data_6TD2
# 
_entry.id   6TD2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.334 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6TD2         
WWPDB D_1292105261 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6TD2 
_pdbx_database_status.recvd_initial_deposition_date   2019-11-07 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Forsgren, N.' 1 ? 
'Ekstrom, F.'  2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Phys.Chem.B 
_citation.journal_id_ASTM           JPCBFK 
_citation.journal_id_CSD            1278 
_citation.journal_id_ISSN           1089-5647 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            124 
_citation.language                  ? 
_citation.page_first                6529 
_citation.page_last                 6539 
_citation.title                     
'Physical Mechanisms Governing Substituent Effects on Arene-Arene Interactions in a Protein Milieu.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acs.jpcb.0c03778 
_citation.pdbx_database_id_PubMed   32610016 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Andersson, C.D.' 1 0000-0001-8198-1688 
primary 'Mishra, B.K.'    2 ?                   
primary 'Forsgren, N.'    3 ?                   
primary 'Ekstrom, F.'     4 ?                   
primary 'Linusson, A.'    5 0000-0003-0063-8912 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6TD2 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     78.957 
_cell.length_a_esd                 ? 
_cell.length_b                     111.957 
_cell.length_b_esd                 ? 
_cell.length_c                     227.429 
_cell.length_c_esd                 ? 
_cell.volume                       2010424.338 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6TD2 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            'P 2ac 2ab' 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase                                                                 59764.488 2   3.1.1.7 ? ? ? 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                             221.208   2   ?       ? ? ? 
3 non-polymer syn '~{N}-[2-(diethylamino)ethyl]-1-[4-(trifluoromethyl)phenyl]methanesulfonamide'       338.389   2   ?       ? ? ? 
4 non-polymer syn 1,2-ETHANEDIOL                                                                       62.068    6   ?       ? ? ? 
5 non-polymer syn '2-(2-METHOXYETHOXY)ETHANOL'                                                         120.147   5   ?       ? ? ? 
6 non-polymer syn '2-{2-[2-(2-{2-[2-(2-ETHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHOXY]-ETHOXY}-ETHANOL' 354.436   1   ?       ? ? ? 
7 non-polymer syn '2-{2-[2-2-(METHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHANOL'                                 208.252   1   ?       ? ? ? 
8 water       nat water                                                                                18.015    170 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SER n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   543 
_entity_src_gen.gene_src_common_name               'House mouse' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 Ache 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               Human 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293F 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_MOUSE 
_struct_ref.pdbx_db_accession          P21836 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_struct_ref.pdbx_align_begin           32 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6TD2 A 1 ? 543 ? P21836 32 ? 574 ? 1 543 
2 1 6TD2 B 1 ? 543 ? P21836 32 ? 574 ? 1 543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                                                              ? 
'C3 H7 N O2'         89.093  
ARG 'L-peptide linking'          y ARGININE                                                                             ? 
'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                                           ? 
'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                                      ? 
'C4 H7 N O4'         133.103 
CYS 'L-peptide linking'          y CYSTEINE                                                                             ? 
'C3 H7 N O2 S'       121.158 
EDO non-polymer                  . 1,2-ETHANEDIOL                                                                       
'ETHYLENE GLYCOL' 'C2 H6 O2'           62.068  
ETE non-polymer                  . '2-{2-[2-2-(METHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHANOL'                                 ? 
'C9 H20 O5'          208.252 
GLN 'L-peptide linking'          y GLUTAMINE                                                                            ? 
'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                                      ? 
'C5 H9 N O4'         147.129 
GLY 'peptide linking'            y GLYCINE                                                                              ? 
'C2 H5 N O2'         75.067  
HIS 'L-peptide linking'          y HISTIDINE                                                                            ? 
'C6 H10 N3 O2 1'     156.162 
HOH non-polymer                  . WATER                                                                                ? 'H2 O' 
18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                                           ? 
'C6 H13 N O2'        131.173 
LEU 'L-peptide linking'          y LEUCINE                                                                              ? 
'C6 H13 N O2'        131.173 
LYS 'L-peptide linking'          y LYSINE                                                                               ? 
'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking'          y METHIONINE                                                                           ? 
'C5 H11 N O2 S'      149.211 
N2K non-polymer                  . '~{N}-[2-(diethylamino)ethyl]-1-[4-(trifluoromethyl)phenyl]methanesulfonamide'       ? 
'C14 H21 F3 N2 O2 S' 338.389 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                                             
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'        221.208 
PE4 non-polymer                  . '2-{2-[2-(2-{2-[2-(2-ETHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHOXY]-ETHOXY}-ETHANOL' 
'POLYETHYLENE GLYCOL PEG4000' 'C16 H34 O8'         354.436 
PG0 non-polymer                  . '2-(2-METHOXYETHOXY)ETHANOL'                                                         'PEG 6000' 
'C5 H12 O3'          120.147 
PHE 'L-peptide linking'          y PHENYLALANINE                                                                        ? 
'C9 H11 N O2'        165.189 
PRO 'L-peptide linking'          y PROLINE                                                                              ? 
'C5 H9 N O2'         115.130 
SER 'L-peptide linking'          y SERINE                                                                               ? 
'C3 H7 N O3'         105.093 
THR 'L-peptide linking'          y THREONINE                                                                            ? 
'C4 H9 N O3'         119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                                           ? 
'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking'          y TYROSINE                                                                             ? 
'C9 H11 N O3'        181.189 
VAL 'L-peptide linking'          y VALINE                                                                               ? 
'C5 H11 N O2'        117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6TD2 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.68 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         66.60 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;30 % (w/v) PEG750MME
0.1 M HEPES pH 7.0
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-02-14 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.041 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'MAX II BEAMLINE I911-5' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.041 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I911-5 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
# 
_reflns.B_iso_Wilson_estimate            45.4038821796 
_reflns.entry_id                         6TD2 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.8 
_reflns.d_resolution_low                 28.9 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       50138 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.5 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.8 
_reflns.pdbx_Rmerge_I_obs                0.093 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            13.4 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.8 
_reflns_shell.d_res_low                   2.95 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           7255 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.494 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               51.8911291687 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6TD2 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.800 
_refine.ls_d_res_low                             28.851 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     49947 
_refine.ls_number_reflns_R_free                  981 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.0010108818 
_refine.ls_percent_reflns_R_free                 1.96408192684 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.175365448692 
_refine.ls_R_factor_R_free                       0.215251914175 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.174582101838 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33784944444 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_starting_model                      1JO6 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 23.8261974636 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.30406205041 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.800 
_refine_hist.d_res_low                        28.851 
_refine_hist.number_atoms_solvent             170 
_refine_hist.number_atoms_total               8670 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        8327 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         173 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.00761252994881 ? 8823  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.993646617486   ? 12038 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0571434259385  ? 1285  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.00742259837966 ? 1572  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 11.3184039651    ? 7094  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.800  2.9475 . . 137 6922 99.6049103993 . . . 0.309969718051 . 0.264600230126 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9475 3.132  . . 155 6906 99.5488509798 . . . 0.278130388538 . 0.236430241013 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.132  3.3735 . . 130 6974 99.7472620051 . . . 0.280423514292 . 0.227055318202 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3735 3.7123 . . 144 7015 99.7075208914 . . . 0.243813916631 . 0.177704656107 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7123 4.248  . . 132 6994 99.3724724585 . . . 0.222016440161 . 0.152050097691 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.248  5.3465 . . 140 7049 98.8042880704 . . . 0.143697216076 . 0.131026728891 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.3465 28.85  . . 143 7106 96.3834596463 . . . 0.177983084745 . 0.159503664654 . . . . . . . . . . . 
# 
_struct.entry_id                     6TD2 
_struct.title                        
'Mus musculus Acetylcholinesterase in complex with N-(2-(diethylamino)ethyl)-1-(4-(trifluoromethyl)phenyl)methanesulfonamide' 
_struct.pdbx_descriptor              'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6TD2 
_struct_keywords.text            'Complex, Inhibitor, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 6 ? 
M N N 3 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
Q N N 5 ? 
R N N 5 ? 
S N N 7 ? 
T N N 8 ? 
U N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P2  AA2 PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P3  AA3 LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P4  AA4 GLY A 135 ? GLY A 143 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P5  AA5 VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P6  AA6 ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P7  AA7 ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P8  AA8 SER A 203 ? SER A 215 ? SER A 203 SER A 215 1 ? 13 
HELX_P HELX_P9  AA9 LEU A 216 ? LEU A 221 ? LEU A 216 LEU A 221 5 ? 6  
HELX_P HELX_P10 AB1 SER A 240 ? VAL A 255 ? SER A 240 VAL A 255 1 ? 16 
HELX_P HELX_P11 AB2 ASP A 266 ? ARG A 274 ? ASP A 266 ARG A 274 1 ? 9  
HELX_P HELX_P12 AB3 PRO A 277 ? GLU A 285 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P13 AB4 TRP A 286 ? LEU A 289 ? TRP A 286 LEU A 289 5 ? 4  
HELX_P HELX_P14 AB5 THR A 311 ? GLY A 319 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P15 AB6 GLY A 335 ? VAL A 340 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P16 AB7 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P17 AB8 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P18 AB9 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P19 AC1 VAL A 407 ? GLN A 421 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P20 AC2 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P21 AC3 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P22 AC4 GLY A 456 ? ASN A 464 ? GLY A 456 ASN A 464 5 ? 9  
HELX_P HELX_P23 AC5 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P24 AC6 ARG A 525 ? ARG A 534 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P25 AC7 ARG A 534 ? SER A 541 ? ARG A 534 SER A 541 1 ? 8  
HELX_P HELX_P26 AC8 ASP B 5   ? GLN B 7   ? ASP B 5   GLN B 7   5 ? 3  
HELX_P HELX_P27 AC9 VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P28 AD1 PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P29 AD2 LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P30 AD3 GLY B 135 ? GLU B 142 ? GLY B 135 GLU B 142 1 ? 8  
HELX_P HELX_P31 AD4 VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P32 AD5 ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P33 AD6 ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P34 AD7 SER B 203 ? SER B 215 ? SER B 203 SER B 215 1 ? 13 
HELX_P HELX_P35 AD8 SER B 215 ? SER B 220 ? SER B 215 SER B 220 1 ? 6  
HELX_P HELX_P36 AD9 ALA B 241 ? VAL B 255 ? ALA B 241 VAL B 255 1 ? 15 
HELX_P HELX_P37 AE1 ASP B 266 ? THR B 275 ? ASP B 266 THR B 275 1 ? 10 
HELX_P HELX_P38 AE2 PRO B 277 ? ASP B 283 ? PRO B 277 ASP B 283 1 ? 7  
HELX_P HELX_P39 AE3 HIS B 284 ? LEU B 289 ? HIS B 284 LEU B 289 5 ? 6  
HELX_P HELX_P40 AE4 THR B 311 ? ASN B 317 ? THR B 311 ASN B 317 1 ? 7  
HELX_P HELX_P41 AE5 GLY B 335 ? VAL B 340 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P42 AE6 SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P43 AE7 SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P44 AE8 ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P45 AE9 VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P46 AF1 PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P47 AF2 GLU B 450 ? PHE B 455 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P48 AF3 GLY B 456 ? ASN B 464 ? GLY B 456 ASN B 464 5 ? 9  
HELX_P HELX_P49 AF4 THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P50 AF5 ARG B 525 ? ARG B 534 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P51 AF6 ARG B 534 ? SER B 541 ? ARG B 534 SER B 541 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 69  SG  ? ? ? 1_555 A CYS 96  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.050 ? ?               
disulf2 disulf ?   ? A CYS 257 SG  ? ? ? 1_555 A CYS 272 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.070 ? ?               
disulf3 disulf ?   ? A CYS 409 SG  ? ? ? 1_555 A CYS 529 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.052 ? ?               
disulf4 disulf ?   ? B CYS 69  SG  ? ? ? 1_555 B CYS 96  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.053 ? ?               
disulf5 disulf ?   ? B CYS 257 SG  ? ? ? 1_555 B CYS 272 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.098 ? ?               
disulf6 disulf ?   ? B CYS 409 SG  ? ? ? 1_555 B CYS 529 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.046 ? ?               
covale1 covale one ? A ASN 350 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 A NAG 601 1_555 ? ? ? ? ? ? ? 1.438 ? N-Glycosylation 
covale2 covale one ? A ASN 464 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 464 A NAG 602 1_555 ? ? ? ? ? ? ? 1.456 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 -2.41 
2 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 3.55  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
AA3 ? 2  ? 
AA4 ? 3  ? 
AA5 ? 11 ? 
AA6 ? 2  ? 
AA7 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
AA3 1  2  ? parallel      
AA4 1  2  ? anti-parallel 
AA4 2  3  ? parallel      
AA5 1  2  ? anti-parallel 
AA5 2  3  ? anti-parallel 
AA5 3  4  ? anti-parallel 
AA5 4  5  ? parallel      
AA5 5  6  ? parallel      
AA5 6  7  ? parallel      
AA5 7  8  ? parallel      
AA5 8  9  ? parallel      
AA5 9  10 ? parallel      
AA5 10 11 ? anti-parallel 
AA6 1  2  ? parallel      
AA7 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
AA1 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
AA1 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
AA2 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
AA2 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
AA2 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
AA2 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
AA2 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
AA2 6  GLY A 192 ? GLU A 202 ? GLY A 192 GLU A 202 
AA2 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
AA2 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
AA2 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
AA2 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
AA2 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
AA3 1  VAL A 68  ? CYS A 69  ? VAL A 68  CYS A 69  
AA3 2  LEU A 92  ? SER A 93  ? LEU A 92  SER A 93  
AA4 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
AA4 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
AA4 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
AA5 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
AA5 2  GLY B 27  ? PRO B 36  ? GLY B 27  PRO B 36  
AA5 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
AA5 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
AA5 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
AA5 6  GLY B 192 ? GLU B 202 ? GLY B 192 GLU B 202 
AA5 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
AA5 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
AA5 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
AA5 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
AA5 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
AA6 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
AA6 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
AA7 1  VAL B 239 ? SER B 240 ? VAL B 239 SER B 240 
AA7 2  VAL B 302 ? VAL B 303 ? VAL B 302 VAL B 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 12  ? N VAL A 12  O GLY A 15  ? O GLY A 15  
AA1 2  3  N GLN A 16  ? N GLN A 16  O LEU A 60  ? O LEU A 60  
AA2 1  2  N ILE A 20  ? N ILE A 20  O ALA A 31  ? O ALA A 31  
AA2 2  3  N SER A 30  ? N SER A 30  O THR A 103 ? O THR A 103 
AA2 3  4  N ASN A 100 ? N ASN A 100 O SER A 148 ? O SER A 148 
AA2 4  5  O VAL A 145 ? O VAL A 145 N LEU A 115 ? N LEU A 115 
AA2 5  6  N THR A 112 ? N THR A 112 O ASP A 193 ? O ASP A 193 
AA2 6  7  N GLY A 201 ? N GLY A 201 O GLN A 228 ? O GLN A 228 
AA2 7  8  N LEU A 227 ? N LEU A 227 O LEU A 327 ? O LEU A 327 
AA2 8  9  N VAL A 330 ? N VAL A 330 O PHE A 430 ? O PHE A 430 
AA2 9  10 N ILE A 429 ? N ILE A 429 O LEU A 513 ? O LEU A 513 
AA2 10 11 N TYR A 510 ? N TYR A 510 O ARG A 521 ? O ARG A 521 
AA3 1  2  N VAL A 68  ? N VAL A 68  O SER A 93  ? O SER A 93  
AA4 1  2  N VAL B 10  ? N VAL B 10  O LEU B 17  ? O LEU B 17  
AA4 2  3  N GLN B 16  ? N GLN B 16  O LEU B 60  ? O LEU B 60  
AA5 1  2  N ALA B 24  ? N ALA B 24  O GLY B 27  ? O GLY B 27  
AA5 2  3  N SER B 30  ? N SER B 30  O THR B 103 ? O THR B 103 
AA5 3  4  N ASN B 100 ? N ASN B 100 O SER B 148 ? O SER B 148 
AA5 4  5  O VAL B 147 ? O VAL B 147 N TRP B 117 ? N TRP B 117 
AA5 5  6  N VAL B 114 ? N VAL B 114 O SER B 196 ? O SER B 196 
AA5 6  7  N GLY B 201 ? N GLY B 201 O GLN B 228 ? O GLN B 228 
AA5 7  8  N LEU B 227 ? N LEU B 227 O LEU B 327 ? O LEU B 327 
AA5 8  9  N VAL B 330 ? N VAL B 330 O PHE B 430 ? O PHE B 430 
AA5 9  10 N ILE B 429 ? N ILE B 429 O LEU B 513 ? O LEU B 513 
AA5 10 11 N TYR B 510 ? N TYR B 510 O ARG B 521 ? O ARG B 521 
AA6 1  2  N VAL B 68  ? N VAL B 68  O SER B 93  ? O SER B 93  
AA7 1  2  N VAL B 239 ? N VAL B 239 O VAL B 303 ? O VAL B 303 
# 
_atom_sites.entry_id                    6TD2 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.012665 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008932 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004397 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C ? ? 3.54356 2.42580 25.62398 1.50364  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
F ? ? 8.95735 ?       7.27484  ?        0.0 
;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N ? ? 4.01032 2.96436 19.97189 1.75589  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O ? ? 7.96527 ?       9.05267  ?        0.0 
;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S ? ? 9.55732 6.39887 1.23737  29.19336 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1   ? 31.56702  13.78399  56.65426  1.000 78.28604  ? 1   GLU A N   1 
ATOM   2    C CA  . GLU A 1 1   ? 30.62587  14.27348  55.63738  1.000 81.17566  ? 1   GLU A CA  1 
ATOM   3    C C   . GLU A 1 1   ? 29.65727  15.26964  56.28263  1.000 86.24314  ? 1   GLU A C   1 
ATOM   4    O O   . GLU A 1 1   ? 29.32909  16.31521  55.69773  1.000 92.60992  ? 1   GLU A O   1 
ATOM   5    C CB  . GLU A 1 1   ? 29.84911  13.11119  54.98384  1.000 71.17677  ? 1   GLU A CB  1 
ATOM   6    C CG  . GLU A 1 1   ? 30.69217  11.86412  54.66178  1.000 71.62406  ? 1   GLU A CG  1 
ATOM   7    C CD  . GLU A 1 1   ? 29.87012  10.69092  54.10667  1.000 73.42471  ? 1   GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 1   ? 28.85596  10.29741  54.74991  1.000 57.41466  ? 1   GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 1   ? 30.24410  10.17406  53.01700  1.000 78.96498  ? 1   GLU A OE2 1 
ATOM   10   N N   . GLY A 1 2   ? 29.19737  14.91686  57.48633  1.000 81.17988  ? 2   GLY A N   1 
ATOM   11   C CA  . GLY A 1 2   ? 28.38335  15.78887  58.31319  1.000 83.66513  ? 2   GLY A CA  1 
ATOM   12   C C   . GLY A 1 2   ? 27.01107  16.16292  57.78502  1.000 86.37275  ? 2   GLY A C   1 
ATOM   13   O O   . GLY A 1 2   ? 26.02700  15.44690  58.01157  1.000 57.37111  ? 2   GLY A O   1 
ATOM   14   N N   . ARG A 1 3   ? 26.93730  17.29591  57.07570  1.000 83.13921  ? 3   ARG A N   1 
ATOM   15   C CA  . ARG A 1 3   ? 25.67610  17.98081  56.82090  1.000 79.78281  ? 3   ARG A CA  1 
ATOM   16   C C   . ARG A 1 3   ? 25.38104  18.12703  55.33509  1.000 74.38407  ? 3   ARG A C   1 
ATOM   17   O O   . ARG A 1 3   ? 24.69922  19.06754  54.93470  1.000 75.95102  ? 3   ARG A O   1 
ATOM   18   C CB  . ARG A 1 3   ? 25.66483  19.35504  57.49177  1.000 85.90915  ? 3   ARG A CB  1 
ATOM   19   C CG  . ARG A 1 3   ? 26.14359  19.35036  58.93520  1.000 94.36204  ? 3   ARG A CG  1 
ATOM   20   C CD  . ARG A 1 3   ? 27.58029  19.86382  59.06221  1.000 97.24243  ? 3   ARG A CD  1 
ATOM   21   N NE  . ARG A 1 3   ? 28.19428  19.52629  60.35294  1.000 103.83699 ? 3   ARG A NE  1 
ATOM   22   C CZ  . ARG A 1 3   ? 27.88934  20.09890  61.52356  1.000 100.79561 ? 3   ARG A CZ  1 
ATOM   23   N NH1 . ARG A 1 3   ? 28.51971  19.71842  62.63564  1.000 98.46749  ? 3   ARG A NH1 1 
ATOM   24   N NH2 . ARG A 1 3   ? 26.95390  21.04463  61.59254  1.000 94.89230  ? 3   ARG A NH2 1 
ATOM   25   N N   . GLU A 1 4   ? 25.87440  17.21153  54.50793  1.000 73.33403  ? 4   GLU A N   1 
ATOM   26   C CA  . GLU A 1 4   ? 25.56436  17.24908  53.08691  1.000 69.31024  ? 4   GLU A CA  1 
ATOM   27   C C   . GLU A 1 4   ? 24.24473  16.54160  52.81240  1.000 65.97885  ? 4   GLU A C   1 
ATOM   28   O O   . GLU A 1 4   ? 23.66825  15.89947  53.69129  1.000 64.25509  ? 4   GLU A O   1 
ATOM   29   C CB  . GLU A 1 4   ? 26.66386  16.58750  52.26476  1.000 74.32994  ? 4   GLU A CB  1 
ATOM   30   C CG  . GLU A 1 4   ? 28.05745  16.81426  52.76225  1.000 82.18358  ? 4   GLU A CG  1 
ATOM   31   C CD  . GLU A 1 4   ? 29.06118  16.41867  51.71838  1.000 91.31672  ? 4   GLU A CD  1 
ATOM   32   O OE1 . GLU A 1 4   ? 30.04900  15.72949  52.06832  1.000 96.27671  ? 4   GLU A OE1 1 
ATOM   33   O OE2 . GLU A 1 4   ? 28.83325  16.77924  50.53908  1.000 91.55175  ? 4   GLU A OE2 1 
ATOM   34   N N   . ASP A 1 5   ? 23.77085  16.66090  51.56514  1.000 63.93129  ? 5   ASP A N   1 
ATOM   35   C CA  . ASP A 1 5   ? 22.62883  15.87244  51.10752  1.000 56.40495  ? 5   ASP A CA  1 
ATOM   36   C C   . ASP A 1 5   ? 23.07384  14.41993  51.00018  1.000 54.52361  ? 5   ASP A C   1 
ATOM   37   O O   . ASP A 1 5   ? 24.02188  14.12684  50.26345  1.000 54.28743  ? 5   ASP A O   1 
ATOM   38   C CB  . ASP A 1 5   ? 22.10360  16.38664  49.76535  1.000 58.78306  ? 5   ASP A CB  1 
ATOM   39   C CG  . ASP A 1 5   ? 20.84895  15.63270  49.27775  1.000 63.33207  ? 5   ASP A CG  1 
ATOM   40   O OD1 . ASP A 1 5   ? 20.27245  16.03056  48.22902  1.000 59.24625  ? 5   ASP A OD1 1 
ATOM   41   O OD2 . ASP A 1 5   ? 20.43748  14.64085  49.92375  1.000 61.36931  ? 5   ASP A OD2 1 
ATOM   42   N N   . PRO A 1 6   ? 22.45999  13.49015  51.73860  1.000 56.72429  ? 6   PRO A N   1 
ATOM   43   C CA  . PRO A 1 6   ? 22.87544  12.08283  51.65249  1.000 58.99396  ? 6   PRO A CA  1 
ATOM   44   C C   . PRO A 1 6   ? 22.42917  11.37261  50.38991  1.000 63.75761  ? 6   PRO A C   1 
ATOM   45   O O   . PRO A 1 6   ? 22.67133  10.16945  50.26455  1.000 68.01806  ? 6   PRO A O   1 
ATOM   46   C CB  . PRO A 1 6   ? 22.21638  11.45044  52.88522  1.000 54.82486  ? 6   PRO A CB  1 
ATOM   47   C CG  . PRO A 1 6   ? 21.03764  12.30988  53.14022  1.000 50.80403  ? 6   PRO A CG  1 
ATOM   48   C CD  . PRO A 1 6   ? 21.46866  13.70184  52.80702  1.000 50.97684  ? 6   PRO A CD  1 
ATOM   49   N N   . GLN A 1 7   ? 21.76733  12.03732  49.45644  1.000 65.00498  ? 7   GLN A N   1 
ATOM   50   C CA  . GLN A 1 7   ? 21.48016  11.39035  48.18729  1.000 68.44007  ? 7   GLN A CA  1 
ATOM   51   C C   . GLN A 1 7   ? 22.47292  11.78027  47.10063  1.000 60.71993  ? 7   GLN A C   1 
ATOM   52   O O   . GLN A 1 7   ? 22.34835  11.30918  45.97018  1.000 61.31250  ? 7   GLN A O   1 
ATOM   53   C CB  . GLN A 1 7   ? 20.04547  11.69618  47.74838  1.000 75.46922  ? 7   GLN A CB  1 
ATOM   54   C CG  . GLN A 1 7   ? 19.08705  10.51295  47.91190  1.000 84.55718  ? 7   GLN A CG  1 
ATOM   55   C CD  . GLN A 1 7   ? 19.26665  9.45012   46.83115  1.000 89.03665  ? 7   GLN A CD  1 
ATOM   56   O OE1 . GLN A 1 7   ? 19.68995  9.75345   45.71444  1.000 92.85864  ? 7   GLN A OE1 1 
ATOM   57   N NE2 . GLN A 1 7   ? 18.93387  8.20033   47.15712  1.000 91.90054  ? 7   GLN A NE2 1 
ATOM   58   N N   . LEU A 1 8   ? 23.47642  12.59555  47.42795  1.000 61.26555  ? 8   LEU A N   1 
ATOM   59   C CA  . LEU A 1 8   ? 24.45339  13.07962  46.46130  1.000 51.44444  ? 8   LEU A CA  1 
ATOM   60   C C   . LEU A 1 8   ? 25.85086  12.52199  46.69459  1.000 54.11529  ? 8   LEU A C   1 
ATOM   61   O O   . LEU A 1 8   ? 26.79080  12.95524  46.01464  1.000 54.41344  ? 8   LEU A O   1 
ATOM   62   C CB  . LEU A 1 8   ? 24.49933  14.61011  46.47270  1.000 41.68997  ? 8   LEU A CB  1 
ATOM   63   C CG  . LEU A 1 8   ? 23.17274  15.21570  46.02559  1.000 47.57436  ? 8   LEU A CG  1 
ATOM   64   C CD1 . LEU A 1 8   ? 23.11817  16.70681  46.28840  1.000 51.65800  ? 8   LEU A CD1 1 
ATOM   65   C CD2 . LEU A 1 8   ? 22.95666  14.91056  44.54923  1.000 47.62887  ? 8   LEU A CD2 1 
ATOM   66   N N   . LEU A 1 9   ? 26.02114  11.57872  47.62916  1.000 49.08300  ? 9   LEU A N   1 
ATOM   67   C CA  . LEU A 1 9   ? 27.31588  10.94698  47.86093  1.000 42.00009  ? 9   LEU A CA  1 
ATOM   68   C C   . LEU A 1 9   ? 27.28455  9.50411   47.36459  1.000 44.44016  ? 9   LEU A C   1 
ATOM   69   O O   . LEU A 1 9   ? 26.43458  8.71440   47.79121  1.000 35.69303  ? 9   LEU A O   1 
ATOM   70   C CB  . LEU A 1 9   ? 27.69235  11.01389  49.33202  1.000 40.90622  ? 9   LEU A CB  1 
ATOM   71   C CG  . LEU A 1 9   ? 27.46510  12.40726  49.91508  1.000 52.60265  ? 9   LEU A CG  1 
ATOM   72   C CD1 . LEU A 1 9   ? 27.58763  12.39139  51.47435  1.000 40.92550  ? 9   LEU A CD1 1 
ATOM   73   C CD2 . LEU A 1 9   ? 28.38779  13.44097  49.24189  1.000 43.00356  ? 9   LEU A CD2 1 
ATOM   74   N N   . VAL A 1 10  ? 28.20736  9.16826   46.45619  1.000 41.85788  ? 10  VAL A N   1 
ATOM   75   C CA  . VAL A 1 10  ? 28.26535  7.86187   45.80259  1.000 41.21111  ? 10  VAL A CA  1 
ATOM   76   C C   . VAL A 1 10  ? 29.72589  7.43469   45.68241  1.000 42.35341  ? 10  VAL A C   1 
ATOM   77   O O   . VAL A 1 10  ? 30.59196  8.26163   45.37121  1.000 41.61635  ? 10  VAL A O   1 
ATOM   78   C CB  . VAL A 1 10  ? 27.60377  7.92175   44.40710  1.000 44.33438  ? 10  VAL A CB  1 
ATOM   79   C CG1 . VAL A 1 10  ? 27.81302  6.60878   43.63338  1.000 45.83948  ? 10  VAL A CG1 1 
ATOM   80   C CG2 . VAL A 1 10  ? 26.11508  8.28049   44.51703  1.000 42.34928  ? 10  VAL A CG2 1 
ATOM   81   N N   . ARG A 1 11  ? 30.00429  6.14560   45.92383  1.000 39.25448  ? 11  ARG A N   1 
ATOM   82   C CA  . ARG A 1 11  ? 31.33099  5.57908   45.69036  1.000 34.91523  ? 11  ARG A CA  1 
ATOM   83   C C   . ARG A 1 11  ? 31.37265  4.85027   44.34962  1.000 42.45474  ? 11  ARG A C   1 
ATOM   84   O O   . ARG A 1 11  ? 30.45664  4.09208   44.01139  1.000 45.36299  ? 11  ARG A O   1 
ATOM   85   C CB  . ARG A 1 11  ? 31.74627  4.60205   46.79586  1.000 35.87817  ? 11  ARG A CB  1 
ATOM   86   C CG  . ARG A 1 11  ? 33.15992  4.01289   46.61779  1.000 36.40759  ? 11  ARG A CG  1 
ATOM   87   C CD  . ARG A 1 11  ? 33.74369  3.43696   47.91200  1.000 52.96385  ? 11  ARG A CD  1 
ATOM   88   N NE  . ARG A 1 11  ? 34.15375  4.47688   48.86369  1.000 57.81429  ? 11  ARG A NE  1 
ATOM   89   C CZ  . ARG A 1 11  ? 35.41541  4.77420   49.16488  1.000 60.78218  ? 11  ARG A CZ  1 
ATOM   90   N NH1 . ARG A 1 11  ? 35.68926  5.73573   50.03736  1.000 65.12397  ? 11  ARG A NH1 1 
ATOM   91   N NH2 . ARG A 1 11  ? 36.40758  4.11144   48.59546  1.000 60.93998  ? 11  ARG A NH2 1 
ATOM   92   N N   . VAL A 1 12  ? 32.44803  5.08135   43.59216  1.000 39.66768  ? 12  VAL A N   1 
ATOM   93   C CA  . VAL A 1 12  ? 32.74704  4.29970   42.39771  1.000 41.61820  ? 12  VAL A CA  1 
ATOM   94   C C   . VAL A 1 12  ? 34.12246  3.66713   42.56675  1.000 43.18368  ? 12  VAL A C   1 
ATOM   95   O O   . VAL A 1 12  ? 34.80804  3.90540   43.56563  1.000 53.07379  ? 12  VAL A O   1 
ATOM   96   C CB  . VAL A 1 12  ? 32.67460  5.16148   41.12255  1.000 32.03628  ? 12  VAL A CB  1 
ATOM   97   C CG1 . VAL A 1 12  ? 31.26847  5.63665   40.90940  1.000 28.30929  ? 12  VAL A CG1 1 
ATOM   98   C CG2 . VAL A 1 12  ? 33.59766  6.34989   41.25008  1.000 34.84402  ? 12  VAL A CG2 1 
ATOM   99   N N   . ARG A 1 13  ? 34.54432  2.87319   41.57973  1.000 38.18692  ? 13  ARG A N   1 
ATOM   100  C CA  . ARG A 1 13  ? 35.78107  2.10975   41.72081  1.000 41.34291  ? 13  ARG A CA  1 
ATOM   101  C C   . ARG A 1 13  ? 36.99085  3.00176   41.99441  1.000 40.51603  ? 13  ARG A C   1 
ATOM   102  O O   . ARG A 1 13  ? 37.98699  2.54275   42.57179  1.000 35.51602  ? 13  ARG A O   1 
ATOM   103  C CB  . ARG A 1 13  ? 36.00512  1.25879   40.47260  1.000 40.99149  ? 13  ARG A CB  1 
ATOM   104  C CG  . ARG A 1 13  ? 37.32747  0.53821   40.48840  1.000 45.09180  ? 13  ARG A CG  1 
ATOM   105  C CD  . ARG A 1 13  ? 37.20794  -0.75924  41.24239  1.000 44.89221  ? 13  ARG A CD  1 
ATOM   106  N NE  . ARG A 1 13  ? 38.46251  -1.50369  41.30876  1.000 50.31524  ? 13  ARG A NE  1 
ATOM   107  C CZ  . ARG A 1 13  ? 39.57953  -1.06239  41.87792  1.000 54.82306  ? 13  ARG A CZ  1 
ATOM   108  N NH1 . ARG A 1 13  ? 39.62796  0.13939   42.44344  1.000 40.18436  ? 13  ARG A NH1 1 
ATOM   109  N NH2 . ARG A 1 13  ? 40.65381  -1.83740  41.88907  1.000 58.26171  ? 13  ARG A NH2 1 
ATOM   110  N N   . GLY A 1 14  ? 36.91564  4.27364   41.61643  1.000 34.74282  ? 14  GLY A N   1 
ATOM   111  C CA  . GLY A 1 14  ? 38.04985  5.15852   41.73392  1.000 37.65230  ? 14  GLY A CA  1 
ATOM   112  C C   . GLY A 1 14  ? 38.04399  5.96586   43.01216  1.000 53.11500  ? 14  GLY A C   1 
ATOM   113  O O   . GLY A 1 14  ? 39.08082  6.51196   43.39941  1.000 60.23327  ? 14  GLY A O   1 
ATOM   114  N N   . GLY A 1 15  ? 36.89462  6.06546   43.66834  1.000 50.70101  ? 15  GLY A N   1 
ATOM   115  C CA  . GLY A 1 15  ? 36.79688  6.81627   44.90313  1.000 50.50639  ? 15  GLY A CA  1 
ATOM   116  C C   . GLY A 1 15  ? 35.39400  7.35753   45.10531  1.000 51.07941  ? 15  GLY A C   1 
ATOM   117  O O   . GLY A 1 15  ? 34.44480  6.90409   44.48046  1.000 61.99456  ? 15  GLY A O   1 
ATOM   118  N N   . GLN A 1 16  ? 35.29409  8.34061   45.99092  1.000 46.52546  ? 16  GLN A N   1 
ATOM   119  C CA  . GLN A 1 16  ? 34.02354  8.93719   46.37914  1.000 52.37128  ? 16  GLN A CA  1 
ATOM   120  C C   . GLN A 1 16  ? 33.68878  10.13912  45.49909  1.000 48.09666  ? 16  GLN A C   1 
ATOM   121  O O   . GLN A 1 16  ? 34.57368  10.88854  45.08025  1.000 57.76650  ? 16  GLN A O   1 
ATOM   122  C CB  . GLN A 1 16  ? 34.06993  9.36935   47.85172  1.000 58.91632  ? 16  GLN A CB  1 
ATOM   123  C CG  . GLN A 1 16  ? 33.42006  8.39162   48.83662  1.000 61.76889  ? 16  GLN A CG  1 
ATOM   124  C CD  . GLN A 1 16  ? 33.92935  8.57319   50.24920  1.000 70.48692  ? 16  GLN A CD  1 
ATOM   125  O OE1 . GLN A 1 16  ? 35.13232  8.79538   50.46689  1.000 68.25837  ? 16  GLN A OE1 1 
ATOM   126  N NE2 . GLN A 1 16  ? 33.02163  8.47909   51.22509  1.000 77.49909  ? 16  GLN A NE2 1 
ATOM   127  N N   . LEU A 1 17  ? 32.39466  10.33055  45.22767  1.000 36.44379  ? 17  LEU A N   1 
ATOM   128  C CA  . LEU A 1 17  ? 31.94554  11.47708  44.44588  1.000 38.95605  ? 17  LEU A CA  1 
ATOM   129  C C   . LEU A 1 17  ? 30.85053  12.22135  45.18854  1.000 43.52179  ? 17  LEU A C   1 
ATOM   130  O O   . LEU A 1 17  ? 30.00786  11.60275  45.84610  1.000 52.20115  ? 17  LEU A O   1 
ATOM   131  C CB  . LEU A 1 17  ? 31.40887  11.06563  43.05937  1.000 35.02599  ? 17  LEU A CB  1 
ATOM   132  C CG  . LEU A 1 17  ? 32.23560  10.05892  42.27322  1.000 33.98802  ? 17  LEU A CG  1 
ATOM   133  C CD1 . LEU A 1 17  ? 31.32304  9.18919   41.43603  1.000 31.87785  ? 17  LEU A CD1 1 
ATOM   134  C CD2 . LEU A 1 17  ? 33.28089  10.77115  41.42494  1.000 32.17157  ? 17  LEU A CD2 1 
ATOM   135  N N   . ARG A 1 18  ? 30.85115  13.54830  45.06168  1.000 39.98505  ? 18  ARG A N   1 
ATOM   136  C CA  . ARG A 1 18  ? 29.74092  14.37794  45.51018  1.000 45.07074  ? 18  ARG A CA  1 
ATOM   137  C C   . ARG A 1 18  ? 29.09564  15.02581  44.28760  1.000 51.07805  ? 18  ARG A C   1 
ATOM   138  O O   . ARG A 1 18  ? 29.70212  15.88693  43.64288  1.000 53.78217  ? 18  ARG A O   1 
ATOM   139  C CB  . ARG A 1 18  ? 30.20064  15.43670  46.50517  1.000 44.97398  ? 18  ARG A CB  1 
ATOM   140  C CG  . ARG A 1 18  ? 29.05372  16.27836  47.05054  1.000 42.68855  ? 18  ARG A CG  1 
ATOM   141  C CD  . ARG A 1 18  ? 29.56277  17.61456  47.51346  1.000 47.83757  ? 18  ARG A CD  1 
ATOM   142  N NE  . ARG A 1 18  ? 30.40899  17.41152  48.68218  1.000 63.71615  ? 18  ARG A NE  1 
ATOM   143  C CZ  . ARG A 1 18  ? 31.72525  17.60413  48.70685  1.000 60.02899  ? 18  ARG A CZ  1 
ATOM   144  N NH1 . ARG A 1 18  ? 32.40581  17.36865  49.82846  1.000 49.61330  ? 18  ARG A NH1 1 
ATOM   145  N NH2 . ARG A 1 18  ? 32.35107  18.04268  47.61600  1.000 52.81850  ? 18  ARG A NH2 1 
ATOM   146  N N   . GLY A 1 19  ? 27.86049  14.62910  43.98911  1.000 50.18817  ? 19  GLY A N   1 
ATOM   147  C CA  . GLY A 1 19  ? 27.08648  15.22078  42.92028  1.000 49.91588  ? 19  GLY A CA  1 
ATOM   148  C C   . GLY A 1 19  ? 26.28089  16.43655  43.34767  1.000 54.41556  ? 19  GLY A C   1 
ATOM   149  O O   . GLY A 1 19  ? 26.49787  17.03340  44.40689  1.000 52.74271  ? 19  GLY A O   1 
ATOM   150  N N   . ILE A 1 20  ? 25.30544  16.77892  42.50812  1.000 52.95364  ? 20  ILE A N   1 
ATOM   151  C CA  . ILE A 1 20  ? 24.58557  18.04254  42.58624  1.000 48.52832  ? 20  ILE A CA  1 
ATOM   152  C C   . ILE A 1 20  ? 23.09963  17.76310  42.38471  1.000 47.75577  ? 20  ILE A C   1 
ATOM   153  O O   . ILE A 1 20  ? 22.71273  16.84815  41.64774  1.000 47.97983  ? 20  ILE A O   1 
ATOM   154  C CB  . ILE A 1 20  ? 25.12267  19.01072  41.50660  1.000 49.50604  ? 20  ILE A CB  1 
ATOM   155  C CG1 . ILE A 1 20  ? 24.65397  20.44945  41.70845  1.000 33.36011  ? 20  ILE A CG1 1 
ATOM   156  C CG2 . ILE A 1 20  ? 24.75249  18.51239  40.12127  1.000 46.10325  ? 20  ILE A CG2 1 
ATOM   157  C CD1 . ILE A 1 20  ? 25.61942  21.25939  42.41140  1.000 46.05880  ? 20  ILE A CD1 1 
ATOM   158  N N   . ARG A 1 21  ? 22.25947  18.56730  43.02773  1.000 46.42069  ? 21  ARG A N   1 
ATOM   159  C CA  . ARG A 1 21  ? 20.80603  18.40163  42.95509  1.000 43.41090  ? 21  ARG A CA  1 
ATOM   160  C C   . ARG A 1 21  ? 20.23945  19.51659  42.07923  1.000 49.87620  ? 21  ARG A C   1 
ATOM   161  O O   . ARG A 1 21  ? 19.99110  20.62663  42.56265  1.000 56.12574  ? 21  ARG A O   1 
ATOM   162  C CB  . ARG A 1 21  ? 20.20065  18.41611  44.35692  1.000 40.53785  ? 21  ARG A CB  1 
ATOM   163  C CG  . ARG A 1 21  ? 18.69189  18.16196  44.41394  1.000 45.32576  ? 21  ARG A CG  1 
ATOM   164  C CD  . ARG A 1 21  ? 17.99652  18.77075  45.66096  1.000 51.96905  ? 21  ARG A CD  1 
ATOM   165  N NE  . ARG A 1 21  ? 16.74115  19.42193  45.27061  1.000 63.28952  ? 21  ARG A NE  1 
ATOM   166  C CZ  . ARG A 1 21  ? 15.62327  19.44557  45.99941  1.000 80.43659  ? 21  ARG A CZ  1 
ATOM   167  N NH1 . ARG A 1 21  ? 14.53865  20.06870  45.53124  1.000 74.23507  ? 21  ARG A NH1 1 
ATOM   168  N NH2 . ARG A 1 21  ? 15.58195  18.85229  47.19347  1.000 90.41609  ? 21  ARG A NH2 1 
ATOM   169  N N   . LEU A 1 22  ? 20.02667  19.21191  40.79036  1.000 47.88759  ? 22  LEU A N   1 
ATOM   170  C CA  . LEU A 1 22  ? 19.59419  20.18140  39.78043  1.000 47.61909  ? 22  LEU A CA  1 
ATOM   171  C C   . LEU A 1 22  ? 18.07635  20.25711  39.67492  1.000 51.68754  ? 22  LEU A C   1 
ATOM   172  O O   . LEU A 1 22  ? 17.37592  19.25700  39.84872  1.000 59.54255  ? 22  LEU A O   1 
ATOM   173  C CB  . LEU A 1 22  ? 20.14781  19.82114  38.39892  1.000 37.05271  ? 22  LEU A CB  1 
ATOM   174  C CG  . LEU A 1 22  ? 21.65603  19.78833  38.22536  1.000 33.43041  ? 22  LEU A CG  1 
ATOM   175  C CD1 . LEU A 1 22  ? 21.96560  19.04038  36.97845  1.000 30.10369  ? 22  LEU A CD1 1 
ATOM   176  C CD2 . LEU A 1 22  ? 22.19447  21.20023  38.16014  1.000 37.73070  ? 22  LEU A CD2 1 
ATOM   177  N N   . LYS A 1 23  ? 17.57450  21.44806  39.34116  1.000 48.53843  ? 23  LYS A N   1 
ATOM   178  C CA  . LYS A 1 23  ? 16.15171  21.64195  39.08096  1.000 54.03546  ? 23  LYS A CA  1 
ATOM   179  C C   . LYS A 1 23  ? 15.86321  21.37526  37.60826  1.000 60.45649  ? 23  LYS A C   1 
ATOM   180  O O   . LYS A 1 23  ? 16.45176  22.01655  36.72912  1.000 67.03811  ? 23  LYS A O   1 
ATOM   181  C CB  . LYS A 1 23  ? 15.70613  23.05617  39.45111  1.000 59.47256  ? 23  LYS A CB  1 
ATOM   182  C CG  . LYS A 1 23  ? 15.54656  23.29238  40.94689  1.000 69.69229  ? 23  LYS A CG  1 
ATOM   183  C CD  . LYS A 1 23  ? 15.10224  24.72124  41.25105  1.000 78.26232  ? 23  LYS A CD  1 
ATOM   184  C CE  . LYS A 1 23  ? 15.52029  25.13040  42.65604  1.000 81.49732  ? 23  LYS A CE  1 
ATOM   185  N NZ  . LYS A 1 23  ? 17.00840  25.09217  42.79252  1.000 75.65775  ? 23  LYS A NZ  1 
ATOM   186  N N   . ALA A 1 24  ? 14.98224  20.41380  37.34004  1.000 55.60991  ? 24  ALA A N   1 
ATOM   187  C CA  . ALA A 1 24  ? 14.32296  20.29588  36.04533  1.000 52.47570  ? 24  ALA A CA  1 
ATOM   188  C C   . ALA A 1 24  ? 12.88898  20.77907  36.17073  1.000 58.73702  ? 24  ALA A C   1 
ATOM   189  O O   . ALA A 1 24  ? 12.35683  20.87582  37.28118  1.000 61.17514  ? 24  ALA A O   1 
ATOM   190  C CB  . ALA A 1 24  ? 14.34805  18.84907  35.54433  1.000 43.25171  ? 24  ALA A CB  1 
ATOM   191  N N   . PRO A 1 25  ? 12.23631  21.11579  35.05618  1.000 60.61958  ? 25  PRO A N   1 
ATOM   192  C CA  . PRO A 1 25  ? 10.89892  21.72862  35.14699  1.000 59.09758  ? 25  PRO A CA  1 
ATOM   193  C C   . PRO A 1 25  ? 9.92153   20.99908  36.04817  1.000 61.65403  ? 25  PRO A C   1 
ATOM   194  O O   . PRO A 1 25  ? 9.07373   21.65028  36.67653  1.000 65.89569  ? 25  PRO A O   1 
ATOM   195  C CB  . PRO A 1 25  ? 10.41890  21.71046  33.69376  1.000 51.12329  ? 25  PRO A CB  1 
ATOM   196  C CG  . PRO A 1 25  ? 11.67441  21.84618  32.90313  1.000 58.61758  ? 25  PRO A CG  1 
ATOM   197  C CD  . PRO A 1 25  ? 12.76066  21.14738  33.67667  1.000 58.85896  ? 25  PRO A CD  1 
ATOM   198  N N   . GLY A 1 26  ? 10.00911  19.67471  36.13618  1.000 51.03445  ? 26  GLY A N   1 
ATOM   199  C CA  . GLY A 1 26  ? 8.98693   18.90408  36.81198  1.000 53.37507  ? 26  GLY A CA  1 
ATOM   200  C C   . GLY A 1 26  ? 9.46297   18.17031  38.04846  1.000 67.13846  ? 26  GLY A C   1 
ATOM   201  O O   . GLY A 1 26  ? 8.75052   17.30728  38.57520  1.000 65.36038  ? 26  GLY A O   1 
ATOM   202  N N   . GLY A 1 27  ? 10.66277  18.50963  38.52248  1.000 59.74014  ? 27  GLY A N   1 
ATOM   203  C CA  . GLY A 1 27  ? 11.23723  17.88623  39.69008  1.000 56.93399  ? 27  GLY A CA  1 
ATOM   204  C C   . GLY A 1 27  ? 12.74992  17.97701  39.69433  1.000 57.21986  ? 27  GLY A C   1 
ATOM   205  O O   . GLY A 1 27  ? 13.37345  18.42956  38.72742  1.000 58.49496  ? 27  GLY A O   1 
ATOM   206  N N   . PRO A 1 28  ? 13.36920  17.55906  40.79334  1.000 53.82284  ? 28  PRO A N   1 
ATOM   207  C CA  . PRO A 1 28  ? 14.83345  17.54373  40.86432  1.000 49.09644  ? 28  PRO A CA  1 
ATOM   208  C C   . PRO A 1 28  ? 15.42474  16.29002  40.24217  1.000 47.86678  ? 28  PRO A C   1 
ATOM   209  O O   . PRO A 1 28  ? 14.77598  15.24630  40.13378  1.000 56.27046  ? 28  PRO A O   1 
ATOM   210  C CB  . PRO A 1 28  ? 15.11072  17.57428  42.36971  1.000 49.66933  ? 28  PRO A CB  1 
ATOM   211  C CG  . PRO A 1 28  ? 13.93266  16.88378  42.94723  1.000 47.80874  ? 28  PRO A CG  1 
ATOM   212  C CD  . PRO A 1 28  ? 12.75031  17.22524  42.08487  1.000 47.20252  ? 28  PRO A CD  1 
ATOM   213  N N   . VAL A 1 29  ? 16.69728  16.41173  39.85125  1.000 43.39440  ? 29  VAL A N   1 
ATOM   214  C CA  . VAL A 1 29  ? 17.47923  15.29816  39.32996  1.000 41.55719  ? 29  VAL A CA  1 
ATOM   215  C C   . VAL A 1 29  ? 18.83196  15.30363  40.01879  1.000 42.11495  ? 29  VAL A C   1 
ATOM   216  O O   . VAL A 1 29  ? 19.28835  16.32836  40.53502  1.000 45.27625  ? 29  VAL A O   1 
ATOM   217  C CB  . VAL A 1 29  ? 17.67429  15.36056  37.79797  1.000 39.66941  ? 29  VAL A CB  1 
ATOM   218  C CG1 . VAL A 1 29  ? 16.44146  14.85083  37.09092  1.000 35.62704  ? 29  VAL A CG1 1 
ATOM   219  C CG2 . VAL A 1 29  ? 18.02689  16.76675  37.36787  1.000 40.79850  ? 29  VAL A CG2 1 
ATOM   220  N N   . SER A 1 30  ? 19.46967  14.13327  40.02500  1.000 43.93677  ? 30  SER A N   1 
ATOM   221  C CA  . SER A 1 30  ? 20.83703  13.97963  40.50994  1.000 45.69605  ? 30  SER A CA  1 
ATOM   222  C C   . SER A 1 30  ? 21.78726  14.04001  39.31716  1.000 42.90221  ? 30  SER A C   1 
ATOM   223  O O   . SER A 1 30  ? 21.53657  13.40680  38.28813  1.000 49.56661  ? 30  SER A O   1 
ATOM   224  C CB  . SER A 1 30  ? 21.00655  12.65642  41.26338  1.000 51.37190  ? 30  SER A CB  1 
ATOM   225  O OG  . SER A 1 30  ? 20.31821  12.63610  42.51000  1.000 53.89559  ? 30  SER A OG  1 
ATOM   226  N N   . ALA A 1 31  ? 22.85568  14.81958  39.43589  1.000 37.23225  ? 31  ALA A N   1 
ATOM   227  C CA  . ALA A 1 31  ? 23.86294  14.87205  38.38749  1.000 38.59375  ? 31  ALA A CA  1 
ATOM   228  C C   . ALA A 1 31  ? 25.24148  14.70641  38.99819  1.000 48.72444  ? 31  ALA A C   1 
ATOM   229  O O   . ALA A 1 31  ? 25.52651  15.25676  40.06980  1.000 55.41075  ? 31  ALA A O   1 
ATOM   230  C CB  . ALA A 1 31  ? 23.80623  16.18140  37.60419  1.000 34.55065  ? 31  ALA A CB  1 
ATOM   231  N N   . PHE A 1 32  ? 26.08641  13.93221  38.31861  1.000 40.39681  ? 32  PHE A N   1 
ATOM   232  C CA  . PHE A 1 32  ? 27.48775  13.76758  38.70105  1.000 40.38961  ? 32  PHE A CA  1 
ATOM   233  C C   . PHE A 1 32  ? 28.33891  14.15229  37.49377  1.000 44.27111  ? 32  PHE A C   1 
ATOM   234  O O   . PHE A 1 32  ? 28.53875  13.35018  36.57696  1.000 42.80271  ? 32  PHE A O   1 
ATOM   235  C CB  . PHE A 1 32  ? 27.77076  12.34934  39.18651  1.000 35.68044  ? 32  PHE A CB  1 
ATOM   236  C CG  . PHE A 1 32  ? 26.90858  11.94419  40.34117  1.000 43.57247  ? 32  PHE A CG  1 
ATOM   237  C CD1 . PHE A 1 32  ? 27.41654  11.94670  41.61867  1.000 46.73197  ? 32  PHE A CD1 1 
ATOM   238  C CD2 . PHE A 1 32  ? 25.59473  11.55645  40.15189  1.000 43.33328  ? 32  PHE A CD2 1 
ATOM   239  C CE1 . PHE A 1 32  ? 26.61841  11.60578  42.67882  1.000 56.23166  ? 32  PHE A CE1 1 
ATOM   240  C CE2 . PHE A 1 32  ? 24.80002  11.19754  41.20403  1.000 42.26537  ? 32  PHE A CE2 1 
ATOM   241  C CZ  . PHE A 1 32  ? 25.30237  11.21951  42.46134  1.000 47.79327  ? 32  PHE A CZ  1 
ATOM   242  N N   . LEU A 1 33  ? 28.82371  15.38704  37.48738  1.000 37.65863  ? 33  LEU A N   1 
ATOM   243  C CA  . LEU A 1 33  ? 29.49907  15.94979  36.33405  1.000 34.00721  ? 33  LEU A CA  1 
ATOM   244  C C   . LEU A 1 33  ? 30.99994  16.00732  36.57706  1.000 41.93333  ? 33  LEU A C   1 
ATOM   245  O O   . LEU A 1 33  ? 31.45084  16.36702  37.67226  1.000 48.93796  ? 33  LEU A O   1 
ATOM   246  C CB  . LEU A 1 33  ? 28.95457  17.34606  36.02669  1.000 35.39594  ? 33  LEU A CB  1 
ATOM   247  C CG  . LEU A 1 33  ? 27.41885  17.43566  36.03545  1.000 31.24130  ? 33  LEU A CG  1 
ATOM   248  C CD1 . LEU A 1 33  ? 26.97885  18.87657  36.00937  1.000 29.81048  ? 33  LEU A CD1 1 
ATOM   249  C CD2 . LEU A 1 33  ? 26.77734  16.63778  34.88938  1.000 25.33791  ? 33  LEU A CD2 1 
ATOM   250  N N   . GLY A 1 34  ? 31.77151  15.63376  35.55779  1.000 32.90844  ? 34  GLY A N   1 
ATOM   251  C CA  . GLY A 1 34  ? 33.21580  15.71911  35.64499  1.000 31.95087  ? 34  GLY A CA  1 
ATOM   252  C C   . GLY A 1 34  ? 33.91513  14.54976  36.30230  1.000 32.52688  ? 34  GLY A C   1 
ATOM   253  O O   . GLY A 1 34  ? 34.95692  14.74471  36.94450  1.000 40.02223  ? 34  GLY A O   1 
ATOM   254  N N   . ILE A 1 35  ? 33.38387  13.33867  36.16679  1.000 32.90146  ? 35  ILE A N   1 
ATOM   255  C CA  . ILE A 1 35  ? 34.02062  12.15740  36.74338  1.000 33.16133  ? 35  ILE A CA  1 
ATOM   256  C C   . ILE A 1 35  ? 35.19426  11.72513  35.87271  1.000 44.74260  ? 35  ILE A C   1 
ATOM   257  O O   . ILE A 1 35  ? 35.00408  11.39167  34.69372  1.000 51.90428  ? 35  ILE A O   1 
ATOM   258  C CB  . ILE A 1 35  ? 33.02256  11.00723  36.89178  1.000 29.20141  ? 35  ILE A CB  1 
ATOM   259  C CG1 . ILE A 1 35  ? 31.76981  11.47431  37.64430  1.000 29.55162  ? 35  ILE A CG1 1 
ATOM   260  C CG2 . ILE A 1 35  ? 33.70899  9.82475   37.56877  1.000 30.32291  ? 35  ILE A CG2 1 
ATOM   261  C CD1 . ILE A 1 35  ? 30.73225  10.35040  37.85971  1.000 28.51800  ? 35  ILE A CD1 1 
ATOM   262  N N   . PRO A 1 36  ? 36.41238  11.70371  36.40286  1.000 46.61880  ? 36  PRO A N   1 
ATOM   263  C CA  . PRO A 1 36  ? 37.55836  11.25279  35.60047  1.000 50.31623  ? 36  PRO A CA  1 
ATOM   264  C C   . PRO A 1 36  ? 37.52188  9.74547   35.39803  1.000 49.88205  ? 36  PRO A C   1 
ATOM   265  O O   . PRO A 1 36  ? 37.39194  8.98222   36.35695  1.000 54.90969  ? 36  PRO A O   1 
ATOM   266  C CB  . PRO A 1 36  ? 38.76592  11.68114  36.44207  1.000 54.07669  ? 36  PRO A CB  1 
ATOM   267  C CG  . PRO A 1 36  ? 38.24730  11.71249  37.84744  1.000 50.87544  ? 36  PRO A CG  1 
ATOM   268  C CD  . PRO A 1 36  ? 36.81329  12.16955  37.74026  1.000 49.34677  ? 36  PRO A CD  1 
ATOM   269  N N   . PHE A 1 37  ? 37.64491  9.31670   34.13888  1.000 45.63280  ? 37  PHE A N   1 
ATOM   270  C CA  . PHE A 1 37  ? 37.58681  7.89930   33.81245  1.000 38.18617  ? 37  PHE A CA  1 
ATOM   271  C C   . PHE A 1 37  ? 38.85352  7.35868   33.15924  1.000 37.82614  ? 37  PHE A C   1 
ATOM   272  O O   . PHE A 1 37  ? 39.01385  6.12999   33.08734  1.000 38.29595  ? 37  PHE A O   1 
ATOM   273  C CB  . PHE A 1 37  ? 36.35831  7.59919   32.92880  1.000 43.07627  ? 37  PHE A CB  1 
ATOM   274  C CG  . PHE A 1 37  ? 36.46290  8.09896   31.51371  1.000 45.34334  ? 37  PHE A CG  1 
ATOM   275  C CD1 . PHE A 1 37  ? 36.97979  7.28325   30.50716  1.000 46.61034  ? 37  PHE A CD1 1 
ATOM   276  C CD2 . PHE A 1 37  ? 35.99867  9.35903   31.17430  1.000 45.76923  ? 37  PHE A CD2 1 
ATOM   277  C CE1 . PHE A 1 37  ? 37.06756  7.73071   29.19749  1.000 38.44924  ? 37  PHE A CE1 1 
ATOM   278  C CE2 . PHE A 1 37  ? 36.08294  9.81088   29.86261  1.000 45.95481  ? 37  PHE A CE2 1 
ATOM   279  C CZ  . PHE A 1 37  ? 36.62701  8.99734   28.87413  1.000 37.16147  ? 37  PHE A CZ  1 
ATOM   280  N N   . ALA A 1 38  ? 39.76152  8.22922   32.71635  1.000 38.06450  ? 38  ALA A N   1 
ATOM   281  C CA  . ALA A 1 38  ? 41.08835  7.85364   32.24653  1.000 37.91932  ? 38  ALA A CA  1 
ATOM   282  C C   . ALA A 1 38  ? 42.12827  8.77126   32.87864  1.000 39.03721  ? 38  ALA A C   1 
ATOM   283  O O   . ALA A 1 38  ? 41.80639  9.85453   33.38488  1.000 39.73042  ? 38  ALA A O   1 
ATOM   284  C CB  . ALA A 1 38  ? 41.19950  7.94332   30.71304  1.000 42.34597  ? 38  ALA A CB  1 
ATOM   285  N N   . GLU A 1 39  ? 43.38796  8.33518   32.84289  1.000 33.93723  ? 39  GLU A N   1 
ATOM   286  C CA  . GLU A 1 39  ? 44.47146  9.25718   33.14780  1.000 39.60591  ? 39  GLU A CA  1 
ATOM   287  C C   . GLU A 1 39  ? 44.52334  10.36544  32.09055  1.000 50.17478  ? 39  GLU A C   1 
ATOM   288  O O   . GLU A 1 39  ? 44.27244  10.11530  30.89890  1.000 43.71335  ? 39  GLU A O   1 
ATOM   289  C CB  . GLU A 1 39  ? 45.81282  8.52433   33.21615  1.000 44.70464  ? 39  GLU A CB  1 
ATOM   290  C CG  . GLU A 1 39  ? 46.02879  7.73849   34.51853  1.000 57.36264  ? 39  GLU A CG  1 
ATOM   291  C CD  . GLU A 1 39  ? 46.21729  8.62324   35.74800  1.000 58.08499  ? 39  GLU A CD  1 
ATOM   292  O OE1 . GLU A 1 39  ? 47.17887  9.42128   35.77515  1.000 59.27495  ? 39  GLU A OE1 1 
ATOM   293  O OE2 . GLU A 1 39  ? 45.39748  8.51844   36.68540  1.000 55.82711  ? 39  GLU A OE2 1 
ATOM   294  N N   . PRO A 1 40  ? 44.80478  11.59993  32.49599  1.000 52.94993  ? 40  PRO A N   1 
ATOM   295  C CA  . PRO A 1 40  ? 44.94180  12.69845  31.53607  1.000 47.65030  ? 40  PRO A CA  1 
ATOM   296  C C   . PRO A 1 40  ? 45.87522  12.31821  30.40572  1.000 44.27606  ? 40  PRO A C   1 
ATOM   297  O O   . PRO A 1 40  ? 47.05849  12.03636  30.63183  1.000 50.15184  ? 40  PRO A O   1 
ATOM   298  C CB  . PRO A 1 40  ? 45.54304  13.82778  32.38543  1.000 43.48110  ? 40  PRO A CB  1 
ATOM   299  C CG  . PRO A 1 40  ? 45.06264  13.55333  33.72952  1.000 32.81214  ? 40  PRO A CG  1 
ATOM   300  C CD  . PRO A 1 40  ? 44.99357  12.05439  33.87694  1.000 32.34230  ? 40  PRO A CD  1 
ATOM   301  N N   . PRO A 1 41  ? 45.39190  12.29925  29.19392  1.000 44.97769  ? 41  PRO A N   1 
ATOM   302  C CA  . PRO A 1 41  ? 46.24984  11.88372  28.07321  1.000 44.94895  ? 41  PRO A CA  1 
ATOM   303  C C   . PRO A 1 41  ? 47.10688  13.05352  27.60758  1.000 45.36696  ? 41  PRO A C   1 
ATOM   304  O O   . PRO A 1 41  ? 46.90625  13.65076  26.55720  1.000 51.58166  ? 41  PRO A O   1 
ATOM   305  C CB  . PRO A 1 41  ? 45.22188  11.42302  27.03686  1.000 39.04560  ? 41  PRO A CB  1 
ATOM   306  C CG  . PRO A 1 41  ? 44.08064  12.36251  27.25769  1.000 36.41513  ? 41  PRO A CG  1 
ATOM   307  C CD  . PRO A 1 41  ? 44.04709  12.68471  28.73481  1.000 45.75024  ? 41  PRO A CD  1 
ATOM   308  N N   . VAL A 1 42  ? 48.09320  13.39946  28.43071  1.000 47.91883  ? 42  VAL A N   1 
ATOM   309  C CA  . VAL A 1 42  ? 48.88593  14.60778  28.25827  1.000 46.81905  ? 42  VAL A CA  1 
ATOM   310  C C   . VAL A 1 42  ? 50.36138  14.22504  28.19917  1.000 44.96460  ? 42  VAL A C   1 
ATOM   311  O O   . VAL A 1 42  ? 50.74446  13.10262  28.51560  1.000 47.28723  ? 42  VAL A O   1 
ATOM   312  C CB  . VAL A 1 42  ? 48.63412  15.62650  29.38575  1.000 39.66104  ? 42  VAL A CB  1 
ATOM   313  C CG1 . VAL A 1 42  ? 47.15226  15.90225  29.52648  1.000 44.73968  ? 42  VAL A CG1 1 
ATOM   314  C CG2 . VAL A 1 42  ? 49.16646  15.09057  30.66719  1.000 40.62820  ? 42  VAL A CG2 1 
ATOM   315  N N   . GLY A 1 43  ? 51.18927  15.18557  27.79643  1.000 45.13182  ? 43  GLY A N   1 
ATOM   316  C CA  . GLY A 1 43  ? 52.61347  14.93074  27.67938  1.000 48.53118  ? 43  GLY A CA  1 
