4278  C CA    . LEU B 1 236 ? 84.73800  131.20600 103.25000 1.000 136.89000 ? 481 LEU B CA    1 
ATOM   4279  C C     . LEU B 1 236 ? 85.41300  131.98100 102.13000 1.000 136.89000 ? 481 LEU B C     1 
ATOM   4280  O O     . LEU B 1 236 ? 84.73600  132.40100 101.18500 1.000 136.89000 ? 481 LEU B O     1 
ATOM   4281  C CB    . LEU B 1 236 ? 84.14700  132.17500 104.26500 1.000 136.89000 ? 481 LEU B CB    1 
ATOM   4282  C CG    . LEU B 1 236 ? 82.81800  131.78000 104.90000 1.000 136.89000 ? 481 LEU B CG    1 
ATOM   4283  C CD1   . LEU B 1 236 ? 82.94600  130.64000 105.89700 1.000 136.89000 ? 481 LEU B CD1   1 
ATOM   4284  C CD2   . LEU B 1 236 ? 82.21000  133.00000 105.55100 1.000 136.89000 ? 481 LEU B CD2   1 
ATOM   4285  N N     . SER B 1 237 ? 86.73200  132.17800 102.21400 1.000 134.01000 ? 482 SER B N     1 
ATOM   4286  C CA    . SER B 1 237 ? 87.45500  132.77700 101.10100 1.000 134.01000 ? 482 SER B CA    1 
ATOM   4287  C C     . SER B 1 237 ? 87.42000  131.86900 99.88600  1.000 134.01000 ? 482 SER B C     1 
ATOM   4288  O O     . SER B 1 237 ? 87.31600  132.34500 98.75100  1.000 134.01000 ? 482 SER B O     1 
ATOM   4289  C CB    . SER B 1 237 ? 88.89800  133.06200 101.50400 1.000 134.01000 ? 482 SER B CB    1 
ATOM   4290  O OG    . SER B 1 237 ? 88.95800  133.99500 102.56600 1.000 134.01000 ? 482 SER B OG    1 
ATOM   4291  N N     . ILE B 1 238 ? 87.50600  130.56000 100.11600 1.000 135.19000 ? 483 ILE B N     1 
ATOM   4292  C CA    . ILE B 1 238 ? 87.34800  129.59600 99.03200  1.000 135.19000 ? 483 ILE B CA    1 
ATOM   4293  C C     . ILE B 1 238 ? 85.93700  129.65700 98.46700  1.000 135.19000 ? 483 ILE B C     1 
ATOM   4294  O O     . ILE B 1 238 ? 85.74100  129.65800 97.24500  1.000 135.19000 ? 483 ILE B O     1 
ATOM   4295  C CB    . ILE B 1 238 ? 87.69600  128.18100 99.52500  1.000 135.19000 ? 483 ILE B CB    1 
ATOM   4296  C CG1   . ILE B 1 238 ? 89.15800  128.10100 99.94200  1.000 135.19000 ? 483 ILE B CG1   1 
ATOM   4297  C CG2   . ILE B 1 238 ? 87.42000  127.15400 98.45600  1.000 135.19000 ? 483 ILE B CG2   1 
ATOM   4298  C CD1   . ILE B 1 238 ? 90.11400  128.38600 98.83200  1.000 135.19000 ? 483 ILE B CD1   1 
ATOM   4299  N N     . LEU B 1 239 ? 84.93800  129.75900 99.34500  1.000 139.06000 ? 484 LEU B N     1 
ATOM   4300  C CA    . LEU B 1 239 ? 83.55800  129.55500 98.91900  1.000 139.06000 ? 484 LEU B CA    1 
ATOM   4301  C C     . LEU B 1 239 ? 83.03600  130.71200 98.08100  1.000 139.06000 ? 484 LEU B C     1 
ATOM   4302  O O     . LEU B 1 239 ? 82.32700  130.49000 97.09500  1.000 139.06000 ? 484 LEU B O     1 
ATOM   4303  C CB    . LEU B 1 239 ? 82.66500  129.32100 100.13300 1.000 139.06000 ? 484 LEU B CB    1 
ATOM   4304  C CG    . LEU B 1 239 ? 82.89500  127.94900 100.76300 1.000 139.06000 ? 484 LEU B CG    1 
ATOM   4305  C CD1   . LEU B 1 239 ? 82.17800  127.82000 102.08300 1.000 139.06000 ? 484 LEU B CD1   1 
ATOM   4306  C CD2   . LEU B 1 239 ? 82.47700  126.84700 99.81400  1.000 139.06000 ? 484 LEU B CD2   1 
ATOM   4307  N N     . PHE B 1 240 ? 83.39100  131.94100 98.41800  1.000 142.43000 ? 485 PHE B N     1 
ATOM   4308  C CA    . PHE B 1 240 ? 82.80500  133.06100 97.69400  1.000 142.43000 ? 485 PHE B CA    1 
ATOM   4309  C C     . PHE B 1 240 ? 83.46700  133.35800 96.36200  1.000 142.43000 ? 485 PHE B C     1 
ATOM   4310  O O     . PHE B 1 240 ? 83.12600  134.37400 95.75000  1.000 142.43000 ? 485 PHE B O     1 
ATOM   4311  C CB    . PHE B 1 240 ? 82.82900  134.32500 98.54400  1.000 142.43000 ? 485 PHE B CB    1 
ATOM   4312  C CG    . PHE B 1 240 ? 81.75000  134.38300 99.56000  1.000 142.43000 ? 485 PHE B CG    1 
ATOM   4313  C CD1   . PHE B 1 240 ? 80.68400  133.50400 99.51200  1.000 142.43000 ? 485 PHE B CD1   1 
ATOM   4314  C CD2   . PHE B 1 240 ? 81.78500  135.33800 100.55100 1.000 142.43000 ? 485 PHE B CD2   1 
ATOM   4315  C CE1   . PHE B 1 240 ? 79.68400  133.56700 100.44900 1.000 142.43000 ? 485 PHE B CE1   1 
ATOM   4316  C CE2   . PHE B 1 240 ? 80.79000  135.41000 101.49100 1.000 142.43000 ? 485 PHE B CE2   1 
ATOM   4317  C CZ    . PHE B 1 240 ? 79.73400  134.52400 101.44000 1.000 142.43000 ? 485 PHE B CZ    1 
ATOM   4318  N N     . LYS B 1 241 ? 84.39600  132.53900 95.88600  1.000 140.64000 ? 486 LYS B N     1 
ATOM   4319  C CA    . LYS B 1 241 ? 85.03400  132.83900 94.61500  1.000 140.64000 ? 486 LYS B CA    1 
ATOM   4320  C C     . LYS B 1 241 ? 85.19500  131.55600 93.80500  1.000 140.64000 ? 486 LYS B C     1 
ATOM   4321  O O     . LYS B 1 241 ? 86.25900  131.25000 93.26700  1.000 140.64000 ? 486 LYS B O     1 
ATOM   4322  C CB    . LYS B 1 241 ? 86.35100  133.57600 94.86000  1.000 140.64000 ? 486 LYS B CB    1 
ATOM   4323  C CG    . LYS B 1 241 ? 86.88100  134.35100 93.66600  1.000 140.64000 ? 486 LYS B CG    1 
ATOM   4324  C CD    . LYS B 1 241 ? 85.88900  135.41400 93.23500  1.000 140.64000 ? 486 LYS B CD    1 
ATOM   4325  C CE    . LYS B 1 241 ? 85.69500  136.45100 94.32300  1.000 140.64000 ? 486 LYS B CE    1 
ATOM   4326  N NZ    . LYS B 1 241 ? 86.93800  137.22500 94.56300  1.000 140.64000 ? 486 LYS B NZ    1 
ATOM   4327  N N     . SER B 1 242 ? 84.12900  130.76700 93.72700  1.000 147.49000 ? 487 SER B N     1 
ATOM   4328  C CA    . SER B 1 242 ? 84.14900  129.57100 92.90100  1.000 147.49000 ? 487 SER B CA    1 
ATOM   4329  C C     . SER B 1 242 ? 82.74800  129.25500 92.40600  1.000 147.49000 ? 487 SER B C     1 
ATOM   4330  O O     . SER B 1 242 ? 81.77200  129.93200 92.73900  1.000 147.49000 ? 487 SER B O     1 
ATOM   4331  C CB    . SER B 1 242 ? 84.70600  128.36600 93.65700  1.000 147.49000 ? 487 SER B CB    1 
ATOM   4332  O OG    . SER B 1 242 ? 84.57700  127.20000 92.86300  1.000 147.49000 ? 487 SER B OG    1 
ATOM   4333  N N     . THR B 1 243 ? 82.67100  128.21000 91.59800  1.000 150.49000 ? 488 THR B N     1 
ATOM   4334  C CA    . THR B 1 243 ? 81.45000  127.55000 91.17100  1.000 150.49000 ? 488 THR B CA    1 
ATOM   4335  C C     . THR B 1 243 ? 81.64400  126.09500 91.57600  1.000 150.49000 ? 488 THR B C     1 
ATOM   4336  O O     . THR B 1 243 ? 82.77100  125.69500 91.89400  1.000 150.49000 ? 488 THR B O     1 
ATOM   4337  C CB    . THR B 1 243 ? 81.24000  127.72800 89.65200  1.000 150.49000 ? 488 THR B CB    1 
ATOM   4338  O OG1   . THR B 1 243 ? 79.85400  127.59600 89.32200  1.000 150.49000 ? 488 THR B OG1   1 
ATOM   4339  C CG2   . THR B 1 243 ? 82.00500  126.69400 88.85600  1.000 150.49000 ? 488 THR B CG2   1 
ATOM   4340  N N     . PRO B 1 244 ? 80.56300  125.30100 91.68000  1.000 151.51000 ? 489 PRO B N     1 
ATOM   4341  C CA    . PRO B 1 244 ? 80.73700  123.89300 92.09000  1.000 151.51000 ? 489 PRO B CA    1 
ATOM   4342  C C     . PRO B 1 244 ? 81.61200  123.06100 91.17300  1.000 151.51000 ? 489 PRO B C     1 
ATOM   4343  O O     . PRO B 1 244 ? 82.34600  122.19500 91.66100  1.000 151.51000 ? 489 PRO B O     1 
ATOM   4344  C CB    . PRO B 1 244 ? 79.30000  123.36200 92.12000  1.000 151.51000 ? 489 PRO B CB    1 
ATOM   4345  C CG    . PRO B 1 244 ? 78.49800  124.53400 92.46900  1.000 151.51000 ? 489 PRO B CG    1 
ATOM   4346  C CD    . PRO B 1 244 ? 79.14600  125.70000 91.79100  1.000 151.51000 ? 489 PRO B CD    1 
ATOM   4347  N N     . SER B 1 245 ? 81.60700  123.32000 89.87300  1.000 148.24000 ? 490 SER B N     1 
ATOM   4348  C CA    . SER B 1 245 ? 82.49200  122.58100 88.98300  1.000 148.24000 ? 490 SER B CA    1 
ATOM   4349  C C     . SER B 1 245 ? 83.91700  123.12800 88.96400  1.000 148.24000 ? 490 SER B C     1 
ATOM   4350  O O     . SER B 1 245 ? 84.72300  122.67600 88.14300  1.000 148.24000 ? 490 SER B O     1 
ATOM   4351  C CB    . SER B 1 245 ? 81.90800  122.56300 87.56800  1.000 148.24000 ? 490 SER B CB    1 
ATOM   4352  O OG    . SER B 1 245 ? 81.82100  123.86900 87.03100  1.000 148.24000 ? 490 SER B OG    1 
ATOM   4353  N N     . GLU B 1 246 ? 84.25500  124.06300 89.85100  1.000 147.70000 ? 491 GLU B N     1 
ATOM   4354  C CA    . GLU B 1 246 ? 85.57900  124.66800 89.90600  1.000 147.70000 ? 491 GLU B CA    1 
ATOM   4355  C C     . GLU B 1 246 ? 86.37700  124.28400 91.14100  1.000 147.70000 ? 491 GLU B C     1 
ATOM   4356  O O     . GLU B 1 246 ? 87.57600  124.01100 91.03400  1.000 147.70000 ? 491 GLU B O     1 
ATOM   4357  C CB    . GLU B 1 246 ? 85.46000  126.19300 89.84100  1.000 147.70000 ? 491 GLU B CB    1 
ATOM   4358  C CG    . GLU B 1 246 ? 86.77600  126.92000 89.85400  1.000 147.70000 ? 491 GLU B CG    1 
ATOM   4359  C CD    . GLU B 1 246 ? 87.59900  126.66600 88.61200  1.000 147.70000 ? 491 GLU B CD    1 
ATOM   4360  O OE1   . GLU B 1 246 ? 87.00700  126.46700 87.53100  1.000 147.70000 ? 491 GLU B OE1   1 
ATOM   4361  O OE2   . GLU B 1 246 ? 88.84100  126.64000 88.71900  1.000 147.70000 ? 491 GLU B OE2   1 
ATOM   4362  N N     . ALA B 1 247 ? 85.75700  124.25900 92.31500  1.000 150.36000 ? 492 ALA B N     1 
ATOM   4363  C CA    . ALA B 1 247 ? 86.46400  123.92100 93.53700  1.000 150.36000 ? 492 ALA B CA    1 
ATOM   4364  C C     . ALA B 1 247 ? 85.93700  122.62300 94.12300  1.000 150.36000 ? 492 ALA B C     1 
ATOM   4365  O O     . ALA B 1 247 ? 84.75000  122.30400 94.01700  1.000 150.36000 ? 492 ALA B O     1 
ATOM   4366  C CB    . ALA B 1 247 ? 86.33800  125.02900 94.58100  1.000 150.36000 ? 492 ALA B CB    1 
ATOM   4367  N N     . ARG B 1 248 ? 86.84600  121.87600 94.73800  1.000 154.99000 ? 493 ARG B N     1 
ATOM   4368  C CA    . ARG B 1 248 ? 86.50700  120.69100 95.50200  1.000 154.99000 ? 493 ARG B CA    1 
ATOM   4369  C C     . ARG B 1 248 ? 87.28400  120.73800 96.80500  1.000 154.99000 ? 493 ARG B C     1 
ATOM   4370  O O     . ARG B 1 248 ? 88.40100  121.26100 96.85300  1.000 154.99000 ? 493 ARG B O     1 
ATOM   4371  C CB    . ARG B 1 248 ? 86.85100  119.39900 94.75900  1.000 154.99000 ? 493 ARG B CB    1 
ATOM   4372  C CG    . ARG B 1 248 ? 86.11200  119.13500 93.45900  1.000 154.99000 ? 493 ARG B CG    1 
ATOM   4373  C CD    . ARG B 1 248 ? 84.65900  118.81700 93.68800  1.000 154.99000 ? 493 ARG B CD    1 
ATOM   4374  N NE    . ARG B 1 248 ? 83.80000  119.97400 93.49700  1.000 154.99000 ? 493 ARG B NE    1 
ATOM   4375  C CZ    . ARG B 1 248 ? 82.53900  120.02800 93.90500  1.000 154.99000 ? 493 ARG B CZ    1 
ATOM   4376  N NH1   . ARG B 1 248 ? 81.99900  119.00400 94.54800  1.000 154.99000 ? 493 ARG B NH1   1 
ATOM   4377  N NH2   . ARG B 1 248 ? 81.82000  121.11000 93.67200  1.000 154.99000 ? 493 ARG B NH2   1 
ATOM   4378  N N     . LEU B 1 249 ? 86.69800  120.18500 97.86200  1.000 149.44000 ? 494 LEU B N     1 
ATOM   4379  C CA    . LEU B 1 249 ? 87.39600  120.16900 99.13600  1.000 149.44000 ? 494 LEU B CA    1 
ATOM   4380  C C     . LEU B 1 249 ? 87.14300  118.85300 99.84700  1.000 149.44000 ? 494 LEU B C     1 
ATOM   4381  O O     . LEU B 1 249 ? 86.20700  118.11700 99.53100  1.000 149.44000 ? 494 LEU B O     1 
ATOM   4382  C CB    . LEU B 1 249 ? 86.98300  121.32500 100.04900 1.000 149.44000 ? 494 LEU B CB    1 
ATOM   4383  C CG    . LEU B 1 249 ? 85.66800  121.21600 100.80400 1.000 149.44000 ? 494 LEU B CG    1 
ATOM   4384  C CD1   . LEU B 1 249 ? 85.73800  122.09200 102.01700 1.000 149.44000 ? 494 LEU B CD1   1 
ATOM   4385  C CD2   . LEU B 1 249 ? 84.53900  121.68300 99.95100  1.000 149.44000 ? 494 LEU B CD2   1 
ATOM   4386  N N     . ILE B 1 250 ? 87.99900  118.58100 100.82700 1.000 157.03000 ? 495 ILE B N     1 
ATOM   4387  C CA    . ILE B 1 250 ? 87.95700  117.36000 101.61900 1.000 157.03000 ? 495 ILE B CA    1 
ATOM   4388  C C     . ILE B 1 250 ? 88.61700  117.63100 102.96600 1.000 157.03000 ? 495 ILE B C     1 
ATOM   4389  O O     . ILE B 1 250 ? 89.67600  118.26300 103.04000 1.000 157.03000 ? 495 ILE B O     1 
ATOM   4390  C CB    . ILE B 1 250 ? 88.61700  116.18800 100.86100 1.000 157.03000 ? 495 ILE B CB    1 
ATOM   4391  C CG1   . ILE B 1 250 ? 88.64400  114.91300 101.70300 1.000 157.03000 ? 495 ILE B CG1   1 
ATOM   4392  C CG2   . ILE B 1 250 ? 89.98900  116.54600 100.33500 1.000 157.03000 ? 495 ILE B CG2   1 
ATOM   4393  C CD1   . ILE B 1 250 ? 89.12300  113.70200 100.93500 1.000 157.03000 ? 495 ILE B CD1   1 
ATOM   4394  N N     . MET B 1 251 ? 87.98400  117.18500 104.04300 1.000 166.27000 ? 496 MET B N     1 
ATOM   4395  C CA    . MET B 1 251 ? 88.46600  117.45200 105.38500 1.000 166.27000 ? 496 MET B CA    1 
ATOM   4396  C C     . MET B 1 251 ? 88.74800  116.16700 106.14400 1.000 166.27000 ? 496 MET B C     1 
ATOM   4397  O O     . MET B 1 251 ? 88.17100  115.11200 105.86700 1.000 166.27000 ? 496 MET B O     1 
ATOM   4398  C CB    . MET B 1 251 ? 87.46800  118.28000 106.17600 1.000 166.27000 ? 496 MET B CB    1 
ATOM   4399  C CG    . MET B 1 251 ? 86.13000  117.62600 106.31600 1.000 166.27000 ? 496 MET B CG    1 
ATOM   4400  S SD    . MET B 1 251 ? 85.28300  117.77500 104.74100 1.000 166.27000 ? 496 MET B SD    1 
ATOM   4401  C CE    . MET B 1 251 ? 85.06600  119.55200 104.70400 1.000 166.27000 ? 496 MET B CE    1 
ATOM   4402  N N     . ILE B 1 252 ? 89.67200  116.27800 107.09500 1.000 159.19000 ? 497 ILE B N     1 
ATOM   4403  C CA    . ILE B 1 252 ? 89.98900  115.23000 108.05400 1.000 159.19000 ? 497 ILE B CA    1 
ATOM   4404  C C     . ILE B 1 252 ? 90.20400  115.90900 109.39800 1.000 159.19000 ? 497 ILE B C     1 
ATOM   4405  O O     . ILE B 1 252 ? 91.09600  116.75300 109.52900 1.000 159.19000 ? 497 ILE B O     1 
ATOM   4406  C CB    . ILE B 1 252 ? 91.23900  114.41900 107.67000 1.000 159.19000 ? 497 ILE B CB    1 
ATOM   4407  C CG1   . ILE B 1 252 ? 91.00700  113.54300 106.43200 1.000 159.19000 ? 497 ILE B CG1   1 
ATOM   4408  C CG2   . ILE B 1 252 ? 91.70200  113.59200 108.84900 1.000 159.19000 ? 497 ILE B CG2   1 
ATOM   4409  C CD1   . ILE B 1 252 ? 91.42600  114.17200 105.11300 1.000 159.19000 ? 497 ILE B CD1   1 
ATOM   4410  N N     . ASP B 1 253 ? 89.40300  115.54800 110.38900 1.000 152.14000 ? 498 ASP B N     1 
ATOM   4411  C CA    . ASP B 1 253 ? 89.51700  116.21900 111.67400 1.000 152.14000 ? 498 ASP B CA    1 
ATOM   4412  C C     . ASP B 1 253 ? 89.10500  115.32800 112.83900 1.000 152.14000 ? 498 ASP B C     1 
ATOM   4413  O O     . ASP B 1 253 ? 87.93500  114.94100 112.95900 1.000 152.14000 ? 498 ASP B O     1 
ATOM   4414  C CB    . ASP B 1 253 ? 88.70400  117.51200 111.64900 1.000 152.14000 ? 498 ASP B CB    1 
ATOM   4415  C CG    . ASP B 1 253 ? 87.33300  117.32600 111.05900 1.000 152.14000 ? 498 ASP B CG    1 
ATOM   4416  O OD1   . ASP B 1 253 ? 87.03700  116.22100 110.56900 1.000 152.14000 ? 498 ASP B OD1   1 
ATOM   4417  O OD2   . ASP B 1 253 ? 86.55200  118.28800 111.07600 1.000 152.14000 ? 498 ASP B OD2   1 
ATOM   4418  N N     . PRO B 1 254 ? 90.04900  114.97500 113.71200 1.000 152.90000 ? 499 PRO B N     1 
ATOM   4419  C CA    . PRO B 1 254 ? 89.69000  114.16800 114.88700 1.000 152.90000 ? 499 PRO B CA    1 
ATOM   4420  C C     . PRO B 1 254 ? 88.87300  114.93500 115.91100 1.000 152.90000 ? 499 PRO B C     1 
ATOM   4421  O O     . PRO B 1 254 ? 88.07300  114.32300 116.62600 1.000 152.90000 ? 499 PRO B O     1 
ATOM   4422  C CB    . PRO B 1 254 ? 91.05300  113.74600 115.44800 1.000 152.90000 ? 499 PRO B CB    1 
ATOM   4423  C CG    . PRO B 1 254 ? 91.98000  113.87100 114.28900 1.000 152.90000 ? 499 PRO B CG    1 
ATOM   4424  C CD    . PRO B 1 254 ? 91.50100  115.04900 113.52200 1.000 152.90000 ? 499 PRO B CD    1 
ATOM   4425  N N     . LYS B 1 255 ? 89.06300  116.24800 116.02600 1.000 147.72000 ? 500 LYS B N     1 
ATOM   4426  C CA    . LYS B 1 255 ? 88.07600  117.09800 116.68600 1.000 147.72000 ? 500 LYS B CA    1 
ATOM   4427  C C     . LYS B 1 255 ? 86.91900  117.22900 115.71700 1.000 147.72000 ? 500 LYS B C     1 
ATOM   4428  O O     . LYS B 1 255 ? 86.92900  118.07800 114.82800 1.000 147.72000 ? 500 LYS B O     1 
ATOM   4429  C CB    . LYS B 1 255 ? 88.63800  118.47200 117.02500 1.000 147.72000 ? 500 LYS B CB    1 
ATOM   4430  C CG    . LYS B 1 255 ? 89.69500  118.54800 118.10400 1.000 147.72000 ? 500 LYS B CG    1 
ATOM   4431  C CD    . LYS B 1 255 ? 90.03400  120.01900 118.34500 1.000 147.72000 ? 500 LYS B CD    1 
ATOM   4432  C CE    . LYS B 1 255 ? 91.15400  120.21200 119.34400 1.000 147.72000 ? 500 LYS B CE    1 
ATOM   4433  N NZ    . LYS B 1 255 ? 91.48600  121.65900 119.50300 1.000 147.72000 ? 500 LYS B NZ    1 
ATOM   4434  N N     . MET B 1 256 ? 85.89200  116.40300 115.88100 1.000 146.70000 ? 501 MET B N     1 
ATOM   4435  C CA    . MET B 1 256 ? 84.78400  116.48600 114.93800 1.000 146.70000 ? 501 MET B CA    1 
ATOM   4436  C C     . MET B 1 256 ? 83.75200  117.52700 115.37600 1.000 146.70000 ? 501 MET B C     1 
ATOM   4437  O O     . MET B 1 256 ? 82.53900  117.32000 115.26700 1.000 146.70000 ? 501 MET B O     1 
ATOM   4438  C CB    . MET B 1 256 ? 84.17500  115.08800 114.75600 1.000 146.70000 ? 501 MET B CB    1 
ATOM   4439  C CG    . MET B 1 256 ? 83.58500  114.42900 116.01400 1.000 146.70000 ? 501 MET B CG    1 
ATOM   4440  S SD    . MET B 1 256 ? 84.78700  113.86400 117.22800 1.000 146.70000 ? 501 MET B SD    1 
ATOM   4441  C CE    . MET B 1 256 ? 85.42100  112.39100 116.43300 1.000 146.70000 ? 501 MET B CE    1 
ATOM   4442  N N     . LEU B 1 257 ? 84.22600  118.69300 115.76200 1.000 140.68000 ? 502 LEU B N     1 
ATOM   4443  C CA    . LEU B 1 257 ? 83.39600  119.67600 116.43500 1.000 140.68000 ? 502 LEU B CA    1 
ATOM   4444  C C     . LEU B 1 257 ? 83.46400  121.05600 115.80700 1.000 140.68000 ? 502 LEU B C     1 
ATOM   4445  O O     . LEU B 1 257 ? 82.42600  121.69300 115.62600 1.000 140.68000 ? 502 LEU B O     1 
ATOM   4446  C CB    . LEU B 1 257 ? 83.84100  119.70400 117.91500 1.000 140.68000 ? 502 LEU B CB    1 
ATOM   4447  C CG    . LEU B 1 257 ? 83.11800  120.44600 119.04200 1.000 140.68000 ? 502 LEU B CG    1 
ATOM   4448  C CD1   . LEU B 1 257 ? 83.54300  121.89900 119.15700 1.000 140.68000 ? 502 LEU B CD1   1 
ATOM   4449  C CD2   . LEU B 1 257 ? 81.61800  120.34700 118.84700 1.000 140.68000 ? 502 LEU B CD2   1 
ATOM   4450  N N     . GLU B 1 258 ? 84.65000  121.52100 115.44400 1.000 133.39000 ? 503 GLU B N     1 
ATOM   4451  C CA    . GLU B 1 258 ? 84.83000  122.89600 115.01000 1.000 133.39000 ? 503 GLU B CA    1 
ATOM   4452  C C     . GLU B 1 258 ? 84.58700  123.07900 113.52400 1.000 133.39000 ? 503 GLU B C     1 
ATOM   4453  O O     . GLU B 1 258 ? 84.66000  124.20800 113.03100 1.000 133.39000 ? 503 GLU B O     1 
ATOM   4454  C CB    . GLU B 1 258 ? 86.24400  123.37600 115.35300 1.000 133.39000 ? 503 GLU B CB    1 
ATOM   4455  C CG    . GLU B 1 258 ? 86.54300  123.51000 116.84300 1.000 133.39000 ? 503 GLU B CG    1 
ATOM   4456  C CD    . GLU B 1 258 ? 85.79300  124.65000 117.50600 1.000 133.39000 ? 503 GLU B CD    1 
ATOM   4457  O OE1   . GLU B 1 258 ? 85.49700  125.65400 116.82800 1.000 133.39000 ? 503 GLU B OE1   1 
ATOM   4458  O OE2   . GLU B 1 258 ? 85.51600  124.55300 118.71800 1.000 133.39000 ? 503 GLU B OE2   1 
ATOM   4459  N N     . LEU B 1 259 ? 84.29700  122.00800 112.80300 1.000 137.98000 ? 504 LEU B N     1 
ATOM   4460  C CA    . LEU B 1 259 ? 84.33100  122.04500 111.35300 1.000 137.98000 ? 504 LEU B CA    1 
ATOM   4461  C C     . LEU B 1 259 ? 83.14200  121.36700 110.69600 1.000 137.98000 ? 504 LEU B C     1 
ATOM   4462  O O     . LEU B 1 259 ? 82.82000  121.70400 109.55000 1.000 137.98000 ? 504 LEU B O     1 
ATOM   4463  C CB    . LEU B 1 259 ? 85.63100  121.39000 110.86600 1.000 137.98000 ? 504 LEU B CB    1 
ATOM   4464  C CG    . LEU B 1 259 ? 86.25900  121.55200 109.48300 1.000 137.98000 ? 504 LEU B CG    1 
ATOM   4465  C CD1   . LEU B 1 259 ? 87.73900  121.30300 109.63600 1.000 137.98000 ? 504 LEU B CD1   1 
ATOM   4466  C CD2   . LEU B 1 259 ? 85.70100  120.60300 108.45900 1.000 137.98000 ? 504 LEU B CD2   1 
ATOM   4467  N N     . SER B 1 260 ? 82.44700  120.46900 111.39100 1.000 139.11000 ? 505 SER B N     1 
ATOM   4468  C CA    . SER B 1 260 ? 81.42500  119.60500 110.81300 1.000 139.11000 ? 505 SER B CA    1 
ATOM   4469  C C     . SER B 1 260 ? 80.16700  120.34400 110.37600 1.000 139.11000 ? 505 SER B C     1 
ATOM   4470  O O     . SER B 1 260 ? 79.25200  119.70300 109.85000 1.000 139.11000 ? 505 SER B O     1 
ATOM   4471  C CB    . SER B 1 260 ? 81.06100  118.51100 111.81500 1.000 139.11000 ? 505 SER B CB    1 
ATOM   4472  O OG    . SER B 1 260 ? 80.04700  117.66800 111.30100 1.000 139.11000 ? 505 SER B OG    1 
ATOM   4473  N N     . ILE B 1 261 ? 80.09700  121.66500 110.56200 1.000 141.37000 ? 506 ILE B N     1 
ATOM   4474  C CA    . ILE B 1 261 ? 79.08700  122.48900 109.91500 1.000 141.37000 ? 506 ILE B CA    1 
ATOM   4475  C C     . ILE B 1 261 ? 79.26600  122.48500 108.39800 1.000 141.37000 ? 506 ILE B C     1 
ATOM   4476  O O     . ILE B 1 261 ? 78.30800  122.72400 107.65400 1.000 141.37000 ? 506 ILE B O     1 
ATOM   4477  C CB    . ILE B 1 261 ? 79.15100  123.91000 110.52300 1.000 141.37000 ? 506 ILE B CB    1 
ATOM   4478  C CG1   . ILE B 1 261 ? 78.00100  124.80100 110.04200 1.000 141.37000 ? 506 ILE B CG1   1 
ATOM   4479  C CG2   . ILE B 1 261 ? 80.49900  124.53600 110.26400 1.000 141.37000 ? 506 ILE B CG2   1 
ATOM   4480  C CD1   . ILE B 1 261 ? 77.85700  126.08000 110.82000 1.000 141.37000 ? 506 ILE B CD1   1 
ATOM   4481  N N     . TYR B 1 262 ? 80.45900  122.14200 107.91300 1.000 143.43000 ? 507 TYR B N     1 
ATOM   4482  C CA    . TYR B 1 262 ? 80.74400  122.03100 106.49200 1.000 143.43000 ? 507 TYR B CA    1 
ATOM   4483  C C     . TYR B 1 262 ? 80.29100  120.70600 105.88800 1.000 143.43000 ? 507 TYR B C     1 
ATOM   4484  O O     . TYR B 1 262 ? 80.82600  120.30100 104.85300 1.000 143.43000 ? 507 TYR B O     1 
ATOM   4485  C CB    . TYR B 1 262 ? 82.24100  122.22600 106.24900 1.000 143.43000 ? 507 TYR B CB    1 
ATOM   4486  C CG    . TYR B 1 262 ? 82.71600  123.64300 106.45500 1.000 143.43000 ? 507 TYR B CG    1 
ATOM   4487  C CD1   . TYR B 1 262 ? 81.82900  124.70800 106.40600 1.000 143.43000 ? 507 TYR B CD1   1 
ATOM   4488  C CD2   . TYR B 1 262 ? 84.04900  123.91200 106.72100 1.000 143.43000 ? 507 TYR B CD2   1 
ATOM   4489  C CE1   . TYR B 1 262 ? 82.26000  125.99700 106.59700 1.000 143.43000 ? 507 TYR B CE1   1 
ATOM   4490  C CE2   . TYR B 1 262 ? 84.48600  125.20000 106.91600 1.000 143.43000 ? 507 TYR B CE2   1 
ATOM   4491  C CZ    . TYR B 1 262 ? 83.58700  126.23600 106.85300 1.000 143.43000 ? 507 TYR B CZ    1 
ATOM   4492  O OH    . TYR B 1 262 ? 84.01400  127.52400 107.04800 1.000 143.43000 ? 507 TYR B OH    1 
ATOM   4493  N N     . GLU B 1 263 ? 79.36200  119.99500 106.51200 1.000 152.43000 ? 508 GLU B N     1 
ATOM   4494  C CA    . GLU B 1 263 ? 78.70400  118.88400 105.85100 1.000 152.43000 ? 508 GLU B CA    1 
ATOM   4495  C C     . GLU B 1 263 ? 77.45500  119.42300 105.17700 1.000 152.43000 ? 508 GLU B C     1 
ATOM   4496  O O     . GLU B 1 263 ? 76.81400  120.34600 105.68400 1.000 152.43000 ? 508 GLU B O     1 
ATOM   4497  C CB    . GLU B 1 263 ? 78.35200  117.77500 106.84100 1.000 152.43000 ? 508 GLU B CB    1 
ATOM   4498  C CG    . GLU B 1 263 ? 78.14500  116.40200 106.20300 1.000 152.43000 ? 508 GLU B CG    1 
ATOM   4499  C CD    . GLU B 1 263 ? 76.74700  116.19100 105.67000 1.000 152.43000 ? 508 GLU B CD    1 
ATOM   4500  O OE1   . GLU B 1 263 ? 75.80700  116.80200 106.21500 1.000 152.43000 ? 508 GLU B OE1   1 
ATOM   4501  O OE2   . GLU B 1 263 ? 76.59000  115.42200 104.70000 1.000 152.43000 ? 508 GLU B OE2   1 
ATOM   4502  N N     . GLY B 1 264 ? 77.12300  118.85500 104.02500 1.000 157.72000 ? 509 GLY B N     1 
ATOM   4503  C CA    . GLY B 1 264 ? 76.06600  119.38500 103.19700 1.000 157.72000 ? 509 GLY B CA    1 
ATOM   4504  C C     . GLY B 1 264 ? 76.53500  120.39800 102.18300 1.000 157.72000 ? 509 GLY B C     1 
ATOM   4505  O O     . GLY B 1 264 ? 75.69700  121.05500 101.55000 1.000 157.72000 ? 509 GLY B O     1 
ATOM   4506  N N     . ILE B 1 265 ? 77.84100  120.55300 102.02300 1.000 155.80000 ? 510 ILE B N     1 
ATOM   4507  C CA    . ILE B 1 265 ? 78.39300  121.49900 101.05400 1.000 155.80000 ? 510 ILE B CA    1 
ATOM   4508  C C     . ILE B 1 265 ? 78.42600  120.82800 99.68500  1.000 155.80000 ? 510 ILE B C     1 
ATOM   4509  O O     . ILE B 1 265 ? 78.95700  119.71600 99.56400  1.000 155.80000 ? 510 ILE B O     1 
ATOM   4510  C CB    . ILE B 1 265 ? 79.78500  121.94800 101.48100 1.000 155.80000 ? 510 ILE B CB    1 
ATOM   4511  C CG1   . ILE B 1 265 ? 79.74200  122.59400 102.86400 1.000 155.80000 ? 510 ILE B CG1   1 
ATOM   4512  C CG2   . ILE B 1 265 ? 80.35600  122.92800 100.49100 1.000 155.80000 ? 510 ILE B CG2   1 
ATOM   4513  C CD1   . ILE B 1 265 ? 78.90100  123.83000 102.93900 1.000 155.80000 ? 510 ILE B CD1   1 
ATOM   4514  N N     . PRO B 1 266 ? 77.86700  121.45200 98.64700  1.000 157.13000 ? 511 PRO B N     1 
ATOM   4515  C CA    . PRO B 1 266 ? 77.98300  120.87800 97.30300  1.000 157.13000 ? 511 PRO B CA    1 
ATOM   4516  C C     . PRO B 1 266 ? 79.38100  120.98000 96.73700  1.000 157.13000 ? 511 PRO B C     1 
ATOM   4517  O O     . PRO B 1 266 ? 79.70000  120.26200 95.78300  1.000 157.13000 ? 511 PRO B O     1 
ATOM   4518  C CB    . PRO B 1 266 ? 76.99000  121.70600 96.48500  1.000 157.13000 ? 511 PRO B CB    1 
ATOM   4519  C CG    . PRO B 1 266 ? 76.96800  123.01100 97.17800  1.000 157.13000 ? 511 PRO B CG    1 
ATOM   4520  C CD    . PRO B 1 266 ? 77.12300  122.71900 98.64000  1.000 157.13000 ? 511 PRO B CD    1 
ATOM   4521  N N     . HIS B 1 267 ? 80.23500  121.83500 97.30300  1.000 148.81000 ? 512 HIS B N     1 
ATOM   4522  C CA    . HIS B 1 267 ? 81.62900  121.88300 96.89300  1.000 148.81000 ? 512 HIS B CA    1 
ATOM   4523  C C     . HIS B 1 267 ? 82.43200  120.68800 97.37800  1.000 148.81000 ? 512 HIS B C     1 
ATOM   4524  O O     . HIS B 1 267 ? 83.58900  120.54900 96.97900  1.000 148.81000 ? 512 HIS B O     1 
ATOM   4525  C CB    . HIS B 1 267 ? 82.28900  123.17500 97.37200  1.000 148.81000 ? 512 HIS B CB    1 
ATOM   4526  C CG    . HIS B 1 267 ? 81.86600  124.39000 96.60900  1.000 148.81000 ? 512 HIS B CG    1 
ATOM   4527  N ND1   . HIS B 1 267 ? 82.33400  124.67000 95.34400  1.000 148.81000 ? 512 HIS B ND1   1 
ATOM   4528  C CD2   . HIS B 1 267 ? 81.02400  125.39900 96.93100  1.000 148.81000 ? 512 HIS B CD2   1 
ATOM   4529  C CE1   . HIS B 1 267 ? 81.80000  125.80100 94.92100  1.000 148.81000 ? 512 HIS B CE1   1 
ATOM   4530  N NE2   . HIS B 1 267 ? 81.00000  126.26300 95.86500  1.000 148.81000 ? 512 HIS B NE2   1 
ATOM   4531  N N     . LEU B 1 268 ? 81.86500  119.83700 98.22500  1.000 156.48000 ? 513 LEU B N     1 
ATOM   4532  C CA    . LEU B 1 268 ? 82.56600  118.65600 98.69600  1.000 156.48000 ? 513 LEU B CA    1 
ATOM   4533  C C     . LEU B 1 268 ? 82.80600  117.66000 97.56800  1.000 156.48000 ? 513 LEU B C     1 
ATOM   4534  O O     . LEU B 1 268 ? 82.16700  117.69300 96.51600  1.000 156.48000 ? 513 LEU B O     1 
ATOM   4535  C CB    . LEU B 1 268 ? 81.76900  117.96500 99.79600  1.000 156.48000 ? 513 LEU B CB    1 
ATOM   4536  C CG    . LEU B 1 268 ? 81.68600  118.70600 101.11800 1.000 156.48000 ? 513 LEU B CG    1 
ATOM   4537  C CD1   . LEU B 1 268 ? 80.68400  118.03300 102.02900 1.000 156.48000 ? 513 LEU B CD1   1 
ATOM   4538  C CD2   . LEU B 1 268 ? 83.04900  118.70300 101.73900 1.000 156.48000 ? 513 LEU B CD2   1 
ATOM   4539  N N     . LEU B 1 269 ? 83.75800  116.76500 97.80500  1.000 156.34000 ? 514 LEU B N     1 
ATOM   4540  C CA    . LEU B 1 269 ? 83.91700  115.58300 96.97400  1.000 156.34000 ? 514 LEU B CA    1 
ATOM   4541  C C     . LEU B 1 269 ? 84.22600  114.38500 97.86900  1.000 156.34000 ? 514 LEU B C     1 
ATOM   4542  O O     . LEU B 1 269 ? 84.88300  113.42800 97.44800  1.000 156.34000 ? 514 LEU B O     1 
ATOM   4543  C CB    . LEU B 1 269 ? 84.98900  115.82300 95.90600  1.000 156.34000 ? 514 LEU B CB    1 
ATOM   4544  C CG    . LEU B 1 269 ? 85.06700  114.94700 94.65100  1.000 156.34000 ? 514 LEU B CG    1 
ATOM   4545  C CD1   . LEU B 1 269 ? 83.77800  115.03500 93.86100  1.000 156.34000 ? 514 LEU B CD1   1 
ATOM   4546  C CD2   . LEU B 1 269 ? 86.23700  115.36700 93.78900  1.000 156.34000 ? 514 LEU B CD2   1 
ATOM   4547  N N     . CYS B 1 270 ? 83.74200  114.43200 99.11400  1.000 160.13000 ? 515 CYS B N     1 
ATOM   4548  C CA    . CYS B 1 270 ? 83.97000  113.42200 100.13900 1.000 160.13000 ? 515 CYS B CA    1 
ATOM   4549  C C     . CYS B 1 270 ? 83.00600  113.66700 101.29300 1.000 160.13000 ? 515 CYS B C     1 
ATOM   4550  O O     . CYS B 1 270 ? 82.68400  114.82400 101.58700 1.000 160.13000 ? 515 CYS B O     1 
ATOM   4551  C CB    . CYS B 1 270 ? 85.41800  113.47500 100.63300 1.000 160.13000 ? 515 CYS B CB    1 
ATOM   4552  S SG    . CYS B 1 270 ? 85.91000  112.21200 101.82800 1.000 160.13000 ? 515 CYS B SG    1 
ATOM   4553  N N     . PRO B 1 271 ? 82.50300  112.62100 101.94900 1.000 155.76000 ? 516 PRO B N     1 
ATOM   4554  C CA    . PRO B 1 271 ? 81.81400  112.82900 103.22500 1.000 155.76000 ? 516 PRO B CA    1 
ATOM   4555  C C     . PRO B 1 271 ? 82.79000  113.31300 104.27700 1.000 155.76000 ? 516 PRO B C     1 
ATOM   4556  O O     . PRO B 1 271 ? 83.96700  112.94500 104.26300 1.000 155.76000 ? 516 PRO B O     1 
ATOM   4557  C CB    . PRO B 1 271 ? 81.26000  111.44200 103.56300 1.000 155.76000 ? 516 PRO B CB    1 
ATOM   4558  C CG    . PRO B 1 271 ? 82.11900  110.49900 102.80600 1.000 155.76000 ? 516 PRO B CG    1 
ATOM   4559  C CD    . PRO B 1 271 ? 82.47400  111.20700 101.53700 1.000 155.76000 ? 516 PRO B CD    1 
ATOM   4560  N N     . VAL B 1 272 ? 82.29200  114.16700 105.17200 1.000 153.96000 ? 517 VAL B N     1 
ATOM   4561  C CA    . VAL B 1 272 ? 83.11300  114.80600 106.19500 1.000 153.96000 ? 517 VAL B CA    1 
ATOM   4562  C C     . VAL B 1 272 ? 83.66600  113.74800 107.13400 1.000 153.96000 ? 517 VAL B C     1 
ATOM   4563  O O     . VAL B 1 272 ? 82.91700  113.09100 107.86600 1.000 153.96000 ? 517 VAL B O     1 
ATOM   4564  C CB    . VAL B 1 272 ? 82.31400  115.86700 106.96500 1.000 153.96000 ? 517 VAL B CB    1 
ATOM   4565  C CG1   . VAL B 1 272 ? 83.13300  116.40000 108.11900 1.000 153.96000 ? 517 VAL B CG1   1 
ATOM   4566  C CG2   . VAL B 1 272 ? 81.92400  116.98600 106.03200 1.000 153.96000 ? 517 VAL B CG2   1 
ATOM   4567  N N     . VAL B 1 273 ? 84.97900  113.56300 107.09000 1.000 151.45000 ? 518 VAL B N     1 
ATOM   4568  C CA    . VAL B 1 273 ? 85.60800  112.41700 107.72900 1.000 151.45000 ? 518 VAL B CA    1 
ATOM   4569  C C     . VAL B 1 273 ? 85.65700  112.65900 109.22600 1.000 151.45000 ? 518 VAL B C     1 
ATOM   4570  O O     . VAL B 1 273 ? 86.33500  113.57400 109.69700 1.000 151.45000 ? 518 VAL B O     1 
ATOM   4571  C CB    . VAL B 1 273 ? 87.00700  112.16900 107.16200 1.000 151.45000 ? 518 VAL B CB    1 
ATOM   4572  C CG1   . VAL B 1 273 ? 87.65900  111.00900 107.88800 1.000 151.45000 ? 518 VAL B CG1   1 
ATOM   4573  C CG2   . VAL B 1 273 ? 86.91700  111.90100 105.67700 1.000 151.45000 ? 518 VAL B CG2   1 
ATOM   4574  N N     . THR B 1 274 ? 84.92800  111.84000 109.97200 1.000 156.51000 ? 519 THR B N     1 
ATOM   4575  C CA    . THR B 1 274 ? 84.85900  111.93900 111.41900 1.000 156.51000 ? 519 THR B CA    1 
ATOM   4576  C C     . THR B 1 274 ? 85.88100  111.03700 112.09700 1.000 156.51000 ? 519 THR B C     1 
ATOM   4577  O O     . THR B 1 274 ? 86.57900  111.46300 113.02000 1.000 156.51000 ? 519 THR B O     1 
ATOM   4578  C CB    . THR B 1 274 ? 83.43900  111.58700 111.87600 1.000 156.51000 ? 519 THR B CB    1 
ATOM   4579  O OG1   . THR B 1 274 ? 82.50500  112.46200 111.23300 1.000 156.51000 ? 519 THR B OG1   1 
ATOM   4580  C CG2   . THR B 1 274 ? 83.29600  111.73200 113.37600 1.000 156.51000 ? 519 THR B CG2   1 
ATOM   4581  N N     . ASP B 1 275 ? 86.00600  109.80400 111.62400 1.000 162.43000 ? 520 ASP B N     1 
ATOM   4582  C CA    . ASP B 1 275 ? 86.89000  108.82600 112.23600 1.000 162.43000 ? 520 ASP B CA    1 
ATOM   4583  C C     . ASP B 1 275 ? 88.29800  108.98400 111.66900 1.000 162.43000 ? 520 ASP B C     1 
ATOM   4584  O O     . ASP B 1 275 ? 88.61600  109.95900 110.98400 1.000 162.43000 ? 520 ASP B O     1 
ATOM   4585  C CB    . ASP B 1 275 ? 86.33600  107.42300 112.02000 1.000 162.43000 ? 520 ASP B CB    1 
ATOM   4586  C CG    . ASP B 1 275 ? 84.99000  107.23300 112.67400 1.000 162.43000 ? 520 ASP B CG    1 
ATOM   4587  O OD1   . ASP B 1 275 ? 84.71600  107.93400 113.66700 1.000 162.43000 ? 520 ASP B OD1   1 
ATOM   4588  O OD2   . ASP B 1 275 ? 84.20300  106.39000 112.19800 1.000 162.43000 ? 520 ASP B OD2   1 
ATOM   4589  N N     . MET B 1 276 ? 89.16200  108.01600 111.94600 1.000 166.98000 ? 521 MET B N     1 
ATOM   4590  C CA    . MET B 1 276 ? 90.55600  108.09000 111.54300 1.000 166.98000 ? 521 MET B CA    1 
ATOM   4591  C C     . MET B 1 276 ? 90.99400  106.94000 110.64900 1.000 166.98000 ? 521 MET B C     1 
ATOM   4592  O O     . MET B 1 276 ? 91.85700  107.13900 109.79200 1.000 166.98000 ? 521 MET B O     1 
ATOM   4593  C CB    . MET B 1 276 ? 91.44600  108.14800 112.79100 1.000 166.98000 ? 521 MET B CB    1 
ATOM   4594  C CG    . MET B 1 276 ? 92.90000  108.44900 112.53700 1.000 166.98000 ? 521 MET B CG    1 
ATOM   4595  S SD    . MET B 1 276 ? 93.74900  108.66100 114.09700 1.000 166.98000 ? 521 MET B SD    1 
ATOM   4596  C CE    . MET B 1 276 ? 93.04400  110.22900 114.57600 1.000 166.98000 ? 521 MET B CE    1 
ATOM   4597  N N     . LYS B 1 277 ? 90.41800  105.74600 110.81300 1.000 166.90000 ? 522 LYS B N     1 
ATOM   4598  C CA    . LYS B 1 277 ? 90.68600  104.66700 109.86700 1.000 166.90000 ? 522 LYS B CA    1 
ATOM   4599  C C     . LYS B 1 277 ? 90.10200  104.99500 108.50200 1.000 166.90000 ? 522 LYS B C     1 
ATOM   4600  O O     . LYS B 1 277 ? 90.71500  104.71700 107.46200 1.000 166.90000 ? 522 LYS B O     1 
ATOM   4601  C CB    . LYS B 1 277 ? 90.11400  103.35700 110.39700 1.000 166.90000 ? 522 LYS B CB    1 
ATOM   4602  C CG    . LYS B 1 277 ? 90.46000  102.16400 109.55200 1.000 166.90000 ? 522 LYS B CG    1 
ATOM   4603  C CD    . LYS B 1 277 ? 91.95900  101.93900 109.54900 1.000 166.90000 ? 522 LYS B CD    1 
ATOM   4604  C CE    . LYS B 1 277 ? 92.44500  101.49200 110.91600 1.000 166.90000 ? 522 LYS B CE    1 
ATOM   4605  N NZ    . LYS B 1 277 ? 93.89500  101.16600 110.91700 1.000 166.90000 ? 522 LYS B NZ    1 
ATOM   4606  N N     . GLU B 1 278 ? 88.94000  105.64000 108.48900 1.000 170.81000 ? 523 GLU B N     1 
ATOM   4607  C CA    . GLU B 1 278 ? 88.40000  106.16400 107.24700 1.000 170.81000 ? 523 GLU B CA    1 
ATOM   4608  C C     . GLU B 1 278 ? 89.22300  107.33900 106.72600 1.000 170.81000 ? 523 GLU B C     1 
ATOM   4609  O O     . GLU B 1 278 ? 89.27000  107.56100 105.51500 1.000 170.81000 ? 523 GLU B O     1 
ATOM   4610  C CB    . GLU B 1 278 ? 86.93600  106.54500 107.46000 1.000 170.81000 ? 523 GLU B CB    1 
ATOM   4611  C CG    . GLU B 1 278 ? 86.17100  106.86400 106.19900 1.000 170.81000 ? 523 GLU B CG    1 
ATOM   4612  C CD    . GLU B 1 278 ? 84.69400  107.01100 106.45900 1.000 170.81000 ? 523 GLU B CD    1 
ATOM   4613  O OE1   . GLU B 1 278 ? 84.28200  106.86700 107.62800 1.000 170.81000 ? 523 GLU B OE1   1 
ATOM   4614  O OE2   . GLU B 1 278 ? 83.94500  107.25900 105.49300 1.000 170.81000 ? 523 GLU B OE2   1 
ATOM   4615  N N     . ALA B 1 279 ? 89.92800  108.05900 107.59900 1.000 165.43000 ? 524 ALA B N     1 
ATOM   4616  C CA    . ALA B 1 279 ? 90.85900  109.07400 107.11700 1.000 165.43000 ? 524 ALA B CA    1 
ATOM   4617  C C     . ALA B 1 279 ? 92.07500  108.43800 106.45600 1.000 165.43000 ? 524 ALA B C     1 
ATOM   4618  O O     . ALA B 1 279 ? 92.61100  108.96900 105.47500 1.000 165.43000 ? 524 ALA B O     1 
ATOM   4619  C CB    . ALA B 1 279 ? 91.28600  109.97400 108.26900 1.000 165.43000 ? 524 ALA B CB    1 
ATOM   4620  N N     . ALA B 1 280 ? 92.52700  107.30400 106.98800 1.000 170.59000 ? 525 ALA B N     1 
ATOM   4621  C CA    . ALA B 1 280 ? 93.57500  106.53700 106.33200 1.000 170.59000 ? 525 ALA B CA    1 
ATOM   4622  C C     . ALA B 1 280 ? 93.09600  105.93600 105.01900 1.000 170.59000 ? 525 ALA B C     1 
ATOM   4623  O O     . ALA B 1 280 ? 93.90900  105.70500 104.11800 1.000 170.59000 ? 525 ALA B O     1 
ATOM   4624  C CB    . ALA B 1 280 ? 94.07800  105.44100 107.26700 1.000 170.59000 ? 525 ALA B CB    1 
ATOM   4625  N N     . ASN B 1 281 ? 91.79900  105.66900 104.90000 1.000 173.74000 ? 526 ASN B N     1 
ATOM   4626  C CA    . ASN B 1 281 ? 91.20100  105.35300 103.60700 1.000 173.74000 ? 526 ASN B CA    1 
ATOM   4627  C C     . ASN B 1 281 ? 91.04100  106.57500 102.70900 1.000 173.74000 ? 526 ASN B C     1 
ATOM   4628  O O     . ASN B 1 281 ? 90.90600  106.41500 101.49200 1.000 173.74000 ? 526 ASN B O     1 
ATOM   4629  C CB    . ASN B 1 281 ? 89.83600  104.69800 103.80000 1.000 173.74000 ? 526 ASN B CB    1 
ATOM   4630  C CG    . ASN B 1 281 ? 89.93800  103.30400 104.35500 1.000 173.74000 ? 526 ASN B CG    1 
ATOM   4631  O OD1   . ASN B 1 281 ? 90.81000  102.53300 103.95900 1.000 173.74000 ? 526 ASN B OD1   1 
ATOM   4632  N ND2   . ASN B 1 281 ? 89.04600  102.96500 105.27600 1.000 173.74000 ? 526 ASN B ND2   1 
ATOM   4633  N N     . ALA B 1 282 ? 91.01800  107.78000 103.28100 1.000 169.43000 ? 527 ALA B N     1 
ATOM   4634  C CA    . ALA B 1 282 ? 90.87400  108.99500 102.48500 1.000 169.43000 ? 527 ALA B CA    1 
ATOM   4635  C C     . ALA B 1 282 ? 92.19300  109.42300 101.86200 1.000 169.43000 ? 527 ALA B C     1 
ATOM   4636  O O     . ALA B 1 282 ? 92.23200  109.85000 100.70200 1.000 169.43000 ? 527 ALA B O     1 
ATOM   4637  C CB    . ALA B 1 282 ? 90.31500  110.12200 103.34900 1.000 169.43000 ? 527 ALA B CB    1 
ATOM   4638  N N     . LEU B 1 283 ? 93.27700  109.31500 102.62300 1.000 165.39000 ? 528 LEU B N     1 
ATOM   4639  C CA    . LEU B 1 283 ? 94.58500  109.68900 102.09700 1.000 165.39000 ? 528 LEU B CA    1 
ATOM   4640  C C     . LEU B 1 283 ? 95.05600  108.72600 101.01200 1.000 165.39000 ? 528 LEU B C     1 
ATOM   4641  O O     . LEU B 1 283 ? 95.84200  109.11300 100.13400 1.000 165.39000 ? 528 LEU B O     1 
ATOM   4642  C CB    . LEU B 1 283 ? 95.60200  109.75900 103.22800 1.000 165.39000 ? 528 LEU B CB    1 
ATOM   4643  C CG    . LEU B 1 283 ? 95.80400  111.09600 103.94800 1.000 165.39000 ? 528 LEU B CG    1 
ATOM   4644  C CD1   . LEU B 1 283 ? 96.13600  112.19200 102.94600 1.000 165.39000 ? 528 LEU B CD1   1 
ATOM   4645  C CD2   . LEU B 1 283 ? 94.63100  111.49400 104.81700 1.000 165.39000 ? 528 LEU B CD2   1 
ATOM   4646  N N     . ARG B 1 284 ? 94.56800  107.48300 101.04700 1.000 173.48000 ? 529 ARG B N     1 
ATOM   4647  C CA    . ARG B 1 284 ? 94.84600  106.52600 99.98100  1.000 173.48000 ? 529 ARG B CA    1 
ATOM   4648  C C     . ARG B 1 284 ? 94.23500  106.98000 98.66200  1.000 173.48000 ? 529 ARG B C     1 
ATOM   4649  O O     . ARG B 1 284 ? 94.90500  106.98500 97.62400  1.000 173.48000 ? 529 ARG B O     1 
ATOM   4650  C CB    . ARG B 1 284 ? 94.31300  105.14700 100.36900 1.000 173.48000 ? 529 ARG B CB    1 
ATOM   4651  C CG    . ARG B 1 284 ? 94.53900  104.06100 99.32000  1.000 173.48000 ? 529 ARG B CG    1 
ATOM   4652  C CD    . ARG B 1 284 ? 96.01100  103.68400 99.17100  1.000 173.48000 ? 529 ARG B CD    1 
ATOM   4653  N NE    . ARG B 1 284 ? 96.58000  103.13900 100.40400 1.000 173.48000 ? 529 ARG B NE    1 
ATOM   4654  C CZ    . ARG B 1 284 ? 96.48700  101.86500 100.77700 1.000 173.48000 ? 529 ARG B CZ    1 
ATOM   4655  N NH1   . ARG B 1 284 ? 95.84500  100.98800 100.01800 1.000 173.48000 ? 529 ARG B NH1   1 
ATOM   4656  N NH2   . ARG B 1 284 ? 97.03800  101.46800 101.91500 1.000 173.48000 ? 529 ARG B NH2   1 
ATOM   4657  N N     . TRP B 1 285 ? 92.96200  107.38600 98.68900  1.000 165.41000 ? 530 TRP B N     1 
ATOM   4658  C CA    . TRP B 1 285 ? 92.32900  107.91600 97.48700  1.000 165.41000 ? 530 TRP B CA    1 
ATOM   4659  C C     . TRP B 1 285 ? 92.92800  109.25400 97.09100  1.000 165.41000 ? 530 TRP B C     1 
ATOM   4660  O O     . TRP B 1 285 ? 92.93400  109.60000 95.90500  1.000 165.41000 ? 530 TRP B O     1 
ATOM   4661  C CB    . TRP B 1 285 ? 90.82500  108.05600 97.69700  1.000 165.41000 ? 530 TRP B CB    1 
ATOM   4662  C CG    . TRP B 1 285 ? 90.11100  108.52400 96.48000  1.000 165.41000 ? 530 TRP B CG    1 
ATOM   4663  C CD1   . TRP B 1 285 ? 90.02300  107.87500 95.28900  1.000 165.41000 ? 530 TRP B CD1   1 
ATOM   4664  C CD2   . TRP B 1 285 ? 89.38400  109.74700 96.32600  1.000 165.41000 ? 530 TRP B CD2   1 
ATOM   4665  N NE1   . TRP B 1 285 ? 89.28400  108.61300 94.39800  1.000 165.41000 ? 530 TRP B NE1   1 
ATOM   4666  C CE2   . TRP B 1 285 ? 88.87800  109.76800 95.01100  1.000 165.41000 ? 530 TRP B CE2   1 
ATOM   4667  C CE3   . TRP B 1 285 ? 89.10800  110.82400 97.17100  1.000 165.41000 ? 530 TRP B CE3   1 
ATOM   4668  C CZ2   . TRP B 1 285 ? 88.11400  110.82300 94.52100  1.000 165.41000 ? 530 TRP B CZ2   1 
ATOM   4669  C CZ3   . TRP B 1 285 ? 88.34700  111.87100 96.68300  1.000 165.41000 ? 530 TRP B CZ3   1 
ATOM   4670  C CH2   . TRP B 1 285 ? 87.86100  111.86300 95.37000  1.000 165.41000 ? 530 TRP B CH2   1 
ATOM   4671  N N     . SER B 1 286 ? 93.46500  109.98900 98.06700  1.000 164.43000 ? 531 SER B N     1 
ATOM   4672  C CA    . SER B 1 286 ? 94.17200  111.23300 97.78700  1.000 164.43000 ? 531 SER B CA    1 
ATOM   4673  C C     . SER B 1 286 ? 95.39300  110.99100 96.90200  1.000 164.43000 ? 531 SER B C     1 
ATOM   4674  O O     . SER B 1 286 ? 95.49100  111.54900 95.80500  1.000 164.43000 ? 531 SER B O     1 
ATOM   4675  C CB    . SER B 1 286 ? 94.57900  111.89600 99.10100  1.000 164.43000 ? 531 SER B CB    1 
ATOM   4676  O OG    . SER B 1 286 ? 93.44800  112.10700 99.92500  1.000 164.43000 ? 531 SER B OG    1 
ATOM   4677  N N     . VAL B 1 287 ? 96.32400  110.13900 97.35000  1.000 157.41000 ? 532 VAL B N     1 
ATOM   4678  C CA    . VAL B 1 287 ? 97.49100  109.85300 96.50800  1.000 157.41000 ? 532 VAL B CA    1 
ATOM   4679  C C     . VAL B 1 287 ? 97.14100  109.06200 95.26000  1.000 157.41000 ? 532 VAL B C     1 
ATOM   4680  O O     . VAL B 1 287 ? 97.85900  109.16600 94.26000  1.000 157.41000 ? 532 VAL B O     1 
ATOM   4681  C CB    . VAL B 1 287 ? 98.61900  109.10300 97.23600  1.000 157.41000 ? 532 VAL B CB    1 
ATOM   4682  C CG1   . VAL B 1 287 ? 99.35200  110.02200 98.14600  1.000 157.41000 ? 532 VAL B CG1   1 
ATOM   4683  C CG2   . VAL B 1 287 ? 98.07500  107.91800 97.99700  1.000 157.41000 ? 532 VAL B CG2   1 
ATOM   4684  N N     . ALA B 1 288 ? 96.05300  108.28800 95.27700  1.000 163.83000 ? 533 ALA B N     1 
ATOM   4685  C CA    . ALA B 1 288 ? 95.65200  107.56300 94.07700  1.000 163.83000 ? 533 ALA B CA    1 
ATOM   4686  C C     . ALA B 1 288 ? 95.17400  108.52100 92.99700  1.000 163.83000 ? 533 ALA B C     1 
ATOM   4687  O O     . ALA B 1 288 ? 95.60700  108.43200 91.84100  1.000 163.83000 ? 533 ALA B O     1 
ATOM   4688  C CB    . ALA B 1 288 ? 94.56400  106.54700 94.41600  1.000 163.83000 ? 533 ALA B CB    1 
ATOM   4689  N N     . GLU B 1 289 ? 94.29800  109.46100 93.36900  1.000 164.82000 ? 534 GLU B N     1 
ATOM   4690  C CA    . GLU B 1 289 ? 93.88000  110.51300 92.45300  1.000 164.82000 ? 534 GLU B CA    1 
ATOM   4691  C C     . GLU B 1 289 ? 95.05700  111.38300 92.04500  1.000 164.82000 ? 534 GLU B C     1 
ATOM   4692  O O     . GLU B 1 289 ? 95.14200  111.81200 90.88500  1.000 164.82000 ? 534 GLU B O     1 
ATOM   4693  C CB    . GLU B 1 289 ? 92.78600  111.35500 93.10600  1.000 164.82000 ? 534 GLU B CB    1 
ATOM   4694  C CG    . GLU B 1 289 ? 92.26600  112.49400 92.24600  1.000 164.82000 ? 534 GLU B CG    1 
ATOM   4695  C CD    . GLU B 1 289 ? 91.50700  112.02100 91.02200  1.000 164.82000 ? 534 GLU B CD    1 
ATOM   4696  O OE1   . GLU B 1 289 ? 90.89900  110.93100 91.07200  1.000 164.82000 ? 534 GLU B OE1   1 
ATOM   4697  O OE2   . GLU B 1 289 ? 91.52200  112.74300 90.00400  1.000 164.82000 ? 534 GLU B OE2   1 
ATOM   4698  N N     . MET B 1 290 ? 95.99600  111.60400 92.97700  1.000 158.14000 ? 535 MET B N     1 
ATOM   4699  C CA    . MET B 1 290 ? 97.19700  112.37900 92.68500  1.000 158.14000 ? 535 MET B CA    1 
ATOM   4700  C C     . MET B 1 290 ? 98.02000  111.75000 91.57500  1.000 158.14000 ? 535 MET B C     1 
ATOM   4701  O O     . MET B 1 290 ? 98.28000  112.39100 90.55800  1.000 158.14000 ? 535 MET B O     1 
ATOM   4702  C CB    . MET B 1 290 ? 98.07600  112.52900 93.92100  1.000 158.14000 ? 535 MET B CB    1 
ATOM   4703  C CG    . MET B 1 290 ? 99.36300  113.20100 93.50600  1.000 158.14000 ? 535 MET B CG    1 
ATOM   4704  S SD    . MET B 1 290 ? 100.72500 113.38600 94.63400  1.000 158.14000 ? 535 MET B SD    1 
ATOM   4705  C CE    . MET B 1 290 ? 101.92500 113.88100 93.41300  1.000 158.14000 ? 535 MET B CE    1 
ATOM   4706  N N     . GLU B 1 291 ? 98.43500  110.49600 91.75000  1.000 162.92000 ? 536 GLU B N     1 
ATOM   4707  C CA    . GLU B 1 291 ? 99.28300  109.87600 90.74000  1.000 162.92000 ? 536 GLU B CA    1 
ATOM   4708  C C     . GLU B 1 291 ? 98.51000  109.56500 89.46700  1.000 162.92000 ? 536 GLU B C     1 
ATOM   4709  O O     . GLU B 1 291 ? 99.10500  109.56800 88.38300  1.000 162.92000 ? 536 GLU B O     1 
ATOM   4710  C CB    . GLU B 1 291 ? 99.95300  108.62500 91.29800  1.000 162.92000 ? 536 GLU B CB    1 
ATOM   4711  C CG    . GLU B 1 291 ? 101.01200 108.95000 92.33600  1.000 162.92000 ? 536 GLU B CG    1 
ATOM   4712  C CD    . GLU B 1 291 ? 101.74300 107.72500 92.84100  1.000 162.92000 ? 536 GLU B CD    1 
ATOM   4713  O OE1   . GLU B 1 291 ? 101.36000 106.60500 92.45300  1.000 162.92000 ? 536 GLU B OE1   1 
ATOM   4714  O OE2   . GLU B 1 291 ? 102.70000 107.88200 93.62700  1.000 162.92000 ? 536 GLU B OE2   1 
ATOM   4715  N N     . ARG B 1 292 ? 97.18900  109.37900 89.57000  1.000 168.15000 ? 537 ARG B N     1 
ATOM   4716  C CA    . ARG B 1 292 ? 96.34400  109.19600 88.39500  1.000 168.15000 ? 537 ARG B CA    1 
ATOM   4717  C C     . ARG B 1 292 ? 96.38300  110.42400 87.49600  1.000 168.15000 ? 537 ARG B C     1 
ATOM   4718  O O     . ARG B 1 292 ? 96.84900  110.36100 86.35000  1.000 168.15000 ? 537 ARG B O     1 
ATOM   4719  C CB    . ARG B 1 292 ? 94.91500  108.90300 88.84200  1.000 168.15000 ? 537 ARG B CB    1 
ATOM   4720  C CG    . ARG B 1 292 ? 93.95300  108.62300 87.71800  1.000 168.15000 ? 537 ARG B CG    1 
ATOM   4721  C CD    . ARG B 1 292 ? 94.31000  107.31800 87.05100  1.000 168.15000 ? 537 ARG B CD    1 
ATOM   4722  N NE    . ARG B 1 292 ? 93.30500  106.92000 86.07200  1.000 168.15000 ? 537 ARG B NE    1 
ATOM   4723  C CZ    . ARG B 1 292 ? 93.30400  107.29500 84.79900  1.000 168.15000 ? 537 ARG B CZ    1 
ATOM   4724  N NH1   . ARG B 1 292 ? 94.26300  108.08100 84.33200  1.000 168.15000 ? 537 ARG B NH1   1 
ATOM   4725  N NH2   . ARG B 1 292 ? 92.34300  106.87500 83.99100  1.000 168.15000 ? 537 ARG B NH2   1 
ATOM   4726  N N     . ARG B 1 293 ? 95.95500  111.57500 88.02600  1.000 163.93000 ? 538 ARG B N     1 
ATOM   4727  C CA    . ARG B 1 293 ? 96.05000  112.79600 87.23500  1.000 163.93000 ? 538 ARG B CA    1 
ATOM   4728  C C     . ARG B 1 293 ? 97.49100  113.24400 87.03400  1.000 163.93000 ? 538 ARG B C     1 
ATOM   4729  O O     . ARG B 1 293 ? 97.76200  113.98200 86.09100  1.000 163.93000 ? 538 ARG B O     1 
ATOM   4730  C CB    . ARG B 1 293 ? 95.24500  113.93800 87.86500  1.000 163.93000 ? 538 ARG B CB    1 
ATOM   4731  C CG    . ARG B 1 293 ? 95.79800  114.48900 89.17700  1.000 163.93000 ? 538 ARG B CG    1 
ATOM   4732  C CD    . ARG B 1 293 ? 94.97500  115.67400 89.69300  1.000 163.93000 ? 538 ARG B CD    1 
ATOM   4733  N NE    . ARG B 1 293 ? 93.60400  115.31500 90.04200  1.000 163.93000 ? 538 ARG B NE    1 
ATOM   4734  C CZ    . ARG B 1 293 ? 92.65900  116.19600 90.35300  1.000 163.93000 ? 538 ARG B CZ    1 
ATOM   4735  N NH1   . ARG B 1 293 ? 92.93300  117.49300 90.36600  1.000 163.93000 ? 538 ARG B NH1   1 
ATOM   4736  N NH2   . ARG B 1 293 ? 91.43700  115.78100 90.65100  1.000 163.93000 ? 538 ARG B NH2   1 
ATOM   4737  N N     . TYR B 1 294 ? 98.43200  112.75200 87.83500  1.000 158.21000 ? 539 TYR B N     1 
ATOM   4738  C CA    . TYR B 1 294 ? 99.80200  113.21900 87.75400  1.000 158.21000 ? 539 TYR B CA    1 
ATOM   4739  C C     . TYR B 1 294 ? 100.55800 112.55000 86.62500  1.000 158.21000 ? 539 TYR B C     1 
ATOM   4740  O O     . TYR B 1 294 ? 101.44900 113.16700 86.03300  1.000 158.21000 ? 539 TYR B O     1 
ATOM   4741  C CB    . TYR B 1 294 ? 100.50200 112.96500 89.08100  1.000 158.21000 ? 539 TYR B CB    1 
ATOM   4742  C CG    . TYR B 1 294 ? 101.86700 113.57100 89.16800  1.000 158.21000 ? 539 TYR B CG    1 
ATOM   4743  C CD1   . TYR B 1 294 ? 102.02100 114.93600 89.35700  1.000 158.21000 ? 539 TYR B CD1   1 
ATOM   4744  C CD2   . TYR B 1 294 ? 103.00300 112.78600 89.07200  1.000 158.21000 ? 539 TYR B CD2   1 
ATOM   4745  C CE1   . TYR B 1 294 ? 103.27000 115.50600 89.44500  1.000 158.21000 ? 539 TYR B CE1   1 
ATOM   4746  C CE2   . TYR B 1 294 ? 104.26000 113.34600 89.15900  1.000 158.21000 ? 539 TYR B CE2   1 
ATOM   4747  C CZ    . TYR B 1 294 ? 104.38500 114.70900 89.34500  1.000 158.21000 ? 539 TYR B CZ    1 
ATOM   4748  O OH    . TYR B 1 294 ? 105.63200 115.27800 89.43000  1.000 158.21000 ? 539 TYR B OH    1 
ATOM   4749  N N     . ARG B 1 295 ? 100.23400 111.30000 86.31800  1.000 163.57000 ? 540 ARG B N     1 
ATOM   4750  C CA    . ARG B 1 295 ? 100.74900 110.71100 85.09400  1.000 163.57000 ? 540 ARG B CA    1 
ATOM   4751  C C     . ARG B 1 295 ? 99.86700  111.02800 83.89600  1.000 163.57000 ? 540 ARG B C     1 
ATOM   4752  O O     . ARG B 1 295 ? 100.37000 111.05100 82.76700  1.000 163.57000 ? 540 ARG B O     1 
ATOM   4753  C CB    . ARG B 1 295 ? 100.92400 109.19400 85.24400  1.000 163.57000 ? 540 ARG B CB    1 
ATOM   4754  C CG    . ARG B 1 295 ? 99.64600  108.38600 85.29900  1.000 163.57000 ? 540 ARG B CG    1 
ATOM   4755  C CD    . ARG B 1 295 ? 99.95000  106.92700 85.56900  1.000 163.57000 ? 540 ARG B CD    1 
ATOM   4756  N NE    . ARG B 1 295 ? 100.43400 106.72500 86.92900  1.000 163.57000 ? 540 ARG B NE    1 
ATOM   4757  C CZ    . ARG B 1 295 ? 100.90600 105.57300 87.39100  1.000 163.57000 ? 540 ARG B CZ    1 
ATOM   4758  N NH1   . ARG B 1 295 ? 100.96500 104.51200 86.59900  1.000 163.57000 ? 540 ARG B NH1   1 
ATOM   4759  N NH2   . ARG B 1 295 ? 101.32100 105.48200 88.64500  1.000 163.57000 ? 540 ARG B NH2   1 
ATOM   4760  N N     . LEU B 1 296 ? 98.58000  111.32800 84.11500  1.000 168.41000 ? 541 LEU B N     1 
ATOM   4761  C CA    . LEU B 1 296 ? 97.74600  111.79600 83.01400  1.000 168.41000 ? 541 LEU B CA    1 
ATOM   4762  C C     . LEU B 1 296 ? 98.19000  113.17500 82.54100  1.000 168.41000 ? 541 LEU B C     1 
ATOM   4763  O O     . LEU B 1 296 ? 98.07000  113.49500 81.35500  1.000 168.41000 ? 541 LEU B O     1 
ATOM   4764  C CB    . LEU B 1 296 ? 96.28200  111.79100 83.46100  1.000 168.41000 ? 541 LEU B CB    1 
ATOM   4765  C CG    . LEU B 1 296 ? 95.11100  111.89500 82.48000  1.000 168.41000 ? 541 LEU B CG    1 
ATOM   4766  C CD1   . LEU B 1 296 ? 94.75900  113.32100 82.10600  1.000 168.41000 ? 541 LEU B CD1   1 
ATOM   4767  C CD2   . LEU B 1 296 ? 95.41900  111.08200 81.23600  1.000 168.41000 ? 541 LEU B CD2   1 
ATOM   4768  N N     . MET B 1 297 ? 98.72300  113.98600 83.45200  1.000 173.78000 ? 542 MET B N     1 
ATOM   4769  C CA    . MET B 1 297 ? 99.26100  115.29300 83.10300  1.000 173.78000 ? 542 MET B CA    1 
ATOM   4770  C C     . MET B 1 297 ? 100.50800 115.16200 82.24900  1.000 173.78000 ? 542 MET B C     1 
ATOM   4771  O O     . MET B 1 297 ? 100.68000 115.90000 81.27300  1.000 173.78000 ? 542 MET B O     1 
ATOM   4772  C CB    . MET B 1 297 ? 99.56000  116.06900 84.38300  1.000 173.78000 ? 542 MET B CB    1 
ATOM   4773  C CG    . MET B 1 297 ? 100.19400 117.41700 84.17600  1.000 173.78000 ? 542 MET B CG    1 
ATOM   4774  S SD    . MET B 1 297 ? 100.45700 118.27800 85.73400  1.000 173.78000 ? 542 MET B SD    1 
ATOM   4775  C CE    . MET B 1 297 ? 101.71000 117.23900 86.47700  1.000 173.78000 ? 542 MET B CE    1 
ATOM   4776  N N     . ALA B 1 298 ? 101.38800 114.22500 82.60000  1.000 170.28000 ? 543 ALA B N     1 
ATOM   4777  C CA    . ALA B 1 298 ? 102.55700 113.97800 81.77100  1.000 170.28000 ? 543 ALA B CA    1 
ATOM   4778  C C     . ALA B 1 298 ? 102.16600 113.34200 80.44700  1.000 170.28000 ? 543 ALA B C     1 
ATOM   4779  O O     . ALA B 1 298 ? 102.87700 113.50600 79.45000  1.000 170.28000 ? 543 ALA B O     1 
ATOM   4780  C CB    . ALA B 1 298 ? 103.55500 113.09800 82.51900  1.000 170.28000 ? 543 ALA B CB    1 
ATOM   4781  N N     . ALA B 1 299 ? 101.04600 112.61800 80.41900  1.000 172.69000 ? 544 ALA B N     1 
ATOM   4782  C CA    . ALA B 1 299 ? 100.51500 112.13000 79.15200  1.000 172.69000 ? 544 ALA B CA    1 
ATOM   4783  C C     . ALA B 1 299 ? 100.02400 113.28100 78.28200  1.000 172.69000 ? 544 ALA B C     1 
ATOM   4784  O O     . ALA B 1 299 ? 100.21400 113.26800 77.06100  1.000 172.69000 ? 544 ALA B O     1 
ATOM   4785  C CB    . ALA B 1 299 ? 99.39300  111.12600 79.40600  1.000 172.69000 ? 544 ALA B CB    1 
ATOM   4786  N N     . MET B 1 300 ? 99.40300  114.28900 78.89100  1.000 177.47000 ? 545 MET B N     1 
ATOM   4787  C CA    . MET B 1 300 ? 98.97100  115.47500 78.16300  1.000 177.47000 ? 545 MET B CA    1 
ATOM   4788  C C     . MET B 1 300 ? 100.06500 116.52600 78.02000  1.000 177.47000 ? 545 MET B C     1 
ATOM   4789  O O     . MET B 1 300 ? 99.80000  117.60200 77.47600  1.000 177.47000 ? 545 MET B O     1 
ATOM   4790  C CB    . MET B 1 300 ? 97.73500  116.08700 78.83000  1.000 177.47000 ? 545 MET B CB    1 
ATOM   4791  C CG    . MET B 1 300 ? 96.41100  115.46800 78.38400  1.000 177.47000 ? 545 MET B CG    1 
ATOM   4792  S SD    . MET B 1 300 ? 96.19600  113.71600 78.76100  1.000 177.47000 ? 545 MET B SD    1 
ATOM   4793  C CE    . MET B 1 300 ? 96.41400  112.94700 77.16100  1.000 177.47000 ? 545 MET B CE    1 
ATOM   4794  N N     . GLY B 1 301 ? 101.27300 116.24900 78.50500  1.000 172.90000 ? 546 GLY B N     1 
ATOM   4795  C CA    . GLY B 1 301 ? 102.45200 117.00800 78.13400  1.000 172.90000 ? 546 GLY B CA    1 
ATOM   4796  C C     . GLY B 1 301 ? 102.57600 118.43900 78.61800  1.000 172.90000 ? 546 GLY B C     1 
ATOM   4797  O O     . GLY B 1 301 ? 102.86100 119.33400 77.81900  1.000 172.90000 ? 546 GLY B O     1 
ATOM   4798  N N     . VAL B 1 302 ? 102.35200 118.67900 79.90800  1.000 168.58000 ? 547 VAL B N     1 
ATOM   4799  C CA    . VAL B 1 302 ? 102.78600 119.89900 80.57300  1.000 168.58000 ? 547 VAL B CA    1 
ATOM   4800  C C     . VAL B 1 302 ? 103.54400 119.50000 81.83300  1.000 168.58000 ? 547 VAL B C     1 
ATOM   4801  O O     . VAL B 1 302 ? 103.76100 118.31900 82.10000  1.000 168.58000 ? 547 VAL B O     1 
ATOM   4802  C CB    . VAL B 1 302 ? 101.62200 120.85800 80.91100  1.000 168.58000 ? 547 VAL B CB    1 
ATOM   4803  C CG1   . VAL B 1 302 ? 100.91700 121.34300 79.65600  1.000 168.58000 ? 547 VAL B CG1   1 
ATOM   4804  C CG2   . VAL B 1 302 ? 100.65000 120.20300 81.83800  1.000 168.58000 ? 547 VAL B CG2   1 
ATOM   4805  N N     . ARG B 1 303 ? 103.95000 120.50100 82.61000  1.000 164.33000 ? 548 ARG B N     1 
ATOM   4806  C CA    . ARG B 1 303 ? 104.78800 120.28100 83.77900  1.000 164.33000 ? 548 ARG B CA    1 
ATOM   4807  C C     . ARG B 1 303 ? 104.02300 120.42600 85.08800  1.000 164.33000 ? 548 ARG B C     1 
ATOM   4808  O O     . ARG B 1 303 ? 104.02300 119.50300 85.90500  1.000 164.33000 ? 548 ARG B O     1 
ATOM   4809  C CB    . ARG B 1 303 ? 105.97300 121.24700 83.73500  1.000 164.33000 ? 548 ARG B CB    1 
ATOM   4810  C CG    . ARG B 1 303 ? 106.97600 121.07300 84.84800  1.000 164.33000 ? 548 ARG B CG    1 
ATOM   4811  C CD    . ARG B 1 303 ? 108.17800 121.96500 84.60000  1.000 164.33000 ? 548 ARG B CD    1 
ATOM   4812  N NE    . ARG B 1 303 ? 107.84500 123.38600 84.63700  1.000 164.33000 ? 548 ARG B NE    1 
ATOM   4813  C CZ    . ARG B 1 303 ? 107.85500 124.18700 83.57500  1.000 164.33000 ? 548 ARG B CZ    1 
ATOM   4814  N NH1   . ARG B 1 303 ? 108.15600 123.70500 82.38000  1.000 164.33000 ? 548 ARG B NH1   1 
ATOM   4815  N NH2   . ARG B 1 303 ? 107.54300 125.46700 83.70400  1.000 164.33000 ? 548 ARG B NH2   1 
ATOM   4816  N N     . ASN B 1 304 ? 103.37200 121.56000 85.31300  1.000 172.58000 ? 549 ASN B N     1 
ATOM   4817  C CA    . ASN B 1 304 ? 102.65200 121.81500 86.55200  1.000 172.58000 ? 549 ASN B CA    1 
ATOM   4818  C C     . ASN B 1 304 ? 101.14600 121.69500 86.34300  1.000 172.58000 ? 549 ASN B C     1 
ATOM   4819  O O     . ASN B 1 304 ? 100.65000 121.75100 85.21500  1.000 172.58000 ? 549 ASN B O     1 
ATOM   4820  C CB    . ASN B 1 304 ? 103.03000 123.19300 87.11300  1.000 172.58000 ? 549 ASN B CB    1 
ATOM   4821  C CG    . ASN B 1 304 ? 102.90900 124.31100 86.08600  1.000 172.58000 ? 549 ASN B CG    1 
ATOM   4822  O OD1   . ASN B 1 304 ? 102.43900 124.10600 84.96700  1.000 172.58000 ? 549 ASN B OD1   1 
ATOM   4823  N ND2   . ASN B 1 304 ? 103.35900 125.50300 86.46400  1.000 172.58000 ? 549 ASN B ND2   1 
ATOM   4824  N N     . LEU B 1 305 ? 100.41600 121.52100 87.45300  1.000 168.11000 ? 550 LEU B N     1 
ATOM   4825  C CA    . LEU B 1 305 ? 98.97700  121.31800 87.32600  1.000 168.11000 ? 550 LEU B CA    1 
ATOM   4826  C C     . LEU B 1 305 ? 98.26100  122.60500 86.94200  1.000 168.11000 ? 550 LEU B C     1 
ATOM   4827  O O     . LEU B 1 305 ? 97.14300  122.54700 86.42800  1.000 168.11000 ? 550 LEU B O     1 
ATOM   4828  C CB    . LEU B 1 305 ? 98.34700  120.78300 88.61500  1.000 168.11000 ? 550 LEU B CB    1 
ATOM   4829  C CG    . LEU B 1 305 ? 97.07100  119.98200 88.28700  1.000 168.11000 ? 550 LEU B CG    1 
ATOM   4830  C CD1   . LEU B 1 305 ? 97.45100  118.57200 87.85900  1.000 168.11000 ? 550 LEU B CD1   1 
ATOM   4831  C CD2   . LEU B 1 305 ? 95.92700  120.00300 89.28100  1.000 168.11000 ? 550 LEU B CD2   1 
ATOM   4832  N N     . ALA B 1 306 ? 98.86700  123.76700 87.19500  1.000 172.08000 ? 551 ALA B N     1 
ATOM   4833  C CA    . ALA B 1 306 ? 98.30900  125.00300 86.66100  1.000 172.08000 ? 551 ALA B CA    1 
ATOM   4834  C C     . ALA B 1 306 ? 98.31800  124.97400 85.14100  1.000 172.08000 ? 551 ALA B C     1 
ATOM   4835  O O     . ALA B 1 306 ? 97.32300  125.33200 84.49500  1.000 172.08000 ? 551 ALA B O     1 
ATOM   4836  C CB    . ALA B 1 306 ? 99.09000  126.20300 87.18400  1.000 172.08000 ? 551 ALA B CB    1 
ATOM   4837  N N     . GLY B 1 307 ? 99.41800  124.48600 84.56200  1.000 175.11000 ? 552 GLY B N     1 
ATOM   4838  C CA    . GLY B 1 307 ? 99.44400  124.23500 83.13400  1.000 175.11000 ? 552 GLY B CA    1 
ATOM   4839  C C     . GLY B 1 307 ? 98.46500  123.15800 82.71600  1.000 175.11000 ? 552 GLY B C     1 
ATOM   4840  O O     . GLY B 1 307 ? 97.84800  123.25500 81.65400  1.000 175.11000 ? 552 GLY B O     1 
ATOM   4841  N N     . PHE B 1 308 ? 98.27700  122.14200 83.56400  1.000 180.79000 ? 553 PHE B N     1 
ATOM   4842  C CA    . PHE B 1 308 ? 97.34300  121.06300 83.25100  1.000 180.79000 ? 553 PHE B CA    1 
ATOM   4843  C C     . PHE B 1 308 ? 95.91200  121.56800 83.19100  1.000 180.79000 ? 553 PHE B C     1 
ATOM   4844  O O     . PHE B 1 308 ? 95.16300  121.23900 82.26600  1.000 180.79000 ? 553 PHE B O     1 
ATOM   4845  C CB    . PHE B 1 308 ? 97.46300  119.94800 84.28500  1.000 180.79000 ? 553 PHE B CB    1 
ATOM   4846  C CG    . PHE B 1 308 ? 96.49700  118.81900 84.08200  1.000 180.79000 ? 553 PHE B CG    1 
ATOM   4847  C CD1   . PHE B 1 308 ? 96.70300  117.88200 83.08200  1.000 180.79000 ? 553 PHE B CD1   1 
ATOM   4848  C CD2   . PHE B 1 308 ? 95.37900  118.68300 84.90100  1.000 180.79000 ? 553 PHE B CD2   1 
ATOM   4849  C CE1   . PHE B 1 308 ? 95.81500  116.83400 82.89900  1.000 180.79000 ? 553 PHE B CE1   1 
ATOM   4850  C CE2   . PHE B 1 308 ? 94.48500  117.63900 84.72100  1.000 180.79000 ? 553 PHE B CE2   1 
ATOM   4851  C CZ    . PHE B 1 308 ? 94.70400  116.71500 83.72100  1.000 180.79000 ? 553 PHE B CZ    1 
ATOM   4852  N N     . ASN B 1 309 ? 95.52000  122.37900 84.16500  1.000 180.61000 ? 554 ASN B N     1 
ATOM   4853  C CA    . ASN B 1 309 ? 94.16800  122.90400 84.17800  1.000 180.61000 ? 554 ASN B CA    1 
ATOM   4854  C C     . ASN B 1 309 ? 93.97500  123.95100 83.10100  1.000 180.61000 ? 554 ASN B C     1 
ATOM   4855  O O     . ASN B 1 309 ? 92.89000  124.02600 82.51900  1.000 180.61000 ? 554 ASN B O     1 
ATOM   4856  C CB    . ASN B 1 309 ? 93.82500  123.47100 85.55100  1.000 180.61000 ? 554 ASN B CB    1 
ATOM   4857  C CG    . ASN B 1 309 ? 93.70300  122.39400 86.60700  1.000 180.61000 ? 554 ASN B CG    1 
ATOM   4858  O OD1   . ASN B 1 309 ? 94.47400  122.35800 87.56200  1.000 180.61000 ? 554 ASN B OD1   1 
ATOM   4859  N ND2   . ASN B 1 309 ? 92.73000  121.50700 86.43700  1.000 180.61000 ? 554 ASN B ND2   1 
ATOM   4860  N N     . ARG B 1 310 ? 95.01800  124.72300 82.78500  1.000 183.84000 ? 555 ARG B N     1 
ATOM   4861  C CA    . ARG B 1 310 ? 94.91400  125.67100 81.68400  1.000 183.84000 ? 555 ARG B CA    1 
ATOM   4862  C C     . ARG B 1 310 ? 94.72700  124.95500 80.35400  1.000 183.84000 ? 555 ARG B C     1 
ATOM   4863  O O     . ARG B 1 310 ? 93.88600  125.35400 79.54200  1.000 183.84000 ? 555 ARG B O     1 
ATOM   4864  C CB    . ARG B 1 310 ? 96.15100  126.56000 81.64400  1.000 183.84000 ? 555 ARG B CB    1 
ATOM   4865  C CG    . ARG B 1 310 ? 96.13600  127.57400 80.51700  1.000 183.84000 ? 555 ARG B CG    1 
ATOM   4866  C CD    . ARG B 1 310 ? 95.02400  128.58900 80.71500  1.000 183.84000 ? 555 ARG B CD    1 
ATOM   4867  N NE    . ARG B 1 310 ? 94.99100  129.57500 79.64100  1.000 183.84000 ? 555 ARG B NE    1 
ATOM   4868  C CZ    . ARG B 1 310 ? 95.67500  130.71300 79.65400  1.000 183.84000 ? 555 ARG B CZ    1 
ATOM   4869  N NH1   . ARG B 1 310 ? 96.44700  131.01400 80.68700  1.000 183.84000 ? 555 ARG B NH1   1 
ATOM   4870  N NH2   . ARG B 1 310 ? 95.58600  131.55300 78.63200  1.000 183.84000 ? 555 ARG B NH2   1 
ATOM   4871  N N     . LYS B 1 311 ? 95.45100  123.85700 80.13900  1.000 189.63000 ? 556 LYS B N     1 
ATOM   4872  C CA    . LYS B 1 311 ? 95.32800  123.17400 78.86000  1.000 189.63000 ? 556 LYS B CA    1 
ATOM   4873  C C     . LYS B 1 311 ? 94.09000  122.29500 78.78500  1.000 189.63000 ? 556 LYS B C     1 
ATOM   4874  O O     . LYS B 1 311 ? 93.52300  122.15100 77.70200  1.000 189.63000 ? 556 LYS B O     1 
ATOM   4875  C CB    . LYS B 1 311 ? 96.58700  122.36300 78.55900  1.000 189.63000 ? 556 LYS B CB    1 
ATOM   4876  C CG    . LYS B 1 311 ? 97.88100  123.18700 78.43000  1.000 189.63000 ? 556 LYS B CG    1 
ATOM   4877  C CD    . LYS B 1 311 ? 97.91300  124.11500 77.21600  1.000 189.63000 ? 556 LYS B CD    1 
ATOM   4878  C CE    . LYS B 1 311 ? 97.67800  125.58200 77.58500  1.000 189.63000 ? 556 LYS B CE    1 
ATOM   4879  N NZ    . LYS B 1 311 ? 97.74900  126.47100 76.40200  1.000 189.63000 ? 556 LYS B NZ    1 
ATOM   4880  N N     . VAL B 1 312 ? 93.62200  121.73100 79.90100  1.000 192.70000 ? 557 VAL B N     1 
ATOM   4881  C CA    . VAL B 1 312 ? 92.35900  121.00300 79.83200  1.000 192.70000 ? 557 VAL B CA    1 
ATOM   4882  C C     . VAL B 1 312 ? 91.19400  121.98100 79.73700  1.000 192.70000 ? 557 VAL B C     1 
ATOM   4883  O O     . VAL B 1 312 ? 90.15400  121.63600 79.16900  1.000 192.70000 ? 557 VAL B O     1 
ATOM   4884  C CB    . VAL B 1 312 ? 92.20100  120.02000 81.01100  1.000 192.70000 ? 557 VAL B CB    1 
ATOM   4885  C CG1   . VAL B 1 312 ? 91.84900  120.72100 82.30700  1.000 192.70000 ? 557 VAL B CG1   1 
ATOM   4886  C CG2   . VAL B 1 312 ? 91.19000  118.92900 80.69100  1.000 192.70000 ? 557 VAL B CG2   1 
ATOM   4887  N N     . LYS B 1 313 ? 91.37500  123.22300 80.19500  1.000 201.08000 ? 558 LYS B N     1 
ATOM   4888  C CA    . LYS B 1 313 ? 90.39500  124.26700 79.94000  1.000 201.08000 ? 558 LYS B CA    1 
ATOM   4889  C C     . LYS B 1 313 ? 90.38400  124.63700 78.46600  1.000 201.08000 ? 558 LYS B C     1 
ATOM   4890  O O     . LYS B 1 313 ? 89.32200  124.70900 77.83800  1.000 201.08000 ? 558 LYS B O     1 
ATOM   4891  C CB    . LYS B 1 313 ? 90.71400  125.49000 80.79700  1.000 201.08000 ? 558 LYS B CB    1 
ATOM   4892  C CG    . LYS B 1 313 ? 89.68000  126.58400 80.72800  1.000 201.08000 ? 558 LYS B CG    1 
ATOM   4893  C CD    . LYS B 1 313 ? 88.42000  126.14900 81.44900  1.000 201.08000 ? 558 LYS B CD    1 
ATOM   4894  C CE    . LYS B 1 313 ? 87.40200  127.26800 81.51300  1.000 201.08000 ? 558 LYS B CE    1 
ATOM   4895  N NZ    . LYS B 1 313 ? 86.13700  126.80900 82.14700  1.000 201.08000 ? 558 LYS B NZ    1 
ATOM   4896  N N     . ASP B 1 314 ? 91.56700  124.83800 77.88900  1.000 198.77000 ? 559 ASP B N     1 
ATOM   4897  C CA    . ASP B 1 314 ? 91.68300  125.14400 76.47100  1.000 198.77000 ? 559 ASP B CA    1 
ATOM   4898  C C     . ASP B 1 314 ? 91.35400  123.95600 75.57800  1.000 198.77000 ? 559 ASP B C     1 
ATOM   4899  O O     . ASP B 1 314 ? 91.21900  124.14100 74.36700  1.000 198.77000 ? 559 ASP B O     1 
ATOM   4900  C CB    . ASP B 1 314 ? 93.09100  125.65100 76.17800  1.000 198.77000 ? 559 ASP B CB    1 
ATOM   4901  C CG    . ASP B 1 314 ? 93.37100  126.97600 76.84500  1.000 198.77000 ? 559 ASP B CG    1 
ATOM   4902  O OD1   . ASP B 1 314 ? 92.40700  127.74100 77.06000  1.000 198.77000 ? 559 ASP B OD1   1 
ATOM   4903  O OD2   . ASP B 1 314 ? 94.54800  127.24900 77.16100  1.000 198.77000 ? 559 ASP B OD2   1 
ATOM   4904  N N     . ALA B 1 315 ? 91.24500  122.75600 76.14400  1.000 209.55000 ? 560 ALA B N     1 
ATOM   4905  C CA    . ALA B 1 315 ? 90.77100  121.56800 75.45000  1.000 209.55000 ? 560 ALA B CA    1 
ATOM   4906  C C     . ALA B 1 315 ? 89.26400  121.37900 75.54800  1.000 209.55000 ? 560 ALA B C     1 
ATOM   4907  O O     . ALA B 1 315 ? 88.62700  121.01700 74.55400  1.000 209.55000 ? 560 ALA B O     1 
ATOM   4908  C CB    . ALA B 1 315 ? 91.47100  120.32100 76.00000  1.000 209.55000 ? 560 ALA B CB    1 
ATOM   4909  N N     . GLU B 1 316 ? 88.67100  121.59800 76.72200  1.000 208.76000 ? 561 GLU B N     1 
ATOM   4910  C CA    . GLU B 1 316 ? 87.22700  121.44500 76.84000  1.000 208.76000 ? 561 GLU B CA    1 
ATOM   4911  C C     . GLU B 1 316 ? 86.49300  122.60500 76.17700  1.000 208.76000 ? 561 GLU B C     1 
ATOM   4912  O O     . GLU B 1 316 ? 85.46800  122.39600 75.51700  1.000 208.76000 ? 561 GLU B O     1 
ATOM   4913  C CB    . GLU B 1 316 ? 86.82000  121.30300 78.30500  1.000 208.76000 ? 561 GLU B CB    1 
ATOM   4914  C CG    . GLU B 1 316 ? 87.23300  119.97800 78.92200  1.000 208.76000 ? 561 GLU B CG    1 
ATOM   4915  C CD    . GLU B 1 316 ? 86.75800  119.81900 80.35700  1.000 208.76000 ? 561 GLU B CD    1 
ATOM   4916  O OE1   . GLU B 1 316 ? 86.21400  120.79100 80.92100  1.000 208.76000 ? 561 GLU B OE1   1 
ATOM   4917  O OE2   . GLU B 1 316 ? 86.92000  118.71600 80.92000  1.000 208.76000 ? 561 GLU B OE2   1 
ATOM   4918  N N     . GLU B 1 317 ? 87.00600  123.82900 76.31300  1.000 208.81000 ? 562 GLU B N     1 
ATOM   4919  C CA    . GLU B 1 317 ? 86.46800  124.96500 75.57900  1.000 208.81000 ? 562 GLU B CA    1 
ATOM   4920  C C     . GLU B 1 317 ? 87.08900  125.12400 74.20100  1.000 208.81000 ? 562 GLU B C     1 
ATOM   4921  O O     . GLU B 1 317 ? 86.86500  126.14700 73.54800  1.000 208.81000 ? 562 GLU B O     1 
ATOM   4922  C CB    . GLU B 1 317 ? 86.61900  126.24700 76.39800  1.000 208.81000 ? 562 GLU B CB    1 
ATOM   4923  C CG    . GLU B 1 317 ? 85.48800  126.46400 77.40900  1.000 208.81000 ? 562 GLU B CG    1 
ATOM   4924  C CD    . GLU B 1 317 ? 85.63200  125.66500 78.68900  1.000 208.81000 ? 562 GLU B CD    1 
ATOM   4925  O OE1   . GLU B 1 317 ? 86.65000  124.97200 78.87000  1.000 208.81000 ? 562 GLU B OE1   1 
ATOM   4926  O OE2   . GLU B 1 317 ? 84.70400  125.73300 79.52400  1.000 208.81000 ? 562 GLU B OE2   1 
ATOM   4927  N N     . ALA B 1 318 ? 87.86400  124.13900 73.74700  1.000 207.40000 ? 563 ALA B N     1 
ATOM   4928  C CA    . ALA B 1 318 ? 87.97800  123.89700 72.31800  1.000 207.40000 ? 563 ALA B CA    1 
ATOM   4929  C C     . ALA B 1 318 ? 86.77800  123.12900 71.79100  1.000 207.40000 ? 563 ALA B C     1 
ATOM   4930  O O     . ALA B 1 318 ? 86.60800  123.02600 70.57200  1.000 207.40000 ? 563 ALA B O     1 
ATOM   4931  C CB    . ALA B 1 318 ? 89.25400  123.12500 71.99100  1.000 207.40000 ? 563 ALA B CB    1 
ATOM   4932  N N     . GLY B 1 319 ? 85.95300  122.58100 72.68300  1.000 213.31000 ? 564 GLY B N     1 
ATOM   4933  C CA    . GLY B 1 319 ? 84.76300  121.85800 72.30400  1.000 213.31000 ? 564 GLY B CA    1 
ATOM   4934  C C     . GLY B 1 319 ? 84.97900  120.40700 71.95300  1.000 213.31000 ? 564 GLY B C     1 
ATOM   4935  O O     . GLY B 1 319 ? 84.00500  119.71400 71.63700  1.000 213.31000 ? 564 GLY B O     1 
ATOM   4936  N N     . THR B 1 320 ? 86.21200  119.92400 71.99000  1.000 214.36000 ? 565 THR B N     1 