ATOM   317  C C   . GLY A 1 43  ? 52.90343  13.73440  26.79549  1.000 66.32723  ? 43  GLY A C   1 
ATOM   318  O O   . GLY A 1 43  ? 52.40175  13.61916  25.67155  1.000 70.76636  ? 43  GLY A O   1 
ATOM   319  N N   . SER A 1 44  ? 53.70018  12.81023  27.32867  1.000 68.13779  ? 44  SER A N   1 
ATOM   320  C CA  . SER A 1 44  ? 54.17809  11.63738  26.60512  1.000 67.50923  ? 44  SER A CA  1 
ATOM   321  C C   . SER A 1 44  ? 53.05065  10.66285  26.28232  1.000 59.24744  ? 44  SER A C   1 
ATOM   322  O O   . SER A 1 44  ? 53.26867  9.64731   25.60987  1.000 60.60194  ? 44  SER A O   1 
ATOM   323  C CB  . SER A 1 44  ? 55.26064  10.93275  27.42295  1.000 71.99106  ? 44  SER A CB  1 
ATOM   324  O OG  . SER A 1 44  ? 54.74663  10.53997  28.68701  1.000 73.56048  ? 44  SER A OG  1 
ATOM   325  N N   . ARG A 1 45  ? 51.84683  10.95352  26.76085  1.000 51.24603  ? 45  ARG A N   1 
ATOM   326  C CA  . ARG A 1 45  ? 50.69346  10.11039  26.49555  1.000 49.55655  ? 45  ARG A CA  1 
ATOM   327  C C   . ARG A 1 45  ? 49.80021  10.65742  25.39276  1.000 50.17934  ? 45  ARG A C   1 
ATOM   328  O O   . ARG A 1 45  ? 48.80315  10.01115  25.04496  1.000 39.34828  ? 45  ARG A O   1 
ATOM   329  C CB  . ARG A 1 45  ? 49.87549  9.90787   27.77756  1.000 43.81830  ? 45  ARG A CB  1 
ATOM   330  C CG  . ARG A 1 45  ? 50.40979  8.81844   28.66362  1.000 46.46686  ? 45  ARG A CG  1 
ATOM   331  C CD  . ARG A 1 45  ? 49.33464  8.35630   29.65809  1.000 68.87622  ? 45  ARG A CD  1 
ATOM   332  N NE  . ARG A 1 45  ? 49.48577  8.94392   30.99165  1.000 76.26053  ? 45  ARG A NE  1 
ATOM   333  C CZ  . ARG A 1 45  ? 50.06534  8.32971   32.01893  1.000 84.70971  ? 45  ARG A CZ  1 
ATOM   334  N NH1 . ARG A 1 45  ? 50.57216  7.10987   31.87550  1.000 80.45282  ? 45  ARG A NH1 1 
ATOM   335  N NH2 . ARG A 1 45  ? 50.14771  8.94148   33.19286  1.000 97.05199  ? 45  ARG A NH2 1 
ATOM   336  N N   . ARG A 1 46  ? 50.13085  11.82747  24.84265  1.000 49.48139  ? 46  ARG A N   1 
ATOM   337  C CA  . ARG A 1 46  ? 49.39538  12.36460  23.70243  1.000 45.98955  ? 46  ARG A CA  1 
ATOM   338  C C   . ARG A 1 46  ? 49.48641  11.40685  22.52170  1.000 37.50371  ? 46  ARG A C   1 
ATOM   339  O O   . ARG A 1 46  ? 50.54919  10.83632  22.24632  1.000 37.82067  ? 46  ARG A O   1 
ATOM   340  C CB  . ARG A 1 46  ? 49.95357  13.73616  23.31396  1.000 47.13645  ? 46  ARG A CB  1 
ATOM   341  C CG  . ARG A 1 46  ? 49.35990  14.35678  22.03773  1.000 39.96918  ? 46  ARG A CG  1 
ATOM   342  C CD  . ARG A 1 46  ? 50.22018  15.54052  21.58931  1.000 34.05232  ? 46  ARG A CD  1 
ATOM   343  N NE  . ARG A 1 46  ? 49.90327  16.76428  22.30922  1.000 41.02749  ? 46  ARG A NE  1 
ATOM   344  C CZ  . ARG A 1 46  ? 50.51461  17.92418  22.09499  1.000 42.91314  ? 46  ARG A CZ  1 
ATOM   345  N NH1 . ARG A 1 46  ? 51.50748  17.99510  21.21899  1.000 36.14985  ? 46  ARG A NH1 1 
ATOM   346  N NH2 . ARG A 1 46  ? 50.16789  18.99900  22.79646  1.000 43.19618  ? 46  ARG A NH2 1 
ATOM   347  N N   . PHE A 1 47  ? 48.35795  11.23574  21.83053  1.000 35.19282  ? 47  PHE A N   1 
ATOM   348  C CA  . PHE A 1 47  ? 48.14908  10.28215  20.73721  1.000 41.07154  ? 47  PHE A CA  1 
ATOM   349  C C   . PHE A 1 47  ? 48.07907  8.83179   21.19857  1.000 40.29599  ? 47  PHE A C   1 
ATOM   350  O O   . PHE A 1 47  ? 48.16612  7.92649   20.36305  1.000 37.99689  ? 47  PHE A O   1 
ATOM   351  C CB  . PHE A 1 47  ? 49.22153  10.33910  19.63325  1.000 38.92752  ? 47  PHE A CB  1 
ATOM   352  C CG  . PHE A 1 47  ? 49.60561  11.72089  19.19100  1.000 36.10203  ? 47  PHE A CG  1 
ATOM   353  C CD1 . PHE A 1 47  ? 48.68127  12.56190  18.60466  1.000 35.11608  ? 47  PHE A CD1 1 
ATOM   354  C CD2 . PHE A 1 47  ? 50.92017  12.15151  19.31308  1.000 37.62046  ? 47  PHE A CD2 1 
ATOM   355  C CE1 . PHE A 1 47  ? 49.05036  13.82436  18.17741  1.000 32.24862  ? 47  PHE A CE1 1 
ATOM   356  C CE2 . PHE A 1 47  ? 51.29711  13.40727  18.88640  1.000 38.86636  ? 47  PHE A CE2 1 
ATOM   357  C CZ  . PHE A 1 47  ? 50.35996  14.24634  18.31566  1.000 36.37993  ? 47  PHE A CZ  1 
ATOM   358  N N   . MET A 1 48  ? 47.92293  8.56236   22.48346  1.000 42.13519  ? 48  MET A N   1 
ATOM   359  C CA  . MET A 1 48  ? 48.02704  7.17802   22.90517  1.000 38.42836  ? 48  MET A CA  1 
ATOM   360  C C   . MET A 1 48  ? 46.74138  6.65014   23.52517  1.000 41.65997  ? 48  MET A C   1 
ATOM   361  O O   . MET A 1 48  ? 45.84039  7.42479   23.88377  1.000 40.89235  ? 48  MET A O   1 
ATOM   362  C CB  . MET A 1 48  ? 49.21851  7.01850   23.85151  1.000 36.08421  ? 48  MET A CB  1 
ATOM   363  C CG  . MET A 1 48  ? 50.41549  6.96431   22.96941  1.000 50.83288  ? 48  MET A CG  1 
ATOM   364  S SD  . MET A 1 48  ? 51.77937  6.10246   23.63727  1.000 68.61540  ? 48  MET A SD  1 
ATOM   365  C CE  . MET A 1 48  ? 51.52216  4.53694   22.86728  1.000 59.87930  ? 48  MET A CE  1 
ATOM   366  N N   . PRO A 1 49  ? 46.58847  5.32701   23.57738  1.000 39.78804  ? 49  PRO A N   1 
ATOM   367  C CA  . PRO A 1 49  ? 45.38879  4.73300   24.18100  1.000 39.54731  ? 49  PRO A CA  1 
ATOM   368  C C   . PRO A 1 49  ? 45.22626  5.19107   25.61549  1.000 43.78889  ? 49  PRO A C   1 
ATOM   369  O O   . PRO A 1 49  ? 46.21419  5.32714   26.35608  1.000 46.92478  ? 49  PRO A O   1 
ATOM   370  C CB  . PRO A 1 49  ? 45.66239  3.22532   24.11404  1.000 38.66758  ? 49  PRO A CB  1 
ATOM   371  C CG  . PRO A 1 49  ? 46.63130  3.07969   22.98351  1.000 45.54194  ? 49  PRO A CG  1 
ATOM   372  C CD  . PRO A 1 49  ? 47.48287  4.30541   23.00254  1.000 35.69472  ? 49  PRO A CD  1 
ATOM   373  N N   . PRO A 1 50  ? 43.99662  5.44550   26.03556  1.000 42.47332  ? 50  PRO A N   1 
ATOM   374  C CA  . PRO A 1 50  ? 43.77067  5.90966   27.40369  1.000 47.49850  ? 50  PRO A CA  1 
ATOM   375  C C   . PRO A 1 50  ? 44.11499  4.82585   28.40388  1.000 51.24242  ? 50  PRO A C   1 
ATOM   376  O O   . PRO A 1 50  ? 43.77748  3.65211   28.21650  1.000 46.13795  ? 50  PRO A O   1 
ATOM   377  C CB  . PRO A 1 50  ? 42.27413  6.23510   27.42481  1.000 48.37939  ? 50  PRO A CB  1 
ATOM   378  C CG  . PRO A 1 50  ? 41.69093  5.36602   26.34391  1.000 47.85424  ? 50  PRO A CG  1 
ATOM   379  C CD  . PRO A 1 50  ? 42.74570  5.28124   25.28082  1.000 46.93512  ? 50  PRO A CD  1 
ATOM   380  N N   . GLU A 1 51  ? 44.82320  5.23040   29.46056  1.000 58.07082  ? 51  GLU A N   1 
ATOM   381  C CA  . GLU A 1 51  ? 45.00102  4.33608   30.59817  1.000 58.05997  ? 51  GLU A CA  1 
ATOM   382  C C   . GLU A 1 51  ? 43.89866  4.58430   31.63164  1.000 56.76552  ? 51  GLU A C   1 
ATOM   383  O O   . GLU A 1 51  ? 43.47575  5.72867   31.83206  1.000 59.50018  ? 51  GLU A O   1 
ATOM   384  C CB  . GLU A 1 51  ? 46.37389  4.53407   31.23709  1.000 62.81163  ? 51  GLU A CB  1 
ATOM   385  C CG  . GLU A 1 51  ? 47.54912  4.31905   30.27914  1.000 76.83843  ? 51  GLU A CG  1 
ATOM   386  C CD  . GLU A 1 51  ? 48.86178  4.05717   31.01540  1.000 91.49015  ? 51  GLU A CD  1 
ATOM   387  O OE1 . GLU A 1 51  ? 49.04344  4.62198   32.12081  1.000 101.83639 ? 51  GLU A OE1 1 
ATOM   388  O OE2 . GLU A 1 51  ? 49.70488  3.28093   30.49780  1.000 87.96640  ? 51  GLU A OE2 1 
ATOM   389  N N   . PRO A 1 52  ? 43.39177  3.52619   32.25550  1.000 60.60119  ? 52  PRO A N   1 
ATOM   390  C CA  . PRO A 1 52  ? 42.35137  3.69087   33.28345  1.000 55.04907  ? 52  PRO A CA  1 
ATOM   391  C C   . PRO A 1 52  ? 42.78916  4.60344   34.42528  1.000 46.96121  ? 52  PRO A C   1 
ATOM   392  O O   . PRO A 1 52  ? 43.93321  4.54791   34.89098  1.000 39.11584  ? 52  PRO A O   1 
ATOM   393  C CB  . PRO A 1 52  ? 42.11854  2.25993   33.77604  1.000 59.45592  ? 52  PRO A CB  1 
ATOM   394  C CG  . PRO A 1 52  ? 42.51461  1.40623   32.61248  1.000 66.97847  ? 52  PRO A CG  1 
ATOM   395  C CD  . PRO A 1 52  ? 43.64092  2.11434   31.92336  1.000 65.08797  ? 52  PRO A CD  1 
ATOM   396  N N   . LYS A 1 53  ? 41.83753  5.41896   34.89051  1.000 38.96829  ? 53  LYS A N   1 
ATOM   397  C CA  . LYS A 1 53  ? 42.10234  6.47672   35.85726  1.000 38.30819  ? 53  LYS A CA  1 
ATOM   398  C C   . LYS A 1 53  ? 42.48676  5.89319   37.21413  1.000 46.60206  ? 53  LYS A C   1 
ATOM   399  O O   . LYS A 1 53  ? 41.75758  5.06953   37.77349  1.000 55.47313  ? 53  LYS A O   1 
ATOM   400  C CB  . LYS A 1 53  ? 40.86769  7.37478   35.97557  1.000 38.00814  ? 53  LYS A CB  1 
ATOM   401  C CG  . LYS A 1 53  ? 40.80849  8.28343   37.20309  1.000 44.26315  ? 53  LYS A CG  1 
ATOM   402  C CD  . LYS A 1 53  ? 42.03230  9.18254   37.39334  1.000 48.46299  ? 53  LYS A CD  1 
ATOM   403  C CE  . LYS A 1 53  ? 41.64155  10.53415  37.98780  1.000 43.66903  ? 53  LYS A CE  1 
ATOM   404  N NZ  . LYS A 1 53  ? 42.81171  11.42929  38.17752  1.000 45.78647  ? 53  LYS A NZ  1 
ATOM   405  N N   . ARG A 1 54  ? 43.64909  6.30593   37.73183  1.000 40.64919  ? 54  ARG A N   1 
ATOM   406  C CA  . ARG A 1 54  ? 44.09804  5.81492   39.02468  1.000 50.24286  ? 54  ARG A CA  1 
ATOM   407  C C   . ARG A 1 54  ? 43.15678  6.31501   40.12265  1.000 48.83022  ? 54  ARG A C   1 
ATOM   408  O O   . ARG A 1 54  ? 42.60706  7.41656   40.02326  1.000 50.81510  ? 54  ARG A O   1 
ATOM   409  C CB  . ARG A 1 54  ? 45.53432  6.25959   39.31865  1.000 51.33688  ? 54  ARG A CB  1 
ATOM   410  C CG  . ARG A 1 54  ? 46.60908  5.61250   38.44928  1.000 53.88391  ? 54  ARG A CG  1 
ATOM   411  C CD  . ARG A 1 54  ? 48.05308  5.93587   38.90505  1.000 69.47893  ? 54  ARG A CD  1 
ATOM   412  N NE  . ARG A 1 54  ? 48.89299  6.44351   37.80594  1.000 92.98623  ? 54  ARG A NE  1 
ATOM   413  C CZ  . ARG A 1 54  ? 49.17070  5.79729   36.66334  1.000 109.38331 ? 54  ARG A CZ  1 
ATOM   414  N NH1 . ARG A 1 54  ? 48.69397  4.57999   36.42162  1.000 116.31963 ? 54  ARG A NH1 1 
ATOM   415  N NH2 . ARG A 1 54  ? 49.93747  6.37302   35.74141  1.000 109.98225 ? 54  ARG A NH2 1 
ATOM   416  N N   . PRO A 1 55  ? 42.92678  5.50810   41.16085  1.000 47.13180  ? 55  PRO A N   1 
ATOM   417  C CA  . PRO A 1 55  ? 42.01528  5.92627   42.23807  1.000 49.29398  ? 55  PRO A CA  1 
ATOM   418  C C   . PRO A 1 55  ? 42.50701  7.17454   42.95282  1.000 47.14272  ? 55  PRO A C   1 
ATOM   419  O O   . PRO A 1 55  ? 43.70630  7.45179   43.01536  1.000 55.61547  ? 55  PRO A O   1 
ATOM   420  C CB  . PRO A 1 55  ? 41.99771  4.72178   43.17957  1.000 47.80910  ? 55  PRO A CB  1 
ATOM   421  C CG  . PRO A 1 55  ? 42.42686  3.59204   42.36156  1.000 49.23085  ? 55  PRO A CG  1 
ATOM   422  C CD  . PRO A 1 55  ? 43.36442  4.11548   41.31906  1.000 46.97058  ? 55  PRO A CD  1 
ATOM   423  N N   . TRP A 1 56  ? 41.55533  7.93232   43.49077  1.000 45.57959  ? 56  TRP A N   1 
ATOM   424  C CA  . TRP A 1 56  ? 41.81899  9.18748   44.17873  1.000 50.57121  ? 56  TRP A CA  1 
ATOM   425  C C   . TRP A 1 56  ? 41.36201  9.11754   45.63347  1.000 63.49256  ? 56  TRP A C   1 
ATOM   426  O O   . TRP A 1 56  ? 40.58866  8.23351   46.03068  1.000 63.06399  ? 56  TRP A O   1 
ATOM   427  C CB  . TRP A 1 56  ? 41.11191  10.33727  43.47254  1.000 50.61622  ? 56  TRP A CB  1 
ATOM   428  C CG  . TRP A 1 56  ? 39.61200  10.20857  43.45372  1.000 57.48857  ? 56  TRP A CG  1 
ATOM   429  C CD1 . TRP A 1 56  ? 38.73753  10.67582  44.39436  1.000 61.85357  ? 56  TRP A CD1 1 
ATOM   430  C CD2 . TRP A 1 56  ? 38.81051  9.58846   42.43824  1.000 55.41118  ? 56  TRP A CD2 1 
ATOM   431  N NE1 . TRP A 1 56  ? 37.44549  10.38492  44.02482  1.000 55.89093  ? 56  TRP A NE1 1 
ATOM   432  C CE2 . TRP A 1 56  ? 37.46529  9.71502   42.83124  1.000 54.76521  ? 56  TRP A CE2 1 
ATOM   433  C CE3 . TRP A 1 56  ? 39.09924  8.94411   41.23355  1.000 63.70934  ? 56  TRP A CE3 1 
ATOM   434  C CZ2 . TRP A 1 56  ? 36.41140  9.22204   42.06103  1.000 61.63519  ? 56  TRP A CZ2 1 
ATOM   435  C CZ3 . TRP A 1 56  ? 38.04406  8.45084   40.46785  1.000 63.60544  ? 56  TRP A CZ3 1 
ATOM   436  C CH2 . TRP A 1 56  ? 36.72027  8.59051   40.88852  1.000 59.16538  ? 56  TRP A CH2 1 
ATOM   437  N N   . SER A 1 57  ? 41.84327  10.06687  46.43664  1.000 68.67005  ? 57  SER A N   1 
ATOM   438  C CA  . SER A 1 57  ? 41.54519  10.08487  47.86342  1.000 62.77337  ? 57  SER A CA  1 
ATOM   439  C C   . SER A 1 57  ? 40.56267  11.20217  48.18442  1.000 56.90138  ? 57  SER A C   1 
ATOM   440  O O   . SER A 1 57  ? 40.54468  12.24625  47.52214  1.000 56.17667  ? 57  SER A O   1 
ATOM   441  C CB  . SER A 1 57  ? 42.82002  10.23120  48.70641  1.000 62.84549  ? 57  SER A CB  1 
ATOM   442  O OG  . SER A 1 57  ? 43.37577  11.52294  48.59740  1.000 60.86502  ? 57  SER A OG  1 
ATOM   443  N N   . GLY A 1 58  ? 39.72047  10.94896  49.19426  1.000 52.72456  ? 58  GLY A N   1 
ATOM   444  C CA  . GLY A 1 58  ? 38.68515  11.88441  49.58044  1.000 52.32251  ? 58  GLY A CA  1 
ATOM   445  C C   . GLY A 1 58  ? 37.49645  11.89571  48.62649  1.000 60.64650  ? 58  GLY A C   1 
ATOM   446  O O   . GLY A 1 58  ? 37.37937  11.09599  47.69442  1.000 47.83174  ? 58  GLY A O   1 
ATOM   447  N N   . VAL A 1 59  ? 36.59012  12.82932  48.88806  1.000 56.60809  ? 59  VAL A N   1 
ATOM   448  C CA  . VAL A 1 59  ? 35.39867  12.98059  48.06395  1.000 52.14926  ? 59  VAL A CA  1 
ATOM   449  C C   . VAL A 1 59  ? 35.73940  13.91832  46.91560  1.000 49.23433  ? 59  VAL A C   1 
ATOM   450  O O   . VAL A 1 59  ? 36.06885  15.08840  47.13452  1.000 51.02306  ? 59  VAL A O   1 
ATOM   451  C CB  . VAL A 1 59  ? 34.20574  13.50690  48.87867  1.000 51.24151  ? 59  VAL A CB  1 
ATOM   452  C CG1 . VAL A 1 59  ? 32.98108  13.57781  47.99174  1.000 55.86995  ? 59  VAL A CG1 1 
ATOM   453  C CG2 . VAL A 1 59  ? 33.91906  12.60028  50.03854  1.000 49.79234  ? 59  VAL A CG2 1 
ATOM   454  N N   . LEU A 1 60  ? 35.68780  13.39671  45.69329  1.000 52.38421  ? 60  LEU A N   1 
ATOM   455  C CA  . LEU A 1 60  ? 35.89583  14.20889  44.50864  1.000 40.73771  ? 60  LEU A CA  1 
ATOM   456  C C   . LEU A 1 60  ? 34.64374  15.02428  44.23769  1.000 48.25362  ? 60  LEU A C   1 
ATOM   457  O O   . LEU A 1 60  ? 33.54003  14.47316  44.17580  1.000 48.78715  ? 60  LEU A O   1 
ATOM   458  C CB  . LEU A 1 60  ? 36.21590  13.32397  43.31005  1.000 41.74907  ? 60  LEU A CB  1 
ATOM   459  C CG  . LEU A 1 60  ? 36.42116  14.02873  41.95632  1.000 37.10465  ? 60  LEU A CG  1 
ATOM   460  C CD1 . LEU A 1 60  ? 37.51541  13.34047  41.16838  1.000 36.74923  ? 60  LEU A CD1 1 
ATOM   461  C CD2 . LEU A 1 60  ? 35.13710  14.04190  41.14861  1.000 41.20541  ? 60  LEU A CD2 1 
ATOM   462  N N   . ASP A 1 61  ? 34.80846  16.33288  44.07174  1.000 41.00919  ? 61  ASP A N   1 
ATOM   463  C CA  . ASP A 1 61  ? 33.66465  17.17566  43.74882  1.000 42.41461  ? 61  ASP A CA  1 
ATOM   464  C C   . ASP A 1 61  ? 33.23929  16.94935  42.29532  1.000 43.06149  ? 61  ASP A C   1 
ATOM   465  O O   . ASP A 1 61  ? 34.04091  17.10236  41.36620  1.000 44.70089  ? 61  ASP A O   1 
ATOM   466  C CB  . ASP A 1 61  ? 33.99536  18.64197  43.99701  1.000 43.59674  ? 61  ASP A CB  1 
ATOM   467  C CG  . ASP A 1 61  ? 32.77864  19.52796  43.89117  1.000 60.45536  ? 61  ASP A CG  1 
ATOM   468  O OD1 . ASP A 1 61  ? 32.29073  19.98385  44.95189  1.000 62.96142  ? 61  ASP A OD1 1 
ATOM   469  O OD2 . ASP A 1 61  ? 32.31309  19.76022  42.74412  1.000 71.95801  ? 61  ASP A OD2 1 
ATOM   470  N N   . ALA A 1 62  ? 31.97225  16.59325  42.10545  1.000 38.53626  ? 62  ALA A N   1 
ATOM   471  C CA  . ALA A 1 62  ? 31.44476  16.23363  40.80150  1.000 38.78319  ? 62  ALA A CA  1 
ATOM   472  C C   . ALA A 1 62  ? 30.23720  17.08352  40.44068  1.000 42.35002  ? 62  ALA A C   1 
ATOM   473  O O   . ALA A 1 62  ? 29.20052  16.54598  40.03289  1.000 40.97378  ? 62  ALA A O   1 
ATOM   474  C CB  . ALA A 1 62  ? 31.05697  14.75946  40.78153  1.000 36.72568  ? 62  ALA A CB  1 
ATOM   475  N N   . THR A 1 63  ? 30.36057  18.40802  40.57552  1.000 42.43701  ? 63  THR A N   1 
ATOM   476  C CA  . THR A 1 63  ? 29.22703  19.30629  40.39272  1.000 45.41731  ? 63  THR A CA  1 
ATOM   477  C C   . THR A 1 63  ? 29.38161  20.30155  39.24127  1.000 51.65062  ? 63  THR A C   1 
ATOM   478  O O   . THR A 1 63  ? 28.43643  21.04174  38.95650  1.000 54.54662  ? 63  THR A O   1 
ATOM   479  C CB  . THR A 1 63  ? 28.95818  20.06814  41.69994  1.000 42.98724  ? 63  THR A CB  1 
ATOM   480  O OG1 . THR A 1 63  ? 30.00044  21.02769  41.91903  1.000 42.73877  ? 63  THR A OG1 1 
ATOM   481  C CG2 . THR A 1 63  ? 28.92188  19.08964  42.89200  1.000 48.41347  ? 63  THR A CG2 1 
ATOM   482  N N   . THR A 1 64  ? 30.52799  20.33991  38.57463  1.000 53.68590  ? 64  THR A N   1 
ATOM   483  C CA  . THR A 1 64  ? 30.76648  21.21120  37.43846  1.000 47.73088  ? 64  THR A CA  1 
ATOM   484  C C   . THR A 1 64  ? 31.08749  20.35370  36.22454  1.000 48.76406  ? 64  THR A C   1 
ATOM   485  O O   . THR A 1 64  ? 31.52952  19.20622  36.34889  1.000 45.78984  ? 64  THR A O   1 
ATOM   486  C CB  . THR A 1 64  ? 31.92380  22.17792  37.70417  1.000 55.08516  ? 64  THR A CB  1 
ATOM   487  O OG1 . THR A 1 64  ? 33.06075  21.44066  38.17105  1.000 71.76659  ? 64  THR A OG1 1 
ATOM   488  C CG2 . THR A 1 64  ? 31.53140  23.17421  38.76542  1.000 53.18162  ? 64  THR A CG2 1 
ATOM   489  N N   . PHE A 1 65  ? 30.84078  20.90299  35.03949  1.000 44.23292  ? 65  PHE A N   1 
ATOM   490  C CA  . PHE A 1 65  ? 31.34669  20.24342  33.84888  1.000 35.91958  ? 65  PHE A CA  1 
ATOM   491  C C   . PHE A 1 65  ? 32.85250  20.45840  33.76997  1.000 36.14306  ? 65  PHE A C   1 
ATOM   492  O O   . PHE A 1 65  ? 33.35851  21.53426  34.11156  1.000 48.77497  ? 65  PHE A O   1 
ATOM   493  C CB  . PHE A 1 65  ? 30.65012  20.77225  32.59594  1.000 39.66989  ? 65  PHE A CB  1 
ATOM   494  C CG  . PHE A 1 65  ? 29.30988  20.13524  32.33724  1.000 45.01891  ? 65  PHE A CG  1 
ATOM   495  C CD1 . PHE A 1 65  ? 29.20518  18.75395  32.17475  1.000 41.17105  ? 65  PHE A CD1 1 
ATOM   496  C CD2 . PHE A 1 65  ? 28.14882  20.91371  32.26356  1.000 43.73102  ? 65  PHE A CD2 1 
ATOM   497  C CE1 . PHE A 1 65  ? 27.96854  18.15926  31.93997  1.000 39.01417  ? 65  PHE A CE1 1 
ATOM   498  C CE2 . PHE A 1 65  ? 26.90778  20.33068  32.04122  1.000 33.56385  ? 65  PHE A CE2 1 
ATOM   499  C CZ  . PHE A 1 65  ? 26.81603  18.95197  31.88285  1.000 39.55890  ? 65  PHE A CZ  1 
ATOM   500  N N   . GLN A 1 66  ? 33.57681  19.42154  33.34130  1.000 29.63930  ? 66  GLN A N   1 
ATOM   501  C CA  . GLN A 1 66  ? 35.01931  19.52277  33.18642  1.000 34.73073  ? 66  GLN A CA  1 
ATOM   502  C C   . GLN A 1 66  ? 35.40166  20.06525  31.80260  1.000 45.40025  ? 66  GLN A C   1 
ATOM   503  O O   . GLN A 1 66  ? 34.56176  20.45931  30.97753  1.000 25.54315  ? 66  GLN A O   1 
ATOM   504  C CB  . GLN A 1 66  ? 35.69317  18.17425  33.44433  1.000 39.81792  ? 66  GLN A CB  1 
ATOM   505  C CG  . GLN A 1 66  ? 36.02159  17.91362  34.90861  1.000 50.87946  ? 66  GLN A CG  1 
ATOM   506  C CD  . GLN A 1 66  ? 37.27754  18.64118  35.41281  1.000 60.55505  ? 66  GLN A CD  1 
ATOM   507  O OE1 . GLN A 1 66  ? 37.89707  19.42787  34.68874  1.000 66.70621  ? 66  GLN A OE1 1 
ATOM   508  N NE2 . GLN A 1 66  ? 37.65217  18.37182  36.66602  1.000 57.64059  ? 66  GLN A NE2 1 
ATOM   509  N N   . ASN A 1 67  ? 36.71127  20.09691  31.56303  1.000 45.13581  ? 67  ASN A N   1 
ATOM   510  C CA  . ASN A 1 67  ? 37.25004  20.74918  30.38057  1.000 36.16193  ? 67  ASN A CA  1 
ATOM   511  C C   . ASN A 1 67  ? 36.81440  20.05510  29.10217  1.000 31.82843  ? 67  ASN A C   1 
ATOM   512  O O   . ASN A 1 67  ? 36.61259  18.83920  29.05494  1.000 29.43077  ? 67  ASN A O   1 
ATOM   513  C CB  . ASN A 1 67  ? 38.77617  20.80743  30.45700  1.000 34.71780  ? 67  ASN A CB  1 
ATOM   514  C CG  . ASN A 1 67  ? 39.26956  21.63528  31.63496  1.000 41.04016  ? 67  ASN A CG  1 
ATOM   515  O OD1 . ASN A 1 67  ? 38.61925  22.60580  32.05392  1.000 48.73889  ? 67  ASN A OD1 1 
ATOM   516  N ND2 . ASN A 1 67  ? 40.44358  21.29524  32.13785  1.000 44.61085  ? 67  ASN A ND2 1 
ATOM   517  N N   . VAL A 1 68  ? 36.66169  20.85433  28.06234  1.000 37.43898  ? 68  VAL A N   1 
ATOM   518  C CA  . VAL A 1 68  ? 36.39910  20.34457  26.72417  1.000 32.08476  ? 68  VAL A CA  1 
ATOM   519  C C   . VAL A 1 68  ? 37.70952  19.90202  26.09448  1.000 33.50303  ? 68  VAL A C   1 
ATOM   520  O O   . VAL A 1 68  ? 38.74882  20.55421  26.26794  1.000 41.48334  ? 68  VAL A O   1 
ATOM   521  C CB  . VAL A 1 68  ? 35.71397  21.42750  25.88739  1.000 31.98425  ? 68  VAL A CB  1 
ATOM   522  C CG1 . VAL A 1 68  ? 35.45528  20.91684  24.49830  1.000 36.28183  ? 68  VAL A CG1 1 
ATOM   523  C CG2 . VAL A 1 68  ? 34.42612  21.83802  26.58025  1.000 30.24050  ? 68  VAL A CG2 1 
ATOM   524  N N   . CYS A 1 69  ? 37.67509  18.77212  25.38884  1.000 30.43313  ? 69  CYS A N   1 
ATOM   525  C CA  . CYS A 1 69  ? 38.85966  18.28663  24.68510  1.000 32.10208  ? 69  CYS A CA  1 
ATOM   526  C C   . CYS A 1 69  ? 39.33880  19.31250  23.66508  1.000 33.00573  ? 69  CYS A C   1 
ATOM   527  O O   . CYS A 1 69  ? 38.53221  19.98041  23.01523  1.000 40.98217  ? 69  CYS A O   1 
ATOM   528  C CB  . CYS A 1 69  ? 38.54294  16.96365  24.00432  1.000 28.22031  ? 69  CYS A CB  1 
ATOM   529  S SG  . CYS A 1 69  ? 38.32189  15.64426  25.21977  1.000 48.48799  ? 69  CYS A SG  1 
ATOM   530  N N   . TYR A 1 70  ? 40.65752  19.45142  23.53587  1.000 31.30747  ? 70  TYR A N   1 
ATOM   531  C CA  . TYR A 1 70  ? 41.20426  20.49364  22.66978  1.000 38.70205  ? 70  TYR A CA  1 
ATOM   532  C C   . TYR A 1 70  ? 40.71928  20.31757  21.23331  1.000 38.81003  ? 70  TYR A C   1 
ATOM   533  O O   . TYR A 1 70  ? 40.75159  19.20925  20.68616  1.000 43.81619  ? 70  TYR A O   1 
ATOM   534  C CB  . TYR A 1 70  ? 42.72918  20.48138  22.71260  1.000 37.57071  ? 70  TYR A CB  1 
ATOM   535  C CG  . TYR A 1 70  ? 43.32759  21.86477  22.82751  1.000 41.62200  ? 70  TYR A CG  1 
ATOM   536  C CD1 . TYR A 1 70  ? 43.80643  22.33180  24.04530  1.000 40.32604  ? 70  TYR A CD1 1 
ATOM   537  C CD2 . TYR A 1 70  ? 43.39776  22.71556  21.72022  1.000 40.13605  ? 70  TYR A CD2 1 
ATOM   538  C CE1 . TYR A 1 70  ? 44.34721  23.59792  24.16344  1.000 47.30855  ? 70  TYR A CE1 1 
ATOM   539  C CE2 . TYR A 1 70  ? 43.94723  23.99154  21.82845  1.000 38.78440  ? 70  TYR A CE2 1 
ATOM   540  C CZ  . TYR A 1 70  ? 44.41691  24.42450  23.05656  1.000 51.48001  ? 70  TYR A CZ  1 
ATOM   541  O OH  . TYR A 1 70  ? 44.96220  25.68302  23.20336  1.000 63.52111  ? 70  TYR A OH  1 
ATOM   542  N N   . GLN A 1 71  ? 40.26560  21.41318  20.62021  1.000 34.70450  ? 71  GLN A N   1 
ATOM   543  C CA  . GLN A 1 71  ? 39.60779  21.29577  19.32390  1.000 43.49563  ? 71  GLN A CA  1 
ATOM   544  C C   . GLN A 1 71  ? 39.57480  22.63316  18.58995  1.000 43.02424  ? 71  GLN A C   1 
ATOM   545  O O   . GLN A 1 71  ? 39.74006  23.70638  19.18315  1.000 41.74562  ? 71  GLN A O   1 
ATOM   546  C CB  . GLN A 1 71  ? 38.18157  20.75814  19.48609  1.000 44.68397  ? 71  GLN A CB  1 
ATOM   547  C CG  . GLN A 1 71  ? 37.29656  21.64187  20.35494  1.000 39.99091  ? 71  GLN A CG  1 
ATOM   548  C CD  . GLN A 1 71  ? 35.96987  20.99926  20.65510  1.000 41.14555  ? 71  GLN A CD  1 
ATOM   549  O OE1 . GLN A 1 71  ? 34.93332  21.41398  20.12792  1.000 46.00256  ? 71  GLN A OE1 1 
ATOM   550  N NE2 . GLN A 1 71  ? 35.99102  19.95652  21.49278  1.000 36.11810  ? 71  GLN A NE2 1 
ATOM   551  N N   . TYR A 1 72  ? 39.34079  22.53837  17.27889  1.000 41.21388  ? 72  TYR A N   1 
ATOM   552  C CA  . TYR A 1 72  ? 39.12719  23.71358  16.44465  1.000 39.62702  ? 72  TYR A CA  1 
ATOM   553  C C   . TYR A 1 72  ? 37.82500  24.38919  16.84660  1.000 37.65548  ? 72  TYR A C   1 
ATOM   554  O O   . TYR A 1 72  ? 36.84414  23.72188  17.18491  1.000 46.09360  ? 72  TYR A O   1 
ATOM   555  C CB  . TYR A 1 72  ? 39.08492  23.31383  14.96196  1.000 32.97489  ? 72  TYR A CB  1 
ATOM   556  C CG  . TYR A 1 72  ? 38.77119  24.47292  14.04001  1.000 36.81426  ? 72  TYR A CG  1 
ATOM   557  C CD1 . TYR A 1 72  ? 37.46848  24.71701  13.59066  1.000 36.81742  ? 72  TYR A CD1 1 
ATOM   558  C CD2 . TYR A 1 72  ? 39.77507  25.33636  13.62954  1.000 35.51894  ? 72  TYR A CD2 1 
ATOM   559  C CE1 . TYR A 1 72  ? 37.18869  25.79725  12.74543  1.000 42.77249  ? 72  TYR A CE1 1 
ATOM   560  C CE2 . TYR A 1 72  ? 39.51046  26.40706  12.79175  1.000 44.00644  ? 72  TYR A CE2 1 
ATOM   561  C CZ  . TYR A 1 72  ? 38.22252  26.64620  12.34320  1.000 51.06914  ? 72  TYR A CZ  1 
ATOM   562  O OH  . TYR A 1 72  ? 38.00563  27.74305  11.49840  1.000 48.85928  ? 72  TYR A OH  1 
ATOM   563  N N   . VAL A 1 73  ? 37.79880  25.71685  16.80746  1.000 36.84436  ? 73  VAL A N   1 
ATOM   564  C CA  . VAL A 1 73  ? 36.59712  26.45590  17.18334  1.000 45.08037  ? 73  VAL A CA  1 
ATOM   565  C C   . VAL A 1 73  ? 36.09941  27.28056  16.00280  1.000 44.01908  ? 73  VAL A C   1 
ATOM   566  O O   . VAL A 1 73  ? 36.85185  28.08084  15.43112  1.000 40.45233  ? 73  VAL A O   1 
ATOM   567  C CB  . VAL A 1 73  ? 36.83442  27.34852  18.41060  1.000 38.35090  ? 73  VAL A CB  1 
ATOM   568  C CG1 . VAL A 1 73  ? 35.57443  28.12208  18.72631  1.000 29.87714  ? 73  VAL A CG1 1 
ATOM   569  C CG2 . VAL A 1 73  ? 37.23055  26.48837  19.56968  1.000 27.19599  ? 73  VAL A CG2 1 
ATOM   570  N N   . ASP A 1 74  ? 34.80879  27.12660  15.69933  1.000 42.78784  ? 74  ASP A N   1 
ATOM   571  C CA  . ASP A 1 74  ? 34.19720  27.73632  14.52905  1.000 47.73740  ? 74  ASP A CA  1 
ATOM   572  C C   . ASP A 1 74  ? 34.12514  29.25603  14.65094  1.000 52.10149  ? 74  ASP A C   1 
ATOM   573  O O   . ASP A 1 74  ? 33.60747  29.79825  15.63661  1.000 46.31793  ? 74  ASP A O   1 
ATOM   574  C CB  . ASP A 1 74  ? 32.80174  27.15736  14.30958  1.000 51.29190  ? 74  ASP A CB  1 
ATOM   575  C CG  . ASP A 1 74  ? 32.15191  27.69276  13.05601  1.000 62.61320  ? 74  ASP A CG  1 
ATOM   576  O OD1 . ASP A 1 74  ? 32.74598  27.52949  11.97183  1.000 63.15712  ? 74  ASP A OD1 1 
ATOM   577  O OD2 . ASP A 1 74  ? 31.06287  28.29988  13.15453  1.000 70.23155  ? 74  ASP A OD2 1 
ATOM   578  N N   . THR A 1 75  ? 34.62007  29.93479  13.60934  1.000 53.34870  ? 75  THR A N   1 
ATOM   579  C CA  . THR A 1 75  ? 34.72742  31.38825  13.55589  1.000 48.24666  ? 75  THR A CA  1 
ATOM   580  C C   . THR A 1 75  ? 33.96628  31.98487  12.38003  1.000 50.59920  ? 75  THR A C   1 
ATOM   581  O O   . THR A 1 75  ? 34.13476  33.17673  12.09106  1.000 53.19219  ? 75  THR A O   1 
ATOM   582  C CB  . THR A 1 75  ? 36.20010  31.81035  13.47598  1.000 45.66644  ? 75  THR A CB  1 
ATOM   583  O OG1 . THR A 1 75  ? 36.87718  31.00285  12.50285  1.000 49.51905  ? 75  THR A OG1 1 
ATOM   584  C CG2 . THR A 1 75  ? 36.87909  31.62894  14.80719  1.000 50.55857  ? 75  THR A CG2 1 
ATOM   585  N N   . LEU A 1 76  ? 33.13583  31.19412  11.69273  1.000 52.19051  ? 76  LEU A N   1 
ATOM   586  C CA  . LEU A 1 76  ? 32.45732  31.70071  10.50291  1.000 53.08205  ? 76  LEU A CA  1 
ATOM   587  C C   . LEU A 1 76  ? 31.48913  32.82232  10.85413  1.000 56.73329  ? 76  LEU A C   1 
ATOM   588  O O   . LEU A 1 76  ? 31.57158  33.92025  10.29850  1.000 70.08223  ? 76  LEU A O   1 
ATOM   589  C CB  . LEU A 1 76  ? 31.72253  30.57284  9.77424   1.000 57.65536  ? 76  LEU A CB  1 
ATOM   590  C CG  . LEU A 1 76  ? 31.18078  31.03296  8.40539   1.000 57.17643  ? 76  LEU A CG  1 
ATOM   591  C CD1 . LEU A 1 76  ? 32.29807  31.64832  7.55595   1.000 48.44180  ? 76  LEU A CD1 1 
ATOM   592  C CD2 . LEU A 1 76  ? 30.44167  29.94471  7.62636   1.000 45.59374  ? 76  LEU A CD2 1 
ATOM   593  N N   . TYR A 1 77  ? 30.55770  32.56821  11.76711  1.000 54.92950  ? 77  TYR A N   1 
ATOM   594  C CA  . TYR A 1 77  ? 29.59499  33.57612  12.20582  1.000 58.78158  ? 77  TYR A CA  1 
ATOM   595  C C   . TYR A 1 77  ? 29.78470  33.82756  13.69648  1.000 65.66766  ? 77  TYR A C   1 
ATOM   596  O O   . TYR A 1 77  ? 29.19514  33.12786  14.53665  1.000 64.12378  ? 77  TYR A O   1 
ATOM   597  C CB  . TYR A 1 77  ? 28.17072  33.13128  11.90914  1.000 53.25179  ? 77  TYR A CB  1 
ATOM   598  C CG  . TYR A 1 77  ? 27.92222  32.75368  10.47218  1.000 50.74081  ? 77  TYR A CG  1 
ATOM   599  C CD1 . TYR A 1 77  ? 27.76744  33.73048  9.50098   1.000 48.09598  ? 77  TYR A CD1 1 
ATOM   600  C CD2 . TYR A 1 77  ? 27.81207  31.42556  10.09004  1.000 46.97668  ? 77  TYR A CD2 1 
ATOM   601  C CE1 . TYR A 1 77  ? 27.51593  33.40581  8.20099   1.000 48.34478  ? 77  TYR A CE1 1 
ATOM   602  C CE2 . TYR A 1 77  ? 27.55517  31.08648  8.77893   1.000 53.27484  ? 77  TYR A CE2 1 
ATOM   603  C CZ  . TYR A 1 77  ? 27.41780  32.08452  7.82936   1.000 58.90558  ? 77  TYR A CZ  1 
ATOM   604  O OH  . TYR A 1 77  ? 27.17089  31.77905  6.49434   1.000 68.16974  ? 77  TYR A OH  1 
ATOM   605  N N   . PRO A 1 78  ? 30.59095  34.81843  14.07282  1.000 67.34988  ? 78  PRO A N   1 
ATOM   606  C CA  . PRO A 1 78  ? 30.83826  35.06408  15.49803  1.000 68.02288  ? 78  PRO A CA  1 
ATOM   607  C C   . PRO A 1 78  ? 29.61148  35.66326  16.18100  1.000 73.47730  ? 78  PRO A C   1 
ATOM   608  O O   . PRO A 1 78  ? 29.02581  36.63548  15.69453  1.000 69.31882  ? 78  PRO A O   1 
ATOM   609  C CB  . PRO A 1 78  ? 32.02003  36.04335  15.48554  1.000 68.69713  ? 78  PRO A CB  1 
ATOM   610  C CG  . PRO A 1 78  ? 32.58675  35.97178  14.08741  1.000 65.09565  ? 78  PRO A CG  1 
ATOM   611  C CD  . PRO A 1 78  ? 31.42678  35.67220  13.21390  1.000 66.58290  ? 78  PRO A CD  1 
ATOM   612  N N   . GLY A 1 79  ? 29.22564  35.06874  17.32381  1.000 71.28185  ? 79  GLY A N   1 
ATOM   613  C CA  . GLY A 1 79  ? 28.10345  35.53569  18.11832  1.000 68.96517  ? 79  GLY A CA  1 
ATOM   614  C C   . GLY A 1 79  ? 26.74254  35.01669  17.69254  1.000 68.67131  ? 79  GLY A C   1 
ATOM   615  O O   . GLY A 1 79  ? 25.78750  35.09385  18.47728  1.000 71.89731  ? 79  GLY A O   1 
ATOM   616  N N   . PHE A 1 80  ? 26.62949  34.51465  16.46673  1.000 65.11102  ? 80  PHE A N   1 
ATOM   617  C CA  . PHE A 1 80  ? 25.41634  33.87061  15.98591  1.000 49.84939  ? 80  PHE A CA  1 
ATOM   618  C C   . PHE A 1 80  ? 25.09437  32.64380  16.83111  1.000 43.29966  ? 80  PHE A C   1 
ATOM   619  O O   . PHE A 1 80  ? 25.93429  31.75507  17.00572  1.000 33.12582  ? 80  PHE A O   1 
ATOM   620  C CB  . PHE A 1 80  ? 25.62397  33.48083  14.51851  1.000 50.72148  ? 80  PHE A CB  1 
ATOM   621  C CG  . PHE A 1 80  ? 24.48203  32.72476  13.90211  1.000 46.00360  ? 80  PHE A CG  1 
ATOM   622  C CD1 . PHE A 1 80  ? 23.24550  33.33220  13.71684  1.000 47.43892  ? 80  PHE A CD1 1 
ATOM   623  C CD2 . PHE A 1 80  ? 24.65539  31.41210  13.48565  1.000 40.21123  ? 80  PHE A CD2 1 
ATOM   624  C CE1 . PHE A 1 80  ? 22.19417  32.64636  13.13752  1.000 48.06638  ? 80  PHE A CE1 1 
ATOM   625  C CE2 . PHE A 1 80  ? 23.61202  30.72275  12.89291  1.000 47.71881  ? 80  PHE A CE2 1 
ATOM   626  C CZ  . PHE A 1 80  ? 22.37427  31.33993  12.72348  1.000 49.38894  ? 80  PHE A CZ  1 
ATOM   627  N N   . GLU A 1 81  ? 23.86634  32.59515  17.35162  1.000 46.95167  ? 81  GLU A N   1 
ATOM   628  C CA  . GLU A 1 81  ? 23.48381  31.49782  18.23575  1.000 48.04740  ? 81  GLU A CA  1 
ATOM   629  C C   . GLU A 1 81  ? 23.61294  30.14970  17.53270  1.000 47.22684  ? 81  GLU A C   1 
ATOM   630  O O   . GLU A 1 81  ? 24.07265  29.17162  18.13256  1.000 54.31390  ? 81  GLU A O   1 
ATOM   631  C CB  . GLU A 1 81  ? 22.05613  31.71530  18.75861  1.000 56.13840  ? 81  GLU A CB  1 
ATOM   632  C CG  . GLU A 1 81  ? 21.41143  30.48822  19.42540  1.000 69.55754  ? 81  GLU A CG  1 
ATOM   633  C CD  . GLU A 1 81  ? 21.68680  30.40044  20.93118  1.000 84.30007  ? 81  GLU A CD  1 
ATOM   634  O OE1 . GLU A 1 81  ? 21.72584  31.46938  21.59042  1.000 92.17439  ? 81  GLU A OE1 1 
ATOM   635  O OE2 . GLU A 1 81  ? 21.85858  29.26500  21.45074  1.000 79.94853  ? 81  GLU A OE2 1 
ATOM   636  N N   . GLY A 1 82  ? 23.23683  30.08220  16.25461  1.000 43.29922  ? 82  GLY A N   1 
ATOM   637  C CA  . GLY A 1 82  ? 23.21394  28.80608  15.55861  1.000 43.90759  ? 82  GLY A CA  1 
ATOM   638  C C   . GLY A 1 82  ? 24.55765  28.11014  15.47650  1.000 41.07234  ? 82  GLY A C   1 
ATOM   639  O O   . GLY A 1 82  ? 24.60171  26.87791  15.37118  1.000 38.64457  ? 82  GLY A O   1 
ATOM   640  N N   . THR A 1 83  ? 25.65612  28.86082  15.51749  1.000 37.39916  ? 83  THR A N   1 
ATOM   641  C CA  . THR A 1 83  ? 26.96995  28.23594  15.59248  1.000 41.16604  ? 83  THR A CA  1 
ATOM   642  C C   . THR A 1 83  ? 27.50853  28.14106  17.01769  1.000 42.66355  ? 83  THR A C   1 
ATOM   643  O O   . THR A 1 83  ? 28.07452  27.10209  17.37897  1.000 39.52188  ? 83  THR A O   1 
ATOM   644  C CB  . THR A 1 83  ? 27.98206  28.97551  14.70640  1.000 45.72713  ? 83  THR A CB  1 
ATOM   645  O OG1 . THR A 1 83  ? 27.72363  30.38307  14.72767  1.000 55.99778  ? 83  THR A OG1 1 
ATOM   646  C CG2 . THR A 1 83  ? 27.87659  28.48532  13.30124  1.000 47.99474  ? 83  THR A CG2 1 
ATOM   647  N N   . GLU A 1 84  ? 27.33335  29.18145  17.84701  1.000 41.06561  ? 84  GLU A N   1 
ATOM   648  C CA  . GLU A 1 84  ? 27.86849  29.11908  19.20795  1.000 45.93646  ? 84  GLU A CA  1 
ATOM   649  C C   . GLU A 1 84  ? 27.28598  27.95278  19.99373  1.000 46.41011  ? 84  GLU A C   1 
ATOM   650  O O   . GLU A 1 84  ? 27.96453  27.40127  20.86913  1.000 48.41049  ? 84  GLU A O   1 
ATOM   651  C CB  . GLU A 1 84  ? 27.62037  30.41749  19.98261  1.000 45.01965  ? 84  GLU A CB  1 
ATOM   652  C CG  . GLU A 1 84  ? 28.13627  31.69498  19.33021  1.000 67.31342  ? 84  GLU A CG  1 
ATOM   653  C CD  . GLU A 1 84  ? 29.64971  31.85726  19.38338  1.000 70.22553  ? 84  GLU A CD  1 
ATOM   654  O OE1 . GLU A 1 84  ? 30.34393  30.99209  19.96989  1.000 55.72402  ? 84  GLU A OE1 1 
ATOM   655  O OE2 . GLU A 1 84  ? 30.14111  32.85842  18.80862  1.000 77.11634  ? 84  GLU A OE2 1 
ATOM   656  N N   . MET A 1 85  ? 26.04725  27.54716  19.69678  1.000 41.49855  ? 85  MET A N   1 
ATOM   657  C CA  . MET A 1 85  ? 25.44554  26.45667  20.46179  1.000 39.83871  ? 85  MET A CA  1 
ATOM   658  C C   . MET A 1 85  ? 26.25017  25.16352  20.36374  1.000 40.87205  ? 85  MET A C   1 
ATOM   659  O O   . MET A 1 85  ? 26.08331  24.27595  21.20919  1.000 45.29872  ? 85  MET A O   1 
ATOM   660  C CB  . MET A 1 85  ? 24.00402  26.21763  20.01105  1.000 37.94655  ? 85  MET A CB  1 
ATOM   661  C CG  . MET A 1 85  ? 23.84873  25.64344  18.62194  1.000 38.81673  ? 85  MET A CG  1 
ATOM   662  S SD  . MET A 1 85  ? 22.11382  25.41813  18.12320  1.000 52.94419  ? 85  MET A SD  1 
ATOM   663  C CE  . MET A 1 85  ? 21.80483  23.82383  18.88264  1.000 43.86894  ? 85  MET A CE  1 
ATOM   664  N N   . TRP A 1 86  ? 27.13371  25.05085  19.36982  1.000 34.14830  ? 86  TRP A N   1 
ATOM   665  C CA  . TRP A 1 86  ? 27.96430  23.87178  19.18459  1.000 29.88457  ? 86  TRP A CA  1 
ATOM   666  C C   . TRP A 1 86  ? 29.39163  24.06517  19.68045  1.000 27.79376  ? 86  TRP A C   1 
ATOM   667  O O   . TRP A 1 86  ? 30.08805  23.07335  19.91456  1.000 35.66915  ? 86  TRP A O   1 
ATOM   668  C CB  . TRP A 1 86  ? 27.98971  23.47448  17.69288  1.000 36.15970  ? 86  TRP A CB  1 
ATOM   669  C CG  . TRP A 1 86  ? 26.62001  23.31533  17.09541  1.000 30.85563  ? 86  TRP A CG  1 
ATOM   670  C CD1 . TRP A 1 86  ? 26.00784  24.15676  16.21591  1.000 36.13288  ? 86  TRP A CD1 1 
ATOM   671  C CD2 . TRP A 1 86  ? 25.68365  22.25458  17.35520  1.000 30.82392  ? 86  TRP A CD2 1 
ATOM   672  N NE1 . TRP A 1 86  ? 24.75224  23.68278  15.90037  1.000 38.05026  ? 86  TRP A NE1 1 
ATOM   673  C CE2 . TRP A 1 86  ? 24.53115  22.51774  16.59108  1.000 35.02121  ? 86  TRP A CE2 1 
ATOM   674  C CE3 . TRP A 1 86  ? 25.71034  21.10847  18.16271  1.000 33.32274  ? 86  TRP A CE3 1 
ATOM   675  C CZ2 . TRP A 1 86  ? 23.41224  21.67504  16.60890  1.000 35.41518  ? 86  TRP A CZ2 1 
ATOM   676  C CZ3 . TRP A 1 86  ? 24.59838  20.27450  18.18420  1.000 30.17180  ? 86  TRP A CZ3 1 
ATOM   677  C CH2 . TRP A 1 86  ? 23.46525  20.56277  17.41013  1.000 32.13014  ? 86  TRP A CH2 1 
ATOM   678  N N   . ASN A 1 87  ? 29.83334  25.30756  19.85731  1.000 25.16390  ? 87  ASN A N   1 
ATOM   679  C CA  . ASN A 1 87  ? 31.19289  25.59868  20.28036  1.000 31.03253  ? 87  ASN A CA  1 
ATOM   680  C C   . ASN A 1 87  ? 31.42583  25.16292  21.73847  1.000 39.31625  ? 87  ASN A C   1 
ATOM   681  O O   . ASN A 1 87  ? 30.47223  25.01999  22.51045  1.000 41.52604  ? 87  ASN A O   1 
ATOM   682  C CB  . ASN A 1 87  ? 31.44910  27.09490  20.10892  1.000 34.20677  ? 87  ASN A CB  1 
ATOM   683  C CG  . ASN A 1 87  ? 31.60981  27.50101  18.65778  1.000 40.37006  ? 87  ASN A CG  1 
ATOM   684  O OD1 . ASN A 1 87  ? 32.12124  26.73353  17.83620  1.000 49.50859  ? 87  ASN A OD1 1 
ATOM   685  N ND2 . ASN A 1 87  ? 31.17626  28.71740  18.33318  1.000 38.54283  ? 87  ASN A ND2 1 
ATOM   686  N N   . PRO A 1 88  ? 32.69066  24.96548  22.14965  1.000 44.89320  ? 88  PRO A N   1 
ATOM   687  C CA  . PRO A 1 88  ? 32.95149  24.50718  23.52890  1.000 39.36509  ? 88  PRO A CA  1 
ATOM   688  C C   . PRO A 1 88  ? 32.49988  25.53518  24.54513  1.000 39.60857  ? 88  PRO A C   1 
ATOM   689  O O   . PRO A 1 88  ? 32.61634  26.74081  24.32088  1.000 47.92401  ? 88  PRO A O   1 
ATOM   690  C CB  . PRO A 1 88  ? 34.47597  24.33783  23.58183  1.000 38.56692  ? 88  PRO A CB  1 
ATOM   691  C CG  . PRO A 1 88  ? 34.96939  24.47516  22.17335  1.000 37.30248  ? 88  PRO A CG  1 
ATOM   692  C CD  . PRO A 1 88  ? 33.94241  25.28565  21.43787  1.000 42.42908  ? 88  PRO A CD  1 
ATOM   693  N N   . ASN A 1 89  ? 32.00164  25.04371  25.68875  1.000 44.51080  ? 89  ASN A N   1 
ATOM   694  C CA  . ASN A 1 89  ? 31.46885  25.90525  26.74593  1.000 35.52243  ? 89  ASN A CA  1 
ATOM   695  C C   . ASN A 1 89  ? 32.21809  25.77925  28.07232  1.000 40.03189  ? 89  ASN A C   1 
ATOM   696  O O   . ASN A 1 89  ? 31.77030  26.33792  29.08219  1.000 57.23886  ? 89  ASN A O   1 
ATOM   697  C CB  . ASN A 1 89  ? 29.97454  25.64077  26.95235  1.000 25.92207  ? 89  ASN A CB  1 
ATOM   698  C CG  . ASN A 1 89  ? 29.68622  24.22241  27.38877  1.000 47.11177  ? 89  ASN A CG  1 
ATOM   699  O OD1 . ASN A 1 89  ? 30.54494  23.33967  27.29188  1.000 40.52577  ? 89  ASN A OD1 1 
ATOM   700  N ND2 . ASN A 1 89  ? 28.46465  23.99352  27.88720  1.000 42.49610  ? 89  ASN A ND2 1 
ATOM   701  N N   . ARG A 1 90  ? 33.31741  25.03630  28.11398  1.000 37.36784  ? 90  ARG A N   1 
ATOM   702  C CA  A ARG A 1 90  ? 34.25280  25.08935  29.22677  0.466 41.33352  ? 90  ARG A CA  1 
ATOM   703  C CA  B ARG A 1 90  ? 34.25563  25.05616  29.22739  0.534 41.40265  ? 90  ARG A CA  1 
ATOM   704  C C   . ARG A 1 90  ? 35.65701  25.18262  28.64893  1.000 40.32792  ? 90  ARG A C   1 
ATOM   705  O O   . ARG A 1 90  ? 35.85669  25.10359  27.43425  1.000 41.67516  ? 90  ARG A O   1 
ATOM   706  C CB  A ARG A 1 90  ? 34.11259  23.87547  30.16542  0.466 42.20624  ? 90  ARG A CB  1 
ATOM   707  C CB  B ARG A 1 90  ? 34.14954  23.79969  30.11649  0.534 42.11346  ? 90  ARG A CB  1 
ATOM   708  C CG  A ARG A 1 90  ? 32.70509  23.67270  30.75960  0.466 40.89402  ? 90  ARG A CG  1 
ATOM   709  C CG  B ARG A 1 90  ? 32.79995  23.58358  30.82950  0.534 40.63526  ? 90  ARG A CG  1 
ATOM   710  C CD  A ARG A 1 90  ? 32.39249  24.60849  31.93496  0.466 42.42586  ? 90  ARG A CD  1 
ATOM   711  C CD  B ARG A 1 90  ? 32.40601  24.72946  31.76835  0.534 42.59751  ? 90  ARG A CD  1 
ATOM   712  N NE  A ARG A 1 90  ? 31.00152  24.47502  32.37148  0.466 44.56220  ? 90  ARG A NE  1 
ATOM   713  N NE  B ARG A 1 90  ? 33.24767  24.82223  32.96020  0.534 43.61666  ? 90  ARG A NE  1 
ATOM   714  C CZ  A ARG A 1 90  ? 30.13713  25.48257  32.48525  0.466 41.78229  ? 90  ARG A CZ  1 
ATOM   715  C CZ  B ARG A 1 90  ? 32.84629  24.51069  34.18784  0.534 47.12080  ? 90  ARG A CZ  1 
ATOM   716  N NH1 A ARG A 1 90  ? 30.51716  26.72504  32.21065  0.466 45.31954  ? 90  ARG A NH1 1 
ATOM   717  N NH1 B ARG A 1 90  ? 31.60941  24.07163  34.39046  0.534 51.01679  ? 90  ARG A NH1 1 
ATOM   718  N NH2 A ARG A 1 90  ? 28.88944  25.24609  32.88518  0.466 31.59263  ? 90  ARG A NH2 1 
ATOM   719  N NH2 B ARG A 1 90  ? 33.68185  24.63186  35.21391  0.534 45.39797  ? 90  ARG A NH2 1 
ATOM   720  N N   . GLU A 1 91  ? 36.63427  25.37473  29.52812  1.000 41.53670  ? 91  GLU A N   1 
ATOM   721  C CA  . GLU A 1 91  ? 38.01113  25.54893  29.08596  1.000 36.75914  ? 91  GLU A CA  1 
ATOM   722  C C   . GLU A 1 91  ? 38.48165  24.40939  28.17846  1.000 44.83567  ? 91  GLU A C   1 
ATOM   723  O O   . GLU A 1 91  ? 38.12994  23.23922  28.37787  1.000 36.53352  ? 91  GLU A O   1 
ATOM   724  C CB  . GLU A 1 91  ? 38.90199  25.64787  30.30280  1.000 39.61403  ? 91  GLU A CB  1 
ATOM   725  C CG  . GLU A 1 91  ? 40.34898  25.59112  29.99594  1.000 48.72055  ? 91  GLU A CG  1 
ATOM   726  C CD  . GLU A 1 91  ? 41.15531  25.99069  31.19133  1.000 55.40965  ? 91  GLU A CD  1 
ATOM   727  O OE1 . GLU A 1 91  ? 40.59211  26.72399  32.04862  1.000 53.37358  ? 91  GLU A OE1 1 
ATOM   728  O OE2 . GLU A 1 91  ? 42.33068  25.56157  31.27282  1.000 53.31225  ? 91  GLU A OE2 1 
ATOM   729  N N   . LEU A 1 92  ? 39.26335  24.76978  27.15272  1.000 48.84627  ? 92  LEU A N   1 
ATOM   730  C CA  . LEU A 1 92  ? 39.88324  23.78985  26.26523  1.000 45.45793  ? 92  LEU A CA  1 
ATOM   731  C C   . LEU A 1 92  ? 41.15233  23.24473  26.91171  1.000 43.81481  ? 92  LEU A C   1 
ATOM   732  O O   . LEU A 1 92  ? 41.96105  24.00925  27.45125  1.000 44.84249  ? 92  LEU A O   1 
ATOM   733  C CB  . LEU A 1 92  ? 40.21923  24.42347  24.91734  1.000 44.53752  ? 92  LEU A CB  1 
ATOM   734  C CG  . LEU A 1 92  ? 39.10255  24.61844  23.90022  1.000 42.92530  ? 92  LEU A CG  1 
ATOM   735  C CD1 . LEU A 1 92  ? 39.57253  25.51025  22.78006  1.000 27.91376  ? 92  LEU A CD1 1 
ATOM   736  C CD2 . LEU A 1 92  ? 38.69005  23.28037  23.36996  1.000 51.34867  ? 92  LEU A CD2 1 
ATOM   737  N N   . SER A 1 93  ? 41.32664  21.92661  26.85593  1.000 35.46761  ? 93  SER A N   1 
ATOM   738  C CA  . SER A 1 93  ? 42.43058  21.25228  27.53113  1.000 35.70473  ? 93  SER A CA  1 
ATOM   739  C C   . SER A 1 93  ? 42.59343  19.85670  26.97170  1.000 35.53181  ? 93  SER A C   1 
ATOM   740  O O   . SER A 1 93  ? 41.60702  19.19121  26.63811  1.000 37.29361  ? 93  SER A O   1 
ATOM   741  C CB  . SER A 1 93  ? 42.21101  21.15222  29.05165  1.000 37.34136  ? 93  SER A CB  1 
ATOM   742  O OG  . SER A 1 93  ? 43.36591  20.65859  29.73325  1.000 33.88170  ? 93  SER A OG  1 
ATOM   743  N N   . GLU A 1 94  ? 43.84912  19.40484  26.91735  1.000 35.95775  ? 94  GLU A N   1 
ATOM   744  C CA  . GLU A 1 94  ? 44.08766  18.00229  26.60807  1.000 34.66175  ? 94  GLU A CA  1 
ATOM   745  C C   . GLU A 1 94  ? 43.67001  17.10166  27.76026  1.000 36.25254  ? 94  GLU A C   1 
ATOM   746  O O   . GLU A 1 94  ? 43.31649  15.93915  27.53654  1.000 43.29840  ? 94  GLU A O   1 
ATOM   747  C CB  . GLU A 1 94  ? 45.54955  17.76735  26.26144  1.000 30.08184  ? 94  GLU A CB  1 
ATOM   748  C CG  . GLU A 1 94  ? 45.91836  18.09129  24.83901  1.000 29.94812  ? 94  GLU A CG  1 
ATOM   749  C CD  . GLU A 1 94  ? 47.38083  17.79036  24.55682  1.000 46.36886  ? 94  GLU A CD  1 
ATOM   750  O OE1 . GLU A 1 94  ? 47.68054  16.70789  23.98517  1.000 41.27583  ? 94  GLU A OE1 1 
ATOM   751  O OE2 . GLU A 1 94  ? 48.23047  18.63261  24.93704  1.000 43.02349  ? 94  GLU A OE2 1 
ATOM   752  N N   . ASP A 1 95  ? 43.70744  17.60856  28.98969  1.000 35.45375  ? 95  ASP A N   1 
ATOM   753  C CA  . ASP A 1 95  ? 43.12977  16.90386  30.13093  1.000 43.33749  ? 95  ASP A CA  1 
ATOM   754  C C   . ASP A 1 95  ? 41.62290  17.10274  30.07708  1.000 44.46612  ? 95  ASP A C   1 
ATOM   755  O O   . ASP A 1 95  ? 41.11628  18.16719  30.45007  1.000 47.15331  ? 95  ASP A O   1 
ATOM   756  C CB  . ASP A 1 95  ? 43.70907  17.42751  31.43630  1.000 47.81109  ? 95  ASP A CB  1 
ATOM   757  C CG  . ASP A 1 95  ? 43.10628  16.76184  32.63728  1.000 52.77986  ? 95  ASP A CG  1 
ATOM   758  O OD1 . ASP A 1 95  ? 42.60285  15.62338  32.49841  1.000 58.19888  ? 95  ASP A OD1 1 
ATOM   759  O OD2 . ASP A 1 95  ? 43.15104  17.37316  33.71939  1.000 58.96766  ? 95  ASP A OD2 1 
ATOM   760  N N   . CYS A 1 96  ? 40.89986  16.07331  29.61809  1.000 40.83365  ? 96  CYS A N   1 
ATOM   761  C CA  . CYS A 1 96  ? 39.49219  16.23152  29.25423  1.000 39.85599  ? 96  CYS A CA  1 
ATOM   762  C C   . CYS A 1 96  ? 38.71948  14.91838  29.28149  1.000 36.98355  ? 96  CYS A C   1 
ATOM   763  O O   . CYS A 1 96  ? 37.53247  14.89669  28.93816  1.000 31.99369  ? 96  CYS A O   1 
ATOM   764  C CB  . CYS A 1 96  ? 39.36117  16.85188  27.85693  1.000 39.73342  ? 96  CYS A CB  1 
ATOM   765  S SG  . CYS A 1 96  ? 39.93336  15.79757  26.47834  1.000 37.66969  ? 96  CYS A SG  1 
ATOM   766  N N   . LEU A 1 97  ? 39.36589  13.82767  29.70038  1.000 33.00203  ? 97  LEU A N   1 
ATOM   767  C CA  . LEU A 1 97  ? 38.74406  12.50495  29.66483  1.000 35.56517  ? 97  LEU A CA  1 
ATOM   768  C C   . LEU A 1 97  ? 37.88299  12.31616  30.92123  1.000 44.71590  ? 97  LEU A C   1 
ATOM   769  O O   . LEU A 1 97  ? 38.22655  11.59421  31.86086  1.000 59.98479  ? 97  LEU A O   1 
ATOM   770  C CB  . LEU A 1 97  ? 39.81835  11.43129  29.49241  1.000 37.54097  ? 97  LEU A CB  1 
ATOM   771  C CG  . LEU A 1 97  ? 40.41448  11.47545  28.06112  1.000 39.47467  ? 97  LEU A CG  1 
ATOM   772  C CD1 . LEU A 1 97  ? 41.38158  10.33244  27.71848  1.000 27.25314  ? 97  LEU A CD1 1 
ATOM   773  C CD2 . LEU A 1 97  ? 39.29827  11.53849  27.01261  1.000 43.89722  ? 97  LEU A CD2 1 
ATOM   774  N N   . TYR A 1 98  ? 36.72568  12.98465  30.92499  1.000 37.74541  ? 98  TYR A N   1 
ATOM   775  C CA  . TYR A 1 98  ? 35.76624  12.92537  32.02463  1.000 43.18470  ? 98  TYR A CA  1 
ATOM   776  C C   . TYR A 1 98  ? 34.40447  12.52975  31.47000  1.000 39.13221  ? 98  TYR A C   1 
ATOM   777  O O   . TYR A 1 98  ? 34.17810  12.60023  30.26015  1.000 34.13473  ? 98  TYR A O   1 
ATOM   778  C CB  . TYR A 1 98  ? 35.67445  14.27536  32.77315  1.000 45.42483  ? 98  TYR A CB  1 
ATOM   779  C CG  . TYR A 1 98  ? 37.01755  14.76237  33.29936  1.000 48.02459  ? 98  TYR A CG  1 
ATOM   780  C CD1 . TYR A 1 98  ? 37.41897  14.49411  34.60582  1.000 51.09213  ? 98  TYR A CD1 1 
ATOM   781  C CD2 . TYR A 1 98  ? 37.89625  15.45435  32.47996  1.000 45.00054  ? 98  TYR A CD2 1 
ATOM   782  C CE1 . TYR A 1 98  ? 38.65507  14.91516  35.08178  1.000 48.85206  ? 98  TYR A CE1 1 
ATOM   783  C CE2 . TYR A 1 98  ? 39.12834  15.87482  32.94521  1.000 49.64676  ? 98  TYR A CE2 1 
ATOM   784  C CZ  . TYR A 1 98  ? 39.50085  15.60751  34.24305  1.000 48.70003  ? 98  TYR A CZ  1 
ATOM   785  O OH  . TYR A 1 98  ? 40.72705  16.03258  34.68668  1.000 53.81294  ? 98  TYR A OH  1 
ATOM   786  N N   . LEU A 1 99  ? 33.49505  12.09273  32.34908  1.000 31.23200  ? 99  LEU A N   1 
ATOM   787  C CA  . LEU A 1 99  ? 32.13281  11.77141  31.92440  1.000 32.07729  ? 99  LEU A CA  1 
ATOM   788  C C   . LEU A 1 99  ? 31.13302  12.35542  32.90664  1.000 39.09794  ? 99  LEU A C   1 
ATOM   789  O O   . LEU A 1 99  ? 31.48547  12.78718  34.00952  1.000 44.10611  ? 99  LEU A O   1 
ATOM   790  C CB  . LEU A 1 99  ? 31.89266  10.25910  31.78006  1.000 24.55908  ? 99  LEU A CB  1 
ATOM   791  C CG  . LEU A 1 99  ? 32.32626  9.31072   32.90099  1.000 33.12004  ? 99  LEU A CG  1 
ATOM   792  C CD1 . LEU A 1 99  ? 31.22345  9.13975   33.90595  1.000 36.78492  ? 99  LEU A CD1 1 
ATOM   793  C CD2 . LEU A 1 99  ? 32.70990  7.96021   32.33382  1.000 31.10190  ? 99  LEU A CD2 1 
ATOM   794  N N   . ASN A 1 100 ? 29.86801  12.34616  32.49153  1.000 30.22216  ? 100 ASN A N   1 
ATOM   795  C CA  . ASN A 1 100 ? 28.78004  12.89860  33.28207  1.000 35.62372  ? 100 ASN A CA  1 
ATOM   796  C C   . ASN A 1 100 ? 27.65843  11.87728  33.42571  1.000 39.17176  ? 100 ASN A C   1 
ATOM   797  O O   . ASN A 1 100 ? 27.48213  10.99863  32.57342  1.000 42.02691  ? 100 ASN A O   1 
ATOM   798  C CB  . ASN A 1 100 ? 28.24099  14.19131  32.65236  1.000 40.06803  ? 100 ASN A CB  1 
ATOM   799  C CG  . ASN A 1 100 ? 29.34415  15.07032  32.07869  1.000 41.55497  ? 100 ASN A CG  1 
ATOM   800  O OD1 . ASN A 1 100 ? 30.15794  15.62561  32.81429  1.000 46.86891  ? 100 ASN A OD1 1 
ATOM   801  N ND2 . ASN A 1 100 ? 29.36472  15.20964  30.76041  1.000 42.16325  ? 100 ASN A ND2 1 
ATOM   802  N N   . VAL A 1 101 ? 26.89768  12.00530  34.51812  1.000 39.39757  ? 101 VAL A N   1 
ATOM   803  C CA  . VAL A 1 101 ? 25.86138  11.04512  34.89558  1.000 35.96563  ? 101 VAL A CA  1 
ATOM   804  C C   . VAL A 1 101 ? 24.67783  11.79041  35.49399  1.000 42.43883  ? 101 VAL A C   1 
ATOM   805  O O   . VAL A 1 101 ? 24.80836  12.40060  36.56158  1.000 53.74920  ? 101 VAL A O   1 
ATOM   806  C CB  . VAL A 1 101 ? 26.37147  10.01980  35.91800  1.000 36.42905  ? 101 VAL A CB  1 
ATOM   807  C CG1 . VAL A 1 101 ? 25.27623  9.01380   36.22123  1.000 42.93633  ? 101 VAL A CG1 1 
ATOM   808  C CG2 . VAL A 1 101 ? 27.63753  9.34020   35.43401  1.000 27.47194  ? 101 VAL A CG2 1 
ATOM   809  N N   . TRP A 1 102 ? 23.52117  11.71581  34.83917  1.000 39.11785  ? 102 TRP A N   1 
ATOM   810  C CA  . TRP A 1 102 ? 22.25429  12.16926  35.40915  1.000 36.25458  ? 102 TRP A CA  1 
ATOM   811  C C   . TRP A 1 102 ? 21.42459  10.95807  35.81322  1.000 31.33625  ? 102 TRP A C   1 
ATOM   812  O O   . TRP A 1 102 ? 21.42410  9.93800   35.11328  1.000 30.83144  ? 102 TRP A O   1 
ATOM   813  C CB  . TRP A 1 102 ? 21.43386  13.01155  34.42040  1.000 36.57122  ? 102 TRP A CB  1 
ATOM   814  C CG  . TRP A 1 102 ? 22.04405  14.30620  34.01229  1.000 34.62959  ? 102 TRP A CG  1 
ATOM   815  C CD1 . TRP A 1 102 ? 21.77623  15.54895  34.52587  1.000 35.46060  ? 102 TRP A CD1 1 
ATOM   816  C CD2 . TRP A 1 102 ? 23.00384  14.49963  32.97776  1.000 37.79768  ? 102 TRP A CD2 1 
ATOM   817  N NE1 . TRP A 1 102 ? 22.52609  16.50421  33.87489  1.000 38.38873  ? 102 TRP A NE1 1 
ATOM   818  C CE2 . TRP A 1 102 ? 23.29083  15.88278  32.92210  1.000 40.26101  ? 102 TRP A CE2 1 
ATOM   819  C CE3 . TRP A 1 102 ? 23.64913  13.63913  32.08637  1.000 39.41075  ? 102 TRP A CE3 1 
ATOM   820  C CZ2 . TRP A 1 102 ? 24.20040  16.41868  32.01401  1.000 36.16322  ? 102 TRP A CZ2 1 
ATOM   821  C CZ3 . TRP A 1 102 ? 24.55357  14.17519  31.18062  1.000 33.29965  ? 102 TRP A CZ3 1 
ATOM   822  C CH2 . TRP A 1 102 ? 24.82090  15.55129  31.15407  1.000 31.47183  ? 102 TRP A CH2 1 
ATOM   823  N N   . THR A 1 103 ? 20.72458  11.06250  36.94363  1.000 32.96135  ? 103 THR A N   1 
ATOM   824  C CA  . THR A 1 103 ? 19.83575  10.00435  37.42504  1.000 31.17640  ? 103 THR A CA  1 
ATOM   825  C C   . THR A 1 103 ? 18.65005  10.63951  38.13289  1.000 34.42006  ? 103 THR A C   1 
ATOM   826  O O   . THR A 1 103 ? 18.76830  11.75240  38.66519  1.000 40.70486  ? 103 THR A O   1 
ATOM   827  C CB  . THR A 1 103 ? 20.52596  9.01961   38.39156  1.000 32.25206  ? 103 THR A CB  1 
ATOM   828  O OG1 . THR A 1 103 ? 20.54207  9.59094   39.70404  1.000 52.86037  ? 103 THR A OG1 1 
ATOM   829  C CG2 . THR A 1 103 ? 21.95329  8.69131   37.99174  1.000 33.04298  ? 103 THR A CG2 1 
ATOM   830  N N   . PRO A 1 104 ? 17.49816  9.96066   38.16027  1.000 36.07851  ? 104 PRO A N   1 
ATOM   831  C CA  . PRO A 1 104 ? 16.38248  10.41244  39.01173  1.000 41.07573  ? 104 PRO A CA  1 
ATOM   832  C C   . PRO A 1 104 ? 16.82774  10.73157  40.43170  1.000 43.30464  ? 104 PRO A C   1 
ATOM   833  O O   . PRO A 1 104 ? 17.84429  10.19937  40.88840  1.000 42.75055  ? 104 PRO A O   1 
ATOM   834  C CB  . PRO A 1 104 ? 15.42121  9.21768   38.98521  1.000 38.59020  ? 104 PRO A CB  1 
ATOM   835  C CG  . PRO A 1 104 ? 15.68116  8.56129   37.66035  1.000 37.47109  ? 104 PRO A CG  1 
ATOM   836  C CD  . PRO A 1 104 ? 17.14847  8.78336   37.34688  1.000 33.18267  ? 104 PRO A CD  1 
ATOM   837  N N   . TYR A 1 105 ? 16.09909  11.60110  41.13254  1.000 40.25363  ? 105 TYR A N   1 
ATOM   838  C CA  . TYR A 1 105 ? 16.44349  11.97594  42.50198  1.000 41.26115  ? 105 TYR A CA  1 
ATOM   839  C C   . TYR A 1 105 ? 15.17994  11.79720  43.32165  1.000 51.25010  ? 105 TYR A C   1 
ATOM   840  O O   . TYR A 1 105 ? 14.16694  12.46906  43.04059  1.000 60.87421  ? 105 TYR A O   1 
ATOM   841  C CB  . TYR A 1 105 ? 16.98046  13.41617  42.60676  1.000 43.60081  ? 105 TYR A CB  1 
ATOM   842  C CG  . TYR A 1 105 ? 17.11032  13.92966  44.03546  1.000 50.01386  ? 105 TYR A CG  1 
ATOM   843  C CD1 . TYR A 1 105 ? 18.33798  13.91281  44.69193  1.000 50.98973  ? 105 TYR A CD1 1 
ATOM   844  C CD2 . TYR A 1 105 ? 16.00797  14.42769  44.73059  1.000 55.89491  ? 105 TYR A CD2 1 
ATOM   845  C CE1 . TYR A 1 105 ? 18.46059  14.37568  46.00523  1.000 53.50029  ? 105 TYR A CE1 1 
ATOM   846  C CE2 . TYR A 1 105 ? 16.12076  14.89053  46.04358  1.000 51.45543  ? 105 TYR A CE2 1 
ATOM   847  C CZ  . TYR A 1 105 ? 17.35641  14.86722  46.66220  1.000 50.03289  ? 105 TYR A CZ  1 
ATOM   848  O OH  . TYR A 1 105 ? 17.50676  15.30217  47.94813  1.000 58.53691  ? 105 TYR A OH  1 
ATOM   849  N N   . PRO A 1 106 ? 15.16590  10.91116  44.33524  1.000 51.27176  ? 106 PRO A N   1 
ATOM   850  C CA  . PRO A 1 106 ? 16.25278  10.00665  44.75447  1.000 50.97582  ? 106 PRO A CA  1 
ATOM   851  C C   . PRO A 1 106 ? 16.61626  8.97979   43.68682  1.000 51.40489  ? 106 PRO A C   1 
ATOM   852  O O   . PRO A 1 106 ? 15.78840  8.74584   42.80064  1.000 50.18674  ? 106 PRO A O   1 
ATOM   853  C CB  . PRO A 1 106 ? 15.66584  9.29903   45.98550  1.000 50.10921  ? 106 PRO A CB  1 
ATOM   854  C CG  . PRO A 1 106 ? 14.17897  9.40975   45.80069  1.000 49.88213  ? 106 PRO A CG  1 
ATOM   855  C CD  . PRO A 1 106 ? 13.97630  10.76754  45.19131  1.000 46.50487  ? 106 PRO A CD  1 
ATOM   856  N N   . ARG A 1 107 ? 17.82347  8.40767   43.75293  1.000 51.08848  ? 107 ARG A N   1 
ATOM   857  C CA  . ARG A 1 107 ? 18.21752  7.39658   42.78015  1.000 50.38609  ? 107 ARG A CA  1 
ATOM   858  C C   . ARG A 1 107 ? 17.24039  6.22173   42.83306  1.000 61.91838  ? 107 ARG A C   1 
ATOM   859  O O   . ARG A 1 107 ? 16.70609  5.89363   43.89663  1.000 72.06729  ? 107 ARG A O   1 
ATOM   860  C CB  . ARG A 1 107 ? 19.64730  6.90991   43.02312  1.000 43.60304  ? 107 ARG A CB  1 
ATOM   861  C CG  . ARG A 1 107 ? 20.71230  8.00257   43.17009  1.000 46.48696  ? 107 ARG A CG  1 
ATOM   862  C CD  . ARG A 1 107 ? 22.09923  7.35933   43.09939  1.000 50.09736  ? 107 ARG A CD  1 
ATOM   863  N NE  . ARG A 1 107 ? 22.52982  6.82192   44.38585  1.000 54.61427  ? 107 ARG A NE  1 
ATOM   864  C CZ  . ARG A 1 107 ? 22.78766  7.55776   45.46124  1.000 62.55251  ? 107 ARG A CZ  1 
ATOM   865  N NH1 . ARG A 1 107 ? 22.69839  8.88108   45.39619  1.000 65.20634  ? 107 ARG A NH1 1 
ATOM   866  N NH2 . ARG A 1 107 ? 23.15470  6.96738   46.59558  1.000 59.98496  ? 107 ARG A NH2 1 
ATOM   867  N N   . PRO A 1 108 ? 16.99038  5.57545   41.69630  1.000 68.14452  ? 108 PRO A N   1 
ATOM   868  C CA  . PRO A 1 108 ? 15.81057  4.70334   41.57181  1.000 72.32786  ? 108 PRO A CA  1 
ATOM   869  C C   . PRO A 1 108 ? 15.89524  3.44825   42.43032  1.000 74.45169  ? 108 PRO A C   1 
ATOM   870  O O   . PRO A 1 108 ? 16.94763  3.05305   42.93807  1.000 70.86915  ? 108 PRO A O   1 
ATOM   871  C CB  . PRO A 1 108 ? 15.77482  4.35739   40.07802  1.000 70.98238  ? 108 PRO A CB  1 
ATOM   872  C CG  . PRO A 1 108 ? 17.14286  4.73078   39.54603  1.000 58.58629  ? 108 PRO A CG  1 
ATOM   873  C CD  . PRO A 1 108 ? 17.63443  5.84211   40.39491  1.000 56.51579  ? 108 PRO A CD  1 
ATOM   874  N N   . ALA A 1 109 ? 14.72645  2.81693   42.57993  1.000 80.81281  ? 109 ALA A N   1 
ATOM   875  C CA  . ALA A 1 109 ? 14.57511  1.66432   43.46244  1.000 85.74076  ? 109 ALA A CA  1 
ATOM   876  C C   . ALA A 1 109 ? 15.02265  0.37876   42.77905  1.000 83.75455  ? 109 ALA A C   1 
ATOM   877  O O   . ALA A 1 109 ? 15.84639  -0.36729  43.31997  1.000 80.33008  ? 109 ALA A O   1 
ATOM   878  C CB  . ALA A 1 109 ? 13.11827  1.54649   43.91410  1.000 89.56105  ? 109 ALA A CB  1 
ATOM   879  N N   . SER A 1 110 ? 14.46477  0.09771   41.59327  1.000 80.66350  ? 110 SER A N   1 
ATOM   880  C CA  . SER A 1 110 ? 14.84707  -0.98544  40.70462  1.000 70.82935  ? 110 SER A CA  1 
ATOM   881  C C   . SER A 1 110 ? 16.00941  -0.55287  39.82827  1.000 65.77301  ? 110 SER A C   1 
ATOM   882  O O   . SER A 1 110 ? 16.22209  0.64447   39.60488  1.000 62.69462  ? 110 SER A O   1 
ATOM   883  C CB  . SER A 1 110 ? 13.66367  -1.38679  39.82509  1.000 71.52454  ? 110 SER A CB  1 
ATOM   884  O OG  . SER A 1 110 ? 12.48148  -1.57906  40.58630  1.000 78.25591  ? 110 SER A OG  1 
ATOM   885  N N   . PRO A 1 111 ? 16.78176  -1.50246  39.30031  1.000 61.39481  ? 111 PRO A N   1 
ATOM   886  C CA  . PRO A 1 111 ? 17.84074  -1.13599  38.34255  1.000 60.34109  ? 111 PRO A CA  1 
ATOM   887  C C   . PRO A 1 111 ? 17.24460  -0.65184  37.02104  1.000 60.41824  ? 111 PRO A C   1 
ATOM   888  O O   . PRO A 1 111 ? 16.43075  -1.33871  36.39815  1.000 62.69225  ? 111 PRO A O   1 
ATOM   889  C CB  . PRO A 1 111 ? 18.63903  -2.43784  38.16991  1.000 53.62156  ? 111 PRO A CB  1 
ATOM   890  C CG  . PRO A 1 111 ? 18.15048  -3.36649  39.23985  1.000 46.09385  ? 111 PRO A CG  1 
ATOM   891  C CD  . PRO A 1 111 ? 16.75379  -2.94921  39.57064  1.000 49.42619  ? 111 PRO A CD  1 
ATOM   892  N N   . THR A 1 112 ? 17.66507  0.54126   36.59279  1.000 53.58656  ? 112 THR A N   1 
ATOM   893  C CA  . THR A 1 112 ? 17.11802  1.33411   35.49779  1.000 50.98649  ? 112 THR A CA  1 
ATOM   894  C C   . THR A 1 112 ? 17.98567  1.24197   34.24971  1.000 48.44806  ? 112 THR A C   1 
ATOM   895  O O   . THR A 1 112 ? 19.21657  1.31699   34.34529  1.000 49.49835  ? 112 THR A O   1 
ATOM   896  C CB  . THR A 1 112 ? 16.99255  2.79842   35.92325  1.000 54.99149  ? 112 THR A CB  1 
ATOM   897  O OG1 . THR A 1 112 ? 16.27088  2.86234   37.16084  1.000 67.63562  ? 112 THR A OG1 1 
ATOM   898  C CG2 . THR A 1 112 ? 16.26816  3.61935   34.87245  1.000 49.18876  ? 112 THR A CG2 1 
ATOM   899  N N   . PRO A 1 113 ? 17.35216  1.08094   33.08310  1.000 41.44877  ? 113 PRO A N   1 
ATOM   900  C CA  . PRO A 1 113 ? 18.11015  1.03024   31.82702  1.000 33.96211  ? 113 PRO A CA  1 
ATOM   901  C C   . PRO A 1 113 ? 18.90289  2.30801   31.60747  1.000 40.74709  ? 113 PRO A C   1 
ATOM   902  O O   . PRO A 1 113 ? 18.42557  3.41053   31.88623  1.000 47.12904  ? 113 PRO A O   1 
ATOM   903  C CB  . PRO A 1 113 ? 17.02007  0.86141   30.76264  1.000 43.48393  ? 113 PRO A CB  1 
ATOM   904  C CG  . PRO A 1 113 ? 15.84612  0.31993   31.49032  1.000 43.17822  ? 113 PRO A CG  1 
ATOM   905  C CD  . PRO A 1 113 ? 15.90892  0.87987   32.86744  1.000 43.26040  ? 113 PRO A CD  1 
ATOM   906  N N   . VAL A 1 114 ? 20.12108  2.14725   31.07735  1.000 40.98754  ? 114 VAL A N   1 
ATOM   907  C CA  . VAL A 1 114 ? 21.09251  3.22906   30.91337  1.000 41.59258  ? 114 VAL A CA  1 
ATOM   908  C C   . VAL A 1 114 ? 21.13766  3.66431   29.45033  1.000 45.29009  ? 114 VAL A C   1 
ATOM   909  O O   . VAL A 1 114 ? 21.09245  2.82944   28.53951  1.000 51.09459  ? 114 VAL A O   1 
ATOM   910  C CB  . VAL A 1 114 ? 22.48602  2.77267   31.40208  1.000 38.88327  ? 114 VAL A CB  1 
ATOM   911  C CG1 . VAL A 1 114 ? 23.47809  3.93118   31.42479  1.000 34.75470  ? 114 VAL A CG1 1 
ATOM   912  C CG2 . VAL A 1 114 ? 22.38176  2.14712   32.78647  1.000 42.86354  ? 114 VAL A CG2 1 
ATOM   913  N N   . LEU A 1 115 ? 21.23004  4.97313   29.22473  1.000 41.41350  ? 115 LEU A N   1 
ATOM   914  C CA  . LEU A 1 115 ? 21.43520  5.55552   27.90619  1.000 32.18836  ? 115 LEU A CA  1 
ATOM   915  C C   . LEU A 1 115 ? 22.76948  6.28266   27.89860  1.000 33.25398  ? 115 LEU A C   1 
ATOM   916  O O   . LEU A 1 115 ? 23.00223  7.17037   28.73007  1.000 44.43044  ? 115 LEU A O   1 
ATOM   917  C CB  . LEU A 1 115 ? 20.32235  6.54698   27.54791  1.000 38.83791  ? 115 LEU A CB  1 
ATOM   918  C CG  . LEU A 1 115 ? 18.95497  6.12023   27.02307  1.000 43.92350  ? 115 LEU A CG  1 
ATOM   919  C CD1 . LEU A 1 115 ? 18.04780  7.32664   26.95088  1.000 46.45903  ? 115 LEU A CD1 1 
ATOM   920  C CD2 . LEU A 1 115 ? 19.10327  5.53811   25.65692  1.000 47.61967  ? 115 LEU A CD2 1 
ATOM   921  N N   . ILE A 1 116 ? 23.62636  5.93655   26.94853  1.000 29.88717  ? 116 ILE A N   1 
ATOM   922  C CA  . ILE A 1 116 ? 24.94649  6.53696   26.82411  1.000 34.28692  ? 116 ILE A CA  1 
ATOM   923  C C   . ILE A 1 116 ? 24.97595  7.37345   25.55400  1.000 37.35221  ? 116 ILE A C   1 
ATOM   924  O O   . ILE A 1 116 ? 24.80589  6.83587   24.45407  1.000 34.14496  ? 116 ILE A O   1 
ATOM   925  C CB  . ILE A 1 116 ? 26.05331  5.47596   26.78497  1.000 35.14618  ? 116 ILE A CB  1 
ATOM   926  C CG1 . ILE A 1 116 ? 25.97163  4.53509   27.98310  1.000 33.53249  ? 116 ILE A CG1 1 
ATOM   927  C CG2 . ILE A 1 116 ? 27.38121  6.13522   26.77917  1.000 25.60501  ? 116 ILE A CG2 1 
ATOM   928  C CD1 . ILE A 1 116 ? 27.05718  3.49505   27.98424  1.000 29.54733  ? 116 ILE A CD1 1 
ATOM   929  N N   . TRP A 1 117 ? 25.25010  8.67208   25.70486  1.000 36.25370  ? 117 TRP A N   1 
ATOM   930  C CA  . TRP A 1 117 ? 25.32405  9.61203   24.59463  1.000 35.34037  ? 117 TRP A CA  1 
ATOM   931  C C   . TRP A 1 117 ? 26.75171  9.79752   24.08079  1.000 39.76675  ? 117 TRP A C   1 
ATOM   932  O O   . TRP A 1 117 ? 27.68645  9.98388   24.86039  1.000 49.91255  ? 117 TRP A O   1 
ATOM   933  C CB  . TRP A 1 117 ? 24.77090  10.96514  25.02663  1.000 32.34730  ? 117 TRP A CB  1 
ATOM   934  C CG  . TRP A 1 117 ? 24.90299  12.01733  23.95940  1.000 35.70677  ? 117 TRP A CG  1 
ATOM   935  C CD1 . TRP A 1 117 ? 25.76083  13.07260  23.95372  1.000 34.90823  ? 117 TRP A CD1 1 
ATOM   936  C CD2 . TRP A 1 117 ? 24.15518  12.10181  22.73931  1.000 36.56989  ? 117 TRP A CD2 1 
ATOM   937  N NE1 . TRP A 1 117 ? 25.58554  13.81987  22.81736  1.000 40.62357  ? 117 TRP A NE1 1 
ATOM   938  C CE2 . TRP A 1 117 ? 24.60546  13.24425  22.05250  1.000 40.68792  ? 117 TRP A CE2 1 
ATOM   939  C CE3 . TRP A 1 117 ? 23.14894  11.32170  22.16211  1.000 34.44639  ? 117 TRP A CE3 1 
ATOM   940  C CZ2 . TRP A 1 117 ? 24.07888  13.63223  20.81807  1.000 34.17169  ? 117 TRP A CZ2 1 
ATOM   941  C CZ3 . TRP A 1 117 ? 22.63061  11.70441  20.94083  1.000 32.87978  ? 117 TRP A CZ3 1 
ATOM   942  C CH2 . TRP A 1 117 ? 23.09927  12.84735  20.28151  1.000 32.99590  ? 117 TRP A CH2 1 
ATOM   943  N N   . ILE A 1 118 ? 26.91321  9.78788   22.76088  1.000 39.30489  ? 118 ILE A N   1 
ATOM   944  C CA  . ILE A 1 118 ? 28.20089  10.06745  22.12826  1.000 36.61954  ? 118 ILE A CA  1 
ATOM   945  C C   . ILE A 1 118 ? 28.02081  11.26473  21.20360  1.000 43.77359  ? 118 ILE A C   1 
ATOM   946  O O   . ILE A 1 118 ? 27.39652  11.13809  20.13896  1.000 39.21132  ? 118 ILE A O   1 
ATOM   947  C CB  . ILE A 1 118 ? 28.74030  8.86405   21.34666  1.000 27.82395  ? 118 ILE A CB  1 
ATOM   948  C CG1 . ILE A 1 118 ? 28.66107  7.58716   22.17126  1.000 23.61757  ? 118 ILE A CG1 1 
ATOM   949  C CG2 . ILE A 1 118 ? 30.17055  9.10684   20.97942  1.000 28.69880  ? 118 ILE A CG2 1 
ATOM   950  C CD1 . ILE A 1 118 ? 29.44495  6.40425   21.58148  1.000 22.22996  ? 118 ILE A CD1 1 
ATOM   951  N N   . TYR A 1 119 ? 28.58449  12.41627  21.58095  1.000 34.31596  ? 119 TYR A N   1 
ATOM   952  C CA  . TYR A 1 119 ? 28.36563  13.61408  20.77828  1.000 33.77131  ? 119 TYR A CA  1 
ATOM   953  C C   . TYR A 1 119 ? 29.03318  13.51086  19.40976  1.000 46.05921  ? 119 TYR A C   1 
ATOM   954  O O   . TYR A 1 119 ? 29.97679  12.74366  19.19049  1.000 43.23906  ? 119 TYR A O   1 
ATOM   955  C CB  . TYR A 1 119 ? 28.88306  14.86321  21.47571  1.000 33.71395  ? 119 TYR A CB  1 
ATOM   956  C CG  . TYR A 1 119 ? 30.35010  14.84139  21.87942  1.000 40.62913  ? 119 TYR A CG  1 
ATOM   957  C CD1 . TYR A 1 119 ? 31.37048  15.00622  20.93548  1.000 47.46039  ? 119 TYR A CD1 1 
ATOM   958  C CD2 . TYR A 1 119 ? 30.70999  14.70423  23.22074  1.000 37.43353  ? 119 TYR A CD2 1 
ATOM   959  C CE1 . TYR A 1 119 ? 32.71244  15.00366  21.31569  1.000 51.65152  ? 119 TYR A CE1 1 
ATOM   960  C CE2 . TYR A 1 119 ? 32.03029  14.70009  23.60925  1.000 46.61606  ? 119 TYR A CE2 1 
ATOM   961  C CZ  . TYR A 1 119 ? 33.03692  14.84373  22.66434  1.000 51.14621  ? 119 TYR A CZ  1 
ATOM   962  O OH  . TYR A 1 119 ? 34.35380  14.82404  23.09762  1.000 42.24721  ? 119 TYR A OH  1 
ATOM   963  N N   . GLY A 1 120 ? 28.53043  14.32220  18.48553  1.000 47.99676  ? 120 GLY A N   1 
ATOM   964  C CA  . GLY A 1 120 ? 29.07339  14.42837  17.15904  1.000 44.13957  ? 120 GLY A CA  1 
ATOM   965  C C   . GLY A 1 120 ? 29.92097  15.66839  16.99686  1.000 48.61466  ? 120 GLY A C   1 
ATOM   966  O O   . GLY A 1 120 ? 30.32052  16.31586  17.96904  1.000 53.97415  ? 120 GLY A O   1 
ATOM   967  N N   . GLY A 1 121 ? 30.18744  16.01453  15.74236  1.000 55.41126  ? 121 GLY A N   1 
ATOM   968  C CA  . GLY A 1 121 ? 31.05093  17.13678  15.44416  1.000 46.38157  ? 121 GLY A CA  1 
ATOM   969  C C   . GLY A 1 121 ? 32.24478  16.72541  14.61157  1.000 38.03463  ? 121 GLY A C   1 
ATOM   970  O O   . GLY A 1 121 ? 33.36078  17.18840  14.86115  1.000 35.83199  ? 121 GLY A O   1 
ATOM   971  N N   . GLY A 1 122 ? 32.02052  15.83136  13.64517  1.000 29.56285  ? 122 GLY A N   1 
ATOM   972  C CA  . GLY A 1 122 ? 32.99731  15.51300  12.61803  1.000 32.41464  ? 122 GLY A CA  1 
ATOM   973  C C   . GLY A 1 122 ? 34.32191  14.93924  13.07610  1.000 37.06510  ? 122 GLY A C   1 
ATOM   974  O O   . GLY A 1 122 ? 35.28702  14.94015  12.30860  1.000 43.84284  ? 122 GLY A O   1 
ATOM   975  N N   . PHE A 1 123 ? 34.39151  14.46009  14.31907  1.000 37.91803  ? 123 PHE A N   1 
ATOM   976  C CA  . PHE A 1 123 ? 35.60949  13.95573  14.95530  1.000 33.68353  ? 123 PHE A CA  1 
ATOM   977  C C   . PHE A 1 123 ? 36.66324  15.03653  15.17512  1.000 35.06327  ? 123 PHE A C   1 
ATOM   978  O O   . PHE A 1 123 ? 37.76941  14.73487  15.65182  1.000 28.05077  ? 123 PHE A O   1 
ATOM   979  C CB  . PHE A 1 123 ? 36.21544  12.79243  14.16764  1.000 28.44030  ? 123 PHE A CB  1 
ATOM   980  C CG  . PHE A 1 123 ? 35.35092  11.56589  14.15856  1.000 35.57826  ? 123 PHE A CG  1 
ATOM   981  C CD1 . PHE A 1 123 ? 35.33881  10.69933  15.24037  1.000 36.39242  ? 123 PHE A CD1 1 
ATOM   982  C CD2 . PHE A 1 123 ? 34.52690  11.29149  13.08251  1.000 39.52938  ? 123 PHE A CD2 1 
ATOM   983  C CE1 . PHE A 1 123 ? 34.54339  9.56534   15.23113  1.000 39.70294  ? 123 PHE A CE1 1 
ATOM   984  C CE2 . PHE A 1 123 ? 33.71943  10.15660  13.07330  1.000 36.69762  ? 123 PHE A CE2 1 
ATOM   985  C CZ  . PHE A 1 123 ? 33.73353  9.29659   14.13554  1.000 39.34676  ? 123 PHE A CZ  1 
ATOM   986  N N   . TYR A 1 124 ? 36.34924  16.29175  14.86617  1.000 40.95966  ? 124 TYR A N   1 
ATOM   987  C CA  . TYR A 1 124 ? 37.22925  17.41760  15.14280  1.000 40.01531  ? 124 TYR A CA  1 
ATOM   988  C C   . TYR A 1 124 ? 36.71181  18.30866  16.26878  1.000 41.08487  ? 124 TYR A C   1 
ATOM   989  O O   . TYR A 1 124 ? 37.38727  19.27118  16.63684  1.000 49.57628  ? 124 TYR A O   1 
ATOM   990  C CB  . TYR A 1 124 ? 37.41969  18.25906  13.86498  1.000 33.99772  ? 124 TYR A CB  1 
ATOM   991  C CG  . TYR A 1 124 ? 36.20953  19.10714  13.55051  1.000 31.31226  ? 124 TYR A CG  1 
ATOM   992  C CD1 . TYR A 1 124 ? 36.13154  20.43262  13.98582  1.000 33.62216  ? 124 TYR A CD1 1 
ATOM   993  C CD2 . TYR A 1 124 ? 35.12362  18.57739  12.85102  1.000 30.55537  ? 124 TYR A CD2 1 
ATOM   994  C CE1 . TYR A 1 124 ? 35.00718  21.21467  13.73090  1.000 29.95119  ? 124 TYR A CE1 1 
ATOM   995  C CE2 . TYR A 1 124 ? 33.98422  19.35389  12.58561  1.000 26.85118  ? 124 TYR A CE2 1 
ATOM   996  C CZ  . TYR A 1 124 ? 33.93892  20.66961  13.03360  1.000 28.56483  ? 124 TYR A CZ  1 
ATOM   997  O OH  . TYR A 1 124 ? 32.82955  21.44564  12.80705  1.000 25.26418  ? 124 TYR A OH  1 
ATOM   998  N N   . SER A 1 125 ? 35.52605  18.04653  16.80499  1.000 34.70486  ? 125 SER A N   1 
ATOM   999  C CA  . SER A 1 125 ? 34.91764  18.97951  17.74631  1.000 34.09575  ? 125 SER A CA  1 
ATOM   1000 C C   . SER A 1 125 ? 33.87904  18.22851  18.56852  1.000 30.00014  ? 125 SER A C   1 
ATOM   1001 O O   . SER A 1 125 ? 33.61440  17.04469  18.33646  1.000 25.75265  ? 125 SER A O   1 
ATOM   1002 C CB  . SER A 1 125 ? 34.29443  20.17582  17.01552  1.000 36.87731  ? 125 SER A CB  1 
ATOM   1003 O OG  . SER A 1 125 ? 33.34347  19.74106  16.05018  1.000 34.51145  ? 125 SER A OG  1 
ATOM   1004 N N   . GLY A 1 126 ? 33.29181  18.92965  19.54060  1.000 33.22547  ? 126 GLY A N   1 
ATOM   1005 C CA  . GLY A 1 126 ? 32.23503  18.34985  20.35349  1.000 36.19415  ? 126 GLY A CA  1 
ATOM   1006 C C   . GLY A 1 126 ? 32.53790  18.35866  21.83493  1.000 39.66795  ? 126 GLY A C   1 
ATOM   1007 O O   . GLY A 1 126 ? 33.70211  18.42860  22.23128  1.000 45.13903  ? 126 GLY A O   1 
ATOM   1008 N N   . ALA A 1 127 ? 31.50236  18.29908  22.66769  1.000 42.64680  ? 127 ALA A N   1 
ATOM   1009 C CA  . ALA A 1 127 ? 31.67236  18.22185  24.11536  1.000 42.17864  ? 127 ALA A CA  1 
ATOM   1010 C C   . ALA A 1 127 ? 30.41346  17.62342  24.70698  1.000 44.52434  ? 127 ALA A C   1 
ATOM   1011 O O   . ALA A 1 127 ? 29.30628  17.90442  24.23513  1.000 47.04839  ? 127 ALA A O   1 
ATOM   1012 C CB  . ALA A 1 127 ? 31.93296  19.58727  24.76443  1.000 29.96001  ? 127 ALA A CB  1 
ATOM   1013 N N   . ALA A 1 128 ? 30.58680  16.80569  25.73771  1.000 34.44039  ? 128 ALA A N   1 
ATOM   1014 C CA  . ALA A 1 128 ? 29.42867  16.19436  26.35958  1.000 37.41710  ? 128 ALA A CA  1 
ATOM   1015 C C   . ALA A 1 128 ? 28.68903  17.16913  27.25442  1.000 38.16645  ? 128 ALA A C   1 
ATOM   1016 O O   . ALA A 1 128 ? 27.61210  16.82282  27.76812  1.000 50.86838  ? 128 ALA A O   1 
ATOM   1017 C CB  . ALA A 1 128 ? 29.83783  14.95184  27.15266  1.000 39.96836  ? 128 ALA A CB  1 
ATOM   1018 N N   . SER A 1 129 ? 29.21525  18.38666  27.40143  1.000 25.14232  ? 129 SER A N   1 
ATOM   1019 C CA  . SER A 1 129 ? 28.69095  19.37833  28.33686  1.000 30.70506  ? 129 SER A CA  1 
ATOM   1020 C C   . SER A 1 129 ? 27.87441  20.48469  27.68433  1.000 33.48517  ? 129 SER A C   1 
ATOM   1021 O O   . SER A 1 129 ? 27.49951  21.43665  28.37564  1.000 34.55744  ? 129 SER A O   1 
ATOM   1022 C CB  . SER A 1 129 ? 29.84227  20.01549  29.13153  1.000 33.98826  ? 129 SER A CB  1 
ATOM   1023 O OG  . SER A 1 129 ? 30.78781  20.67545  28.30540  1.000 27.61853  ? 129 SER A OG  1 
ATOM   1024 N N   . LEU A 1 130 ? 27.62068  20.41184  26.37823  1.000 37.41703  ? 130 LEU A N   1 
ATOM   1025 C CA  . LEU A 1 130 ? 26.78232  21.40025  25.71132  1.000 33.46530  ? 130 LEU A CA  1 
ATOM   1026 C C   . LEU A 1 130 ? 25.33991  21.30113  26.20396  1.000 37.34485  ? 130 LEU A C   1 
ATOM   1027 O O   . LEU A 1 130 ? 24.89633  20.27478  26.72837  1.000 48.88014  ? 130 LEU A O   1 
ATOM   1028 C CB  . LEU A 1 130 ? 26.82072  21.20177  24.19477  1.000 39.88043  ? 130 LEU A CB  1 
ATOM   1029 C CG  . LEU A 1 130 ? 28.19401  21.02116  23.56315  1.000 34.64841  ? 130 LEU A CG  1 
ATOM   1030 C CD1 . LEU A 1 130 ? 28.04279  20.65746  22.11448  1.000 33.22673  ? 130 LEU A CD1 1 
ATOM   1031 C CD2 . LEU A 1 130 ? 28.97362  22.30542  23.70949  1.000 40.07510  ? 130 LEU A CD2 1 
ATOM   1032 N N   . ASP A 1 131 ? 24.59511  22.38919  26.00752  1.000 37.72868  ? 131 ASP A N   1 
ATOM   1033 C CA  . ASP A 1 131 ? 23.25485  22.47330  26.57671  1.000 31.99978  ? 131 ASP A CA  1 
ATOM   1034 C C   . ASP A 1 131 ? 22.28671  21.51522  25.90621  1.000 44.30431  ? 131 ASP A C   1 
ATOM   1035 O O   . ASP A 1 131 ? 21.38591  20.98628  26.56977  1.000 48.78432  ? 131 ASP A O   1 
ATOM   1036 C CB  . ASP A 1 131 ? 22.74147  23.90267  26.48561  1.000 29.61249  ? 131 ASP A CB  1 
ATOM   1037 C CG  . ASP A 1 131 ? 23.32263  24.78625  27.56960  1.000 46.80860  ? 131 ASP A CG  1 
ATOM   1038 O OD1 . ASP A 1 131 ? 22.97284  25.98680  27.61619  1.000 44.94739  ? 131 ASP A OD1 1 
ATOM   1039 O OD2 . ASP A 1 131 ? 24.12706  24.26667  28.38657  1.000 57.51136  ? 131 ASP A OD2 1 
ATOM   1040 N N   . VAL A 1 132 ? 22.45531  21.27372  24.60158  1.000 46.63976  ? 132 VAL A N   1 
ATOM   1041 C CA  . VAL A 1 132 ? 21.56990  20.36131  23.87913  1.000 35.57122  ? 132 VAL A CA  1 
ATOM   1042 C C   . VAL A 1 132 ? 21.76875  18.90797  24.27774  1.000 36.88619  ? 132 VAL A C   1 
ATOM   1043 O O   . VAL A 1 132 ? 20.99170  18.04998  23.84021  1.000 39.69704  ? 132 VAL A O   1 
ATOM   1044 C CB  . VAL A 1 132 ? 21.76673  20.51030  22.35859  1.000 33.42807  ? 132 VAL A CB  1 
ATOM   1045 C CG1 . VAL A 1 132 ? 21.22460  21.85068  21.89014  1.000 36.63542  ? 132 VAL A CG1 1 
ATOM   1046 C CG2 . VAL A 1 132 ? 23.24443  20.36667  21.98977  1.000 29.62764  ? 132 VAL A CG2 1 
ATOM   1047 N N   . TYR A 1 133 ? 22.78069  18.59936  25.09668  1.000 31.17574  ? 133 TYR A N   1 
ATOM   1048 C CA  . TYR A 1 133 ? 23.01843  17.23456  25.55741  1.000 40.76746  ? 133 TYR A CA  1 
ATOM   1049 C C   . TYR A 1 133 ? 22.64402  17.05149  27.02938  1.000 45.64860  ? 133 TYR A C   1 
ATOM   1050 O O   . TYR A 1 133 ? 23.13423  16.12955  27.68705  1.000 51.89695  ? 133 TYR A O   1 
ATOM   1051 C CB  . TYR A 1 133 ? 24.48022  16.83506  25.33149  1.000 43.59697  ? 133 TYR A CB  1 
ATOM   1052 C CG  . TYR A 1 133 ? 24.97329  16.96438  23.90309  1.000 44.96721  ? 133 TYR A CG  1 
ATOM   1053 C CD1 . TYR A 1 133 ? 24.09654  16.85759  22.83042  1.000 44.02423  ? 133 TYR A CD1 1 
ATOM   1054 C CD2 . TYR A 1 133 ? 26.31972  17.21595  23.62737  1.000 45.24649  ? 133 TYR A CD2 1 
ATOM   1055 C CE1 . TYR A 1 133 ? 24.54186  16.98206  21.51882  1.000 44.22012  ? 133 TYR A CE1 1 
ATOM   1056 C CE2 . TYR A 1 133 ? 26.77156  17.35312  22.31767  1.000 44.51193  ? 133 TYR A CE2 1 
ATOM   1057 C CZ  . TYR A 1 133 ? 25.87670  17.22514  21.26567  1.000 42.02957  ? 133 TYR A CZ  1 
ATOM   1058 O OH  . TYR A 1 133 ? 26.29992  17.34129  19.95761  1.000 34.76545  ? 133 TYR A OH  1 
ATOM   1059 N N   . ASP A 1 134 ? 21.78115  17.90926  27.55587  1.000 39.87547  ? 134 ASP A N   1 
ATOM   1060 C CA  . ASP A 1 134 ? 21.51589  17.95789  28.98784  1.000 40.03698  ? 134 ASP A CA  1 
ATOM   1061 C C   . ASP A 1 134 ? 20.56318  16.82869  29.36581  1.000 41.12083  ? 134 ASP A C   1 
ATOM   1062 O O   . ASP A 1 134 ? 19.39723  16.80715  28.94122  1.000 40.59318  ? 134 ASP A O   1 
ATOM   1063 C CB  . ASP A 1 134 ? 20.95949  19.33731  29.33728  1.000 39.83957  ? 134 ASP A CB  1 
ATOM   1064 C CG  . ASP A 1 134 ? 20.80902  19.56752  30.82929  1.000 43.14785  ? 134 ASP A CG  1 
ATOM   1065 O OD1 . ASP A 1 134 ? 19.72291  19.34191  31.35228  1.000 47.95829  ? 134 ASP A OD1 1 
ATOM   1066 O OD2 . ASP A 1 134 ? 21.77282  20.01144  31.49165  1.000 58.57980  ? 134 ASP A OD2 1 
ATOM   1067 N N   . GLY A 1 135 ? 21.06756  15.87818  30.15608  1.000 39.73021  ? 135 GLY A N   1 
ATOM   1068 C CA  . GLY A 1 135 ? 20.28725  14.70667  30.51080  1.000 41.16398  ? 135 GLY A CA  1 
ATOM   1069 C C   . GLY A 1 135 ? 19.27268  14.91369  31.61267  1.000 38.64351  ? 135 GLY A C   1 
ATOM   1070 O O   . GLY A 1 135 ? 18.60447  13.94900  31.99655  1.000 35.26230  ? 135 GLY A O   1 
ATOM   1071 N N   . ARG A 1 136 ? 19.12139  16.14135  32.11984  1.000 33.48726  ? 136 ARG A N   1 
ATOM   1072 C CA  . ARG A 1 136 ? 18.23010  16.34200  33.25309  1.000 33.35426  ? 136 ARG A CA  1 
ATOM   1073 C C   . ARG A 1 136 ? 16.79017  15.98451  32.90782  1.000 41.23886  ? 136 ARG A C   1 
ATOM   1074 O O   . ARG A 1 136 ? 16.04475  15.53739  33.79017  1.000 44.72026  ? 136 ARG A O   1 
ATOM   1075 C CB  . ARG A 1 136 ? 18.32742  17.78091  33.76799  1.000 28.64744  ? 136 ARG A CB  1 
ATOM   1076 C CG  . ARG A 1 136 ? 17.39126  18.78465  33.12702  1.000 31.78971  ? 136 ARG A CG  1 
ATOM   1077 C CD  . ARG A 1 136 ? 17.60017  20.16466  33.72145  1.000 38.95597  ? 136 ARG A CD  1 
ATOM   1078 N NE  . ARG A 1 136 ? 19.01690  20.51655  33.74608  1.000 47.11677  ? 136 ARG A NE  1 
ATOM   1079 C CZ  . ARG A 1 136 ? 19.56650  21.37731  34.60655  1.000 51.74167  ? 136 ARG A CZ  1 
ATOM   1080 N NH1 . ARG A 1 136 ? 20.87401  21.62867  34.55741  1.000 47.50134  ? 136 ARG A NH1 1 
ATOM   1081 N NH2 . ARG A 1 136 ? 18.81240  21.99572  35.51509  1.000 53.94999  ? 136 ARG A NH2 1 
ATOM   1082 N N   . PHE A 1 137 ? 16.38092  16.14237  31.63783  1.000 38.44437  ? 137 PHE A N   1 
ATOM   1083 C CA  . PHE A 1 137 ? 14.98073  15.89148  31.29200  1.000 35.35243  ? 137 PHE A CA  1 
ATOM   1084 C C   . PHE A 1 137 ? 14.71318  14.41150  31.07374  1.000 38.31435  ? 137 PHE A C   1 
ATOM   1085 O O   . PHE A 1 137 ? 13.69325  13.88693  31.54526  1.000 40.30779  ? 137 PHE A O   1 
ATOM   1086 C CB  . PHE A 1 137 ? 14.58149  16.67101  30.05424  1.000 32.12489  ? 137 PHE A CB  1 
ATOM   1087 C CG  . PHE A 1 137 ? 14.96927  18.10583  30.10342  1.000 42.46038  ? 137 PHE A CG  1 
ATOM   1088 C CD1 . PHE A 1 137 ? 14.21317  19.01484  30.83365  1.000 41.24301  ? 137 PHE A CD1 1 
ATOM   1089 C CD2 . PHE A 1 137 ? 16.09773  18.55616  29.41702  1.000 40.37394  ? 137 PHE A CD2 1 
ATOM   1090 C CE1 . PHE A 1 137 ? 14.56351  20.36250  30.87189  1.000 41.93703  ? 137 PHE A CE1 1 
ATOM   1091 C CE2 . PHE A 1 137 ? 16.46208  19.89586  29.45525  1.000 35.04423  ? 137 PHE A CE2 1 
ATOM   1092 C CZ  . PHE A 1 137 ? 15.69153  20.80362  30.18595  1.000 37.68877  ? 137 PHE A CZ  1 
ATOM   1093 N N   . LEU A 1 138 ? 15.61214  13.72633  30.36276  1.000 30.82648  ? 138 LEU A N   1 
ATOM   1094 C CA  . LEU A 1 138 ? 15.45392  12.28848  30.18702  1.000 41.51331  ? 138 LEU A CA  1 
ATOM   1095 C C   . LEU A 1 138 ? 15.45762  11.57452  31.53432  1.000 48.46988  ? 138 LEU A C   1 
ATOM   1096 O O   . LEU A 1 138 ? 14.72633  10.59488  31.73373  1.000 52.00782  ? 138 LEU A O   1 
ATOM   1097 C CB  . LEU A 1 138 ? 16.55054  11.75503  29.26152  1.000 43.88112  ? 138 LEU A CB  1 
ATOM   1098 C CG  . LEU A 1 138 ? 16.22453  11.96463  27.77946  1.000 39.25373  ? 138 LEU A CG  1 
ATOM   1099 C CD1 . LEU A 1 138 ? 17.39263  11.63029  26.86240  1.000 39.12818  ? 138 LEU A CD1 1 
ATOM   1100 C CD2 . LEU A 1 138 ? 15.03195  11.11572  27.43685  1.000 31.68682  ? 138 LEU A CD2 1 
ATOM   1101 N N   . ALA A 1 139 ? 16.24925  12.07554  32.48544  1.000 42.94031  ? 139 ALA A N   1 
ATOM   1102 C CA  . ALA A 1 139 ? 16.26998  11.47565  33.81125  1.000 39.77483  ? 139 ALA A CA  1 
ATOM   1103 C C   . ALA A 1 139 ? 14.97028  11.75721  34.55330  1.000 50.70843  ? 139 ALA A C   1 
ATOM   1104 O O   . ALA A 1 139 ? 14.30299  10.83025  35.02499  1.000 57.41347  ? 139 ALA A O   1 
ATOM   1105 C CB  . ALA A 1 139 ? 17.47867  11.98162  34.60135  1.000 35.16976  ? 139 ALA A CB  1 
ATOM   1106 N N   . GLN A 1 140 ? 14.57879  13.03103  34.64931  1.000 50.14889  ? 140 GLN A N   1 
ATOM   1107 C CA  . GLN A 1 140 ? 13.41020  13.38119  35.45782  1.000 45.86739  ? 140 GLN A CA  1 
ATOM   1108 C C   . GLN A 1 140 ? 12.12968  12.81982  34.85847  1.000 53.76648  ? 140 GLN A C   1 
ATOM   1109 O O   . GLN A 1 140 ? 11.29399  12.25289  35.57426  1.000 56.71076  ? 140 GLN A O   1 
ATOM   1110 C CB  . GLN A 1 140 ? 13.29440  14.89763  35.60262  1.000 42.69668  ? 140 GLN A CB  1 
ATOM   1111 C CG  . GLN A 1 140 ? 12.40248  15.34662  36.74607  1.000 50.18181  ? 140 GLN A CG  1 
ATOM   1112 C CD  . GLN A 1 140 ? 10.91638  15.22128  36.44345  1.000 56.77734  ? 140 GLN A CD  1 
ATOM   1113 O OE1 . GLN A 1 140 ? 10.47075  15.50970  35.33154  1.000 59.50632  ? 140 GLN A OE1 1 
ATOM   1114 N NE2 . GLN A 1 140 ? 10.14157  14.78464  37.43928  1.000 58.89748  ? 140 GLN A NE2 1 
ATOM   1115 N N   . VAL A 1 141 ? 11.95222  12.97964  33.54478  1.000 52.46520  ? 141 VAL A N   1 
ATOM   1116 C CA  . VAL A 1 141 ? 10.65837  12.68433  32.94656  1.000 46.18110  ? 141 VAL A CA  1 
ATOM   1117 C C   . VAL A 1 141 ? 10.51788  11.19779  32.64710  1.000 46.87909  ? 141 VAL A C   1 
ATOM   1118 O O   . VAL A 1 141 ? 9.46242   10.60415  32.89839  1.000 54.95222  ? 141 VAL A O   1 
ATOM   1119 C CB  . VAL A 1 141 ? 10.45203  13.54745  31.69168  1.000 44.19589  ? 141 VAL A CB  1 
ATOM   1120 C CG1 . VAL A 1 141 ? 9.06557   13.32386  31.12507  1.000 35.63932  ? 141 VAL A CG1 1 
ATOM   1121 C CG2 . VAL A 1 141 ? 10.65152  15.01636  32.03235  1.000 49.61724  ? 141 VAL A CG2 1 
ATOM   1122 N N   . GLU A 1 142 ? 11.56920  10.56516  32.12866  1.000 42.33911  ? 142 GLU A N   1 
ATOM   1123 C CA  . GLU A 1 142 ? 11.49152  9.15893   31.76265  1.000 47.57186  ? 142 GLU A CA  1 
ATOM   1124 C C   . GLU A 1 142 ? 12.10547  8.22019   32.79493  1.000 50.44143  ? 142 GLU A C   1 
ATOM   1125 O O   . GLU A 1 142 ? 11.99672  6.99690   32.63773  1.000 52.34853  ? 142 GLU A O   1 
ATOM   1126 C CB  . GLU A 1 142 ? 12.16331  8.93061   30.40577  1.000 48.28841  ? 142 GLU A CB  1 
ATOM   1127 C CG  . GLU A 1 142 ? 11.36310  9.44892   29.23178  1.000 50.09111  ? 142 GLU A CG  1 
ATOM   1128 C CD  . GLU A 1 142 ? 9.97811   8.83570   29.15332  1.000 59.41318  ? 142 GLU A CD  1 
ATOM   1129 O OE1 . GLU A 1 142 ? 9.81506   7.64031   29.49288  1.000 64.58489  ? 142 GLU A OE1 1 
ATOM   1130 O OE2 . GLU A 1 142 ? 9.04762   9.55167   28.73909  1.000 61.67415  ? 142 GLU A OE2 1 
ATOM   1131 N N   . GLY A 1 143 ? 12.74235  8.74857   33.83543  1.000 50.86537  ? 143 GLY A N   1 
ATOM   1132 C CA  . GLY A 1 143 ? 13.33977  7.90760   34.85069  1.000 47.99459  ? 143 GLY A CA  1 
ATOM   1133 C C   . GLY A 1 143 ? 14.66560  7.30603   34.46791  1.000 46.89798  ? 143 GLY A C   1 
ATOM   1134 O O   . GLY A 1 143 ? 15.15343  6.42236   35.17655  1.000 54.16388  ? 143 GLY A O   1 
ATOM   1135 N N   . ALA A 1 144 ? 15.27387  7.76977   33.38459  1.000 47.15314  ? 144 ALA A N   1 
ATOM   1136 C CA  . ALA A 1 144 ? 16.43012  7.09922   32.81907  1.000 42.84166  ? 144 ALA A CA  1 
ATOM   1137 C C   . ALA A 1 144 ? 17.72274  7.56516   33.48597  1.000 44.60833  ? 144 ALA A C   1 
ATOM   1138 O O   . ALA A 1 144 ? 17.80580  8.65121   34.06438  1.000 49.25080  ? 144 ALA A O   1 
ATOM   1139 C CB  . ALA A 1 144 ? 16.49451  7.34967   31.31760  1.000 32.41542  ? 144 ALA A CB  1 
ATOM   1140 N N   . VAL A 1 145 ? 18.73540  6.70992   33.41364  1.000 37.80548  ? 145 VAL A N   1 
ATOM   1141 C CA  . VAL A 1 145 ? 20.10316  7.07202   33.75998  1.000 36.91113  ? 145 VAL A CA  1 
ATOM   1142 C C   . VAL A 1 145 ? 20.81792  7.39557   32.45749  1.000 42.24386  ? 145 VAL A C   1 
ATOM   1143 O O   . VAL A 1 145 ? 20.92054  6.53940   31.56805  1.000 43.68507  ? 145 VAL A O   1 
ATOM   1144 C CB  . VAL A 1 145 ? 20.82073  5.93835   34.51232  1.000 37.31926  ? 145 VAL A CB  1 
ATOM   1145 C CG1 . VAL A 1 145 ? 22.28701  6.31929   34.78324  1.000 31.37808  ? 145 VAL A CG1 1 
ATOM   1146 C CG2 . VAL A 1 145 ? 20.05913  5.54622   35.79996  1.000 31.84056  ? 145 VAL A CG2 1 
ATOM   1147 N N   . LEU A 1 146 ? 21.30274  8.62450   32.33417  1.000 39.07330  ? 146 LEU A N   1 
ATOM   1148 C CA  . LEU A 1 146 ? 21.98260  9.06396   31.13141  1.000 39.70072  ? 146 LEU A CA  1 
ATOM   1149 C C   . LEU A 1 146 ? 23.45801  9.29377   31.43346  1.000 46.55449  ? 146 LEU A C   1 
ATOM   1150 O O   . LEU A 1 146 ? 23.80355  9.86870   32.47348  1.000 46.32273  ? 146 LEU A O   1 
ATOM   1151 C CB  . LEU A 1 146 ? 21.34425  10.33223  30.58516  1.000 33.68468  ? 146 LEU A CB  1 
ATOM   1152 C CG  . LEU A 1 146 ? 21.80329  10.58804  29.15276  1.000 34.07391  ? 146 LEU A CG  1 
ATOM   1153 C CD1 . LEU A 1 146 ? 20.58837  10.76192  28.25416  1.000 37.93088  ? 146 LEU A CD1 1 
ATOM   1154 C CD2 . LEU A 1 146 ? 22.69402  11.80645  29.10129  1.000 32.87736  ? 146 LEU A CD2 1 
ATOM   1155 N N   . VAL A 1 147 ? 24.32216  8.82508   30.52796  1.000 39.10955  ? 147 VAL A N   1 
ATOM   1156 C CA  . VAL A 1 147 ? 25.77090  8.92551   30.67248  1.000 33.58337  ? 147 VAL A CA  1 
ATOM   1157 C C   . VAL A 1 147 ? 26.33931  9.51190   29.39068  1.000 42.07422  ? 147 VAL A C   1 
ATOM   1158 O O   . VAL A 1 147 ? 26.19281  8.91534   28.31950  1.000 46.10932  ? 147 VAL A O   1 
ATOM   1159 C CB  . VAL A 1 147 ? 26.42083  7.55843   30.95098  1.000 39.02128  ? 147 VAL A CB  1 
ATOM   1160 C CG1 . VAL A 1 147 ? 27.93413  7.69863   31.08128  1.000 33.13803  ? 147 VAL A CG1 1 
ATOM   1161 C CG2 . VAL A 1 147 ? 25.84287  6.92353   32.20055  1.000 51.05800  ? 147 VAL A CG2 1 
ATOM   1162 N N   . SER A 1 148 ? 27.01403  10.65356  29.49565  1.000 44.56046  ? 148 SER A N   1 
ATOM   1163 C CA  . SER A 1 148 ? 27.74426  11.20744  28.36320  1.000 39.71887  ? 148 SER A CA  1 
ATOM   1164 C C   . SER A 1 148 ? 29.18575  11.48205  28.76405  1.000 36.35797  ? 148 SER A C   1 
ATOM   1165 O O   . SER A 1 148 ? 29.45425  12.01570  29.84210  1.000 50.96085  ? 148 SER A O   1 
ATOM   1166 C CB  . SER A 1 148 ? 27.08993  12.49423  27.81734  1.000 49.83566  ? 148 SER A CB  1 
ATOM   1167 O OG  . SER A 1 148 ? 27.25673  13.60021  28.68343  1.000 53.67806  ? 148 SER A OG  1 
ATOM   1168 N N   . MET A 1 149 ? 30.09913  11.10615  27.87775  1.000 37.10922  ? 149 MET A N   1 
ATOM   1169 C CA  . MET A 1 149 ? 31.55016  11.14761  28.01432  1.000 30.27393  ? 149 MET A CA  1 
ATOM   1170 C C   . MET A 1 149 ? 32.16126  12.19313  27.07979  1.000 35.96880  ? 149 MET A C   1 
ATOM   1171 O O   . MET A 1 149 ? 31.61556  12.52255  26.01875  1.000 42.81186  ? 149 MET A O   1 
ATOM   1172 C CB  . MET A 1 149 ? 32.14303  9.79488   27.61397  1.000 39.78131  ? 149 MET A CB  1 
ATOM   1173 C CG  . MET A 1 149 ? 32.19046  9.74496   26.07471  1.000 40.53843  ? 149 MET A CG  1 
ATOM   1174 S SD  . MET A 1 149 ? 31.99312  8.12376   25.36728  1.000 64.91127  ? 149 MET A SD  1 
ATOM   1175 C CE  . MET A 1 149 ? 30.36676  7.71468   25.91063  1.000 56.78622  ? 149 MET A CE  1 
ATOM   1176 N N   . ASN A 1 150 ? 33.33001  12.68050  27.46947  1.000 31.98848  ? 150 ASN A N   1 
ATOM   1177 C CA  . ASN A 1 150 ? 34.24573  13.36307  26.56958  1.000 25.65584  ? 150 ASN A CA  1 
ATOM   1178 C C   . ASN A 1 150 ? 35.17745  12.33042  25.94409  1.000 37.27424  ? 150 ASN A C   1 
ATOM   1179 O O   . ASN A 1 150 ? 35.55071  11.34301  26.58853  1.000 34.61389  ? 150 ASN A O   1 
ATOM   1180 C CB  . ASN A 1 150 ? 35.04600  14.42448  27.32880  1.000 22.13824  ? 150 ASN A CB  1 
ATOM   1181 C CG  . ASN A 1 150 ? 34.27705  15.71494  27.51869  1.000 24.12207  ? 150 ASN A CG  1 
ATOM   1182 O OD1 . ASN A 1 150 ? 33.16328  15.85683  27.03093  1.000 21.38931  ? 150 ASN A OD1 1 
ATOM   1183 N ND2 . ASN A 1 150 ? 34.83079  16.62759  28.30742  1.000 22.70701  ? 150 ASN A ND2 1 
ATOM   1184 N N   . TYR A 1 151 ? 35.51717  12.53774  24.67113  1.000 36.16384  ? 151 TYR A N   1 
ATOM   1185 C CA  . TYR A 1 151 ? 36.47684  11.68288  23.99429  1.000 29.94118  ? 151 TYR A CA  1 
ATOM   1186 C C   . TYR A 1 151 ? 37.32485  12.56562  23.09792  1.000 36.75736  ? 151 TYR A C   1 
ATOM   1187 O O   . TYR A 1 151 ? 36.86386  13.60627  22.61081  1.000 39.54102  ? 151 TYR A O   1 
ATOM   1188 C CB  . TYR A 1 151 ? 35.79476  10.55747  23.19714  1.000 31.85459  ? 151 TYR A CB  1 
ATOM   1189 C CG  . TYR A 1 151 ? 34.92934  11.03395  22.04264  1.000 41.16756  ? 151 TYR A CG  1 
ATOM   1190 C CD1 . TYR A 1 151 ? 33.59733  11.36082  22.23703  1.000 34.26694  ? 151 TYR A CD1 1 
ATOM   1191 C CD2 . TYR A 1 151 ? 35.45141  11.14448  20.74549  1.000 39.58693  ? 151 TYR A CD2 1 
ATOM   1192 C CE1 . TYR A 1 151 ? 32.80960  11.78269  21.19085  1.000 39.78845  ? 151 TYR A CE1 1 
ATOM   1193 C CE2 . TYR A 1 151 ? 34.67272  11.57433  19.69683  1.000 28.44494  ? 151 TYR A CE2 1 
ATOM   1194 C CZ  . TYR A 1 151 ? 33.35316  11.89446  19.91818  1.000 35.26347  ? 151 TYR A CZ  1 
ATOM   1195 O OH  . TYR A 1 151 ? 32.56419  12.32159  18.86766  1.000 28.85475  ? 151 TYR A OH  1 
ATOM   1196 N N   . ARG A 1 152 ? 38.58196  12.16994  22.91610  1.000 33.00141  ? 152 ARG A N   1 
ATOM   1197 C CA  . ARG A 1 152 ? 39.51405  13.05168  22.23430  1.000 34.57951  ? 152 ARG A CA  1 
ATOM   1198 C C   . ARG A 1 152 ? 39.12611  13.19844  20.77037  1.000 37.27369  ? 152 ARG A C   1 
ATOM   1199 O O   . ARG A 1 152 ? 38.77929  12.21724  20.10027  1.000 37.68802  ? 152 ARG A O   1 
ATOM   1200 C CB  . ARG A 1 152 ? 40.93811  12.52453  22.36244  1.000 37.18391  ? 152 ARG A CB  1 
ATOM   1201 C CG  . ARG A 1 152 ? 41.71612  13.17206  23.49908  1.000 42.10194  ? 152 ARG A CG  1 
ATOM   1202 C CD  . ARG A 1 152 ? 42.96122  12.38199  23.85097  1.000 34.04676  ? 152 ARG A CD  1 
ATOM   1203 N NE  . ARG A 1 152 ? 42.67022  10.96884  24.06124  1.000 29.83131  ? 152 ARG A NE  1 
ATOM   1204 C CZ  . ARG A 1 152 ? 43.58556  10.00470  23.97422  1.000 38.97817  ? 152 ARG A CZ  1 
ATOM   1205 N NH1 . ARG A 1 152 ? 44.85011  10.30643  23.64175  1.000 36.45504  ? 152 ARG A NH1 1 
ATOM   1206 N NH2 . ARG A 1 152 ? 43.22875  8.73419   24.18976  1.000 28.13737  ? 152 ARG A NH2 1 
ATOM   1207 N N   . VAL A 1 153 ? 39.17798  14.42853  20.27250  1.000 32.63253  ? 153 VAL A N   1 
ATOM   1208 C CA  . VAL A 1 153 ? 38.86901  14.65342  18.86999  1.000 31.27858  ? 153 VAL A CA  1 
ATOM   1209 C C   . VAL A 1 153 ? 40.11173  15.16057  18.16446  1.000 39.14360  ? 153 VAL A C   1 
ATOM   1210 O O   . VAL A 1 153 ? 41.16514  15.33586  18.78905  1.000 49.27880  ? 153 VAL A O   1 
ATOM   1211 C CB  . VAL A 1 153 ? 37.70325  15.63454  18.69913  1.000 26.47303  ? 153 VAL A CB  1 
ATOM   1212 C CG1 . VAL A 1 153 ? 36.45329  15.02265  19.24043  1.000 22.49122  ? 153 VAL A CG1 1 
ATOM   1213 C CG2 . VAL A 1 153 ? 38.02045  16.95041  19.38633  1.000 22.06392  ? 153 VAL A CG2 1 
ATOM   1214 N N   . GLY A 1 154 ? 39.99492  15.39322  16.85983  1.000 36.77602  ? 154 GLY A N   1 
ATOM   1215 C CA  . GLY A 1 154 ? 41.07987  16.02161  16.13854  1.000 39.30587  ? 154 GLY A CA  1 
ATOM   1216 C C   . GLY A 1 154 ? 42.32444  15.15088  16.04456  1.000 40.87629  ? 154 GLY A C   1 
ATOM   1217 O O   . GLY A 1 154 ? 42.27805  13.91163  16.09054  1.000 45.55666  ? 154 GLY A O   1 
ATOM   1218 N N   . THR A 1 155 ? 43.46096  15.83319  15.88719  1.000 36.05431  ? 155 THR A N   1 
ATOM   1219 C CA  . THR A 1 155 ? 44.73724  15.13281  15.89668  1.000 40.32470  ? 155 THR A CA  1 
ATOM   1220 C C   . THR A 1 155 ? 44.87485  14.27341  17.14572  1.000 49.18806  ? 155 THR A C   1 
ATOM   1221 O O   . THR A 1 155 ? 45.28486  13.10829  17.06243  1.000 58.42761  ? 155 THR A O   1 
ATOM   1222 C CB  . THR A 1 155 ? 45.89385  16.13248  15.80970  1.000 41.97206  ? 155 THR A CB  1 
ATOM   1223 O OG1 . THR A 1 155 ? 45.68558  17.20580  16.74308  1.000 36.14587  ? 155 THR A OG1 1 
ATOM   1224 C CG2 . THR A 1 155 ? 46.00516  16.69312  14.41387  1.000 29.32492  ? 155 THR A CG2 1 
ATOM   1225 N N   . PHE A 1 156 ? 44.49780  14.82180  18.31224  1.000 43.69559  ? 156 PHE A N   1 
ATOM   1226 C CA  . PHE A 1 156 ? 44.71346  14.11951  19.57931  1.000 40.12278  ? 156 PHE A CA  1 
ATOM   1227 C C   . PHE A 1 156 ? 43.90600  12.83128  19.65732  1.000 43.48317  ? 156 PHE A C   1 
ATOM   1228 O O   . PHE A 1 156 ? 44.32971  11.87031  20.31422  1.000 47.92080  ? 156 PHE A O   1 
ATOM   1229 C CB  . PHE A 1 156 ? 44.36778  15.03543  20.75733  1.000 30.93793  ? 156 PHE A CB  1 
ATOM   1230 C CG  . PHE A 1 156 ? 44.79123  16.46570  20.55713  1.000 34.11228  ? 156 PHE A CG  1 
ATOM   1231 C CD1 . PHE A 1 156 ? 46.04102  16.89630  20.97698  1.000 28.81930  ? 156 PHE A CD1 1 
ATOM   1232 C CD2 . PHE A 1 156 ? 43.94023  17.38343  19.94049  1.000 34.96549  ? 156 PHE A CD2 1 
ATOM   1233 C CE1 . PHE A 1 156 ? 46.44262  18.20660  20.78152  1.000 29.51683  ? 156 PHE A CE1 1 
ATOM   1234 C CE2 . PHE A 1 156 ? 44.33639  18.71025  19.75246  1.000 27.34988  ? 156 PHE A CE2 1 
ATOM   1235 C CZ  . PHE A 1 156 ? 45.59064  19.11572  20.17000  1.000 28.79127  ? 156 PHE A CZ  1 
ATOM   1236 N N   . GLY A 1 157 ? 42.74672  12.79727  19.00118  1.000 40.66435  ? 157 GLY A N   1 
ATOM   1237 C CA  . GLY A 1 157 ? 41.90552  11.62008  18.96253  1.000 37.98085  ? 157 GLY A CA  1 
ATOM   1238 C C   . GLY A 1 157 ? 42.25333  10.63356  17.86627  1.000 37.58763  ? 157 GLY A C   1 
ATOM   1239 O O   . GLY A 1 157 ? 42.15060  9.42149   18.07713  1.000 40.49430  ? 157 GLY A O   1 
ATOM   1240 N N   . PHE A 1 158 ? 42.67074  11.11666  16.68547  1.000 34.68573  ? 158 PHE A N   1 
ATOM   1241 C CA  . PHE A 1 158 ? 42.68236  10.22569  15.53401  1.000 37.60955  ? 158 PHE A CA  1 
ATOM   1242 C C   . PHE A 1 158 ? 43.90105  10.32054  14.62403  1.000 39.20082  ? 158 PHE A C   1 
ATOM   1243 O O   . PHE A 1 158 ? 44.01060  9.50742   13.69513  1.000 33.90209  ? 158 PHE A O   1 
ATOM   1244 C CB  . PHE A 1 158 ? 41.38745  10.43454  14.73988  1.000 28.25541  ? 158 PHE A CB  1 
ATOM   1245 C CG  . PHE A 1 158 ? 40.15970  10.17427  15.55860  1.000 27.05629  ? 158 PHE A CG  1 
ATOM   1246 C CD1 . PHE A 1 158 ? 39.65716  8.88719   15.68494  1.000 31.51659  ? 158 PHE A CD1 1 
ATOM   1247 C CD2 . PHE A 1 158 ? 39.54768  11.20237  16.26528  1.000 24.97953  ? 158 PHE A CD2 1 
ATOM   1248 C CE1 . PHE A 1 158 ? 38.53574  8.63334   16.47044  1.000 31.05198  ? 158 PHE A CE1 1 
ATOM   1249 C CE2 . PHE A 1 158 ? 38.42706  10.95989  17.05402  1.000 23.01025  ? 158 PHE A CE2 1 
ATOM   1250 C CZ  . PHE A 1 158 ? 37.92356  9.68232   17.15972  1.000 23.19039  ? 158 PHE A CZ  1 
ATOM   1251 N N   . LEU A 1 159 ? 44.83466  11.23323  14.87748  1.000 34.06789  ? 159 LEU A N   1 
ATOM   1252 C CA  . LEU A 1 159 ? 46.08437  11.22921  14.12817  1.000 31.10653  ? 159 LEU A CA  1 
ATOM   1253 C C   . LEU A 1 159 ? 46.75946  9.88377   14.27942  1.000 31.14203  ? 159 LEU A C   1 
ATOM   1254 O O   . LEU A 1 159 ? 47.08108  9.46842   15.38904  1.000 49.89879  ? 159 LEU A O   1 
ATOM   1255 C CB  . LEU A 1 159 ? 47.01292  12.33368  14.62539  1.000 35.73783  ? 159 LEU A CB  1 
ATOM   1256 C CG  . LEU A 1 159 ? 48.36044  12.44008  13.91599  1.000 39.68542  ? 159 LEU A CG  1 
ATOM   1257 C CD1 . LEU A 1 159 ? 48.70674  13.89307  13.64869  1.000 45.23037  ? 159 LEU A CD1 1 
ATOM   1258 C CD2 . LEU A 1 159 ? 49.46287  11.78012  14.71554  1.000 33.37824  ? 159 LEU A CD2 1 
ATOM   1259 N N   . ALA A 1 160 ? 46.98855  9.20746   13.17409  1.000 35.62741  ? 160 ALA A N   1 
ATOM   1260 C CA  . ALA A 1 160 ? 47.55424  7.87182   13.20761  1.000 37.28704  ? 160 ALA A CA  1 
ATOM   1261 C C   . ALA A 1 160 ? 48.72489  7.76405   12.24554  1.000 43.35350  ? 160 ALA A C   1 
ATOM   1262 O O   . ALA A 1 160 ? 48.66773  8.26501   11.11817  1.000 45.80396  ? 160 ALA A O   1 
ATOM   1263 C CB  . ALA A 1 160 ? 46.50131  6.81481   12.84467  1.000 38.21067  ? 160 ALA A CB  1 
ATOM   1264 N N   . LEU A 1 161 ? 49.79984  7.12999   12.70924  1.000 42.86538  ? 161 LEU A N   1 
ATOM   1265 C CA  . LEU A 1 161 ? 50.77240  6.50991   11.81677  1.000 50.07197  ? 161 LEU A CA  1 
ATOM   1266 C C   . LEU A 1 161 ? 50.58043  5.01194   11.96349  1.000 50.18135  ? 161 LEU A C   1 
ATOM   1267 O O   . LEU A 1 161 ? 51.17244  4.39489   12.86324  1.000 45.01630  ? 161 LEU A O   1 
ATOM   1268 C CB  . LEU A 1 161 ? 52.21156  6.92737   12.12980  1.000 47.66658  ? 161 LEU A CB  1 
ATOM   1269 C CG  . LEU A 1 161 ? 52.31074  8.43755   11.89662  1.000 50.91124  ? 161 LEU A CG  1 
ATOM   1270 C CD1 . LEU A 1 161 ? 53.30051  9.11531   12.80833  1.000 51.07132  ? 161 LEU A CD1 1 
ATOM   1271 C CD2 . LEU A 1 161 ? 52.57933  8.77309   10.42561  1.000 58.94562  ? 161 LEU A CD2 1 
ATOM   1272 N N   . PRO A 1 162 ? 49.73022  4.39125   11.13065  1.000 48.45918  ? 162 PRO A N   1 
ATOM   1273 C CA  . PRO A 1 162 ? 49.30531  3.01208   11.40002  1.000 44.20872  ? 162 PRO A CA  1 
ATOM   1274 C C   . PRO A 1 162 ? 50.47101  2.04604   11.44965  1.000 48.85270  ? 162 PRO A C   1 
ATOM   1275 O O   . PRO A 1 162 ? 51.48236  2.21880   10.77114  1.000 54.85488  ? 162 PRO A O   1 
ATOM   1276 C CB  . PRO A 1 162 ? 48.36413  2.69509   10.23910  1.000 37.73926  ? 162 PRO A CB  1 
ATOM   1277 C CG  . PRO A 1 162 ? 47.78185  4.01340   9.89024   1.000 37.46146  ? 162 PRO A CG  1 
ATOM   1278 C CD  . PRO A 1 162 ? 48.90093  5.02394   10.08920  1.000 36.13519  ? 162 PRO A CD  1 
ATOM   1279 N N   . GLY A 1 163 ? 50.32888  1.03514   12.30237  1.000 52.17449  ? 163 GLY A N   1 
ATOM   1280 C CA  . GLY A 1 163 ? 51.37462  0.07730   12.54936  1.000 52.60547  ? 163 GLY A CA  1 
ATOM   1281 C C   . GLY A 1 163 ? 52.33423  0.45212   13.65858  1.000 54.29324  ? 163 GLY A C   1 
ATOM   1282 O O   . GLY A 1 163 ? 53.05838  -0.42300  14.15381  1.000 61.58772  ? 163 GLY A O   1 
ATOM   1283 N N   . SER A 1 164 ? 52.36521  1.71741   14.06425  1.000 50.06838  ? 164 SER A N   1 
ATOM   1284 C CA  . SER A 1 164 ? 53.28279  2.17556   15.09855  1.000 60.12976  ? 164 SER A CA  1 
ATOM   1285 C C   . SER A 1 164 ? 52.69686  1.97648   16.50001  1.000 61.54163  ? 164 SER A C   1 
ATOM   1286 O O   . SER A 1 164 ? 51.48702  1.78043   16.68013  1.000 52.07098  ? 164 SER A O   1 
ATOM   1287 C CB  . SER A 1 164 ? 53.62124  3.64808   14.88935  1.000 58.26848  ? 164 SER A CB  1 
ATOM   1288 O OG  . SER A 1 164 ? 52.59944  4.46830   15.43262  1.000 51.78039  ? 164 SER A OG  1 
ATOM   1289 N N   . ARG A 1 165 ? 53.57906  2.04176   17.50411  1.000 64.91567  ? 165 ARG A N   1 
ATOM   1290 C CA  . ARG A 1 165 ? 53.12213  1.94851   18.88505  1.000 68.21300  ? 165 ARG A CA  1 
ATOM   1291 C C   . ARG A 1 165 ? 52.79558  3.30963   19.49566  1.000 62.57603  ? 165 ARG A C   1 
ATOM   1292 O O   . ARG A 1 165 ? 51.86669  3.39568   20.30645  1.000 64.31756  ? 165 ARG A O   1 
ATOM   1293 C CB  . ARG A 1 165 ? 54.15368  1.21627   19.75228  1.000 80.68088  ? 165 ARG A CB  1 
ATOM   1294 C CG  . ARG A 1 165 ? 53.53131  0.39194   20.90776  1.000 95.55447  ? 165 ARG A CG  1 
ATOM   1295 C CD  . ARG A 1 165 ? 52.67272  -0.82213  20.44497  1.000 104.71318 ? 165 ARG A CD  1 
ATOM   1296 N NE  . ARG A 1 165 ? 53.47031  -2.00109  20.08075  1.000 116.46871 ? 165 ARG A NE  1 
ATOM   1297 C CZ  . ARG A 1 165 ? 53.59946  -2.47711  18.83971  1.000 115.07536 ? 165 ARG A CZ  1 
ATOM   1298 N NH1 . ARG A 1 165 ? 52.96953  -1.88877  17.82476  1.000 104.08071 ? 165 ARG A NH1 1 
ATOM   1299 N NH2 . ARG A 1 165 ? 54.35639  -3.54828  18.61231  1.000 115.89094 ? 165 ARG A NH2 1 
ATOM   1300 N N   . GLU A 1 166 ? 53.48837  4.38274   19.09260  1.000 51.19014  ? 166 GLU A N   1 
ATOM   1301 C CA  . GLU A 1 166 ? 53.31731  5.69542   19.71237  1.000 46.82901  ? 166 GLU A CA  1 
ATOM   1302 C C   . GLU A 1 166 ? 52.14210  6.49338   19.15354  1.000 51.89008  ? 166 GLU A C   1 
ATOM   1303 O O   . GLU A 1 166 ? 51.86174  7.58583   19.66555  1.000 57.37631  ? 166 GLU A O   1 
ATOM   1304 C CB  . GLU A 1 166 ? 54.60131  6.51780   19.57110  1.000 49.31374  ? 166 GLU A CB  1 
ATOM   1305 C CG  . GLU A 1 166 ? 55.86302  5.75620   19.92735  1.000 65.89906  ? 166 GLU A CG  1 
ATOM   1306 C CD  . GLU A 1 166 ? 56.44033  4.98283   18.73988  1.000 78.80691  ? 166 GLU A CD  1 
ATOM   1307 O OE1 . GLU A 1 166 ? 55.68198  4.28259   18.02638  1.000 77.51322  ? 166 GLU A OE1 1 
ATOM   1308 O OE2 . GLU A 1 166 ? 57.66493  5.05978   18.53067  1.000 84.11696  ? 166 GLU A OE2 1 
ATOM   1309 N N   . ALA A 1 167 ? 51.45200  5.98699   18.13151  1.000 46.99378  ? 167 ALA A N   1 
ATOM   1310 C CA  . ALA A 1 167 ? 50.32668  6.67997   17.51546  1.000 46.36047  ? 167 ALA A CA  1 
ATOM   1311 C C   . ALA A 1 167 ? 49.51292  5.70364   16.68120  1.000 49.86097  ? 167 ALA A C   1 
ATOM   1312 O O   . ALA A 1 167 ? 49.47020  5.82397   15.45249  1.000 55.21255  ? 167 ALA A O   1 
ATOM   1313 C CB  . ALA A 1 167 ? 50.80776  7.83490   16.63982  1.000 46.83993  ? 167 ALA A CB  1 
ATOM   1314 N N   . PRO A 1 168 ? 48.85617  4.72404   17.30164  1.000 49.27186  ? 168 PRO A N   1 
ATOM   1315 C CA  . PRO A 1 168 ? 48.23637  3.65041   16.52689  1.000 49.23591  ? 168 PRO A CA  1 
ATOM   1316 C C   . PRO A 1 168 ? 46.89087  4.03176   15.94530  1.000 44.05235  ? 168 PRO A C   1 
ATOM   1317 O O   . PRO A 1 168 ? 46.26543  3.19946   15.27489  1.000 40.25710  ? 168 PRO A O   1 
ATOM   1318 C CB  . PRO A 1 168 ? 48.09122  2.54422   17.57154  1.000 49.53898  ? 168 PRO A CB  1 
ATOM   1319 C CG  . PRO A 1 168 ? 47.73615  3.31742   18.80894  1.000 47.91003  ? 168 PRO A CG  1 
ATOM   1320 C CD  . PRO A 1 168 ? 48.52127  4.61543   18.73265  1.000 47.57836  ? 168 PRO A CD  1 
ATOM   1321 N N   . GLY A 1 169 ? 46.43319  5.25151   16.21488  1.000 40.17195  ? 169 GLY A N   1 
ATOM   1322 C CA  . GLY A 1 169 ? 45.16042  5.72296   15.71648  1.000 43.17937  ? 169 GLY A CA  1 
ATOM   1323 C C   . GLY A 1 169 ? 43.95814  5.15221   16.44419  1.000 37.43929  ? 169 GLY A C   1 
ATOM   1324 O O   . GLY A 1 169 ? 44.04272  4.21943   17.25023  1.000 44.24574  ? 169 GLY A O   1 
ATOM   1325 N N   . ASN A 1 170 ? 42.80728  5.74648   16.14062  1.000 34.81272  ? 170 ASN A N   1 
ATOM   1326 C CA  . ASN A 1 170 ? 41.50999  5.40841   16.71769  1.000 42.57490  ? 170 ASN A CA  1 
ATOM   1327 C C   . ASN A 1 170 ? 41.43596  5.59784   18.24630  1.000 44.28281  ? 170 ASN A C   1 
ATOM   1328 O O   . ASN A 1 170 ? 40.48135  5.10950   18.87225  1.000 42.08965  ? 170 ASN A O   1 
ATOM   1329 C CB  . ASN A 1 170 ? 41.11263  3.97130   16.35195  1.000 41.16157  ? 170 ASN A CB  1 
ATOM   1330 C CG  . ASN A 1 170 ? 40.82736  3.79821   14.87325  1.000 42.04076  ? 170 ASN A CG  1 
ATOM   1331 O OD1 . ASN A 1 170 ? 40.33736  4.70912   14.21398  1.000 45.23351  ? 170 ASN A OD1 1 
ATOM   1332 N ND2 . ASN A 1 170 ? 41.13550  2.61856   14.34424  1.000 37.07146  ? 170 ASN A ND2 1 
ATOM   1333 N N   . VAL A 1 171 ? 42.39234  6.30215   18.87482  1.000 36.84401  ? 171 VAL A N   1 
ATOM   1334 C CA  . VAL A 1 171 ? 42.38675  6.36202   20.34165  1.000 33.16621  ? 171 VAL A CA  1 
ATOM   1335 C C   . VAL A 1 171 ? 41.19187  7.15306   20.85588  1.000 34.18672  ? 171 VAL A C   1 
ATOM   1336 O O   . VAL A 1 171 ? 40.74286  6.94210   21.98648  1.000 41.17879  ? 171 VAL A O   1 
ATOM   1337 C CB  . VAL A 1 171 ? 43.70074  6.93523   20.91483  1.000 34.31068  ? 171 VAL A CB  1 
ATOM   1338 C CG1 . VAL A 1 171 ? 44.92378  6.28125   20.27115  1.000 30.12371  ? 171 VAL A CG1 1 
ATOM   1339 C CG2 . VAL A 1 171 ? 43.73848  8.46741   20.81496  1.000 27.46162  ? 171 VAL A CG2 1 
ATOM   1340 N N   . GLY A 1 172 ? 40.64803  8.06228   20.05410  1.000 34.36885  ? 172 GLY A N   1 
ATOM   1341 C CA  . GLY A 1 172 ? 39.39020  8.68382   20.43131  1.000 31.90154  ? 172 GLY A CA  1 
ATOM   1342 C C   . GLY A 1 172 ? 38.28436  7.66277   20.61400  1.000 30.76457  ? 172 GLY A C   1 
ATOM   1343 O O   . GLY A 1 172 ? 37.47995  7.76393   21.53962  1.000 34.48377  ? 172 GLY A O   1 
ATOM   1344 N N   . LEU A 1 173 ? 38.23362  6.66023   19.73200  1.000 31.64620  ? 173 LEU A N   1 
ATOM   1345 C CA  . LEU A 1 173 ? 37.25878  5.58628   19.88272  1.000 35.95574  ? 173 LEU A CA  1 
ATOM   1346 C C   . LEU A 1 173 ? 37.55672  4.74798   21.11511  1.000 44.57367  ? 173 LEU A C   1 
ATOM   1347 O O   . LEU A 1 173 ? 36.63226  4.25150   21.76966  1.000 48.31075  ? 173 LEU A O   1 
ATOM   1348 C CB  . LEU A 1 173 ? 37.24351  4.71519   18.62559  1.000 31.87640  ? 173 LEU A CB  1 
ATOM   1349 C CG  . LEU A 1 173 ? 36.60711  5.39412   17.40648  1.000 35.18380  ? 173 LEU A CG  1 
ATOM   1350 C CD1 . LEU A 1 173 ? 36.86583  4.61466   16.13033  1.000 41.60630  ? 173 LEU A CD1 1 
ATOM   1351 C CD2 . LEU A 1 173 ? 35.10798  5.57765   17.61161  1.000 31.67594  ? 173 LEU A CD2 1 
ATOM   1352 N N   . LEU A 1 174 ? 38.83895  4.60281   21.45004  1.000 47.73594  ? 174 LEU A N   1 
ATOM   1353 C CA  . LEU A 1 174 ? 39.24234  3.86476   22.63835  1.000 41.82056  ? 174 LEU A CA  1 
ATOM   1354 C C   . LEU A 1 174 ? 38.87055  4.60827   23.92595  1.000 50.28192  ? 174 LEU A C   1 
ATOM   1355 O O   . LEU A 1 174 ? 38.59449  3.97008   24.95271  1.000 53.17681  ? 174 LEU A O   1 
ATOM   1356 C CB  . LEU A 1 174 ? 40.74783  3.59777   22.57277  1.000 32.78061  ? 174 LEU A CB  1 
ATOM   1357 C CG  . LEU A 1 174 ? 41.28953  2.50210   21.64777  1.000 29.16393  ? 174 LEU A CG  1 
ATOM   1358 C CD1 . LEU A 1 174 ? 42.77890  2.31760   21.85969  1.000 31.28727  ? 174 LEU A CD1 1 
ATOM   1359 C CD2 . LEU A 1 174 ? 40.57970  1.18724   21.85179  1.000 29.90676  ? 174 LEU A CD2 1 
ATOM   1360 N N   . ASP A 1 175 ? 38.88260  5.94752   23.90127  1.000 43.84212  ? 175 ASP A N   1 
ATOM   1361 C CA  . ASP A 1 175 ? 38.31295  6.71847   25.00554  1.000 38.01916  ? 175 ASP A CA  1 
ATOM   1362 C C   . ASP A 1 175 ? 36.86547  6.30609   25.25947  1.000 39.52209  ? 175 ASP A C   1 
ATOM   1363 O O   . ASP A 1 175 ? 36.48115  5.99127   26.39025  1.000 46.77896  ? 175 ASP A O   1 
ATOM   1364 C CB  . ASP A 1 175 ? 38.38976  8.22369   24.70429  1.000 40.83164  ? 175 ASP A CB  1 
ATOM   1365 C CG  . ASP A 1 175 ? 39.83216  8.74769   24.57605  1.000 47.37009  ? 175 ASP A CG  1 
ATOM   1366 O OD1 . ASP A 1 175 ? 40.04618  9.79933   23.91678  1.000 46.98976  ? 175 ASP A OD1 1 
ATOM   1367 O OD2 . ASP A 1 175 ? 40.75320  8.12391   25.14541  1.000 46.25080  ? 175 ASP A OD2 1 
ATOM   1368 N N   . GLN A 1 176 ? 36.05033  6.29284   24.20288  1.000 46.56712  ? 176 GLN A N   1 
ATOM   1369 C CA  . GLN A 1 176 ? 34.64005  5.94515   24.32921  1.000 37.56024  ? 176 GLN A CA  1 
ATOM   1370 C C   . GLN A 1 176 ? 34.45900  4.53733   24.88137  1.000 44.50802  ? 176 GLN A C   1 
ATOM   1371 O O   . GLN A 1 176 ? 33.60982  4.30351   25.75377  1.000 43.97256  ? 176 GLN A O   1 
ATOM   1372 C CB  . GLN A 1 176 ? 33.96558  6.06828   22.97035  1.000 37.88356  ? 176 GLN A CB  1 
ATOM   1373 C CG  . GLN A 1 176 ? 34.14585  7.40684   22.28606  1.000 43.88241  ? 176 GLN A CG  1 
ATOM   1374 C CD  . GLN A 1 176 ? 33.44535  7.42949   20.93819  1.000 49.65072  ? 176 GLN A CD  1 
ATOM   1375 O OE1 . GLN A 1 176 ? 32.74244  6.47403   20.57527  1.000 45.40302  ? 176 GLN A OE1 1 
ATOM   1376 N NE2 . GLN A 1 176 ? 33.63516  8.51214   20.18709  1.000 45.71345  ? 176 GLN A NE2 1 
ATOM   1377 N N   . ARG A 1 177 ? 35.22888  3.57675   24.35676  1.000 42.49228  ? 177 ARG A N   1 
ATOM   1378 C CA  . ARG A 1 177 ? 35.18467  2.21721   24.88868  1.000 43.83452  ? 177 ARG A CA  1 
ATOM   1379 C C   . ARG A 1 177 ? 35.49214  2.19684   26.38546  1.000 49.66128  ? 177 ARG A C   1 
ATOM   1380 O O   . ARG A 1 177 ? 34.81490  1.50303   27.15428  1.000 55.69055  ? 177 ARG A O   1 
ATOM   1381 C CB  . ARG A 1 177 ? 36.16151  1.32216   24.11595  1.000 36.60607  ? 177 ARG A CB  1 
ATOM   1382 C CG  . ARG A 1 177 ? 36.24801  -0.12145  24.59237  1.000 33.22016  ? 177 ARG A CG  1 
ATOM   1383 C CD  . ARG A 1 177 ? 36.24852  -1.08759  23.43993  1.000 40.05318  ? 177 ARG A CD  1 
ATOM   1384 N NE  . ARG A 1 177 ? 37.58713  -1.42293  22.96849  1.000 54.90312  ? 177 ARG A NE  1 
ATOM   1385 C CZ  . ARG A 1 177 ? 37.85524  -1.81058  21.71787  1.000 59.26735  ? 177 ARG A CZ  1 
ATOM   1386 N NH1 . ARG A 1 177 ? 36.88034  -1.88666  20.81344  1.000 38.62364  ? 177 ARG A NH1 1 
ATOM   1387 N NH2 . ARG A 1 177 ? 39.10070  -2.10851  21.36278  1.000 66.98752  ? 177 ARG A NH2 1 
ATOM   1388 N N   . LEU A 1 178 ? 36.50659  2.95901   26.81792  1.000 42.58562  ? 178 LEU A N   1 