ATOM   4937  C CA    . THR B 1 320 ? 86.46400  118.54500 71.59500  1.000 214.36000 ? 565 THR B CA    1 
ATOM   4938  C C     . THR B 1 320 ? 86.29100  117.60600 72.78700  1.000 214.36000 ? 565 THR B C     1 
ATOM   4939  O O     . THR B 1 320 ? 86.82100  117.87300 73.87100  1.000 214.36000 ? 565 THR B O     1 
ATOM   4940  C CB    . THR B 1 320 ? 87.85700  118.39400 70.95900  1.000 214.36000 ? 565 THR B CB    1 
ATOM   4941  O OG1   . THR B 1 320 ? 88.11200  117.01300 70.67400  1.000 214.36000 ? 565 THR B OG1   1 
ATOM   4942  C CG2   . THR B 1 320 ? 88.98600  118.99700 71.81200  1.000 214.36000 ? 565 THR B CG2   1 
ATOM   4943  N N     . PRO B 1 321 ? 85.50500  116.54800 72.64900  1.000 216.35000 ? 566 PRO B N     1 
ATOM   4944  C CA    . PRO B 1 321 ? 85.41300  115.53600 73.71500  1.000 216.35000 ? 566 PRO B CA    1 
ATOM   4945  C C     . PRO B 1 321 ? 86.62000  114.60600 73.66800  1.000 216.35000 ? 566 PRO B C     1 
ATOM   4946  O O     . PRO B 1 321 ? 86.62100  113.55800 73.02400  1.000 216.35000 ? 566 PRO B O     1 
ATOM   4947  C CB    . PRO B 1 321 ? 84.11000  114.80500 73.37900  1.000 216.35000 ? 566 PRO B CB    1 
ATOM   4948  C CG    . PRO B 1 321 ? 83.35500  115.72700 72.48500  1.000 216.35000 ? 566 PRO B CG    1 
ATOM   4949  C CD    . PRO B 1 321 ? 84.40900  116.41300 71.68000  1.000 216.35000 ? 566 PRO B CD    1 
ATOM   4950  N N     . LEU B 1 322 ? 87.70100  115.02500 74.33100  1.000 213.46000 ? 567 LEU B N     1 
ATOM   4951  C CA    . LEU B 1 322 ? 88.88300  114.17400 74.41500  1.000 213.46000 ? 567 LEU B CA    1 
ATOM   4952  C C     . LEU B 1 322 ? 88.59800  112.92700 75.25200  1.000 213.46000 ? 567 LEU B C     1 
ATOM   4953  O O     . LEU B 1 322 ? 88.58400  111.81500 74.70900  1.000 213.46000 ? 567 LEU B O     1 
ATOM   4954  C CB    . LEU B 1 322 ? 90.08800  114.98200 74.93100  1.000 213.46000 ? 567 LEU B CB    1 
ATOM   4955  C CG    . LEU B 1 322 ? 90.33200  115.62400 76.31000  1.000 213.46000 ? 567 LEU B CG    1 
ATOM   4956  C CD1   . LEU B 1 322 ? 91.80100  115.98000 76.48400  1.000 213.46000 ? 567 LEU B CD1   1 
ATOM   4957  C CD2   . LEU B 1 322 ? 89.45800  116.85100 76.52900  1.000 213.46000 ? 567 LEU B CD2   1 
ATOM   4958  N N     . THR B 1 323 ? 88.26700  113.11500 76.54100  1.000 211.74000 ? 568 THR B N     1 
ATOM   4959  C CA    . THR B 1 323 ? 87.92200  112.07300 77.52800  1.000 211.74000 ? 568 THR B CA    1 
ATOM   4960  C C     . THR B 1 323 ? 88.85000  110.86400 77.44600  1.000 211.74000 ? 568 THR B C     1 
ATOM   4961  O O     . THR B 1 323 ? 88.41000  109.71500 77.35500  1.000 211.74000 ? 568 THR B O     1 
ATOM   4962  C CB    . THR B 1 323 ? 86.46200  111.64500 77.38700  1.000 211.74000 ? 568 THR B CB    1 
ATOM   4963  O OG1   . THR B 1 323 ? 86.24900  111.05800 76.09800  1.000 211.74000 ? 568 THR B OG1   1 
ATOM   4964  C CG2   . THR B 1 323 ? 85.54500  112.84400 77.55100  1.000 211.74000 ? 568 THR B CG2   1 
ATOM   4965  N N     . ASP B 1 324 ? 90.15200  111.15500 77.45800  1.000 208.69000 ? 569 ASP B N     1 
ATOM   4966  C CA    . ASP B 1 324 ? 91.14900  110.20100 76.97800  1.000 208.69000 ? 569 ASP B CA    1 
ATOM   4967  C C     . ASP B 1 324 ? 91.25800  108.92100 77.80300  1.000 208.69000 ? 569 ASP B C     1 
ATOM   4968  O O     . ASP B 1 324 ? 91.62200  107.88700 77.21800  1.000 208.69000 ? 569 ASP B O     1 
ATOM   4969  C CB    . ASP B 1 324 ? 92.51000  110.90400 76.88700  1.000 208.69000 ? 569 ASP B CB    1 
ATOM   4970  C CG    . ASP B 1 324 ? 92.50100  112.04800 75.89800  1.000 208.69000 ? 569 ASP B CG    1 
ATOM   4971  O OD1   . ASP B 1 324 ? 91.69800  112.00300 74.94300  1.000 208.69000 ? 569 ASP B OD1   1 
ATOM   4972  O OD2   . ASP B 1 324 ? 93.29200  112.99700 76.07900  1.000 208.69000 ? 569 ASP B OD2   1 
ATOM   4973  N N     . PRO B 1 325 ? 90.98700  108.90600 79.11700  1.000 199.94000 ? 570 PRO B N     1 
ATOM   4974  C CA    . PRO B 1 325 ? 90.67300  107.58100 79.65800  1.000 199.94000 ? 570 PRO B CA    1 
ATOM   4975  C C     . PRO B 1 325 ? 89.27400  107.11200 79.26700  1.000 199.94000 ? 570 PRO B C     1 
ATOM   4976  O O     . PRO B 1 325 ? 88.30300  107.77700 79.62200  1.000 199.94000 ? 570 PRO B O     1 
ATOM   4977  C CB    . PRO B 1 325 ? 90.77500  107.78700 81.16700  1.000 199.94000 ? 570 PRO B CB    1 
ATOM   4978  C CG    . PRO B 1 325 ? 91.70500  108.93500 81.32200  1.000 199.94000 ? 570 PRO B CG    1 
ATOM   4979  C CD    . PRO B 1 325 ? 91.39000  109.84000 80.18400  1.000 199.94000 ? 570 PRO B CD    1 
ATOM   4980  N N     . LEU B 1 342 ? 89.10800  119.71900 84.64300  1.000 148.14000 ? 587 LEU B N     1 
ATOM   4981  C CA    . LEU B 1 342 ? 88.91000  119.03100 85.91400  1.000 148.14000 ? 587 LEU B CA    1 
ATOM   4982  C C     . LEU B 1 342 ? 89.30200  119.97200 87.04800  1.000 148.14000 ? 587 LEU B C     1 
ATOM   4983  O O     . LEU B 1 342 ? 90.34100  120.62300 86.98000  1.000 148.14000 ? 587 LEU B O     1 
ATOM   4984  C CB    . LEU B 1 342 ? 89.71200  117.72600 85.96400  1.000 148.14000 ? 587 LEU B CB    1 
ATOM   4985  C CG    . LEU B 1 342 ? 89.03800  116.43900 85.45900  1.000 148.14000 ? 587 LEU B CG    1 
ATOM   4986  C CD1   . LEU B 1 342 ? 87.84700  116.07600 86.32500  1.000 148.14000 ? 587 LEU B CD1   1 
ATOM   4987  C CD2   . LEU B 1 342 ? 88.61800  116.49700 83.99400  1.000 148.14000 ? 587 LEU B CD2   1 
ATOM   4988  N N     . PRO B 1 343 ? 88.47200  120.03800 88.08500  1.000 142.42000 ? 588 PRO B N     1 
ATOM   4989  C CA    . PRO B 1 343 ? 88.54200  121.15300 89.02900  1.000 142.42000 ? 588 PRO B CA    1 
ATOM   4990  C C     . PRO B 1 343 ? 89.71100  121.02600 89.99300  1.000 142.42000 ? 588 PRO B C     1 
ATOM   4991  O O     . PRO B 1 343 ? 90.40600  120.01300 90.06000  1.000 142.42000 ? 588 PRO B O     1 
ATOM   4992  C CB    . PRO B 1 343 ? 87.21200  121.04900 89.77700  1.000 142.42000 ? 588 PRO B CB    1 
ATOM   4993  C CG    . PRO B 1 343 ? 86.91400  119.61100 89.76800  1.000 142.42000 ? 588 PRO B CG    1 
ATOM   4994  C CD    . PRO B 1 343 ? 87.39500  119.09800 88.44400  1.000 142.42000 ? 588 PRO B CD    1 
ATOM   4995  N N     . THR B 1 344 ? 89.90200  122.09700 90.75400  1.000 143.91000 ? 589 THR B N     1 
ATOM   4996  C CA    . THR B 1 344 ? 90.87400  122.11300 91.82900  1.000 143.91000 ? 589 THR B CA    1 
ATOM   4997  C C     . THR B 1 344 ? 90.41800  121.20700 92.96300  1.000 143.91000 ? 589 THR B C     1 
ATOM   4998  O O     . THR B 1 344 ? 89.27000  120.76200 93.01500  1.000 143.91000 ? 589 THR B O     1 
ATOM   4999  C CB    . THR B 1 344 ? 91.06100  123.53100 92.36100  1.000 143.91000 ? 589 THR B CB    1 
ATOM   5000  O OG1   . THR B 1 344 ? 89.81600  124.00000 92.89000  1.000 143.91000 ? 589 THR B OG1   1 
ATOM   5001  C CG2   . THR B 1 344 ? 91.49500  124.46200 91.25300  1.000 143.91000 ? 589 THR B CG2   1 
ATOM   5002  N N     . ILE B 1 345 ? 91.33000  120.94800 93.89000  1.000 145.72000 ? 590 ILE B N     1 
ATOM   5003  C CA    . ILE B 1 345 ? 91.02200  120.11400 95.04400  1.000 145.72000 ? 590 ILE B CA    1 
ATOM   5004  C C     . ILE B 1 345 ? 91.90100  120.53300 96.21400  1.000 145.72000 ? 590 ILE B C     1 
ATOM   5005  O O     . ILE B 1 345 ? 93.12900  120.55400 96.11200  1.000 145.72000 ? 590 ILE B O     1 
ATOM   5006  C CB    . ILE B 1 345 ? 91.17400  118.61700 94.70100  1.000 145.72000 ? 590 ILE B CB    1 
ATOM   5007  C CG1   . ILE B 1 345 ? 91.01100  117.75100 95.95200  1.000 145.72000 ? 590 ILE B CG1   1 
ATOM   5008  C CG2   . ILE B 1 345 ? 92.44400  118.34600 93.88300  1.000 145.72000 ? 590 ILE B CG2   1 
ATOM   5009  C CD1   . ILE B 1 345 ? 89.63400  117.79700 96.55600  1.000 145.72000 ? 590 ILE B CD1   1 
ATOM   5010  N N     . VAL B 1 346 ? 91.27400  120.87700 97.32900  1.000 155.45000 ? 591 VAL B N     1 
ATOM   5011  C CA    . VAL B 1 346 ? 92.00900  121.27800 98.51800  1.000 155.45000 ? 591 VAL B CA    1 
ATOM   5012  C C     . VAL B 1 346 ? 91.70600  120.29200 99.63200  1.000 155.45000 ? 591 VAL B C     1 
ATOM   5013  O O     . VAL B 1 346 ? 90.62300  119.70500 99.69500  1.000 155.45000 ? 591 VAL B O     1 
ATOM   5014  C CB    . VAL B 1 346 ? 91.66800  122.71900 98.94500  1.000 155.45000 ? 591 VAL B CB    1 
ATOM   5015  C CG1   . VAL B 1 346 ? 92.11500  123.68800 97.88000  1.000 155.45000 ? 591 VAL B CG1   1 
ATOM   5016  C CG2   . VAL B 1 346 ? 90.18700  122.87000 99.16800  1.000 155.45000 ? 591 VAL B CG2   1 
ATOM   5017  N N     . VAL B 1 347 ? 92.68600  120.08600 100.50100 1.000 152.89000 ? 592 VAL B N     1 
ATOM   5018  C CA    . VAL B 1 347 ? 92.55000  119.16000 101.61300 1.000 152.89000 ? 592 VAL B CA    1 
ATOM   5019  C C     . VAL B 1 347 ? 92.69000  119.98200 102.88200 1.000 152.89000 ? 592 VAL B C     1 
ATOM   5020  O O     . VAL B 1 347 ? 93.77800  120.48800 103.18200 1.000 152.89000 ? 592 VAL B O     1 
ATOM   5021  C CB    . VAL B 1 347 ? 93.59000  118.03900 101.56300 1.000 152.89000 ? 592 VAL B CB    1 
ATOM   5022  C CG1   . VAL B 1 347 ? 93.31600  117.04000 102.64700 1.000 152.89000 ? 592 VAL B CG1   1 
ATOM   5023  C CG2   . VAL B 1 347 ? 93.57900  117.37300 100.21600 1.000 152.89000 ? 592 VAL B CG2   1 
ATOM   5024  N N     . VAL B 1 348 ? 91.60300  120.10300 103.63700 1.000 153.87000 ? 593 VAL B N     1 
ATOM   5025  C CA    . VAL B 1 348 ? 91.55000  121.05200 104.74200 1.000 153.87000 ? 593 VAL B CA    1 
ATOM   5026  C C     . VAL B 1 348 ? 91.65500  120.30100 106.05900 1.000 153.87000 ? 593 VAL B C     1 
ATOM   5027  O O     . VAL B 1 348 ? 91.04800  120.68700 107.06500 1.000 153.87000 ? 593 VAL B O     1 
ATOM   5028  C CB    . VAL B 1 348 ? 90.29200  121.93500 104.66200 1.000 153.87000 ? 593 VAL B CB    1 
ATOM   5029  C CG1   . VAL B 1 348 ? 90.38900  122.83300 103.45800 1.000 153.87000 ? 593 VAL B CG1   1 
ATOM   5030  C CG2   . VAL B 1 348 ? 89.05200  121.10200 104.52500 1.000 153.87000 ? 593 VAL B CG2   1 
ATOM   5031  N N     . VAL B 1 349 ? 92.40100  119.19600 106.02100 1.000 151.06000 ? 594 VAL B N     1 
ATOM   5032  C CA    . VAL B 1 349 ? 92.75000  118.40700 107.19600 1.000 151.06000 ? 594 VAL B CA    1 
ATOM   5033  C C     . VAL B 1 349 ? 93.35100  119.28000 108.28700 1.000 151.06000 ? 594 VAL B C     1 
ATOM   5034  O O     . VAL B 1 349 ? 94.16500  120.17100 108.02600 1.000 151.06000 ? 594 VAL B O     1 
ATOM   5035  C CB    . VAL B 1 349 ? 93.69900  117.27100 106.76800 1.000 151.06000 ? 594 VAL B CB    1 
ATOM   5036  C CG1   . VAL B 1 349 ? 94.81600  117.81700 105.91300 1.000 151.06000 ? 594 VAL B CG1   1 
ATOM   5037  C CG2   . VAL B 1 349 ? 94.29400  116.54400 107.97300 1.000 151.06000 ? 594 VAL B CG2   1 
ATOM   5038  N N     . ASP B 1 350 ? 92.89200  119.06400 109.51400 1.000 157.52000 ? 595 ASP B N     1 
ATOM   5039  C CA    . ASP B 1 350 ? 93.44600  119.72300 110.67900 1.000 157.52000 ? 595 ASP B CA    1 
ATOM   5040  C C     . ASP B 1 350 ? 93.34800  118.78800 111.87700 1.000 157.52000 ? 595 ASP B C     1 
ATOM   5041  O O     . ASP B 1 350 ? 92.72700  117.72300 111.80700 1.000 157.52000 ? 595 ASP B O     1 
ATOM   5042  C CB    . ASP B 1 350 ? 92.74700  121.06000 110.92600 1.000 157.52000 ? 595 ASP B CB    1 
ATOM   5043  C CG    . ASP B 1 350 ? 91.25100  120.94800 110.87600 1.000 157.52000 ? 595 ASP B CG    1 
ATOM   5044  O OD1   . ASP B 1 350 ? 90.75100  119.86700 110.50500 1.000 157.52000 ? 595 ASP B OD1   1 
ATOM   5045  O OD2   . ASP B 1 350 ? 90.57800  121.94300 111.21000 1.000 157.52000 ? 595 ASP B OD2   1 
ATOM   5046  N N     . GLU B 1 351 ? 93.95300  119.22700 112.98800 1.000 165.50000 ? 596 GLU B N     1 
ATOM   5047  C CA    . GLU B 1 351 ? 94.25100  118.39900 114.16600 1.000 165.50000 ? 596 GLU B CA    1 
ATOM   5048  C C     . GLU B 1 351 ? 94.94300  117.10100 113.76700 1.000 165.50000 ? 596 GLU B C     1 
ATOM   5049  O O     . GLU B 1 351 ? 94.59700  116.01100 114.22500 1.000 165.50000 ? 596 GLU B O     1 
ATOM   5050  C CB    . GLU B 1 351 ? 93.00700  118.11500 115.00500 1.000 165.50000 ? 596 GLU B CB    1 
ATOM   5051  C CG    . GLU B 1 351 ? 92.47700  119.31500 115.73100 1.000 165.50000 ? 596 GLU B CG    1 
ATOM   5052  C CD    . GLU B 1 351 ? 91.44300  120.05800 114.93300 1.000 165.50000 ? 596 GLU B CD    1 
ATOM   5053  O OE1   . GLU B 1 351 ? 91.07400  119.56900 113.84800 1.000 165.50000 ? 596 GLU B OE1   1 
ATOM   5054  O OE2   . GLU B 1 351 ? 90.99000  121.12700 115.39100 1.000 165.50000 ? 596 GLU B OE2   1 
ATOM   5055  N N     . PHE B 1 352 ? 95.95900  117.23300 112.91900 1.000 167.79000 ? 597 PHE B N     1 
ATOM   5056  C CA    . PHE B 1 352 ? 96.63600  116.06600 112.37800 1.000 167.79000 ? 597 PHE B CA    1 
ATOM   5057  C C     . PHE B 1 352 ? 97.54800  115.37900 113.38400 1.000 167.79000 ? 597 PHE B C     1 
ATOM   5058  O O     . PHE B 1 352 ? 98.12200  114.33700 113.05100 1.000 167.79000 ? 597 PHE B O     1 
ATOM   5059  C CB    . PHE B 1 352 ? 97.42800  116.45800 111.12500 1.000 167.79000 ? 597 PHE B CB    1 
ATOM   5060  C CG    . PHE B 1 352 ? 98.47800  117.52600 111.35300 1.000 167.79000 ? 597 PHE B CG    1 
ATOM   5061  C CD1   . PHE B 1 352 ? 99.77500  117.18700 111.71400 1.000 167.79000 ? 597 PHE B CD1   1 
ATOM   5062  C CD2   . PHE B 1 352 ? 98.17500  118.87000 111.16800 1.000 167.79000 ? 597 PHE B CD2   1 
ATOM   5063  C CE1   . PHE B 1 352 ? 100.72900 118.15500 111.91400 1.000 167.79000 ? 597 PHE B CE1   1 
ATOM   5064  C CE2   . PHE B 1 352 ? 99.14100  119.84600 111.35700 1.000 167.79000 ? 597 PHE B CE2   1 
ATOM   5065  C CZ    . PHE B 1 352 ? 100.41500 119.48600 111.73300 1.000 167.79000 ? 597 PHE B CZ    1 
ATOM   5066  N N     . ALA B 1 353 ? 97.71700  115.94600 114.58000 1.000 168.78000 ? 598 ALA B N     1 
ATOM   5067  C CA    . ALA B 1 353 ? 98.53400  115.31200 115.60400 1.000 168.78000 ? 598 ALA B CA    1 
ATOM   5068  C C     . ALA B 1 353 ? 97.94300  113.98700 116.05700 1.000 168.78000 ? 598 ALA B C     1 
ATOM   5069  O O     . ALA B 1 353 ? 98.69000  113.05900 116.38400 1.000 168.78000 ? 598 ALA B O     1 
ATOM   5070  C CB    . ALA B 1 353 ? 98.68700  116.24800 116.79700 1.000 168.78000 ? 598 ALA B CB    1 
ATOM   5071  N N     . ASP B 1 354 ? 96.61300  113.87500 116.06400 1.000 165.12000 ? 599 ASP B N     1 
ATOM   5072  C CA    . ASP B 1 354 ? 95.97700  112.64300 116.51200 1.000 165.12000 ? 599 ASP B CA    1 
ATOM   5073  C C     . ASP B 1 354 ? 96.19200  111.50700 115.52300 1.000 165.12000 ? 599 ASP B C     1 
ATOM   5074  O O     . ASP B 1 354 ? 96.29900  110.34900 115.93400 1.000 165.12000 ? 599 ASP B O     1 
ATOM   5075  C CB    . ASP B 1 354 ? 94.48800  112.87400 116.74100 1.000 165.12000 ? 599 ASP B CB    1 
ATOM   5076  C CG    . ASP B 1 354 ? 94.21300  113.78400 117.91700 1.000 165.12000 ? 599 ASP B CG    1 
ATOM   5077  O OD1   . ASP B 1 354 ? 95.02700  113.80300 118.86100 1.000 165.12000 ? 599 ASP B OD1   1 
ATOM   5078  O OD2   . ASP B 1 354 ? 93.17900  114.48000 117.90300 1.000 165.12000 ? 599 ASP B OD2   1 
ATOM   5079  N N     . MET B 1 355 ? 96.26200  111.81400 114.22700 1.000 170.66000 ? 600 MET B N     1 
ATOM   5080  C CA    . MET B 1 355 ? 96.63600  110.79800 113.24900 1.000 170.66000 ? 600 MET B CA    1 
ATOM   5081  C C     . MET B 1 355 ? 98.07100  110.34300 113.46800 1.000 170.66000 ? 600 MET B C     1 
ATOM   5082  O O     . MET B 1 355 ? 98.35100  109.14600 113.58100 1.000 170.66000 ? 600 MET B O     1 
ATOM   5083  C CB    . MET B 1 355 ? 96.46900  111.34200 111.83400 1.000 170.66000 ? 600 MET B CB    1 
ATOM   5084  C CG    . MET B 1 355 ? 95.04900  111.63600 111.43600 1.000 170.66000 ? 600 MET B CG    1 
ATOM   5085  S SD    . MET B 1 355 ? 95.00400  112.39600 109.80800 1.000 170.66000 ? 600 MET B SD    1 
ATOM   5086  C CE    . MET B 1 355 ? 95.40300  111.00600 108.75700 1.000 170.66000 ? 600 MET B CE    1 
ATOM   5087  N N     . MET B 1 356 ? 98.98900  111.29800 113.58400 1.000 175.46000 ? 601 MET B N     1 
ATOM   5088  C CA    . MET B 1 356 ? 100.40500 110.98300 113.67900 1.000 175.46000 ? 601 MET B CA    1 
ATOM   5089  C C     . MET B 1 356 ? 100.81100 110.46600 115.05400 1.000 175.46000 ? 601 MET B C     1 
ATOM   5090  O O     . MET B 1 356 ? 101.97200 110.08600 115.23200 1.000 175.46000 ? 601 MET B O     1 
ATOM   5091  C CB    . MET B 1 356 ? 101.20700 112.22500 113.29100 1.000 175.46000 ? 601 MET B CB    1 
ATOM   5092  C CG    . MET B 1 356 ? 100.95400 112.63100 111.84200 1.000 175.46000 ? 601 MET B CG    1 
ATOM   5093  S SD    . MET B 1 356 ? 101.68500 114.18700 111.31500 1.000 175.46000 ? 601 MET B SD    1 
ATOM   5094  C CE    . MET B 1 356 ? 103.42100 113.76400 111.25600 1.000 175.46000 ? 601 MET B CE    1 
ATOM   5095  N N     . MET B 1 357 ? 99.89400  110.43900 116.02200 1.000 172.17000 ? 602 MET B N     1 
ATOM   5096  C CA    . MET B 1 357 ? 100.15300 109.79500 117.30200 1.000 172.17000 ? 602 MET B CA    1 
ATOM   5097  C C     . MET B 1 357 ? 99.36400  108.51200 117.51400 1.000 172.17000 ? 602 MET B C     1 
ATOM   5098  O O     . MET B 1 357 ? 99.85600  107.61400 118.20400 1.000 172.17000 ? 602 MET B O     1 
ATOM   5099  C CB    . MET B 1 357 ? 99.84700  110.74700 118.46500 1.000 172.17000 ? 602 MET B CB    1 
ATOM   5100  C CG    . MET B 1 357 ? 100.83200 111.88800 118.62200 1.000 172.17000 ? 602 MET B CG    1 
ATOM   5101  S SD    . MET B 1 357 ? 100.53000 112.87700 120.09800 1.000 172.17000 ? 602 MET B SD    1 
ATOM   5102  C CE    . MET B 1 357 ? 99.07000  113.78300 119.61000 1.000 172.17000 ? 602 MET B CE    1 
ATOM   5103  N N     . ILE B 1 358 ? 98.16300  108.38900 116.94900 1.000 173.14000 ? 603 ILE B N     1 
ATOM   5104  C CA    . ILE B 1 358 ? 97.22700  107.32700 117.31600 1.000 173.14000 ? 603 ILE B CA    1 
ATOM   5105  C C     . ILE B 1 358 ? 97.27100  106.15900 116.33100 1.000 173.14000 ? 603 ILE B C     1 
ATOM   5106  O O     . ILE B 1 358 ? 97.56400  105.02600 116.71800 1.000 173.14000 ? 603 ILE B O     1 
ATOM   5107  C CB    . ILE B 1 358 ? 95.79300  107.87800 117.47900 1.000 173.14000 ? 603 ILE B CB    1 
ATOM   5108  C CG1   . ILE B 1 358 ? 95.71600  108.78700 118.70700 1.000 173.14000 ? 603 ILE B CG1   1 
ATOM   5109  C CG2   . ILE B 1 358 ? 94.79800  106.74800 117.63200 1.000 173.14000 ? 603 ILE B CG2   1 
ATOM   5110  C CD1   . ILE B 1 358 ? 94.42300  109.56000 118.81500 1.000 173.14000 ? 603 ILE B CD1   1 
ATOM   5111  N N     . VAL B 1 359 ? 96.97500  106.40900 115.05400 1.000 176.93000 ? 604 VAL B N     1 
ATOM   5112  C CA    . VAL B 1 359 ? 96.90100  105.28900 114.11700 1.000 176.93000 ? 604 VAL B CA    1 
ATOM   5113  C C     . VAL B 1 359 ? 98.28800  104.81700 113.67800 1.000 176.93000 ? 604 VAL B C     1 
ATOM   5114  O O     . VAL B 1 359 ? 98.50400  103.60500 113.54000 1.000 176.93000 ? 604 VAL B O     1 
ATOM   5115  C CB    . VAL B 1 359 ? 95.96300  105.65500 112.94700 1.000 176.93000 ? 604 VAL B CB    1 
ATOM   5116  C CG1   . VAL B 1 359 ? 96.39400  106.90600 112.28100 1.000 176.93000 ? 604 VAL B CG1   1 
ATOM   5117  C CG2   . VAL B 1 359 ? 95.86700  104.52900 111.91500 1.000 176.93000 ? 604 VAL B CG2   1 
ATOM   5118  N N     . GLY B 1 360 ? 99.25500  105.71600 113.51800 1.000 178.76000 ? 605 GLY B N     1 
ATOM   5119  C CA    . GLY B 1 360 ? 100.61600 105.25400 113.33800 1.000 178.76000 ? 605 GLY B CA    1 
ATOM   5120  C C     . GLY B 1 360 ? 101.46200 105.98900 112.32400 1.000 178.76000 ? 605 GLY B C     1 
ATOM   5121  O O     . GLY B 1 360 ? 101.14400 107.10700 111.91100 1.000 178.76000 ? 605 GLY B O     1 
ATOM   5122  N N     . LYS B 1 361 ? 102.55000 105.34500 111.90900 1.000 177.50000 ? 606 LYS B N     1 
ATOM   5123  C CA    . LYS B 1 361 ? 103.55100 105.97200 111.06200 1.000 177.50000 ? 606 LYS B CA    1 
ATOM   5124  C C     . LYS B 1 361 ? 103.12700 106.03600 109.60100 1.000 177.50000 ? 606 LYS B C     1 
ATOM   5125  O O     . LYS B 1 361 ? 103.68900 106.83600 108.84100 1.000 177.50000 ? 606 LYS B O     1 
ATOM   5126  C CB    . LYS B 1 361 ? 104.88000 105.21300 111.20700 1.000 177.50000 ? 606 LYS B CB    1 
ATOM   5127  C CG    . LYS B 1 361 ? 106.12800 105.93700 110.70600 1.000 177.50000 ? 606 LYS B CG    1 
ATOM   5128  C CD    . LYS B 1 361 ? 107.38900 105.17700 111.07400 1.000 177.50000 ? 606 LYS B CD    1 
ATOM   5129  C CE    . LYS B 1 361 ? 108.63000 105.92700 110.63900 1.000 177.50000 ? 606 LYS B CE    1 
ATOM   5130  N NZ    . LYS B 1 361 ? 109.86800 105.20900 111.03700 1.000 177.50000 ? 606 LYS B NZ    1 
ATOM   5131  N N     . LYS B 1 362 ? 102.11400 105.25100 109.21200 1.000 176.49000 ? 607 LYS B N     1 
ATOM   5132  C CA    . LYS B 1 362 ? 101.63100 105.23800 107.83300 1.000 176.49000 ? 607 LYS B CA    1 
ATOM   5133  C C     . LYS B 1 362 ? 101.06600 106.59300 107.42400 1.000 176.49000 ? 607 LYS B C     1 
ATOM   5134  O O     . LYS B 1 362 ? 101.13200 106.95800 106.24200 1.000 176.49000 ? 607 LYS B O     1 
ATOM   5135  C CB    . LYS B 1 362 ? 100.58000 104.13400 107.67000 1.000 176.49000 ? 607 LYS B CB    1 
ATOM   5136  C CG    . LYS B 1 362 ? 100.16000 103.80100 106.23400 1.000 176.49000 ? 607 LYS B CG    1 
ATOM   5137  C CD    . LYS B 1 362 ? 98.85000  104.47200 105.81900 1.000 176.49000 ? 607 LYS B CD    1 
ATOM   5138  C CE    . LYS B 1 362 ? 98.42400  104.04000 104.42100 1.000 176.49000 ? 607 LYS B CE    1 
ATOM   5139  N NZ    . LYS B 1 362 ? 97.16100  104.69000 103.97500 1.000 176.49000 ? 607 LYS B NZ    1 
ATOM   5140  N N     . VAL B 1 363 ? 100.56800 107.36600 108.39800 1.000 178.92000 ? 608 VAL B N     1 
ATOM   5141  C CA    . VAL B 1 363 ? 100.08700 108.71800 108.12800 1.000 178.92000 ? 608 VAL B CA    1 
ATOM   5142  C C     . VAL B 1 363 ? 101.21000 109.59500 107.60400 1.000 178.92000 ? 608 VAL B C     1 
ATOM   5143  O O     . VAL B 1 363 ? 101.13900 110.07800 106.47500 1.000 178.92000 ? 608 VAL B O     1 
ATOM   5144  C CB    . VAL B 1 363 ? 99.43700  109.32500 109.37900 1.000 178.92000 ? 608 VAL B CB    1 
ATOM   5145  C CG1   . VAL B 1 363 ? 99.15500  110.79700 109.15800 1.000 178.92000 ? 608 VAL B CG1   1 
ATOM   5146  C CG2   . VAL B 1 363 ? 98.15700  108.62600 109.63300 1.000 178.92000 ? 608 VAL B CG2   1 
ATOM   5147  N N     . GLU B 1 364 ? 102.27800 109.77400 108.38800 1.000 175.77000 ? 609 GLU B N     1 
ATOM   5148  C CA    . GLU B 1 364 ? 103.37900 110.62300 107.94600 1.000 175.77000 ? 609 GLU B CA    1 
ATOM   5149  C C     . GLU B 1 364 ? 104.12600 110.04300 106.75300 1.000 175.77000 ? 609 GLU B C     1 
ATOM   5150  O O     . GLU B 1 364 ? 104.62600 110.81700 105.92700 1.000 175.77000 ? 609 GLU B O     1 
ATOM   5151  C CB    . GLU B 1 364 ? 104.35000 110.89700 109.09900 1.000 175.77000 ? 609 GLU B CB    1 
ATOM   5152  C CG    . GLU B 1 364 ? 105.05400 109.69100 109.68800 1.000 175.77000 ? 609 GLU B CG    1 
ATOM   5153  C CD    . GLU B 1 364 ? 105.95300 110.06100 110.85300 1.000 175.77000 ? 609 GLU B CD    1 
ATOM   5154  O OE1   . GLU B 1 364 ? 106.04500 111.26300 111.17800 1.000 175.77000 ? 609 GLU B OE1   1 
ATOM   5155  O OE2   . GLU B 1 364 ? 106.55900 109.15100 111.45300 1.000 175.77000 ? 609 GLU B OE2   1 
ATOM   5156  N N     . GLU B 1 365 ? 104.14200 108.71100 106.61200 1.000 177.77000 ? 610 GLU B N     1 
ATOM   5157  C CA    . GLU B 1 365 ? 104.68600 108.08800 105.40900 1.000 177.77000 ? 610 GLU B CA    1 
ATOM   5158  C C     . GLU B 1 365 ? 103.87700 108.43500 104.16900 1.000 177.77000 ? 610 GLU B C     1 
ATOM   5159  O O     . GLU B 1 365 ? 104.42900 108.47900 103.06500 1.000 177.77000 ? 610 GLU B O     1 
ATOM   5160  C CB    . GLU B 1 365 ? 104.73900 106.57600 105.57400 1.000 177.77000 ? 610 GLU B CB    1 
ATOM   5161  C CG    . GLU B 1 365 ? 105.81100 106.09400 106.50400 1.000 177.77000 ? 610 GLU B CG    1 
ATOM   5162  C CD    . GLU B 1 365 ? 105.72900 104.60600 106.71800 1.000 177.77000 ? 610 GLU B CD    1 
ATOM   5163  O OE1   . GLU B 1 365 ? 104.74600 103.99700 106.24700 1.000 177.77000 ? 610 GLU B OE1   1 
ATOM   5164  O OE2   . GLU B 1 365 ? 106.64100 104.04500 107.35800 1.000 177.77000 ? 610 GLU B OE2   1 
ATOM   5165  N N     . LEU B 1 366 ? 102.57700 108.67100 104.31800 1.000 168.20000 ? 611 LEU B N     1 
ATOM   5166  C CA    . LEU B 1 366 ? 101.82800 109.12800 103.15800 1.000 168.20000 ? 611 LEU B CA    1 
ATOM   5167  C C     . LEU B 1 366 ? 101.91300 110.64200 103.00700 1.000 168.20000 ? 611 LEU B C     1 
ATOM   5168  O O     . LEU B 1 366 ? 101.90000 111.15300 101.88200 1.000 168.20000 ? 611 LEU B O     1 
ATOM   5169  C CB    . LEU B 1 366 ? 100.36900 108.67600 103.26200 1.000 168.20000 ? 611 LEU B CB    1 
ATOM   5170  C CG    . LEU B 1 366 ? 99.53400  108.68200 101.97800 1.000 168.20000 ? 611 LEU B CG    1 
ATOM   5171  C CD1   . LEU B 1 366 ? 98.49700  107.57600 102.04700 1.000 168.20000 ? 611 LEU B CD1   1 
ATOM   5172  C CD2   . LEU B 1 366 ? 98.84100  109.99600 101.72800 1.000 168.20000 ? 611 LEU B CD2   1 
ATOM   5173  N N     . ILE B 1 367 ? 101.96800 111.36300 104.12800 1.000 167.88000 ? 612 ILE B N     1 
ATOM   5174  C CA    . ILE B 1 367 ? 101.89900 112.82100 104.08200 1.000 167.88000 ? 612 ILE B CA    1 
ATOM   5175  C C     . ILE B 1 367 ? 103.18600 113.38900 103.50000 1.000 167.88000 ? 612 ILE B C     1 
ATOM   5176  O O     . ILE B 1 367 ? 103.16500 114.40400 102.80200 1.000 167.88000 ? 612 ILE B O     1 
ATOM   5177  C CB    . ILE B 1 367 ? 101.55600 113.40300 105.46900 1.000 167.88000 ? 612 ILE B CB    1 
ATOM   5178  C CG1   . ILE B 1 367 ? 100.13600 113.01100 105.86500 1.000 167.88000 ? 612 ILE B CG1   1 
ATOM   5179  C CG2   . ILE B 1 367 ? 101.55100 114.91900 105.48400 1.000 167.88000 ? 612 ILE B CG2   1 
ATOM   5180  C CD1   . ILE B 1 367 ? 99.06600  113.50100 104.91700 1.000 167.88000 ? 612 ILE B CD1   1 
ATOM   5181  N N     . ALA B 1 368 ? 104.30500 112.67600 103.67000 1.000 166.76000 ? 613 ALA B N     1 
ATOM   5182  C CA    . ALA B 1 368 ? 105.57000 113.12100 103.08500 1.000 166.76000 ? 613 ALA B CA    1 
ATOM   5183  C C     . ALA B 1 368 ? 105.54400 113.09600 101.56000 1.000 166.76000 ? 613 ALA B C     1 
ATOM   5184  O O     . ALA B 1 368 ? 106.22700 113.89000 100.90400 1.000 166.76000 ? 613 ALA B O     1 
ATOM   5185  C CB    . ALA B 1 368 ? 106.71200 112.25400 103.60000 1.000 166.76000 ? 613 ALA B CB    1 
ATOM   5186  N N     . ARG B 1 369 ? 104.74600 112.20400 100.97700 1.000 169.24000 ? 614 ARG B N     1 
ATOM   5187  C CA    . ARG B 1 369 ? 104.68600 112.05200 99.53000  1.000 169.24000 ? 614 ARG B CA    1 
ATOM   5188  C C     . ARG B 1 369 ? 103.39400 112.59300 98.92600  1.000 169.24000 ? 614 ARG B C     1 
ATOM   5189  O O     . ARG B 1 369 ? 103.23500 112.56900 97.70200  1.000 169.24000 ? 614 ARG B O     1 
ATOM   5190  C CB    . ARG B 1 369 ? 104.88800 110.58500 99.14000  1.000 169.24000 ? 614 ARG B CB    1 
ATOM   5191  C CG    . ARG B 1 369 ? 106.35600 110.14500 99.08100  1.000 169.24000 ? 614 ARG B CG    1 
ATOM   5192  C CD    . ARG B 1 369 ? 106.91200 109.74100 100.44400 1.000 169.24000 ? 614 ARG B CD    1 
ATOM   5193  N NE    . ARG B 1 369 ? 106.16600 108.63700 101.03800 1.000 169.24000 ? 614 ARG B NE    1 
ATOM   5194  C CZ    . ARG B 1 369 ? 106.42100 107.35300 100.81100 1.000 169.24000 ? 614 ARG B CZ    1 
ATOM   5195  N NH1   . ARG B 1 369 ? 107.41500 107.00100 100.01000 1.000 169.24000 ? 614 ARG B NH1   1 
ATOM   5196  N NH2   . ARG B 1 369 ? 105.68500 106.42000 101.39300 1.000 169.24000 ? 614 ARG B NH2   1 
ATOM   5197  N N     . ILE B 1 370 ? 102.46300 113.05900 99.75300  1.000 161.46000 ? 615 ILE B N     1 
ATOM   5198  C CA    . ILE B 1 370 ? 101.36400 113.88500 99.26200  1.000 161.46000 ? 615 ILE B CA    1 
ATOM   5199  C C     . ILE B 1 370 ? 101.69800 115.30800 99.70100  1.000 161.46000 ? 615 ILE B C     1 
ATOM   5200  O O     . ILE B 1 370 ? 100.92300 116.25000 99.50900  1.000 161.46000 ? 615 ILE B O     1 
ATOM   5201  C CB    . ILE B 1 370 ? 99.99900  113.37600 99.78000  1.000 161.46000 ? 615 ILE B CB    1 
ATOM   5202  C CG1   . ILE B 1 370 ? 98.79500  113.98100 99.03700  1.000 161.46000 ? 615 ILE B CG1   1 
ATOM   5203  C CG2   . ILE B 1 370 ? 99.84200  113.66500 101.22900 1.000 161.46000 ? 615 ILE B CG2   1 
ATOM   5204  C CD1   . ILE B 1 370 ? 98.68000  113.61000 97.60200  1.000 161.46000 ? 615 ILE B CD1   1 
ATOM   5205  N N     . ALA B 1 371 ? 102.88200 115.48000 100.27600 1.000 155.11000 ? 616 ALA B N     1 
ATOM   5206  C CA    . ALA B 1 371 ? 103.32200 116.80200 100.68400 1.000 155.11000 ? 616 ALA B CA    1 
ATOM   5207  C C     . ALA B 1 371 ? 104.17600 117.45600 99.61700  1.000 155.11000 ? 616 ALA B C     1 
ATOM   5208  O O     . ALA B 1 371 ? 103.82000 118.50800 99.08000  1.000 155.11000 ? 616 ALA B O     1 
ATOM   5209  C CB    . ALA B 1 371 ? 104.11300 116.71700 101.98800 1.000 155.11000 ? 616 ALA B CB    1 
ATOM   5210  N N     . GLN B 1 372 ? 105.30300 116.83000 99.29800  1.000 152.57000 ? 617 GLN B N     1 
ATOM   5211  C CA    . GLN B 1 372 ? 106.26400 117.48500 98.42800  1.000 152.57000 ? 617 GLN B CA    1 
ATOM   5212  C C     . GLN B 1 372 ? 105.85200 117.36000 96.97600  1.000 152.57000 ? 617 GLN B C     1 
ATOM   5213  O O     . GLN B 1 372 ? 105.88700 118.33900 96.22400  1.000 152.57000 ? 617 GLN B O     1 
ATOM   5214  C CB    . GLN B 1 372 ? 107.64500 116.88800 98.64500  1.000 152.57000 ? 617 GLN B CB    1 
ATOM   5215  C CG    . GLN B 1 372 ? 108.75200 117.74800 98.11400  1.000 152.57000 ? 617 GLN B CG    1 
ATOM   5216  C CD    . GLN B 1 372 ? 110.10700 117.19600 98.46600  1.000 152.57000 ? 617 GLN B CD    1 
ATOM   5217  O OE1   . GLN B 1 372 ? 110.21800 116.07800 98.95800  1.000 152.57000 ? 617 GLN B OE1   1 
ATOM   5218  N NE2   . GLN B 1 372 ? 111.14500 117.99900 98.27200  1.000 152.57000 ? 617 GLN B NE2   1 
ATOM   5219  N N     . LYS B 1 373 ? 105.44000 116.16600 96.57100  1.000 147.84000 ? 618 LYS B N     1 
ATOM   5220  C CA    . LYS B 1 373 ? 105.17600 115.92500 95.16700  1.000 147.84000 ? 618 LYS B CA    1 
ATOM   5221  C C     . LYS B 1 373 ? 103.84000 116.49300 94.72600  1.000 147.84000 ? 618 LYS B C     1 
ATOM   5222  O O     . LYS B 1 373 ? 103.63400 116.69500 93.52700  1.000 147.84000 ? 618 LYS B O     1 
ATOM   5223  C CB    . LYS B 1 373 ? 105.23700 114.43000 94.89100  1.000 147.84000 ? 618 LYS B CB    1 
ATOM   5224  C CG    . LYS B 1 373 ? 106.57300 113.84300 95.23800  1.000 147.84000 ? 618 LYS B CG    1 
ATOM   5225  C CD    . LYS B 1 373 ? 107.63000 114.42700 94.34400  1.000 147.84000 ? 618 LYS B CD    1 
ATOM   5226  C CE    . LYS B 1 373 ? 108.97400 113.83700 94.65500  1.000 147.84000 ? 618 LYS B CE    1 
ATOM   5227  N NZ    . LYS B 1 373 ? 110.02000 114.45700 93.80300  1.000 147.84000 ? 618 LYS B NZ    1 
ATOM   5228  N N     . ALA B 1 374 ? 102.94000 116.78300 95.65900  1.000 152.07000 ? 619 ALA B N     1 
ATOM   5229  C CA    . ALA B 1 374 ? 101.63300 117.30100 95.28500  1.000 152.07000 ? 619 ALA B CA    1 
ATOM   5230  C C     . ALA B 1 374 ? 101.62300 118.80400 95.04600  1.000 152.07000 ? 619 ALA B C     1 
ATOM   5231  O O     . ALA B 1 374 ? 100.53600 119.36800 94.87900  1.000 152.07000 ? 619 ALA B O     1 
ATOM   5232  C CB    . ALA B 1 374 ? 100.59400 116.95900 96.34000  1.000 152.07000 ? 619 ALA B CB    1 
ATOM   5233  N N     . ARG B 1 375 ? 102.79100 119.45800 95.03900  1.000 151.36000 ? 620 ARG B N     1 
ATOM   5234  C CA    . ARG B 1 375 ? 102.88200 120.90600 94.87800  1.000 151.36000 ? 620 ARG B CA    1 
ATOM   5235  C C     . ARG B 1 375 ? 102.35900 121.35400 93.52100  1.000 151.36000 ? 620 ARG B C     1 
ATOM   5236  O O     . ARG B 1 375 ? 101.46300 122.19800 93.42900  1.000 151.36000 ? 620 ARG B O     1 
ATOM   5237  C CB    . ARG B 1 375 ? 104.33700 121.34500 95.09600  1.000 151.36000 ? 620 ARG B CB    1 
ATOM   5238  C CG    . ARG B 1 375 ? 104.54800 122.84800 95.11300  1.000 151.36000 ? 620 ARG B CG    1 
ATOM   5239  C CD    . ARG B 1 375 ? 105.14900 123.36400 93.82400  1.000 151.36000 ? 620 ARG B CD    1 
ATOM   5240  N NE    . ARG B 1 375 ? 105.19200 124.81900 93.76600  1.000 151.36000 ? 620 ARG B NE    1 
ATOM   5241  C CZ    . ARG B 1 375 ? 104.21900 125.56400 93.25200  1.000 151.36000 ? 620 ARG B CZ    1 
ATOM   5242  N NH1   . ARG B 1 375 ? 103.14300 124.98300 92.74600  1.000 151.36000 ? 620 ARG B NH1   1 
ATOM   5243  N NH2   . ARG B 1 375 ? 104.32700 126.88600 93.22900  1.000 151.36000 ? 620 ARG B NH2   1 
ATOM   5244  N N     . ALA B 1 376 ? 102.89900 120.78600 92.45400  1.000 152.91000 ? 621 ALA B N     1 
ATOM   5245  C CA    . ALA B 1 376 ? 102.36100 121.05600 91.12800  1.000 152.91000 ? 621 ALA B CA    1 
ATOM   5246  C C     . ALA B 1 376 ? 101.31700 120.02000 90.75100  1.000 152.91000 ? 621 ALA B C     1 
ATOM   5247  O O     . ALA B 1 376 ? 101.29800 119.49500 89.64200  1.000 152.91000 ? 621 ALA B O     1 
ATOM   5248  C CB    . ALA B 1 376 ? 103.49300 121.09100 90.11300  1.000 152.91000 ? 621 ALA B CB    1 
ATOM   5249  N N     . ALA B 1 377 ? 100.41100 119.74600 91.67900  1.000 148.73000 ? 622 ALA B N     1 
ATOM   5250  C CA    . ALA B 1 377 ? 99.38000  118.75600 91.46000  1.000 148.73000 ? 622 ALA B CA    1 
ATOM   5251  C C     . ALA B 1 377 ? 98.02100  119.22300 91.93100  1.000 148.73000 ? 622 ALA B C     1 
ATOM   5252  O O     . ALA B 1 377 ? 97.07700  118.42800 91.92400  1.000 148.73000 ? 622 ALA B O     1 
ATOM   5253  C CB    . ALA B 1 377 ? 99.73400  117.43600 92.15100  1.000 148.73000 ? 622 ALA B CB    1 
ATOM   5254  N N     . GLY B 1 378 ? 97.89100  120.47300 92.35700  1.000 147.91000 ? 623 GLY B N     1 
ATOM   5255  C CA    . GLY B 1 378 ? 96.59100  121.01500 92.70200  1.000 147.91000 ? 623 GLY B CA    1 
ATOM   5256  C C     . GLY B 1 378 ? 96.07700  120.66700 94.08100  1.000 147.91000 ? 623 GLY B C     1 
ATOM   5257  O O     . GLY B 1 378 ? 95.34100  121.45200 94.67100  1.000 147.91000 ? 623 GLY B O     1 
ATOM   5258  N N     . ILE B 1 379 ? 96.42200  119.48800 94.58900  1.000 151.24000 ? 624 ILE B N     1 
ATOM   5259  C CA    . ILE B 1 379 ? 96.12500  119.12200 95.96800  1.000 151.24000 ? 624 ILE B CA    1 
ATOM   5260  C C     . ILE B 1 379 ? 96.97000  120.01700 96.86700  1.000 151.24000 ? 624 ILE B C     1 
ATOM   5261  O O     . ILE B 1 379 ? 98.19700  119.89500 96.89500  1.000 151.24000 ? 624 ILE B O     1 
ATOM   5262  C CB    . ILE B 1 379 ? 96.40500  117.63700 96.22500  1.000 151.24000 ? 624 ILE B CB    1 
ATOM   5263  C CG1   . ILE B 1 379 ? 95.41400  116.75400 95.45900  1.000 151.24000 ? 624 ILE B CG1   1 
ATOM   5264  C CG2   . ILE B 1 379 ? 96.34400  117.32700 97.70000  1.000 151.24000 ? 624 ILE B CG2   1 
ATOM   5265  C CD1   . ILE B 1 379 ? 95.88300  116.26500 94.09900  1.000 151.24000 ? 624 ILE B CD1   1 
ATOM   5266  N N     . HIS B 1 380 ? 96.33200  120.94700 97.57400  1.000 146.11000 ? 625 HIS B N     1 
ATOM   5267  C CA    . HIS B 1 380 ? 97.11300  121.98900 98.22300  1.000 146.11000 ? 625 HIS B CA    1 
ATOM   5268  C C     . HIS B 1 380 ? 97.40000  121.73200 99.69200  1.000 146.11000 ? 625 HIS B C     1 
ATOM   5269  O O     . HIS B 1 380 ? 98.43100  122.20300 100.17800 1.000 146.11000 ? 625 HIS B O     1 
ATOM   5270  C CB    . HIS B 1 380 ? 96.44300  123.34800 98.05900  1.000 146.11000 ? 625 HIS B CB    1 
ATOM   5271  C CG    . HIS B 1 380 ? 96.47000  123.85100 96.65400  1.000 146.11000 ? 625 HIS B CG    1 
ATOM   5272  N ND1   . HIS B 1 380 ? 97.64700  124.09300 95.98000  1.000 146.11000 ? 625 HIS B ND1   1 
ATOM   5273  C CD2   . HIS B 1 380 ? 95.47500  124.22300 95.81700  1.000 146.11000 ? 625 HIS B CD2   1 
ATOM   5274  C CE1   . HIS B 1 380 ? 97.37300  124.54100 94.76800  1.000 146.11000 ? 625 HIS B CE1   1 
ATOM   5275  N NE2   . HIS B 1 380 ? 96.06100  124.62900 94.64400  1.000 146.11000 ? 625 HIS B NE2   1 
ATOM   5276  N N     . LEU B 1 381 ? 96.51200  121.02700 100.40200 1.000 146.78000 ? 626 LEU B N     1 
ATOM   5277  C CA    . LEU B 1 381 ? 96.80500  120.37900 101.68700 1.000 146.78000 ? 626 LEU B CA    1 
ATOM   5278  C C     . LEU B 1 381 ? 97.21500  121.38600 102.77000 1.000 146.78000 ? 626 LEU B C     1 
ATOM   5279  O O     . LEU B 1 381 ? 98.37300  121.49600 103.16400 1.000 146.78000 ? 626 LEU B O     1 
ATOM   5280  C CB    . LEU B 1 381 ? 97.86900  119.29400 101.48600 1.000 146.78000 ? 626 LEU B CB    1 
ATOM   5281  C CG    . LEU B 1 381 ? 98.15600  118.23300 102.54400 1.000 146.78000 ? 626 LEU B CG    1 
ATOM   5282  C CD1   . LEU B 1 381 ? 98.36100  116.96200 101.78500 1.000 146.78000 ? 626 LEU B CD1   1 
ATOM   5283  C CD2   . LEU B 1 381 ? 99.41100  118.49500 103.35800 1.000 146.78000 ? 626 LEU B CD2   1 
ATOM   5284  N N     . ILE B 1 382 ? 96.24200  122.18800 103.19000 1.000 143.44000 ? 627 ILE B N     1 
ATOM   5285  C CA    . ILE B 1 382 ? 96.49300  122.96800 104.38800 1.000 143.44000 ? 627 ILE B CA    1 
ATOM   5286  C C     . ILE B 1 382 ? 96.41000  122.05800 105.60800 1.000 143.44000 ? 627 ILE B C     1 
ATOM   5287  O O     . ILE B 1 382 ? 95.81400  120.97800 105.58100 1.000 143.44000 ? 627 ILE B O     1 
ATOM   5288  C CB    . ILE B 1 382 ? 95.53100  124.15500 104.50800 1.000 143.44000 ? 627 ILE B CB    1 
ATOM   5289  C CG1   . ILE B 1 382 ? 94.11300  123.66600 104.70300 1.000 143.44000 ? 627 ILE B CG1   1 
ATOM   5290  C CG2   . ILE B 1 382 ? 95.57500  124.98400 103.25400 1.000 143.44000 ? 627 ILE B CG2   1 
ATOM   5291  C CD1   . ILE B 1 382 ? 93.16200  124.76700 105.02200 1.000 143.44000 ? 627 ILE B CD1   1 
ATOM   5292  N N     . LEU B 1 383 ? 97.04500  122.49300 106.68900 1.000 145.95000 ? 628 LEU B N     1 
ATOM   5293  C CA    . LEU B 1 383 ? 97.19000  121.67700 107.88300 1.000 145.95000 ? 628 LEU B CA    1 
ATOM   5294  C C     . LEU B 1 383 ? 97.11400  122.56600 109.10800 1.000 145.95000 ? 628 LEU B C     1 
ATOM   5295  O O     . LEU B 1 383 ? 97.46000  123.74300 109.05400 1.000 145.95000 ? 628 LEU B O     1 
ATOM   5296  C CB    . LEU B 1 383 ? 98.52300  120.93000 107.89300 1.000 145.95000 ? 628 LEU B CB    1 
ATOM   5297  C CG    . LEU B 1 383 ? 98.78000  119.76200 106.95700 1.000 145.95000 ? 628 LEU B CG    1 
ATOM   5298  C CD1   . LEU B 1 383 ? 100.25300 119.42700 106.95200 1.000 145.95000 ? 628 LEU B CD1   1 
ATOM   5299  C CD2   . LEU B 1 383 ? 98.01600  118.60200 107.50000 1.000 145.95000 ? 628 LEU B CD2   1 
ATOM   5300  N N     . ALA B 1 384 ? 96.69300  121.98100 110.22800 1.000 150.13000 ? 629 ALA B N     1 
ATOM   5301  C CA    . ALA B 1 384 ? 96.61800  122.71800 111.48200 1.000 150.13000 ? 629 ALA B CA    1 
ATOM   5302  C C     . ALA B 1 384 ? 96.67300  121.74100 112.64300 1.000 150.13000 ? 629 ALA B C     1 
ATOM   5303  O O     . ALA B 1 384 ? 95.96800  120.73200 112.63300 1.000 150.13000 ? 629 ALA B O     1 
ATOM   5304  C CB    . ALA B 1 384 ? 95.33900  123.55100 111.55900 1.000 150.13000 ? 629 ALA B CB    1 
ATOM   5305  N N     . THR B 1 385 ? 97.51000  122.03800 113.62700 1.000 148.23000 ? 630 THR B N     1 
ATOM   5306  C CA    . THR B 1 385 ? 97.62900  121.25000 114.84600 1.000 148.23000 ? 630 THR B CA    1 
ATOM   5307  C C     . THR B 1 385 ? 97.49600  122.14400 116.06700 1.000 148.23000 ? 630 THR B C     1 
ATOM   5308  O O     . THR B 1 385 ? 97.11600  123.30700 115.97200 1.000 148.23000 ? 630 THR B O     1 
ATOM   5309  C CB    . THR B 1 385 ? 98.95600  120.50700 114.90800 1.000 148.23000 ? 630 THR B CB    1 
ATOM   5310  O OG1   . THR B 1 385 ? 99.03500  119.81500 116.16000 1.000 148.23000 ? 630 THR B OG1   1 
ATOM   5311  C CG2   . THR B 1 385 ? 100.11400 121.48200 114.78400 1.000 148.23000 ? 630 THR B CG2   1 
ATOM   5312  N N     . GLN B 1 386 ? 97.82000  121.58600 117.22600 1.000 148.29000 ? 631 GLN B N     1 
ATOM   5313  C CA    . GLN B 1 386 ? 97.87800  122.36500 118.45000 1.000 148.29000 ? 631 GLN B CA    1 
ATOM   5314  C C     . GLN B 1 386 ? 99.29500  122.58300 118.95800 1.000 148.29000 ? 631 GLN B C     1 
ATOM   5315  O O     . GLN B 1 386 ? 99.62700  123.69700 119.36900 1.000 148.29000 ? 631 GLN B O     1 
ATOM   5316  C CB    . GLN B 1 386 ? 97.04000  121.69300 119.54000 1.000 148.29000 ? 631 GLN B CB    1 
ATOM   5317  C CG    . GLN B 1 386 ? 96.85900  122.53500 120.79000 1.000 148.29000 ? 631 GLN B CG    1 
ATOM   5318  C CD    . GLN B 1 386 ? 95.98300  123.74500 120.55800 1.000 148.29000 ? 631 GLN B CD    1 
ATOM   5319  O OE1   . GLN B 1 386 ? 94.93800  123.65600 119.91800 1.000 148.29000 ? 631 GLN B OE1   1 
ATOM   5320  N NE2   . GLN B 1 386 ? 96.41300  124.89000 121.06900 1.000 148.29000 ? 631 GLN B NE2   1 
ATOM   5321  N N     . ARG B 1 387 ? 100.15800 121.56800 118.92700 1.000 146.64000 ? 632 ARG B N     1 
ATOM   5322  C CA    . ARG B 1 387 ? 101.50900 121.68700 119.47800 1.000 146.64000 ? 632 ARG B CA    1 
ATOM   5323  C C     . ARG B 1 387 ? 102.48500 121.06800 118.48800 1.000 146.64000 ? 632 ARG B C     1 
ATOM   5324  O O     . ARG B 1 387 ? 102.77400 119.86700 118.56100 1.000 146.64000 ? 632 ARG B O     1 
ATOM   5325  C CB    . ARG B 1 387 ? 101.60900 121.01700 120.84800 1.000 146.64000 ? 632 ARG B CB    1 
ATOM   5326  C CG    . ARG B 1 387 ? 102.87500 121.30400 121.68100 1.000 146.64000 ? 632 ARG B CG    1 
ATOM   5327  C CD    . ARG B 1 387 ? 103.97200 120.23600 121.52000 1.000 146.64000 ? 632 ARG B CD    1 
ATOM   5328  N NE    . ARG B 1 387 ? 103.52000 118.88800 121.87000 1.000 146.64000 ? 632 ARG B NE    1 
ATOM   5329  C CZ    . ARG B 1 387 ? 104.10100 117.76500 121.44900 1.000 146.64000 ? 632 ARG B CZ    1 
ATOM   5330  N NH1   . ARG B 1 387 ? 105.15200 117.81700 120.64800 1.000 146.64000 ? 632 ARG B NH1   1 
ATOM   5331  N NH2   . ARG B 1 387 ? 103.62000 116.58500 121.81400 1.000 146.64000 ? 632 ARG B NH2   1 
ATOM   5332  N N     . PRO B 1 388 ? 102.98500 121.83700 117.52900 1.000 149.40000 ? 633 PRO B N     1 
ATOM   5333  C CA    . PRO B 1 388 ? 103.98100 121.28300 116.59900 1.000 149.40000 ? 633 PRO B CA    1 
ATOM   5334  C C     . PRO B 1 388 ? 105.41600 121.27600 117.11700 1.000 149.40000 ? 633 PRO B C     1 
ATOM   5335  O O     . PRO B 1 388 ? 106.08600 122.31100 117.06700 1.000 149.40000 ? 633 PRO B O     1 
ATOM   5336  C CB    . PRO B 1 388 ? 103.84700 122.20800 115.38800 1.000 149.40000 ? 633 PRO B CB    1 
ATOM   5337  C CG    . PRO B 1 388 ? 103.34300 123.50000 115.94300 1.000 149.40000 ? 633 PRO B CG    1 
ATOM   5338  C CD    . PRO B 1 388 ? 102.48200 123.15500 117.10300 1.000 149.40000 ? 633 PRO B CD    1 
ATOM   5339  N N     . SER B 1 389 ? 105.93300 120.14000 117.59200 1.000 151.71000 ? 634 SER B N     1 
ATOM   5340  C CA    . SER B 1 389 ? 107.36700 120.11700 117.86600 1.000 151.71000 ? 634 SER B CA    1 
ATOM   5341  C C     . SER B 1 389 ? 108.14400 118.99600 117.18700 1.000 151.71000 ? 634 SER B C     1 
ATOM   5342  O O     . SER B 1 389 ? 108.99000 119.25400 116.32700 1.000 151.71000 ? 634 SER B O     1 
ATOM   5343  C CB    . SER B 1 389 ? 107.60200 120.01900 119.36800 1.000 151.71000 ? 634 SER B CB    1 
ATOM   5344  O OG    . SER B 1 389 ? 107.18600 118.75400 119.84000 1.000 151.71000 ? 634 SER B OG    1 
ATOM   5345  N N     . VAL B 1 390 ? 107.86800 117.74700 117.57100 1.000 159.98000 ? 635 VAL B N     1 
ATOM   5346  C CA    . VAL B 1 390 ? 108.71500 116.61600 117.19000 1.000 159.98000 ? 635 VAL B CA    1 
ATOM   5347  C C     . VAL B 1 390 ? 107.88600 115.50700 116.56100 1.000 159.98000 ? 635 VAL B C     1 
ATOM   5348  O O     . VAL B 1 390 ? 108.03300 115.19100 115.37600 1.000 159.98000 ? 635 VAL B O     1 
ATOM   5349  C CB    . VAL B 1 390 ? 109.47900 116.05300 118.40700 1.000 159.98000 ? 635 VAL B CB    1 
ATOM   5350  C CG1   . VAL B 1 390 ? 110.30900 114.83400 118.01000 1.000 159.98000 ? 635 VAL B CG1   1 
ATOM   5351  C CG2   . VAL B 1 390 ? 110.35200 117.10800 119.05500 1.000 159.98000 ? 635 VAL B CG2   1 
ATOM   5352  N N     . ASP B 1 391 ? 107.01400 114.90600 117.36700 1.000 169.23000 ? 636 ASP B N     1 
ATOM   5353  C CA    . ASP B 1 391 ? 106.13100 113.83200 116.94500 1.000 169.23000 ? 636 ASP B CA    1 
ATOM   5354  C C     . ASP B 1 391 ? 104.98000 114.34700 116.11300 1.000 169.23000 ? 636 ASP B C     1 
ATOM   5355  O O     . ASP B 1 391 ? 104.55200 113.67800 115.17300 1.000 169.23000 ? 636 ASP B O     1 
ATOM   5356  C CB    . ASP B 1 391 ? 105.57300 113.10800 118.17900 1.000 169.23000 ? 636 ASP B CB    1 
ATOM   5357  C CG    . ASP B 1 391 ? 104.92600 111.77300 117.85800 1.000 169.23000 ? 636 ASP B CG    1 
ATOM   5358  O OD1   . ASP B 1 391 ? 104.94300 111.32700 116.69400 1.000 169.23000 ? 636 ASP B OD1   1 
ATOM   5359  O OD2   . ASP B 1 391 ? 104.38400 111.15900 118.80000 1.000 169.23000 ? 636 ASP B OD2   1 
ATOM   5360  N N     . VAL B 1 392 ? 104.50000 115.54000 116.43800 1.000 173.60000 ? 637 VAL B N     1 
ATOM   5361  C CA    . VAL B 1 392 ? 103.37100 116.11500 115.72900 1.000 173.60000 ? 637 VAL B CA    1 
ATOM   5362  C C     . VAL B 1 392 ? 103.78200 116.53600 114.32400 1.000 173.60000 ? 637 VAL B C     1 
ATOM   5363  O O     . VAL B 1 392 ? 103.06900 116.28000 113.34800 1.000 173.60000 ? 637 VAL B O     1 
ATOM   5364  C CB    . VAL B 1 392 ? 102.79700 117.28000 116.55000 1.000 173.60000 ? 637 VAL B CB    1 
ATOM   5365  C CG1   . VAL B 1 392 ? 101.75300 118.03500 115.76800 1.000 173.60000 ? 637 VAL B CG1   1 
ATOM   5366  C CG2   . VAL B 1 392 ? 102.21900 116.73700 117.85600 1.000 173.60000 ? 637 VAL B CG2   1 
ATOM   5367  N N     . ILE B 1 393 ? 104.94300 117.16600 114.19000 1.000 165.29000 ? 638 ILE B N     1 
ATOM   5368  C CA    . ILE B 1 393 ? 105.51000 117.45200 112.88000 1.000 165.29000 ? 638 ILE B CA    1 
ATOM   5369  C C     . ILE B 1 393 ? 106.94200 116.95500 112.86200 1.000 165.29000 ? 638 ILE B C     1 
ATOM   5370  O O     . ILE B 1 393 ? 107.79200 117.46800 113.60100 1.000 165.29000 ? 638 ILE B O     1 
ATOM   5371  C CB    . ILE B 1 393 ? 105.45800 118.94400 112.51900 1.000 165.29000 ? 638 ILE B CB    1 
ATOM   5372  C CG1   . ILE B 1 393 ? 104.01800 119.39200 112.33700 1.000 165.29000 ? 638 ILE B CG1   1 
ATOM   5373  C CG2   . ILE B 1 393 ? 106.22900 119.20700 111.24700 1.000 165.29000 ? 638 ILE B CG2   1 
ATOM   5374  C CD1   . ILE B 1 393 ? 103.87000 120.83600 112.04300 1.000 165.29000 ? 638 ILE B CD1   1 
ATOM   5375  N N     . THR B 1 394 ? 107.20700 115.95900 112.03000 1.000 158.42000 ? 639 THR B N     1 
ATOM   5376  C CA    . THR B 1 394 ? 108.56000 115.56200 111.68200 1.000 158.42000 ? 639 THR B CA    1 
ATOM   5377  C C     . THR B 1 394 ? 108.99900 116.38800 110.48100 1.000 158.42000 ? 639 THR B C     1 
ATOM   5378  O O     . THR B 1 394 ? 108.15500 116.94000 109.76800 1.000 158.42000 ? 639 THR B O     1 
ATOM   5379  C CB    . THR B 1 394 ? 108.62100 114.06800 111.38000 1.000 158.42000 ? 639 THR B CB    1 
ATOM   5380  O OG1   . THR B 1 394 ? 107.63500 113.74900 110.39400 1.000 158.42000 ? 639 THR B OG1   1 
ATOM   5381  C CG2   . THR B 1 394 ? 108.34900 113.26300 112.63400 1.000 158.42000 ? 639 THR B CG2   1 
ATOM   5382  N N     . GLY B 1 395 ? 110.31000 116.48100 110.27100 1.000 152.72000 ? 640 GLY B N     1 
ATOM   5383  C CA    . GLY B 1 395 ? 110.87700 117.36300 109.26600 1.000 152.72000 ? 640 GLY B CA    1 
ATOM   5384  C C     . GLY B 1 395 ? 110.51100 117.03600 107.83500 1.000 152.72000 ? 640 GLY B C     1 
ATOM   5385  O O     . GLY B 1 395 ? 110.52100 117.91500 106.96800 1.000 152.72000 ? 640 GLY B O     1 
ATOM   5386  N N     . LEU B 1 396 ? 110.14600 115.77600 107.58100 1.000 154.76000 ? 641 LEU B N     1 
ATOM   5387  C CA    . LEU B 1 396 ? 109.76400 115.35300 106.23700 1.000 154.76000 ? 641 LEU B CA    1 
ATOM   5388  C C     . LEU B 1 396 ? 108.32700 115.72300 105.89000 1.000 154.76000 ? 641 LEU B C     1 
ATOM   5389  O O     . LEU B 1 396 ? 107.81200 115.27600 104.86100 1.000 154.76000 ? 641 LEU B O     1 
ATOM   5390  C CB    . LEU B 1 396 ? 109.99000 113.84500 106.06700 1.000 154.76000 ? 641 LEU B CB    1 
ATOM   5391  C CG    . LEU B 1 396 ? 109.18700 112.75500 106.78400 1.000 154.76000 ? 641 LEU B CG    1 
ATOM   5392  C CD1   . LEU B 1 396 ? 109.32500 111.45000 106.03800 1.000 154.76000 ? 641 LEU B CD1   1 
ATOM   5393  C CD2   . LEU B 1 396 ? 109.71300 112.53600 108.17700 1.000 154.76000 ? 641 LEU B CD2   1 
ATOM   5394  N N     . ILE B 1 397 ? 107.66200 116.49900 106.74200 1.000 156.36000 ? 642 ILE B N     1 
ATOM   5395  C CA    . ILE B 1 397 ? 106.42600 117.19000 106.41100 1.000 156.36000 ? 642 ILE B CA    1 
ATOM   5396  C C     . ILE B 1 397 ? 106.56200 118.69400 106.60300 1.000 156.36000 ? 642 ILE B C     1 
ATOM   5397  O O     . ILE B 1 397 ? 105.98100 119.46500 105.83000 1.000 156.36000 ? 642 ILE B O     1 
ATOM   5398  C CB    . ILE B 1 397 ? 105.24100 116.62300 107.22900 1.000 156.36000 ? 642 ILE B CB    1 
ATOM   5399  C CG1   . ILE B 1 397 ? 104.98000 115.16000 106.85500 1.000 156.36000 ? 642 ILE B CG1   1 
ATOM   5400  C CG2   . ILE B 1 397 ? 103.94000 117.37600 107.01100 1.000 156.36000 ? 642 ILE B CG2   1 
ATOM   5401  C CD1   . ILE B 1 397 ? 105.61600 114.12500 107.76100 1.000 156.36000 ? 642 ILE B CD1   1 
ATOM   5402  N N     . LYS B 1 398 ? 107.40800 119.12700 107.54300 1.000 148.76000 ? 643 LYS B N     1 
ATOM   5403  C CA    . LYS B 1 398 ? 107.73900 120.53000 107.77000 1.000 148.76000 ? 643 LYS B CA    1 
ATOM   5404  C C     . LYS B 1 398 ? 108.32900 121.20600 106.54700 1.000 148.76000 ? 643 LYS B C     1 
ATOM   5405  O O     . LYS B 1 398 ? 107.97100 122.34900 106.24700 1.000 148.76000 ? 643 LYS B O     1 
ATOM   5406  C CB    . LYS B 1 398 ? 108.73700 120.64000 108.93300 1.000 148.76000 ? 643 LYS B CB    1 
ATOM   5407  C CG    . LYS B 1 398 ? 109.15300 122.05800 109.39100 1.000 148.76000 ? 643 LYS B CG    1 
ATOM   5408  C CD    . LYS B 1 398 ? 110.52900 122.49200 108.83800 1.000 148.76000 ? 643 LYS B CD    1 
ATOM   5409  C CE    . LYS B 1 398 ? 111.09800 123.73100 109.53600 1.000 148.76000 ? 643 LYS B CE    1 
ATOM   5410  N NZ    . LYS B 1 398 ? 110.32600 124.98100 109.32300 1.000 148.76000 ? 643 LYS B NZ    1 
ATOM   5411  N N     . ALA B 1 399 ? 109.19900 120.51400 105.82300 1.000 140.48000 ? 644 ALA B N     1 
ATOM   5412  C CA    . ALA B 1 399 ? 110.05100 121.17900 104.84800 1.000 140.48000 ? 644 ALA B CA    1 
ATOM   5413  C C     . ALA B 1 399 ? 109.35300 121.37800 103.50700 1.000 140.48000 ? 644 ALA B C     1 
ATOM   5414  O O     . ALA B 1 399 ? 109.68100 122.30600 102.76100 1.000 140.48000 ? 644 ALA B O     1 
ATOM   5415  C CB    . ALA B 1 399 ? 111.34000 120.38200 104.67900 1.000 140.48000 ? 644 ALA B CB    1 
ATOM   5416  N N     . ASN B 1 400 ? 108.40700 120.50300 103.17300 1.000 146.09000 ? 645 ASN B N     1 
ATOM   5417  C CA    . ASN B 1 400 ? 107.81200 120.49900 101.84200 1.000 146.09000 ? 645 ASN B CA    1 
ATOM   5418  C C     . ASN B 1 400 ? 106.87900 121.68500 101.64000 1.000 146.09000 ? 645 ASN B C     1 
ATOM   5419  O O     . ASN B 1 400 ? 106.81500 122.25500 100.54900 1.000 146.09000 ? 645 ASN B O     1 
ATOM   5420  C CB    . ASN B 1 400 ? 107.04000 119.20600 101.60800 1.000 146.09000 ? 645 ASN B CB    1 
ATOM   5421  C CG    . ASN B 1 400 ? 107.84800 117.98700 101.94900 1.000 146.09000 ? 645 ASN B CG    1 
ATOM   5422  O OD1   . ASN B 1 400 ? 107.40200 117.13000 102.70500 1.000 146.09000 ? 645 ASN B OD1   1 
ATOM   5423  N ND2   . ASN B 1 400 ? 109.07700 117.94000 101.46000 1.000 146.09000 ? 645 ASN B ND2   1 
ATOM   5424  N N     . ILE B 1 401 ? 106.14300 122.04200 102.68500 1.000 144.96000 ? 646 ILE B N     1 
ATOM   5425  C CA    . ILE B 1 401 ? 105.22300 123.17500 102.67700 1.000 144.96000 ? 646 ILE B CA    1 
ATOM   5426  C C     . ILE B 1 401 ? 106.01100 124.47700 102.57000 1.000 144.96000 ? 646 ILE B C     1 
ATOM   5427  O O     . ILE B 1 401 ? 106.84200 124.77300 103.44000 1.000 144.96000 ? 646 ILE B O     1 
ATOM   5428  C CB    . ILE B 1 401 ? 104.33600 123.16000 103.93100 1.000 144.96000 ? 646 ILE B CB    1 
ATOM   5429  C CG1   . ILE B 1 401 ? 103.38300 121.96900 103.89600 1.000 144.96000 ? 646 ILE B CG1   1 
ATOM   5430  C CG2   . ILE B 1 401 ? 103.57100 124.44400 104.06700 1.000 144.96000 ? 646 ILE B CG2   1 
ATOM   5431  C CD1   . ILE B 1 401 ? 102.65000 121.76900 105.19100 1.000 144.96000 ? 646 ILE B CD1   1 
ATOM   5432  N N     . PRO B 1 402 ? 105.80900 125.26000 101.51600 1.000 142.35000 ? 647 PRO B N     1 
ATOM   5433  C CA    . PRO B 1 402 ? 106.56500 126.50700 101.35800 1.000 142.35000 ? 647 PRO B CA    1 
ATOM   5434  C C     . PRO B 1 402 ? 106.16100 127.59000 102.34000 1.000 142.35000 ? 647 PRO B C     1 
ATOM   5435  O O     . PRO B 1 402 ? 107.00900 128.19200 103.00500 1.000 142.35000 ? 647 PRO B O     1 
ATOM   5436  C CB    . PRO B 1 402 ? 106.22900 126.93400 99.92400  1.000 142.35000 ? 647 PRO B CB    1 
ATOM   5437  C CG    . PRO B 1 402 ? 105.69100 125.70700 99.26200  1.000 142.35000 ? 647 PRO B CG    1 
ATOM   5438  C CD    . PRO B 1 402 ? 104.97500 124.97900 100.34100 1.000 142.35000 ? 647 PRO B CD    1 
ATOM   5439  N N     . THR B 1 403 ? 104.85700 127.83900 102.42300 1.000 142.52000 ? 648 THR B N     1 
ATOM   5440  C CA    . THR B 1 403 ? 104.32800 129.02500 103.08300 1.000 142.52000 ? 648 THR B CA    1 
ATOM   5441  C C     . THR B 1 403 ? 103.57600 128.65300 104.35200 1.000 142.52000 ? 648 THR B C     1 
ATOM   5442  O O     . THR B 1 403 ? 102.81900 127.68100 104.37000 1.000 142.52000 ? 648 THR B O     1 
ATOM   5443  C CB    . THR B 1 403 ? 103.40700 129.76300 102.12600 1.000 142.52000 ? 648 THR B CB    1 
ATOM   5444  O OG1   . THR B 1 403 ? 102.39700 128.86000 101.67300 1.000 142.52000 ? 648 THR B OG1   1 
ATOM   5445  C CG2   . THR B 1 403 ? 104.19300 130.26200 100.94800 1.000 142.52000 ? 648 THR B CG2   1 
ATOM   5446  N N     . ARG B 1 404 ? 103.77700 129.42900 105.41200 1.000 132.74000 ? 649 ARG B N     1 
ATOM   5447  C CA    . ARG B 1 404 ? 103.37800 129.00800 106.74500 1.000 132.74000 ? 649 ARG B CA    1 
ATOM   5448  C C     . ARG B 1 404 ? 102.58200 130.12400 107.40100 1.000 132.74000 ? 649 ARG B C     1 
ATOM   5449  O O     . ARG B 1 404 ? 102.56500 131.26400 106.92900 1.000 132.74000 ? 649 ARG B O     1 
ATOM   5450  C CB    . ARG B 1 404 ? 104.59300 128.63900 107.60900 1.000 132.74000 ? 649 ARG B CB    1 
ATOM   5451  C CG    . ARG B 1 404 ? 105.27500 127.31500 107.24200 1.000 132.74000 ? 649 ARG B CG    1 
ATOM   5452  C CD    . ARG B 1 404 ? 106.30000 127.49900 106.13000 1.000 132.74000 ? 649 ARG B CD    1 
ATOM   5453  N NE    . ARG B 1 404 ? 106.86300 126.26100 105.62500 1.000 132.74000 ? 649 ARG B NE    1 
ATOM   5454  C CZ    . ARG B 1 404 ? 107.92800 125.67900 106.14500 1.000 132.74000 ? 649 ARG B CZ    1 
ATOM   5455  N NH1   . ARG B 1 404 ? 108.53000 126.22100 107.18700 1.000 132.74000 ? 649 ARG B NH1   1 
ATOM   5456  N NH2   . ARG B 1 404 ? 108.38500 124.55700 105.61700 1.000 132.74000 ? 649 ARG B NH2   1 
ATOM   5457  N N     . ILE B 1 405 ? 101.93300 129.78400 108.51300 1.000 135.35000 ? 650 ILE B N     1 
ATOM   5458  C CA    . ILE B 1 405 ? 101.12800 130.71700 109.29500 1.000 135.35000 ? 650 ILE B CA    1 
ATOM   5459  C C     . ILE B 1 405 ? 100.99700 130.14700 110.70400 1.000 135.35000 ? 650 ILE B C     1 
ATOM   5460  O O     . ILE B 1 405 ? 100.96300 128.92800 110.89400 1.000 135.35000 ? 650 ILE B O     1 
ATOM   5461  C CB    . ILE B 1 405 ? 99.76200  130.96800 108.62000 1.000 135.35000 ? 650 ILE B CB    1 
ATOM   5462  C CG1   . ILE B 1 405 ? 99.01900  132.11700 109.27100 1.000 135.35000 ? 650 ILE B CG1   1 
ATOM   5463  C CG2   . ILE B 1 405 ? 98.89500  129.76600 108.61100 1.000 135.35000 ? 650 ILE B CG2   1 
ATOM   5464  C CD1   . ILE B 1 405 ? 99.60200  133.40700 108.93700 1.000 135.35000 ? 650 ILE B CD1   1 
ATOM   5465  N N     . ALA B 1 406 ? 100.98100 131.00400 111.71400 1.000 132.14000 ? 651 ALA B N     1 
ATOM   5466  C CA    . ALA B 1 406 ? 100.99800 130.51100 113.08200 1.000 132.14000 ? 651 ALA B CA    1 
ATOM   5467  C C     . ALA B 1 406 ? 100.32700 131.53900 113.97600 1.000 132.14000 ? 651 ALA B C     1 
ATOM   5468  O O     . ALA B 1 406 ? 99.82200  132.56700 113.51500 1.000 132.14000 ? 651 ALA B O     1 
ATOM   5469  C CB    . ALA B 1 406 ? 102.43300 130.20200 113.52700 1.000 132.14000 ? 651 ALA B CB    1 
ATOM   5470  N N     . PHE B 1 407 ? 100.31200 131.25300 115.27200 1.000 136.82000 ? 652 PHE B N     1 
ATOM   5471  C CA    . PHE B 1 407 ? 99.79500  132.16800 116.27100 1.000 136.82000 ? 652 PHE B CA    1 
ATOM   5472  C C     . PHE B 1 407 ? 100.69200 132.05200 117.49500 1.000 136.82000 ? 652 PHE B C     1 
ATOM   5473  O O     . PHE B 1 407 ? 101.73600 131.39400 117.45300 1.000 136.82000 ? 652 PHE B O     1 
ATOM   5474  C CB    . PHE B 1 407 ? 98.32800  131.86300 116.57700 1.000 136.82000 ? 652 PHE B CB    1 
ATOM   5475  C CG    . PHE B 1 407 ? 97.41000  132.03100 115.40100 1.000 136.82000 ? 652 PHE B CG    1 
ATOM   5476  C CD1   . PHE B 1 407 ? 96.99600  133.28700 114.99700 1.000 136.82000 ? 652 PHE B CD1   1 
ATOM   5477  C CD2   . PHE B 1 407 ? 96.96100  130.92600 114.69900 1.000 136.82000 ? 652 PHE B CD2   1 
ATOM   5478  C CE1   . PHE B 1 407 ? 96.14800  133.43400 113.91700 1.000 136.82000 ? 652 PHE B CE1   1 
ATOM   5479  C CE2   . PHE B 1 407 ? 96.11400  131.06900 113.61900 1.000 136.82000 ? 652 PHE B CE2   1 
ATOM   5480  C CZ    . PHE B 1 407 ? 95.71100  132.32400 113.22700 1.000 136.82000 ? 652 PHE B CZ    1 
ATOM   5481  N N     . GLN B 1 408 ? 100.28900 132.68700 118.59600 1.000 139.10000 ? 653 GLN B N     1 
ATOM   5482  C CA    . GLN B 1 408 ? 101.18500 132.84200 119.73600 1.000 139.10000 ? 653 GLN B CA    1 
ATOM   5483  C C     . GLN B 1 408 ? 101.32200 131.52200 120.48300 1.000 139.10000 ? 653 GLN B C     1 
ATOM   5484  O O     . GLN B 1 408 ? 100.32900 130.89200 120.85000 1.000 139.10000 ? 653 GLN B O     1 
ATOM   5485  C CB    . GLN B 1 408 ? 100.71700 133.98200 120.65100 1.000 139.10000 ? 653 GLN B CB    1 
ATOM   5486  C CG    . GLN B 1 408 ? 99.34200  133.90200 121.33200 1.000 139.10000 ? 653 GLN B CG    1 
ATOM   5487  C CD    . GLN B 1 408 ? 99.40100  133.25400 122.70900 1.000 139.10000 ? 653 GLN B CD    1 
ATOM   5488  O OE1   . GLN B 1 408 ? 100.46800 133.16500 123.31000 1.000 139.10000 ? 653 GLN B OE1   1 
ATOM   5489  N NE2   . GLN B 1 408 ? 98.24700  132.87600 123.24600 1.000 139.10000 ? 653 GLN B NE2   1 
ATOM   5490  N N     . VAL B 1 409 ? 102.55900 131.07600 120.65300 1.000 146.91000 ? 654 VAL B N     1 
ATOM   5491  C CA    . VAL B 1 409 ? 102.85800 129.71300 121.05800 1.000 146.91000 ? 654 VAL B CA    1 
ATOM   5492  C C     . VAL B 1 409 ? 103.95200 129.78000 122.12200 1.000 146.91000 ? 654 VAL B C     1 
ATOM   5493  O O     . VAL B 1 409 ? 104.33100 130.86600 122.56800 1.000 146.91000 ? 654 VAL B O     1 
ATOM   5494  C CB    . VAL B 1 409 ? 103.24700 128.84000 119.83400 1.000 146.91000 ? 654 VAL B CB    1 
ATOM   5495  C CG1   . VAL B 1 409 ? 104.67400 129.11900 119.33400 1.000 146.91000 ? 654 VAL B CG1   1 
ATOM   5496  C CG2   . VAL B 1 409 ? 102.90100 127.33000 120.00100 1.000 146.91000 ? 654 VAL B CG2   1 
ATOM   5497  N N     . SER B 1 410 ? 104.40700 128.60800 122.57800 1.000 153.76000 ? 655 SER B N     1 
ATOM   5498  C CA    . SER B 1 410 ? 105.46000 128.49000 123.58000 1.000 153.76000 ? 655 SER B CA    1 
ATOM   5499  C C     . SER B 1 410 ? 106.74700 129.18400 123.15200 1.000 153.76000 ? 655 SER B C     1 
ATOM   5500  O O     . SER B 1 410 ? 107.14300 129.13800 121.98300 1.000 153.76000 ? 655 SER B O     1 
ATOM   5501  C CB    . SER B 1 410 ? 105.75200 127.01500 123.85000 1.000 153.76000 ? 655 SER B CB    1 
ATOM   5502  O OG    . SER B 1 410 ? 106.85100 126.86900 124.73000 1.000 153.76000 ? 655 SER B OG    1 
ATOM   5503  N N     . SER B 1 411 ? 107.41300 129.81400 124.12300 1.000 157.24000 ? 656 SER B N     1 
ATOM   5504  C CA    . SER B 1 411 ? 108.67400 130.52200 123.89500 1.000 157.24000 ? 656 SER B CA    1 
ATOM   5505  C C     . SER B 1 411 ? 109.83200 129.52500 123.96000 1.000 157.24000 ? 656 SER B C     1 
ATOM   5506  O O     . SER B 1 411 ? 110.71000 129.57000 124.82300 1.000 157.24000 ? 656 SER B O     1 
ATOM   5507  C CB    . SER B 1 411 ? 108.83300 131.65100 124.90400 1.000 157.24000 ? 656 SER B CB    1 
ATOM   5508  O OG    . SER B 1 411 ? 108.93000 131.14100 126.22100 1.000 157.24000 ? 656 SER B OG    1 
ATOM   5509  N N     . LYS B 1 412 ? 109.81900 128.61500 122.99500 1.000 157.15000 ? 657 LYS B N     1 
ATOM   5510  C CA    . LYS B 1 412 ? 110.69900 127.46000 122.89800 1.000 157.15000 ? 657 LYS B CA    1 
ATOM   5511  C C     . LYS B 1 412 ? 110.92800 127.22500 121.40900 1.000 157.15000 ? 657 LYS B C     1 
ATOM   5512  O O     . LYS B 1 412 ? 110.75300 128.14100 120.60100 1.000 157.15000 ? 657 LYS B O     1 
ATOM   5513  C CB    . LYS B 1 412 ? 110.09900 126.24100 123.62800 1.000 157.15000 ? 657 LYS B CB    1 
ATOM   5514  C CG    . LYS B 1 412 ? 110.12900 126.32700 125.15200 1.000 157.15000 ? 657 LYS B CG    1 
ATOM   5515  C CD    . LYS B 1 412 ? 109.51800 125.11600 125.83400 1.000 157.15000 ? 657 LYS B CD    1 
ATOM   5516  C CE    . LYS B 1 412 ? 109.53100 125.30200 127.34700 1.000 157.15000 ? 657 LYS B CE    1 
ATOM   5517  N NZ    . LYS B 1 412 ? 108.92300 124.16300 128.07800 1.000 157.15000 ? 657 LYS B NZ    1 
ATOM   5518  N N     . ILE B 1 413 ? 111.33100 126.00200 121.04300 1.000 158.74000 ? 658 ILE B N     1 
ATOM   5519  C CA    . ILE B 1 413 ? 111.54600 125.61800 119.64500 1.000 158.74000 ? 658 ILE B CA    1 
ATOM   5520  C C     . ILE B 1 413 ? 110.28900 125.79300 118.78700 1.000 158.74000 ? 658 ILE B C     1 
ATOM   5521  O O     . ILE B 1 413 ? 110.39400 125.96800 117.56600 1.000 158.74000 ? 658 ILE B O     1 
ATOM   5522  C CB    . ILE B 1 413 ? 112.08300 124.16500 119.60700 1.000 158.74000 ? 658 ILE B CB    1 
ATOM   5523  C CG1   . ILE B 1 413 ? 112.62600 123.78300 118.23000 1.000 158.74000 ? 658 ILE B CG1   1 
ATOM   5524  C CG2   . ILE B 1 413 ? 111.02800 123.17400 120.05900 1.000 158.74000 ? 658 ILE B CG2   1 
ATOM   5525  C CD1   . ILE B 1 413 ? 113.40100 122.49000 118.22800 1.000 158.74000 ? 658 ILE B CD1   1 
ATOM   5526  N N     . ASP B 1 414 ? 109.10300 125.80900 119.41100 1.000 159.46000 ? 659 ASP B N     1 
ATOM   5527  C CA    . ASP B 1 414 ? 107.84800 126.11900 118.73800 1.000 159.46000 ? 659 ASP B CA    1 
ATOM   5528  C C     . ASP B 1 414 ? 107.82300 127.52200 118.15000 1.000 159.46000 ? 659 ASP B C     1 
ATOM   5529  O O     . ASP B 1 414 ? 107.05900 127.77200 117.21400 1.000 159.46000 ? 659 ASP B O     1 
ATOM   5530  C CB    . ASP B 1 414 ? 106.68600 125.98300 119.72400 1.000 159.46000 ? 659 ASP B CB    1 
ATOM   5531  C CG    . ASP B 1 414 ? 106.52200 124.56900 120.24500 1.000 159.46000 ? 659 ASP B CG    1 
ATOM   5532  O OD1   . ASP B 1 414 ? 106.90200 123.62100 119.52700 1.000 159.46000 ? 659 ASP B OD1   1 
ATOM   5533  O OD2   . ASP B 1 414 ? 106.00900 124.40700 121.37400 1.000 159.46000 ? 659 ASP B OD2   1 
ATOM   5534  N N     . SER B 1 415 ? 108.64300 128.43600 118.67500 1.000 157.64000 ? 660 SER B N     1 
ATOM   5535  C CA    . SER B 1 415 ? 108.59200 129.82500 118.23900 1.000 157.64000 ? 660 SER B CA    1 
ATOM   5536  C C     . SER B 1 415 ? 109.14000 129.99900 116.82700 1.000 157.64000 ? 660 SER B C     1 
ATOM   5537  O O     . SER B 1 415 ? 108.81000 130.97800 116.15100 1.000 157.64000 ? 660 SER B O     1 
ATOM   5538  C CB    . SER B 1 415 ? 109.37200 130.69100 119.21900 1.000 157.64000 ? 660 SER B CB    1 
ATOM   5539  O OG    . SER B 1 415 ? 108.92300 130.43200 120.53300 1.000 157.64000 ? 660 SER B OG    1 
ATOM   5540  N N     . ARG B 1 416 ? 109.97500 129.06700 116.36500 1.000 159.29000 ? 661 ARG B N     1 
ATOM   5541  C CA    . ARG B 1 416 ? 110.53300 129.13400 115.02400 1.000 159.29000 ? 661 ARG B CA    1 
ATOM   5542  C C     . ARG B 1 416 ? 110.46000 127.81600 114.26900 1.000 159.29000 ? 661 ARG B C     1 
ATOM   5543  O O     . ARG B 1 416 ? 111.00900 127.73400 113.16500 1.000 159.29000 ? 661 ARG B O     1 
ATOM   5544  C CB    . ARG B 1 416 ? 111.99800 129.61700 115.05400 1.000 159.29000 ? 661 ARG B CB    1 
ATOM   5545  C CG    . ARG B 1 416 ? 113.06400 128.60400 115.50400 1.000 159.29000 ? 661 ARG B CG    1 
ATOM   5546  C CD    . ARG B 1 416 ? 113.17500 128.48600 117.01600 1.000 159.29000 ? 661 ARG B CD    1 
ATOM   5547  N NE    . ARG B 1 416 ? 113.62000 129.73400 117.62500 1.000 159.29000 ? 661 ARG B NE    1 
ATOM   5548  C CZ    . ARG B 1 416 ? 113.27500 130.12700 118.84500 1.000 159.29000 ? 661 ARG B CZ    1 
ATOM   5549  N NH1   . ARG B 1 416 ? 112.47900 129.36900 119.57700 1.000 159.29000 ? 661 ARG B NH1   1 
ATOM   5550  N NH2   . ARG B 1 416 ? 113.71700 131.27900 119.32900 1.000 159.29000 ? 661 ARG B NH2   1 
ATOM   5551  N N     . THR B 1 417 ? 109.81200 126.78800 114.82600 1.000 159.75000 ? 662 THR B N     1 
ATOM   5552  C CA    . THR B 1 417 ? 109.65700 125.53500 114.09300 1.000 159.75000 ? 662 THR B CA    1 
ATOM   5553  C C     . THR B 1 417 ? 108.78400 125.71800 112.86000 1.000 159.75000 ? 662 THR B C     1 
ATOM   5554  O O     . THR B 1 417 ? 109.16700 125.32500 111.75200 1.000 159.75000 ? 662 THR B O     1 
ATOM   5555  C CB    . THR B 1 417 ? 109.06700 124.46500 115.00800 1.000 159.75000 ? 662 THR B CB    1 
ATOM   5556  O OG1   . THR B 1 417 ? 109.95600 124.23800 116.10600 1.000 159.75000 ? 662 THR B OG1   1 
ATOM   5557  C CG2   . THR B 1 417 ? 108.86600 123.16000 114.25000 1.000 159.75000 ? 662 THR B CG2   1 
ATOM   5558  N N     . ILE B 1 418 ? 107.62300 126.33800 113.02700 1.000 151.82000 ? 663 ILE B N     1 
ATOM   5559  C CA    . ILE B 1 418 ? 106.73900 126.65800 111.92100 1.000 151.82000 ? 663 ILE B CA    1 
ATOM   5560  C C     . ILE B 1 418 ? 106.92700 128.09300 111.44400 1.000 151.82000 ? 663 ILE B C     1 
ATOM   5561  O O     . ILE B 1 418 ? 106.84600 128.36500 110.24500 1.000 151.82000 ? 663 ILE B O     1 
ATOM   5562  C CB    . ILE B 1 418 ? 105.27400 126.37800 112.31400 1.000 151.82000 ? 663 ILE B CB    1 
ATOM   5563  C CG1   . ILE B 1 418 ? 104.30500 126.66300 111.17100 1.000 151.82000 ? 663 ILE B CG1   1 
ATOM   5564  C CG2   . ILE B 1 418 ? 104.89800 127.09900 113.59900 1.000 151.82000 ? 663 ILE B CG2   1 
ATOM   5565  C CD1   . ILE B 1 418 ? 102.90400 126.29000 111.50700 1.000 151.82000 ? 663 ILE B CD1   1 
ATOM   5566  N N     . LEU B 1 419 ? 107.27200 129.00100 112.35100 1.000 155.23000 ? 664 LEU B N     1 
ATOM   5567  C CA    . LEU B 1 419 ? 107.22300 130.42700 112.09000 1.000 155.23000 ? 664 LEU B CA    1 
ATOM   5568  C C     . LEU B 1 419 ? 108.45200 130.95600 111.37400 1.000 155.23000 ? 664 LEU B C     1 
ATOM   5569  O O     . LEU B 1 419 ? 108.36900 132.03700 110.77700 1.000 155.23000 ? 664 LEU B O     1 
ATOM   5570  C CB    . LEU B 1 419 ? 107.02900 131.17500 113.41800 1.000 155.23000 ? 664 LEU B CB    1 
ATOM   5571  C CG    . LEU B 1 419 ? 106.62400 132.64000 113.55100 1.000 155.23000 ? 664 LEU B CG    1 
ATOM   5572  C CD1   . LEU B 1 419 ? 105.77600 132.75800 114.80300 1.000 155.23000 ? 664 LEU B CD1   1 
ATOM   5573  C CD2   . LEU B 1 419 ? 107.83200 133.54600 113.66000 1.000 155.23000 ? 664 LEU B CD2   1 
ATOM   5574  N N     . ASP B 1 420 ? 109.59200 130.25000 111.46700 1.000 158.82000 ? 665 ASP B N     1 
ATOM   5575  C CA    . ASP B 1 420 ? 110.87000 130.47200 110.78100 1.000 158.82000 ? 665 ASP B CA    1 
ATOM   5576  C C     . ASP B 1 420 ? 111.60100 131.71400 111.30200 1.000 158.82000 ? 665 ASP B C     1 
ATOM   5577  O O     . ASP B 1 420 ? 112.70100 132.03400 110.84100 1.000 158.82000 ? 665 ASP B O     1 
ATOM   5578  C CB    . ASP B 1 420 ? 110.66200 130.54600 109.26000 1.000 158.82000 ? 665 ASP B CB    1 
ATOM   5579  C CG    . ASP B 1 420 ? 111.91100 130.22700 108.47500 1.000 158.82000 ? 665 ASP B CG    1 
ATOM   5580  O OD1   . ASP B 1 420 ? 112.93000 129.83800 109.08200 1.000 158.82000 ? 665 ASP B OD1   1 
ATOM   5581  O OD2   . ASP B 1 420 ? 111.87200 130.37800 107.23800 1.000 158.82000 ? 665 ASP B OD2   1 
ATOM   5582  N N     . GLN B 1 421 ? 111.01700 132.41700 112.27300 1.000 150.97000 ? 666 GLN B N     1 
ATOM   5583  C CA    . GLN B 1 421 ? 111.61800 133.60400 112.86300 1.000 150.97000 ? 666 GLN B CA    1 
ATOM   5584  C C     . GLN B 1 421 ? 111.30200 133.61700 114.35000 1.000 150.97000 ? 666 GLN B C     1 
ATOM   5585  O O     . GLN B 1 421 ? 110.81000 132.63500 114.91000 1.000 150.97000 ? 666 GLN B O     1 
ATOM   5586  C CB    . GLN B 1 421 ? 111.11200 134.89500 112.20300 1.000 150.97000 ? 666 GLN B CB    1 
ATOM   5587  C CG    . GLN B 1 421 ? 111.49600 135.09300 110.74300 1.000 150.97000 ? 666 GLN B CG    1 
ATOM   5588  C CD    . GLN B 1 421 ? 112.97600 135.33600 110.53200 1.000 150.97000 ? 666 GLN B CD    1 
ATOM   5589  O OE1   . GLN B 1 421 ? 113.62100 136.04600 111.30200 1.000 150.97000 ? 666 GLN B OE1   1 
ATOM   5590  N NE2   . GLN B 1 421 ? 113.52000 134.75400 109.47200 1.000 150.97000 ? 666 GLN B NE2   1 
ATOM   5591  N N     . GLY B 1 422 ? 111.57300 134.74900 114.99000 1.000 148.19000 ? 667 GLY B N     1 
ATOM   5592  C CA    . GLY B 1 422 ? 111.24600 134.91800 116.39100 1.000 148.19000 ? 667 GLY B CA    1 
ATOM   5593  C C     . GLY B 1 422 ? 109.86600 135.50600 116.60000 1.000 148.19000 ? 667 GLY B C     1 
ATOM   5594  O O     . GLY B 1 422 ? 109.67300 136.72000 116.48600 1.000 148.19000 ? 667 GLY B O     1 