ATOM   1389 C CA  . LEU A 1 178 ? 36.87261  2.97906   28.23218  1.000 40.81591  ? 178 LEU A CA  1 
ATOM   1390 C C   . LEU A 1 178 ? 35.74158  3.52559   29.08887  1.000 46.64806  ? 178 LEU A C   1 
ATOM   1391 O O   . LEU A 1 178 ? 35.46870  3.00053   30.17610  1.000 53.96300  ? 178 LEU A O   1 
ATOM   1392 C CB  . LEU A 1 178 ? 38.12898  3.81064   28.44787  1.000 34.16695  ? 178 LEU A CB  1 
ATOM   1393 C CG  . LEU A 1 178 ? 38.61422  3.86950   29.88844  1.000 33.48982  ? 178 LEU A CG  1 
ATOM   1394 C CD1 . LEU A 1 178 ? 38.80320  2.47125   30.40511  1.000 34.17019  ? 178 LEU A CD1 1 
ATOM   1395 C CD2 . LEU A 1 178 ? 39.91515  4.61852   29.93935  1.000 33.33276  ? 178 LEU A CD2 1 
ATOM   1396 N N   . ALA A 1 179 ? 35.07767  4.58729   28.62319  1.000 35.80125  ? 179 ALA A N   1 
ATOM   1397 C CA  . ALA A 1 179 ? 33.87184  5.04233   29.30377  1.000 32.60684  ? 179 ALA A CA  1 
ATOM   1398 C C   . ALA A 1 179 ? 32.81879  3.93986   29.35988  1.000 34.17968  ? 179 ALA A C   1 
ATOM   1399 O O   . ALA A 1 179 ? 32.10144  3.80953   30.35494  1.000 48.12797  ? 179 ALA A O   1 
ATOM   1400 C CB  . ALA A 1 179 ? 33.31992  6.28705   28.61773  1.000 25.58049  ? 179 ALA A CB  1 
ATOM   1401 N N   . LEU A 1 180 ? 32.71875  3.12240   28.31379  1.000 33.59497  ? 180 LEU A N   1 
ATOM   1402 C CA  . LEU A 1 180 ? 31.72867  2.05191   28.33598  1.000 36.71044  ? 180 LEU A CA  1 
ATOM   1403 C C   . LEU A 1 180 ? 32.11304  0.97251   29.34250  1.000 42.44709  ? 180 LEU A C   1 
ATOM   1404 O O   . LEU A 1 180 ? 31.24589  0.44111   30.04842  1.000 44.44045  ? 180 LEU A O   1 
ATOM   1405 C CB  . LEU A 1 180 ? 31.54561  1.46155   26.93427  1.000 32.97413  ? 180 LEU A CB  1 
ATOM   1406 C CG  . LEU A 1 180 ? 31.07821  2.40103   25.81964  1.000 32.41874  ? 180 LEU A CG  1 
ATOM   1407 C CD1 . LEU A 1 180 ? 30.30806  1.64659   24.73684  1.000 26.30305  ? 180 LEU A CD1 1 
ATOM   1408 C CD2 . LEU A 1 180 ? 30.22825  3.53061   26.36731  1.000 33.26107  ? 180 LEU A CD2 1 
ATOM   1409 N N   . GLN A 1 181 ? 33.40494  0.63339   29.42487  1.000 42.57680  ? 181 GLN A N   1 
ATOM   1410 C CA  . GLN A 1 181 ? 33.85913  -0.26220  30.48555  1.000 49.25547  ? 181 GLN A CA  1 
ATOM   1411 C C   . GLN A 1 181 ? 33.55851  0.32650   31.85211  1.000 51.83039  ? 181 GLN A C   1 
ATOM   1412 O O   . GLN A 1 181 ? 33.17710  -0.39958  32.78181  1.000 55.79865  ? 181 GLN A O   1 
ATOM   1413 C CB  . GLN A 1 181 ? 35.35508  -0.53367  30.36771  1.000 52.87609  ? 181 GLN A CB  1 
ATOM   1414 C CG  . GLN A 1 181 ? 35.70803  -1.77958  29.59188  1.000 62.90929  ? 181 GLN A CG  1 
ATOM   1415 C CD  . GLN A 1 181 ? 36.98971  -1.60489  28.80579  1.000 62.36665  ? 181 GLN A CD  1 
ATOM   1416 O OE1 . GLN A 1 181 ? 37.68371  -0.59354  28.94354  1.000 60.16446  ? 181 GLN A OE1 1 
ATOM   1417 N NE2 . GLN A 1 181 ? 37.31288  -2.58795  27.97544  1.000 61.58703  ? 181 GLN A NE2 1 
ATOM   1418 N N   . TRP A 1 182 ? 33.73622  1.64579   31.98817  1.000 49.50991  ? 182 TRP A N   1 
ATOM   1419 C CA  . TRP A 1 182 ? 33.42892  2.32846   33.23923  1.000 39.60337  ? 182 TRP A CA  1 
ATOM   1420 C C   . TRP A 1 182 ? 31.96116  2.15556   33.60942  1.000 44.92292  ? 182 TRP A C   1 
ATOM   1421 O O   . TRP A 1 182 ? 31.63374  1.84390   34.75892  1.000 50.26702  ? 182 TRP A O   1 
ATOM   1422 C CB  . TRP A 1 182 ? 33.78441  3.81049   33.13422  1.000 29.88106  ? 182 TRP A CB  1 
ATOM   1423 C CG  . TRP A 1 182 ? 33.71585  4.51752   34.45795  1.000 44.43031  ? 182 TRP A CG  1 
ATOM   1424 C CD1 . TRP A 1 182 ? 34.73113  4.65998   35.37387  1.000 38.68011  ? 182 TRP A CD1 1 
ATOM   1425 C CD2 . TRP A 1 182 ? 32.56815  5.16320   35.03073  1.000 44.75266  ? 182 TRP A CD2 1 
ATOM   1426 N NE1 . TRP A 1 182 ? 34.28403  5.35618   36.47711  1.000 38.33716  ? 182 TRP A NE1 1 
ATOM   1427 C CE2 . TRP A 1 182 ? 32.96254  5.67606   36.29651  1.000 44.32250  ? 182 TRP A CE2 1 
ATOM   1428 C CE3 . TRP A 1 182 ? 31.24875  5.36345   34.59976  1.000 40.10387  ? 182 TRP A CE3 1 
ATOM   1429 C CZ2 . TRP A 1 182 ? 32.08243  6.38474   37.12988  1.000 37.79030  ? 182 TRP A CZ2 1 
ATOM   1430 C CZ3 . TRP A 1 182 ? 30.36939  6.06241   35.43626  1.000 37.76717  ? 182 TRP A CZ3 1 
ATOM   1431 C CH2 . TRP A 1 182 ? 30.79431  6.55743   36.69045  1.000 39.82266  ? 182 TRP A CH2 1 
ATOM   1432 N N   . VAL A 1 183 ? 31.05627  2.32981   32.64509  1.000 41.55034  ? 183 VAL A N   1 
ATOM   1433 C CA  . VAL A 1 183 ? 29.64430  2.14542   32.96496  1.000 44.20090  ? 183 VAL A CA  1 
ATOM   1434 C C   . VAL A 1 183 ? 29.37750  0.71471   33.44343  1.000 46.33011  ? 183 VAL A C   1 
ATOM   1435 O O   . VAL A 1 183 ? 28.62857  0.50661   34.40206  1.000 47.43497  ? 183 VAL A O   1 
ATOM   1436 C CB  . VAL A 1 183 ? 28.75932  2.54490   31.76810  1.000 37.31723  ? 183 VAL A CB  1 
ATOM   1437 C CG1 . VAL A 1 183 ? 27.30723  2.08503   31.98136  1.000 29.30423  ? 183 VAL A CG1 1 
ATOM   1438 C CG2 . VAL A 1 183 ? 28.79907  4.05374   31.59193  1.000 30.86464  ? 183 VAL A CG2 1 
ATOM   1439 N N   . GLN A 1 184 ? 30.00851  -0.29052  32.81873  1.000 49.26773  ? 184 GLN A N   1 
ATOM   1440 C CA  . GLN A 1 184 ? 29.76058  -1.67450  33.23598  1.000 42.73628  ? 184 GLN A CA  1 
ATOM   1441 C C   . GLN A 1 184 ? 30.11320  -1.88403  34.70076  1.000 44.17110  ? 184 GLN A C   1 
ATOM   1442 O O   . GLN A 1 184 ? 29.44008  -2.64544  35.40726  1.000 41.26718  ? 184 GLN A O   1 
ATOM   1443 C CB  . GLN A 1 184 ? 30.55037  -2.66735  32.37770  1.000 35.14759  ? 184 GLN A CB  1 
ATOM   1444 C CG  . GLN A 1 184 ? 29.92791  -2.97515  31.02728  1.000 49.77814  ? 184 GLN A CG  1 
ATOM   1445 C CD  . GLN A 1 184 ? 28.54541  -3.59856  31.12046  1.000 49.45623  ? 184 GLN A CD  1 
ATOM   1446 O OE1 . GLN A 1 184 ? 28.39004  -4.78268  31.45040  1.000 50.95192  ? 184 GLN A OE1 1 
ATOM   1447 N NE2 . GLN A 1 184 ? 27.52840  -2.80129  30.80782  1.000 40.34378  ? 184 GLN A NE2 1 
ATOM   1448 N N   . GLU A 1 185 ? 31.17151  -1.23491  35.17577  1.000 42.04466  ? 185 GLU A N   1 
ATOM   1449 C CA  . GLU A 1 185 ? 31.59165  -1.50504  36.54098  1.000 45.85447  ? 185 GLU A CA  1 
ATOM   1450 C C   . GLU A 1 185 ? 30.84511  -0.66816  37.56308  1.000 45.66355  ? 185 GLU A C   1 
ATOM   1451 O O   . GLU A 1 185 ? 30.58570  -1.14654  38.67439  1.000 59.88311  ? 185 GLU A O   1 
ATOM   1452 C CB  . GLU A 1 185 ? 33.09868  -1.28191  36.70890  1.000 44.15427  ? 185 GLU A CB  1 
ATOM   1453 C CG  . GLU A 1 185 ? 33.72021  -2.31618  37.65759  1.000 46.83093  ? 185 GLU A CG  1 
ATOM   1454 C CD  . GLU A 1 185 ? 35.10828  -1.94791  38.12752  1.000 57.72514  ? 185 GLU A CD  1 
ATOM   1455 O OE1 . GLU A 1 185 ? 35.53542  -2.47756  39.17608  1.000 62.15890  ? 185 GLU A OE1 1 
ATOM   1456 O OE2 . GLU A 1 185 ? 35.77025  -1.13231  37.44623  1.000 64.74456  ? 185 GLU A OE2 1 
ATOM   1457 N N   . ASN A 1 186 ? 30.45588  0.54849   37.19912  1.000 39.60536  ? 186 ASN A N   1 
ATOM   1458 C CA  . ASN A 1 186 ? 30.08012  1.55118   38.17515  1.000 37.56887  ? 186 ASN A CA  1 
ATOM   1459 C C   . ASN A 1 186 ? 28.62156  1.98219   38.12179  1.000 45.68558  ? 186 ASN A C   1 
ATOM   1460 O O   . ASN A 1 186 ? 28.13384  2.54246   39.11185  1.000 49.63441  ? 186 ASN A O   1 
ATOM   1461 C CB  . ASN A 1 186 ? 30.97047  2.78579   38.00260  1.000 34.90113  ? 186 ASN A CB  1 
ATOM   1462 C CG  . ASN A 1 186 ? 32.41772  2.49397   38.31939  1.000 44.94503  ? 186 ASN A CG  1 
ATOM   1463 O OD1 . ASN A 1 186 ? 32.74695  2.01715   39.40663  1.000 50.53596  ? 186 ASN A OD1 1 
ATOM   1464 N ND2 . ASN A 1 186 ? 33.29411  2.75588   37.36096  1.000 47.95709  ? 186 ASN A ND2 1 
ATOM   1465 N N   . ILE A 1 187 ? 27.90686  1.73170   37.01977  1.000 34.21784  ? 187 ILE A N   1 
ATOM   1466 C CA  . ILE A 1 187 ? 26.62514  2.40513   36.84866  1.000 34.46792  ? 187 ILE A CA  1 
ATOM   1467 C C   . ILE A 1 187 ? 25.58123  1.87550   37.83077  1.000 37.50388  ? 187 ILE A C   1 
ATOM   1468 O O   . ILE A 1 187 ? 24.59859  2.56995   38.11650  1.000 42.55287  ? 187 ILE A O   1 
ATOM   1469 C CB  . ILE A 1 187 ? 26.14400  2.33532   35.37483  1.000 32.37976  ? 187 ILE A CB  1 
ATOM   1470 C CG1 . ILE A 1 187 ? 25.13469  3.44753   35.08786  1.000 31.72323  ? 187 ILE A CG1 1 
ATOM   1471 C CG2 . ILE A 1 187 ? 25.52015  0.98596   35.02181  1.000 33.35981  ? 187 ILE A CG2 1 
ATOM   1472 C CD1 . ILE A 1 187 ? 25.69072  4.83447   35.33100  1.000 30.97196  ? 187 ILE A CD1 1 
ATOM   1473 N N   . ALA A 1 188 ? 25.78630  0.68237   38.39076  1.000 36.99187  ? 188 ALA A N   1 
ATOM   1474 C CA  . ALA A 1 188 ? 24.87161  0.18078   39.41836  1.000 49.45806  ? 188 ALA A CA  1 
ATOM   1475 C C   . ALA A 1 188 ? 24.94532  0.98791   40.71855  1.000 48.34326  ? 188 ALA A C   1 
ATOM   1476 O O   . ALA A 1 188 ? 23.95918  1.03518   41.45488  1.000 58.03366  ? 188 ALA A O   1 
ATOM   1477 C CB  . ALA A 1 188 ? 25.14054  -1.29956  39.70990  1.000 42.91420  ? 188 ALA A CB  1 
ATOM   1478 N N   . ALA A 1 189 ? 26.08436  1.61830   41.03497  1.000 39.38417  ? 189 ALA A N   1 
ATOM   1479 C CA  . ALA A 1 189 ? 26.12761  2.52296   42.18704  1.000 40.30201  ? 189 ALA A CA  1 
ATOM   1480 C C   . ALA A 1 189 ? 25.17221  3.69810   42.04874  1.000 48.71837  ? 189 ALA A C   1 
ATOM   1481 O O   . ALA A 1 189 ? 24.91142  4.39063   43.03692  1.000 63.30998  ? 189 ALA A O   1 
ATOM   1482 C CB  . ALA A 1 189 ? 27.53804  3.06887   42.40954  1.000 40.14187  ? 189 ALA A CB  1 
ATOM   1483 N N   . PHE A 1 190 ? 24.64827  3.94152   40.85638  1.000 38.15043  ? 190 PHE A N   1 
ATOM   1484 C CA  . PHE A 1 190 ? 23.70631  5.01640   40.61734  1.000 37.82060  ? 190 PHE A CA  1 
ATOM   1485 C C   . PHE A 1 190 ? 22.30772  4.48513   40.34627  1.000 41.19070  ? 190 PHE A C   1 
ATOM   1486 O O   . PHE A 1 190 ? 21.37981  5.28241   40.19013  1.000 47.21804  ? 190 PHE A O   1 
ATOM   1487 C CB  . PHE A 1 190 ? 24.16933  5.87793   39.43386  1.000 39.25314  ? 190 PHE A CB  1 
ATOM   1488 C CG  . PHE A 1 190 ? 25.54946  6.47489   39.59195  1.000 40.52364  ? 190 PHE A CG  1 
ATOM   1489 C CD1 . PHE A 1 190 ? 26.68266  5.73006   39.29072  1.000 36.70319  ? 190 PHE A CD1 1 
ATOM   1490 C CD2 . PHE A 1 190 ? 25.71340  7.80171   39.98372  1.000 45.07635  ? 190 PHE A CD2 1 
ATOM   1491 C CE1 . PHE A 1 190 ? 27.95629  6.28160   39.41347  1.000 34.57954  ? 190 PHE A CE1 1 
ATOM   1492 C CE2 . PHE A 1 190 ? 26.98682  8.36653   40.09633  1.000 40.24125  ? 190 PHE A CE2 1 
ATOM   1493 C CZ  . PHE A 1 190 ? 28.10657  7.60013   39.80575  1.000 34.79886  ? 190 PHE A CZ  1 
ATOM   1494 N N   . GLY A 1 191 ? 22.12481  3.16663   40.29852  1.000 39.16215  ? 191 GLY A N   1 
ATOM   1495 C CA  . GLY A 1 191 ? 20.83256  2.61037   39.96808  1.000 40.06541  ? 191 GLY A CA  1 
ATOM   1496 C C   . GLY A 1 191 ? 20.65155  2.27983   38.50419  1.000 66.67798  ? 191 GLY A C   1 
ATOM   1497 O O   . GLY A 1 191 ? 19.53178  1.95002   38.08992  1.000 68.54433  ? 191 GLY A O   1 
ATOM   1498 N N   . GLY A 1 192 ? 21.71248  2.36573   37.70417  1.000 37.05490  ? 192 GLY A N   1 
ATOM   1499 C CA  . GLY A 1 192 ? 21.64396  1.88841   36.35259  1.000 48.99942  ? 192 GLY A CA  1 
ATOM   1500 C C   . GLY A 1 192 ? 21.84433  0.38791   36.26683  1.000 53.25835  ? 192 GLY A C   1 
ATOM   1501 O O   . GLY A 1 192 ? 22.54755  -0.22467  37.07389  1.000 48.96065  ? 192 GLY A O   1 
ATOM   1502 N N   . ASP A 1 193 ? 21.20161  -0.19683  35.25737  1.000 47.79985  ? 193 ASP A N   1 
ATOM   1503 C CA  . ASP A 1 193 ? 21.29107  -1.59957  34.88930  1.000 43.50724  ? 193 ASP A CA  1 
ATOM   1504 C C   . ASP A 1 193 ? 22.46139  -1.77565  33.92346  1.000 42.19822  ? 193 ASP A C   1 
ATOM   1505 O O   . ASP A 1 193 ? 22.33464  -1.45227  32.74375  1.000 39.11209  ? 193 ASP A O   1 
ATOM   1506 C CB  . ASP A 1 193 ? 19.96299  -2.02638  34.25715  1.000 48.22732  ? 193 ASP A CB  1 
ATOM   1507 C CG  . ASP A 1 193 ? 19.78532  -3.53033  34.17429  1.000 55.23566  ? 193 ASP A CG  1 
ATOM   1508 O OD1 . ASP A 1 193 ? 20.79697  -4.26534  34.25625  1.000 56.83512  ? 193 ASP A OD1 1 
ATOM   1509 O OD2 . ASP A 1 193 ? 18.61346  -3.96662  34.00270  1.000 53.90800  ? 193 ASP A OD2 1 
ATOM   1510 N N   . PRO A 1 194 ? 23.61727  -2.27468  34.36806  1.000 47.07761  ? 194 PRO A N   1 
ATOM   1511 C CA  . PRO A 1 194 ? 24.71651  -2.51122  33.41979  1.000 46.43197  ? 194 PRO A CA  1 
ATOM   1512 C C   . PRO A 1 194 ? 24.38429  -3.54882  32.35546  1.000 51.49530  ? 194 PRO A C   1 
ATOM   1513 O O   . PRO A 1 194 ? 25.18635  -3.73626  31.43102  1.000 52.99594  ? 194 PRO A O   1 
ATOM   1514 C CB  . PRO A 1 194 ? 25.85984  -2.98835  34.32316  1.000 40.72025  ? 194 PRO A CB  1 
ATOM   1515 C CG  . PRO A 1 194 ? 25.16662  -3.58087  35.48889  1.000 39.06172  ? 194 PRO A CG  1 
ATOM   1516 C CD  . PRO A 1 194 ? 23.96391  -2.72638  35.72411  1.000 38.65858  ? 194 PRO A CD  1 
ATOM   1517 N N   . MET A 1 195 ? 23.24087  -4.22737  32.46312  1.000 47.60687  ? 195 MET A N   1 
ATOM   1518 C CA  . MET A 1 195 ? 22.82573  -5.24825  31.51366  1.000 47.56359  ? 195 MET A CA  1 
ATOM   1519 C C   . MET A 1 195 ? 21.75089  -4.73298  30.55417  1.000 47.41253  ? 195 MET A C   1 
ATOM   1520 O O   . MET A 1 195 ? 21.22938  -5.50355  29.73705  1.000 44.84138  ? 195 MET A O   1 
ATOM   1521 C CB  . MET A 1 195 ? 22.33311  -6.48174  32.27430  1.000 45.72289  ? 195 MET A CB  1 
ATOM   1522 C CG  . MET A 1 195 ? 23.46761  -7.24957  32.91092  1.000 59.55346  ? 195 MET A CG  1 
ATOM   1523 S SD  . MET A 1 195 ? 23.17171  -8.98844  33.27865  1.000 76.98101  ? 195 MET A SD  1 
ATOM   1524 C CE  . MET A 1 195 ? 21.78390  -8.92296  34.40321  1.000 74.28103  ? 195 MET A CE  1 
ATOM   1525 N N   . SER A 1 196 ? 21.41392  -3.43432  30.63434  1.000 43.82324  ? 196 SER A N   1 
ATOM   1526 C CA  . SER A 1 196 ? 20.48539  -2.77405  29.71565  1.000 40.03387  ? 196 SER A CA  1 
ATOM   1527 C C   . SER A 1 196 ? 21.10529  -1.41624  29.39403  1.000 49.73174  ? 196 SER A C   1 
ATOM   1528 O O   . SER A 1 196 ? 20.76203  -0.39221  29.99292  1.000 54.16072  ? 196 SER A O   1 
ATOM   1529 C CB  . SER A 1 196 ? 19.09364  -2.62553  30.31961  1.000 39.71667  ? 196 SER A CB  1 
ATOM   1530 O OG  . SER A 1 196 ? 18.09795  -2.50671  29.31610  1.000 44.57714  ? 196 SER A OG  1 
ATOM   1531 N N   . VAL A 1 197 ? 22.03295  -1.40949  28.44284  1.000 45.14699  ? 197 VAL A N   1 
ATOM   1532 C CA  . VAL A 1 197 ? 22.78911  -0.21458  28.09584  1.000 41.91713  ? 197 VAL A CA  1 
ATOM   1533 C C   . VAL A 1 197 ? 22.63817  0.03277   26.59886  1.000 40.86942  ? 197 VAL A C   1 
ATOM   1534 O O   . VAL A 1 197 ? 23.00449  -0.82252  25.77733  1.000 45.31886  ? 197 VAL A O   1 
ATOM   1535 C CB  . VAL A 1 197 ? 24.26374  -0.35373  28.50646  1.000 43.63811  ? 197 VAL A CB  1 
ATOM   1536 C CG1 . VAL A 1 197 ? 25.14833  0.64057   27.74942  1.000 34.38667  ? 197 VAL A CG1 1 
ATOM   1537 C CG2 . VAL A 1 197 ? 24.39714  -0.17500  30.00614  1.000 46.34368  ? 197 VAL A CG2 1 
ATOM   1538 N N   . THR A 1 198 ? 22.09466  1.20017   26.25413  1.000 37.54457  ? 198 THR A N   1 
ATOM   1539 C CA  . THR A 1 198 ? 21.81333  1.61400   24.88285  1.000 36.01435  ? 198 THR A CA  1 
ATOM   1540 C C   . THR A 1 198 ? 22.70218  2.79775   24.51252  1.000 36.57635  ? 198 THR A C   1 
ATOM   1541 O O   . THR A 1 198 ? 22.66789  3.83261   25.18781  1.000 35.15927  ? 198 THR A O   1 
ATOM   1542 C CB  . THR A 1 198 ? 20.32864  1.97117   24.73304  1.000 30.86126  ? 198 THR A CB  1 
ATOM   1543 O OG1 . THR A 1 198 ? 19.52436  0.77799   24.75883  1.000 38.41259  ? 198 THR A OG1 1 
ATOM   1544 C CG2 . THR A 1 198 ? 20.07479  2.77839   23.46853  1.000 34.95822  ? 198 THR A CG2 1 
ATOM   1545 N N   . LEU A 1 199 ? 23.50502  2.64210   23.45157  1.000 30.98516  ? 199 LEU A N   1 
ATOM   1546 C CA  . LEU A 1 199 ? 24.30184  3.75106   22.93997  1.000 25.28270  ? 199 LEU A CA  1 
ATOM   1547 C C   . LEU A 1 199 ? 23.44185  4.61849   22.03137  1.000 32.75917  ? 199 LEU A C   1 
ATOM   1548 O O   . LEU A 1 199 ? 22.52473  4.12626   21.36700  1.000 42.46077  ? 199 LEU A O   1 
ATOM   1549 C CB  . LEU A 1 199 ? 25.50356  3.23874   22.15276  1.000 24.69497  ? 199 LEU A CB  1 
ATOM   1550 C CG  . LEU A 1 199 ? 26.50394  2.28786   22.81114  1.000 36.80344  ? 199 LEU A CG  1 
ATOM   1551 C CD1 . LEU A 1 199 ? 27.70031  2.11644   21.91809  1.000 40.87286  ? 199 LEU A CD1 1 
ATOM   1552 C CD2 . LEU A 1 199 ? 26.95794  2.80508   24.15779  1.000 44.91401  ? 199 LEU A CD2 1 
ATOM   1553 N N   . PHE A 1 200 ? 23.73165  5.91819   22.00278  1.000 26.92753  ? 200 PHE A N   1 
ATOM   1554 C CA  . PHE A 1 200 ? 23.07273  6.76503   21.01704  1.000 33.48136  ? 200 PHE A CA  1 
ATOM   1555 C C   . PHE A 1 200 ? 23.89337  8.02583   20.81425  1.000 41.54538  ? 200 PHE A C   1 
ATOM   1556 O O   . PHE A 1 200 ? 24.52800  8.53040   21.74634  1.000 40.78974  ? 200 PHE A O   1 
ATOM   1557 C CB  . PHE A 1 200 ? 21.60737  7.07457   21.38470  1.000 36.04248  ? 200 PHE A CB  1 
ATOM   1558 C CG  . PHE A 1 200 ? 21.40838  8.10967   22.47322  1.000 40.08583  ? 200 PHE A CG  1 
ATOM   1559 C CD1 . PHE A 1 200 ? 22.11801  8.07203   23.66669  1.000 45.29306  ? 200 PHE A CD1 1 
ATOM   1560 C CD2 . PHE A 1 200 ? 20.42465  9.08204   22.32435  1.000 40.46581  ? 200 PHE A CD2 1 
ATOM   1561 C CE1 . PHE A 1 200 ? 21.88575  9.02924   24.67872  1.000 38.81461  ? 200 PHE A CE1 1 
ATOM   1562 C CE2 . PHE A 1 200 ? 20.18249  10.03020  23.31635  1.000 32.49869  ? 200 PHE A CE2 1 
ATOM   1563 C CZ  . PHE A 1 200 ? 20.92057  10.00780  24.49630  1.000 33.61082  ? 200 PHE A CZ  1 
ATOM   1564 N N   . GLY A 1 201 ? 23.91366  8.48787   19.56309  1.000 38.96181  ? 201 GLY A N   1 
ATOM   1565 C CA  . GLY A 1 201 ? 24.75935  9.59998   19.16458  1.000 31.65478  ? 201 GLY A CA  1 
ATOM   1566 C C   . GLY A 1 201 ? 24.30123  10.17199  17.84354  1.000 31.61135  ? 201 GLY A C   1 
ATOM   1567 O O   . GLY A 1 201 ? 23.50196  9.57156   17.12145  1.000 43.56664  ? 201 GLY A O   1 
ATOM   1568 N N   . GLU A 1 202 ? 24.82247  11.35312  17.53591  1.000 28.45956  ? 202 GLU A N   1 
ATOM   1569 C CA  . GLU A 1 202 ? 24.50577  12.04327  16.30185  1.000 36.90271  ? 202 GLU A CA  1 
ATOM   1570 C C   . GLU A 1 202 ? 25.79092  12.36903  15.53874  1.000 44.71232  ? 202 GLU A C   1 
ATOM   1571 O O   . GLU A 1 202 ? 26.85475  12.54717  16.14321  1.000 41.61526  ? 202 GLU A O   1 
ATOM   1572 C CB  . GLU A 1 202 ? 23.69148  13.29866  16.61761  1.000 38.42977  ? 202 GLU A CB  1 
ATOM   1573 C CG  . GLU A 1 202 ? 23.10951  13.97306  15.41108  1.000 39.80019  ? 202 GLU A CG  1 
ATOM   1574 C CD  . GLU A 1 202 ? 23.98723  15.08219  14.92435  1.000 43.42353  ? 202 GLU A CD  1 
ATOM   1575 O OE1 . GLU A 1 202 ? 25.06077  15.29086  15.53160  1.000 48.18377  ? 202 GLU A OE1 1 
ATOM   1576 O OE2 . GLU A 1 202 ? 23.59191  15.76230  13.95780  1.000 43.11694  ? 202 GLU A OE2 1 
ATOM   1577 N N   . SER A 1 203 ? 25.68497  12.41677  14.20196  1.000 45.56575  ? 203 SER A N   1 
ATOM   1578 C CA  . SER A 1 203 ? 26.78222  12.78308  13.26566  1.000 42.39777  ? 203 SER A CA  1 
ATOM   1579 C C   . SER A 1 203 ? 27.96640  11.84025  13.49002  1.000 37.38152  ? 203 SER A C   1 
ATOM   1580 O O   . SER A 1 203 ? 27.79653  10.60901  13.43836  1.000 32.83513  ? 203 SER A O   1 
ATOM   1581 C CB  . SER A 1 203 ? 27.08721  14.27446  13.42302  1.000 51.67257  ? 203 SER A CB  1 
ATOM   1582 O OG  . SER A 1 203 ? 28.21825  14.68835  12.66653  1.000 61.32673  ? 203 SER A OG  1 
ATOM   1583 N N   . ALA A 1 204 ? 29.17724  12.35269  13.72126  1.000 35.14306  ? 204 ALA A N   1 
ATOM   1584 C CA  . ALA A 1 204 ? 30.29459  11.49608  14.11110  1.000 34.47160  ? 204 ALA A CA  1 
ATOM   1585 C C   . ALA A 1 204 ? 29.97466  10.65280  15.33618  1.000 44.39388  ? 204 ALA A C   1 
ATOM   1586 O O   . ALA A 1 204 ? 30.58164  9.59429   15.53302  1.000 49.66585  ? 204 ALA A O   1 
ATOM   1587 C CB  . ALA A 1 204 ? 31.52969  12.34179  14.40235  1.000 30.74232  ? 204 ALA A CB  1 
ATOM   1588 N N   . GLY A 1 205 ? 29.05769  11.11743  16.19260  1.000 44.23347  ? 205 GLY A N   1 
ATOM   1589 C CA  . GLY A 1 205 ? 28.66176  10.31173  17.33618  1.000 41.16074  ? 205 GLY A CA  1 
ATOM   1590 C C   . GLY A 1 205 ? 27.86226  9.09494   16.91790  1.000 38.95672  ? 205 GLY A C   1 
ATOM   1591 O O   . GLY A 1 205 ? 28.11373  7.98131   17.39196  1.000 42.23634  ? 205 GLY A O   1 
ATOM   1592 N N   . ALA A 1 206 ? 26.89513  9.29193   16.01581  1.000 35.92262  ? 206 ALA A N   1 
ATOM   1593 C CA  . ALA A 1 206 ? 26.19400  8.16945   15.40016  1.000 37.18464  ? 206 ALA A CA  1 
ATOM   1594 C C   . ALA A 1 206 ? 27.17014  7.21638   14.71319  1.000 41.33019  ? 206 ALA A C   1 
ATOM   1595 O O   . ALA A 1 206 ? 27.10661  5.99342   14.91569  1.000 39.93659  ? 206 ALA A O   1 
ATOM   1596 C CB  . ALA A 1 206 ? 25.16099  8.69259   14.40298  1.000 38.76053  ? 206 ALA A CB  1 
ATOM   1597 N N   . ALA A 1 207 ? 28.07518  7.76421   13.88407  1.000 33.69776  ? 207 ALA A N   1 
ATOM   1598 C CA  . ALA A 1 207 ? 29.13033  6.96643   13.25578  1.000 27.42071  ? 207 ALA A CA  1 
ATOM   1599 C C   . ALA A 1 207 ? 29.86828  6.09708   14.26655  1.000 38.55563  ? 207 ALA A C   1 
ATOM   1600 O O   . ALA A 1 207 ? 30.06772  4.89655   14.04235  1.000 37.53362  ? 207 ALA A O   1 
ATOM   1601 C CB  . ALA A 1 207 ? 30.12099  7.88481   12.55684  1.000 34.15417  ? 207 ALA A CB  1 
ATOM   1602 N N   . SER A 1 208 ? 30.28393  6.69887   15.39096  1.000 47.10726  ? 208 SER A N   1 
ATOM   1603 C CA  . SER A 1 208 ? 31.00995  5.97264   16.43416  1.000 36.95611  ? 208 SER A CA  1 
ATOM   1604 C C   . SER A 1 208 ? 30.19123  4.80577   16.97083  1.000 40.19160  ? 208 SER A C   1 
ATOM   1605 O O   . SER A 1 208 ? 30.71000  3.69323   17.13273  1.000 46.91682  ? 208 SER A O   1 
ATOM   1606 C CB  . SER A 1 208 ? 31.38446  6.92426   17.57022  1.000 31.62810  ? 208 SER A CB  1 
ATOM   1607 O OG  . SER A 1 208 ? 32.19716  7.99875   17.11424  1.000 36.85213  ? 208 SER A OG  1 
ATOM   1608 N N   . VAL A 1 209 ? 28.90869  5.04064   17.26773  1.000 31.09996  ? 209 VAL A N   1 
ATOM   1609 C CA  . VAL A 1 209 ? 28.04716  3.92974   17.66277  1.000 30.03878  ? 209 VAL A CA  1 
ATOM   1610 C C   . VAL A 1 209 ? 28.17909  2.78710   16.66314  1.000 40.62099  ? 209 VAL A C   1 
ATOM   1611 O O   . VAL A 1 209 ? 28.35028  1.62184   17.04701  1.000 39.44019  ? 209 VAL A O   1 
ATOM   1612 C CB  . VAL A 1 209 ? 26.58691  4.40138   17.80765  1.000 31.21857  ? 209 VAL A CB  1 
ATOM   1613 C CG1 . VAL A 1 209 ? 25.67609  3.23358   18.14273  1.000 25.71079  ? 209 VAL A CG1 1 
ATOM   1614 C CG2 . VAL A 1 209 ? 26.48382  5.46236   18.88304  1.000 38.57794  ? 209 VAL A CG2 1 
ATOM   1615 N N   . GLY A 1 210 ? 28.15133  3.10946   15.36226  1.000 41.22650  ? 210 GLY A N   1 
ATOM   1616 C CA  . GLY A 1 210 ? 28.35432  2.08213   14.34923  1.000 38.87199  ? 210 GLY A CA  1 
ATOM   1617 C C   . GLY A 1 210 ? 29.66033  1.32347   14.52344  1.000 39.25197  ? 210 GLY A C   1 
ATOM   1618 O O   . GLY A 1 210 ? 29.69895  0.09372   14.41677  1.000 43.07867  ? 210 GLY A O   1 
ATOM   1619 N N   . MET A 1 211 ? 30.74404  2.03473   14.82920  1.000 31.23495  ? 211 MET A N   1 
ATOM   1620 C CA  . MET A 1 211 ? 32.02047  1.34079   14.95777  1.000 37.53924  ? 211 MET A CA  1 
ATOM   1621 C C   . MET A 1 211 ? 32.08054  0.45938   16.20517  1.000 41.04680  ? 211 MET A C   1 
ATOM   1622 O O   . MET A 1 211 ? 32.76683  -0.57063  16.19100  1.000 42.57782  ? 211 MET A O   1 
ATOM   1623 C CB  . MET A 1 211 ? 33.16043  2.35019   14.93277  1.000 37.98751  ? 211 MET A CB  1 
ATOM   1624 C CG  . MET A 1 211 ? 32.89011  3.42838   13.92361  1.000 47.80958  ? 211 MET A CG  1 
ATOM   1625 S SD  . MET A 1 211 ? 34.34978  4.00923   13.08903  1.000 53.32289  ? 211 MET A SD  1 
ATOM   1626 C CE  . MET A 1 211 ? 33.60224  5.14848   11.95094  1.000 56.72882  ? 211 MET A CE  1 
ATOM   1627 N N   . HIS A 1 212 ? 31.36443  0.81431   17.28173  1.000 37.09764  ? 212 HIS A N   1 
ATOM   1628 C CA  . HIS A 1 212 ? 31.31247  -0.10933  18.41524  1.000 35.39802  ? 212 HIS A CA  1 
ATOM   1629 C C   . HIS A 1 212 ? 30.51286  -1.35931  18.07902  1.000 36.09352  ? 212 HIS A C   1 
ATOM   1630 O O   . HIS A 1 212 ? 30.84476  -2.44585  18.56144  1.000 38.33326  ? 212 HIS A O   1 
ATOM   1631 C CB  . HIS A 1 212 ? 30.74459  0.57206   19.66350  1.000 31.89873  ? 212 HIS A CB  1 
ATOM   1632 C CG  . HIS A 1 212 ? 31.60603  1.68256   20.17431  1.000 26.45347  ? 212 HIS A CG  1 
ATOM   1633 N ND1 . HIS A 1 212 ? 32.90172  1.48146   20.59514  1.000 24.37546  ? 212 HIS A ND1 1 
ATOM   1634 C CD2 . HIS A 1 212 ? 31.37749  3.01407   20.27473  1.000 24.24022  ? 212 HIS A CD2 1 
ATOM   1635 C CE1 . HIS A 1 212 ? 33.42941  2.64091   20.94688  1.000 27.53930  ? 212 HIS A CE1 1 
ATOM   1636 N NE2 . HIS A 1 212 ? 32.52522  3.58765   20.75995  1.000 22.70575  ? 212 HIS A NE2 1 
ATOM   1637 N N   . ILE A 1 213 ? 29.47483  -1.23353  17.24639  1.000 32.80783  ? 213 ILE A N   1 
ATOM   1638 C CA  . ILE A 1 213 ? 28.77553  -2.41482  16.74574  1.000 30.94258  ? 213 ILE A CA  1 
ATOM   1639 C C   . ILE A 1 213 ? 29.73690  -3.33561  16.00413  1.000 36.88773  ? 213 ILE A C   1 
ATOM   1640 O O   . ILE A 1 213 ? 29.65885  -4.56605  16.12311  1.000 41.70475  ? 213 ILE A O   1 
ATOM   1641 C CB  . ILE A 1 213 ? 27.60702  -1.99196  15.83960  1.000 33.55720  ? 213 ILE A CB  1 
ATOM   1642 C CG1 . ILE A 1 213 ? 26.59313  -1.17265  16.62143  1.000 34.21429  ? 213 ILE A CG1 1 
ATOM   1643 C CG2 . ILE A 1 213 ? 26.96028  -3.21059  15.15214  1.000 34.69930  ? 213 ILE A CG2 1 
ATOM   1644 C CD1 . ILE A 1 213 ? 25.46154  -0.68956  15.77359  1.000 37.94934  ? 213 ILE A CD1 1 
ATOM   1645 N N   . LEU A 1 214 ? 30.65451  -2.75519  15.21919  1.000 43.24061  ? 214 LEU A N   1 
ATOM   1646 C CA  . LEU A 1 214 ? 31.50819  -3.51773  14.31350  1.000 45.74102  ? 214 LEU A CA  1 
ATOM   1647 C C   . LEU A 1 214 ? 32.82280  -3.95951  14.93286  1.000 49.94800  ? 214 LEU A C   1 
ATOM   1648 O O   . LEU A 1 214 ? 33.49372  -4.83477  14.36309  1.000 58.26718  ? 214 LEU A O   1 
ATOM   1649 C CB  . LEU A 1 214 ? 31.78889  -2.70020  13.04335  1.000 40.08988  ? 214 LEU A CB  1 
ATOM   1650 C CG  . LEU A 1 214 ? 30.47748  -2.42486  12.29979  1.000 37.71211  ? 214 LEU A CG  1 
ATOM   1651 C CD1 . LEU A 1 214 ? 30.66152  -1.47412  11.12893  1.000 29.83237  ? 214 LEU A CD1 1 
ATOM   1652 C CD2 . LEU A 1 214 ? 29.82576  -3.74781  11.84261  1.000 34.41612  ? 214 LEU A CD2 1 
ATOM   1653 N N   . SER A 1 215 ? 33.20513  -3.38646  16.07256  1.000 38.58575  ? 215 SER A N   1 
ATOM   1654 C CA  . SER A 1 215 ? 34.42941  -3.76749  16.76066  1.000 37.90089  ? 215 SER A CA  1 
ATOM   1655 C C   . SER A 1 215 ? 34.09372  -4.75737  17.86434  1.000 46.42796  ? 215 SER A C   1 
ATOM   1656 O O   . SER A 1 215 ? 33.37996  -4.41792  18.80989  1.000 43.69264  ? 215 SER A O   1 
ATOM   1657 C CB  . SER A 1 215 ? 35.13886  -2.55098  17.33732  1.000 36.91074  ? 215 SER A CB  1 
ATOM   1658 O OG  . SER A 1 215 ? 36.48898  -2.87316  17.56516  1.000 44.43297  ? 215 SER A OG  1 
ATOM   1659 N N   . LEU A 1 216 ? 34.62342  -5.96991  17.75122  1.000 59.26892  ? 216 LEU A N   1 
ATOM   1660 C CA  . LEU A 1 216 ? 34.17875  -7.04909  18.62807  1.000 66.29932  ? 216 LEU A CA  1 
ATOM   1661 C C   . LEU A 1 216 ? 34.36985  -6.76285  20.12172  1.000 63.94413  ? 216 LEU A C   1 
ATOM   1662 O O   . LEU A 1 216 ? 33.47489  -7.12310  20.90688  1.000 67.12082  ? 216 LEU A O   1 
ATOM   1663 C CB  . LEU A 1 216 ? 34.87396  -8.34825  18.19739  1.000 72.68833  ? 216 LEU A CB  1 
ATOM   1664 C CG  . LEU A 1 216 ? 34.68626  -9.55165  19.11765  1.000 79.15255  ? 216 LEU A CG  1 
ATOM   1665 C CD1 . LEU A 1 216 ? 33.24890  -10.04888 19.08678  1.000 74.63026  ? 216 LEU A CD1 1 
ATOM   1666 C CD2 . LEU A 1 216 ? 35.65905  -10.65658 18.74825  1.000 86.33911  ? 216 LEU A CD2 1 
ATOM   1667 N N   . PRO A 1 217 ? 35.46228  -6.14592  20.58564  1.000 60.40260  ? 217 PRO A N   1 
ATOM   1668 C CA  . PRO A 1 217 ? 35.55278  -5.85583  22.02910  1.000 52.36962  ? 217 PRO A CA  1 
ATOM   1669 C C   . PRO A 1 217 ? 34.46338  -4.93486  22.56983  1.000 52.37391  ? 217 PRO A C   1 
ATOM   1670 O O   . PRO A 1 217 ? 33.99771  -5.15930  23.68973  1.000 63.43124  ? 217 PRO A O   1 
ATOM   1671 C CB  . PRO A 1 217 ? 36.95089  -5.23864  22.16076  1.000 47.18089  ? 217 PRO A CB  1 
ATOM   1672 C CG  . PRO A 1 217 ? 37.73255  -5.91695  21.10094  1.000 50.22707  ? 217 PRO A CG  1 
ATOM   1673 C CD  . PRO A 1 217 ? 36.77657  -5.99309  19.93351  1.000 58.20775  ? 217 PRO A CD  1 
ATOM   1674 N N   . SER A 1 218 ? 34.03662  -3.90695  21.83091  1.000 52.74070  ? 218 SER A N   1 
ATOM   1675 C CA  . SER A 1 218 ? 32.96995  -3.03489  22.33089  1.000 45.69896  ? 218 SER A CA  1 
ATOM   1676 C C   . SER A 1 218 ? 31.63032  -3.74810  22.45458  1.000 51.03584  ? 218 SER A C   1 
ATOM   1677 O O   . SER A 1 218 ? 30.73818  -3.23870  23.14432  1.000 42.98793  ? 218 SER A O   1 
ATOM   1678 C CB  . SER A 1 218 ? 32.77512  -1.81499  21.42443  1.000 34.13859  ? 218 SER A CB  1 
ATOM   1679 O OG  . SER A 1 218 ? 33.91984  -0.98263  21.42332  1.000 39.06172  ? 218 SER A OG  1 
ATOM   1680 N N   . ARG A 1 219 ? 31.46838  -4.90848  21.80535  1.000 59.85979  ? 219 ARG A N   1 
ATOM   1681 C CA  . ARG A 1 219 ? 30.13581  -5.47541  21.61684  1.000 59.29190  ? 219 ARG A CA  1 
ATOM   1682 C C   . ARG A 1 219 ? 29.52987  -5.99941  22.90989  1.000 55.34461  ? 219 ARG A C   1 
ATOM   1683 O O   . ARG A 1 219 ? 28.30395  -6.12213  22.99629  1.000 59.39698  ? 219 ARG A O   1 
ATOM   1684 C CB  . ARG A 1 219 ? 30.16756  -6.58868  20.56678  1.000 57.15703  ? 219 ARG A CB  1 
ATOM   1685 C CG  . ARG A 1 219 ? 29.93897  -6.11406  19.13849  1.000 55.82058  ? 219 ARG A CG  1 
ATOM   1686 C CD  . ARG A 1 219 ? 28.64221  -5.33068  18.99936  1.000 61.46285  ? 219 ARG A CD  1 
ATOM   1687 N NE  . ARG A 1 219 ? 27.46888  -6.07995  19.43961  1.000 72.48464  ? 219 ARG A NE  1 
ATOM   1688 C CZ  . ARG A 1 219 ? 26.70798  -6.81969  18.63439  1.000 76.86233  ? 219 ARG A CZ  1 
ATOM   1689 N NH1 . ARG A 1 219 ? 27.00031  -6.91602  17.34018  1.000 66.53756  ? 219 ARG A NH1 1 
ATOM   1690 N NH2 . ARG A 1 219 ? 25.65317  -7.46529  19.12733  1.000 85.00732  ? 219 ARG A NH2 1 
ATOM   1691 N N   . SER A 1 220 ? 30.34407  -6.29677  23.91307  1.000 54.78992  ? 220 SER A N   1 
ATOM   1692 C CA  . SER A 1 220 ? 29.83626  -6.78186  25.18860  1.000 55.92657  ? 220 SER A CA  1 
ATOM   1693 C C   . SER A 1 220 ? 29.62360  -5.66515  26.20802  1.000 52.51652  ? 220 SER A C   1 
ATOM   1694 O O   . SER A 1 220 ? 29.35974  -5.95783  27.37868  1.000 56.79861  ? 220 SER A O   1 
ATOM   1695 C CB  . SER A 1 220 ? 30.77873  -7.84631  25.75718  1.000 50.67870  ? 220 SER A CB  1 
ATOM   1696 O OG  . SER A 1 220 ? 32.12641  -7.54436  25.44336  1.000 51.16169  ? 220 SER A OG  1 
ATOM   1697 N N   . LEU A 1 221 ? 29.72193  -4.39900  25.79212  1.000 42.97057  ? 221 LEU A N   1 
ATOM   1698 C CA  . LEU A 1 221 ? 29.52548  -3.27311  26.69311  1.000 34.20757  ? 221 LEU A CA  1 
ATOM   1699 C C   . LEU A 1 221 ? 28.19486  -2.57251  26.49708  1.000 38.70920  ? 221 LEU A C   1 
ATOM   1700 O O   . LEU A 1 221 ? 27.87639  -1.66552  27.27476  1.000 51.60628  ? 221 LEU A O   1 
ATOM   1701 C CB  . LEU A 1 221 ? 30.65095  -2.23979  26.53122  1.000 30.47706  ? 221 LEU A CB  1 
ATOM   1702 C CG  . LEU A 1 221 ? 32.07686  -2.79166  26.45937  1.000 46.29654  ? 221 LEU A CG  1 
ATOM   1703 C CD1 . LEU A 1 221 ? 33.05948  -1.65908  26.21019  1.000 47.40311  ? 221 LEU A CD1 1 
ATOM   1704 C CD2 . LEU A 1 221 ? 32.45326  -3.57030  27.71087  1.000 33.36207  ? 221 LEU A CD2 1 
ATOM   1705 N N   . PHE A 1 222 ? 27.42272  -2.94917  25.47912  1.000 39.68199  ? 222 PHE A N   1 
ATOM   1706 C CA  . PHE A 1 222 ? 26.11725  -2.35118  25.22665  1.000 38.59880  ? 222 PHE A CA  1 
ATOM   1707 C C   . PHE A 1 222 ? 25.21816  -3.41947  24.61329  1.000 40.82549  ? 222 PHE A C   1 
ATOM   1708 O O   . PHE A 1 222 ? 25.68057  -4.50109  24.23460  1.000 44.15536  ? 222 PHE A O   1 
ATOM   1709 C CB  . PHE A 1 222 ? 26.25066  -1.09833  24.34782  1.000 42.32010  ? 222 PHE A CB  1 
ATOM   1710 C CG  . PHE A 1 222 ? 26.70988  -1.37575  22.93308  1.000 44.70320  ? 222 PHE A CG  1 
ATOM   1711 C CD1 . PHE A 1 222 ? 28.06045  -1.52756  22.64266  1.000 38.27716  ? 222 PHE A CD1 1 
ATOM   1712 C CD2 . PHE A 1 222 ? 25.78636  -1.45563  21.89063  1.000 42.35543  ? 222 PHE A CD2 1 
ATOM   1713 C CE1 . PHE A 1 222 ? 28.48144  -1.77774  21.34326  1.000 43.32976  ? 222 PHE A CE1 1 
ATOM   1714 C CE2 . PHE A 1 222 ? 26.19933  -1.70623  20.59276  1.000 44.19688  ? 222 PHE A CE2 1 
ATOM   1715 C CZ  . PHE A 1 222 ? 27.55056  -1.86305  20.31448  1.000 44.74079  ? 222 PHE A CZ  1 
ATOM   1716 N N   . HIS A 1 223 ? 23.91345  -3.14050  24.55717  1.000 33.27351  ? 223 HIS A N   1 
ATOM   1717 C CA  . HIS A 1 223 ? 22.98210  -4.13267  24.01692  1.000 48.44458  ? 223 HIS A CA  1 
ATOM   1718 C C   . HIS A 1 223 ? 22.04751  -3.61481  22.93569  1.000 49.68501  ? 223 HIS A C   1 
ATOM   1719 O O   . HIS A 1 223 ? 21.46069  -4.43632  22.21944  1.000 57.34755  ? 223 HIS A O   1 
ATOM   1720 C CB  . HIS A 1 223 ? 22.13696  -4.76819  25.13609  1.000 53.00176  ? 223 HIS A CB  1 
ATOM   1721 C CG  . HIS A 1 223 ? 22.90866  -5.08117  26.38514  1.000 54.81761  ? 223 HIS A CG  1 
ATOM   1722 N ND1 . HIS A 1 223 ? 23.22547  -4.12554  27.32965  1.000 52.81108  ? 223 HIS A ND1 1 
ATOM   1723 C CD2 . HIS A 1 223 ? 23.44909  -6.24345  26.83106  1.000 54.56155  ? 223 HIS A CD2 1 
ATOM   1724 C CE1 . HIS A 1 223 ? 23.91760  -4.68750  28.30602  1.000 48.91575  ? 223 HIS A CE1 1 
ATOM   1725 N NE2 . HIS A 1 223 ? 24.06130  -5.97283  28.03198  1.000 51.37230  ? 223 HIS A NE2 1 
ATOM   1726 N N   . ARG A 1 224 ? 21.90030  -2.30285  22.77945  1.000 41.89841  ? 224 ARG A N   1 
ATOM   1727 C CA  . ARG A 1 224 ? 21.09278  -1.71980  21.72133  1.000 44.60187  ? 224 ARG A CA  1 
ATOM   1728 C C   . ARG A 1 224 ? 21.76928  -0.43311  21.26161  1.000 50.76877  ? 224 ARG A C   1 
ATOM   1729 O O   . ARG A 1 224 ? 22.63539  0.11043   21.95737  1.000 57.83689  ? 224 ARG A O   1 
ATOM   1730 C CB  . ARG A 1 224 ? 19.66127  -1.46000  22.19980  1.000 39.96133  ? 224 ARG A CB  1 
ATOM   1731 C CG  . ARG A 1 224 ? 18.76297  -2.67975  22.10501  1.000 44.45732  ? 224 ARG A CG  1 
ATOM   1732 C CD  . ARG A 1 224 ? 17.49941  -2.50198  22.91549  1.000 45.75479  ? 224 ARG A CD  1 
ATOM   1733 N NE  . ARG A 1 224 ? 17.82326  -2.42505  24.32588  1.000 55.16873  ? 224 ARG A NE  1 
ATOM   1734 C CZ  . ARG A 1 224 ? 17.93766  -3.48445  25.11528  1.000 57.60700  ? 224 ARG A CZ  1 
ATOM   1735 N NH1 . ARG A 1 224 ? 17.72873  -4.70708  24.63215  1.000 57.05368  ? 224 ARG A NH1 1 
ATOM   1736 N NH2 . ARG A 1 224 ? 18.25717  -3.31783  26.38997  1.000 56.79999  ? 224 ARG A NH2 1 
ATOM   1737 N N   . ALA A 1 225 ? 21.37179  0.05892   20.08328  1.000 39.29789  ? 225 ALA A N   1 
ATOM   1738 C CA  . ALA A 1 225 ? 22.08970  1.16827   19.46685  1.000 40.70650  ? 225 ALA A CA  1 
ATOM   1739 C C   . ALA A 1 225 ? 21.15637  2.03445   18.62874  1.000 41.99352  ? 225 ALA A C   1 
ATOM   1740 O O   . ALA A 1 225 ? 20.26765  1.51661   17.94651  1.000 42.70246  ? 225 ALA A O   1 
ATOM   1741 C CB  . ALA A 1 225 ? 23.23745  0.65139   18.59410  1.000 43.88219  ? 225 ALA A CB  1 
ATOM   1742 N N   . VAL A 1 226 ? 21.39395  3.35210   18.67438  1.000 40.03998  ? 226 VAL A N   1 
ATOM   1743 C CA  . VAL A 1 226 ? 20.63507  4.37538   17.95041  1.000 39.09859  ? 226 VAL A CA  1 
ATOM   1744 C C   . VAL A 1 226 ? 21.63209  5.28639   17.24785  1.000 36.06098  ? 226 VAL A C   1 
ATOM   1745 O O   . VAL A 1 226 ? 22.48420  5.89731   17.89946  1.000 44.07299  ? 226 VAL A O   1 
ATOM   1746 C CB  . VAL A 1 226 ? 19.73622  5.20564   18.89061  1.000 45.30833  ? 226 VAL A CB  1 
ATOM   1747 C CG1 . VAL A 1 226 ? 18.79169  6.11131   18.08186  1.000 46.74938  ? 226 VAL A CG1 1 
ATOM   1748 C CG2 . VAL A 1 226 ? 18.95992  4.30900   19.85038  1.000 30.77790  ? 226 VAL A CG2 1 
ATOM   1749 N N   . LEU A 1 227 ? 21.52772  5.38369   15.93467  1.000 37.84359  ? 227 LEU A N   1 
ATOM   1750 C CA  . LEU A 1 227 ? 22.45484  6.15147   15.10347  1.000 36.11290  ? 227 LEU A CA  1 
ATOM   1751 C C   . LEU A 1 227 ? 21.65503  7.24969   14.42049  1.000 39.51627  ? 227 LEU A C   1 
ATOM   1752 O O   . LEU A 1 227 ? 20.81075  6.96101   13.56317  1.000 42.02935  ? 227 LEU A O   1 
ATOM   1753 C CB  . LEU A 1 227 ? 23.13101  5.26228   14.06211  1.000 40.82938  ? 227 LEU A CB  1 
ATOM   1754 C CG  . LEU A 1 227 ? 24.15826  4.20733   14.47700  1.000 43.85906  ? 227 LEU A CG  1 
ATOM   1755 C CD1 . LEU A 1 227 ? 23.51874  3.05646   15.23377  1.000 42.19877  ? 227 LEU A CD1 1 
ATOM   1756 C CD2 . LEU A 1 227 ? 24.84004  3.69957   13.22042  1.000 45.12417  ? 227 LEU A CD2 1 
ATOM   1757 N N   . GLN A 1 228 ? 21.89870  8.49913   14.80956  1.000 39.72968  ? 228 GLN A N   1 
ATOM   1758 C CA  . GLN A 1 228 ? 21.14024  9.64318   14.30816  1.000 39.61293  ? 228 GLN A CA  1 
ATOM   1759 C C   . GLN A 1 228 ? 22.02442  10.41961  13.33412  1.000 43.95513  ? 228 GLN A C   1 
ATOM   1760 O O   . GLN A 1 228 ? 23.04601  10.99182  13.73328  1.000 47.39057  ? 228 GLN A O   1 
ATOM   1761 C CB  . GLN A 1 228 ? 20.64265  10.52653  15.45962  1.000 33.97918  ? 228 GLN A CB  1 
ATOM   1762 C CG  . GLN A 1 228 ? 20.16442  9.74429   16.68732  1.000 33.53078  ? 228 GLN A CG  1 
ATOM   1763 C CD  . GLN A 1 228 ? 19.76854  10.61440  17.90053  1.000 39.08632  ? 228 GLN A CD  1 
ATOM   1764 O OE1 . GLN A 1 228 ? 19.58029  10.10214  19.00276  1.000 50.41400  ? 228 GLN A OE1 1 
ATOM   1765 N NE2 . GLN A 1 228 ? 19.62921  11.90682  17.69573  1.000 35.11116  ? 228 GLN A NE2 1 
ATOM   1766 N N   . SER A 1 229 ? 21.64126  10.40966  12.05225  1.000 37.87716  ? 229 SER A N   1 
ATOM   1767 C CA  . SER A 1 229 ? 22.28358  11.22293  11.02068  1.000 30.65017  ? 229 SER A CA  1 
ATOM   1768 C C   . SER A 1 229 ? 23.77099  10.89926  10.89405  1.000 33.05052  ? 229 SER A C   1 
ATOM   1769 O O   . SER A 1 229 ? 24.61845  11.78701  10.77767  1.000 28.90346  ? 229 SER A O   1 
ATOM   1770 C CB  . SER A 1 229 ? 22.07697  12.71613  11.28774  1.000 28.96172  ? 229 SER A CB  1 
ATOM   1771 O OG  . SER A 1 229 ? 20.69657  13.03932  11.34202  1.000 34.97495  ? 229 SER A OG  1 
ATOM   1772 N N   . GLY A 1 230 ? 24.09088  9.61193   10.91029  1.000 33.54312  ? 230 GLY A N   1 
ATOM   1773 C CA  . GLY A 1 230 ? 25.48361  9.22052   10.83368  1.000 27.68825  ? 230 GLY A CA  1 
ATOM   1774 C C   . GLY A 1 230 ? 25.65960  7.71789   10.78625  1.000 36.21354  ? 230 GLY A C   1 
ATOM   1775 O O   . GLY A 1 230 ? 24.80473  6.96657   11.27308  1.000 31.99214  ? 230 GLY A O   1 
ATOM   1776 N N   . THR A 1 231 ? 26.78789  7.27410   10.23391  1.000 36.41667  ? 231 THR A N   1 
ATOM   1777 C CA  . THR A 1 231 ? 27.01302  5.88457   9.86554   1.000 34.47622  ? 231 THR A CA  1 
ATOM   1778 C C   . THR A 1 231 ? 28.50093  5.58513   9.91966   1.000 33.17512  ? 231 THR A C   1 
ATOM   1779 O O   . THR A 1 231 ? 29.31315  6.46374   9.61495   1.000 37.12778  ? 231 THR A O   1 
ATOM   1780 C CB  . THR A 1 231 ? 26.49013  5.62136   8.44808   1.000 38.33553  ? 231 THR A CB  1 
ATOM   1781 O OG1 . THR A 1 231 ? 26.88517  6.71394   7.59755   1.000 39.53602  ? 231 THR A OG1 1 
ATOM   1782 C CG2 . THR A 1 231 ? 24.96788  5.48249   8.44933   1.000 28.99076  ? 231 THR A CG2 1 
ATOM   1783 N N   . PRO A 1 232 ? 28.89617  4.36135   10.27824  1.000 36.25926  ? 232 PRO A N   1 
ATOM   1784 C CA  . PRO A 1 232 ? 30.31397  4.00464   10.10799  1.000 36.42878  ? 232 PRO A CA  1 
ATOM   1785 C C   . PRO A 1 232 ? 30.69895  3.81921   8.63977   1.000 39.40927  ? 232 PRO A C   1 
ATOM   1786 O O   . PRO A 1 232 ? 31.83962  4.12501   8.26557   1.000 34.34307  ? 232 PRO A O   1 
ATOM   1787 C CB  . PRO A 1 232 ? 30.44794  2.70551   10.91352  1.000 34.71824  ? 232 PRO A CB  1 
ATOM   1788 C CG  . PRO A 1 232 ? 29.09070  2.07142   10.80729  1.000 25.98321  ? 232 PRO A CG  1 
ATOM   1789 C CD  . PRO A 1 232 ? 28.09577  3.22903   10.78466  1.000 25.32602  ? 232 PRO A CD  1 
ATOM   1790 N N   . ASN A 1 233 ? 29.78178  3.33424   7.79785   1.000 41.41915  ? 233 ASN A N   1 
ATOM   1791 C CA  . ASN A 1 233 ? 29.99591  3.31431   6.35599   1.000 36.63631  ? 233 ASN A CA  1 
ATOM   1792 C C   . ASN A 1 233 ? 29.92768  4.74178   5.81324   1.000 39.43210  ? 233 ASN A C   1 
ATOM   1793 O O   . ASN A 1 233 ? 29.54666  5.68091   6.51965   1.000 42.03334  ? 233 ASN A O   1 
ATOM   1794 C CB  . ASN A 1 233 ? 28.96071  2.41849   5.67589   1.000 36.77819  ? 233 ASN A CB  1 
ATOM   1795 C CG  . ASN A 1 233 ? 27.55847  2.64123   6.21855   1.000 48.46930  ? 233 ASN A CG  1 
ATOM   1796 O OD1 . ASN A 1 233 ? 27.36210  2.76172   7.43903   1.000 52.37648  ? 233 ASN A OD1 1 
ATOM   1797 N ND2 . ASN A 1 233 ? 26.57302  2.71617   5.31573   1.000 50.40657  ? 233 ASN A ND2 1 
ATOM   1798 N N   . GLY A 1 234 ? 30.31768  4.91223   4.54909   1.000 41.94125  ? 234 GLY A N   1 
ATOM   1799 C CA  . GLY A 1 234 ? 30.18637  6.19512   3.89079   1.000 37.46027  ? 234 GLY A CA  1 
ATOM   1800 C C   . GLY A 1 234 ? 31.49826  6.93230   3.69330   1.000 38.42169  ? 234 GLY A C   1 
ATOM   1801 O O   . GLY A 1 234 ? 32.57107  6.46735   4.07967   1.000 49.87098  ? 234 GLY A O   1 
ATOM   1802 N N   . PRO A 1 235 ? 31.43170  8.11935   3.09079   1.000 35.54524  ? 235 PRO A N   1 
ATOM   1803 C CA  . PRO A 1 235 ? 32.66686  8.76320   2.60438   1.000 36.46379  ? 235 PRO A CA  1 
ATOM   1804 C C   . PRO A 1 235 ? 33.48167  9.52576   3.64580   1.000 41.78036  ? 235 PRO A C   1 
ATOM   1805 O O   . PRO A 1 235 ? 34.64772  9.85702   3.37335   1.000 37.40485  ? 235 PRO A O   1 
ATOM   1806 C CB  . PRO A 1 235 ? 32.15850  9.71755   1.51126   1.000 30.50357  ? 235 PRO A CB  1 
ATOM   1807 C CG  . PRO A 1 235 ? 30.69747  9.94767   1.82309   1.000 27.08696  ? 235 PRO A CG  1 
ATOM   1808 C CD  . PRO A 1 235 ? 30.20607  8.70719   2.51634   1.000 33.20496  ? 235 PRO A CD  1 
ATOM   1809 N N   . TRP A 1 236 ? 32.93726  9.83602   4.81744   1.000 41.66317  ? 236 TRP A N   1 
ATOM   1810 C CA  . TRP A 1 236 ? 33.65955  10.71212  5.73052   1.000 43.63746  ? 236 TRP A CA  1 
ATOM   1811 C C   . TRP A 1 236 ? 34.09154  10.06003  7.03893   1.000 39.93732  ? 236 TRP A C   1 
ATOM   1812 O O   . TRP A 1 236 ? 35.07492  10.51402  7.62229   1.000 35.48697  ? 236 TRP A O   1 
ATOM   1813 C CB  . TRP A 1 236 ? 32.82304  11.96256  6.04407   1.000 46.75089  ? 236 TRP A CB  1 
ATOM   1814 C CG  . TRP A 1 236 ? 31.47071  11.65974  6.58972   1.000 42.18188  ? 236 TRP A CG  1 
ATOM   1815 C CD1 . TRP A 1 236 ? 30.30906  11.54333  5.89356   1.000 38.98329  ? 236 TRP A CD1 1 
ATOM   1816 C CD2 . TRP A 1 236 ? 31.14531  11.42603  7.95571   1.000 44.46885  ? 236 TRP A CD2 1 
ATOM   1817 N NE1 . TRP A 1 236 ? 29.26962  11.26188  6.74528   1.000 41.83215  ? 236 TRP A NE1 1 
ATOM   1818 C CE2 . TRP A 1 236 ? 29.75874  11.17741  8.01909   1.000 44.21401  ? 236 TRP A CE2 1 
ATOM   1819 C CE3 . TRP A 1 236 ? 31.89049  11.41017  9.13817   1.000 40.62244  ? 236 TRP A CE3 1 
ATOM   1820 C CZ2 . TRP A 1 236 ? 29.10150  10.91362  9.21918   1.000 42.82233  ? 236 TRP A CZ2 1 
ATOM   1821 C CZ3 . TRP A 1 236 ? 31.23428  11.16018  10.32819  1.000 42.21535  ? 236 TRP A CZ3 1 
ATOM   1822 C CH2 . TRP A 1 236 ? 29.85235  10.91711  10.36065  1.000 39.90590  ? 236 TRP A CH2 1 
ATOM   1823 N N   . ALA A 1 237 ? 33.43285  8.98507   7.48194   1.000 38.04194  ? 237 ALA A N   1 
ATOM   1824 C CA  . ALA A 1 237 ? 33.68163  8.42738   8.80462   1.000 36.51944  ? 237 ALA A CA  1 
ATOM   1825 C C   . ALA A 1 237 ? 35.02694  7.70829   8.93881   1.000 42.87885  ? 237 ALA A C   1 
ATOM   1826 O O   . ALA A 1 237 ? 35.47723  7.49460   10.07250  1.000 50.94581  ? 237 ALA A O   1 
ATOM   1827 C CB  . ALA A 1 237 ? 32.54927  7.46628   9.17617   1.000 35.78642  ? 237 ALA A CB  1 
ATOM   1828 N N   . THR A 1 238 ? 35.67964  7.31328   7.84248   1.000 34.49449  ? 238 THR A N   1 
ATOM   1829 C CA  . THR A 1 238 ? 36.89733  6.51437   7.95559   1.000 28.57133  ? 238 THR A CA  1 
ATOM   1830 C C   . THR A 1 238 ? 37.91902  6.93606   6.90994   1.000 38.41848  ? 238 THR A C   1 
ATOM   1831 O O   . THR A 1 238 ? 37.59830  7.60214   5.92414   1.000 46.87967  ? 238 THR A O   1 
ATOM   1832 C CB  . THR A 1 238 ? 36.62366  5.02732   7.76436   1.000 32.14659  ? 238 THR A CB  1 
ATOM   1833 O OG1 . THR A 1 238 ? 35.74465  4.85196   6.64784   1.000 44.82428  ? 238 THR A OG1 1 
ATOM   1834 C CG2 . THR A 1 238 ? 35.94390  4.47588   8.98865   1.000 30.09754  ? 238 THR A CG2 1 
ATOM   1835 N N   . VAL A 1 239 ? 39.16192  6.51471   7.12056   1.000 37.06025  ? 239 VAL A N   1 
ATOM   1836 C CA  . VAL A 1 239 ? 40.21062  6.68669   6.12472   1.000 29.31916  ? 239 VAL A CA  1 
ATOM   1837 C C   . VAL A 1 239 ? 41.07992  5.43676   6.09522   1.000 37.29650  ? 239 VAL A C   1 
ATOM   1838 O O   . VAL A 1 239 ? 41.19442  4.70905   7.08697   1.000 40.21384  ? 239 VAL A O   1 
ATOM   1839 C CB  . VAL A 1 239 ? 41.07941  7.94170   6.36737   1.000 32.59019  ? 239 VAL A CB  1 
ATOM   1840 C CG1 . VAL A 1 239 ? 40.27749  9.21602   6.08542   1.000 27.63393  ? 239 VAL A CG1 1 
ATOM   1841 C CG2 . VAL A 1 239 ? 41.69201  7.94378   7.77799   1.000 38.32376  ? 239 VAL A CG2 1 
ATOM   1842 N N   . SER A 1 240 ? 41.65647  5.16719   4.92416   1.000 42.77198  ? 240 SER A N   1 
ATOM   1843 C CA  . SER A 1 240 ? 42.60735  4.07728   4.78904   1.000 38.32015  ? 240 SER A CA  1 
ATOM   1844 C C   . SER A 1 240 ? 43.80855  4.32156   5.69672   1.000 38.13442  ? 240 SER A C   1 
ATOM   1845 O O   . SER A 1 240 ? 44.07435  5.44921   6.13863   1.000 29.97399  ? 240 SER A O   1 
ATOM   1846 C CB  . SER A 1 240 ? 43.09307  3.96621   3.34753   1.000 37.79753  ? 240 SER A CB  1 
ATOM   1847 O OG  . SER A 1 240 ? 43.44838  5.26414   2.88000   1.000 37.09647  ? 240 SER A OG  1 
ATOM   1848 N N   . ALA A 1 241 ? 44.55933  3.24652   5.95350   1.000 45.27874  ? 241 ALA A N   1 
ATOM   1849 C CA  . ALA A 1 241 ? 45.85384  3.40747   6.60622   1.000 43.34308  ? 241 ALA A CA  1 
ATOM   1850 C C   . ALA A 1 241 ? 46.72863  4.37797   5.82199   1.000 38.97160  ? 241 ALA A C   1 
ATOM   1851 O O   . ALA A 1 241 ? 47.26832  5.33997   6.38367   1.000 36.51555  ? 241 ALA A O   1 
ATOM   1852 C CB  . ALA A 1 241 ? 46.53450  2.05009   6.76427   1.000 41.46064  ? 241 ALA A CB  1 
ATOM   1853 N N   . GLY A 1 242 ? 46.82889  4.17072   4.50325   1.000 43.09608  ? 242 GLY A N   1 
ATOM   1854 C CA  . GLY A 1 242 ? 47.66155  5.03792   3.68891   1.000 40.32487  ? 242 GLY A CA  1 
ATOM   1855 C C   . GLY A 1 242 ? 47.29149  6.50257   3.81274   1.000 43.56900  ? 242 GLY A C   1 
ATOM   1856 O O   . GLY A 1 242 ? 48.16468  7.36410   3.95519   1.000 46.95824  ? 242 GLY A O   1 
ATOM   1857 N N   . GLU A 1 243 ? 45.99618  6.80943   3.76731   1.000 36.78672  ? 243 GLU A N   1 
ATOM   1858 C CA  . GLU A 1 243 ? 45.61162  8.21211   3.77814   1.000 35.14030  ? 243 GLU A CA  1 
ATOM   1859 C C   . GLU A 1 243 ? 45.80333  8.81834   5.15656   1.000 41.23853  ? 243 GLU A C   1 
ATOM   1860 O O   . GLU A 1 243 ? 46.15838  9.99759   5.28095   1.000 42.60166  ? 243 GLU A O   1 
ATOM   1861 C CB  . GLU A 1 243 ? 44.16946  8.37871   3.31279   1.000 35.12908  ? 243 GLU A CB  1 
ATOM   1862 C CG  . GLU A 1 243 ? 43.65513  9.81008   3.43609   1.000 38.64908  ? 243 GLU A CG  1 
ATOM   1863 C CD  . GLU A 1 243 ? 44.34285  10.80707  2.49195   1.000 43.54077  ? 243 GLU A CD  1 
ATOM   1864 O OE1 . GLU A 1 243 ? 44.09937  12.02471  2.62943   1.000 46.95357  ? 243 GLU A OE1 1 
ATOM   1865 O OE2 . GLU A 1 243 ? 45.12446  10.39088  1.61323   1.000 48.79679  ? 243 GLU A OE2 1 
ATOM   1866 N N   . ALA A 1 244 ? 45.55640  8.04182   6.21115   1.000 45.90584  ? 244 ALA A N   1 
ATOM   1867 C CA  . ALA A 1 244 ? 45.81558  8.56880   7.54093   1.000 41.27590  ? 244 ALA A CA  1 
ATOM   1868 C C   . ALA A 1 244 ? 47.29445  8.88491   7.67806   1.000 33.66343  ? 244 ALA A C   1 
ATOM   1869 O O   . ALA A 1 244 ? 47.67217  9.98085   8.10324   1.000 33.05396  ? 244 ALA A O   1 
ATOM   1870 C CB  . ALA A 1 244 ? 45.34709  7.58047   8.60660   1.000 38.87272  ? 244 ALA A CB  1 
ATOM   1871 N N   . ARG A 1 245 ? 48.14591  7.96639   7.22476   1.000 34.12732  ? 245 ARG A N   1 
ATOM   1872 C CA  . ARG A 1 245 ? 49.58381  8.18925   7.31316   1.000 45.72872  ? 245 ARG A CA  1 
ATOM   1873 C C   . ARG A 1 245 ? 49.99701  9.43116   6.53907   1.000 49.09919  ? 245 ARG A C   1 
ATOM   1874 O O   . ARG A 1 245 ? 50.78318  10.25069  7.02968   1.000 51.60886  ? 245 ARG A O   1 
ATOM   1875 C CB  . ARG A 1 245 ? 50.35027  6.96635   6.80707   1.000 37.10027  ? 245 ARG A CB  1 
ATOM   1876 C CG  . ARG A 1 245 ? 51.83988  7.21421   6.78886   1.000 39.10262  ? 245 ARG A CG  1 
ATOM   1877 C CD  . ARG A 1 245 ? 52.61239  5.98006   6.40375   1.000 42.35741  ? 245 ARG A CD  1 
ATOM   1878 N NE  . ARG A 1 245 ? 52.57276  4.96796   7.44936   1.000 42.46710  ? 245 ARG A NE  1 
ATOM   1879 C CZ  . ARG A 1 245 ? 53.32834  5.01731   8.53759   1.000 52.62231  ? 245 ARG A CZ  1 
ATOM   1880 N NH1 . ARG A 1 245 ? 54.15961  6.03243   8.71183   1.000 57.09573  ? 245 ARG A NH1 1 
ATOM   1881 N NH2 . ARG A 1 245 ? 53.25037  4.06547   9.45560   1.000 56.29369  ? 245 ARG A NH2 1 
ATOM   1882 N N   . ARG A 1 246 ? 49.47763  9.58724   5.32065   1.000 42.43597  ? 246 ARG A N   1 
ATOM   1883 C CA  . ARG A 1 246 ? 49.85001  10.74676  4.53318   1.000 36.33596  ? 246 ARG A CA  1 
ATOM   1884 C C   . ARG A 1 246 ? 49.37130  12.02318  5.20479   1.000 39.61720  ? 246 ARG A C   1 
ATOM   1885 O O   . ARG A 1 246 ? 50.09174  13.02905  5.23165   1.000 52.71789  ? 246 ARG A O   1 
ATOM   1886 C CB  . ARG A 1 246 ? 49.29275  10.60868  3.11916   1.000 45.69898  ? 246 ARG A CB  1 
ATOM   1887 C CG  . ARG A 1 246 ? 49.33024  11.89412  2.32424   1.000 45.13515  ? 246 ARG A CG  1 
ATOM   1888 C CD  . ARG A 1 246 ? 48.34652  11.85479  1.18654   1.000 42.83712  ? 246 ARG A CD  1 
ATOM   1889 N NE  . ARG A 1 246 ? 47.11208  12.54898  1.52986   1.000 41.73592  ? 246 ARG A NE  1 
ATOM   1890 C CZ  . ARG A 1 246 ? 47.01875  13.86445  1.70616   1.000 46.89733  ? 246 ARG A CZ  1 
ATOM   1891 N NH1 . ARG A 1 246 ? 48.10059  14.62773  1.58743   1.000 42.88896  ? 246 ARG A NH1 1 
ATOM   1892 N NH2 . ARG A 1 246 ? 45.84457  14.41936  2.00951   1.000 35.66899  ? 246 ARG A NH2 1 
ATOM   1893 N N   . ARG A 1 247 ? 48.17616  11.98397  5.79753   1.000 35.90475  ? 247 ARG A N   1 
ATOM   1894 C CA  . ARG A 1 247 ? 47.66133  13.14897  6.50999   1.000 40.91243  ? 247 ARG A CA  1 
ATOM   1895 C C   . ARG A 1 247 ? 48.45641  13.45192  7.77651   1.000 38.63452  ? 247 ARG A C   1 
ATOM   1896 O O   . ARG A 1 247 ? 48.61604  14.62306  8.13467   1.000 42.00671  ? 247 ARG A O   1 
ATOM   1897 C CB  . ARG A 1 247 ? 46.19124  12.94920  6.85504   1.000 38.15983  ? 247 ARG A CB  1 
ATOM   1898 C CG  . ARG A 1 247 ? 45.26975  12.90684  5.65305   1.000 30.84257  ? 247 ARG A CG  1 
ATOM   1899 C CD  . ARG A 1 247 ? 43.82960  12.97719  6.10876   1.000 34.93732  ? 247 ARG A CD  1 
ATOM   1900 N NE  . ARG A 1 247 ? 42.86927  12.55654  5.09349   1.000 40.01709  ? 247 ARG A NE  1 
ATOM   1901 C CZ  . ARG A 1 247 ? 41.55937  12.75464  5.20248   1.000 46.68484  ? 247 ARG A CZ  1 
ATOM   1902 N NH1 . ARG A 1 247 ? 41.07143  13.35574  6.28159   1.000 52.38529  ? 247 ARG A NH1 1 
ATOM   1903 N NH2 . ARG A 1 247 ? 40.73344  12.35536  4.24958   1.000 44.74541  ? 247 ARG A NH2 1 
ATOM   1904 N N   . ALA A 1 248 ? 48.96052  12.42960  8.46681   1.000 36.24590  ? 248 ALA A N   1 
ATOM   1905 C CA  . ALA A 1 248 ? 49.75568  12.68689  9.66808   1.000 37.62801  ? 248 ALA A CA  1 
ATOM   1906 C C   . ALA A 1 248 ? 51.13127  13.24508  9.32657   1.000 43.13475  ? 248 ALA A C   1 
ATOM   1907 O O   . ALA A 1 248 ? 51.57827  14.20639  9.96386   1.000 47.69172  ? 248 ALA A O   1 
ATOM   1908 C CB  . ALA A 1 248 ? 49.90383  11.42121  10.51370  1.000 29.58624  ? 248 ALA A CB  1 
ATOM   1909 N N   . THR A 1 249 ? 51.82676  12.67327  8.33213   1.000 43.03576  ? 249 THR A N   1 
ATOM   1910 C CA  . THR A 1 249 ? 53.17586  13.17080  8.08136   1.000 45.18081  ? 249 THR A CA  1 
ATOM   1911 C C   . THR A 1 249 ? 53.13503  14.56357  7.47436   1.000 47.11275  ? 249 THR A C   1 
ATOM   1912 O O   . THR A 1 249 ? 54.08786  15.33578  7.64132   1.000 49.97527  ? 249 THR A O   1 
ATOM   1913 C CB  . THR A 1 249 ? 54.01067  12.22417  7.18704   1.000 46.83375  ? 249 THR A CB  1 
ATOM   1914 O OG1 . THR A 1 249 ? 53.80075  12.52956  5.81451   1.000 54.01929  ? 249 THR A OG1 1 
ATOM   1915 C CG2 . THR A 1 249 ? 53.71415  10.73835  7.42709   1.000 39.18600  ? 249 THR A CG2 1 
ATOM   1916 N N   . LEU A 1 250 ? 52.04623  14.90291  6.77134   1.000 54.73302  ? 250 LEU A N   1 
ATOM   1917 C CA  . LEU A 1 250 ? 51.91605  16.24924  6.22054   1.000 50.23726  ? 250 LEU A CA  1 
ATOM   1918 C C   . LEU A 1 250 ? 51.78312  17.26623  7.33808   1.000 50.74566  ? 250 LEU A C   1 
ATOM   1919 O O   . LEU A 1 250 ? 52.44636  18.31034  7.32315   1.000 53.33457  ? 250 LEU A O   1 
ATOM   1920 C CB  . LEU A 1 250 ? 50.71242  16.33730  5.28677   1.000 36.69033  ? 250 LEU A CB  1 
ATOM   1921 C CG  . LEU A 1 250 ? 50.32878  17.74077  4.76317   1.000 43.44956  ? 250 LEU A CG  1 
ATOM   1922 C CD1 . LEU A 1 250 ? 51.50645  18.58225  4.28516   1.000 41.32866  ? 250 LEU A CD1 1 
ATOM   1923 C CD2 . LEU A 1 250 ? 49.29918  17.65009  3.66128   1.000 38.00154  ? 250 LEU A CD2 1 
ATOM   1924 N N   . LEU A 1 251 ? 50.94569  16.96023  8.32868   1.000 48.27795  ? 251 LEU A N   1 
ATOM   1925 C CA  . LEU A 1 251 ? 50.78411  17.85091  9.47127   1.000 45.01780  ? 251 LEU A CA  1 
ATOM   1926 C C   . LEU A 1 251 ? 52.07224  17.96940  10.27165  1.000 44.38424  ? 251 LEU A C   1 
ATOM   1927 O O   . LEU A 1 251 ? 52.42082  19.05845  10.74158  1.000 49.45118  ? 251 LEU A O   1 
ATOM   1928 C CB  . LEU A 1 251 ? 49.65599  17.34731  10.35594  1.000 43.24005  ? 251 LEU A CB  1 
ATOM   1929 C CG  . LEU A 1 251 ? 49.39306  18.25498  11.52570  1.000 37.28904  ? 251 LEU A CG  1 
ATOM   1930 C CD1 . LEU A 1 251 ? 47.98463  18.76870  11.38574  1.000 34.93532  ? 251 LEU A CD1 1 
ATOM   1931 C CD2 . LEU A 1 251 ? 49.55291  17.40761  12.73093  1.000 38.99997  ? 251 LEU A CD2 1 
ATOM   1932 N N   . ALA A 1 252 ? 52.79111  16.85861  10.44103  1.000 42.12393  ? 252 ALA A N   1 
ATOM   1933 C CA  . ALA A 1 252 ? 54.11927  16.92162  11.03912  1.000 41.69480  ? 252 ALA A CA  1 
ATOM   1934 C C   . ALA A 1 252 ? 55.00320  17.92452  10.30723  1.000 43.47314  ? 252 ALA A C   1 
ATOM   1935 O O   . ALA A 1 252 ? 55.60707  18.80616  10.92689  1.000 49.88677  ? 252 ALA A O   1 
ATOM   1936 C CB  . ALA A 1 252 ? 54.75290  15.53201  11.03566  1.000 44.46636  ? 252 ALA A CB  1 
ATOM   1937 N N   . ARG A 1 253 ? 55.07336  17.81978  8.97815   1.000 45.85973  ? 253 ARG A N   1 
ATOM   1938 C CA  . ARG A 1 253 ? 55.89117  18.75712  8.21505   1.000 50.08357  ? 253 ARG A CA  1 
ATOM   1939 C C   . ARG A 1 253 ? 55.37866  20.18033  8.36719   1.000 49.78884  ? 253 ARG A C   1 
ATOM   1940 O O   . ARG A 1 253 ? 56.16894  21.12771  8.42741   1.000 49.11684  ? 253 ARG A O   1 
ATOM   1941 C CB  . ARG A 1 253 ? 55.92144  18.35114  6.74657   1.000 49.55585  ? 253 ARG A CB  1 
ATOM   1942 C CG  . ARG A 1 253 ? 56.79536  17.14705  6.48638   1.000 69.56580  ? 253 ARG A CG  1 
ATOM   1943 C CD  . ARG A 1 253 ? 56.82781  16.79336  5.00051   1.000 81.77008  ? 253 ARG A CD  1 
ATOM   1944 N NE  . ARG A 1 253 ? 57.38887  17.86393  4.18784   1.000 93.54140  ? 253 ARG A NE  1 
ATOM   1945 C CZ  . ARG A 1 253 ? 56.72825  18.49957  3.21970   1.000 105.75321 ? 253 ARG A CZ  1 
ATOM   1946 N NH1 . ARG A 1 253 ? 57.33754  19.45763  2.51324   1.000 104.99356 ? 253 ARG A NH1 1 
ATOM   1947 N NH2 . ARG A 1 253 ? 55.46426  18.17307  2.95111   1.000 99.16307  ? 253 ARG A NH2 1 
ATOM   1948 N N   . LEU A 1 254 ? 54.05493  20.34534  8.45724   1.000 54.25707  ? 254 LEU A N   1 
ATOM   1949 C CA  . LEU A 1 254 ? 53.45105  21.67250  8.54854   1.000 58.12324  ? 254 LEU A CA  1 
ATOM   1950 C C   . LEU A 1 254 ? 53.80084  22.39252  9.84201   1.000 55.06201  ? 254 LEU A C   1 
ATOM   1951 O O   . LEU A 1 254 ? 53.76754  23.62911  9.87203   1.000 51.51977  ? 254 LEU A O   1 
ATOM   1952 C CB  . LEU A 1 254 ? 51.93078  21.57474  8.41406   1.000 55.14754  ? 254 LEU A CB  1 
ATOM   1953 C CG  . LEU A 1 254 ? 51.43125  21.33184  6.98943   1.000 54.04009  ? 254 LEU A CG  1 
ATOM   1954 C CD1 . LEU A 1 254 ? 49.93013  21.08364  6.96927   1.000 58.74846  ? 254 LEU A CD1 1 
ATOM   1955 C CD2 . LEU A 1 254 ? 51.79286  22.50255  6.13557   1.000 43.56280  ? 254 LEU A CD2 1 
ATOM   1956 N N   . VAL A 1 255 ? 54.12897  21.65308  10.90103  1.000 58.10841  ? 255 VAL A N   1 
ATOM   1957 C CA  . VAL A 1 255 ? 54.55773  22.22739  12.17187  1.000 57.85500  ? 255 VAL A CA  1 
ATOM   1958 C C   . VAL A 1 255 ? 56.05100  22.04684  12.39970  1.000 63.28848  ? 255 VAL A C   1 
ATOM   1959 O O   . VAL A 1 255 ? 56.54635  22.35005  13.48959  1.000 64.70102  ? 255 VAL A O   1 
ATOM   1960 C CB  . VAL A 1 255 ? 53.76440  21.64732  13.34800  1.000 44.86205  ? 255 VAL A CB  1 
ATOM   1961 C CG1 . VAL A 1 255 ? 52.29764  22.02943  13.23703  1.000 47.41465  ? 255 VAL A CG1 1 
ATOM   1962 C CG2 . VAL A 1 255 ? 53.92031  20.14309  13.38117  1.000 40.87166  ? 255 VAL A CG2 1 
ATOM   1963 N N   . GLY A 1 256 ? 56.78057  21.54589  11.40461  1.000 65.76115  ? 256 GLY A N   1 
ATOM   1964 C CA  . GLY A 1 256 ? 58.22526  21.50793  11.48235  1.000 66.35099  ? 256 GLY A CA  1 
ATOM   1965 C C   . GLY A 1 256 ? 58.83434  20.22519  11.99362  1.000 57.67700  ? 256 GLY A C   1 
ATOM   1966 O O   . GLY A 1 256 ? 59.94631  20.26087  12.52631  1.000 53.34801  ? 256 GLY A O   1 
ATOM   1967 N N   . CYS A 1 257 ? 58.16092  19.08935  11.82272  1.000 52.07240  ? 257 CYS A N   1 
ATOM   1968 C CA  . CYS A 1 257 ? 58.64451  17.79994  12.31730  1.000 58.55498  ? 257 CYS A CA  1 
ATOM   1969 C C   . CYS A 1 257 ? 58.90327  16.86157  11.15415  1.000 71.03864  ? 257 CYS A C   1 
ATOM   1970 O O   . CYS A 1 257 ? 57.95312  16.30474  10.57718  1.000 72.38113  ? 257 CYS A O   1 
ATOM   1971 C CB  . CYS A 1 257 ? 57.63979  17.17945  13.28105  1.000 58.02506  ? 257 CYS A CB  1 
ATOM   1972 S SG  . CYS A 1 257 ? 57.40218  18.15081  14.77728  1.000 67.42984  ? 257 CYS A SG  1 
ATOM   1973 N N   . PRO A 1 258 ? 60.15893  16.66497  10.75435  1.000 84.42361  ? 258 PRO A N   1 
ATOM   1974 C CA  . PRO A 1 258 ? 60.37694  15.77337  9.61783   1.000 93.69525  ? 258 PRO A CA  1 
ATOM   1975 C C   . PRO A 1 258 ? 61.12086  14.49742  10.00985  1.000 92.75362  ? 258 PRO A C   1 
ATOM   1976 O O   . PRO A 1 258 ? 60.63850  13.41249  9.68159   1.000 89.36423  ? 258 PRO A O   1 
ATOM   1977 C CB  . PRO A 1 258 ? 61.21370  16.64254  8.65565   1.000 97.84788  ? 258 PRO A CB  1 
ATOM   1978 C CG  . PRO A 1 258 ? 61.60490  17.91702  9.47181   1.000 93.70222  ? 258 PRO A CG  1 
ATOM   1979 C CD  . PRO A 1 258 ? 61.27538  17.60512  10.90937  1.000 89.10585  ? 258 PRO A CD  1 
ATOM   1980 N N   . ASN A 1 265 ? 61.29212  6.20790   10.20789  1.000 93.58425  ? 265 ASN A N   1 
ATOM   1981 C CA  . ASN A 1 265 ? 61.13405  5.97956   11.64511  1.000 87.20898  ? 265 ASN A CA  1 
ATOM   1982 C C   . ASN A 1 265 ? 60.06712  6.92375   12.23603  1.000 74.89197  ? 265 ASN A C   1 
ATOM   1983 O O   . ASN A 1 265 ? 60.26267  8.14120   12.31671  1.000 70.67788  ? 265 ASN A O   1 
ATOM   1984 C CB  . ASN A 1 265 ? 62.48833  6.15008   12.35550  1.000 89.79953  ? 265 ASN A CB  1 
ATOM   1985 C CG  . ASN A 1 265 ? 62.46519  5.68176   13.81347  1.000 86.01753  ? 265 ASN A CG  1 
ATOM   1986 O OD1 . ASN A 1 265 ? 61.68665  6.18727   14.61834  1.000 75.96372  ? 265 ASN A OD1 1 
ATOM   1987 N ND2 . ASN A 1 265 ? 63.34361  4.73137   14.15946  1.000 87.13953  ? 265 ASN A ND2 1 
ATOM   1988 N N   . ASP A 1 266 ? 58.93111  6.35030   12.64679  1.000 63.43232  ? 266 ASP A N   1 
ATOM   1989 C CA  . ASP A 1 266 ? 57.82092  7.14915   13.15542  1.000 53.95427  ? 266 ASP A CA  1 
ATOM   1990 C C   . ASP A 1 266 ? 58.02402  7.61023   14.58850  1.000 60.11576  ? 266 ASP A C   1 
ATOM   1991 O O   . ASP A 1 266 ? 57.34179  8.54862   15.02417  1.000 58.20656  ? 266 ASP A O   1 
ATOM   1992 C CB  . ASP A 1 266 ? 56.51272  6.36364   13.08998  1.000 52.54447  ? 266 ASP A CB  1 
ATOM   1993 C CG  . ASP A 1 266 ? 56.19539  5.87241   11.69982  1.000 62.25237  ? 266 ASP A CG  1 
ATOM   1994 O OD1 . ASP A 1 266 ? 56.58097  6.54985   10.72051  1.000 69.12875  ? 266 ASP A OD1 1 
ATOM   1995 O OD2 . ASP A 1 266 ? 55.55727  4.80490   11.58887  1.000 62.44043  ? 266 ASP A OD2 1 
ATOM   1996 N N   . THR A 1 267 ? 58.91885  6.95526   15.33421  1.000 62.91237  ? 267 THR A N   1 
ATOM   1997 C CA  . THR A 1 267 ? 59.16063  7.34068   16.72172  1.000 61.00629  ? 267 THR A CA  1 
ATOM   1998 C C   . THR A 1 267 ? 59.66736  8.77833   16.81129  1.000 55.19388  ? 267 THR A C   1 
ATOM   1999 O O   . THR A 1 267 ? 59.13405  9.58672   17.58167  1.000 46.87978  ? 267 THR A O   1 
ATOM   2000 C CB  . THR A 1 267 ? 60.15471  6.36653   17.37456  1.000 67.03851  ? 267 THR A CB  1 
ATOM   2001 O OG1 . THR A 1 267 ? 59.66719  5.01876   17.26805  1.000 67.65517  ? 267 THR A OG1 1 
ATOM   2002 C CG2 . THR A 1 267 ? 60.35890  6.70131   18.84507  1.000 52.41191  ? 267 THR A CG2 1 
ATOM   2003 N N   . GLU A 1 268 ? 60.69615  9.11692   16.01529  1.000 63.14747  ? 268 GLU A N   1 
ATOM   2004 C CA  . GLU A 1 268 ? 61.28123  10.45782  16.06365  1.000 63.19441  ? 268 GLU A CA  1 
ATOM   2005 C C   . GLU A 1 268 ? 60.28457  11.52630  15.63024  1.000 58.60278  ? 268 GLU A C   1 
ATOM   2006 O O   . GLU A 1 268 ? 60.32961  12.65547  16.13296  1.000 58.18809  ? 268 GLU A O   1 
ATOM   2007 C CB  . GLU A 1 268 ? 62.54147  10.52114  15.19700  1.000 65.82912  ? 268 GLU A CB  1 
ATOM   2008 C CG  . GLU A 1 268 ? 63.26796  9.19128   15.08513  1.000 86.49193  ? 268 GLU A CG  1 
ATOM   2009 C CD  . GLU A 1 268 ? 64.29192  9.16568   13.95625  1.000 107.73478 ? 268 GLU A CD  1 
ATOM   2010 O OE1 . GLU A 1 268 ? 65.08830  8.19561   13.89416  1.000 117.28487 ? 268 GLU A OE1 1 
ATOM   2011 O OE2 . GLU A 1 268 ? 64.29742  10.11105  13.13118  1.000 109.75567 ? 268 GLU A OE2 1 
ATOM   2012 N N   . LEU A 1 269 ? 59.36747  11.18991  14.72020  1.000 56.39176  ? 269 LEU A N   1 
ATOM   2013 C CA  . LEU A 1 269 ? 58.41715  12.18655  14.24646  1.000 54.20411  ? 269 LEU A CA  1 
ATOM   2014 C C   . LEU A 1 269 ? 57.34006  12.44946  15.29233  1.000 55.44184  ? 269 LEU A C   1 
ATOM   2015 O O   . LEU A 1 269 ? 57.07145  13.60718  15.63335  1.000 60.16701  ? 269 LEU A O   1 
ATOM   2016 C CB  . LEU A 1 269 ? 57.81989  11.75315  12.90134  1.000 46.45436  ? 269 LEU A CB  1 
ATOM   2017 C CG  . LEU A 1 269 ? 56.71335  12.61536  12.28513  1.000 44.99970  ? 269 LEU A CG  1 
ATOM   2018 C CD1 . LEU A 1 269 ? 56.69645  12.39794  10.80986  1.000 54.35920  ? 269 LEU A CD1 1 
ATOM   2019 C CD2 . LEU A 1 269 ? 55.31512  12.31063  12.80862  1.000 43.10069  ? 269 LEU A CD2 1 
ATOM   2020 N N   . ILE A 1 270 ? 56.71781  11.38904  15.82244  1.000 57.92154  ? 270 ILE A N   1 
ATOM   2021 C CA  . ILE A 1 270 ? 55.70398  11.56236  16.86976  1.000 49.66949  ? 270 ILE A CA  1 
ATOM   2022 C C   . ILE A 1 270 ? 56.30513  12.25848  18.08432  1.000 44.84498  ? 270 ILE A C   1 
ATOM   2023 O O   . ILE A 1 270 ? 55.70209  13.17252  18.65733  1.000 44.88901  ? 270 ILE A O   1 
ATOM   2024 C CB  . ILE A 1 270 ? 55.08530  10.21079  17.26516  1.000 41.57861  ? 270 ILE A CB  1 
ATOM   2025 C CG1 . ILE A 1 270 ? 54.22056  9.65000   16.15963  1.000 41.73912  ? 270 ILE A CG1 1 
ATOM   2026 C CG2 . ILE A 1 270 ? 54.23438  10.35468  18.48612  1.000 45.73415  ? 270 ILE A CG2 1 
ATOM   2027 C CD1 . ILE A 1 270 ? 54.27181  8.14303   16.14490  1.000 49.54492  ? 270 ILE A CD1 1 
ATOM   2028 N N   . ALA A 1 271 ? 57.49869  11.82601  18.50208  1.000 46.45214  ? 271 ALA A N   1 
ATOM   2029 C CA  . ALA A 1 271 ? 58.18082  12.50381  19.59556  1.000 50.12379  ? 271 ALA A CA  1 
ATOM   2030 C C   . ALA A 1 271 ? 58.20207  14.01257  19.36893  1.000 58.52541  ? 271 ALA A C   1 
ATOM   2031 O O   . ALA A 1 271 ? 57.87688  14.79068  20.27319  1.000 63.53698  ? 271 ALA A O   1 
ATOM   2032 C CB  . ALA A 1 271 ? 59.59183  11.94431  19.75264  1.000 45.35423  ? 271 ALA A CB  1 
ATOM   2033 N N   . CYS A 1 272 ? 58.53026  14.44444  18.14982  1.000 53.76615  ? 272 CYS A N   1 
ATOM   2034 C CA  . CYS A 1 272 ? 58.52445  15.87231  17.85442  1.000 50.00899  ? 272 CYS A CA  1 
ATOM   2035 C C   . CYS A 1 272 ? 57.11927  16.44401  17.99066  1.000 45.62937  ? 272 CYS A C   1 
ATOM   2036 O O   . CYS A 1 272 ? 56.92643  17.49740  18.61119  1.000 46.17247  ? 272 CYS A O   1 
ATOM   2037 C CB  . CYS A 1 272 ? 59.08874  16.12595  16.45341  1.000 51.20632  ? 272 CYS A CB  1 
ATOM   2038 S SG  . CYS A 1 272 ? 59.10700  17.87511  15.91873  1.000 70.21586  ? 272 CYS A SG  1 
ATOM   2039 N N   . LEU A 1 273 ? 56.12203  15.75603  17.41624  1.000 41.01535  ? 273 LEU A N   1 
ATOM   2040 C CA  . LEU A 1 273 ? 54.73507  16.20265  17.53444  1.000 43.42100  ? 273 LEU A CA  1 
ATOM   2041 C C   . LEU A 1 273 ? 54.33113  16.37689  18.99612  1.000 49.18339  ? 273 LEU A C   1 
ATOM   2042 O O   . LEU A 1 273 ? 53.61252  17.32056  19.34030  1.000 51.00716  ? 273 LEU A O   1 
ATOM   2043 C CB  . LEU A 1 273 ? 53.80510  15.21085  16.83913  1.000 40.96300  ? 273 LEU A CB  1 
ATOM   2044 C CG  . LEU A 1 273 ? 53.59438  15.41023  15.32984  1.000 47.03609  ? 273 LEU A CG  1 
ATOM   2045 C CD1 . LEU A 1 273 ? 52.79782  14.26448  14.71364  1.000 44.09584  ? 273 LEU A CD1 1 
ATOM   2046 C CD2 . LEU A 1 273 ? 52.89289  16.72439  15.04093  1.000 49.22491  ? 273 LEU A CD2 1 
ATOM   2047 N N   . ARG A 1 274 ? 54.80920  15.49519  19.87763  1.000 47.08251  ? 274 ARG A N   1 
ATOM   2048 C CA  A ARG A 1 274 ? 54.48512  15.57982  21.29652  0.583 41.76285  ? 274 ARG A CA  1 
ATOM   2049 C CA  B ARG A 1 274 ? 54.45719  15.59818  21.28633  0.417 41.60596  ? 274 ARG A CA  1 
ATOM   2050 C C   . ARG A 1 274 ? 55.09331  16.80262  21.96873  1.000 46.88885  ? 274 ARG A C   1 
ATOM   2051 O O   . ARG A 1 274 ? 54.71525  17.11559  23.10477  1.000 50.86832  ? 274 ARG A O   1 
ATOM   2052 C CB  A ARG A 1 274 ? 54.95696  14.32047  22.03207  0.583 38.85018  ? 274 ARG A CB  1 
ATOM   2053 C CB  B ARG A 1 274 ? 54.84839  14.31484  22.02301  0.417 38.87059  ? 274 ARG A CB  1 
ATOM   2054 C CG  A ARG A 1 274 ? 54.26483  13.04110  21.61578  0.583 36.21309  ? 274 ARG A CG  1 
ATOM   2055 C CG  B ARG A 1 274 ? 53.66783  13.43142  22.38233  0.417 32.51297  ? 274 ARG A CG  1 
ATOM   2056 C CD  A ARG A 1 274 ? 54.52624  11.91826  22.61978  0.583 36.87424  ? 274 ARG A CD  1 
ATOM   2057 C CD  B ARG A 1 274 ? 54.12570  12.05943  22.85353  0.417 35.90270  ? 274 ARG A CD  1 
ATOM   2058 N NE  A ARG A 1 274 ? 55.95001  11.70154  22.86192  0.583 37.56116  ? 274 ARG A NE  1 
ATOM   2059 N NE  B ARG A 1 274 ? 53.24220  10.99734  22.38341  0.417 33.35812  ? 274 ARG A NE  1 
ATOM   2060 C CZ  A ARG A 1 274 ? 56.66155  10.73286  22.30036  0.583 39.42035  ? 274 ARG A CZ  1 
ATOM   2061 C CZ  B ARG A 1 274 ? 53.59531  9.72234   22.29737  0.417 34.95170  ? 274 ARG A CZ  1 
ATOM   2062 N NH1 A ARG A 1 274 ? 56.07731  9.88749   21.46132  0.583 38.59425  ? 274 ARG A NH1 1 
ATOM   2063 N NH1 B ARG A 1 274 ? 54.81449  9.34939   22.65259  0.417 37.43233  ? 274 ARG A NH1 1 
ATOM   2064 N NH2 A ARG A 1 274 ? 57.95353  10.60953  22.57848  0.583 42.52620  ? 274 ARG A NH2 1 
ATOM   2065 N NH2 B ARG A 1 274 ? 52.73148  8.82512   21.85241  0.417 34.51027  ? 274 ARG A NH2 1 
ATOM   2066 N N   . THR A 1 275 ? 56.03508  17.48756  21.31844  1.000 41.55208  ? 275 THR A N   1 
ATOM   2067 C CA  . THR A 1 275 ? 56.62917  18.68306  21.89785  1.000 39.85998  ? 275 THR A CA  1 
ATOM   2068 C C   . THR A 1 275 ? 56.00901  19.95580  21.33666  1.000 47.30035  ? 275 THR A C   1 
ATOM   2069 O O   . THR A 1 275 ? 56.59030  21.03540  21.47220  1.000 58.35096  ? 275 THR A O   1 
ATOM   2070 C CB  . THR A 1 275 ? 58.15166  18.68936  21.70425  1.000 41.95899  ? 275 THR A CB  1 
ATOM   2071 O OG1 . THR A 1 275 ? 58.47742  18.92172  20.33420  1.000 51.40282  ? 275 THR A OG1 1 
ATOM   2072 C CG2 . THR A 1 275 ? 58.74581  17.36398  22.12592  1.000 46.56750  ? 275 THR A CG2 1 
ATOM   2073 N N   . ARG A 1 276 ? 54.84216  19.85490  20.71273  1.000 43.72874  ? 276 ARG A N   1 
ATOM   2074 C CA  . ARG A 1 276 ? 54.26481  21.06109  20.14639  1.000 47.19710  ? 276 ARG A CA  1 
ATOM   2075 C C   . ARG A 1 276 ? 53.02297  21.48352  20.92668  1.000 45.53378  ? 276 ARG A C   1 
ATOM   2076 O O   . ARG A 1 276 ? 52.24136  20.63809  21.38889  1.000 34.77423  ? 276 ARG A O   1 
ATOM   2077 C CB  . ARG A 1 276 ? 53.89568  20.89859  18.66149  1.000 44.31120  ? 276 ARG A CB  1 
ATOM   2078 C CG  . ARG A 1 276 ? 55.07356  20.55625  17.76673  1.000 49.73503  ? 276 ARG A CG  1 
ATOM   2079 C CD  . ARG A 1 276 ? 55.57419  21.79853  17.03512  1.000 55.12603  ? 276 ARG A CD  1 
ATOM   2080 N NE  . ARG A 1 276 ? 56.91823  21.62622  16.47449  1.000 69.75513  ? 276 ARG A NE  1 
ATOM   2081 C CZ  . ARG A 1 276 ? 58.05128  21.90483  17.11280  1.000 74.27588  ? 276 ARG A CZ  1 
ATOM   2082 N NH1 . ARG A 1 276 ? 58.01048  22.37135  18.35938  1.000 76.86579  ? 276 ARG A NH1 1 
ATOM   2083 N NH2 . ARG A 1 276 ? 59.22170  21.71703  16.50074  1.000 68.11725  ? 276 ARG A NH2 1 
ATOM   2084 N N   . PRO A 1 277 ? 52.82681  22.79153  21.09187  1.000 41.99379  ? 277 PRO A N   1 
ATOM   2085 C CA  . PRO A 1 277 ? 51.60970  23.28133  21.73398  1.000 43.66281  ? 277 PRO A CA  1 
ATOM   2086 C C   . PRO A 1 277 ? 50.38091  22.69151  21.06344  1.000 48.36131  ? 277 PRO A C   1 
ATOM   2087 O O   . PRO A 1 277 ? 50.38252  22.42436  19.85887  1.000 55.62164  ? 277 PRO A O   1 
ATOM   2088 C CB  . PRO A 1 277 ? 51.68550  24.79618  21.52201  1.000 48.02751  ? 277 PRO A CB  1 
ATOM   2089 C CG  . PRO A 1 277 ? 53.11607  25.09020  21.27182  1.000 46.69650  ? 277 PRO A CG  1 
ATOM   2090 C CD  . PRO A 1 277 ? 53.67847  23.88639  20.60067  1.000 43.44994  ? 277 PRO A CD  1 
ATOM   2091 N N   . ALA A 1 278 ? 49.32570  22.47780  21.85747  1.000 51.21718  ? 278 ALA A N   1 
ATOM   2092 C CA  . ALA A 1 278 ? 48.09646  21.93576  21.28890  1.000 44.00758  ? 278 ALA A CA  1 
ATOM   2093 C C   . ALA A 1 278 ? 47.52856  22.85316  20.21808  1.000 46.76283  ? 278 ALA A C   1 
ATOM   2094 O O   . ALA A 1 278 ? 46.96171  22.37449  19.22803  1.000 39.03575  ? 278 ALA A O   1 
ATOM   2095 C CB  . ALA A 1 278 ? 47.05792  21.69822  22.37737  1.000 38.83416  ? 278 ALA A CB  1 
ATOM   2096 N N   . GLN A 1 279 ? 47.69651  24.16778  20.38051  1.000 50.43105  ? 279 GLN A N   1 
ATOM   2097 C CA  . GLN A 1 279 ? 47.11774  25.09781  19.41721  1.000 45.58593  ? 279 GLN A CA  1 
ATOM   2098 C C   . GLN A 1 279 ? 47.81209  25.00695  18.06466  1.000 51.97735  ? 279 GLN A C   1 
ATOM   2099 O O   . GLN A 1 279 ? 47.16404  25.15636  17.02262  1.000 60.91991  ? 279 GLN A O   1 
ATOM   2100 C CB  . GLN A 1 279 ? 47.17994  26.52346  19.95477  1.000 44.30578  ? 279 GLN A CB  1 
ATOM   2101 C CG  . GLN A 1 279 ? 46.23666  27.46350  19.24748  1.000 51.45198  ? 279 GLN A CG  1 
ATOM   2102 C CD  . GLN A 1 279 ? 44.78878  27.04141  19.37977  1.000 55.88045  ? 279 GLN A CD  1 
ATOM   2103 O OE1 . GLN A 1 279 ? 44.32552  26.69707  20.47343  1.000 55.92051  ? 279 GLN A OE1 1 
ATOM   2104 N NE2 . GLN A 1 279 ? 44.06204  27.06120  18.26453  1.000 55.95224  ? 279 GLN A NE2 1 
ATOM   2105 N N   . ASP A 1 280 ? 49.12763  24.77065  18.05701  1.000 50.55670  ? 280 ASP A N   1 
ATOM   2106 C CA  . ASP A 1 280 ? 49.84931  24.66452  16.79252  1.000 51.58978  ? 280 ASP A CA  1 
ATOM   2107 C C   . ASP A 1 280 ? 49.29352  23.52636  15.94486  1.000 58.02471  ? 280 ASP A C   1 
ATOM   2108 O O   . ASP A 1 280 ? 49.23422  23.62972  14.71427  1.000 59.53526  ? 280 ASP A O   1 
ATOM   2109 C CB  . ASP A 1 280 ? 51.34588  24.45748  17.04246  1.000 55.74218  ? 280 ASP A CB  1 
ATOM   2110 C CG  . ASP A 1 280 ? 52.07205  25.74646  17.39360  1.000 67.69498  ? 280 ASP A CG  1 
ATOM   2111 O OD1 . ASP A 1 280 ? 51.39140  26.78821  17.55085  1.000 71.85316  ? 280 ASP A OD1 1 
ATOM   2112 O OD2 . ASP A 1 280 ? 53.32388  25.70970  17.51373  1.000 69.91630  ? 280 ASP A OD2 1 
ATOM   2113 N N   . LEU A 1 281 ? 48.87996  22.42925  16.58604  1.000 56.56340  ? 281 LEU A N   1 
ATOM   2114 C CA  . LEU A 1 281 ? 48.27011  21.33344  15.84210  1.000 44.39148  ? 281 LEU A CA  1 
ATOM   2115 C C   . LEU A 1 281 ? 46.88644  21.73291  15.34820  1.000 45.74324  ? 281 LEU A C   1 
ATOM   2116 O O   . LEU A 1 281 ? 46.55781  21.54915  14.16770  1.000 50.80825  ? 281 LEU A O   1 
ATOM   2117 C CB  . LEU A 1 281 ? 48.20030  20.07019  16.70979  1.000 39.49971  ? 281 LEU A CB  1 
ATOM   2118 C CG  . LEU A 1 281 ? 49.47144  19.52243  17.37270  1.000 37.76385  ? 281 LEU A CG  1 
ATOM   2119 C CD1 . LEU A 1 281 ? 49.15724  18.21231  18.03017  1.000 39.04740  ? 281 LEU A CD1 1 
ATOM   2120 C CD2 . LEU A 1 281 ? 50.63820  19.34696  16.39847  1.000 36.17525  ? 281 LEU A CD2 1 
ATOM   2121 N N   . VAL A 1 282 ? 46.06700  22.29680  16.24211  1.000 40.63319  ? 282 VAL A N   1 
ATOM   2122 C CA  . VAL A 1 282 ? 44.73143  22.75799  15.86394  1.000 42.08270  ? 282 VAL A CA  1 
ATOM   2123 C C   . VAL A 1 282 ? 44.82156  23.72458  14.68400  1.000 45.92780  ? 282 VAL A C   1 
ATOM   2124 O O   . VAL A 1 282 ? 44.10097  23.58588  13.68775  1.000 46.43879  ? 282 VAL A O   1 
ATOM   2125 C CB  . VAL A 1 282 ? 44.02049  23.38314  17.08409  1.000 35.73743  ? 282 VAL A CB  1 
ATOM   2126 C CG1 . VAL A 1 282 ? 42.76084  24.12213  16.68574  1.000 31.72233  ? 282 VAL A CG1 1 
ATOM   2127 C CG2 . VAL A 1 282 ? 43.67249  22.29399  18.09143  1.000 33.84579  ? 282 VAL A CG2 1 
ATOM   2128 N N   . ASP A 1 283 ? 45.76010  24.67835  14.75603  1.000 47.68161  ? 283 ASP A N   1 
ATOM   2129 C CA  . ASP A 1 283 ? 45.87848  25.73465  13.74925  1.000 53.89966  ? 283 ASP A CA  1 
ATOM   2130 C C   . ASP A 1 283 ? 46.14881  25.20346  12.33553  1.000 52.32959  ? 283 ASP A C   1 
ATOM   2131 O O   . ASP A 1 283 ? 45.81482  25.88505  11.35591  1.000 52.03773  ? 283 ASP A O   1 
ATOM   2132 C CB  . ASP A 1 283 ? 46.98772  26.71562  14.15574  1.000 56.48878  ? 283 ASP A CB  1 
ATOM   2133 C CG  . ASP A 1 283 ? 46.52062  27.75442  15.18342  1.000 57.71393  ? 283 ASP A CG  1 
ATOM   2134 O OD1 . ASP A 1 283 ? 45.29020  27.86116  15.41387  1.000 52.10279  ? 283 ASP A OD1 1 
ATOM   2135 O OD2 . ASP A 1 283 ? 47.39186  28.46419  15.75332  1.000 60.92912  ? 283 ASP A OD2 1 
ATOM   2136 N N   . HIS A 1 284 ? 46.72793  24.00623  12.20580  1.000 48.86802  ? 284 HIS A N   1 
ATOM   2137 C CA  . HIS A 1 284 ? 47.07332  23.43139  10.91533  1.000 45.92844  ? 284 HIS A CA  1 
ATOM   2138 C C   . HIS A 1 284 ? 46.22614  22.22007  10.54142  1.000 49.90468  ? 284 HIS A C   1 
ATOM   2139 O O   . HIS A 1 284 ? 46.42300  21.65830  9.45944   1.000 45.48726  ? 284 HIS A O   1 
ATOM   2140 C CB  . HIS A 1 284 ? 48.55981  23.05634  10.89865  1.000 47.58061  ? 284 HIS A CB  1 
ATOM   2141 C CG  . HIS A 1 284 ? 49.47317  24.23227  10.73110  1.000 55.85685  ? 284 HIS A CG  1 
ATOM   2142 N ND1 . HIS A 1 284 ? 50.20011  24.76616  11.77271  1.000 59.35490  ? 284 HIS A ND1 1 
ATOM   2143 C CD2 . HIS A 1 284 ? 49.76493  24.98756  9.64449   1.000 63.97212  ? 284 HIS A CD2 1 
ATOM   2144 C CE1 . HIS A 1 284 ? 50.90234  25.79757  11.33645  1.000 66.49482  ? 284 HIS A CE1 1 
ATOM   2145 N NE2 . HIS A 1 284 ? 50.65424  25.95575  10.04784  1.000 67.49732  ? 284 HIS A NE2 1 
ATOM   2146 N N   . GLU A 1 285 ? 45.26036  21.83153  11.37915  1.000 52.77572  ? 285 GLU A N   1 
ATOM   2147 C CA  . GLU A 1 285 ? 44.53290  20.58430  11.15471  1.000 46.13299  ? 285 GLU A CA  1 
ATOM   2148 C C   . GLU A 1 285 ? 43.79401  20.57526  9.81651   1.000 46.80661  ? 285 GLU A C   1 
ATOM   2149 O O   . GLU A 1 285 ? 43.78915  19.55839  9.11323   1.000 45.04299  ? 285 GLU A O   1 
ATOM   2150 C CB  . GLU A 1 285 ? 43.55753  20.33896  12.29761  1.000 42.32859  ? 285 GLU A CB  1 
ATOM   2151 C CG  . GLU A 1 285 ? 42.51684  19.29882  11.96906  1.000 50.24136  ? 285 GLU A CG  1 
ATOM   2152 C CD  . GLU A 1 285 ? 41.53536  19.09852  13.09558  1.000 50.95371  ? 285 GLU A CD  1 
ATOM   2153 O OE1 . GLU A 1 285 ? 41.58612  19.93173  14.02979  1.000 41.63065  ? 285 GLU A OE1 1 
ATOM   2154 O OE2 . GLU A 1 285 ? 40.72417  18.13011  13.03591  1.000 47.40014  ? 285 GLU A OE2 1 
ATOM   2155 N N   . TRP A 1 286 ? 43.16621  21.68661  9.44055   1.000 47.34547  ? 286 TRP A N   1 
ATOM   2156 C CA  . TRP A 1 286 ? 42.37553  21.70055  8.20851   1.000 44.73267  ? 286 TRP A CA  1 
ATOM   2157 C C   . TRP A 1 286 ? 43.21316  21.78692  6.94089   1.000 51.66121  ? 286 TRP A C   1 
ATOM   2158 O O   . TRP A 1 286 ? 42.64259  21.79897  5.84131   1.000 46.30614  ? 286 TRP A O   1 
ATOM   2159 C CB  . TRP A 1 286 ? 41.38736  22.86543  8.21419   1.000 41.70278  ? 286 TRP A CB  1 
ATOM   2160 C CG  . TRP A 1 286 ? 40.31659  22.66460  9.19053   1.000 45.47601  ? 286 TRP A CG  1 
ATOM   2161 C CD1 . TRP A 1 286 ? 40.25717  23.16741  10.45694  1.000 42.05602  ? 286 TRP A CD1 1 
ATOM   2162 C CD2 . TRP A 1 286 ? 39.14797  21.85996  9.01977   1.000 49.91339  ? 286 TRP A CD2 1 
ATOM   2163 N NE1 . TRP A 1 286 ? 39.10952  22.74727  11.07467  1.000 40.82831  ? 286 TRP A NE1 1 
ATOM   2164 C CE2 . TRP A 1 286 ? 38.41160  21.93714  10.21977  1.000 47.35040  ? 286 TRP A CE2 1 
ATOM   2165 C CE3 . TRP A 1 286 ? 38.65256  21.08187  7.97174   1.000 45.11911  ? 286 TRP A CE3 1 
ATOM   2166 C CZ2 . TRP A 1 286 ? 37.20082  21.27496  10.39678  1.000 48.79562  ? 286 TRP A CZ2 1 
ATOM   2167 C CZ3 . TRP A 1 286 ? 37.45123  20.42681  8.14706   1.000 52.05676  ? 286 TRP A CZ3 1 
ATOM   2168 C CH2 . TRP A 1 286 ? 36.73785  20.52670  9.35381   1.000 54.46141  ? 286 TRP A CH2 1 
ATOM   2169 N N   . HIS A 1 287 ? 44.53345  21.85243  7.05495   1.000 56.90347  ? 287 HIS A N   1 
ATOM   2170 C CA  . HIS A 1 287 ? 45.38599  22.04620  5.89144   1.000 54.70170  ? 287 HIS A CA  1 
ATOM   2171 C C   . HIS A 1 287 ? 45.83198  20.73589  5.25002   1.000 49.27299  ? 287 HIS A C   1 
ATOM   2172 O O   . HIS A 1 287 ? 46.50536  20.76831  4.21665   1.000 53.15093  ? 287 HIS A O   1 
ATOM   2173 C CB  . HIS A 1 287 ? 46.60819  22.88568  6.28149   1.000 55.28461  ? 287 HIS A CB  1 
ATOM   2174 C CG  . HIS A 1 287 ? 46.26810  24.27204  6.73500   1.000 64.20333  ? 287 HIS A CG  1 
ATOM   2175 N ND1 . HIS A 1 287 ? 47.17829  25.09508  7.36483   1.000 70.11385  ? 287 HIS A ND1 1 
ATOM   2176 C CD2 . HIS A 1 287 ? 45.12049  24.98432  6.64194   1.000 66.62516  ? 287 HIS A CD2 1 
ATOM   2177 C CE1 . HIS A 1 287 ? 46.60564  26.25201  7.64541   1.000 68.85580  ? 287 HIS A CE1 1 
ATOM   2178 N NE2 . HIS A 1 287 ? 45.35695  26.21102  7.21568   1.000 70.27826  ? 287 HIS A NE2 1 
ATOM   2179 N N   . VAL A 1 288 ? 45.47027  19.59154  5.82107   1.000 49.22773  ? 288 VAL A N   1 
ATOM   2180 C CA  . VAL A 1 288 ? 45.90800  18.29962  5.30409   1.000 50.89802  ? 288 VAL A CA  1 
ATOM   2181 C C   . VAL A 1 288 ? 44.81074  17.61267  4.48220   1.000 49.46338  ? 288 VAL A C   1 
ATOM   2182 O O   . VAL A 1 288 ? 44.87480  16.40587  4.26390   1.000 53.78965  ? 288 VAL A O   1 
ATOM   2183 C CB  . VAL A 1 288 ? 46.42256  17.37882  6.43255   1.000 45.10154  ? 288 VAL A CB  1 
ATOM   2184 C CG1 . VAL A 1 288 ? 47.48193  18.09110  7.26171   1.000 35.75885  ? 288 VAL A CG1 1 
ATOM   2185 C CG2 . VAL A 1 288 ? 45.28051  16.86008  7.30459   1.000 32.26236  ? 288 VAL A CG2 1 
ATOM   2186 N N   . LEU A 1 289 ? 43.80445  18.36267  4.01415   1.000 44.55509  ? 289 LEU A N   1 
ATOM   2187 C CA  . LEU A 1 289 ? 42.79422  17.59318  3.28540   1.000 37.79108  ? 289 LEU A CA  1 
ATOM   2188 C C   . LEU A 1 289 ? 43.15686  17.49786  1.80351   1.000 43.46483  ? 289 LEU A C   1 
ATOM   2189 O O   . LEU A 1 289 ? 43.64087  18.46749  1.21981   1.000 47.30286  ? 289 LEU A O   1 
ATOM   2190 C CB  . LEU A 1 289 ? 41.41030  18.21781  3.43493   1.000 36.91248  ? 289 LEU A CB  1 
ATOM   2191 C CG  . LEU A 1 289 ? 40.59830  17.83233  4.67572   1.000 36.27995  ? 289 LEU A CG  1 
ATOM   2192 C CD1 . LEU A 1 289 ? 39.33500  18.64888  4.71235   1.000 30.51016  ? 289 LEU A CD1 1 
ATOM   2193 C CD2 . LEU A 1 289 ? 40.26957  16.35316  4.67432   1.000 29.72491  ? 289 LEU A CD2 1 
ATOM   2194 N N   . PRO A 1 290 ? 42.92408  16.33832  1.18742   1.000 36.85015  ? 290 PRO A N   1 
ATOM   2195 C CA  . PRO A 1 290 ? 43.41825  16.12595  -0.17982  1.000 39.70120  ? 290 PRO A CA  1 
ATOM   2196 C C   . PRO A 1 290 ? 42.82313  17.06348  -1.22437  1.000 45.30155  ? 290 PRO A C   1 
ATOM   2197 O O   . PRO A 1 290 ? 43.55359  17.48357  -2.13064  1.000 48.12272  ? 290 PRO A O   1 
ATOM   2198 C CB  . PRO A 1 290 ? 43.06058  14.65777  -0.44755  1.000 50.53488  ? 290 PRO A CB  1 
ATOM   2199 C CG  . PRO A 1 290 ? 41.96539  14.32857  0.55197   1.000 49.71049  ? 290 PRO A CG  1 
ATOM   2200 C CD  . PRO A 1 290 ? 42.25134  15.15222  1.74193   1.000 48.55251  ? 290 PRO A CD  1 
ATOM   2201 N N   . GLN A 1 291 ? 41.53086  17.39615  -1.14513  1.000 46.55124  ? 291 GLN A N   1 
ATOM   2202 C CA  . GLN A 1 291 ? 40.90104  18.31347  -2.09311  1.000 50.86113  ? 291 GLN A CA  1 
ATOM   2203 C C   . GLN A 1 291 ? 40.02101  19.31360  -1.34916  1.000 61.98708  ? 291 GLN A C   1 
ATOM   2204 O O   . GLN A 1 291 ? 39.63840  19.10282  -0.19365  1.000 71.63746  ? 291 GLN A O   1 
ATOM   2205 C CB  . GLN A 1 291 ? 40.04598  17.58117  -3.14865  1.000 46.71683  ? 291 GLN A CB  1 
ATOM   2206 C CG  . GLN A 1 291 ? 40.62998  16.27685  -3.68565  1.000 51.97685  ? 291 GLN A CG  1 
ATOM   2207 C CD  . GLN A 1 291 ? 40.21771  15.07189  -2.85445  1.000 64.50916  ? 291 GLN A CD  1 
ATOM   2208 O OE1 . GLN A 1 291 ? 39.47231  15.19634  -1.86539  1.000 71.61846  ? 291 GLN A OE1 1 
ATOM   2209 N NE2 . GLN A 1 291 ? 40.71144  13.89723  -3.23905  1.000 61.12791  ? 291 GLN A NE2 1 
ATOM   2210 N N   . GLU A 1 292 ? 39.70480  20.41462  -2.03492  1.000 60.91301  ? 292 GLU A N   1 
ATOM   2211 C CA  . GLU A 1 292 ? 38.69754  21.35115  -1.55239  1.000 55.73403  ? 292 GLU A CA  1 
ATOM   2212 C C   . GLU A 1 292 ? 37.39801  20.59605  -1.30161  1.000 58.53003  ? 292 GLU A C   1 
ATOM   2213 O O   . GLU A 1 292 ? 36.83304  20.00082  -2.22195  1.000 63.53836  ? 292 GLU A O   1 
ATOM   2214 C CB  . GLU A 1 292 ? 38.49259  22.46415  -2.58140  1.000 47.37219  ? 292 GLU A CB  1 
ATOM   2215 C CG  . GLU A 1 292 ? 37.96739  23.78810  -2.03316  1.000 61.10634  ? 292 GLU A CG  1 
ATOM   2216 C CD  . GLU A 1 292 ? 37.65176  24.81817  -3.13238  1.000 79.61034  ? 292 GLU A CD  1 
ATOM   2217 O OE1 . GLU A 1 292 ? 37.70804  24.48019  -4.33937  1.000 81.20335  ? 292 GLU A OE1 1 
ATOM   2218 O OE2 . GLU A 1 292 ? 37.34383  25.97850  -2.78397  1.000 86.43411  ? 292 GLU A OE2 1 
ATOM   2219 N N   . SER A 1 293 ? 36.92797  20.58858  -0.05708  1.000 51.25600  ? 293 SER A N   1 
ATOM   2220 C CA  . SER A 1 293 ? 35.77685  19.75264  0.24516   1.000 51.10663  ? 293 SER A CA  1 
ATOM   2221 C C   . SER A 1 293 ? 34.88389  20.41469  1.28155   1.000 44.81783  ? 293 SER A C   1 
ATOM   2222 O O   . SER A 1 293 ? 35.27418  21.37269  1.94958   1.000 52.77608  ? 293 SER A O   1 
ATOM   2223 C CB  . SER A 1 293 ? 36.21787  18.37331  0.73917   1.000 53.86660  ? 293 SER A CB  1 
ATOM   2224 O OG  . SER A 1 293 ? 37.32573  18.48663  1.60782   1.000 59.09999  ? 293 SER A OG  1 
ATOM   2225 N N   . ILE A 1 294 ? 33.65577  19.90552  1.36897   1.000 38.80949  ? 294 ILE A N   1 
ATOM   2226 C CA  . ILE A 1 294 ? 32.79342  20.07511  2.52817   1.000 39.68862  ? 294 ILE A CA  1 
ATOM   2227 C C   . ILE A 1 294 ? 32.40488  18.68214  3.00949   1.000 46.24166  ? 294 ILE A C   1 
ATOM   2228 O O   . ILE A 1 294 ? 32.45326  17.70366  2.25753   1.000 39.84471  ? 294 ILE A O   1 
ATOM   2229 C CB  . ILE A 1 294 ? 31.54069  20.92147  2.23320   1.000 38.52328  ? 294 ILE A CB  1 
ATOM   2230 C CG1 . ILE A 1 294 ? 30.61143  20.19928  1.26501   1.000 40.85482  ? 294 ILE A CG1 1 
ATOM   2231 C CG2 . ILE A 1 294 ? 31.92521  22.27421  1.68472   1.000 37.42656  ? 294 ILE A CG2 1 
ATOM   2232 C CD1 . ILE A 1 294 ? 29.41109  21.02613  0.90232   1.000 47.09035  ? 294 ILE A CD1 1 
ATOM   2233 N N   . PHE A 1 295 ? 32.03798  18.59347  4.29220   1.000 47.70579  ? 295 PHE A N   1 
ATOM   2234 C CA  . PHE A 1 295 ? 31.68867  17.31107  4.90546   1.000 39.72672  ? 295 PHE A CA  1 
ATOM   2235 C C   . PHE A 1 295 ? 32.86546  16.34259  4.81609   1.000 39.24537  ? 295 PHE A C   1 
ATOM   2236 O O   . PHE A 1 295 ? 32.70637  15.15297  4.52955   1.000 32.99597  ? 295 PHE A O   1 
ATOM   2237 C CB  . PHE A 1 295 ? 30.42241  16.70311  4.28235   1.000 32.37752  ? 295 PHE A CB  1 
ATOM   2238 C CG  . PHE A 1 295 ? 29.55327  15.97565  5.27980   1.000 45.80117  ? 295 PHE A CG  1 
ATOM   2239 C CD1 . PHE A 1 295 ? 30.12554  15.08721  6.20538   1.000 46.12581  ? 295 PHE A CD1 1 
ATOM   2240 C CD2 . PHE A 1 295 ? 28.17632  16.19488  5.32871   1.000 38.75284  ? 295 PHE A CD2 1 
ATOM   2241 C CE1 . PHE A 1 295 ? 29.34876  14.40859  7.12002   1.000 27.00824  ? 295 PHE A CE1 1 
ATOM   2242 C CE2 . PHE A 1 295 ? 27.38350  15.51849  6.26173   1.000 32.33713  ? 295 PHE A CE2 1 
ATOM   2243 C CZ  . PHE A 1 295 ? 27.97047  14.62972  7.15445   1.000 31.20505  ? 295 PHE A CZ  1 
ATOM   2244 N N   . ARG A 1 296 ? 34.06337  16.87281  5.03454   1.000 33.92271  ? 296 ARG A N   1 
ATOM   2245 C CA  . ARG A 1 296 ? 35.26356  16.06492  5.13158   1.000 34.01404  ? 296 ARG A CA  1 
ATOM   2246 C C   . ARG A 1 296 ? 36.06609  16.59689  6.29671   1.000 44.34120  ? 296 ARG A C   1 
ATOM   2247 O O   . ARG A 1 296 ? 36.22732  17.81247  6.44651   1.000 45.97887  ? 296 ARG A O   1 
ATOM   2248 C CB  . ARG A 1 296 ? 36.12071  16.09895  3.85548   1.000 34.37412  ? 296 ARG A CB  1 
ATOM   2249 C CG  . ARG A 1 296 ? 35.48376  15.43173  2.65430   1.000 40.21537  ? 296 ARG A CG  1 
ATOM   2250 C CD  . ARG A 1 296 ? 35.14810  13.96965  2.91760   1.000 41.77250  ? 296 ARG A CD  1 
ATOM   2251 N NE  . ARG A 1 296 ? 34.71229  13.32708  1.68439   1.000 44.15606  ? 296 ARG A NE  1 
ATOM   2252 C CZ  . ARG A 1 296 ? 33.44589  13.15428  1.32369   1.000 44.70715  ? 296 ARG A CZ  1 
ATOM   2253 N NH1 . ARG A 1 296 ? 32.46026  13.56213  2.10838   1.000 45.30172  ? 296 ARG A NH1 1 
ATOM   2254 N NH2 . ARG A 1 296 ? 33.16903  12.57053  0.16625   1.000 52.11776  ? 296 ARG A NH2 1 
ATOM   2255 N N   . PHE A 1 297 ? 36.57067  15.67489  7.10844   1.000 43.48675  ? 297 PHE A N   1 
ATOM   2256 C CA  . PHE A 1 297 ? 37.29625  15.99514  8.32069   1.000 36.78163  ? 297 PHE A CA  1 
ATOM   2257 C C   . PHE A 1 297 ? 38.66620  15.32941  8.28840   1.000 40.91837  ? 297 PHE A C   1 
ATOM   2258 O O   . PHE A 1 297 ? 38.79819  14.18451  7.84473   1.000 44.03558  ? 297 PHE A O   1 
ATOM   2259 C CB  . PHE A 1 297 ? 36.46230  15.56307  9.49781   1.000 41.05965  ? 297 PHE A CB  1 
ATOM   2260 C CG  . PHE A 1 297 ? 34.98948  15.82310  9.30150   1.000 34.00266  ? 297 PHE A CG  1 
ATOM   2261 C CD1 . PHE A 1 297 ? 34.10691  14.77903  9.08342   1.000 27.59332  ? 297 PHE A CD1 1 
ATOM   2262 C CD2 . PHE A 1 297 ? 34.49661  17.12099  9.30065   1.000 29.35416  ? 297 PHE A CD2 1 
ATOM   2263 C CE1 . PHE A 1 297 ? 32.75075  15.02051  8.88775   1.000 28.50582  ? 297 PHE A CE1 1 
ATOM   2264 C CE2 . PHE A 1 297 ? 33.13678  17.37293  9.11255   1.000 30.41808  ? 297 PHE A CE2 1 
ATOM   2265 C CZ  . PHE A 1 297 ? 32.26168  16.31973  8.90157   1.000 27.82453  ? 297 PHE A CZ  1 
ATOM   2266 N N   . SER A 1 298 ? 39.68562  16.06184  8.75642   1.000 38.57217  ? 298 SER A N   1 
ATOM   2267 C CA  . SER A 1 298 ? 41.07112  15.65930  8.53088   1.000 33.40393  ? 298 SER A CA  1 
ATOM   2268 C C   . SER A 1 298 ? 41.45858  14.41640  9.32693   1.000 42.38210  ? 298 SER A C   1 
ATOM   2269 O O   . SER A 1 298 ? 42.18531  13.55222  8.81924   1.000 45.14249  ? 298 SER A O   1 
ATOM   2270 C CB  . SER A 1 298 ? 42.00248  16.80308  8.88611   1.000 34.03470  ? 298 SER A CB  1 
ATOM   2271 O OG  . SER A 1 298 ? 41.90764  17.81280  7.91878   1.000 48.08723  ? 298 SER A OG  1 
ATOM   2272 N N   . PHE A 1 299 ? 41.02370  14.30975  10.57876  1.000 42.53189  ? 299 PHE A N   1 
ATOM   2273 C CA  . PHE A 1 299 ? 41.49033  13.22930  11.44677  1.000 44.40889  ? 299 PHE A CA  1 
ATOM   2274 C C   . PHE A 1 299 ? 40.29547  12.47231  12.01100  1.000 46.18730  ? 299 PHE A C   1 
ATOM   2275 O O   . PHE A 1 299 ? 39.59147  12.97122  12.89992  1.000 45.87305  ? 299 PHE A O   1 
ATOM   2276 C CB  . PHE A 1 299 ? 42.41608  13.77905  12.53355  1.000 34.26086  ? 299 PHE A CB  1 
ATOM   2277 C CG  . PHE A 1 299 ? 43.72853  14.28336  11.97666  1.000 27.73850  ? 299 PHE A CG  1 
ATOM   2278 C CD1 . PHE A 1 299 ? 44.76107  13.41122  11.69923  1.000 28.95975  ? 299 PHE A CD1 1 
ATOM   2279 C CD2 . PHE A 1 299 ? 43.89444  15.61831  11.66170  1.000 31.45185  ? 299 PHE A CD2 1 
ATOM   2280 C CE1 . PHE A 1 299 ? 45.94294  13.87224  11.14701  1.000 38.02001  ? 299 PHE A CE1 1 
ATOM   2281 C CE2 . PHE A 1 299 ? 45.07828  16.08366  11.11229  1.000 29.38914  ? 299 PHE A CE2 1 
ATOM   2282 C CZ  . PHE A 1 299 ? 46.10046  15.21597  10.85789  1.000 30.62365  ? 299 PHE A CZ  1 
ATOM   2283 N N   . VAL A 1 300 ? 40.08204  11.26989  11.47671  1.000 43.15119  ? 300 VAL A N   1 
ATOM   2284 C CA  . VAL A 1 300 ? 38.89790  10.44743  11.72025  1.000 36.57205  ? 300 VAL A CA  1 
ATOM   2285 C C   . VAL A 1 300 ? 39.36359  9.01394   11.97003  1.000 31.92472  ? 300 VAL A C   1 
ATOM   2286 O O   . VAL A 1 300 ? 40.56434  8.72451   11.83645  1.000 32.16931  ? 300 VAL A O   1 
ATOM   2287 C CB  . VAL A 1 300 ? 37.90296  10.54303  10.54008  1.000 35.35683  ? 300 VAL A CB  1 
ATOM   2288 C CG1 . VAL A 1 300 ? 37.34444  11.96315  10.39342  1.000 24.42398  ? 300 VAL A CG1 1 
ATOM   2289 C CG2 . VAL A 1 300 ? 38.54903  10.09185  9.22501   1.000 31.50281  ? 300 VAL A CG2 1 
ATOM   2290 N N   . PRO A 1 301 ? 38.47550  8.09922   12.36816  1.000 32.64798  ? 301 PRO A N   1 
ATOM   2291 C CA  . PRO A 1 301 ? 38.88159  6.69734   12.53459  1.000 28.02929  ? 301 PRO A CA  1 
ATOM   2292 C C   . PRO A 1 301 ? 39.60268  6.13143   11.31780  1.000 41.38109  ? 301 PRO A C   1 
ATOM   2293 O O   . PRO A 1 301 ? 39.29575  6.46092   10.16666  1.000 45.41545  ? 301 PRO A O   1 
ATOM   2294 C CB  . PRO A 1 301 ? 37.55005  5.97850   12.77592  1.000 28.26367  ? 301 PRO A CB  1 
ATOM   2295 C CG  . PRO A 1 301 ? 36.72401  7.00232   13.52649  1.000 27.42961  ? 301 PRO A CG  1 
ATOM   2296 C CD  . PRO A 1 301 ? 37.16434  8.36487   13.00213  1.000 35.29216  ? 301 PRO A CD  1 
ATOM   2297 N N   . VAL A 1 302 ? 40.56389  5.25739   11.58779  1.000 42.60799  ? 302 VAL A N   1 
ATOM   2298 C CA  . VAL A 1 302 ? 41.35892  4.61131   10.55055  1.000 46.99581  ? 302 VAL A CA  1 
ATOM   2299 C C   . VAL A 1 302 ? 40.91149  3.16373   10.42935  1.000 49.09150  ? 302 VAL A C   1 
ATOM   2300 O O   . VAL A 1 302 ? 40.53993  2.52916   11.42147  1.000 43.37793  ? 302 VAL A O   1 
ATOM   2301 C CB  . VAL A 1 302 ? 42.86555  4.65265   10.87647  1.000 49.97542  ? 302 VAL A CB  1 
ATOM   2302 C CG1 . VAL A 1 302 ? 43.69283  4.48404   9.61203   1.000 34.41665  ? 302 VAL A CG1 1 
ATOM   2303 C CG2 . VAL A 1 302 ? 43.21956  5.90475   11.66042  1.000 62.31257  ? 302 VAL A CG2 1 
ATOM   2304 N N   . VAL A 1 303 ? 40.98118  2.62204   9.21330   1.000 51.04674  ? 303 VAL A N   1 
ATOM   2305 C CA  . VAL A 1 303 ? 40.81972  1.18088   9.05592   1.000 46.59410  ? 303 VAL A CA  1 
ATOM   2306 C C   . VAL A 1 303 ? 42.16328  0.54472   9.38357   1.000 46.87552  ? 303 VAL A C   1 
ATOM   2307 O O   . VAL A 1 303 ? 43.02321  0.37809   8.51333   1.000 52.55874  ? 303 VAL A O   1 
ATOM   2308 C CB  . VAL A 1 303 ? 40.30867  0.80157   7.65433   1.000 36.00911  ? 303 VAL A CB  1 
ATOM   2309 C CG1 . VAL A 1 303 ? 40.04301  -0.67490  7.57373   1.000 38.11947  ? 303 VAL A CG1 1 
ATOM   2310 C CG2 . VAL A 1 303 ? 39.03173  1.51688   7.37860   1.000 33.86413  ? 303 VAL A CG2 1 
ATOM   2311 N N   . ASP A 1 304 ? 42.33933  0.19796   10.65970  1.000 50.57919  ? 304 ASP A N   1 
ATOM   2312 C CA  . ASP A 1 304 ? 43.60702  -0.17825  11.26980  1.000 41.31693  ? 304 ASP A CA  1 
ATOM   2313 C C   . ASP A 1 304 ? 43.92421  -1.65720  11.14992  1.000 44.54568  ? 304 ASP A C   1 
ATOM   2314 O O   . ASP A 1 304 ? 45.06804  -2.04321  11.42262  1.000 49.93384  ? 304 ASP A O   1 
ATOM   2315 C CB  . ASP A 1 304 ? 43.59824  0.16874   12.77128  1.000 58.41096  ? 304 ASP A CB  1 
ATOM   2316 C CG  . ASP A 1 304 ? 42.31770  -0.30379  13.50275  1.000 69.86444  ? 304 ASP A CG  1 
ATOM   2317 O OD1 . ASP A 1 304 ? 42.10020  0.13991   14.65750  1.000 72.86620  ? 304 ASP A OD1 1 
ATOM   2318 O OD2 . ASP A 1 304 ? 41.53640  -1.10806  12.93972  1.000 71.37904  ? 304 ASP A OD2 1 
ATOM   2319 N N   . GLY A 1 305 ? 42.94123  -2.48881  10.79214  1.000 44.86330  ? 305 GLY A N   1 
ATOM   2320 C CA  . GLY A 1 305 ? 43.05403  -3.92852  10.98678  1.000 54.07281  ? 305 GLY A CA  1 
ATOM   2321 C C   . GLY A 1 305 ? 43.08031  -4.35392  12.44151  1.000 65.11718  ? 305 GLY A C   1 
ATOM   2322 O O   . GLY A 1 305 ? 43.70711  -5.36922  12.77514  1.000 72.93040  ? 305 GLY A O   1 
ATOM   2323 N N   . ASP A 1 306 ? 42.41143  -3.59770  13.32180  1.000 62.24000  ? 306 ASP A N   1 
ATOM   2324 C CA  . ASP A 1 306 ? 42.44182  -3.81296  14.76688  1.000 58.32121  ? 306 ASP A CA  1 
ATOM   2325 C C   . ASP A 1 306 ? 41.07829  -3.51759  15.38709  1.000 51.88485  ? 306 ASP A C   1 
ATOM   2326 O O   . ASP A 1 306 ? 40.24466  -4.41901  15.52837  1.000 54.49558  ? 306 ASP A O   1 
ATOM   2327 C CB  . ASP A 1 306 ? 43.51830  -2.92909  15.40261  1.000 65.04063  ? 306 ASP A CB  1 
ATOM   2328 C CG  . ASP A 1 306 ? 43.85964  -3.34105  16.83176  1.000 66.19857  ? 306 ASP A CG  1 
ATOM   2329 O OD1 . ASP A 1 306 ? 43.48631  -4.46461  17.25290  1.000 60.39084  ? 306 ASP A OD1 1 
ATOM   2330 O OD2 . ASP A 1 306 ? 44.52320  -2.53206  17.52093  1.000 62.49553  ? 306 ASP A OD2 1 
ATOM   2331 N N   . PHE A 1 307 ? 40.85422  -2.26050  15.78154  1.000 44.87214  ? 307 PHE A N   1 
ATOM   2332 C CA  . PHE A 1 307 ? 39.51092  -1.80352  16.11304  1.000 43.22869  ? 307 PHE A CA  1 
ATOM   2333 C C   . PHE A 1 307 ? 38.53275  -2.16634  15.00100  1.000 47.73221  ? 307 PHE A C   1 
ATOM   2334 O O   . PHE A 1 307 ? 37.56506  -2.90777  15.21028  1.000 56.31010  ? 307 PHE A O   1 
ATOM   2335 C CB  . PHE A 1 307 ? 39.53054  -0.29500  16.35300  1.000 40.51073  ? 307 PHE A CB  1 
ATOM   2336 C CG  . PHE A 1 307 ? 38.35792  0.20443   17.13526  1.000 52.10922  ? 307 PHE A CG  1 
ATOM   2337 C CD1 . PHE A 1 307 ? 38.46830  0.45987   18.49428  1.000 56.31924  ? 307 PHE A CD1 1 
ATOM   2338 C CD2 . PHE A 1 307 ? 37.14061  0.40998   16.52043  1.000 50.99142  ? 307 PHE A CD2 1 
ATOM   2339 C CE1 . PHE A 1 307 ? 37.38438  0.91010   19.22204  1.000 56.41836  ? 307 PHE A CE1 1 
ATOM   2340 C CE2 . PHE A 1 307 ? 36.05800  0.86401   17.24476  1.000 51.68454  ? 307 PHE A CE2 1 
ATOM   2341 C CZ  . PHE A 1 307 ? 36.18075  1.11084   18.59580  1.000 51.77157  ? 307 PHE A CZ  1 
ATOM   2342 N N   . LEU A 1 308 ? 38.79076  -1.67184  13.79822  1.000 43.06702  ? 308 LEU A N   1 
ATOM   2343 C CA  . LEU A 1 308 ? 38.04915  -2.08443  12.60843  1.000 47.87814  ? 308 LEU A CA  1 
ATOM   2344 C C   . LEU A 1 308 ? 38.84094  -3.18385  11.89010  1.000 48.15654  ? 308 LEU A C   1 
ATOM   2345 O O   . LEU A 1 308 ? 39.84533  -2.91507  11.22685  1.000 45.37092  ? 308 LEU A O   1 
ATOM   2346 C CB  . LEU A 1 308 ? 37.77879  -0.87792  11.71009  1.000 45.80442  ? 308 LEU A CB  1 
ATOM   2347 C CG  . LEU A 1 308 ? 36.94431  0.22049   12.38442  1.000 39.43940  ? 308 LEU A CG  1 
ATOM   2348 C CD1 . LEU A 1 308 ? 36.82464  1.46963   11.54893  1.000 32.92458  ? 308 LEU A CD1 1 
ATOM   2349 C CD2 . LEU A 1 308 ? 35.56061  -0.31153  12.72892  1.000 47.72723  ? 308 LEU A CD2 1 
ATOM   2350 N N   . SER A 1 309 ? 38.38361  -4.43178  12.02548  1.000 53.27295  ? 309 SER A N   1 
ATOM   2351 C CA  . SER A 1 309 ? 39.07768  -5.54605  11.38803  1.000 47.68264  ? 309 SER A CA  1 
ATOM   2352 C C   . SER A 1 309 ? 39.18453  -5.36361  9.87118   1.000 58.81845  ? 309 SER A C   1 
ATOM   2353 O O   . SER A 1 309 ? 40.12327  -5.87279  9.24655   1.000 61.66142  ? 309 SER A O   1 
ATOM   2354 C CB  . SER A 1 309 ? 38.36422  -6.84602  11.73717  1.000 50.45353  ? 309 SER A CB  1 
ATOM   2355 O OG  . SER A 1 309 ? 37.36380  -7.12617  10.78254  1.000 65.28808  ? 309 SER A OG  1 
ATOM   2356 N N   . ASP A 1 310 ? 38.24906  -4.63485  9.26941   1.000 49.54272  ? 310 ASP A N   1 
ATOM   2357 C CA  . ASP A 1 310 ? 38.21595  -4.36004  7.83617   1.000 47.61141  ? 310 ASP A CA  1 
ATOM   2358 C C   . ASP A 1 310 ? 37.40247  -3.08224  7.66534   1.000 48.12808  ? 310 ASP A C   1 
ATOM   2359 O O   . ASP A 1 310 ? 36.92914  -2.50042  8.64376   1.000 49.72956  ? 310 ASP A O   1 
ATOM   2360 C CB  . ASP A 1 310 ? 37.62002  -5.54735  7.06650   1.000 54.28030  ? 310 ASP A CB  1 
ATOM   2361 C CG  . ASP A 1 310 ? 37.90276  -5.50369  5.56161   1.000 62.34456  ? 310 ASP A CG  1 
ATOM   2362 O OD1 . ASP A 1 310 ? 38.00946  -6.59171  4.95628   1.000 65.93851  ? 310 ASP A OD1 1 
ATOM   2363 O OD2 . ASP A 1 310 ? 37.98822  -4.40199  4.97401   1.000 63.17982  ? 310 ASP A OD2 1 
ATOM   2364 N N   . THR A 1 311 ? 37.23956  -2.63843  6.42603   1.000 47.98951  ? 311 THR A N   1 
ATOM   2365 C CA  . THR A 1 311 ? 36.45780  -1.43226  6.19942   1.000 44.33959  ? 311 THR A CA  1 
ATOM   2366 C C   . THR A 1 311 ? 35.02378  -1.65257  6.67951   1.000 45.73645  ? 311 THR A C   1 
ATOM   2367 O O   . THR A 1 311 ? 34.51429  -2.77706  6.62400   1.000 42.03531  ? 311 THR A O   1 
ATOM   2368 C CB  . THR A 1 311 ? 36.45096  -1.04929  4.71915   1.000 42.48409  ? 311 THR A CB  1 
ATOM   2369 O OG1 . THR A 1 311 ? 35.44591  -1.81327  4.04489   1.000 45.28697  ? 311 THR A OG1 1 
ATOM   2370 C CG2 . THR A 1 311 ? 37.80149  -1.32685  4.08247   1.000 38.31198  ? 311 THR A CG2 1 
ATOM   2371 N N   . PRO A 1 312 ? 34.36381  -0.60278  7.19767   1.000 51.26448  ? 312 PRO A N   1 
ATOM   2372 C CA  . PRO A 1 312 ? 32.95018  -0.74794  7.59098   1.000 47.63297  ? 312 PRO A CA  1 
ATOM   2373 C C   . PRO A 1 312 ? 32.06766  -1.29713  6.48127   1.000 49.41305  ? 312 PRO A C   1 
ATOM   2374 O O   . PRO A 1 312 ? 31.18665  -2.11764  6.77088   1.000 47.66514  ? 312 PRO A O   1 
ATOM   2375 C CB  . PRO A 1 312 ? 32.55913  0.68304   7.99357   1.000 38.41271  ? 312 PRO A CB  1 
ATOM   2376 C CG  . PRO A 1 312 ? 33.82419  1.27377   8.50430   1.000 33.43285  ? 312 PRO A CG  1 
ATOM   2377 C CD  . PRO A 1 312 ? 34.92572  0.68527   7.65249   1.000 49.10504  ? 312 PRO A CD  1 
ATOM   2378 N N   . GLU A 1 313 ? 32.28499  -0.87773  5.22287   1.000 53.82480  ? 313 GLU A N   1 
ATOM   2379 C CA  A GLU A 1 313 ? 31.53652  -1.44159  4.09452   0.571 50.66073  ? 313 GLU A CA  1 
ATOM   2380 C CA  B GLU A 1 313 ? 31.51817  -1.43787  4.11372   0.429 50.53878  ? 313 GLU A CA  1 
ATOM   2381 C C   . GLU A 1 313 ? 31.65164  -2.96021  4.06850   1.000 48.73252  ? 313 GLU A C   1 
ATOM   2382 O O   . GLU A 1 313 ? 30.64728  -3.67545  4.02604   1.000 51.17990  ? 313 GLU A O   1 
ATOM   2383 C CB  A GLU A 1 313 ? 32.03205  -0.85238  2.76607   0.571 48.97365  ? 313 GLU A CB  1 
ATOM   2384 C CB  B GLU A 1 313 ? 31.95882  -0.79354  2.79551   0.429 48.88848  ? 313 GLU A CB  1 
ATOM   2385 C CG  A GLU A 1 313 ? 30.95405  -0.75818  1.67117   0.571 46.62774  ? 313 GLU A CG  1 
ATOM   2386 C CG  B GLU A 1 313 ? 31.03802  0.34593   2.31162   0.429 44.28276  ? 313 GLU A CG  1 
ATOM   2387 C CD  A GLU A 1 313 ? 31.44308  -1.17938  0.28185   0.571 46.93143  ? 313 GLU A CD  1 
ATOM   2388 C CD  B GLU A 1 313 ? 31.50855  1.74169   2.73321   0.429 38.84849  ? 313 GLU A CD  1 
ATOM   2389 O OE1 A GLU A 1 313 ? 32.66707  -1.36398  0.07923   0.571 44.66164  ? 313 GLU A OE1 1 
ATOM   2390 O OE1 B GLU A 1 313 ? 30.97886  2.73305   2.18194   0.429 31.37957  ? 313 GLU A OE1 1 
ATOM   2391 O OE2 A GLU A 1 313 ? 30.58409  -1.32605  -0.61184  0.571 47.29162  ? 313 GLU A OE2 1 
ATOM   2392 O OE2 B GLU A 1 313 ? 32.40138  1.85153   3.60885   0.429 31.55142  ? 313 GLU A OE2 1 
ATOM   2393 N N   . ALA A 1 314 ? 32.88384  -3.47391  4.11092   1.000 43.05315  ? 314 ALA A N   1 
ATOM   2394 C CA  . ALA A 1 314 ? 33.08742  -4.92055  4.17031   1.000 41.71411  ? 314 ALA A CA  1 
ATOM   2395 C C   . ALA A 1 314 ? 32.42438  -5.54277  5.39710   1.000 52.75351  ? 314 ALA A C   1 
ATOM   2396 O O   . ALA A 1 314 ? 31.92721  -6.67361  5.33514   1.000 54.90789  ? 314 ALA A O   1 
ATOM   2397 C CB  . ALA A 1 314 ? 34.58418  -5.23926  4.17092   1.000 43.04223  ? 314 ALA A CB  1 
ATOM   2398 N N   . LEU A 1 315 ? 32.42456  -4.83422  6.53287   1.000 50.50366  ? 315 LEU A N   1 
ATOM   2399 C CA  . LEU A 1 315 ? 31.98532  -5.46516  7.77337   1.000 47.76483  ? 315 LEU A CA  1 
ATOM   2400 C C   . LEU A 1 315 ? 30.46488  -5.52461  7.87176   1.000 49.09888  ? 315 LEU A C   1 
ATOM   2401 O O   . LEU A 1 315 ? 29.91623  -6.50182  8.39769   1.000 54.88391  ? 315 LEU A O   1 
ATOM   2402 C CB  . LEU A 1 315 ? 32.57596  -4.73404  8.98298   1.000 49.76465  ? 315 LEU A CB  1 
ATOM   2403 C CG  . LEU A 1 315 ? 34.07043  -4.89847  9.29864   1.000 45.27356  ? 315 LEU A CG  1 
ATOM   2404 C CD1 . LEU A 1 315 ? 34.45540  -3.91234  10.36237  1.000 40.94573  ? 315 LEU A CD1 1 
ATOM   2405 C CD2 . LEU A 1 315 ? 34.43795  -6.31129  9.72920   1.000 45.81353  ? 315 LEU A CD2 1 
ATOM   2406 N N   . ILE A 1 316 ? 29.75975  -4.50261  7.37787   1.000 45.56184  ? 316 ILE A N   1 
ATOM   2407 C CA  . ILE A 1 316 ? 28.30270  -4.59683  7.39309   1.000 51.66790  ? 316 ILE A CA  1 
ATOM   2408 C C   . ILE A 1 316 ? 27.81884  -5.56143  6.32106   1.000 59.03822  ? 316 ILE A C   1 
ATOM   2409 O O   . ILE A 1 316 ? 26.75920  -6.17859  6.47089   1.000 68.87539  ? 316 ILE A O   1 
ATOM   2410 C CB  . ILE A 1 316 ? 27.64817  -3.21020  7.24458   1.000 48.27035  ? 316 ILE A CB  1 
ATOM   2411 C CG1 . ILE A 1 316 ? 27.70757  -2.71215  5.80345   1.000 60.70226  ? 316 ILE A CG1 1 
ATOM   2412 C CG2 . ILE A 1 316 ? 28.30376  -2.20492  8.17790   1.000 38.04449  ? 316 ILE A CG2 1 
ATOM   2413 C CD1 . ILE A 1 316 ? 27.11741  -1.30961  5.62463   1.000 65.05874  ? 316 ILE A CD1 1 
ATOM   2414 N N   . ASN A 1 317 ? 28.59032  -5.73781  5.24307   1.000 57.95401  ? 317 ASN A N   1 
ATOM   2415 C CA  . ASN A 1 317 ? 28.15725  -6.62860  4.17127   1.000 66.88973  ? 317 ASN A CA  1 
ATOM   2416 C C   . ASN A 1 317 ? 28.13552  -8.08078  4.62141   1.000 67.69733  ? 317 ASN A C   1 
ATOM   2417 O O   . ASN A 1 317 ? 27.34249  -8.87457  4.10168   1.000 74.68177  ? 317 ASN A O   1 
ATOM   2418 C CB  . ASN A 1 317 ? 29.06470  -6.49424  2.93602   1.000 72.12298  ? 317 ASN A CB  1 
ATOM   2419 C CG  . ASN A 1 317 ? 28.84600  -5.18636  2.15741   1.000 79.46739  ? 317 ASN A CG  1 
ATOM   2420 O OD1 . ASN A 1 317 ? 27.83934  -4.48313  2.33125   1.000 75.40794  ? 317 ASN A OD1 1 
ATOM   2421 N ND2 . ASN A 1 317 ? 29.80215  -4.86326  1.28386   1.000 84.47885  ? 317 ASN A ND2 1 
ATOM   2422 N N   . THR A 1 318 ? 28.98216  -8.44654  5.58702   1.000 60.44354  ? 318 THR A N   1 
ATOM   2423 C CA  . THR A 1 318 ? 29.29143  -9.85489  5.80113   1.000 67.44623  ? 318 THR A CA  1 
ATOM   2424 C C   . THR A 1 318 ? 29.26549  -10.30011 7.25777   1.000 72.64760  ? 318 THR A C   1 
ATOM   2425 O O   . THR A 1 318 ? 29.71885  -11.41464 7.54082   1.000 81.81503  ? 318 THR A O   1 
ATOM   2426 C CB  . THR A 1 318 ? 30.67409  -10.18252 5.22399   1.000 71.58577  ? 318 THR A CB  1 
ATOM   2427 O OG1 . THR A 1 318 ? 31.62794  -9.23344  5.71999   1.000 68.47747  ? 318 THR A OG1 1 
ATOM   2428 C CG2 . THR A 1 318 ? 30.65222  -10.12455 3.70114   1.000 76.84881  ? 318 THR A CG2 1 
ATOM   2429 N N   . GLY A 1 319 ? 28.76315  -9.48073  8.19181   1.000 69.82898  ? 319 GLY A N   1 
ATOM   2430 C CA  . GLY A 1 319 ? 28.73694  -9.83885  9.59380   1.000 73.13761  ? 319 GLY A CA  1 
ATOM   2431 C C   . GLY A 1 319 ? 27.36986  -10.30990 10.07667  1.000 75.32377  ? 319 GLY A C   1 
ATOM   2432 O O   . GLY A 1 319 ? 26.33444  -9.98613  9.49932   1.000 76.14207  ? 319 GLY A O   1 
ATOM   2433 N N   . ASP A 1 320 ? 27.38103  -11.08255 11.16054  1.000 76.48958  ? 320 ASP A N   1 
ATOM   2434 C CA  . ASP A 1 320 ? 26.16136  -11.63166 11.74027  1.000 78.31319  ? 320 ASP A CA  1 
ATOM   2435 C C   . ASP A 1 320 ? 25.58342  -10.64930 12.75627  1.000 77.83018  ? 320 ASP A C   1 
ATOM   2436 O O   . ASP A 1 320 ? 26.30040  -10.18317 13.64963  1.000 85.04442  ? 320 ASP A O   1 
ATOM   2437 C CB  . ASP A 1 320 ? 26.46287  -12.97833 12.39615  1.000 87.53620  ? 320 ASP A CB  1 
ATOM   2438 C CG  . ASP A 1 320 ? 25.27126  -13.55330 13.11896  1.000 96.29199  ? 320 ASP A CG  1 
ATOM   2439 O OD1 . ASP A 1 320 ? 24.17882  -13.59874 12.51394  1.000 95.72889  ? 320 ASP A OD1 1 
ATOM   2440 O OD2 . ASP A 1 320 ? 25.43166  -13.96609 14.28879  1.000 99.83047  ? 320 ASP A OD2 1 
ATOM   2441 N N   . PHE A 1 321 ? 24.28450  -10.32853 12.61811  1.000 71.52745  ? 321 PHE A N   1 
ATOM   2442 C CA  . PHE A 1 321 ? 23.67560  -9.26984  13.42247  1.000 67.51423  ? 321 PHE A CA  1 
ATOM   2443 C C   . PHE A 1 321 ? 22.32798  -9.65006  14.02443  1.000 69.41071  ? 321 PHE A C   1 
ATOM   2444 O O   . PHE A 1 321 ? 21.53609  -8.75310  14.33042  1.000 71.42169  ? 321 PHE A O   1 
ATOM   2445 C CB  . PHE A 1 321 ? 23.48106  -7.98513  12.61509  1.000 61.30306  ? 321 PHE A CB  1 
ATOM   2446 C CG  . PHE A 1 321 ? 24.75615  -7.33668  12.16873  1.000 62.20277  ? 321 PHE A CG  1 
ATOM   2447 C CD1 . PHE A 1 321 ? 25.74129  -7.00131  13.08244  1.000 60.63624  ? 321 PHE A CD1 1 
ATOM   2448 C CD2 . PHE A 1 321 ? 24.96162  -7.05224  10.82030  1.000 59.51968  ? 321 PHE A CD2 1 
ATOM   2449 C CE1 . PHE A 1 321 ? 26.91002  -6.39906  12.65838  1.000 59.03096  ? 321 PHE A CE1 1 
ATOM   2450 C CE2 . PHE A 1 321 ? 26.12226  -6.45370  10.39563  1.000 55.49611  ? 321 PHE A CE2 1 
ATOM   2451 C CZ  . PHE A 1 321 ? 27.10219  -6.12699  11.31301  1.000 53.18161  ? 321 PHE A CZ  1 
ATOM   2452 N N   . GLN A 1 322 ? 22.03006  -10.93440 14.20243  1.000 71.68762  ? 322 GLN A N   1 
ATOM   2453 C CA  . GLN A 1 322 ? 20.84729  -11.23627 14.98978  1.000 80.23669  ? 322 GLN A CA  1 
ATOM   2454 C C   . GLN A 1 322 ? 21.05445  -10.75622 16.41594  1.000 82.95734  ? 322 GLN A C   1 
ATOM   2455 O O   . GLN A 1 322 ? 22.16929  -10.42129 16.83136  1.000 80.82280  ? 322 GLN A O   1 
ATOM   2456 C CB  . GLN A 1 322 ? 20.53455  -12.72704 15.00086  1.000 92.46403  ? 322 GLN A CB  1 
ATOM   2457 C CG  . GLN A 1 322 ? 20.52030  -13.38683 13.64898  1.000 101.21955 ? 322 GLN A CG  1 
ATOM   2458 C CD  . GLN A 1 322 ? 21.23820  -14.72284 13.66711  1.000 109.34198 ? 322 GLN A CD  1 
ATOM   2459 O OE1 . GLN A 1 322 ? 20.88780  -15.61859 14.44294  1.000 113.75784 ? 322 GLN A OE1 1 
ATOM   2460 N NE2 . GLN A 1 322 ? 22.24334  -14.86894 12.80724  1.000 107.68376 ? 322 GLN A NE2 1 
ATOM   2461 N N   . ASP A 1 323 ? 19.96009  -10.73820 17.17305  1.000 89.03225  ? 323 ASP A N   1 