ATOM   5595  N N     . GLY B 1 423 ? 108.89800 134.64800 116.90600 1.000 147.51000 ? 668 GLY B N     1 
ATOM   5596  C CA    . GLY B 1 423 ? 107.52100 135.06900 117.07600 1.000 147.51000 ? 668 GLY B CA    1 
ATOM   5597  C C     . GLY B 1 423 ? 106.85900 134.42700 118.27400 1.000 147.51000 ? 668 GLY B C     1 
ATOM   5598  O O     . GLY B 1 423 ? 105.68700 134.04300 118.20000 1.000 147.51000 ? 668 GLY B O     1 
ATOM   5599  N N     . ALA B 1 424 ? 107.62500 134.27500 119.36000 1.000 146.43000 ? 669 ALA B N     1 
ATOM   5600  C CA    . ALA B 1 424 ? 107.19200 133.53000 120.53900 1.000 146.43000 ? 669 ALA B CA    1 
ATOM   5601  C C     . ALA B 1 424 ? 105.95400 134.14200 121.18400 1.000 146.43000 ? 669 ALA B C     1 
ATOM   5602  O O     . ALA B 1 424 ? 104.88300 133.52600 121.22000 1.000 146.43000 ? 669 ALA B O     1 
ATOM   5603  C CB    . ALA B 1 424 ? 108.33800 133.46600 121.54800 1.000 146.43000 ? 669 ALA B CB    1 
ATOM   5604  N N     . GLU B 1 425 ? 106.07900 135.36300 121.69600 1.000 140.54000 ? 670 GLU B N     1 
ATOM   5605  C CA    . GLU B 1 425 ? 104.92200 136.03100 122.27200 1.000 140.54000 ? 670 GLU B CA    1 
ATOM   5606  C C     . GLU B 1 425 ? 104.77900 137.46400 121.79000 1.000 140.54000 ? 670 GLU B C     1 
ATOM   5607  O O     . GLU B 1 425 ? 103.88900 138.17100 122.27600 1.000 140.54000 ? 670 GLU B O     1 
ATOM   5608  C CB    . GLU B 1 425 ? 104.96300 136.02100 123.80700 1.000 140.54000 ? 670 GLU B CB    1 
ATOM   5609  C CG    . GLU B 1 425 ? 106.04200 136.89800 124.44900 1.000 140.54000 ? 670 GLU B CG    1 
ATOM   5610  C CD    . GLU B 1 425 ? 107.30600 136.13500 124.81500 1.000 140.54000 ? 670 GLU B CD    1 
ATOM   5611  O OE1   . GLU B 1 425 ? 107.48700 134.99800 124.33300 1.000 140.54000 ? 670 GLU B OE1   1 
ATOM   5612  O OE2   . GLU B 1 425 ? 108.11300 136.67200 125.60300 1.000 140.54000 ? 670 GLU B OE2   1 
ATOM   5613  N N     . GLN B 1 426 ? 105.62600 137.92000 120.86900 1.000 129.51000 ? 671 GLN B N     1 
ATOM   5614  C CA    . GLN B 1 426 ? 105.43300 139.24400 120.29400 1.000 129.51000 ? 671 GLN B CA    1 
ATOM   5615  C C     . GLN B 1 426 ? 104.16500 139.29600 119.45200 1.000 129.51000 ? 671 GLN B C     1 
ATOM   5616  O O     . GLN B 1 426 ? 103.50000 140.33800 119.39400 1.000 129.51000 ? 671 GLN B O     1 
ATOM   5617  C CB    . GLN B 1 426 ? 106.66100 139.63900 119.47600 1.000 129.51000 ? 671 GLN B CB    1 
ATOM   5618  C CG    . GLN B 1 426 ? 106.58600 141.03000 118.86700 1.000 129.51000 ? 671 GLN B CG    1 
ATOM   5619  C CD    . GLN B 1 426 ? 106.49600 142.11900 119.91400 1.000 129.51000 ? 671 GLN B CD    1 
ATOM   5620  O OE1   . GLN B 1 426 ? 107.22900 142.10500 120.90000 1.000 129.51000 ? 671 GLN B OE1   1 
ATOM   5621  N NE2   . GLN B 1 426 ? 105.57600 143.05800 119.71800 1.000 129.51000 ? 671 GLN B NE2   1 
ATOM   5622  N N     . LEU B 1 427 ? 103.80300 138.18300 118.81800 1.000 129.34000 ? 672 LEU B N     1 
ATOM   5623  C CA    . LEU B 1 427 ? 102.47500 138.05100 118.23800 1.000 129.34000 ? 672 LEU B CA    1 
ATOM   5624  C C     . LEU B 1 427 ? 101.45800 138.08200 119.36600 1.000 129.34000 ? 672 LEU B C     1 
ATOM   5625  O O     . LEU B 1 427 ? 101.53800 137.27800 120.30000 1.000 129.34000 ? 672 LEU B O     1 
ATOM   5626  C CB    . LEU B 1 427 ? 102.37400 136.75000 117.43900 1.000 129.34000 ? 672 LEU B CB    1 
ATOM   5627  C CG    . LEU B 1 427 ? 101.21500 136.49900 116.46700 1.000 129.34000 ? 672 LEU B CG    1 
ATOM   5628  C CD1   . LEU B 1 427 ? 101.69300 135.61400 115.35500 1.000 129.34000 ? 672 LEU B CD1   1 
ATOM   5629  C CD2   . LEU B 1 427 ? 100.03600 135.83300 117.12100 1.000 129.34000 ? 672 LEU B CD2   1 
ATOM   5630  N N     . LEU B 1 428 ? 100.53200 139.04200 119.29400 1.000 126.13000 ? 673 LEU B N     1 
ATOM   5631  C CA    . LEU B 1 428 ? 99.59400  139.27100 120.38800 1.000 126.13000 ? 673 LEU B CA    1 
ATOM   5632  C C     . LEU B 1 428 ? 98.64600  138.09600 120.57400 1.000 126.13000 ? 673 LEU B C     1 
ATOM   5633  O O     . LEU B 1 428 ? 98.23600  137.78900 121.69800 1.000 126.13000 ? 673 LEU B O     1 
ATOM   5634  C CB    . LEU B 1 428 ? 98.78900  140.54100 120.12800 1.000 126.13000 ? 673 LEU B CB    1 
ATOM   5635  C CG    . LEU B 1 428 ? 99.51800  141.87600 120.10800 1.000 126.13000 ? 673 LEU B CG    1 
ATOM   5636  C CD1   . LEU B 1 428 ? 98.55500  142.98800 119.72500 1.000 126.13000 ? 673 LEU B CD1   1 
ATOM   5637  C CD2   . LEU B 1 428 ? 100.14000 142.14400 121.45300 1.000 126.13000 ? 673 LEU B CD2   1 
ATOM   5638  N N     . GLY B 1 429 ? 98.28900  137.42800 119.48400 1.000 137.93000 ? 674 GLY B N     1 
ATOM   5639  C CA    . GLY B 1 429 ? 97.20100  136.47800 119.49200 1.000 137.93000 ? 674 GLY B CA    1 
ATOM   5640  C C     . GLY B 1 429 ? 95.86600  137.19100 119.42500 1.000 137.93000 ? 674 GLY B C     1 
ATOM   5641  O O     . GLY B 1 429 ? 95.76900  138.41400 119.56900 1.000 137.93000 ? 674 GLY B O     1 
ATOM   5642  N N     . HIS B 1 430 ? 94.82100  136.39400 119.17400 1.000 138.15000 ? 675 HIS B N     1 
ATOM   5643  C CA    . HIS B 1 430 ? 93.42100  136.83400 119.20100 1.000 138.15000 ? 675 HIS B CA    1 
ATOM   5644  C C     . HIS B 1 430 ? 93.18600  137.96100 118.19000 1.000 138.15000 ? 675 HIS B C     1 
ATOM   5645  O O     . HIS B 1 430 ? 92.63200  139.01600 118.50300 1.000 138.15000 ? 675 HIS B O     1 
ATOM   5646  C CB    . HIS B 1 430 ? 93.01300  137.22400 120.63200 1.000 138.15000 ? 675 HIS B CB    1 
ATOM   5647  C CG    . HIS B 1 430 ? 91.53900  137.37700 120.84800 1.000 138.15000 ? 675 HIS B CG    1 
ATOM   5648  N ND1   . HIS B 1 430 ? 90.89200  138.58800 120.73000 1.000 138.15000 ? 675 HIS B ND1   1 
ATOM   5649  C CD2   . HIS B 1 430 ? 90.59000  136.47700 121.19600 1.000 138.15000 ? 675 HIS B CD2   1 
ATOM   5650  C CE1   . HIS B 1 430 ? 89.61000  138.42700 121.00000 1.000 138.15000 ? 675 HIS B CE1   1 
ATOM   5651  N NE2   . HIS B 1 430 ? 89.39800  137.15300 121.27300 1.000 138.15000 ? 675 HIS B NE2   1 
ATOM   5652  N N     . GLY B 1 431 ? 93.65700  137.73600 116.96400 1.000 142.03000 ? 676 GLY B N     1 
ATOM   5653  C CA    . GLY B 1 431 ? 93.47400  138.70500 115.90400 1.000 142.03000 ? 676 GLY B CA    1 
ATOM   5654  C C     . GLY B 1 431 ? 94.62500  138.87500 114.93200 1.000 142.03000 ? 676 GLY B C     1 
ATOM   5655  O O     . GLY B 1 431 ? 94.38800  139.19100 113.76300 1.000 142.03000 ? 676 GLY B O     1 
ATOM   5656  N N     . ASP B 1 432 ? 95.86300  138.67100 115.36900 1.000 142.90000 ? 677 ASP B N     1 
ATOM   5657  C CA    . ASP B 1 432 ? 97.00700  138.83200 114.48100 1.000 142.90000 ? 677 ASP B CA    1 
ATOM   5658  C C     . ASP B 1 432 ? 97.70800  137.50100 114.24000 1.000 142.90000 ? 677 ASP B C     1 
ATOM   5659  O O     . ASP B 1 432 ? 97.46300  136.50200 114.91900 1.000 142.90000 ? 677 ASP B O     1 
ATOM   5660  C CB    . ASP B 1 432 ? 97.99800  139.86200 115.03100 1.000 142.90000 ? 677 ASP B CB    1 
ATOM   5661  C CG    . ASP B 1 432 ? 97.47200  141.28000 114.95400 1.000 142.90000 ? 677 ASP B CG    1 
ATOM   5662  O OD1   . ASP B 1 432 ? 96.57300  141.54100 114.13700 1.000 142.90000 ? 677 ASP B OD1   1 
ATOM   5663  O OD2   . ASP B 1 432 ? 97.98600  142.14800 115.68500 1.000 142.90000 ? 677 ASP B OD2   1 
ATOM   5664  N N     . MET B 1 433 ? 98.62300  137.52000 113.27600 1.000 138.34000 ? 678 MET B N     1 
ATOM   5665  C CA    . MET B 1 433 ? 99.16000  136.30900 112.67600 1.000 138.34000 ? 678 MET B CA    1 
ATOM   5666  C C     . MET B 1 433 ? 100.36200 136.68700 111.81700 1.000 138.34000 ? 678 MET B C     1 
ATOM   5667  O O     . MET B 1 433 ? 100.49500 137.83800 111.38900 1.000 138.34000 ? 678 MET B O     1 
ATOM   5668  C CB    . MET B 1 433 ? 98.06500  135.60600 111.86900 1.000 138.34000 ? 678 MET B CB    1 
ATOM   5669  C CG    . MET B 1 433 ? 97.48300  136.47200 110.78000 1.000 138.34000 ? 678 MET B CG    1 
ATOM   5670  S SD    . MET B 1 433 ? 95.84600  135.97700 110.21400 1.000 138.34000 ? 678 MET B SD    1 
ATOM   5671  C CE    . MET B 1 433 ? 96.13600  134.44900 109.34200 1.000 138.34000 ? 678 MET B CE    1 
ATOM   5672  N N     . LEU B 1 434 ? 101.24600 135.71100 111.58300 1.000 130.75000 ? 679 LEU B N     1 
ATOM   5673  C CA    . LEU B 1 434 ? 102.49400 135.92300 110.84500 1.000 130.75000 ? 679 LEU B CA    1 
ATOM   5674  C C     . LEU B 1 434 ? 102.50700 135.12500 109.55100 1.000 130.75000 ? 679 LEU B C     1 
ATOM   5675  O O     . LEU B 1 434 ? 102.73400 133.91300 109.56100 1.000 130.75000 ? 679 LEU B O     1 
ATOM   5676  C CB    . LEU B 1 434 ? 103.70100 135.56800 111.69100 1.000 130.75000 ? 679 LEU B CB    1 
ATOM   5677  C CG    . LEU B 1 434 ? 104.02200 136.64700 112.70800 1.000 130.75000 ? 679 LEU B CG    1 
ATOM   5678  C CD1   . LEU B 1 434 ? 105.15900 136.20600 113.59400 1.000 130.75000 ? 679 LEU B CD1   1 
ATOM   5679  C CD2   . LEU B 1 434 ? 104.35900 137.94200 111.99100 1.000 130.75000 ? 679 LEU B CD2   1 
ATOM   5680  N N     . TYR B 1 435 ? 102.29700 135.82200 108.44300 1.000 134.48000 ? 680 TYR B N     1 
ATOM   5681  C CA    . TYR B 1 435 ? 102.27000 135.23200 107.11500 1.000 134.48000 ? 680 TYR B CA    1 
ATOM   5682  C C     . TYR B 1 435 ? 103.66100 135.21200 106.50000 1.000 134.48000 ? 680 TYR B C     1 
ATOM   5683  O O     . TYR B 1 435 ? 104.44400 136.14900 106.67200 1.000 134.48000 ? 680 TYR B O     1 
ATOM   5684  C CB    . TYR B 1 435 ? 101.32500 136.02700 106.21800 1.000 134.48000 ? 680 TYR B CB    1 
ATOM   5685  C CG    . TYR B 1 435 ? 101.27400 135.55900 104.79000 1.000 134.48000 ? 680 TYR B CG    1 
ATOM   5686  C CD1   . TYR B 1 435 ? 100.58300 134.41200 104.44100 1.000 134.48000 ? 680 TYR B CD1   1 
ATOM   5687  C CD2   . TYR B 1 435 ? 101.91100 136.27300 103.78700 1.000 134.48000 ? 680 TYR B CD2   1 
ATOM   5688  C CE1   . TYR B 1 435 ? 100.52900 133.98500 103.13000 1.000 134.48000 ? 680 TYR B CE1   1 
ATOM   5689  C CE2   . TYR B 1 435 ? 101.86800 135.85300 102.47700 1.000 134.48000 ? 680 TYR B CE2   1 
ATOM   5690  C CZ    . TYR B 1 435 ? 101.18100 134.70700 102.15600 1.000 134.48000 ? 680 TYR B CZ    1 
ATOM   5691  O OH    . TYR B 1 435 ? 101.13100 134.29300 100.84800 1.000 134.48000 ? 680 TYR B OH    1 
ATOM   5692  N N     . LEU B 1 436 ? 103.95900 134.14200 105.77000 1.000 137.00000 ? 681 LEU B N     1 
ATOM   5693  C CA    . LEU B 1 436 ? 105.19800 134.04200 105.01400 1.000 137.00000 ? 681 LEU B CA    1 
ATOM   5694  C C     . LEU B 1 436 ? 104.87100 133.80900 103.55000 1.000 137.00000 ? 681 LEU B C     1 
ATOM   5695  O O     . LEU B 1 436 ? 104.37200 132.72800 103.20100 1.000 137.00000 ? 681 LEU B O     1 
ATOM   5696  C CB    . LEU B 1 436 ? 106.09600 132.91900 105.52600 1.000 137.00000 ? 681 LEU B CB    1 
ATOM   5697  C CG    . LEU B 1 436 ? 107.05900 133.26300 106.65500 1.000 137.00000 ? 681 LEU B CG    1 
ATOM   5698  C CD1   . LEU B 1 436 ? 107.89300 134.45100 106.23700 1.000 137.00000 ? 681 LEU B CD1   1 
ATOM   5699  C CD2   . LEU B 1 436 ? 106.38700 133.50500 107.98900 1.000 137.00000 ? 681 LEU B CD2   1 
ATOM   5700  N N     . PRO B 1 437 ? 105.14000 134.76100 102.66500 1.000 141.08000 ? 682 PRO B N     1 
ATOM   5701  C CA    . PRO B 1 437 ? 105.06000 134.49700 101.22600 1.000 141.08000 ? 682 PRO B CA    1 
ATOM   5702  C C     . PRO B 1 437 ? 106.18200 133.56500 100.80200 1.000 141.08000 ? 682 PRO B C     1 
ATOM   5703  O O     . PRO B 1 437 ? 107.12200 133.34500 101.58300 1.000 141.08000 ? 682 PRO B O     1 
ATOM   5704  C CB    . PRO B 1 437 ? 105.21100 135.90000 100.61100 1.000 141.08000 ? 682 PRO B CB    1 
ATOM   5705  C CG    . PRO B 1 437 ? 105.96200 136.67000 101.61700 1.000 141.08000 ? 682 PRO B CG    1 
ATOM   5706  C CD    . PRO B 1 437 ? 105.53700 136.14800 102.95400 1.000 141.08000 ? 682 PRO B CD    1 
ATOM   5707  N N     . PRO B 1 438 ? 106.11500 132.96300 99.60300  1.000 135.69000 ? 683 PRO B N     1 
ATOM   5708  C CA    . PRO B 1 438 ? 107.20700 132.05400 99.20700  1.000 135.69000 ? 683 PRO B CA    1 
ATOM   5709  C C     . PRO B 1 438 ? 108.54500 132.75200 99.02400  1.000 135.69000 ? 683 PRO B C     1 
ATOM   5710  O O     . PRO B 1 438 ? 109.57200 132.23300 99.47900  1.000 135.69000 ? 683 PRO B O     1 
ATOM   5711  C CB    . PRO B 1 438 ? 106.69000 131.43200 97.90200  1.000 135.69000 ? 683 PRO B CB    1 
ATOM   5712  C CG    . PRO B 1 438 ? 105.68300 132.37700 97.39700  1.000 135.69000 ? 683 PRO B CG    1 
ATOM   5713  C CD    . PRO B 1 438 ? 105.03300 132.96700 98.59800  1.000 135.69000 ? 683 PRO B CD    1 
ATOM   5714  N N     . GLY B 1 439 ? 108.56600 133.92200 98.40300  1.000 139.44000 ? 684 GLY B N     1 
ATOM   5715  C CA    . GLY B 1 439 ? 109.76700 134.72600 98.38500  1.000 139.44000 ? 684 GLY B CA    1 
ATOM   5716  C C     . GLY B 1 439 ? 109.81000 135.68300 99.55400  1.000 139.44000 ? 684 GLY B C     1 
ATOM   5717  O O     . GLY B 1 439 ? 108.79400 135.88900 100.21300 1.000 139.44000 ? 684 GLY B O     1 
ATOM   5718  N N     . THR B 1 440 ? 111.00400 136.23900 99.78400  1.000 146.00000 ? 685 THR B N     1 
ATOM   5719  C CA    . THR B 1 440 ? 111.27800 137.25400 100.80700 1.000 146.00000 ? 685 THR B CA    1 
ATOM   5720  C C     . THR B 1 440 ? 110.88600 136.73600 102.19600 1.000 146.00000 ? 685 THR B C     1 
ATOM   5721  O O     . THR B 1 440 ? 109.89500 137.14900 102.80100 1.000 146.00000 ? 685 THR B O     1 
ATOM   5722  C CB    . THR B 1 440 ? 110.59200 138.58800 100.48100 1.000 146.00000 ? 685 THR B CB    1 
ATOM   5723  O OG1   . THR B 1 440 ? 110.83700 138.91900 99.11200  1.000 146.00000 ? 685 THR B OG1   1 
ATOM   5724  C CG2   . THR B 1 440 ? 111.19400 139.70700 101.32100 1.000 146.00000 ? 685 THR B CG2   1 
ATOM   5725  N N     . GLY B 1 441 ? 111.66600 135.76500 102.66200 1.000 137.59000 ? 686 GLY B N     1 
ATOM   5726  C CA    . GLY B 1 441 ? 111.36400 135.06200 103.89500 1.000 137.59000 ? 686 GLY B CA    1 
ATOM   5727  C C     . GLY B 1 441 ? 111.49700 135.86800 105.17400 1.000 137.59000 ? 686 GLY B C     1 
ATOM   5728  O O     . GLY B 1 441 ? 112.28700 135.52000 106.05500 1.000 137.59000 ? 686 GLY B O     1 
ATOM   5729  N N     . LEU B 1 442 ? 110.73000 136.95300 105.28200 1.000 129.33000 ? 687 LEU B N     1 
ATOM   5730  C CA    . LEU B 1 442 ? 110.52000 137.71500 106.49400 1.000 129.33000 ? 687 LEU B CA    1 
ATOM   5731  C C     . LEU B 1 442 ? 109.02600 137.76000 106.79600 1.000 129.33000 ? 687 LEU B C     1 
ATOM   5732  O O     . LEU B 1 442 ? 108.21500 137.83100 105.86800 1.000 129.33000 ? 687 LEU B O     1 
ATOM   5733  C CB    . LEU B 1 442 ? 111.09900 139.14200 106.36600 1.000 129.33000 ? 687 LEU B CB    1 
ATOM   5734  C CG    . LEU B 1 442 ? 110.63000 140.17400 105.33600 1.000 129.33000 ? 687 LEU B CG    1 
ATOM   5735  C CD1   . LEU B 1 442 ? 109.48900 141.06100 105.84200 1.000 129.33000 ? 687 LEU B CD1   1 
ATOM   5736  C CD2   . LEU B 1 442 ? 111.80800 141.02900 104.89700 1.000 129.33000 ? 687 LEU B CD2   1 
ATOM   5737  N N     . PRO B 1 443 ? 108.62700 137.70100 108.06300 1.000 130.93000 ? 688 PRO B N     1 
ATOM   5738  C CA    . PRO B 1 443 ? 107.21100 137.49000 108.39000 1.000 130.93000 ? 688 PRO B CA    1 
ATOM   5739  C C     . PRO B 1 443 ? 106.37300 138.75000 108.21300 1.000 130.93000 ? 688 PRO B C     1 
ATOM   5740  O O     . PRO B 1 443 ? 106.49600 139.71500 108.97200 1.000 130.93000 ? 688 PRO B O     1 
ATOM   5741  C CB    . PRO B 1 443 ? 107.26300 137.03700 109.85600 1.000 130.93000 ? 688 PRO B CB    1 
ATOM   5742  C CG    . PRO B 1 443 ? 108.49800 137.64500 110.39900 1.000 130.93000 ? 688 PRO B CG    1 
ATOM   5743  C CD    . PRO B 1 443 ? 109.47600 137.70100 109.26700 1.000 130.93000 ? 688 PRO B CD    1 
ATOM   5744  N N     . ILE B 1 444 ? 105.50800 138.73700 107.20200 1.000 127.10000 ? 689 ILE B N     1 
ATOM   5745  C CA    . ILE B 1 444 ? 104.49700 139.77900 107.08400 1.000 127.10000 ? 689 ILE B CA    1 
ATOM   5746  C C     . ILE B 1 444 ? 103.43600 139.54100 108.14600 1.000 127.10000 ? 689 ILE B C     1 
ATOM   5747  O O     . ILE B 1 444 ? 102.80500 138.48000 108.18200 1.000 127.10000 ? 689 ILE B O     1 
ATOM   5748  C CB    . ILE B 1 444 ? 103.88000 139.79400 105.68500 1.000 127.10000 ? 689 ILE B CB    1 
ATOM   5749  C CG1   . ILE B 1 444 ? 104.94100 140.12700 104.64400 1.000 127.10000 ? 689 ILE B CG1   1 
ATOM   5750  C CG2   . ILE B 1 444 ? 102.75300 140.79100 105.62900 1.000 127.10000 ? 689 ILE B CG2   1 
ATOM   5751  C CD1   . ILE B 1 444 ? 105.56100 141.48500 104.83900 1.000 127.10000 ? 689 ILE B CD1   1 
ATOM   5752  N N     . ARG B 1 445 ? 103.24000 140.52000 109.01900 1.000 128.10000 ? 690 ARG B N     1 
ATOM   5753  C CA    . ARG B 1 445 ? 102.23800 140.41100 110.06800 1.000 128.10000 ? 690 ARG B CA    1 
ATOM   5754  C C     . ARG B 1 445 ? 100.89400 140.90200 109.55200 1.000 128.10000 ? 690 ARG B C     1 
ATOM   5755  O O     . ARG B 1 445 ? 100.80800 141.97600 108.94900 1.000 128.10000 ? 690 ARG B O     1 
ATOM   5756  C CB    . ARG B 1 445 ? 102.65400 141.20700 111.29800 1.000 128.10000 ? 690 ARG B CB    1 
ATOM   5757  C CG    . ARG B 1 445 ? 101.69900 141.05700 112.44800 1.000 128.10000 ? 690 ARG B CG    1 
ATOM   5758  C CD    . ARG B 1 445 ? 102.22200 141.76700 113.66100 1.000 128.10000 ? 690 ARG B CD    1 
ATOM   5759  N NE    . ARG B 1 445 ? 101.28900 141.67300 114.76800 1.000 128.10000 ? 690 ARG B NE    1 
ATOM   5760  C CZ    . ARG B 1 445 ? 101.51600 142.18000 115.97000 1.000 128.10000 ? 690 ARG B CZ    1 
ATOM   5761  N NH1   . ARG B 1 445 ? 102.65000 142.81600 116.22000 1.000 128.10000 ? 690 ARG B NH1   1 
ATOM   5762  N NH2   . ARG B 1 445 ? 100.61100 142.04800 116.92300 1.000 128.10000 ? 690 ARG B NH2   1 
ATOM   5763  N N     . VAL B 1 446 ? 99.85000  140.11700 109.79800 1.000 134.72000 ? 691 VAL B N     1 
ATOM   5764  C CA    . VAL B 1 446 ? 98.53500  140.32700 109.20800 1.000 134.72000 ? 691 VAL B CA    1 
ATOM   5765  C C     . VAL B 1 446 ? 97.52100  140.51000 110.32300 1.000 134.72000 ? 691 VAL B C     1 
ATOM   5766  O O     . VAL B 1 446 ? 97.46600  139.69800 111.25200 1.000 134.72000 ? 691 VAL B O     1 
ATOM   5767  C CB    . VAL B 1 446 ? 98.13200  139.14400 108.31000 1.000 134.72000 ? 691 VAL B CB    1 
ATOM   5768  C CG1   . VAL B 1 446 ? 96.70200  139.27500 107.86600 1.000 134.72000 ? 691 VAL B CG1   1 
ATOM   5769  C CG2   . VAL B 1 446 ? 99.04400  139.05600 107.10900 1.000 134.72000 ? 691 VAL B CG2   1 
ATOM   5770  N N     . HIS B 1 447 ? 96.72400  141.57000 110.23700 1.000 134.35000 ? 692 HIS B N     1 
ATOM   5771  C CA    . HIS B 1 447 ? 95.52700  141.66200 111.06000 1.000 134.35000 ? 692 HIS B CA    1 
ATOM   5772  C C     . HIS B 1 447 ? 94.45500  140.77700 110.44400 1.000 134.35000 ? 692 HIS B C     1 
ATOM   5773  O O     . HIS B 1 447 ? 93.89900  141.10500 109.39300 1.000 134.35000 ? 692 HIS B O     1 
ATOM   5774  C CB    . HIS B 1 447 ? 95.05600  143.10400 111.18600 1.000 134.35000 ? 692 HIS B CB    1 
ATOM   5775  C CG    . HIS B 1 447 ? 95.97300  143.96500 111.99200 1.000 134.35000 ? 692 HIS B CG    1 
ATOM   5776  N ND1   . HIS B 1 447 ? 96.12800  143.81300 113.35200 1.000 134.35000 ? 692 HIS B ND1   1 
ATOM   5777  C CD2   . HIS B 1 447 ? 96.75900  145.00800 111.63900 1.000 134.35000 ? 692 HIS B CD2   1 
ATOM   5778  C CE1   . HIS B 1 447 ? 96.98400  144.71300 113.79900 1.000 134.35000 ? 692 HIS B CE1   1 
ATOM   5779  N NE2   . HIS B 1 447 ? 97.38000  145.45200 112.77900 1.000 134.35000 ? 692 HIS B NE2   1 
ATOM   5780  N N     . GLY B 1 448 ? 94.18100  139.64800 111.09000 1.000 138.20000 ? 693 GLY B N     1 
ATOM   5781  C CA    . GLY B 1 448 ? 93.17800  138.72700 110.60200 1.000 138.20000 ? 693 GLY B CA    1 
ATOM   5782  C C     . GLY B 1 448 ? 91.77900  139.27400 110.76800 1.000 138.20000 ? 693 GLY B C     1 
ATOM   5783  O O     . GLY B 1 448 ? 91.52900  140.23200 111.49700 1.000 138.20000 ? 693 GLY B O     1 
ATOM   5784  N N     . ALA B 1 449 ? 90.84200  138.65200 110.06500 1.000 135.64000 ? 694 ALA B N     1 
ATOM   5785  C CA    . ALA B 1 449 ? 89.44000  139.04300 110.11200 1.000 135.64000 ? 694 ALA B CA    1 
ATOM   5786  C C     . ALA B 1 449 ? 88.63600  137.93400 110.76900 1.000 135.64000 ? 694 ALA B C     1 
ATOM   5787  O O     . ALA B 1 449 ? 88.80400  136.76100 110.42800 1.000 135.64000 ? 694 ALA B O     1 
ATOM   5788  C CB    . ALA B 1 449 ? 88.90500  139.32100 108.71100 1.000 135.64000 ? 694 ALA B CB    1 
ATOM   5789  N N     . PHE B 1 450 ? 87.77300  138.29700 111.71100 1.000 142.50000 ? 695 PHE B N     1 
ATOM   5790  C CA    . PHE B 1 450 ? 86.98600  137.26700 112.35800 1.000 142.50000 ? 695 PHE B CA    1 
ATOM   5791  C C     . PHE B 1 450 ? 85.86700  136.83200 111.43100 1.000 142.50000 ? 695 PHE B C     1 
ATOM   5792  O O     . PHE B 1 450 ? 85.46200  137.55500 110.52000 1.000 142.50000 ? 695 PHE B O     1 
ATOM   5793  C CB    . PHE B 1 450 ? 86.39000  137.76500 113.66800 1.000 142.50000 ? 695 PHE B CB    1 
ATOM   5794  C CG    . PHE B 1 450 ? 85.15000  138.59100 113.49400 1.000 142.50000 ? 695 PHE B CG    1 
ATOM   5795  C CD1   . PHE B 1 450 ? 85.23200  139.89700 113.05500 1.000 142.50000 ? 695 PHE B CD1   1 
ATOM   5796  C CD2   . PHE B 1 450 ? 83.90400  138.08000 113.83800 1.000 142.50000 ? 695 PHE B CD2   1 
ATOM   5797  C CE1   . PHE B 1 450 ? 84.09600  140.66600 112.91200 1.000 142.50000 ? 695 PHE B CE1   1 
ATOM   5798  C CE2   . PHE B 1 450 ? 82.76300  138.84500 113.69600 1.000 142.50000 ? 695 PHE B CE2   1 
ATOM   5799  C CZ    . PHE B 1 450 ? 82.86000  140.13900 113.23500 1.000 142.50000 ? 695 PHE B CZ    1 
ATOM   5800  N N     . VAL B 1 451 ? 85.36900  135.62700 111.67000 1.000 148.01000 ? 696 VAL B N     1 
ATOM   5801  C CA    . VAL B 1 451 ? 84.18900  135.11300 110.99000 1.000 148.01000 ? 696 VAL B CA    1 
ATOM   5802  C C     . VAL B 1 451 ? 83.28100  134.51800 112.05100 1.000 148.01000 ? 696 VAL B C     1 
ATOM   5803  O O     . VAL B 1 451 ? 83.69200  133.61100 112.78400 1.000 148.01000 ? 696 VAL B O     1 
ATOM   5804  C CB    . VAL B 1 451 ? 84.53100  134.05800 109.92400 1.000 148.01000 ? 696 VAL B CB    1 
ATOM   5805  C CG1   . VAL B 1 451 ? 83.27000  133.43100 109.39800 1.000 148.01000 ? 696 VAL B CG1   1 
ATOM   5806  C CG2   . VAL B 1 451 ? 85.30200  134.67500 108.77100 1.000 148.01000 ? 696 VAL B CG2   1 
ATOM   5807  N N     . SER B 1 452 ? 82.06400  135.03800 112.15000 1.000 146.28000 ? 697 SER B N     1 
ATOM   5808  C CA    . SER B 1 452 ? 81.08800  134.45000 113.04700 1.000 146.28000 ? 697 SER B CA    1 
ATOM   5809  C C     . SER B 1 452 ? 80.69100  133.06700 112.56600 1.000 146.28000 ? 697 SER B C     1 
ATOM   5810  O O     . SER B 1 452 ? 80.66200  132.78800 111.36700 1.000 146.28000 ? 697 SER B O     1 
ATOM   5811  C CB    . SER B 1 452 ? 79.84500  135.32500 113.14300 1.000 146.28000 ? 697 SER B CB    1 
ATOM   5812  O OG    . SER B 1 452 ? 78.83200  134.66700 113.88200 1.000 146.28000 ? 697 SER B OG    1 
ATOM   5813  N N     . ASP B 1 453 ? 80.38300  132.19400 113.52200 1.000 150.29000 ? 698 ASP B N     1 
ATOM   5814  C CA    . ASP B 1 453 ? 79.79200  130.91200 113.17500 1.000 150.29000 ? 698 ASP B CA    1 
ATOM   5815  C C     . ASP B 1 453 ? 78.39500  131.06700 112.58700 1.000 150.29000 ? 698 ASP B C     1 
ATOM   5816  O O     . ASP B 1 453 ? 77.94500  130.19100 111.84300 1.000 150.29000 ? 698 ASP B O     1 
ATOM   5817  C CB    . ASP B 1 453 ? 79.77400  130.00400 114.40300 1.000 150.29000 ? 698 ASP B CB    1 
ATOM   5818  C CG    . ASP B 1 453 ? 79.11500  130.65300 115.60300 1.000 150.29000 ? 698 ASP B CG    1 
ATOM   5819  O OD1   . ASP B 1 453 ? 78.74700  131.84400 115.52600 1.000 150.29000 ? 698 ASP B OD1   1 
ATOM   5820  O OD2   . ASP B 1 453 ? 78.97300  129.96700 116.63500 1.000 150.29000 ? 698 ASP B OD2   1 
ATOM   5821  N N     . ASP B 1 454 ? 77.71200  132.17000 112.89300 1.000 155.76000 ? 699 ASP B N     1 
ATOM   5822  C CA    . ASP B 1 454 ? 76.44600  132.46300 112.23800 1.000 155.76000 ? 699 ASP B CA    1 
ATOM   5823  C C     . ASP B 1 454 ? 76.66000  132.83600 110.77900 1.000 155.76000 ? 699 ASP B C     1 
ATOM   5824  O O     . ASP B 1 454 ? 75.84100  132.49000 109.91800 1.000 155.76000 ? 699 ASP B O     1 
ATOM   5825  C CB    . ASP B 1 454 ? 75.73300  133.58400 112.98400 1.000 155.76000 ? 699 ASP B CB    1 
ATOM   5826  C CG    . ASP B 1 454 ? 75.33000  133.17600 114.38000 1.000 155.76000 ? 699 ASP B CG    1 
ATOM   5827  O OD1   . ASP B 1 454 ? 75.09400  131.96800 114.59300 1.000 155.76000 ? 699 ASP B OD1   1 
ATOM   5828  O OD2   . ASP B 1 454 ? 75.25800  134.05400 115.26400 1.000 155.76000 ? 699 ASP B OD2   1 
ATOM   5829  N N     . GLU B 1 455 ? 77.75400  133.54500 110.48600 1.000 148.40000 ? 700 GLU B N     1 
ATOM   5830  C CA    . GLU B 1 455 ? 78.13600  133.78500 109.09800 1.000 148.40000 ? 700 GLU B CA    1 
ATOM   5831  C C     . GLU B 1 455 ? 78.41800  132.47400 108.38700 1.000 148.40000 ? 700 GLU B C     1 
ATOM   5832  O O     . GLU B 1 455 ? 78.01500  132.28400 107.23200 1.000 148.40000 ? 700 GLU B O     1 
ATOM   5833  C CB    . GLU B 1 455 ? 79.37000  134.67700 109.03800 1.000 148.40000 ? 700 GLU B CB    1 
ATOM   5834  C CG    . GLU B 1 455 ? 79.18000  136.05300 109.59700 1.000 148.40000 ? 700 GLU B CG    1 
ATOM   5835  C CD    . GLU B 1 455 ? 80.46500  136.83900 109.59100 1.000 148.40000 ? 700 GLU B CD    1 
ATOM   5836  O OE1   . GLU B 1 455 ? 81.51400  136.25700 109.24800 1.000 148.40000 ? 700 GLU B OE1   1 
ATOM   5837  O OE2   . GLU B 1 455 ? 80.43400  138.03400 109.93900 1.000 148.40000 ? 700 GLU B OE2   1 
ATOM   5838  N N     . VAL B 1 456 ? 79.09600  131.55600 109.07900 1.000 148.95000 ? 701 VAL B N     1 
ATOM   5839  C CA    . VAL B 1 456 ? 79.37700  130.23600 108.53200 1.000 148.95000 ? 701 VAL B CA    1 
ATOM   5840  C C     . VAL B 1 456 ? 78.08100  129.49500 108.25700 1.000 148.95000 ? 701 VAL B C     1 
ATOM   5841  O O     . VAL B 1 456 ? 77.93400  128.85100 107.21500 1.000 148.95000 ? 701 VAL B O     1 
ATOM   5842  C CB    . VAL B 1 456 ? 80.29200  129.45300 109.48900 1.000 148.95000 ? 701 VAL B CB    1 
ATOM   5843  C CG1   . VAL B 1 456 ? 80.48800  128.04000 109.01500 1.000 148.95000 ? 701 VAL B CG1   1 
ATOM   5844  C CG2   . VAL B 1 456 ? 81.63000  130.12400 109.58300 1.000 148.95000 ? 701 VAL B CG2   1 
ATOM   5845  N N     . HIS B 1 457 ? 77.09800  129.63200 109.14700 1.000 150.10000 ? 702 HIS B N     1 
ATOM   5846  C CA    . HIS B 1 457 ? 75.83300  128.93800 108.94400 1.000 150.10000 ? 702 HIS B CA    1 
ATOM   5847  C C     . HIS B 1 457 ? 75.04000  129.54500 107.79500 1.000 150.10000 ? 702 HIS B C     1 
ATOM   5848  O O     . HIS B 1 457 ? 74.35900  128.82100 107.06100 1.000 150.10000 ? 702 HIS B O     1 
ATOM   5849  C CB    . HIS B 1 457 ? 74.99700  128.95000 110.21600 1.000 150.10000 ? 702 HIS B CB    1 
ATOM   5850  C CG    . HIS B 1 457 ? 73.70400  128.21600 110.07100 1.000 150.10000 ? 702 HIS B CG    1 
ATOM   5851  N ND1   . HIS B 1 457 ? 73.63000  126.84100 110.05000 1.000 150.10000 ? 702 HIS B ND1   1 
ATOM   5852  C CD2   . HIS B 1 457 ? 72.43900  128.66400 109.89400 1.000 150.10000 ? 702 HIS B CD2   1 
ATOM   5853  C CE1   . HIS B 1 457 ? 72.37100  126.47400 109.89200 1.000 150.10000 ? 702 HIS B CE1   1 
ATOM   5854  N NE2   . HIS B 1 457 ? 71.62800  127.56100 109.79400 1.000 150.10000 ? 702 HIS B NE2   1 
ATOM   5855  N N     . ARG B 1 458 ? 75.13300  130.86500 107.61100 1.000 145.94000 ? 703 ARG B N     1 
ATOM   5856  C CA    . ARG B 1 458 ? 74.47900  131.48700 106.46300 1.000 145.94000 ? 703 ARG B CA    1 
ATOM   5857  C C     . ARG B 1 458 ? 75.13000  131.06400 105.15500 1.000 145.94000 ? 703 ARG B C     1 
ATOM   5858  O O     . ARG B 1 458 ? 74.43600  130.85300 104.15500 1.000 145.94000 ? 703 ARG B O     1 
ATOM   5859  C CB    . ARG B 1 458 ? 74.48300  133.00700 106.59500 1.000 145.94000 ? 703 ARG B CB    1 
ATOM   5860  C CG    . ARG B 1 458 ? 73.49500  133.52400 107.61300 1.000 145.94000 ? 703 ARG B CG    1 
ATOM   5861  C CD    . ARG B 1 458 ? 73.50200  135.02600 107.65700 1.000 145.94000 ? 703 ARG B CD    1 
ATOM   5862  N NE    . ARG B 1 458 ? 74.71200  135.55000 108.27100 1.000 145.94000 ? 703 ARG B NE    1 
ATOM   5863  C CZ    . ARG B 1 458 ? 75.05100  136.83000 108.24600 1.000 145.94000 ? 703 ARG B CZ    1 
ATOM   5864  N NH1   . ARG B 1 458 ? 74.28400  137.70800 107.62200 1.000 145.94000 ? 703 ARG B NH1   1 
ATOM   5865  N NH2   . ARG B 1 458 ? 76.16100  137.23300 108.83800 1.000 145.94000 ? 703 ARG B NH2   1 
ATOM   5866  N N     . VAL B 1 459 ? 76.45300  130.89200 105.15100 1.000 151.99000 ? 704 VAL B N     1 
ATOM   5867  C CA    . VAL B 1 459 ? 77.13100  130.44500 103.93600 1.000 151.99000 ? 704 VAL B CA    1 
ATOM   5868  C C     . VAL B 1 459 ? 76.83500  128.97300 103.66000 1.000 151.99000 ? 704 VAL B C     1 
ATOM   5869  O O     . VAL B 1 459 ? 76.61600  128.57400 102.50600 1.000 151.99000 ? 704 VAL B O     1 
ATOM   5870  C CB    . VAL B 1 459 ? 78.63900  130.72500 104.04500 1.000 151.99000 ? 704 VAL B CB    1 
ATOM   5871  C CG1   . VAL B 1 459 ? 79.38700  130.14700 102.86700 1.000 151.99000 ? 704 VAL B CG1   1 
ATOM   5872  C CG2   . VAL B 1 459 ? 78.86800  132.21100 104.09000 1.000 151.99000 ? 704 VAL B CG2   1 
ATOM   5873  N N     . VAL B 1 460 ? 76.79100  128.15500 104.71500 1.000 153.92000 ? 705 VAL B N     1 
ATOM   5874  C CA    . VAL B 1 460 ? 76.41000  126.75100 104.58600 1.000 153.92000 ? 705 VAL B CA    1 
ATOM   5875  C C     . VAL B 1 460 ? 74.98700  126.62500 104.05900 1.000 153.92000 ? 705 VAL B C     1 
ATOM   5876  O O     . VAL B 1 460 ? 74.71800  125.82000 103.16300 1.000 153.92000 ? 705 VAL B O     1 
ATOM   5877  C CB    . VAL B 1 460 ? 76.60200  126.02500 105.93300 1.000 153.92000 ? 705 VAL B CB    1 
ATOM   5878  C CG1   . VAL B 1 460 ? 75.88700  124.68900 105.95500 1.000 153.92000 ? 705 VAL B CG1   1 
ATOM   5879  C CG2   . VAL B 1 460 ? 78.07700  125.77800 106.17200 1.000 153.92000 ? 705 VAL B CG2   1 
ATOM   5880  N N     . GLU B 1 461 ? 74.07600  127.47800 104.53000 1.000 160.68000 ? 706 GLU B N     1 
ATOM   5881  C CA    . GLU B 1 461 ? 72.70200  127.39500 104.04900 1.000 160.68000 ? 706 GLU B CA    1 
ATOM   5882  C C     . GLU B 1 461 ? 72.55600  127.95500 102.63700 1.000 160.68000 ? 706 GLU B C     1 
ATOM   5883  O O     . GLU B 1 461 ? 71.73800  127.45400 101.85600 1.000 160.68000 ? 706 GLU B O     1 
ATOM   5884  C CB    . GLU B 1 461 ? 71.76200  128.11100 105.02000 1.000 160.68000 ? 706 GLU B CB    1 
ATOM   5885  C CG    . GLU B 1 461 ? 70.28400  127.93100 104.69300 1.000 160.68000 ? 706 GLU B CG    1 
ATOM   5886  C CD    . GLU B 1 461 ? 69.82000  126.48700 104.83300 1.000 160.68000 ? 706 GLU B CD    1 
ATOM   5887  O OE1   . GLU B 1 461 ? 70.35400  125.75900 105.69700 1.000 160.68000 ? 706 GLU B OE1   1 
ATOM   5888  O OE2   . GLU B 1 461 ? 68.93200  126.06900 104.06200 1.000 160.68000 ? 706 GLU B OE2   1 
ATOM   5889  N N     . ALA B 1 462 ? 73.35300  128.96100 102.27600 1.000 155.55000 ? 707 ALA B N     1 
ATOM   5890  C CA    . ALA B 1 462 ? 73.28500  129.49600 100.92200 1.000 155.55000 ? 707 ALA B CA    1 
ATOM   5891  C C     . ALA B 1 462 ? 73.84700  128.51100 99.91100  1.000 155.55000 ? 707 ALA B C     1 
ATOM   5892  O O     . ALA B 1 462 ? 73.35600  128.42800 98.78100  1.000 155.55000 ? 707 ALA B O     1 
ATOM   5893  C CB    . ALA B 1 462 ? 74.02900  130.82200 100.84000 1.000 155.55000 ? 707 ALA B CB    1 
ATOM   5894  N N     . TRP B 1 463 ? 74.87200  127.75500 100.29300 1.000 157.40000 ? 708 TRP B N     1 
ATOM   5895  C CA    . TRP B 1 463 ? 75.30400  126.67100 99.42600  1.000 157.40000 ? 708 TRP B CA    1 
ATOM   5896  C C     . TRP B 1 463 ? 74.42500  125.44200 99.56100  1.000 157.40000 ? 708 TRP B C     1 
ATOM   5897  O O     . TRP B 1 463 ? 74.45900  124.57800 98.68700  1.000 157.40000 ? 708 TRP B O     1 
ATOM   5898  C CB    . TRP B 1 463 ? 76.76100  126.29900 99.69100  1.000 157.40000 ? 708 TRP B CB    1 
ATOM   5899  C CG    . TRP B 1 463 ? 77.69300  127.34500 99.21300  1.000 157.40000 ? 708 TRP B CG    1 
ATOM   5900  C CD1   . TRP B 1 463 ? 78.40100  128.22600 99.97400  1.000 157.40000 ? 708 TRP B CD1   1 
ATOM   5901  C CD2   . TRP B 1 463 ? 77.97200  127.67800 97.85000  1.000 157.40000 ? 708 TRP B CD2   1 
ATOM   5902  N NE1   . TRP B 1 463 ? 79.13300  129.06200 99.17000  1.000 157.40000 ? 708 TRP B NE1   1 
ATOM   5903  C CE2   . TRP B 1 463 ? 78.88200  128.74800 97.86000  1.000 157.40000 ? 708 TRP B CE2   1 
ATOM   5904  C CE3   . TRP B 1 463 ? 77.55300  127.16300 96.62100  1.000 157.40000 ? 708 TRP B CE3   1 
ATOM   5905  C CZ2   . TRP B 1 463 ? 79.37900  129.31200 96.69100  1.000 157.40000 ? 708 TRP B CZ2   1 
ATOM   5906  C CZ3   . TRP B 1 463 ? 78.04900  127.72400 95.46400  1.000 157.40000 ? 708 TRP B CZ3   1 
ATOM   5907  C CH2   . TRP B 1 463 ? 78.94700  128.79100 95.50700  1.000 157.40000 ? 708 TRP B CH2   1 
ATOM   5908  N N     . LYS B 1 464 ? 73.63200  125.35700 100.62000 1.000 162.60000 ? 709 LYS B N     1 
ATOM   5909  C CA    . LYS B 1 464 ? 72.70900  124.25400 100.82200 1.000 162.60000 ? 709 LYS B CA    1 
ATOM   5910  C C     . LYS B 1 464 ? 71.42800  124.41700 100.01700 1.000 162.60000 ? 709 LYS B C     1 
ATOM   5911  O O     . LYS B 1 464 ? 70.78600  123.41100 99.69400  1.000 162.60000 ? 709 LYS B O     1 
ATOM   5912  C CB    . LYS B 1 464 ? 72.40600  124.14100 102.32000 1.000 162.60000 ? 709 LYS B CB    1 
ATOM   5913  C CG    . LYS B 1 464 ? 71.62600  122.93000 102.79600 1.000 162.60000 ? 709 LYS B CG    1 
ATOM   5914  C CD    . LYS B 1 464 ? 71.50400  122.98500 104.31500 1.000 162.60000 ? 709 LYS B CD    1 
ATOM   5915  C CE    . LYS B 1 464 ? 70.68800  121.84200 104.88200 1.000 162.60000 ? 709 LYS B CE    1 
ATOM   5916  N NZ    . LYS B 1 464 ? 70.56700  121.95700 106.36100 1.000 162.60000 ? 709 LYS B NZ    1 
ATOM   5917  N N     . LEU B 1 465 ? 71.04600  125.65600 99.69300  1.000 165.81000 ? 710 LEU B N     1 
ATOM   5918  C CA    . LEU B 1 465 ? 70.00200  125.88200 98.69700  1.000 165.81000 ? 710 LEU B CA    1 
ATOM   5919  C C     . LEU B 1 465 ? 70.41600  125.30900 97.35100  1.000 165.81000 ? 710 LEU B C     1 
ATOM   5920  O O     . LEU B 1 465 ? 69.76200  124.41300 96.80800  1.000 165.81000 ? 710 LEU B O     1 
ATOM   5921  C CB    . LEU B 1 465 ? 69.69600  127.37400 98.55500  1.000 165.81000 ? 710 LEU B CB    1 
ATOM   5922  C CG    . LEU B 1 465 ? 68.92500  128.10600 99.64800  1.000 165.81000 ? 710 LEU B CG    1 
ATOM   5923  C CD1   . LEU B 1 465 ? 68.83100  129.58400 99.31800  1.000 165.81000 ? 710 LEU B CD1   1 
ATOM   5924  C CD2   . LEU B 1 465 ? 67.54200  127.51100 99.78300  1.000 165.81000 ? 710 LEU B CD2   1 
ATOM   5925  N N     . ARG B 1 466 ? 71.51900  125.80700 96.80200  1.000 159.63000 ? 711 ARG B N     1 
ATOM   5926  C CA    . ARG B 1 466 ? 72.09300  125.25200 95.58200  1.000 159.63000 ? 711 ARG B CA    1 
ATOM   5927  C C     . ARG B 1 466 ? 73.01300  124.08700 95.94800  1.000 159.63000 ? 711 ARG B C     1 
ATOM   5928  O O     . ARG B 1 466 ? 74.22900  124.13100 95.78100  1.000 159.63000 ? 711 ARG B O     1 
ATOM   5929  C CB    . ARG B 1 466 ? 72.82300  126.34800 94.82300  1.000 159.63000 ? 711 ARG B CB    1 
ATOM   5930  C CG    . ARG B 1 466 ? 71.88700  127.43800 94.33200  1.000 159.63000 ? 711 ARG B CG    1 
ATOM   5931  C CD    . ARG B 1 466 ? 72.63700  128.55000 93.63800  1.000 159.63000 ? 711 ARG B CD    1 
ATOM   5932  N NE    . ARG B 1 466 ? 73.43700  129.31600 94.58700  1.000 159.63000 ? 711 ARG B NE    1 
ATOM   5933  C CZ    . ARG B 1 466 ? 74.76300  129.32300 94.59600  1.000 159.63000 ? 711 ARG B CZ    1 
ATOM   5934  N NH1   . ARG B 1 466 ? 75.43100  128.61200 93.70100  1.000 159.63000 ? 711 ARG B NH1   1 
ATOM   5935  N NH2   . ARG B 1 466 ? 75.42200  130.04600 95.49100  1.000 159.63000 ? 711 ARG B NH2   1 
ATOM   5936  N N     . GLY B 1 467 ? 72.39600  123.02700 96.46100  1.000 165.98000 ? 712 GLY B N     1 
ATOM   5937  C CA    . GLY B 1 467 ? 73.12400  122.04800 97.23900  1.000 165.98000 ? 712 GLY B CA    1 
ATOM   5938  C C     . GLY B 1 467 ? 73.08600  120.61000 96.78100  1.000 165.98000 ? 712 GLY B C     1 
ATOM   5939  O O     . GLY B 1 467 ? 72.91800  119.71700 97.61300  1.000 165.98000 ? 712 GLY B O     1 
ATOM   5940  N N     . ALA B 1 468 ? 73.20300  120.36800 95.48400  1.000 168.17000 ? 713 ALA B N     1 
ATOM   5941  C CA    . ALA B 1 468 ? 73.36200  119.00400 94.99000  1.000 168.17000 ? 713 ALA B CA    1 
ATOM   5942  C C     . ALA B 1 468 ? 74.73700  118.48400 95.38600  1.000 168.17000 ? 713 ALA B C     1 
ATOM   5943  O O     . ALA B 1 468 ? 75.74700  119.04500 94.94500  1.000 168.17000 ? 713 ALA B O     1 
ATOM   5944  C CB    . ALA B 1 468 ? 73.19300  118.96400 93.47600  1.000 168.17000 ? 713 ALA B CB    1 
ATOM   5945  N N     . PRO B 1 469 ? 74.83400  117.44100 96.19900  1.000 170.84000 ? 714 PRO B N     1 
ATOM   5946  C CA    . PRO B 1 469 ? 76.13500  117.00800 96.70900  1.000 170.84000 ? 714 PRO B CA    1 
ATOM   5947  C C     . PRO B 1 469 ? 76.88300  116.19600 95.65900  1.000 170.84000 ? 714 PRO B C     1 
ATOM   5948  O O     . PRO B 1 469 ? 76.40700  115.97000 94.54800  1.000 170.84000 ? 714 PRO B O     1 
ATOM   5949  C CB    . PRO B 1 469 ? 75.76800  116.13400 97.91200  1.000 170.84000 ? 714 PRO B CB    1 
ATOM   5950  C CG    . PRO B 1 469 ? 74.32100  116.42600 98.19400  1.000 170.84000 ? 714 PRO B CG    1 
ATOM   5951  C CD    . PRO B 1 469 ? 73.74000  116.70700 96.84900  1.000 170.84000 ? 714 PRO B CD    1 
ATOM   5952  N N     . ASP B 1 470 ? 78.07700  115.74900 96.03900  1.000 165.22000 ? 715 ASP B N     1 
ATOM   5953  C CA    . ASP B 1 470 ? 78.85000  114.82700 95.21400  1.000 165.22000 ? 715 ASP B CA    1 
ATOM   5954  C C     . ASP B 1 470 ? 79.74600  114.04200 96.16500  1.000 165.22000 ? 715 ASP B C     1 
ATOM   5955  O O     . ASP B 1 470 ? 80.80800  114.52500 96.56100  1.000 165.22000 ? 715 ASP B O     1 
ATOM   5956  C CB    . ASP B 1 470 ? 79.65800  115.57000 94.15900  1.000 165.22000 ? 715 ASP B CB    1 
ATOM   5957  C CG    . ASP B 1 470 ? 80.23400  114.64500 93.09600  1.000 165.22000 ? 715 ASP B CG    1 
ATOM   5958  O OD1   . ASP B 1 470 ? 80.02800  113.41400 93.17700  1.000 165.22000 ? 715 ASP B OD1   1 
ATOM   5959  O OD2   . ASP B 1 470 ? 80.89300  115.15700 92.16600  1.000 165.22000 ? 715 ASP B OD2   1 
ATOM   5960  N N     . TYR B 1 471 ? 79.31800  112.84200 96.52000  1.000 162.08000 ? 716 TYR B N     1 
ATOM   5961  C CA    . TYR B 1 471 ? 80.10300  111.97400 97.37700  1.000 162.08000 ? 716 TYR B CA    1 
ATOM   5962  C C     . TYR B 1 471 ? 80.82400  110.93500 96.53300  1.000 162.08000 ? 716 TYR B C     1 
ATOM   5963  O O     . TYR B 1 471 ? 80.42000  110.63600 95.40700  1.000 162.08000 ? 716 TYR B O     1 
ATOM   5964  C CB    . TYR B 1 471 ? 79.21700  111.27900 98.40800  1.000 162.08000 ? 716 TYR B CB    1 
ATOM   5965  C CG    . TYR B 1 471 ? 78.60800  112.21000 99.42800  1.000 162.08000 ? 716 TYR B CG    1 
ATOM   5966  C CD1   . TYR B 1 471 ? 79.33100  112.62800 100.53600 1.000 162.08000 ? 716 TYR B CD1   1 
ATOM   5967  C CD2   . TYR B 1 471 ? 77.30500  112.67000 99.28600  1.000 162.08000 ? 716 TYR B CD2   1 
ATOM   5968  C CE1   . TYR B 1 471 ? 78.77400  113.47800 101.47500 1.000 162.08000 ? 716 TYR B CE1   1 
ATOM   5969  C CE2   . TYR B 1 471 ? 76.74100  113.52100 100.22300 1.000 162.08000 ? 716 TYR B CE2   1 
ATOM   5970  C CZ    . TYR B 1 471 ? 77.48300  113.92000 101.31400 1.000 162.08000 ? 716 TYR B CZ    1 
ATOM   5971  O OH    . TYR B 1 471 ? 76.93400  114.76600 102.24900 1.000 162.08000 ? 716 TYR B OH    1 
ATOM   5972  N N     . ILE B 1 472 ? 81.90600  110.39300 97.08500  1.000 175.36000 ? 717 ILE B N     1 
ATOM   5973  C CA    . ILE B 1 472 ? 82.60400  109.26800 96.48300  1.000 175.36000 ? 717 ILE B CA    1 
ATOM   5974  C C     . ILE B 1 472 ? 82.82600  108.23100 97.57700  1.000 175.36000 ? 717 ILE B C     1 
ATOM   5975  O O     . ILE B 1 472 ? 82.95400  108.56500 98.76000  1.000 175.36000 ? 717 ILE B O     1 
ATOM   5976  C CB    . ILE B 1 472 ? 83.92500  109.70500 95.79800  1.000 175.36000 ? 717 ILE B CB    1 
ATOM   5977  C CG1   . ILE B 1 472 ? 84.41400  108.63600 94.82200  1.000 175.36000 ? 717 ILE B CG1   1 
ATOM   5978  C CG2   . ILE B 1 472 ? 85.00800  110.06200 96.80700  1.000 175.36000 ? 717 ILE B CG2   1 
ATOM   5979  C CD1   . ILE B 1 472 ? 83.49400  108.43500 93.64700  1.000 175.36000 ? 717 ILE B CD1   1 
ATOM   5980  N N     . GLU B 1 473 ? 82.79900  106.95600 97.18900  1.000 186.29000 ? 718 GLU B N     1 
ATOM   5981  C CA    . GLU B 1 473 ? 82.78800  105.86200 98.15400  1.000 186.29000 ? 718 GLU B CA    1 
ATOM   5982  C C     . GLU B 1 473 ? 83.97400  104.92000 97.99200  1.000 186.29000 ? 718 GLU B C     1 
ATOM   5983  O O     . GLU B 1 473 ? 83.91400  103.77200 98.44100  1.000 186.29000 ? 718 GLU B O     1 
ATOM   5984  C CB    . GLU B 1 473 ? 81.47500  105.08100 98.06400  1.000 186.29000 ? 718 GLU B CB    1 
ATOM   5985  C CG    . GLU B 1 473 ? 80.26000  105.82000 98.61900  1.000 186.29000 ? 718 GLU B CG    1 
ATOM   5986  C CD    . GLU B 1 473 ? 79.62400  106.77000 97.62000  1.000 186.29000 ? 718 GLU B CD    1 
ATOM   5987  O OE1   . GLU B 1 473 ? 80.08400  106.81700 96.45900  1.000 186.29000 ? 718 GLU B OE1   1 
ATOM   5988  O OE2   . GLU B 1 473 ? 78.66000  107.47100 97.99900  1.000 186.29000 ? 718 GLU B OE2   1 
ATOM   5989  N N     . ASP B 1 474 ? 85.06400  105.38600 97.37900  1.000 177.73000 ? 719 ASP B N     1 
ATOM   5990  C CA    . ASP B 1 474 ? 86.29200  104.60000 97.37700  1.000 177.73000 ? 719 ASP B CA    1 
ATOM   5991  C C     . ASP B 1 474 ? 86.96400  104.63400 98.74100  1.000 177.73000 ? 719 ASP B C     1 
ATOM   5992  O O     . ASP B 1 474 ? 87.83900  103.80900 99.02700  1.000 177.73000 ? 719 ASP B O     1 
ATOM   5993  C CB    . ASP B 1 474 ? 87.24400  105.11400 96.30000  1.000 177.73000 ? 719 ASP B CB    1 
ATOM   5994  C CG    . ASP B 1 474 ? 86.70000  104.91500 94.89900  1.000 177.73000 ? 719 ASP B CG    1 
ATOM   5995  O OD1   . ASP B 1 474 ? 85.90100  103.97700 94.69600  1.000 177.73000 ? 719 ASP B OD1   1 
ATOM   5996  O OD2   . ASP B 1 474 ? 87.06800  105.69500 93.99800  1.000 177.73000 ? 719 ASP B OD2   1 
ATOM   5997  N N     . ILE B 1 475 ? 86.56400  105.57600 99.58600  1.000 168.79000 ? 720 ILE B N     1 
ATOM   5998  C CA    . ILE B 1 475 ? 87.09300  105.74800 100.92500 1.000 168.79000 ? 720 ILE B CA    1 
ATOM   5999  C C     . ILE B 1 475 ? 86.26200  104.97000 101.94400 1.000 168.79000 ? 720 ILE B C     1 
ATOM   6000  O O     . ILE B 1 475 ? 86.76800  104.08300 102.63300 1.000 168.79000 ? 720 ILE B O     1 
ATOM   6001  C CB    . ILE B 1 475 ? 87.12800  107.22900 101.26800 1.000 168.79000 ? 720 ILE B CB    1 
ATOM   6002  C CG1   . ILE B 1 475 ? 88.05500  107.95500 100.29800 1.000 168.79000 ? 720 ILE B CG1   1 
ATOM   6003  C CG2   . ILE B 1 475 ? 87.53400  107.42400 102.70400 1.000 168.79000 ? 720 ILE B CG2   1 
ATOM   6004  C CD1   . ILE B 1 475 ? 87.88500  109.43900 100.30400 1.000 168.79000 ? 720 ILE B CD1   1 
ATOM   6005  N N     . LEU C 1 70  ? 126.99300 121.28300 67.76700  1.000 134.27000 ? 315 LEU C N     1 
ATOM   6006  C CA    . LEU C 1 70  ? 126.75700 122.24000 68.84300  1.000 134.27000 ? 315 LEU C CA    1 
ATOM   6007  C C     . LEU C 1 70  ? 125.65600 123.20900 68.46400  1.000 134.27000 ? 315 LEU C C     1 
ATOM   6008  O O     . LEU C 1 70  ? 125.53600 123.57900 67.29700  1.000 134.27000 ? 315 LEU C O     1 
ATOM   6009  C CB    . LEU C 1 70  ? 128.02800 123.02600 69.18000  1.000 134.27000 ? 315 LEU C CB    1 
ATOM   6010  C CG    . LEU C 1 70  ? 129.07500 122.45500 70.13900  1.000 134.27000 ? 315 LEU C CG    1 
ATOM   6011  C CD1   . LEU C 1 70  ? 129.85900 121.31100 69.52800  1.000 134.27000 ? 315 LEU C CD1   1 
ATOM   6012  C CD2   . LEU C 1 70  ? 130.02000 123.55600 70.57500  1.000 134.27000 ? 315 LEU C CD2   1 
ATOM   6013  N N     . PRO C 1 71  ? 124.84400 123.61100 69.43700  1.000 138.64000 ? 316 PRO C N     1 
ATOM   6014  C CA    . PRO C 1 71  ? 123.91700 124.70800 69.21000  1.000 138.64000 ? 316 PRO C CA    1 
ATOM   6015  C C     . PRO C 1 71  ? 124.68800 126.00600 69.09800  1.000 138.64000 ? 316 PRO C C     1 
ATOM   6016  O O     . PRO C 1 71  ? 125.57100 126.27800 69.92500  1.000 138.64000 ? 316 PRO C O     1 
ATOM   6017  C CB    . PRO C 1 71  ? 123.03100 124.69500 70.46500  1.000 138.64000 ? 316 PRO C CB    1 
ATOM   6018  C CG    . PRO C 1 71  ? 123.21100 123.35300 71.04600  1.000 138.64000 ? 316 PRO C CG    1 
ATOM   6019  C CD    . PRO C 1 71  ? 124.63400 123.00400 70.75600  1.000 138.64000 ? 316 PRO C CD    1 
ATOM   6020  N N     . PRO C 1 72  ? 124.41000 126.82000 68.08600  1.000 139.92000 ? 317 PRO C N     1 
ATOM   6021  C CA    . PRO C 1 72  ? 125.15100 128.07400 67.92700  1.000 139.92000 ? 317 PRO C CA    1 
ATOM   6022  C C     . PRO C 1 72  ? 124.73400 129.08600 68.97800  1.000 139.92000 ? 317 PRO C C     1 
ATOM   6023  O O     . PRO C 1 72  ? 123.77800 128.89300 69.73200  1.000 139.92000 ? 317 PRO C O     1 
ATOM   6024  C CB    . PRO C 1 72  ? 124.77600 128.53400 66.51800  1.000 139.92000 ? 317 PRO C CB    1 
ATOM   6025  C CG    . PRO C 1 72  ? 123.44500 127.93000 66.28000  1.000 139.92000 ? 317 PRO C CG    1 
ATOM   6026  C CD    . PRO C 1 72  ? 123.43900 126.61300 66.99900  1.000 139.92000 ? 317 PRO C CD    1 
ATOM   6027  N N     . LEU C 1 73  ? 125.48500 130.18500 69.02000  1.000 130.87000 ? 318 LEU C N     1 
ATOM   6028  C CA    . LEU C 1 73  ? 125.19300 131.25200 69.96400  1.000 130.87000 ? 318 LEU C CA    1 
ATOM   6029  C C     . LEU C 1 73  ? 123.90200 131.91300 69.52300  1.000 130.87000 ? 318 LEU C C     1 
ATOM   6030  O O     . LEU C 1 73  ? 123.88600 132.82100 68.68600  1.000 130.87000 ? 318 LEU C O     1 
ATOM   6031  C CB    . LEU C 1 73  ? 126.34200 132.25400 70.05600  1.000 130.87000 ? 318 LEU C CB    1 
ATOM   6032  C CG    . LEU C 1 73  ? 127.37900 131.99100 71.15300  1.000 130.87000 ? 318 LEU C CG    1 
ATOM   6033  C CD1   . LEU C 1 73  ? 126.69900 132.08100 72.50400  1.000 130.87000 ? 318 LEU C CD1   1 
ATOM   6034  C CD2   . LEU C 1 73  ? 128.10300 130.65700 71.01000  1.000 130.87000 ? 318 LEU C CD2   1 
ATOM   6035  N N     . SER C 1 74  ? 122.81700 131.43100 70.10400  1.000 130.70000 ? 319 SER C N     1 
ATOM   6036  C CA    . SER C 1 74  ? 121.49100 131.52500 69.52800  1.000 130.70000 ? 319 SER C CA    1 
ATOM   6037  C C     . SER C 1 74  ? 120.53800 131.02300 70.58800  1.000 130.70000 ? 319 SER C C     1 
ATOM   6038  O O     . SER C 1 74  ? 120.95200 130.36300 71.54200  1.000 130.70000 ? 319 SER C O     1 
ATOM   6039  C CB    . SER C 1 74  ? 121.38100 130.68100 68.26700  1.000 130.70000 ? 319 SER C CB    1 
ATOM   6040  O OG    . SER C 1 74  ? 121.54600 129.31500 68.60700  1.000 130.70000 ? 319 SER C OG    1 
ATOM   6041  N N     . LEU C 1 75  ? 119.26100 131.36600 70.41800  1.000 128.55000 ? 320 LEU C N     1 
ATOM   6042  C CA    . LEU C 1 75  ? 118.12500 131.12300 71.30800  1.000 128.55000 ? 320 LEU C CA    1 
ATOM   6043  C C     . LEU C 1 75  ? 118.22700 131.92200 72.59900  1.000 128.55000 ? 320 LEU C C     1 
ATOM   6044  O O     . LEU C 1 75  ? 117.34700 131.79800 73.45700  1.000 128.55000 ? 320 LEU C O     1 
ATOM   6045  C CB    . LEU C 1 75  ? 117.92000 129.63900 71.66500  1.000 128.55000 ? 320 LEU C CB    1 
ATOM   6046  C CG    . LEU C 1 75  ? 117.43100 128.61900 70.63300  1.000 128.55000 ? 320 LEU C CG    1 
ATOM   6047  C CD1   . LEU C 1 75  ? 118.52200 128.21400 69.65200  1.000 128.55000 ? 320 LEU C CD1   1 
ATOM   6048  C CD2   . LEU C 1 75  ? 116.91600 127.39400 71.34000  1.000 128.55000 ? 320 LEU C CD2   1 
ATOM   6049  N N     . LEU C 1 76  ? 119.26700 132.73500 72.76700  1.000 133.28000 ? 321 LEU C N     1 
ATOM   6050  C CA    . LEU C 1 76  ? 119.42700 133.61300 73.90700  1.000 133.28000 ? 321 LEU C CA    1 
ATOM   6051  C C     . LEU C 1 76  ? 118.55400 134.84700 73.73300  1.000 133.28000 ? 321 LEU C C     1 
ATOM   6052  O O     . LEU C 1 76  ? 118.11900 135.17800 72.62800  1.000 133.28000 ? 321 LEU C O     1 
ATOM   6053  C CB    . LEU C 1 76  ? 120.88600 134.05200 74.06200  1.000 133.28000 ? 321 LEU C CB    1 
ATOM   6054  C CG    . LEU C 1 76  ? 121.94300 133.20800 74.78400  1.000 133.28000 ? 321 LEU C CG    1 
ATOM   6055  C CD1   . LEU C 1 76  ? 121.51700 132.94400 76.21200  1.000 133.28000 ? 321 LEU C CD1   1 
ATOM   6056  C CD2   . LEU C 1 76  ? 122.28800 131.92600 74.06500  1.000 133.28000 ? 321 LEU C CD2   1 
ATOM   6057  N N     . ASP C 1 77  ? 118.29300 135.52400 74.83800  1.000 139.73000 ? 322 ASP C N     1 
ATOM   6058  C CA    . ASP C 1 77  ? 117.70400 136.84600 74.74200  1.000 139.73000 ? 322 ASP C CA    1 
ATOM   6059  C C     . ASP C 1 77  ? 118.73500 137.78800 74.14100  1.000 139.73000 ? 322 ASP C C     1 
ATOM   6060  O O     . ASP C 1 77  ? 119.89600 137.76900 74.56100  1.000 139.73000 ? 322 ASP C O     1 
ATOM   6061  C CB    . ASP C 1 77  ? 117.25500 137.36500 76.10400  1.000 139.73000 ? 322 ASP C CB    1 
ATOM   6062  C CG    . ASP C 1 77  ? 116.01700 136.66300 76.61800  1.000 139.73000 ? 322 ASP C CG    1 
ATOM   6063  O OD1   . ASP C 1 77  ? 115.22100 136.17700 75.78900  1.000 139.73000 ? 322 ASP C OD1   1 
ATOM   6064  O OD2   . ASP C 1 77  ? 115.83800 136.59800 77.85200  1.000 139.73000 ? 322 ASP C OD2   1 
ATOM   6065  N N     . PRO C 1 78  ? 118.37700 138.56800 73.12500  1.000 142.45000 ? 323 PRO C N     1 
ATOM   6066  C CA    . PRO C 1 78  ? 119.28500 139.61600 72.64500  1.000 142.45000 ? 323 PRO C CA    1 
ATOM   6067  C C     . PRO C 1 78  ? 119.47900 140.65800 73.73000  1.000 142.45000 ? 323 PRO C C     1 
ATOM   6068  O O     . PRO C 1 78  ? 118.51100 141.20500 74.26600  1.000 142.45000 ? 323 PRO C O     1 
ATOM   6069  C CB    . PRO C 1 78  ? 118.55400 140.18700 71.42700  1.000 142.45000 ? 323 PRO C CB    1 
ATOM   6070  C CG    . PRO C 1 78  ? 117.62800 139.10000 71.00000  1.000 142.45000 ? 323 PRO C CG    1 
ATOM   6071  C CD    . PRO C 1 78  ? 117.19100 138.43300 72.26600  1.000 142.45000 ? 323 PRO C CD    1 
ATOM   6072  N N     . ALA C 1 79  ? 120.74400 140.88900 74.08400  1.000 155.18000 ? 324 ALA C N     1 
ATOM   6073  C CA    . ALA C 1 79  ? 121.09600 141.84000 75.12900  1.000 155.18000 ? 324 ALA C CA    1 
ATOM   6074  C C     . ALA C 1 79  ? 120.69100 143.23700 74.69200  1.000 155.18000 ? 324 ALA C C     1 
ATOM   6075  O O     . ALA C 1 79  ? 121.33400 143.83200 73.82100  1.000 155.18000 ? 324 ALA C O     1 
ATOM   6076  C CB    . ALA C 1 79  ? 122.59200 141.78000 75.43300  1.000 155.18000 ? 324 ALA C CB    1 
ATOM   6077  N N     . GLU C 1 80  ? 119.61300 143.74400 75.28500  1.000 158.63000 ? 325 GLU C N     1 
ATOM   6078  C CA    . GLU C 1 80  ? 118.96000 144.95300 74.81500  1.000 158.63000 ? 325 GLU C CA    1 
ATOM   6079  C C     . GLU C 1 80  ? 119.83300 146.17800 75.06500  1.000 158.63000 ? 325 GLU C C     1 
ATOM   6080  O O     . GLU C 1 80  ? 120.76500 146.16400 75.87500  1.000 158.63000 ? 325 GLU C O     1 
ATOM   6081  C CB    . GLU C 1 80  ? 117.60600 145.12900 75.50400  1.000 158.63000 ? 325 GLU C CB    1 
ATOM   6082  C CG    . GLU C 1 80  ? 117.69000 145.55300 76.96900  1.000 158.63000 ? 325 GLU C CG    1 
ATOM   6083  C CD    . GLU C 1 80  ? 117.81400 144.38900 77.93900  1.000 158.63000 ? 325 GLU C CD    1 
ATOM   6084  O OE1   . GLU C 1 80  ? 118.13900 143.26300 77.50600  1.000 158.63000 ? 325 GLU C OE1   1 
ATOM   6085  O OE2   . GLU C 1 80  ? 117.58500 144.60400 79.14600  1.000 158.63000 ? 325 GLU C OE2   1 
ATOM   6086  N N     . VAL C 1 81  ? 119.52900 147.24500 74.33700  1.000 163.53000 ? 326 VAL C N     1 
ATOM   6087  C CA    . VAL C 1 81  ? 120.31100 148.47000 74.42300  1.000 163.53000 ? 326 VAL C CA    1 
ATOM   6088  C C     . VAL C 1 81  ? 119.87700 149.21800 75.67600  1.000 163.53000 ? 326 VAL C C     1 
ATOM   6089  O O     . VAL C 1 81  ? 118.73700 149.67700 75.77500  1.000 163.53000 ? 326 VAL C O     1 
ATOM   6090  C CB    . VAL C 1 81  ? 120.13700 149.33300 73.17100  1.000 163.53000 ? 326 VAL C CB    1 
ATOM   6091  C CG1   . VAL C 1 81  ? 120.91000 150.63400 73.31700  1.000 163.53000 ? 326 VAL C CG1   1 
ATOM   6092  C CG2   . VAL C 1 81  ? 120.58900 148.56200 71.94600  1.000 163.53000 ? 326 VAL C CG2   1 
ATOM   6093  N N     . LYS C 1 82  ? 120.77800 149.32400 76.64200  1.000 154.70000 ? 327 LYS C N     1 
ATOM   6094  C CA    . LYS C 1 82  ? 120.55900 150.13600 77.82600  1.000 154.70000 ? 327 LYS C CA    1 
ATOM   6095  C C     . LYS C 1 82  ? 121.81000 150.96200 78.07900  1.000 154.70000 ? 327 LYS C C     1 
ATOM   6096  O O     . LYS C 1 82  ? 122.93200 150.50600 77.83000  1.000 154.70000 ? 327 LYS C O     1 
ATOM   6097  C CB    . LYS C 1 82  ? 120.18100 149.28100 79.05900  1.000 154.70000 ? 327 LYS C CB    1 
ATOM   6098  C CG    . LYS C 1 82  ? 121.30900 148.53700 79.77500  1.000 154.70000 ? 327 LYS C CG    1 
ATOM   6099  C CD    . LYS C 1 82  ? 121.71400 147.26300 79.05100  1.000 154.70000 ? 327 LYS C CD    1 
ATOM   6100  C CE    . LYS C 1 82  ? 120.63700 146.20100 79.18000  1.000 154.70000 ? 327 LYS C CE    1 
ATOM   6101  N NZ    . LYS C 1 82  ? 120.98600 144.96700 78.42500  1.000 154.70000 ? 327 LYS C NZ    1 
ATOM   6102  N N     . GLN C 1 83  ? 121.60800 152.20200 78.51800  1.000 152.49000 ? 328 GLN C N     1 
ATOM   6103  C CA    . GLN C 1 83  ? 122.70700 153.15100 78.70200  1.000 152.49000 ? 328 GLN C CA    1 
ATOM   6104  C C     . GLN C 1 83  ? 122.32400 154.07200 79.85800  1.000 152.49000 ? 328 GLN C C     1 
ATOM   6105  O O     . GLN C 1 83  ? 121.68100 155.10600 79.66600  1.000 152.49000 ? 328 GLN C O     1 
ATOM   6106  C CB    . GLN C 1 83  ? 122.97400 153.91500 77.41400  1.000 152.49000 ? 328 GLN C CB    1 
ATOM   6107  C CG    . GLN C 1 83  ? 124.19300 154.80800 77.43400  1.000 152.49000 ? 328 GLN C CG    1 
ATOM   6108  C CD    . GLN C 1 83  ? 124.47600 155.39900 76.06900  1.000 152.49000 ? 328 GLN C CD    1 
ATOM   6109  O OE1   . GLN C 1 83  ? 123.73500 155.16300 75.11500  1.000 152.49000 ? 328 GLN C OE1   1 
ATOM   6110  N NE2   . GLN C 1 83  ? 125.55300 156.16400 75.96500  1.000 152.49000 ? 328 GLN C NE2   1 
ATOM   6111  N N     . LYS C 1 84  ? 122.72600 153.67500 81.06100  1.000 140.54000 ? 329 LYS C N     1 
ATOM   6112  C CA    . LYS C 1 84  ? 122.42900 154.37900 82.30100  1.000 140.54000 ? 329 LYS C CA    1 
ATOM   6113  C C     . LYS C 1 84  ? 123.66400 154.39000 83.19300  1.000 140.54000 ? 329 LYS C C     1 
ATOM   6114  O O     . LYS C 1 84  ? 123.57600 154.30500 84.42200  1.000 140.54000 ? 329 LYS C O     1 
ATOM   6115  C CB    . LYS C 1 84  ? 121.22200 153.74600 82.99800  1.000 140.54000 ? 329 LYS C CB    1 
ATOM   6116  C CG    . LYS C 1 84  ? 121.36700 152.24800 83.26800  1.000 140.54000 ? 329 LYS C CG    1 
ATOM   6117  C CD    . LYS C 1 84  ? 120.16600 151.67600 84.00500  1.000 140.54000 ? 329 LYS C CD    1 
ATOM   6118  C CE    . LYS C 1 84  ? 118.95700 151.52100 83.10200  1.000 140.54000 ? 329 LYS C CE    1 
ATOM   6119  N NZ    . LYS C 1 84  ? 119.16600 150.46000 82.08400  1.000 140.54000 ? 329 LYS C NZ    1 
ATOM   6120  N N     . SER C 1 85  ? 124.83300 154.56600 82.58000  1.000 143.32000 ? 330 SER C N     1 
ATOM   6121  C CA    . SER C 1 85  ? 126.11400 154.17900 83.15500  1.000 143.32000 ? 330 SER C CA    1 
ATOM   6122  C C     . SER C 1 85  ? 126.68800 155.18800 84.15200  1.000 143.32000 ? 330 SER C C     1 
ATOM   6123  O O     . SER C 1 85  ? 127.90900 155.15200 84.36200  1.000 143.32000 ? 330 SER C O     1 
ATOM   6124  C CB    . SER C 1 85  ? 127.12400 153.92200 82.03400  1.000 143.32000 ? 330 SER C CB    1 
ATOM   6125  O OG    . SER C 1 85  ? 127.38400 155.10400 81.30000  1.000 143.32000 ? 330 SER C OG    1 
ATOM   6126  N N     . TYR C 1 86  ? 125.85700 156.05700 84.74200  1.000 136.88000 ? 331 TYR C N     1 
ATOM   6127  C CA    . TYR C 1 86  ? 126.18900 156.85700 85.92600  1.000 136.88000 ? 331 TYR C CA    1 
ATOM   6128  C C     . TYR C 1 86  ? 127.36400 157.80600 85.66500  1.000 136.88000 ? 331 TYR C C     1 
ATOM   6129  O O     . TYR C 1 86  ? 128.49200 157.58600 86.11100  1.000 136.88000 ? 331 TYR C O     1 
ATOM   6130  C CB    . TYR C 1 86  ? 126.46500 155.94800 87.12600  1.000 136.88000 ? 331 TYR C CB    1 
ATOM   6131  C CG    . TYR C 1 86  ? 125.28700 155.08500 87.48100  1.000 136.88000 ? 331 TYR C CG    1 
ATOM   6132  C CD1   . TYR C 1 86  ? 124.20700 155.61000 88.17200  1.000 136.88000 ? 331 TYR C CD1   1 
ATOM   6133  C CD2   . TYR C 1 86  ? 125.25300 153.74500 87.12000  1.000 136.88000 ? 331 TYR C CD2   1 
ATOM   6134  C CE1   . TYR C 1 86  ? 123.12100 154.82400 88.49600  1.000 136.88000 ? 331 TYR C CE1   1 
ATOM   6135  C CE2   . TYR C 1 86  ? 124.17300 152.94800 87.44000  1.000 136.88000 ? 331 TYR C CE2   1 
ATOM   6136  C CZ    . TYR C 1 86  ? 123.10900 153.49400 88.12500  1.000 136.88000 ? 331 TYR C CZ    1 
ATOM   6137  O OH    . TYR C 1 86  ? 122.03100 152.70800 88.45400  1.000 136.88000 ? 331 TYR C OH    1 
ATOM   6138  N N     . SER C 1 87  ? 127.06900 158.81600 84.84700  1.000 133.99000 ? 332 SER C N     1 
ATOM   6139  C CA    . SER C 1 87  ? 128.01400 159.87300 84.51100  1.000 133.99000 ? 332 SER C CA    1 
ATOM   6140  C C     . SER C 1 87  ? 128.56200 160.54900 85.77200  1.000 133.99000 ? 332 SER C C     1 
ATOM   6141  O O     . SER C 1 87  ? 127.84100 160.70500 86.76200  1.000 133.99000 ? 332 SER C O     1 
ATOM   6142  C CB    . SER C 1 87  ? 127.32600 160.89700 83.60900  1.000 133.99000 ? 332 SER C CB    1 
ATOM   6143  O OG    . SER C 1 87  ? 126.98600 160.31700 82.36200  1.000 133.99000 ? 332 SER C OG    1 
ATOM   6144  N N     . PRO C 1 88  ? 129.85400 160.96600 85.75800  1.000 133.73000 ? 333 PRO C N     1 
ATOM   6145  C CA    . PRO C 1 88  ? 130.55400 161.28800 87.01500  1.000 133.73000 ? 333 PRO C CA    1 
ATOM   6146  C C     . PRO C 1 88  ? 130.10900 162.54200 87.75700  1.000 133.73000 ? 333 PRO C C     1 
ATOM   6147  O O     . PRO C 1 88  ? 130.63600 162.82400 88.83800  1.000 133.73000 ? 333 PRO C O     1 
ATOM   6148  C CB    . PRO C 1 88  ? 132.01500 161.42400 86.56700  1.000 133.73000 ? 333 PRO C CB    1 
ATOM   6149  C CG    . PRO C 1 88  ? 131.94500 161.76900 85.13900  1.000 133.73000 ? 333 PRO C CG    1 
ATOM   6150  C CD    . PRO C 1 88  ? 130.76900 161.02800 84.60400  1.000 133.73000 ? 333 PRO C CD    1 
ATOM   6151  N N     . GLU C 1 89  ? 129.15900 163.29600 87.20300  1.000 136.00000 ? 334 GLU C N     1 
ATOM   6152  C CA    . GLU C 1 89  ? 128.48600 164.34400 87.96600  1.000 136.00000 ? 334 GLU C CA    1 
ATOM   6153  C C     . GLU C 1 89  ? 127.75700 163.76700 89.17200  1.000 136.00000 ? 334 GLU C C     1 
ATOM   6154  O O     . GLU C 1 89  ? 128.05300 164.12200 90.32300  1.000 136.00000 ? 334 GLU C O     1 
ATOM   6155  C CB    . GLU C 1 89  ? 127.50100 165.08000 87.06200  1.000 136.00000 ? 334 GLU C CB    1 
ATOM   6156  C CG    . GLU C 1 89  ? 126.69900 166.15700 87.75400  1.000 136.00000 ? 334 GLU C CG    1 
ATOM   6157  C CD    . GLU C 1 89  ? 125.69800 166.81100 86.82100  1.000 136.00000 ? 334 GLU C CD    1 
ATOM   6158  O OE1   . GLU C 1 89  ? 125.62500 166.40100 85.64300  1.000 136.00000 ? 334 GLU C OE1   1 
ATOM   6159  O OE2   . GLU C 1 89  ? 124.97900 167.72800 87.26800  1.000 136.00000 ? 334 GLU C OE2   1 
ATOM   6160  N N     . SER C 1 90  ? 126.81700 162.85200 88.91500  1.000 121.62000 ? 335 SER C N     1 
ATOM   6161  C CA    . SER C 1 90  ? 126.07000 162.19800 89.98200  1.000 121.62000 ? 335 SER C CA    1 
ATOM   6162  C C     . SER C 1 90  ? 126.97400 161.34500 90.85600  1.000 121.62000 ? 335 SER C C     1 
ATOM   6163  O O     . SER C 1 90  ? 126.72000 161.19500 92.05500  1.000 121.62000 ? 335 SER C O     1 
ATOM   6164  C CB    . SER C 1 90  ? 124.96400 161.34000 89.37800  1.000 121.62000 ? 335 SER C CB    1 
ATOM   6165  O OG    . SER C 1 90  ? 124.05600 162.13700 88.64400  1.000 121.62000 ? 335 SER C OG    1 
ATOM   6166  N N     . LEU C 1 91  ? 128.04700 160.81000 90.28000  1.000 118.85000 ? 336 LEU C N     1 
ATOM   6167  C CA    . LEU C 1 91  ? 128.97500 159.99700 91.05000  1.000 118.85000 ? 336 LEU C CA    1 
ATOM   6168  C C     . LEU C 1 91  ? 129.76900 160.84200 92.03200  1.000 118.85000 ? 336 LEU C C     1 
ATOM   6169  O O     . LEU C 1 91  ? 129.95600 160.44700 93.18900  1.000 118.85000 ? 336 LEU C O     1 
ATOM   6170  C CB    . LEU C 1 91  ? 129.91500 159.26800 90.10500  1.000 118.85000 ? 336 LEU C CB    1 
ATOM   6171  C CG    . LEU C 1 91  ? 130.78100 158.24400 90.80100  1.000 118.85000 ? 336 LEU C CG    1 
ATOM   6172  C CD1   . LEU C 1 91  ? 129.84700 157.20600 91.36000  1.000 118.85000 ? 336 LEU C CD1   1 
ATOM   6173  C CD2   . LEU C 1 91  ? 131.73500 157.64800 89.80300  1.000 118.85000 ? 336 LEU C CD2   1 
ATOM   6174  N N     . GLU C 1 92  ? 130.24100 162.00800 91.58800  1.000 117.19000 ? 337 GLU C N     1 
ATOM   6175  C CA    . GLU C 1 92  ? 130.92300 162.93100 92.48500  1.000 117.19000 ? 337 GLU C CA    1 
ATOM   6176  C C     . GLU C 1 92  ? 129.97400 163.44000 93.55900  1.000 117.19000 ? 337 GLU C C     1 
ATOM   6177  O O     . GLU C 1 92  ? 130.37700 163.64100 94.71500  1.000 117.19000 ? 337 GLU C O     1 
ATOM   6178  C CB    . GLU C 1 92  ? 131.50200 164.08700 91.67300  1.000 117.19000 ? 337 GLU C CB    1 
ATOM   6179  C CG    . GLU C 1 92  ? 132.50400 164.97500 92.39200  1.000 117.19000 ? 337 GLU C CG    1 
ATOM   6180  C CD    . GLU C 1 92  ? 131.85100 166.09300 93.17600  1.000 117.19000 ? 337 GLU C CD    1 
ATOM   6181  O OE1   . GLU C 1 92  ? 130.70100 166.45000 92.85300  1.000 117.19000 ? 337 GLU C OE1   1 
ATOM   6182  O OE2   . GLU C 1 92  ? 132.49800 166.63300 94.09400  1.000 117.19000 ? 337 GLU C OE2   1 
ATOM   6183  N N     . ALA C 1 93  ? 128.70200 163.63400 93.19300  1.000 116.25000 ? 338 ALA C N     1 
ATOM   6184  C CA    . ALA C 1 93  ? 127.69500 164.02900 94.17200  1.000 116.25000 ? 338 ALA C CA    1 
ATOM   6185  C C     . ALA C 1 93  ? 127.50000 162.95500 95.23300  1.000 116.25000 ? 338 ALA C C     1 
ATOM   6186  O O     . ALA C 1 93  ? 127.45500 163.25900 96.42900  1.000 116.25000 ? 338 ALA C O     1 
ATOM   6187  C CB    . ALA C 1 93  ? 126.37300 164.32700 93.47200  1.000 116.25000 ? 338 ALA C CB    1 
ATOM   6188  N N     . MET C 1 94  ? 127.40800 161.69300 94.81000  1.000 107.06000 ? 339 MET C N     1 
ATOM   6189  C CA    . MET C 1 94  ? 127.26900 160.58700 95.75000  1.000 107.06000 ? 339 MET C CA    1 
ATOM   6190  C C     . MET C 1 94  ? 128.50300 160.43700 96.62600  1.000 107.06000 ? 339 MET C C     1 
ATOM   6191  O O     . MET C 1 94  ? 128.38400 160.09200 97.80400  1.000 107.06000 ? 339 MET C O     1 
ATOM   6192  C CB    . MET C 1 94  ? 127.00800 159.29300 94.98800  1.000 107.06000 ? 339 MET C CB    1 
ATOM   6193  C CG    . MET C 1 94  ? 126.68200 158.10700 95.85900  1.000 107.06000 ? 339 MET C CG    1 
ATOM   6194  S SD    . MET C 1 94  ? 126.48400 156.61500 94.87800  1.000 107.06000 ? 339 MET C SD    1 
ATOM   6195  C CE    . MET C 1 94  ? 124.96600 156.97900 94.00400  1.000 107.06000 ? 339 MET C CE    1 
ATOM   6196  N N     . SER C 1 95  ? 129.68400 160.72200 96.07700  1.000 100.34000 ? 340 SER C N     1 
ATOM   6197  C CA    . SER C 1 95  ? 130.90900 160.61500 96.86100  1.000 100.34000 ? 340 SER C CA    1 
ATOM   6198  C C     . SER C 1 95  ? 130.97100 161.68000 97.94400  1.000 100.34000 ? 340 SER C C     1 
ATOM   6199  O O     . SER C 1 95  ? 131.30000 161.37800 99.09900  1.000 100.34000 ? 340 SER C O     1 
ATOM   6200  C CB    . SER C 1 95  ? 132.12300 160.71200 95.94800  1.000 100.34000 ? 340 SER C CB    1 
ATOM   6201  O OG    . SER C 1 95  ? 132.16800 159.60200 95.07600  1.000 100.34000 ? 340 SER C OG    1 
ATOM   6202  N N     . ARG C 1 96  ? 130.64200 162.92600 97.59900  1.000 103.79000 ? 341 ARG C N     1 
ATOM   6203  C CA    . ARG C 1 96  ? 130.57900 163.95800 98.62800  1.000 103.79000 ? 341 ARG C CA    1 
ATOM   6204  C C     . ARG C 1 96  ? 129.46100 163.68800 99.61900  1.000 103.79000 ? 341 ARG C C     1 
ATOM   6205  O O     . ARG C 1 96  ? 129.59400 164.01500 100.80600 1.000 103.79000 ? 341 ARG C O     1 
ATOM   6206  C CB    . ARG C 1 96  ? 130.39700 165.33400 98.00000  1.000 103.79000 ? 341 ARG C CB    1 
ATOM   6207  C CG    . ARG C 1 96  ? 131.53100 165.77700 97.09300  1.000 103.79000 ? 341 ARG C CG    1 
ATOM   6208  C CD    . ARG C 1 96  ? 132.76500 166.28200 97.84700  1.000 103.79000 ? 341 ARG C CD    1 
ATOM   6209  N NE    . ARG C 1 96  ? 133.62500 165.21700 98.35900  1.000 103.79000 ? 341 ARG C NE    1 
ATOM   6210  C CZ    . ARG C 1 96  ? 134.49900 164.53700 97.62700  1.000 103.79000 ? 341 ARG C CZ    1 
ATOM   6211  N NH1   . ARG C 1 96  ? 134.65200 164.80300 96.34100  1.000 103.79000 ? 341 ARG C NH1   1 
ATOM   6212  N NH2   . ARG C 1 96  ? 135.23100 163.59000 98.18700  1.000 103.79000 ? 341 ARG C NH2   1 
ATOM   6213  N N     . LEU C 1 97  ? 128.38000 163.05200 99.16000  1.000 98.74000  ? 342 LEU C N     1 
ATOM   6214  C CA    . LEU C 1 97  ? 127.29300 162.68900 100.05600 1.000 98.74000  ? 342 LEU C CA    1 
ATOM   6215  C C     . LEU C 1 97  ? 127.74300 161.63700 101.05500 1.000 98.74000  ? 342 LEU C C     1 
ATOM   6216  O O     . LEU C 1 97  ? 127.40600 161.72400 102.23600 1.000 98.74000  ? 342 LEU C O     1 
ATOM   6217  C CB    . LEU C 1 97  ? 126.09500 162.20600 99.23900  1.000 98.74000  ? 342 LEU C CB    1 
ATOM   6218  C CG    . LEU C 1 97  ? 124.72300 162.06400 99.90100  1.000 98.74000  ? 342 LEU C CG    1 
ATOM   6219  C CD1   . LEU C 1 97  ? 123.65600 162.42700 98.89800  1.000 98.74000  ? 342 LEU C CD1   1 
ATOM   6220  C CD2   . LEU C 1 97  ? 124.47200 160.66000 100.38400 1.000 98.74000  ? 342 LEU C CD2   1 
ATOM   6221  N N     . LEU C 1 98  ? 128.52800 160.65700 100.61000 1.000 97.91000  ? 343 LEU C N     1 
ATOM   6222  C CA    . LEU C 1 98  ? 129.04100 159.65600 101.53700 1.000 97.91000  ? 343 LEU C CA    1 
ATOM   6223  C C     . LEU C 1 98  ? 130.03900 160.26600 102.50400 1.000 97.91000  ? 343 LEU C C     1 
ATOM   6224  O O     . LEU C 1 98  ? 130.06900 159.88900 103.68100 1.000 97.91000  ? 343 LEU C O     1 
ATOM   6225  C CB    . LEU C 1 98  ? 129.66800 158.49300 100.77400 1.000 97.91000  ? 343 LEU C CB    1 
ATOM   6226  C CG    . LEU C 1 98  ? 130.20500 157.32000 101.59500 1.000 97.91000  ? 343 LEU C CG    1 
ATOM   6227  C CD1   . LEU C 1 98  ? 129.88700 156.04700 100.90300 1.000 97.91000  ? 343 LEU C CD1   1 
ATOM   6228  C CD2   . LEU C 1 98  ? 131.70900 157.39200 101.73200 1.000 97.91000  ? 343 LEU C CD2   1 
ATOM   6229  N N     . GLU C 1 99  ? 130.86000 161.20300 102.02200 1.000 106.00000 ? 344 GLU C N     1 
ATOM   6230  C CA    . GLU C 1 99  ? 131.80700 161.88400 102.89900 1.000 106.00000 ? 344 GLU C CA    1 
ATOM   6231  C C     . GLU C 1 99  ? 131.09200 162.65300 104.00300 1.000 106.00000 ? 344 GLU C C     1 
ATOM   6232  O O     . GLU C 1 99  ? 131.49500 162.59400 105.17200 1.000 106.00000 ? 344 GLU C O     1 
ATOM   6233  C CB    . GLU C 1 99  ? 132.68900 162.82700 102.08900 1.000 106.00000 ? 344 GLU C CB    1 
ATOM   6234  C CG    . GLU C 1 99  ? 133.71600 163.55400 102.93200 1.000 106.00000 ? 344 GLU C CG    1 
ATOM   6235  C CD    . GLU C 1 99  ? 134.61600 164.45600 102.11500 1.000 106.00000 ? 344 GLU C CD    1 
ATOM   6236  O OE1   . GLU C 1 99  ? 134.42200 164.53300 100.88300 1.000 106.00000 ? 344 GLU C OE1   1 
ATOM   6237  O OE2   . GLU C 1 99  ? 135.52000 165.08600 102.70600 1.000 106.00000 ? 344 GLU C OE2   1 
ATOM   6238  N N     . ILE C 1 100 ? 130.00200 163.33900 103.65700 1.000 103.29000 ? 345 ILE C N     1 
ATOM   6239  C CA    . ILE C 1 100 ? 129.21600 164.03600 104.66900 1.000 103.29000 ? 345 ILE C CA    1 
ATOM   6240  C C     . ILE C 1 100 ? 128.53500 163.04400 105.60400 1.000 103.29000 ? 345 ILE C C     1 
ATOM   6241  O O     . ILE C 1 100 ? 128.68600 163.13100 106.82600 1.000 103.29000 ? 345 ILE C O     1 
ATOM   6242  C CB    . ILE C 1 100 ? 128.19900 164.98400 104.01200 1.000 103.29000 ? 345 ILE C CB    1 
ATOM   6243  C CG1   . ILE C 1 100 ? 128.92600 166.09200 103.26100 1.000 103.29000 ? 345 ILE C CG1   1 
ATOM   6244  C CG2   . ILE C 1 100 ? 127.28500 165.58500 105.05600 1.000 103.29000 ? 345 ILE C CG2   1 
ATOM   6245  C CD1   . ILE C 1 100 ? 129.78500 166.94700 104.15200 1.000 103.29000 ? 345 ILE C CD1   1 
ATOM   6246  N N     . LYS C 1 101 ? 127.81900 162.05900 105.04800 1.000 98.38000  ? 346 LYS C N     1 
ATOM   6247  C CA    . LYS C 1 101 ? 127.01500 161.15500 105.86700 1.000 98.38000  ? 346 LYS C CA    1 
ATOM   6248  C C     . LYS C 1 101 ? 127.85500 160.22400 106.72800 1.000 98.38000  ? 346 LYS C C     1 
ATOM   6249  O O     . LYS C 1 101 ? 127.32500 159.64400 107.67800 1.000 98.38000  ? 346 LYS C O     1 
ATOM   6250  C CB    . LYS C 1 101 ? 126.07800 160.32700 104.99300 1.000 98.38000  ? 346 LYS C CB    1 
ATOM   6251  C CG    . LYS C 1 101 ? 125.02600 161.13400 104.26800 1.000 98.38000  ? 346 LYS C CG    1 
ATOM   6252  C CD    . LYS C 1 101 ? 123.99400 161.71900 105.18500 1.000 98.38000  ? 346 LYS C CD    1 
ATOM   6253  C CE    . LYS C 1 101 ? 123.03000 160.65300 105.62000 1.000 98.38000  ? 346 LYS C CE    1 
ATOM   6254  N NZ    . LYS C 1 101 ? 121.91200 161.21500 106.41200 1.000 98.38000  ? 346 LYS C NZ    1 
ATOM   6255  N N     . LEU C 1 102 ? 129.13900 160.06100 106.43200 1.000 94.46000  ? 347 LEU C N     1 
ATOM   6256  C CA    . LEU C 1 102 ? 130.01700 159.45500 107.41900 1.000 94.46000  ? 347 LEU C CA    1 
ATOM   6257  C C     . LEU C 1 102 ? 130.59500 160.47800 108.37600 1.000 94.46000  ? 347 LEU C C     1 
ATOM   6258  O O     . LEU C 1 102 ? 130.77300 160.17100 109.56000 1.000 94.46000  ? 347 LEU C O     1 
ATOM   6259  C CB    . LEU C 1 102 ? 131.15600 158.69900 106.74600 1.000 94.46000  ? 347 LEU C CB    1 
ATOM   6260  C CG    . LEU C 1 102 ? 130.77900 157.39400 106.06800 1.000 94.46000  ? 347 LEU C CG    1 
ATOM   6261  C CD1   . LEU C 1 102 ? 132.00800 156.77500 105.46600 1.000 94.46000  ? 347 LEU C CD1   1 
ATOM   6262  C CD2   . LEU C 1 102 ? 130.14900 156.46600 107.06700 1.000 94.46000  ? 347 LEU C CD2   1 
ATOM   6263  N N     . LYS C 1 103 ? 130.87400 161.69300 107.89000 1.000 96.62000  ? 348 LYS C N     1 
ATOM   6264  C CA    . LYS C 1 103 ? 131.39300 162.75400 108.74800 1.000 96.62000  ? 348 LYS C CA    1 
ATOM   6265  C C     . LYS C 1 103 ? 130.36800 163.17500 109.79600 1.000 96.62000  ? 348 LYS C C     1 
ATOM   6266  O O     . LYS C 1 103 ? 130.74100 163.66400 110.87000 1.000 96.62000  ? 348 LYS C O     1 
ATOM   6267  C CB    . LYS C 1 103 ? 131.82500 163.93600 107.87400 1.000 96.62000  ? 348 LYS C CB    1 
ATOM   6268  C CG    . LYS C 1 103 ? 132.43800 165.11700 108.60600 1.000 96.62000  ? 348 LYS C CG    1 
ATOM   6269  C CD    . LYS C 1 103 ? 133.75200 164.74900 109.25000 1.000 96.62000  ? 348 LYS C CD    1 
ATOM   6270  C CE    . LYS C 1 103 ? 134.37500 165.95700 109.90900 1.000 96.62000  ? 348 LYS C CE    1 
ATOM   6271  N NZ    . LYS C 1 103 ? 135.62900 165.60800 110.61700 1.000 96.62000  ? 348 LYS C NZ    1 
ATOM   6272  N N     . GLU C 1 104 ? 129.08200 162.97000 109.50800 1.000 102.16000 ? 349 GLU C N     1 
ATOM   6273  C CA    . GLU C 1 104 ? 128.04900 163.12000 110.52400 1.000 102.16000 ? 349 GLU C CA    1 
ATOM   6274  C C     . GLU C 1 104 ? 128.27700 162.15800 111.67900 1.000 102.16000 ? 349 GLU C C     1 
ATOM   6275  O O     . GLU C 1 104 ? 128.14800 162.53500 112.84700 1.000 102.16000 ? 349 GLU C O     1 
ATOM   6276  C CB    . GLU C 1 104 ? 126.67900 162.88100 109.89900 1.000 102.16000 ? 349 GLU C CB    1 
ATOM   6277  C CG    . GLU C 1 104 ? 126.28400 163.90900 108.86300 1.000 102.16000 ? 349 GLU C CG    1 
ATOM   6278  C CD    . GLU C 1 104 ? 125.01100 163.53600 108.14100 1.000 102.16000 ? 349 GLU C CD    1 
ATOM   6279  O OE1   . GLU C 1 104 ? 124.49700 162.42800 108.39500 1.000 102.16000 ? 349 GLU C OE1   1 
ATOM   6280  O OE2   . GLU C 1 104 ? 124.52800 164.34100 107.32000 1.000 102.16000 ? 349 GLU C OE2   1 
ATOM   6281  N N     . PHE C 1 105 ? 128.65000 160.92200 111.37500 1.000 91.09000  ? 350 PHE C N     1 
ATOM   6282  C CA    . PHE C 1 105 ? 129.00400 159.97800 112.42100 1.000 91.09000  ? 350 PHE C CA    1 
ATOM   6283  C C     . PHE C 1 105 ? 130.45100 160.21400 112.82200 1.000 91.09000  ? 350 PHE C C     1 
ATOM   6284  O O     . PHE C 1 105 ? 131.12200 161.12000 112.32400 1.000 91.09000  ? 350 PHE C O     1 
ATOM   6285  C CB    . PHE C 1 105 ? 128.76000 158.55000 111.95700 1.000 91.09000  ? 350 PHE C CB    1 
ATOM   6286  C CG    . PHE C 1 105 ? 127.31900 158.22000 111.79100 1.000 91.09000  ? 350 PHE C CG    1 
ATOM   6287  C CD1   . PHE C 1 105 ? 126.54800 157.89200 112.88500 1.000 91.09000  ? 350 PHE C CD1   1 
ATOM   6288  C CD2   . PHE C 1 105 ? 126.73100 158.24900 110.54400 1.000 91.09000  ? 350 PHE C CD2   1 
ATOM   6289  C CE1   . PHE C 1 105 ? 125.21700 157.59100 112.73600 1.000 91.09000  ? 350 PHE C CE1   1 
ATOM   6290  C CE2   . PHE C 1 105 ? 125.39900 157.95000 110.38800 1.000 91.09000  ? 350 PHE C CE2   1 
ATOM   6291  C CZ    . PHE C 1 105 ? 124.64100 157.62200 111.48500 1.000 91.09000  ? 350 PHE C CZ    1 
ATOM   6292  N N     . GLY C 1 106 ? 130.96100 159.38000 113.71200 1.000 92.05000  ? 351 GLY C N     1 
ATOM   6293  C CA    . GLY C 1 106 ? 132.25300 159.64700 114.30300 1.000 92.05000  ? 351 GLY C CA    1 
ATOM   6294  C C     . GLY C 1 106 ? 133.45700 159.21300 113.49600 1.000 92.05000  ? 351 GLY C C     1 
ATOM   6295  O O     . GLY C 1 106 ? 134.42800 158.72600 114.07600 1.000 92.05000  ? 351 GLY C O     1 
ATOM   6296  N N     . VAL C 1 107 ? 133.43100 159.35400 112.17600 1.000 89.91000  ? 352 VAL C N     1 
ATOM   6297  C CA    . VAL C 1 107 ? 134.60000 159.01800 111.37700 1.000 89.91000  ? 352 VAL C CA    1 
ATOM   6298  C C     . VAL C 1 107 ? 134.96700 160.19300 110.48900 1.000 89.91000  ? 352 VAL C C     1 
ATOM   6299  O O     . VAL C 1 107 ? 134.12300 161.02000 110.13300 1.000 89.91000  ? 352 VAL C O     1 
ATOM   6300  C CB    . VAL C 1 107 ? 134.38500 157.75100 110.52700 1.000 89.91000  ? 352 VAL C CB    1 
ATOM   6301  C CG1   . VAL C 1 107 ? 134.23700 156.53400 111.40300 1.000 89.91000  ? 352 VAL C CG1   1 
ATOM   6302  C CG2   . VAL C 1 107 ? 133.16900 157.90600 109.68700 1.000 89.91000  ? 352 VAL C CG2   1 
ATOM   6303  N N     . GLU C 1 108 ? 136.24700 160.26900 110.14600 1.000 108.37000 ? 353 GLU C N     1 
ATOM   6304  C CA    . GLU C 1 108 ? 136.73500 161.17000 109.11400 1.000 108.37000 ? 353 GLU C CA    1 
ATOM   6305  C C     . GLU C 1 108 ? 137.17200 160.34100 107.91800 1.000 108.37000 ? 353 GLU C C     1 
ATOM   6306  O O     . GLU C 1 108 ? 137.93300 159.38100 108.06500 1.000 108.37000 ? 353 GLU C O     1 
ATOM   6307  C CB    . GLU C 1 108 ? 137.89500 162.03100 109.60800 1.000 108.37000 ? 353 GLU C CB    1 
ATOM   6308  C CG    . GLU C 1 108 ? 138.37700 163.01700 108.55600 1.000 108.37000 ? 353 GLU C CG    1 
ATOM   6309  C CD    . GLU C 1 108 ? 139.48600 163.91400 109.05000 1.000 108.37000 ? 353 GLU C CD    1 
ATOM   6310  O OE1   . GLU C 1 108 ? 139.89600 163.76200 110.21800 1.000 108.37000 ? 353 GLU C OE1   1 
ATOM   6311  O OE2   . GLU C 1 108 ? 139.95000 164.77100 108.27000 1.000 108.37000 ? 353 GLU C OE2   1 
ATOM   6312  N N     . VAL C 1 109 ? 136.70700 160.72500 106.73900 1.000 107.19000 ? 354 VAL C N     1 
ATOM   6313  C CA    . VAL C 1 109 ? 136.79300 159.89900 105.54800 1.000 107.19000 ? 354 VAL C CA    1 
ATOM   6314  C C     . VAL C 1 109 ? 137.33400 160.74800 104.40500 1.000 107.19000 ? 354 VAL C C     1 
ATOM   6315  O O     . VAL C 1 109 ? 136.93700 161.90600 104.24500 1.000 107.19000 ? 354 VAL C O     1 
ATOM   6316  C CB    . VAL C 1 109 ? 135.41000 159.29100 105.23100 1.000 107.19000 ? 354 VAL C CB    1 
ATOM   6317  C CG1   . VAL C 1 109 ? 134.32700 160.34400 105.31600 1.000 107.19000 ? 354 VAL C CG1   1 
ATOM   6318  C CG2   . VAL C 1 109 ? 135.37000 158.70100 103.86500 1.000 107.19000 ? 354 VAL C CG2   1 
ATOM   6319  N N     . SER C 1 110 ? 138.28700 160.20500 103.65000 1.000 107.13000 ? 355 SER C N     1 
ATOM   6320  C CA    . SER C 1 110 ? 138.79400 160.85400 102.44200 1.000 107.13000 ? 355 SER C CA    1 
ATOM   6321  C C     . SER C 1 110 ? 138.56700 159.89900 101.27800 1.000 107.13000 ? 355 SER C C     1 
ATOM   6322  O O     . SER C 1 110 ? 139.33100 158.94800 101.09000 1.000 107.13000 ? 355 SER C O     1 
ATOM   6323  C CB    . SER C 1 110 ? 140.26400 161.21800 102.58800 1.000 107.13000 ? 355 SER C CB    1 
ATOM   6324  O OG    . SER C 1 110 ? 141.05400 160.05200 102.70200 1.000 107.13000 ? 355 SER C OG    1 
ATOM   6325  N N     . VAL C 1 111 ? 137.51300 160.15500 100.50400 1.000 99.86000  ? 356 VAL C N     1 
ATOM   6326  C CA    . VAL C 1 111 ? 137.14000 159.26000 99.41800  1.000 99.86000  ? 356 VAL C CA    1 
ATOM   6327  C C     . VAL C 1 111 ? 138.11700 159.43700 98.26800  1.000 99.86000  ? 356 VAL C C     1 
ATOM   6328  O O     . VAL C 1 111 ? 138.49300 160.56300 97.92300  1.000 99.86000  ? 356 VAL C O     1 
ATOM   6329  C CB    . VAL C 1 111 ? 135.69700 159.55300 98.98600  1.000 99.86000  ? 356 VAL C CB    1 
ATOM   6330  C CG1   . VAL C 1 111 ? 135.24800 158.60000 97.89800  1.000 99.86000  ? 356 VAL C CG1   1 
ATOM   6331  C CG2   . VAL C 1 111 ? 134.78100 159.48600 100.18000 1.000 99.86000  ? 356 VAL C CG2   1 
ATOM   6332  N N     . ASP C 1 112 ? 138.55100 158.32800 97.67000  1.000 100.14000 ? 357 ASP C N     1 
ATOM   6333  C CA    . ASP C 1 112 ? 139.66300 158.37600 96.73400  1.000 100.14000 ? 357 ASP C CA    1 
ATOM   6334  C C     . ASP C 1 112 ? 139.24000 158.11000 95.29600  1.000 100.14000 ? 357 ASP C C     1 
ATOM   6335  O O     . ASP C 1 112 ? 139.44900 158.96300 94.43400  1.000 100.14000 ? 357 ASP C O     1 
ATOM   6336  C CB    . ASP C 1 112 ? 140.73700 157.37700 97.17100  1.000 100.14000 ? 357 ASP C CB    1 
ATOM   6337  C CG    . ASP C 1 112 ? 142.09300 157.66400 96.55400  1.000 100.14000 ? 357 ASP C CG    1 
ATOM   6338  O OD1   . ASP C 1 112 ? 142.21600 158.62300 95.76400  1.000 100.14000 ? 357 ASP C OD1   1 
ATOM   6339  O OD2   . ASP C 1 112 ? 143.05200 156.93400 96.88200  1.000 100.14000 ? 357 ASP C OD2   1 
ATOM   6340  N N     . SER C 1 113 ? 138.65000 156.95700 95.00600  1.000 96.59000  ? 358 SER C N     1 
ATOM   6341  C CA    . SER C 1 113 ? 138.29700 156.64200 93.63000  1.000 96.59000  ? 358 SER C CA    1 
ATOM   6342  C C     . SER C 1 113 ? 137.14700 155.65400 93.63500  1.000 96.59000  ? 358 SER C C     1 
ATOM   6343  O O     . SER C 1 113 ? 136.92600 154.93900 94.61300  1.000 96.59000  ? 358 SER C O     1 
ATOM   6344  C CB    . SER C 1 113 ? 139.47800 156.06500 92.85500  1.000 96.59000  ? 358 SER C CB    1 
ATOM   6345  O OG    . SER C 1 113 ? 139.80100 154.78100 93.34300  1.000 96.59000  ? 358 SER C OG    1 
ATOM   6346  N N     . VAL C 1 114 ? 136.41000 155.62900 92.52700  1.000 91.41000  ? 359 VAL C N     1 
ATOM   6347  C CA    . VAL C 1 114 ? 135.15700 154.89300 92.43200  1.000 91.41000  ? 359 VAL C CA    1 
ATOM   6348  C C     . VAL C 1 114 ? 135.23900 153.94700 91.24300  1.000 91.41000  ? 359 VAL C C     1 
ATOM   6349  O O     . VAL C 1 114 ? 135.79400 154.30200 90.19900  1.000 91.41000  ? 359 VAL C O     1 
ATOM   6350  C CB    . VAL C 1 114 ? 133.96000 155.85500 92.27500  1.000 91.41000  ? 359 VAL C CB    1 
ATOM   6351  C CG1   . VAL C 1 114 ? 132.66700 155.11200 92.36800  1.000 91.41000  ? 359 VAL C CG1   1 
ATOM   6352  C CG2   . VAL C 1 114 ? 133.99200 156.97000 93.29700  1.000 91.41000  ? 359 VAL C CG2   1 
ATOM   6353  N N     . HIS C 1 115 ? 134.69100 152.73800 91.39900  1.000 93.73000  ? 360 HIS C N     1 
ATOM   6354  C CA    . HIS C 1 115 ? 134.51300 151.80100 90.29400  1.000 93.73000  ? 360 HIS C CA    1 
ATOM   6355  C C     . HIS C 1 115 ? 133.02200 151.55400 90.09200  1.000 93.73000  ? 360 HIS C C     1 
ATOM   6356  O O     . HIS C 1 115 ? 132.42800 150.72000 90.79000  1.000 93.73000  ? 360 HIS C O     1 
ATOM   6357  C CB    . HIS C 1 115 ? 135.24000 150.48700 90.57700  1.000 93.73000  ? 360 HIS C CB    1 
ATOM   6358  C CG    . HIS C 1 115 ? 136.70300 150.64500 90.82800  1.000 93.73000  ? 360 HIS C CG    1 
ATOM   6359  N ND1   . HIS C 1 115 ? 137.61400 150.85100 89.81700  1.000 93.73000  ? 360 HIS C ND1   1 
ATOM   6360  C CD2   . HIS C 1 115 ? 137.41500 150.62600 91.97900  1.000 93.73000  ? 360 HIS C CD2   1 
ATOM   6361  C CE1   . HIS C 1 115 ? 138.82500 150.94800 90.33300  1.000 93.73000  ? 360 HIS C CE1   1 
ATOM   6362  N NE2   . HIS C 1 115 ? 138.73100 150.81800 91.64400  1.000 93.73000  ? 360 HIS C NE2   1 
ATOM   6363  N N     . PRO C 1 116 ? 132.37000 152.24500 89.15600  1.000 91.71000  ? 361 PRO C N     1 
ATOM   6364  C CA    . PRO C 1 116 ? 130.93100 152.03800 88.95000  1.000 91.71000  ? 361 PRO C CA    1 
ATOM   6365  C C     . PRO C 1 116 ? 130.64200 150.78200 88.14900  1.000 91.71000  ? 361 PRO C C     1 
ATOM   6366  O O     . PRO C 1 116 ? 131.33400 150.46200 87.18000  1.000 91.71000  ? 361 PRO C O     1 
ATOM   6367  C CB    . PRO C 1 116 ? 130.50400 153.29100 88.17900  1.000 91.71000  ? 361 PRO C CB    1 
ATOM   6368  C CG    . PRO C 1 116 ? 131.72200 153.71100 87.46900  1.000 91.71000  ? 361 PRO C CG    1 
ATOM   6369  C CD    . PRO C 1 116 ? 132.88100 153.37100 88.36000  1.000 91.71000  ? 361 PRO C CD    1 
ATOM   6370  N N     . GLY C 1 117 ? 129.59400 150.07200 88.55600  1.000 97.35000  ? 362 GLY C N     1 
ATOM   6371  C CA    . GLY C 1 117 ? 129.29300 148.78100 87.99100  1.000 97.35000  ? 362 GLY C CA    1 
ATOM   6372  C C     . GLY C 1 117 ? 127.84000 148.61500 87.60800  1.000 97.35000  ? 362 GLY C C     1 
ATOM   6373  O O     . GLY C 1 117 ? 127.06100 149.57100 87.60600  1.000 97.35000  ? 362 GLY C O     1 
ATOM   6374  N N     . PRO C 1 118 ? 127.44700 147.38600 87.26800  1.000 105.27000 ? 363 PRO C N     1 
ATOM   6375  C CA    . PRO C 1 118 ? 126.07900 147.15100 86.79200  1.000 105.27000 ? 363 PRO C CA    1 
ATOM   6376  C C     . PRO C 1 118 ? 125.04500 147.07800 87.89900  1.000 105.27000 ? 363 PRO C C     1 
ATOM   6377  O O     . PRO C 1 118 ? 123.89700 147.48200 87.70000  1.000 105.27000 ? 363 PRO C O     1 
ATOM   6378  C CB    . PRO C 1 118 ? 126.19300 145.80800 86.06400  1.000 105.27000 ? 363 PRO C CB    1 
ATOM   6379  C CG    . PRO C 1 118 ? 127.30800 145.12000 86.73600  1.000 105.27000 ? 363 PRO C CG    1 
ATOM   6380  C CD    . PRO C 1 118 ? 128.28800 146.18600 87.13500  1.000 105.27000 ? 363 PRO C CD    1 
ATOM   6381  N N     . VAL C 1 119 ? 125.42000 146.55700 89.06000  1.000 97.92000  ? 364 VAL C N     1 
ATOM   6382  C CA    . VAL C 1 119 ? 124.48700 146.32400 90.15700  1.000 97.92000  ? 364 VAL C CA    1 
ATOM   6383  C C     . VAL C 1 119 ? 124.82600 147.19400 91.35500  1.000 97.92000  ? 364 VAL C C     1 
ATOM   6384  O O     . VAL C 1 119 ? 123.98400 147.94300 91.85200  1.000 97.92000  ? 364 VAL C O     1 
ATOM   6385  C CB    . VAL C 1 119 ? 124.45400 144.83200 90.54500  1.000 97.92000  ? 364 VAL C CB    1 
ATOM   6386  C CG1   . VAL C 1 119 ? 123.44000 144.59600 91.64900  1.000 97.92000  ? 364 VAL C CG1   1 
ATOM   6387  C CG2   . VAL C 1 119 ? 124.16300 143.98600 89.33500  1.000 97.92000  ? 364 VAL C CG2   1 
ATOM   6388  N N     . ILE C 1 120 ? 126.05700 147.10700 91.83700  1.000 95.71000  ? 365 ILE C N     1 
ATOM   6389  C CA    . ILE C 1 120 ? 126.51300 147.95800 92.92100  1.000 95.71000  ? 365 ILE C CA    1 
ATOM   6390  C C     . ILE C 1 120 ? 127.54700 148.91100 92.36700  1.000 95.71000  ? 365 ILE C C     1 
ATOM   6391  O O     . ILE C 1 120 ? 127.86200 148.88300 91.17400  1.000 95.71000  ? 365 ILE C O     1 
ATOM   6392  C CB    . ILE C 1 120 ? 127.07500 147.13900 94.09300  1.000 95.71000  ? 365 ILE C CB    1 
ATOM   6393  C CG1   . ILE C 1 120 ? 128.11900 146.12600 93.62500  1.000 95.71000  ? 365 ILE C CG1   1 
ATOM   6394  C CG2   . ILE C 1 120 ? 125.97700 146.44900 94.81600  1.000 95.71000  ? 365 ILE C CG2   1 
ATOM   6395  C CD1   . ILE C 1 120 ? 129.55400 146.57000 93.79400  1.000 95.71000  ? 365 ILE C CD1   1 
ATOM   6396  N N     . THR C 1 121 ? 128.08800 149.75000 93.23300  1.000 92.37000  ? 366 THR C N     1 
ATOM   6397  C CA    . THR C 1 121 ? 129.12500 150.68800 92.84800  1.000 92.37000  ? 366 THR C CA    1 
ATOM   6398  C C     . THR C 1 121 ? 130.26200 150.56300 93.84500  1.000 92.37000  ? 366 THR C C     1 
ATOM   6399  O O     . THR C 1 121 ? 130.05900 150.75500 95.04600  1.000 92.37000  ? 366 THR C O     1 
ATOM   6400  C CB    . THR C 1 121 ? 128.57500 152.10700 92.80900  1.000 92.37000  ? 366 THR C CB    1 
ATOM   6401  O OG1   . THR C 1 121 ? 127.46900 152.15000 91.90200  1.000 92.37000  ? 366 THR C OG1   1 
ATOM   6402  C CG2   . THR C 1 121 ? 129.62100 153.03800 92.31700  1.000 92.37000  ? 366 THR C CG2   1 
ATOM   6403  N N     . ARG C 1 122 ? 131.44500 150.22200 93.35200  1.000 85.13000  ? 367 ARG C N     1 
ATOM   6404  C CA    . ARG C 1 122 ? 132.59800 150.02100 94.21600  1.000 85.13000  ? 367 ARG C CA    1 
ATOM   6405  C C     . ARG C 1 122 ? 133.20500 151.36600 94.58600  1.000 85.13000  ? 367 ARG C C     1 
ATOM   6406  O O     . ARG C 1 122 ? 133.41000 152.22000 93.72100  1.000 85.13000  ? 367 ARG C O     1 
ATOM   6407  C CB    . ARG C 1 122 ? 133.63200 149.15500 93.50800  1.000 85.13000  ? 367 ARG C CB    1 
ATOM   6408  C CG    . ARG C 1 122 ? 134.89300 148.87900 94.29300  1.000 85.13000  ? 367 ARG C CG    1 
ATOM   6409  C CD    . ARG C 1 122 ? 134.67200 147.81300 95.33700  1.000 85.13000  ? 367 ARG C CD    1 
ATOM   6410  N NE    . ARG C 1 122 ? 135.87600 147.56500 96.11500  1.000 85.13000  ? 367 ARG C NE    1 
ATOM   6411  C CZ    . ARG C 1 122 ? 136.85700 146.75200 95.74400  1.000 85.13000  ? 367 ARG C CZ    1 
ATOM   6412  N NH1   . ARG C 1 122 ? 136.80000 146.11600 94.58700  1.000 85.13000  ? 367 ARG C NH1   1 
ATOM   6413  N NH2   . ARG C 1 122 ? 137.90600 146.58900 96.52900  1.000 85.13000  ? 367 ARG C NH2   1 
ATOM   6414  N N     . PHE C 1 123 ? 133.49600 151.55000 95.86900  1.000 87.79000  ? 368 PHE C N     1 
ATOM   6415  C CA    . PHE C 1 123 ? 134.11500 152.76400 96.36900  1.000 87.79000  ? 368 PHE C CA    1 
ATOM   6416  C C     . PHE C 1 123 ? 135.41700 152.44400 97.07700  1.000 87.79000  ? 368 PHE C C     1 
ATOM   6417  O O     . PHE C 1 123 ? 135.67100 151.31000 97.48100  1.000 87.79000  ? 368 PHE C O     1 
ATOM   6418  C CB    . PHE C 1 123 ? 133.18800 153.50300 97.32100  1.000 87.79000  ? 368 PHE C CB    1 
ATOM   6419  C CG    . PHE C 1 123 ? 132.09900 154.22900 96.63300  1.000 87.79000  ? 368 PHE C CG    1 
ATOM   6420  C CD1   . PHE C 1 123 ? 132.28500 155.53000 96.21800  1.000 87.79000  ? 368 PHE C CD1   1 
ATOM   6421  C CD2   . PHE C 1 123 ? 130.91100 153.60000 96.35000  1.000 87.79000  ? 368 PHE C CD2   1 
ATOM   6422  C CE1   . PHE C 1 123 ? 131.28500 156.20600 95.57400  1.000 87.79000  ? 368 PHE C CE1   1 
ATOM   6423  C CE2   . PHE C 1 123 ? 129.91200 154.26600 95.69300  1.000 87.79000  ? 368 PHE C CE2   1 
ATOM   6424  C CZ    . PHE C 1 123 ? 130.09700 155.57100 95.30900  1.000 87.79000  ? 368 PHE C CZ    1 
ATOM   6425  N N     . GLU C 1 124 ? 136.24400 153.46900 97.22200  1.000 98.60000  ? 369 GLU C N     1 
ATOM   6426  C CA    . GLU C 1 124 ? 137.51400 153.35100 97.92100  1.000 98.60000  ? 369 GLU C CA    1 
ATOM   6427  C C     . GLU C 1 124 ? 137.60400 154.49700 98.91300  1.000 98.60000  ? 369 GLU C C     1 
ATOM   6428  O O     . GLU C 1 124 ? 137.84900 155.64300 98.52400  1.000 98.60000  ? 369 GLU C O     1 
ATOM   6429  C CB    . GLU C 1 124 ? 138.69000 153.37100 96.94700  1.000 98.60000  ? 369 GLU C CB    1 
ATOM   6430  C CG    . GLU C 1 124 ? 138.78000 152.13800 96.05700  1.000 98.60000  ? 369 GLU C CG    1 
ATOM   6431  C CD    . GLU C 1 124 ? 139.95400 152.18700 95.09200  1.000 98.60000  ? 369 GLU C CD    1 
ATOM   6432  O OE1   . GLU C 1 124 ? 140.62400 153.23500 95.03200  1.000 98.60000  ? 369 GLU C OE1   1 
ATOM   6433  O OE2   . GLU C 1 124 ? 140.20600 151.18200 94.39200  1.000 98.60000  ? 369 GLU C OE2   1 
ATOM   6434  N N     . ILE C 1 125 ? 137.39100 154.19200 100.18300 1.000 92.73000  ? 370 ILE C N     1 
ATOM   6435  C CA    . ILE C 1 125 ? 137.60900 155.14600 101.25800 1.000 92.73000  ? 370 ILE C CA    1 
ATOM   6436  C C     . ILE C 1 125 ? 139.05300 155.04200 101.70400 1.000 92.73000  ? 370 ILE C C     1 
ATOM   6437  O O     . ILE C 1 125 ? 139.51000 153.96700 102.09900 1.000 92.73000  ? 370 ILE C O     1 
ATOM   6438  C CB    . ILE C 1 125 ? 136.66500 154.88300 102.43600 1.000 92.73000  ? 370 ILE C CB    1 
ATOM   6439  C CG1   . ILE C 1 125 ? 135.25700 155.30300 102.07400 1.000 92.73000  ? 370 ILE C CG1   1 
ATOM   6440  C CG2   . ILE C 1 125 ? 137.16100 155.54900 103.70800 1.000 92.73000  ? 370 ILE C CG2   1 
ATOM   6441  C CD1   . ILE C 1 125 ? 134.29200 154.98400 103.13300 1.000 92.73000  ? 370 ILE C CD1   1 
ATOM   6442  N N     . GLN C 1 126 ? 139.77400 156.15100 101.64800 1.000 98.06000  ? 371 GLN C N     1 
ATOM   6443  C CA    . GLN C 1 126 ? 141.00200 156.26200 102.41100 1.000 98.06000  ? 371 GLN C CA    1 
ATOM   6444  C C     . GLN C 1 126 ? 140.66100 156.91400 103.74000 1.000 98.06000  ? 371 GLN C C     1 
ATOM   6445  O O     . GLN C 1 126 ? 140.38600 158.12200 103.76900 1.000 98.06000  ? 371 GLN C O     1 
ATOM   6446  C CB    . GLN C 1 126 ? 142.04400 157.07200 101.66700 1.000 98.06000  ? 371 GLN C CB    1 
ATOM   6447  C CG    . GLN C 1 126 ? 143.30900 157.23400 102.46400 1.000 98.06000  ? 371 GLN C CG    1 
ATOM   6448  C CD    . GLN C 1 126 ? 143.95400 155.91000 102.79100 1.000 98.06000  ? 371 GLN C CD    1 
ATOM   6449  O OE1   . GLN C 1 126 ? 144.05500 155.02600 101.94300 1.000 98.06000  ? 371 GLN C OE1   1 
ATOM   6450  N NE2   . GLN C 1 126 ? 144.37600 155.75700 104.03500 1.000 98.06000  ? 371 GLN C NE2   1 
ATOM   6451  N N     . PRO C 1 127 ? 140.63400 156.17400 104.84100 1.000 90.46000  ? 372 PRO C N     1 
ATOM   6452  C CA    . PRO C 1 127 ? 140.27400 156.77300 106.12400 1.000 90.46000  ? 372 PRO C CA    1 
ATOM   6453  C C     . PRO C 1 127 ? 141.42900 157.58800 106.67700 1.000 90.46000  ? 372 PRO C C     1 
ATOM   6454  O O     . PRO C 1 127 ? 142.58200 157.44000 106.27500 1.000 90.46000  ? 372 PRO C O     1 
ATOM   6455  C CB    . PRO C 1 127 ? 139.98000 155.55900 107.00500 1.000 90.46000  ? 372 PRO C CB    1 
ATOM   6456  C CG    . PRO C 1 127 ? 140.85900 154.51500 106.45800 1.000 90.46000  ? 372 PRO C CG    1 
ATOM   6457  C CD    . PRO C 1 127 ? 140.93800 154.74200 104.97600 1.000 90.46000  ? 372 PRO C CD    1 
ATOM   6458  N N     . ALA C 1 128 ? 141.09800 158.45300 107.62400 1.000 87.55000  ? 373 ALA C N     1 
ATOM   6459  C CA    . ALA C 1 128 ? 142.04800 159.44300 108.10600 1.000 87.55000  ? 373 ALA C CA    1 
ATOM   6460  C C     . ALA C 1 128 ? 143.04000 158.80600 109.07000 1.000 87.55000  ? 373 ALA C C     1 
ATOM   6461  O O     . ALA C 1 128 ? 143.07000 157.59000 109.27500 1.000 87.55000  ? 373 ALA C O     1 
ATOM   6462  C CB    . ALA C 1 128 ? 141.30900 160.60400 108.75700 1.000 87.55000  ? 373 ALA C CB    1 
ATOM   6463  N N     . ALA C 1 129 ? 143.86900 159.63900 109.68100 1.000 91.24000  ? 374 ALA C N     1 
ATOM   6464  C CA    . ALA C 1 129 ? 144.85100 159.15300 110.63400 1.000 91.24000  ? 374 ALA C CA    1 
ATOM   6465  C C     . ALA C 1 129 ? 144.17900 158.79200 111.94700 1.000 91.24000  ? 374 ALA C C     1 
ATOM   6466  O O     . ALA C 1 129 ? 143.40700 159.58000 112.49800 1.000 91.24000  ? 374 ALA C O     1 
ATOM   6467  C CB    . ALA C 1 129 ? 145.91900 160.21200 110.87400 1.000 91.24000  ? 374 ALA C CB    1 
ATOM   6468  N N     . GLY C 1 130 ? 144.47800 157.60600 112.45200 1.000 81.58000  ? 375 GLY C N     1 
ATOM   6469  C CA    . GLY C 1 130 ? 143.97800 157.22500 113.75200 1.000 81.58000  ? 375 GLY C CA    1 
ATOM   6470  C C     . GLY C 1 130 ? 142.51100 156.87200 113.74300 1.000 81.58000  ? 375 GLY C C     1 
ATOM   6471  O O     . GLY C 1 130 ? 141.71900 157.47000 114.47300 1.000 81.58000  ? 375 GLY C O     1 
ATOM   6472  N N     . VAL C 1 131 ? 142.13800 155.91000 112.91100 1.000 78.01000  ? 376 VAL C N     1 
ATOM   6473  C CA    . VAL C 1 131 ? 140.79900 155.34300 112.94400 1.000 78.01000  ? 376 VAL C CA    1 
ATOM   6474  C C     . VAL C 1 131 ? 140.90200 153.88700 112.51700 1.000 78.01000  ? 376 VAL C C     1 
ATOM   6475  O O     . VAL C 1 131 ? 141.67400 153.53500 111.62200 1.000 78.01000  ? 376 VAL C O     1 
ATOM   6476  C CB    . VAL C 1 131 ? 139.81500 156.17100 112.08500 1.000 78.01000  ? 376 VAL C CB    1 
ATOM   6477  C CG1   . VAL C 1 131 ? 140.23500 156.21900 110.63500 1.000 78.01000  ? 376 VAL C CG1   1 
ATOM   6478  C CG2   . VAL C 1 131 ? 138.40500 155.64900 112.21600 1.000 78.01000  ? 376 VAL C CG2   1 
ATOM   6479  N N     . LYS C 1 132 ? 140.16700 153.02900 113.21000 1.000 78.73000  ? 377 LYS C N     1 
ATOM   6480  C CA    . LYS C 1 132 ? 140.20900 151.59900 112.95700 1.000 78.73000  ? 377 LYS C CA    1 
ATOM   6481  C C     . LYS C 1 132 ? 139.31400 151.27100 111.76800 1.000 78.73000  ? 377 LYS C C     1 
ATOM   6482  O O     . LYS C 1 132 ? 138.87100 152.15000 111.02700 1.000 78.73000  ? 377 LYS C O     1 
ATOM   6483  C CB    . LYS C 1 132 ? 139.78400 150.83400 114.20400 1.000 78.73000  ? 377 LYS C CB    1 
ATOM   6484  C CG    . LYS C 1 132 ? 140.70000 151.01400 115.39900 1.000 78.73000  ? 377 LYS C CG    1 
ATOM   6485  C CD    . LYS C 1 132 ? 140.21400 150.19100 116.57900 1.000 78.73000  ? 377 LYS C CD    1 
ATOM   6486  C CE    . LYS C 1 132 ? 141.12000 150.36700 117.78300 1.000 78.73000  ? 377 LYS C CE    1 
ATOM   6487  N NZ    . LYS C 1 132 ? 140.66300 149.57500 118.95700 1.000 78.73000  ? 377 LYS C NZ    1 
ATOM   6488  N N     . VAL C 1 133 ? 139.03400 149.98900 111.57200 1.000 75.05000  ? 378 VAL C N     1 
ATOM   6489  C CA    . VAL C 1 133 ? 138.07100 149.57300 110.56600 1.000 75.05000  ? 378 VAL C CA    1 
ATOM   6490  C C     . VAL C 1 133 ? 136.72900 149.23700 111.20500 1.000 75.05000  ? 378 VAL C C     1 
ATOM   6491  O O     . VAL C 1 133 ? 135.68500 149.37900 110.54700 1.000 75.05000  ? 378 VAL C O     1 
ATOM   6492  C CB    . VAL C 1 133 ? 138.63800 148.38300 109.76900 1.000 75.05000  ? 378 VAL C CB    1 
ATOM   6493  C CG1   . VAL C 1 133 ? 137.75600 147.98600 108.60100 1.000 75.05000  ? 378 VAL C CG1   1 
ATOM   6494  C CG2   . VAL C 1 133 ? 139.99900 148.73800 109.27100 1.000 75.05000  ? 378 VAL C CG2   1 
ATOM   6495  N N     . SER C 1 134 ? 136.71900 148.86100 112.48800 1.000 72.82000  ? 379 SER C N     1 
ATOM   6496  C CA    . SER C 1 134 ? 135.47000 148.58000 113.18800 1.000 72.82000  ? 379 SER C CA    1 
ATOM   6497  C C     . SER C 1 134 ? 134.58200 149.80900 113.27600 1.000 72.82000  ? 379 SER C C     1 
ATOM   6498  O O     . SER C 1 134 ? 133.35700 149.68700 113.23800 1.000 72.82000  ? 379 SER C O     1 
ATOM   6499  C CB    . SER C 1 134 ? 135.76000 148.05100 114.58900 1.000 72.82000  ? 379 SER C CB    1 
ATOM   6500  O OG    . SER C 1 134 ? 136.33700 149.06100 115.39400 1.000 72.82000  ? 379 SER C OG    1 
ATOM   6501  N N     . ARG C 1 135 ? 135.17300 151.00200 113.29700 1.000 77.68000  ? 380 ARG C N     1 
ATOM   6502  C CA    . ARG C 1 135 ? 134.37900 152.22100 113.24700 1.000 77.68000  ? 380 ARG C CA    1 
ATOM   6503  C C     . ARG C 1 135 ? 133.73100 152.45100 111.88900 1.000 77.68000  ? 380 ARG C C     1 
ATOM   6504  O O     . ARG C 1 135 ? 132.96500 153.40600 111.74600 1.000 77.68000  ? 380 ARG C O     1 
ATOM   6505  C CB    . ARG C 1 135 ? 135.24000 153.42200 113.61800 1.000 77.68000  ? 380 ARG C CB    1 
ATOM   6506  C CG    . ARG C 1 135 ? 135.77400 153.35700 115.02700 1.000 77.68000  ? 380 ARG C CG    1 
ATOM   6507  C CD    . ARG C 1 135 ? 136.68700 154.51900 115.33200 1.000 77.68000  ? 380 ARG C CD    1 
ATOM   6508  N NE    . ARG C 1 135 ? 135.97300 155.77400 115.52100 1.000 77.68000  ? 380 ARG C NE    1 
ATOM   6509  C CZ    . ARG C 1 135 ? 136.57600 156.95300 115.59500 1.000 77.68000  ? 380 ARG C CZ    1 
ATOM   6510  N NH1   . ARG C 1 135 ? 137.89000 157.03100 115.47100 1.000 77.68000  ? 380 ARG C NH1   1 
ATOM   6511  N NH2   . ARG C 1 135 ? 135.87100 158.05400 115.78600 1.000 77.68000  ? 380 ARG C NH2   1 
ATOM   6512  N N     . ILE C 1 136 ? 134.02500 151.62800 110.89200 1.000 71.99000  ? 381 ILE C N     1 
ATOM   6513  C CA    . ILE C 1 136 ? 133.19700 151.52000 109.71000 1.000 71.99000  ? 381 ILE C CA    1 
ATOM   6514  C C     . ILE C 1 136 ? 132.25300 150.33800 109.81100 1.000 71.99000  ? 381 ILE C C     1 
ATOM   6515  O O     . ILE C 1 136 ? 131.05300 150.47200 109.57700 1.000 71.99000  ? 381 ILE C O     1 
ATOM   6516  C CB    . ILE C 1 136 ? 134.07900 151.42000 108.45000 1.000 71.99000  ? 381 ILE C CB    1 
ATOM   6517  C CG1   . ILE C 1 136 ? 134.95200 152.65800 108.34500 1.000 71.99000  ? 381 ILE C CG1   1 
ATOM   6518  C CG2   . ILE C 1 136 ? 133.22600 151.25900 107.22400 1.000 71.99000  ? 381 ILE C CG2   1 
ATOM   6519  C CD1   . ILE C 1 136 ? 134.17100 153.93200 108.28700 1.000 71.99000  ? 381 ILE C CD1   1 
ATOM   6520  N N     . SER C 1 137 ? 132.77800 149.17800 110.20400 1.000 75.41000  ? 382 SER C N     1 
ATOM   6521  C CA    . SER C 1 137 ? 132.02000 147.93800 110.08200 1.000 75.41000  ? 382 SER C CA    1 
ATOM   6522  C C     . SER C 1 137 ? 130.88700 147.81100 111.09200 1.000 75.41000  ? 382 SER C C     1 
ATOM   6523  O O     . SER C 1 137 ? 129.95000 147.04900 110.84100 1.000 75.41000  ? 382 SER C O     1 
ATOM   6524  C CB    . SER C 1 137 ? 132.95000 146.73800 110.21500 1.000 75.41000  ? 382 SER C CB    1 
ATOM   6525  O OG    . SER C 1 137 ? 133.85200 146.68600 109.12900 1.000 75.41000  ? 382 SER C OG    1 
ATOM   6526  N N     . ASN C 1 138 ? 130.94900 148.51300 112.22400 1.000 73.50000  ? 383 ASN C N     1 
ATOM   6527  C CA    . ASN C 1 138 ? 129.82500 148.47400 113.15000 1.000 73.50000  ? 383 ASN C CA    1 
ATOM   6528  C C     . ASN C 1 138 ? 128.61300 149.17100 112.56600 1.000 73.50000  ? 383 ASN C C     1 
ATOM   6529  O O     . ASN C 1 138 ? 127.48400 148.70200 112.72600 1.000 73.50000  ? 383 ASN C O     1 
ATOM   6530  C CB    . ASN C 1 138 ? 130.18100 149.12100 114.48300 1.000 73.50000  ? 383 ASN C CB    1 
ATOM   6531  C CG    . ASN C 1 138 ? 131.15300 148.30800 115.27800 1.000 73.50000  ? 383 ASN C CG    1 
ATOM   6532  O OD1   . ASN C 1 138 ? 132.22700 148.77800 115.63800 1.000 73.50000  ? 383 ASN C OD1   1 
ATOM   6533  N ND2   . ASN C 1 138 ? 130.78900 147.06500 115.55300 1.000 73.50000  ? 383 ASN C ND2   1 
ATOM   6534  N N     . LEU C 1 139 ? 128.82800 150.27900 111.87200 1.000 71.45000  ? 384 LEU C N     1 
ATOM   6535  C CA    . LEU C 1 139 ? 127.73100 151.11700 111.42100 1.000 71.45000  ? 384 LEU C CA    1 
ATOM   6536  C C     . LEU C 1 139 ? 127.33900 150.84500 109.97700 1.000 71.45000  ? 384 LEU C C     1 
ATOM   6537  O O     . LEU C 1 139 ? 126.93900 151.76500 109.26400 1.000 71.45000  ? 384 LEU C O     1 
ATOM   6538  C CB    . LEU C 1 139 ? 128.07200 152.58900 111.65000 1.000 71.45000  ? 384 LEU C CB    1 
ATOM   6539  C CG    . LEU C 1 139 ? 129.44400 153.14900 111.29900 1.000 71.45000  ? 384 LEU C CG    1 
ATOM   6540  C CD1   . LEU C 1 139 ? 129.59000 153.54900 109.86100 1.000 71.45000  ? 384 LEU C CD1   1 
ATOM   6541  C CD2   . LEU C 1 139 ? 129.67900 154.34200 112.18500 1.000 71.45000  ? 384 LEU C CD2   1 
ATOM   6542  N N     . ALA C 1 140 ? 127.42000 149.58800 109.54300 1.000 74.32000  ? 385 ALA C N     1 
ATOM   6543  C CA    . ALA C 1 140 ? 126.88800 149.23400 108.23300 1.000 74.32000  ? 385 ALA C CA    1 
ATOM   6544  C C     . ALA C 1 140 ? 125.37600 149.39600 108.19500 1.000 74.32000  ? 385 ALA C C     1 
ATOM   6545  O O     . ALA C 1 140 ? 124.83600 149.96700 107.24400 1.000 74.32000  ? 385 ALA C O     1 
ATOM   6546  C CB    . ALA C 1 140 ? 127.27900 147.80600 107.87400 1.000 74.32000  ? 385 ALA C CB    1 
ATOM   6547  N N     . LYS C 1 141 ? 124.68800 148.91200 109.23000 1.000 71.71000  ? 386 LYS C N     1 
ATOM   6548  C CA    . LYS C 1 141 ? 123.24300 149.08300 109.34300 1.000 71.71000  ? 386 LYS C CA    1 
ATOM   6549  C C     . LYS C 1 141 ? 122.86300 150.55500 109.42400 1.000 71.71000  ? 386 LYS C C     1 
ATOM   6550  O O     . LYS C 1 141 ? 121.96300 151.01900 108.71000 1.000 71.71000  ? 386 LYS C O     1 
ATOM   6551  C CB    . LYS C 1 141 ? 122.74900 148.34500 110.58500 1.000 71.71000  ? 386 LYS C CB    1 
ATOM   6552  C CG    . LYS C 1 141 ? 121.26300 148.40900 110.83900 1.000 71.71000  ? 386 LYS C CG    1 
ATOM   6553  C CD    . LYS C 1 141 ? 120.50900 147.50200 109.89600 1.000 71.71000  ? 386 LYS C CD    1 
ATOM   6554  C CE    . LYS C 1 141 ? 119.04000 147.42800 110.26900 1.000 71.71000  ? 386 LYS C CE    1 
ATOM   6555  N NZ    . LYS C 1 141 ? 118.27200 146.56000 109.33800 1.000 71.71000  ? 386 LYS C NZ    1 
ATOM   6556  N N     . ASP C 1 142 ? 123.56500 151.30600 110.26800 1.000 81.79000  ? 387 ASP C N     1 
ATOM   6557  C CA    . ASP C 1 142 ? 123.20800 152.69300 110.51400 1.000 81.79000  ? 387 ASP C CA    1 
ATOM   6558  C C     . ASP C 1 142 ? 123.51000 153.56900 109.31600 1.000 81.79000  ? 387 ASP C C     1 
ATOM   6559  O O     . ASP C 1 142 ? 122.79100 154.53800 109.06200 1.000 81.79000  ? 387 ASP C O     1 
ATOM   6560  C CB    . ASP C 1 142 ? 123.95400 153.19300 111.73800 1.000 81.79000  ? 387 ASP C CB    1 
ATOM   6561  C CG    . ASP C 1 142 ? 123.55400 152.45800 112.98000 1.000 81.79000  ? 387 ASP C CG    1 
ATOM   6562  O OD1   . ASP C 1 142 ? 122.38200 152.04300 113.05500 1.000 81.79000  ? 387 ASP C OD1   1 
ATOM   6563  O OD2   . ASP C 1 142 ? 124.41100 152.26000 113.86200 1.000 81.79000  ? 387 ASP C OD2   1 
ATOM   6564  N N     . LEU C 1 143 ? 124.56100 153.25000 108.57100 1.000 77.84000  ? 388 LEU C N     1 
ATOM   6565  C CA    . LEU C 1 143 ? 124.76700 153.94400 107.31500 1.000 77.84000  ? 388 LEU C CA    1 
ATOM   6566  C C     . LEU C 1 143 ? 123.73300 153.51800 106.29300 1.000 77.84000  ? 388 LEU C C     1 
ATOM   6567  O O     . LEU C 1 143 ? 123.29000 154.33600 105.47900 1.000 77.84000  ? 388 LEU C O     1 
ATOM   6568  C CB    . LEU C 1 143 ? 126.17000 153.67300 106.79900 1.000 77.84000  ? 388 LEU C CB    1 
ATOM   6569  C CG    . LEU C 1 143 ? 126.56800 154.39700 105.53400 1.000 77.84000  ? 388 LEU C CG    1 
ATOM   6570  C CD1   . LEU C 1 143 ? 126.48400 155.87600 105.78600 1.000 77.84000  ? 388 LEU C CD1   1 
ATOM   6571  C CD2   . LEU C 1 143 ? 127.96500 153.99500 105.15800 1.000 77.84000  ? 388 LEU C CD2   1 
ATOM   6572  N N     . ALA C 1 144 ? 123.31000 152.25400 106.35600 1.000 90.76000  ? 389 ALA C N     1 
ATOM   6573  C CA    . ALA C 1 144 ? 122.39100 151.71500 105.36500 1.000 90.76000  ? 389 ALA C CA    1 
ATOM   6574  C C     . ALA C 1 144 ? 121.01500 152.33900 105.48000 1.000 90.76000  ? 389 ALA C C     1 
ATOM   6575  O O     . ALA C 1 144 ? 120.33100 152.51000 104.46800 1.000 90.76000  ? 389 ALA C O     1 
ATOM   6576  C CB    . ALA C 1 144 ? 122.29100 150.19900 105.50700 1.000 90.76000  ? 389 ALA C CB    1 
ATOM   6577  N N     . ARG C 1 145 ? 120.61200 152.73400 106.67900 1.000 93.86000  ? 390 ARG C N     1 
ATOM   6578  C CA    . ARG C 1 145 ? 119.34300 153.44000 106.79900 1.000 93.86000  ? 390 ARG C CA    1 
ATOM   6579  C C     . ARG C 1 145 ? 119.46000 154.92300 106.45000 1.000 93.86000  ? 390 ARG C C     1 
ATOM   6580  O O     . ARG C 1 145 ? 118.50600 155.67400 106.66800 1.000 93.86000  ? 390 ARG C O     1 
ATOM   6581  C CB    . ARG C 1 145 ? 118.76700 153.25500 108.20800 1.000 93.86000  ? 390 ARG C CB    1 
ATOM   6582  C CG    . ARG C 1 145 ? 119.52300 153.94700 109.32000 1.000 93.86000  ? 390 ARG C CG    1 
ATOM   6583  C CD    . ARG C 1 145 ? 118.72000 155.09700 109.87900 1.000 93.86000  ? 390 ARG C CD    1 
ATOM   6584  N NE    . ARG C 1 145 ? 119.45700 155.84200 110.88600 1.000 93.86000  ? 390 ARG C NE    1 
ATOM   6585  C CZ    . ARG C 1 145 ? 120.21700 156.89500 110.61800 1.000 93.86000  ? 390 ARG C CZ    1 
ATOM   6586  N NH1   . ARG C 1 145 ? 120.32500 157.32900 109.37600 1.000 93.86000  ? 390 ARG C NH1   1 
ATOM   6587  N NH2   . ARG C 1 145 ? 120.85800 157.52200 111.59100 1.000 93.86000  ? 390 ARG C NH2   1 
ATOM   6588  N N     . SER C 1 146 ? 120.58700 155.35200 105.88500 1.000 84.26000  ? 391 SER C N     1 
ATOM   6589  C CA    . SER C 1 146 ? 120.83000 156.74900 105.59200 1.000 84.26000  ? 391 SER C CA    1 
ATOM   6590  C C     . SER C 1 146 ? 121.20700 157.00500 104.14900 1.000 84.26000  ? 391 SER C C     1 
ATOM   6591  O O     . SER C 1 146 ? 121.48500 158.15400 103.79800 1.000 84.26000  ? 391 SER C O     1 
ATOM   6592  C CB    . SER C 1 146 ? 121.95800 157.27900 106.47200 1.000 84.26000  ? 391 SER C CB    1 
ATOM   6593  O OG    . SER C 1 146 ? 123.17300 156.65500 106.10500 1.000 84.26000  ? 391 SER C OG    1 
ATOM   6594  N N     . LEU C 1 147 ? 121.26600 155.97900 103.31500 1.000 86.32000  ? 392 LEU C N     1 
ATOM   6595  C CA    . LEU C 1 147 ? 121.66600 156.16900 101.93200 1.000 86.32000  ? 392 LEU C CA    1 
ATOM   6596  C C     . LEU C 1 147 ? 120.59400 155.72900 100.95400 1.000 86.32000  ? 392 LEU C C     1 
ATOM   6597  O O     . LEU C 1 147 ? 120.89600 155.57500 99.76400  1.000 86.32000  ? 392 LEU C O     1 
ATOM   6598  C CB    . LEU C 1 147 ? 122.96400 155.42200 101.64200 1.000 86.32000  ? 392 LEU C CB    1 
ATOM   6599  C CG    . LEU C 1 147 ? 124.17400 155.93400 102.41600 1.000 86.32000  ? 392 LEU C CG    1 
ATOM   6600  C CD1   . LEU C 1 147 ? 125.41900 155.14400 102.05600 1.000 86.32000  ? 392 LEU C CD1   1 
ATOM   6601  C CD2   . LEU C 1 147 ? 124.36800 157.40000 102.14700 1.000 86.32000  ? 392 LEU C CD2   1 
ATOM   6602  N N     . ALA C 1 148 ? 119.36200 155.52700 101.43700 1.000 93.08000  ? 393 ALA C N     1 
ATOM   6603  C CA    . ALA C 1 148 ? 118.20800 155.08700 100.64500 1.000 93.08000  ? 393 ALA C CA    1 
ATOM   6604  C C     . ALA C 1 148 ? 118.49000 153.77500 99.91800  1.000 93.08000  ? 393 ALA C C     1 
ATOM   6605  O O     . ALA C 1 148 ? 118.08700 153.57700 98.77200  1.000 93.08000  ? 393 ALA C O     1 
ATOM   6606  C CB    . ALA C 1 148 ? 117.74400 156.17400 99.66800  1.000 93.08000  ? 393 ALA C CB    1 
ATOM   6607  N N     . VAL C 1 149 ? 119.20100 152.87500 100.58600 1.000 89.82000  ? 394 VAL C N     1 
ATOM   6608  C CA    . VAL C 1 149 ? 119.55400 151.58400 100.02600 1.000 89.82000  ? 394 VAL C CA    1 
ATOM   6609  C C     . VAL C 1 149 ? 118.97800 150.50100 100.92000 1.000 89.82000  ? 394 VAL C C     1 
ATOM   6610  O O     . VAL C 1 149 ? 118.42200 150.77100 101.98100 1.000 89.82000  ? 394 VAL C O     1 
ATOM   6611  C CB    . VAL C 1 149 ? 121.06700 151.41300 99.88700  1.000 89.82000  ? 394 VAL C CB    1 
ATOM   6612  C CG1   . VAL C 1 149 ? 121.61100 152.43900 98.93500  1.000 89.82000  ? 394 VAL C CG1   1 
ATOM   6613  C CG2   . VAL C 1 149 ? 121.70700 151.55600 101.24400 1.000 89.82000  ? 394 VAL C CG2   1 
ATOM   6614  N N     . ILE C 1 150 ? 119.12600 149.25700 100.48200 1.000 93.66000  ? 395 ILE C N     1 
ATOM   6615  C CA    . ILE C 1 150 ? 118.67500 148.14100 101.30000 1.000 93.66000  ? 395 ILE C CA    1 
ATOM   6616  C C     . ILE C 1 150 ? 119.69100 147.83900 102.38800 1.000 93.66000  ? 395 ILE C C     1 
ATOM   6617  O O     . ILE C 1 150 ? 119.37600 147.90400 103.58100 1.000 93.66000  ? 395 ILE C O     1 
ATOM   6618  C CB    . ILE C 1 150 ? 118.39600 146.91100 100.42700 1.000 93.66000  ? 395 ILE C CB    1 
ATOM   6619  C CG1   . ILE C 1 150 ? 117.25600 147.22500 99.46100  1.000 93.66000  ? 395 ILE C CG1   1 
ATOM   6620  C CG2   . ILE C 1 150 ? 118.06000 145.72100 101.30000 1.000 93.66000  ? 395 ILE C CG2   1 
ATOM   6621  C CD1   . ILE C 1 150 ? 117.07800 146.20700 98.36700  1.000 93.66000  ? 395 ILE C CD1   1 
ATOM   6622  N N     . SER C 1 151 ? 120.92300 147.52100 101.99300 1.000 91.54000  ? 396 SER C N     1 
ATOM   6623  C CA    . SER C 1 151 ? 122.01600 147.31900 102.93700 1.000 91.54000  ? 396 SER C CA    1 
ATOM   6624  C C     . SER C 1 151 ? 123.33100 147.43700 102.19100 1.000 91.54000  ? 396 SER C C     1 
ATOM   6625  O O     . SER C 1 151 ? 123.53000 146.76100 101.18000 1.000 91.54000  ? 396 SER C O     1 
ATOM   6626  C CB    . SER C 1 151 ? 121.93500 145.95200 103.61500 1.000 91.54000  ? 396 SER C CB    1 
ATOM   6627  O OG    . SER C 1 151 ? 122.16900 144.92500 102.67400 1.000 91.54000  ? 396 SER C OG    1 
ATOM   6628  N N     . VAL C 1 152 ? 124.22500 148.27000 102.69700 1.000 82.30000  ? 397 VAL C N     1 
ATOM   6629  C CA    . VAL C 1 152 ? 125.53300 148.42400 102.08600 1.000 82.30000  ? 397 VAL C CA    1 
ATOM   6630  C C     . VAL C 1 152 ? 126.44000 147.28800 102.55200 1.000 82.30000  ? 397 VAL C C     1 
ATOM   6631  O O     . VAL C 1 152 ? 126.14200 146.57900 103.51400 1.000 82.30000  ? 397 VAL C O     1 
ATOM   6632  C CB    . VAL C 1 152 ? 126.10900 149.80500 102.44200 1.000 82.30000  ? 397 VAL C CB    1 
ATOM   6633  C CG1   . VAL C 1 152 ? 126.69200 149.80800 103.83900 1.000 82.30000  ? 397 VAL C CG1   1 
ATOM   6634  C CG2   . VAL C 1 152 ? 127.08000 150.30400 101.40700 1.000 82.30000  ? 397 VAL C CG2   1 
ATOM   6635  N N     . ARG C 1 153 ? 127.54500 147.08400 101.84500 1.000 78.80000  ? 398 ARG C N     1 
ATOM   6636  C CA    . ARG C 1 153 ? 128.50500 146.05100 102.20000 1.000 78.80000  ? 398 ARG C CA    1 
ATOM   6637  C C     . ARG C 1 153 ? 129.87400 146.67300 102.42900 1.000 78.80000  ? 398 ARG C C     1 
ATOM   6638  O O     . ARG C 1 153 ? 130.29500 147.55900 101.68300 1.000 78.80000  ? 398 ARG C O     1 
ATOM   6639  C CB    . ARG C 1 153 ? 128.58200 144.97800 101.11600 1.000 78.80000  ? 398 ARG C CB    1 
ATOM   6640  C CG    . ARG C 1 153 ? 129.53100 143.83800 101.42900 1.000 78.80000  ? 398 ARG C CG    1 
ATOM   6641  C CD    . ARG C 1 153 ? 129.45600 142.74200 100.39400 1.000 78.80000  ? 398 ARG C CD    1 
ATOM   6642  N NE    . ARG C 1 153 ? 130.40800 141.67700 100.68100 1.000 78.80000  ? 398 ARG C NE    1 
ATOM   6643  C CZ    . ARG C 1 153 ? 131.62200 141.60800 100.15300 1.000 78.80000  ? 398 ARG C CZ    1 
ATOM   6644  N NH1   . ARG C 1 153 ? 132.02200 142.52800 99.29000  1.000 78.80000  ? 398 ARG C NH1   1 
ATOM   6645  N NH2   . ARG C 1 153 ? 132.42800 140.60900 100.47200 1.000 78.80000  ? 398 ARG C NH2   1 
ATOM   6646  N N     . VAL C 1 154 ? 130.56000 146.20600 103.46800 1.000 70.27000  ? 399 VAL C N     1 
ATOM   6647  C CA    . VAL C 1 154 ? 131.86000 146.71900 103.87000 1.000 70.27000  ? 399 VAL C CA    1 
ATOM   6648  C C     . VAL C 1 154 ? 132.91900 145.69700 103.50800 1.000 70.27000  ? 399 VAL C C     1 
ATOM   6649  O O     . VAL C 1 154 ? 132.88500 144.56300 103.99600 1.000 70.27000  ? 399 VAL C O     1 
ATOM   6650  C CB    . VAL C 1 154 ? 131.90000 147.01200 105.37300 1.000 70.27000  ? 399 VAL C CB    1 
ATOM   6651  C CG1   . VAL C 1 154 ? 133.29800 147.35100 105.80000 1.000 70.27000  ? 399 VAL C CG1   1 
ATOM   6652  C CG2   . VAL C 1 154 ? 130.96700 148.13900 105.69500 1.000 70.27000  ? 399 VAL C CG2   1 
ATOM   6653  N N     . VAL C 1 155 ? 133.86400 146.09400 102.66600 1.000 74.29000  ? 400 VAL C N     1 
ATOM   6654  C CA    . VAL C 1 155 ? 135.05400 145.30000 102.39000 1.000 74.29000  ? 400 VAL C CA    1 
ATOM   6655  C C     . VAL C 1 155 ? 136.15900 145.80700 103.29700 1.000 74.29000  ? 400 VAL C C     1 
ATOM   6656  O O     . VAL C 1 155 ? 136.51000 146.99000 103.25300 1.000 74.29000  ? 400 VAL C O     1 
ATOM   6657  C CB    . VAL C 1 155 ? 135.47200 145.39200 100.91800 1.000 74.29000  ? 400 VAL C CB    1 
ATOM   6658  C CG1   . VAL C 1 155 ? 136.78100 144.69300 100.71600 1.000 74.29000  ? 400 VAL C CG1   1 
ATOM   6659  C CG2   . VAL C 1 155 ? 134.43300 144.76600 100.04400 1.000 74.29000  ? 400 VAL C CG2   1 
ATOM   6660  N N     . GLU C 1 156 ? 136.71300 144.92300 104.11500 1.000 80.04000  ? 401 GLU C N     1 
ATOM   6661  C CA    . GLU C 1 156 ? 137.69200 145.34200 105.10000 1.000 80.04000  ? 401 GLU C CA    1 
ATOM   6662  C C     . GLU C 1 156 ? 139.12600 145.21800 104.62200 1.000 80.04000  ? 401 GLU C C     1 
ATOM   6663  O O     . GLU C 1 156 ? 140.03300 145.67200 105.32300 1.000 80.04000  ? 401 GLU C O     1 
ATOM   6664  C CB    . GLU C 1 156 ? 137.52500 144.53700 106.38100 1.000 80.04000  ? 401 GLU C CB    1 
ATOM   6665  C CG    . GLU C 1 156 ? 136.23700 144.82200 107.10200 1.000 80.04000  ? 401 GLU C CG    1 
ATOM   6666  C CD    . GLU C 1 156 ? 136.11400 144.02500 108.37800 1.000 80.04000  ? 401 GLU C CD    1 
ATOM   6667  O OE1   . GLU C 1 156 ? 136.98500 143.16400 108.62000 1.000 80.04000  ? 401 GLU C OE1   1 
ATOM   6668  O OE2   . GLU C 1 156 ? 135.15200 144.25900 109.13900 1.000 80.04000  ? 401 GLU C OE2   1 
ATOM   6669  N N     . VAL C 1 157 ? 139.36300 144.61700 103.46600 1.000 72.63000  ? 402 VAL C N     1 
ATOM   6670  C CA    . VAL C 1 157 ? 140.72000 144.50800 102.95100 1.000 72.63000  ? 402 VAL C CA    1 
ATOM   6671  C C     . VAL C 1 157 ? 140.67100 144.53700 101.43300 1.000 72.63000  ? 402 VAL C C     1 
ATOM   6672  O O     . VAL C 1 157 ? 139.93600 143.77800 100.79900 1.000 72.63000  ? 402 VAL C O     1 
ATOM   6673  C CB    . VAL C 1 157 ? 141.44700 143.25900 103.50200 1.000 72.63000  ? 402 VAL C CB    1 
ATOM   6674  C CG1   . VAL C 1 157 ? 140.62900 141.98600 103.33800 1.000 72.63000  ? 402 VAL C CG1   1 
ATOM   6675  C CG2   . VAL C 1 157 ? 142.78900 143.08900 102.82700 1.000 72.63000  ? 402 VAL C CG2   1 
ATOM   6676  N N     . ILE C 1 158 ? 141.42500 145.45600 100.85100 1.000 82.99000  ? 403 ILE C N     1 
ATOM   6677  C CA    . ILE C 1 158 ? 141.53200 145.54800 99.40400  1.000 82.99000  ? 403 ILE C CA    1 
ATOM   6678  C C     . ILE C 1 158 ? 142.89800 144.97500 99.04300  1.000 82.99000  ? 403 ILE C C     1 
ATOM   6679  O O     . ILE C 1 158 ? 143.85000 145.11400 99.82500  1.000 82.99000  ? 403 ILE C O     1 
ATOM   6680  C CB    . ILE C 1 158 ? 141.31400 146.99900 98.93800  1.000 82.99000  ? 403 ILE C CB    1 
ATOM   6681  C CG1   . ILE C 1 158 ? 141.27800 147.11100 97.41800  1.000 82.99000  ? 403 ILE C CG1   1 
ATOM   6682  C CG2   . ILE C 1 158 ? 142.33100 147.94400 99.55400  1.000 82.99000  ? 403 ILE C CG2   1 
ATOM   6683  C CD1   . ILE C 1 158 ? 140.75500 148.42700 96.92600  1.000 82.99000  ? 403 ILE C CD1   1 
ATOM   6684  N N     . PRO C 1 159 ? 143.03100 144.25400 97.93900  1.000 83.69000  ? 404 PRO C N     1 
ATOM   6685  C CA    . PRO C 1 159 ? 144.35100 143.72800 97.57300  1.000 83.69000  ? 404 PRO C CA    1 
ATOM   6686  C C     . PRO C 1 159 ? 145.33400 144.80200 97.14300  1.000 83.69000  ? 404 PRO C C     1 
ATOM   6687  O O     . PRO C 1 159 ? 145.18400 145.39000 96.07000  1.000 83.69000  ? 404 PRO C O     1 
ATOM   6688  C CB    . PRO C 1 159 ? 144.03500 142.78300 96.40900  1.000 83.69000  ? 404 PRO C CB    1 
ATOM   6689  C CG    . PRO C 1 159 ? 142.63500 142.39200 96.62300  1.000 83.69000  ? 404 PRO C CG    1 
ATOM   6690  C CD    . PRO C 1 159 ? 141.95400 143.58100 97.19700  1.000 83.69000  ? 404 PRO C CD    1 
ATOM   6691  N N     . GLY C 1 160 ? 146.33900 145.07100 97.97300  1.000 88.56000  ? 405 GLY C N     1 
ATOM   6692  C CA    . GLY C 1 160 ? 147.46500 145.88100 97.56600  1.000 88.56000  ? 405 GLY C CA    1 
ATOM   6693  C C     . GLY C 1 160 ? 147.33700 147.37300 97.79000  1.000 88.56000  ? 405 GLY C C     1 
ATOM   6694  O O     . GLY C 1 160 ? 148.32800 148.09300 97.61700  1.000 88.56000  ? 405 GLY C O     1 
ATOM   6695  N N     . LYS C 1 161 ? 146.16800 147.86900 98.15700  1.000 87.27000  ? 406 LYS C N     1 
ATOM   6696  C CA    . LYS C 1 161 ? 145.99600 149.28500 98.42600  1.000 87.27000  ? 406 LYS C CA    1 
ATOM   6697  C C     . LYS C 1 161 ? 145.76700 149.49100 99.91300  1.000 87.27000  ? 406 LYS C C     1 
ATOM   6698  O O     . LYS C 1 161 ? 145.67400 148.54000 100.68900 1.000 87.27000  ? 406 LYS C O     1 
ATOM   6699  C CB    . LYS C 1 161 ? 144.82900 149.85000 97.62700  1.000 87.27000  ? 406 LYS C CB    1 
ATOM   6700  C CG    . LYS C 1 161 ? 145.00200 149.84800 96.13500  1.000 87.27000  ? 406 LYS C CG    1 
ATOM   6701  C CD    . LYS C 1 161 ? 143.74100 150.40300 95.51500  1.000 87.27000  ? 406 LYS C CD    1 
ATOM   6702  C CE    . LYS C 1 161 ? 143.78300 150.38400 94.01500  1.000 87.27000  ? 406 LYS C CE    1 
ATOM   6703  N NZ    . LYS C 1 161 ? 142.49700 150.90100 93.48500  1.000 87.27000  ? 406 LYS C NZ    1 
ATOM   6704  N N     . THR C 1 162 ? 145.65700 150.75300 100.31000 1.000 91.32000  ? 407 THR C N     1 
ATOM   6705  C CA    . THR C 1 162 ? 145.41200 151.08700 101.70200 1.000 91.32000  ? 407 THR C CA    1 
ATOM   6706  C C     . THR C 1 162 ? 143.94400 151.30000 102.01500 1.000 91.32000  ? 407 THR C C     1 
ATOM   6707  O O     . THR C 1 162 ? 143.60200 151.49000 103.18400 1.000 91.32000  ? 407 THR C O     1 
ATOM   6708  C CB    . THR C 1 162 ? 146.17500 152.35400 102.09900 1.000 91.32000  ? 407 THR C CB    1 
ATOM   6709  O OG1   . THR C 1 162 ? 145.67100 153.46500 101.35500 1.000 91.32000  ? 407 THR C OG1   1 
ATOM   6710  C CG2   . THR C 1 162 ? 147.64600 152.19700 101.81300 1.000 91.32000  ? 407 THR C CG2   1 
ATOM   6711  N N     . THR C 1 163 ? 143.07100 151.26800 101.01600 1.000 89.70000  ? 408 THR C N     1 
ATOM   6712  C CA    . THR C 1 163 ? 141.71400 151.74100 101.21700 1.000 89.70000  ? 408 THR C CA    1 
ATOM   6713  C C     . THR C 1 163 ? 140.86300 150.69700 101.92900 1.000 89.70000  ? 408 THR C C     1 
ATOM   6714  O O     . THR C 1 163 ? 141.30400 149.59000 102.23700 1.000 89.70000  ? 408 THR C O     1 
ATOM   6715  C CB    . THR C 1 163 ? 141.07900 152.11900 99.88700  1.000 89.70000  ? 408 THR C CB    1 
ATOM   6716  O OG1   . THR C 1 163 ? 140.98000 150.95600 99.06200  1.000 89.70000  ? 408 THR C OG1   1 
ATOM   6717  C CG2   . THR C 1 163 ? 141.91800 153.17000 99.19000  1.000 89.70000  ? 408 THR C CG2   1 
ATOM   6718  N N     . VAL C 1 164 ? 139.62300 151.07700 102.21600 1.000 81.00000  ? 409 VAL C N     1 
ATOM   6719  C CA    . VAL C 1 164 ? 138.64200 150.21800 102.86200 1.000 81.00000  ? 409 VAL C CA    1 
ATOM   6720  C C     . VAL C 1 164 ? 137.39200 150.25400 102.00600 1.000 81.00000  ? 409 VAL C C     1 
ATOM   6721  O O     . VAL C 1 164 ? 136.83400 151.32800 101.76600 1.000 81.00000  ? 409 VAL C O     1 
ATOM   6722  C CB    . VAL C 1 164 ? 138.32500 150.67400 104.29200 1.000 81.00000  ? 409 VAL C CB    1 
ATOM   6723  C CG1   . VAL C 1 164 ? 137.21400 149.84200 104.86400 1.000 81.00000  ? 409 VAL C CG1   1 
ATOM   6724  C CG2   . VAL C 1 164 ? 139.55500 150.57500 105.16700 1.000 81.00000  ? 409 VAL C CG2   1 
ATOM   6725  N N     . GLY C 1 165 ? 136.94800 149.09000 101.55300 1.000 81.97000  ? 410 GLY C N     1 
ATOM   6726  C CA    . GLY C 1 165 ? 135.95600 149.04800 100.50200 1.000 81.97000  ? 410 GLY C CA    1 
ATOM   6727  C C     . GLY C 1 165 ? 134.53400 149.17100 101.02100 1.000 81.97000  ? 410 GLY C C     1 
ATOM   6728  O O     . GLY C 1 165 ? 134.18000 148.63900 102.07200 1.000 81.97000  ? 410 GLY C O     1 
ATOM   6729  N N     . ILE C 1 166 ? 133.71600 149.88300 100.24900 1.000 81.73000  ? 411 ILE C N     1 
ATOM   6730  C CA    . ILE C 1 166 ? 132.27700 149.97700 100.45400 1.000 81.73000  ? 411 ILE C CA    1 
ATOM   6731  C C     . ILE C 1 166 ? 131.58300 149.81500 99.11100  1.000 81.73000  ? 411 ILE C C     1 
ATOM   6732  O O     . ILE C 1 166 ? 131.92800 150.49400 98.13900  1.000 81.73000  ? 411 ILE C O     1 
ATOM   6733  C CB    . ILE C 1 166 ? 131.88100 151.29600 101.14300 1.000 81.73000  ? 411 ILE C CB    1 
ATOM   6734  C CG1   . ILE C 1 166 ? 132.08900 151.16100 102.64400 1.000 81.73000  ? 411 ILE C CG1   1 
ATOM   6735  C CG2   . ILE C 1 166 ? 130.47200 151.71000 100.82800 1.000 81.73000  ? 411 ILE C CG2   1 
ATOM   6736  C CD1   . ILE C 1 166 ? 131.75200 152.38400 103.40500 1.000 81.73000  ? 411 ILE C CD1   1 
ATOM   6737  N N     . GLU C 1 167 ? 130.62600 148.89600 99.05400  1.000 89.25000  ? 412 GLU C N     1 
ATOM   6738  C CA    . GLU C 1 167 ? 129.84900 148.60500 97.85600  1.000 89.25000  ? 412 GLU C CA    1 
ATOM   6739  C C     . GLU C 1 167 ? 128.42400 149.09800 98.09400  1.000 89.25000  ? 412 GLU C C     1 
ATOM   6740  O O     . GLU C 1 167 ? 127.63600 148.43200 98.76900  1.000 89.25000  ? 412 GLU C O     1 
ATOM   6741  C CB    . GLU C 1 167 ? 129.87300 147.11200 97.56100  1.000 89.25000  ? 412 GLU C CB    1 
ATOM   6742  C CG    . GLU C 1 167 ? 131.24600 146.56300 97.24600  1.000 89.25000  ? 412 GLU C CG    1 
ATOM   6743  C CD    . GLU C 1 167 ? 131.24100 145.05400 97.07600  1.000 89.25000  ? 412 GLU C CD    1 
ATOM   6744  O OE1   . GLU C 1 167 ? 130.20100 144.42600 97.35800  1.000 89.25000  ? 412 GLU C OE1   1 
ATOM   6745  O OE2   . GLU C 1 167 ? 132.27500 144.49300 96.65900  1.000 89.25000  ? 412 GLU C OE2   1 
ATOM   6746  N N     . ILE C 1 168 ? 128.09500 150.25400 97.53700  1.000 89.60000  ? 413 ILE C N     1 
ATOM   6747  C CA    . ILE C 1 168 ? 126.76000 150.82700 97.71300  1.000 89.60000  ? 413 ILE C CA    1 
ATOM   6748  C C     . ILE C 1 168 ? 125.79900 150.15500 96.73800  1.000 89.60000  ? 413 ILE C C     1 
ATOM   6749  O O     . ILE C 1 168 ? 126.14700 149.98400 95.56200  1.000 89.60000  ? 413 ILE C O     1 
ATOM   6750  C CB    . ILE C 1 168 ? 126.79100 152.33100 97.49800  1.000 89.60000  ? 413 ILE C CB    1 
ATOM   6751  C CG1   . ILE C 1 168 ? 127.57500 153.00100 98.60900  1.000 89.60000  ? 413 ILE C CG1   1 
ATOM   6752  C CG2   . ILE C 1 168 ? 125.40700 152.91600 97.47000  1.000 89.60000  ? 413 ILE C CG2   1 
ATOM   6753  C CD1   . ILE C 1 168 ? 127.68100 154.47700 98.42200  1.000 89.60000  ? 413 ILE C CD1   1 
ATOM   6754  N N     . PRO C 1 169 ? 124.62100 149.73700 97.18900  1.000 93.54000  ? 414 PRO C N     1 
ATOM   6755  C CA    . PRO C 1 169 ? 123.57400 149.30900 96.25900  1.000 93.54000  ? 414 PRO C CA    1 
ATOM   6756  C C     . PRO C 1 169 ? 123.12400 150.47500 95.39900  1.000 93.54000  ? 414 PRO C C     1 
ATOM   6757  O O     . PRO C 1 169 ? 122.83600 151.55800 95.90200  1.000 93.54000  ? 414 PRO C O     1 
ATOM   6758  C CB    . PRO C 1 169 ? 122.45100 148.84200 97.18600  1.000 93.54000  ? 414 PRO C CB    1 
ATOM   6759  C CG    . PRO C 1 169 ? 123.11500 148.57400 98.47400  1.000 93.54000  ? 414 PRO C CG    1 
ATOM   6760  C CD    . PRO C 1 169 ? 124.22000 149.55600 98.58700  1.000 93.54000  ? 414 PRO C CD    1 
ATOM   6761  N N     . ASN C 1 170 ? 123.06000 150.24900 94.09700  1.000 112.64000 ? 415 ASN C N     1 
ATOM   6762  C CA    . ASN C 1 170 ? 122.67400 151.28900 93.16000  1.000 112.64000 ? 415 ASN C CA    1 
ATOM   6763  C C     . ASN C 1 170 ? 121.25600 151.01300 92.68800  1.000 112.64000 ? 415 ASN C C     1 
ATOM   6764  O O     . ASN C 1 170 ? 120.96400 149.91400 92.21400  1.000 112.64000 ? 415 ASN C O     1 
ATOM   6765  C CB    . ASN C 1 170 ? 123.64300 151.32500 91.98500  1.000 112.64000 ? 415 ASN C CB    1 
ATOM   6766  C CG    . ASN C 1 170 ? 123.77000 152.69700 91.38300  1.000 112.64000 ? 415 ASN C CG    1 
ATOM   6767  O OD1   . ASN C 1 170 ? 124.74600 152.98700 90.69500  1.000 112.64000 ? 415 ASN C OD1   1 
ATOM   6768  N ND2   . ASN C 1 170 ? 122.79500 153.56000 91.64400  1.000 112.64000 ? 415 ASN C ND2   1 
ATOM   6769  N N     . GLU C 1 171 ? 120.38000 152.00800 92.81000  1.000 115.57000 ? 416 GLU C N     1 
ATOM   6770  C CA    . GLU C 1 171 ? 118.94800 151.76400 92.63300  1.000 115.57000 ? 416 GLU C CA    1 
ATOM   6771  C C     . GLU C 1 171 ? 118.49100 151.96200 91.19400  1.000 115.57000 ? 416 GLU C C     1 
ATOM   6772  O O     . GLU C 1 171 ? 117.45100 152.56400 90.93900  1.000 115.57000 ? 416 GLU C O     1 
ATOM   6773  C CB    . GLU C 1 171 ? 118.16000 152.67200 93.56800  1.000 115.57000 ? 416 GLU C CB    1 
ATOM   6774  C CG    . GLU C 1 171 ? 118.31700 152.35700 95.03500  1.000 115.57000 ? 416 GLU C CG    1 
ATOM   6775  C CD    . GLU C 1 171 ? 117.65100 151.06000 95.41800  1.000 115.57000 ? 416 GLU C CD    1 
ATOM   6776  O OE1   . GLU C 1 171 ? 116.61900 150.72100 94.80900  1.000 115.57000 ? 416 GLU C OE1   1 
ATOM   6777  O OE2   . GLU C 1 171 ? 118.15700 150.37900 96.33000  1.000 115.57000 ? 416 GLU C OE2   1 
ATOM   6778  N N     . ASP C 1 172 ? 119.26200 151.42000 90.24900  1.000 127.23000 ? 417 ASP C N     1 
ATOM   6779  C CA    . ASP C 1 172 ? 118.78200 151.15900 88.89200  1.000 127.23000 ? 417 ASP C CA    1 
ATOM   6780  C C     . ASP C 1 172 ? 119.72100 150.09300 88.33000  1.000 127.23000 ? 417 ASP C C     1 
ATOM   6781  O O     . ASP C 1 172 ? 120.81400 150.42100 87.86300  1.000 127.23000 ? 417 ASP C O     1 
ATOM   6782  C CB    . ASP C 1 172 ? 118.78200 152.41500 88.03300  1.000 127.23000 ? 417 ASP C CB    1 
ATOM   6783  C CG    . ASP C 1 172 ? 118.00800 152.24000 86.73900  1.000 127.23000 ? 417 ASP C CG    1 
ATOM   6784  O OD1   . ASP C 1 172 ? 117.48000 151.13700 86.48500  1.000 127.23000 ? 417 ASP C OD1   1 
ATOM   6785  O OD2   . ASP C 1 172 ? 117.92500 153.21900 85.97100  1.000 127.23000 ? 417 ASP C OD2   1 
ATOM   6786  N N     . ARG C 1 173 ? 119.29000 148.84000 88.36600  1.000 114.10000 ? 418 ARG C N     1 
ATOM   6787  C CA    . ARG C 1 173 ? 120.16300 147.74800 87.98100  1.000 114.10000 ? 418 ARG C CA    1 
ATOM   6788  C C     . ARG C 1 173 ? 119.73300 147.18000 86.64200  1.000 114.10000 ? 418 ARG C C     1 
ATOM   6789  O O     . ARG C 1 173 ? 118.61700 147.40400 86.17100  1.000 114.10000 ? 418 ARG C O     1 
ATOM   6790  C CB    . ARG C 1 173 ? 120.17200 146.62500 89.02400  1.000 114.10000 ? 418 ARG C CB    1 
ATOM   6791  C CG    . ARG C 1 173 ? 119.01500 145.64800 88.92400  1.000 114.10000 ? 418 ARG C CG    1 
ATOM   6792  C CD    . ARG C 1 173 ? 117.77100 146.14600 89.61800  1.000 114.10000 ? 418 ARG C CD    1 
ATOM   6793  N NE    . ARG C 1 173 ? 118.01100 146.40000 91.03400  1.000 114.10000 ? 418 ARG C NE    1 
ATOM   6794  C CZ    . ARG C 1 173 ? 117.99000 145.46300 91.97700  1.000 114.10000 ? 418 ARG C CZ    1 
ATOM   6795  N NH1   . ARG C 1 173 ? 117.73200 144.20200 91.66300  1.000 114.10000 ? 418 ARG C NH1   1 
ATOM   6796  N NH2   . ARG C 1 173 ? 118.22000 145.78800 93.24000  1.000 114.10000 ? 418 ARG C NH2   1 
ATOM   6797  N N     . GLN C 1 174 ? 120.64900 146.44900 86.02900  1.000 122.64000 ? 419 GLN C N     1 
ATOM   6798  C CA    . GLN C 1 174 ? 120.33300 145.60800 84.89100  1.000 122.64000 ? 419 GLN C CA    1 
ATOM   6799  C C     . GLN C 1 174 ? 120.14500 144.18700 85.38400  1.000 122.64000 ? 419 GLN C C     1 
ATOM   6800  O O     . GLN C 1 174 ? 120.65400 143.80700 86.43900  1.000 122.64000 ? 419 GLN C O     1 
ATOM   6801  C CB    . GLN C 1 174 ? 121.44300 145.62500 83.83900  1.000 122.64000 ? 419 GLN C CB    1 
ATOM   6802  C CG    . GLN C 1 174 ? 121.67300 146.95500 83.16000  1.000 122.64000 ? 419 GLN C CG    1 
ATOM   6803  C CD    . GLN C 1 174 ? 122.60700 147.84400 83.94400  1.000 122.64000 ? 419 GLN C CD    1 
ATOM   6804  O OE1   . GLN C 1 174 ? 123.30800 147.38100 84.84000  1.000 122.64000 ? 419 GLN C OE1   1 
ATOM   6805  N NE2   . GLN C 1 174 ? 122.62900 149.12600 83.60800  1.000 122.64000 ? 419 GLN C NE2   1 
ATOM   6806  N N     . MET C 1 175 ? 119.39800 143.40400 84.62600  1.000 125.01000 ? 420 MET C N     1 
ATOM   6807  C CA    . MET C 1 175 ? 119.54400 141.96700 84.74400  1.000 125.01000 ? 420 MET C CA    1 
ATOM   6808  C C     . MET C 1 175 ? 120.73500 141.55600 83.89200  1.000 125.01000 ? 420 MET C C     1 
ATOM   6809  O O     . MET C 1 175 ? 120.87400 141.99600 82.74600  1.000 125.01000 ? 420 MET C O     1 
ATOM   6810  C CB    . MET C 1 175 ? 118.25900 141.23700 84.34400  1.000 125.01000 ? 420 MET C CB    1 
ATOM   6811  C CG    . MET C 1 175 ? 117.70900 141.50700 82.95500  1.000 125.01000 ? 420 MET C CG    1 
ATOM   6812  S SD    . MET C 1 175 ? 116.15400 140.63000 82.72300  1.000 125.01000 ? 420 MET C SD    1 
ATOM   6813  C CE    . MET C 1 175 ? 115.08200 141.57100 83.80100  1.000 125.01000 ? 420 MET C CE    1 
ATOM   6814  N N     . VAL C 1 176 ? 121.64500 140.79000 84.48600  1.000 116.55000 ? 421 VAL C N     1 
ATOM   6815  C CA    . VAL C 1 176 ? 122.83500 140.36400 83.76100  1.000 116.55000 ? 421 VAL C CA    1 
ATOM   6816  C C     . VAL C 1 176 ? 122.39700 139.34400 82.72100  1.000 116.55000 ? 421 VAL C C     1 
ATOM   6817  O O     . VAL C 1 176 ? 121.96600 138.24100 83.06600  1.000 116.55000 ? 421 VAL C O     1 
ATOM   6818  C CB    . VAL C 1 176 ? 123.89200 139.78300 84.69800  1.000 116.55000 ? 421 VAL C CB    1 
ATOM   6819  C CG1   . VAL C 1 176 ? 125.05700 139.28100 83.89100  1.000 116.55000 ? 421 VAL C CG1   1 
ATOM   6820  C CG2   . VAL C 1 176 ? 124.34600 140.82900 85.68400  1.000 116.55000 ? 421 VAL C CG2   1 
ATOM   6821  N N     . ARG C 1 177 ? 122.46900 139.72400 81.45300  1.000 127.22000 ? 422 ARG C N     1 
ATOM   6822  C CA    . ARG C 1 177 ? 122.02600 138.83600 80.39200  1.000 127.22000 ? 422 ARG C CA    1 
ATOM   6823  C C     . ARG C 1 177 ? 122.99000 137.67100 80.23900  1.000 127.22000 ? 422 ARG C C     1 
ATOM   6824  O O     . ARG C 1 177 ? 124.21000 137.83700 80.30800  1.000 127.22000 ? 422 ARG C O     1 
ATOM   6825  C CB    . ARG C 1 177 ? 121.89500 139.60000 79.07900  1.000 127.22000 ? 422 ARG C CB    1 
ATOM   6826  C CG    . ARG C 1 177 ? 120.82500 140.66800 79.11800  1.000 127.22000 ? 422 ARG C CG    1 
ATOM   6827  C CD    . ARG C 1 177 ? 119.45400 140.03500 79.22500  1.000 127.22000 ? 422 ARG C CD    1 
ATOM   6828  N NE    . ARG C 1 177 ? 118.39400 141.03300 79.24100  1.000 127.22000 ? 422 ARG C NE    1 
ATOM   6829  C CZ    . ARG C 1 177 ? 117.10700 140.74600 79.38800  1.000 127.22000 ? 422 ARG C CZ    1 
ATOM   6830  N NH1   . ARG C 1 177 ? 116.72300 139.48600 79.53200  1.000 127.22000 ? 422 ARG C NH1   1 
ATOM   6831  N NH2   . ARG C 1 177 ? 116.20400 141.71700 79.39700  1.000 127.22000 ? 422 ARG C NH2   1 
ATOM   6832  N N     . PHE C 1 178 ? 122.42500 136.48200 80.05200  1.000 114.14000 ? 423 PHE C N     1 
ATOM   6833  C CA    . PHE C 1 178 ? 123.23800 135.28200 79.98900  1.000 114.14000 ? 423 PHE C CA    1 
ATOM   6834  C C     . PHE C 1 178 ? 124.05300 135.24300 78.70900  1.000 114.14000 ? 423 PHE C C     1 
ATOM   6835  O O     . PHE C 1 178 ? 125.16100 134.69000 78.69300  1.000 114.14000 ? 423 PHE C O     1 
ATOM   6836  C CB    . PHE C 1 178 ? 122.33500 134.06200 80.10200  1.000 114.14000 ? 423 PHE C CB    1 
ATOM   6837  C CG    . PHE C 1 178 ? 123.07000 132.78800 80.30200  1.000 114.14000 ? 423 PHE C CG    1 
ATOM   6838  C CD1   . PHE C 1 178 ? 123.62700 132.49000 81.52400  1.000 114.14000 ? 423 PHE C CD1   1 
ATOM   6839  C CD2   . PHE C 1 178 ? 123.19000 131.87800 79.28100  1.000 114.14000 ? 423 PHE C CD2   1 
ATOM   6840  C CE1   . PHE C 1 178 ? 124.29900 131.31600 81.71800  1.000 114.14000 ? 423 PHE C CE1   1 
ATOM   6841  C CE2   . PHE C 1 178 ? 123.86000 130.69900 79.47300  1.000 114.14000 ? 423 PHE C CE2   1 
ATOM   6842  C CZ    . PHE C 1 178 ? 124.41600 130.42000 80.69000  1.000 114.14000 ? 423 PHE C CZ    1 
ATOM   6843  N N     . SER C 1 179 ? 123.53200 135.85900 77.64500  1.000 122.42000 ? 424 SER C N     1 
ATOM   6844  C CA    . SER C 1 179 ? 124.26900 135.96700 76.39200  1.000 122.42000 ? 424 SER C CA    1 
ATOM   6845  C C     . SER C 1 179 ? 125.51500 136.81300 76.56200  1.000 122.42000 ? 424 SER C C     1 
ATOM   6846  O O     . SER C 1 179 ? 126.55000 136.53700 75.94500  1.000 122.42000 ? 424 SER C O     1 
ATOM   6847  C CB    . SER C 1 179 ? 123.38500 136.58500 75.32000  1.000 122.42000 ? 424 SER C CB    1 
ATOM   6848  O OG    . SER C 1 179 ? 123.14000 137.94400 75.63000  1.000 122.42000 ? 424 SER C OG    1 
ATOM   6849  N N     . GLU C 1 180 ? 125.42600 137.85300 77.39100  1.000 124.67000 ? 425 GLU C N     1 
ATOM   6850  C CA    . GLU C 1 180 ? 126.57400 138.70700 77.65700  1.000 124.67000 ? 425 GLU C CA    1 
ATOM   6851  C C     . GLU C 1 180 ? 127.67900 137.93900 78.36400  1.000 124.67000 ? 425 GLU C C     1 
ATOM   6852  O O     . GLU C 1 180 ? 128.86400 138.21600 78.15200  1.000 124.67000 ? 425 GLU C O     1 
ATOM   6853  C CB    . GLU C 1 180 ? 126.13500 139.90300 78.49100  1.000 124.67000 ? 425 GLU C CB    1 
ATOM   6854  C CG    . GLU C 1 180 ? 127.19500 140.94600 78.69900  1.000 124.67000 ? 425 GLU C CG    1 
ATOM   6855  C CD    . GLU C 1 180 ? 126.69300 142.10100 79.52600  1.000 124.67000 ? 425 GLU C CD    1 
ATOM   6856  O OE1   . GLU C 1 180 ? 125.52200 142.05500 79.95400  1.000 124.67000 ? 425 GLU C OE1   1 
ATOM   6857  O OE2   . GLU C 1 180 ? 127.46300 143.05600 79.74800  1.000 124.67000 ? 425 GLU C OE2   1 
ATOM   6858  N N     . VAL C 1 181 ? 127.31300 136.95500 79.18100  1.000 116.34000 ? 426 VAL C N     1 
ATOM   6859  C CA    . VAL C 1 181 ? 128.31400 136.06600 79.74600  1.000 116.34000 ? 426 VAL C CA    1 
ATOM   6860  C C     . VAL C 1 181 ? 128.87200 135.16000 78.66800  1.000 116.34000 ? 426 VAL C C     1 
ATOM   6861  O O     . VAL C 1 181 ? 130.08600 134.95100 78.58000  1.000 116.34000 ? 426 VAL C O     1 
ATOM   6862  C CB    . VAL C 1 181 ? 127.70500 135.25200 80.89100  1.000 116.34000 ? 426 VAL C CB    1 
ATOM   6863  C CG1   . VAL C 1 181 ? 128.74900 134.37600 81.50700  1.000 116.34000 ? 426 VAL C CG1   1 
ATOM   6864  C CG2   . VAL C 1 181 ? 127.11500 136.17600 81.90300  1.000 116.34000 ? 426 VAL C CG2   1 
ATOM   6865  N N     . LEU C 1 182 ? 127.99600 134.62700 77.81800  1.000 121.09000 ? 427 LEU C N     1 
ATOM   6866  C CA    . LEU C 1 182 ? 128.44000 133.66800 76.81600  1.000 121.09000 ? 427 LEU C CA    1 
ATOM   6867  C C     . LEU C 1 182 ? 129.25200 134.31700 75.71200  1.000 121.09000 ? 427 LEU C C     1 
ATOM   6868  O O     . LEU C 1 182 ? 130.12600 133.66900 75.13200  1.000 121.09000 ? 427 LEU C O     1 
ATOM   6869  C CB    . LEU C 1 182 ? 127.24900 132.96700 76.19800  1.000 121.09000 ? 427 LEU C CB    1 
ATOM   6870  C CG    . LEU C 1 182 ? 126.44000 132.08700 77.12400  1.000 121.09000 ? 427 LEU C CG    1 
ATOM   6871  C CD1   . LEU C 1 182 ? 125.24300 131.67000 76.33500  1.000 121.09000 ? 427 LEU C CD1   1 
ATOM   6872  C CD2   . LEU C 1 182 ? 127.25700 130.90200 77.56000  1.000 121.09000 ? 427 LEU C CD2   1 
ATOM   6873  N N     . SER C 1 183 ? 128.99400 135.58300 75.40600  1.000 125.47000 ? 428 SER C N     1 
ATOM   6874  C CA    . SER C 1 183 ? 129.67200 136.23300 74.29600  1.000 125.47000 ? 428 SER C CA    1 
ATOM   6875  C C     . SER C 1 183 ? 131.01100 136.83200 74.69000  1.000 125.47000 ? 428 SER C C     1 
ATOM   6876  O O     . SER C 1 183 ? 131.52100 137.70000 73.97600  1.000 125.47000 ? 428 SER C O     1 
ATOM   6877  C CB    . SER C 1 183 ? 128.78300 137.31400 73.69100  1.000 125.47000 ? 428 SER C CB    1 
ATOM   6878  O OG    . SER C 1 183 ? 128.58200 138.36100 74.61900  1.000 125.47000 ? 428 SER C OG    1 
ATOM   6879  N N     . SER C 1 184 ? 131.58800 136.39800 75.80300  1.000 124.22000 ? 429 SER C N     1 
ATOM   6880  C CA    . SER C 1 184 ? 132.91200 136.84600 76.16200  1.000 124.22000 ? 429 SER C CA    1 
ATOM   6881  C C     . SER C 1 184 ? 133.93000 136.19200 75.24500  1.000 124.22000 ? 429 SER C C     1 
ATOM   6882  O O     . SER C 1 184 ? 133.67500 135.12800 74.68000  1.000 124.22000 ? 429 SER C O     1 
ATOM   6883  C CB    . SER C 1 184 ? 133.24100 136.47300 77.60100  1.000 124.22000 ? 429 SER C CB    1 
ATOM   6884  O OG    . SER C 1 184 ? 133.51600 135.08700 77.70000  1.000 124.22000 ? 429 SER C OG    1 
ATOM   6885  N N     . PRO C 1 185 ? 135.10000 136.80800 75.08200  1.000 136.58000 ? 430 PRO C N     1 
ATOM   6886  C CA    . PRO C 1 185 ? 136.22400 136.05300 74.52400  1.000 136.58000 ? 430 PRO C CA    1 
ATOM   6887  C C     . PRO C 1 185 ? 136.65900 134.92700 75.43600  1.000 136.58000 ? 430 PRO C C     1 
ATOM   6888  O O     . PRO C 1 185 ? 137.15600 133.90600 74.94600  1.000 136.58000 ? 430 PRO C O     1 
ATOM   6889  C CB    . PRO C 1 185 ? 137.32100 137.11500 74.37200  1.000 136.58000 ? 430 PRO C CB    1 
ATOM   6890  C CG    . PRO C 1 185 ? 136.59000 138.40700 74.31100  1.000 136.58000 ? 430 PRO C CG    1 
ATOM   6891  C CD    . PRO C 1 185 ? 135.41700 138.23600 75.22400  1.000 136.58000 ? 430 PRO C CD    1 
ATOM   6892  N N     . GLU C 1 186 ? 136.45400 135.07500 76.74800  1.000 135.34000 ? 431 GLU C N     1 
ATOM   6893  C CA    . GLU C 1 186 ? 136.92800 134.08500 77.70300  1.000 135.34000 ? 431 GLU C CA    1 
ATOM   6894  C C     . GLU C 1 186 ? 136.13500 132.79400 77.62500  1.000 135.34000 ? 431 GLU C C     1 
ATOM   6895  O O     . GLU C 1 186 ? 136.70200 131.71500 77.82500  1.000 135.34000 ? 431 GLU C O     1 
ATOM   6896  C CB    . GLU C 1 186 ? 136.86000 134.65500 79.11300  1.000 135.34000 ? 431 GLU C CB    1 
ATOM   6897  C CG    . GLU C 1 186 ? 137.71800 135.88600 79.30100  1.000 135.34000 ? 431 GLU C CG    1 
ATOM   6898  C CD    . GLU C 1 186 ? 139.19300 135.59300 79.18600  1.000 135.34000 ? 431 GLU C CD    1 
ATOM   6899  O OE1   . GLU C 1 186 ? 139.61700 134.48900 79.58300  1.000 135.34000 ? 431 GLU C OE1   1 
ATOM   6900  O OE2   . GLU C 1 186 ? 139.93200 136.46700 78.69100  1.000 135.34000 ? 431 GLU C OE2   1 
ATOM   6901  N N     . TYR C 1 187 ? 134.83600 132.87600 77.32600  1.000 125.09000 ? 432 TYR C N     1 
ATOM   6902  C CA    . TYR C 1 187 ? 134.03900 131.65900 77.24200  1.000 125.09000 ? 432 TYR C CA    1 
ATOM   6903  C C     . TYR C 1 187 ? 134.37700 130.85400 75.99700  1.000 125.09000 ? 432 TYR C C     1 
ATOM   6904  O O     . TYR C 1 187 ? 134.23500 129.62600 75.99000  1.000 125.09000 ? 432 TYR C O     1 
ATOM   6905  C CB    . TYR C 1 187 ? 132.55300 131.98700 77.25800  1.000 125.09000 ? 432 TYR C CB    1 
ATOM   6906  C CG    . TYR C 1 187 ? 131.69600 130.76300 77.35700  1.000 125.09000 ? 432 TYR C CG    1 
ATOM   6907  C CD1   . TYR C 1 187 ? 131.63200 130.04600 78.53500  1.000 125.09000 ? 432 TYR C CD1   1 
ATOM   6908  C CD2   . TYR C 1 187 ? 130.95600 130.32400 76.27700  1.000 125.09000 ? 432 TYR C CD2   1 
ATOM   6909  C CE1   . TYR C 1 187 ? 130.85700 128.92700 78.63700  1.000 125.09000 ? 432 TYR C CE1   1 
ATOM   6910  C CE2   . TYR C 1 187 ? 130.17700 129.20400 76.37000  1.000 125.09000 ? 432 TYR C CE2   1 
ATOM   6911  C CZ    . TYR C 1 187 ? 130.12800 128.51100 77.55500  1.000 125.09000 ? 432 TYR C CZ    1 