ATOM   2462 C CA  . ASP A 1 323 ? 19.98481  -10.26925 18.55759  1.000 101.00548 ? 323 ASP A CA  1 
ATOM   2463 C C   . ASP A 1 323 ? 20.67298  -8.91083  18.64429  1.000 91.79871  ? 323 ASP A C   1 
ATOM   2464 O O   . ASP A 1 323 ? 21.52542  -8.66421  19.49887  1.000 88.49651  ? 323 ASP A O   1 
ATOM   2465 C CB  . ASP A 1 323 ? 20.65124  -11.29712 19.47822  1.000 112.74062 ? 323 ASP A CB  1 
ATOM   2466 C CG  . ASP A 1 323 ? 20.06952  -12.70036 19.31141  1.000 119.32169 ? 323 ASP A CG  1 
ATOM   2467 O OD1 . ASP A 1 323 ? 20.80659  -13.60442 18.85480  1.000 121.85745 ? 323 ASP A OD1 1 
ATOM   2468 O OD2 . ASP A 1 323 ? 18.87550  -12.89717 19.63655  1.000 118.34205 ? 323 ASP A OD2 1 
ATOM   2469 N N   . LEU A 1 324 ? 20.32703  -8.03745  17.70502  1.000 89.20874  ? 324 LEU A N   1 
ATOM   2470 C CA  . LEU A 1 324 ? 20.82091  -6.66935  17.67657  1.000 77.93171  ? 324 LEU A CA  1 
ATOM   2471 C C   . LEU A 1 324 ? 19.67761  -5.77766  17.24188  1.000 74.74748  ? 324 LEU A C   1 
ATOM   2472 O O   . LEU A 1 324 ? 19.11455  -5.97720  16.16396  1.000 74.79457  ? 324 LEU A O   1 
ATOM   2473 C CB  . LEU A 1 324 ? 21.99546  -6.50605  16.72189  1.000 61.01613  ? 324 LEU A CB  1 
ATOM   2474 C CG  . LEU A 1 324 ? 22.29070  -5.01764  16.58953  1.000 58.85368  ? 324 LEU A CG  1 
ATOM   2475 C CD1 . LEU A 1 324 ? 23.13829  -4.56623  17.74889  1.000 58.55835  ? 324 LEU A CD1 1 
ATOM   2476 C CD2 . LEU A 1 324 ? 22.97726  -4.70702  15.27063  1.000 60.76817  ? 324 LEU A CD2 1 
ATOM   2477 N N   . GLN A 1 325 ? 19.33514  -4.80540  18.07205  1.000 52.96993  ? 325 GLN A N   1 
ATOM   2478 C CA  . GLN A 1 325 ? 18.24058  -3.89330  17.78934  1.000 50.75326  ? 325 GLN A CA  1 
ATOM   2479 C C   . GLN A 1 325 ? 18.78626  -2.48808  17.58089  1.000 49.91359  ? 325 GLN A C   1 
ATOM   2480 O O   . GLN A 1 325 ? 19.51919  -1.96659  18.42966  1.000 55.50888  ? 325 GLN A O   1 
ATOM   2481 C CB  . GLN A 1 325 ? 17.21916  -3.92425  18.91854  1.000 50.78874  ? 325 GLN A CB  1 
ATOM   2482 C CG  . GLN A 1 325 ? 16.48996  -5.24675  19.00210  1.000 57.37209  ? 325 GLN A CG  1 
ATOM   2483 C CD  . GLN A 1 325 ? 16.75929  -5.97532  20.29321  1.000 60.53849  ? 325 GLN A CD  1 
ATOM   2484 O OE1 . GLN A 1 325 ? 17.11568  -5.36272  21.30560  1.000 54.92234  ? 325 GLN A OE1 1 
ATOM   2485 N NE2 . GLN A 1 325 ? 16.58505  -7.29308  20.27219  1.000 66.04358  ? 325 GLN A NE2 1 
ATOM   2486 N N   . VAL A 1 326 ? 18.42093  -1.87871  16.45598  1.000 42.45958  ? 326 VAL A N   1 
ATOM   2487 C CA  . VAL A 1 326 ? 18.98574  -0.60947  16.02338  1.000 39.54500  ? 326 VAL A CA  1 
ATOM   2488 C C   . VAL A 1 326 ? 17.85425  0.34973   15.67661  1.000 43.48160  ? 326 VAL A C   1 
ATOM   2489 O O   . VAL A 1 326 ? 16.83213  -0.05588  15.11082  1.000 49.56181  ? 326 VAL A O   1 
ATOM   2490 C CB  . VAL A 1 326 ? 19.92120  -0.80864  14.81027  1.000 42.44747  ? 326 VAL A CB  1 
ATOM   2491 C CG1 . VAL A 1 326 ? 20.41726  0.50943   14.29121  1.000 47.49709  ? 326 VAL A CG1 1 
ATOM   2492 C CG2 . VAL A 1 326 ? 21.08854  -1.67115  15.17977  1.000 42.89074  ? 326 VAL A CG2 1 
ATOM   2493 N N   . LEU A 1 327 ? 18.04550  1.62428   16.00866  1.000 38.93988  ? 327 LEU A N   1 
ATOM   2494 C CA  . LEU A 1 327 ? 17.19055  2.71681   15.56666  1.000 34.88600  ? 327 LEU A CA  1 
ATOM   2495 C C   . LEU A 1 327 ? 18.04683  3.66956   14.74959  1.000 38.30201  ? 327 LEU A C   1 
ATOM   2496 O O   . LEU A 1 327 ? 19.12369  4.05548   15.20459  1.000 45.28908  ? 327 LEU A O   1 
ATOM   2497 C CB  . LEU A 1 327 ? 16.57345  3.43892   16.76655  1.000 37.18953  ? 327 LEU A CB  1 
ATOM   2498 C CG  . LEU A 1 327 ? 15.62292  4.60289   16.50479  1.000 40.50169  ? 327 LEU A CG  1 
ATOM   2499 C CD1 . LEU A 1 327 ? 14.43451  4.10890   15.73540  1.000 45.18933  ? 327 LEU A CD1 1 
ATOM   2500 C CD2 . LEU A 1 327 ? 15.17072  5.22630   17.80447  1.000 45.51834  ? 327 LEU A CD2 1 
ATOM   2501 N N   . VAL A 1 328 ? 17.58199  4.04245   13.54770  1.000 40.82923  ? 328 VAL A N   1 
ATOM   2502 C CA  . VAL A 1 328 ? 18.35959  4.85747   12.61098  1.000 32.68615  ? 328 VAL A CA  1 
ATOM   2503 C C   . VAL A 1 328 ? 17.44477  5.85863   11.93256  1.000 41.77411  ? 328 VAL A C   1 
ATOM   2504 O O   . VAL A 1 328 ? 16.26084  5.59083   11.71210  1.000 49.08971  ? 328 VAL A O   1 
ATOM   2505 C CB  . VAL A 1 328 ? 19.04731  4.01991   11.51810  1.000 30.67421  ? 328 VAL A CB  1 
ATOM   2506 C CG1 . VAL A 1 328 ? 20.17195  3.22419   12.09816  1.000 30.72457  ? 328 VAL A CG1 1 
ATOM   2507 C CG2 . VAL A 1 328 ? 18.01574  3.11280   10.81222  1.000 29.91279  ? 328 VAL A CG2 1 
ATOM   2508 N N   . GLY A 1 329 ? 18.00527  6.99788   11.54994  1.000 25.51822  ? 329 GLY A N   1 
ATOM   2509 C CA  . GLY A 1 329 ? 17.17456  7.99340   10.90116  1.000 30.53777  ? 329 GLY A CA  1 
ATOM   2510 C C   . GLY A 1 329 ? 17.97332  9.21162   10.49682  1.000 34.96392  ? 329 GLY A C   1 
ATOM   2511 O O   . GLY A 1 329 ? 19.18289  9.31283   10.74997  1.000 28.62339  ? 329 GLY A O   1 
ATOM   2512 N N   . VAL A 1 330 ? 17.26093  10.15181  9.86130   1.000 33.32988  ? 330 VAL A N   1 
ATOM   2513 C CA  . VAL A 1 330 ? 17.85995  11.33183  9.24742   1.000 32.81191  ? 330 VAL A CA  1 
ATOM   2514 C C   . VAL A 1 330 ? 16.92694  12.51633  9.46955   1.000 32.71758  ? 330 VAL A C   1 
ATOM   2515 O O   . VAL A 1 330 ? 15.72560  12.35601  9.71128   1.000 30.91597  ? 330 VAL A O   1 
ATOM   2516 C CB  . VAL A 1 330 ? 18.13756  11.12833  7.72078   1.000 39.46198  ? 330 VAL A CB  1 
ATOM   2517 C CG1 . VAL A 1 330 ? 19.11262  9.95389   7.47990   1.000 36.77134  ? 330 VAL A CG1 1 
ATOM   2518 C CG2 . VAL A 1 330 ? 16.83538  10.91331  6.91758   1.000 23.87173  ? 330 VAL A CG2 1 
ATOM   2519 N N   . VAL A 1 331 ? 17.49053  13.72402  9.39829   1.000 34.36537  ? 331 VAL A N   1 
ATOM   2520 C CA  . VAL A 1 331 ? 16.63885  14.91109  9.33571   1.000 41.49576  ? 331 VAL A CA  1 
ATOM   2521 C C   . VAL A 1 331 ? 16.32198  15.18408  7.86424   1.000 45.23912  ? 331 VAL A C   1 
ATOM   2522 O O   . VAL A 1 331 ? 16.85031  14.50705  6.97402   1.000 47.80827  ? 331 VAL A O   1 
ATOM   2523 C CB  . VAL A 1 331 ? 17.29103  16.11954  10.03448  1.000 40.91720  ? 331 VAL A CB  1 
ATOM   2524 C CG1 . VAL A 1 331 ? 17.34610  15.88141  11.51675  1.000 40.69954  ? 331 VAL A CG1 1 
ATOM   2525 C CG2 . VAL A 1 331 ? 18.67833  16.36022  9.50947   1.000 44.54525  ? 331 VAL A CG2 1 
ATOM   2526 N N   . LYS A 1 332 ? 15.43840  16.14912  7.59266   1.000 43.35586  ? 332 LYS A N   1 
ATOM   2527 C CA  . LYS A 1 332 ? 14.93102  16.31691  6.22960   1.000 46.71469  ? 332 LYS A CA  1 
ATOM   2528 C C   . LYS A 1 332 ? 15.98435  16.91873  5.30773   1.000 50.00113  ? 332 LYS A C   1 
ATOM   2529 O O   . LYS A 1 332 ? 16.09183  16.52456  4.14185   1.000 57.12550  ? 332 LYS A O   1 
ATOM   2530 C CB  . LYS A 1 332 ? 13.67242  17.18232  6.23457   1.000 39.46266  ? 332 LYS A CB  1 
ATOM   2531 C CG  . LYS A 1 332 ? 12.88996  17.16697  4.93486   1.000 43.54151  ? 332 LYS A CG  1 
ATOM   2532 C CD  . LYS A 1 332 ? 11.64670  18.06749  5.00566   1.000 54.53667  ? 332 LYS A CD  1 
ATOM   2533 C CE  . LYS A 1 332 ? 11.99518  19.40701  5.66954   1.000 67.01375  ? 332 LYS A CE  1 
ATOM   2534 N NZ  . LYS A 1 332 ? 11.30233  20.60311  5.11417   1.000 70.27998  ? 332 LYS A NZ  1 
ATOM   2535 N N   . ASP A 1 333 ? 16.78230  17.85072  5.81313   1.000 45.05885  ? 333 ASP A N   1 
ATOM   2536 C CA  . ASP A 1 333 ? 17.76261  18.57899  5.01374   1.000 37.19133  ? 333 ASP A CA  1 
ATOM   2537 C C   . ASP A 1 333 ? 19.15507  18.38435  5.62103   1.000 35.06214  ? 333 ASP A C   1 
ATOM   2538 O O   . ASP A 1 333 ? 19.73434  19.30487  6.22024   1.000 27.98568  ? 333 ASP A O   1 
ATOM   2539 C CB  . ASP A 1 333 ? 17.37435  20.05866  4.92690   1.000 36.86582  ? 333 ASP A CB  1 
ATOM   2540 C CG  . ASP A 1 333 ? 15.93930  20.24990  4.49748   1.000 49.38146  ? 333 ASP A CG  1 
ATOM   2541 O OD1 . ASP A 1 333 ? 15.04218  20.14073  5.35597   1.000 60.71454  ? 333 ASP A OD1 1 
ATOM   2542 O OD2 . ASP A 1 333 ? 15.69789  20.48209  3.29722   1.000 58.19046  ? 333 ASP A OD2 1 
ATOM   2543 N N   . GLU A 1 334 ? 19.70867  17.18133  5.43640   1.000 31.37653  ? 334 GLU A N   1 
ATOM   2544 C CA  . GLU A 1 334 ? 20.99249  16.85515  6.04821   1.000 32.94690  ? 334 GLU A CA  1 
ATOM   2545 C C   . GLU A 1 334 ? 22.12847  17.71499  5.50336   1.000 34.49662  ? 334 GLU A C   1 
ATOM   2546 O O   . GLU A 1 334 ? 23.12259  17.94105  6.20914   1.000 33.84134  ? 334 GLU A O   1 
ATOM   2547 C CB  . GLU A 1 334 ? 21.30793  15.37618  5.83364   1.000 30.89286  ? 334 GLU A CB  1 
ATOM   2548 C CG  . GLU A 1 334 ? 20.40017  14.44565  6.60335   1.000 39.22870  ? 334 GLU A CG  1 
ATOM   2549 C CD  . GLU A 1 334 ? 20.81330  14.28107  8.06320   1.000 42.11228  ? 334 GLU A CD  1 
ATOM   2550 O OE1 . GLU A 1 334 ? 21.70230  15.03215  8.53730   1.000 34.12724  ? 334 GLU A OE1 1 
ATOM   2551 O OE2 . GLU A 1 334 ? 20.22412  13.40635  8.74103   1.000 46.49954  ? 334 GLU A OE2 1 
ATOM   2552 N N   . GLY A 1 335 ? 22.00602  18.19959  4.26541   1.000 28.12940  ? 335 GLY A N   1 
ATOM   2553 C CA  . GLY A 1 335 ? 23.12674  18.83376  3.60805   1.000 28.59776  ? 335 GLY A CA  1 
ATOM   2554 C C   . GLY A 1 335 ? 23.23449  20.33191  3.79866   1.000 34.91961  ? 335 GLY A C   1 
ATOM   2555 O O   . GLY A 1 335 ? 24.34627  20.87342  3.76364   1.000 34.81854  ? 335 GLY A O   1 
ATOM   2556 N N   . SER A 1 336 ? 22.09797  21.00671  4.01698   1.000 33.55085  ? 336 SER A N   1 
ATOM   2557 C CA  . SER A 1 336 ? 22.05836  22.47026  3.94064   1.000 34.59106  ? 336 SER A CA  1 
ATOM   2558 C C   . SER A 1 336 ? 23.13872  23.13301  4.79600   1.000 35.81557  ? 336 SER A C   1 
ATOM   2559 O O   . SER A 1 336 ? 23.86034  24.01691  4.32100   1.000 38.99449  ? 336 SER A O   1 
ATOM   2560 C CB  . SER A 1 336 ? 20.67399  22.98165  4.33736   1.000 31.27735  ? 336 SER A CB  1 
ATOM   2561 O OG  . SER A 1 336 ? 20.21383  22.39556  5.53306   1.000 35.76883  ? 336 SER A OG  1 
ATOM   2562 N N   . TYR A 1 337 ? 23.27609  22.69991  6.05332   1.000 34.82072  ? 337 TYR A N   1 
ATOM   2563 C CA  . TYR A 1 337 ? 24.28096  23.26348  6.96268   1.000 36.79999  ? 337 TYR A CA  1 
ATOM   2564 C C   . TYR A 1 337 ? 25.66202  23.36158  6.31477   1.000 35.87030  ? 337 TYR A C   1 
ATOM   2565 O O   . TYR A 1 337 ? 26.35480  24.37683  6.44986   1.000 35.55575  ? 337 TYR A O   1 
ATOM   2566 C CB  . TYR A 1 337 ? 24.34623  22.40847  8.23382   1.000 34.11319  ? 337 TYR A CB  1 
ATOM   2567 C CG  . TYR A 1 337 ? 25.01943  23.02892  9.43177   1.000 41.72675  ? 337 TYR A CG  1 
ATOM   2568 C CD1 . TYR A 1 337 ? 24.28129  23.41905  10.54047  1.000 59.25899  ? 337 TYR A CD1 1 
ATOM   2569 C CD2 . TYR A 1 337 ? 26.39628  23.18458  9.48354   1.000 50.25402  ? 337 TYR A CD2 1 
ATOM   2570 C CE1 . TYR A 1 337 ? 24.89937  23.98034  11.66283  1.000 63.67886  ? 337 TYR A CE1 1 
ATOM   2571 C CE2 . TYR A 1 337 ? 27.02204  23.74120  10.59527  1.000 55.89061  ? 337 TYR A CE2 1 
ATOM   2572 C CZ  . TYR A 1 337 ? 26.26683  24.13492  11.67884  1.000 62.74477  ? 337 TYR A CZ  1 
ATOM   2573 O OH  . TYR A 1 337 ? 26.88536  24.68157  12.77570  1.000 66.14280  ? 337 TYR A OH  1 
ATOM   2574 N N   . PHE A 1 338 ? 26.07274  22.32336  5.59090   1.000 34.71584  ? 338 PHE A N   1 
ATOM   2575 C CA  . PHE A 1 338 ? 27.44899  22.25262  5.12109   1.000 34.91441  ? 338 PHE A CA  1 
ATOM   2576 C C   . PHE A 1 338 ? 27.74403  23.20277  3.96637   1.000 37.03157  ? 338 PHE A C   1 
ATOM   2577 O O   . PHE A 1 338 ? 28.90427  23.59251  3.79063   1.000 41.09081  ? 338 PHE A O   1 
ATOM   2578 C CB  . PHE A 1 338 ? 27.77017  20.81494  4.73573   1.000 36.50916  ? 338 PHE A CB  1 
ATOM   2579 C CG  . PHE A 1 338 ? 27.63250  19.85877  5.87713   1.000 38.59408  ? 338 PHE A CG  1 
ATOM   2580 C CD1 . PHE A 1 338 ? 26.41202  19.27349  6.16204   1.000 49.06232  ? 338 PHE A CD1 1 
ATOM   2581 C CD2 . PHE A 1 338 ? 28.71122  19.58094  6.69534   1.000 38.34926  ? 338 PHE A CD2 1 
ATOM   2582 C CE1 . PHE A 1 338 ? 26.26681  18.40775  7.23439   1.000 49.89163  ? 338 PHE A CE1 1 
ATOM   2583 C CE2 . PHE A 1 338 ? 28.57948  18.71787  7.75860   1.000 42.84450  ? 338 PHE A CE2 1 
ATOM   2584 C CZ  . PHE A 1 338 ? 27.35253  18.13284  8.03252   1.000 48.68092  ? 338 PHE A CZ  1 
ATOM   2585 N N   . LEU A 1 339 ? 26.72665  23.61716  3.20731   1.000 34.99264  ? 339 LEU A N   1 
ATOM   2586 C CA  . LEU A 1 339 ? 26.97395  24.44239  2.02717   1.000 39.94672  ? 339 LEU A CA  1 
ATOM   2587 C C   . LEU A 1 339 ? 27.62249  25.77934  2.38646   1.000 40.85946  ? 339 LEU A C   1 
ATOM   2588 O O   . LEU A 1 339 ? 28.47468  26.28257  1.64299   1.000 46.43679  ? 339 LEU A O   1 
ATOM   2589 C CB  . LEU A 1 339 ? 25.66682  24.65636  1.26646   1.000 37.53150  ? 339 LEU A CB  1 
ATOM   2590 C CG  . LEU A 1 339 ? 24.93259  23.35308  0.98274   1.000 36.41616  ? 339 LEU A CG  1 
ATOM   2591 C CD1 . LEU A 1 339 ? 23.65554  23.62939  0.21433   1.000 34.93046  ? 339 LEU A CD1 1 
ATOM   2592 C CD2 . LEU A 1 339 ? 25.85856  22.40060  0.20653   1.000 36.32936  ? 339 LEU A CD2 1 
ATOM   2593 N N   . VAL A 1 340 ? 27.23978  26.37214  3.52163   1.000 37.53084  ? 340 VAL A N   1 
ATOM   2594 C CA  . VAL A 1 340 ? 27.74653  27.69828  3.87198   1.000 39.89130  ? 340 VAL A CA  1 
ATOM   2595 C C   . VAL A 1 340 ? 29.17693  27.66417  4.38344   1.000 39.28310  ? 340 VAL A C   1 
ATOM   2596 O O   . VAL A 1 340 ? 29.74021  28.72110  4.70260   1.000 40.09966  ? 340 VAL A O   1 
ATOM   2597 C CB  . VAL A 1 340 ? 26.83451  28.36983  4.91760   1.000 36.95137  ? 340 VAL A CB  1 
ATOM   2598 C CG1 . VAL A 1 340 ? 25.38035  28.35984  4.43712   1.000 35.80964  ? 340 VAL A CG1 1 
ATOM   2599 C CG2 . VAL A 1 340 ? 26.96968  27.66185  6.25757   1.000 39.60574  ? 340 VAL A CG2 1 
ATOM   2600 N N   . TYR A 1 341 ? 29.79381  26.49173  4.45937   1.000 33.39114  ? 341 TYR A N   1 
ATOM   2601 C CA  . TYR A 1 341 ? 31.18201  26.37610  4.89116   1.000 46.35942  ? 341 TYR A CA  1 
ATOM   2602 C C   . TYR A 1 341 ? 32.09279  25.97840  3.73631   1.000 53.41971  ? 341 TYR A C   1 
ATOM   2603 O O   . TYR A 1 341 ? 33.03377  25.19930  3.91728   1.000 54.50020  ? 341 TYR A O   1 
ATOM   2604 C CB  . TYR A 1 341 ? 31.32413  25.37062  6.03485   1.000 45.89355  ? 341 TYR A CB  1 
ATOM   2605 C CG  . TYR A 1 341 ? 30.82494  25.88264  7.36401   1.000 39.70948  ? 341 TYR A CG  1 
ATOM   2606 C CD1 . TYR A 1 341 ? 29.56118  25.53554  7.83770   1.000 35.11176  ? 341 TYR A CD1 1 
ATOM   2607 C CD2 . TYR A 1 341 ? 31.60569  26.73163  8.13457   1.000 44.97742  ? 341 TYR A CD2 1 
ATOM   2608 C CE1 . TYR A 1 341 ? 29.10184  26.01009  9.04452   1.000 38.93195  ? 341 TYR A CE1 1 
ATOM   2609 C CE2 . TYR A 1 341 ? 31.15773  27.21356  9.34895   1.000 43.59387  ? 341 TYR A CE2 1 
ATOM   2610 C CZ  . TYR A 1 341 ? 29.90720  26.85660  9.80076   1.000 44.47017  ? 341 TYR A CZ  1 
ATOM   2611 O OH  . TYR A 1 341 ? 29.46817  27.34172  11.01682  1.000 42.84339  ? 341 TYR A OH  1 
ATOM   2612 N N   . GLY A 1 342 ? 31.82165  26.49863  2.53524   1.000 57.08845  ? 342 GLY A N   1 
ATOM   2613 C CA  . GLY A 1 342 ? 32.60528  26.09483  1.38226   1.000 57.04650  ? 342 GLY A CA  1 
ATOM   2614 C C   . GLY A 1 342 ? 32.05934  26.39343  -0.00298  1.000 54.82101  ? 342 GLY A C   1 
ATOM   2615 O O   . GLY A 1 342 ? 32.78025  26.95108  -0.83739  1.000 56.97264  ? 342 GLY A O   1 
ATOM   2616 N N   . VAL A 1 343 ? 30.81182  26.02507  -0.27975  1.000 50.38316  ? 343 VAL A N   1 
ATOM   2617 C CA  . VAL A 1 343 ? 30.29069  26.11220  -1.64559  1.000 43.65812  ? 343 VAL A CA  1 
ATOM   2618 C C   . VAL A 1 343 ? 30.00035  27.56371  -2.00302  1.000 44.61814  ? 343 VAL A C   1 
ATOM   2619 O O   . VAL A 1 343 ? 29.02880  28.14107  -1.48964  1.000 50.79407  ? 343 VAL A O   1 
ATOM   2620 C CB  . VAL A 1 343 ? 29.02626  25.26118  -1.82341  1.000 37.17696  ? 343 VAL A CB  1 
ATOM   2621 C CG1 . VAL A 1 343 ? 28.67129  25.14762  -3.28429  1.000 28.54349  ? 343 VAL A CG1 1 
ATOM   2622 C CG2 . VAL A 1 343 ? 29.21603  23.89098  -1.21515  1.000 44.01056  ? 343 VAL A CG2 1 
ATOM   2623 N N   . PRO A 1 344 ? 30.78011  28.17808  -2.89491  1.000 42.53130  ? 344 PRO A N   1 
ATOM   2624 C CA  . PRO A 1 344 ? 30.51881  29.57714  -3.24880  1.000 42.38690  ? 344 PRO A CA  1 
ATOM   2625 C C   . PRO A 1 344 ? 29.08404  29.74089  -3.72196  1.000 44.21843  ? 344 PRO A C   1 
ATOM   2626 O O   . PRO A 1 344 ? 28.53228  28.87041  -4.40115  1.000 45.60399  ? 344 PRO A O   1 
ATOM   2627 C CB  . PRO A 1 344 ? 31.52934  29.86314  -4.37156  1.000 34.22041  ? 344 PRO A CB  1 
ATOM   2628 C CG  . PRO A 1 344 ? 32.52050  28.74867  -4.32443  1.000 33.72891  ? 344 PRO A CG  1 
ATOM   2629 C CD  . PRO A 1 344 ? 31.77804  27.56417  -3.78984  1.000 40.54512  ? 344 PRO A CD  1 
ATOM   2630 N N   . GLY A 1 345 ? 28.47299  30.85406  -3.32176  1.000 42.95946  ? 345 GLY A N   1 
ATOM   2631 C CA  . GLY A 1 345 ? 27.08344  31.13928  -3.59879  1.000 40.50065  ? 345 GLY A CA  1 
ATOM   2632 C C   . GLY A 1 345 ? 26.17587  31.00935  -2.39599  1.000 46.38323  ? 345 GLY A C   1 
ATOM   2633 O O   . GLY A 1 345 ? 25.11384  31.64696  -2.37503  1.000 50.92212  ? 345 GLY A O   1 
ATOM   2634 N N   . PHE A 1 346 ? 26.57246  30.22616  -1.38348  1.000 44.36109  ? 346 PHE A N   1 
ATOM   2635 C CA  . PHE A 1 346 ? 25.73177  29.93569  -0.22713  1.000 40.10582  ? 346 PHE A CA  1 
ATOM   2636 C C   . PHE A 1 346 ? 26.13141  30.75226  1.00278   1.000 41.80398  ? 346 PHE A C   1 
ATOM   2637 O O   . PHE A 1 346 ? 27.31619  31.01929  1.24225   1.000 37.30496  ? 346 PHE A O   1 
ATOM   2638 C CB  . PHE A 1 346 ? 25.78824  28.45202  0.10717   1.000 38.76070  ? 346 PHE A CB  1 
ATOM   2639 C CG  . PHE A 1 346 ? 25.17114  27.58293  -0.93624  1.000 47.65796  ? 346 PHE A CG  1 
ATOM   2640 C CD1 . PHE A 1 346 ? 25.90878  27.17072  -2.04087  1.000 45.35758  ? 346 PHE A CD1 1 
ATOM   2641 C CD2 . PHE A 1 346 ? 23.85182  27.18030  -0.82313  1.000 48.54485  ? 346 PHE A CD2 1 
ATOM   2642 C CE1 . PHE A 1 346 ? 25.34542  26.36776  -2.99679  1.000 39.48698  ? 346 PHE A CE1 1 
ATOM   2643 C CE2 . PHE A 1 346 ? 23.28010  26.38124  -1.78878  1.000 46.10096  ? 346 PHE A CE2 1 
ATOM   2644 C CZ  . PHE A 1 346 ? 24.03081  25.97329  -2.87587  1.000 41.89624  ? 346 PHE A CZ  1 
ATOM   2645 N N   . SER A 1 347 ? 25.12205  31.13648  1.78178   1.000 37.31350  ? 347 SER A N   1 
ATOM   2646 C CA  . SER A 1 347 ? 25.29409  31.90240  3.00550   1.000 40.90704  ? 347 SER A CA  1 
ATOM   2647 C C   . SER A 1 347 ? 24.01030  31.83075  3.81954   1.000 49.56965  ? 347 SER A C   1 
ATOM   2648 O O   . SER A 1 347 ? 22.92750  31.58847  3.27883   1.000 60.37208  ? 347 SER A O   1 
ATOM   2649 C CB  . SER A 1 347 ? 25.64602  33.35905  2.72004   1.000 38.75167  ? 347 SER A CB  1 
ATOM   2650 O OG  . SER A 1 347 ? 25.17617  34.17467  3.78158   1.000 44.49922  ? 347 SER A OG  1 
ATOM   2651 N N   . LYS A 1 348 ? 24.14093  32.06868  5.13053   1.000 41.79701  ? 348 LYS A N   1 
ATOM   2652 C CA  . LYS A 1 348 ? 22.97787  32.07339  6.01103   1.000 38.20640  ? 348 LYS A CA  1 
ATOM   2653 C C   . LYS A 1 348 ? 22.18956  33.36936  5.94717   1.000 42.97547  ? 348 LYS A C   1 
ATOM   2654 O O   . LYS A 1 348 ? 21.04134  33.39614  6.41036   1.000 43.41955  ? 348 LYS A O   1 
ATOM   2655 C CB  . LYS A 1 348 ? 23.39329  31.82483  7.46206   1.000 45.14709  ? 348 LYS A CB  1 
ATOM   2656 C CG  . LYS A 1 348 ? 23.76520  33.07617  8.25110   1.000 50.68017  ? 348 LYS A CG  1 
ATOM   2657 C CD  . LYS A 1 348 ? 23.79229  32.77588  9.74673   1.000 45.17780  ? 348 LYS A CD  1 
ATOM   2658 C CE  . LYS A 1 348 ? 24.47515  33.87885  10.51905  1.000 48.05560  ? 348 LYS A CE  1 
ATOM   2659 N NZ  . LYS A 1 348 ? 23.67656  35.13093  10.55906  1.000 55.43028  ? 348 LYS A NZ  1 
ATOM   2660 N N   . ASP A 1 349 ? 22.75937  34.42359  5.35802   1.000 46.60399  ? 349 ASP A N   1 
ATOM   2661 C CA  . ASP A 1 349 ? 22.17991  35.76232  5.37318   1.000 51.61494  ? 349 ASP A CA  1 
ATOM   2662 C C   . ASP A 1 349 ? 21.51198  36.15550  4.05679   1.000 54.09070  ? 349 ASP A C   1 
ATOM   2663 O O   . ASP A 1 349 ? 20.92789  37.24523  3.98051   1.000 57.80036  ? 349 ASP A O   1 
ATOM   2664 C CB  . ASP A 1 349 ? 23.27713  36.77199  5.73222   1.000 54.65581  ? 349 ASP A CB  1 
ATOM   2665 C CG  . ASP A 1 349 ? 23.66760  36.70396  7.20784   1.000 61.78678  ? 349 ASP A CG  1 
ATOM   2666 O OD1 . ASP A 1 349 ? 24.87181  36.54386  7.50341   1.000 66.96100  ? 349 ASP A OD1 1 
ATOM   2667 O OD2 . ASP A 1 349 ? 22.76774  36.78611  8.07080   1.000 62.86353  ? 349 ASP A OD2 1 
ATOM   2668 N N   . ASN A 1 350 ? 21.57781  35.26707  3.04932   1.000 57.79916  ? 350 ASN A N   1 
ATOM   2669 C CA  . ASN A 1 350 ? 21.17851  35.38403  1.64702   1.000 48.74194  ? 350 ASN A CA  1 
ATOM   2670 C C   . ASN A 1 350 ? 20.17862  34.27319  1.42270   1.000 46.70087  ? 350 ASN A C   1 
ATOM   2671 O O   . ASN A 1 350 ? 20.16592  33.30766  2.18693   1.000 42.10891  ? 350 ASN A O   1 
ATOM   2672 C CB  . ASN A 1 350 ? 22.44249  35.25976  0.76779   1.000 59.83593  ? 350 ASN A CB  1 
ATOM   2673 C CG  . ASN A 1 350 ? 22.78376  36.57310  0.07107   1.000 93.20202  ? 350 ASN A CG  1 
ATOM   2674 O OD1 . ASN A 1 350 ? 22.20048  37.59139  0.38838   1.000 106.08485 ? 350 ASN A OD1 1 
ATOM   2675 N ND2 . ASN A 1 350 ? 23.85837  36.60025  -0.74306  1.000 116.87237 ? 350 ASN A ND2 1 
ATOM   2676 N N   . GLU A 1 351 ? 19.33650  34.38119  0.40546   1.000 51.09550  ? 351 GLU A N   1 
ATOM   2677 C CA  . GLU A 1 351 ? 18.54256  33.19360  0.12125   1.000 51.14315  ? 351 GLU A CA  1 
ATOM   2678 C C   . GLU A 1 351 ? 19.34296  32.09954  -0.58456  1.000 43.87873  ? 351 GLU A C   1 
ATOM   2679 O O   . GLU A 1 351 ? 18.77583  31.03573  -0.88010  1.000 35.86080  ? 351 GLU A O   1 
ATOM   2680 C CB  . GLU A 1 351 ? 17.31779  33.54188  -0.71354  1.000 61.90765  ? 351 GLU A CB  1 
ATOM   2681 C CG  . GLU A 1 351 ? 16.63545  34.82102  -0.31126  1.000 72.89616  ? 351 GLU A CG  1 
ATOM   2682 C CD  . GLU A 1 351 ? 15.73801  34.63389  0.87417   1.000 80.74712  ? 351 GLU A CD  1 
ATOM   2683 O OE1 . GLU A 1 351 ? 15.42130  33.45753  1.18231   1.000 80.80210  ? 351 GLU A OE1 1 
ATOM   2684 O OE2 . GLU A 1 351 ? 15.34852  35.66120  1.48508   1.000 82.47400  ? 351 GLU A OE2 1 
ATOM   2685 N N   . SER A 1 352 ? 20.62148  32.33771  -0.89400  1.000 34.42910  ? 352 SER A N   1 
ATOM   2686 C CA  . SER A 1 352 ? 21.46287  31.32271  -1.52740  1.000 43.89883  ? 352 SER A CA  1 
ATOM   2687 C C   . SER A 1 352 ? 20.87045  30.78977  -2.84067  1.000 42.46692  ? 352 SER A C   1 
ATOM   2688 O O   . SER A 1 352 ? 20.91901  29.58910  -3.12548  1.000 30.92299  ? 352 SER A O   1 
ATOM   2689 C CB  . SER A 1 352 ? 21.73826  30.18241  -0.55336  1.000 38.97713  ? 352 SER A CB  1 
ATOM   2690 O OG  . SER A 1 352 ? 22.60016  30.66031  0.44800   1.000 43.10793  ? 352 SER A OG  1 
ATOM   2691 N N   . LEU A 1 353 ? 20.30182  31.68350  -3.64860  1.000 42.44414  ? 353 LEU A N   1 
ATOM   2692 C CA  . LEU A 1 353 ? 19.83222  31.31243  -4.98111  1.000 41.24490  ? 353 LEU A CA  1 
ATOM   2693 C C   . LEU A 1 353 ? 21.02335  31.32720  -5.93771  1.000 45.92923  ? 353 LEU A C   1 
ATOM   2694 O O   . LEU A 1 353 ? 21.52028  32.40120  -6.29723  1.000 53.34011  ? 353 LEU A O   1 
ATOM   2695 C CB  . LEU A 1 353 ? 18.73962  32.26927  -5.44422  1.000 41.81588  ? 353 LEU A CB  1 
ATOM   2696 C CG  . LEU A 1 353 ? 17.42933  32.15021  -4.67155  1.000 43.47928  ? 353 LEU A CG  1 
ATOM   2697 C CD1 . LEU A 1 353 ? 16.32411  33.01282  -5.29375  1.000 44.82934  ? 353 LEU A CD1 1 
ATOM   2698 C CD2 . LEU A 1 353 ? 17.00629  30.69808  -4.62273  1.000 35.93145  ? 353 LEU A CD2 1 
ATOM   2699 N N   . ILE A 1 354 ? 21.47033  30.14854  -6.36202  1.000 38.35209  ? 354 ILE A N   1 
ATOM   2700 C CA  . ILE A 1 354 ? 22.70999  30.00464  -7.11281  1.000 39.52627  ? 354 ILE A CA  1 
ATOM   2701 C C   . ILE A 1 354 ? 22.42480  29.78048  -8.59584  1.000 47.65468  ? 354 ILE A C   1 
ATOM   2702 O O   . ILE A 1 354 ? 21.28624  29.57330  -9.01438  1.000 49.01650  ? 354 ILE A O   1 
ATOM   2703 C CB  . ILE A 1 354 ? 23.57991  28.86891  -6.54657  1.000 39.23663  ? 354 ILE A CB  1 
ATOM   2704 C CG1 . ILE A 1 354 ? 22.76214  27.57782  -6.42826  1.000 30.76890  ? 354 ILE A CG1 1 
ATOM   2705 C CG2 . ILE A 1 354 ? 24.14428  29.27312  -5.20861  1.000 51.62398  ? 354 ILE A CG2 1 
ATOM   2706 C CD1 . ILE A 1 354 ? 23.53825  26.32634  -6.76692  1.000 29.98552  ? 354 ILE A CD1 1 
ATOM   2707 N N   . SER A 1 355 ? 23.48327  29.82151  -9.40521  1.000 40.36511  ? 355 SER A N   1 
ATOM   2708 C CA  . SER A 1 355 ? 23.41820  29.59064  -10.84263 1.000 39.28020  ? 355 SER A CA  1 
ATOM   2709 C C   . SER A 1 355 ? 23.79158  28.15211  -11.18851 1.000 39.91364  ? 355 SER A C   1 
ATOM   2710 O O   . SER A 1 355 ? 24.34219  27.40558  -10.38024 1.000 48.40955  ? 355 SER A O   1 
ATOM   2711 C CB  . SER A 1 355 ? 24.35477  30.55017  -11.58012 1.000 43.45943  ? 355 SER A CB  1 
ATOM   2712 O OG  . SER A 1 355 ? 25.70584  30.10909  -11.49294 1.000 44.05452  ? 355 SER A OG  1 
ATOM   2713 N N   . ARG A 1 356 ? 23.50085  27.77048  -12.42818 1.000 44.01209  ? 356 ARG A N   1 
ATOM   2714 C CA  . ARG A 1 356 ? 23.93444  26.46036  -12.89923 1.000 47.05947  ? 356 ARG A CA  1 
ATOM   2715 C C   . ARG A 1 356 ? 25.44235  26.30777  -12.74598 1.000 46.84552  ? 356 ARG A C   1 
ATOM   2716 O O   . ARG A 1 356 ? 25.92290  25.30969  -12.20117 1.000 45.12376  ? 356 ARG A O   1 
ATOM   2717 C CB  . ARG A 1 356 ? 23.50391  26.24999  -14.35353 1.000 46.58624  ? 356 ARG A CB  1 
ATOM   2718 C CG  . ARG A 1 356 ? 24.04140  24.96323  -14.96542 1.000 49.39977  ? 356 ARG A CG  1 
ATOM   2719 C CD  . ARG A 1 356 ? 23.01903  24.30044  -15.86515 1.000 49.69230  ? 356 ARG A CD  1 
ATOM   2720 N NE  . ARG A 1 356 ? 22.26926  23.27305  -15.15560 1.000 56.45796  ? 356 ARG A NE  1 
ATOM   2721 C CZ  . ARG A 1 356 ? 22.56835  21.97909  -15.19039 1.000 54.09412  ? 356 ARG A CZ  1 
ATOM   2722 N NH1 . ARG A 1 356 ? 23.60698  21.56101  -15.90146 1.000 53.70404  ? 356 ARG A NH1 1 
ATOM   2723 N NH2 . ARG A 1 356 ? 21.83232  21.10579  -14.51329 1.000 51.17806  ? 356 ARG A NH2 1 
ATOM   2724 N N   . ALA A 1 357 ? 26.20330  27.31100  -13.19119 1.000 51.45196  ? 357 ALA A N   1 
ATOM   2725 C CA  . ALA A 1 357 ? 27.65372  27.26436  -13.04688 1.000 51.17322  ? 357 ALA A CA  1 
ATOM   2726 C C   . ALA A 1 357 ? 28.05645  26.92363  -11.61462 1.000 51.05666  ? 357 ALA A C   1 
ATOM   2727 O O   . ALA A 1 357 ? 28.87472  26.02457  -11.38316 1.000 54.94802  ? 357 ALA A O   1 
ATOM   2728 C CB  . ALA A 1 357 ? 28.25933  28.59504  -13.48827 1.000 52.34393  ? 357 ALA A CB  1 
ATOM   2729 N N   . GLN A 1 358 ? 27.44860  27.59997  -10.63488 1.000 46.47880  ? 358 GLN A N   1 
ATOM   2730 C CA  . GLN A 1 358 ? 27.82477  27.37646  -9.23944  1.000 41.51571  ? 358 GLN A CA  1 
ATOM   2731 C C   . GLN A 1 358 ? 27.41240  25.99804  -8.74665  1.000 38.97033  ? 358 GLN A C   1 
ATOM   2732 O O   . GLN A 1 358 ? 28.12194  25.39093  -7.93597  1.000 38.51356  ? 358 GLN A O   1 
ATOM   2733 C CB  . GLN A 1 358 ? 27.22317  28.46169  -8.35285  1.000 37.38246  ? 358 GLN A CB  1 
ATOM   2734 C CG  . GLN A 1 358 ? 27.76494  29.81488  -8.72086  1.000 39.19328  ? 358 GLN A CG  1 
ATOM   2735 C CD  . GLN A 1 358 ? 27.12883  30.93680  -7.96608  1.000 41.97806  ? 358 GLN A CD  1 
ATOM   2736 O OE1 . GLN A 1 358 ? 25.89677  31.02944  -7.87319  1.000 42.19346  ? 358 GLN A OE1 1 
ATOM   2737 N NE2 . GLN A 1 358 ? 27.96677  31.82577  -7.43182  1.000 46.66248  ? 358 GLN A NE2 1 
ATOM   2738 N N   . PHE A 1 359 ? 26.27774  25.49001  -9.21528  1.000 37.34672  ? 359 PHE A N   1 
ATOM   2739 C CA  . PHE A 1 359 ? 25.88201  24.13358  -8.86286  1.000 38.00452  ? 359 PHE A CA  1 
ATOM   2740 C C   . PHE A 1 359 ? 26.94461  23.12754  -9.29387  1.000 44.89979  ? 359 PHE A C   1 
ATOM   2741 O O   . PHE A 1 359 ? 27.36900  22.27471  -8.50402  1.000 43.14993  ? 359 PHE A O   1 
ATOM   2742 C CB  . PHE A 1 359 ? 24.53688  23.82056  -9.50362  1.000 31.17600  ? 359 PHE A CB  1 
ATOM   2743 C CG  . PHE A 1 359 ? 24.07506  22.42509  -9.28468  1.000 35.35410  ? 359 PHE A CG  1 
ATOM   2744 C CD1 . PHE A 1 359 ? 23.79932  21.59744  -10.35577 1.000 39.96616  ? 359 PHE A CD1 1 
ATOM   2745 C CD2 . PHE A 1 359 ? 23.89070  21.94153  -8.00783  1.000 39.96198  ? 359 PHE A CD2 1 
ATOM   2746 C CE1 . PHE A 1 359 ? 23.35835  20.30471  -10.15481 1.000 40.57807  ? 359 PHE A CE1 1 
ATOM   2747 C CE2 . PHE A 1 359 ? 23.44391  20.65206  -7.80178  1.000 43.71930  ? 359 PHE A CE2 1 
ATOM   2748 C CZ  . PHE A 1 359 ? 23.17232  19.83413  -8.87755  1.000 36.37072  ? 359 PHE A CZ  1 
ATOM   2749 N N   . LEU A 1 360 ? 27.40229  23.22575  -10.54826 1.000 45.45381  ? 360 LEU A N   1 
ATOM   2750 C CA  . LEU A 1 360 ? 28.42101  22.30124  -11.02891 1.000 38.59481  ? 360 LEU A CA  1 
ATOM   2751 C C   . LEU A 1 360 ? 29.70669  22.44503  -10.22116 1.000 40.15106  ? 360 LEU A C   1 
ATOM   2752 O O   . LEU A 1 360 ? 30.34209  21.44382  -9.87107  1.000 40.46253  ? 360 LEU A O   1 
ATOM   2753 C CB  . LEU A 1 360 ? 28.66956  22.52189  -12.52109 1.000 46.64769  ? 360 LEU A CB  1 
ATOM   2754 C CG  . LEU A 1 360 ? 27.63291  21.92709  -13.49928 1.000 60.21005  ? 360 LEU A CG  1 
ATOM   2755 C CD1 . LEU A 1 360 ? 26.29909  22.64437  -13.47963 1.000 67.10224  ? 360 LEU A CD1 1 
ATOM   2756 C CD2 . LEU A 1 360 ? 28.13740  21.89027  -14.94420 1.000 56.25160  ? 360 LEU A CD2 1 
ATOM   2757 N N   . ALA A 1 361 ? 30.08925  23.68404  -9.88974  1.000 40.71818  ? 361 ALA A N   1 
ATOM   2758 C CA  . ALA A 1 361 ? 31.25512  23.90145  -9.03622  1.000 44.57963  ? 361 ALA A CA  1 
ATOM   2759 C C   . ALA A 1 361 ? 31.05282  23.28598  -7.65292  1.000 44.10094  ? 361 ALA A C   1 
ATOM   2760 O O   . ALA A 1 361 ? 31.98288  22.70328  -7.07854  1.000 43.22557  ? 361 ALA A O   1 
ATOM   2761 C CB  . ALA A 1 361 ? 31.54697  25.39873  -8.92356  1.000 34.09201  ? 361 ALA A CB  1 
ATOM   2762 N N   . GLY A 1 362 ? 29.83982  23.40165  -7.10567  1.000 38.77991  ? 362 GLY A N   1 
ATOM   2763 C CA  . GLY A 1 362 ? 29.56526  22.83101  -5.80122  1.000 38.85850  ? 362 GLY A CA  1 
ATOM   2764 C C   . GLY A 1 362 ? 29.54308  21.31847  -5.80759  1.000 46.95868  ? 362 GLY A C   1 
ATOM   2765 O O   . GLY A 1 362 ? 29.91445  20.68825  -4.81272  1.000 52.12035  ? 362 GLY A O   1 
ATOM   2766 N N   . VAL A 1 363 ? 29.10331  20.71373  -6.91415  1.000 44.72734  ? 363 VAL A N   1 
ATOM   2767 C CA  . VAL A 1 363 ? 29.09610  19.25585  -7.00221  1.000 42.97609  ? 363 VAL A CA  1 
ATOM   2768 C C   . VAL A 1 363 ? 30.50875  18.71698  -6.83135  1.000 41.80280  ? 363 VAL A C   1 
ATOM   2769 O O   . VAL A 1 363 ? 30.71984  17.69445  -6.17170  1.000 42.00543  ? 363 VAL A O   1 
ATOM   2770 C CB  . VAL A 1 363 ? 28.45960  18.78772  -8.33052  1.000 38.63321  ? 363 VAL A CB  1 
ATOM   2771 C CG1 . VAL A 1 363 ? 28.88884  17.38280  -8.66900  1.000 30.01649  ? 363 VAL A CG1 1 
ATOM   2772 C CG2 . VAL A 1 363 ? 26.94502  18.82904  -8.23474  1.000 42.68501  ? 363 VAL A CG2 1 
ATOM   2773 N N   . ARG A 1 364 ? 31.50527  19.41310  -7.38879  1.000 38.51678  ? 364 ARG A N   1 
ATOM   2774 C CA  . ARG A 1 364 ? 32.87949  18.94069  -7.26396  1.000 38.23286  ? 364 ARG A CA  1 
ATOM   2775 C C   . ARG A 1 364 ? 33.43064  19.14206  -5.86227  1.000 36.17072  ? 364 ARG A C   1 
ATOM   2776 O O   . ARG A 1 364 ? 34.42213  18.49569  -5.50140  1.000 33.93900  ? 364 ARG A O   1 
ATOM   2777 C CB  . ARG A 1 364 ? 33.79683  19.64154  -8.26740  1.000 32.86792  ? 364 ARG A CB  1 
ATOM   2778 C CG  . ARG A 1 364 ? 33.22536  19.73144  -9.65493  1.000 52.88936  ? 364 ARG A CG  1 
ATOM   2779 C CD  . ARG A 1 364 ? 33.08730  18.36760  -10.33257 1.000 63.60934  ? 364 ARG A CD  1 
ATOM   2780 N NE  . ARG A 1 364 ? 34.20006  17.44203  -10.11049 1.000 77.03818  ? 364 ARG A NE  1 
ATOM   2781 C CZ  . ARG A 1 364 ? 35.23323  17.29336  -10.93156 1.000 77.73835  ? 364 ARG A CZ  1 
ATOM   2782 N NH1 . ARG A 1 364 ? 35.29777  17.99786  -12.04902 1.000 83.15949  ? 364 ARG A NH1 1 
ATOM   2783 N NH2 . ARG A 1 364 ? 36.19427  16.42796  -10.63809 1.000 83.43417  ? 364 ARG A NH2 1 
ATOM   2784 N N   . ILE A 1 365 ? 32.83972  20.04080  -5.08205  1.000 38.41104  ? 365 ILE A N   1 
ATOM   2785 C CA  . ILE A 1 365 ? 33.27379  20.24038  -3.70594  1.000 41.53954  ? 365 ILE A CA  1 
ATOM   2786 C C   . ILE A 1 365 ? 32.55633  19.28558  -2.75772  1.000 48.16024  ? 365 ILE A C   1 
ATOM   2787 O O   . ILE A 1 365 ? 33.19036  18.63447  -1.92101  1.000 44.94824  ? 365 ILE A O   1 
ATOM   2788 C CB  . ILE A 1 365 ? 33.07142  21.71587  -3.30929  1.000 41.18109  ? 365 ILE A CB  1 
ATOM   2789 C CG1 . ILE A 1 365 ? 33.98616  22.59649  -4.15452  1.000 37.64904  ? 365 ILE A CG1 1 
ATOM   2790 C CG2 . ILE A 1 365 ? 33.34464  21.93348  -1.81765  1.000 33.94614  ? 365 ILE A CG2 1 
ATOM   2791 C CD1 . ILE A 1 365 ? 33.73910  24.07070  -3.96540  1.000 40.47606  ? 365 ILE A CD1 1 
ATOM   2792 N N   . GLY A 1 366 ? 31.23076  19.16509  -2.90139  1.000 49.22776  ? 366 GLY A N   1 
ATOM   2793 C CA  . GLY A 1 366 ? 30.46492  18.20660  -2.12124  1.000 45.30352  ? 366 GLY A CA  1 
ATOM   2794 C C   . GLY A 1 366 ? 30.75063  16.75174  -2.45069  1.000 43.84001  ? 366 GLY A C   1 
ATOM   2795 O O   . GLY A 1 366 ? 30.48353  15.87614  -1.62106  1.000 50.47404  ? 366 GLY A O   1 
ATOM   2796 N N   . VAL A 1 367 ? 31.26988  16.46667  -3.64146  1.000 40.27072  ? 367 VAL A N   1 
ATOM   2797 C CA  . VAL A 1 367 ? 31.65180  15.09821  -3.98568  1.000 40.95044  ? 367 VAL A CA  1 
ATOM   2798 C C   . VAL A 1 367 ? 33.13328  15.09791  -4.34980  1.000 45.66086  ? 367 VAL A C   1 
ATOM   2799 O O   . VAL A 1 367 ? 33.49601  14.76466  -5.48888  1.000 46.77476  ? 367 VAL A O   1 
ATOM   2800 C CB  . VAL A 1 367 ? 30.78797  14.52894  -5.12363  1.000 27.95657  ? 367 VAL A CB  1 
ATOM   2801 C CG1 . VAL A 1 367 ? 30.83321  13.02358  -5.09407  1.000 29.32846  ? 367 VAL A CG1 1 
ATOM   2802 C CG2 . VAL A 1 367 ? 29.34603  15.00153  -5.01091  1.000 26.95065  ? 367 VAL A CG2 1 
ATOM   2803 N N   . PRO A 1 368 ? 34.02213  15.42823  -3.40598  1.000 47.08621  ? 368 PRO A N   1 
ATOM   2804 C CA  . PRO A 1 368 ? 35.40650  15.75195  -3.78947  1.000 43.45743  ? 368 PRO A CA  1 
ATOM   2805 C C   . PRO A 1 368 ? 36.16464  14.59606  -4.41009  1.000 42.02808  ? 368 PRO A C   1 
ATOM   2806 O O   . PRO A 1 368 ? 37.02274  14.83021  -5.27389  1.000 42.53303  ? 368 PRO A O   1 
ATOM   2807 C CB  . PRO A 1 368 ? 36.04396  16.20108  -2.46421  1.000 39.62763  ? 368 PRO A CB  1 
ATOM   2808 C CG  . PRO A 1 368 ? 35.17895  15.62582  -1.40451  1.000 39.86197  ? 368 PRO A CG  1 
ATOM   2809 C CD  . PRO A 1 368 ? 33.79563  15.57098  -1.95698  1.000 39.22934  ? 368 PRO A CD  1 
ATOM   2810 N N   . GLN A 1 369 ? 35.87089  13.35932  -4.01857  1.000 40.32305  ? 369 GLN A N   1 
ATOM   2811 C CA  A GLN A 1 369 ? 36.61761  12.22764  -4.55044  0.465 43.99822  ? 369 GLN A CA  1 
ATOM   2812 C CA  B GLN A 1 369 ? 36.57913  12.19259  -4.53550  0.535 44.04308  ? 369 GLN A CA  1 
ATOM   2813 C C   . GLN A 1 369 ? 36.11068  11.77131  -5.92428  1.000 50.56125  ? 369 GLN A C   1 
ATOM   2814 O O   . GLN A 1 369 ? 36.63347  10.78624  -6.46810  1.000 52.09442  ? 369 GLN A O   1 
ATOM   2815 C CB  A GLN A 1 369 ? 36.58825  11.07583  -3.53077  0.465 40.71686  ? 369 GLN A CB  1 
ATOM   2816 C CB  B GLN A 1 369 ? 36.42544  11.01210  -3.56808  0.535 40.48907  ? 369 GLN A CB  1 
ATOM   2817 C CG  A GLN A 1 369 ? 37.51882  11.27543  -2.29481  0.465 37.74141  ? 369 GLN A CG  1 
ATOM   2818 C CG  B GLN A 1 369 ? 35.20583  10.13357  -3.82922  0.535 32.59260  ? 369 GLN A CG  1 
ATOM   2819 C CD  A GLN A 1 369 ? 36.87094  12.06958  -1.14212  0.465 32.91736  ? 369 GLN A CD  1 
ATOM   2820 C CD  B GLN A 1 369 ? 33.97992  10.60452  -3.08887  0.535 30.46399  ? 369 GLN A CD  1 
ATOM   2821 O OE1 A GLN A 1 369 ? 35.82519  11.69246  -0.60788  0.465 29.71439  ? 369 GLN A OE1 1 
ATOM   2822 O OE1 B GLN A 1 369 ? 33.76627  11.80800  -2.91465  0.535 29.39332  ? 369 GLN A OE1 1 
ATOM   2823 N NE2 A GLN A 1 369 ? 37.50552  13.17267  -0.76281  0.465 33.58516  ? 369 GLN A NE2 1 
ATOM   2824 N NE2 B GLN A 1 369 ? 33.16417  9.65653   -2.64107  0.535 30.08107  ? 369 GLN A NE2 1 
ATOM   2825 N N   . ALA A 1 370 ? 35.14844  12.48448  -6.51624  1.000 48.55393  ? 370 ALA A N   1 
ATOM   2826 C CA  . ALA A 1 370 ? 34.52079  12.07891  -7.76940  1.000 51.13981  ? 370 ALA A CA  1 
ATOM   2827 C C   . ALA A 1 370 ? 35.30292  12.55091  -8.99702  1.000 49.89692  ? 370 ALA A C   1 
ATOM   2828 O O   . ALA A 1 370 ? 35.65841  13.73152  -9.10568  1.000 43.87670  ? 370 ALA A O   1 
ATOM   2829 C CB  . ALA A 1 370 ? 33.08876  12.61349  -7.82854  1.000 48.92530  ? 370 ALA A CB  1 
ATOM   2830 N N   . SER A 1 371 ? 35.53683  11.62476  -9.93190  1.000 48.05219  ? 371 SER A N   1 
ATOM   2831 C CA  . SER A 1 371 ? 36.13999  11.94658  -11.21955 1.000 50.02887  ? 371 SER A CA  1 
ATOM   2832 C C   . SER A 1 371 ? 35.20879  12.83421  -12.04289 1.000 57.58049  ? 371 SER A C   1 
ATOM   2833 O O   . SER A 1 371 ? 34.04398  13.06094  -11.69888 1.000 62.52438  ? 371 SER A O   1 
ATOM   2834 C CB  . SER A 1 371 ? 36.46031  10.67720  -12.01017 1.000 45.60478  ? 371 SER A CB  1 
ATOM   2835 O OG  . SER A 1 371 ? 35.28093  10.08769  -12.54837 1.000 47.68468  ? 371 SER A OG  1 
ATOM   2836 N N   . ASP A 1 372 ? 35.74293  13.33622  -13.15563 1.000 59.97211  ? 372 ASP A N   1 
ATOM   2837 C CA  . ASP A 1 372 ? 34.95646  14.20786  -14.01868 1.000 65.32679  ? 372 ASP A CA  1 
ATOM   2838 C C   . ASP A 1 372 ? 33.65158  13.54608  -14.43908 1.000 65.68395  ? 372 ASP A C   1 
ATOM   2839 O O   . ASP A 1 372 ? 32.58485  14.17419  -14.38664 1.000 60.71581  ? 372 ASP A O   1 
ATOM   2840 C CB  . ASP A 1 372 ? 35.78523  14.60652  -15.23678 1.000 66.24472  ? 372 ASP A CB  1 
ATOM   2841 C CG  . ASP A 1 372 ? 36.53604  15.89440  -15.01334 1.000 67.13569  ? 372 ASP A CG  1 
ATOM   2842 O OD1 . ASP A 1 372 ? 36.89914  16.14900  -13.83583 1.000 60.92758  ? 372 ASP A OD1 1 
ATOM   2843 O OD2 . ASP A 1 372 ? 36.77802  16.62821  -16.00507 1.000 68.07839  ? 372 ASP A OD2 1 
ATOM   2844 N N   . LEU A 1 373 ? 33.71427  12.26778  -14.83147 1.000 63.36318  ? 373 LEU A N   1 
ATOM   2845 C CA  . LEU A 1 373 ? 32.51548  11.57054  -15.28532 1.000 58.42579  ? 373 LEU A CA  1 
ATOM   2846 C C   . LEU A 1 373 ? 31.50886  11.39629  -14.14818 1.000 62.26130  ? 373 LEU A C   1 
ATOM   2847 O O   . LEU A 1 373 ? 30.32096  11.71870  -14.29824 1.000 62.36768  ? 373 LEU A O   1 
ATOM   2848 C CB  . LEU A 1 373 ? 32.89753  10.22094  -15.89426 1.000 52.71336  ? 373 LEU A CB  1 
ATOM   2849 C CG  . LEU A 1 373 ? 31.73826  9.42134   -16.50296 1.000 51.90993  ? 373 LEU A CG  1 
ATOM   2850 C CD1 . LEU A 1 373 ? 30.98830  10.26532  -17.52572 1.000 48.51079  ? 373 LEU A CD1 1 
ATOM   2851 C CD2 . LEU A 1 373 ? 32.22587  8.12404   -17.14982 1.000 50.77827  ? 373 LEU A CD2 1 
ATOM   2852 N N   . ALA A 1 374 ? 31.96262  10.88934  -12.99906 1.000 58.64954  ? 374 ALA A N   1 
ATOM   2853 C CA  . ALA A 1 374 ? 31.04617  10.68389  -11.88206 1.000 46.30085  ? 374 ALA A CA  1 
ATOM   2854 C C   . ALA A 1 374 ? 30.41686  11.99405  -11.43109 1.000 43.45061  ? 374 ALA A C   1 
ATOM   2855 O O   . ALA A 1 374 ? 29.24791  12.02695  -11.02594 1.000 42.57719  ? 374 ALA A O   1 
ATOM   2856 C CB  . ALA A 1 374 ? 31.77856  10.02196  -10.72942 1.000 47.90623  ? 374 ALA A CB  1 
ATOM   2857 N N   . ALA A 1 375 ? 31.17666  13.08538  -11.48461 1.000 45.73616  ? 375 ALA A N   1 
ATOM   2858 C CA  . ALA A 1 375 ? 30.59439  14.38475  -11.18660 1.000 42.22248  ? 375 ALA A CA  1 
ATOM   2859 C C   . ALA A 1 375 ? 29.46011  14.69085  -12.15185 1.000 51.45527  ? 375 ALA A C   1 
ATOM   2860 O O   . ALA A 1 375 ? 28.35609  15.05604  -11.73270 1.000 56.87266  ? 375 ALA A O   1 
ATOM   2861 C CB  . ALA A 1 375 ? 31.66858  15.46264  -11.24271 1.000 35.06355  ? 375 ALA A CB  1 
ATOM   2862 N N   . GLU A 1 376 ? 29.70732  14.52122  -13.45512 1.000 57.44068  ? 376 GLU A N   1 
ATOM   2863 C CA  A GLU A 1 376 ? 28.64076  14.75590  -14.41914 0.494 59.04419  ? 376 GLU A CA  1 
ATOM   2864 C CA  B GLU A 1 376 ? 28.65688  14.71748  -14.45137 0.506 59.19405  ? 376 GLU A CA  1 
ATOM   2865 C C   . GLU A 1 376 ? 27.44248  13.85998  -14.13036 1.000 54.80480  ? 376 GLU A C   1 
ATOM   2866 O O   . GLU A 1 376 ? 26.29987  14.31899  -14.20510 1.000 58.63943  ? 376 GLU A O   1 
ATOM   2867 C CB  A GLU A 1 376 ? 29.14717  14.55964  -15.85328 0.494 59.31566  ? 376 GLU A CB  1 
ATOM   2868 C CB  B GLU A 1 376 ? 29.17771  14.37940  -15.85692 0.506 59.37036  ? 376 GLU A CB  1 
ATOM   2869 C CG  A GLU A 1 376 ? 28.29213  15.26089  -16.92587 0.494 61.07151  ? 376 GLU A CG  1 
ATOM   2870 C CG  B GLU A 1 376 ? 30.27703  15.28892  -16.39679 0.506 60.52789  ? 376 GLU A CG  1 
ATOM   2871 C CD  A GLU A 1 376 ? 28.20185  16.78214  -16.74495 0.494 64.96689  ? 376 GLU A CD  1 
ATOM   2872 C CD  B GLU A 1 376 ? 30.41495  15.19532  -17.91549 0.506 64.09880  ? 376 GLU A CD  1 
ATOM   2873 O OE1 A GLU A 1 376 ? 29.23936  17.42561  -16.46550 0.494 67.05053  ? 376 GLU A OE1 1 
ATOM   2874 O OE1 B GLU A 1 376 ? 29.45032  14.73224  -18.56064 0.506 63.78018  ? 376 GLU A OE1 1 
ATOM   2875 O OE2 A GLU A 1 376 ? 27.08986  17.33957  -16.88983 0.494 62.14430  ? 376 GLU A OE2 1 
ATOM   2876 O OE2 B GLU A 1 376 ? 31.48066  15.57196  -18.46110 0.506 61.81798  ? 376 GLU A OE2 1 
ATOM   2877 N N   . ALA A 1 377 ? 27.67635  12.59732  -13.76853 1.000 38.07711  ? 377 ALA A N   1 
ATOM   2878 C CA  . ALA A 1 377 ? 26.55576  11.71610  -13.46147 1.000 37.97993  ? 377 ALA A CA  1 
ATOM   2879 C C   . ALA A 1 377 ? 25.71459  12.27868  -12.31628 1.000 42.33828  ? 377 ALA A C   1 
ATOM   2880 O O   . ALA A 1 377 ? 24.48719  12.38671  -12.43532 1.000 41.69107  ? 377 ALA A O   1 
ATOM   2881 C CB  . ALA A 1 377 ? 27.05879  10.31015  -13.15114 1.000 38.71904  ? 377 ALA A CB  1 
ATOM   2882 N N   . VAL A 1 378 ? 26.36109  12.67098  -11.20702 1.000 41.15159  ? 378 VAL A N   1 
ATOM   2883 C CA  . VAL A 1 378 ? 25.65375  13.36097  -10.12599 1.000 38.35124  ? 378 VAL A CA  1 
ATOM   2884 C C   . VAL A 1 378 ? 24.86628  14.55337  -10.67064 1.000 41.52346  ? 378 VAL A C   1 
ATOM   2885 O O   . VAL A 1 378 ? 23.67575  14.71996  -10.37627 1.000 41.02209  ? 378 VAL A O   1 
ATOM   2886 C CB  . VAL A 1 378 ? 26.63940  13.79687  -9.02186  1.000 34.56817  ? 378 VAL A CB  1 
ATOM   2887 C CG1 . VAL A 1 378 ? 25.98360  14.82009  -8.08223  1.000 29.17832  ? 378 VAL A CG1 1 
ATOM   2888 C CG2 . VAL A 1 378 ? 27.12985  12.59752  -8.21618  1.000 32.29502  ? 378 VAL A CG2 1 
ATOM   2889 N N   . VAL A 1 379 ? 25.51796  15.40182  -11.47265 1.000 43.20787  ? 379 VAL A N   1 
ATOM   2890 C CA  . VAL A 1 379 ? 24.84822  16.59562  -11.99100 1.000 46.82313  ? 379 VAL A CA  1 
ATOM   2891 C C   . VAL A 1 379 ? 23.65234  16.21926  -12.85620 1.000 47.78856  ? 379 VAL A C   1 
ATOM   2892 O O   . VAL A 1 379 ? 22.62442  16.89929  -12.83952 1.000 43.56712  ? 379 VAL A O   1 
ATOM   2893 C CB  . VAL A 1 379 ? 25.83110  17.47407  -12.78075 1.000 40.15372  ? 379 VAL A CB  1 
ATOM   2894 C CG1 . VAL A 1 379 ? 25.06711  18.55690  -13.53646 1.000 42.66927  ? 379 VAL A CG1 1 
ATOM   2895 C CG2 . VAL A 1 379 ? 26.82699  18.08875  -11.86276 1.000 35.49073  ? 379 VAL A CG2 1 
ATOM   2896 N N   . LEU A 1 380 ? 23.77598  15.14477  -13.63514 1.000 48.71980  ? 380 LEU A N   1 
ATOM   2897 C CA  . LEU A 1 380 ? 22.67487  14.69086  -14.47898 1.000 52.18394  ? 380 LEU A CA  1 
ATOM   2898 C C   . LEU A 1 380 ? 21.50380  14.17771  -13.64242 1.000 52.32044  ? 380 LEU A C   1 
ATOM   2899 O O   . LEU A 1 380 ? 20.33613  14.43341  -13.96932 1.000 53.80150  ? 380 LEU A O   1 
ATOM   2900 C CB  . LEU A 1 380 ? 23.17002  13.59671  -15.42616 1.000 56.79245  ? 380 LEU A CB  1 
ATOM   2901 C CG  . LEU A 1 380 ? 23.75724  14.00909  -16.76881 1.000 70.32429  ? 380 LEU A CG  1 
ATOM   2902 C CD1 . LEU A 1 380 ? 22.61921  14.18420  -17.75474 1.000 83.81907  ? 380 LEU A CD1 1 
ATOM   2903 C CD2 . LEU A 1 380 ? 24.61302  15.27462  -16.69686 1.000 65.49169  ? 380 LEU A CD2 1 
ATOM   2904 N N   . HIS A 1 381 ? 21.79064  13.43978  -12.56912 1.000 44.48470  ? 381 HIS A N   1 
ATOM   2905 C CA  . HIS A 1 381 ? 20.71086  12.88608  -11.75732 1.000 54.24118  ? 381 HIS A CA  1 
ATOM   2906 C C   . HIS A 1 381 ? 19.92039  13.98239  -11.03834 1.000 53.88821  ? 381 HIS A C   1 
ATOM   2907 O O   . HIS A 1 381 ? 18.68123  13.97091  -11.04390 1.000 57.31464  ? 381 HIS A O   1 
ATOM   2908 C CB  . HIS A 1 381 ? 21.26347  11.87357  -10.75257 1.000 57.02017  ? 381 HIS A CB  1 
ATOM   2909 C CG  . HIS A 1 381 ? 20.19847  11.19064  -9.95637  1.000 58.88051  ? 381 HIS A CG  1 
ATOM   2910 N ND1 . HIS A 1 381 ? 19.63249  9.99491   -10.34296 1.000 62.21420  ? 381 HIS A ND1 1 
ATOM   2911 C CD2 . HIS A 1 381 ? 19.57293  11.55082  -8.81112  1.000 58.33245  ? 381 HIS A CD2 1 
ATOM   2912 C CE1 . HIS A 1 381 ? 18.71107  9.64200   -9.46476  1.000 61.65120  ? 381 HIS A CE1 1 
ATOM   2913 N NE2 . HIS A 1 381 ? 18.65389  10.57009  -8.52611  1.000 61.03718  ? 381 HIS A NE2 1 
ATOM   2914 N N   . TYR A 1 382 ? 20.61198  14.94644  -10.42200 1.000 40.47802  ? 382 TYR A N   1 
ATOM   2915 C CA  . TYR A 1 382 ? 19.91707  15.86013  -9.52269  1.000 43.08046  ? 382 TYR A CA  1 
ATOM   2916 C C   . TYR A 1 382 ? 19.26356  17.02315  -10.24110 1.000 52.80295  ? 382 TYR A C   1 
ATOM   2917 O O   . TYR A 1 382 ? 18.34224  17.63153  -9.68289  1.000 66.90448  ? 382 TYR A O   1 
ATOM   2918 C CB  . TYR A 1 382 ? 20.86689  16.38880  -8.44038  1.000 34.37706  ? 382 TYR A CB  1 
ATOM   2919 C CG  . TYR A 1 382 ? 21.03655  15.38705  -7.32686  1.000 37.88819  ? 382 TYR A CG  1 
ATOM   2920 C CD1 . TYR A 1 382 ? 21.80163  14.25089  -7.51003  1.000 35.59388  ? 382 TYR A CD1 1 
ATOM   2921 C CD2 . TYR A 1 382 ? 20.38724  15.55000  -6.10419  1.000 48.68415  ? 382 TYR A CD2 1 
ATOM   2922 C CE1 . TYR A 1 382 ? 21.94310  13.31480  -6.50126  1.000 43.67371  ? 382 TYR A CE1 1 
ATOM   2923 C CE2 . TYR A 1 382 ? 20.52400  14.62147  -5.08486  1.000 46.68375  ? 382 TYR A CE2 1 
ATOM   2924 C CZ  . TYR A 1 382 ? 21.30297  13.50247  -5.29162  1.000 46.99915  ? 382 TYR A CZ  1 
ATOM   2925 O OH  . TYR A 1 382 ? 21.44951  12.56263  -4.29617  1.000 48.43216  ? 382 TYR A OH  1 
ATOM   2926 N N   . THR A 1 383 ? 19.70356  17.34174  -11.45264 1.000 46.83728  ? 383 THR A N   1 
ATOM   2927 C CA  . THR A 1 383 ? 19.13727  18.47797  -12.16619 1.000 52.09268  ? 383 THR A CA  1 
ATOM   2928 C C   . THR A 1 383 ? 17.70758  18.18573  -12.61688 1.000 46.43301  ? 383 THR A C   1 
ATOM   2929 O O   . THR A 1 383 ? 17.36346  17.05944  -12.98344 1.000 43.92177  ? 383 THR A O   1 
ATOM   2930 C CB  . THR A 1 383 ? 20.00280  18.82729  -13.37077 1.000 54.35494  ? 383 THR A CB  1 
ATOM   2931 O OG1 . THR A 1 383 ? 19.30161  19.73444  -14.22870 1.000 59.76439  ? 383 THR A OG1 1 
ATOM   2932 C CG2 . THR A 1 383 ? 20.22850  17.62390  -14.12816 1.000 60.72496  ? 383 THR A CG2 1 
ATOM   2933 N N   . ASP A 1 384 ? 16.86943  19.21151  -12.56790 1.000 43.08593  ? 384 ASP A N   1 
ATOM   2934 C CA  . ASP A 1 384 ? 15.49099  19.11609  -13.02302 1.000 51.28535  ? 384 ASP A CA  1 
ATOM   2935 C C   . ASP A 1 384 ? 15.46581  19.54774  -14.48778 1.000 50.93617  ? 384 ASP A C   1 
ATOM   2936 O O   . ASP A 1 384 ? 15.61595  20.73327  -14.79883 1.000 45.47534  ? 384 ASP A O   1 
ATOM   2937 C CB  . ASP A 1 384 ? 14.58828  19.97623  -12.13726 1.000 54.58609  ? 384 ASP A CB  1 
ATOM   2938 C CG  . ASP A 1 384 ? 13.14004  20.02686  -12.61869 1.000 62.35720  ? 384 ASP A CG  1 
ATOM   2939 O OD1 . ASP A 1 384 ? 12.77476  19.35906  -13.61510 1.000 64.84850  ? 384 ASP A OD1 1 
ATOM   2940 O OD2 . ASP A 1 384 ? 12.36148  20.76298  -11.98397 1.000 64.06589  ? 384 ASP A OD2 1 
ATOM   2941 N N   . TRP A 1 385 ? 15.28700  18.58655  -15.39160 1.000 51.18637  ? 385 TRP A N   1 
ATOM   2942 C CA  . TRP A 1 385 ? 15.43793  18.90412  -16.80404 1.000 50.79753  ? 385 TRP A CA  1 
ATOM   2943 C C   . TRP A 1 385 ? 14.26172  19.68727  -17.35735 1.000 50.79392  ? 385 TRP A C   1 
ATOM   2944 O O   . TRP A 1 385 ? 14.38172  20.25476  -18.44575 1.000 54.13431  ? 385 TRP A O   1 
ATOM   2945 C CB  . TRP A 1 385 ? 15.70321  17.62160  -17.59814 1.000 45.52290  ? 385 TRP A CB  1 
ATOM   2946 C CG  . TRP A 1 385 ? 17.06832  17.12309  -17.25074 1.000 43.97835  ? 385 TRP A CG  1 
ATOM   2947 C CD1 . TRP A 1 385 ? 17.38115  16.11518  -16.38600 1.000 42.66454  ? 385 TRP A CD1 1 
ATOM   2948 C CD2 . TRP A 1 385 ? 18.31598  17.67827  -17.68540 1.000 49.52728  ? 385 TRP A CD2 1 
ATOM   2949 N NE1 . TRP A 1 385 ? 18.74678  15.98169  -16.28510 1.000 41.66665  ? 385 TRP A NE1 1 
ATOM   2950 C CE2 . TRP A 1 385 ? 19.34410  16.93258  -17.06840 1.000 48.36202  ? 385 TRP A CE2 1 
ATOM   2951 C CE3 . TRP A 1 385 ? 18.66708  18.72912  -18.54877 1.000 48.47244  ? 385 TRP A CE3 1 
ATOM   2952 C CZ2 . TRP A 1 385 ? 20.70186  17.20312  -17.28502 1.000 46.55729  ? 385 TRP A CZ2 1 
ATOM   2953 C CZ3 . TRP A 1 385 ? 20.02314  19.00076  -18.76172 1.000 46.70121  ? 385 TRP A CZ3 1 
ATOM   2954 C CH2 . TRP A 1 385 ? 21.01837  18.24059  -18.12802 1.000 49.60696  ? 385 TRP A CH2 1 
ATOM   2955 N N   . LEU A 1 386 ? 13.16088  19.78458  -16.61394 1.000 51.17062  ? 386 LEU A N   1 
ATOM   2956 C CA  . LEU A 1 386 ? 12.11322  20.73859  -16.95066 1.000 53.07474  ? 386 LEU A CA  1 
ATOM   2957 C C   . LEU A 1 386 ? 12.48698  22.17487  -16.58925 1.000 58.06089  ? 386 LEU A C   1 
ATOM   2958 O O   . LEU A 1 386 ? 11.92168  23.11324  -17.16000 1.000 66.35935  ? 386 LEU A O   1 
ATOM   2959 C CB  . LEU A 1 386 ? 10.80701  20.35284  -16.25004 1.000 48.33854  ? 386 LEU A CB  1 
ATOM   2960 C CG  . LEU A 1 386 ? 9.64151   19.97185  -17.15555 1.000 61.41126  ? 386 LEU A CG  1 
ATOM   2961 C CD1 . LEU A 1 386 ? 8.38432   19.68152  -16.33876 1.000 59.82179  ? 386 LEU A CD1 1 
ATOM   2962 C CD2 . LEU A 1 386 ? 9.39687   21.06528  -18.22333 1.000 66.59490  ? 386 LEU A CD2 1 
ATOM   2963 N N   . HIS A 1 387 ? 13.41280  22.36731  -15.65068 1.000 57.84185  ? 387 HIS A N   1 
ATOM   2964 C CA  . HIS A 1 387 ? 13.79969  23.68538  -15.15370 1.000 63.89568  ? 387 HIS A CA  1 
ATOM   2965 C C   . HIS A 1 387 ? 15.28120  23.65591  -14.78215 1.000 59.61146  ? 387 HIS A C   1 
ATOM   2966 O O   . HIS A 1 387 ? 15.63706  23.87833  -13.61963 1.000 56.77197  ? 387 HIS A O   1 
ATOM   2967 C CB  . HIS A 1 387 ? 12.95554  24.09465  -13.93281 1.000 69.88650  ? 387 HIS A CB  1 
ATOM   2968 C CG  . HIS A 1 387 ? 11.49222  24.29335  -14.21571 1.000 73.01427  ? 387 HIS A CG  1 
ATOM   2969 N ND1 . HIS A 1 387 ? 10.51755  23.44114  -13.73812 1.000 71.80221  ? 387 HIS A ND1 1 
ATOM   2970 C CD2 . HIS A 1 387 ? 10.83705  25.26069  -14.90304 1.000 76.79990  ? 387 HIS A CD2 1 
ATOM   2971 C CE1 . HIS A 1 387 ? 9.32786   23.86757  -14.12599 1.000 73.31799  ? 387 HIS A CE1 1 
ATOM   2972 N NE2 . HIS A 1 387 ? 9.49353   24.97013  -14.83512 1.000 78.66557  ? 387 HIS A NE2 1 
ATOM   2973 N N   . PRO A 1 388 ? 16.18147  23.39661  -15.73375 1.000 59.21666  ? 388 PRO A N   1 
ATOM   2974 C CA  . PRO A 1 388 ? 17.58080  23.13083  -15.36453 1.000 48.13575  ? 388 PRO A CA  1 
ATOM   2975 C C   . PRO A 1 388 ? 18.35114  24.34933  -14.88848 1.000 47.26049  ? 388 PRO A C   1 
ATOM   2976 O O   . PRO A 1 388 ? 19.50301  24.19379  -14.46935 1.000 52.44992  ? 388 PRO A O   1 
ATOM   2977 C CB  . PRO A 1 388 ? 18.17872  22.57985  -16.66132 1.000 48.37747  ? 388 PRO A CB  1 
ATOM   2978 C CG  . PRO A 1 388 ? 17.36562  23.25104  -17.76359 1.000 49.17824  ? 388 PRO A CG  1 
ATOM   2979 C CD  . PRO A 1 388 ? 15.98343  23.47670  -17.19687 1.000 56.24307  ? 388 PRO A CD  1 
ATOM   2980 N N   . GLU A 1 389 ? 17.76506  25.54814  -14.92708 1.000 47.96566  ? 389 GLU A N   1 
ATOM   2981 C CA  . GLU A 1 389 ? 18.47047  26.77020  -14.55788 1.000 51.85141  ? 389 GLU A CA  1 
ATOM   2982 C C   . GLU A 1 389 ? 17.79002  27.55263  -13.44266 1.000 47.14077  ? 389 GLU A C   1 
ATOM   2983 O O   . GLU A 1 389 ? 18.20701  28.68598  -13.17383 1.000 45.60672  ? 389 GLU A O   1 
ATOM   2984 C CB  . GLU A 1 389 ? 18.62988  27.68831  -15.77555 1.000 65.61806  ? 389 GLU A CB  1 
ATOM   2985 C CG  . GLU A 1 389 ? 19.01570  26.99976  -17.07490 1.000 73.35994  ? 389 GLU A CG  1 
ATOM   2986 C CD  . GLU A 1 389 ? 20.35415  27.46393  -17.63876 1.000 73.30697  ? 389 GLU A CD  1 
ATOM   2987 O OE1 . GLU A 1 389 ? 20.60238  27.17239  -18.82478 1.000 78.38877  ? 389 GLU A OE1 1 
ATOM   2988 O OE2 . GLU A 1 389 ? 21.15761  28.09731  -16.91473 1.000 68.45025  ? 389 GLU A OE2 1 
ATOM   2989 N N   . ASP A 1 390 ? 16.73818  27.00325  -12.81797 1.000 46.78836  ? 390 ASP A N   1 
ATOM   2990 C CA  . ASP A 1 390 ? 16.03367  27.67277  -11.72025 1.000 43.04463  ? 390 ASP A CA  1 
ATOM   2991 C C   . ASP A 1 390 ? 16.99138  27.78955  -10.54318 1.000 42.21287  ? 390 ASP A C   1 
ATOM   2992 O O   . ASP A 1 390 ? 17.48586  26.76217  -10.05696 1.000 35.71879  ? 390 ASP A O   1 
ATOM   2993 C CB  . ASP A 1 390 ? 14.75887  26.90197  -11.31749 1.000 47.50104  ? 390 ASP A CB  1 
ATOM   2994 C CG  . ASP A 1 390 ? 13.87759  27.63735  -10.26125 1.000 61.31631  ? 390 ASP A CG  1 
ATOM   2995 O OD1 . ASP A 1 390 ? 14.20313  28.74359  -9.76394  1.000 68.04146  ? 390 ASP A OD1 1 
ATOM   2996 O OD2 . ASP A 1 390 ? 12.79286  27.10361  -9.95254  1.000 69.08453  ? 390 ASP A OD2 1 
ATOM   2997 N N   . PRO A 1 391 ? 17.31403  29.00416  -10.08633 1.000 44.19460  ? 391 PRO A N   1 