ATOM   6912  O OH    . TYR C 1 187 ? 129.34700 127.38600 77.65800  1.000 125.09000 ? 432 TYR C OH    1 
ATOM   6913  N N     . ASP C 1 188 ? 134.84200 131.51900 74.94700  1.000 139.86000 ? 433 ASP C N     1 
ATOM   6914  C CA    . ASP C 1 188 ? 135.30000 130.81600 73.76300  1.000 139.86000 ? 433 ASP C CA    1 
ATOM   6915  C C     . ASP C 1 188 ? 136.70500 130.26800 73.94700  1.000 139.86000 ? 433 ASP C C     1 
ATOM   6916  O O     . ASP C 1 188 ? 137.17700 129.49400 73.10900  1.000 139.86000 ? 433 ASP C O     1 
ATOM   6917  C CB    . ASP C 1 188 ? 135.24900 131.75900 72.55800  1.000 139.86000 ? 433 ASP C CB    1 
ATOM   6918  C CG    . ASP C 1 188 ? 135.15300 131.02300 71.23400  1.000 139.86000 ? 433 ASP C CG    1 
ATOM   6919  O OD1   . ASP C 1 188 ? 135.08000 129.77800 71.22600  1.000 139.86000 ? 433 ASP C OD1   1 
ATOM   6920  O OD2   . ASP C 1 188 ? 135.14000 131.70200 70.18900  1.000 139.86000 ? 433 ASP C OD2   1 
ATOM   6921  N N     . GLU C 1 189 ? 137.37800 130.63300 75.03100  1.000 139.16000 ? 434 GLU C N     1 
ATOM   6922  C CA    . GLU C 1 189 ? 138.74400 130.20600 75.25600  1.000 139.16000 ? 434 GLU C CA    1 
ATOM   6923  C C     . GLU C 1 189 ? 138.90200 129.27700 76.44600  1.000 139.16000 ? 434 GLU C C     1 
ATOM   6924  O O     . GLU C 1 189 ? 140.03600 128.90300 76.76400  1.000 139.16000 ? 434 GLU C O     1 
ATOM   6925  C CB    . GLU C 1 189 ? 139.66000 131.42500 75.42600  1.000 139.16000 ? 434 GLU C CB    1 
ATOM   6926  C CG    . GLU C 1 189 ? 139.84700 132.23400 74.14700  1.000 139.16000 ? 434 GLU C CG    1 
ATOM   6927  C CD    . GLU C 1 189 ? 140.70600 133.46500 74.35000  1.000 139.16000 ? 434 GLU C CD    1 
ATOM   6928  O OE1   . GLU C 1 189 ? 141.07500 133.75000 75.50700  1.000 139.16000 ? 434 GLU C OE1   1 
ATOM   6929  O OE2   . GLU C 1 189 ? 141.00600 134.15200 73.35400  1.000 139.16000 ? 434 GLU C OE2   1 
ATOM   6930  N N     . HIS C 1 190 ? 137.82000 128.89200 77.11800  1.000 126.96000 ? 435 HIS C N     1 
ATOM   6931  C CA    . HIS C 1 190 ? 137.93700 127.82800 78.10500  1.000 126.96000 ? 435 HIS C CA    1 
ATOM   6932  C C     . HIS C 1 190 ? 138.05600 126.48900 77.40100  1.000 126.96000 ? 435 HIS C C     1 
ATOM   6933  O O     . HIS C 1 190 ? 137.12500 126.03800 76.72600  1.000 126.96000 ? 435 HIS C O     1 
ATOM   6934  C CB    . HIS C 1 190 ? 136.77100 127.83300 79.08300  1.000 126.96000 ? 435 HIS C CB    1 
ATOM   6935  C CG    . HIS C 1 190 ? 136.93900 128.81800 80.19200  1.000 126.96000 ? 435 HIS C CG    1 
ATOM   6936  N ND1   . HIS C 1 190 ? 137.82500 128.61600 81.22600  1.000 126.96000 ? 435 HIS C ND1   1 
ATOM   6937  C CD2   . HIS C 1 190 ? 136.35000 130.01300 80.42800  1.000 126.96000 ? 435 HIS C CD2   1 
ATOM   6938  C CE1   . HIS C 1 190 ? 137.77300 129.64300 82.05400  1.000 126.96000 ? 435 HIS C CE1   1 
ATOM   6939  N NE2   . HIS C 1 190 ? 136.88500 130.50500 81.59300  1.000 126.96000 ? 435 HIS C NE2   1 
ATOM   6940  N N     . LYS C 1 191 ? 139.22200 125.86900 77.56600  1.000 131.27000 ? 436 LYS C N     1 
ATOM   6941  C CA    . LYS C 1 191 ? 139.55100 124.64000 76.86600  1.000 131.27000 ? 436 LYS C CA    1 
ATOM   6942  C C     . LYS C 1 191 ? 138.71600 123.47300 77.36400  1.000 131.27000 ? 436 LYS C C     1 
ATOM   6943  O O     . LYS C 1 191 ? 138.43100 122.54500 76.60100  1.000 131.27000 ? 436 LYS C O     1 
ATOM   6944  C CB    . LYS C 1 191 ? 141.03900 124.35900 77.05200  1.000 131.27000 ? 436 LYS C CB    1 
ATOM   6945  C CG    . LYS C 1 191 ? 141.60300 123.24100 76.21800  1.000 131.27000 ? 436 LYS C CG    1 
ATOM   6946  C CD    . LYS C 1 191 ? 143.07400 123.03900 76.53600  1.000 131.27000 ? 436 LYS C CD    1 
ATOM   6947  C CE    . LYS C 1 191 ? 143.97500 123.78800 75.56400  1.000 131.27000 ? 436 LYS C CE    1 
ATOM   6948  N NZ    . LYS C 1 191 ? 144.06100 125.24500 75.86600  1.000 131.27000 ? 436 LYS C NZ    1 
ATOM   6949  N N     . SER C 1 192 ? 138.29500 123.51800 78.62100  1.000 125.28000 ? 437 SER C N     1 
ATOM   6950  C CA    . SER C 1 192 ? 137.65800 122.37500 79.24600  1.000 125.28000 ? 437 SER C CA    1 
ATOM   6951  C C     . SER C 1 192 ? 136.24500 122.16500 78.73400  1.000 125.28000 ? 437 SER C C     1 
ATOM   6952  O O     . SER C 1 192 ? 135.54600 123.10500 78.34900  1.000 125.28000 ? 437 SER C O     1 
ATOM   6953  C CB    . SER C 1 192 ? 137.61700 122.54000 80.75600  1.000 125.28000 ? 437 SER C CB    1 
ATOM   6954  O OG    . SER C 1 192 ? 136.90000 121.47700 81.35800  1.000 125.28000 ? 437 SER C OG    1 
ATOM   6955  N N     . THR C 1 193 ? 135.82800 120.90200 78.75000  1.000 120.17000 ? 438 THR C N     1 
ATOM   6956  C CA    . THR C 1 193 ? 134.51200 120.53200 78.26500  1.000 120.17000 ? 438 THR C CA    1 
ATOM   6957  C C     . THR C 1 193 ? 133.41500 120.90900 79.23700  1.000 120.17000 ? 438 THR C C     1 
ATOM   6958  O O     . THR C 1 193 ? 132.24800 120.94600 78.84500  1.000 120.17000 ? 438 THR C O     1 
ATOM   6959  C CB    . THR C 1 193 ? 134.45600 119.03200 78.00800  1.000 120.17000 ? 438 THR C CB    1 
ATOM   6960  O OG1   . THR C 1 193 ? 134.68000 118.33800 79.24000  1.000 120.17000 ? 438 THR C OG1   1 
ATOM   6961  C CG2   . THR C 1 193 ? 135.52400 118.62800 77.00800  1.000 120.17000 ? 438 THR C CG2   1 
ATOM   6962  N N     . VAL C 1 194 ? 133.75000 121.18000 80.49100  1.000 111.07000 ? 439 VAL C N     1 
ATOM   6963  C CA    . VAL C 1 194 ? 132.72200 121.46300 81.48500  1.000 111.07000 ? 439 VAL C CA    1 
ATOM   6964  C C     . VAL C 1 194 ? 132.96100 122.80400 82.17700  1.000 111.07000 ? 439 VAL C C     1 
ATOM   6965  O O     . VAL C 1 194 ? 133.41800 122.84000 83.32600  1.000 111.07000 ? 439 VAL C O     1 
ATOM   6966  C CB    . VAL C 1 194 ? 132.61900 120.29800 82.48200  1.000 111.07000 ? 439 VAL C CB    1 
ATOM   6967  C CG1   . VAL C 1 194 ? 131.82000 119.18300 81.86600  1.000 111.07000 ? 439 VAL C CG1   1 
ATOM   6968  C CG2   . VAL C 1 194 ? 134.00500 119.74400 82.79600  1.000 111.07000 ? 439 VAL C CG2   1 
ATOM   6969  N N     . PRO C 1 195 ? 132.64800 123.92900 81.54200  1.000 110.03000 ? 440 PRO C N     1 
ATOM   6970  C CA    . PRO C 1 195 ? 132.83000 125.22000 82.20300  1.000 110.03000 ? 440 PRO C CA    1 
ATOM   6971  C C     . PRO C 1 195 ? 131.63100 125.55600 83.07600  1.000 110.03000 ? 440 PRO C C     1 
ATOM   6972  O O     . PRO C 1 195 ? 130.61000 124.87400 83.07300  1.000 110.03000 ? 440 PRO C O     1 
ATOM   6973  C CB    . PRO C 1 195 ? 132.94400 126.19500 81.03300  1.000 110.03000 ? 440 PRO C CB    1 
ATOM   6974  C CG    . PRO C 1 195 ? 132.08900 125.58800 80.00400  1.000 110.03000 ? 440 PRO C CG    1 
ATOM   6975  C CD    . PRO C 1 195 ? 132.23300 124.10100 80.14100  1.000 110.03000 ? 440 PRO C CD    1 
ATOM   6976  N N     . LEU C 1 196 ? 131.78000 126.63300 83.84000  1.000 111.87000 ? 441 LEU C N     1 
ATOM   6977  C CA    . LEU C 1 196 ? 130.71000 127.16300 84.67900  1.000 111.87000 ? 441 LEU C CA    1 
ATOM   6978  C C     . LEU C 1 196 ? 130.63100 128.66400 84.47000  1.000 111.87000 ? 441 LEU C C     1 
ATOM   6979  O O     . LEU C 1 196 ? 131.43100 129.41600 85.03600  1.000 111.87000 ? 441 LEU C O     1 
ATOM   6980  C CB    . LEU C 1 196 ? 130.95100 126.84800 86.14600  1.000 111.87000 ? 441 LEU C CB    1 
ATOM   6981  C CG    . LEU C 1 196 ? 130.83100 125.37700 86.48700  1.000 111.87000 ? 441 LEU C CG    1 
ATOM   6982  C CD1   . LEU C 1 196 ? 131.22500 125.16000 87.93200  1.000 111.87000 ? 441 LEU C CD1   1 
ATOM   6983  C CD2   . LEU C 1 196 ? 129.40600 124.95200 86.22000  1.000 111.87000 ? 441 LEU C CD2   1 
ATOM   6984  N N     . ALA C 1 197 ? 129.66900 129.09900 83.66800  1.000 103.22000 ? 442 ALA C N     1 
ATOM   6985  C CA    . ALA C 1 197 ? 129.48600 130.51100 83.37500  1.000 103.22000 ? 442 ALA C CA    1 
ATOM   6986  C C     . ALA C 1 197 ? 128.49300 131.08000 84.37400  1.000 103.22000 ? 442 ALA C C     1 
ATOM   6987  O O     . ALA C 1 197 ? 127.30000 130.77600 84.31400  1.000 103.22000 ? 442 ALA C O     1 
ATOM   6988  C CB    . ALA C 1 197 ? 128.99900 130.69900 81.94500  1.000 103.22000 ? 442 ALA C CB    1 
ATOM   6989  N N     . LEU C 1 198 ? 128.98400 131.90000 85.29800  1.000 92.89000  ? 443 LEU C N     1 
ATOM   6990  C CA    . LEU C 1 198 ? 128.13900 132.43700 86.35700  1.000 92.89000  ? 443 LEU C CA    1 
ATOM   6991  C C     . LEU C 1 198 ? 127.60300 133.81800 86.00500  1.000 92.89000  ? 443 LEU C C     1 
ATOM   6992  O O     . LEU C 1 198 ? 126.38800 134.02200 85.93500  1.000 92.89000  ? 443 LEU C O     1 
ATOM   6993  C CB    . LEU C 1 198 ? 128.92800 132.48300 87.66400  1.000 92.89000  ? 443 LEU C CB    1 
ATOM   6994  C CG    . LEU C 1 198 ? 129.35200 131.10800 88.15800  1.000 92.89000  ? 443 LEU C CG    1 
ATOM   6995  C CD1   . LEU C 1 198 ? 130.21200 131.24100 89.38900  1.000 92.89000  ? 443 LEU C CD1   1 
ATOM   6996  C CD2   . LEU C 1 198 ? 128.13200 130.27300 88.44400  1.000 92.89000  ? 443 LEU C CD2   1 
ATOM   6997  N N     . GLY C 1 199 ? 128.49500 134.77400 85.78600  1.000 95.80000  ? 444 GLY C N     1 
ATOM   6998  C CA    . GLY C 1 199 ? 128.05500 136.11600 85.47100  1.000 95.80000  ? 444 GLY C CA    1 
ATOM   6999  C C     . GLY C 1 199 ? 129.21400 137.08600 85.52500  1.000 95.80000  ? 444 GLY C C     1 
ATOM   7000  O O     . GLY C 1 199 ? 130.37000 136.70500 85.34800  1.000 95.80000  ? 444 GLY C O     1 
ATOM   7001  N N     . HIS C 1 200 ? 128.87900 138.34100 85.76900  1.000 109.80000 ? 445 HIS C N     1 
ATOM   7002  C CA    . HIS C 1 200 ? 129.87500 139.38500 85.90500  1.000 109.80000 ? 445 HIS C CA    1 
ATOM   7003  C C     . HIS C 1 200 ? 130.18300 139.65500 87.36700  1.000 109.80000 ? 445 HIS C C     1 
ATOM   7004  O O     . HIS C 1 200 ? 129.39900 139.34200 88.26600  1.000 109.80000 ? 445 HIS C O     1 
ATOM   7005  C CB    . HIS C 1 200 ? 129.40800 140.67200 85.23900  1.000 109.80000 ? 445 HIS C CB    1 
ATOM   7006  C CG    . HIS C 1 200 ? 129.30100 140.57000 83.75700  1.000 109.80000 ? 445 HIS C CG    1 
ATOM   7007  N ND1   . HIS C 1 200 ? 130.40600 140.52200 82.93700  1.000 109.80000 ? 445 HIS C ND1   1 
ATOM   7008  C CD2   . HIS C 1 200 ? 128.22400 140.51800 82.94300  1.000 109.80000 ? 445 HIS C CD2   1 
ATOM   7009  C CE1   . HIS C 1 200 ? 130.01400 140.43700 81.67900  1.000 109.80000 ? 445 HIS C CE1   1 
ATOM   7010  N NE2   . HIS C 1 200 ? 128.69400 140.43300 81.65500  1.000 109.80000 ? 445 HIS C NE2   1 
ATOM   7011  N N     . ASP C 1 201 ? 131.34100 140.25400 87.59100  1.000 110.41000 ? 446 ASP C N     1 
ATOM   7012  C CA    . ASP C 1 201 ? 131.75100 140.65300 88.92300  1.000 110.41000 ? 446 ASP C CA    1 
ATOM   7013  C C     . ASP C 1 201 ? 131.27600 142.07400 89.19100  1.000 110.41000 ? 446 ASP C C     1 
ATOM   7014  O O     . ASP C 1 201 ? 130.44800 142.62700 88.46500  1.000 110.41000 ? 446 ASP C O     1 
ATOM   7015  C CB    . ASP C 1 201 ? 133.26100 140.51100 89.08900  1.000 110.41000 ? 446 ASP C CB    1 
ATOM   7016  C CG    . ASP C 1 201 ? 134.05400 141.31100 88.07100  1.000 110.41000 ? 446 ASP C CG    1 
ATOM   7017  O OD1   . ASP C 1 201 ? 133.47100 141.92000 87.14700  1.000 110.41000 ? 446 ASP C OD1   1 
ATOM   7018  O OD2   . ASP C 1 201 ? 135.29400 141.32300 88.19700  1.000 110.41000 ? 446 ASP C OD2   1 
ATOM   7019  N N     . ILE C 1 202 ? 131.82400 142.68500 90.24000  1.000 104.37000 ? 447 ILE C N     1 
ATOM   7020  C CA    . ILE C 1 202 ? 131.46700 144.04900 90.58500  1.000 104.37000 ? 447 ILE C CA    1 
ATOM   7021  C C     . ILE C 1 202 ? 132.01500 145.05300 89.58700  1.000 104.37000 ? 447 ILE C C     1 
ATOM   7022  O O     . ILE C 1 202 ? 131.54400 146.19300 89.54100  1.000 104.37000 ? 447 ILE C O     1 
ATOM   7023  C CB    . ILE C 1 202 ? 131.96200 144.34800 92.00400  1.000 104.37000 ? 447 ILE C CB    1 
ATOM   7024  C CG1   . ILE C 1 202 ? 133.47400 144.20100 92.07600  1.000 104.37000 ? 447 ILE C CG1   1 
ATOM   7025  C CG2   . ILE C 1 202 ? 131.33500 143.38900 92.97700  1.000 104.37000 ? 447 ILE C CG2   1 
ATOM   7026  C CD1   . ILE C 1 202 ? 134.03300 144.61600 93.39800  1.000 104.37000 ? 447 ILE C CD1   1 
ATOM   7027  N N     . GLY C 1 203 ? 132.99400 144.66400 88.78000  1.000 113.19000 ? 448 GLY C N     1 
ATOM   7028  C CA    . GLY C 1 203 ? 133.47000 145.53000 87.72600  1.000 113.19000 ? 448 GLY C CA    1 
ATOM   7029  C C     . GLY C 1 203 ? 132.67900 145.33700 86.45200  1.000 113.19000 ? 448 GLY C C     1 
ATOM   7030  O O     . GLY C 1 203 ? 132.73600 146.17100 85.54600  1.000 113.19000 ? 448 GLY C O     1 
ATOM   7031  N N     . GLY C 1 204 ? 131.93100 144.24600 86.37000  1.000 112.60000 ? 449 GLY C N     1 
ATOM   7032  C CA    . GLY C 1 204 ? 131.22300 143.90800 85.15800  1.000 112.60000 ? 449 GLY C CA    1 
ATOM   7033  C C     . GLY C 1 204 ? 131.99100 143.03100 84.19600  1.000 112.60000 ? 449 GLY C C     1 
ATOM   7034  O O     . GLY C 1 204 ? 131.52300 142.81800 83.07300  1.000 112.60000 ? 449 GLY C O     1 
ATOM   7035  N N     . ARG C 1 205 ? 133.14400 142.53000 84.59200  1.000 112.83000 ? 450 ARG C N     1 
ATOM   7036  C CA    . ARG C 1 205 ? 133.91500 141.60600 83.77900  1.000 112.83000 ? 450 ARG C CA    1 
ATOM   7037  C C     . ARG C 1 205 ? 133.40800 140.18400 84.00600  1.000 112.83000 ? 450 ARG C C     1 
ATOM   7038  O O     . ARG C 1 205 ? 133.04900 139.83500 85.13100  1.000 112.83000 ? 450 ARG C O     1 
ATOM   7039  C CB    . ARG C 1 205 ? 135.38500 141.70500 84.14500  1.000 112.83000 ? 450 ARG C CB    1 
ATOM   7040  C CG    . ARG C 1 205 ? 135.93000 143.08900 83.91900  1.000 112.83000 ? 450 ARG C CG    1 
ATOM   7041  C CD    . ARG C 1 205 ? 137.39300 143.19500 84.28100  1.000 112.83000 ? 450 ARG C CD    1 
ATOM   7042  N NE    . ARG C 1 205 ? 137.86500 144.57400 84.17900  1.000 112.83000 ? 450 ARG C NE    1 
ATOM   7043  C CZ    . ARG C 1 205 ? 138.33400 145.12400 83.06300  1.000 112.83000 ? 450 ARG C CZ    1 
ATOM   7044  N NH1   . ARG C 1 205 ? 138.39500 144.41000 81.94600  1.000 112.83000 ? 450 ARG C NH1   1 
ATOM   7045  N NH2   . ARG C 1 205 ? 138.74100 146.38600 83.06000  1.000 112.83000 ? 450 ARG C NH2   1 
ATOM   7046  N N     . PRO C 1 206 ? 133.34900 139.35400 82.96500  1.000 102.82000 ? 451 PRO C N     1 
ATOM   7047  C CA    . PRO C 1 206 ? 132.73700 138.02900 83.11800  1.000 102.82000 ? 451 PRO C CA    1 
ATOM   7048  C C     . PRO C 1 206 ? 133.59400 137.09200 83.95100  1.000 102.82000 ? 451 PRO C C     1 
ATOM   7049  O O     . PRO C 1 206 ? 134.81400 137.03100 83.79800  1.000 102.82000 ? 451 PRO C O     1 
ATOM   7050  C CB    . PRO C 1 206 ? 132.61000 137.53200 81.67700  1.000 102.82000 ? 451 PRO C CB    1 
ATOM   7051  C CG    . PRO C 1 206 ? 133.66800 138.24700 80.95000  1.000 102.82000 ? 451 PRO C CG    1 
ATOM   7052  C CD    . PRO C 1 206 ? 133.77400 139.60000 81.58000  1.000 102.82000 ? 451 PRO C CD    1 
ATOM   7053  N N     . ILE C 1 207 ? 132.93400 136.37000 84.84900  1.000 97.62000  ? 452 ILE C N     1 
ATOM   7054  C CA    . ILE C 1 207 ? 133.58700 135.44300 85.76100  1.000 97.62000  ? 452 ILE C CA    1 
ATOM   7055  C C     . ILE C 1 207 ? 133.10800 134.05000 85.41000  1.000 97.62000  ? 452 ILE C C     1 
ATOM   7056  O O     . ILE C 1 207 ? 131.96900 133.68100 85.71800  1.000 97.62000  ? 452 ILE C O     1 
ATOM   7057  C CB    . ILE C 1 207 ? 133.28600 135.76500 87.22600  1.000 97.62000  ? 452 ILE C CB    1 
ATOM   7058  C CG1   . ILE C 1 207 ? 133.69800 137.19800 87.53400  1.000 97.62000  ? 452 ILE C CG1   1 
ATOM   7059  C CG2   . ILE C 1 207 ? 134.02500 134.80900 88.12800  1.000 97.62000  ? 452 ILE C CG2   1 
ATOM   7060  C CD1   . ILE C 1 207 ? 135.16200 137.47300 87.30100  1.000 97.62000  ? 452 ILE C CD1   1 
ATOM   7061  N N     . ILE C 1 208 ? 133.96800 133.27800 84.76200  1.000 105.51000 ? 453 ILE C N     1 
ATOM   7062  C CA    . ILE C 1 208 ? 133.65300 131.92600 84.33600  1.000 105.51000 ? 453 ILE C CA    1 
ATOM   7063  C C     . ILE C 1 208 ? 134.65700 130.99900 84.99300  1.000 105.51000 ? 453 ILE C C     1 
ATOM   7064  O O     . ILE C 1 208 ? 135.86400 131.26200 84.95300  1.000 105.51000 ? 453 ILE C O     1 
ATOM   7065  C CB    . ILE C 1 208 ? 133.71800 131.79300 82.80800  1.000 105.51000 ? 453 ILE C CB    1 
ATOM   7066  C CG1   . ILE C 1 208 ? 132.84800 132.85100 82.15300  1.000 105.51000 ? 453 ILE C CG1   1 
ATOM   7067  C CG2   . ILE C 1 208 ? 133.21700 130.43800 82.38200  1.000 105.51000 ? 453 ILE C CG2   1 
ATOM   7068  C CD1   . ILE C 1 208 ? 133.16100 133.04800 80.71000  1.000 105.51000 ? 453 ILE C CD1   1 
ATOM   7069  N N     . THR C 1 209 ? 134.17000 129.92400 85.59900  1.000 109.11000 ? 454 THR C N     1 
ATOM   7070  C CA    . THR C 1 209 ? 135.03500 128.97400 86.27600  1.000 109.11000 ? 454 THR C CA    1 
ATOM   7071  C C     . THR C 1 209 ? 134.96700 127.61500 85.60100  1.000 109.11000 ? 454 THR C C     1 
ATOM   7072  O O     . THR C 1 209 ? 134.01300 127.29100 84.89200  1.000 109.11000 ? 454 THR C O     1 
ATOM   7073  C CB    . THR C 1 209 ? 134.65800 128.82600 87.74500  1.000 109.11000 ? 454 THR C CB    1 
ATOM   7074  O OG1   . THR C 1 209 ? 133.31200 128.35300 87.84100  1.000 109.11000 ? 454 THR C OG1   1 
ATOM   7075  C CG2   . THR C 1 209 ? 134.76900 130.16000 88.43600  1.000 109.11000 ? 454 THR C CG2   1 
ATOM   7076  N N     . ASP C 1 210 ? 136.00000 126.81900 85.83800  1.000 119.23000 ? 455 ASP C N     1 
ATOM   7077  C CA    . ASP C 1 210 ? 136.12000 125.48700 85.27000  1.000 119.23000 ? 455 ASP C CA    1 
ATOM   7078  C C     . ASP C 1 210 ? 135.69900 124.47300 86.32000  1.000 119.23000 ? 455 ASP C C     1 
ATOM   7079  O O     . ASP C 1 210 ? 136.20200 124.49800 87.44600  1.000 119.23000 ? 455 ASP C O     1 
ATOM   7080  C CB    . ASP C 1 210 ? 137.55300 125.22900 84.81700  1.000 119.23000 ? 455 ASP C CB    1 
ATOM   7081  C CG    . ASP C 1 210 ? 137.69300 123.97400 83.98900  1.000 119.23000 ? 455 ASP C CG    1 
ATOM   7082  O OD1   . ASP C 1 210 ? 136.69100 123.26500 83.76000  1.000 119.23000 ? 455 ASP C OD1   1 
ATOM   7083  O OD2   . ASP C 1 210 ? 138.82900 123.69700 83.55900  1.000 119.23000 ? 455 ASP C OD2   1 
ATOM   7084  N N     . LEU C 1 211 ? 134.79900 123.56800 85.94400  1.000 115.42000 ? 456 LEU C N     1 
ATOM   7085  C CA    . LEU C 1 211 ? 134.28600 122.60700 86.90300  1.000 115.42000 ? 456 LEU C CA    1 
ATOM   7086  C C     . LEU C 1 211 ? 135.28800 121.50400 87.19600  1.000 115.42000 ? 456 LEU C C     1 
ATOM   7087  O O     . LEU C 1 211 ? 135.24300 120.91400 88.27900  1.000 115.42000 ? 456 LEU C O     1 
ATOM   7088  C CB    . LEU C 1 211 ? 132.94000 122.04200 86.43900  1.000 115.42000 ? 456 LEU C CB    1 
ATOM   7089  C CG    . LEU C 1 211 ? 132.07900 121.31200 87.47200  1.000 115.42000 ? 456 LEU C CG    1 
ATOM   7090  C CD1   . LEU C 1 211 ? 130.63200 121.58300 87.24500  1.000 115.42000 ? 456 LEU C CD1   1 
ATOM   7091  C CD2   . LEU C 1 211 ? 132.26800 119.85100 87.32200  1.000 115.42000 ? 456 LEU C CD2   1 
ATOM   7092  N N     . ALA C 1 212 ? 136.23400 121.26100 86.29700  1.000 121.19000 ? 457 ALA C N     1 
ATOM   7093  C CA    . ALA C 1 212 ? 137.27100 120.27100 86.54300  1.000 121.19000 ? 457 ALA C CA    1 
ATOM   7094  C C     . ALA C 1 212 ? 138.26400 120.69600 87.61500  1.000 121.19000 ? 457 ALA C C     1 
ATOM   7095  O O     . ALA C 1 212 ? 139.05200 119.86200 88.06800  1.000 121.19000 ? 457 ALA C O     1 
ATOM   7096  C CB    . ALA C 1 212 ? 138.03100 119.96300 85.25200  1.000 121.19000 ? 457 ALA C CB    1 
ATOM   7097  N N     . LYS C 1 213 ? 138.25900 121.95900 88.02300  1.000 119.14000 ? 458 LYS C N     1 
ATOM   7098  C CA    . LYS C 1 213 ? 139.10700 122.40500 89.11600  1.000 119.14000 ? 458 LYS C CA    1 
ATOM   7099  C C     . LYS C 1 213 ? 138.29700 123.09300 90.20300  1.000 119.14000 ? 458 LYS C C     1 
ATOM   7100  O O     . LYS C 1 213 ? 138.80100 124.00200 90.86400  1.000 119.14000 ? 458 LYS C O     1 
ATOM   7101  C CB    . LYS C 1 213 ? 140.21500 123.33600 88.62700  1.000 119.14000 ? 458 LYS C CB    1 
ATOM   7102  C CG    . LYS C 1 213 ? 141.48700 122.63600 88.19400  1.000 119.14000 ? 458 LYS C CG    1 
ATOM   7103  C CD    . LYS C 1 213 ? 141.40200 122.09100 86.78500  1.000 119.14000 ? 458 LYS C CD    1 
ATOM   7104  C CE    . LYS C 1 213 ? 141.46600 123.21900 85.77400  1.000 119.14000 ? 458 LYS C CE    1 
ATOM   7105  N NZ    . LYS C 1 213 ? 141.47600 122.70800 84.37900  1.000 119.14000 ? 458 LYS C NZ    1 
ATOM   7106  N N     . MET C 1 214 ? 137.04400 122.69900 90.39600  1.000 121.61000 ? 459 MET C N     1 
ATOM   7107  C CA    . MET C 1 214 ? 136.35600 123.24600 91.56100  1.000 121.61000 ? 459 MET C CA    1 
ATOM   7108  C C     . MET C 1 214 ? 136.81400 122.52700 92.83000  1.000 121.61000 ? 459 MET C C     1 
ATOM   7109  O O     . MET C 1 214 ? 137.19100 123.21000 93.78900  1.000 121.61000 ? 459 MET C O     1 
ATOM   7110  C CB    . MET C 1 214 ? 134.83400 123.19600 91.40700  1.000 121.61000 ? 459 MET C CB    1 
ATOM   7111  C CG    . MET C 1 214 ? 134.33500 123.92800 90.19800  1.000 121.61000 ? 459 MET C CG    1 
ATOM   7112  S SD    . MET C 1 214 ? 134.60500 125.69500 90.06100  1.000 121.61000 ? 459 MET C SD    1 
ATOM   7113  C CE    . MET C 1 214 ? 133.21000 126.29300 90.99200  1.000 121.61000 ? 459 MET C CE    1 
ATOM   7114  N N     . PRO C 1 215 ? 136.81300 121.17600 92.91200  1.000 110.68000 ? 460 PRO C N     1 
ATOM   7115  C CA    . PRO C 1 215 ? 136.35300 120.03200 92.11600  1.000 110.68000 ? 460 PRO C CA    1 
ATOM   7116  C C     . PRO C 1 215 ? 134.89300 119.74200 92.37600  1.000 110.68000 ? 460 PRO C C     1 
ATOM   7117  O O     . PRO C 1 215 ? 134.32500 118.87100 91.73300  1.000 110.68000 ? 460 PRO C O     1 
ATOM   7118  C CB    . PRO C 1 215 ? 137.22500 118.88900 92.60700  1.000 110.68000 ? 460 PRO C CB    1 
ATOM   7119  C CG    . PRO C 1 215 ? 137.48900 119.23200 93.99900  1.000 110.68000 ? 460 PRO C CG    1 
ATOM   7120  C CD    . PRO C 1 215 ? 137.61500 120.71600 94.05800  1.000 110.68000 ? 460 PRO C CD    1 
ATOM   7121  N N     . HIS C 1 216 ? 134.29900 120.44800 93.33200  1.000 111.31000 ? 461 HIS C N     1 
ATOM   7122  C CA    . HIS C 1 216 ? 132.89400 120.26800 93.66500  1.000 111.31000 ? 461 HIS C CA    1 
ATOM   7123  C C     . HIS C 1 216 ? 132.31400 121.61300 94.06900  1.000 111.31000 ? 461 HIS C C     1 
ATOM   7124  O O     . HIS C 1 216 ? 133.01400 122.62800 94.09900  1.000 111.31000 ? 461 HIS C O     1 
ATOM   7125  C CB    . HIS C 1 216 ? 132.71400 119.23300 94.76800  1.000 111.31000 ? 461 HIS C CB    1 
ATOM   7126  C CG    . HIS C 1 216 ? 133.10200 117.85700 94.35500  1.000 111.31000 ? 461 HIS C CG    1 
ATOM   7127  N ND1   . HIS C 1 216 ? 132.32200 117.09100 93.52200  1.000 111.31000 ? 461 HIS C ND1   1 
ATOM   7128  C CD2   . HIS C 1 216 ? 134.21000 117.12800 94.61400  1.000 111.31000 ? 461 HIS C CD2   1 
ATOM   7129  C CE1   . HIS C 1 216 ? 132.91800 115.93300 93.30800  1.000 111.31000 ? 461 HIS C CE1   1 
ATOM   7130  N NE2   . HIS C 1 216 ? 134.06600 115.93000 93.96100  1.000 111.31000 ? 461 HIS C NE2   1 
ATOM   7131  N N     . LEU C 1 217 ? 131.02500 121.61900 94.39900  1.000 111.44000 ? 462 LEU C N     1 
ATOM   7132  C CA    . LEU C 1 217 ? 130.33100 122.88900 94.52600  1.000 111.44000 ? 462 LEU C CA    1 
ATOM   7133  C C     . LEU C 1 217 ? 129.18500 122.80800 95.52100  1.000 111.44000 ? 462 LEU C C     1 
ATOM   7134  O O     . LEU C 1 217 ? 128.38900 121.86800 95.49000  1.000 111.44000 ? 462 LEU C O     1 
ATOM   7135  C CB    . LEU C 1 217 ? 129.80500 123.32700 93.16700  1.000 111.44000 ? 462 LEU C CB    1 
ATOM   7136  C CG    . LEU C 1 217 ? 129.31000 124.75400 93.13500  1.000 111.44000 ? 462 LEU C CG    1 
ATOM   7137  C CD1   . LEU C 1 217 ? 130.48200 125.62800 93.47400  1.000 111.44000 ? 462 LEU C CD1   1 
ATOM   7138  C CD2   . LEU C 1 217 ? 128.81900 125.05800 91.76900  1.000 111.44000 ? 462 LEU C CD2   1 
ATOM   7139  N N     . LEU C 1 218 ? 129.09100 123.82000 96.37900  1.000 108.99000 ? 463 LEU C N     1 
ATOM   7140  C CA    . LEU C 1 218 ? 128.04100 123.92800 97.37900  1.000 108.99000 ? 463 LEU C CA    1 
ATOM   7141  C C     . LEU C 1 218 ? 127.28300 125.23200 97.16900  1.000 108.99000 ? 463 LEU C C     1 
ATOM   7142  O O     . LEU C 1 218 ? 127.89600 126.29600 97.04400  1.000 108.99000 ? 463 LEU C O     1 
ATOM   7143  C CB    . LEU C 1 218 ? 128.62800 123.88000 98.78500  1.000 108.99000 ? 463 LEU C CB    1 
ATOM   7144  C CG    . LEU C 1 218 ? 127.58300 123.82900 99.88900  1.000 108.99000 ? 463 LEU C CG    1 
ATOM   7145  C CD1   . LEU C 1 218 ? 126.81100 122.53000 99.78200  1.000 108.99000 ? 463 LEU C CD1   1 
ATOM   7146  C CD2   . LEU C 1 218 ? 128.21400 123.97700 101.26000 1.000 108.99000 ? 463 LEU C CD2   1 
ATOM   7147  N N     . VAL C 1 219 ? 125.95600 125.14600 97.14000  1.000 106.17000 ? 464 VAL C N     1 
ATOM   7148  C CA    . VAL C 1 219 ? 125.08200 126.26600 96.81200  1.000 106.17000 ? 464 VAL C CA    1 
ATOM   7149  C C     . VAL C 1 219 ? 124.18000 126.55500 98.00600  1.000 106.17000 ? 464 VAL C C     1 
ATOM   7150  O O     . VAL C 1 219 ? 123.60500 125.63500 98.59500  1.000 106.17000 ? 464 VAL C O     1 
ATOM   7151  C CB    . VAL C 1 219 ? 124.26400 125.95800 95.54100  1.000 106.17000 ? 464 VAL C CB    1 
ATOM   7152  C CG1   . VAL C 1 219 ? 123.25500 127.02700 95.25400  1.000 106.17000 ? 464 VAL C CG1   1 
ATOM   7153  C CG2   . VAL C 1 219 ? 125.17900 125.80800 94.36100  1.000 106.17000 ? 464 VAL C CG2   1 
ATOM   7154  N N     . ALA C 1 220 ? 124.04900 127.83000 98.35700  1.000 108.05000 ? 465 ALA C N     1 
ATOM   7155  C CA    . ALA C 1 220 ? 123.25600 128.27900 99.49300  1.000 108.05000 ? 465 ALA C CA    1 
ATOM   7156  C C     . ALA C 1 220 ? 122.08300 129.12700 99.00000  1.000 108.05000 ? 465 ALA C C     1 
ATOM   7157  O O     . ALA C 1 220 ? 121.75000 129.12700 97.81700  1.000 108.05000 ? 465 ALA C O     1 
ATOM   7158  C CB    . ALA C 1 220 ? 124.13200 129.04700 100.47800 1.000 108.05000 ? 465 ALA C CB    1 
ATOM   7159  N N     . GLY C 1 221 ? 121.41600 129.81100 99.92700  1.000 108.76000 ? 466 GLY C N     1 
ATOM   7160  C CA    . GLY C 1 221 ? 120.35400 130.73200 99.56200  1.000 108.76000 ? 466 GLY C CA    1 
ATOM   7161  C C     . GLY C 1 221 ? 119.03500 130.42900 100.23600 1.000 108.76000 ? 466 GLY C C     1 
ATOM   7162  O O     . GLY C 1 221 ? 118.50600 129.32500 100.09400 1.000 108.76000 ? 466 GLY C O     1 
ATOM   7163  N N     . THR C 1 222 ? 118.48400 131.40100 100.95500 1.000 112.52000 ? 467 THR C N     1 
ATOM   7164  C CA    . THR C 1 222 ? 117.34000 131.16300 101.83900 1.000 112.52000 ? 467 THR C CA    1 
ATOM   7165  C C     . THR C 1 222 ? 116.02200 131.50800 101.15000 1.000 112.52000 ? 467 THR C C     1 
ATOM   7166  O O     . THR C 1 222 ? 115.23900 132.31300 101.66000 1.000 112.52000 ? 467 THR C O     1 
ATOM   7167  C CB    . THR C 1 222 ? 117.49400 131.97100 103.11900 1.000 112.52000 ? 467 THR C CB    1 
ATOM   7168  O OG1   . THR C 1 222 ? 117.42800 133.36500 102.80000 1.000 112.52000 ? 467 THR C OG1   1 
ATOM   7169  C CG2   . THR C 1 222 ? 118.82500 131.68500 103.76500 1.000 112.52000 ? 467 THR C CG2   1 
ATOM   7170  N N     . THR C 1 223 ? 115.77400 130.83600 100.01800 1.000 117.74000 ? 468 THR C N     1 
ATOM   7171  C CA    . THR C 1 223 ? 114.73100 131.19100 99.04300  1.000 117.74000 ? 468 THR C CA    1 
ATOM   7172  C C     . THR C 1 223 ? 114.83100 132.68200 98.72200  1.000 117.74000 ? 468 THR C C     1 
ATOM   7173  O O     . THR C 1 223 ? 113.86600 133.44500 98.79100  1.000 117.74000 ? 468 THR C O     1 
ATOM   7174  C CB    . THR C 1 223 ? 113.33300 130.79600 99.53600  1.000 117.74000 ? 468 THR C CB    1 
ATOM   7175  O OG1   . THR C 1 223 ? 113.40200 129.49000 100.11100 1.000 117.74000 ? 468 THR C OG1   1 
ATOM   7176  C CG2   . THR C 1 223 ? 112.35700 130.68800 98.36300  1.000 117.74000 ? 468 THR C CG2   1 
ATOM   7177  N N     . GLY C 1 224 ? 116.04900 133.10600 98.42700  1.000 115.58000 ? 469 GLY C N     1 
ATOM   7178  C CA    . GLY C 1 224 ? 116.32300 134.51900 98.40400  1.000 115.58000 ? 469 GLY C CA    1 
ATOM   7179  C C     . GLY C 1 224 ? 116.48000 135.04900 97.00600  1.000 115.58000 ? 469 GLY C C     1 
ATOM   7180  O O     . GLY C 1 224 ? 115.49600 135.30900 96.31000  1.000 115.58000 ? 469 GLY C O     1 
ATOM   7181  N N     . SER C 1 225 ? 117.73300 135.21800 96.60200  1.000 124.18000 ? 470 SER C N     1 
ATOM   7182  C CA    . SER C 1 225 ? 118.03900 135.80400 95.30700  1.000 124.18000 ? 470 SER C CA    1 
ATOM   7183  C C     . SER C 1 225 ? 117.63400 134.87400 94.18200  1.000 124.18000 ? 470 SER C C     1 
ATOM   7184  O O     . SER C 1 225 ? 116.81500 135.22400 93.32500  1.000 124.18000 ? 470 SER C O     1 
ATOM   7185  C CB    . SER C 1 225 ? 119.53000 136.08600 95.21800  1.000 124.18000 ? 470 SER C CB    1 
ATOM   7186  O OG    . SER C 1 225 ? 120.22400 134.86200 95.15900  1.000 124.18000 ? 470 SER C OG    1 
ATOM   7187  N N     . GLY C 1 226 ? 118.22300 133.69400 94.16000  1.000 118.02000 ? 471 GLY C N     1 
ATOM   7188  C CA    . GLY C 1 226 ? 117.91100 132.68700 93.18100  1.000 118.02000 ? 471 GLY C CA    1 
ATOM   7189  C C     . GLY C 1 226 ? 118.73800 131.47600 93.51000  1.000 118.02000 ? 471 GLY C C     1 
ATOM   7190  O O     . GLY C 1 226 ? 119.95800 131.56600 93.66200  1.000 118.02000 ? 471 GLY C O     1 
ATOM   7191  N N     . LYS C 1 227 ? 118.08400 130.33700 93.62800  1.000 117.31000 ? 472 LYS C N     1 
ATOM   7192  C CA    . LYS C 1 227 ? 118.77200 129.14300 94.07400  1.000 117.31000 ? 472 LYS C CA    1 
ATOM   7193  C C     . LYS C 1 227 ? 118.47100 128.06500 93.04900  1.000 117.31000 ? 472 LYS C C     1 
ATOM   7194  O O     . LYS C 1 227 ? 119.29800 127.19600 92.76900  1.000 117.31000 ? 472 LYS C O     1 
ATOM   7195  C CB    . LYS C 1 227 ? 118.30700 128.79900 95.48800  1.000 117.31000 ? 472 LYS C CB    1 
ATOM   7196  C CG    . LYS C 1 227 ? 119.10400 127.76000 96.20900  1.000 117.31000 ? 472 LYS C CG    1 
ATOM   7197  C CD    . LYS C 1 227 ? 118.42300 126.42600 96.11300  1.000 117.31000 ? 472 LYS C CD    1 
ATOM   7198  C CE    . LYS C 1 227 ? 119.15600 125.41900 96.94000  1.000 117.31000 ? 472 LYS C CE    1 
ATOM   7199  N NZ    . LYS C 1 227 ? 118.57200 124.05400 96.88900  1.000 117.31000 ? 472 LYS C NZ    1 
ATOM   7200  N N     . SER C 1 228 ? 117.28300 128.15000 92.46300  1.000 113.94000 ? 473 SER C N     1 
ATOM   7201  C CA    . SER C 1 228 ? 116.97700 127.38100 91.26800  1.000 113.94000 ? 473 SER C CA    1 
ATOM   7202  C C     . SER C 1 228 ? 117.73400 127.93800 90.07300  1.000 113.94000 ? 473 SER C C     1 
ATOM   7203  O O     . SER C 1 228 ? 118.48100 127.22000 89.39200  1.000 113.94000 ? 473 SER C O     1 
ATOM   7204  C CB    . SER C 1 228 ? 115.47800 127.43500 91.02300  1.000 113.94000 ? 473 SER C CB    1 
ATOM   7205  O OG    . SER C 1 228 ? 115.07000 128.74600 90.68700  1.000 113.94000 ? 473 SER C OG    1 
ATOM   7206  N N     . VAL C 1 229 ? 117.50800 129.22100 89.79100  1.000 107.26000 ? 474 VAL C N     1 
ATOM   7207  C CA    . VAL C 1 229 ? 118.36400 129.97300 88.89300  1.000 107.26000 ? 474 VAL C CA    1 
ATOM   7208  C C     . VAL C 1 229 ? 119.76900 129.98000 89.45800  1.000 107.26000 ? 474 VAL C C     1 
ATOM   7209  O O     . VAL C 1 229 ? 119.97800 130.21300 90.65400  1.000 107.26000 ? 474 VAL C O     1 
ATOM   7210  C CB    . VAL C 1 229 ? 117.81100 131.39200 88.71500  1.000 107.26000 ? 474 VAL C CB    1 
ATOM   7211  C CG1   . VAL C 1 229 ? 118.76100 132.26300 87.92700  1.000 107.26000 ? 474 VAL C CG1   1 
ATOM   7212  C CG2   . VAL C 1 229 ? 116.47300 131.32600 88.02500  1.000 107.26000 ? 474 VAL C CG2   1 
ATOM   7213  N N     . GLY C 1 230 ? 120.73300 129.69100 88.60200  1.000 110.63000 ? 475 GLY C N     1 
ATOM   7214  C CA    . GLY C 1 230 ? 122.11300 129.54400 88.99100  1.000 110.63000 ? 475 GLY C CA    1 
ATOM   7215  C C     . GLY C 1 230 ? 122.47800 128.09200 88.82800  1.000 110.63000 ? 475 GLY C C     1 
ATOM   7216  O O     . GLY C 1 230 ? 123.42700 127.77500 88.11800  1.000 110.63000 ? 475 GLY C O     1 
ATOM   7217  N N     . VAL C 1 231 ? 121.63900 127.20200 89.35400  1.000 110.33000 ? 476 VAL C N     1 
ATOM   7218  C CA    . VAL C 1 231 ? 121.75200 125.79300 89.00600  1.000 110.33000 ? 476 VAL C CA    1 
ATOM   7219  C C     . VAL C 1 231 ? 121.34000 125.58800 87.56200  1.000 110.33000 ? 476 VAL C C     1 
ATOM   7220  O O     . VAL C 1 231 ? 122.04300 124.93500 86.77700  1.000 110.33000 ? 476 VAL C O     1 
ATOM   7221  C CB    . VAL C 1 231 ? 120.89900 124.94300 89.95500  1.000 110.33000 ? 476 VAL C CB    1 
ATOM   7222  C CG1   . VAL C 1 231 ? 120.89300 123.50100 89.50600  1.000 110.33000 ? 476 VAL C CG1   1 
ATOM   7223  C CG2   . VAL C 1 231 ? 121.43200 125.06400 91.34800  1.000 110.33000 ? 476 VAL C CG2   1 
ATOM   7224  N N     . ASN C 1 232 ? 120.20300 126.17600 87.19100  1.000 118.85000 ? 477 ASN C N     1 
ATOM   7225  C CA    . ASN C 1 232 ? 119.77200 126.16000 85.80000  1.000 118.85000 ? 477 ASN C CA    1 
ATOM   7226  C C     . ASN C 1 232 ? 120.77700 126.86700 84.91000  1.000 118.85000 ? 477 ASN C C     1 
ATOM   7227  O O     . ASN C 1 232 ? 121.05200 126.41500 83.79400  1.000 118.85000 ? 477 ASN C O     1 
ATOM   7228  C CB    . ASN C 1 232 ? 118.40400 126.81400 85.68200  1.000 118.85000 ? 477 ASN C CB    1 
ATOM   7229  C CG    . ASN C 1 232 ? 117.33900 126.02600 86.38500  1.000 118.85000 ? 477 ASN C CG    1 
ATOM   7230  O OD1   . ASN C 1 232 ? 117.29700 124.80100 86.29000  1.000 118.85000 ? 477 ASN C OD1   1 
ATOM   7231  N ND2   . ASN C 1 232 ? 116.48000 126.71900 87.12000  1.000 118.85000 ? 477 ASN C ND2   1 
ATOM   7232  N N     . ALA C 1 233 ? 121.37800 127.94300 85.41800  1.000 115.13000 ? 478 ALA C N     1 
ATOM   7233  C CA    . ALA C 1 233 ? 122.34200 128.70800 84.63900  1.000 115.13000 ? 478 ALA C CA    1 
ATOM   7234  C C     . ALA C 1 233 ? 123.59800 127.89500 84.36300  1.000 115.13000 ? 478 ALA C C     1 
ATOM   7235  O O     . ALA C 1 233 ? 124.06100 127.81900 83.21800  1.000 115.13000 ? 478 ALA C O     1 
ATOM   7236  C CB    . ALA C 1 233 ? 122.68700 130.00000 85.37100  1.000 115.13000 ? 478 ALA C CB    1 
ATOM   7237  N N     . MET C 1 234 ? 124.14100 127.25200 85.39700  1.000 108.82000 ? 479 MET C N     1 
ATOM   7238  C CA    . MET C 1 234 ? 125.31300 126.41300 85.21200  1.000 108.82000 ? 479 MET C CA    1 
ATOM   7239  C C     . MET C 1 234 ? 125.01000 125.21200 84.33900  1.000 108.82000 ? 479 MET C C     1 
ATOM   7240  O O     . MET C 1 234 ? 125.86900 124.78100 83.56500  1.000 108.82000 ? 479 MET C O     1 
ATOM   7241  C CB    . MET C 1 234 ? 125.85300 125.95500 86.55800  1.000 108.82000 ? 479 MET C CB    1 
ATOM   7242  C CG    . MET C 1 234 ? 126.49500 127.05300 87.35300  1.000 108.82000 ? 479 MET C CG    1 
ATOM   7243  S SD    . MET C 1 234 ? 127.18200 126.39700 88.86400  1.000 108.82000 ? 479 MET C SD    1 
ATOM   7244  C CE    . MET C 1 234 ? 125.69600 126.06200 89.79400  1.000 108.82000 ? 479 MET C CE    1 
ATOM   7245  N N     . LEU C 1 235 ? 123.79000 124.69700 84.40100  1.000 110.12000 ? 480 LEU C N     1 
ATOM   7246  C CA    . LEU C 1 235 ? 123.48900 123.51400 83.61800  1.000 110.12000 ? 480 LEU C CA    1 
ATOM   7247  C C     . LEU C 1 235 ? 123.34900 123.85800 82.14000  1.000 110.12000 ? 480 LEU C C     1 
ATOM   7248  O O     . LEU C 1 235 ? 123.88900 123.15700 81.27000  1.000 110.12000 ? 480 LEU C O     1 
ATOM   7249  C CB    . LEU C 1 235 ? 122.23500 122.85700 84.17100  1.000 110.12000 ? 480 LEU C CB    1 
ATOM   7250  C CG    . LEU C 1 235 ? 121.97100 121.47600 83.61000  1.000 110.12000 ? 480 LEU C CG    1 
ATOM   7251  C CD1   . LEU C 1 235 ? 123.20200 120.62600 83.81600  1.000 110.12000 ? 480 LEU C CD1   1 
ATOM   7252  C CD2   . LEU C 1 235 ? 120.81500 120.87100 84.36100  1.000 110.12000 ? 480 LEU C CD2   1 
ATOM   7253  N N     . LEU C 1 236 ? 122.67100 124.96600 81.83900  1.000 114.83000 ? 481 LEU C N     1 
ATOM   7254  C CA    . LEU C 1 236 ? 122.61500 125.44100 80.46200  1.000 114.83000 ? 481 LEU C CA    1 
ATOM   7255  C C     . LEU C 1 236 ? 123.97300 125.89000 79.95400  1.000 114.83000 ? 481 LEU C C     1 
ATOM   7256  O O     . LEU C 1 236 ? 124.21500 125.82400 78.74700  1.000 114.83000 ? 481 LEU C O     1 
ATOM   7257  C CB    . LEU C 1 236 ? 121.60300 126.58100 80.32200  1.000 114.83000 ? 481 LEU C CB    1 
ATOM   7258  C CG    . LEU C 1 236 ? 120.13400 126.26000 80.00000  1.000 114.83000 ? 481 LEU C CG    1 
ATOM   7259  C CD1   . LEU C 1 236 ? 119.39000 125.55900 81.12700  1.000 114.83000 ? 481 LEU C CD1   1 
ATOM   7260  C CD2   . LEU C 1 236 ? 119.40000 127.53200 79.60400  1.000 114.83000 ? 481 LEU C CD2   1 
ATOM   7261  N N     . SER C 1 237 ? 124.86900 126.31800 80.83900  1.000 115.30000 ? 482 SER C N     1 
ATOM   7262  C CA    . SER C 1 237 ? 126.21000 126.64900 80.38600  1.000 115.30000 ? 482 SER C CA    1 
ATOM   7263  C C     . SER C 1 237 ? 127.05000 125.40700 80.13300  1.000 115.30000 ? 482 SER C C     1 
ATOM   7264  O O     . SER C 1 237 ? 127.97600 125.45400 79.31700  1.000 115.30000 ? 482 SER C O     1 
ATOM   7265  C CB    . SER C 1 237 ? 126.90400 127.54200 81.40400  1.000 115.30000 ? 482 SER C CB    1 
ATOM   7266  O OG    . SER C 1 237 ? 127.19300 126.81200 82.57300  1.000 115.30000 ? 482 SER C OG    1 
ATOM   7267  N N     . ILE C 1 238 ? 126.77500 124.31200 80.84700  1.000 111.56000 ? 483 ILE C N     1 
ATOM   7268  C CA    . ILE C 1 238 ? 127.34200 123.01600 80.47600  1.000 111.56000 ? 483 ILE C CA    1 
ATOM   7269  C C     . ILE C 1 238 ? 126.87900 122.62100 79.08600  1.000 111.56000 ? 483 ILE C C     1 
ATOM   7270  O O     . ILE C 1 238 ? 127.67200 122.16000 78.25400  1.000 111.56000 ? 483 ILE C O     1 
ATOM   7271  C CB    . ILE C 1 238 ? 126.96100 121.94300 81.51400  1.000 111.56000 ? 483 ILE C CB    1 
ATOM   7272  C CG1   . ILE C 1 238 ? 127.71400 122.15500 82.81900  1.000 111.56000 ? 483 ILE C CG1   1 
ATOM   7273  C CG2   . ILE C 1 238 ? 127.22900 120.54800 80.99400  1.000 111.56000 ? 483 ILE C CG2   1 
ATOM   7274  C CD1   . ILE C 1 238 ? 129.19700 121.94200 82.68700  1.000 111.56000 ? 483 ILE C CD1   1 
ATOM   7275  N N     . LEU C 1 239 ? 125.59800 122.84700 78.79700  1.000 116.21000 ? 484 LEU C N     1 
ATOM   7276  C CA    . LEU C 1 239 ? 125.02000 122.29900 77.57900  1.000 116.21000 ? 484 LEU C CA    1 
ATOM   7277  C C     . LEU C 1 239 ? 125.50800 123.02400 76.32600  1.000 116.21000 ? 484 LEU C C     1 
ATOM   7278  O O     . LEU C 1 239 ? 125.57400 122.41600 75.25400  1.000 116.21000 ? 484 LEU C O     1 
ATOM   7279  C CB    . LEU C 1 239 ? 123.50300 122.34900 77.68800  1.000 116.21000 ? 484 LEU C CB    1 
ATOM   7280  C CG    . LEU C 1 239 ? 122.71500 121.36300 76.83800  1.000 116.21000 ? 484 LEU C CG    1 
ATOM   7281  C CD1   . LEU C 1 239 ? 121.47700 121.00400 77.61900  1.000 116.21000 ? 484 LEU C CD1   1 
ATOM   7282  C CD2   . LEU C 1 239 ? 122.32800 121.90000 75.47300  1.000 116.21000 ? 484 LEU C CD2   1 
ATOM   7283  N N     . PHE C 1 240 ? 125.88200 124.29700 76.43400  1.000 125.78000 ? 485 PHE C N     1 
ATOM   7284  C CA    . PHE C 1 240 ? 126.27200 125.04600 75.24400  1.000 125.78000 ? 485 PHE C CA    1 
ATOM   7285  C C     . PHE C 1 240 ? 127.69000 124.78000 74.77800  1.000 125.78000 ? 485 PHE C C     1 
ATOM   7286  O O     . PHE C 1 240 ? 128.04900 125.23900 73.69200  1.000 125.78000 ? 485 PHE C O     1 
ATOM   7287  C CB    . PHE C 1 240 ? 126.12400 126.54800 75.46200  1.000 125.78000 ? 485 PHE C CB    1 
ATOM   7288  C CG    . PHE C 1 240 ? 124.72600 127.05300 75.29800  1.000 125.78000 ? 485 PHE C CG    1 
ATOM   7289  C CD1   . PHE C 1 240 ? 123.77000 126.31300 74.63500  1.000 125.78000 ? 485 PHE C CD1   1 
ATOM   7290  C CD2   . PHE C 1 240 ? 124.37000 128.28300 75.80500  1.000 125.78000 ? 485 PHE C CD2   1 
ATOM   7291  C CE1   . PHE C 1 240 ? 122.48400 126.79900 74.48700  1.000 125.78000 ? 485 PHE C CE1   1 
ATOM   7292  C CE2   . PHE C 1 240 ? 123.09300 128.77100 75.66300  1.000 125.78000 ? 485 PHE C CE2   1 
ATOM   7293  C CZ    . PHE C 1 240 ? 122.15200 128.02900 75.00500  1.000 125.78000 ? 485 PHE C CZ    1 
ATOM   7294  N N     . LYS C 1 241 ? 128.51700 124.09100 75.55500  1.000 122.11000 ? 486 LYS C N     1 
ATOM   7295  C CA    . LYS C 1 241 ? 129.83200 123.72100 75.03200  1.000 122.11000 ? 486 LYS C CA    1 
ATOM   7296  C C     . LYS C 1 241 ? 130.13800 122.32200 75.55700  1.000 122.11000 ? 486 LYS C C     1 
ATOM   7297  O O     . LYS C 1 241 ? 130.79000 122.16700 76.59000  1.000 122.11000 ? 486 LYS C O     1 
ATOM   7298  C CB    . LYS C 1 241 ? 130.90400 124.72100 75.43800  1.000 122.11000 ? 486 LYS C CB    1 
ATOM   7299  C CG    . LYS C 1 241 ? 132.24000 124.49800 74.74600  1.000 122.11000 ? 486 LYS C CG    1 
ATOM   7300  C CD    . LYS C 1 241 ? 133.31900 125.44800 75.24600  1.000 122.11000 ? 486 LYS C CD    1 
ATOM   7301  C CE    . LYS C 1 241 ? 133.49900 126.64500 74.33400  1.000 122.11000 ? 486 LYS C CE    1 
ATOM   7302  N NZ    . LYS C 1 241 ? 132.45200 127.67500 74.54000  1.000 122.11000 ? 486 LYS C NZ    1 
ATOM   7303  N N     . SER C 1 242 ? 129.69300 121.31500 74.81100  1.000 124.42000 ? 487 SER C N     1 
ATOM   7304  C CA    . SER C 1 242 ? 129.74900 119.91000 75.20200  1.000 124.42000 ? 487 SER C CA    1 
ATOM   7305  C C     . SER C 1 242 ? 129.24800 119.07900 74.03100  1.000 124.42000 ? 487 SER C C     1 
ATOM   7306  O O     . SER C 1 242 ? 128.74200 119.60700 73.03700  1.000 124.42000 ? 487 SER C O     1 
ATOM   7307  C CB    . SER C 1 242 ? 128.89000 119.58700 76.43000  1.000 124.42000 ? 487 SER C CB    1 
ATOM   7308  O OG    . SER C 1 242 ? 129.34900 120.23000 77.60500  1.000 124.42000 ? 487 SER C OG    1 
ATOM   7309  N N     . THR C 1 243 ? 129.39600 117.77000 74.16700  1.000 127.97000 ? 488 THR C N     1 
ATOM   7310  C CA    . THR C 1 243 ? 128.67700 116.76400 73.40300  1.000 127.97000 ? 488 THR C CA    1 
ATOM   7311  C C     . THR C 1 243 ? 128.25200 115.69300 74.39700  1.000 127.97000 ? 488 THR C C     1 
ATOM   7312  O O     . THR C 1 243 ? 128.85200 115.57200 75.46900  1.000 127.97000 ? 488 THR C O     1 
ATOM   7313  C CB    . THR C 1 243 ? 129.53500 116.14000 72.29100  1.000 127.97000 ? 488 THR C CB    1 
ATOM   7314  O OG1   . THR C 1 243 ? 130.71100 115.56000 72.86200  1.000 127.97000 ? 488 THR C OG1   1 
ATOM   7315  C CG2   . THR C 1 243 ? 129.91600 117.15200 71.20900  1.000 127.97000 ? 488 THR C CG2   1 
ATOM   7316  N N     . PRO C 1 244 ? 127.21300 114.90900 74.07700  1.000 127.92000 ? 489 PRO C N     1 
ATOM   7317  C CA    . PRO C 1 244 ? 126.83300 113.80100 74.97100  1.000 127.92000 ? 489 PRO C CA    1 
ATOM   7318  C C     . PRO C 1 244 ? 127.87100 112.71000 75.09500  1.000 127.92000 ? 489 PRO C C     1 
ATOM   7319  O O     . PRO C 1 244 ? 127.79200 111.91500 76.03800  1.000 127.92000 ? 489 PRO C O     1 
ATOM   7320  C CB    . PRO C 1 244 ? 125.55400 113.26000 74.33100  1.000 127.92000 ? 489 PRO C CB    1 
ATOM   7321  C CG    . PRO C 1 244 ? 124.98900 114.41100 73.64100  1.000 127.92000 ? 489 PRO C CG    1 
ATOM   7322  C CD    . PRO C 1 244 ? 126.15900 115.16100 73.08500  1.000 127.92000 ? 489 PRO C CD    1 
ATOM   7323  N N     . SER C 1 245 ? 128.83100 112.63600 74.18200  1.000 129.08000 ? 490 SER C N     1 
ATOM   7324  C CA    . SER C 1 245 ? 129.96100 111.73500 74.32500  1.000 129.08000 ? 490 SER C CA    1 
ATOM   7325  C C     . SER C 1 245 ? 131.08500 112.33300 75.16000  1.000 129.08000 ? 490 SER C C     1 
ATOM   7326  O O     . SER C 1 245 ? 132.19400 111.79400 75.15200  1.000 129.08000 ? 490 SER C O     1 
ATOM   7327  C CB    . SER C 1 245 ? 130.48800 111.33700 72.94500  1.000 129.08000 ? 490 SER C CB    1 
ATOM   7328  O OG    . SER C 1 245 ? 131.01700 112.45600 72.25800  1.000 129.08000 ? 490 SER C OG    1 
ATOM   7329  N N     . GLU C 1 246 ? 130.83800 113.43400 75.86500  1.000 121.18000 ? 491 GLU C N     1 
ATOM   7330  C CA    . GLU C 1 246 ? 131.86900 114.03800 76.69400  1.000 121.18000 ? 491 GLU C CA    1 
ATOM   7331  C C     . GLU C 1 246 ? 131.37900 114.32400 78.10400  1.000 121.18000 ? 491 GLU C C     1 
ATOM   7332  O O     . GLU C 1 246 ? 132.16300 114.27300 79.05700  1.000 121.18000 ? 491 GLU C O     1 
ATOM   7333  C CB    . GLU C 1 246 ? 132.37500 115.32200 76.04800  1.000 121.18000 ? 491 GLU C CB    1 
ATOM   7334  C CG    . GLU C 1 246 ? 133.23900 115.09100 74.83600  1.000 121.18000 ? 491 GLU C CG    1 
ATOM   7335  C CD    . GLU C 1 246 ? 133.62000 116.38000 74.15400  1.000 121.18000 ? 491 GLU C CD    1 
ATOM   7336  O OE1   . GLU C 1 246 ? 133.08500 117.43700 74.54600  1.000 121.18000 ? 491 GLU C OE1   1 
ATOM   7337  O OE2   . GLU C 1 246 ? 134.45100 116.34000 73.22600  1.000 121.18000 ? 491 GLU C OE2   1 
ATOM   7338  N N     . ALA C 1 247 ? 130.09200 114.62300 78.25400  1.000 120.72000 ? 492 ALA C N     1 
ATOM   7339  C CA    . ALA C 1 247 ? 129.56600 115.05200 79.54700  1.000 120.72000 ? 492 ALA C CA    1 
ATOM   7340  C C     . ALA C 1 247 ? 128.08200 114.73200 79.61300  1.000 120.72000 ? 492 ALA C C     1 
ATOM   7341  O O     . ALA C 1 247 ? 127.27400 115.39800 78.96200  1.000 120.72000 ? 492 ALA C O     1 
ATOM   7342  C CB    . ALA C 1 247 ? 129.81000 116.54000 79.76200  1.000 120.72000 ? 492 ALA C CB    1 
ATOM   7343  N N     . ARG C 1 248 ? 127.72600 113.73300 80.40800  1.000 121.41000 ? 493 ARG C N     1 
ATOM   7344  C CA    . ARG C 1 248 ? 126.34500 113.33600 80.62100  1.000 121.41000 ? 493 ARG C CA    1 
ATOM   7345  C C     . ARG C 1 248 ? 126.01900 113.48900 82.09500  1.000 121.41000 ? 493 ARG C C     1 
ATOM   7346  O O     . ARG C 1 248 ? 126.82000 113.10600 82.95100  1.000 121.41000 ? 493 ARG C O     1 
ATOM   7347  C CB    . ARG C 1 248 ? 126.12600 111.89800 80.17700  1.000 121.41000 ? 493 ARG C CB    1 
ATOM   7348  C CG    . ARG C 1 248 ? 124.71100 111.41000 80.29800  1.000 121.41000 ? 493 ARG C CG    1 
ATOM   7349  C CD    . ARG C 1 248 ? 124.59900 110.03100 79.70100  1.000 121.41000 ? 493 ARG C CD    1 
ATOM   7350  N NE    . ARG C 1 248 ? 124.86000 110.03800 78.26800  1.000 121.41000 ? 493 ARG C NE    1 
ATOM   7351  C CZ    . ARG C 1 248 ? 125.00000 108.94100 77.53400  1.000 121.41000 ? 493 ARG C CZ    1 
ATOM   7352  N NH1   . ARG C 1 248 ? 124.90000 107.74600 78.09800  1.000 121.41000 ? 493 ARG C NH1   1 
ATOM   7353  N NH2   . ARG C 1 248 ? 125.24100 109.04100 76.23600  1.000 121.41000 ? 493 ARG C NH2   1 
ATOM   7354  N N     . LEU C 1 249 ? 124.85800 114.05600 82.40000  1.000 125.19000 ? 494 LEU C N     1 
ATOM   7355  C CA    . LEU C 1 249 ? 124.53400 114.34500 83.78700  1.000 125.19000 ? 494 LEU C CA    1 
ATOM   7356  C C     . LEU C 1 249 ? 123.47500 113.39600 84.32800  1.000 125.19000 ? 494 LEU C C     1 
ATOM   7357  O O     . LEU C 1 249 ? 122.79100 112.68000 83.59400  1.000 125.19000 ? 494 LEU C O     1 
ATOM   7358  C CB    . LEU C 1 249 ? 124.04900 115.78400 83.98600  1.000 125.19000 ? 494 LEU C CB    1 
ATOM   7359  C CG    . LEU C 1 249 ? 122.58700 116.04900 83.64600  1.000 125.19000 ? 494 LEU C CG    1 
ATOM   7360  C CD1   . LEU C 1 249 ? 122.03100 117.16400 84.50000  1.000 125.19000 ? 494 LEU C CD1   1 
ATOM   7361  C CD2   . LEU C 1 249 ? 122.46000 116.42200 82.19400  1.000 125.19000 ? 494 LEU C CD2   1 
ATOM   7362  N N     . ILE C 1 250 ? 123.36800 113.40700 85.65500  1.000 132.79000 ? 495 ILE C N     1 
ATOM   7363  C CA    . ILE C 1 250 ? 122.32400 112.72000 86.40400  1.000 132.79000 ? 495 ILE C CA    1 
ATOM   7364  C C     . ILE C 1 250 ? 121.85700 113.67300 87.48900  1.000 132.79000 ? 495 ILE C C     1 
ATOM   7365  O O     . ILE C 1 250 ? 122.66400 114.11800 88.31000  1.000 132.79000 ? 495 ILE C O     1 
ATOM   7366  C CB    . ILE C 1 250 ? 122.81000 111.40800 87.04300  1.000 132.79000 ? 495 ILE C CB    1 
ATOM   7367  C CG1   . ILE C 1 250 ? 123.09600 110.34000 85.99100  1.000 132.79000 ? 495 ILE C CG1   1 
ATOM   7368  C CG2   . ILE C 1 250 ? 121.82900 110.91600 88.09200  1.000 132.79000 ? 495 ILE C CG2   1 
ATOM   7369  C CD1   . ILE C 1 250 ? 124.54300 110.25300 85.61000  1.000 132.79000 ? 495 ILE C CD1   1 
ATOM   7370  N N     . MET C 1 251 ? 120.57000 113.98800 87.50200  1.000 147.55000 ? 496 MET C N     1 
ATOM   7371  C CA    . MET C 1 251 ? 120.02700 114.83200 88.55000  1.000 147.55000 ? 496 MET C CA    1 
ATOM   7372  C C     . MET C 1 251 ? 119.23500 113.99700 89.53900  1.000 147.55000 ? 496 MET C C     1 
ATOM   7373  O O     . MET C 1 251 ? 118.76700 112.89800 89.23700  1.000 147.55000 ? 496 MET C O     1 
ATOM   7374  C CB    . MET C 1 251 ? 119.14000 115.93200 87.97300  1.000 147.55000 ? 496 MET C CB    1 
ATOM   7375  C CG    . MET C 1 251 ? 117.78600 115.47600 87.50700  1.000 147.55000 ? 496 MET C CG    1 
ATOM   7376  S SD    . MET C 1 251 ? 117.87700 114.52700 85.98500  1.000 147.55000 ? 496 MET C SD    1 
ATOM   7377  C CE    . MET C 1 251 ? 116.20900 114.72300 85.36700  1.000 147.55000 ? 496 MET C CE    1 
ATOM   7378  N N     . ILE C 1 252 ? 119.11000 114.53200 90.74500  1.000 142.60000 ? 497 ILE C N     1 
ATOM   7379  C CA    . ILE C 1 252 ? 118.24900 113.96700 91.77200  1.000 142.60000 ? 497 ILE C CA    1 
ATOM   7380  C C     . ILE C 1 252 ? 117.31500 115.07500 92.21400  1.000 142.60000 ? 497 ILE C C     1 
ATOM   7381  O O     . ILE C 1 252 ? 117.77400 116.14100 92.63700  1.000 142.60000 ? 497 ILE C O     1 
ATOM   7382  C CB    . ILE C 1 252 ? 119.03200 113.41200 92.97100  1.000 142.60000 ? 497 ILE C CB    1 
ATOM   7383  C CG1   . ILE C 1 252 ? 119.83900 112.17900 92.57900  1.000 142.60000 ? 497 ILE C CG1   1 
ATOM   7384  C CG2   . ILE C 1 252 ? 118.08600 113.05000 94.07100  1.000 142.60000 ? 497 ILE C CG2   1 
ATOM   7385  C CD1   . ILE C 1 252 ? 121.26900 112.46400 92.18600  1.000 142.60000 ? 497 ILE C CD1   1 
ATOM   7386  N N     . ASP C 1 253 ? 116.01500 114.83400 92.10900  1.000 145.39000 ? 498 ASP C N     1 
ATOM   7387  C CA    . ASP C 1 253 ? 115.04400 115.89300 92.32800  1.000 145.39000 ? 498 ASP C CA    1 
ATOM   7388  C C     . ASP C 1 253 ? 114.24400 115.60200 93.58500  1.000 145.39000 ? 498 ASP C C     1 
ATOM   7389  O O     . ASP C 1 253 ? 113.40500 114.68900 93.58200  1.000 145.39000 ? 498 ASP C O     1 
ATOM   7390  C CB    . ASP C 1 253 ? 114.11600 116.01700 91.12400  1.000 145.39000 ? 498 ASP C CB    1 
ATOM   7391  C CG    . ASP C 1 253 ? 113.40500 117.34000 91.08000  1.000 145.39000 ? 498 ASP C CG    1 
ATOM   7392  O OD1   . ASP C 1 253 ? 113.61800 118.15500 91.99900  1.000 145.39000 ? 498 ASP C OD1   1 
ATOM   7393  O OD2   . ASP C 1 253 ? 112.66500 117.58100 90.10500  1.000 145.39000 ? 498 ASP C OD2   1 
ATOM   7394  N N     . PRO C 1 254 ? 114.48100 116.32000 94.66900  1.000 142.59000 ? 499 PRO C N     1 
ATOM   7395  C CA    . PRO C 1 254 ? 113.62500 116.20000 95.85600  1.000 142.59000 ? 499 PRO C CA    1 
ATOM   7396  C C     . PRO C 1 254 ? 112.19700 116.65000 95.61800  1.000 142.59000 ? 499 PRO C C     1 
ATOM   7397  O O     . PRO C 1 254 ? 111.25800 115.88200 95.83500  1.000 142.59000 ? 499 PRO C O     1 
ATOM   7398  C CB    . PRO C 1 254 ? 114.32800 117.10400 96.86900  1.000 142.59000 ? 499 PRO C CB    1 
ATOM   7399  C CG    . PRO C 1 254 ? 115.74800 117.07600 96.42500  1.000 142.59000 ? 499 PRO C CG    1 
ATOM   7400  C CD    . PRO C 1 254 ? 115.70300 117.08100 94.95100  1.000 142.59000 ? 499 PRO C CD    1 
ATOM   7401  N N     . LYS C 1 255 ? 112.01400 117.88500 95.17800  1.000 142.29000 ? 500 LYS C N     1 
ATOM   7402  C CA    . LYS C 1 255 ? 110.69200 118.39200 94.84100  1.000 142.29000 ? 500 LYS C CA    1 
ATOM   7403  C C     . LYS C 1 255 ? 110.56700 118.45400 93.32300  1.000 142.29000 ? 500 LYS C C     1 
ATOM   7404  O O     . LYS C 1 255 ? 111.16300 119.31500 92.67000  1.000 142.29000 ? 500 LYS C O     1 
ATOM   7405  C CB    . LYS C 1 255 ? 110.41900 119.73700 95.52300  1.000 142.29000 ? 500 LYS C CB    1 
ATOM   7406  C CG    . LYS C 1 255 ? 111.47600 120.82400 95.41700  1.000 142.29000 ? 500 LYS C CG    1 
ATOM   7407  C CD    . LYS C 1 255 ? 110.99700 122.09000 96.10400  1.000 142.29000 ? 500 LYS C CD    1 
ATOM   7408  C CE    . LYS C 1 255 ? 111.00000 121.93200 97.61000  1.000 142.29000 ? 500 LYS C CE    1 
ATOM   7409  N NZ    . LYS C 1 255 ? 112.38500 121.79000 98.12800  1.000 142.29000 ? 500 LYS C NZ    1 
ATOM   7410  N N     . MET C 1 256 ? 109.76800 117.54500 92.76400  1.000 143.62000 ? 501 MET C N     1 
ATOM   7411  C CA    . MET C 1 256 ? 109.63700 117.41100 91.31500  1.000 143.62000 ? 501 MET C CA    1 
ATOM   7412  C C     . MET C 1 256 ? 108.85500 118.61700 90.80200  1.000 143.62000 ? 501 MET C C     1 
ATOM   7413  O O     . MET C 1 256 ? 107.64400 118.58400 90.57700  1.000 143.62000 ? 501 MET C O     1 
ATOM   7414  C CB    . MET C 1 256 ? 108.97000 116.09100 90.95000  1.000 143.62000 ? 501 MET C CB    1 
ATOM   7415  C CG    . MET C 1 256 ? 108.94200 115.78700 89.45900  1.000 143.62000 ? 501 MET C CG    1 
ATOM   7416  S SD    . MET C 1 256 ? 108.27400 114.15000 89.11400  1.000 143.62000 ? 501 MET C SD    1 
ATOM   7417  C CE    . MET C 1 256 ? 108.26600 114.18000 87.33100  1.000 143.62000 ? 501 MET C CE    1 
ATOM   7418  N N     . LEU C 1 257 ? 109.58500 119.71800 90.64700  1.000 136.49000 ? 502 LEU C N     1 
ATOM   7419  C CA    . LEU C 1 257 ? 109.02200 121.01800 90.31300  1.000 136.49000 ? 502 LEU C CA    1 
ATOM   7420  C C     . LEU C 1 257 ? 109.51700 121.52900 88.97000  1.000 136.49000 ? 502 LEU C C     1 
ATOM   7421  O O     . LEU C 1 257 ? 108.70900 121.78500 88.07200  1.000 136.49000 ? 502 LEU C O     1 
ATOM   7422  C CB    . LEU C 1 257 ? 109.37800 122.01100 91.42500  1.000 136.49000 ? 502 LEU C CB    1 
ATOM   7423  C CG    . LEU C 1 257 ? 109.04100 123.47800 91.19400  1.000 136.49000 ? 502 LEU C CG    1 
ATOM   7424  C CD1   . LEU C 1 257 ? 107.55300 123.66900 91.02200  1.000 136.49000 ? 502 LEU C CD1   1 
ATOM   7425  C CD2   . LEU C 1 257 ? 109.56900 124.30900 92.34500  1.000 136.49000 ? 502 LEU C CD2   1 
ATOM   7426  N N     . GLU C 1 258 ? 110.82600 121.66600 88.80500  1.000 136.84000 ? 503 GLU C N     1 
ATOM   7427  C CA    . GLU C 1 258 ? 111.38800 122.42400 87.70000  1.000 136.84000 ? 503 GLU C CA    1 
ATOM   7428  C C     . GLU C 1 258 ? 112.29300 121.60900 86.79400  1.000 136.84000 ? 503 GLU C C     1 
ATOM   7429  O O     . GLU C 1 258 ? 112.11800 121.64300 85.57500  1.000 136.84000 ? 503 GLU C O     1 
ATOM   7430  C CB    . GLU C 1 258 ? 112.13800 123.64100 88.25500  1.000 136.84000 ? 503 GLU C CB    1 
ATOM   7431  C CG    . GLU C 1 258 ? 113.09000 123.31300 89.38400  1.000 136.84000 ? 503 GLU C CG    1 
ATOM   7432  C CD    . GLU C 1 258 ? 113.92400 124.47600 89.76300  1.000 136.84000 ? 503 GLU C CD    1 
ATOM   7433  O OE1   . GLU C 1 258 ? 113.75100 125.53500 89.12600  1.000 136.84000 ? 503 GLU C OE1   1 
ATOM   7434  O OE2   . GLU C 1 258 ? 114.75300 124.32000 90.68100  1.000 136.84000 ? 503 GLU C OE2   1 
ATOM   7435  N N     . LEU C 1 259 ? 113.24000 120.85600 87.34100  1.000 131.75000 ? 504 LEU C N     1 
ATOM   7436  C CA    . LEU C 1 259 ? 114.23900 120.18100 86.53500  1.000 131.75000 ? 504 LEU C CA    1 
ATOM   7437  C C     . LEU C 1 259 ? 113.77100 118.81300 86.07800  1.000 131.75000 ? 504 LEU C C     1 
ATOM   7438  O O     . LEU C 1 259 ? 114.58200 118.01200 85.60800  1.000 131.75000 ? 504 LEU C O     1 
ATOM   7439  C CB    . LEU C 1 259 ? 115.57400 120.10600 87.28500  1.000 131.75000 ? 504 LEU C CB    1 
ATOM   7440  C CG    . LEU C 1 259 ? 115.82000 119.30700 88.56100  1.000 131.75000 ? 504 LEU C CG    1 
ATOM   7441  C CD1   . LEU C 1 259 ? 117.30200 119.08400 88.69200  1.000 131.75000 ? 504 LEU C CD1   1 
ATOM   7442  C CD2   . LEU C 1 259 ? 115.33600 120.06200 89.77900  1.000 131.75000 ? 504 LEU C CD2   1 
ATOM   7443  N N     . SER C 1 260 ? 112.47200 118.55000 86.17700  1.000 133.27000 ? 505 SER C N     1 
ATOM   7444  C CA    . SER C 1 260 ? 111.79000 117.55500 85.35700  1.000 133.27000 ? 505 SER C CA    1 
ATOM   7445  C C     . SER C 1 260 ? 111.36700 118.16200 84.02100  1.000 133.27000 ? 505 SER C C     1 
ATOM   7446  O O     . SER C 1 260 ? 110.22100 118.05300 83.58900  1.000 133.27000 ? 505 SER C O     1 
ATOM   7447  C CB    . SER C 1 260 ? 110.59100 117.00400 86.11400  1.000 133.27000 ? 505 SER C CB    1 
ATOM   7448  O OG    . SER C 1 260 ? 109.64100 118.02500 86.36400  1.000 133.27000 ? 505 SER C OG    1 
ATOM   7449  N N     . ILE C 1 261 ? 112.32000 118.81000 83.35800  1.000 130.92000 ? 506 ILE C N     1 
ATOM   7450  C CA    . ILE C 1 261 ? 112.09000 119.51600 82.11000  1.000 130.92000 ? 506 ILE C CA    1 
ATOM   7451  C C     . ILE C 1 261 ? 113.17800 119.05200 81.15700  1.000 130.92000 ? 506 ILE C C     1 
ATOM   7452  O O     . ILE C 1 261 ? 113.08600 119.22500 79.93700  1.000 130.92000 ? 506 ILE C O     1 
ATOM   7453  C CB    . ILE C 1 261 ? 112.11600 121.04000 82.32900  1.000 130.92000 ? 506 ILE C CB    1 
ATOM   7454  C CG1   . ILE C 1 261 ? 111.53600 121.78400 81.13300  1.000 130.92000 ? 506 ILE C CG1   1 
ATOM   7455  C CG2   . ILE C 1 261 ? 113.52100 121.53000 82.61500  1.000 130.92000 ? 506 ILE C CG2   1 
ATOM   7456  C CD1   . ILE C 1 261 ? 111.32500 123.24200 81.39500  1.000 130.92000 ? 506 ILE C CD1   1 
ATOM   7457  N N     . TYR C 1 262 ? 114.19900 118.41600 81.71100  1.000 131.48000 ? 507 TYR C N     1 
ATOM   7458  C CA    . TYR C 1 262 ? 115.35500 118.00400 80.93900  1.000 131.48000 ? 507 TYR C CA    1 
ATOM   7459  C C     . TYR C 1 262 ? 115.17200 116.64400 80.29400  1.000 131.48000 ? 507 TYR C C     1 
ATOM   7460  O O     . TYR C 1 262 ? 116.06100 116.20300 79.56100  1.000 131.48000 ? 507 TYR C O     1 
ATOM   7461  C CB    . TYR C 1 262 ? 116.59100 117.99200 81.83600  1.000 131.48000 ? 507 TYR C CB    1 
ATOM   7462  C CG    . TYR C 1 262 ? 116.98200 119.36200 82.32200  1.000 131.48000 ? 507 TYR C CG    1 
ATOM   7463  C CD1   . TYR C 1 262 ? 117.72600 120.21200 81.51700  1.000 131.48000 ? 507 TYR C CD1   1 
ATOM   7464  C CD2   . TYR C 1 262 ? 116.59600 119.80900 83.57700  1.000 131.48000 ? 507 TYR C CD2   1 
ATOM   7465  C CE1   . TYR C 1 262 ? 118.08500 121.46300 81.94900  1.000 131.48000 ? 507 TYR C CE1   1 
ATOM   7466  C CE2   . TYR C 1 262 ? 116.95000 121.06100 84.01800  1.000 131.48000 ? 507 TYR C CE2   1 
ATOM   7467  C CZ    . TYR C 1 262 ? 117.69000 121.88400 83.19600  1.000 131.48000 ? 507 TYR C CZ    1 
ATOM   7468  O OH    . TYR C 1 262 ? 118.05400 123.13500 83.62500  1.000 131.48000 ? 507 TYR C OH    1 
ATOM   7469  N N     . GLU C 1 263 ? 114.05200 115.97600 80.55400  1.000 134.31000 ? 508 GLU C N     1 
ATOM   7470  C CA    . GLU C 1 263 ? 113.82300 114.64800 80.01100  1.000 134.31000 ? 508 GLU C CA    1 
ATOM   7471  C C     . GLU C 1 263 ? 113.65900 114.71500 78.50200  1.000 134.31000 ? 508 GLU C C     1 
ATOM   7472  O O     . GLU C 1 263 ? 112.82300 115.46200 77.98900  1.000 134.31000 ? 508 GLU C O     1 
ATOM   7473  C CB    . GLU C 1 263 ? 112.58600 114.02200 80.64100  1.000 134.31000 ? 508 GLU C CB    1 
ATOM   7474  C CG    . GLU C 1 263 ? 112.73000 113.69600 82.10900  1.000 134.31000 ? 508 GLU C CG    1 
ATOM   7475  C CD    . GLU C 1 263 ? 111.49200 113.02400 82.67000  1.000 134.31000 ? 508 GLU C CD    1 
ATOM   7476  O OE1   . GLU C 1 263 ? 110.48200 112.92900 81.94500  1.000 134.31000 ? 508 GLU C OE1   1 
ATOM   7477  O OE2   . GLU C 1 263 ? 111.53000 112.58000 83.83200  1.000 134.31000 ? 508 GLU C OE2   1 
ATOM   7478  N N     . GLY C 1 264 ? 114.47600 113.94000 77.79700  1.000 140.14000 ? 509 GLY C N     1 
ATOM   7479  C CA    . GLY C 1 264 ? 114.47000 113.91200 76.34500  1.000 140.14000 ? 509 GLY C CA    1 
ATOM   7480  C C     . GLY C 1 264 ? 115.78800 114.27700 75.70400  1.000 140.14000 ? 509 GLY C C     1 
ATOM   7481  O O     . GLY C 1 264 ? 115.88500 114.24100 74.47100  1.000 140.14000 ? 509 GLY C O     1 
ATOM   7482  N N     . ILE C 1 265 ? 116.81700 114.61200 76.47100  1.000 137.07000 ? 510 ILE C N     1 
ATOM   7483  C CA    . ILE C 1 265 ? 118.07400 115.06400 75.89100  1.000 137.07000 ? 510 ILE C CA    1 
ATOM   7484  C C     . ILE C 1 265 ? 119.01800 113.87100 75.77500  1.000 137.07000 ? 510 ILE C C     1 
ATOM   7485  O O     . ILE C 1 265 ? 118.94600 112.94500 76.59400  1.000 137.07000 ? 510 ILE C O     1 
ATOM   7486  C CB    . ILE C 1 265 ? 118.66400 116.21500 76.71800  1.000 137.07000 ? 510 ILE C CB    1 
ATOM   7487  C CG1   . ILE C 1 265 ? 119.00400 115.76800 78.13300  1.000 137.07000 ? 510 ILE C CG1   1 
ATOM   7488  C CG2   . ILE C 1 265 ? 117.67100 117.35600 76.79500  1.000 137.07000 ? 510 ILE C CG2   1 
ATOM   7489  C CD1   . ILE C 1 265 ? 119.76400 116.80500 78.91200  1.000 137.07000 ? 510 ILE C CD1   1 
ATOM   7490  N N     . PRO C 1 266 ? 119.87700 113.81500 74.75600  1.000 141.26000 ? 511 PRO C N     1 
ATOM   7491  C CA    . PRO C 1 266 ? 120.77300 112.66600 74.59100  1.000 141.26000 ? 511 PRO C CA    1 
ATOM   7492  C C     . PRO C 1 266 ? 121.97300 112.63300 75.52400  1.000 141.26000 ? 511 PRO C C     1 
ATOM   7493  O O     . PRO C 1 266 ? 122.81300 111.74400 75.36900  1.000 141.26000 ? 511 PRO C O     1 
ATOM   7494  C CB    . PRO C 1 266 ? 121.23400 112.79600 73.13100  1.000 141.26000 ? 511 PRO C CB    1 
ATOM   7495  C CG    . PRO C 1 266 ? 121.06700 114.21400 72.80400  1.000 141.26000 ? 511 PRO C CG    1 
ATOM   7496  C CD    . PRO C 1 266 ? 119.84400 114.64800 73.54500  1.000 141.26000 ? 511 PRO C CD    1 
ATOM   7497  N N     . HIS C 1 267 ? 122.11300 113.55400 76.48100  1.000 131.80000 ? 512 HIS C N     1 
ATOM   7498  C CA    . HIS C 1 267 ? 123.00500 113.31300 77.61700  1.000 131.80000 ? 512 HIS C CA    1 
ATOM   7499  C C     . HIS C 1 267 ? 122.19200 113.47800 78.89800  1.000 131.80000 ? 512 HIS C C     1 
ATOM   7500  O O     . HIS C 1 267 ? 122.11100 114.53900 79.51100  1.000 131.80000 ? 512 HIS C O     1 
ATOM   7501  C CB    . HIS C 1 267 ? 124.28800 114.17600 77.58600  1.000 131.80000 ? 512 HIS C CB    1 
ATOM   7502  C CG    . HIS C 1 267 ? 124.06700 115.65200 77.52600  1.000 131.80000 ? 512 HIS C CG    1 
ATOM   7503  N ND1   . HIS C 1 267 ? 123.80400 116.32300 76.35400  1.000 131.80000 ? 512 HIS C ND1   1 
ATOM   7504  C CD2   . HIS C 1 267 ? 124.12200 116.59300 78.49600  1.000 131.80000 ? 512 HIS C CD2   1 
ATOM   7505  C CE1   . HIS C 1 267 ? 123.68300 117.61200 76.61100  1.000 131.80000 ? 512 HIS C CE1   1 
ATOM   7506  N NE2   . HIS C 1 267 ? 123.86300 117.80100 77.90300  1.000 131.80000 ? 512 HIS C NE2   1 
ATOM   7507  N N     . LEU C 1 268 ? 121.56400 112.38100 79.29200  1.000 134.63000 ? 513 LEU C N     1 
ATOM   7508  C CA    . LEU C 1 268 ? 120.90500 112.27700 80.58500  1.000 134.63000 ? 513 LEU C CA    1 
ATOM   7509  C C     . LEU C 1 268 ? 120.81900 110.78300 80.84500  1.000 134.63000 ? 513 LEU C C     1 
ATOM   7510  O O     . LEU C 1 268 ? 120.04800 110.09200 80.17500  1.000 134.63000 ? 513 LEU C O     1 
ATOM   7511  C CB    . LEU C 1 268 ? 119.52900 112.92300 80.56000  1.000 134.63000 ? 513 LEU C CB    1 
ATOM   7512  C CG    . LEU C 1 268 ? 118.84400 113.01500 81.91400  1.000 134.63000 ? 513 LEU C CG    1 
ATOM   7513  C CD1   . LEU C 1 268 ? 119.66000 113.91200 82.79600  1.000 134.63000 ? 513 LEU C CD1   1 
ATOM   7514  C CD2   . LEU C 1 268 ? 117.42700 113.53300 81.77800  1.000 134.63000 ? 513 LEU C CD2   1 
ATOM   7515  N N     . LEU C 1 269 ? 121.62200 110.28400 81.77800  1.000 140.35000 ? 514 LEU C N     1 
ATOM   7516  C CA    . LEU C 1 269 ? 121.83100 108.84600 81.88800  1.000 140.35000 ? 514 LEU C CA    1 
ATOM   7517  C C     . LEU C 1 269 ? 120.63700 108.11500 82.48200  1.000 140.35000 ? 514 LEU C C     1 
ATOM   7518  O O     . LEU C 1 269 ? 120.48200 106.91400 82.24600  1.000 140.35000 ? 514 LEU C O     1 
ATOM   7519  C CB    . LEU C 1 269 ? 123.09600 108.58700 82.70900  1.000 140.35000 ? 514 LEU C CB    1 
ATOM   7520  C CG    . LEU C 1 269 ? 123.85700 107.25900 82.68500  1.000 140.35000 ? 514 LEU C CG    1 
ATOM   7521  C CD1   . LEU C 1 269 ? 123.32600 106.21500 83.65500  1.000 140.35000 ? 514 LEU C CD1   1 
ATOM   7522  C CD2   . LEU C 1 269 ? 123.85300 106.72000 81.26800  1.000 140.35000 ? 514 LEU C CD2   1 
ATOM   7523  N N     . CYS C 1 270 ? 119.77700 108.80900 83.21100  1.000 142.45000 ? 515 CYS C N     1 
ATOM   7524  C CA    . CYS C 1 270 ? 118.60200 108.20200 83.81200  1.000 142.45000 ? 515 CYS C CA    1 
ATOM   7525  C C     . CYS C 1 270 ? 117.48700 109.23100 83.77500  1.000 142.45000 ? 515 CYS C C     1 
ATOM   7526  O O     . CYS C 1 270 ? 117.75400 110.42700 83.62200  1.000 142.45000 ? 515 CYS C O     1 
ATOM   7527  C CB    . CYS C 1 270 ? 118.89600 107.76100 85.25200  1.000 142.45000 ? 515 CYS C CB    1 
ATOM   7528  S SG    . CYS C 1 270 ? 119.16200 109.13100 86.37100  1.000 142.45000 ? 515 CYS C SG    1 
ATOM   7529  N N     . PRO C 1 271 ? 116.22400 108.81300 83.93400  1.000 142.22000 ? 516 PRO C N     1 
ATOM   7530  C CA    . PRO C 1 271 ? 115.15900 109.81000 84.10100  1.000 142.22000 ? 516 PRO C CA    1 
ATOM   7531  C C     . PRO C 1 271 ? 115.19800 110.47700 85.46600  1.000 142.22000 ? 516 PRO C C     1 
ATOM   7532  O O     . PRO C 1 271 ? 116.15400 110.29700 86.22800  1.000 142.22000 ? 516 PRO C O     1 
ATOM   7533  C CB    . PRO C 1 271 ? 113.87800 108.99400 83.91200  1.000 142.22000 ? 516 PRO C CB    1 
ATOM   7534  C CG    . PRO C 1 271 ? 114.25600 107.62500 84.26800  1.000 142.22000 ? 516 PRO C CG    1 
ATOM   7535  C CD    . PRO C 1 271 ? 115.66200 107.45900 83.79100  1.000 142.22000 ? 516 PRO C CD    1 
ATOM   7536  N N     . VAL C 1 272 ? 114.17200 111.27000 85.77400  1.000 142.40000 ? 517 VAL C N     1 
ATOM   7537  C CA    . VAL C 1 272 ? 114.19200 112.07400 86.98800  1.000 142.40000 ? 517 VAL C CA    1 
ATOM   7538  C C     . VAL C 1 272 ? 114.10200 111.16100 88.20300  1.000 142.40000 ? 517 VAL C C     1 
ATOM   7539  O O     . VAL C 1 272 ? 113.47800 110.09200 88.16300  1.000 142.40000 ? 517 VAL C O     1 
ATOM   7540  C CB    . VAL C 1 272 ? 113.07100 113.12800 86.96100  1.000 142.40000 ? 517 VAL C CB    1 
ATOM   7541  C CG1   . VAL C 1 272 ? 111.68100 112.50800 87.10600  1.000 142.40000 ? 517 VAL C CG1   1 
ATOM   7542  C CG2   . VAL C 1 272 ? 113.30900 114.19900 88.00700  1.000 142.40000 ? 517 VAL C CG2   1 
ATOM   7543  N N     . VAL C 1 273 ? 114.82900 111.51600 89.24200  1.000 143.75000 ? 518 VAL C N     1 
ATOM   7544  C CA    . VAL C 1 273 ? 114.83800 110.75100 90.47500  1.000 143.75000 ? 518 VAL C CA    1 
ATOM   7545  C C     . VAL C 1 273 ? 114.06500 111.55200 91.50900  1.000 143.75000 ? 518 VAL C C     1 
ATOM   7546  O O     . VAL C 1 273 ? 114.25000 112.76600 91.62700  1.000 143.75000 ? 518 VAL C O     1 
ATOM   7547  C CB    . VAL C 1 273 ? 116.28000 110.46700 90.92600  1.000 143.75000 ? 518 VAL C CB    1 
ATOM   7548  C CG1   . VAL C 1 273 ? 116.30400 109.67700 92.21900  1.000 143.75000 ? 518 VAL C CG1   1 
ATOM   7549  C CG2   . VAL C 1 273 ? 117.02200 109.71900 89.83300  1.000 143.75000 ? 518 VAL C CG2   1 
ATOM   7550  N N     . THR C 1 274 ? 113.16500 110.88600 92.22500  1.000 140.80000 ? 519 THR C N     1 
ATOM   7551  C CA    . THR C 1 274 ? 112.27200 111.56000 93.15200  1.000 140.80000 ? 519 THR C CA    1 
ATOM   7552  C C     . THR C 1 274 ? 112.55300 111.19100 94.60100  1.000 140.80000 ? 519 THR C C     1 
ATOM   7553  O O     . THR C 1 274 ? 112.85100 112.06400 95.41800  1.000 140.80000 ? 519 THR C O     1 
ATOM   7554  C CB    . THR C 1 274 ? 110.82800 111.21700 92.79300  1.000 140.80000 ? 519 THR C CB    1 
ATOM   7555  O OG1   . THR C 1 274 ? 110.64800 109.80000 92.88100  1.000 140.80000 ? 519 THR C OG1   1 
ATOM   7556  C CG2   . THR C 1 274 ? 110.50900 111.67200 91.38500  1.000 140.80000 ? 519 THR C CG2   1 
ATOM   7557  N N     . ASP C 1 275 ? 112.47700 109.91000 94.93500  1.000 148.34000 ? 520 ASP C N     1 
ATOM   7558  C CA    . ASP C 1 275 ? 112.62600 109.46900 96.31100  1.000 148.34000 ? 520 ASP C CA    1 
ATOM   7559  C C     . ASP C 1 275 ? 114.08800 109.50400 96.72000  1.000 148.34000 ? 520 ASP C C     1 
ATOM   7560  O O     . ASP C 1 275 ? 114.98900 109.30800 95.90300  1.000 148.34000 ? 520 ASP C O     1 
ATOM   7561  C CB    . ASP C 1 275 ? 112.07800 108.05100 96.47400  1.000 148.34000 ? 520 ASP C CB    1 
ATOM   7562  C CG    . ASP C 1 275 ? 111.95500 107.61500 97.92400  1.000 148.34000 ? 520 ASP C CG    1 
ATOM   7563  O OD1   . ASP C 1 275 ? 112.22300 108.41600 98.84700  1.000 148.34000 ? 520 ASP C OD1   1 
ATOM   7564  O OD2   . ASP C 1 275 ? 111.59700 106.44100 98.13900  1.000 148.34000 ? 520 ASP C OD2   1 
ATOM   7565  N N     . MET C 1 276 ? 114.31600 109.74800 98.01000  1.000 150.74000 ? 521 MET C N     1 
ATOM   7566  C CA    . MET C 1 276 ? 115.66600 109.62500 98.54300  1.000 150.74000 ? 521 MET C CA    1 
ATOM   7567  C C     . MET C 1 276 ? 116.08500 108.16500 98.62400  1.000 150.74000 ? 521 MET C C     1 
ATOM   7568  O O     . MET C 1 276 ? 117.26200 107.83600 98.42700  1.000 150.74000 ? 521 MET C O     1 
ATOM   7569  C CB    . MET C 1 276 ? 115.74900 110.28400 99.91200  1.000 150.74000 ? 521 MET C CB    1 
ATOM   7570  C CG    . MET C 1 276 ? 115.32200 111.70300 99.85000  1.000 150.74000 ? 521 MET C CG    1 
ATOM   7571  S SD    . MET C 1 276 ? 116.21200 112.53000 98.53500  1.000 150.74000 ? 521 MET C SD    1 
ATOM   7572  C CE    . MET C 1 276 ? 115.30700 114.04900 98.51700  1.000 150.74000 ? 521 MET C CE    1 
ATOM   7573  N N     . LYS C 1 277 ? 115.13000 107.27700 98.90400  1.000 149.86000 ? 522 LYS C N     1 
ATOM   7574  C CA    . LYS C 1 277 ? 115.41800 105.85100 98.87300  1.000 149.86000 ? 522 LYS C CA    1 
ATOM   7575  C C     . LYS C 1 277 ? 115.63100 105.37400 97.44700  1.000 149.86000 ? 522 LYS C C     1 
ATOM   7576  O O     . LYS C 1 277 ? 116.32800 104.38000 97.22300  1.000 149.86000 ? 522 LYS C O     1 
ATOM   7577  C CB    . LYS C 1 277 ? 114.29100 105.06600 99.54400  1.000 149.86000 ? 522 LYS C CB    1 
ATOM   7578  C CG    . LYS C 1 277 ? 114.26800 105.14600 101.06900 1.000 149.86000 ? 522 LYS C CG    1 
ATOM   7579  C CD    . LYS C 1 277 ? 113.42900 106.32000 101.56400 1.000 149.86000 ? 522 LYS C CD    1 
ATOM   7580  C CE    . LYS C 1 277 ? 113.18000 106.24900 103.05800 1.000 149.86000 ? 522 LYS C CE    1 
ATOM   7581  N NZ    . LYS C 1 277 ? 114.43400 106.38300 103.83500 1.000 149.86000 ? 522 LYS C NZ    1 
ATOM   7582  N N     . GLU C 1 278 ? 115.04700 106.06700 96.47300  1.000 145.44000 ? 523 GLU C N     1 
ATOM   7583  C CA    . GLU C 1 278 ? 115.42300 105.81400 95.09200  1.000 145.44000 ? 523 GLU C CA    1 
ATOM   7584  C C     . GLU C 1 278 ? 116.79300 106.40500 94.79900  1.000 145.44000 ? 523 GLU C C     1 
ATOM   7585  O O     . GLU C 1 278 ? 117.59500 105.80500 94.07400  1.000 145.44000 ? 523 GLU C O     1 
ATOM   7586  C CB    . GLU C 1 278 ? 114.37800 106.39800 94.14500  1.000 145.44000 ? 523 GLU C CB    1 
ATOM   7587  C CG    . GLU C 1 278 ? 114.52500 105.95700 92.70900  1.000 145.44000 ? 523 GLU C CG    1 
ATOM   7588  C CD    . GLU C 1 278 ? 114.11300 104.51500 92.50900  1.000 145.44000 ? 523 GLU C CD    1 
ATOM   7589  O OE1   . GLU C 1 278 ? 113.25500 104.02600 93.27300  1.000 145.44000 ? 523 GLU C OE1   1 
ATOM   7590  O OE2   . GLU C 1 278 ? 114.64300 103.85800 91.59900  1.000 145.44000 ? 523 GLU C OE2   1 
ATOM   7591  N N     . ALA C 1 279 ? 117.08600 107.57200 95.37600  1.000 140.63000 ? 524 ALA C N     1 
ATOM   7592  C CA    . ALA C 1 279 ? 118.32300 108.28300 95.08000  1.000 140.63000 ? 524 ALA C CA    1 
ATOM   7593  C C     . ALA C 1 279 ? 119.54800 107.60100 95.66100  1.000 140.63000 ? 524 ALA C C     1 
ATOM   7594  O O     . ALA C 1 279 ? 120.65300 107.80900 95.15000  1.000 140.63000 ? 524 ALA C O     1 
ATOM   7595  C CB    . ALA C 1 279 ? 118.25000 109.70900 95.60900  1.000 140.63000 ? 524 ALA C CB    1 
ATOM   7596  N N     . ALA C 1 280 ? 119.38200 106.81300 96.72400  1.000 140.66000 ? 525 ALA C N     1 
ATOM   7597  C CA    . ALA C 1 280 ? 120.51500 106.07800 97.27300  1.000 140.66000 ? 525 ALA C CA    1 
ATOM   7598  C C     . ALA C 1 280 ? 121.01900 105.02700 96.29600  1.000 140.66000 ? 525 ALA C C     1 
ATOM   7599  O O     . ALA C 1 280 ? 122.22200 104.74400 96.26300  1.000 140.66000 ? 525 ALA C O     1 
ATOM   7600  C CB    . ALA C 1 280 ? 120.13400 105.43300 98.60400  1.000 140.66000 ? 525 ALA C CB    1 
ATOM   7601  N N     . ASN C 1 281 ? 120.12600 104.47100 95.47200  1.000 136.41000 ? 526 ASN C N     1 
ATOM   7602  C CA    . ASN C 1 281 ? 120.55700 103.55900 94.42000  1.000 136.41000 ? 526 ASN C CA    1 
ATOM   7603  C C     . ASN C 1 281 ? 121.37900 104.28400 93.36700  1.000 136.41000 ? 526 ASN C C     1 
ATOM   7604  O O     . ASN C 1 281 ? 122.36900 103.74000 92.86900  1.000 136.41000 ? 526 ASN C O     1 
ATOM   7605  C CB    . ASN C 1 281 ? 119.35000 102.87200 93.78600  1.000 136.41000 ? 526 ASN C CB    1 
ATOM   7606  C CG    . ASN C 1 281 ? 118.74100 101.82300 94.69100  1.000 136.41000 ? 526 ASN C CG    1 
ATOM   7607  O OD1   . ASN C 1 281 ? 119.45400 101.07300 95.35200  1.000 136.41000 ? 526 ASN C OD1   1 
ATOM   7608  N ND2   . ASN C 1 281 ? 117.41800 101.75700 94.71700  1.000 136.41000 ? 526 ASN C ND2   1 
ATOM   7609  N N     . ALA C 1 282 ? 121.02000 105.52900 93.05100  1.000 130.99000 ? 527 ALA C N     1 
ATOM   7610  C CA    . ALA C 1 282 ? 121.80900 106.29000 92.08900  1.000 130.99000 ? 527 ALA C CA    1 
ATOM   7611  C C     . ALA C 1 282 ? 123.15400 106.70000 92.67400  1.000 130.99000 ? 527 ALA C C     1 
ATOM   7612  O O     . ALA C 1 282 ? 124.17100 106.70800 91.96800  1.000 130.99000 ? 527 ALA C O     1 
ATOM   7613  C CB    . ALA C 1 282 ? 121.03100 107.51600 91.62400  1.000 130.99000 ? 527 ALA C CB    1 
ATOM   7614  N N     . LEU C 1 283 ? 123.18200 107.02400 93.96600  1.000 128.83000 ? 528 LEU C N     1 
ATOM   7615  C CA    . LEU C 1 283 ? 124.44200 107.36800 94.61300  1.000 128.83000 ? 528 LEU C CA    1 
ATOM   7616  C C     . LEU C 1 283 ? 125.37300 106.16500 94.68900  1.000 128.83000 ? 528 LEU C C     1 
ATOM   7617  O O     . LEU C 1 283 ? 126.57500 106.28800 94.43000  1.000 128.83000 ? 528 LEU C O     1 
ATOM   7618  C CB    . LEU C 1 283 ? 124.18200 107.92900 96.00700  1.000 128.83000 ? 528 LEU C CB    1 
ATOM   7619  C CG    . LEU C 1 283 ? 123.51000 109.29600 96.03900  1.000 128.83000 ? 528 LEU C CG    1 
ATOM   7620  C CD1   . LEU C 1 283 ? 123.19900 109.69700 97.46500  1.000 128.83000 ? 528 LEU C CD1   1 
ATOM   7621  C CD2   . LEU C 1 283 ? 124.40300 110.31700 95.37500  1.000 128.83000 ? 528 LEU C CD2   1 
ATOM   7622  N N     . ARG C 1 284 ? 124.83300 104.99200 95.01700  1.000 135.08000 ? 529 ARG C N     1 
ATOM   7623  C CA    . ARG C 1 284 ? 125.65500 103.79200 95.01900  1.000 135.08000 ? 529 ARG C CA    1 
ATOM   7624  C C     . ARG C 1 284 ? 126.05900 103.38900 93.60700  1.000 135.08000 ? 529 ARG C C     1 
ATOM   7625  O O     . ARG C 1 284 ? 127.13800 102.81500 93.42000  1.000 135.08000 ? 529 ARG C O     1 
ATOM   7626  C CB    . ARG C 1 284 ? 124.92300 102.65700 95.73400  1.000 135.08000 ? 529 ARG C CB    1 
ATOM   7627  C CG    . ARG C 1 284 ? 124.86000 102.85600 97.24400  1.000 135.08000 ? 529 ARG C CG    1 
ATOM   7628  C CD    . ARG C 1 284 ? 124.30900 101.64300 97.98000  1.000 135.08000 ? 529 ARG C CD    1 
ATOM   7629  N NE    . ARG C 1 284 ? 122.88900 101.43800 97.72500  1.000 135.08000 ? 529 ARG C NE    1 
ATOM   7630  C CZ    . ARG C 1 284 ? 121.91900 102.00700 98.43000  1.000 135.08000 ? 529 ARG C CZ    1 
ATOM   7631  N NH1   . ARG C 1 284 ? 122.21500 102.82000 99.43400  1.000 135.08000 ? 529 ARG C NH1   1 
ATOM   7632  N NH2   . ARG C 1 284 ? 120.65200 101.76700 98.13200  1.000 135.08000 ? 529 ARG C NH2   1 
ATOM   7633  N N     . TRP C 1 285 ? 125.23600 103.71700 92.60500  1.000 125.28000 ? 530 TRP C N     1 
ATOM   7634  C CA    . TRP C 1 285 ? 125.65700 103.54000 91.22200  1.000 125.28000 ? 530 TRP C CA    1 
ATOM   7635  C C     . TRP C 1 285 ? 126.84700 104.42600 90.89900  1.000 125.28000 ? 530 TRP C C     1 
ATOM   7636  O O     . TRP C 1 285 ? 127.76700 104.00700 90.19100  1.000 125.28000 ? 530 TRP C O     1 
ATOM   7637  C CB    . TRP C 1 285 ? 124.52000 103.86300 90.26100  1.000 125.28000 ? 530 TRP C CB    1 
ATOM   7638  C CG    . TRP C 1 285 ? 124.92500 103.61700 88.86000  1.000 125.28000 ? 530 TRP C CG    1 
ATOM   7639  C CD1   . TRP C 1 285 ? 124.98400 102.41700 88.23000  1.000 125.28000 ? 530 TRP C CD1   1 
ATOM   7640  C CD2   . TRP C 1 285 ? 125.45000 104.57600 87.94400  1.000 125.28000 ? 530 TRP C CD2   1 
ATOM   7641  N NE1   . TRP C 1 285 ? 125.45500 102.57500 86.95400  1.000 125.28000 ? 530 TRP C NE1   1 
ATOM   7642  C CE2   . TRP C 1 285 ? 125.75800 103.89400 86.75700  1.000 125.28000 ? 530 TRP C CE2   1 
ATOM   7643  C CE3   . TRP C 1 285 ? 125.67800 105.95000 88.01000  1.000 125.28000 ? 530 TRP C CE3   1 
ATOM   7644  C CZ2   . TRP C 1 285 ? 126.27200 104.53800 85.64200  1.000 125.28000 ? 530 TRP C CZ2   1 
ATOM   7645  C CZ3   . TRP C 1 285 ? 126.18400 106.58900 86.90400  1.000 125.28000 ? 530 TRP C CZ3   1 
ATOM   7646  C CH2   . TRP C 1 285 ? 126.47700 105.88400 85.73500  1.000 125.28000 ? 530 TRP C CH2   1 
ATOM   7647  N N     . SER C 1 286 ? 126.83600 105.65900 91.40000  1.000 129.89000 ? 531 SER C N     1 
ATOM   7648  C CA    . SER C 1 286 ? 127.94900 106.56800 91.15200  1.000 129.89000 ? 531 SER C CA    1 
ATOM   7649  C C     . SER C 1 286 ? 129.21500 106.10200 91.85900  1.000 129.89000 ? 531 SER C C     1 
ATOM   7650  O O     . SER C 1 286 ? 130.31500 106.22100 91.30900  1.000 129.89000 ? 531 SER C O     1 
ATOM   7651  C CB    . SER C 1 286 ? 127.58000 107.97700 91.59800  1.000 129.89000 ? 531 SER C CB    1 
ATOM   7652  O OG    . SER C 1 286 ? 126.49100 108.46300 90.84200  1.000 129.89000 ? 531 SER C OG    1 
ATOM   7653  N N     . VAL C 1 287 ? 129.07000 105.56900 93.07600  1.000 130.82000 ? 532 VAL C N     1 
ATOM   7654  C CA    . VAL C 1 287 ? 130.21400 105.02100 93.80700  1.000 130.82000 ? 532 VAL C CA    1 
ATOM   7655  C C     . VAL C 1 287 ? 130.79800 103.82800 93.06000  1.000 130.82000 ? 532 VAL C C     1 
ATOM   7656  O O     . VAL C 1 287 ? 132.02000 103.71100 92.89800  1.000 130.82000 ? 532 VAL C O     1 
ATOM   7657  C CB    . VAL C 1 287 ? 129.80300 104.64100 95.24300  1.000 130.82000 ? 532 VAL C CB    1 
ATOM   7658  C CG1   . VAL C 1 287 ? 130.93700 103.93200 95.96600  1.000 130.82000 ? 532 VAL C CG1   1 
ATOM   7659  C CG2   . VAL C 1 287 ? 129.39700 105.86300 96.02200  1.000 130.82000 ? 532 VAL C CG2   1 
ATOM   7660  N N     . ALA C 1 288 ? 129.92700 102.94700 92.55700  1.000 131.33000 ? 533 ALA C N     1 
ATOM   7661  C CA    . ALA C 1 288 ? 130.38800 101.78500 91.80600  1.000 131.33000 ? 533 ALA C CA    1 
ATOM   7662  C C     . ALA C 1 288 ? 131.03300 102.19400 90.48900  1.000 131.33000 ? 533 ALA C C     1 
ATOM   7663  O O     . ALA C 1 288 ? 132.02700 101.59000 90.06300  1.000 131.33000 ? 533 ALA C O     1 
ATOM   7664  C CB    . ALA C 1 288 ? 129.22200 100.83200 91.55600  1.000 131.33000 ? 533 ALA C CB    1 
ATOM   7665  N N     . GLU C 1 289 ? 130.50400 103.23900 89.85300  1.000 131.34000 ? 534 GLU C N     1 
ATOM   7666  C CA    . GLU C 1 289 ? 131.07200 103.70700 88.59700  1.000 131.34000 ? 534 GLU C CA    1 
ATOM   7667  C C     . GLU C 1 289 ? 132.42300 104.36500 88.82200  1.000 131.34000 ? 534 GLU C C     1 
ATOM   7668  O O     . GLU C 1 289 ? 133.34200 104.19300 88.01800  1.000 131.34000 ? 534 GLU C O     1 
ATOM   7669  C CB    . GLU C 1 289 ? 130.10600 104.67000 87.91900  1.000 131.34000 ? 534 GLU C CB    1 
ATOM   7670  C CG    . GLU C 1 289 ? 130.55000 105.12100 86.54600  1.000 131.34000 ? 534 GLU C CG    1 
ATOM   7671  C CD    . GLU C 1 289 ? 130.52100 104.00700 85.52500  1.000 131.34000 ? 534 GLU C CD    1 
ATOM   7672  O OE1   . GLU C 1 289 ? 129.72100 103.06000 85.68600  1.000 131.34000 ? 534 GLU C OE1   1 
ATOM   7673  O OE2   . GLU C 1 289 ? 131.29600 104.08500 84.55100  1.000 131.34000 ? 534 GLU C OE2   1 
ATOM   7674  N N     . MET C 1 290 ? 132.56900 105.08500 89.93400  1.000 134.21000 ? 535 MET C N     1 
ATOM   7675  C CA    . MET C 1 290 ? 133.85800 105.64400 90.32500  1.000 134.21000 ? 535 MET C CA    1 
ATOM   7676  C C     . MET C 1 290 ? 134.86800 104.55100 90.63400  1.000 134.21000 ? 535 MET C C     1 
ATOM   7677  O O     . MET C 1 290 ? 136.05500 104.67800 90.30700  1.000 134.21000 ? 535 MET C O     1 
ATOM   7678  C CB    . MET C 1 290 ? 133.65700 106.53900 91.54100  1.000 134.21000 ? 535 MET C CB    1 
ATOM   7679  C CG    . MET C 1 290 ? 134.88800 107.21100 92.07900  1.000 134.21000 ? 535 MET C CG    1 
ATOM   7680  S SD    . MET C 1 290 ? 134.36800 108.13200 93.52700  1.000 134.21000 ? 535 MET C SD    1 
ATOM   7681  C CE    . MET C 1 290 ? 134.04600 106.78200 94.65100  1.000 134.21000 ? 535 MET C CE    1 
ATOM   7682  N N     . GLU C 1 291 ? 134.41000 103.46400 91.25200  1.000 141.91000 ? 536 GLU C N     1 
ATOM   7683  C CA    . GLU C 1 291 ? 135.32000 102.38200 91.60100  1.000 141.91000 ? 536 GLU C CA    1 
ATOM   7684  C C     . GLU C 1 291 ? 135.81100 101.65700 90.35700  1.000 141.91000 ? 536 GLU C C     1 
ATOM   7685  O O     . GLU C 1 291 ? 137.01600 101.42800 90.20500  1.000 141.91000 ? 536 GLU C O     1 
ATOM   7686  C CB    . GLU C 1 291 ? 134.64000 101.41100 92.56400  1.000 141.91000 ? 536 GLU C CB    1 
ATOM   7687  C CG    . GLU C 1 291 ? 135.54900 100.29100 93.05700  1.000 141.91000 ? 536 GLU C CG    1 
ATOM   7688  C CD    . GLU C 1 291 ? 136.67500 100.78600 93.95100  1.000 141.91000 ? 536 GLU C CD    1 
ATOM   7689  O OE1   . GLU C 1 291 ? 136.49700 101.81900 94.62700  1.000 141.91000 ? 536 GLU C OE1   1 
ATOM   7690  O OE2   . GLU C 1 291 ? 137.74300 100.13900 93.97700  1.000 141.91000 ? 536 GLU C OE2   1 
ATOM   7691  N N     . ARG C 1 292 ? 134.89900 101.31400 89.44000  1.000 135.94000 ? 537 ARG C N     1 
ATOM   7692  C CA    . ARG C 1 292 ? 135.34500 100.68600 88.19900  1.000 135.94000 ? 537 ARG C CA    1 
ATOM   7693  C C     . ARG C 1 292 ? 136.11400 101.67000 87.33100  1.000 135.94000 ? 537 ARG C C     1 
ATOM   7694  O O     . ARG C 1 292 ? 136.96900 101.25800 86.54300  1.000 135.94000 ? 537 ARG C O     1 
ATOM   7695  C CB    . ARG C 1 292 ? 134.16600 100.08300 87.42600  1.000 135.94000 ? 537 ARG C CB    1 
ATOM   7696  C CG    . ARG C 1 292 ? 133.04400 101.03100 87.00300  1.000 135.94000 ? 537 ARG C CG    1 
ATOM   7697  C CD    . ARG C 1 292 ? 133.19700 101.56000 85.57900  1.000 135.94000 ? 537 ARG C CD    1 
ATOM   7698  N NE    . ARG C 1 292 ? 133.27300 100.48900 84.59400  1.000 135.94000 ? 537 ARG C NE    1 
ATOM   7699  C CZ    . ARG C 1 292 ? 134.06000 100.52400 83.52700  1.000 135.94000 ? 537 ARG C CZ    1 
ATOM   7700  N NH1   . ARG C 1 292 ? 134.83600 101.57400 83.31200  1.000 135.94000 ? 537 ARG C NH1   1 
ATOM   7701  N NH2   . ARG C 1 292 ? 134.07500 99.51000  82.67800  1.000 135.94000 ? 537 ARG C NH2   1 
ATOM   7702  N N     . ARG C 1 293 ? 135.83600 102.96400 87.48700  1.000 138.92000 ? 538 ARG C N     1 
ATOM   7703  C CA    . ARG C 1 293 ? 136.62100 103.99500 86.83100  1.000 138.92000 ? 538 ARG C CA    1 
ATOM   7704  C C     . ARG C 1 293 ? 138.06600 103.96600 87.30800  1.000 138.92000 ? 538 ARG C C     1 
ATOM   7705  O O     . ARG C 1 293 ? 138.99500 104.01100 86.49500  1.000 138.92000 ? 538 ARG C O     1 
ATOM   7706  C CB    . ARG C 1 293 ? 135.98200 105.35600 87.10500  1.000 138.92000 ? 538 ARG C CB    1 
ATOM   7707  C CG    . ARG C 1 293 ? 136.62200 106.52100 86.39300  1.000 138.92000 ? 538 ARG C CG    1 
ATOM   7708  C CD    . ARG C 1 293 ? 136.33600 106.46700 84.91100  1.000 138.92000 ? 538 ARG C CD    1 
ATOM   7709  N NE    . ARG C 1 293 ? 134.90400 106.52800 84.64100  1.000 138.92000 ? 538 ARG C NE    1 
ATOM   7710  C CZ    . ARG C 1 293 ? 134.21000 107.65500 84.52800  1.000 138.92000 ? 538 ARG C CZ    1 
ATOM   7711  N NH1   . ARG C 1 293 ? 134.81400 108.82800 84.65300  1.000 138.92000 ? 538 ARG C NH1   1 
ATOM   7712  N NH2   . ARG C 1 293 ? 132.91000 107.60900 84.28100  1.000 138.92000 ? 538 ARG C NH2   1 
ATOM   7713  N N     . TYR C 1 294 ? 138.27500 103.85000 88.62000  1.000 139.76000 ? 539 TYR C N     1 
ATOM   7714  C CA    . TYR C 1 294 ? 139.64000 103.76900 89.13000  1.000 139.76000 ? 539 TYR C CA    1 
ATOM   7715  C C     . TYR C 1 294 ? 140.30900 102.45300 88.77400  1.000 139.76000 ? 539 TYR C C     1 
ATOM   7716  O O     . TYR C 1 294 ? 141.52100 102.43500 88.53200  1.000 139.76000 ? 539 TYR C O     1 
ATOM   7717  C CB    . TYR C 1 294 ? 139.67200 103.97500 90.64000  1.000 139.76000 ? 539 TYR C CB    1 
ATOM   7718  C CG    . TYR C 1 294 ? 139.55100 105.41600 91.03700  1.000 139.76000 ? 539 TYR C CG    1 
ATOM   7719  C CD1   . TYR C 1 294 ? 139.68900 106.42400 90.09100  1.000 139.76000 ? 539 TYR C CD1   1 
ATOM   7720  C CD2   . TYR C 1 294 ? 139.33100 105.77800 92.35900  1.000 139.76000 ? 539 TYR C CD2   1 
ATOM   7721  C CE1   . TYR C 1 294 ? 139.58400 107.75200 90.44200  1.000 139.76000 ? 539 TYR C CE1   1 
ATOM   7722  C CE2   . TYR C 1 294 ? 139.22600 107.11100 92.72600  1.000 139.76000 ? 539 TYR C CE2   1 
ATOM   7723  C CZ    . TYR C 1 294 ? 139.35500 108.09300 91.76200  1.000 139.76000 ? 539 TYR C CZ    1 
ATOM   7724  O OH    . TYR C 1 294 ? 139.25000 109.42000 92.12000  1.000 139.76000 ? 539 TYR C OH    1 
ATOM   7725  N N     . ARG C 1 295 ? 139.54800 101.35400 88.74900  1.000 139.64000 ? 540 ARG C N     1 
ATOM   7726  C CA    . ARG C 1 295 ? 140.09500 100.07800 88.29600  1.000 139.64000 ? 540 ARG C CA    1 
ATOM   7727  C C     . ARG C 1 295 ? 140.55800 100.17700 86.85200  1.000 139.64000 ? 540 ARG C C     1 
ATOM   7728  O O     . ARG C 1 295 ? 141.65700 99.72200  86.50700  1.000 139.64000 ? 540 ARG C O     1 
ATOM   7729  C CB    . ARG C 1 295 ? 139.04800 98.97400  88.44300  1.000 139.64000 ? 540 ARG C CB    1 
ATOM   7730  C CG    . ARG C 1 295 ? 138.67600 98.65300  89.87900  1.000 139.64000 ? 540 ARG C CG    1 
ATOM   7731  C CD    . ARG C 1 295 ? 137.44200 97.75700  89.96200  1.000 139.64000 ? 540 ARG C CD    1 
ATOM   7732  N NE    . ARG C 1 295 ? 137.68300 96.37900  89.55000  1.000 139.64000 ? 540 ARG C NE    1 
ATOM   7733  C CZ    . ARG C 1 295 ? 138.01200 95.40200  90.39000  1.000 139.64000 ? 540 ARG C CZ    1 
ATOM   7734  N NH1   . ARG C 1 295 ? 138.13200 95.65400  91.68600  1.000 139.64000 ? 540 ARG C NH1   1 
ATOM   7735  N NH2   . ARG C 1 295 ? 138.21000 94.17100  89.94000  1.000 139.64000 ? 540 ARG C NH2   1 
ATOM   7736  N N     . LEU C 1 296 ? 139.76100 100.83800 86.01600  1.000 141.35000 ? 541 LEU C N     1 
ATOM   7737  C CA    . LEU C 1 296 ? 140.10300 100.99300 84.61400  1.000 141.35000 ? 541 LEU C CA    1 
ATOM   7738  C C     . LEU C 1 296 ? 141.28200 101.93700 84.43200  1.000 141.35000 ? 541 LEU C C     1 
ATOM   7739  O O     . LEU C 1 296 ? 142.09700 101.73500 83.52700  1.000 141.35000 ? 541 LEU C O     1 
ATOM   7740  C CB    . LEU C 1 296 ? 138.86500 101.47700 83.85700  1.000 141.35000 ? 541 LEU C CB    1 
ATOM   7741  C CG    . LEU C 1 296 ? 138.76600 101.36800 82.33400  1.000 141.35000 ? 541 LEU C CG    1 
ATOM   7742  C CD1   . LEU C 1 296 ? 139.42000 102.51200 81.59500  1.000 141.35000 ? 541 LEU C CD1   1 
ATOM   7743  C CD2   . LEU C 1 296 ? 139.38000 100.05900 81.89800  1.000 141.35000 ? 541 LEU C CD2   1 
ATOM   7744  N N     . MET C 1 297 ? 141.39400 102.96200 85.27700  1.000 143.05000 ? 542 MET C N     1 
ATOM   7745  C CA    . MET C 1 297 ? 142.52100 103.88000 85.16700  1.000 143.05000 ? 542 MET C CA    1 
ATOM   7746  C C     . MET C 1 297 ? 143.81500 103.21200 85.59800  1.000 143.05000 ? 542 MET C C     1 
ATOM   7747  O O     . MET C 1 297 ? 144.83200 103.30700 84.90300  1.000 143.05000 ? 542 MET C O     1 
ATOM   7748  C CB    . MET C 1 297 ? 142.27500 105.13400 85.99800  1.000 143.05000 ? 542 MET C CB    1 
ATOM   7749  C CG    . MET C 1 297 ? 141.27000 106.08200 85.40600  1.000 143.05000 ? 542 MET C CG    1 
ATOM   7750  S SD    . MET C 1 297 ? 141.04400 107.52200 86.45400  1.000 143.05000 ? 542 MET C SD    1 
ATOM   7751  C CE    . MET C 1 297 ? 139.77100 108.38400 85.54900  1.000 143.05000 ? 542 MET C CE    1 
ATOM   7752  N N     . ALA C 1 298 ? 143.79400 102.52100 86.74000  1.000 147.58000 ? 543 ALA C N     1 
ATOM   7753  C CA    . ALA C 1 298 ? 144.99900 101.86900 87.23200  1.000 147.58000 ? 543 ALA C CA    1 
ATOM   7754  C C     . ALA C 1 298 ? 145.37900 100.65800 86.39300  1.000 147.58000 ? 543 ALA C C     1 
ATOM   7755  O O     . ALA C 1 298 ? 146.53300 100.22300 86.44800  1.000 147.58000 ? 543 ALA C O     1 
ATOM   7756  C CB    . ALA C 1 298 ? 144.82700 101.47100 88.69600  1.000 147.58000 ? 543 ALA C CB    1 
ATOM   7757  N N     . ALA C 1 299 ? 144.44500 100.11200 85.60900  1.000 147.54000 ? 544 ALA C N     1 
ATOM   7758  C CA    . ALA C 1 299 ? 144.81900 99.13300  84.59800  1.000 147.54000 ? 544 ALA C CA    1 
ATOM   7759  C C     . ALA C 1 299 ? 145.44200 99.77800  83.36900  1.000 147.54000 ? 544 ALA C C     1 
ATOM   7760  O O     . ALA C 1 299 ? 145.99600 99.06700  82.52500  1.000 147.54000 ? 544 ALA C O     1 
ATOM   7761  C CB    . ALA C 1 299 ? 143.60300 98.30500  84.18200  1.000 147.54000 ? 544 ALA C CB    1 
ATOM   7762  N N     . MET C 1 300 ? 145.36300 101.10100 83.24700  1.000 148.88000 ? 545 MET C N     1 
ATOM   7763  C CA    . MET C 1 300 ? 145.94500 101.81100 82.12100  1.000 148.88000 ? 545 MET C CA    1 
ATOM   7764  C C     . MET C 1 300 ? 147.07800 102.74500 82.52100  1.000 148.88000 ? 545 MET C C     1 
ATOM   7765  O O     . MET C 1 300 ? 147.63900 103.42300 81.65500  1.000 148.88000 ? 545 MET C O     1 
ATOM   7766  C CB    . MET C 1 300 ? 144.86000 102.59300 81.38200  1.000 148.88000 ? 545 MET C CB    1 
ATOM   7767  C CG    . MET C 1 300 ? 143.83000 101.69700 80.73200  1.000 148.88000 ? 545 MET C CG    1 
ATOM   7768  S SD    . MET C 1 300 ? 144.58600 100.53800 79.58300  1.000 148.88000 ? 545 MET C SD    1 
ATOM   7769  C CE    . MET C 1 300 ? 145.15300 101.66000 78.31100  1.000 148.88000 ? 545 MET C CE    1 
ATOM   7770  N N     . GLY C 1 301 ? 147.41300 102.82500 83.80700  1.000 144.16000 ? 546 GLY C N     1 
ATOM   7771  C CA    . GLY C 1 301 ? 148.59800 103.54100 84.24200  1.000 144.16000 ? 546 GLY C CA    1 
ATOM   7772  C C     . GLY C 1 301 ? 148.44500 105.04100 84.38100  1.000 144.16000 ? 546 GLY C C     1 
ATOM   7773  O O     . GLY C 1 301 ? 149.06700 105.65300 85.25400  1.000 144.16000 ? 546 GLY C O     1 
ATOM   7774  N N     . VAL C 1 302 ? 147.62400 105.64000 83.51900  1.000 145.60000 ? 547 VAL C N     1 
ATOM   7775  C CA    . VAL C 1 302 ? 147.43000 107.08300 83.50600  1.000 145.60000 ? 547 VAL C CA    1 
ATOM   7776  C C     . VAL C 1 302 ? 146.64900 107.49700 84.74900  1.000 145.60000 ? 547 VAL C C     1 
ATOM   7777  O O     . VAL C 1 302 ? 145.78300 106.75500 85.23100  1.000 145.60000 ? 547 VAL C O     1 
ATOM   7778  C CB    . VAL C 1 302 ? 146.71800 107.47600 82.19800  1.000 145.60000 ? 547 VAL C CB    1 
ATOM   7779  C CG1   . VAL C 1 302 ? 146.51300 108.97800 82.07700  1.000 145.60000 ? 547 VAL C CG1   1 
ATOM   7780  C CG2   . VAL C 1 302 ? 147.50300 106.94400 81.00600  1.000 145.60000 ? 547 VAL C CG2   1 
ATOM   7781  N N     . ARG C 1 303 ? 146.97800 108.67300 85.29600  1.000 136.95000 ? 548 ARG C N     1 
ATOM   7782  C CA    . ARG C 1 303 ? 146.43500 109.08600 86.58600  1.000 136.95000 ? 548 ARG C CA    1 
ATOM   7783  C C     . ARG C 1 303 ? 144.94200 109.38600 86.50500  1.000 136.95000 ? 548 ARG C C     1 
ATOM   7784  O O     . ARG C 1 303 ? 144.12200 108.66900 87.08600  1.000 136.95000 ? 548 ARG C O     1 
ATOM   7785  C CB    . ARG C 1 303 ? 147.17600 110.31800 87.09600  1.000 136.95000 ? 548 ARG C CB    1 
ATOM   7786  C CG    . ARG C 1 303 ? 148.64200 110.13300 87.40000  1.000 136.95000 ? 548 ARG C CG    1 
ATOM   7787  C CD    . ARG C 1 303 ? 149.15300 111.42200 88.00700  1.000 136.95000 ? 548 ARG C CD    1 
ATOM   7788  N NE    . ARG C 1 303 ? 150.59100 111.43800 88.23300  1.000 136.95000 ? 548 ARG C NE    1 
ATOM   7789  C CZ    . ARG C 1 303 ? 151.24200 112.48500 88.72800  1.000 136.95000 ? 548 ARG C CZ    1 
ATOM   7790  N NH1   . ARG C 1 303 ? 150.57500 113.58300 89.05700  1.000 136.95000 ? 548 ARG C NH1   1 
ATOM   7791  N NH2   . ARG C 1 303 ? 152.55500 112.43600 88.89800  1.000 136.95000 ? 548 ARG C NH2   1 
ATOM   7792  N N     . ASN C 1 304 ? 144.56700 110.42900 85.77300  1.000 132.66000 ? 549 ASN C N     1 
ATOM   7793  C CA    . ASN C 1 304 ? 143.20000 110.92000 85.78300  1.000 132.66000 ? 549 ASN C CA    1 
ATOM   7794  C C     . ASN C 1 304 ? 142.56000 110.77400 84.40300  1.000 132.66000 ? 549 ASN C C     1 
ATOM   7795  O O     . ASN C 1 304 ? 143.10100 110.12100 83.50500  1.000 132.66000 ? 549 ASN C O     1 
ATOM   7796  C CB    . ASN C 1 304 ? 143.16700 112.35900 86.30600  1.000 132.66000 ? 549 ASN C CB    1 
ATOM   7797  C CG    . ASN C 1 304 ? 144.10200 113.28400 85.55700  1.000 132.66000 ? 549 ASN C CG    1 
ATOM   7798  O OD1   . ASN C 1 304 ? 144.74500 112.89400 84.58900  1.000 132.66000 ? 549 ASN C OD1   1 
ATOM   7799  N ND2   . ASN C 1 304 ? 144.18200 114.52500 86.01000  1.000 132.66000 ? 549 ASN C ND2   1 
ATOM   7800  N N     . LEU C 1 305 ? 141.39100 111.39100 84.23800  1.000 133.43000 ? 550 LEU C N     1 
ATOM   7801  C CA    . LEU C 1 305 ? 140.53800 111.09900 83.09200  1.000 133.43000 ? 550 LEU C CA    1 
ATOM   7802  C C     . LEU C 1 305 ? 141.02300 111.76500 81.80900  1.000 133.43000 ? 550 LEU C C     1 
ATOM   7803  O O     . LEU C 1 305 ? 140.96500 111.15200 80.73900  1.000 133.43000 ? 550 LEU C O     1 
ATOM   7804  C CB    . LEU C 1 305 ? 139.10900 111.52400 83.40800  1.000 133.43000 ? 550 LEU C CB    1 
ATOM   7805  C CG    . LEU C 1 305 ? 138.05300 111.21100 82.36000  1.000 133.43000 ? 550 LEU C CG    1 
ATOM   7806  C CD1   . LEU C 1 305 ? 138.00500 109.72300 82.10700  1.000 133.43000 ? 550 LEU C CD1   1 
ATOM   7807  C CD2   . LEU C 1 305 ? 136.70600 111.70400 82.83800  1.000 133.43000 ? 550 LEU C CD2   1 
ATOM   7808  N N     . ALA C 1 306 ? 141.50400 113.00700 81.89600  1.000 139.20000 ? 551 ALA C N     1 
ATOM   7809  C CA    . ALA C 1 306 ? 141.85400 113.76600 80.69700  1.000 139.20000 ? 551 ALA C CA    1 
ATOM   7810  C C     . ALA C 1 306 ? 143.07900 113.18800 80.00200  1.000 139.20000 ? 551 ALA C C     1 
ATOM   7811  O O     . ALA C 1 306 ? 143.12300 113.11100 78.76400  1.000 139.20000 ? 551 ALA C O     1 
ATOM   7812  C CB    . ALA C 1 306 ? 142.09200 115.22800 81.06300  1.000 139.20000 ? 551 ALA C CB    1 
ATOM   7813  N N     . GLY C 1 307 ? 144.08000 112.78300 80.78600  1.000 147.23000 ? 552 GLY C N     1 
ATOM   7814  C CA    . GLY C 1 307 ? 145.21100 112.07300 80.22100  1.000 147.23000 ? 552 GLY C CA    1 
ATOM   7815  C C     . GLY C 1 307 ? 144.80300 110.75300 79.60000  1.000 147.23000 ? 552 GLY C C     1 
ATOM   7816  O O     . GLY C 1 307 ? 145.34500 110.34800 78.57100  1.000 147.23000 ? 552 GLY C O     1 
ATOM   7817  N N     . PHE C 1 308 ? 143.81000 110.08600 80.19100  1.000 149.14000 ? 553 PHE C N     1 
ATOM   7818  C CA    . PHE C 1 308 ? 143.30300 108.85100 79.60500  1.000 149.14000 ? 553 PHE C CA    1 
ATOM   7819  C C     . PHE C 1 308 ? 142.59100 109.09600 78.28000  1.000 149.14000 ? 553 PHE C C     1 
ATOM   7820  O O     . PHE C 1 308 ? 142.70000 108.28000 77.35800  1.000 149.14000 ? 553 PHE C O     1 
ATOM   7821  C CB    . PHE C 1 308 ? 142.36500 108.15100 80.58200  1.000 149.14000 ? 553 PHE C CB    1 
ATOM   7822  C CG    . PHE C 1 308 ? 141.73600 106.91800 80.02100  1.000 149.14000 ? 553 PHE C CG    1 
ATOM   7823  C CD1   . PHE C 1 308 ? 142.48300 105.76900 79.84700  1.000 149.14000 ? 553 PHE C CD1   1 
ATOM   7824  C CD2   . PHE C 1 308 ? 140.39800 106.90900 79.66000  1.000 149.14000 ? 553 PHE C CD2   1 
ATOM   7825  C CE1   . PHE C 1 308 ? 141.91000 104.63000 79.32300  1.000 149.14000 ? 553 PHE C CE1   1 
ATOM   7826  C CE2   . PHE C 1 308 ? 139.81900 105.77500 79.13500  1.000 149.14000 ? 553 PHE C CE2   1 
ATOM   7827  C CZ    . PHE C 1 308 ? 140.57700 104.63500 78.96300  1.000 149.14000 ? 553 PHE C CZ    1 
ATOM   7828  N N     . ASN C 1 309 ? 141.87700 110.21100 78.15200  1.000 149.92000 ? 554 ASN C N     1 
ATOM   7829  C CA    . ASN C 1 309 ? 141.17000 110.44300 76.90100  1.000 149.92000 ? 554 ASN C CA    1 
ATOM   7830  C C     . ASN C 1 309 ? 142.11900 110.90200 75.80300  1.000 149.92000 ? 554 ASN C C     1 
ATOM   7831  O O     . ASN C 1 309 ? 141.94300 110.53100 74.63700  1.000 149.92000 ? 554 ASN C O     1 
ATOM   7832  C CB    . ASN C 1 309 ? 140.04000 111.44800 77.09900  1.000 149.92000 ? 554 ASN C CB    1 
ATOM   7833  C CG    . ASN C 1 309 ? 139.00000 110.95500 78.07800  1.000 149.92000 ? 554 ASN C CG    1 
ATOM   7834  O OD1   . ASN C 1 309 ? 138.70200 111.61500 79.06600  1.000 149.92000 ? 554 ASN C OD1   1 
ATOM   7835  N ND2   . ASN C 1 309 ? 138.48500 109.76100 77.83800  1.000 149.92000 ? 554 ASN C ND2   1 
ATOM   7836  N N     . ARG C 1 310 ? 143.15100 111.67900 76.14400  1.000 156.55000 ? 555 ARG C N     1 
ATOM   7837  C CA    . ARG C 1 310 ? 144.15200 111.94500 75.11600  1.000 156.55000 ? 555 ARG C CA    1 
ATOM   7838  C C     . ARG C 1 310 ? 144.97100 110.69900 74.80100  1.000 156.55000 ? 555 ARG C C     1 
ATOM   7839  O O     . ARG C 1 310 ? 145.45000 110.55400 73.66700  1.000 156.55000 ? 555 ARG C O     1 
ATOM   7840  C CB    . ARG C 1 310 ? 145.05400 113.12200 75.50300  1.000 156.55000 ? 555 ARG C CB    1 
ATOM   7841  C CG    . ARG C 1 310 ? 145.95800 112.90000 76.68300  1.000 156.55000 ? 555 ARG C CG    1 
ATOM   7842  C CD    . ARG C 1 310 ? 146.76200 114.14700 77.00300  1.000 156.55000 ? 555 ARG C CD    1 
ATOM   7843  N NE    . ARG C 1 310 ? 145.91300 115.25900 77.41800  1.000 156.55000 ? 555 ARG C NE    1 
ATOM   7844  C CZ    . ARG C 1 310 ? 146.36000 116.48800 77.65500  1.000 156.55000 ? 555 ARG C CZ    1 
ATOM   7845  N NH1   . ARG C 1 310 ? 147.65100 116.75800 77.53400  1.000 156.55000 ? 555 ARG C NH1   1 
ATOM   7846  N NH2   . ARG C 1 310 ? 145.51900 117.44300 78.02300  1.000 156.55000 ? 555 ARG C NH2   1 
ATOM   7847  N N     . LYS C 1 311 ? 145.06500 109.76100 75.74800  1.000 165.15000 ? 556 LYS C N     1 
ATOM   7848  C CA    . LYS C 1 311 ? 145.66800 108.47200 75.44900  1.000 165.15000 ? 556 LYS C CA    1 
ATOM   7849  C C     . LYS C 1 311 ? 144.81400 107.66900 74.47700  1.000 165.15000 ? 556 LYS C C     1 
ATOM   7850  O O     . LYS C 1 311 ? 145.35100 107.03100 73.57000  1.000 165.15000 ? 556 LYS C O     1 
ATOM   7851  C CB    . LYS C 1 311 ? 145.90200 107.68500 76.73600  1.000 165.15000 ? 556 LYS C CB    1 
ATOM   7852  C CG    . LYS C 1 311 ? 146.57100 106.34600 76.50100  1.000 165.15000 ? 556 LYS C CG    1 
ATOM   7853  C CD    . LYS C 1 311 ? 147.96000 106.55900 75.91300  1.000 165.15000 ? 556 LYS C CD    1 
ATOM   7854  C CE    . LYS C 1 311 ? 148.69600 105.24900 75.68000  1.000 165.15000 ? 556 LYS C CE    1 
ATOM   7855  N NZ    . LYS C 1 311 ? 150.02000 105.46400 75.02500  1.000 165.15000 ? 556 LYS C NZ    1 
ATOM   7856  N N     . VAL C 1 312 ? 143.48800 107.69700 74.62900  1.000 173.50000 ? 557 VAL C N     1 
ATOM   7857  C CA    . VAL C 1 312 ? 142.68400 106.90600 73.69600  1.000 173.50000 ? 557 VAL C CA    1 
ATOM   7858  C C     . VAL C 1 312 ? 142.61900 107.59600 72.32900  1.000 173.50000 ? 557 VAL C C     1 
ATOM   7859  O O     . VAL C 1 312 ? 142.51400 106.91000 71.29900  1.000 173.50000 ? 557 VAL C O     1 
ATOM   7860  C CB    . VAL C 1 312 ? 141.28200 106.58000 74.26600  1.000 173.50000 ? 557 VAL C CB    1 
ATOM   7861  C CG1   . VAL C 1 312 ? 140.34300 107.76800 74.25700  1.000 173.50000 ? 557 VAL C CG1   1 
ATOM   7862  C CG2   . VAL C 1 312 ? 140.65200 105.39200 73.53700  1.000 173.50000 ? 557 VAL C CG2   1 
ATOM   7863  N N     . LYS C 1 313 ? 142.75900 108.93200 72.29200  1.000 179.75000 ? 558 LYS C N     1 
ATOM   7864  C CA    . LYS C 1 313 ? 142.96000 109.63400 71.02400  1.000 179.75000 ? 558 LYS C CA    1 
ATOM   7865  C C     . LYS C 1 313 ? 144.22000 109.15100 70.32300  1.000 179.75000 ? 558 LYS C C     1 
ATOM   7866  O O     . LYS C 1 313 ? 144.17200 108.68800 69.17900  1.000 179.75000 ? 558 LYS C O     1 
ATOM   7867  C CB    . LYS C 1 313 ? 143.06100 111.14700 71.22500  1.000 179.75000 ? 558 LYS C CB    1 
ATOM   7868  C CG    . LYS C 1 313 ? 141.79600 111.88800 71.56500  1.000 179.75000 ? 558 LYS C CG    1 
ATOM   7869  C CD    . LYS C 1 313 ? 142.01500 113.38400 71.31600  1.000 179.75000 ? 558 LYS C CD    1 
ATOM   7870  C CE    . LYS C 1 313 ? 143.01400 113.98200 72.29300  1.000 179.75000 ? 558 LYS C CE    1 
ATOM   7871  N NZ    . LYS C 1 313 ? 143.18000 115.44500 72.12800  1.000 179.75000 ? 558 LYS C NZ    1 
ATOM   7872  N N     . ASP C 1 314 ? 145.36200 109.23700 71.00700  1.000 187.98000 ? 559 ASP C N     1 
ATOM   7873  C CA    . ASP C 1 314 ? 146.61800 108.82900 70.38900  1.000 187.98000 ? 559 ASP C CA    1 
ATOM   7874  C C     . ASP C 1 314 ? 146.73300 107.32300 70.20100  1.000 187.98000 ? 559 ASP C C     1 
ATOM   7875  O O     . ASP C 1 314 ? 147.62300 106.87500 69.47300  1.000 187.98000 ? 559 ASP C O     1 
ATOM   7876  C CB    . ASP C 1 314 ? 147.79200 109.33800 71.21600  1.000 187.98000 ? 559 ASP C CB    1 
ATOM   7877  C CG    . ASP C 1 314 ? 147.94300 110.83300 71.12800  1.000 187.98000 ? 559 ASP C CG    1 
ATOM   7878  O OD1   . ASP C 1 314 ? 147.56000 111.40100 70.08500  1.000 187.98000 ? 559 ASP C OD1   1 
ATOM   7879  O OD2   . ASP C 1 314 ? 148.44000 111.44100 72.09800  1.000 187.98000 ? 559 ASP C OD2   1 
ATOM   7880  N N     . ALA C 1 315 ? 145.86200 106.53800 70.83300  1.000 190.51000 ? 560 ALA C N     1 
ATOM   7881  C CA    . ALA C 1 315 ? 145.84900 105.10000 70.61500  1.000 190.51000 ? 560 ALA C CA    1 
ATOM   7882  C C     . ALA C 1 315 ? 145.06400 104.74400 69.36000  1.000 190.51000 ? 560 ALA C C     1 
ATOM   7883  O O     . ALA C 1 315 ? 145.62100 104.19400 68.40600  1.000 190.51000 ? 560 ALA C O     1 
ATOM   7884  C CB    . ALA C 1 315 ? 145.27000 104.39200 71.83900  1.000 190.51000 ? 560 ALA C CB    1 
ATOM   7885  N N     . GLU C 1 316 ? 143.77000 105.06600 69.32500  1.000 194.43000 ? 561 GLU C N     1 
ATOM   7886  C CA    . GLU C 1 316 ? 142.95300 104.71600 68.17100  1.000 194.43000 ? 561 GLU C CA    1 
ATOM   7887  C C     . GLU C 1 316 ? 142.86300 105.85100 67.15700  1.000 194.43000 ? 561 GLU C C     1 
ATOM   7888  O O     . GLU C 1 316 ? 141.86300 105.96000 66.44000  1.000 194.43000 ? 561 GLU C O     1 
ATOM   7889  C CB    . GLU C 1 316 ? 141.55900 104.26700 68.61100  1.000 194.43000 ? 561 GLU C CB    1 
ATOM   7890  C CG    . GLU C 1 316 ? 141.54300 102.91400 69.31600  1.000 194.43000 ? 561 GLU C CG    1 
ATOM   7891  C CD    . GLU C 1 316 ? 140.15100 102.46400 69.71800  1.000 194.43000 ? 561 GLU C CD    1 
ATOM   7892  O OE1   . GLU C 1 316 ? 139.20000 103.25500 69.56400  1.000 194.43000 ? 561 GLU C OE1   1 
ATOM   7893  O OE2   . GLU C 1 316 ? 140.00700 101.31600 70.18700  1.000 194.43000 ? 561 GLU C OE2   1 
ATOM   7894  N N     . GLU C 1 317 ? 143.88900 106.70400 67.09400  1.000 195.96000 ? 562 GLU C N     1 
ATOM   7895  C CA    . GLU C 1 317 ? 143.99300 107.72200 66.05600  1.000 195.96000 ? 562 GLU C CA    1 
ATOM   7896  C C     . GLU C 1 317 ? 144.07400 107.13000 64.65600  1.000 195.96000 ? 562 GLU C C     1 
ATOM   7897  O O     . GLU C 1 317 ? 143.16500 107.31900 63.84200  1.000 195.96000 ? 562 GLU C O     1 
ATOM   7898  C CB    . GLU C 1 317 ? 145.22200 108.59300 66.31700  1.000 195.96000 ? 562 GLU C CB    1 
ATOM   7899  C CG    . GLU C 1 317 ? 145.38800 109.72200 65.33100  1.000 195.96000 ? 562 GLU C CG    1 
ATOM   7900  C CD    . GLU C 1 317 ? 144.31900 110.78200 65.48300  1.000 195.96000 ? 562 GLU C CD    1 
ATOM   7901  O OE1   . GLU C 1 317 ? 143.82400 110.97600 66.61400  1.000 195.96000 ? 562 GLU C OE1   1 
ATOM   7902  O OE2   . GLU C 1 317 ? 143.96300 111.41500 64.46800  1.000 195.96000 ? 562 GLU C OE2   1 
ATOM   7903  N N     . ALA C 1 318 ? 145.14900 106.41000 64.36700  1.000 196.21000 ? 563 ALA C N     1 
ATOM   7904  C CA    . ALA C 1 318 ? 145.30500 105.75600 63.07900  1.000 196.21000 ? 563 ALA C CA    1 
ATOM   7905  C C     . ALA C 1 318 ? 144.69300 104.36500 63.05500  1.000 196.21000 ? 563 ALA C C     1 
ATOM   7906  O O     . ALA C 1 318 ? 144.70400 103.71500 62.00600  1.000 196.21000 ? 563 ALA C O     1 
ATOM   7907  C CB    . ALA C 1 318 ? 146.78800 105.67800 62.70500  1.000 196.21000 ? 563 ALA C CB    1 
ATOM   7908  N N     . GLY C 1 319 ? 144.16000 103.89900 64.17800  1.000 194.16000 ? 564 GLY C N     1 
ATOM   7909  C CA    . GLY C 1 319 ? 143.61300 102.56300 64.26700  1.000 194.16000 ? 564 GLY C CA    1 
ATOM   7910  C C     . GLY C 1 319 ? 144.54800 101.61000 64.97900  1.000 194.16000 ? 564 GLY C C     1 
ATOM   7911  O O     . GLY C 1 319 ? 145.48300 101.06900 64.38300  1.000 194.16000 ? 564 GLY C O     1 
ATOM   7912  N N     . THR C 1 320 ? 144.30000 101.40600 66.26500  1.000 193.22000 ? 565 THR C N     1 
ATOM   7913  C CA    . THR C 1 320 ? 145.05500 100.45000 67.07600  1.000 193.22000 ? 565 THR C CA    1 
ATOM   7914  C C     . THR C 1 320 ? 144.10400 100.02800 68.18700  1.000 193.22000 ? 565 THR C C     1 
ATOM   7915  O O     . THR C 1 320 ? 143.98200 100.72200 69.20800  1.000 193.22000 ? 565 THR C O     1 
ATOM   7916  C CB    . THR C 1 320 ? 146.34300 101.04200 67.64300  1.000 193.22000 ? 565 THR C CB    1 
ATOM   7917  O OG1   . THR C 1 320 ? 147.17600 101.51700 66.57700  1.000 193.22000 ? 565 THR C OG1   1 
ATOM   7918  C CG2   . THR C 1 320 ? 147.11200 99.99000  68.42500  1.000 193.22000 ? 565 THR C CG2   1 
ATOM   7919  N N     . PRO C 1 321 ? 143.39900 98.90500  68.01900  1.000 194.79000 ? 566 PRO C N     1 
ATOM   7920  C CA    . PRO C 1 321 ? 142.22600 98.63100  68.86000  1.000 194.79000 ? 566 PRO C CA    1 
ATOM   7921  C C     . PRO C 1 321 ? 142.57900 98.28600  70.29800  1.000 194.79000 ? 566 PRO C C     1 
ATOM   7922  O O     . PRO C 1 321 ? 143.60300 97.65900  70.57700  1.000 194.79000 ? 566 PRO C O     1 
ATOM   7923  C CB    . PRO C 1 321 ? 141.56500 97.43400  68.16200  1.000 194.79000 ? 566 PRO C CB    1 
ATOM   7924  C CG    . PRO C 1 321 ? 142.08500 97.46200  66.76900  1.000 194.79000 ? 566 PRO C CG    1 
ATOM   7925  C CD    . PRO C 1 321 ? 143.48900 97.96500  66.89100  1.000 194.79000 ? 566 PRO C CD    1 
ATOM   7926  N N     . LEU C 1 322 ? 141.71200 98.72200  71.21000  1.000 184.59000 ? 567 LEU C N     1 
ATOM   7927  C CA    . LEU C 1 322 ? 141.76800 98.30800  72.60900  1.000 184.59000 ? 567 LEU C CA    1 
ATOM   7928  C C     . LEU C 1 322 ? 140.36300 98.42800  73.18700  1.000 184.59000 ? 567 LEU C C     1 
ATOM   7929  O O     . LEU C 1 322 ? 139.82000 99.52800  73.32700  1.000 184.59000 ? 567 LEU C O     1 
ATOM   7930  C CB    . LEU C 1 322 ? 142.80400 99.11300  73.40500  1.000 184.59000 ? 567 LEU C CB    1 
ATOM   7931  C CG    . LEU C 1 322 ? 142.78600 100.60900 73.73400  1.000 184.59000 ? 567 LEU C CG    1 
ATOM   7932  C CD1   . LEU C 1 322 ? 143.73400 100.90000 74.87400  1.000 184.59000 ? 567 LEU C CD1   1 
ATOM   7933  C CD2   . LEU C 1 322 ? 143.15600 101.43200 72.52300  1.000 184.59000 ? 567 LEU C CD2   1 
ATOM   7934  N N     . THR C 1 323 ? 139.74100 97.28200  73.43700  1.000 177.10000 ? 568 THR C N     1 
ATOM   7935  C CA    . THR C 1 323 ? 138.47400 97.20100  74.14300  1.000 177.10000 ? 568 THR C CA    1 
ATOM   7936  C C     . THR C 1 323 ? 138.60600 96.13700  75.21900  1.000 177.10000 ? 568 THR C C     1 
ATOM   7937  O O     . THR C 1 323 ? 139.46500 95.25500  75.14000  1.000 177.10000 ? 568 THR C O     1 
ATOM   7938  C CB    . THR C 1 323 ? 137.28500 96.85400  73.22000  1.000 177.10000 ? 568 THR C CB    1 
ATOM   7939  O OG1   . THR C 1 323 ? 137.51100 95.58800  72.58800  1.000 177.10000 ? 568 THR C OG1   1 
ATOM   7940  C CG2   . THR C 1 323 ? 137.05800 97.92900  72.15900  1.000 177.10000 ? 568 THR C CG2   1 
ATOM   7941  N N     . ASP C 1 324 ? 137.72900 96.23600  76.21600  1.000 178.90000 ? 569 ASP C N     1 
ATOM   7942  C CA    . ASP C 1 324 ? 137.64300 95.36600  77.38600  1.000 178.90000 ? 569 ASP C CA    1 
ATOM   7943  C C     . ASP C 1 324 ? 138.97800 95.19100  78.10800  1.000 178.90000 ? 569 ASP C C     1 
ATOM   7944  O O     . ASP C 1 324 ? 139.60200 94.13100  77.97400  1.000 178.90000 ? 569 ASP C O     1 
ATOM   7945  C CB    . ASP C 1 324 ? 137.09800 93.99100  76.98000  1.000 178.90000 ? 569 ASP C CB    1 
ATOM   7946  C CG    . ASP C 1 324 ? 135.66900 94.05100  76.46600  1.000 178.90000 ? 569 ASP C CG    1 
ATOM   7947  O OD1   . ASP C 1 324 ? 134.93200 94.97700  76.85900  1.000 178.90000 ? 569 ASP C OD1   1 
ATOM   7948  O OD2   . ASP C 1 324 ? 135.27900 93.16500  75.67500  1.000 178.90000 ? 569 ASP C OD2   1 
ATOM   7949  N N     . PRO C 1 325 ? 139.47400 96.18100  78.85400  1.000 165.06000 ? 570 PRO C N     1 
ATOM   7950  C CA    . PRO C 1 325 ? 140.71200 95.98100  79.61600  1.000 165.06000 ? 570 PRO C CA    1 
ATOM   7951  C C     . PRO C 1 325 ? 140.53700 95.24000  80.93200  1.000 165.06000 ? 570 PRO C C     1 
ATOM   7952  O O     . PRO C 1 325 ? 141.49800 95.15900  81.70200  1.000 165.06000 ? 570 PRO C O     1 
ATOM   7953  C CB    . PRO C 1 325 ? 141.19100 97.41900  79.87200  1.000 165.06000 ? 570 PRO C CB    1 
ATOM   7954  C CG    . PRO C 1 325 ? 140.46200 98.25300  78.88600  1.000 165.06000 ? 570 PRO C CG    1 
ATOM   7955  C CD    . PRO C 1 325 ? 139.12700 97.60800  78.80000  1.000 165.06000 ? 570 PRO C CD    1 
ATOM   7956  N N     . LEU C 1 326 ? 139.35100 94.71500  81.22400  1.000 152.15000 ? 571 LEU C N     1 
ATOM   7957  C CA    . LEU C 1 326 ? 139.15000 93.85400  82.38400  1.000 152.15000 ? 571 LEU C CA    1 
ATOM   7958  C C     . LEU C 1 326 ? 138.33600 92.62300  81.99800  1.000 152.15000 ? 571 LEU C C     1 
ATOM   7959  O O     . LEU C 1 326 ? 138.89100 91.58100  81.65000  1.000 152.15000 ? 571 LEU C O     1 
ATOM   7960  C CB    . LEU C 1 326 ? 138.45400 94.61000  83.51700  1.000 152.15000 ? 571 LEU C CB    1 
ATOM   7961  C CG    . LEU C 1 326 ? 139.22400 95.73000  84.21800  1.000 152.15000 ? 571 LEU C CG    1 
ATOM   7962  C CD1   . LEU C 1 326 ? 138.34300 96.41500  85.24100  1.000 152.15000 ? 571 LEU C CD1   1 
ATOM   7963  C CD2   . LEU C 1 326 ? 140.46900 95.18800  84.87800  1.000 152.15000 ? 571 LEU C CD2   1 
ATOM   7964  N N     . LEU C 1 339 ? 135.28400 100.86800 72.64400  1.000 163.11000 ? 584 LEU C N     1 
ATOM   7965  C CA    . LEU C 1 339 ? 135.64200 101.61400 73.84200  1.000 163.11000 ? 584 LEU C CA    1 
ATOM   7966  C C     . LEU C 1 339 ? 136.05200 103.03500 73.49000  1.000 163.11000 ? 584 LEU C C     1 
ATOM   7967  O O     . LEU C 1 339 ? 137.02300 103.24600 72.76800  1.000 163.11000 ? 584 LEU C O     1 
ATOM   7968  C CB    . LEU C 1 339 ? 136.76900 100.91300 74.59200  1.000 163.11000 ? 584 LEU C CB    1 
ATOM   7969  C CG    . LEU C 1 339 ? 137.15200 101.58100 75.90800  1.000 163.11000 ? 584 LEU C CG    1 
ATOM   7970  C CD1   . LEU C 1 339 ? 135.96300 101.58700 76.84500  1.000 163.11000 ? 584 LEU C CD1   1 
ATOM   7971  C CD2   . LEU C 1 339 ? 138.32100 100.86200 76.54100  1.000 163.11000 ? 584 LEU C CD2   1 
ATOM   7972  N N     . SER C 1 340 ? 135.31800 104.00600 74.01600  1.000 159.54000 ? 585 SER C N     1 
ATOM   7973  C CA    . SER C 1 340 ? 135.48300 105.41000 73.66400  1.000 159.54000 ? 585 SER C CA    1 
ATOM   7974  C C     . SER C 1 340 ? 135.89900 106.20800 74.89600  1.000 159.54000 ? 585 SER C C     1 
ATOM   7975  O O     . SER C 1 340 ? 136.29300 105.64700 75.92100  1.000 159.54000 ? 585 SER C O     1 
ATOM   7976  C CB    . SER C 1 340 ? 134.19300 105.97000 73.06700  1.000 159.54000 ? 585 SER C CB    1 
ATOM   7977  O OG    . SER C 1 340 ? 133.18800 106.05300 74.06100  1.000 159.54000 ? 585 SER C OG    1 
ATOM   7978  N N     . THR C 1 341 ? 135.83400 107.53200 74.77000  1.000 141.90000 ? 586 THR C N     1 
ATOM   7979  C CA    . THR C 1 341 ? 136.08000 108.41100 75.90300  1.000 141.90000 ? 586 THR C CA    1 
ATOM   7980  C C     . THR C 1 341 ? 134.99800 108.23100 76.95200  1.000 141.90000 ? 586 THR C C     1 
ATOM   7981  O O     . THR C 1 341 ? 133.80600 108.23300 76.63600  1.000 141.90000 ? 586 THR C O     1 
ATOM   7982  C CB    . THR C 1 341 ? 136.11400 109.86900 75.46200  1.000 141.90000 ? 586 THR C CB    1 
ATOM   7983  O OG1   . THR C 1 341 ? 134.85000 110.22000 74.89100  1.000 141.90000 ? 586 THR C OG1   1 
ATOM   7984  C CG2   . THR C 1 341 ? 137.21200 110.09400 74.44800  1.000 141.90000 ? 586 THR C CG2   1 
ATOM   7985  N N     . LEU C 1 342 ? 135.41300 108.06800 78.19200  1.000 125.18000 ? 587 LEU C N     1 
ATOM   7986  C CA    . LEU C 1 342 ? 134.45300 108.00700 79.27700  1.000 125.18000 ? 587 LEU C CA    1 
ATOM   7987  C C     . LEU C 1 342 ? 133.97700 109.41700 79.59400  1.000 125.18000 ? 587 LEU C C     1 
ATOM   7988  O O     . LEU C 1 342 ? 134.80300 110.31800 79.77400  1.000 125.18000 ? 587 LEU C O     1 
ATOM   7989  C CB    . LEU C 1 342 ? 135.08300 107.35800 80.49500  1.000 125.18000 ? 587 LEU C CB    1 
ATOM   7990  C CG    . LEU C 1 342 ? 135.47000 105.91700 80.18900  1.000 125.18000 ? 587 LEU C CG    1 
ATOM   7991  C CD1   . LEU C 1 342 ? 136.23100 105.33100 81.34800  1.000 125.18000 ? 587 LEU C CD1   1 
ATOM   7992  C CD2   . LEU C 1 342 ? 134.23800 105.08800 79.87300  1.000 125.18000 ? 587 LEU C CD2   1 
ATOM   7993  N N     . PRO C 1 343 ? 132.67400 109.65400 79.65100  1.000 117.85000 ? 588 PRO C N     1 
ATOM   7994  C CA    . PRO C 1 343 ? 132.17400 111.02200 79.76100  1.000 117.85000 ? 588 PRO C CA    1 
ATOM   7995  C C     . PRO C 1 343 ? 132.36400 111.57900 81.15900  1.000 117.85000 ? 588 PRO C C     1 
ATOM   7996  O O     . PRO C 1 343 ? 132.44800 110.85100 82.14700  1.000 117.85000 ? 588 PRO C O     1 
ATOM   7997  C CB    . PRO C 1 343 ? 130.68900 110.87600 79.43400  1.000 117.85000 ? 588 PRO C CB    1 
ATOM   7998  C CG    . PRO C 1 343 ? 130.36800 109.50600 79.87600  1.000 117.85000 ? 588 PRO C CG    1 
ATOM   7999  C CD    . PRO C 1 343 ? 131.58200 108.67300 79.61000  1.000 117.85000 ? 588 PRO C CD    1 
ATOM   8000  N N     . THR C 1 344 ? 132.44000 112.90100 81.22100  1.000 115.65000 ? 589 THR C N     1 
ATOM   8001  C CA    . THR C 1 344 ? 132.59100 113.59900 82.49100  1.000 115.65000 ? 589 THR C CA    1 
ATOM   8002  C C     . THR C 1 344 ? 131.22400 113.66400 83.14800  1.000 115.65000 ? 589 THR C C     1 
ATOM   8003  O O     . THR C 1 344 ? 130.40600 114.52600 82.82700  1.000 115.65000 ? 589 THR C O     1 
ATOM   8004  C CB    . THR C 1 344 ? 133.16800 114.98700 82.27500  1.000 115.65000 ? 589 THR C CB    1 
ATOM   8005  O OG1   . THR C 1 344 ? 134.38600 114.87600 81.53300  1.000 115.65000 ? 589 THR C OG1   1 
ATOM   8006  C CG2   . THR C 1 344 ? 133.46700 115.62900 83.60800  1.000 115.65000 ? 589 THR C CG2   1 
ATOM   8007  N N     . ILE C 1 345 ? 130.96900 112.73700 84.06300  1.000 112.38000 ? 590 ILE C N     1 
ATOM   8008  C CA    . ILE C 1 345 ? 129.65800 112.62700 84.68000  1.000 112.38000 ? 590 ILE C CA    1 
ATOM   8009  C C     . ILE C 1 345 ? 129.47400 113.76100 85.67400  1.000 112.38000 ? 590 ILE C C     1 
ATOM   8010  O O     . ILE C 1 345 ? 130.37900 114.07200 86.45700  1.000 112.38000 ? 590 ILE C O     1 
ATOM   8011  C CB    . ILE C 1 345 ? 129.51400 111.25800 85.35700  1.000 112.38000 ? 590 ILE C CB    1 
ATOM   8012  C CG1   . ILE C 1 345 ? 129.74300 110.15200 84.33500  1.000 112.38000 ? 590 ILE C CG1   1 
ATOM   8013  C CG2   . ILE C 1 345 ? 128.15200 111.09600 85.97500  1.000 112.38000 ? 590 ILE C CG2   1 
ATOM   8014  C CD1   . ILE C 1 345 ? 128.76500 110.18300 83.19600  1.000 112.38000 ? 590 ILE C CD1   1 
ATOM   8015  N N     . VAL C 1 346 ? 128.31000 114.40000 85.63500  1.000 109.98000 ? 591 VAL C N     1 
ATOM   8016  C CA    . VAL C 1 346 ? 127.96000 115.44800 86.58100  1.000 109.98000 ? 591 VAL C CA    1 
ATOM   8017  C C     . VAL C 1 346 ? 126.73800 114.99200 87.35700  1.000 109.98000 ? 591 VAL C C     1 
ATOM   8018  O O     . VAL C 1 346 ? 125.73000 114.60100 86.76400  1.000 109.98000 ? 591 VAL C O     1 
ATOM   8019  C CB    . VAL C 1 346 ? 127.68800 116.78400 85.87200  1.000 109.98000 ? 591 VAL C CB    1 
ATOM   8020  C CG1   . VAL C 1 346 ? 127.26300 117.83400 86.86800  1.000 109.98000 ? 591 VAL C CG1   1 
ATOM   8021  C CG2   . VAL C 1 346 ? 128.91700 117.24200 85.13700  1.000 109.98000 ? 591 VAL C CG2   1 
ATOM   8022  N N     . VAL C 1 347 ? 126.82600 115.02600 88.67700  1.000 114.38000 ? 592 VAL C N     1 
ATOM   8023  C CA    . VAL C 1 347 ? 125.69000 114.72800 89.53400  1.000 114.38000 ? 592 VAL C CA    1 
ATOM   8024  C C     . VAL C 1 347 ? 125.28700 116.02300 90.21300  1.000 114.38000 ? 592 VAL C C     1 
ATOM   8025  O O     . VAL C 1 347 ? 126.13000 116.71000 90.79800  1.000 114.38000 ? 592 VAL C O     1 
ATOM   8026  C CB    . VAL C 1 347 ? 126.02400 113.64000 90.55800  1.000 114.38000 ? 592 VAL C CB    1 
ATOM   8027  C CG1   . VAL C 1 347 ? 124.84200 113.39500 91.46200  1.000 114.38000 ? 592 VAL C CG1   1 
ATOM   8028  C CG2   . VAL C 1 347 ? 126.41400 112.37700 89.84200  1.000 114.38000 ? 592 VAL C CG2   1 
ATOM   8029  N N     . VAL C 1 348 ? 124.01500 116.37900 90.11700  1.000 121.34000 ? 593 VAL C N     1 
ATOM   8030  C CA    . VAL C 1 348 ? 123.52200 117.61900 90.69200  1.000 121.34000 ? 593 VAL C CA    1 
ATOM   8031  C C     . VAL C 1 348 ? 122.39100 117.30100 91.65500  1.000 121.34000 ? 593 VAL C C     1 
ATOM   8032  O O     . VAL C 1 348 ? 121.67300 116.31100 91.48600  1.000 121.34000 ? 593 VAL C O     1 
ATOM   8033  C CB    . VAL C 1 348 ? 123.07100 118.60900 89.60100  1.000 121.34000 ? 593 VAL C CB    1 
ATOM   8034  C CG1   . VAL C 1 348 ? 124.25200 119.06100 88.78700  1.000 121.34000 ? 593 VAL C CG1   1 
ATOM   8035  C CG2   . VAL C 1 348 ? 122.08500 117.96500 88.68400  1.000 121.34000 ? 593 VAL C CG2   1 
ATOM   8036  N N     . VAL C 1 349 ? 122.25600 118.13200 92.68200  1.000 128.65000 ? 594 VAL C N     1 
ATOM   8037  C CA    . VAL C 1 349 ? 121.25400 117.96500 93.72700  1.000 128.65000 ? 594 VAL C CA    1 
ATOM   8038  C C     . VAL C 1 349 ? 120.50600 119.27900 93.88300  1.000 128.65000 ? 594 VAL C C     1 
ATOM   8039  O O     . VAL C 1 349 ? 121.12800 120.32800 94.07600  1.000 128.65000 ? 594 VAL C O     1 
ATOM   8040  C CB    . VAL C 1 349 ? 121.89500 117.54800 95.06400  1.000 128.65000 ? 594 VAL C CB    1 
ATOM   8041  C CG1   . VAL C 1 349 ? 120.88900 117.64200 96.19700  1.000 128.65000 ? 594 VAL C CG1   1 
ATOM   8042  C CG2   . VAL C 1 349 ? 122.44600 116.13700 94.97000  1.000 128.65000 ? 594 VAL C CG2   1 
ATOM   8043  N N     . ASP C 1 350 ? 119.17700 119.22800 93.80400  1.000 138.47000 ? 595 ASP C N     1 
ATOM   8044  C CA    . ASP C 1 350 ? 118.39200 120.44500 93.97300  1.000 138.47000 ? 595 ASP C CA    1 
ATOM   8045  C C     . ASP C 1 350 ? 118.28800 120.83700 95.44400  1.000 138.47000 ? 595 ASP C C     1 
ATOM   8046  O O     . ASP C 1 350 ? 118.68400 121.94100 95.82400  1.000 138.47000 ? 595 ASP C O     1 
ATOM   8047  C CB    . ASP C 1 350 ? 116.99700 120.26200 93.36600  1.000 138.47000 ? 595 ASP C CB    1 
ATOM   8048  C CG    . ASP C 1 350 ? 116.24600 121.58100 93.18200  1.000 138.47000 ? 595 ASP C CG    1 
ATOM   8049  O OD1   . ASP C 1 350 ? 116.81900 122.65600 93.45900  1.000 138.47000 ? 595 ASP C OD1   1 
ATOM   8050  O OD2   . ASP C 1 350 ? 115.06700 121.54200 92.76800  1.000 138.47000 ? 595 ASP C OD2   1 
ATOM   8051  N N     . GLU C 1 351 ? 117.75200 119.94700 96.29100  1.000 132.90000 ? 596 GLU C N     1 
ATOM   8052  C CA    . GLU C 1 351 ? 117.44400 120.27300 97.68300  1.000 132.90000 ? 596 GLU C CA    1 
ATOM   8053  C C     . GLU C 1 351 ? 118.08400 119.21700 98.58400  1.000 132.90000 ? 596 GLU C C     1 
ATOM   8054  O O     . GLU C 1 351 ? 117.50500 118.18900 98.91900  1.000 132.90000 ? 596 GLU C O     1 
ATOM   8055  C CB    . GLU C 1 351 ? 115.93300 120.36100 97.91300  1.000 132.90000 ? 596 GLU C CB    1 
ATOM   8056  C CG    . GLU C 1 351 ? 115.50500 120.75600 99.31100  1.000 132.90000 ? 596 GLU C CG    1 
ATOM   8057  C CD    . GLU C 1 351 ? 115.77000 122.20700 99.60100  1.000 132.90000 ? 596 GLU C CD    1 
ATOM   8058  O OE1   . GLU C 1 351 ? 115.81400 122.99500 98.63600  1.000 132.90000 ? 596 GLU C OE1   1 
ATOM   8059  O OE2   . GLU C 1 351 ? 115.92000 122.56000 100.78800 1.000 132.90000 ? 596 GLU C OE2   1 
ATOM   8060  N N     . PHE C 1 352 ? 119.31500 119.49100 99.00200  1.000 133.54000 ? 597 PHE C N     1 
ATOM   8061  C CA    . PHE C 1 352 ? 120.06800 118.55100 99.82000  1.000 133.54000 ? 597 PHE C CA    1 
ATOM   8062  C C     . PHE C 1 352 ? 119.50500 118.42700 101.23000 1.000 133.54000 ? 597 PHE C C     1 
ATOM   8063  O O     . PHE C 1 352 ? 119.73700 117.40800 101.90100 1.000 133.54000 ? 597 PHE C O     1 
ATOM   8064  C CB    . PHE C 1 352 ? 121.52300 119.00800 99.82200  1.000 133.54000 ? 597 PHE C CB    1 
ATOM   8065  C CG    . PHE C 1 352 ? 122.42600 118.15900 100.63400 1.000 133.54000 ? 597 PHE C CG    1 
ATOM   8066  C CD1   . PHE C 1 352 ? 122.72300 116.87400 100.23700 1.000 133.54000 ? 597 PHE C CD1   1 
ATOM   8067  C CD2   . PHE C 1 352 ? 123.00800 118.66100 101.77600 1.000 133.54000 ? 597 PHE C CD2   1 
ATOM   8068  C CE1   . PHE C 1 352 ? 123.56600 116.09100 100.98600 1.000 133.54000 ? 597 PHE C CE1   1 
ATOM   8069  C CE2   . PHE C 1 352 ? 123.85500 117.89000 102.52000 1.000 133.54000 ? 597 PHE C CE2   1 
ATOM   8070  C CZ    . PHE C 1 352 ? 124.12900 116.60000 102.12900 1.000 133.54000 ? 597 PHE C CZ    1 
ATOM   8071  N N     . ALA C 1 353 ? 118.73900 119.42700 101.67100 1.000 142.12000 ? 598 ALA C N     1 
ATOM   8072  C CA    . ALA C 1 353 ? 118.15300 119.42500 103.00500 1.000 142.12000 ? 598 ALA C CA    1 
ATOM   8073  C C     . ALA C 1 353 ? 117.16000 118.28300 103.17700 1.000 142.12000 ? 598 ALA C C     1 
ATOM   8074  O O     . ALA C 1 353 ? 117.20400 117.55200 104.17100 1.000 142.12000 ? 598 ALA C O     1 
ATOM   8075  C CB    . ALA C 1 353 ? 117.47900 120.77100 103.27200 1.000 142.12000 ? 598 ALA C CB    1 
ATOM   8076  N N     . ASP C 1 354 ? 116.27800 118.09000 102.19100 1.000 151.43000 ? 599 ASP C N     1 
ATOM   8077  C CA    . ASP C 1 354 ? 115.31300 116.99400 102.26400 1.000 151.43000 ? 599 ASP C CA    1 
ATOM   8078  C C     . ASP C 1 354 ? 115.99300 115.64600 102.09600 1.000 151.43000 ? 599 ASP C C     1 
ATOM   8079  O O     . ASP C 1 354 ? 115.51000 114.63000 102.61200 1.000 151.43000 ? 599 ASP C O     1 
ATOM   8080  C CB    . ASP C 1 354 ? 114.23200 117.17000 101.20300 1.000 151.43000 ? 599 ASP C CB    1 
ATOM   8081  C CG    . ASP C 1 354 ? 113.33900 118.33400 101.49700 1.000 151.43000 ? 599 ASP C CG    1 
ATOM   8082  O OD1   . ASP C 1 354 ? 113.20900 118.65900 102.68800 1.000 151.43000 ? 599 ASP C OD1   1 
ATOM   8083  O OD2   . ASP C 1 354 ? 112.77200 118.92100 100.55400 1.000 151.43000 ? 599 ASP C OD2   1 
ATOM   8084  N N     . MET C 1 355 ? 117.11900 115.62500 101.38700 1.000 152.88000 ? 600 MET C N     1 
ATOM   8085  C CA    . MET C 1 355 ? 117.85400 114.38700 101.19400 1.000 152.88000 ? 600 MET C CA    1 
ATOM   8086  C C     . MET C 1 355 ? 118.47400 113.92400 102.50200 1.000 152.88000 ? 600 MET C C     1 
ATOM   8087  O O     . MET C 1 355 ? 118.46400 112.73000 102.81600 1.000 152.88000 ? 600 MET C O     1 
ATOM   8088  C CB    . MET C 1 355 ? 118.91800 114.58300 100.12200 1.000 152.88000 ? 600 MET C CB    1 
ATOM   8089  C CG    . MET C 1 355 ? 119.57100 113.31200 99.66200  1.000 152.88000 ? 600 MET C CG    1 
ATOM   8090  S SD    . MET C 1 355 ? 120.83900 113.66200 98.44000  1.000 152.88000 ? 600 MET C SD    1 
ATOM   8091  C CE    . MET C 1 355 ? 119.81900 114.22300 97.09600  1.000 152.88000 ? 600 MET C CE    1 
ATOM   8092  N N     . MET C 1 356 ? 118.99900 114.86100 103.29700 1.000 157.69000 ? 601 MET C N     1 
ATOM   8093  C CA    . MET C 1 356 ? 119.43700 114.47600 104.63500 1.000 157.69000 ? 601 MET C CA    1 
ATOM   8094  C C     . MET C 1 356 ? 118.25800 114.22700 105.56300 1.000 157.69000 ? 601 MET C C     1 
ATOM   8095  O O     . MET C 1 356 ? 118.34700 113.38400 106.46100 1.000 157.69000 ? 601 MET C O     1 
ATOM   8096  C CB    . MET C 1 356 ? 120.35600 115.52700 105.24600 1.000 157.69000 ? 601 MET C CB    1 
ATOM   8097  C CG    . MET C 1 356 ? 121.76900 115.51100 104.72800 1.000 157.69000 ? 601 MET C CG    1 
ATOM   8098  S SD    . MET C 1 356 ? 122.75500 116.71200 105.62800 1.000 157.69000 ? 601 MET C SD    1 
ATOM   8099  C CE    . MET C 1 356 ? 122.85600 115.91900 107.22200 1.000 157.69000 ? 601 MET C CE    1 
ATOM   8100  N N     . MET C 1 357 ? 117.14900 114.95000 105.37800 1.000 163.50000 ? 602 MET C N     1 
ATOM   8101  C CA    . MET C 1 357 ? 116.07300 114.88500 106.36200 1.000 163.50000 ? 602 MET C CA    1 
ATOM   8102  C C     . MET C 1 357 ? 115.26500 113.60200 106.22400 1.000 163.50000 ? 602 MET C C     1 
ATOM   8103  O O     . MET C 1 357 ? 114.71500 113.10200 107.21100 1.000 163.50000 ? 602 MET C O     1 
ATOM   8104  C CB    . MET C 1 357 ? 115.17000 116.11100 106.23600 1.000 163.50000 ? 602 MET C CB    1 
ATOM   8105  C CG    . MET C 1 357 ? 114.28300 116.32500 107.44700 1.000 163.50000 ? 602 MET C CG    1 
ATOM   8106  S SD    . MET C 1 357 ? 115.29500 116.67000 108.90000 1.000 163.50000 ? 602 MET C SD    1 
ATOM   8107  C CE    . MET C 1 357 ? 114.23800 116.07500 110.21700 1.000 163.50000 ? 602 MET C CE    1 
ATOM   8108  N N     . ILE C 1 358 ? 115.20200 113.04100 105.02500 1.000 156.05000 ? 603 ILE C N     1 
ATOM   8109  C CA    . ILE C 1 358 ? 114.56500 111.74700 104.85800 1.000 156.05000 ? 603 ILE C CA    1 
ATOM   8110  C C     . ILE C 1 358 ? 115.55700 110.64900 105.21900 1.000 156.05000 ? 603 ILE C C     1 
ATOM   8111  O O     . ILE C 1 358 ? 115.30800 109.86000 106.13600 1.000 156.05000 ? 603 ILE C O     1 
ATOM   8112  C CB    . ILE C 1 358 ? 114.01400 111.58200 103.43400 1.000 156.05000 ? 603 ILE C CB    1 
ATOM   8113  C CG1   . ILE C 1 358 ? 112.86300 112.56500 103.22400 1.000 156.05000 ? 603 ILE C CG1   1 
ATOM   8114  C CG2   . ILE C 1 358 ? 113.55800 110.15800 103.20100 1.000 156.05000 ? 603 ILE C CG2   1 
ATOM   8115  C CD1   . ILE C 1 358 ? 112.33600 112.61500 101.81800 1.000 156.05000 ? 603 ILE C CD1   1 
ATOM   8116  N N     . VAL C 1 359 ? 116.69100 110.59700 104.52600 1.000 153.79000 ? 604 VAL C N     1 
ATOM   8117  C CA    . VAL C 1 359 ? 117.72900 109.60600 104.79400 1.000 153.79000 ? 604 VAL C CA    1 
ATOM   8118  C C     . VAL C 1 359 ? 118.86600 110.33200 105.50100 1.000 153.79000 ? 604 VAL C C     1 
ATOM   8119  O O     . VAL C 1 359 ? 119.57400 111.14300 104.90300 1.000 153.79000 ? 604 VAL C O     1 
ATOM   8120  C CB    . VAL C 1 359 ? 118.21200 108.91700 103.51700 1.000 153.79000 ? 604 VAL C CB    1 
ATOM   8121  C CG1   . VAL C 1 359 ? 119.29300 107.90200 103.85100 1.000 153.79000 ? 604 VAL C CG1   1 
ATOM   8122  C CG2   . VAL C 1 359 ? 117.05800 108.26000 102.79200 1.000 153.79000 ? 604 VAL C CG2   1 
ATOM   8123  N N     . GLY C 1 360 ? 119.06200 110.02800 106.77500 1.000 156.03000 ? 605 GLY C N     1 
ATOM   8124  C CA    . GLY C 1 360 ? 119.99100 110.79600 107.57400 1.000 156.03000 ? 605 GLY C CA    1 
ATOM   8125  C C     . GLY C 1 360 ? 121.44800 110.41300 107.45000 1.000 156.03000 ? 605 GLY C C     1 
ATOM   8126  O O     . GLY C 1 360 ? 122.31800 111.28600 107.41400 1.000 156.03000 ? 605 GLY C O     1 
ATOM   8127  N N     . LYS C 1 361 ? 121.74100 109.11700 107.39800 1.000 154.56000 ? 606 LYS C N     1 
ATOM   8128  C CA    . LYS C 1 361 ? 123.10900 108.68300 107.64300 1.000 154.56000 ? 606 LYS C CA    1 
ATOM   8129  C C     . LYS C 1 361 ? 123.76600 108.12900 106.38700 1.000 154.56000 ? 606 LYS C C     1 
ATOM   8130  O O     . LYS C 1 361 ? 124.96200 108.34700 106.15700 1.000 154.56000 ? 606 LYS C O     1 
ATOM   8131  C CB    . LYS C 1 361 ? 123.12700 107.65700 108.77400 1.000 154.56000 ? 606 LYS C CB    1 
ATOM   8132  C CG    . LYS C 1 361 ? 122.55000 108.15600 110.10500 1.000 154.56000 ? 606 LYS C CG    1 
ATOM   8133  C CD    . LYS C 1 361 ? 123.42100 109.21300 110.79600 1.000 154.56000 ? 606 LYS C CD    1 
ATOM   8134  C CE    . LYS C 1 361 ? 122.85500 110.63000 110.66800 1.000 154.56000 ? 606 LYS C CE    1 
ATOM   8135  N NZ    . LYS C 1 361 ? 123.66700 111.63900 111.38600 1.000 154.56000 ? 606 LYS C NZ    1 
ATOM   8136  N N     . LYS C 1 362 ? 123.00600 107.38900 105.57500 1.000 149.80000 ? 607 LYS C N     1 
ATOM   8137  C CA    . LYS C 1 362 ? 123.57000 106.75500 104.38600 1.000 149.80000 ? 607 LYS C CA    1 
ATOM   8138  C C     . LYS C 1 362 ? 124.01500 107.79000 103.36000 1.000 149.80000 ? 607 LYS C C     1 
ATOM   8139  O O     . LYS C 1 362 ? 125.09900 107.67900 102.77100 1.000 149.80000 ? 607 LYS C O     1 
ATOM   8140  C CB    . LYS C 1 362 ? 122.54300 105.80500 103.76900 1.000 149.80000 ? 607 LYS C CB    1 
ATOM   8141  C CG    . LYS C 1 362 ? 122.18200 104.61800 104.63600 1.000 149.80000 ? 607 LYS C CG    1 
ATOM   8142  C CD    . LYS C 1 362 ? 121.18400 103.72400 103.92000 1.000 149.80000 ? 607 LYS C CD    1 
ATOM   8143  C CE    . LYS C 1 362 ? 120.67600 102.59900 104.81300 1.000 149.80000 ? 607 LYS C CE    1 
ATOM   8144  N NZ    . LYS C 1 362 ? 121.71000 101.57800 105.12600 1.000 149.80000 ? 607 LYS C NZ    1 
ATOM   8145  N N     . VAL C 1 363 ? 123.19900 108.83100 103.18800 1.000 150.29000 ? 608 VAL C N     1 
ATOM   8146  C CA    . VAL C 1 363 ? 123.44800 109.83500 102.16000 1.000 150.29000 ? 608 VAL C CA    1 
ATOM   8147  C C     . VAL C 1 363 ? 124.71400 110.61700 102.46200 1.000 150.29000 ? 608 VAL C C     1 
ATOM   8148  O O     . VAL C 1 363 ? 125.57400 110.76500 101.59400 1.000 150.29000 ? 608 VAL C O     1 
ATOM   8149  C CB    . VAL C 1 363 ? 122.24300 110.77600 102.02000 1.000 150.29000 ? 608 VAL C CB    1 
ATOM   8150  C CG1   . VAL C 1 363 ? 122.61600 111.98700 101.19600 1.000 150.29000 ? 608 VAL C CG1   1 
ATOM   8151  C CG2   . VAL C 1 363 ? 121.10900 110.04900 101.35400 1.000 150.29000 ? 608 VAL C CG2   1 
ATOM   8152  N N     . GLU C 1 364 ? 124.84700 111.10700 103.69700 1.000 148.54000 ? 609 GLU C N     1 
ATOM   8153  C CA    . GLU C 1 364 ? 125.94100 112.01200 104.04300 1.000 148.54000 ? 609 GLU C CA    1 
ATOM   8154  C C     . GLU C 1 364 ? 127.28800 111.31000 103.96900 1.000 148.54000 ? 609 GLU C C     1 
ATOM   8155  O O     . GLU C 1 364 ? 128.27900 111.87900 103.49000 1.000 148.54000 ? 609 GLU C O     1 
ATOM   8156  C CB    . GLU C 1 364 ? 125.70000 112.57500 105.43900 1.000 148.54000 ? 609 GLU C CB    1 
ATOM   8157  C CG    . GLU C 1 364 ? 126.65500 113.65200 105.85800 1.000 148.54000 ? 609 GLU C CG    1 
ATOM   8158  C CD    . GLU C 1 364 ? 126.26100 114.26000 107.18200 1.000 148.54000 ? 609 GLU C CD    1 
ATOM   8159  O OE1   . GLU C 1 364 ? 125.30000 113.75700 107.80000 1.000 148.54000 ? 609 GLU C OE1   1 
ATOM   8160  O OE2   . GLU C 1 364 ? 126.89000 115.25700 107.59100 1.000 148.54000 ? 609 GLU C OE2   1 
ATOM   8161  N N     . GLU C 1 365 ? 127.31700 110.04300 104.36400 1.000 145.22000 ? 610 GLU C N     1 
ATOM   8162  C CA    . GLU C 1 365 ? 128.54600 109.27500 104.26800 1.000 145.22000 ? 610 GLU C CA    1 
ATOM   8163  C C     . GLU C 1 365 ? 128.86300 108.91200 102.82100 1.000 145.22000 ? 610 GLU C C     1 
ATOM   8164  O O     . GLU C 1 365 ? 130.03400 108.91500 102.42300 1.000 145.22000 ? 610 GLU C O     1 
ATOM   8165  C CB    . GLU C 1 365 ? 128.42900 108.04400 105.15700 1.000 145.22000 ? 610 GLU C CB    1 
ATOM   8166  C CG    . GLU C 1 365 ? 128.26600 108.43300 106.61800 1.000 145.22000 ? 610 GLU C CG    1 
ATOM   8167  C CD    . GLU C 1 365 ? 128.08300 107.24800 107.53500 1.000 145.22000 ? 610 GLU C CD    1 
ATOM   8168  O OE1   . GLU C 1 365 ? 127.96400 106.11300 107.02800 1.000 145.22000 ? 610 GLU C OE1   1 
ATOM   8169  O OE2   . GLU C 1 365 ? 128.05200 107.45400 108.76600 1.000 145.22000 ? 610 GLU C OE2   1 
ATOM   8170  N N     . LEU C 1 366 ? 127.83800 108.64500 102.00000 1.000 140.53000 ? 611 LEU C N     1 
ATOM   8171  C CA    . LEU C 1 366 ? 128.09800 108.42600 100.57600 1.000 140.53000 ? 611 LEU C CA    1 
ATOM   8172  C C     . LEU C 1 366 ? 128.56700 109.70200 99.88100  1.000 140.53000 ? 611 LEU C C     1 
ATOM   8173  O O     . LEU C 1 366 ? 129.40200 109.65000 98.96800  1.000 140.53000 ? 611 LEU C O     1 
ATOM   8174  C CB    . LEU C 1 366 ? 126.85300 107.86700 99.89100  1.000 140.53000 ? 611 LEU C CB    1 
ATOM   8175  C CG    . LEU C 1 366 ? 126.55600 106.39400 100.15900 1.000 140.53000 ? 611 LEU C CG    1 
ATOM   8176  C CD1   . LEU C 1 366 ? 125.20200 106.02300 99.60700  1.000 140.53000 ? 611 LEU C CD1   1 
ATOM   8177  C CD2   . LEU C 1 366 ? 127.63000 105.53200 99.53500  1.000 140.53000 ? 611 LEU C CD2   1 
ATOM   8178  N N     . ILE C 1 367 ? 128.05000 110.85300 100.30800 1.000 134.97000 ? 612 ILE C N     1 
ATOM   8179  C CA    . ILE C 1 367 ? 128.47100 112.12400 99.73700  1.000 134.97000 ? 612 ILE C CA    1 
ATOM   8180  C C     . ILE C 1 367 ? 129.91500 112.41100 100.09500 1.000 134.97000 ? 612 ILE C C     1 
ATOM   8181  O O     . ILE C 1 367 ? 130.70000 112.83600 99.24300  1.000 134.97000 ? 612 ILE C O     1 
ATOM   8182  C CB    . ILE C 1 367 ? 127.52700 113.25700 100.18200 1.000 134.97000 ? 612 ILE C CB    1 
ATOM   8183  C CG1   . ILE C 1 367 ? 126.17700 113.10100 99.49800  1.000 134.97000 ? 612 ILE C CG1   1 
ATOM   8184  C CG2   . ILE C 1 367 ? 128.09100 114.62400 99.86500  1.000 134.97000 ? 612 ILE C CG2   1 
ATOM   8185  C CD1   . ILE C 1 367 ? 126.26700 113.09700 97.99500  1.000 134.97000 ? 612 ILE C CD1   1 
ATOM   8186  N N     . ALA C 1 368 ? 130.30600 112.13600 101.33800 1.000 136.53000 ? 613 ALA C N     1 
ATOM   8187  C CA    . ALA C 1 368 ? 131.70700 112.32000 101.69400 1.000 136.53000 ? 613 ALA C CA    1 
ATOM   8188  C C     . ALA C 1 368 ? 132.60400 111.28800 101.01500 1.000 136.53000 ? 613 ALA C C     1 
ATOM   8189  O O     . ALA C 1 368 ? 133.76300 111.58900 100.71500 1.000 136.53000 ? 613 ALA C O     1 
ATOM   8190  C CB    . ALA C 1 368 ? 131.87300 112.27400 103.20600 1.000 136.53000 ? 613 ALA C CB    1 
ATOM   8191  N N     . ARG C 1 369 ? 132.07400 110.09600 100.72900 1.000 133.53000 ? 614 ARG C N     1 
ATOM   8192  C CA    . ARG C 1 369 ? 132.80600 109.08400 99.96700  1.000 133.53000 ? 614 ARG C CA    1 
ATOM   8193  C C     . ARG C 1 369 ? 133.11800 109.57500 98.55400  1.000 133.53000 ? 614 ARG C C     1 
ATOM   8194  O O     . ARG C 1 369 ? 134.27000 109.51800 98.08600  1.000 133.53000 ? 614 ARG C O     1 
ATOM   8195  C CB    . ARG C 1 369 ? 131.95900 107.81000 99.93700  1.000 133.53000 ? 614 ARG C CB    1 
ATOM   8196  C CG    . ARG C 1 369 ? 132.49600 106.59700 99.20000  1.000 133.53000 ? 614 ARG C CG    1 
ATOM   8197  C CD    . ARG C 1 369 ? 133.60800 105.89000 99.94200  1.000 133.53000 ? 614 ARG C CD    1 
ATOM   8198  N NE    . ARG C 1 369 ? 133.88600 104.59100 99.33400  1.000 133.53000 ? 614 ARG C NE    1 
ATOM   8199  C CZ    . ARG C 1 369 ? 134.70400 104.39800 98.30600  1.000 133.53000 ? 614 ARG C CZ    1 
ATOM   8200  N NH1   . ARG C 1 369 ? 135.34100 105.42000 97.76000  1.000 133.53000 ? 614 ARG C NH1   1 
ATOM   8201  N NH2   . ARG C 1 369 ? 134.88500 103.18000 97.82200  1.000 133.53000 ? 614 ARG C NH2   1 
ATOM   8202  N N     . ILE C 1 370 ? 132.09600 110.08400 97.86800  1.000 128.86000 ? 615 ILE C N     1 
ATOM   8203  C CA    . ILE C 1 370 ? 132.28200 110.58900 96.51400  1.000 128.86000 ? 615 ILE C CA    1 
ATOM   8204  C C     . ILE C 1 370 ? 133.11500 111.86600 96.52900  1.000 128.86000 ? 615 ILE C C     1 
ATOM   8205  O O     . ILE C 1 370 ? 133.94000 112.09200 95.63900  1.000 128.86000 ? 615 ILE C O     1 
ATOM   8206  C CB    . ILE C 1 370 ? 130.91300 110.78600 95.84400  1.000 128.86000 ? 615 ILE C CB    1 
ATOM   8207  C CG1   . ILE C 1 370 ? 130.20500 109.44500 95.74100  1.000 128.86000 ? 615 ILE C CG1   1 
ATOM   8208  C CG2   . ILE C 1 370 ? 131.04400 111.34100 94.45300  1.000 128.86000 ? 615 ILE C CG2   1 
ATOM   8209  C CD1   . ILE C 1 370 ? 128.77100 109.55600 95.32900  1.000 128.86000 ? 615 ILE C CD1   1 
ATOM   8210  N N     . ALA C 1 371 ? 132.96600 112.68700 97.57000  1.000 130.38000 ? 616 ALA C N     1 
ATOM   8211  C CA    . ALA C 1 371 ? 133.75500 113.90800 97.68300  1.000 130.38000 ? 616 ALA C CA    1 
ATOM   8212  C C     . ALA C 1 371 ? 135.22000 113.60200 97.94400  1.000 130.38000 ? 616 ALA C C     1 
ATOM   8213  O O     . ALA C 1 371 ? 136.09700 114.38000 97.55400  1.000 130.38000 ? 616 ALA C O     1 
ATOM   8214  C CB    . ALA C 1 371 ? 133.19000 114.78900 98.79400  1.000 130.38000 ? 616 ALA C CB    1 
ATOM   8215  N N     . GLN C 1 372 ? 135.49400 112.47800 98.59900  1.000 129.57000 ? 617 GLN C N     1 
ATOM   8216  C CA    . GLN C 1 372 ? 136.85300 111.97300 98.68200  1.000 129.57000 ? 617 GLN C CA    1 
ATOM   8217  C C     . GLN C 1 372 ? 137.38900 111.60900 97.30800  1.000 129.57000 ? 617 GLN C C     1 
ATOM   8218  O O     . GLN C 1 372 ? 138.34300 112.22100 96.81900  1.000 129.57000 ? 617 GLN C O     1 
ATOM   8219  C CB    . GLN C 1 372 ? 136.89600 110.76300 99.60400  1.000 129.57000 ? 617 GLN C CB    1 
ATOM   8220  C CG    . GLN C 1 372 ? 138.24500 110.10900 99.67800  1.000 129.57000 ? 617 GLN C CG    1 
ATOM   8221  C CD    . GLN C 1 372 ? 138.23500 108.88700 100.55900 1.000 129.57000 ? 617 GLN C CD    1 
ATOM   8222  O OE1   . GLN C 1 372 ? 137.21900 108.54800 101.16000 1.000 129.57000 ? 617 GLN C OE1   1 
ATOM   8223  N NE2   . GLN C 1 372 ? 139.35800 108.19400 100.61100 1.000 129.57000 ? 617 GLN C NE2   1 
ATOM   8224  N N     . LYS C 1 373 ? 136.77700 110.62300 96.65400  1.000 135.08000 ? 618 LYS C N     1 
ATOM   8225  C CA    . LYS C 1 373 ? 137.44400 110.00600 95.50900  1.000 135.08000 ? 618 LYS C CA    1 
ATOM   8226  C C     . LYS C 1 373 ? 136.90100 110.43400 94.14600  1.000 135.08000 ? 618 LYS C C     1 
ATOM   8227  O O     . LYS C 1 373 ? 137.11000 109.71600 93.16300  1.000 135.08000 ? 618 LYS C O     1 
ATOM   8228  C CB    . LYS C 1 373 ? 137.39900 108.48300 95.61100  1.000 135.08000 ? 618 LYS C CB    1 