ATOM   2998 C CA  . PRO A 1 391 ? 18.15469  29.12947  -8.88806  1.000 38.97662  ? 391 PRO A CA  1 
ATOM   2999 C C   . PRO A 1 391 ? 17.60174  28.39506  -7.68192  1.000 45.00561  ? 391 PRO A C   1 
ATOM   3000 O O   . PRO A 1 391 ? 18.38903  27.88699  -6.87507  1.000 47.46774  ? 391 PRO A O   1 
ATOM   3001 C CB  . PRO A 1 391 ? 18.19815  30.64075  -8.64930  1.000 40.90589  ? 391 PRO A CB  1 
ATOM   3002 C CG  . PRO A 1 391 ? 17.89830  31.25622  -9.99129  1.000 43.32517  ? 391 PRO A CG  1 
ATOM   3003 C CD  . PRO A 1 391 ? 16.97564  30.31401  -10.68028 1.000 42.41472  ? 391 PRO A CD  1 
ATOM   3004 N N   . THR A 1 392 ? 16.27733  28.30001  -7.52363  1.000 51.83266  ? 392 THR A N   1 
ATOM   3005 C CA  . THR A 1 392 ? 15.77072  27.63380  -6.32661  1.000 54.16421  ? 392 THR A CA  1 
ATOM   3006 C C   . THR A 1 392 ? 15.95681  26.11903  -6.41514  1.000 51.74332  ? 392 THR A C   1 
ATOM   3007 O O   . THR A 1 392 ? 16.47375  25.50214  -5.46995  1.000 46.58311  ? 392 THR A O   1 
ATOM   3008 C CB  . THR A 1 392 ? 14.30852  28.00914  -6.04340  1.000 47.08663  ? 392 THR A CB  1 
ATOM   3009 O OG1 . THR A 1 392 ? 14.21923  29.39143  -5.66342  1.000 37.27511  ? 392 THR A OG1 1 
ATOM   3010 C CG2 . THR A 1 392 ? 13.79541  27.19017  -4.88930  1.000 45.38028  ? 392 THR A CG2 1 
ATOM   3011 N N   . HIS A 1 393 ? 15.55346  25.49083  -7.53570  1.000 44.13218  ? 393 HIS A N   1 
ATOM   3012 C CA  A HIS A 1 393 ? 15.78825  24.05313  -7.60059  0.533 39.37154  ? 393 HIS A CA  1 
ATOM   3013 C CA  B HIS A 1 393 ? 15.79429  24.05946  -7.73563  0.467 39.70669  ? 393 HIS A CA  1 
ATOM   3014 C C   . HIS A 1 393 ? 17.26452  23.71964  -7.50904  1.000 35.00327  ? 393 HIS A C   1 
ATOM   3015 O O   . HIS A 1 393 ? 17.60796  22.67082  -6.95842  1.000 42.71486  ? 393 HIS A O   1 
ATOM   3016 C CB  A HIS A 1 393 ? 15.23835  23.39102  -8.85757  0.533 41.19515  ? 393 HIS A CB  1 
ATOM   3017 C CB  B HIS A 1 393 ? 15.39725  23.65310  -9.16525  0.467 41.21611  ? 393 HIS A CB  1 
ATOM   3018 C CG  A HIS A 1 393 ? 15.52811  21.91837  -8.89341  0.533 39.22929  ? 393 HIS A CG  1 
ATOM   3019 C CG  B HIS A 1 393 ? 13.94998  23.28846  -9.35018  0.467 42.28985  ? 393 HIS A CG  1 
ATOM   3020 N ND1 A HIS A 1 393 ? 16.69707  21.40106  -9.41261  0.533 33.04900  ? 393 HIS A ND1 1 
ATOM   3021 N ND1 B HIS A 1 393 ? 13.03235  24.14645  -9.92041  0.467 43.91715  ? 393 HIS A ND1 1 
ATOM   3022 C CD2 A HIS A 1 393 ? 14.84011  20.86162  -8.39624  0.533 37.42324  ? 393 HIS A CD2 1 
ATOM   3023 C CD2 B HIS A 1 393 ? 13.27911  22.13607  -9.10632  0.467 39.48210  ? 393 HIS A CD2 1 
ATOM   3024 C CE1 A HIS A 1 393 ? 16.69845  20.08807  -9.27099  0.533 32.69722  ? 393 HIS A CE1 1 
ATOM   3025 C CE1 B HIS A 1 393 ? 11.85509  23.55030  -9.99347  0.467 39.54668  ? 393 HIS A CE1 1 
ATOM   3026 N NE2 A HIS A 1 393 ? 15.58157  19.73423  -8.65946  0.533 37.73719  ? 393 HIS A NE2 1 
ATOM   3027 N NE2 B HIS A 1 393 ? 11.97831  22.32916  -9.50640  0.467 39.32364  ? 393 HIS A NE2 1 
ATOM   3028 N N   . LEU A 1 394 ? 18.14831  24.58789  -7.99589  1.000 31.75652  ? 394 LEU A N   1 
ATOM   3029 C CA  . LEU A 1 394 ? 19.56819  24.26880  -8.00015  1.000 35.82018  ? 394 LEU A CA  1 
ATOM   3030 C C   . LEU A 1 394 ? 20.13805  24.28143  -6.59044  1.000 36.73695  ? 394 LEU A C   1 
ATOM   3031 O O   . LEU A 1 394 ? 20.83874  23.34635  -6.18096  1.000 33.68897  ? 394 LEU A O   1 
ATOM   3032 C CB  . LEU A 1 394 ? 20.31325  25.25736  -8.89291  1.000 43.52620  ? 394 LEU A CB  1 
ATOM   3033 C CG  . LEU A 1 394 ? 20.23760  24.95853  -10.38829 1.000 46.24048  ? 394 LEU A CG  1 
ATOM   3034 C CD1 . LEU A 1 394 ? 20.80187  26.11237  -11.18828 1.000 50.01553  ? 394 LEU A CD1 1 
ATOM   3035 C CD2 . LEU A 1 394 ? 20.95933  23.65961  -10.70827 1.000 45.02531  ? 394 LEU A CD2 1 
ATOM   3036 N N   . ARG A 1 395 ? 19.85105  25.35078  -5.84683  1.000 32.90675  ? 395 ARG A N   1 
ATOM   3037 C CA  . ARG A 1 395 ? 20.19120  25.43419  -4.43673  1.000 38.92196  ? 395 ARG A CA  1 
ATOM   3038 C C   . ARG A 1 395 ? 19.75299  24.17701  -3.68475  1.000 39.13774  ? 395 ARG A C   1 
ATOM   3039 O O   . ARG A 1 395 ? 20.58117  23.44220  -3.12407  1.000 33.03589  ? 395 ARG A O   1 
ATOM   3040 C CB  . ARG A 1 395 ? 19.55235  26.69529  -3.84176  1.000 36.36834  ? 395 ARG A CB  1 
ATOM   3041 C CG  . ARG A 1 395 ? 19.63377  26.74463  -2.31700  1.000 35.59296  ? 395 ARG A CG  1 
ATOM   3042 C CD  . ARG A 1 395 ? 18.70816  27.77683  -1.70046  1.000 32.10303  ? 395 ARG A CD  1 
ATOM   3043 N NE  . ARG A 1 395 ? 17.34789  27.28444  -1.52747  1.000 32.53754  ? 395 ARG A NE  1 
ATOM   3044 C CZ  . ARG A 1 395 ? 16.29278  28.08277  -1.39310  1.000 34.88201  ? 395 ARG A CZ  1 
ATOM   3045 N NH1 . ARG A 1 395 ? 16.45549  29.40131  -1.41071  1.000 32.70868  ? 395 ARG A NH1 1 
ATOM   3046 N NH2 . ARG A 1 395 ? 15.07957  27.56909  -1.25490  1.000 30.85394  ? 395 ARG A NH2 1 
ATOM   3047 N N   . ASP A 1 396 ? 18.44622  23.90237  -3.68915  1.000 37.71280  ? 396 ASP A N   1 
ATOM   3048 C CA  . ASP A 1 396 ? 17.93951  22.76455  -2.93072  1.000 37.21284  ? 396 ASP A CA  1 
ATOM   3049 C C   . ASP A 1 396 ? 18.50850  21.45099  -3.45320  1.000 36.80060  ? 396 ASP A C   1 
ATOM   3050 O O   . ASP A 1 396 ? 18.66277  20.48945  -2.68498  1.000 37.10193  ? 396 ASP A O   1 
ATOM   3051 C CB  . ASP A 1 396 ? 16.40611  22.75094  -2.95804  1.000 36.05426  ? 396 ASP A CB  1 
ATOM   3052 C CG  . ASP A 1 396 ? 15.79039  24.04533  -2.40189  1.000 44.07931  ? 396 ASP A CG  1 
ATOM   3053 O OD1 . ASP A 1 396 ? 16.49317  24.78681  -1.65824  1.000 45.88050  ? 396 ASP A OD1 1 
ATOM   3054 O OD2 . ASP A 1 396 ? 14.59940  24.31183  -2.68738  1.000 41.80262  ? 396 ASP A OD2 1 
ATOM   3055 N N   . ALA A 1 397 ? 18.83321  21.39513  -4.75035  1.000 33.84396  ? 397 ALA A N   1 
ATOM   3056 C CA  . ALA A 1 397 ? 19.51051  20.22479  -5.29871  1.000 33.72501  ? 397 ALA A CA  1 
ATOM   3057 C C   . ALA A 1 397 ? 20.92909  20.10304  -4.75855  1.000 36.22679  ? 397 ALA A C   1 
ATOM   3058 O O   . ALA A 1 397 ? 21.41154  18.99299  -4.50794  1.000 35.53442  ? 397 ALA A O   1 
ATOM   3059 C CB  . ALA A 1 397 ? 19.53613  20.29746  -6.82083  1.000 34.86522  ? 397 ALA A CB  1 
ATOM   3060 N N   . MET A 1 398 ? 21.61858  21.23068  -4.58984  1.000 32.72756  ? 398 MET A N   1 
ATOM   3061 C CA  . MET A 1 398 ? 22.96521  21.18328  -4.04448  1.000 37.37988  ? 398 MET A CA  1 
ATOM   3062 C C   . MET A 1 398 ? 22.95282  20.69731  -2.60081  1.000 43.29880  ? 398 MET A C   1 
ATOM   3063 O O   . MET A 1 398 ? 23.82998  19.92734  -2.19011  1.000 41.02576  ? 398 MET A O   1 
ATOM   3064 C CB  . MET A 1 398 ? 23.61172  22.55916  -4.14273  1.000 39.26316  ? 398 MET A CB  1 
ATOM   3065 C CG  . MET A 1 398 ? 25.04355  22.61652  -3.63692  1.000 39.90107  ? 398 MET A CG  1 
ATOM   3066 S SD  . MET A 1 398 ? 26.20268  21.87368  -4.79728  1.000 39.87729  ? 398 MET A SD  1 
ATOM   3067 C CE  . MET A 1 398 ? 26.47861  20.27466  -4.05051  1.000 41.90875  ? 398 MET A CE  1 
ATOM   3068 N N   . SER A 1 399 ? 21.97885  21.15536  -1.80954  1.000 44.50333  ? 399 SER A N   1 
ATOM   3069 C CA  . SER A 1 399 ? 21.83497  20.64392  -0.45208  1.000 36.29448  ? 399 SER A CA  1 
ATOM   3070 C C   . SER A 1 399 ? 21.58639  19.14514  -0.47890  1.000 37.05957  ? 399 SER A C   1 
ATOM   3071 O O   . SER A 1 399 ? 22.15990  18.39476  0.32226   1.000 42.94123  ? 399 SER A O   1 
ATOM   3072 C CB  . SER A 1 399 ? 20.70308  21.39020  0.26624   1.000 36.42899  ? 399 SER A CB  1 
ATOM   3073 O OG  . SER A 1 399 ? 20.12171  20.66009  1.34694   1.000 38.03710  ? 399 SER A OG  1 
ATOM   3074 N N   . ALA A 1 400 ? 20.77836  18.68280  -1.43559  1.000 27.39913  ? 400 ALA A N   1 
ATOM   3075 C CA  . ALA A 1 400 ? 20.43224  17.26695  -1.48026  1.000 25.24155  ? 400 ALA A CA  1 
ATOM   3076 C C   . ALA A 1 400 ? 21.59150  16.39710  -1.96093  1.000 37.60435  ? 400 ALA A C   1 
ATOM   3077 O O   . ALA A 1 400 ? 21.68281  15.23176  -1.56383  1.000 39.09014  ? 400 ALA A O   1 
ATOM   3078 C CB  . ALA A 1 400 ? 19.21016  17.05659  -2.36792  1.000 28.16959  ? 400 ALA A CB  1 
ATOM   3079 N N   . VAL A 1 401 ? 22.46105  16.90785  -2.83844  1.000 46.55928  ? 401 VAL A N   1 
ATOM   3080 C CA  . VAL A 1 401 ? 23.63621  16.12431  -3.21842  1.000 46.55019  ? 401 VAL A CA  1 
ATOM   3081 C C   . VAL A 1 401 ? 24.47529  15.83367  -1.98218  1.000 42.31925  ? 401 VAL A C   1 
ATOM   3082 O O   . VAL A 1 401 ? 24.82713  14.67986  -1.69828  1.000 38.73071  ? 401 VAL A O   1 
ATOM   3083 C CB  . VAL A 1 401 ? 24.46107  16.85238  -4.29826  1.000 37.17834  ? 401 VAL A CB  1 
ATOM   3084 C CG1 . VAL A 1 401 ? 25.76477  16.11639  -4.55162  1.000 25.24797  ? 401 VAL A CG1 1 
ATOM   3085 C CG2 . VAL A 1 401 ? 23.66947  16.99069  -5.56955  1.000 28.62373  ? 401 VAL A CG2 1 
ATOM   3086 N N   . VAL A 1 402 ? 24.76095  16.88044  -1.20422  1.000 39.60844  ? 402 VAL A N   1 
ATOM   3087 C CA  . VAL A 1 402 ? 25.61514  16.74669  -0.02996  1.000 44.31520  ? 402 VAL A CA  1 
ATOM   3088 C C   . VAL A 1 402 ? 24.93562  15.91728  1.04923   1.000 43.47758  ? 402 VAL A C   1 
ATOM   3089 O O   . VAL A 1 402 ? 25.57989  15.08333  1.70192   1.000 37.33204  ? 402 VAL A O   1 
ATOM   3090 C CB  . VAL A 1 402 ? 26.00716  18.13377  0.49334   1.000 39.43218  ? 402 VAL A CB  1 
ATOM   3091 C CG1 . VAL A 1 402 ? 26.60323  18.00807  1.86260   1.000 35.89405  ? 402 VAL A CG1 1 
ATOM   3092 C CG2 . VAL A 1 402 ? 26.97595  18.78404  -0.47317  1.000 40.21421  ? 402 VAL A CG2 1 
ATOM   3093 N N   . GLY A 1 403 ? 23.62845  16.12071  1.24429   1.000 42.05133  ? 403 GLY A N   1 
ATOM   3094 C CA  . GLY A 1 403 ? 22.91684  15.38674  2.28297   1.000 36.96124  ? 403 GLY A CA  1 
ATOM   3095 C C   . GLY A 1 403 ? 22.74223  13.91756  1.94495   1.000 38.79268  ? 403 GLY A C   1 
ATOM   3096 O O   . GLY A 1 403 ? 22.95803  13.04530  2.79088   1.000 39.95317  ? 403 GLY A O   1 
ATOM   3097 N N   . ASP A 1 404 ? 22.35681  13.62759  0.69804   1.000 45.14687  ? 404 ASP A N   1 
ATOM   3098 C CA  . ASP A 1 404 ? 22.20811  12.24667  0.24023   1.000 39.62820  ? 404 ASP A CA  1 
ATOM   3099 C C   . ASP A 1 404 ? 23.52783  11.49097  0.30300   1.000 40.50584  ? 404 ASP A C   1 
ATOM   3100 O O   . ASP A 1 404 ? 23.58866  10.37332  0.82721   1.000 39.92824  ? 404 ASP A O   1 
ATOM   3101 C CB  . ASP A 1 404 ? 21.67305  12.21859  -1.19264  1.000 30.71180  ? 404 ASP A CB  1 
ATOM   3102 C CG  . ASP A 1 404 ? 20.21502  12.61213  -1.28166  1.000 41.47425  ? 404 ASP A CG  1 
ATOM   3103 O OD1 . ASP A 1 404 ? 19.64804  13.02476  -0.23880  1.000 47.95126  ? 404 ASP A OD1 1 
ATOM   3104 O OD2 . ASP A 1 404 ? 19.62992  12.49636  -2.38688  1.000 46.46975  ? 404 ASP A OD2 1 
ATOM   3105 N N   . HIS A 1 405 ? 24.59331  12.08214  -0.24951  1.000 42.37924  ? 405 HIS A N   1 
ATOM   3106 C CA  . HIS A 1 405 ? 25.87235  11.38294  -0.36888  1.000 44.68013  ? 405 HIS A CA  1 
ATOM   3107 C C   . HIS A 1 405 ? 26.48349  11.06488  1.00009   1.000 41.09270  ? 405 HIS A C   1 
ATOM   3108 O O   . HIS A 1 405 ? 27.12181  10.01679  1.17370   1.000 35.67420  ? 405 HIS A O   1 
ATOM   3109 C CB  . HIS A 1 405 ? 26.82962  12.22854  -1.22041  1.000 37.17555  ? 405 HIS A CB  1 
ATOM   3110 C CG  . HIS A 1 405 ? 28.21873  11.66704  -1.34622  1.000 35.05937  ? 405 HIS A CG  1 
ATOM   3111 N ND1 . HIS A 1 405 ? 29.34885  12.46051  -1.28007  1.000 24.88945  ? 405 HIS A ND1 1 
ATOM   3112 C CD2 . HIS A 1 405 ? 28.66142  10.40004  -1.55394  1.000 30.47965  ? 405 HIS A CD2 1 
ATOM   3113 C CE1 . HIS A 1 405 ? 30.42669  11.70717  -1.43258  1.000 29.30332  ? 405 HIS A CE1 1 
ATOM   3114 N NE2 . HIS A 1 405 ? 30.03810  10.45251  -1.59828  1.000 27.61380  ? 405 HIS A NE2 1 
ATOM   3115 N N   . ASN A 1 406 ? 26.30146  11.94730  1.98424   1.000 40.63368  ? 406 ASN A N   1 
ATOM   3116 C CA  . ASN A 1 406 ? 26.98881  11.78675  3.26741   1.000 41.58641  ? 406 ASN A CA  1 
ATOM   3117 C C   . ASN A 1 406 ? 26.13149  11.18074  4.37756   1.000 43.90860  ? 406 ASN A C   1 
ATOM   3118 O O   . ASN A 1 406 ? 26.67459  10.50025  5.25723   1.000 48.94752  ? 406 ASN A O   1 
ATOM   3119 C CB  . ASN A 1 406 ? 27.54109  13.12978  3.74992   1.000 34.81547  ? 406 ASN A CB  1 
ATOM   3120 C CG  . ASN A 1 406 ? 28.62043  13.66700  2.84435   1.000 39.96299  ? 406 ASN A CG  1 
ATOM   3121 O OD1 . ASN A 1 406 ? 29.65358  13.02560  2.64163   1.000 36.93183  ? 406 ASN A OD1 1 
ATOM   3122 N ND2 . ASN A 1 406 ? 28.37849  14.84365  2.26925   1.000 49.16227  ? 406 ASN A ND2 1 
ATOM   3123 N N   . VAL A 1 407 ? 24.81858  11.40252  4.38740   1.000 36.09164  ? 407 VAL A N   1 
ATOM   3124 C CA  . VAL A 1 407 ? 24.01852  10.80848  5.45007   1.000 37.28195  ? 407 VAL A CA  1 
ATOM   3125 C C   . VAL A 1 407 ? 22.97519  9.83639   4.89209   1.000 39.67422  ? 407 VAL A C   1 
ATOM   3126 O O   . VAL A 1 407 ? 23.03515  8.62828   5.16646   1.000 37.59616  ? 407 VAL A O   1 
ATOM   3127 C CB  . VAL A 1 407 ? 23.37142  11.90047  6.33205   1.000 36.82339  ? 407 VAL A CB  1 
ATOM   3128 C CG1 . VAL A 1 407 ? 22.54705  11.26736  7.47096   1.000 32.63590  ? 407 VAL A CG1 1 
ATOM   3129 C CG2 . VAL A 1 407 ? 24.44403  12.84397  6.91969   1.000 22.67701  ? 407 VAL A CG2 1 
ATOM   3130 N N   . VAL A 1 408 ? 22.02174  10.33950  4.09708   1.000 40.65723  ? 408 VAL A N   1 
ATOM   3131 C CA  . VAL A 1 408 ? 20.79712  9.57179   3.84777   1.000 35.12754  ? 408 VAL A CA  1 
ATOM   3132 C C   . VAL A 1 408 ? 21.09478  8.25507   3.13345   1.000 46.68057  ? 408 VAL A C   1 
ATOM   3133 O O   . VAL A 1 408 ? 20.50443  7.21686   3.45099   1.000 53.55179  ? 408 VAL A O   1 
ATOM   3134 C CB  . VAL A 1 408 ? 19.76150  10.41329  3.07771   1.000 23.72783  ? 408 VAL A CB  1 
ATOM   3135 C CG1 . VAL A 1 408 ? 18.46209  9.70872   3.10680   1.000 24.95466  ? 408 VAL A CG1 1 
ATOM   3136 C CG2 . VAL A 1 408 ? 19.56523  11.79267  3.72775   1.000 31.68739  ? 408 VAL A CG2 1 
ATOM   3137 N N   . CYS A 1 409 ? 22.01943  8.25839   2.18392   1.000 42.56600  ? 409 CYS A N   1 
ATOM   3138 C CA  . CYS A 1 409 ? 22.25700  7.01375   1.45889   1.000 43.91495  ? 409 CYS A CA  1 
ATOM   3139 C C   . CYS A 1 409 ? 23.17938  6.04838   2.20147   1.000 44.45043  ? 409 CYS A C   1 
ATOM   3140 O O   . CYS A 1 409 ? 23.01757  4.82603   2.06563   1.000 40.15666  ? 409 CYS A O   1 
ATOM   3141 C CB  . CYS A 1 409 ? 22.80686  7.32237   0.07147   1.000 47.55703  ? 409 CYS A CB  1 
ATOM   3142 S SG  . CYS A 1 409 ? 21.55466  8.04185   -1.02942  1.000 49.26878  ? 409 CYS A SG  1 
ATOM   3143 N N   . PRO A 1 410 ? 24.16382  6.53322   2.97215   1.000 44.30453  ? 410 PRO A N   1 
ATOM   3144 C CA  . PRO A 1 410 ? 24.83110  5.62300   3.92747   1.000 39.96162  ? 410 PRO A CA  1 
ATOM   3145 C C   . PRO A 1 410 ? 23.87805  4.98615   4.93122   1.000 35.08637  ? 410 PRO A C   1 
ATOM   3146 O O   . PRO A 1 410 ? 23.94398  3.76397   5.14835   1.000 31.87793  ? 410 PRO A O   1 
ATOM   3147 C CB  . PRO A 1 410 ? 25.86123  6.53491   4.59658   1.000 37.35282  ? 410 PRO A CB  1 
ATOM   3148 C CG  . PRO A 1 410 ? 26.22195  7.50930   3.51859   1.000 34.79245  ? 410 PRO A CG  1 
ATOM   3149 C CD  . PRO A 1 410 ? 24.93303  7.78223   2.79373   1.000 39.37933  ? 410 PRO A CD  1 
ATOM   3150 N N   . VAL A 1 411 ? 22.98698  5.77906   5.54518   1.000 31.93943  ? 411 VAL A N   1 
ATOM   3151 C CA  . VAL A 1 411 ? 22.00076  5.22637   6.47720   1.000 36.72891  ? 411 VAL A CA  1 
ATOM   3152 C C   . VAL A 1 411 ? 21.10730  4.22007   5.76293   1.000 41.51673  ? 411 VAL A C   1 
ATOM   3153 O O   . VAL A 1 411 ? 20.78181  3.14766   6.29669   1.000 40.25439  ? 411 VAL A O   1 
ATOM   3154 C CB  . VAL A 1 411 ? 21.16380  6.35683   7.11155   1.000 37.44125  ? 411 VAL A CB  1 
ATOM   3155 C CG1 . VAL A 1 411 ? 19.97343  5.78803   7.86739   1.000 26.01260  ? 411 VAL A CG1 1 
ATOM   3156 C CG2 . VAL A 1 411 ? 22.01767  7.25510   8.00064   1.000 34.22074  ? 411 VAL A CG2 1 
ATOM   3157 N N   . ALA A 1 412 ? 20.68345  4.55744   4.54781   1.000 42.81872  ? 412 ALA A N   1 
ATOM   3158 C CA  . ALA A 1 412 ? 19.90212  3.61619   3.75532   1.000 34.21571  ? 412 ALA A CA  1 
ATOM   3159 C C   . ALA A 1 412 ? 20.67394  2.32291   3.52603   1.000 32.90151  ? 412 ALA A C   1 
ATOM   3160 O O   . ALA A 1 412 ? 20.11726  1.22342   3.64838   1.000 33.67330  ? 412 ALA A O   1 
ATOM   3161 C CB  . ALA A 1 412 ? 19.51701  4.26590   2.43374   1.000 33.91170  ? 412 ALA A CB  1 
ATOM   3162 N N   . GLN A 1 413 ? 21.96342  2.43536   3.20089   1.000 33.86956  ? 413 GLN A N   1 
ATOM   3163 C CA  . GLN A 1 413 ? 22.78508  1.24347   3.00854   1.000 42.33627  ? 413 GLN A CA  1 
ATOM   3164 C C   . GLN A 1 413 ? 22.93043  0.46077   4.31534   1.000 47.75354  ? 413 GLN A C   1 
ATOM   3165 O O   . GLN A 1 413 ? 22.80990  -0.77451  4.32961   1.000 45.99006  ? 413 GLN A O   1 
ATOM   3166 C CB  . GLN A 1 413 ? 24.14845  1.65674   2.42771   1.000 40.15876  ? 413 GLN A CB  1 
ATOM   3167 C CG  . GLN A 1 413 ? 25.20831  0.56748   2.39064   1.000 48.37393  ? 413 GLN A CG  1 
ATOM   3168 C CD  . GLN A 1 413 ? 25.36845  -0.09086  1.03927   1.000 78.72279  ? 413 GLN A CD  1 
ATOM   3169 O OE1 . GLN A 1 413 ? 24.42369  -0.67430  0.47964   1.000 84.29792  ? 413 GLN A OE1 1 
ATOM   3170 N NE2 . GLN A 1 413 ? 26.58775  -0.01763  0.50427   1.000 94.60336  ? 413 GLN A NE2 1 
ATOM   3171 N N   . LEU A 1 414 ? 23.17628  1.16641   5.42741   1.000 46.57411  ? 414 LEU A N   1 
ATOM   3172 C CA  . LEU A 1 414 ? 23.29963  0.49556   6.71978   1.000 49.35100  ? 414 LEU A CA  1 
ATOM   3173 C C   . LEU A 1 414 ? 21.98995  -0.18342  7.12451   1.000 50.82178  ? 414 LEU A C   1 
ATOM   3174 O O   . LEU A 1 414 ? 21.99788  -1.33037  7.59094   1.000 45.98647  ? 414 LEU A O   1 
ATOM   3175 C CB  . LEU A 1 414 ? 23.75162  1.49621   7.78797   1.000 40.03047  ? 414 LEU A CB  1 
ATOM   3176 C CG  . LEU A 1 414 ? 23.77456  1.08316   9.26393   1.000 41.70656  ? 414 LEU A CG  1 
ATOM   3177 C CD1 . LEU A 1 414 ? 24.92278  0.12378   9.59765   1.000 41.18304  ? 414 LEU A CD1 1 
ATOM   3178 C CD2 . LEU A 1 414 ? 23.87933  2.33761   10.11099  1.000 40.05822  ? 414 LEU A CD2 1 
ATOM   3179 N N   . ALA A 1 415 ? 20.85212  0.49905   6.93268   1.000 43.11980  ? 415 ALA A N   1 
ATOM   3180 C CA  . ALA A 1 415 ? 19.57397  -0.06374  7.36030   1.000 37.67268  ? 415 ALA A CA  1 
ATOM   3181 C C   . ALA A 1 415 ? 19.23201  -1.32425  6.57596   1.000 43.96645  ? 415 ALA A C   1 
ATOM   3182 O O   . ALA A 1 415 ? 18.73890  -2.30817  7.14100   1.000 41.82636  ? 415 ALA A O   1 
ATOM   3183 C CB  . ALA A 1 415 ? 18.47217  0.97417   7.19919   1.000 34.75109  ? 415 ALA A CB  1 
ATOM   3184 N N   . GLY A 1 416 ? 19.49422  -1.31696  5.26940   1.000 45.59611  ? 416 GLY A N   1 
ATOM   3185 C CA  . GLY A 1 416 ? 19.17621  -2.47471  4.45765   1.000 46.75298  ? 416 GLY A CA  1 
ATOM   3186 C C   . GLY A 1 416 ? 20.11811  -3.63739  4.66849   1.000 51.85439  ? 416 GLY A C   1 
ATOM   3187 O O   . GLY A 1 416 ? 19.69815  -4.80002  4.59163   1.000 44.58675  ? 416 GLY A O   1 
ATOM   3188 N N   . ARG A 1 417 ? 21.39808  -3.35544  4.93010   1.000 51.04697  ? 417 ARG A N   1 
ATOM   3189 C CA  . ARG A 1 417 ? 22.33235  -4.46039  5.07071   1.000 55.59581  ? 417 ARG A CA  1 
ATOM   3190 C C   . ARG A 1 417 ? 22.24868  -5.06527  6.46430   1.000 57.03514  ? 417 ARG A C   1 
ATOM   3191 O O   . ARG A 1 417 ? 22.32170  -6.28812  6.60678   1.000 61.25247  ? 417 ARG A O   1 
ATOM   3192 C CB  . ARG A 1 417 ? 23.75313  -4.01270  4.71952   1.000 60.88991  ? 417 ARG A CB  1 
ATOM   3193 C CG  . ARG A 1 417 ? 24.61341  -5.15846  4.17660   1.000 75.06383  ? 417 ARG A CG  1 
ATOM   3194 C CD  . ARG A 1 417 ? 24.62417  -5.25088  2.64449   1.000 83.66508  ? 417 ARG A CD  1 
ATOM   3195 N NE  . ARG A 1 417 ? 25.32936  -6.45857  2.19840   1.000 97.95505  ? 417 ARG A NE  1 
ATOM   3196 C CZ  . ARG A 1 417 ? 25.67259  -6.73063  0.93888   1.000 104.73455 ? 417 ARG A CZ  1 
ATOM   3197 N NH1 . ARG A 1 417 ? 26.31375  -7.86336  0.65806   1.000 107.09321 ? 417 ARG A NH1 1 
ATOM   3198 N NH2 . ARG A 1 417 ? 25.38242  -5.87758  -0.03982  1.000 107.54452 ? 417 ARG A NH2 1 
ATOM   3199 N N   . LEU A 1 418 ? 22.04382  -4.24139  7.49835   1.000 58.57093  ? 418 LEU A N   1 
ATOM   3200 C CA  . LEU A 1 418 ? 21.77165  -4.79339  8.82473   1.000 54.77408  ? 418 LEU A CA  1 
ATOM   3201 C C   . LEU A 1 418 ? 20.50764  -5.63837  8.80507   1.000 56.10637  ? 418 LEU A C   1 
ATOM   3202 O O   . LEU A 1 418 ? 20.49338  -6.76722  9.30920   1.000 63.16274  ? 418 LEU A O   1 
ATOM   3203 C CB  . LEU A 1 418 ? 21.63060  -3.68135  9.86646   1.000 51.48351  ? 418 LEU A CB  1 
ATOM   3204 C CG  . LEU A 1 418 ? 22.84114  -2.83976  10.25823  1.000 45.36586  ? 418 LEU A CG  1 
ATOM   3205 C CD1 . LEU A 1 418 ? 22.44800  -1.88670  11.34572  1.000 35.40263  ? 418 LEU A CD1 1 
ATOM   3206 C CD2 . LEU A 1 418 ? 23.99086  -3.70872  10.67888  1.000 38.54407  ? 418 LEU A CD2 1 
ATOM   3207 N N   . ALA A 1 419 ? 19.42909  -5.10362  8.22475   1.000 47.26752  ? 419 ALA A N   1 
ATOM   3208 C CA  . ALA A 1 419 ? 18.15783  -5.82045  8.24563   1.000 50.76261  ? 419 ALA A CA  1 
ATOM   3209 C C   . ALA A 1 419 ? 18.26604  -7.16529  7.53790   1.000 56.78616  ? 419 ALA A C   1 
ATOM   3210 O O   . ALA A 1 419 ? 17.76091  -8.17746  8.03283   1.000 60.76764  ? 419 ALA A O   1 
ATOM   3211 C CB  . ALA A 1 419 ? 17.05953  -4.96579  7.61889   1.000 45.37154  ? 419 ALA A CB  1 
ATOM   3212 N N   . ALA A 1 420 ? 18.93970  -7.20027  6.38878   1.000 60.98465  ? 420 ALA A N   1 
ATOM   3213 C CA  . ALA A 1 420 ? 19.14481  -8.45698  5.68253   1.000 52.81076  ? 420 ALA A CA  1 
ATOM   3214 C C   . ALA A 1 420 ? 19.88476  -9.47574  6.52915   1.000 54.49500  ? 420 ALA A C   1 
ATOM   3215 O O   . ALA A 1 420 ? 19.74069  -10.67961 6.29540   1.000 57.87695  ? 420 ALA A O   1 
ATOM   3216 C CB  . ALA A 1 420 ? 19.91129  -8.20550  4.38197   1.000 52.47008  ? 420 ALA A CB  1 
ATOM   3217 N N   . GLN A 1 421 ? 20.65266  -9.02419  7.52203   1.000 63.72720  ? 421 GLN A N   1 
ATOM   3218 C CA  . GLN A 1 421 ? 21.49764  -9.89749  8.32678   1.000 67.58559  ? 421 GLN A CA  1 
ATOM   3219 C C   . GLN A 1 421 ? 20.94091  -10.11838 9.73190   1.000 67.81246  ? 421 GLN A C   1 
ATOM   3220 O O   . GLN A 1 421 ? 21.70378  -10.34890 10.67204  1.000 68.08057  ? 421 GLN A O   1 
ATOM   3221 C CB  . GLN A 1 421 ? 22.91775  -9.33894  8.39262   1.000 70.01785  ? 421 GLN A CB  1 
ATOM   3222 C CG  . GLN A 1 421 ? 23.44302  -8.93809  7.02756   1.000 77.26838  ? 421 GLN A CG  1 
ATOM   3223 C CD  . GLN A 1 421 ? 24.68661  -9.67647  6.60312   1.000 85.70878  ? 421 GLN A CD  1 
ATOM   3224 O OE1 . GLN A 1 421 ? 24.94796  -10.81400 7.03239   1.000 85.88599  ? 421 GLN A OE1 1 
ATOM   3225 N NE2 . GLN A 1 421 ? 25.46121  -9.03863  5.72610   1.000 85.74548  ? 421 GLN A NE2 1 
ATOM   3226 N N   . GLY A 1 422 ? 19.61638  -10.04823 9.89226   1.000 71.83852  ? 422 GLY A N   1 
ATOM   3227 C CA  . GLY A 1 422 ? 18.95125  -10.49283 11.10560  1.000 76.91312  ? 422 GLY A CA  1 
ATOM   3228 C C   . GLY A 1 422 ? 18.68865  -9.43734  12.15983  1.000 74.33600  ? 422 GLY A C   1 
ATOM   3229 O O   . GLY A 1 422 ? 18.07473  -9.75338  13.18981  1.000 80.46667  ? 422 GLY A O   1 
ATOM   3230 N N   . ALA A 1 423 ? 19.12905  -8.20430  11.94567  1.000 66.68613  ? 423 ALA A N   1 
ATOM   3231 C CA  . ALA A 1 423 ? 18.95025  -7.16149  12.93987  1.000 57.61049  ? 423 ALA A CA  1 
ATOM   3232 C C   . ALA A 1 423 ? 17.53657  -6.60638  12.88197  1.000 57.27470  ? 423 ALA A C   1 
ATOM   3233 O O   . ALA A 1 423 ? 16.97126  -6.41919  11.80131  1.000 71.56270  ? 423 ALA A O   1 
ATOM   3234 C CB  . ALA A 1 423 ? 19.95877  -6.04087  12.71084  1.000 44.52041  ? 423 ALA A CB  1 
ATOM   3235 N N   . ARG A 1 424 ? 16.96153  -6.34560  14.04816  1.000 47.23381  ? 424 ARG A N   1 
ATOM   3236 C CA  . ARG A 1 424 ? 15.70584  -5.60910  14.10425  1.000 53.31087  ? 424 ARG A CA  1 
ATOM   3237 C C   . ARG A 1 424 ? 16.03338  -4.12635  13.95552  1.000 48.96093  ? 424 ARG A C   1 
ATOM   3238 O O   . ARG A 1 424 ? 16.65604  -3.53316  14.84237  1.000 48.49080  ? 424 ARG A O   1 
ATOM   3239 C CB  . ARG A 1 424 ? 14.94326  -5.89879  15.39959  1.000 51.74908  ? 424 ARG A CB  1 
ATOM   3240 C CG  . ARG A 1 424 ? 13.50821  -5.36030  15.39060  1.000 54.29354  ? 424 ARG A CG  1 
ATOM   3241 C CD  . ARG A 1 424 ? 12.48494  -6.35306  15.96479  1.000 71.77162  ? 424 ARG A CD  1 
ATOM   3242 N NE  . ARG A 1 424 ? 12.95629  -6.99451  17.19426  1.000 90.87381  ? 424 ARG A NE  1 
ATOM   3243 C CZ  . ARG A 1 424 ? 12.65572  -6.57766  18.42911  1.000 92.83234  ? 424 ARG A CZ  1 
ATOM   3244 N NH1 . ARG A 1 424 ? 13.13312  -7.22480  19.48699  1.000 89.23944  ? 424 ARG A NH1 1 
ATOM   3245 N NH2 . ARG A 1 424 ? 11.88814  -5.50583  18.61351  1.000 91.05709  ? 424 ARG A NH2 1 
ATOM   3246 N N   . VAL A 1 425 ? 15.61916  -3.52748  12.83179  1.000 45.28242  ? 425 VAL A N   1 
ATOM   3247 C CA  . VAL A 1 425 ? 15.93910  -2.14297  12.49023  1.000 45.06515  ? 425 VAL A CA  1 
ATOM   3248 C C   . VAL A 1 425 ? 14.66944  -1.30394  12.54274  1.000 43.44906  ? 425 VAL A C   1 
ATOM   3249 O O   . VAL A 1 425 ? 13.58484  -1.78692  12.20395  1.000 41.53509  ? 425 VAL A O   1 
ATOM   3250 C CB  . VAL A 1 425 ? 16.58458  -2.06344  11.09322  1.000 45.75375  ? 425 VAL A CB  1 
ATOM   3251 C CG1 . VAL A 1 425 ? 17.01269  -0.63498  10.77733  1.000 42.63515  ? 425 VAL A CG1 1 
ATOM   3252 C CG2 . VAL A 1 425 ? 17.74894  -3.05255  10.98414  1.000 43.21383  ? 425 VAL A CG2 1 
ATOM   3253 N N   . TYR A 1 426 ? 14.80444  -0.04996  12.97611  1.000 41.12602  ? 426 TYR A N   1 
ATOM   3254 C CA  . TYR A 1 426 ? 13.70726  0.91275   12.99437  1.000 40.51545  ? 426 TYR A CA  1 
ATOM   3255 C C   . TYR A 1 426 ? 14.22279  2.22842   12.44371  1.000 42.35962  ? 426 TYR A C   1 
ATOM   3256 O O   . TYR A 1 426 ? 15.26383  2.72532   12.88745  1.000 42.66475  ? 426 TYR A O   1 
ATOM   3257 C CB  . TYR A 1 426 ? 13.14816  1.14553   14.39743  1.000 37.89611  ? 426 TYR A CB  1 
ATOM   3258 C CG  . TYR A 1 426 ? 12.34390  0.01340   14.97743  1.000 45.57999  ? 426 TYR A CG  1 
ATOM   3259 C CD1 . TYR A 1 426 ? 12.92355  -0.88414  15.87124  1.000 49.02374  ? 426 TYR A CD1 1 
ATOM   3260 C CD2 . TYR A 1 426 ? 10.99697  -0.15059  14.65955  1.000 48.23959  ? 426 TYR A CD2 1 
ATOM   3261 C CE1 . TYR A 1 426 ? 12.18652  -1.93240  16.43694  1.000 58.19110  ? 426 TYR A CE1 1 
ATOM   3262 C CE2 . TYR A 1 426 ? 10.24923  -1.19810  15.21395  1.000 59.16148  ? 426 TYR A CE2 1 
ATOM   3263 C CZ  . TYR A 1 426 ? 10.85350  -2.08522  16.10838  1.000 64.57899  ? 426 TYR A CZ  1 
ATOM   3264 O OH  . TYR A 1 426 ? 10.14098  -3.12617  16.67433  1.000 67.85074  ? 426 TYR A OH  1 
ATOM   3265 N N   . ALA A 1 427 ? 13.50078  2.79767   11.48845  1.000 41.63906  ? 427 ALA A N   1 
ATOM   3266 C CA  . ALA A 1 427 ? 14.04819  3.90049   10.71937  1.000 37.21797  ? 427 ALA A CA  1 
ATOM   3267 C C   . ALA A 1 427 ? 13.04703  5.04382   10.66871  1.000 43.69457  ? 427 ALA A C   1 
ATOM   3268 O O   . ALA A 1 427 ? 11.83853  4.81880   10.55480  1.000 54.47329  ? 427 ALA A O   1 
ATOM   3269 C CB  . ALA A 1 427 ? 14.43705  3.42883   9.31094   1.000 32.80296  ? 427 ALA A CB  1 
ATOM   3270 N N   . TYR A 1 428 ? 13.55613  6.27109   10.76299  1.000 40.75195  ? 428 TYR A N   1 
ATOM   3271 C CA  . TYR A 1 428 ? 12.71565  7.46021   10.82224  1.000 45.07998  ? 428 TYR A CA  1 
ATOM   3272 C C   . TYR A 1 428 ? 13.29439  8.53324   9.90743   1.000 39.41325  ? 428 TYR A C   1 
ATOM   3273 O O   . TYR A 1 428 ? 14.47194  8.49023   9.53931   1.000 34.74826  ? 428 TYR A O   1 
ATOM   3274 C CB  . TYR A 1 428 ? 12.60944  8.01180   12.26513  1.000 39.56974  ? 428 TYR A CB  1 
ATOM   3275 C CG  . TYR A 1 428 ? 13.93436  8.53746   12.79185  1.000 40.25543  ? 428 TYR A CG  1 
ATOM   3276 C CD1 . TYR A 1 428 ? 14.39892  9.81454   12.44977  1.000 39.66205  ? 428 TYR A CD1 1 
ATOM   3277 C CD2 . TYR A 1 428 ? 14.73363  7.75322   13.60903  1.000 41.30650  ? 428 TYR A CD2 1 
ATOM   3278 C CE1 . TYR A 1 428 ? 15.62189  10.28836  12.91079  1.000 31.01738  ? 428 TYR A CE1 1 
ATOM   3279 C CE2 . TYR A 1 428 ? 15.94887  8.21884   14.07904  1.000 39.56090  ? 428 TYR A CE2 1 
ATOM   3280 C CZ  . TYR A 1 428 ? 16.38779  9.48494   13.72955  1.000 35.66528  ? 428 TYR A CZ  1 
ATOM   3281 O OH  . TYR A 1 428 ? 17.60441  9.93464   14.20269  1.000 37.29004  ? 428 TYR A OH  1 
ATOM   3282 N N   . ILE A 1 429 ? 12.46757  9.52528   9.57129   1.000 30.86304  ? 429 ILE A N   1 
ATOM   3283 C CA  . ILE A 1 429 ? 12.97147  10.79900  9.06956   1.000 34.95860  ? 429 ILE A CA  1 
ATOM   3284 C C   . ILE A 1 429 ? 12.34684  11.91536  9.90357   1.000 41.16447  ? 429 ILE A C   1 
ATOM   3285 O O   . ILE A 1 429 ? 11.11704  12.01230  10.00649  1.000 41.79346  ? 429 ILE A O   1 
ATOM   3286 C CB  . ILE A 1 429 ? 12.71480  11.00128  7.56305   1.000 36.27108  ? 429 ILE A CB  1 
ATOM   3287 C CG1 . ILE A 1 429 ? 13.20613  12.37859  7.13256   1.000 35.73169  ? 429 ILE A CG1 1 
ATOM   3288 C CG2 . ILE A 1 429 ? 11.25543  10.81981  7.20720   1.000 31.27233  ? 429 ILE A CG2 1 
ATOM   3289 C CD1 . ILE A 1 429 ? 13.14389  12.59383  5.68363   1.000 41.54913  ? 429 ILE A CD1 1 
ATOM   3290 N N   . PHE A 1 430 ? 13.20163  12.73300  10.51973  1.000 41.58828  ? 430 PHE A N   1 
ATOM   3291 C CA  . PHE A 1 430 ? 12.78612  13.84724  11.36441  1.000 41.34095  ? 430 PHE A CA  1 
ATOM   3292 C C   . PHE A 1 430 ? 12.51395  15.06754  10.48859  1.000 45.44594  ? 430 PHE A C   1 
ATOM   3293 O O   . PHE A 1 430 ? 13.41615  15.55462  9.79430   1.000 47.66504  ? 430 PHE A O   1 
ATOM   3294 C CB  . PHE A 1 430 ? 13.88516  14.13336  12.38736  1.000 38.25107  ? 430 PHE A CB  1 
ATOM   3295 C CG  . PHE A 1 430 ? 13.50564  15.12050  13.43819  1.000 40.61113  ? 430 PHE A CG  1 
ATOM   3296 C CD1 . PHE A 1 430 ? 13.73309  16.47561  13.24463  1.000 42.72524  ? 430 PHE A CD1 1 
ATOM   3297 C CD2 . PHE A 1 430 ? 12.95293  14.69334  14.64310  1.000 44.18195  ? 430 PHE A CD2 1 
ATOM   3298 C CE1 . PHE A 1 430 ? 13.38922  17.39192  14.22139  1.000 46.40298  ? 430 PHE A CE1 1 
ATOM   3299 C CE2 . PHE A 1 430 ? 12.60538  15.60311  15.63328  1.000 42.54181  ? 430 PHE A CE2 1 
ATOM   3300 C CZ  . PHE A 1 430 ? 12.82077  16.95010  15.42489  1.000 46.35561  ? 430 PHE A CZ  1 
ATOM   3301 N N   . GLU A 1 431 ? 11.27928  15.57176  10.52871  1.000 44.26733  ? 431 GLU A N   1 
ATOM   3302 C CA  . GLU A 1 431 ? 10.82221  16.56699  9.56671   1.000 44.12604  ? 431 GLU A CA  1 
ATOM   3303 C C   . GLU A 1 431 ? 10.34729  17.88221  10.18062  1.000 46.43268  ? 431 GLU A C   1 
ATOM   3304 O O   . GLU A 1 431 ? 9.81917   18.72965  9.44839   1.000 51.30314  ? 431 GLU A O   1 
ATOM   3305 C CB  . GLU A 1 431 ? 9.68669   15.98623  8.72376   1.000 49.44024  ? 431 GLU A CB  1 
ATOM   3306 C CG  . GLU A 1 431 ? 10.11418  15.08447  7.59479   1.000 52.44886  ? 431 GLU A CG  1 
ATOM   3307 C CD  . GLU A 1 431 ? 8.92502   14.63752  6.77238   1.000 60.94531  ? 431 GLU A CD  1 
ATOM   3308 O OE1 . GLU A 1 431 ? 7.81350   14.55299  7.35086   1.000 64.07679  ? 431 GLU A OE1 1 
ATOM   3309 O OE2 . GLU A 1 431 ? 9.09562   14.38066  5.55613   1.000 63.19683  ? 431 GLU A OE2 1 
ATOM   3310 N N   . HIS A 1 432 ? 10.49284  18.08881  11.48422  1.000 40.67390  ? 432 HIS A N   1 
ATOM   3311 C CA  . HIS A 1 432 ? 9.98217   19.30035  12.11486  1.000 40.15203  ? 432 HIS A CA  1 
ATOM   3312 C C   . HIS A 1 432 ? 11.10233  20.30525  12.34455  1.000 44.54187  ? 432 HIS A C   1 
ATOM   3313 O O   . HIS A 1 432 ? 12.13836  19.97467  12.93554  1.000 46.85090  ? 432 HIS A O   1 
ATOM   3314 C CB  . HIS A 1 432 ? 9.28480   18.99187  13.43615  1.000 39.30192  ? 432 HIS A CB  1 
ATOM   3315 C CG  . HIS A 1 432 ? 8.95036   20.21324  14.23279  1.000 42.91766  ? 432 HIS A CG  1 
ATOM   3316 N ND1 . HIS A 1 432 ? 7.76284   20.89532  14.08368  1.000 46.75624  ? 432 HIS A ND1 1 
ATOM   3317 C CD2 . HIS A 1 432 ? 9.64264   20.87071  15.19247  1.000 44.80628  ? 432 HIS A CD2 1 
ATOM   3318 C CE1 . HIS A 1 432 ? 7.73934   21.92363  14.91227  1.000 46.60501  ? 432 HIS A CE1 1 
ATOM   3319 N NE2 . HIS A 1 432 ? 8.86685   21.92958  15.59956  1.000 47.20479  ? 432 HIS A NE2 1 
ATOM   3320 N N   . ARG A 1 433 ? 10.87970  21.53279  11.88635  1.000 49.65436  ? 433 ARG A N   1 
ATOM   3321 C CA  . ARG A 1 433 ? 11.83152  22.62511  12.05372  1.000 49.63199  ? 433 ARG A CA  1 
ATOM   3322 C C   . ARG A 1 433 ? 11.48773  23.40312  13.32170  1.000 50.89018  ? 433 ARG A C   1 
ATOM   3323 O O   . ARG A 1 433 ? 10.35644  23.89301  13.46941  1.000 48.06587  ? 433 ARG A O   1 
ATOM   3324 C CB  . ARG A 1 433 ? 11.81300  23.54039  10.82737  1.000 40.31556  ? 433 ARG A CB  1 
ATOM   3325 C CG  . ARG A 1 433 ? 12.76687  24.71426  10.91222  1.000 44.33009  ? 433 ARG A CG  1 
ATOM   3326 C CD  . ARG A 1 433 ? 12.65727  25.60912  9.69229   1.000 44.31110  ? 433 ARG A CD  1 
ATOM   3327 N NE  . ARG A 1 433 ? 13.02029  26.99598  9.96695   1.000 45.32404  ? 433 ARG A NE  1 
ATOM   3328 C CZ  . ARG A 1 433 ? 14.19984  27.52671  9.66861   1.000 52.43419  ? 433 ARG A CZ  1 
ATOM   3329 N NH1 . ARG A 1 433 ? 15.13227  26.78154  9.08709   1.000 48.29958  ? 433 ARG A NH1 1 
ATOM   3330 N NH2 . ARG A 1 433 ? 14.44559  28.80044  9.95419   1.000 61.20748  ? 433 ARG A NH2 1 
ATOM   3331 N N   . ALA A 1 434 ? 12.46315  23.51806  14.22812  1.000 45.36077  ? 434 ALA A N   1 
ATOM   3332 C CA  . ALA A 1 434 ? 12.22753  24.18946  15.50201  1.000 40.68204  ? 434 ALA A CA  1 
ATOM   3333 C C   . ALA A 1 434 ? 11.68047  25.58616  15.25807  1.000 37.06584  ? 434 ALA A C   1 
ATOM   3334 O O   . ALA A 1 434 ? 12.10999  26.28398  14.33544  1.000 38.82519  ? 434 ALA A O   1 
ATOM   3335 C CB  . ALA A 1 434 ? 13.52088  24.25526  16.32971  1.000 33.21859  ? 434 ALA A CB  1 
ATOM   3336 N N   . SER A 1 435 ? 10.69079  25.97872  16.06287  1.000 40.25128  ? 435 SER A N   1 
ATOM   3337 C CA  . SER A 1 435 ? 10.16827  27.33135  15.92778  1.000 39.15210  ? 435 SER A CA  1 
ATOM   3338 C C   . SER A 1 435 ? 11.22724  28.35445  16.29156  1.000 42.10865  ? 435 SER A C   1 
ATOM   3339 O O   . SER A 1 435 ? 11.13407  29.50616  15.85291  1.000 38.23447  ? 435 SER A O   1 
ATOM   3340 C CB  . SER A 1 435 ? 8.91189   27.51213  16.78629  1.000 44.12054  ? 435 SER A CB  1 
ATOM   3341 O OG  . SER A 1 435 ? 9.20218   27.58971  18.17806  1.000 49.87289  ? 435 SER A OG  1 
ATOM   3342 N N   . THR A 1 436 ? 12.25296  27.92795  17.04318  1.000 47.23044  ? 436 THR A N   1 
ATOM   3343 C CA  . THR A 1 436 ? 13.30089  28.77511  17.59627  1.000 49.49983  ? 436 THR A CA  1 
ATOM   3344 C C   . THR A 1 436 ? 14.59290  28.71981  16.79740  1.000 53.78911  ? 436 THR A C   1 
ATOM   3345 O O   . THR A 1 436 ? 15.58351  29.32990  17.21194  1.000 62.33862  ? 436 THR A O   1 
ATOM   3346 C CB  . THR A 1 436 ? 13.59798  28.37680  19.05340  1.000 48.18230  ? 436 THR A CB  1 
ATOM   3347 O OG1 . THR A 1 436 ? 14.50929  27.27365  19.06691  1.000 54.91623  ? 436 THR A OG1 1 
ATOM   3348 C CG2 . THR A 1 436 ? 12.33837  27.95650  19.77262  1.000 40.76129  ? 436 THR A CG2 1 
ATOM   3349 N N   . LEU A 1 437 ? 14.61309  27.99626  15.68015  1.000 51.97901  ? 437 LEU A N   1 
ATOM   3350 C CA  . LEU A 1 437 ? 15.80793  27.91610  14.84313  1.000 45.24075  ? 437 LEU A CA  1 
ATOM   3351 C C   . LEU A 1 437 ? 16.25429  29.31045  14.41243  1.000 40.40331  ? 437 LEU A C   1 
ATOM   3352 O O   . LEU A 1 437 ? 15.43564  30.16046  14.05709  1.000 48.23552  ? 437 LEU A O   1 
ATOM   3353 C CB  . LEU A 1 437 ? 15.52041  27.05363  13.60878  1.000 44.02866  ? 437 LEU A CB  1 
ATOM   3354 C CG  . LEU A 1 437 ? 16.65499  26.30579  12.90671  1.000 41.68430  ? 437 LEU A CG  1 
ATOM   3355 C CD1 . LEU A 1 437 ? 17.66200  25.84430  13.89640  1.000 45.71416  ? 437 LEU A CD1 1 
ATOM   3356 C CD2 . LEU A 1 437 ? 16.09884  25.11311  12.19910  1.000 44.43911  ? 437 LEU A CD2 1 
ATOM   3357 N N   . THR A 1 438 ? 17.55765  29.55702  14.46504  1.000 37.70013  ? 438 THR A N   1 
ATOM   3358 C CA  . THR A 1 438 ? 18.10673  30.84127  14.05180  1.000 39.24282  ? 438 THR A CA  1 
ATOM   3359 C C   . THR A 1 438 ? 18.73918  30.79834  12.66766  1.000 41.07738  ? 438 THR A C   1 
ATOM   3360 O O   . THR A 1 438 ? 19.10894  31.85219  12.14157  1.000 46.11085  ? 438 THR A O   1 
ATOM   3361 C CB  . THR A 1 438 ? 19.12388  31.36051  15.10183  1.000 42.86025  ? 438 THR A CB  1 
ATOM   3362 O OG1 . THR A 1 438 ? 20.19946  30.42750  15.28630  1.000 33.51779  ? 438 THR A OG1 1 
ATOM   3363 C CG2 . THR A 1 438 ? 18.43709  31.62561  16.41437  1.000 33.87961  ? 438 THR A CG2 1 
ATOM   3364 N N   . TRP A 1 439 ? 18.86341  29.61602  12.06617  1.000 38.46867  ? 439 TRP A N   1 
ATOM   3365 C CA  . TRP A 1 439 ? 19.29355  29.50774  10.67991  1.000 42.12078  ? 439 TRP A CA  1 
ATOM   3366 C C   . TRP A 1 439 ? 18.15059  29.89847  9.73154   1.000 43.18722  ? 439 TRP A C   1 
ATOM   3367 O O   . TRP A 1 439 ? 16.97658  29.86103  10.10725  1.000 40.34084  ? 439 TRP A O   1 
ATOM   3368 C CB  . TRP A 1 439 ? 19.76460  28.08438  10.38259  1.000 40.78504  ? 439 TRP A CB  1 
ATOM   3369 C CG  . TRP A 1 439 ? 21.02363  27.64934  11.11327  1.000 39.20916  ? 439 TRP A CG  1 
ATOM   3370 C CD1 . TRP A 1 439 ? 21.09544  26.84887  12.22227  1.000 36.20147  ? 439 TRP A CD1 1 
ATOM   3371 C CD2 . TRP A 1 439 ? 22.38232  27.96094  10.75899  1.000 40.61986  ? 439 TRP A CD2 1 
ATOM   3372 N NE1 . TRP A 1 439 ? 22.41244  26.65914  12.59024  1.000 36.77967  ? 439 TRP A NE1 1 
ATOM   3373 C CE2 . TRP A 1 439 ? 23.22083  27.32595  11.70741  1.000 38.59579  ? 439 TRP A CE2 1 
ATOM   3374 C CE3 . TRP A 1 439 ? 22.97035  28.71794  9.73847   1.000 44.23397  ? 439 TRP A CE3 1 
ATOM   3375 C CZ2 . TRP A 1 439 ? 24.61310  27.42326  11.66163  1.000 37.29722  ? 439 TRP A CZ2 1 
ATOM   3376 C CZ3 . TRP A 1 439 ? 24.35612  28.82209  9.70034   1.000 47.36502  ? 439 TRP A CZ3 1 
ATOM   3377 C CH2 . TRP A 1 439 ? 25.16001  28.17971  10.66188  1.000 45.71153  ? 439 TRP A CH2 1 
ATOM   3378 N N   . PRO A 1 440 ? 18.46465  30.27629  8.49238   1.000 46.71768  ? 440 PRO A N   1 
ATOM   3379 C CA  . PRO A 1 440 ? 17.41147  30.74298  7.58037   1.000 43.18241  ? 440 PRO A CA  1 
ATOM   3380 C C   . PRO A 1 440 ? 16.46439  29.62288  7.16187   1.000 44.27382  ? 440 PRO A C   1 
ATOM   3381 O O   . PRO A 1 440 ? 16.75130  28.43230  7.31621   1.000 48.67148  ? 440 PRO A O   1 
ATOM   3382 C CB  . PRO A 1 440 ? 18.20499  31.27692  6.38280   1.000 44.88765  ? 440 PRO A CB  1 
ATOM   3383 C CG  . PRO A 1 440 ? 19.45990  30.44842  6.38426   1.000 42.88698  ? 440 PRO A CG  1 
ATOM   3384 C CD  . PRO A 1 440 ? 19.79432  30.32261  7.84833   1.000 50.07708  ? 440 PRO A CD  1 
ATOM   3385 N N   . LEU A 1 441 ? 15.31153  30.02619  6.60697   1.000 41.38000  ? 441 LEU A N   1 
ATOM   3386 C CA  . LEU A 1 441 ? 14.31022  29.03217  6.23454   1.000 34.95208  ? 441 LEU A CA  1 
ATOM   3387 C C   . LEU A 1 441 ? 14.80071  28.11660  5.14164   1.000 42.44771  ? 441 LEU A C   1 
ATOM   3388 O O   . LEU A 1 441 ? 14.43553  26.93473  5.13063   1.000 49.00705  ? 441 LEU A O   1 
ATOM   3389 C CB  . LEU A 1 441 ? 12.99735  29.68294  5.80673   1.000 41.09643  ? 441 LEU A CB  1 
ATOM   3390 C CG  . LEU A 1 441 ? 12.30295  30.25543  7.03679   1.000 61.69915  ? 441 LEU A CG  1 
ATOM   3391 C CD1 . LEU A 1 441 ? 11.70767  31.63260  6.76196   1.000 61.64798  ? 441 LEU A CD1 1 
ATOM   3392 C CD2 . LEU A 1 441 ? 11.28434  29.27964  7.68547   1.000 67.55665  ? 441 LEU A CD2 1 
ATOM   3393 N N   . TRP A 1 442 ? 15.61894  28.62975  4.21493   1.000 48.73257  ? 442 TRP A N   1 
ATOM   3394 C CA  . TRP A 1 442 ? 16.01597  27.79249  3.08779   1.000 42.61233  ? 442 TRP A CA  1 
ATOM   3395 C C   . TRP A 1 442 ? 16.77671  26.55499  3.55131   1.000 38.27878  ? 442 TRP A C   1 
ATOM   3396 O O   . TRP A 1 442 ? 16.78668  25.55518  2.82558   1.000 47.60985  ? 442 TRP A O   1 
ATOM   3397 C CB  . TRP A 1 442 ? 16.82663  28.58861  2.02688   1.000 31.48709  ? 442 TRP A CB  1 
ATOM   3398 C CG  . TRP A 1 442 ? 18.27884  28.94601  2.36506   1.000 34.57028  ? 442 TRP A CG  1 
ATOM   3399 C CD1 . TRP A 1 442 ? 18.75913  30.18493  2.74084   1.000 37.38532  ? 442 TRP A CD1 1 
ATOM   3400 C CD2 . TRP A 1 442 ? 19.42662  28.07355  2.32695   1.000 28.94159  ? 442 TRP A CD2 1 
ATOM   3401 N NE1 . TRP A 1 442 ? 20.12274  30.12514  2.94366   1.000 31.76596  ? 442 TRP A NE1 1 
ATOM   3402 C CE2 . TRP A 1 442 ? 20.55274  28.84187  2.71683   1.000 28.33473  ? 442 TRP A CE2 1 
ATOM   3403 C CE3 . TRP A 1 442 ? 19.60914  26.71986  2.01610   1.000 27.85898  ? 442 TRP A CE3 1 
ATOM   3404 C CZ2 . TRP A 1 442 ? 21.83605  28.29547  2.81362   1.000 28.50314  ? 442 TRP A CZ2 1 
ATOM   3405 C CZ3 . TRP A 1 442 ? 20.89230  26.17549  2.10976   1.000 24.74848  ? 442 TRP A CZ3 1 
ATOM   3406 C CH2 . TRP A 1 442 ? 21.98587  26.96669  2.50524   1.000 30.67061  ? 442 TRP A CH2 1 
ATOM   3407 N N   . MET A 1 443 ? 17.37625  26.56801  4.75378   1.000 30.31391  ? 443 MET A N   1 
ATOM   3408 C CA  . MET A 1 443 ? 18.08268  25.36413  5.18584   1.000 28.27506  ? 443 MET A CA  1 
ATOM   3409 C C   . MET A 1 443 ? 17.16094  24.27636  5.70879   1.000 37.65316  ? 443 MET A C   1 
ATOM   3410 O O   . MET A 1 443 ? 17.63793  23.16375  5.95930   1.000 39.37483  ? 443 MET A O   1 
ATOM   3411 C CB  . MET A 1 443 ? 19.13223  25.65702  6.25115   1.000 25.61868  ? 443 MET A CB  1 
ATOM   3412 C CG  . MET A 1 443 ? 20.39622  26.16706  5.65494   1.000 38.99013  ? 443 MET A CG  1 
ATOM   3413 S SD  . MET A 1 443 ? 21.30512  27.28229  6.72666   1.000 40.47835  ? 443 MET A SD  1 
ATOM   3414 C CE  . MET A 1 443 ? 22.55947  26.14725  7.27446   1.000 33.96137  ? 443 MET A CE  1 
ATOM   3415 N N   . GLY A 1 444 ? 15.87318  24.55548  5.86976   1.000 35.67205  ? 444 GLY A N   1 
ATOM   3416 C CA  . GLY A 1 444 ? 14.94751  23.49231  6.23635   1.000 39.46563  ? 444 GLY A CA  1 
ATOM   3417 C C   . GLY A 1 444 ? 15.16603  23.01334  7.65953   1.000 39.92023  ? 444 GLY A C   1 
ATOM   3418 O O   . GLY A 1 444 ? 15.29624  23.81510  8.59302   1.000 47.83674  ? 444 GLY A O   1 
ATOM   3419 N N   . VAL A 1 445 ? 15.17558  21.69262  7.83295   1.000 30.63970  ? 445 VAL A N   1 
ATOM   3420 C CA  . VAL A 1 445 ? 15.53885  21.04692  9.09597   1.000 33.94667  ? 445 VAL A CA  1 
ATOM   3421 C C   . VAL A 1 445 ? 16.98733  20.58600  8.96828   1.000 36.49772  ? 445 VAL A C   1 
ATOM   3422 O O   . VAL A 1 445 ? 17.23858  19.50918  8.40229   1.000 42.49209  ? 445 VAL A O   1 
ATOM   3423 C CB  . VAL A 1 445 ? 14.59807  19.86911  9.42036   1.000 33.82748  ? 445 VAL A CB  1 
ATOM   3424 C CG1 . VAL A 1 445 ? 15.06802  19.10601  10.66809  1.000 27.18908  ? 445 VAL A CG1 1 
ATOM   3425 C CG2 . VAL A 1 445 ? 13.16299  20.35309  9.59530   1.000 32.40131  ? 445 VAL A CG2 1 
ATOM   3426 N N   . PRO A 1 446 ? 17.96420  21.35677  9.44596   1.000 29.40679  ? 446 PRO A N   1 
ATOM   3427 C CA  . PRO A 1 446 ? 19.37019  21.05223  9.15170   1.000 25.54117  ? 446 PRO A CA  1 
ATOM   3428 C C   . PRO A 1 446 ? 19.92544  19.95334  10.04483  1.000 39.61406  ? 446 PRO A C   1 
ATOM   3429 O O   . PRO A 1 446 ? 19.33128  19.55558  11.04992  1.000 46.41706  ? 446 PRO A O   1 
ATOM   3430 C CB  . PRO A 1 446 ? 20.09603  22.37658  9.41690   1.000 22.38511  ? 446 PRO A CB  1 
ATOM   3431 C CG  . PRO A 1 446 ? 18.99383  23.40715  9.60846   1.000 22.44409  ? 446 PRO A CG  1 
ATOM   3432 C CD  . PRO A 1 446 ? 17.81744  22.65537  10.11307  1.000 22.68625  ? 446 PRO A CD  1 
ATOM   3433 N N   . HIS A 1 447 ? 21.09384  19.46496  9.63244   1.000 42.31251  ? 447 HIS A N   1 
ATOM   3434 C CA  . HIS A 1 447 ? 21.89335  18.51530  10.39716  1.000 34.03061  ? 447 HIS A CA  1 
ATOM   3435 C C   . HIS A 1 447 ? 22.02168  18.97292  11.84895  1.000 40.73873  ? 447 HIS A C   1 
ATOM   3436 O O   . HIS A 1 447 ? 22.52802  20.06857  12.12009  1.000 41.79689  ? 447 HIS A O   1 
ATOM   3437 C CB  . HIS A 1 447 ? 23.27083  18.40548  9.72616   1.000 24.53605  ? 447 HIS A CB  1 
ATOM   3438 C CG  . HIS A 1 447 ? 24.07240  17.19899  10.11632  1.000 24.71089  ? 447 HIS A CG  1 
ATOM   3439 N ND1 . HIS A 1 447 ? 23.59328  15.91084  9.99814   1.000 24.73442  ? 447 HIS A ND1 1 
ATOM   3440 C CD2 . HIS A 1 447 ? 25.34661  17.08575  10.57636  1.000 29.29680  ? 447 HIS A CD2 1 
ATOM   3441 C CE1 . HIS A 1 447 ? 24.52880  15.05816  10.39204  1.000 29.48444  ? 447 HIS A CE1 1 
ATOM   3442 N NE2 . HIS A 1 447 ? 25.60377  15.74450  10.74547  1.000 28.70225  ? 447 HIS A NE2 1 
ATOM   3443 N N   . GLY A 1 448 ? 21.50866  18.15142  12.77789  1.000 42.21966  ? 448 GLY A N   1 
ATOM   3444 C CA  . GLY A 1 448 ? 21.69728  18.33854  14.20619  1.000 40.35625  ? 448 GLY A CA  1 
ATOM   3445 C C   . GLY A 1 448 ? 20.50324  18.86101  14.99123  1.000 41.87766  ? 448 GLY A C   1 
ATOM   3446 O O   . GLY A 1 448 ? 20.55736  18.85103  16.22976  1.000 46.96015  ? 448 GLY A O   1 
ATOM   3447 N N   . TYR A 1 449 ? 19.43368  19.31828  14.33810  1.000 38.15269  ? 449 TYR A N   1 
ATOM   3448 C CA  . TYR A 1 449 ? 18.32165  19.95373  15.03562  1.000 31.76573  ? 449 TYR A CA  1 
ATOM   3449 C C   . TYR A 1 449 ? 17.15883  18.99268  15.28673  1.000 32.11514  ? 449 TYR A C   1 
ATOM   3450 O O   . TYR A 1 449 ? 16.01430  19.43079  15.42404  1.000 33.27108  ? 449 TYR A O   1 
ATOM   3451 C CB  . TYR A 1 449 ? 17.89288  21.21673  14.28236  1.000 29.57719  ? 449 TYR A CB  1 
ATOM   3452 C CG  . TYR A 1 449 ? 19.01331  22.24867  14.38082  1.000 41.19387  ? 449 TYR A CG  1 
ATOM   3453 C CD1 . TYR A 1 449 ? 19.06137  23.17420  15.42884  1.000 39.67156  ? 449 TYR A CD1 1 
ATOM   3454 C CD2 . TYR A 1 449 ? 20.07780  22.23771  13.47757  1.000 40.10415  ? 449 TYR A CD2 1 
ATOM   3455 C CE1 . TYR A 1 449 ? 20.11779  24.09664  15.53802  1.000 37.54858  ? 449 TYR A CE1 1 
ATOM   3456 C CE2 . TYR A 1 449 ? 21.13108  23.15195  13.58323  1.000 34.01256  ? 449 TYR A CE2 1 
ATOM   3457 C CZ  . TYR A 1 449 ? 21.14688  24.07580  14.60778  1.000 34.43481  ? 449 TYR A CZ  1 
ATOM   3458 O OH  . TYR A 1 449 ? 22.20261  24.96214  14.70656  1.000 31.93897  ? 449 TYR A OH  1 
ATOM   3459 N N   . GLU A 1 450 ? 17.44505  17.68497  15.32251  1.000 32.31630  ? 450 GLU A N   1 
ATOM   3460 C CA  . GLU A 1 450 ? 16.65434  16.67546  16.02898  1.000 34.36616  ? 450 GLU A CA  1 
ATOM   3461 C C   . GLU A 1 450 ? 16.94569  16.69543  17.52763  1.000 47.98791  ? 450 GLU A C   1 
ATOM   3462 O O   . GLU A 1 450 ? 16.08406  16.34707  18.34427  1.000 52.02506  ? 450 GLU A O   1 
ATOM   3463 C CB  . GLU A 1 450 ? 17.07154  15.30883  15.52487  1.000 22.64598  ? 450 GLU A CB  1 
ATOM   3464 C CG  . GLU A 1 450 ? 18.60101  15.33881  15.61079  1.000 31.08832  ? 450 GLU A CG  1 
ATOM   3465 C CD  . GLU A 1 450 ? 19.31560  14.35070  14.81530  1.000 50.20679  ? 450 GLU A CD  1 
ATOM   3466 O OE1 . GLU A 1 450 ? 19.01081  13.15133  14.93968  1.000 57.06020  ? 450 GLU A OE1 1 
ATOM   3467 O OE2 . GLU A 1 450 ? 20.21146  14.79013  14.07381  1.000 64.10583  ? 450 GLU A OE2 1 
ATOM   3468 N N   . ILE A 1 451 ? 18.17057  17.08978  17.88805  1.000 41.21250  ? 451 ILE A N   1 
ATOM   3469 C CA  . ILE A 1 451 ? 18.77146  16.66860  19.13941  1.000 33.44982  ? 451 ILE A CA  1 
ATOM   3470 C C   . ILE A 1 451 ? 18.08849  17.36461  20.30657  1.000 44.13979  ? 451 ILE A C   1 
ATOM   3471 O O   . ILE A 1 451 ? 17.79367  16.74008  21.33520  1.000 52.58385  ? 451 ILE A O   1 
ATOM   3472 C CB  . ILE A 1 451 ? 20.29075  16.94694  19.10535  1.000 22.72367  ? 451 ILE A CB  1 
ATOM   3473 C CG1 . ILE A 1 451 ? 21.02789  16.02172  18.13675  1.000 23.37218  ? 451 ILE A CG1 1 
ATOM   3474 C CG2 . ILE A 1 451 ? 20.91353  16.79791  20.47828  1.000 29.19421  ? 451 ILE A CG2 1 
ATOM   3475 C CD1 . ILE A 1 451 ? 22.49498  16.45052  17.89779  1.000 21.24061  ? 451 ILE A CD1 1 
ATOM   3476 N N   . GLU A 1 452 ? 17.81532  18.66591  20.16164  1.000 36.40386  ? 452 GLU A N   1 
ATOM   3477 C CA  . GLU A 1 452 ? 17.15727  19.41571  21.22093  1.000 34.85582  ? 452 GLU A CA  1 
ATOM   3478 C C   . GLU A 1 452 ? 15.81064  18.80521  21.57738  1.000 42.14902  ? 452 GLU A C   1 
ATOM   3479 O O   . GLU A 1 452 ? 15.33514  18.99353  22.70544  1.000 47.55881  ? 452 GLU A O   1 
ATOM   3480 C CB  . GLU A 1 452 ? 17.00159  20.89648  20.82176  1.000 37.63078  ? 452 GLU A CB  1 
ATOM   3481 C CG  . GLU A 1 452 ? 16.53903  21.16484  19.37239  1.000 37.15240  ? 452 GLU A CG  1 
ATOM   3482 C CD  . GLU A 1 452 ? 16.73843  22.61658  18.92212  1.000 38.29612  ? 452 GLU A CD  1 
ATOM   3483 O OE1 . GLU A 1 452 ? 15.80648  23.43139  19.05775  1.000 40.46225  ? 452 GLU A OE1 1 
ATOM   3484 O OE2 . GLU A 1 452 ? 17.83724  22.94994  18.42860  1.000 42.73270  ? 452 GLU A OE2 1 
ATOM   3485 N N   . PHE A 1 453 ? 15.20882  18.04378  20.66025  1.000 35.22825  ? 453 PHE A N   1 
ATOM   3486 C CA  . PHE A 1 453 ? 13.92704  17.41218  20.93896  1.000 36.86912  ? 453 PHE A CA  1 
ATOM   3487 C C   . PHE A 1 453 ? 14.05841  16.02786  21.56902  1.000 36.90781  ? 453 PHE A C   1 
ATOM   3488 O O   . PHE A 1 453 ? 13.20279  15.64875  22.36963  1.000 42.61899  ? 453 PHE A O   1 
ATOM   3489 C CB  . PHE A 1 453 ? 13.09717  17.32903  19.65498  1.000 36.80728  ? 453 PHE A CB  1 
ATOM   3490 C CG  . PHE A 1 453 ? 12.61418  18.66491  19.16513  1.000 36.57273  ? 453 PHE A CG  1 
ATOM   3491 C CD1 . PHE A 1 453 ? 11.36358  19.13767  19.53535  1.000 31.24224  ? 453 PHE A CD1 1 
ATOM   3492 C CD2 . PHE A 1 453 ? 13.42120  19.45063  18.33367  1.000 37.09325  ? 453 PHE A CD2 1 
ATOM   3493 C CE1 . PHE A 1 453 ? 10.91994  20.36551  19.09173  1.000 40.89217  ? 453 PHE A CE1 1 
ATOM   3494 C CE2 . PHE A 1 453 ? 12.98926  20.68145  17.87976  1.000 36.80075  ? 453 PHE A CE2 1 
ATOM   3495 C CZ  . PHE A 1 453 ? 11.73152  21.14271  18.25631  1.000 44.04957  ? 453 PHE A CZ  1 
ATOM   3496 N N   . ILE A 1 454 ? 15.09072  15.25785  21.22084  1.000 32.20227  ? 454 ILE A N   1 
ATOM   3497 C CA  . ILE A 1 454 ? 15.30070  13.95831  21.85398  1.000 32.64811  ? 454 ILE A CA  1 
ATOM   3498 C C   . ILE A 1 454 ? 15.60727  14.13910  23.32989  1.000 42.14232  ? 454 ILE A C   1 
ATOM   3499 O O   . ILE A 1 454 ? 15.13113  13.37106  24.17510  1.000 50.18303  ? 454 ILE A O   1 
ATOM   3500 C CB  . ILE A 1 454 ? 16.44552  13.19033  21.16179  1.000 41.16221  ? 454 ILE A CB  1 
ATOM   3501 C CG1 . ILE A 1 454 ? 16.26888  13.08945  19.62632  1.000 32.42511  ? 454 ILE A CG1 1 
ATOM   3502 C CG2 . ILE A 1 454 ? 16.63961  11.82210  21.82909  1.000 37.39653  ? 454 ILE A CG2 1 
ATOM   3503 C CD1 . ILE A 1 454 ? 15.01143  12.40670  19.17517  1.000 28.53411  ? 454 ILE A CD1 1 
ATOM   3504 N N   . PHE A 1 455 ? 16.42870  15.14791  23.66162  1.000 44.72213  ? 455 PHE A N   1 
ATOM   3505 C CA  . PHE A 1 455 ? 16.84729  15.40076  25.03872  1.000 41.50389  ? 455 PHE A CA  1 
ATOM   3506 C C   . PHE A 1 455 ? 15.80141  16.17344  25.83579  1.000 46.53925  ? 455 PHE A C   1 
ATOM   3507 O O   . PHE A 1 455 ? 15.88336  16.21353  27.07768  1.000 46.53254  ? 455 PHE A O   1 
ATOM   3508 C CB  . PHE A 1 455 ? 18.18119  16.15151  25.05589  1.000 28.17586  ? 455 PHE A CB  1 
ATOM   3509 C CG  . PHE A 1 455 ? 19.37476  15.25747  24.88794  1.000 27.30679  ? 455 PHE A CG  1 
ATOM   3510 C CD1 . PHE A 1 455 ? 19.77685  14.84712  23.62659  1.000 32.95740  ? 455 PHE A CD1 1 
ATOM   3511 C CD2 . PHE A 1 455 ? 20.10559  14.83592  25.99048  1.000 36.23234  ? 455 PHE A CD2 1 
ATOM   3512 C CE1 . PHE A 1 455 ? 20.88975  14.01846  23.46664  1.000 39.23649  ? 455 PHE A CE1 1 
ATOM   3513 C CE2 . PHE A 1 455 ? 21.21313  14.00685  25.85167  1.000 39.05192  ? 455 PHE A CE2 1 
ATOM   3514 C CZ  . PHE A 1 455 ? 21.60694  13.59262  24.58599  1.000 42.83567  ? 455 PHE A CZ  1 
ATOM   3515 N N   . GLY A 1 456 ? 14.83080  16.78254  25.14744  1.000 42.74457  ? 456 GLY A N   1 
ATOM   3516 C CA  . GLY A 1 456 ? 13.65554  17.34200  25.78884  1.000 44.51801  ? 456 GLY A CA  1 
ATOM   3517 C C   . GLY A 1 456 ? 13.74289  18.79142  26.21742  1.000 50.70255  ? 456 GLY A C   1 
ATOM   3518 O O   . GLY A 1 456 ? 12.95094  19.21584  27.06933  1.000 51.10075  ? 456 GLY A O   1 
ATOM   3519 N N   . LEU A 1 457 ? 14.66451  19.56898  25.65014  1.000 49.59833  ? 457 LEU A N   1 
ATOM   3520 C CA  . LEU A 1 457 ? 14.74683  20.99220  25.97072  1.000 38.73650  ? 457 LEU A CA  1 
ATOM   3521 C C   . LEU A 1 457 ? 13.42261  21.72945  25.84972  1.000 42.78778  ? 457 LEU A C   1 
ATOM   3522 O O   . LEU A 1 457 ? 13.15433  22.57927  26.71468  1.000 48.56056  ? 457 LEU A O   1 
ATOM   3523 C CB  . LEU A 1 457 ? 15.80276  21.67098  25.09373  1.000 38.58199  ? 457 LEU A CB  1 
ATOM   3524 C CG  . LEU A 1 457 ? 17.21284  21.68584  25.68366  1.000 38.98375  ? 457 LEU A CG  1 
ATOM   3525 C CD1 . LEU A 1 457 ? 17.86910  20.28604  25.62336  1.000 33.11363  ? 457 LEU A CD1 1 
ATOM   3526 C CD2 . LEU A 1 457 ? 18.06616  22.73833  24.97615  1.000 42.38961  ? 457 LEU A CD2 1 
ATOM   3527 N N   . PRO A 1 458 ? 12.54343  21.46218  24.83747  1.000 43.03571  ? 458 PRO A N   1 
ATOM   3528 C CA  . PRO A 1 458 ? 11.22081  22.11000  24.81352  1.000 41.64816  ? 458 PRO A CA  1 
ATOM   3529 C C   . PRO A 1 458 ? 10.49409  22.13789  26.15251  1.000 49.89894  ? 458 PRO A C   1 
ATOM   3530 O O   . PRO A 1 458 ? 9.64822   23.01199  26.36978  1.000 53.88125  ? 458 PRO A O   1 
ATOM   3531 C CB  . PRO A 1 458 ? 10.45265  21.26413  23.80377  1.000 36.10072  ? 458 PRO A CB  1 
ATOM   3532 C CG  . PRO A 1 458 ? 11.47932  20.84499  22.86440  1.000 41.28351  ? 458 PRO A CG  1 
ATOM   3533 C CD  . PRO A 1 458 ? 12.74495  20.64301  23.63258  1.000 34.22780  ? 458 PRO A CD  1 
ATOM   3534 N N   . LEU A 1 459 ? 10.81398  21.20108  27.05561  1.000 43.22333  ? 459 LEU A N   1 