ATOM   8229  C CG    . LYS C 1 373 ? 138.36300 107.90400 96.61600  1.000 135.08000 ? 618 LYS C CG    1 
ATOM   8230  C CD    . LYS C 1 373 ? 138.37000 106.39100 96.53800  1.000 135.08000 ? 618 LYS C CD    1 
ATOM   8231  C CE    . LYS C 1 373 ? 139.34000 105.79500 97.53900  1.000 135.08000 ? 618 LYS C CE    1 
ATOM   8232  N NZ    . LYS C 1 373 ? 139.34700 104.30900 97.49400  1.000 135.08000 ? 618 LYS C NZ    1 
ATOM   8233  N N     . ALA C 1 374 ? 136.25500 111.59000 94.04000  1.000 123.19000 ? 619 ALA C N     1 
ATOM   8234  C CA    . ALA C 1 374 ? 135.57700 111.90100 92.79300  1.000 123.19000 ? 619 ALA C CA    1 
ATOM   8235  C C     . ALA C 1 374 ? 136.39000 112.73200 91.81100  1.000 123.19000 ? 619 ALA C C     1 
ATOM   8236  O O     . ALA C 1 374 ? 136.10600 112.66200 90.61100  1.000 123.19000 ? 619 ALA C O     1 
ATOM   8237  C CB    . ALA C 1 374 ? 134.26700 112.62600 93.09200  1.000 123.19000 ? 619 ALA C CB    1 
ATOM   8238  N N     . ARG C 1 375 ? 137.37900 113.50300 92.28200  1.000 120.39000 ? 620 ARG C N     1 
ATOM   8239  C CA    . ARG C 1 375 ? 138.06000 114.48600 91.43300  1.000 120.39000 ? 620 ARG C CA    1 
ATOM   8240  C C     . ARG C 1 375 ? 138.81000 113.82900 90.28400  1.000 120.39000 ? 620 ARG C C     1 
ATOM   8241  O O     . ARG C 1 375 ? 138.70700 114.26300 89.13200  1.000 120.39000 ? 620 ARG C O     1 
ATOM   8242  C CB    . ARG C 1 375 ? 139.02700 115.32400 92.26600  1.000 120.39000 ? 620 ARG C CB    1 
ATOM   8243  C CG    . ARG C 1 375 ? 139.88900 116.27000 91.44200  1.000 120.39000 ? 620 ARG C CG    1 
ATOM   8244  C CD    . ARG C 1 375 ? 140.85100 117.03900 92.32500  1.000 120.39000 ? 620 ARG C CD    1 
ATOM   8245  N NE    . ARG C 1 375 ? 141.88300 117.73400 91.55900  1.000 120.39000 ? 620 ARG C NE    1 
ATOM   8246  C CZ    . ARG C 1 375 ? 141.76800 118.96300 91.06800  1.000 120.39000 ? 620 ARG C CZ    1 
ATOM   8247  N NH1   . ARG C 1 375 ? 140.65200 119.65200 91.25700  1.000 120.39000 ? 620 ARG C NH1   1 
ATOM   8248  N NH2   . ARG C 1 375 ? 142.76900 119.50500 90.39000  1.000 120.39000 ? 620 ARG C NH2   1 
ATOM   8249  N N     . ALA C 1 376 ? 139.56200 112.77200 90.57600  1.000 127.56000 ? 621 ALA C N     1 
ATOM   8250  C CA    . ALA C 1 376 ? 140.31100 112.09800 89.52800  1.000 127.56000 ? 621 ALA C CA    1 
ATOM   8251  C C     . ALA C 1 376 ? 139.40800 111.30800 88.60000  1.000 127.56000 ? 621 ALA C C     1 
ATOM   8252  O O     . ALA C 1 376 ? 139.75000 111.12000 87.42900  1.000 127.56000 ? 621 ALA C O     1 
ATOM   8253  C CB    . ALA C 1 376 ? 141.35800 111.17200 90.14400  1.000 127.56000 ? 621 ALA C CB    1 
ATOM   8254  N N     . ALA C 1 377 ? 138.25600 110.87300 89.08700  1.000 129.65000 ? 622 ALA C N     1 
ATOM   8255  C CA    . ALA C 1 377 ? 137.41000 109.98300 88.31500  1.000 129.65000 ? 622 ALA C CA    1 
ATOM   8256  C C     . ALA C 1 377 ? 136.60400 110.69700 87.24500  1.000 129.65000 ? 622 ALA C C     1 
ATOM   8257  O O     . ALA C 1 377 ? 136.03900 110.03100 86.37300  1.000 129.65000 ? 622 ALA C O     1 
ATOM   8258  C CB    . ALA C 1 377 ? 136.46200 109.23600 89.25200  1.000 129.65000 ? 622 ALA C CB    1 
ATOM   8259  N N     . GLY C 1 378 ? 136.52100 112.02100 87.28500  1.000 123.15000 ? 623 GLY C N     1 
ATOM   8260  C CA    . GLY C 1 378 ? 135.65200 112.73300 86.37700  1.000 123.15000 ? 623 GLY C CA    1 
ATOM   8261  C C     . GLY C 1 378 ? 134.20500 112.81700 86.80900  1.000 123.15000 ? 623 GLY C C     1 
ATOM   8262  O O     . GLY C 1 378 ? 133.44900 113.60800 86.23400  1.000 123.15000 ? 623 GLY C O     1 
ATOM   8263  N N     . ILE C 1 379 ? 133.78500 112.02000 87.78700  1.000 118.63000 ? 624 ILE C N     1 
ATOM   8264  C CA    . ILE C 1 379 ? 132.46100 112.18100 88.36200  1.000 118.63000 ? 624 ILE C CA    1 
ATOM   8265  C C     . ILE C 1 379 ? 132.47100 113.40200 89.26200  1.000 118.63000 ? 624 ILE C C     1 
ATOM   8266  O O     . ILE C 1 379 ? 133.39400 113.59300 90.05700  1.000 118.63000 ? 624 ILE C O     1 
ATOM   8267  C CB    . ILE C 1 379 ? 132.07000 110.92000 89.13400  1.000 118.63000 ? 624 ILE C CB    1 
ATOM   8268  C CG1   . ILE C 1 379 ? 132.03400 109.74200 88.18000  1.000 118.63000 ? 624 ILE C CG1   1 
ATOM   8269  C CG2   . ILE C 1 379 ? 130.73200 111.08100 89.80600  1.000 118.63000 ? 624 ILE C CG2   1 
ATOM   8270  C CD1   . ILE C 1 379 ? 131.86300 108.43500 88.87700  1.000 118.63000 ? 624 ILE C CD1   1 
ATOM   8271  N N     . HIS C 1 380 ? 131.46100 114.24700 89.13500  1.000 109.11000 ? 625 HIS C N     1 
ATOM   8272  C CA    . HIS C 1 380 ? 131.41500 115.44800 89.94000  1.000 109.11000 ? 625 HIS C CA    1 
ATOM   8273  C C     . HIS C 1 380 ? 130.07100 115.57900 90.63300  1.000 109.11000 ? 625 HIS C C     1 
ATOM   8274  O O     . HIS C 1 380 ? 129.09300 114.91600 90.28500  1.000 109.11000 ? 625 HIS C O     1 
ATOM   8275  C CB    . HIS C 1 380 ? 131.68900 116.66800 89.09600  1.000 109.11000 ? 625 HIS C CB    1 
ATOM   8276  C CG    . HIS C 1 380 ? 133.07400 116.70700 88.54600  1.000 109.11000 ? 625 HIS C CG    1 
ATOM   8277  N ND1   . HIS C 1 380 ? 133.42300 116.07900 87.37300  1.000 109.11000 ? 625 HIS C ND1   1 
ATOM   8278  C CD2   . HIS C 1 380 ? 134.19000 117.32500 88.99100  1.000 109.11000 ? 625 HIS C CD2   1 
ATOM   8279  C CE1   . HIS C 1 380 ? 134.70000 116.30200 87.12200  1.000 109.11000 ? 625 HIS C CE1   1 
ATOM   8280  N NE2   . HIS C 1 380 ? 135.18900 117.05500 88.09000  1.000 109.11000 ? 625 HIS C NE2   1 
ATOM   8281  N N     . LEU C 1 381 ? 130.04500 116.46000 91.62100  1.000 112.32000 ? 626 LEU C N     1 
ATOM   8282  C CA    . LEU C 1 381 ? 128.90500 116.62600 92.50000  1.000 112.32000 ? 626 LEU C CA    1 
ATOM   8283  C C     . LEU C 1 381 ? 128.63200 118.10700 92.69000  1.000 112.32000 ? 626 LEU C C     1 
ATOM   8284  O O     . LEU C 1 381 ? 129.53700 118.86300 93.05100  1.000 112.32000 ? 626 LEU C O     1 
ATOM   8285  C CB    . LEU C 1 381 ? 129.16100 115.96900 93.84700  1.000 112.32000 ? 626 LEU C CB    1 
ATOM   8286  C CG    . LEU C 1 381 ? 127.97700 116.08000 94.79000  1.000 112.32000 ? 626 LEU C CG    1 
ATOM   8287  C CD1   . LEU C 1 381 ? 126.82100 115.28700 94.23300  1.000 112.32000 ? 626 LEU C CD1   1 
ATOM   8288  C CD2   . LEU C 1 381 ? 128.35900 115.59900 96.16500  1.000 112.32000 ? 626 LEU C CD2   1 
ATOM   8289  N N     . ILE C 1 382 ? 127.39200 118.51900 92.44800  1.000 116.90000 ? 627 ILE C N     1 
ATOM   8290  C CA    . ILE C 1 382 ? 126.96400 119.89900 92.63700  1.000 116.90000 ? 627 ILE C CA    1 
ATOM   8291  C C     . ILE C 1 382 ? 125.83300 119.88100 93.65000  1.000 116.90000 ? 627 ILE C C     1 
ATOM   8292  O O     . ILE C 1 382 ? 124.72200 119.43600 93.33800  1.000 116.90000 ? 627 ILE C O     1 
ATOM   8293  C CB    . ILE C 1 382 ? 126.49600 120.54600 91.33300  1.000 116.90000 ? 627 ILE C CB    1 
ATOM   8294  C CG1   . ILE C 1 382 ? 127.52200 120.34400 90.22500  1.000 116.90000 ? 627 ILE C CG1   1 
ATOM   8295  C CG2   . ILE C 1 382 ? 126.24600 122.01500 91.55400  1.000 116.90000 ? 627 ILE C CG2   1 
ATOM   8296  C CD1   . ILE C 1 382 ? 128.86200 120.92900 90.52100  1.000 116.90000 ? 627 ILE C CD1   1 
ATOM   8297  N N     . LEU C 1 383 ? 126.09900 120.36800 94.85100  1.000 116.44000 ? 628 LEU C N     1 
ATOM   8298  C CA    . LEU C 1 383 ? 125.10300 120.36500 95.90600  1.000 116.44000 ? 628 LEU C CA    1 
ATOM   8299  C C     . LEU C 1 383 ? 124.41900 121.71700 95.99400  1.000 116.44000 ? 628 LEU C C     1 
ATOM   8300  O O     . LEU C 1 383 ? 124.90700 122.71700 95.46600  1.000 116.44000 ? 628 LEU C O     1 
ATOM   8301  C CB    . LEU C 1 383 ? 125.73900 120.01800 97.24500  1.000 116.44000 ? 628 LEU C CB    1 
ATOM   8302  C CG    . LEU C 1 383 ? 126.32200 118.61600 97.23100  1.000 116.44000 ? 628 LEU C CG    1 
ATOM   8303  C CD1   . LEU C 1 383 ? 126.99800 118.34500 98.54000  1.000 116.44000 ? 628 LEU C CD1   1 
ATOM   8304  C CD2   . LEU C 1 383 ? 125.23900 117.59400 96.96200  1.000 116.44000 ? 628 LEU C CD2   1 
ATOM   8305  N N     . ALA C 1 384 ? 123.27700 121.73300 96.68100  1.000 121.92000 ? 629 ALA C N     1 
ATOM   8306  C CA    . ALA C 1 384 ? 122.48500 122.95200 96.82700  1.000 121.92000 ? 629 ALA C CA    1 
ATOM   8307  C C     . ALA C 1 384 ? 121.53900 122.79900 98.00700  1.000 121.92000 ? 629 ALA C C     1 
ATOM   8308  O O     . ALA C 1 384 ? 120.61400 121.98500 97.95200  1.000 121.92000 ? 629 ALA C O     1 
ATOM   8309  C CB    . ALA C 1 384 ? 121.70800 123.23900 95.54800  1.000 121.92000 ? 629 ALA C CB    1 
ATOM   8310  N N     . THR C 1 385 ? 121.76100 123.57200 99.06400  1.000 118.21000 ? 630 THR C N     1 
ATOM   8311  C CA    . THR C 1 385 ? 120.84800 123.61600 100.19400 1.000 118.21000 ? 630 THR C CA    1 
ATOM   8312  C C     . THR C 1 385 ? 120.08900 124.93000 100.22700 1.000 118.21000 ? 630 THR C C     1 
ATOM   8313  O O     . THR C 1 385 ? 120.61100 125.98500 99.85600  1.000 118.21000 ? 630 THR C O     1 
ATOM   8314  C CB    . THR C 1 385 ? 121.56500 123.42600 101.52900 1.000 118.21000 ? 630 THR C CB    1 
ATOM   8315  O OG1   . THR C 1 385 ? 120.62600 123.61800 102.59500 1.000 118.21000 ? 630 THR C OG1   1 
ATOM   8316  C CG2   . THR C 1 385 ? 122.72300 124.38700 101.68100 1.000 118.21000 ? 630 THR C CG2   1 
ATOM   8317  N N     . GLN C 1 386 ? 118.83600 124.85100 100.65000 1.000 119.02000 ? 631 GLN C N     1 
ATOM   8318  C CA    . GLN C 1 386 ? 118.00500 126.03100 100.78200 1.000 119.02000 ? 631 GLN C CA    1 
ATOM   8319  C C     . GLN C 1 386 ? 117.93200 126.47000 102.23200 1.000 119.02000 ? 631 GLN C C     1 
ATOM   8320  O O     . GLN C 1 386 ? 117.39400 127.54000 102.53100 1.000 119.02000 ? 631 GLN C O     1 
ATOM   8321  C CB    . GLN C 1 386 ? 116.61300 125.74900 100.20500 1.000 119.02000 ? 631 GLN C CB    1 
ATOM   8322  C CG    . GLN C 1 386 ? 115.77200 126.96000 99.85100  1.000 119.02000 ? 631 GLN C CG    1 
ATOM   8323  C CD    . GLN C 1 386 ? 114.52600 126.57400 99.09500  1.000 119.02000 ? 631 GLN C CD    1 
ATOM   8324  O OE1   . GLN C 1 386 ? 114.25900 125.39400 98.88500  1.000 119.02000 ? 631 GLN C OE1   1 
ATOM   8325  N NE2   . GLN C 1 386 ? 113.76500 127.56700 98.65900  1.000 119.02000 ? 631 GLN C NE2   1 
ATOM   8326  N N     . ARG C 1 387 ? 118.50300 125.68600 103.13600 1.000 119.01000 ? 632 ARG C N     1 
ATOM   8327  C CA    . ARG C 1 387 ? 118.65400 126.09600 104.51800 1.000 119.01000 ? 632 ARG C CA    1 
ATOM   8328  C C     . ARG C 1 387 ? 120.12600 126.03400 104.88900 1.000 119.01000 ? 632 ARG C C     1 
ATOM   8329  O O     . ARG C 1 387 ? 120.75200 124.96900 104.75000 1.000 119.01000 ? 632 ARG C O     1 
ATOM   8330  C CB    . ARG C 1 387 ? 117.82500 125.22100 105.44800 1.000 119.01000 ? 632 ARG C CB    1 
ATOM   8331  C CG    . ARG C 1 387 ? 116.33800 125.45000 105.31000 1.000 119.01000 ? 632 ARG C CG    1 
ATOM   8332  C CD    . ARG C 1 387 ? 115.58200 124.65100 106.34100 1.000 119.01000 ? 632 ARG C CD    1 
ATOM   8333  N NE    . ARG C 1 387 ? 115.66100 123.22100 106.08100 1.000 119.01000 ? 632 ARG C NE    1 
ATOM   8334  C CZ    . ARG C 1 387 ? 116.32800 122.36700 106.84400 1.000 119.01000 ? 632 ARG C CZ    1 
ATOM   8335  N NH1   . ARG C 1 387 ? 116.98800 122.80300 107.90800 1.000 119.01000 ? 632 ARG C NH1   1 
ATOM   8336  N NH2   . ARG C 1 387 ? 116.34400 121.08300 106.53400 1.000 119.01000 ? 632 ARG C NH2   1 
ATOM   8337  N N     . PRO C 1 388 ? 120.72100 127.13200 105.32700 1.000 123.15000 ? 633 PRO C N     1 
ATOM   8338  C CA    . PRO C 1 388 ? 122.13000 127.14200 105.73200 1.000 123.15000 ? 633 PRO C CA    1 
ATOM   8339  C C     . PRO C 1 388 ? 122.35700 126.74500 107.18500 1.000 123.15000 ? 633 PRO C C     1 
ATOM   8340  O O     . PRO C 1 388 ? 123.16700 127.34600 107.89400 1.000 123.15000 ? 633 PRO C O     1 
ATOM   8341  C CB    . PRO C 1 388 ? 122.52700 128.60400 105.51600 1.000 123.15000 ? 633 PRO C CB    1 
ATOM   8342  C CG    . PRO C 1 388 ? 121.49100 129.17400 104.63500 1.000 123.15000 ? 633 PRO C CG    1 
ATOM   8343  C CD    . PRO C 1 388 ? 120.24200 128.48700 105.03400 1.000 123.15000 ? 633 PRO C CD    1 
ATOM   8344  N N     . SER C 1 389 ? 121.65800 125.71600 107.63900 1.000 132.50000 ? 634 SER C N     1 
ATOM   8345  C CA    . SER C 1 389 ? 121.80300 125.32300 109.02600 1.000 132.50000 ? 634 SER C CA    1 
ATOM   8346  C C     . SER C 1 389 ? 123.04200 124.45100 109.19200 1.000 132.50000 ? 634 SER C C     1 
ATOM   8347  O O     . SER C 1 389 ? 123.64400 123.98600 108.22200 1.000 132.50000 ? 634 SER C O     1 
ATOM   8348  C CB    . SER C 1 389 ? 120.55300 124.59100 109.50900 1.000 132.50000 ? 634 SER C CB    1 
ATOM   8349  O OG    . SER C 1 389 ? 120.38900 123.36100 108.82800 1.000 132.50000 ? 634 SER C OG    1 
ATOM   8350  N N     . VAL C 1 390 ? 123.43400 124.24300 110.44600 1.000 129.94000 ? 635 VAL C N     1 
ATOM   8351  C CA    . VAL C 1 390 ? 124.53700 123.33900 110.73400 1.000 129.94000 ? 635 VAL C CA    1 
ATOM   8352  C C     . VAL C 1 390 ? 124.02700 121.90000 110.79900 1.000 129.94000 ? 635 VAL C C     1 
ATOM   8353  O O     . VAL C 1 390 ? 124.82300 120.95400 110.70000 1.000 129.94000 ? 635 VAL C O     1 
ATOM   8354  C CB    . VAL C 1 390 ? 125.23900 123.81900 112.01900 1.000 129.94000 ? 635 VAL C CB    1 
ATOM   8355  C CG1   . VAL C 1 390 ? 126.54900 123.08300 112.28800 1.000 129.94000 ? 635 VAL C CG1   1 
ATOM   8356  C CG2   . VAL C 1 390 ? 125.49800 125.30500 111.92600 1.000 129.94000 ? 635 VAL C CG2   1 
ATOM   8357  N N     . ASP C 1 391 ? 122.70900 121.71200 110.90500 1.000 139.45000 ? 636 ASP C N     1 
ATOM   8358  C CA    . ASP C 1 391 ? 122.12300 120.38200 110.77000 1.000 139.45000 ? 636 ASP C CA    1 
ATOM   8359  C C     . ASP C 1 391 ? 122.32500 119.82800 109.36600 1.000 139.45000 ? 636 ASP C C     1 
ATOM   8360  O O     . ASP C 1 391 ? 122.51200 118.62000 109.18800 1.000 139.45000 ? 636 ASP C O     1 
ATOM   8361  C CB    . ASP C 1 391 ? 120.63000 120.43000 111.10000 1.000 139.45000 ? 636 ASP C CB    1 
ATOM   8362  C CG    . ASP C 1 391 ? 120.35800 120.69600 112.56900 1.000 139.45000 ? 636 ASP C CG    1 
ATOM   8363  O OD1   . ASP C 1 391 ? 121.19300 120.30800 113.41100 1.000 139.45000 ? 636 ASP C OD1   1 
ATOM   8364  O OD2   . ASP C 1 391 ? 119.30500 121.28900 112.88400 1.000 139.45000 ? 636 ASP C OD2   1 
ATOM   8365  N N     . VAL C 1 392 ? 122.29200 120.69300 108.35800 1.000 134.48000 ? 637 VAL C N     1 
ATOM   8366  C CA    . VAL C 1 392 ? 122.48700 120.26900 106.98000 1.000 134.48000 ? 637 VAL C CA    1 
ATOM   8367  C C     . VAL C 1 392 ? 123.96900 120.31500 106.64300 1.000 134.48000 ? 637 VAL C C     1 
ATOM   8368  O O     . VAL C 1 392 ? 124.58300 119.28600 106.34500 1.000 134.48000 ? 637 VAL C O     1 
ATOM   8369  C CB    . VAL C 1 392 ? 121.68200 121.15300 106.01900 1.000 134.48000 ? 637 VAL C CB    1 
ATOM   8370  C CG1   . VAL C 1 392 ? 121.95800 120.75100 104.59300 1.000 134.48000 ? 637 VAL C CG1   1 
ATOM   8371  C CG2   . VAL C 1 392 ? 120.20900 121.05400 106.33500 1.000 134.48000 ? 637 VAL C CG2   1 
ATOM   8372  N N     . ILE C 1 393 ? 124.55600 121.50800 106.69500 1.000 135.30000 ? 638 ILE C N     1 
ATOM   8373  C CA    . ILE C 1 393 ? 125.97900 121.68300 106.41400 1.000 135.30000 ? 638 ILE C CA    1 
ATOM   8374  C C     . ILE C 1 393 ? 126.74400 121.25200 107.66100 1.000 135.30000 ? 638 ILE C C     1 
ATOM   8375  O O     . ILE C 1 393 ? 126.71500 121.93000 108.68700 1.000 135.30000 ? 638 ILE C O     1 
ATOM   8376  C CB    . ILE C 1 393 ? 126.31200 123.12200 106.01900 1.000 135.30000 ? 638 ILE C CB    1 
ATOM   8377  C CG1   . ILE C 1 393 ? 125.63300 123.48100 104.70600 1.000 135.30000 ? 638 ILE C CG1   1 
ATOM   8378  C CG2   . ILE C 1 393 ? 127.80400 123.30800 105.88900 1.000 135.30000 ? 638 ILE C CG2   1 
ATOM   8379  C CD1   . ILE C 1 393 ? 125.75600 124.93000 104.37000 1.000 135.30000 ? 638 ILE C CD1   1 
ATOM   8380  N N     . THR C 1 394 ? 127.42500 120.12300 107.58000 1.000 131.85000 ? 639 THR C N     1 
ATOM   8381  C CA    . THR C 1 394 ? 128.25300 119.64200 108.67000 1.000 131.85000 ? 639 THR C CA    1 
ATOM   8382  C C     . THR C 1 394 ? 129.71200 119.73300 108.26800 1.000 131.85000 ? 639 THR C C     1 
ATOM   8383  O O     . THR C 1 394 ? 130.05600 120.20200 107.18400 1.000 131.85000 ? 639 THR C O     1 
ATOM   8384  C CB    . THR C 1 394 ? 127.89800 118.20500 109.02400 1.000 131.85000 ? 639 THR C CB    1 
ATOM   8385  O OG1   . THR C 1 394 ? 128.20600 117.36400 107.90900 1.000 131.85000 ? 639 THR C OG1   1 
ATOM   8386  C CG2   . THR C 1 394 ? 126.42100 118.10100 109.32900 1.000 131.85000 ? 639 THR C CG2   1 
ATOM   8387  N N     . GLY C 1 395 ? 130.58300 119.25400 109.15300 1.000 125.55000 ? 640 GLY C N     1 
ATOM   8388  C CA    . GLY C 1 395 ? 131.94900 119.01600 108.74300 1.000 125.55000 ? 640 GLY C CA    1 
ATOM   8389  C C     . GLY C 1 395 ? 132.08100 117.86300 107.77500 1.000 125.55000 ? 640 GLY C C     1 
ATOM   8390  O O     . GLY C 1 395 ? 133.06900 117.79300 107.04000 1.000 125.55000 ? 640 GLY C O     1 
ATOM   8391  N N     . LEU C 1 396 ? 131.09400 116.96600 107.75000 1.000 132.05000 ? 641 LEU C N     1 
ATOM   8392  C CA    . LEU C 1 396 ? 131.14800 115.81500 106.86100 1.000 132.05000 ? 641 LEU C CA    1 
ATOM   8393  C C     . LEU C 1 396 ? 130.85900 116.22000 105.42200 1.000 132.05000 ? 641 LEU C C     1 
ATOM   8394  O O     . LEU C 1 396 ? 131.31700 115.55900 104.48400 1.000 132.05000 ? 641 LEU C O     1 
ATOM   8395  C CB    . LEU C 1 396 ? 130.14500 114.76900 107.33600 1.000 132.05000 ? 641 LEU C CB    1 
ATOM   8396  C CG    . LEU C 1 396 ? 130.24900 114.45800 108.83400 1.000 132.05000 ? 641 LEU C CG    1 
ATOM   8397  C CD1   . LEU C 1 396 ? 129.17300 113.48600 109.28800 1.000 132.05000 ? 641 LEU C CD1   1 
ATOM   8398  C CD2   . LEU C 1 396 ? 131.62500 113.95200 109.21700 1.000 132.05000 ? 641 LEU C CD2   1 
ATOM   8399  N N     . ILE C 1 397 ? 130.09200 117.29600 105.23900 1.000 129.08000 ? 642 ILE C N     1 
ATOM   8400  C CA    . ILE C 1 397 ? 129.84100 117.85400 103.91500 1.000 129.08000 ? 642 ILE C CA    1 
ATOM   8401  C C     . ILE C 1 397 ? 130.91200 118.87100 103.56100 1.000 129.08000 ? 642 ILE C C     1 
ATOM   8402  O O     . ILE C 1 397 ? 131.34800 118.96700 102.40900 1.000 129.08000 ? 642 ILE C O     1 
ATOM   8403  C CB    . ILE C 1 397 ? 128.43000 118.46100 103.87700 1.000 129.08000 ? 642 ILE C CB    1 
ATOM   8404  C CG1   . ILE C 1 397 ? 127.41600 117.38000 104.21300 1.000 129.08000 ? 642 ILE C CG1   1 
ATOM   8405  C CG2   . ILE C 1 397 ? 128.11500 119.02600 102.52300 1.000 129.08000 ? 642 ILE C CG2   1 
ATOM   8406  C CD1   . ILE C 1 397 ? 127.49400 116.20400 103.26900 1.000 129.08000 ? 642 ILE C CD1   1 
ATOM   8407  N N     . LYS C 1 398 ? 131.40500 119.59400 104.55800 1.000 121.79000 ? 643 LYS C N     1 
ATOM   8408  C CA    . LYS C 1 398 ? 132.58300 120.43000 104.41400 1.000 121.79000 ? 643 LYS C CA    1 
ATOM   8409  C C     . LYS C 1 398 ? 133.87400 119.63600 104.52500 1.000 121.79000 ? 643 LYS C C     1 
ATOM   8410  O O     . LYS C 1 398 ? 134.93400 120.22800 104.75600 1.000 121.79000 ? 643 LYS C O     1 
ATOM   8411  C CB    . LYS C 1 398 ? 132.56100 121.54400 105.46000 1.000 121.79000 ? 643 LYS C CB    1 
ATOM   8412  C CG    . LYS C 1 398 ? 131.41700 122.51700 105.27600 1.000 121.79000 ? 643 LYS C CG    1 
ATOM   8413  C CD    . LYS C 1 398 ? 131.52300 123.70300 106.21900 1.000 121.79000 ? 643 LYS C CD    1 
ATOM   8414  C CE    . LYS C 1 398 ? 131.13400 123.33500 107.63500 1.000 121.79000 ? 643 LYS C CE    1 
ATOM   8415  N NZ    . LYS C 1 398 ? 131.12700 124.53300 108.51000 1.000 121.79000 ? 643 LYS C NZ    1 
ATOM   8416  N N     . ALA C 1 399 ? 133.80100 118.31100 104.38600 1.000 122.48000 ? 644 ALA C N     1 
ATOM   8417  C CA    . ALA C 1 399 ? 134.99600 117.48300 104.39800 1.000 122.48000 ? 644 ALA C CA    1 
ATOM   8418  C C     . ALA C 1 399 ? 135.83400 117.70500 103.15300 1.000 122.48000 ? 644 ALA C C     1 
ATOM   8419  O O     . ALA C 1 399 ? 137.04900 117.90600 103.24500 1.000 122.48000 ? 644 ALA C O     1 
ATOM   8420  C CB    . ALA C 1 399 ? 134.60600 116.01500 104.51800 1.000 122.48000 ? 644 ALA C CB    1 
ATOM   8421  N N     . ASN C 1 400 ? 135.21300 117.65400 101.97600 1.000 124.49000 ? 645 ASN C N     1 
ATOM   8422  C CA    . ASN C 1 400 ? 135.99500 117.72900 100.75100 1.000 124.49000 ? 645 ASN C CA    1 
ATOM   8423  C C     . ASN C 1 400 ? 135.37700 118.60900 99.67300  1.000 124.49000 ? 645 ASN C C     1 
ATOM   8424  O O     . ASN C 1 400 ? 135.73800 118.45900 98.50100  1.000 124.49000 ? 645 ASN C O     1 
ATOM   8425  C CB    . ASN C 1 400 ? 136.22800 116.33100 100.18400 1.000 124.49000 ? 645 ASN C CB    1 
ATOM   8426  C CG    . ASN C 1 400 ? 137.02900 115.45500 101.11500 1.000 124.49000 ? 645 ASN C CG    1 
ATOM   8427  O OD1   . ASN C 1 400 ? 136.55200 114.41900 101.57000 1.000 124.49000 ? 645 ASN C OD1   1 
ATOM   8428  N ND2   . ASN C 1 400 ? 138.24000 115.88900 101.43900 1.000 124.49000 ? 645 ASN C ND2   1 
ATOM   8429  N N     . ILE C 1 401 ? 134.46900 119.51700 100.01300 1.000 110.53000 ? 646 ILE C N     1 
ATOM   8430  C CA    . ILE C 1 401 ? 133.94000 120.45600 99.03000  1.000 110.53000 ? 646 ILE C CA    1 
ATOM   8431  C C     . ILE C 1 401 ? 134.30800 121.85700 99.49400  1.000 110.53000 ? 646 ILE C C     1 
ATOM   8432  O O     . ILE C 1 401 ? 133.54200 122.49500 100.22900 1.000 110.53000 ? 646 ILE C O     1 
ATOM   8433  C CB    . ILE C 1 401 ? 132.42800 120.28900 98.85500  1.000 110.53000 ? 646 ILE C CB    1 
ATOM   8434  C CG1   . ILE C 1 401 ? 132.12600 118.85400 98.44900  1.000 110.53000 ? 646 ILE C CG1   1 
ATOM   8435  C CG2   . ILE C 1 401 ? 131.91400 121.21300 97.77100  1.000 110.53000 ? 646 ILE C CG2   1 
ATOM   8436  C CD1   . ILE C 1 401 ? 130.68600 118.49500 98.51000  1.000 110.53000 ? 646 ILE C CD1   1 
ATOM   8437  N N     . PRO C 1 402 ? 135.48600 122.35900 99.13200  1.000 108.20000 ? 647 PRO C N     1 
ATOM   8438  C CA    . PRO C 1 402 ? 135.90300 123.66700 99.64100  1.000 108.20000 ? 647 PRO C CA    1 
ATOM   8439  C C     . PRO C 1 402 ? 135.35200 124.83000 98.85200  1.000 108.20000 ? 647 PRO C C     1 
ATOM   8440  O O     . PRO C 1 402 ? 135.27300 125.93700 99.39800  1.000 108.20000 ? 647 PRO C O     1 
ATOM   8441  C CB    . PRO C 1 402 ? 137.42800 123.61200 99.53500  1.000 108.20000 ? 647 PRO C CB    1 
ATOM   8442  C CG    . PRO C 1 402 ? 137.66300 122.70000 98.39200  1.000 108.20000 ? 647 PRO C CG    1 
ATOM   8443  C CD    . PRO C 1 402 ? 136.57200 121.67300 98.41900  1.000 108.20000 ? 647 PRO C CD    1 
ATOM   8444  N N     . THR C 1 403 ? 134.97400 124.62800 97.59700  1.000 110.40000 ? 648 THR C N     1 
ATOM   8445  C CA    . THR C 1 403 ? 134.46700 125.72200 96.78500  1.000 110.40000 ? 648 THR C CA    1 
ATOM   8446  C C     . THR C 1 403 ? 133.02200 125.98900 97.16000  1.000 110.40000 ? 648 THR C C     1 
ATOM   8447  O O     . THR C 1 403 ? 132.18800 125.08200 97.12600  1.000 110.40000 ? 648 THR C O     1 
ATOM   8448  C CB    . THR C 1 403 ? 134.58000 125.39800 95.30400  1.000 110.40000 ? 648 THR C CB    1 
ATOM   8449  O OG1   . THR C 1 403 ? 135.94800 125.14000 94.98100  1.000 110.40000 ? 648 THR C OG1   1 
ATOM   8450  C CG2   . THR C 1 403 ? 134.13400 126.57200 94.51300  1.000 110.40000 ? 648 THR C CG2   1 
ATOM   8451  N N     . ARG C 1 404 ? 132.72800 127.22600 97.52800  1.000 103.57000 ? 649 ARG C N     1 
ATOM   8452  C CA    . ARG C 1 404 ? 131.42000 127.58800 98.03500  1.000 103.57000 ? 649 ARG C CA    1 
ATOM   8453  C C     . ARG C 1 404 ? 130.81000 128.66300 97.15600  1.000 103.57000 ? 649 ARG C C     1 
ATOM   8454  O O     . ARG C 1 404 ? 131.48000 129.63100 96.79000  1.000 103.57000 ? 649 ARG C O     1 
ATOM   8455  C CB    . ARG C 1 404 ? 131.52300 128.11500 99.45100  1.000 103.57000 ? 649 ARG C CB    1 
ATOM   8456  C CG    . ARG C 1 404 ? 132.33600 127.25300 100.36300 1.000 103.57000 ? 649 ARG C CG    1 
ATOM   8457  C CD    . ARG C 1 404 ? 131.68500 125.93800 100.65700 1.000 103.57000 ? 649 ARG C CD    1 
ATOM   8458  N NE    . ARG C 1 404 ? 132.57600 125.17400 101.50800 1.000 103.57000 ? 649 ARG C NE    1 
ATOM   8459  C CZ    . ARG C 1 404 ? 132.56500 125.23100 102.83100 1.000 103.57000 ? 649 ARG C CZ    1 
ATOM   8460  N NH1   . ARG C 1 404 ? 131.68800 125.99900 103.44900 1.000 103.57000 ? 649 ARG C NH1   1 
ATOM   8461  N NH2   . ARG C 1 404 ? 133.42800 124.51800 103.53100 1.000 103.57000 ? 649 ARG C NH2   1 
ATOM   8462  N N     . ILE C 1 405 ? 129.54000 128.49400 96.82000  1.000 100.43000 ? 650 ILE C N     1 
ATOM   8463  C CA    . ILE C 1 405 ? 128.73500 129.56200 96.25200  1.000 100.43000 ? 650 ILE C CA    1 
ATOM   8464  C C     . ILE C 1 405 ? 127.60300 129.82600 97.22000  1.000 100.43000 ? 650 ILE C C     1 
ATOM   8465  O O     . ILE C 1 405 ? 126.76400 128.95100 97.45400  1.000 100.43000 ? 650 ILE C O     1 
ATOM   8466  C CB    . ILE C 1 405 ? 128.19300 129.21100 94.86200  1.000 100.43000 ? 650 ILE C CB    1 
ATOM   8467  C CG1   . ILE C 1 405 ? 129.31900 129.19600 93.83800  1.000 100.43000 ? 650 ILE C CG1   1 
ATOM   8468  C CG2   . ILE C 1 405 ? 127.11300 130.18400 94.44600  1.000 100.43000 ? 650 ILE C CG2   1 
ATOM   8469  C CD1   . ILE C 1 405 ? 128.86100 128.76400 92.46800  1.000 100.43000 ? 650 ILE C CD1   1 
ATOM   8470  N N     . ALA C 1 406 ? 127.58400 131.01300 97.80100  1.000 100.02000 ? 651 ALA C N     1 
ATOM   8471  C CA    . ALA C 1 406 ? 126.51300 131.39400 98.70100  1.000 100.02000 ? 651 ALA C CA    1 
ATOM   8472  C C     . ALA C 1 406 ? 125.78500 132.57900 98.10900  1.000 100.02000 ? 651 ALA C C     1 
ATOM   8473  O O     . ALA C 1 406 ? 126.41200 133.57000 97.72700  1.000 100.02000 ? 651 ALA C O     1 
ATOM   8474  C CB    . ALA C 1 406 ? 127.03900 131.73800 100.08500 1.000 100.02000 ? 651 ALA C CB    1 
ATOM   8475  N N     . PHE C 1 407 ? 124.47000 132.47000 98.03000  1.000 105.18000 ? 652 PHE C N     1 
ATOM   8476  C CA    . PHE C 1 407 ? 123.62800 133.58500 97.64200  1.000 105.18000 ? 652 PHE C CA    1 
ATOM   8477  C C     . PHE C 1 407 ? 123.33200 134.42500 98.87800  1.000 105.18000 ? 652 PHE C C     1 
ATOM   8478  O O     . PHE C 1 407 ? 124.00800 134.31400 99.90400  1.000 105.18000 ? 652 PHE C O     1 
ATOM   8479  C CB    . PHE C 1 407 ? 122.36500 133.07800 96.96600  1.000 105.18000 ? 652 PHE C CB    1 
ATOM   8480  C CG    . PHE C 1 407 ? 122.61700 132.44300 95.64700  1.000 105.18000 ? 652 PHE C CG    1 
ATOM   8481  C CD1   . PHE C 1 407 ? 122.78700 133.21200 94.52200  1.000 105.18000 ? 652 PHE C CD1   1 
ATOM   8482  C CD2   . PHE C 1 407 ? 122.70800 131.07700 95.53400  1.000 105.18000 ? 652 PHE C CD2   1 
ATOM   8483  C CE1   . PHE C 1 407 ? 123.01400 132.63400 93.30900  1.000 105.18000 ? 652 PHE C CE1   1 
ATOM   8484  C CE2   . PHE C 1 407 ? 122.94400 130.49200 94.31900  1.000 105.18000 ? 652 PHE C CE2   1 
ATOM   8485  C CZ    . PHE C 1 407 ? 123.10300 131.27000 93.20700  1.000 105.18000 ? 652 PHE C CZ    1 
ATOM   8486  N N     . GLN C 1 408 ? 122.34200 135.30400 98.78300  1.000 97.51000  ? 653 GLN C N     1 
ATOM   8487  C CA    . GLN C 1 408 ? 121.94800 136.08800 99.94200  1.000 97.51000  ? 653 GLN C CA    1 
ATOM   8488  C C     . GLN C 1 408 ? 121.31600 135.18800 100.99300 1.000 97.51000  ? 653 GLN C C     1 
ATOM   8489  O O     . GLN C 1 408 ? 120.39800 134.41900 100.70000 1.000 97.51000  ? 653 GLN C O     1 
ATOM   8490  C CB    . GLN C 1 408 ? 120.97500 137.18700 99.54500  1.000 97.51000  ? 653 GLN C CB    1 
ATOM   8491  C CG    . GLN C 1 408 ? 120.57800 138.04900 100.71500 1.000 97.51000  ? 653 GLN C CG    1 
ATOM   8492  C CD    . GLN C 1 408 ? 119.62800 139.14800 100.32900 1.000 97.51000  ? 653 GLN C CD    1 
ATOM   8493  O OE1   . GLN C 1 408 ? 119.23100 139.25900 99.17600  1.000 97.51000  ? 653 GLN C OE1   1 
ATOM   8494  N NE2   . GLN C 1 408 ? 119.24700 139.96700 101.29800 1.000 97.51000  ? 653 GLN C NE2   1 
ATOM   8495  N N     . VAL C 1 409 ? 121.84400 135.25400 102.21100 1.000 96.98000  ? 654 VAL C N     1 
ATOM   8496  C CA    . VAL C 1 409 ? 121.26200 134.57900 103.35700 1.000 96.98000  ? 654 VAL C CA    1 
ATOM   8497  C C     . VAL C 1 409 ? 120.93500 135.63400 104.39500 1.000 96.98000  ? 654 VAL C C     1 
ATOM   8498  O O     . VAL C 1 409 ? 121.43100 136.75500 104.34700 1.000 96.98000  ? 654 VAL C O     1 
ATOM   8499  C CB    . VAL C 1 409 ? 122.18700 133.50600 103.94000 1.000 96.98000  ? 654 VAL C CB    1 
ATOM   8500  C CG1   . VAL C 1 409 ? 122.40300 132.41400 102.92900 1.000 96.98000  ? 654 VAL C CG1   1 
ATOM   8501  C CG2   . VAL C 1 409 ? 123.50000 134.13000 104.33100 1.000 96.98000  ? 654 VAL C CG2   1 
ATOM   8502  N N     . SER C 1 410 ? 120.08300 135.26000 105.34100 1.000 106.36000 ? 655 SER C N     1 
ATOM   8503  C CA    . SER C 1 410 ? 119.51900 136.20200 106.29600 1.000 106.36000 ? 655 SER C CA    1 
ATOM   8504  C C     . SER C 1 410 ? 120.12600 136.04700 107.68400 1.000 106.36000 ? 655 SER C C     1 
ATOM   8505  O O     . SER C 1 410 ? 119.47700 136.34400 108.68800 1.000 106.36000 ? 655 SER C O     1 
ATOM   8506  C CB    . SER C 1 410 ? 118.00100 136.04200 106.35600 1.000 106.36000 ? 655 SER C CB    1 
ATOM   8507  O OG    . SER C 1 410 ? 117.64400 134.76100 106.84900 1.000 106.36000 ? 655 SER C OG    1 
ATOM   8508  N N     . SER C 1 411 ? 121.37400 135.60000 107.75800 1.000 112.69000 ? 656 SER C N     1 
ATOM   8509  C CA    . SER C 1 411 ? 121.99100 135.33200 109.04900 1.000 112.69000 ? 656 SER C CA    1 
ATOM   8510  C C     . SER C 1 411 ? 123.49900 135.43900 108.92800 1.000 112.69000 ? 656 SER C C     1 
ATOM   8511  O O     . SER C 1 411 ? 124.10500 134.74000 108.11100 1.000 112.69000 ? 656 SER C O     1 
ATOM   8512  C CB    . SER C 1 411 ? 121.60300 133.94700 109.56300 1.000 112.69000 ? 656 SER C CB    1 
ATOM   8513  O OG    . SER C 1 411 ? 122.34700 133.61100 110.71800 1.000 112.69000 ? 656 SER C OG    1 
ATOM   8514  N N     . LYS C 1 412 ? 124.09300 136.30900 109.74700 1.000 112.58000 ? 657 LYS C N     1 
ATOM   8515  C CA    . LYS C 1 412 ? 125.54500 136.38900 109.83100 1.000 112.58000 ? 657 LYS C CA    1 
ATOM   8516  C C     . LYS C 1 412 ? 126.13900 135.08200 110.33900 1.000 112.58000 ? 657 LYS C C     1 
ATOM   8517  O O     . LYS C 1 412 ? 127.24000 134.69200 109.92300 1.000 112.58000 ? 657 LYS C O     1 
ATOM   8518  C CB    . LYS C 1 412 ? 125.93700 137.56200 110.73100 1.000 112.58000 ? 657 LYS C CB    1 
ATOM   8519  C CG    . LYS C 1 412 ? 127.43600 137.78600 110.88500 1.000 112.58000 ? 657 LYS C CG    1 
ATOM   8520  C CD    . LYS C 1 412 ? 128.08200 138.25600 109.59600 1.000 112.58000 ? 657 LYS C CD    1 
ATOM   8521  C CE    . LYS C 1 412 ? 129.58500 138.37900 109.76600 1.000 112.58000 ? 657 LYS C CE    1 
ATOM   8522  N NZ    . LYS C 1 412 ? 129.95300 139.42400 110.75400 1.000 112.58000 ? 657 LYS C NZ    1 
ATOM   8523  N N     . ILE C 1 413 ? 125.41000 134.38500 111.21500 1.000 112.32000 ? 658 ILE C N     1 
ATOM   8524  C CA    . ILE C 1 413 ? 125.78800 133.03700 111.62100 1.000 112.32000 ? 658 ILE C CA    1 
ATOM   8525  C C     . ILE C 1 413 ? 125.80600 132.10700 110.41600 1.000 112.32000 ? 658 ILE C C     1 
ATOM   8526  O O     . ILE C 1 413 ? 126.72000 131.29200 110.25300 1.000 112.32000 ? 658 ILE C O     1 
ATOM   8527  C CB    . ILE C 1 413 ? 124.82700 132.53100 112.71000 1.000 112.32000 ? 658 ILE C CB    1 
ATOM   8528  C CG1   . ILE C 1 413 ? 124.81200 133.49800 113.89100 1.000 112.32000 ? 658 ILE C CG1   1 
ATOM   8529  C CG2   . ILE C 1 413 ? 125.22400 131.14100 113.17400 1.000 112.32000 ? 658 ILE C CG2   1 
ATOM   8530  C CD1   . ILE C 1 413 ? 126.13800 133.62400 114.58900 1.000 112.32000 ? 658 ILE C CD1   1 
ATOM   8531  N N     . ASP C 1 414 ? 124.83700 132.25600 109.51700 1.000 113.85000 ? 659 ASP C N     1 
ATOM   8532  C CA    . ASP C 1 414 ? 124.87500 131.44700 108.30700 1.000 113.85000 ? 659 ASP C CA    1 
ATOM   8533  C C     . ASP C 1 414 ? 125.93600 131.94500 107.33200 1.000 113.85000 ? 659 ASP C C     1 
ATOM   8534  O O     . ASP C 1 414 ? 126.51200 131.14800 106.57300 1.000 113.85000 ? 659 ASP C O     1 
ATOM   8535  C CB    . ASP C 1 414 ? 123.49700 131.41800 107.66400 1.000 113.85000 ? 659 ASP C CB    1 
ATOM   8536  C CG    . ASP C 1 414 ? 122.48400 130.69600 108.52100 1.000 113.85000 ? 659 ASP C CG    1 
ATOM   8537  O OD1   . ASP C 1 414 ? 122.90700 129.87500 109.35900 1.000 113.85000 ? 659 ASP C OD1   1 
ATOM   8538  O OD2   . ASP C 1 414 ? 121.27100 130.92700 108.34800 1.000 113.85000 ? 659 ASP C OD2   1 
ATOM   8539  N N     . SER C 1 415 ? 126.22500 133.25000 107.36500 1.000 112.73000 ? 660 SER C N     1 
ATOM   8540  C CA    . SER C 1 415 ? 127.29600 133.81500 106.55200 1.000 112.73000 ? 660 SER C CA    1 
ATOM   8541  C C     . SER C 1 415 ? 128.65400 133.25900 106.93900 1.000 112.73000 ? 660 SER C C     1 
ATOM   8542  O O     . SER C 1 415 ? 129.54000 133.14200 106.08600 1.000 112.73000 ? 660 SER C O     1 
ATOM   8543  C CB    . SER C 1 415 ? 127.30600 135.33400 106.68000 1.000 112.73000 ? 660 SER C CB    1 
ATOM   8544  O OG    . SER C 1 415 ? 128.45700 135.88500 106.07100 1.000 112.73000 ? 660 SER C OG    1 
ATOM   8545  N N     . ARG C 1 416 ? 128.84900 132.92100 108.20800 1.000 114.08000 ? 661 ARG C N     1 
ATOM   8546  C CA    . ARG C 1 416 ? 130.04700 132.18200 108.57500 1.000 114.08000 ? 661 ARG C CA    1 
ATOM   8547  C C     . ARG C 1 416 ? 129.82800 130.67300 108.59100 1.000 114.08000 ? 661 ARG C C     1 
ATOM   8548  O O     . ARG C 1 416 ? 130.78400 129.92600 108.81700 1.000 114.08000 ? 661 ARG C O     1 
ATOM   8549  C CB    . ARG C 1 416 ? 130.59700 132.66500 109.92100 1.000 114.08000 ? 661 ARG C CB    1 
ATOM   8550  C CG    . ARG C 1 416 ? 129.67900 132.50900 111.10400 1.000 114.08000 ? 661 ARG C CG    1 
ATOM   8551  C CD    . ARG C 1 416 ? 130.38800 132.96900 112.37000 1.000 114.08000 ? 661 ARG C CD    1 
ATOM   8552  N NE    . ARG C 1 416 ? 130.78600 134.37300 112.30800 1.000 114.08000 ? 661 ARG C NE    1 
ATOM   8553  C CZ    . ARG C 1 416 ? 130.00500 135.38900 112.66100 1.000 114.08000 ? 661 ARG C CZ    1 
ATOM   8554  N NH1   . ARG C 1 416 ? 128.77700 135.15700 113.09700 1.000 114.08000 ? 661 ARG C NH1   1 
ATOM   8555  N NH2   . ARG C 1 416 ? 130.44700 136.63500 112.57500 1.000 114.08000 ? 661 ARG C NH2   1 
ATOM   8556  N N     . THR C 1 417 ? 128.60200 130.20500 108.35300 1.000 108.01000 ? 662 THR C N     1 
ATOM   8557  C CA    . THR C 1 417 ? 128.40100 128.77400 108.16000 1.000 108.01000 ? 662 THR C CA    1 
ATOM   8558  C C     . THR C 1 417 ? 128.90300 128.32800 106.79900 1.000 108.01000 ? 662 THR C C     1 
ATOM   8559  O O     . THR C 1 417 ? 129.71100 127.39700 106.70900 1.000 108.01000 ? 662 THR C O     1 
ATOM   8560  C CB    . THR C 1 417 ? 126.93400 128.40700 108.32000 1.000 108.01000 ? 662 THR C CB    1 
ATOM   8561  O OG1   . THR C 1 417 ? 126.50100 128.74200 109.64200 1.000 108.01000 ? 662 THR C OG1   1 
ATOM   8562  C CG2   . THR C 1 417 ? 126.72900 126.92700 108.07200 1.000 108.01000 ? 662 THR C CG2   1 
ATOM   8563  N N     . ILE C 1 418 ? 128.43000 128.96300 105.72300 1.000 106.06000 ? 663 ILE C N     1 
ATOM   8564  C CA    . ILE C 1 418 ? 128.90700 128.57300 104.39100 1.000 106.06000 ? 663 ILE C CA    1 
ATOM   8565  C C     . ILE C 1 418 ? 130.34400 129.02300 104.19000 1.000 106.06000 ? 663 ILE C C     1 
ATOM   8566  O O     . ILE C 1 418 ? 131.24400 128.21200 103.95200 1.000 106.06000 ? 663 ILE C O     1 
ATOM   8567  C CB    . ILE C 1 418 ? 128.01700 129.13100 103.27100 1.000 106.06000 ? 663 ILE C CB    1 
ATOM   8568  C CG1   . ILE C 1 418 ? 126.62800 128.53100 103.30900 1.000 106.06000 ? 663 ILE C CG1   1 
ATOM   8569  C CG2   . ILE C 1 418 ? 128.63200 128.83300 101.93200 1.000 106.06000 ? 663 ILE C CG2   1 
ATOM   8570  C CD1   . ILE C 1 418 ? 125.65200 129.43200 103.92800 1.000 106.06000 ? 663 ILE C CD1   1 
ATOM   8571  N N     . LEU C 1 419 ? 130.57900 130.32200 104.26600 1.000 111.55000 ? 664 LEU C N     1 
ATOM   8572  C CA    . LEU C 1 419 ? 131.92300 130.82100 104.06800 1.000 111.55000 ? 664 LEU C CA    1 
ATOM   8573  C C     . LEU C 1 419 ? 132.69900 130.75300 105.36800 1.000 111.55000 ? 664 LEU C C     1 
ATOM   8574  O O     . LEU C 1 419 ? 132.15100 130.91300 106.45700 1.000 111.55000 ? 664 LEU C O     1 
ATOM   8575  C CB    . LEU C 1 419 ? 131.91200 132.25500 103.54400 1.000 111.55000 ? 664 LEU C CB    1 
ATOM   8576  C CG    . LEU C 1 419 ? 131.76000 132.46700 102.03800 1.000 111.55000 ? 664 LEU C CG    1 
ATOM   8577  C CD1   . LEU C 1 419 ? 130.34900 132.23500 101.58500 1.000 111.55000 ? 664 LEU C CD1   1 
ATOM   8578  C CD2   . LEU C 1 419 ? 132.20900 133.86100 101.65800 1.000 111.55000 ? 664 LEU C CD2   1 
ATOM   8579  N N     . ASP C 1 420 ? 133.99400 130.50200 105.24200 1.000 122.84000 ? 665 ASP C N     1 
ATOM   8580  C CA    . ASP C 1 420 ? 134.86600 130.65200 106.39200 1.000 122.84000 ? 665 ASP C CA    1 
ATOM   8581  C C     . ASP C 1 420 ? 135.02200 132.11100 106.80900 1.000 122.84000 ? 665 ASP C C     1 
ATOM   8582  O O     . ASP C 1 420 ? 135.37300 132.37300 107.96300 1.000 122.84000 ? 665 ASP C O     1 
ATOM   8583  C CB    . ASP C 1 420 ? 136.21300 129.99400 106.08800 1.000 122.84000 ? 665 ASP C CB    1 
ATOM   8584  C CG    . ASP C 1 420 ? 136.76600 130.39900 104.73900 1.000 122.84000 ? 665 ASP C CG    1 
ATOM   8585  O OD1   . ASP C 1 420 ? 136.07500 131.13600 104.01000 1.000 122.84000 ? 665 ASP C OD1   1 
ATOM   8586  O OD2   . ASP C 1 420 ? 137.88600 129.96300 104.39600 1.000 122.84000 ? 665 ASP C OD2   1 
ATOM   8587  N N     . GLN C 1 421 ? 134.75200 133.06000 105.91500 1.000 114.37000 ? 666 GLN C N     1 
ATOM   8588  C CA    . GLN C 1 421 ? 134.68400 134.46600 106.28200 1.000 114.37000 ? 666 GLN C CA    1 
ATOM   8589  C C     . GLN C 1 421 ? 133.27600 134.80600 106.75600 1.000 114.37000 ? 666 GLN C C     1 
ATOM   8590  O O     . GLN C 1 421 ? 132.44500 133.93000 107.00400 1.000 114.37000 ? 666 GLN C O     1 
ATOM   8591  C CB    . GLN C 1 421 ? 135.07500 135.36900 105.11600 1.000 114.37000 ? 666 GLN C CB    1 
ATOM   8592  C CG    . GLN C 1 421 ? 136.51600 135.26400 104.69200 1.000 114.37000 ? 666 GLN C CG    1 
ATOM   8593  C CD    . GLN C 1 421 ? 136.73000 134.20300 103.64700 1.000 114.37000 ? 666 GLN C CD    1 
ATOM   8594  O OE1   . GLN C 1 421 ? 135.79900 133.80500 102.95500 1.000 114.37000 ? 666 GLN C OE1   1 
ATOM   8595  N NE2   . GLN C 1 421 ? 137.95900 133.72300 103.53800 1.000 114.37000 ? 666 GLN C NE2   1 
ATOM   8596  N N     . GLY C 1 422 ? 133.00000 136.09900 106.88000 1.000 113.00000 ? 667 GLY C N     1 
ATOM   8597  C CA    . GLY C 1 422 ? 131.67100 136.55600 107.21500 1.000 113.00000 ? 667 GLY C CA    1 
ATOM   8598  C C     . GLY C 1 422 ? 131.31600 137.77700 106.39200 1.000 113.00000 ? 667 GLY C C     1 
ATOM   8599  O O     . GLY C 1 422 ? 132.17700 138.42700 105.79700 1.000 113.00000 ? 667 GLY C O     1 
ATOM   8600  N N     . GLY C 1 423 ? 130.02200 138.07800 106.36700 1.000 108.13000 ? 668 GLY C N     1 
ATOM   8601  C CA    . GLY C 1 423 ? 129.51000 139.21800 105.62800 1.000 108.13000 ? 668 GLY C CA    1 
ATOM   8602  C C     . GLY C 1 423 ? 128.55900 138.86800 104.50900 1.000 108.13000 ? 668 GLY C C     1 
ATOM   8603  O O     . GLY C 1 423 ? 128.09800 139.78000 103.81000 1.000 108.13000 ? 668 GLY C O     1 
ATOM   8604  N N     . ALA C 1 424 ? 128.20900 137.59700 104.31800 1.000 103.65000 ? 669 ALA C N     1 
ATOM   8605  C CA    . ALA C 1 424 ? 127.36500 137.16800 103.21300 1.000 103.65000 ? 669 ALA C CA    1 
ATOM   8606  C C     . ALA C 1 424 ? 125.89200 137.41800 103.45300 1.000 103.65000 ? 669 ALA C C     1 
ATOM   8607  O O     . ALA C 1 424 ? 125.06700 136.97600 102.64800 1.000 103.65000 ? 669 ALA C O     1 
ATOM   8608  C CB    . ALA C 1 424 ? 127.58700 135.68400 102.92700 1.000 103.65000 ? 669 ALA C CB    1 
ATOM   8609  N N     . GLU C 1 425 ? 125.53200 138.09300 104.53800 1.000 105.50000 ? 670 GLU C N     1 
ATOM   8610  C CA    . GLU C 1 425 ? 124.16600 138.53100 104.75100 1.000 105.50000 ? 670 GLU C CA    1 
ATOM   8611  C C     . GLU C 1 425 ? 123.89200 139.86800 104.08500 1.000 105.50000 ? 670 GLU C C     1 
ATOM   8612  O O     . GLU C 1 425 ? 122.75400 140.13500 103.68900 1.000 105.50000 ? 670 GLU C O     1 
ATOM   8613  C CB    . GLU C 1 425 ? 123.88200 138.61000 106.25600 1.000 105.50000 ? 670 GLU C CB    1 
ATOM   8614  C CG    . GLU C 1 425 ? 122.43800 138.84600 106.63300 1.000 105.50000 ? 670 GLU C CG    1 
ATOM   8615  C CD    . GLU C 1 425 ? 122.20900 138.76900 108.12400 1.000 105.50000 ? 670 GLU C CD    1 
ATOM   8616  O OE1   . GLU C 1 425 ? 123.19200 138.55500 108.86300 1.000 105.50000 ? 670 GLU C OE1   1 
ATOM   8617  O OE2   . GLU C 1 425 ? 121.04500 138.91500 108.55600 1.000 105.50000 ? 670 GLU C OE2   1 
ATOM   8618  N N     . GLN C 1 426 ? 124.92100 140.67900 103.89400 1.000 95.58000  ? 671 GLN C N     1 
ATOM   8619  C CA    . GLN C 1 426 ? 124.79400 142.00300 103.29300 1.000 95.58000  ? 671 GLN C CA    1 
ATOM   8620  C C     . GLN C 1 426 ? 124.85400 141.93100 101.77500 1.000 95.58000  ? 671 GLN C C     1 
ATOM   8621  O O     . GLN C 1 426 ? 125.70700 142.55100 101.14900 1.000 95.58000  ? 671 GLN C O     1 
ATOM   8622  C CB    . GLN C 1 426 ? 125.88300 142.91700 103.83100 1.000 95.58000  ? 671 GLN C CB    1 
ATOM   8623  C CG    . GLN C 1 426 ? 125.81300 143.13500 105.32400 1.000 95.58000  ? 671 GLN C CG    1 
ATOM   8624  C CD    . GLN C 1 426 ? 126.92300 144.02300 105.82300 1.000 95.58000  ? 671 GLN C CD    1 
ATOM   8625  O OE1   . GLN C 1 426 ? 127.77300 144.45900 105.05200 1.000 95.58000  ? 671 GLN C OE1   1 
ATOM   8626  N NE2   . GLN C 1 426 ? 126.93200 144.28900 107.12000 1.000 95.58000  ? 671 GLN C NE2   1 
ATOM   8627  N N     . LEU C 1 427 ? 123.97700 141.15300 101.16400 1.000 101.96000 ? 672 LEU C N     1 
ATOM   8628  C CA    . LEU C 1 427 ? 123.82700 141.16300 99.72100  1.000 101.96000 ? 672 LEU C CA    1 
ATOM   8629  C C     . LEU C 1 427 ? 122.44600 141.71300 99.36600  1.000 101.96000 ? 672 LEU C C     1 
ATOM   8630  O O     . LEU C 1 427 ? 121.70300 142.16100 100.24400 1.000 101.96000 ? 672 LEU C O     1 
ATOM   8631  C CB    . LEU C 1 427 ? 124.08000 139.76600 99.16600  1.000 101.96000 ? 672 LEU C CB    1 
ATOM   8632  C CG    . LEU C 1 427 ? 125.54000 139.35800 99.26500  1.000 101.96000 ? 672 LEU C CG    1 
ATOM   8633  C CD1   . LEU C 1 427 ? 125.68100 137.94100 98.78500  1.000 101.96000 ? 672 LEU C CD1   1 
ATOM   8634  C CD2   . LEU C 1 427 ? 126.39000 140.30100 98.44100  1.000 101.96000 ? 672 LEU C CD2   1 
ATOM   8635  N N     . LEU C 1 428 ? 122.08900 141.68500 98.08300  1.000 105.43000 ? 673 LEU C N     1 
ATOM   8636  C CA    . LEU C 1 428 ? 120.92600 142.42100 97.62600  1.000 105.43000 ? 673 LEU C CA    1 
ATOM   8637  C C     . LEU C 1 428 ? 119.79200 141.56500 97.10400  1.000 105.43000 ? 673 LEU C C     1 
ATOM   8638  O O     . LEU C 1 428 ? 118.63300 141.96500 97.24200  1.000 105.43000 ? 673 LEU C O     1 
ATOM   8639  C CB    . LEU C 1 428 ? 121.32600 143.40900 96.52900  1.000 105.43000 ? 673 LEU C CB    1 
ATOM   8640  C CG    . LEU C 1 428 ? 122.37900 144.39200 97.01400  1.000 105.43000 ? 673 LEU C CG    1 
ATOM   8641  C CD1   . LEU C 1 428 ? 122.66300 145.35500 95.91200  1.000 105.43000 ? 673 LEU C CD1   1 
ATOM   8642  C CD2   . LEU C 1 428 ? 121.93500 145.10900 98.26500  1.000 105.43000 ? 673 LEU C CD2   1 
ATOM   8643  N N     . GLY C 1 429 ? 120.07200 140.41600 96.51800  1.000 109.23000 ? 674 GLY C N     1 
ATOM   8644  C CA    . GLY C 1 429 ? 119.02700 139.59600 95.95600  1.000 109.23000 ? 674 GLY C CA    1 
ATOM   8645  C C     . GLY C 1 429 ? 118.98600 139.65400 94.44400  1.000 109.23000 ? 674 GLY C C     1 
ATOM   8646  O O     . GLY C 1 429 ? 119.69600 140.42400 93.79200  1.000 109.23000 ? 674 GLY C O     1 
ATOM   8647  N N     . HIS C 1 430 ? 118.11900 138.80100 93.89500  1.000 117.39000 ? 675 HIS C N     1 
ATOM   8648  C CA    . HIS C 1 430 ? 117.87400 138.63900 92.46300  1.000 117.39000 ? 675 HIS C CA    1 
ATOM   8649  C C     . HIS C 1 430 ? 119.15500 138.28500 91.70700  1.000 117.39000 ? 675 HIS C C     1 
ATOM   8650  O O     . HIS C 1 430 ? 119.67300 139.05600 90.89900  1.000 117.39000 ? 675 HIS C O     1 
ATOM   8651  C CB    . HIS C 1 430 ? 117.18700 139.88000 91.89200  1.000 117.39000 ? 675 HIS C CB    1 
ATOM   8652  C CG    . HIS C 1 430 ? 115.88900 140.17700 92.56200  1.000 117.39000 ? 675 HIS C CG    1 
ATOM   8653  N ND1   . HIS C 1 430 ? 114.76200 139.41100 92.36600  1.000 117.39000 ? 675 HIS C ND1   1 
ATOM   8654  C CD2   . HIS C 1 430 ? 115.54700 141.12800 93.46200  1.000 117.39000 ? 675 HIS C CD2   1 
ATOM   8655  C CE1   . HIS C 1 430 ? 113.77500 139.88800 93.10200  1.000 117.39000 ? 675 HIS C CE1   1 
ATOM   8656  N NE2   . HIS C 1 430 ? 114.22500 140.93100 93.77600  1.000 117.39000 ? 675 HIS C NE2   1 
ATOM   8657  N N     . GLY C 1 431 ? 119.66900 137.09900 92.01100  1.000 109.71000 ? 676 GLY C N     1 
ATOM   8658  C CA    . GLY C 1 431 ? 120.80500 136.56000 91.29100  1.000 109.71000 ? 676 GLY C CA    1 
ATOM   8659  C C     . GLY C 1 431 ? 122.14900 137.05300 91.76700  1.000 109.71000 ? 676 GLY C C     1 
ATOM   8660  O O     . GLY C 1 431 ? 123.06100 137.24000 90.95400  1.000 109.71000 ? 676 GLY C O     1 
ATOM   8661  N N     . ASP C 1 432 ? 122.30800 137.26200 93.06600  1.000 105.14000 ? 677 ASP C N     1 
ATOM   8662  C CA    . ASP C 1 432 ? 123.55000 137.76000 93.62900  1.000 105.14000 ? 677 ASP C CA    1 
ATOM   8663  C C     . ASP C 1 432 ? 124.18100 136.66200 94.46500  1.000 105.14000 ? 677 ASP C C     1 
ATOM   8664  O O     . ASP C 1 432 ? 123.56400 136.17200 95.41300  1.000 105.14000 ? 677 ASP C O     1 
ATOM   8665  C CB    . ASP C 1 432 ? 123.29900 138.99300 94.48700  1.000 105.14000 ? 677 ASP C CB    1 
ATOM   8666  C CG    . ASP C 1 432 ? 124.56600 139.73300 94.82500  1.000 105.14000 ? 677 ASP C CG    1 
ATOM   8667  O OD1   . ASP C 1 432 ? 125.64200 139.34100 94.33500  1.000 105.14000 ? 677 ASP C OD1   1 
ATOM   8668  O OD2   . ASP C 1 432 ? 124.49000 140.70700 95.60000  1.000 105.14000 ? 677 ASP C OD2   1 
ATOM   8669  N N     . MET C 1 433 ? 125.41000 136.29300 94.12900  1.000 101.80000 ? 678 MET C N     1 
ATOM   8670  C CA    . MET C 1 433 ? 126.12000 135.24900 94.84800  1.000 101.80000 ? 678 MET C CA    1 
ATOM   8671  C C     . MET C 1 433 ? 127.49300 135.74500 95.26700  1.000 101.80000 ? 678 MET C C     1 
ATOM   8672  O O     . MET C 1 433 ? 128.07500 136.63600 94.64700  1.000 101.80000 ? 678 MET C O     1 
ATOM   8673  C CB    . MET C 1 433 ? 126.27400 133.97500 94.00500  1.000 101.80000 ? 678 MET C CB    1 
ATOM   8674  C CG    . MET C 1 433 ? 127.10800 134.14800 92.75100  1.000 101.80000 ? 678 MET C CG    1 
ATOM   8675  S SD    . MET C 1 433 ? 127.32200 132.65900 91.75400  1.000 101.80000 ? 678 MET C SD    1 
ATOM   8676  C CE    . MET C 1 433 ? 125.72300 132.48000 90.98500  1.000 101.80000 ? 678 MET C CE    1 
ATOM   8677  N N     . LEU C 1 434 ? 128.00400 135.16600 96.34000  1.000 92.24000  ? 679 LEU C N     1 
ATOM   8678  C CA    . LEU C 1 434 ? 129.41300 135.28600 96.66400  1.000 92.24000  ? 679 LEU C CA    1 
ATOM   8679  C C     . LEU C 1 434 ? 130.10400 134.01600 96.21400  1.000 92.24000  ? 679 LEU C C     1 
ATOM   8680  O O     . LEU C 1 434 ? 129.71500 132.91500 96.61500  1.000 92.24000  ? 679 LEU C O     1 
ATOM   8681  C CB    . LEU C 1 434 ? 129.65200 135.52000 98.14900  1.000 92.24000  ? 679 LEU C CB    1 
ATOM   8682  C CG    . LEU C 1 434 ? 129.26800 136.89900 98.65600  1.000 92.24000  ? 679 LEU C CG    1 
ATOM   8683  C CD1   . LEU C 1 434 ? 129.62300 137.03000 100.12200 1.000 92.24000  ? 679 LEU C CD1   1 
ATOM   8684  C CD2   . LEU C 1 434 ? 129.95300 137.96300 97.83700  1.000 92.24000  ? 679 LEU C CD2   1 
ATOM   8685  N N     . TYR C 1 435 ? 131.10600 134.17100 95.36600  1.000 96.80000  ? 680 TYR C N     1 
ATOM   8686  C CA    . TYR C 1 435 ? 131.89300 133.04900 94.89900  1.000 96.80000  ? 680 TYR C CA    1 
ATOM   8687  C C     . TYR C 1 435 ? 133.11600 132.92100 95.77800  1.000 96.80000  ? 680 TYR C C     1 
ATOM   8688  O O     . TYR C 1 435 ? 133.87800 133.87800 95.93600  1.000 96.80000  ? 680 TYR C O     1 
ATOM   8689  C CB    . TYR C 1 435 ? 132.31300 133.23600 93.44800  1.000 96.80000  ? 680 TYR C CB    1 
ATOM   8690  C CG    . TYR C 1 435 ? 133.09400 132.07700 92.91200  1.000 96.80000  ? 680 TYR C CG    1 
ATOM   8691  C CD1   . TYR C 1 435 ? 132.46200 130.89700 92.56900  1.000 96.80000  ? 680 TYR C CD1   1 
ATOM   8692  C CD2   . TYR C 1 435 ? 134.46400 132.16200 92.75000  1.000 96.80000  ? 680 TYR C CD2   1 
ATOM   8693  C CE1   . TYR C 1 435 ? 133.17300 129.83600 92.07900  1.000 96.80000  ? 680 TYR C CE1   1 
ATOM   8694  C CE2   . TYR C 1 435 ? 135.18400 131.10700 92.26300  1.000 96.80000  ? 680 TYR C CE2   1 
ATOM   8695  C CZ    . TYR C 1 435 ? 134.53600 129.94800 91.93300  1.000 96.80000  ? 680 TYR C CZ    1 
ATOM   8696  O OH    . TYR C 1 435 ? 135.26600 128.89600 91.44400  1.000 96.80000  ? 680 TYR C OH    1 
ATOM   8697  N N     . LEU C 1 436 ? 133.29500 131.74100 96.35100  1.000 101.38000 ? 681 LEU C N     1 
ATOM   8698  C CA    . LEU C 1 436 ? 134.45000 131.46100 97.17000  1.000 101.38000 ? 681 LEU C CA    1 
ATOM   8699  C C     . LEU C 1 436 ? 135.31900 130.46600 96.42700  1.000 101.38000 ? 681 LEU C C     1 
ATOM   8700  O O     . LEU C 1 436 ? 134.90200 129.31300 96.25000  1.000 101.38000 ? 681 LEU C O     1 
ATOM   8701  C CB    . LEU C 1 436 ? 134.02800 130.90100 98.51400  1.000 101.38000 ? 681 LEU C CB    1 
ATOM   8702  C CG    . LEU C 1 436 ? 135.17700 130.86300 99.49300  1.000 101.38000 ? 681 LEU C CG    1 
ATOM   8703  C CD1   . LEU C 1 436 ? 135.60200 132.28500 99.77500  1.000 101.38000 ? 681 LEU C CD1   1 
ATOM   8704  C CD2   . LEU C 1 436 ? 134.73700 130.17500 100.75200 1.000 101.38000 ? 681 LEU C CD2   1 
ATOM   8705  N N     . PRO C 1 437 ? 136.51600 130.84700 95.99500  1.000 107.15000 ? 682 PRO C N     1 
ATOM   8706  C CA    . PRO C 1 437 ? 137.26800 130.03700 95.04300  1.000 107.15000 ? 682 PRO C CA    1 
ATOM   8707  C C     . PRO C 1 437 ? 137.84900 128.81100 95.72000  1.000 107.15000 ? 682 PRO C C     1 
ATOM   8708  O O     . PRO C 1 437 ? 137.75000 128.67800 96.94800  1.000 107.15000 ? 682 PRO C O     1 
ATOM   8709  C CB    . PRO C 1 437 ? 138.37300 130.99800 94.58200  1.000 107.15000 ? 682 PRO C CB    1 
ATOM   8710  C CG    . PRO C 1 437 ? 138.61100 131.84200 95.74800  1.000 107.15000 ? 682 PRO C CG    1 
ATOM   8711  C CD    . PRO C 1 437 ? 137.27400 132.03500 96.41100  1.000 107.15000 ? 682 PRO C CD    1 
ATOM   8712  N N     . PRO C 1 438 ? 138.40800 127.86900 94.95400  1.000 111.09000 ? 683 PRO C N     1 
ATOM   8713  C CA    . PRO C 1 438 ? 139.17600 126.78700 95.57800  1.000 111.09000 ? 683 PRO C CA    1 
ATOM   8714  C C     . PRO C 1 438 ? 140.33900 127.28500 96.41400  1.000 111.09000 ? 683 PRO C C     1 
ATOM   8715  O O     . PRO C 1 438 ? 141.27400 127.91900 95.92000  1.000 111.09000 ? 683 PRO C O     1 
ATOM   8716  C CB    . PRO C 1 438 ? 139.66400 125.97100 94.37700  1.000 111.09000 ? 683 PRO C CB    1 
ATOM   8717  C CG    . PRO C 1 438 ? 138.63400 126.18700 93.36100  1.000 111.09000 ? 683 PRO C CG    1 
ATOM   8718  C CD    . PRO C 1 438 ? 138.16200 127.59400 93.52700  1.000 111.09000 ? 683 PRO C CD    1 
ATOM   8719  N N     . GLY C 1 439 ? 140.25100 127.02000 97.70700  1.000 127.34000 ? 684 GLY C N     1 
ATOM   8720  C CA    . GLY C 1 439 ? 141.35800 127.26800 98.59400  1.000 127.34000 ? 684 GLY C CA    1 
ATOM   8721  C C     . GLY C 1 439 ? 141.42600 128.65300 99.18300  1.000 127.34000 ? 684 GLY C C     1 
ATOM   8722  O O     . GLY C 1 439 ? 141.02800 128.84500 100.33500 1.000 127.34000 ? 684 GLY C O     1 
ATOM   8723  N N     . THR C 1 440 ? 141.91300 129.61900 98.41100  1.000 125.35000 ? 685 THR C N     1 
ATOM   8724  C CA    . THR C 1 440 ? 142.34100 130.88500 98.99000  1.000 125.35000 ? 685 THR C CA    1 
ATOM   8725  C C     . THR C 1 440 ? 141.15800 131.72000 99.46000  1.000 125.35000 ? 685 THR C C     1 
ATOM   8726  O O     . THR C 1 440 ? 140.08400 131.71800 98.85300  1.000 125.35000 ? 685 THR C O     1 
ATOM   8727  C CB    . THR C 1 440 ? 143.19900 131.66900 97.99400  1.000 125.35000 ? 685 THR C CB    1 
ATOM   8728  O OG1   . THR C 1 440 ? 143.58500 132.92400 98.57100  1.000 125.35000 ? 685 THR C OG1   1 
ATOM   8729  C CG2   . THR C 1 440 ? 142.47600 131.88800 96.67300  1.000 125.35000 ? 685 THR C CG2   1 
ATOM   8730  N N     . GLY C 1 441 ? 141.34900 132.39400 100.58800 1.000 114.08000 ? 686 GLY C N     1 
ATOM   8731  C CA    . GLY C 1 441 ? 140.26700 133.13800 101.18700 1.000 114.08000 ? 686 GLY C CA    1 
ATOM   8732  C C     . GLY C 1 441 ? 140.18700 134.54600 100.65200 1.000 114.08000 ? 686 GLY C C     1 
ATOM   8733  O O     . GLY C 1 441 ? 140.84000 135.46200 101.15700 1.000 114.08000 ? 686 GLY C O     1 
ATOM   8734  N N     . LEU C 1 442 ? 139.36200 134.72000 99.64100  1.000 116.16000 ? 687 LEU C N     1 
ATOM   8735  C CA    . LEU C 1 442 ? 139.16200 136.00000 98.99000  1.000 116.16000 ? 687 LEU C CA    1 
ATOM   8736  C C     . LEU C 1 442 ? 137.82000 135.90800 98.28000  1.000 116.16000 ? 687 LEU C C     1 
ATOM   8737  O O     . LEU C 1 442 ? 137.76200 135.47500 97.12300  1.000 116.16000 ? 687 LEU C O     1 
ATOM   8738  C CB    . LEU C 1 442 ? 140.32400 136.30300 98.03800  1.000 116.16000 ? 687 LEU C CB    1 
ATOM   8739  C CG    . LEU C 1 442 ? 140.55000 137.70100 97.45000  1.000 116.16000 ? 687 LEU C CG    1 
ATOM   8740  C CD1   . LEU C 1 442 ? 139.76600 137.95100 96.17600  1.000 116.16000 ? 687 LEU C CD1   1 
ATOM   8741  C CD2   . LEU C 1 442 ? 140.21500 138.76500 98.49500  1.000 116.16000 ? 687 LEU C CD2   1 
ATOM   8742  N N     . PRO C 1 443 ? 136.71900 136.25300 98.95500  1.000 105.30000 ? 688 PRO C N     1 
ATOM   8743  C CA    . PRO C 1 443 ? 135.39000 136.02100 98.38000  1.000 105.30000 ? 688 PRO C CA    1 
ATOM   8744  C C     . PRO C 1 443 ? 135.07900 136.90700 97.19300  1.000 105.30000 ? 688 PRO C C     1 
ATOM   8745  O O     . PRO C 1 443 ? 134.90700 138.12000 97.32900  1.000 105.30000 ? 688 PRO C O     1 
ATOM   8746  C CB    . PRO C 1 443 ? 134.45000 136.32800 99.54900  1.000 105.30000 ? 688 PRO C CB    1 
ATOM   8747  C CG    . PRO C 1 443 ? 135.28000 136.17100 100.75400 1.000 105.30000 ? 688 PRO C CG    1 
ATOM   8748  C CD    . PRO C 1 443 ? 136.63600 136.64600 100.36700 1.000 105.30000 ? 688 PRO C CD    1 
ATOM   8749  N N     . ILE C 1 444 ? 135.01900 136.29300 96.01600  1.000 101.19000 ? 689 ILE C N     1 
ATOM   8750  C CA    . ILE C 1 444 ? 134.60400 136.99800 94.81700  1.000 101.19000 ? 689 ILE C CA    1 
ATOM   8751  C C     . ILE C 1 444 ? 133.10500 137.24900 94.88700  1.000 101.19000 ? 689 ILE C C     1 
ATOM   8752  O O     . ILE C 1 444 ? 132.33400 136.37200 95.29400  1.000 101.19000 ? 689 ILE C O     1 
ATOM   8753  C CB    . ILE C 1 444 ? 134.98100 136.16600 93.58100  1.000 101.19000 ? 689 ILE C CB    1 
ATOM   8754  C CG1   . ILE C 1 444 ? 136.48000 135.90100 93.56200  1.000 101.19000 ? 689 ILE C CG1   1 
ATOM   8755  C CG2   . ILE C 1 444 ? 134.60300 136.87400 92.31000  1.000 101.19000 ? 689 ILE C CG2   1 
ATOM   8756  C CD1   . ILE C 1 444 ? 137.31000 137.15000 93.44000  1.000 101.19000 ? 689 ILE C CD1   1 
ATOM   8757  N N     . ARG C 1 445 ? 132.68200 138.45700 94.51900  1.000 96.44000  ? 690 ARG C N     1 
ATOM   8758  C CA    . ARG C 1 445 ? 131.26600 138.77800 94.41200  1.000 96.44000  ? 690 ARG C CA    1 
ATOM   8759  C C     . ARG C 1 445 ? 130.84900 138.68800 92.95400  1.000 96.44000  ? 690 ARG C C     1 
ATOM   8760  O O     . ARG C 1 445 ? 131.40500 139.38700 92.10400  1.000 96.44000  ? 690 ARG C O     1 
ATOM   8761  C CB    . ARG C 1 445 ? 130.96200 140.16500 94.95700  1.000 96.44000  ? 690 ARG C CB    1 
ATOM   8762  C CG    . ARG C 1 445 ? 129.48800 140.43200 94.98700  1.000 96.44000  ? 690 ARG C CG    1 
ATOM   8763  C CD    . ARG C 1 445 ? 129.18400 141.78700 95.56000  1.000 96.44000  ? 690 ARG C CD    1 
ATOM   8764  N NE    . ARG C 1 445 ? 127.74900 142.02500 95.61900  1.000 96.44000  ? 690 ARG C NE    1 
ATOM   8765  C CZ    . ARG C 1 445 ? 127.20000 143.15700 96.04000  1.000 96.44000  ? 690 ARG C CZ    1 
ATOM   8766  N NH1   . ARG C 1 445 ? 127.97000 144.16200 96.42300  1.000 96.44000  ? 690 ARG C NH1   1 
ATOM   8767  N NH2   . ARG C 1 445 ? 125.88200 143.28700 96.06800  1.000 96.44000  ? 690 ARG C NH2   1 
ATOM   8768  N N     . VAL C 1 446 ? 129.87000 137.83900 92.67000  1.000 99.68000  ? 691 VAL C N     1 
ATOM   8769  C CA    . VAL C 1 446 ? 129.46500 137.51000 91.31000  1.000 99.68000  ? 691 VAL C CA    1 
ATOM   8770  C C     . VAL C 1 446 ? 127.97700 137.77400 91.17100  1.000 99.68000  ? 691 VAL C C     1 
ATOM   8771  O O     . VAL C 1 446 ? 127.18100 137.29100 91.98100  1.000 99.68000  ? 691 VAL C O     1 
ATOM   8772  C CB    . VAL C 1 446 ? 129.78700 136.04400 90.97600  1.000 99.68000  ? 691 VAL C CB    1 
ATOM   8773  C CG1   . VAL C 1 446 ? 129.15500 135.63800 89.67300  1.000 99.68000  ? 691 VAL C CG1   1 
ATOM   8774  C CG2   . VAL C 1 446 ? 131.27400 135.84600 90.89400  1.000 99.68000  ? 691 VAL C CG2   1 
ATOM   8775  N N     . HIS C 1 447 ? 127.59500 138.52900 90.15000  1.000 99.17000  ? 692 HIS C N     1 
ATOM   8776  C CA    . HIS C 1 447 ? 126.18500 138.74100 89.86300  1.000 99.17000  ? 692 HIS C CA    1 
ATOM   8777  C C     . HIS C 1 447 ? 125.74700 137.68600 88.86200  1.000 99.17000  ? 692 HIS C C     1 
ATOM   8778  O O     . HIS C 1 447 ? 126.17200 137.70900 87.70500  1.000 99.17000  ? 692 HIS C O     1 
ATOM   8779  C CB    . HIS C 1 447 ? 125.94800 140.14600 89.33400  1.000 99.17000  ? 692 HIS C CB    1 
ATOM   8780  C CG    . HIS C 1 447 ? 126.41500 141.21200 90.26700  1.000 99.17000  ? 692 HIS C CG    1 
ATOM   8781  N ND1   . HIS C 1 447 ? 127.63100 141.84100 90.12400  1.000 99.17000  ? 692 HIS C ND1   1 
ATOM   8782  C CD2   . HIS C 1 447 ? 125.86400 141.71000 91.39700  1.000 99.17000  ? 692 HIS C CD2   1 
ATOM   8783  C CE1   . HIS C 1 447 ? 127.78700 142.71900 91.09700  1.000 99.17000  ? 692 HIS C CE1   1 
ATOM   8784  N NE2   . HIS C 1 447 ? 126.73000 142.65700 91.88500  1.000 99.17000  ? 692 HIS C NE2   1 
ATOM   8785  N N     . GLY C 1 448 ? 124.91200 136.75500 89.31200  1.000 107.87000 ? 693 GLY C N     1 
ATOM   8786  C CA    . GLY C 1 448 ? 124.51300 135.65500 88.46000  1.000 107.87000 ? 693 GLY C CA    1 
ATOM   8787  C C     . GLY C 1 448 ? 123.55300 136.10200 87.37800  1.000 107.87000 ? 693 GLY C C     1 
ATOM   8788  O O     . GLY C 1 448 ? 122.80600 137.06400 87.53400  1.000 107.87000 ? 693 GLY C O     1 
ATOM   8789  N N     . ALA C 1 449 ? 123.58300 135.39100 86.25900  1.000 108.41000 ? 694 ALA C N     1 
ATOM   8790  C CA    . ALA C 1 449 ? 122.82200 135.78500 85.08400  1.000 108.41000 ? 694 ALA C CA    1 
ATOM   8791  C C     . ALA C 1 449 ? 121.41300 135.21900 85.16800  1.000 108.41000 ? 694 ALA C C     1 
ATOM   8792  O O     . ALA C 1 449 ? 121.23200 134.00200 85.24300  1.000 108.41000 ? 694 ALA C O     1 
ATOM   8793  C CB    . ALA C 1 449 ? 123.51300 135.31200 83.80900  1.000 108.41000 ? 694 ALA C CB    1 
ATOM   8794  N N     . PHE C 1 450 ? 120.42000 136.10100 85.15200  1.000 109.00000 ? 695 PHE C N     1 
ATOM   8795  C CA    . PHE C 1 450 ? 119.03300 135.66300 85.18700  1.000 109.00000 ? 695 PHE C CA    1 
ATOM   8796  C C     . PHE C 1 450 ? 118.64500 135.10800 83.82700  1.000 109.00000 ? 695 PHE C C     1 
ATOM   8797  O O     . PHE C 1 450 ? 118.48100 135.86100 82.86400  1.000 109.00000 ? 695 PHE C O     1 
ATOM   8798  C CB    . PHE C 1 450 ? 118.11600 136.81100 85.58400  1.000 109.00000 ? 695 PHE C CB    1 
ATOM   8799  C CG    . PHE C 1 450 ? 116.66500 136.44800 85.57100  1.000 109.00000 ? 695 PHE C CG    1 
ATOM   8800  C CD1   . PHE C 1 450 ? 116.13600 135.61500 86.54300  1.000 109.00000 ? 695 PHE C CD1   1 
ATOM   8801  C CD2   . PHE C 1 450 ? 115.82500 136.93600 84.58400  1.000 109.00000 ? 695 PHE C CD2   1 
ATOM   8802  C CE1   . PHE C 1 450 ? 114.79400 135.28000 86.54200  1.000 109.00000 ? 695 PHE C CE1   1 
ATOM   8803  C CE2   . PHE C 1 450 ? 114.48100 136.59900 84.57200  1.000 109.00000 ? 695 PHE C CE2   1 
ATOM   8804  C CZ    . PHE C 1 450 ? 113.96800 135.77000 85.55400  1.000 109.00000 ? 695 PHE C CZ    1 
ATOM   8805  N N     . VAL C 1 451 ? 118.49500 133.79300 83.74800  1.000 109.26000 ? 696 VAL C N     1 
ATOM   8806  C CA    . VAL C 1 451 ? 118.08000 133.11800 82.53000  1.000 109.26000 ? 696 VAL C CA    1 
ATOM   8807  C C     . VAL C 1 451 ? 116.67200 132.57300 82.74100  1.000 109.26000 ? 696 VAL C C     1 
ATOM   8808  O O     . VAL C 1 451 ? 116.34000 132.06500 83.81600  1.000 109.26000 ? 696 VAL C O     1 
ATOM   8809  C CB    . VAL C 1 451 ? 119.09700 132.02400 82.12900  1.000 109.26000 ? 696 VAL C CB    1 
ATOM   8810  C CG1   . VAL C 1 451 ? 119.27900 130.97700 83.21300  1.000 109.26000 ? 696 VAL C CG1   1 
ATOM   8811  C CG2   . VAL C 1 451 ? 118.71100 131.37400 80.82500  1.000 109.26000 ? 696 VAL C CG2   1 
ATOM   8812  N N     . SER C 1 452 ? 115.82200 132.74500 81.73400  1.000 124.22000 ? 697 SER C N     1 
ATOM   8813  C CA    . SER C 1 452 ? 114.40900 132.44500 81.87800  1.000 124.22000 ? 697 SER C CA    1 
ATOM   8814  C C     . SER C 1 452 ? 114.13400 130.96600 81.65800  1.000 124.22000 ? 697 SER C C     1 
ATOM   8815  O O     . SER C 1 452 ? 114.95500 130.22700 81.11400  1.000 124.22000 ? 697 SER C O     1 
ATOM   8816  C CB    . SER C 1 452 ? 113.58400 133.24400 80.87900  1.000 124.22000 ? 697 SER C CB    1 
ATOM   8817  O OG    . SER C 1 452 ? 113.84200 132.78100 79.56700  1.000 124.22000 ? 697 SER C OG    1 
ATOM   8818  N N     . ASP C 1 453 ? 112.93200 130.55000 82.06300  1.000 128.12000 ? 698 ASP C N     1 
ATOM   8819  C CA    . ASP C 1 453 ? 112.45600 129.20700 81.75900  1.000 128.12000 ? 698 ASP C CA    1 
ATOM   8820  C C     . ASP C 1 453 ? 112.27300 129.01800 80.26300  1.000 128.12000 ? 698 ASP C C     1 
ATOM   8821  O O     . ASP C 1 453 ? 112.38800 127.89000 79.75600  1.000 128.12000 ? 698 ASP C O     1 
ATOM   8822  C CB    . ASP C 1 453 ? 111.13000 128.95400 82.47200  1.000 128.12000 ? 698 ASP C CB    1 
ATOM   8823  C CG    . ASP C 1 453 ? 111.25500 129.01500 83.97800  1.000 128.12000 ? 698 ASP C CG    1 
ATOM   8824  O OD1   . ASP C 1 453 ? 112.35100 128.72500 84.49500  1.000 128.12000 ? 698 ASP C OD1   1 
ATOM   8825  O OD2   . ASP C 1 453 ? 110.25500 129.35200 84.64600  1.000 128.12000 ? 698 ASP C OD2   1 
ATOM   8826  N N     . ASP C 1 454 ? 111.97000 130.11900 79.56700  1.000 135.34000 ? 699 ASP C N     1 
ATOM   8827  C CA    . ASP C 1 454 ? 111.77900 130.11000 78.12300  1.000 135.34000 ? 699 ASP C CA    1 
ATOM   8828  C C     . ASP C 1 454 ? 113.00700 129.58600 77.40300  1.000 135.34000 ? 699 ASP C C     1 
ATOM   8829  O O     . ASP C 1 454 ? 112.90300 128.68900 76.56400  1.000 135.34000 ? 699 ASP C O     1 
ATOM   8830  C CB    . ASP C 1 454 ? 111.44000 131.51600 77.63300  1.000 135.34000 ? 699 ASP C CB    1 
ATOM   8831  C CG    . ASP C 1 454 ? 111.23500 131.57100 76.13800  1.000 135.34000 ? 699 ASP C CG    1 
ATOM   8832  O OD1   . ASP C 1 454 ? 110.18800 131.09000 75.66300  1.000 135.34000 ? 699 ASP C OD1   1 
ATOM   8833  O OD2   . ASP C 1 454 ? 112.12800 132.09000 75.43800  1.000 135.34000 ? 699 ASP C OD2   1 
ATOM   8834  N N     . GLU C 1 455 ? 114.18600 130.10200 77.74700  1.000 136.35000 ? 700 GLU C N     1 
ATOM   8835  C CA    . GLU C 1 455 ? 115.38500 129.62500 77.07500  1.000 136.35000 ? 700 GLU C CA    1 
ATOM   8836  C C     . GLU C 1 455 ? 115.72900 128.20500 77.49100  1.000 136.35000 ? 700 GLU C C     1 
ATOM   8837  O O     . GLU C 1 455 ? 116.32300 127.46900 76.69900  1.000 136.35000 ? 700 GLU C O     1 
ATOM   8838  C CB    . GLU C 1 455 ? 116.55400 130.56200 77.34400  1.000 136.35000 ? 700 GLU C CB    1 
ATOM   8839  C CG    . GLU C 1 455 ? 116.34800 131.92900 76.75300  1.000 136.35000 ? 700 GLU C CG    1 
ATOM   8840  C CD    . GLU C 1 455 ? 117.53100 132.82100 76.97900  1.000 136.35000 ? 700 GLU C CD    1 
ATOM   8841  O OE1   . GLU C 1 455 ? 118.49700 132.37200 77.62100  1.000 136.35000 ? 700 GLU C OE1   1 
ATOM   8842  O OE2   . GLU C 1 455 ? 117.48900 133.97900 76.53900  1.000 136.35000 ? 700 GLU C OE2   1 
ATOM   8843  N N     . VAL C 1 456 ? 115.30100 127.79100 78.68800  1.000 135.51000 ? 701 VAL C N     1 
ATOM   8844  C CA    . VAL C 1 456 ? 115.51100 126.41400 79.13100  1.000 135.51000 ? 701 VAL C CA    1 
ATOM   8845  C C     . VAL C 1 456 ? 114.76800 125.44800 78.21900  1.000 135.51000 ? 701 VAL C C     1 
ATOM   8846  O O     . VAL C 1 456 ? 115.37900 124.59600 77.56300  1.000 135.51000 ? 701 VAL C O     1 
ATOM   8847  C CB    . VAL C 1 456 ? 115.08300 126.24300 80.59900  1.000 135.51000 ? 701 VAL C CB    1 
ATOM   8848  C CG1   . VAL C 1 456 ? 115.17300 124.78800 81.01000  1.000 135.51000 ? 701 VAL C CG1   1 
ATOM   8849  C CG2   . VAL C 1 456 ? 115.94800 127.08400 81.50000  1.000 135.51000 ? 701 VAL C CG2   1 
ATOM   8850  N N     . HIS C 1 457 ? 113.44800 125.59900 78.11600  1.000 129.80000 ? 702 HIS C N     1 
ATOM   8851  C CA    . HIS C 1 457 ? 112.69900 124.68900 77.26000  1.000 129.80000 ? 702 HIS C CA    1 
ATOM   8852  C C     . HIS C 1 457 ? 112.61100 125.16700 75.81300  1.000 129.80000 ? 702 HIS C C     1 
ATOM   8853  O O     . HIS C 1 457 ? 111.74700 124.69700 75.06700  1.000 129.80000 ? 702 HIS C O     1 
ATOM   8854  C CB    . HIS C 1 457 ? 111.30400 124.42000 77.82600  1.000 129.80000 ? 702 HIS C CB    1 
ATOM   8855  C CG    . HIS C 1 457 ? 110.42900 125.62500 77.89500  1.000 129.80000 ? 702 HIS C CG    1 
ATOM   8856  N ND1   . HIS C 1 457 ? 110.41800 126.47700 78.97700  1.000 129.80000 ? 702 HIS C ND1   1 
ATOM   8857  C CD2   . HIS C 1 457 ? 109.53800 126.12500 77.01000  1.000 129.80000 ? 702 HIS C CD2   1 
ATOM   8858  C CE1   . HIS C 1 457 ? 109.54200 127.44200 78.76200  1.000 129.80000 ? 702 HIS C CE1   1 
ATOM   8859  N NE2   . HIS C 1 457 ? 109.00200 127.25800 77.57200  1.000 129.80000 ? 702 HIS C NE2   1 
ATOM   8860  N N     . ARG C 1 458 ? 113.46600 126.10500 75.40900  1.000 132.43000 ? 703 ARG C N     1 
ATOM   8861  C CA    . ARG C 1 458 ? 113.82300 126.22800 74.00100  1.000 132.43000 ? 703 ARG C CA    1 
ATOM   8862  C C     . ARG C 1 458 ? 115.09400 125.46100 73.66900  1.000 132.43000 ? 703 ARG C C     1 
ATOM   8863  O O     . ARG C 1 458 ? 115.16200 124.80600 72.62400  1.000 132.43000 ? 703 ARG C O     1 
ATOM   8864  C CB    . ARG C 1 458 ? 114.00700 127.69200 73.60600  1.000 132.43000 ? 703 ARG C CB    1 
ATOM   8865  C CG    . ARG C 1 458 ? 112.74000 128.46800 73.38700  1.000 132.43000 ? 703 ARG C CG    1 
ATOM   8866  C CD    . ARG C 1 458 ? 113.09600 129.90300 73.09600  1.000 132.43000 ? 703 ARG C CD    1 
ATOM   8867  N NE    . ARG C 1 458 ? 113.75200 130.03700 71.80100  1.000 132.43000 ? 703 ARG C NE    1 
ATOM   8868  C CZ    . ARG C 1 458 ? 114.38100 131.13300 71.39400  1.000 132.43000 ? 703 ARG C CZ    1 
ATOM   8869  N NH1   . ARG C 1 458 ? 114.46200 132.18800 72.18900  1.000 132.43000 ? 703 ARG C NH1   1 
ATOM   8870  N NH2   . ARG C 1 458 ? 114.93800 131.17000 70.19200  1.000 132.43000 ? 703 ARG C NH2   1 
ATOM   8871  N N     . VAL C 1 459 ? 116.11000 125.53800 74.53200  1.000 135.69000 ? 704 VAL C N     1 
ATOM   8872  C CA    . VAL C 1 459 ? 117.35800 124.82600 74.28400  1.000 135.69000 ? 704 VAL C CA    1 
ATOM   8873  C C     . VAL C 1 459 ? 117.16300 123.32400 74.44200  1.000 135.69000 ? 704 VAL C C     1 
ATOM   8874  O O     . VAL C 1 459 ? 117.78900 122.53600 73.72100  1.000 135.69000 ? 704 VAL C O     1 
ATOM   8875  C CB    . VAL C 1 459 ? 118.45000 125.40300 75.20300  1.000 135.69000 ? 704 VAL C CB    1 
ATOM   8876  C CG1   . VAL C 1 459 ? 119.70300 124.57300 75.20000  1.000 135.69000 ? 704 VAL C CG1   1 
ATOM   8877  C CG2   . VAL C 1 459 ? 118.80600 126.77700 74.71500  1.000 135.69000 ? 704 VAL C CG2   1 
ATOM   8878  N N     . VAL C 1 460 ? 116.24600 122.90700 75.32300  1.000 137.37000 ? 705 VAL C N     1 
ATOM   8879  C CA    . VAL C 1 460 ? 115.86000 121.49600 75.41000  1.000 137.37000 ? 705 VAL C CA    1 
ATOM   8880  C C     . VAL C 1 460 ? 115.29800 121.00500 74.07800  1.000 137.37000 ? 705 VAL C C     1 
ATOM   8881  O O     . VAL C 1 460 ? 115.70300 119.95600 73.56100  1.000 137.37000 ? 705 VAL C O     1 
ATOM   8882  C CB    . VAL C 1 460 ? 114.85800 121.29000 76.56200  1.000 137.37000 ? 705 VAL C CB    1 
ATOM   8883  C CG1   . VAL C 1 460 ? 114.19500 119.93300 76.46600  1.000 137.37000 ? 705 VAL C CG1   1 
ATOM   8884  C CG2   . VAL C 1 460 ? 115.56900 121.39000 77.89300  1.000 137.37000 ? 705 VAL C CG2   1 
ATOM   8885  N N     . GLU C 1 461 ? 114.41000 121.79400 73.47200  1.000 140.63000 ? 706 GLU C N     1 
ATOM   8886  C CA    . GLU C 1 461 ? 113.80000 121.39600 72.21000  1.000 140.63000 ? 706 GLU C CA    1 
ATOM   8887  C C     . GLU C 1 461 ? 114.79900 121.44600 71.06300  1.000 140.63000 ? 706 GLU C C     1 
ATOM   8888  O O     . GLU C 1 461 ? 114.77200 120.59200 70.17100  1.000 140.63000 ? 706 GLU C O     1 
ATOM   8889  C CB    . GLU C 1 461 ? 112.60600 122.29200 71.90900  1.000 140.63000 ? 706 GLU C CB    1 
ATOM   8890  C CG    . GLU C 1 461 ? 111.48800 122.15900 72.90600  1.000 140.63000 ? 706 GLU C CG    1 
ATOM   8891  C CD    . GLU C 1 461 ? 110.33000 123.06300 72.57900  1.000 140.63000 ? 706 GLU C CD    1 
ATOM   8892  O OE1   . GLU C 1 461 ? 110.45400 123.85400 71.62300  1.000 140.63000 ? 706 GLU C OE1   1 
ATOM   8893  O OE2   . GLU C 1 461 ? 109.29900 122.99000 73.27900  1.000 140.63000 ? 706 GLU C OE2   1 
ATOM   8894  N N     . ALA C 1 462 ? 115.69700 122.43000 71.07400  1.000 139.12000 ? 707 ALA C N     1 
ATOM   8895  C CA    . ALA C 1 462 ? 116.72600 122.49800 70.04600  1.000 139.12000 ? 707 ALA C CA    1 
ATOM   8896  C C     . ALA C 1 462 ? 117.79400 121.43600 70.23900  1.000 139.12000 ? 707 ALA C C     1 
ATOM   8897  O O     . ALA C 1 462 ? 118.55900 121.15900 69.30900  1.000 139.12000 ? 707 ALA C O     1 
ATOM   8898  C CB    . ALA C 1 462 ? 117.37000 123.88200 70.03400  1.000 139.12000 ? 707 ALA C CB    1 
ATOM   8899  N N     . TRP C 1 463 ? 117.86400 120.84600 71.42700  1.000 138.68000 ? 708 TRP C N     1 
ATOM   8900  C CA    . TRP C 1 463 ? 118.84200 119.82000 71.72000  1.000 138.68000 ? 708 TRP C CA    1 
ATOM   8901  C C     . TRP C 1 463 ? 118.29600 118.41200 71.54000  1.000 138.68000 ? 708 TRP C C     1 
ATOM   8902  O O     . TRP C 1 463 ? 119.08000 117.48300 71.31300  1.000 138.68000 ? 708 TRP C O     1 
ATOM   8903  C CB    . TRP C 1 463 ? 119.36100 120.01700 73.14600  1.000 138.68000 ? 708 TRP C CB    1 
ATOM   8904  C CG    . TRP C 1 463 ? 120.45400 119.10700 73.47300  1.000 138.68000 ? 708 TRP C CG    1 
ATOM   8905  C CD1   . TRP C 1 463 ? 120.38100 118.01500 74.25900  1.000 138.68000 ? 708 TRP C CD1   1 
ATOM   8906  C CD2   . TRP C 1 463 ? 121.79300 119.16200 72.97900  1.000 138.68000 ? 708 TRP C CD2   1 
ATOM   8907  N NE1   . TRP C 1 463 ? 121.59400 117.38400 74.31000  1.000 138.68000 ? 708 TRP C NE1   1 
ATOM   8908  C CE2   . TRP C 1 463 ? 122.48200 118.07400 73.53000  1.000 138.68000 ? 708 TRP C CE2   1 
ATOM   8909  C CE3   . TRP C 1 463 ? 122.47900 120.03200 72.13100  1.000 138.68000 ? 708 TRP C CE3   1 
ATOM   8910  C CZ2   . TRP C 1 463 ? 123.82500 117.83200 73.26600  1.000 138.68000 ? 708 TRP C CZ2   1 
ATOM   8911  C CZ3   . TRP C 1 463 ? 123.81300 119.78500 71.87000  1.000 138.68000 ? 708 TRP C CZ3   1 
ATOM   8912  C CH2   . TRP C 1 463 ? 124.47200 118.70000 72.43600  1.000 138.68000 ? 708 TRP C CH2   1 
ATOM   8913  N N     . LYS C 1 464 ? 116.97100 118.23300 71.57600  1.000 140.16000 ? 709 LYS C N     1 
ATOM   8914  C CA    . LYS C 1 464 ? 116.37800 116.91500 71.34800  1.000 140.16000 ? 709 LYS C CA    1 
ATOM   8915  C C     . LYS C 1 464 ? 116.55700 116.39800 69.92700  1.000 140.16000 ? 709 LYS C C     1 
ATOM   8916  O O     . LYS C 1 464 ? 116.24900 115.22600 69.68800  1.000 140.16000 ? 709 LYS C O     1 
ATOM   8917  C CB    . LYS C 1 464 ? 114.88800 116.92400 71.68000  1.000 140.16000 ? 709 LYS C CB    1 
ATOM   8918  C CG    . LYS C 1 464 ? 114.57100 116.93200 73.15500  1.000 140.16000 ? 709 LYS C CG    1 
ATOM   8919  C CD    . LYS C 1 464 ? 113.07800 116.85900 73.38000  1.000 140.16000 ? 709 LYS C CD    1 
ATOM   8920  C CE    . LYS C 1 464 ? 112.74200 116.88000 74.85600  1.000 140.16000 ? 709 LYS C CE    1 
ATOM   8921  N NZ    . LYS C 1 464 ? 111.27400 116.84300 75.09100  1.000 140.16000 ? 709 LYS C NZ    1 
ATOM   8922  N N     . LEU C 1 465 ? 117.02000 117.23000 68.99100  1.000 144.66000 ? 710 LEU C N     1 
ATOM   8923  C CA    . LEU C 1 465 ? 117.38500 116.75300 67.66300  1.000 144.66000 ? 710 LEU C CA    1 
ATOM   8924  C C     . LEU C 1 465 ? 118.52000 115.74100 67.71800  1.000 144.66000 ? 710 LEU C C     1 
ATOM   8925  O O     . LEU C 1 465 ? 118.55400 114.80100 66.91400  1.000 144.66000 ? 710 LEU C O     1 
ATOM   8926  C CB    . LEU C 1 465 ? 117.78900 117.93800 66.78600  1.000 144.66000 ? 710 LEU C CB    1 
ATOM   8927  C CG    . LEU C 1 465 ? 118.21200 117.63800 65.34900  1.000 144.66000 ? 710 LEU C CG    1 
ATOM   8928  C CD1   . LEU C 1 465 ? 117.05000 117.03200 64.58000  1.000 144.66000 ? 710 LEU C CD1   1 
ATOM   8929  C CD2   . LEU C 1 465 ? 118.74900 118.88300 64.66100  1.000 144.66000 ? 710 LEU C CD2   1 
ATOM   8930  N N     . ARG C 1 466 ? 119.42800 115.89000 68.68200  1.000 142.84000 ? 711 ARG C N     1 
ATOM   8931  C CA    . ARG C 1 466 ? 120.70200 115.18100 68.61800  1.000 142.84000 ? 711 ARG C CA    1 
ATOM   8932  C C     . ARG C 1 466 ? 120.55100 113.71000 68.98200  1.000 142.84000 ? 711 ARG C C     1 
ATOM   8933  O O     . ARG C 1 466 ? 121.43700 112.90300 68.68100  1.000 142.84000 ? 711 ARG C O     1 
ATOM   8934  C CB    . ARG C 1 466 ? 121.73800 115.85900 69.52000  1.000 142.84000 ? 711 ARG C CB    1 
ATOM   8935  C CG    . ARG C 1 466 ? 122.53300 116.99200 68.84900  1.000 142.84000 ? 711 ARG C CG    1 
ATOM   8936  C CD    . ARG C 1 466 ? 121.69600 118.24700 68.66600  1.000 142.84000 ? 711 ARG C CD    1 
ATOM   8937  N NE    . ARG C 1 466 ? 122.44200 119.35300 68.08900  1.000 142.84000 ? 711 ARG C NE    1 
ATOM   8938  C CZ    . ARG C 1 466 ? 121.88800 120.51300 67.76500  1.000 142.84000 ? 711 ARG C CZ    1 
ATOM   8939  N NH1   . ARG C 1 466 ? 120.59200 120.70800 67.97300  1.000 142.84000 ? 711 ARG C NH1   1 
ATOM   8940  N NH2   . ARG C 1 466 ? 122.62700 121.47800 67.24100  1.000 142.84000 ? 711 ARG C NH2   1 
ATOM   8941  N N     . GLY C 1 467 ? 119.44600 113.33500 69.62100  1.000 141.38000 ? 712 GLY C N     1 
ATOM   8942  C CA    . GLY C 1 467 ? 119.22200 111.92500 69.86800  1.000 141.38000 ? 712 GLY C CA    1 
ATOM   8943  C C     . GLY C 1 467 ? 118.10000 111.58400 70.82300  1.000 141.38000 ? 712 GLY C C     1 
ATOM   8944  O O     . GLY C 1 467 ? 117.13600 112.33900 70.97100  1.000 141.38000 ? 712 GLY C O     1 
ATOM   8945  N N     . ALA C 1 468 ? 118.22400 110.43400 71.47000  1.000 145.35000 ? 713 ALA C N     1 
ATOM   8946  C CA    . ALA C 1 468 ? 117.26800 109.88200 72.40700  1.000 145.35000 ? 713 ALA C CA    1 
ATOM   8947  C C     . ALA C 1 468 ? 117.88100 109.79500 73.80200  1.000 145.35000 ? 713 ALA C C     1 
ATOM   8948  O O     . ALA C 1 468 ? 119.10100 109.65300 73.93300  1.000 145.35000 ? 713 ALA C O     1 
ATOM   8949  C CB    . ALA C 1 468 ? 116.82500 108.48700 71.95100  1.000 145.35000 ? 713 ALA C CB    1 
ATOM   8950  N N     . PRO C 1 469 ? 117.06900 109.88300 74.87700  1.000 144.32000 ? 714 PRO C N     1 
ATOM   8951  C CA    . PRO C 1 469 ? 117.63700 109.77400 76.22800  1.000 144.32000 ? 714 PRO C CA    1 
ATOM   8952  C C     . PRO C 1 469 ? 118.08000 108.35900 76.55500  1.000 144.32000 ? 714 PRO C C     1 
ATOM   8953  O O     . PRO C 1 469 ? 117.34300 107.60300 77.19300  1.000 144.32000 ? 714 PRO C O     1 
ATOM   8954  C CB    . PRO C 1 469 ? 116.48500 110.22900 77.13400  1.000 144.32000 ? 714 PRO C CB    1 
ATOM   8955  C CG    . PRO C 1 469 ? 115.26000 109.97400 76.34600  1.000 144.32000 ? 714 PRO C CG    1 
ATOM   8956  C CD    . PRO C 1 469 ? 115.63100 110.21300 74.91500  1.000 144.32000 ? 714 PRO C CD    1 
ATOM   8957  N N     . ASP C 1 470 ? 119.27700 107.99100 76.09800  1.000 148.44000 ? 715 ASP C N     1 
ATOM   8958  C CA    . ASP C 1 470 ? 119.78200 106.64100 76.30400  1.000 148.44000 ? 715 ASP C CA    1 
ATOM   8959  C C     . ASP C 1 470 ? 120.09800 106.41700 77.77300  1.000 148.44000 ? 715 ASP C C     1 
ATOM   8960  O O     . ASP C 1 470 ? 120.69000 107.27600 78.43200  1.000 148.44000 ? 715 ASP C O     1 
ATOM   8961  C CB    . ASP C 1 470 ? 121.02000 106.39800 75.44800  1.000 148.44000 ? 715 ASP C CB    1 
ATOM   8962  C CG    . ASP C 1 470 ? 120.69500 106.31800 73.97200  1.000 148.44000 ? 715 ASP C CG    1 
ATOM   8963  O OD1   . ASP C 1 470 ? 119.56600 105.91100 73.63400  1.000 148.44000 ? 715 ASP C OD1   1 
ATOM   8964  O OD2   . ASP C 1 470 ? 121.56700 106.65900 73.14900  1.000 148.44000 ? 715 ASP C OD2   1 
ATOM   8965  N N     . TYR C 1 471 ? 119.68300 105.26800 78.28700  1.000 142.51000 ? 716 TYR C N     1 
ATOM   8966  C CA    . TYR C 1 471 ? 119.68800 105.00200 79.71300  1.000 142.51000 ? 716 TYR C CA    1 
ATOM   8967  C C     . TYR C 1 471 ? 120.50000 103.75400 80.02700  1.000 142.51000 ? 716 TYR C C     1 
ATOM   8968  O O     . TYR C 1 471 ? 120.52000 102.79400 79.25200  1.000 142.51000 ? 716 TYR C O     1 
ATOM   8969  C CB    . TYR C 1 471 ? 118.26000 104.82300 80.23500  1.000 142.51000 ? 716 TYR C CB    1 
ATOM   8970  C CG    . TYR C 1 471 ? 117.42200 106.08100 80.26100  1.000 142.51000 ? 716 TYR C CG    1 
ATOM   8971  C CD1   . TYR C 1 471 ? 118.01000 107.33600 80.29200  1.000 142.51000 ? 716 TYR C CD1   1 
ATOM   8972  C CD2   . TYR C 1 471 ? 116.03500 106.00800 80.22800  1.000 142.51000 ? 716 TYR C CD2   1 
ATOM   8973  C CE1   . TYR C 1 471 ? 117.24100 108.48300 80.31100  1.000 142.51000 ? 716 TYR C CE1   1 
ATOM   8974  C CE2   . TYR C 1 471 ? 115.25700 107.14900 80.24000  1.000 142.51000 ? 716 TYR C CE2   1 
ATOM   8975  C CZ    . TYR C 1 471 ? 115.86700 108.38200 80.28400  1.000 142.51000 ? 716 TYR C CZ    1 
ATOM   8976  O OH    . TYR C 1 471 ? 115.09900 109.52000 80.29900  1.000 142.51000 ? 716 TYR C OH    1 
ATOM   8977  N N     . ILE C 1 472 ? 121.17200 103.78200 81.17200  1.000 141.95000 ? 717 ILE C N     1 
ATOM   8978  C CA    . ILE C 1 472 ? 121.75100 102.59400 81.78600  1.000 141.95000 ? 717 ILE C CA    1 
ATOM   8979  C C     . ILE C 1 472 ? 120.92800 102.32900 83.03800  1.000 141.95000 ? 717 ILE C C     1 
ATOM   8980  O O     . ILE C 1 472 ? 121.09400 102.99400 84.06500  1.000 141.95000 ? 717 ILE C O     1 
ATOM   8981  C CB    . ILE C 1 472 ? 123.23800 102.76500 82.11000  1.000 141.95000 ? 717 ILE C CB    1 
ATOM   8982  C CG1   . ILE C 1 472 ? 124.03100 103.04500 80.83700  1.000 141.95000 ? 717 ILE C CG1   1 
ATOM   8983  C CG2   . ILE C 1 472 ? 123.78000 101.51700 82.78100  1.000 141.95000 ? 717 ILE C CG2   1 
ATOM   8984  C CD1   . ILE C 1 472 ? 123.96100 101.93500 79.81500  1.000 141.95000 ? 717 ILE C CD1   1 
ATOM   8985  N N     . GLU C 1 473 ? 120.04100 101.34700 82.96400  1.000 144.36000 ? 718 GLU C N     1 
ATOM   8986  C CA    . GLU C 1 473 ? 119.06800 101.11000 84.01800  1.000 144.36000 ? 718 GLU C CA    1 
ATOM   8987  C C     . GLU C 1 473 ? 119.63800 100.34700 85.20500  1.000 144.36000 ? 718 GLU C C     1 
ATOM   8988  O O     . GLU C 1 473 ? 118.87500 99.97100  86.10000  1.000 144.36000 ? 718 GLU C O     1 
ATOM   8989  C CB    . GLU C 1 473 ? 117.87300 100.36700 83.43400  1.000 144.36000 ? 718 GLU C CB    1 
ATOM   8990  C CG    . GLU C 1 473 ? 117.14300 101.18500 82.39300  1.000 144.36000 ? 718 GLU C CG    1 
ATOM   8991  C CD    . GLU C 1 473 ? 116.04000 100.41300 81.71400  1.000 144.36000 ? 718 GLU C CD    1 
ATOM   8992  O OE1   . GLU C 1 473 ? 115.93000 99.19400  81.96000  1.000 144.36000 ? 718 GLU C OE1   1 
ATOM   8993  O OE2   . GLU C 1 473 ? 115.28400 101.02400 80.93100  1.000 144.36000 ? 718 GLU C OE2   1 
ATOM   8994  N N     . ASP C 1 474 ? 120.95000 100.12300 85.24600  1.000 149.33000 ? 719 ASP C N     1 
ATOM   8995  C CA    . ASP C 1 474 ? 121.63400 99.56500  86.40500  1.000 149.33000 ? 719 ASP C CA    1 
ATOM   8996  C C     . ASP C 1 474 ? 121.81400 100.60000 87.51400  1.000 149.33000 ? 719 ASP C C     1 
ATOM   8997  O O     . ASP C 1 474 ? 122.32200 100.27000 88.59100  1.000 149.33000 ? 719 ASP C O     1 
ATOM   8998  C CB    . ASP C 1 474 ? 122.99700 99.01200  85.96400  1.000 149.33000 ? 719 ASP C CB    1 
ATOM   8999  C CG    . ASP C 1 474 ? 123.55800 97.96900  86.91600  1.000 149.33000 ? 719 ASP C CG    1 
ATOM   9000  O OD1   . ASP C 1 474 ? 122.86600 97.58400  87.88100  1.000 149.33000 ? 719 ASP C OD1   1 
ATOM   9001  O OD2   . ASP C 1 474 ? 124.70900 97.53900  86.69700  1.000 149.33000 ? 719 ASP C OD2   1 
ATOM   9002  N N     . ILE C 1 475 ? 121.41100 101.84900 87.26800  1.000 140.27000 ? 720 ILE C N     1 
ATOM   9003  C CA    . ILE C 1 475 ? 121.46500 102.89600 88.27500  1.000 140.27000 ? 720 ILE C CA    1 
ATOM   9004  C C     . ILE C 1 475 ? 120.46000 102.65500 89.40300  1.000 140.27000 ? 720 ILE C C     1 
ATOM   9005  O O     . ILE C 1 475 ? 120.67500 103.10800 90.53400  1.000 140.27000 ? 720 ILE C O     1 
ATOM   9006  C CB    . ILE C 1 475 ? 121.26800 104.25000 87.55800  1.000 140.27000 ? 720 ILE C CB    1 
ATOM   9007  C CG1   . ILE C 1 475 ? 121.47800 105.43100 88.50200  1.000 140.27000 ? 720 ILE C CG1   1 
ATOM   9008  C CG2   . ILE C 1 475 ? 119.92100 104.31600 86.86200  1.000 140.27000 ? 720 ILE C CG2   1 
ATOM   9009  C CD1   . ILE C 1 475 ? 121.56100 106.74900 87.80800  1.000 140.27000 ? 720 ILE C CD1   1 
ATOM   9010  N N     . LEU C 1 476 ? 119.38600 101.91400 89.14600  1.000 134.08000 ? 721 LEU C N     1 
ATOM   9011  C CA    . LEU C 1 476 ? 118.34900 101.73500 90.15200  1.000 134.08000 ? 721 LEU C CA    1 
ATOM   9012  C C     . LEU C 1 476 ? 118.21800 100.27400 90.56900  1.000 134.08000 ? 721 LEU C C     1 
ATOM   9013  O O     . LEU C 1 476 ? 117.96800 99.40100  89.73900  1.000 134.08000 ? 721 LEU C O     1 
ATOM   9014  C CB    . LEU C 1 476 ? 117.02100 102.25400 89.61800  1.000 134.08000 ? 721 LEU C CB    1 
ATOM   9015  C CG    . LEU C 1 476 ? 117.10900 103.71600 89.17600  1.000 134.08000 ? 721 LEU C CG    1 
ATOM   9016  C CD1   . LEU C 1 476 ? 115.82200 104.20000 88.55300  1.000 134.08000 ? 721 LEU C CD1   1 
ATOM   9017  C CD2   . LEU C 1 476 ? 117.55700 104.62900 90.30000  1.000 134.08000 ? 721 LEU C CD2   1 
ATOM   9018  N N     . LEU D 1 70  ? 172.47300 106.02200 97.09800  1.000 120.12000 ? 315 LEU D N     1 
ATOM   9019  C CA    . LEU D 1 70  ? 171.72300 107.27100 97.14900  1.000 120.12000 ? 315 LEU D CA    1 
ATOM   9020  C C     . LEU D 1 70  ? 172.17400 108.20100 96.01900  1.000 120.12000 ? 315 LEU D C     1 
ATOM   9021  O O     . LEU D 1 70  ? 173.34200 108.19400 95.64900  1.000 120.12000 ? 315 LEU D O     1 
ATOM   9022  C CB    . LEU D 1 70  ? 171.88100 107.93000 98.52900  1.000 120.12000 ? 315 LEU D CB    1 
ATOM   9023  C CG    . LEU D 1 70  ? 173.25400 108.28500 99.11500  1.000 120.12000 ? 315 LEU D CG    1 
ATOM   9024  C CD1   . LEU D 1 70  ? 173.74600 109.67700 98.72100  1.000 120.12000 ? 315 LEU D CD1   1 
ATOM   9025  C CD2   . LEU D 1 70  ? 173.21200 108.14700 100.62700 1.000 120.12000 ? 315 LEU D CD2   1 
ATOM   9026  N N     . PRO D 1 71  ? 171.25400 108.98800 95.46800  1.000 119.76000 ? 316 PRO D N     1 
ATOM   9027  C CA    . PRO D 1 71  ? 171.61000 109.88400 94.37500  1.000 119.76000 ? 316 PRO D CA    1 
ATOM   9028  C C     . PRO D 1 71  ? 172.38100 111.08200 94.89000  1.000 119.76000 ? 316 PRO D C     1 
ATOM   9029  O O     . PRO D 1 71  ? 172.29300 111.41900 96.07800  1.000 119.76000 ? 316 PRO D O     1 
ATOM   9030  C CB    . PRO D 1 71  ? 170.24800 110.30500 93.81400  1.000 119.76000 ? 316 PRO D CB    1 
ATOM   9031  C CG    . PRO D 1 71  ? 169.34800 110.21900 94.96500  1.000 119.76000 ? 316 PRO D CG    1 
ATOM   9032  C CD    . PRO D 1 71  ? 169.81500 109.05700 95.77100  1.000 119.76000 ? 316 PRO D CD    1 
ATOM   9033  N N     . PRO D 1 72  ? 173.16100 111.73600 94.03700  1.000 124.48000 ? 317 PRO D N     1 
ATOM   9034  C CA    . PRO D 1 72  ? 173.78800 112.99300 94.44000  1.000 124.48000 ? 317 PRO D CA    1 
ATOM   9035  C C     . PRO D 1 72  ? 172.75400 114.09600 94.54800  1.000 124.48000 ? 317 PRO D C     1 
ATOM   9036  O O     . PRO D 1 72  ? 171.68200 114.04600 93.94300  1.000 124.48000 ? 317 PRO D O     1 
ATOM   9037  C CB    . PRO D 1 72  ? 174.78700 113.27600 93.31400  1.000 124.48000 ? 317 PRO D CB    1 
ATOM   9038  C CG    . PRO D 1 72  ? 174.22900 112.57200 92.14400  1.000 124.48000 ? 317 PRO D CG    1 
ATOM   9039  C CD    . PRO D 1 72  ? 173.57200 111.33400 92.68200  1.000 124.48000 ? 317 PRO D CD    1 
ATOM   9040  N N     . LEU D 1 73  ? 173.10700 115.10600 95.34400  1.000 124.08000 ? 318 LEU D N     1 
ATOM   9041  C CA    . LEU D 1 73  ? 172.19500 116.20800 95.62200  1.000 124.08000 ? 318 LEU D CA    1 
ATOM   9042  C C     . LEU D 1 73  ? 171.93400 117.05400 94.38600  1.000 124.08000 ? 318 LEU D C     1 
ATOM   9043  O O     . LEU D 1 73  ? 170.84600 117.62200 94.24300  1.000 124.08000 ? 318 LEU D O     1 
ATOM   9044  C CB    . LEU D 1 73  ? 172.76700 117.05400 96.75700  1.000 124.08000 ? 318 LEU D CB    1 
ATOM   9045  C CG    . LEU D 1 73  ? 171.98400 118.27600 97.21900  1.000 124.08000 ? 318 LEU D CG    1 
ATOM   9046  C CD1   . LEU D 1 73  ? 170.59400 117.85000 97.60000  1.000 124.08000 ? 318 LEU D CD1   1 
ATOM   9047  C CD2   . LEU D 1 73  ? 172.68400 118.91800 98.39700  1.000 124.08000 ? 318 LEU D CD2   1 
ATOM   9048  N N     . SER D 1 74  ? 172.87000 117.08800 93.46000  1.000 125.51000 ? 319 SER D N     1 
ATOM   9049  C CA    . SER D 1 74  ? 172.78200 117.96100 92.30400  1.000 125.51000 ? 319 SER D CA    1 
ATOM   9050  C C     . SER D 1 74  ? 171.72100 117.55200 91.29700  1.000 125.51000 ? 319 SER D C     1 
ATOM   9051  O O     . SER D 1 74  ? 171.68200 118.22300 90.26600  1.000 125.51000 ? 319 SER D O     1 
ATOM   9052  C CB    . SER D 1 74  ? 174.14100 118.02900 91.61400  1.000 125.51000 ? 319 SER D CB    1 
ATOM   9053  O OG    . SER D 1 74  ? 174.07500 118.85500 90.46700  1.000 125.51000 ? 319 SER D OG    1 
ATOM   9054  N N     . LEU D 1 75  ? 170.86500 116.54800 91.50100  1.000 122.58000 ? 320 LEU D N     1 
ATOM   9055  C CA    . LEU D 1 75  ? 169.84600 116.23900 90.50700  1.000 122.58000 ? 320 LEU D CA    1 
ATOM   9056  C C     . LEU D 1 75  ? 168.72000 117.25900 90.47900  1.000 122.58000 ? 320 LEU D C     1 
ATOM   9057  O O     . LEU D 1 75  ? 167.99300 117.33100 89.48500  1.000 122.58000 ? 320 LEU D O     1 
ATOM   9058  C CB    . LEU D 1 75  ? 169.25900 114.85600 90.75400  1.000 122.58000 ? 320 LEU D CB    1 
ATOM   9059  C CG    . LEU D 1 75  ? 170.23100 113.70300 90.55100  1.000 122.58000 ? 320 LEU D CG    1 
ATOM   9060  C CD1   . LEU D 1 75  ? 169.53400 112.39900 90.85300  1.000 122.58000 ? 320 LEU D CD1   1 
ATOM   9061  C CD2   . LEU D 1 75  ? 170.77700 113.71700 89.13700  1.000 122.58000 ? 320 LEU D CD2   1 
ATOM   9062  N N     . LEU D 1 76  ? 168.55100 118.03800 91.53300  1.000 122.45000 ? 321 LEU D N     1 
ATOM   9063  C CA    . LEU D 1 76  ? 167.47000 119.00100 91.58400  1.000 122.45000 ? 321 LEU D CA    1 
ATOM   9064  C C     . LEU D 1 76  ? 168.01900 120.39500 91.28800  1.000 122.45000 ? 321 LEU D C     1 
ATOM   9065  O O     . LEU D 1 76  ? 169.17900 120.55400 90.89800  1.000 122.45000 ? 321 LEU D O     1 
ATOM   9066  C CB    . LEU D 1 76  ? 166.75700 118.87700 92.93000  1.000 122.45000 ? 321 LEU D CB    1 
ATOM   9067  C CG    . LEU D 1 76  ? 167.53700 119.13700 94.21400  1.000 122.45000 ? 321 LEU D CG    1 
ATOM   9068  C CD1   . LEU D 1 76  ? 167.29300 120.53900 94.72500  1.000 122.45000 ? 321 LEU D CD1   1 
ATOM   9069  C CD2   . LEU D 1 76  ? 167.19100 118.10400 95.26000  1.000 122.45000 ? 321 LEU D CD2   1 
ATOM   9070  N N     . ASP D 1 77  ? 167.17100 121.40700 91.45200  1.000 127.43000 ? 322 ASP D N     1 
ATOM   9071  C CA    . ASP D 1 77  ? 167.50800 122.77500 91.05800  1.000 127.43000 ? 322 ASP D CA    1 
ATOM   9072  C C     . ASP D 1 77  ? 168.59900 123.33500 91.96000  1.000 127.43000 ? 322 ASP D C     1 
ATOM   9073  O O     . ASP D 1 77  ? 168.47200 123.27400 93.18500  1.000 127.43000 ? 322 ASP D O     1 
ATOM   9074  C CB    . ASP D 1 77  ? 166.25700 123.65200 91.14600  1.000 127.43000 ? 322 ASP D CB    1 
ATOM   9075  C CG    . ASP D 1 77  ? 166.42800 125.03400 90.51400  1.000 127.43000 ? 322 ASP D CG    1 
ATOM   9076  O OD1   . ASP D 1 77  ? 167.48900 125.36300 89.95300  1.000 127.43000 ? 322 ASP D OD1   1 
ATOM   9077  O OD2   . ASP D 1 77  ? 165.46000 125.81500 90.59000  1.000 127.43000 ? 322 ASP D OD2   1 
ATOM   9078  N N     . PRO D 1 78  ? 169.67400 123.88900 91.40300  1.000 125.86000 ? 323 PRO D N     1 
ATOM   9079  C CA    . PRO D 1 78  ? 170.60800 124.66500 92.22600  1.000 125.86000 ? 323 PRO D CA    1 
ATOM   9080  C C     . PRO D 1 78  ? 170.02100 125.97800 92.71900  1.000 125.86000 ? 323 PRO D C     1 
ATOM   9081  O O     . PRO D 1 78  ? 168.86200 126.30400 92.44300  1.000 125.86000 ? 323 PRO D O     1 
ATOM   9082  C CB    . PRO D 1 78  ? 171.79400 124.90000 91.28400  1.000 125.86000 ? 323 PRO D CB    1 
ATOM   9083  C CG    . PRO D 1 78  ? 171.23800 124.72700 89.91600  1.000 125.86000 ? 323 PRO D CG    1 
ATOM   9084  C CD    . PRO D 1 78  ? 170.20000 123.66200 90.04800  1.000 125.86000 ? 323 PRO D CD    1 
ATOM   9085  N N     . ALA D 1 79  ? 170.83900 126.74000 93.44100  1.000 135.57000 ? 324 ALA D N     1 
ATOM   9086  C CA    . ALA D 1 79  ? 170.35900 127.89000 94.19200  1.000 135.57000 ? 324 ALA D CA    1 
ATOM   9087  C C     . ALA D 1 79  ? 169.91500 129.02000 93.27200  1.000 135.57000 ? 324 ALA D C     1 
ATOM   9088  O O     . ALA D 1 79  ? 170.46600 129.22600 92.18700  1.000 135.57000 ? 324 ALA D O     1 
ATOM   9089  C CB    . ALA D 1 79  ? 171.44400 128.39700 95.14000  1.000 135.57000 ? 324 ALA D CB    1 
ATOM   9090  N N     . GLU D 1 80  ? 168.88800 129.73800 93.71900  1.000 138.84000 ? 325 GLU D N     1 
ATOM   9091  C CA    . GLU D 1 80  ? 168.39300 130.92900 93.03700  1.000 138.84000 ? 325 GLU D CA    1 
ATOM   9092  C C     . GLU D 1 80  ? 169.47700 131.99300 93.08900  1.000 138.84000 ? 325 GLU D C     1 
ATOM   9093  O O     . GLU D 1 80  ? 169.74600 132.57300 94.14300  1.000 138.84000 ? 325 GLU D O     1 
ATOM   9094  C CB    . GLU D 1 80  ? 167.11000 131.42100 93.69800  1.000 138.84000 ? 325 GLU D CB    1 
ATOM   9095  C CG    . GLU D 1 80  ? 166.48300 132.64400 93.05200  1.000 138.84000 ? 325 GLU D CG    1 
ATOM   9096  C CD    . GLU D 1 80  ? 165.91000 132.36000 91.67700  1.000 138.84000 ? 325 GLU D CD    1 
ATOM   9097  O OE1   . GLU D 1 80  ? 165.51300 131.20400 91.41900  1.000 138.84000 ? 325 GLU D OE1   1 
ATOM   9098  O OE2   . GLU D 1 80  ? 165.85800 133.29500 90.85100  1.000 138.84000 ? 325 GLU D OE2   1 
ATOM   9099  N N     . VAL D 1 81  ? 170.10000 132.27200 91.94700  1.000 141.39000 ? 326 VAL D N     1 
ATOM   9100  C CA    . VAL D 1 81  ? 171.18200 133.24500 91.93000  1.000 141.39000 ? 326 VAL D CA    1 
ATOM   9101  C C     . VAL D 1 81  ? 170.51400 134.60600 91.82500  1.000 141.39000 ? 326 VAL D C     1 
ATOM   9102  O O     . VAL D 1 81  ? 170.38900 135.18200 90.73700  1.000 141.39000 ? 326 VAL D O     1 
ATOM   9103  C CB    . VAL D 1 81  ? 172.16300 132.98100 90.77500  1.000 141.39000 ? 326 VAL D CB    1 
ATOM   9104  C CG1   . VAL D 1 81  ? 173.36800 133.92000 90.85000  1.000 141.39000 ? 326 VAL D CG1   1 
ATOM   9105  C CG2   . VAL D 1 81  ? 172.60100 131.52900 90.78900  1.000 141.39000 ? 326 VAL D CG2   1 
ATOM   9106  N N     . LYS D 1 82  ? 170.06600 135.10800 92.97300  1.000 134.29000 ? 327 LYS D N     1 
ATOM   9107  C CA    . LYS D 1 82  ? 169.25900 136.31200 93.07900  1.000 134.29000 ? 327 LYS D CA    1 
ATOM   9108  C C     . LYS D 1 82  ? 169.15300 136.72600 94.53400  1.000 134.29000 ? 327 LYS D C     1 
ATOM   9109  O O     . LYS D 1 82  ? 168.84100 135.90300 95.40000  1.000 134.29000 ? 327 LYS D O     1 
ATOM   9110  C CB    . LYS D 1 82  ? 167.85300 136.09700 92.51200  1.000 134.29000 ? 327 LYS D CB    1 
ATOM   9111  C CG    . LYS D 1 82  ? 166.96000 137.32400 92.60000  1.000 134.29000 ? 327 LYS D CG    1 
ATOM   9112  C CD    . LYS D 1 82  ? 165.59100 137.07000 91.99900  1.000 134.29000 ? 327 LYS D CD    1 
ATOM   9113  C CE    . LYS D 1 82  ? 164.74200 138.32800 92.03300  1.000 134.29000 ? 327 LYS D CE    1 
ATOM   9114  N NZ    . LYS D 1 82  ? 164.39100 138.71600 93.42500  1.000 134.29000 ? 327 LYS D NZ    1 
ATOM   9115  N N     . GLN D 1 83  ? 169.41700 137.99400 94.81100  1.000 131.01000 ? 328 GLN D N     1 
ATOM   9116  C CA    . GLN D 1 83  ? 169.00100 138.60800 96.06100  1.000 131.01000 ? 328 GLN D CA    1 
ATOM   9117  C C     . GLN D 1 83  ? 168.67600 140.05900 95.75600  1.000 131.01000 ? 328 GLN D C     1 
ATOM   9118  O O     . GLN D 1 83  ? 169.43400 140.73700 95.05700  1.000 131.01000 ? 328 GLN D O     1 
ATOM   9119  C CB    . GLN D 1 83  ? 170.06900 138.45600 97.15900  1.000 131.01000 ? 328 GLN D CB    1 
ATOM   9120  C CG    . GLN D 1 83  ? 171.44900 139.04500 96.88900  1.000 131.01000 ? 328 GLN D CG    1 
ATOM   9121  C CD    . GLN D 1 83  ? 171.57200 140.48100 97.35100  1.000 131.01000 ? 328 GLN D CD    1 
ATOM   9122  O OE1   . GLN D 1 83  ? 170.92200 140.89000 98.30900  1.000 131.01000 ? 328 GLN D OE1   1 
ATOM   9123  N NE2   . GLN D 1 83  ? 172.40600 141.25400 96.66800  1.000 131.01000 ? 328 GLN D NE2   1 
ATOM   9124  N N     . LYS D 1 84  ? 167.51100 140.51100 96.20200  1.000 126.22000 ? 329 LYS D N     1 
ATOM   9125  C CA    . LYS D 1 84  ? 167.13600 141.90900 96.03100  1.000 126.22000 ? 329 LYS D CA    1 
ATOM   9126  C C     . LYS D 1 84  ? 167.42100 142.58900 97.35800  1.000 126.22000 ? 329 LYS D C     1 
ATOM   9127  O O     . LYS D 1 84  ? 166.61900 142.54100 98.29100  1.000 126.22000 ? 329 LYS D O     1 
ATOM   9128  C CB    . LYS D 1 84  ? 165.68300 142.03900 95.60300  1.000 126.22000 ? 329 LYS D CB    1 
ATOM   9129  C CG    . LYS D 1 84  ? 165.28100 143.45000 95.22900  1.000 126.22000 ? 329 LYS D CG    1 
ATOM   9130  C CD    . LYS D 1 84  ? 163.88900 143.46700 94.62600  1.000 126.22000 ? 329 LYS D CD    1 
ATOM   9131  C CE    . LYS D 1 84  ? 163.46000 144.86300 94.19200  1.000 126.22000 ? 329 LYS D CE    1 
ATOM   9132  N NZ    . LYS D 1 84  ? 162.11200 144.85800 93.55100  1.000 126.22000 ? 329 LYS D NZ    1 
ATOM   9133  N N     . SER D 1 85  ? 168.59700 143.20900 97.44400  1.000 138.71000 ? 330 SER D N     1 
ATOM   9134  C CA    . SER D 1 85  ? 169.08800 143.80500 98.68300  1.000 138.71000 ? 330 SER D CA    1 
ATOM   9135  C C     . SER D 1 85  ? 168.26200 145.03500 99.00800  1.000 138.71000 ? 330 SER D C     1 
ATOM   9136  O O     . SER D 1 85  ? 168.46800 146.10900 98.43800  1.000 138.71000 ? 330 SER D O     1 
ATOM   9137  C CB    . SER D 1 85  ? 170.56100 144.17000 98.56300  1.000 138.71000 ? 330 SER D CB    1 
ATOM   9138  O OG    . SER D 1 85  ? 170.99400 144.82000 99.74300  1.000 138.71000 ? 330 SER D OG    1 
ATOM   9139  N N     . TYR D 1 86  ? 167.31000 144.86600 99.91800  1.000 134.76000 ? 331 TYR D N     1 
ATOM   9140  C CA    . TYR D 1 86  ? 166.50600 145.97600 100.40300 1.000 134.76000 ? 331 TYR D CA    1 
ATOM   9141  C C     . TYR D 1 86  ? 167.40700 146.90700 101.19600 1.000 134.76000 ? 331 TYR D C     1 
ATOM   9142  O O     . TYR D 1 86  ? 167.95000 146.51400 102.23400 1.000 134.76000 ? 331 TYR D O     1 
ATOM   9143  C CB    . TYR D 1 86  ? 165.36400 145.44300 101.25700 1.000 134.76000 ? 331 TYR D CB    1 
ATOM   9144  C CG    . TYR D 1 86  ? 164.37100 144.62100 100.47100 1.000 134.76000 ? 331 TYR D CG    1 
ATOM   9145  C CD1   . TYR D 1 86  ? 164.18700 144.82400 99.10800  1.000 134.76000 ? 331 TYR D CD1   1 
ATOM   9146  C CD2   . TYR D 1 86  ? 163.66400 143.59500 101.08000 1.000 134.76000 ? 331 TYR D CD2   1 
ATOM   9147  C CE1   . TYR D 1 86  ? 163.29000 144.05700 98.38500  1.000 134.76000 ? 331 TYR D CE1   1 
ATOM   9148  C CE2   . TYR D 1 86  ? 162.77300 142.81900 100.36500 1.000 134.76000 ? 331 TYR D CE2   1 
ATOM   9149  C CZ    . TYR D 1 86  ? 162.58500 143.05400 99.02100  1.000 134.76000 ? 331 TYR D CZ    1 
ATOM   9150  O OH    . TYR D 1 86  ? 161.69000 142.27900 98.31500  1.000 134.76000 ? 331 TYR D OH    1 
ATOM   9151  N N     . SER D 1 87  ? 167.58600 148.12300 100.68100 1.000 139.36000 ? 332 SER D N     1 
ATOM   9152  C CA    . SER D 1 87  ? 168.66300 148.99900 101.10600 1.000 139.36000 ? 332 SER D CA    1 
ATOM   9153  C C     . SER D 1 87  ? 168.46400 149.46300 102.54300 1.000 139.36000 ? 332 SER D C     1 
ATOM   9154  O O     . SER D 1 87  ? 167.34000 149.46300 103.05200 1.000 139.36000 ? 332 SER D O     1 
ATOM   9155  C CB    . SER D 1 87  ? 168.74000 150.21400 100.18700 1.000 139.36000 ? 332 SER D CB    1 
ATOM   9156  O OG    . SER D 1 87  ? 167.62100 151.05600 100.38400 1.000 139.36000 ? 332 SER D OG    1 
ATOM   9157  N N     . PRO D 1 88  ? 169.55100 149.84400 103.22500 1.000 140.43000 ? 333 PRO D N     1 
ATOM   9158  C CA    . PRO D 1 88  ? 169.39700 150.55200 104.50400 1.000 140.43000 ? 333 PRO D CA    1 
ATOM   9159  C C     . PRO D 1 88  ? 168.62100 151.84300 104.37300 1.000 140.43000 ? 333 PRO D C     1 
ATOM   9160  O O     . PRO D 1 88  ? 167.96800 152.26000 105.33600 1.000 140.43000 ? 333 PRO D O     1 
ATOM   9161  C CB    . PRO D 1 88  ? 170.84500 150.80400 104.93900 1.000 140.43000 ? 333 PRO D CB    1 
ATOM   9162  C CG    . PRO D 1 88  ? 171.61200 149.71700 104.29100 1.000 140.43000 ? 333 PRO D CG    1 
ATOM   9163  C CD    . PRO D 1 88  ? 170.95700 149.49000 102.96600 1.000 140.43000 ? 333 PRO D CD    1 
ATOM   9164  N N     . GLU D 1 89  ? 168.66000 152.47400 103.19900 1.000 141.39000 ? 334 GLU D N     1 
ATOM   9165  C CA    . GLU D 1 89  ? 167.73400 153.55700 102.90200 1.000 141.39000 ? 334 GLU D CA    1 
ATOM   9166  C C     . GLU D 1 89  ? 166.28900 153.07800 102.93800 1.000 141.39000 ? 334 GLU D C     1 
ATOM   9167  O O     . GLU D 1 89  ? 165.44100 153.69500 103.59100 1.000 141.39000 ? 334 GLU D O     1 
ATOM   9168  C CB    . GLU D 1 89  ? 168.06000 154.16300 101.54000 1.000 141.39000 ? 334 GLU D CB    1 
ATOM   9169  C CG    . GLU D 1 89  ? 167.10000 155.25400 101.12400 1.000 141.39000 ? 334 GLU D CG    1 
ATOM   9170  C CD    . GLU D 1 89  ? 167.17400 156.47500 102.01700 1.000 141.39000 ? 334 GLU D CD    1 
ATOM   9171  O OE1   . GLU D 1 89  ? 168.25900 156.75800 102.57200 1.000 141.39000 ? 334 GLU D OE1   1 
ATOM   9172  O OE2   . GLU D 1 89  ? 166.13800 157.15300 102.17400 1.000 141.39000 ? 334 GLU D OE2   1 
ATOM   9173  N N     . SER D 1 90  ? 165.99100 151.96800 102.25600 1.000 133.74000 ? 335 SER D N     1 
ATOM   9174  C CA    . SER D 1 90  ? 164.61000 151.49500 102.18700 1.000 133.74000 ? 335 SER D CA    1 
ATOM   9175  C C     . SER D 1 90  ? 164.14700 150.93700 103.52400 1.000 133.74000 ? 335 SER D C     1 
ATOM   9176  O O     . SER D 1 90  ? 162.99100 151.13300 103.91800 1.000 133.74000 ? 335 SER D O     1 
ATOM   9177  C CB    . SER D 1 90  ? 164.46000 150.44000 101.09400 1.000 133.74000 ? 335 SER D CB    1 
ATOM   9178  O OG    . SER D 1 90  ? 163.12800 149.95900 101.04500 1.000 133.74000 ? 335 SER D OG    1 
ATOM   9179  N N     . LEU D 1 91  ? 165.03900 150.25500 104.24100 1.000 127.19000 ? 336 LEU D N     1 
ATOM   9180  C CA    . LEU D 1 91  ? 164.69000 149.76600 105.56500 1.000 127.19000 ? 336 LEU D CA    1 
ATOM   9181  C C     . LEU D 1 91  ? 164.52100 150.90500 106.55200 1.000 127.19000 ? 336 LEU D C     1 
ATOM   9182  O O     . LEU D 1 91  ? 163.64900 150.83900 107.42200 1.000 127.19000 ? 336 LEU D O     1 
ATOM   9183  C CB    . LEU D 1 91  ? 165.74800 148.79100 106.05300 1.000 127.19000 ? 336 LEU D CB    1 
ATOM   9184  C CG    . LEU D 1 91  ? 165.74700 147.52400 105.21100 1.000 127.19000 ? 336 LEU D CG    1 
ATOM   9185  C CD1   . LEU D 1 91  ? 166.90600 146.62300 105.58700 1.000 127.19000 ? 336 LEU D CD1   1 
ATOM   9186  C CD2   . LEU D 1 91  ? 164.42100 146.80900 105.37200 1.000 127.19000 ? 336 LEU D CD2   1 
ATOM   9187  N N     . GLU D 1 92  ? 165.31100 151.96900 106.41000 1.000 124.49000 ? 337 GLU D N     1 
ATOM   9188  C CA    . GLU D 1 92  ? 165.13700 153.12600 107.27500 1.000 124.49000 ? 337 GLU D CA    1 
ATOM   9189  C C     . GLU D 1 92  ? 163.84100 153.85700 106.95500 1.000 124.49000 ? 337 GLU D C     1 
ATOM   9190  O O     . GLU D 1 92  ? 163.15700 154.35800 107.86000 1.000 124.49000 ? 337 GLU D O     1 
ATOM   9191  C CB    . GLU D 1 92  ? 166.34000 154.05600 107.14200 1.000 124.49000 ? 337 GLU D CB    1 
ATOM   9192  C CG    . GLU D 1 92  ? 166.28600 155.24800 108.06300 1.000 124.49000 ? 337 GLU D CG    1 
ATOM   9193  C CD    . GLU D 1 92  ? 166.32500 154.85600 109.52700 1.000 124.49000 ? 337 GLU D CD    1 
ATOM   9194  O OE1   . GLU D 1 92  ? 166.94900 153.82900 109.87000 1.000 124.49000 ? 337 GLU D OE1   1 
ATOM   9195  O OE2   . GLU D 1 92  ? 165.70800 155.57000 110.34100 1.000 124.49000 ? 337 GLU D OE2   1 
ATOM   9196  N N     . ALA D 1 93  ? 163.47300 153.88900 105.67400 1.000 121.02000 ? 338 ALA D N     1 
ATOM   9197  C CA    . ALA D 1 93  ? 162.19600 154.46400 105.27700 1.000 121.02000 ? 338 ALA D CA    1 
ATOM   9198  C C     . ALA D 1 93  ? 161.03500 153.66000 105.84000 1.000 121.02000 ? 338 ALA D C     1 
ATOM   9199  O O     . ALA D 1 93  ? 160.06100 154.23600 106.33400 1.000 121.02000 ? 338 ALA D O     1 
ATOM   9200  C CB    . ALA D 1 93  ? 162.10800 154.53800 103.75600 1.000 121.02000 ? 338 ALA D CB    1 
ATOM   9201  N N     . MET D 1 94  ? 161.13300 152.32800 105.79600 1.000 110.95000 ? 339 MET D N     1 
ATOM   9202  C CA    . MET D 1 94  ? 160.09600 151.49100 106.39100 1.000 110.95000 ? 339 MET D CA    1 
ATOM   9203  C C     . MET D 1 94  ? 160.04200 151.65700 107.89600 1.000 110.95000 ? 339 MET D C     1 
ATOM   9204  O O     . MET D 1 94  ? 158.95800 151.61400 108.48100 1.000 110.95000 ? 339 MET D O     1 
ATOM   9205  C CB    . MET D 1 94  ? 160.31500 150.02600 106.04100 1.000 110.95000 ? 339 MET D CB    1 
ATOM   9206  C CG    . MET D 1 94  ? 159.95600 149.66000 104.62500 1.000 110.95000 ? 339 MET D CG    1 
ATOM   9207  S SD    . MET D 1 94  ? 158.20500 149.91200 104.28400 1.000 110.95000 ? 339 MET D SD    1 
ATOM   9208  C CE    . MET D 1 94  ? 158.25700 151.33800 103.20000 1.000 110.95000 ? 339 MET D CE    1 
ATOM   9209  N N     . SER D 1 95  ? 161.19400 151.86300 108.53100 1.000 106.78000 ? 340 SER D N     1 
ATOM   9210  C CA    . SER D 1 95  ? 161.21500 152.05900 109.97200 1.000 106.78000 ? 340 SER D CA    1 
ATOM   9211  C C     . SER D 1 95  ? 160.51800 153.35200 110.35800 1.000 106.78000 ? 340 SER D C     1 
ATOM   9212  O O     . SER D 1 95  ? 159.69600 153.37000 111.28200 1.000 106.78000 ? 340 SER D O     1 
ATOM   9213  C CB    . SER D 1 95  ? 162.65000 152.07000 110.47600 1.000 106.78000 ? 340 SER D CB    1 
ATOM   9214  O OG    . SER D 1 95  ? 163.30200 153.24400 110.04000 1.000 106.78000 ? 340 SER D OG    1 
ATOM   9215  N N     . ARG D 1 96  ? 160.80300 154.43500 109.63900 1.000 104.07000 ? 341 ARG D N     1 
ATOM   9216  C CA    . ARG D 1 96  ? 160.13100 155.69000 109.94700 1.000 104.07000 ? 341 ARG D CA    1 
ATOM   9217  C C     . ARG D 1 96  ? 158.66000 155.65100 109.56400 1.000 104.07000 ? 341 ARG D C     1 
ATOM   9218  O O     . ARG D 1 96  ? 157.83300 156.27700 110.23600 1.000 104.07000 ? 341 ARG D O     1 
ATOM   9219  C CB    . ARG D 1 96  ? 160.83700 156.84900 109.25800 1.000 104.07000 ? 341 ARG D CB    1 
ATOM   9220  C CG    . ARG D 1 96  ? 162.26400 157.07400 109.72700 1.000 104.07000 ? 341 ARG D CG    1 
ATOM   9221  C CD    . ARG D 1 96  ? 162.35200 157.80700 111.06900 1.000 104.07000 ? 341 ARG D CD    1 
ATOM   9222  N NE    . ARG D 1 96  ? 162.13200 156.95500 112.23500 1.000 104.07000 ? 341 ARG D NE    1 
ATOM   9223  C CZ    . ARG D 1 96  ? 163.04100 156.13900 112.75400 1.000 104.07000 ? 341 ARG D CZ    1 
ATOM   9224  N NH1   . ARG D 1 96  ? 164.25200 156.05700 112.22500 1.000 104.07000 ? 341 ARG D NH1   1 
ATOM   9225  N NH2   . ARG D 1 96  ? 162.74100 155.40900 113.81500 1.000 104.07000 ? 341 ARG D NH2   1 
ATOM   9226  N N     . LEU D 1 97  ? 158.31100 154.89200 108.52500 1.000 101.22000 ? 342 LEU D N     1 
ATOM   9227  C CA    . LEU D 1 97  ? 156.91100 154.75100 108.15100 1.000 101.22000 ? 342 LEU D CA    1 
ATOM   9228  C C     . LEU D 1 97  ? 156.14200 153.98300 109.21000 1.000 101.22000 ? 342 LEU D C     1 
ATOM   9229  O O     . LEU D 1 97  ? 155.01900 154.36000 109.56300 1.000 101.22000 ? 342 LEU D O     1 
ATOM   9230  C CB    . LEU D 1 97  ? 156.80700 154.05800 106.79600 1.000 101.22000 ? 342 LEU D CB    1 
ATOM   9231  C CG    . LEU D 1 97  ? 155.40100 153.89200 106.22900 1.000 101.22000 ? 342 LEU D CG    1 
ATOM   9232  C CD1   . LEU D 1 97  ? 154.74800 155.24100 106.04800 1.000 101.22000 ? 342 LEU D CD1   1 
ATOM   9233  C CD2   . LEU D 1 97  ? 155.45700 153.15700 104.90600 1.000 101.22000 ? 342 LEU D CD2   1 
ATOM   9234  N N     . LEU D 1 98  ? 156.75400 152.92800 109.74800 1.000 91.11000  ? 343 LEU D N     1 
ATOM   9235  C CA    . LEU D 1 98  ? 156.15000 152.16100 110.82700 1.000 91.11000  ? 343 LEU D CA    1 
ATOM   9236  C C     . LEU D 1 98  ? 156.00000 153.01400 112.07300 1.000 91.11000  ? 343 LEU D C     1 
ATOM   9237  O O     . LEU D 1 98  ? 154.96700 152.94900 112.75700 1.000 91.11000  ? 343 LEU D O     1 
ATOM   9238  C CB    . LEU D 1 98  ? 157.00900 150.92800 111.09600 1.000 91.11000  ? 343 LEU D CB    1 
ATOM   9239  C CG    . LEU D 1 98  ? 156.55200 149.74700 111.94700 1.000 91.11000  ? 343 LEU D CG    1 
ATOM   9240  C CD1   . LEU D 1 98  ? 156.76800 149.94400 113.42900 1.000 91.11000  ? 343 LEU D CD1   1 
ATOM   9241  C CD2   . LEU D 1 98  ? 155.10400 149.49500 111.66200 1.000 91.11000  ? 343 LEU D CD2   1 
ATOM   9242  N N     . GLU D 1 99  ? 157.00300 153.85100 112.35100 1.000 98.77000  ? 344 GLU D N     1 
ATOM   9243  C CA    . GLU D 1 99  ? 156.93700 154.76200 113.48700 1.000 98.77000  ? 344 GLU D CA    1 
ATOM   9244  C C     . GLU D 1 99  ? 155.77700 155.73800 113.35800 1.000 98.77000  ? 344 GLU D C     1 
ATOM   9245  O O     . GLU D 1 99  ? 154.98300 155.89500 114.29100 1.000 98.77000  ? 344 GLU D O     1 
ATOM   9246  C CB    . GLU D 1 99  ? 158.24200 155.53500 113.62400 1.000 98.77000  ? 344 GLU D CB    1 
ATOM   9247  C CG    . GLU D 1 99  ? 158.21900 156.51500 114.78500 1.000 98.77000  ? 344 GLU D CG    1 
ATOM   9248  C CD    . GLU D 1 99  ? 159.48200 157.34700 114.88500 1.000 98.77000  ? 344 GLU D CD    1 
ATOM   9249  O OE1   . GLU D 1 99  ? 160.37200 157.18400 114.02500 1.000 98.77000  ? 344 GLU D OE1   1 
ATOM   9250  O OE2   . GLU D 1 99  ? 159.58100 158.16900 115.82200 1.000 98.77000  ? 344 GLU D OE2   1 
ATOM   9251  N N     . ILE D 1 100 ? 155.64600 156.37900 112.19700 1.000 92.48000  ? 345 ILE D N     1 
ATOM   9252  C CA    . ILE D 1 100 ? 154.62900 157.41400 112.04200 1.000 92.48000  ? 345 ILE D CA    1 
ATOM   9253  C C     . ILE D 1 100 ? 153.23300 156.80100 112.00200 1.000 92.48000  ? 345 ILE D C     1 
ATOM   9254  O O     . ILE D 1 100 ? 152.29300 157.33600 112.60700 1.000 92.48000  ? 345 ILE D O     1 
ATOM   9255  C CB    . ILE D 1 100 ? 154.93400 158.26900 110.80000 1.000 92.48000  ? 345 ILE D CB    1 
ATOM   9256  C CG1   . ILE D 1 100 ? 156.25300 159.01200 111.00300 1.000 92.48000  ? 345 ILE D CG1   1 
ATOM   9257  C CG2   . ILE D 1 100 ? 153.84600 159.28900 110.55100 1.000 92.48000  ? 345 ILE D CG2   1 
ATOM   9258  C CD1   . ILE D 1 100 ? 156.81300 159.62700 109.74700 1.000 92.48000  ? 345 ILE D CD1   1 
ATOM   9259  N N     . LYS D 1 101 ? 153.08200 155.64500 111.34400 1.000 84.77000  ? 346 LYS D N     1 
ATOM   9260  C CA    . LYS D 1 101 ? 151.77300 155.00300 111.29600 1.000 84.77000  ? 346 LYS D CA    1 
ATOM   9261  C C     . LYS D 1 101 ? 151.33600 154.50700 112.66200 1.000 84.77000  ? 346 LYS D C     1 
ATOM   9262  O O     . LYS D 1 101 ? 150.15200 154.59700 112.99900 1.000 84.77000  ? 346 LYS D O     1 
ATOM   9263  C CB    . LYS D 1 101 ? 151.76900 153.85500 110.29700 1.000 84.77000  ? 346 LYS D CB    1 
ATOM   9264  C CG    . LYS D 1 101 ? 151.80300 154.30200 108.86700 1.000 84.77000  ? 346 LYS D CG    1 
ATOM   9265  C CD    . LYS D 1 101 ? 150.50900 154.98600 108.51400 1.000 84.77000  ? 346 LYS D CD    1 
ATOM   9266  C CE    . LYS D 1 101 ? 150.48800 155.38700 107.05700 1.000 84.77000  ? 346 LYS D CE    1 
ATOM   9267  N NZ    . LYS D 1 101 ? 149.23900 156.12100 106.71900 1.000 84.77000  ? 346 LYS D NZ    1 
ATOM   9268  N N     . LEU D 1 102 ? 152.26200 154.01300 113.48100 1.000 80.23000  ? 347 LEU D N     1 
ATOM   9269  C CA    . LEU D 1 102 ? 151.82100 153.65100 114.81900 1.000 80.23000  ? 347 LEU D CA    1 
ATOM   9270  C C     . LEU D 1 102 ? 151.62800 154.86600 115.70700 1.000 80.23000  ? 347 LEU D C     1 
ATOM   9271  O O     . LEU D 1 102 ? 150.82700 154.81400 116.64400 1.000 80.23000  ? 347 LEU D O     1 
ATOM   9272  C CB    . LEU D 1 102 ? 152.78800 152.67300 115.46200 1.000 80.23000  ? 347 LEU D CB    1 
ATOM   9273  C CG    . LEU D 1 102 ? 152.65700 151.29800 114.83600 1.000 80.23000  ? 347 LEU D CG    1 
ATOM   9274  C CD1   . LEU D 1 102 ? 153.66200 150.37400 115.45600 1.000 80.23000  ? 347 LEU D CD1   1 
ATOM   9275  C CD2   . LEU D 1 102 ? 151.25900 150.77600 115.04100 1.000 80.23000  ? 347 LEU D CD2   1 
ATOM   9276  N N     . LYS D 1 103 ? 152.32000 155.96700 115.42600 1.000 88.34000  ? 348 LYS D N     1 
ATOM   9277  C CA    . LYS D 1 103 ? 152.08400 157.17600 116.19900 1.000 88.34000  ? 348 LYS D CA    1 
ATOM   9278  C C     . LYS D 1 103 ? 150.71700 157.75900 115.88500 1.000 88.34000  ? 348 LYS D C     1 
ATOM   9279  O O     . LYS D 1 103 ? 150.10500 158.40200 116.74400 1.000 88.34000  ? 348 LYS D O     1 
ATOM   9280  C CB    . LYS D 1 103 ? 153.18900 158.19200 115.92100 1.000 88.34000  ? 348 LYS D CB    1 
ATOM   9281  C CG    . LYS D 1 103 ? 153.14400 159.45000 116.76700 1.000 88.34000  ? 348 LYS D CG    1 
ATOM   9282  C CD    . LYS D 1 103 ? 154.34300 160.33300 116.48900 1.000 88.34000  ? 348 LYS D CD    1 
ATOM   9283  C CE    . LYS D 1 103 ? 154.20800 161.67000 117.18600 1.000 88.34000  ? 348 LYS D CE    1 
ATOM   9284  N NZ    . LYS D 1 103 ? 154.21700 161.50600 118.66100 1.000 88.34000  ? 348 LYS D NZ    1 
ATOM   9285  N N     . GLU D 1 104 ? 150.21300 157.51700 114.67500 1.000 96.34000  ? 349 GLU D N     1 
ATOM   9286  C CA    . GLU D 1 104 ? 148.87600 157.99100 114.34400 1.000 96.34000  ? 349 GLU D CA    1 
ATOM   9287  C C     . GLU D 1 104 ? 147.80500 157.23600 115.11100 1.000 96.34000  ? 349 GLU D C     1 
ATOM   9288  O O     . GLU D 1 104 ? 146.78100 157.82200 115.47200 1.000 96.34000  ? 349 GLU D O     1 
ATOM   9289  C CB    . GLU D 1 104 ? 148.62800 157.89500 112.84300 1.000 96.34000  ? 349 GLU D CB    1 
ATOM   9290  C CG    . GLU D 1 104 ? 149.42400 158.90300 112.04900 1.000 96.34000  ? 349 GLU D CG    1 
ATOM   9291  C CD    . GLU D 1 104 ? 149.13600 158.84000 110.57200 1.000 96.34000  ? 349 GLU D CD    1 
ATOM   9292  O OE1   . GLU D 1 104 ? 148.38900 157.93400 110.14800 1.000 96.34000  ? 349 GLU D OE1   1 
ATOM   9293  O OE2   . GLU D 1 104 ? 149.64900 159.70700 109.83500 1.000 96.34000  ? 349 GLU D OE2   1 
ATOM   9294  N N     . PHE D 1 105 ? 148.01800 155.96000 115.39400 1.000 80.59000  ? 350 PHE D N     1 
ATOM   9295  C CA    . PHE D 1 105 ? 147.08100 155.29100 116.27400 1.000 80.59000  ? 350 PHE D CA    1 
ATOM   9296  C C     . PHE D 1 105 ? 147.44600 155.57800 117.72200 1.000 80.59000  ? 350 PHE D C     1 
ATOM   9297  O O     . PHE D 1 105 ? 148.37700 156.32600 118.02400 1.000 80.59000  ? 350 PHE D O     1 
ATOM   9298  C CB    . PHE D 1 105 ? 147.05300 153.80000 115.99900 1.000 80.59000  ? 350 PHE D CB    1 
ATOM   9299  C CG    . PHE D 1 105 ? 146.50000 153.46100 114.67300 1.000 80.59000  ? 350 PHE D CG    1 
ATOM   9300  C CD1   . PHE D 1 105 ? 145.14300 153.50400 114.45600 1.000 80.59000  ? 350 PHE D CD1   1 
ATOM   9301  C CD2   . PHE D 1 105 ? 147.33100 153.09700 113.64000 1.000 80.59000  ? 350 PHE D CD2   1 
ATOM   9302  C CE1   . PHE D 1 105 ? 144.62200 153.19300 113.22600 1.000 80.59000  ? 350 PHE D CE1   1 
ATOM   9303  C CE2   . PHE D 1 105 ? 146.81900 152.77900 112.41000 1.000 80.59000  ? 350 PHE D CE2   1 
ATOM   9304  C CZ    . PHE D 1 105 ? 145.46300 152.82800 112.20000 1.000 80.59000  ? 350 PHE D CZ    1 
ATOM   9305  N N     . GLY D 1 106 ? 146.72100 154.95300 118.63700 1.000 77.48000  ? 351 GLY D N     1 
ATOM   9306  C CA    . GLY D 1 106 ? 146.88600 155.26500 120.03900 1.000 77.48000  ? 351 GLY D CA    1 
ATOM   9307  C C     . GLY D 1 106 ? 148.03600 154.57200 120.73800 1.000 77.48000  ? 351 GLY D C     1 
ATOM   9308  O O     . GLY D 1 106 ? 147.89100 154.15100 121.88800 1.000 77.48000  ? 351 GLY D O     1 
ATOM   9309  N N     . VAL D 1 107 ? 149.17800 154.42300 120.06700 1.000 74.47000  ? 352 VAL D N     1 
ATOM   9310  C CA    . VAL D 1 107 ? 150.39300 153.92400 120.69200 1.000 74.47000  ? 352 VAL D CA    1 
ATOM   9311  C C     . VAL D 1 107 ? 151.54400 154.83500 120.30000 1.000 74.47000  ? 352 VAL D C     1 
ATOM   9312  O O     . VAL D 1 107 ? 151.45000 155.63000 119.36700 1.000 74.47000  ? 352 VAL D O     1 
ATOM   9313  C CB    . VAL D 1 107 ? 150.71900 152.46900 120.30600 1.000 74.47000  ? 352 VAL D CB    1 
ATOM   9314  C CG1   . VAL D 1 107 ? 149.63500 151.52600 120.77500 1.000 74.47000  ? 352 VAL D CG1   1 
ATOM   9315  C CG2   . VAL D 1 107 ? 150.91300 152.35400 118.82000 1.000 74.47000  ? 352 VAL D CG2   1 
ATOM   9316  N N     . GLU D 1 108 ? 152.64100 154.70400 121.03000 1.000 86.44000  ? 353 GLU D N     1 
ATOM   9317  C CA    . GLU D 1 108 ? 153.86300 155.43500 120.74700 1.000 86.44000  ? 353 GLU D CA    1 
ATOM   9318  C C     . GLU D 1 108 ? 155.00900 154.43700 120.74800 1.000 86.44000  ? 353 GLU D C     1 
ATOM   9319  O O     . GLU D 1 108 ? 155.05500 153.53800 121.59000 1.000 86.44000  ? 353 GLU D O     1 
ATOM   9320  C CB    . GLU D 1 108 ? 154.08100 156.54200 121.76900 1.000 86.44000  ? 353 GLU D CB    1 
ATOM   9321  C CG    . GLU D 1 108 ? 155.21400 157.48200 121.44200 1.000 86.44000  ? 353 GLU D CG    1 
ATOM   9322  C CD    . GLU D 1 108 ? 155.30900 158.62400 122.43000 1.000 86.44000  ? 353 GLU D CD    1 
ATOM   9323  O OE1   . GLU D 1 108 ? 154.52100 158.63900 123.39800 1.000 86.44000  ? 353 GLU D OE1   1 
ATOM   9324  O OE2   . GLU D 1 108 ? 156.16200 159.51300 122.23400 1.000 86.44000  ? 353 GLU D OE2   1 
ATOM   9325  N N     . VAL D 1 109 ? 155.92800 154.58600 119.80000 1.000 87.21000  ? 354 VAL D N     1 
ATOM   9326  C CA    . VAL D 1 109 ? 156.75300 153.47400 119.35600 1.000 87.21000  ? 354 VAL D CA    1 
ATOM   9327  C C     . VAL D 1 109 ? 158.15100 153.99100 119.03700 1.000 87.21000  ? 354 VAL D C     1 
ATOM   9328  O O     . VAL D 1 109 ? 158.37200 155.19500 118.90100 1.000 87.21000  ? 354 VAL D O     1 
ATOM   9329  C CB    . VAL D 1 109 ? 156.07600 152.81900 118.13000 1.000 87.21000  ? 354 VAL D CB    1 
ATOM   9330  C CG1   . VAL D 1 109 ? 156.23400 153.68400 116.91900 1.000 87.21000  ? 354 VAL D CG1   1 
ATOM   9331  C CG2   . VAL D 1 109 ? 156.52000 151.40400 117.87600 1.000 87.21000  ? 354 VAL D CG2   1 
ATOM   9332  N N     . SER D 1 110 ? 159.11200 153.06900 118.95200 1.000 90.90000  ? 355 SER D N     1 
ATOM   9333  C CA    . SER D 1 110 ? 160.47300 153.41200 118.54600 1.000 90.90000  ? 355 SER D CA    1 
ATOM   9334  C C     . SER D 1 110 ? 161.14000 152.18000 117.95700 1.000 90.90000  ? 355 SER D C     1 
ATOM   9335  O O     . SER D 1 110 ? 161.44200 151.23000 118.68300 1.000 90.90000  ? 355 SER D O     1 
ATOM   9336  C CB    . SER D 1 110 ? 161.28600 153.94200 119.71700 1.000 90.90000  ? 355 SER D CB    1 
ATOM   9337  O OG    . SER D 1 110 ? 162.61700 154.18400 119.30700 1.000 90.90000  ? 355 SER D OG    1 
ATOM   9338  N N     . VAL D 1 111 ? 161.37800 152.20500 116.64900 1.000 93.86000  ? 356 VAL D N     1 
ATOM   9339  C CA    . VAL D 1 111 ? 162.12200 151.14000 115.99700 1.000 93.86000  ? 356 VAL D CA    1 
ATOM   9340  C C     . VAL D 1 111 ? 163.58800 151.27100 116.36400 1.000 93.86000  ? 356 VAL D C     1 
ATOM   9341  O O     . VAL D 1 111 ? 164.13900 152.37700 116.37300 1.000 93.86000  ? 356 VAL D O     1 
ATOM   9342  C CB    . VAL D 1 111 ? 161.92100 151.23400 114.47700 1.000 93.86000  ? 356 VAL D CB    1 
ATOM   9343  C CG1   . VAL D 1 111 ? 162.70900 150.17500 113.75000 1.000 93.86000  ? 356 VAL D CG1   1 
ATOM   9344  C CG2   . VAL D 1 111 ? 160.46300 151.13100 114.14300 1.000 93.86000  ? 356 VAL D CG2   1 
ATOM   9345  N N     . ASP D 1 112 ? 164.23300 150.15600 116.68600 1.000 99.70000  ? 357 ASP D N     1 
ATOM   9346  C CA    . ASP D 1 112 ? 165.67200 150.22700 116.89800 1.000 99.70000  ? 357 ASP D CA    1 
ATOM   9347  C C     . ASP D 1 112 ? 166.47700 149.36500 115.94300 1.000 99.70000  ? 357 ASP D C     1 
ATOM   9348  O O     . ASP D 1 112 ? 167.54100 149.78800 115.49000 1.000 99.70000  ? 357 ASP D O     1 
ATOM   9349  C CB    . ASP D 1 112 ? 166.03600 149.86500 118.35100 1.000 99.70000  ? 357 ASP D CB    1 
ATOM   9350  C CG    . ASP D 1 112 ? 165.61700 148.46300 118.74700 1.000 99.70000  ? 357 ASP D CG    1 
ATOM   9351  O OD1   . ASP D 1 112 ? 164.92100 147.77600 117.97100 1.000 99.70000  ? 357 ASP D OD1   1 
ATOM   9352  O OD2   . ASP D 1 112 ? 166.00800 148.03900 119.85300 1.000 99.70000  ? 357 ASP D OD2   1 
ATOM   9353  N N     . SER D 1 113 ? 166.00300 148.17000 115.61700 1.000 94.21000  ? 358 SER D N     1 
ATOM   9354  C CA    . SER D 1 113 ? 166.82400 147.22100 114.88700 1.000 94.21000  ? 358 SER D CA    1 
ATOM   9355  C C     . SER D 1 113 ? 165.97500 146.44800 113.89600 1.000 94.21000  ? 358 SER D C     1 
ATOM   9356  O O     . SER D 1 113 ? 164.92300 145.91400 114.25200 1.000 94.21000  ? 358 SER D O     1 
ATOM   9357  C CB    . SER D 1 113 ? 167.52500 146.26100 115.84800 1.000 94.21000  ? 358 SER D CB    1 
ATOM   9358  O OG    . SER D 1 113 ? 166.57800 145.47400 116.54000 1.000 94.21000  ? 358 SER D OG    1 
ATOM   9359  N N     . VAL D 1 114 ? 166.45400 146.37800 112.66200 1.000 88.58000  ? 359 VAL D N     1 
ATOM   9360  C CA    . VAL D 1 114 ? 165.75800 145.73500 111.56100 1.000 88.58000  ? 359 VAL D CA    1 
ATOM   9361  C C     . VAL D 1 114 ? 166.55800 144.50500 111.16500 1.000 88.58000  ? 359 VAL D C     1 
ATOM   9362  O O     . VAL D 1 114 ? 167.78700 144.56900 111.05500 1.000 88.58000  ? 359 VAL D O     1 
ATOM   9363  C CB    . VAL D 1 114 ? 165.60300 146.71100 110.38400 1.000 88.58000  ? 359 VAL D CB    1 
ATOM   9364  C CG1   . VAL D 1 114 ? 164.95400 146.04700 109.19800 1.000 88.58000  ? 359 VAL D CG1   1 
ATOM   9365  C CG2   . VAL D 1 114 ? 164.81700 147.92100 110.82200 1.000 88.58000  ? 359 VAL D CG2   1 
ATOM   9366  N N     . HIS D 1 115 ? 165.87400 143.38300 110.96900 1.000 86.54000  ? 360 HIS D N     1 
ATOM   9367  C CA    . HIS D 1 115 ? 166.52200 142.13500 110.58000 1.000 86.54000  ? 360 HIS D CA    1 
ATOM   9368  C C     . HIS D 1 115 ? 165.75600 141.56300 109.39900 1.000 86.54000  ? 360 HIS D C     1 
ATOM   9369  O O     . HIS D 1 115 ? 164.77400 140.83500 109.58200 1.000 86.54000  ? 360 HIS D O     1 
ATOM   9370  C CB    . HIS D 1 115 ? 166.55200 141.15600 111.74100 1.000 86.54000  ? 360 HIS D CB    1 
ATOM   9371  C CG    . HIS D 1 115 ? 167.14600 141.73300 112.98100 1.000 86.54000  ? 360 HIS D CG    1 
ATOM   9372  N ND1   . HIS D 1 115 ? 168.48500 142.02700 113.09500 1.000 86.54000  ? 360 HIS D ND1   1 
ATOM   9373  C CD2   . HIS D 1 115 ? 166.58300 142.07300 114.16200 1.000 86.54000  ? 360 HIS D CD2   1 
ATOM   9374  C CE1   . HIS D 1 115 ? 168.72300 142.52600 114.29400 1.000 86.54000  ? 360 HIS D CE1   1 
ATOM   9375  N NE2   . HIS D 1 115 ? 167.58500 142.56200 114.96300 1.000 86.54000  ? 360 HIS D NE2   1 
ATOM   9376  N N     . PRO D 1 116 ? 166.16700 141.87500 108.17600 1.000 88.77000  ? 361 PRO D N     1 
ATOM   9377  C CA    . PRO D 1 116 ? 165.42100 141.42100 107.00100 1.000 88.77000  ? 361 PRO D CA    1 
ATOM   9378  C C     . PRO D 1 116 ? 165.65400 139.94300 106.74300 1.000 88.77000  ? 361 PRO D C     1 
ATOM   9379  O O     . PRO D 1 116 ? 166.53600 139.31000 107.31800 1.000 88.77000  ? 361 PRO D O     1 
ATOM   9380  C CB    . PRO D 1 116 ? 165.99600 142.27100 105.86900 1.000 88.77000  ? 361 PRO D CB    1 
ATOM   9381  C CG    . PRO D 1 116 ? 167.37600 142.54600 106.30100 1.000 88.77000  ? 361 PRO D CG    1 
ATOM   9382  C CD    . PRO D 1 116 ? 167.33100 142.69000 107.79800 1.000 88.77000  ? 361 PRO D CD    1 
ATOM   9383  N N     . GLY D 1 117 ? 164.83800 139.39900 105.85200 1.000 93.07000  ? 362 GLY D N     1 
ATOM   9384  C CA    . GLY D 1 117 ? 164.91200 137.99600 105.54900 1.000 93.07000  ? 362 GLY D CA    1 
ATOM   9385  C C     . GLY D 1 117 ? 164.29300 137.62900 104.22100 1.000 93.07000  ? 362 GLY D C     1 
ATOM   9386  O O     . GLY D 1 117 ? 164.01100 138.48500 103.38100 1.000 93.07000  ? 362 GLY D O     1 
ATOM   9387  N N     . PRO D 1 118 ? 164.08100 136.33400 104.00900 1.000 92.35000  ? 363 PRO D N     1 
ATOM   9388  C CA    . PRO D 1 118 ? 163.60900 135.86000 102.70500 1.000 92.35000  ? 363 PRO D CA    1 
ATOM   9389  C C     . PRO D 1 118 ? 162.18600 136.25700 102.38200 1.000 92.35000  ? 363 PRO D C     1 
ATOM   9390  O O     . PRO D 1 118 ? 161.90800 136.69400 101.26400 1.000 92.35000  ? 363 PRO D O     1 
ATOM   9391  C CB    . PRO D 1 118 ? 163.73000 134.34000 102.82800 1.000 92.35000  ? 363 PRO D CB    1 
ATOM   9392  C CG    . PRO D 1 118 ? 164.74600 134.13000 103.87800 1.000 92.35000  ? 363 PRO D CG    1 
ATOM   9393  C CD    . PRO D 1 118 ? 164.52400 135.22100 104.86000 1.000 92.35000  ? 363 PRO D CD    1 
ATOM   9394  N N     . VAL D 1 119 ? 161.27100 136.10400 103.32800 1.000 89.50000  ? 364 VAL D N     1 
ATOM   9395  C CA    . VAL D 1 119 ? 159.86900 136.38500 103.09100 1.000 89.50000  ? 364 VAL D CA    1 
ATOM   9396  C C     . VAL D 1 119 ? 159.40100 137.59900 103.87900 1.000 89.50000  ? 364 VAL D C     1 
ATOM   9397  O O     . VAL D 1 119 ? 158.64900 138.42900 103.36300 1.000 89.50000  ? 364 VAL D O     1 
ATOM   9398  C CB    . VAL D 1 119 ? 159.01000 135.14900 103.42300 1.000 89.50000  ? 364 VAL D CB    1 
ATOM   9399  C CG1   . VAL D 1 119 ? 157.55100 135.38300 103.08000 1.000 89.50000  ? 364 VAL D CG1   1 
ATOM   9400  C CG2   . VAL D 1 119 ? 159.54300 133.92900 102.71500 1.000 89.50000  ? 364 VAL D CG2   1 
ATOM   9401  N N     . ILE D 1 120 ? 159.86800 137.74500 105.11200 1.000 85.95000  ? 365 ILE D N     1 
ATOM   9402  C CA    . ILE D 1 120 ? 159.39600 138.82400 105.96400 1.000 85.95000  ? 365 ILE D CA    1 
ATOM   9403  C C     . ILE D 1 120 ? 160.56000 139.71300 106.35300 1.000 85.95000  ? 365 ILE D C     1 
ATOM   9404  O O     . ILE D 1 120 ? 161.69400 139.50300 105.91300 1.000 85.95000  ? 365 ILE D O     1 
ATOM   9405  C CB    . ILE D 1 120 ? 158.67100 138.27100 107.20100 1.000 85.95000  ? 365 ILE D CB    1 
ATOM   9406  C CG1   . ILE D 1 120 ? 159.57600 137.34700 108.02100 1.000 85.95000  ? 365 ILE D CG1   1 
ATOM   9407  C CG2   . ILE D 1 120 ? 157.43300 137.52600 106.78500 1.000 85.95000  ? 365 ILE D CG2   1 
ATOM   9408  C CD1   . ILE D 1 120 ? 160.22000 137.99100 109.24800 1.000 85.95000  ? 365 ILE D CD1   1 
ATOM   9409  N N     . THR D 1 121 ? 160.28700 140.70300 107.19200 1.000 83.10000  ? 366 THR D N     1 
ATOM   9410  C CA    . THR D 1 121 ? 161.32200 141.59400 107.70300 1.000 83.10000  ? 366 THR D CA    1 
ATOM   9411  C C     . THR D 1 121 ? 160.96900 141.90700 109.15100 1.000 83.10000  ? 366 THR D C     1 
ATOM   9412  O O     . THR D 1 121 ? 160.05600 142.69000 109.41600 1.000 83.10000  ? 366 THR D O     1 
ATOM   9413  C CB    . THR D 1 121 ? 161.42000 142.86000 106.87000 1.000 83.10000  ? 366 THR D CB    1 
ATOM   9414  O OG1   . THR D 1 121 ? 161.71300 142.51300 105.51400 1.000 83.10000  ? 366 THR D OG1   1 
ATOM   9415  C CG2   . THR D 1 121 ? 162.52300 143.73500 107.38900 1.000 83.10000  ? 366 THR D CG2   1 
ATOM   9416  N N     . ARG D 1 122 ? 161.69000 141.28900 110.07600 1.000 81.95000  ? 367 ARG D N     1 
ATOM   9417  C CA    . ARG D 1 122 ? 161.42100 141.47000 111.49300 1.000 81.95000  ? 367 ARG D CA    1 
ATOM   9418  C C     . ARG D 1 122 ? 161.83600 142.85800 111.94700 1.000 81.95000  ? 367 ARG D C     1 
ATOM   9419  O O     . ARG D 1 122 ? 162.95900 143.29300 111.68800 1.000 81.95000  ? 367 ARG D O     1 
ATOM   9420  C CB    . ARG D 1 122 ? 162.16800 140.41400 112.29500 1.000 81.95000  ? 367 ARG D CB    1 
ATOM   9421  C CG    . ARG D 1 122 ? 161.99000 140.53900 113.78100 1.000 81.95000  ? 367 ARG D CG    1 
ATOM   9422  C CD    . ARG D 1 122 ? 162.67800 139.40400 114.50300 1.000 81.95000  ? 367 ARG D CD    1 
ATOM   9423  N NE    . ARG D 1 122 ? 162.01600 138.13800 114.22400 1.000 81.95000  ? 367 ARG D NE    1 
ATOM   9424  C CZ    . ARG D 1 122 ? 160.97600 137.67500 114.90900 1.000 81.95000  ? 367 ARG D CZ    1 
ATOM   9425  N NH1   . ARG D 1 122 ? 160.48900 138.36800 115.92700 1.000 81.95000  ? 367 ARG D NH1   1 
ATOM   9426  N NH2   . ARG D 1 122 ? 160.42700 136.51400 114.58400 1.000 81.95000  ? 367 ARG D NH2   1 
ATOM   9427  N N     . PHE D 1 123 ? 160.93100 143.55700 112.61900 1.000 84.44000  ? 368 PHE D N     1 
ATOM   9428  C CA    . PHE D 1 123 ? 161.24400 144.82600 113.26500 1.000 84.44000  ? 368 PHE D CA    1 
ATOM   9429  C C     . PHE D 1 123 ? 161.18500 144.60000 114.76300 1.000 84.44000  ? 368 PHE D C     1 
ATOM   9430  O O     . PHE D 1 123 ? 160.09900 144.41200 115.31900 1.000 84.44000  ? 368 PHE D O     1 
ATOM   9431  C CB    . PHE D 1 123 ? 160.26300 145.93700 112.90300 1.000 84.44000  ? 368 PHE D CB    1 
ATOM   9432  C CG    . PHE D 1 123 ? 160.33400 146.40700 111.49000 1.000 84.44000  ? 368 PHE D CG    1 
ATOM   9433  C CD1   . PHE D 1 123 ? 161.35900 146.03700 110.65100 1.000 84.44000  ? 368 PHE D CD1   1 
ATOM   9434  C CD2   . PHE D 1 123 ? 159.36200 147.26300 111.01500 1.000 84.44000  ? 368 PHE D CD2   1 
ATOM   9435  C CE1   . PHE D 1 123 ? 161.38900 146.49000 109.36100 1.000 84.44000  ? 368 PHE D CE1   1 
ATOM   9436  C CE2   . PHE D 1 123 ? 159.39900 147.72100 109.73000 1.000 84.44000  ? 368 PHE D CE2   1 
ATOM   9437  C CZ    . PHE D 1 123 ? 160.40800 147.33200 108.90100 1.000 84.44000  ? 368 PHE D CZ    1 
ATOM   9438  N N     . GLU D 1 124 ? 162.33200 144.62800 115.42200 1.000 96.52000  ? 369 GLU D N     1 
ATOM   9439  C CA    . GLU D 1 124 ? 162.28700 144.75300 116.86400 1.000 96.52000  ? 369 GLU D CA    1 
ATOM   9440  C C     . GLU D 1 124 ? 161.88900 146.17400 117.21900 1.000 96.52000  ? 369 GLU D C     1 
ATOM   9441  O O     . GLU D 1 124 ? 162.13000 147.11700 116.46400 1.000 96.52000  ? 369 GLU D O     1 
ATOM   9442  C CB    . GLU D 1 124 ? 163.62700 144.39800 117.49600 1.000 96.52000  ? 369 GLU D CB    1 
ATOM   9443  C CG    . GLU D 1 124 ? 164.00200 142.93900 117.35500 1.000 96.52000  ? 369 GLU D CG    1 
ATOM   9444  C CD    . GLU D 1 124 ? 165.29200 142.59700 118.07100 1.000 96.52000  ? 369 GLU D CD    1 
ATOM   9445  O OE1   . GLU D 1 124 ? 165.93700 143.51900 118.61400 1.000 96.52000  ? 369 GLU D OE1   1 
ATOM   9446  O OE2   . GLU D 1 124 ? 165.66400 141.40400 118.08700 1.000 96.52000  ? 369 GLU D OE2   1 
ATOM   9447  N N     . ILE D 1 125 ? 161.23900 146.32000 118.36300 1.000 84.83000  ? 370 ILE D N     1 
ATOM   9448  C CA    . ILE D 1 125 ? 160.70100 147.59900 118.80200 1.000 84.83000  ? 370 ILE D CA    1 
ATOM   9449  C C     . ILE D 1 125 ? 160.92900 147.73500 120.29400 1.000 84.83000  ? 370 ILE D C     1 
ATOM   9450  O O     . ILE D 1 125 ? 160.55000 146.85000 121.06300 1.000 84.83000  ? 370 ILE D O     1 
ATOM   9451  C CB    . ILE D 1 125 ? 159.20000 147.72300 118.48000 1.000 84.83000  ? 370 ILE D CB    1 
ATOM   9452  C CG1   . ILE D 1 125 ? 158.97700 147.99500 117.00200 1.000 84.83000  ? 370 ILE D CG1   1 
ATOM   9453  C CG2   . ILE D 1 125 ? 158.53900 148.77300 119.32500 1.000 84.83000  ? 370 ILE D CG2   1 
ATOM   9454  C CD1   . ILE D 1 125 ? 157.55000 147.97400 116.62200 1.000 84.83000  ? 370 ILE D CD1   1 
ATOM   9455  N N     . GLN D 1 126 ? 161.56900 148.82300 120.70400 1.000 85.69000  ? 371 GLN D N     1 
ATOM   9456  C CA    . GLN D 1 126 ? 161.41000 149.30400 122.06400 1.000 85.69000  ? 371 GLN D CA    1 
ATOM   9457  C C     . GLN D 1 126 ? 160.20100 150.22000 122.06000 1.000 85.69000  ? 371 GLN D C     1 
ATOM   9458  O O     . GLN D 1 126 ? 160.27600 151.31800 121.49100 1.000 85.69000  ? 371 GLN D O     1 
ATOM   9459  C CB    . GLN D 1 126 ? 162.64400 150.05000 122.53600 1.000 85.69000  ? 371 GLN D CB    1 
ATOM   9460  C CG    . GLN D 1 126 ? 162.53100 150.62000 123.94500 1.000 85.69000  ? 371 GLN D CG    1 
ATOM   9461  C CD    . GLN D 1 126 ? 162.42400 149.55400 125.01800 1.000 85.69000  ? 371 GLN D CD    1 
ATOM   9462  O OE1   . GLN D 1 126 ? 163.06500 148.51000 124.94100 1.000 85.69000  ? 371 GLN D OE1   1 
ATOM   9463  N NE2   . GLN D 1 126 ? 161.62800 149.82700 126.04100 1.000 85.69000  ? 371 GLN D NE2   1 
ATOM   9464  N N     . PRO D 1 127 ? 159.07000 149.81300 122.62400 1.000 79.22000  ? 372 PRO D N     1 
ATOM   9465  C CA    . PRO D 1 127 ? 157.90400 150.69100 122.65300 1.000 79.22000  ? 372 PRO D CA    1 
ATOM   9466  C C     . PRO D 1 127 ? 158.12300 151.80000 123.65800 1.000 79.22000  ? 372 PRO D C     1 
ATOM   9467  O O     . PRO D 1 127 ? 159.07000 151.78700 124.44300 1.000 79.22000  ? 372 PRO D O     1 
ATOM   9468  C CB    . PRO D 1 127 ? 156.77700 149.76700 123.09900 1.000 79.22000  ? 372 PRO D CB    1 
ATOM   9469  C CG    . PRO D 1 127 ? 157.29300 148.40200 122.90900 1.000 79.22000  ? 372 PRO D CG    1 
ATOM   9470  C CD    . PRO D 1 127 ? 158.74700 148.50000 123.18400 1.000 79.22000  ? 372 PRO D CD    1 
ATOM   9471  N N     . ALA D 1 128 ? 157.21800 152.76700 123.64000 1.000 83.02000  ? 373 ALA D N     1 
ATOM   9472  C CA    . ALA D 1 128 ? 157.36200 153.86900 124.56900 1.000 83.02000  ? 373 ALA D CA    1 
ATOM   9473  C C     . ALA D 1 128 ? 157.01400 153.41800 125.98000 1.000 83.02000  ? 373 ALA D C     1 
ATOM   9474  O O     . ALA D 1 128 ? 156.44600 152.34800 126.20200 1.000 83.02000  ? 373 ALA D O     1 
ATOM   9475  C CB    . ALA D 1 128 ? 156.48000 155.04000 124.16000 1.000 83.02000  ? 373 ALA D CB    1 
ATOM   9476  N N     . ALA D 1 129 ? 157.38900 154.24300 126.94300 1.000 82.89000  ? 374 ALA D N     1 
ATOM   9477  C CA    . ALA D 1 129 ? 157.05000 153.95800 128.32400 1.000 82.89000  ? 374 ALA D CA    1 
ATOM   9478  C C     . ALA D 1 129 ? 155.55400 154.11800 128.54000 1.000 82.89000  ? 374 ALA D C     1 
ATOM   9479  O O     . ALA D 1 129 ? 154.95700 155.12500 128.15500 1.000 82.89000  ? 374 ALA D O     1 
ATOM   9480  C CB    . ALA D 1 129 ? 157.81500 154.89000 129.25200 1.000 82.89000  ? 374 ALA D CB    1 
ATOM   9481  N N     . GLY D 1 130 ? 154.94400 153.11300 129.14400 1.000 80.12000  ? 375 GLY D N     1 
ATOM   9482  C CA    . GLY D 1 130 ? 153.55700 153.18200 129.51500 1.000 80.12000  ? 375 GLY D CA    1 
ATOM   9483  C C     . GLY D 1 130 ? 152.62700 152.34500 128.67000 1.000 80.12000  ? 375 GLY D C     1 
ATOM   9484  O O     . GLY D 1 130 ? 151.54400 151.98900 129.14100 1.000 80.12000  ? 375 GLY D O     1 
ATOM   9485  N N     . VAL D 1 131 ? 153.00900 152.01700 127.45500 1.000 75.78000  ? 376 VAL D N     1 
ATOM   9486  C CA    . VAL D 1 131 ? 152.10200 151.30500 126.56900 1.000 75.78000  ? 376 VAL D CA    1 
ATOM   9487  C C     . VAL D 1 131 ? 152.15000 149.81700 126.89200 1.000 75.78000  ? 376 VAL D C     1 
ATOM   9488  O O     . VAL D 1 131 ? 153.17700 149.28600 127.32800 1.000 75.78000  ? 376 VAL D O     1 
ATOM   9489  C CB    . VAL D 1 131 ? 152.45000 151.61000 125.10000 1.000 75.78000  ? 376 VAL D CB    1 
ATOM   9490  C CG1   . VAL D 1 131 ? 153.79200 151.06100 124.73200 1.000 75.78000  ? 376 VAL D CG1   1 
ATOM   9491  C CG2   . VAL D 1 131 ? 151.38800 151.10300 124.14600 1.000 75.78000  ? 376 VAL D CG2   1 
ATOM   9492  N N     . LYS D 1 132 ? 151.00700 149.15400 126.74800 1.000 72.11000  ? 377 LYS D N     1 
ATOM   9493  C CA    . LYS D 1 132 ? 150.89200 147.71500 126.92600 1.000 72.11000  ? 377 LYS D CA    1 
ATOM   9494  C C     . LYS D 1 132 ? 151.35900 147.00700 125.65700 1.000 72.11000  ? 377 LYS D C     1 
ATOM   9495  O O     . LYS D 1 132 ? 151.99100 147.59800 124.77900 1.000 72.11000  ? 377 LYS D O     1 
ATOM   9496  C CB    . LYS D 1 132 ? 149.45400 147.34000 127.26400 1.000 72.11000  ? 377 LYS D CB    1 
ATOM   9497  C CG    . LYS D 1 132 ? 148.92900 147.85800 128.58300 1.000 72.11000  ? 377 LYS D CG    1 
ATOM   9498  C CD    . LYS D 1 132 ? 147.49200 147.41300 128.74000 1.000 72.11000  ? 377 LYS D CD    1 
ATOM   9499  C CE    . LYS D 1 132 ? 146.84100 148.00500 129.95900 1.000 72.11000  ? 377 LYS D CE    1 
ATOM   9500  N NZ    . LYS D 1 132 ? 147.39700 147.43400 131.19800 1.000 72.11000  ? 377 LYS D NZ    1 
ATOM   9501  N N     . VAL D 1 133 ? 151.05500 145.71800 125.54800 1.000 65.05000  ? 378 VAL D N     1 
ATOM   9502  C CA    . VAL D 1 133 ? 151.35000 144.94200 124.35500 1.000 65.05000  ? 378 VAL D CA    1 
ATOM   9503  C C     . VAL D 1 133 ? 150.07800 144.53500 123.62800 1.000 65.05000  ? 378 VAL D C     1 
ATOM   9504  O O     . VAL D 1 133 ? 150.04500 144.51300 122.39600 1.000 65.05000  ? 378 VAL D O     1 
ATOM   9505  C CB    . VAL D 1 133 ? 152.20200 143.70900 124.71400 1.000 65.05000  ? 378 VAL D CB    1 
ATOM   9506  C CG1   . VAL D 1 133 ? 152.56600 142.89200 123.48800 1.000 65.05000  ? 378 VAL D CG1   1 
ATOM   9507  C CG2   . VAL D 1 133 ? 153.43400 144.15200 125.39500 1.000 65.05000  ? 378 VAL D CG2   1 
ATOM   9508  N N     . SER D 1 134 ? 149.01000 144.23400 124.37000 1.000 66.76000  ? 379 SER D N     1 
ATOM   9509  C CA    . SER D 1 134 ? 147.74500 143.88900 123.73000 1.000 66.76000  ? 379 SER D CA    1 
ATOM   9510  C C     . SER D 1 134 ? 147.16800 145.07100 122.97000 1.000 66.76000  ? 379 SER D C     1 
ATOM   9511  O O     . SER D 1 134 ? 146.45900 144.88100 121.97500 1.000 66.76000  ? 379 SER D O     1 
ATOM   9512  C CB    . SER D 1 134 ? 146.74000 143.39900 124.76200 1.000 66.76000  ? 379 SER D CB    1 
ATOM   9513  O OG    . SER D 1 134 ? 146.34200 144.46500 125.59800 1.000 66.76000  ? 379 SER D OG    1 
ATOM   9514  N N     . ARG D 1 135 ? 147.50200 146.29000 123.38900 1.000 66.10000  ? 380 ARG D N     1 
ATOM   9515  C CA    . ARG D 1 135 ? 147.12900 147.44800 122.60300 1.000 66.10000  ? 380 ARG D CA    1 
ATOM   9516  C C     . ARG D 1 135 ? 147.91500 147.51300 121.29900 1.000 66.10000  ? 380 ARG D C     1 
ATOM   9517  O O     . ARG D 1 135 ? 147.44600 148.12700 120.34000 1.000 66.10000  ? 380 ARG D O     1 
ATOM   9518  C CB    . ARG D 1 135 ? 147.29800 148.71800 123.44100 1.000 66.10000  ? 380 ARG D CB    1 
ATOM   9519  C CG    . ARG D 1 135 ? 146.57100 149.91200 122.85800 1.000 66.10000  ? 380 ARG D CG    1 
ATOM   9520  C CD    . ARG D 1 135 ? 146.49500 151.10500 123.78200 1.000 66.10000  ? 380 ARG D CD    1 
ATOM   9521  N NE    . ARG D 1 135 ? 147.75700 151.80100 123.96700 1.000 66.10000  ? 380 ARG D NE    1 
ATOM   9522  C CZ    . ARG D 1 135 ? 147.90500 152.82500 124.79700 1.000 66.10000  ? 380 ARG D CZ    1 
ATOM   9523  N NH1   . ARG D 1 135 ? 146.86900 153.25700 125.49500 1.000 66.10000  ? 380 ARG D NH1   1 
ATOM   9524  N NH2   . ARG D 1 135 ? 149.07500 153.42500 124.92600 1.000 66.10000  ? 380 ARG D NH2   1 
ATOM   9525  N N     . ILE D 1 136 ? 149.07300 146.86000 121.21200 1.000 62.74000  ? 381 ILE D N     1 
ATOM   9526  C CA    . ILE D 1 136 ? 149.68800 146.66800 119.90200 1.000 62.74000  ? 381 ILE D CA    1 
ATOM   9527  C C     . ILE D 1 136 ? 148.99100 145.54500 119.14800 1.000 62.74000  ? 381 ILE D C     1 
ATOM   9528  O O     . ILE D 1 136 ? 148.63900 145.69400 117.97300 1.000 62.74000  ? 381 ILE D O     1 
ATOM   9529  C CB    . ILE D 1 136 ? 151.19900 146.40300 120.03200 1.000 62.74000  ? 381 ILE D CB    1 
ATOM   9530  C CG1   . ILE D 1 136 ? 151.91700 147.62200 120.59700 1.000 62.74000  ? 381 ILE D CG1   1 
ATOM   9531  C CG2   . ILE D 1 136 ? 151.80300 146.01600 118.69300 1.000 62.74000  ? 381 ILE D CG2   1 
ATOM   9532  C CD1   . ILE D 1 136 ? 151.88300 148.80200 119.68900 1.000 62.74000  ? 381 ILE D CD1   1 
ATOM   9533  N N     . SER D 1 137 ? 148.75000 144.41700 119.81800 1.000 63.23000  ? 382 SER D N     1 
ATOM   9534  C CA    . SER D 1 137 ? 148.28700 143.21900 119.12600 1.000 63.23000  ? 382 SER D CA    1 
ATOM   9535  C C     . SER D 1 137 ? 146.85700 143.32300 118.62900 1.000 63.23000  ? 382 SER D C     1 
ATOM   9536  O O     . SER D 1 137 ? 146.45900 142.53300 117.77200 1.000 63.23000  ? 382 SER D O     1 
ATOM   9537  C CB    . SER D 1 137 ? 148.41300 142.00200 120.02700 1.000 63.23000  ? 382 SER D CB    1 
ATOM   9538  O OG    . SER D 1 137 ? 149.76900 141.72100 120.29400 1.000 63.23000  ? 382 SER D OG    1 
ATOM   9539  N N     . ASN D 1 138 ? 146.07400 144.27000 119.13400 1.000 69.00000  ? 383 ASN D N     1 
ATOM   9540  C CA    . ASN D 1 138 ? 144.78400 144.56300 118.53100 1.000 69.00000  ? 383 ASN D CA    1 
ATOM   9541  C C     . ASN D 1 138 ? 144.87800 145.59400 117.42200 1.000 69.00000  ? 383 ASN D C     1 
ATOM   9542  O O     . ASN D 1 138 ? 143.87400 146.23900 117.10600 1.000 69.00000  ? 383 ASN D O     1 
ATOM   9543  C CB    . ASN D 1 138 ? 143.79000 145.03700 119.58400 1.000 69.00000  ? 383 ASN D CB    1 
ATOM   9544  C CG    . ASN D 1 138 ? 143.41300 143.95400 120.53900 1.000 69.00000  ? 383 ASN D CG    1 
ATOM   9545  O OD1   . ASN D 1 138 ? 143.67400 144.04400 121.73400 1.000 69.00000  ? 383 ASN D OD1   1 
ATOM   9546  N ND2   . ASN D 1 138 ? 142.80200 142.90500 120