ATOM   3535 C CA  . LEU A 1 459 ? 10.15363  21.15417  28.35616  1.000 56.62125  ? 459 LEU A CA  1 
ATOM   3536 C C   . LEU A 1 459 ? 10.56648  22.29806  29.27991  1.000 56.33809  ? 459 LEU A C   1 
ATOM   3537 O O   . LEU A 1 459 ? 9.94046   22.47407  30.33702  1.000 55.80668  ? 459 LEU A O   1 
ATOM   3538 C CB  . LEU A 1 459 ? 10.43037  19.81009  29.03475  1.000 53.22350  ? 459 LEU A CB  1 
ATOM   3539 C CG  . LEU A 1 459 ? 9.80944   18.60569  28.33015  1.000 45.59989  ? 459 LEU A CG  1 
ATOM   3540 C CD1 . LEU A 1 459 ? 10.38382  17.31792  28.85876  1.000 45.59565  ? 459 LEU A CD1 1 
ATOM   3541 C CD2 . LEU A 1 459 ? 8.33585   18.62765  28.55684  1.000 50.20778  ? 459 LEU A CD2 1 
ATOM   3542 N N   . ASP A 1 460 ? 11.58785  23.07652  28.90021  1.000 45.81525  ? 460 ASP A N   1 
ATOM   3543 C CA  . ASP A 1 460 ? 12.06348  24.23803  29.64028  1.000 49.93926  ? 460 ASP A CA  1 
ATOM   3544 C C   . ASP A 1 460 ? 11.23462  25.46772  29.28558  1.000 51.98419  ? 460 ASP A C   1 
ATOM   3545 O O   . ASP A 1 460 ? 11.40234  26.02271  28.19471  1.000 58.55607  ? 460 ASP A O   1 
ATOM   3546 C CB  . ASP A 1 460 ? 13.54030  24.48044  29.32505  1.000 53.68891  ? 460 ASP A CB  1 
ATOM   3547 C CG  . ASP A 1 460 ? 14.21083  25.38872  30.32682  1.000 65.71634  ? 460 ASP A CG  1 
ATOM   3548 O OD1 . ASP A 1 460 ? 13.50697  26.18740  30.98745  1.000 69.69586  ? 460 ASP A OD1 1 
ATOM   3549 O OD2 . ASP A 1 460 ? 15.45063  25.30391  30.44442  1.000 66.77103  ? 460 ASP A OD2 1 
ATOM   3550 N N   . PRO A 1 461 ? 10.35283  25.93415  30.17446  1.000 58.45087  ? 461 PRO A N   1 
ATOM   3551 C CA  . PRO A 1 461 ? 9.47519   27.06278  29.81049  1.000 61.56245  ? 461 PRO A CA  1 
ATOM   3552 C C   . PRO A 1 461 ? 10.24192  28.25486  29.27999  1.000 66.46157  ? 461 PRO A C   1 
ATOM   3553 O O   . PRO A 1 461 ? 9.82392   28.88732  28.29940  1.000 70.24915  ? 461 PRO A O   1 
ATOM   3554 C CB  . PRO A 1 461 ? 8.76199   27.40276  31.12946  1.000 60.80331  ? 461 PRO A CB  1 
ATOM   3555 C CG  . PRO A 1 461 ? 8.95796   26.21752  32.01306  1.000 64.23630  ? 461 PRO A CG  1 
ATOM   3556 C CD  . PRO A 1 461 ? 10.25713  25.58851  31.60136  1.000 62.41527  ? 461 PRO A CD  1 
ATOM   3557 N N   . SER A 1 462 ? 11.39281  28.54196  29.88759  1.000 66.17224  ? 462 SER A N   1 
ATOM   3558 C CA  . SER A 1 462 ? 12.20660  29.69657  29.53523  1.000 69.74485  ? 462 SER A CA  1 
ATOM   3559 C C   . SER A 1 462 ? 12.73039  29.66121  28.10347  1.000 67.99777  ? 462 SER A C   1 
ATOM   3560 O O   . SER A 1 462 ? 13.25045  30.67684  27.63103  1.000 72.20882  ? 462 SER A O   1 
ATOM   3561 C CB  . SER A 1 462 ? 13.39009  29.78815  30.49229  1.000 64.99707  ? 462 SER A CB  1 
ATOM   3562 O OG  . SER A 1 462 ? 14.48709  29.05259  29.97708  1.000 57.96963  ? 462 SER A OG  1 
ATOM   3563 N N   . LEU A 1 463 ? 12.62245  28.53532  27.40753  1.000 58.28709  ? 463 LEU A N   1 
ATOM   3564 C CA  . LEU A 1 463 ? 13.24062  28.38842  26.10562  1.000 41.82040  ? 463 LEU A CA  1 
ATOM   3565 C C   . LEU A 1 463 ? 12.30516  28.71548  24.95048  1.000 61.80245  ? 463 LEU A C   1 
ATOM   3566 O O   . LEU A 1 463 ? 12.73677  28.65846  23.79141  1.000 61.56332  ? 463 LEU A O   1 
ATOM   3567 C CB  . LEU A 1 463 ? 13.78968  26.97152  25.94920  1.000 47.05065  ? 463 LEU A CB  1 
ATOM   3568 C CG  . LEU A 1 463 ? 15.14217  26.76189  26.64449  1.000 44.15263  ? 463 LEU A CG  1 
ATOM   3569 C CD1 . LEU A 1 463 ? 15.91499  25.60013  26.04486  1.000 36.15217  ? 463 LEU A CD1 1 
ATOM   3570 C CD2 . LEU A 1 463 ? 15.97656  28.03955  26.60699  1.000 41.34042  ? 463 LEU A CD2 1 
ATOM   3571 N N   . ASN A 1 464 ? 11.04154  29.04626  25.23293  1.000 66.57758  ? 464 ASN A N   1 
ATOM   3572 C CA  . ASN A 1 464 ? 10.13045  29.65581  24.26050  1.000 64.75665  ? 464 ASN A CA  1 
ATOM   3573 C C   . ASN A 1 464 ? 9.76048   28.71211  23.11019  1.000 59.94823  ? 464 ASN A C   1 
ATOM   3574 O O   . ASN A 1 464 ? 9.50175   29.16550  21.99356  1.000 66.50846  ? 464 ASN A O   1 
ATOM   3575 C CB  . ASN A 1 464 ? 10.70623  30.97418  23.71281  1.000 69.48503  ? 464 ASN A CB  1 
ATOM   3576 C CG  . ASN A 1 464 ? 10.81582  32.06663  24.78601  1.000 92.51576  ? 464 ASN A CG  1 
ATOM   3577 O OD1 . ASN A 1 464 ? 10.08141  32.04948  25.78087  1.000 89.27946  ? 464 ASN A OD1 1 
ATOM   3578 N ND2 . ASN A 1 464 ? 11.73692  33.02517  24.58087  1.000 115.93244 ? 464 ASN A ND2 1 
ATOM   3579 N N   . TYR A 1 465 ? 9.72882   27.39903  23.34718  1.000 51.50021  ? 465 TYR A N   1 
ATOM   3580 C CA  . TYR A 1 465 ? 9.14373   26.49784  22.36455  1.000 40.73396  ? 465 TYR A CA  1 
ATOM   3581 C C   . TYR A 1 465 ? 7.62202   26.54895  22.45971  1.000 54.91907  ? 465 TYR A C   1 
ATOM   3582 O O   . TYR A 1 465 ? 7.05901   26.92819  23.48663  1.000 50.91195  ? 465 TYR A O   1 
ATOM   3583 C CB  . TYR A 1 465 ? 9.60277   25.05970  22.57582  1.000 38.88673  ? 465 TYR A CB  1 
ATOM   3584 C CG  . TYR A 1 465 ? 11.03876  24.79425  22.25911  1.000 38.40012  ? 465 TYR A CG  1 
ATOM   3585 C CD1 . TYR A 1 465 ? 11.42745  24.36418  20.98747  1.000 42.07442  ? 465 TYR A CD1 1 
ATOM   3586 C CD2 . TYR A 1 465 ? 12.01866  24.96232  23.22558  1.000 39.22132  ? 465 TYR A CD2 1 
ATOM   3587 C CE1 . TYR A 1 465 ? 12.76310  24.11647  20.68821  1.000 37.38550  ? 465 TYR A CE1 1 
ATOM   3588 C CE2 . TYR A 1 465 ? 13.35181  24.71167  22.94809  1.000 43.55629  ? 465 TYR A CE2 1 
ATOM   3589 C CZ  . TYR A 1 465 ? 13.72240  24.28807  21.67618  1.000 45.43042  ? 465 TYR A CZ  1 
ATOM   3590 O OH  . TYR A 1 465 ? 15.05828  24.04725  21.40961  1.000 47.01358  ? 465 TYR A OH  1 
ATOM   3591 N N   . THR A 1 466 ? 6.95388   26.15600  21.37241  1.000 61.87813  ? 466 THR A N   1 
ATOM   3592 C CA  . THR A 1 466 ? 5.49286   26.12193  21.35923  1.000 58.81919  ? 466 THR A CA  1 
ATOM   3593 C C   . THR A 1 466 ? 4.98849   24.97670  22.23323  1.000 55.56625  ? 466 THR A C   1 
ATOM   3594 O O   . THR A 1 466 ? 5.73785   24.06207  22.59539  1.000 52.11437  ? 466 THR A O   1 
ATOM   3595 C CB  . THR A 1 466 ? 4.94617   25.94547  19.93383  1.000 57.05658  ? 466 THR A CB  1 
ATOM   3596 O OG1 . THR A 1 466 ? 4.99788   24.55748  19.56777  1.000 54.13514  ? 466 THR A OG1 1 
ATOM   3597 C CG2 . THR A 1 466 ? 5.74102   26.76296  18.92199  1.000 51.83341  ? 466 THR A CG2 1 
ATOM   3598 N N   . THR A 1 467 ? 3.69223   25.02116  22.56161  1.000 57.42394  ? 467 THR A N   1 
ATOM   3599 C CA  . THR A 1 467 ? 3.11791   23.94136  23.36158  1.000 61.30434  ? 467 THR A CA  1 
ATOM   3600 C C   . THR A 1 467 ? 3.17996   22.61180  22.61332  1.000 67.93495  ? 467 THR A C   1 
ATOM   3601 O O   . THR A 1 467 ? 3.59424   21.59208  23.18222  1.000 57.01791  ? 467 THR A O   1 
ATOM   3602 C CB  . THR A 1 467 ? 1.68166   24.27815  23.76756  1.000 60.50225  ? 467 THR A CB  1 
ATOM   3603 O OG1 . THR A 1 467 ? 1.69662   25.27465  24.79523  1.000 59.65333  ? 467 THR A OG1 1 
ATOM   3604 C CG2 . THR A 1 467 ? 0.97784   23.05409  24.29864  1.000 54.99302  ? 467 THR A CG2 1 
ATOM   3605 N N   . GLU A 1 468 ? 2.80763   22.61044  21.32407  1.000 75.97719  ? 468 GLU A N   1 
ATOM   3606 C CA  . GLU A 1 468 ? 2.91575   21.39115  20.52510  1.000 72.82045  ? 468 GLU A CA  1 
ATOM   3607 C C   . GLU A 1 468 ? 4.34905   20.88718  20.48267  1.000 65.13928  ? 468 GLU A C   1 
ATOM   3608 O O   . GLU A 1 468 ? 4.58450   19.67398  20.50918  1.000 70.87825  ? 468 GLU A O   1 
ATOM   3609 C CB  . GLU A 1 468 ? 2.40886   21.62210  19.10349  1.000 78.11208  ? 468 GLU A CB  1 
ATOM   3610 C CG  . GLU A 1 468 ? 1.05525   22.28339  19.01056  1.000 92.95588  ? 468 GLU A CG  1 
ATOM   3611 C CD  . GLU A 1 468 ? 1.17342   23.78525  18.84064  1.000 103.84770 ? 468 GLU A CD  1 
ATOM   3612 O OE1 . GLU A 1 468 ? 0.79394   24.51662  19.78606  1.000 106.02057 ? 468 GLU A OE1 1 
ATOM   3613 O OE2 . GLU A 1 468 ? 1.65967   24.22731  17.77002  1.000 105.72705 ? 468 GLU A OE2 1 
ATOM   3614 N N   . GLU A 1 469 ? 5.32328   21.80203  20.41376  1.000 55.56918  ? 469 GLU A N   1 
ATOM   3615 C CA  . GLU A 1 469 ? 6.71678   21.37477  20.41976  1.000 48.71157  ? 469 GLU A CA  1 
ATOM   3616 C C   . GLU A 1 469 ? 7.05793   20.63198  21.69702  1.000 44.58996  ? 469 GLU A C   1 
ATOM   3617 O O   . GLU A 1 469 ? 7.90722   19.73740  21.68859  1.000 45.18943  ? 469 GLU A O   1 
ATOM   3618 C CB  . GLU A 1 469 ? 7.64506   22.57449  20.22538  1.000 52.17707  ? 469 GLU A CB  1 
ATOM   3619 C CG  . GLU A 1 469 ? 7.72524   22.97546  18.76037  1.000 53.14619  ? 469 GLU A CG  1 
ATOM   3620 C CD  . GLU A 1 469 ? 8.70984   24.07803  18.48952  1.000 49.66746  ? 469 GLU A CD  1 
ATOM   3621 O OE1 . GLU A 1 469 ? 8.59152   25.14905  19.12891  1.000 49.28218  ? 469 GLU A OE1 1 
ATOM   3622 O OE2 . GLU A 1 469 ? 9.59862   23.85911  17.63190  1.000 43.01019  ? 469 GLU A OE2 1 
ATOM   3623 N N   . ARG A 1 470 ? 6.37066   20.95256  22.79451  1.000 47.88989  ? 470 ARG A N   1 
ATOM   3624 C CA  . ARG A 1 470 ? 6.68626   20.32236  24.06793  1.000 45.55264  ? 470 ARG A CA  1 
ATOM   3625 C C   . ARG A 1 470 ? 6.07504   18.93243  24.15159  1.000 45.02575  ? 470 ARG A C   1 
ATOM   3626 O O   . ARG A 1 470 ? 6.74880   17.98608  24.57894  1.000 54.71977  ? 470 ARG A O   1 
ATOM   3627 C CB  . ARG A 1 470 ? 6.24082   21.22129  25.23086  1.000 55.04661  ? 470 ARG A CB  1 
ATOM   3628 C CG  . ARG A 1 470 ? 5.86411   20.47412  26.50659  1.000 65.73583  ? 470 ARG A CG  1 
ATOM   3629 C CD  . ARG A 1 470 ? 5.15625   21.35726  27.54146  1.000 72.89407  ? 470 ARG A CD  1 
ATOM   3630 N NE  . ARG A 1 470 ? 4.42702   20.55756  28.53957  1.000 87.37260  ? 470 ARG A NE  1 
ATOM   3631 C CZ  . ARG A 1 470 ? 4.81230   20.34337  29.81312  1.000 91.55542  ? 470 ARG A CZ  1 
ATOM   3632 N NH1 . ARG A 1 470 ? 4.03973   19.60420  30.60719  1.000 89.37202  ? 470 ARG A NH1 1 
ATOM   3633 N NH2 . ARG A 1 470 ? 5.97000   20.81784  30.30029  1.000 79.46503  ? 470 ARG A NH2 1 
ATOM   3634 N N   . ILE A 1 471 ? 4.80678   18.79135  23.72928  1.000 47.21099  ? 471 ILE A N   1 
ATOM   3635 C CA  . ILE A 1 471 ? 4.21418   17.46723  23.51717  1.000 51.16816  ? 471 ILE A CA  1 
ATOM   3636 C C   . ILE A 1 471 ? 5.04249   16.64352  22.53439  1.000 51.33941  ? 471 ILE A C   1 
ATOM   3637 O O   . ILE A 1 471 ? 5.25703   15.43732  22.72802  1.000 60.66432  ? 471 ILE A O   1 
ATOM   3638 C CB  . ILE A 1 471 ? 2.76335   17.59922  23.01736  1.000 47.22089  ? 471 ILE A CB  1 
ATOM   3639 C CG1 . ILE A 1 471 ? 1.85879   18.28101  24.04297  1.000 52.99855  ? 471 ILE A CG1 1 
ATOM   3640 C CG2 . ILE A 1 471 ? 2.16769   16.24954  22.68351  1.000 48.10462  ? 471 ILE A CG2 1 
ATOM   3641 C CD1 . ILE A 1 471 ? 1.21050   19.54595  23.54121  1.000 54.25587  ? 471 ILE A CD1 1 
ATOM   3642 N N   . PHE A 1 472 ? 5.47613   17.26360  21.44037  1.000 48.01809  ? 472 PHE A N   1 
ATOM   3643 C CA  . PHE A 1 472 ? 6.26844   16.53401  20.46230  1.000 44.38395  ? 472 PHE A CA  1 
ATOM   3644 C C   . PHE A 1 472 ? 7.52443   15.97922  21.10984  1.000 44.47289  ? 472 PHE A C   1 
ATOM   3645 O O   . PHE A 1 472 ? 7.85468   14.79965  20.94263  1.000 49.11470  ? 472 PHE A O   1 
ATOM   3646 C CB  . PHE A 1 472 ? 6.60894   17.45100  19.28986  1.000 39.38655  ? 472 PHE A CB  1 
ATOM   3647 C CG  . PHE A 1 472 ? 7.48741   16.82178  18.24492  1.000 42.45002  ? 472 PHE A CG  1 
ATOM   3648 C CD1 . PHE A 1 472 ? 7.15613   15.60859  17.65344  1.000 46.98668  ? 472 PHE A CD1 1 
ATOM   3649 C CD2 . PHE A 1 472 ? 8.63433   17.47183  17.81832  1.000 45.93911  ? 472 PHE A CD2 1 
ATOM   3650 C CE1 . PHE A 1 472 ? 7.98115   15.04658  16.66242  1.000 42.18709  ? 472 PHE A CE1 1 
ATOM   3651 C CE2 . PHE A 1 472 ? 9.45375   16.91959  16.83351  1.000 46.64885  ? 472 PHE A CE2 1 
ATOM   3652 C CZ  . PHE A 1 472 ? 9.12607   15.70751  16.25961  1.000 41.00821  ? 472 PHE A CZ  1 
ATOM   3653 N N   . ALA A 1 473 ? 8.21592   16.81036  21.89440  1.000 39.10665  ? 473 ALA A N   1 
ATOM   3654 C CA  . ALA A 1 473 ? 9.47200   16.37270  22.49526  1.000 41.48289  ? 473 ALA A CA  1 
ATOM   3655 C C   . ALA A 1 473 ? 9.23908   15.23050  23.47712  1.000 47.11949  ? 473 ALA A C   1 
ATOM   3656 O O   . ALA A 1 473 ? 10.01728  14.26583  23.51211  1.000 34.95283  ? 473 ALA A O   1 
ATOM   3657 C CB  . ALA A 1 473 ? 10.17196  17.54714  23.17921  1.000 34.54873  ? 473 ALA A CB  1 
ATOM   3658 N N   . GLN A 1 474 ? 8.16026   15.31778  24.27227  1.000 43.55406  ? 474 GLN A N   1 
ATOM   3659 C CA  . GLN A 1 474 ? 7.78385   14.21305  25.15193  1.000 42.15744  ? 474 GLN A CA  1 
ATOM   3660 C C   . GLN A 1 474 ? 7.58642   12.92462  24.37056  1.000 51.03424  ? 474 GLN A C   1 
ATOM   3661 O O   . GLN A 1 474 ? 7.98266   11.84562  24.83254  1.000 49.74689  ? 474 GLN A O   1 
ATOM   3662 C CB  . GLN A 1 474 ? 6.51603   14.54445  25.93331  1.000 42.60920  ? 474 GLN A CB  1 
ATOM   3663 C CG  . GLN A 1 474 ? 6.54312   15.86892  26.65005  1.000 61.53370  ? 474 GLN A CG  1 
ATOM   3664 C CD  . GLN A 1 474 ? 5.24052   16.18406  27.35026  1.000 77.38366  ? 474 GLN A CD  1 
ATOM   3665 O OE1 . GLN A 1 474 ? 4.30497   15.38442  27.34219  1.000 88.51854  ? 474 GLN A OE1 1 
ATOM   3666 N NE2 . GLN A 1 474 ? 5.16334   17.36498  27.94408  1.000 84.00727  ? 474 GLN A NE2 1 
ATOM   3667 N N   . ARG A 1 475 ? 6.99207   13.02233  23.17464  1.000 48.85176  ? 475 ARG A N   1 
ATOM   3668 C CA  . ARG A 1 475 ? 6.70321   11.83542  22.37711  1.000 47.29107  ? 475 ARG A CA  1 
ATOM   3669 C C   . ARG A 1 475 ? 7.98986   11.13063  21.94897  1.000 49.32650  ? 475 ARG A C   1 
ATOM   3670 O O   . ARG A 1 475 ? 8.10978   9.90224   22.07169  1.000 50.54546  ? 475 ARG A O   1 
ATOM   3671 C CB  . ARG A 1 475 ? 5.86621   12.23275  21.16608  1.000 40.39738  ? 475 ARG A CB  1 
ATOM   3672 C CG  . ARG A 1 475 ? 4.65242   11.38711  20.99027  1.000 44.73376  ? 475 ARG A CG  1 
ATOM   3673 C CD  . ARG A 1 475 ? 3.84292   11.89049  19.81838  1.000 51.33925  ? 475 ARG A CD  1 
ATOM   3674 N NE  . ARG A 1 475 ? 4.31359   11.30255  18.57010  1.000 53.73262  ? 475 ARG A NE  1 
ATOM   3675 C CZ  . ARG A 1 475 ? 4.44216   11.97035  17.43207  1.000 51.13997  ? 475 ARG A CZ  1 
ATOM   3676 N NH1 . ARG A 1 475 ? 4.13746   13.26233  17.37415  1.000 47.85648  ? 475 ARG A NH1 1 
ATOM   3677 N NH2 . ARG A 1 475 ? 4.87900   11.34292  16.35133  1.000 55.97144  ? 475 ARG A NH2 1 
ATOM   3678 N N   . LEU A 1 476 ? 8.97068   11.89633  21.45124  1.000 39.87500  ? 476 LEU A N   1 
ATOM   3679 C CA  . LEU A 1 476 ? 10.21427  11.28341  21.00801  1.000 43.85154  ? 476 LEU A CA  1 
ATOM   3680 C C   . LEU A 1 476 ? 11.06937  10.83015  22.16853  1.000 43.13586  ? 476 LEU A C   1 
ATOM   3681 O O   . LEU A 1 476 ? 11.85755  9.88911   22.01871  1.000 48.03668  ? 476 LEU A O   1 
ATOM   3682 C CB  . LEU A 1 476 ? 11.03023  12.23161  20.13471  1.000 51.24529  ? 476 LEU A CB  1 
ATOM   3683 C CG  . LEU A 1 476 ? 10.33118  12.91063  18.97087  1.000 46.68924  ? 476 LEU A CG  1 
ATOM   3684 C CD1 . LEU A 1 476 ? 11.01987  14.22970  18.66559  1.000 35.93289  ? 476 LEU A CD1 1 
ATOM   3685 C CD2 . LEU A 1 476 ? 10.32989  11.97535  17.78279  1.000 51.65012  ? 476 LEU A CD2 1 
ATOM   3686 N N   . MET A 1 477 ? 10.96968  11.51023  23.30975  1.000 43.83678  ? 477 MET A N   1 
ATOM   3687 C CA  . MET A 1 477 ? 11.58791  10.98814  24.51945  1.000 37.79858  ? 477 MET A CA  1 
ATOM   3688 C C   . MET A 1 477 ? 11.02810  9.61061   24.86720  1.000 37.96599  ? 477 MET A C   1 
ATOM   3689 O O   . MET A 1 477 ? 11.77693  8.71435   25.27023  1.000 38.72015  ? 477 MET A O   1 
ATOM   3690 C CB  . MET A 1 477 ? 11.37841  11.96177  25.67340  1.000 43.25265  ? 477 MET A CB  1 
ATOM   3691 C CG  . MET A 1 477 ? 12.16951  13.24599  25.55987  1.000 44.67751  ? 477 MET A CG  1 
ATOM   3692 S SD  . MET A 1 477 ? 11.73067  14.37033  26.90514  1.000 57.19480  ? 477 MET A SD  1 
ATOM   3693 C CE  . MET A 1 477 ? 12.93201  13.91550  28.15240  1.000 52.34096  ? 477 MET A CE  1 
ATOM   3694 N N   . LYS A 1 478 ? 9.71520   9.41072   24.71272  1.000 38.13488  ? 478 LYS A N   1 
ATOM   3695 C CA  . LYS A 1 478 ? 9.18406   8.07852   24.98259  1.000 45.04780  ? 478 LYS A CA  1 
ATOM   3696 C C   . LYS A 1 478 ? 9.58751   7.07492   23.90589  1.000 46.63548  ? 478 LYS A C   1 
ATOM   3697 O O   . LYS A 1 478 ? 9.82055   5.90525   24.22557  1.000 46.77310  ? 478 LYS A O   1 
ATOM   3698 C CB  . LYS A 1 478 ? 7.65992   8.10729   25.18329  1.000 45.35067  ? 478 LYS A CB  1 
ATOM   3699 C CG  . LYS A 1 478 ? 7.22394   9.17581   26.16376  1.000 56.25941  ? 478 LYS A CG  1 
ATOM   3700 C CD  . LYS A 1 478 ? 5.83213   8.94794   26.77404  1.000 70.11775  ? 478 LYS A CD  1 
ATOM   3701 C CE  . LYS A 1 478 ? 5.89201   8.90224   28.33607  1.000 73.72200  ? 478 LYS A CE  1 
ATOM   3702 N NZ  . LYS A 1 478 ? 5.88275   10.25669  29.00749  1.000 71.86567  ? 478 LYS A NZ  1 
ATOM   3703 N N   . TYR A 1 479 ? 9.69152   7.49590   22.64038  1.000 48.64984  ? 479 TYR A N   1 
ATOM   3704 C CA  . TYR A 1 479 ? 10.19803  6.59430   21.60342  1.000 44.02484  ? 479 TYR A CA  1 
ATOM   3705 C C   . TYR A 1 479 ? 11.60115  6.10737   21.93645  1.000 38.57099  ? 479 TYR A C   1 
ATOM   3706 O O   . TYR A 1 479 ? 11.87445  4.90137   21.93898  1.000 36.83182  ? 479 TYR A O   1 
ATOM   3707 C CB  . TYR A 1 479 ? 10.22722  7.30538   20.25877  1.000 42.06511  ? 479 TYR A CB  1 
ATOM   3708 C CG  . TYR A 1 479 ? 8.89362   7.46312   19.60499  1.000 43.58317  ? 479 TYR A CG  1 
ATOM   3709 C CD1 . TYR A 1 479 ? 7.88940   6.52923   19.79005  1.000 43.69751  ? 479 TYR A CD1 1 
ATOM   3710 C CD2 . TYR A 1 479 ? 8.63711   8.56123   18.79404  1.000 40.07611  ? 479 TYR A CD2 1 
ATOM   3711 C CE1 . TYR A 1 479 ? 6.65710   6.68766   19.16693  1.000 48.23026  ? 479 TYR A CE1 1 
ATOM   3712 C CE2 . TYR A 1 479 ? 7.41585   8.73051   18.18059  1.000 41.25564  ? 479 TYR A CE2 1 
ATOM   3713 C CZ  . TYR A 1 479 ? 6.42841   7.79888   18.35813  1.000 42.46162  ? 479 TYR A CZ  1 
ATOM   3714 O OH  . TYR A 1 479 ? 5.21542   8.00599   17.72877  1.000 42.39892  ? 479 TYR A OH  1 
ATOM   3715 N N   . TRP A 1 480 ? 12.51289  7.04777   22.18676  1.000 34.18917  ? 480 TRP A N   1 
ATOM   3716 C CA  . TRP A 1 480 ? 13.90779  6.70431   22.43007  1.000 39.25655  ? 480 TRP A CA  1 
ATOM   3717 C C   . TRP A 1 480 ? 14.06082  5.83700   23.68102  1.000 48.64314  ? 480 TRP A C   1 
ATOM   3718 O O   . TRP A 1 480 ? 14.78459  4.83081   23.66631  1.000 47.02897  ? 480 TRP A O   1 
ATOM   3719 C CB  . TRP A 1 480 ? 14.72769  7.98662   22.54819  1.000 31.29848  ? 480 TRP A CB  1 
ATOM   3720 C CG  . TRP A 1 480 ? 15.50379  8.34011   21.32353  1.000 31.47998  ? 480 TRP A CG  1 
ATOM   3721 C CD1 . TRP A 1 480 ? 16.85365  8.49855   21.23129  1.000 36.00910  ? 480 TRP A CD1 1 
ATOM   3722 C CD2 . TRP A 1 480 ? 14.98375  8.58495   20.01333  1.000 39.97661  ? 480 TRP A CD2 1 
ATOM   3723 N NE1 . TRP A 1 480 ? 17.21204  8.82752   19.94446  1.000 38.08110  ? 480 TRP A NE1 1 
ATOM   3724 C CE2 . TRP A 1 480 ? 16.08128  8.89230   19.17773  1.000 45.29159  ? 480 TRP A CE2 1 
ATOM   3725 C CE3 . TRP A 1 480 ? 13.69742  8.57769   19.46293  1.000 42.78654  ? 480 TRP A CE3 1 
ATOM   3726 C CZ2 . TRP A 1 480 ? 15.93127  9.18865   17.82374  1.000 48.41647  ? 480 TRP A CZ2 1 
ATOM   3727 C CZ3 . TRP A 1 480 ? 13.55079  8.87664   18.12512  1.000 43.37749  ? 480 TRP A CZ3 1 
ATOM   3728 C CH2 . TRP A 1 480 ? 14.66111  9.17603   17.31643  1.000 43.86767  ? 480 TRP A CH2 1 
ATOM   3729 N N   . THR A 1 481 ? 13.36955  6.20403   24.77483  1.000 47.17408  ? 481 THR A N   1 
ATOM   3730 C CA  . THR A 1 481 ? 13.49379  5.45659   26.02299  1.000 42.31764  ? 481 THR A CA  1 
ATOM   3731 C C   . THR A 1 481 ? 12.80130  4.10227   25.94148  1.000 46.00961  ? 481 THR A C   1 
ATOM   3732 O O   . THR A 1 481 ? 13.32721  3.10953   26.45226  1.000 52.20147  ? 481 THR A O   1 
ATOM   3733 C CB  . THR A 1 481 ? 12.92987  6.25638   27.19464  1.000 43.30582  ? 481 THR A CB  1 
ATOM   3734 O OG1 . THR A 1 481 ? 11.69690  6.86218   26.80604  1.000 53.30142  ? 481 THR A OG1 1 
ATOM   3735 C CG2 . THR A 1 481 ? 13.90480  7.34511   27.61042  1.000 41.61812  ? 481 THR A CG2 1 
ATOM   3736 N N   . ASN A 1 482 ? 11.61596  4.03262   25.32843  1.000 53.49903  ? 482 ASN A N   1 
ATOM   3737 C CA  . ASN A 1 482 ? 10.99259  2.72570   25.11851  1.000 54.40171  ? 482 ASN A CA  1 
ATOM   3738 C C   . ASN A 1 482 ? 11.93228  1.79212   24.36969  1.000 59.88562  ? 482 ASN A C   1 
ATOM   3739 O O   . ASN A 1 482 ? 12.00400  0.59528   24.67737  1.000 61.74472  ? 482 ASN A O   1 
ATOM   3740 C CB  . ASN A 1 482 ? 9.67865   2.85563   24.34624  1.000 49.58198  ? 482 ASN A CB  1 
ATOM   3741 C CG  . ASN A 1 482 ? 8.50626   3.19592   25.23575  1.000 55.53701  ? 482 ASN A CG  1 
ATOM   3742 O OD1 . ASN A 1 482 ? 8.51600   2.93894   26.44774  1.000 58.81931  ? 482 ASN A OD1 1 
ATOM   3743 N ND2 . ASN A 1 482 ? 7.48487   3.79084   24.63897  1.000 46.79133  ? 482 ASN A ND2 1 
ATOM   3744 N N   . PHE A 1 483 ? 12.66816  2.32699   23.38399  1.000 53.00621  ? 483 PHE A N   1 
ATOM   3745 C CA  . PHE A 1 483 ? 13.60520  1.50175   22.63311  1.000 50.21686  ? 483 PHE A CA  1 
ATOM   3746 C C   . PHE A 1 483 ? 14.78779  1.07655   23.49634  1.000 53.88684  ? 483 PHE A C   1 
ATOM   3747 O O   . PHE A 1 483 ? 15.25892  -0.06472  23.38484  1.000 57.00116  ? 483 PHE A O   1 
ATOM   3748 C CB  . PHE A 1 483 ? 14.09598  2.22995   21.37928  1.000 45.68343  ? 483 PHE A CB  1 
ATOM   3749 C CG  . PHE A 1 483 ? 15.13230  1.45053   20.61427  1.000 39.79617  ? 483 PHE A CG  1 
ATOM   3750 C CD1 . PHE A 1 483 ? 16.47759  1.75798   20.71597  1.000 36.40542  ? 483 PHE A CD1 1 
ATOM   3751 C CD2 . PHE A 1 483 ? 14.75558  0.33691   19.86275  1.000 40.77687  ? 483 PHE A CD2 1 
ATOM   3752 C CE1 . PHE A 1 483 ? 17.42841  1.00889   20.02599  1.000 43.16362  ? 483 PHE A CE1 1 
ATOM   3753 C CE2 . PHE A 1 483 ? 15.69871  -0.42159  19.18756  1.000 39.25554  ? 483 PHE A CE2 1 
ATOM   3754 C CZ  . PHE A 1 483 ? 17.03682  -0.07846  19.25814  1.000 42.16555  ? 483 PHE A CZ  1 
ATOM   3755 N N   . ALA A 1 484 ? 15.28296  1.97423   24.36374  1.000 51.65354  ? 484 ALA A N   1 
ATOM   3756 C CA  . ALA A 1 484 ? 16.35095  1.59351   25.29188  1.000 46.57727  ? 484 ALA A CA  1 
ATOM   3757 C C   . ALA A 1 484 ? 15.90358  0.50104   26.25536  1.000 48.55826  ? 484 ALA A C   1 
ATOM   3758 O O   . ALA A 1 484 ? 16.71316  -0.35727  26.61808  1.000 52.20404  ? 484 ALA A O   1 
ATOM   3759 C CB  . ALA A 1 484 ? 16.84508  2.80894   26.07622  1.000 40.54507  ? 484 ALA A CB  1 
ATOM   3760 N N   . ARG A 1 485 ? 14.62173  0.50729   26.65921  1.000 42.58382  ? 485 ARG A N   1 
ATOM   3761 C CA  . ARG A 1 485 ? 14.09112  -0.44453  27.63874  1.000 56.30648  ? 485 ARG A CA  1 
ATOM   3762 C C   . ARG A 1 485 ? 13.76665  -1.79202  27.01236  1.000 55.21980  ? 485 ARG A C   1 
ATOM   3763 O O   . ARG A 1 485 ? 14.07059  -2.83857  27.59242  1.000 49.20306  ? 485 ARG A O   1 
ATOM   3764 C CB  . ARG A 1 485 ? 12.81672  0.09933   28.30055  1.000 63.18952  ? 485 ARG A CB  1 
ATOM   3765 C CG  . ARG A 1 485 ? 13.00084  1.14184   29.39008  1.000 68.71103  ? 485 ARG A CG  1 
ATOM   3766 C CD  . ARG A 1 485 ? 11.66584  1.44304   30.09163  1.000 72.66363  ? 485 ARG A CD  1 
ATOM   3767 N NE  . ARG A 1 485 ? 10.82862  2.33755   29.29611  1.000 75.51514  ? 485 ARG A NE  1 
ATOM   3768 C CZ  . ARG A 1 485 ? 10.70834  3.64715   29.51094  1.000 80.15739  ? 485 ARG A CZ  1 
ATOM   3769 N NH1 . ARG A 1 485 ? 11.35907  4.22550   30.51514  1.000 75.18251  ? 485 ARG A NH1 1 
ATOM   3770 N NH2 . ARG A 1 485 ? 9.93407   4.38224   28.71745  1.000 85.51352  ? 485 ARG A NH2 1 
ATOM   3771 N N   . THR A 1 486 ? 13.09757  -1.78105  25.85254  1.000 62.45670  ? 486 THR A N   1 
ATOM   3772 C CA  . THR A 1 486 ? 12.48123  -2.97551  25.28253  1.000 60.43213  ? 486 THR A CA  1 
ATOM   3773 C C   . THR A 1 486 ? 13.04200  -3.38491  23.92645  1.000 54.48369  ? 486 THR A C   1 
ATOM   3774 O O   . THR A 1 486 ? 12.71566  -4.47755  23.44990  1.000 51.11664  ? 486 THR A O   1 
ATOM   3775 C CB  . THR A 1 486 ? 10.96142  -2.77944  25.13237  1.000 59.28518  ? 486 THR A CB  1 
ATOM   3776 O OG1 . THR A 1 486 ? 10.70688  -1.87403  24.04586  1.000 60.10029  ? 486 THR A OG1 1 
ATOM   3777 C CG2 . THR A 1 486 ? 10.33754  -2.22157  26.41676  1.000 51.90265  ? 486 THR A CG2 1 
ATOM   3778 N N   . GLY A 1 487 ? 13.87501  -2.56184  23.29861  1.000 55.75074  ? 487 GLY A N   1 
ATOM   3779 C CA  . GLY A 1 487 ? 14.28108  -2.84262  21.93549  1.000 63.21205  ? 487 GLY A CA  1 
ATOM   3780 C C   . GLY A 1 487 ? 13.18867  -2.62012  20.91613  1.000 62.11753  ? 487 GLY A C   1 
ATOM   3781 O O   . GLY A 1 487 ? 13.13440  -3.33301  19.91342  1.000 66.20644  ? 487 GLY A O   1 
ATOM   3782 N N   . ASP A 1 488 ? 12.31647  -1.64170  21.15050  1.000 60.24593  ? 488 ASP A N   1 
ATOM   3783 C CA  . ASP A 1 488 ? 11.08946  -1.42623  20.39449  1.000 57.45424  ? 488 ASP A CA  1 
ATOM   3784 C C   . ASP A 1 488 ? 10.51722  -0.07297  20.79860  1.000 52.48378  ? 488 ASP A C   1 
ATOM   3785 O O   . ASP A 1 488 ? 10.10454  0.10860   21.95088  1.000 57.23779  ? 488 ASP A O   1 
ATOM   3786 C CB  . ASP A 1 488 ? 10.09350  -2.56268  20.66201  1.000 57.98355  ? 488 ASP A CB  1 
ATOM   3787 C CG  . ASP A 1 488 ? 8.75587   -2.37988  19.94155  1.000 57.27422  ? 488 ASP A CG  1 
ATOM   3788 O OD1 . ASP A 1 488 ? 8.52615   -1.34440  19.27139  1.000 55.97425  ? 488 ASP A OD1 1 
ATOM   3789 O OD2 . ASP A 1 488 ? 7.92023   -3.30081  20.04901  1.000 59.26695  ? 488 ASP A OD2 1 
ATOM   3790 N N   . PRO A 1 489 ? 10.46467  0.89816   19.88404  1.000 51.23029  ? 489 PRO A N   1 
ATOM   3791 C CA  . PRO A 1 489 ? 10.07152  2.25655   20.29049  1.000 49.36753  ? 489 PRO A CA  1 
ATOM   3792 C C   . PRO A 1 489 ? 8.59595   2.37898   20.59989  1.000 50.29702  ? 489 PRO A C   1 
ATOM   3793 O O   . PRO A 1 489 ? 8.17766   3.40796   21.15035  1.000 50.86200  ? 489 PRO A O   1 
ATOM   3794 C CB  . PRO A 1 489 ? 10.47523  3.12052   19.08274  1.000 44.72066  ? 489 PRO A CB  1 
ATOM   3795 C CG  . PRO A 1 489 ? 10.44477  2.16988   17.90661  1.000 44.20452  ? 489 PRO A CG  1 
ATOM   3796 C CD  . PRO A 1 489 ? 10.68777  0.77399   18.42573  1.000 44.70015  ? 489 PRO A CD  1 
ATOM   3797 N N   . ASN A 1 490 ? 7.80684   1.35452   20.29286  1.000 54.69510  ? 490 ASN A N   1 
ATOM   3798 C CA  . ASN A 1 490 ? 6.36070   1.43033   20.42226  1.000 64.51080  ? 490 ASN A CA  1 
ATOM   3799 C C   . ASN A 1 490 ? 5.93507   1.33489   21.87967  1.000 77.31455  ? 490 ASN A C   1 
ATOM   3800 O O   . ASN A 1 490 ? 6.61607   0.72452   22.71157  1.000 79.35799  ? 490 ASN A O   1 
ATOM   3801 C CB  . ASN A 1 490 ? 5.69758   0.31581   19.61095  1.000 65.43230  ? 490 ASN A CB  1 
ATOM   3802 C CG  . ASN A 1 490 ? 5.74104   0.57841   18.11227  1.000 62.65580  ? 490 ASN A CG  1 
ATOM   3803 O OD1 . ASN A 1 490 ? 5.14725   1.54239   17.62474  1.000 53.14414  ? 490 ASN A OD1 1 
ATOM   3804 N ND2 . ASN A 1 490 ? 6.43139   -0.28945  17.37374  1.000 66.60372  ? 490 ASN A ND2 1 
ATOM   3805 N N   . ASP A 1 491 ? 4.79144   1.95417   22.18854  1.000 92.54470  ? 491 ASP A N   1 
ATOM   3806 C CA  . ASP A 1 491 ? 4.22387   1.83902   23.53649  1.000 105.92924 ? 491 ASP A CA  1 
ATOM   3807 C C   . ASP A 1 491 ? 3.47400   0.52509   23.65946  1.000 95.50480  ? 491 ASP A C   1 
ATOM   3808 O O   . ASP A 1 491 ? 2.65181   0.20576   22.79605  1.000 93.53022  ? 491 ASP A O   1 
ATOM   3809 C CB  . ASP A 1 491 ? 3.26396   2.98283   23.85991  1.000 125.95137 ? 491 ASP A CB  1 
ATOM   3810 C CG  . ASP A 1 491 ? 3.84222   4.34205   23.54962  1.000 134.10143 ? 491 ASP A CG  1 
ATOM   3811 O OD1 . ASP A 1 491 ? 3.89480   4.71079   22.34668  1.000 131.80176 ? 491 ASP A OD1 1 
ATOM   3812 O OD2 . ASP A 1 491 ? 4.22565   5.04093   24.51550  1.000 135.50205 ? 491 ASP A OD2 1 
ATOM   3813 N N   . PRO A 1 492 ? 3.73680   -0.26672  24.69019  1.000 97.57590  ? 492 PRO A N   1 
ATOM   3814 C CA  . PRO A 1 492 ? 2.92540   -1.47902  24.86094  1.000 102.52295 ? 492 PRO A CA  1 
ATOM   3815 C C   . PRO A 1 492 ? 1.47210   -1.14544  25.15291  1.000 109.86208 ? 492 PRO A C   1 
ATOM   3816 O O   . PRO A 1 492 ? 0.56261   -1.75856  24.57484  1.000 106.62002 ? 492 PRO A O   1 
ATOM   3817 C CB  . PRO A 1 492 ? 3.62504   -2.20729  26.02094  1.000 102.35665 ? 492 PRO A CB  1 
ATOM   3818 C CG  . PRO A 1 492 ? 5.01462   -1.61717  26.08095  1.000 97.20492  ? 492 PRO A CG  1 
ATOM   3819 C CD  . PRO A 1 492 ? 4.84944   -0.19048  25.65259  1.000 97.20376  ? 492 PRO A CD  1 
ATOM   3820 N N   . ARG A 1 493 ? 1.23293   -0.14383  26.00774  1.000 116.28704 ? 493 ARG A N   1 
ATOM   3821 C CA  . ARG A 1 493 ? -0.12873  0.19189   26.41747  1.000 116.90779 ? 493 ARG A CA  1 
ATOM   3822 C C   . ARG A 1 493 ? -0.89104  0.89687   25.30152  1.000 127.43960 ? 493 ARG A C   1 
ATOM   3823 O O   . ARG A 1 493 ? -2.07779  0.62253   25.08704  1.000 135.93446 ? 493 ARG A O   1 
ATOM   3824 C CB  . ARG A 1 493 ? -0.09714  1.06248   27.67585  1.000 102.85987 ? 493 ARG A CB  1 
ATOM   3825 N N   . ASP A 1 494 ? -0.22762  1.79924   24.57624  1.000 127.34719 ? 494 ASP A N   1 
ATOM   3826 C CA  . ASP A 1 494 ? -0.88373  2.63878   23.57254  1.000 130.19874 ? 494 ASP A CA  1 
ATOM   3827 C C   . ASP A 1 494 ? -1.03704  1.85456   22.27426  1.000 129.74278 ? 494 ASP A C   1 
ATOM   3828 O O   . ASP A 1 494 ? -0.19755  1.92355   21.37035  1.000 122.95660 ? 494 ASP A O   1 
ATOM   3829 C CB  . ASP A 1 494 ? -0.09629  3.92270   23.35556  1.000 127.78852 ? 494 ASP A CB  1 
ATOM   3830 C CG  . ASP A 1 494 ? -0.98109  5.08551   22.97841  1.000 134.33788 ? 494 ASP A CG  1 
ATOM   3831 O OD1 . ASP A 1 494 ? -2.21904  4.94990   23.09030  1.000 141.46843 ? 494 ASP A OD1 1 
ATOM   3832 O OD2 . ASP A 1 494 ? -0.43723  6.13146   22.56473  1.000 132.35123 ? 494 ASP A OD2 1 
ATOM   3833 N N   . SER A 1 495 ? -2.14281  1.10956   22.17884  1.000 133.22986 ? 495 SER A N   1 
ATOM   3834 C CA  . SER A 1 495 ? -2.39648  0.27172   21.01071  1.000 130.96887 ? 495 SER A CA  1 
ATOM   3835 C C   . SER A 1 495 ? -3.06883  1.05820   19.88760  1.000 131.33773 ? 495 SER A C   1 
ATOM   3836 O O   . SER A 1 495 ? -2.76875  0.83490   18.70678  1.000 125.88356 ? 495 SER A O   1 
ATOM   3837 C CB  . SER A 1 495 ? -3.25472  -0.93332  21.41282  1.000 132.00729 ? 495 SER A CB  1 
ATOM   3838 O OG  . SER A 1 495 ? -3.01486  -2.04610  20.56755  1.000 127.39286 ? 495 SER A OG  1 
ATOM   3839 N N   . LYS A 1 496 ? -3.97016  1.98615   20.24236  1.000 133.88290 ? 496 LYS A N   1 
ATOM   3840 C CA  . LYS A 1 496 ? -4.71913  2.74493   19.24016  1.000 128.58465 ? 496 LYS A CA  1 
ATOM   3841 C C   . LYS A 1 496 ? -3.79929  3.62533   18.39507  1.000 123.54167 ? 496 LYS A C   1 
ATOM   3842 O O   . LYS A 1 496 ? -4.01810  3.78346   17.18535  1.000 117.11433 ? 496 LYS A O   1 
ATOM   3843 C CB  . LYS A 1 496 ? -5.79544  3.58876   19.92712  1.000 127.13759 ? 496 LYS A CB  1 
ATOM   3844 N N   . SER A 1 497 ? -2.76213  4.21041   19.02023  1.000 118.45776 ? 497 SER A N   1 
ATOM   3845 C CA  . SER A 1 497 ? -1.72264  4.99253   18.35631  1.000 101.31712 ? 497 SER A CA  1 
ATOM   3846 C C   . SER A 1 497 ? -1.24681  4.28363   17.09596  1.000 99.14701  ? 497 SER A C   1 
ATOM   3847 O O   . SER A 1 497 ? -1.27205  3.04655   17.02549  1.000 107.30912 ? 497 SER A O   1 
ATOM   3848 C CB  . SER A 1 497 ? -0.52746  5.22666   19.28981  1.000 87.44343  ? 497 SER A CB  1 
ATOM   3849 O OG  . SER A 1 497 ? -0.66784  6.40220   20.07165  1.000 82.89277  ? 497 SER A OG  1 
ATOM   3850 N N   . PRO A 1 498 ? -0.82331  5.02246   16.07704  1.000 87.31990  ? 498 PRO A N   1 
ATOM   3851 C CA  . PRO A 1 498 ? -0.18949  4.36980   14.92853  1.000 75.99478  ? 498 PRO A CA  1 
ATOM   3852 C C   . PRO A 1 498 ? 1.11934   3.71567   15.35285  1.000 65.15572  ? 498 PRO A C   1 
ATOM   3853 O O   . PRO A 1 498 ? 1.88823   4.27691   16.13501  1.000 59.48054  ? 498 PRO A O   1 
ATOM   3854 C CB  . PRO A 1 498 ? 0.02925   5.52009   13.93886  1.000 71.55221  ? 498 PRO A CB  1 
ATOM   3855 C CG  . PRO A 1 498 ? -0.06116  6.77063   14.76884  1.000 69.73175  ? 498 PRO A CG  1 
ATOM   3856 C CD  . PRO A 1 498 ? -0.97789  6.47568   15.89422  1.000 75.82793  ? 498 PRO A CD  1 
ATOM   3857 N N   . GLN A 1 499 ? 1.35174   2.50675   14.84582  1.000 63.33747  ? 499 GLN A N   1 
ATOM   3858 C CA  . GLN A 1 499 ? 2.51192   1.70801   15.21445  1.000 61.87367  ? 499 GLN A CA  1 
ATOM   3859 C C   . GLN A 1 499 ? 3.71147   2.00921   14.32102  1.000 58.96524  ? 499 GLN A C   1 
ATOM   3860 O O   . GLN A 1 499 ? 3.56499   2.38643   13.15659  1.000 59.73618  ? 499 GLN A O   1 
ATOM   3861 C CB  . GLN A 1 499 ? 2.17341   0.22011   15.15025  1.000 65.43412  ? 499 GLN A CB  1 
ATOM   3862 C CG  . GLN A 1 499 ? 1.02983   -0.16429  16.06969  1.000 81.28831  ? 499 GLN A CG  1 
ATOM   3863 C CD  . GLN A 1 499 ? 1.38430   0.04849   17.53913  1.000 86.90138  ? 499 GLN A CD  1 
ATOM   3864 O OE1 . GLN A 1 499 ? 2.09180   -0.75994  18.14080  1.000 84.57353  ? 499 GLN A OE1 1 
ATOM   3865 N NE2 . GLN A 1 499 ? 0.88743   1.13828   18.12078  1.000 90.44144  ? 499 GLN A NE2 1 
ATOM   3866 N N   . TRP A 1 500 ? 4.90999   1.83606   14.89222  1.000 56.70762  ? 500 TRP A N   1 
ATOM   3867 C CA  . TRP A 1 500 ? 6.17705   2.03754   14.20077  1.000 48.74668  ? 500 TRP A CA  1 
ATOM   3868 C C   . TRP A 1 500 ? 6.71215   0.67907   13.77959  1.000 53.36741  ? 500 TRP A C   1 
ATOM   3869 O O   . TRP A 1 500 ? 7.14298   -0.09927  14.64714  1.000 59.47892  ? 500 TRP A O   1 
ATOM   3870 C CB  . TRP A 1 500 ? 7.17251   2.74339   15.11977  1.000 42.71962  ? 500 TRP A CB  1 
ATOM   3871 C CG  . TRP A 1 500 ? 8.46862   3.19139   14.49138  1.000 49.79182  ? 500 TRP A CG  1 
ATOM   3872 C CD1 . TRP A 1 500 ? 9.02572   2.75011   13.32049  1.000 50.49642  ? 500 TRP A CD1 1 
ATOM   3873 C CD2 . TRP A 1 500 ? 9.37766   4.17096   15.02160  1.000 48.04731  ? 500 TRP A CD2 1 
ATOM   3874 N NE1 . TRP A 1 500 ? 10.21716  3.40218   13.08852  1.000 46.09872  ? 500 TRP A NE1 1 
ATOM   3875 C CE2 . TRP A 1 500 ? 10.45887  4.27094   14.12197  1.000 43.29441  ? 500 TRP A CE2 1 
ATOM   3876 C CE3 . TRP A 1 500 ? 9.37544   4.97908   16.16591  1.000 40.61725  ? 500 TRP A CE3 1 
ATOM   3877 C CZ2 . TRP A 1 500 ? 11.51863  5.15343   14.32881  1.000 36.85569  ? 500 TRP A CZ2 1 
ATOM   3878 C CZ3 . TRP A 1 500 ? 10.43057  5.84767   16.37170  1.000 32.72963  ? 500 TRP A CZ3 1 
ATOM   3879 C CH2 . TRP A 1 500 ? 11.48605  5.92861   15.46209  1.000 34.21626  ? 500 TRP A CH2 1 
ATOM   3880 N N   . PRO A 1 501 ? 6.69602   0.33944   12.49262  1.000 50.79747  ? 501 PRO A N   1 
ATOM   3881 C CA  . PRO A 1 501 ? 7.06744   -1.01850  12.07032  1.000 47.27277  ? 501 PRO A CA  1 
ATOM   3882 C C   . PRO A 1 501 ? 8.55334   -1.11158  11.78604  1.000 46.33282  ? 501 PRO A C   1 
ATOM   3883 O O   . PRO A 1 501 ? 9.19004   -0.10479  11.43184  1.000 50.23576  ? 501 PRO A O   1 
ATOM   3884 C CB  . PRO A 1 501 ? 6.24611   -1.21774  10.78687  1.000 49.56948  ? 501 PRO A CB  1 
ATOM   3885 C CG  . PRO A 1 501 ? 6.20656   0.17209   10.17880  1.000 50.90472  ? 501 PRO A CG  1 
ATOM   3886 C CD  . PRO A 1 501 ? 6.20345   1.15230   11.36278  1.000 50.33483  ? 501 PRO A CD  1 
ATOM   3887 N N   . PRO A 1 502 ? 9.13880   -2.30025  11.91648  1.000 41.87275  ? 502 PRO A N   1 
ATOM   3888 C CA  . PRO A 1 502 ? 10.55956  -2.46487  11.58540  1.000 47.42722  ? 502 PRO A CA  1 
ATOM   3889 C C   . PRO A 1 502 ? 10.83296  -2.25207  10.10273  1.000 52.21681  ? 502 PRO A C   1 
ATOM   3890 O O   . PRO A 1 502 ? 10.01011  -2.56570  9.23927   1.000 64.14886  ? 502 PRO A O   1 
ATOM   3891 C CB  . PRO A 1 502 ? 10.85855  -3.91433  11.99261  1.000 42.40719  ? 502 PRO A CB  1 
ATOM   3892 C CG  . PRO A 1 502 ? 9.80600   -4.25619  12.98253  1.000 46.14864  ? 502 PRO A CG  1 
ATOM   3893 C CD  . PRO A 1 502 ? 8.57605   -3.50769  12.53524  1.000 44.82197  ? 502 PRO A CD  1 
ATOM   3894 N N   . TYR A 1 503 ? 12.01400  -1.70926  9.81811   1.000 45.63815  ? 503 TYR A N   1 
ATOM   3895 C CA  . TYR A 1 503 ? 12.50927  -1.60226  8.45390   1.000 48.69665  ? 503 TYR A CA  1 
ATOM   3896 C C   . TYR A 1 503 ? 12.93500  -2.98048  7.95867   1.000 59.72911  ? 503 TYR A C   1 
ATOM   3897 O O   . TYR A 1 503 ? 13.85364  -3.58511  8.52114   1.000 60.98600  ? 503 TYR A O   1 
ATOM   3898 C CB  . TYR A 1 503 ? 13.67960  -0.62415  8.39379   1.000 47.54880  ? 503 TYR A CB  1 
ATOM   3899 C CG  . TYR A 1 503 ? 14.24867  -0.43822  7.00248   1.000 51.55744  ? 503 TYR A CG  1 
ATOM   3900 C CD1 . TYR A 1 503 ? 15.26528  -1.25850  6.51993   1.000 49.46832  ? 503 TYR A CD1 1 
ATOM   3901 C CD2 . TYR A 1 503 ? 13.77301  0.56408   6.17404   1.000 55.96037  ? 503 TYR A CD2 1 
ATOM   3902 C CE1 . TYR A 1 503 ? 15.77866  -1.08607  5.25278   1.000 52.37064  ? 503 TYR A CE1 1 
ATOM   3903 C CE2 . TYR A 1 503 ? 14.28975  0.74774   4.90549   1.000 61.61584  ? 503 TYR A CE2 1 
ATOM   3904 C CZ  . TYR A 1 503 ? 15.28600  -0.08208  4.44728   1.000 59.33472  ? 503 TYR A CZ  1 
ATOM   3905 O OH  . TYR A 1 503 ? 15.77950  0.10164   3.17753   1.000 65.65265  ? 503 TYR A OH  1 
ATOM   3906 N N   . THR A 1 504 ? 12.27907  -3.46541  6.90141   1.000 70.04827  ? 504 THR A N   1 
ATOM   3907 C CA  . THR A 1 504 ? 12.55126  -4.75221  6.27294   1.000 70.81776  ? 504 THR A CA  1 
ATOM   3908 C C   . THR A 1 504 ? 13.17778  -4.54483  4.89829   1.000 69.93698  ? 504 THR A C   1 
ATOM   3909 O O   . THR A 1 504 ? 12.96989  -3.51788  4.25312   1.000 76.77603  ? 504 THR A O   1 
ATOM   3910 C CB  . THR A 1 504 ? 11.26077  -5.56022  6.11813   1.000 71.13042  ? 504 THR A CB  1 
ATOM   3911 O OG1 . THR A 1 504 ? 10.19722  -4.68668  5.71666   1.000 69.44960  ? 504 THR A OG1 1 
ATOM   3912 C CG2 . THR A 1 504 ? 10.90109  -6.19771  7.43241   1.000 70.28690  ? 504 THR A CG2 1 
ATOM   3913 N N   . THR A 1 505 ? 13.94271  -5.53466  4.43363   1.000 63.82768  ? 505 THR A N   1 
ATOM   3914 C CA  . THR A 1 505 ? 14.39373  -5.45791  3.04846   1.000 64.02268  ? 505 THR A CA  1 
ATOM   3915 C C   . THR A 1 505 ? 13.22141  -5.53962  2.08161   1.000 68.17777  ? 505 THR A C   1 
ATOM   3916 O O   . THR A 1 505 ? 13.24721  -4.88871  1.03435   1.000 79.40613  ? 505 THR A O   1 
ATOM   3917 C CB  . THR A 1 505 ? 15.41384  -6.55321  2.72814   1.000 61.44302  ? 505 THR A CB  1 
ATOM   3918 O OG1 . THR A 1 505 ? 14.76491  -7.82729  2.65888   1.000 65.00749  ? 505 THR A OG1 1 
ATOM   3919 C CG2 . THR A 1 505 ? 16.51322  -6.57830  3.77699   1.000 62.01654  ? 505 THR A CG2 1 
ATOM   3920 N N   . ALA A 1 506 ? 12.17436  -6.29766  2.42295   1.000 65.91845  ? 506 ALA A N   1 
ATOM   3921 C CA  . ALA A 1 506 ? 11.07175  -6.50299  1.48462   1.000 70.47574  ? 506 ALA A CA  1 
ATOM   3922 C C   . ALA A 1 506 ? 10.15977  -5.28263  1.38799   1.000 73.92124  ? 506 ALA A C   1 
ATOM   3923 O O   . ALA A 1 506 ? 9.65408   -4.97380  0.29901   1.000 71.17388  ? 506 ALA A O   1 
ATOM   3924 C CB  . ALA A 1 506 ? 10.25424  -7.73933  1.87036   1.000 68.15412  ? 506 ALA A CB  1 
ATOM   3925 N N   . ALA A 1 507 ? 9.92517   -4.57260  2.50203   1.000 63.50189  ? 507 ALA A N   1 
ATOM   3926 C CA  . ALA A 1 507 ? 8.98491   -3.45995  2.47348   1.000 57.13695  ? 507 ALA A CA  1 
ATOM   3927 C C   . ALA A 1 507 ? 9.61209   -2.09855  2.73902   1.000 54.50019  ? 507 ALA A C   1 
ATOM   3928 O O   . ALA A 1 507 ? 9.03311   -1.08918  2.33392   1.000 63.33158  ? 507 ALA A O   1 
ATOM   3929 C CB  . ALA A 1 507 ? 7.83478   -3.69641  3.46557   1.000 56.51787  ? 507 ALA A CB  1 
ATOM   3930 N N   . GLN A 1 508 ? 10.77898  -2.04106  3.36351   1.000 50.37431  ? 508 GLN A N   1 
ATOM   3931 C CA  . GLN A 1 508 ? 11.50360  -0.78946  3.60059   1.000 51.43206  ? 508 GLN A CA  1 
ATOM   3932 C C   . GLN A 1 508 ? 10.61683  0.28715   4.22444   1.000 54.74607  ? 508 GLN A C   1 
ATOM   3933 O O   . GLN A 1 508 ? 10.60710  1.44777   3.80735   1.000 43.65093  ? 508 GLN A O   1 
ATOM   3934 C CB  . GLN A 1 508 ? 12.16794  -0.28698  2.32113   1.000 51.08885  ? 508 GLN A CB  1 
ATOM   3935 C CG  . GLN A 1 508 ? 12.57983  -1.38908  1.35868   1.000 60.46295  ? 508 GLN A CG  1 
ATOM   3936 C CD  . GLN A 1 508 ? 13.23294  -0.83316  0.11779   1.000 67.36750  ? 508 GLN A CD  1 
ATOM   3937 O OE1 . GLN A 1 508 ? 13.80812  0.25632   0.16242   1.000 66.09203  ? 508 GLN A OE1 1 
ATOM   3938 N NE2 . GLN A 1 508 ? 13.13306  -1.56043  -1.00382  1.000 60.87035  ? 508 GLN A NE2 1 
ATOM   3939 N N   . GLN A 1 509 ? 9.90633   -0.10336  5.27940   1.000 62.78670  ? 509 GLN A N   1 
ATOM   3940 C CA  . GLN A 1 509 ? 9.05706   0.81808   6.02018   1.000 54.47398  ? 509 GLN A CA  1 
ATOM   3941 C C   . GLN A 1 509 ? 9.86698   1.69604   6.96728   1.000 44.61711  ? 509 GLN A C   1 
ATOM   3942 O O   . GLN A 1 509 ? 10.84448  1.24913   7.56957   1.000 50.49272  ? 509 GLN A O   1 
ATOM   3943 C CB  . GLN A 1 509 ? 8.02447   0.04094   6.81642   1.000 49.31560  ? 509 GLN A CB  1 
ATOM   3944 C CG  . GLN A 1 509 ? 6.70813   -0.07178  6.12774   1.000 51.33706  ? 509 GLN A CG  1 
ATOM   3945 C CD  . GLN A 1 509 ? 6.01399   -1.30731  6.56624   1.000 54.26187  ? 509 GLN A CD  1 
ATOM   3946 O OE1 . GLN A 1 509 ? 6.66831   -2.29346  6.92098   1.000 56.24630  ? 509 GLN A OE1 1 
ATOM   3947 N NE2 . GLN A 1 509 ? 4.68894   -1.26708  6.59971   1.000 55.95757  ? 509 GLN A NE2 1 
ATOM   3948 N N   . TYR A 1 510 ? 9.44663   2.95333   7.09261   1.000 37.62680  ? 510 TYR A N   1 
ATOM   3949 C CA  . TYR A 1 510 ? 10.03233  3.90548   8.02639   1.000 42.61462  ? 510 TYR A CA  1 
ATOM   3950 C C   . TYR A 1 510 ? 8.95038   4.92891   8.36072   1.000 52.50504  ? 510 TYR A C   1 
ATOM   3951 O O   . TYR A 1 510 ? 7.95663   5.04841   7.63683   1.000 69.39701  ? 510 TYR A O   1 
ATOM   3952 C CB  . TYR A 1 510 ? 11.30377  4.54711   7.44747   1.000 33.71433  ? 510 TYR A CB  1 
ATOM   3953 C CG  . TYR A 1 510 ? 11.07885  5.52984   6.31654   1.000 44.62473  ? 510 TYR A CG  1 
ATOM   3954 C CD1 . TYR A 1 510 ? 10.70772  5.10270   5.03321   1.000 52.41311  ? 510 TYR A CD1 1 
ATOM   3955 C CD2 . TYR A 1 510 ? 11.25280  6.88994   6.52597   1.000 43.31038  ? 510 TYR A CD2 1 
ATOM   3956 C CE1 . TYR A 1 510 ? 10.50129  6.02184   3.99571   1.000 51.78118  ? 510 TYR A CE1 1 
ATOM   3957 C CE2 . TYR A 1 510 ? 11.04973  7.80638   5.51210   1.000 47.97784  ? 510 TYR A CE2 1 
ATOM   3958 C CZ  . TYR A 1 510 ? 10.67386  7.38085   4.24408   1.000 49.87919  ? 510 TYR A CZ  1 
ATOM   3959 O OH  . TYR A 1 510 ? 10.48115  8.34332   3.25975   1.000 41.60430  ? 510 TYR A OH  1 
ATOM   3960 N N   . VAL A 1 511 ? 9.11369   5.63961   9.48715   1.000 36.66623  ? 511 VAL A N   1 
ATOM   3961 C CA  . VAL A 1 511 ? 8.08569   6.56571   9.96645   1.000 37.51568  ? 511 VAL A CA  1 
ATOM   3962 C C   . VAL A 1 511 ? 8.60422   7.98895   9.87491   1.000 39.61125  ? 511 VAL A C   1 
ATOM   3963 O O   . VAL A 1 511 ? 9.80973   8.24254   9.95477   1.000 48.44143  ? 511 VAL A O   1 
ATOM   3964 C CB  . VAL A 1 511 ? 7.60838   6.30475   11.41826  1.000 46.48455  ? 511 VAL A CB  1 
ATOM   3965 C CG1 . VAL A 1 511 ? 6.87694   4.98187   11.55050  1.000 47.78107  ? 511 VAL A CG1 1 
ATOM   3966 C CG2 . VAL A 1 511 ? 8.77042   6.40909   12.40872  1.000 37.27452  ? 511 VAL A CG2 1 
ATOM   3967 N N   . SER A 1 512 ? 7.67112   8.92670   9.74304   1.000 36.70908  ? 512 SER A N   1 
ATOM   3968 C CA  . SER A 1 512 ? 7.96723   10.35261  9.76266   1.000 37.24780  ? 512 SER A CA  1 
ATOM   3969 C C   . SER A 1 512 ? 7.77229   10.89634  11.17114  1.000 45.59045  ? 512 SER A C   1 
ATOM   3970 O O   . SER A 1 512 ? 6.70947   10.71059  11.77407  1.000 62.69667  ? 512 SER A O   1 
ATOM   3971 C CB  . SER A 1 512 ? 7.06061   11.10403  8.78796   1.000 43.41619  ? 512 SER A CB  1 
ATOM   3972 O OG  . SER A 1 512 ? 5.69322   10.85631  9.08318   1.000 50.20305  ? 512 SER A OG  1 
ATOM   3973 N N   . LEU A 1 513 ? 8.78606   11.57482  11.68799  1.000 43.33312  ? 513 LEU A N   1 
ATOM   3974 C CA  . LEU A 1 513 ? 8.71538   12.21307  12.99908  1.000 37.46971  ? 513 LEU A CA  1 
ATOM   3975 C C   . LEU A 1 513 ? 8.42159   13.70004  12.79708  1.000 35.02824  ? 513 LEU A C   1 
ATOM   3976 O O   . LEU A 1 513 ? 9.30697   14.47189  12.42125  1.000 36.87463  ? 513 LEU A O   1 
ATOM   3977 C CB  . LEU A 1 513 ? 10.01214  11.98881  13.77692  1.000 31.85242  ? 513 LEU A CB  1 
ATOM   3978 C CG  . LEU A 1 513 ? 10.41366  10.54413  14.11644  1.000 33.90891  ? 513 LEU A CG  1 
ATOM   3979 C CD1 . LEU A 1 513 ? 11.76327  10.48749  14.83406  1.000 29.43818  ? 513 LEU A CD1 1 
ATOM   3980 C CD2 . LEU A 1 513 ? 9.33932   9.85097   14.95800  1.000 33.53968  ? 513 LEU A CD2 1 
ATOM   3981 N N   . ASN A 1 514 ? 7.17750   14.10602  13.04865  1.000 40.39661  ? 514 ASN A N   1 
ATOM   3982 C CA  . ASN A 1 514 ? 6.81166   15.52433  13.02265  1.000 48.02340  ? 514 ASN A CA  1 
ATOM   3983 C C   . ASN A 1 514 ? 5.59841   15.71866  13.92283  1.000 50.55036  ? 514 ASN A C   1 
ATOM   3984 O O   . ASN A 1 514 ? 5.18508   14.79965  14.63338  1.000 57.89888  ? 514 ASN A O   1 
ATOM   3985 C CB  . ASN A 1 514 ? 6.55021   16.00670  11.58980  1.000 49.60592  ? 514 ASN A CB  1 
ATOM   3986 C CG  . ASN A 1 514 ? 5.31450   15.36947  10.98244  1.000 59.04930  ? 514 ASN A CG  1 
ATOM   3987 O OD1 . ASN A 1 514 ? 4.19941   15.80510  11.23734  1.000 70.03871  ? 514 ASN A OD1 1 
ATOM   3988 N ND2 . ASN A 1 514 ? 5.50774   14.31909  10.19082  1.000 56.54717  ? 514 ASN A ND2 1 
ATOM   3989 N N   . LEU A 1 515 ? 5.00211   16.91573  13.86805  1.000 55.23935  ? 515 LEU A N   1 
ATOM   3990 C CA  . LEU A 1 515 ? 3.95382   17.26854  14.82585  1.000 45.24842  ? 515 LEU A CA  1 
ATOM   3991 C C   . LEU A 1 515 ? 2.68153   16.45202  14.63056  1.000 54.66472  ? 515 LEU A C   1 
ATOM   3992 O O   . LEU A 1 515 ? 1.92512   16.25360  15.58824  1.000 60.90601  ? 515 LEU A O   1 
ATOM   3993 C CB  . LEU A 1 515 ? 3.63864   18.75793  14.74136  1.000 47.04670  ? 515 LEU A CB  1 
ATOM   3994 C CG  . LEU A 1 515 ? 4.82253   19.69260  14.97573  1.000 46.31130  ? 515 LEU A CG  1 
ATOM   3995 C CD1 . LEU A 1 515 ? 4.37341   21.14067  14.97077  1.000 48.75441  ? 515 LEU A CD1 1 
ATOM   3996 C CD2 . LEU A 1 515 ? 5.53310   19.34376  16.28720  1.000 44.81911  ? 515 LEU A CD2 1 
ATOM   3997 N N   . LYS A 1 516 ? 2.41628   15.98994  13.41337  1.000 53.47845  ? 516 LYS A N   1 
ATOM   3998 C CA  . LYS A 1 516 ? 1.31409   15.07817  13.18100  1.000 55.56948  ? 516 LYS A CA  1 
ATOM   3999 C C   . LYS A 1 516 ? 1.67341   13.68635  13.71165  1.000 58.54128  ? 516 LYS A C   1 
ATOM   4000 O O   . LYS A 1 516 ? 2.84556   13.38820  13.96127  1.000 55.49949  ? 516 LYS A O   1 
ATOM   4001 C CB  . LYS A 1 516 ? 0.98660   15.00737  11.68940  1.000 59.48821  ? 516 LYS A CB  1 
ATOM   4002 C CG  . LYS A 1 516 ? 0.93366   16.34462  10.92796  1.000 66.26352  ? 516 LYS A CG  1 
ATOM   4003 C CD  . LYS A 1 516 ? 1.01569   16.09169  9.40073   1.000 71.22442  ? 516 LYS A CD  1 
ATOM   4004 C CE  . LYS A 1 516 ? 0.77290   17.35050  8.56065   1.000 76.92108  ? 516 LYS A CE  1 
ATOM   4005 N NZ  . LYS A 1 516 ? 0.65051   17.04979  7.08938   1.000 79.66034  ? 516 LYS A NZ  1 
ATOM   4006 N N   . PRO A 1 517 ? 0.67735   12.82264  13.91800  1.000 59.54380  ? 517 PRO A N   1 
ATOM   4007 C CA  . PRO A 1 517 ? 0.97395   11.44215  14.31345  1.000 54.47154  ? 517 PRO A CA  1 
ATOM   4008 C C   . PRO A 1 517 ? 1.84232   10.73470  13.28655  1.000 56.69363  ? 517 PRO A C   1 
ATOM   4009 O O   . PRO A 1 517 ? 1.94767   11.14942  12.12940  1.000 58.34930  ? 517 PRO A O   1 
ATOM   4010 C CB  . PRO A 1 517 ? -0.41068  10.79765  14.40807  1.000 53.69228  ? 517 PRO A CB  1 
ATOM   4011 C CG  . PRO A 1 517 ? -1.30831  11.92292  14.73584  1.000 55.18210  ? 517 PRO A CG  1 
ATOM   4012 C CD  . PRO A 1 517 ? -0.76147  13.12163  14.02611  1.000 54.03594  ? 517 PRO A CD  1 
ATOM   4013 N N   . LEU A 1 518 ? 2.48542   9.65792   13.74372  1.000 55.39283  ? 518 LEU A N   1 
ATOM   4014 C CA  . LEU A 1 518 ? 3.36161   8.85600   12.89523  1.000 52.61930  ? 518 LEU A CA  1 
ATOM   4015 C C   . LEU A 1 518 ? 2.65485   8.45616   11.61009  1.000 53.79404  ? 518 LEU A C   1 
ATOM   4016 O O   . LEU A 1 518 ? 1.52669   7.95398   11.64118  1.000 55.68104  ? 518 LEU A O   1 
ATOM   4017 C CB  . LEU A 1 518 ? 3.80212   7.59244   13.63547  1.000 49.26075  ? 518 LEU A CB  1 
ATOM   4018 C CG  . LEU A 1 518 ? 4.93359   7.58137   14.65021  1.000 46.67822  ? 518 LEU A CG  1 
ATOM   4019 C CD1 . LEU A 1 518 ? 5.30113   6.14885   14.93090  1.000 47.41490  ? 518 LEU A CD1 1 
ATOM   4020 C CD2 . LEU A 1 518 ? 6.13692   8.33422   14.15207  1.000 54.52498  ? 518 LEU A CD2 1 
ATOM   4021 N N   . GLU A 1 519 ? 3.32727   8.68083   10.48050  1.000 57.21181  ? 519 GLU A N   1 
ATOM   4022 C CA  . GLU A 1 519 ? 2.87142   8.22308   9.17051   1.000 55.74821  ? 519 GLU A CA  1 
ATOM   4023 C C   . GLU A 1 519 ? 3.94848   7.30330   8.60908   1.000 51.13828  ? 519 GLU A C   1 
ATOM   4024 O O   . GLU A 1 519 ? 5.13917   7.61065   8.71034   1.000 51.20635  ? 519 GLU A O   1 
ATOM   4025 C CB  . GLU A 1 519 ? 2.58135   9.41505   8.24169   1.000 53.93170  ? 519 GLU A CB  1 
ATOM   4026 C CG  . GLU A 1 519 ? 2.53583   9.08424   6.75167   1.000 77.52842  ? 519 GLU A CG  1 
ATOM   4027 C CD  . GLU A 1 519 ? 2.55170   10.32323  5.84752   1.000 83.75118  ? 519 GLU A CD  1 
ATOM   4028 O OE1 . GLU A 1 519 ? 3.51830   10.48425  5.07078   1.000 76.50018  ? 519 GLU A OE1 1 
ATOM   4029 O OE2 . GLU A 1 519 ? 1.58782   11.12110  5.89632   1.000 85.63953  ? 519 GLU A OE2 1 
ATOM   4030 N N   . VAL A 1 520 ? 3.54674   6.15271   8.08138   1.000 52.28966  ? 520 VAL A N   1 
ATOM   4031 C CA  . VAL A 1 520 ? 4.50578   5.15364   7.61371   1.000 55.97921  ? 520 VAL A CA  1 
ATOM   4032 C C   . VAL A 1 520 ? 4.75022   5.32716   6.11817   1.000 54.98058  ? 520 VAL A C   1 
ATOM   4033 O O   . VAL A 1 520 ? 3.80202   5.46056   5.32753   1.000 54.92543  ? 520 VAL A O   1 
ATOM   4034 C CB  . VAL A 1 520 ? 4.01513   3.73189   7.92304   1.000 54.31707  ? 520 VAL A CB  1 
ATOM   4035 C CG1 . VAL A 1 520 ? 4.96855   2.71207   7.33577   1.000 54.03190  ? 520 VAL A CG1 1 
ATOM   4036 C CG2 . VAL A 1 520 ? 3.90034   3.53907   9.40805   1.000 54.11553  ? 520 VAL A CG2 1 
ATOM   4037 N N   . ARG A 1 521 ? 6.02532   5.30079   5.72897   1.000 49.35669  ? 521 ARG A N   1 
ATOM   4038 C CA  . ARG A 1 521 ? 6.44061   5.42978   4.34151   1.000 49.43489  ? 521 ARG A CA  1 
ATOM   4039 C C   . ARG A 1 521 ? 7.33009   4.25740   3.95358   1.000 58.14814  ? 521 ARG A C   1 
ATOM   4040 O O   . ARG A 1 521 ? 7.97664   3.62905   4.79499   1.000 58.33208  ? 521 ARG A O   1 
ATOM   4041 C CB  . ARG A 1 521 ? 7.18107   6.74323   4.09766   1.000 47.11695  ? 521 ARG A CB  1 
ATOM   4042 C CG  . ARG A 1 521 ? 6.49149   7.91087   4.71095   1.000 47.31770  ? 521 ARG A CG  1 
ATOM   4043 C CD  . ARG A 1 521 ? 7.10092   9.22258   4.30410   1.000 48.51883  ? 521 ARG A CD  1 
ATOM   4044 N NE  . ARG A 1 521 ? 6.30893   10.32458  4.84743   1.000 48.39892  ? 521 ARG A NE  1 
ATOM   4045 C CZ  . ARG A 1 521 ? 6.80284   11.51802  5.17804   1.000 53.91504  ? 521 ARG A CZ  1 
ATOM   4046 N NH1 . ARG A 1 521 ? 8.09078   11.79575  4.99629   1.000 47.49768  ? 521 ARG A NH1 1 
ATOM   4047 N NH2 . ARG A 1 521 ? 6.00179   12.44150  5.68533   1.000 60.99700  ? 521 ARG A NH2 1 
ATOM   4048 N N   . ARG A 1 522 ? 7.34073   3.96733   2.65535   1.000 53.35312  ? 522 ARG A N   1 
ATOM   4049 C CA  . ARG A 1 522 ? 8.17904   2.93007   2.07451   1.000 55.41786  ? 522 ARG A CA  1 
ATOM   4050 C C   . ARG A 1 522 ? 9.22613   3.57934   1.17900   1.000 55.30974  ? 522 ARG A C   1 
ATOM   4051 O O   . ARG A 1 522 ? 8.89432   4.42079   0.33733   1.000 52.53949  ? 522 ARG A O   1 
ATOM   4052 C CB  . ARG A 1 522 ? 7.32612   1.91130   1.29689   1.000 58.55893  ? 522 ARG A CB  1 
ATOM   4053 C CG  . ARG A 1 522 ? 6.33136   1.14246   2.16918   1.000 69.91036  ? 522 ARG A CG  1 
ATOM   4054 C CD  . ARG A 1 522 ? 5.16436   0.49461   1.41802   1.000 86.89107  ? 522 ARG A CD  1 
ATOM   4055 N NE  . ARG A 1 522 ? 3.88870   1.16230   1.73377   1.000 113.67945 ? 522 ARG A NE  1 
ATOM   4056 C CZ  . ARG A 1 522 ? 3.14731   0.98047   2.83865   1.000 122.14321 ? 522 ARG A CZ  1 
ATOM   4057 N NH1 . ARG A 1 522 ? 3.52184   0.13128   3.79103   1.000 114.65176 ? 522 ARG A NH1 1 
ATOM   4058 N NH2 . ARG A 1 522 ? 2.01035   1.65788   2.99250   1.000 129.36463 ? 522 ARG A NH2 1 
ATOM   4059 N N   . GLY A 1 523 ? 10.48763  3.21754   1.39082   1.000 47.36413  ? 523 GLY A N   1 
ATOM   4060 C CA  . GLY A 1 523 ? 11.55051  3.62508   0.50098   1.000 44.73470  ? 523 GLY A CA  1 
ATOM   4061 C C   . GLY A 1 523 ? 12.37284  4.81171   0.94357   1.000 55.93708  ? 523 GLY A C   1 
ATOM   4062 O O   . GLY A 1 523 ? 12.02764  5.96349   0.66066   1.000 71.89770  ? 523 GLY A O   1 
ATOM   4063 N N   . LEU A 1 524 ? 13.48303  4.53249   1.62123   1.000 40.82559  ? 524 LEU A N   1 
ATOM   4064 C CA  . LEU A 1 524 ? 14.45131  5.55511   1.99719   1.000 45.03940  ? 524 LEU A CA  1 
ATOM   4065 C C   . LEU A 1 524 ? 15.19065  6.10379   0.78286   1.000 46.60419  ? 524 LEU A C   1 
ATOM   4066 O O   . LEU A 1 524 ? 16.23587  5.54860   0.40788   1.000 40.55010  ? 524 LEU A O   1 
ATOM   4067 C CB  . LEU A 1 524 ? 15.46733  4.97271   2.97473   1.000 50.80528  ? 524 LEU A CB  1 
ATOM   4068 C CG  . LEU A 1 524 ? 15.17798  5.16123   4.45203   1.000 62.94133  ? 524 LEU A CG  1 
ATOM   4069 C CD1 . LEU A 1 524 ? 15.79796  4.02197   5.24687   1.000 66.59954  ? 524 LEU A CD1 1 
ATOM   4070 C CD2 . LEU A 1 524 ? 15.71749  6.51180   4.89911   1.000 58.89731  ? 524 LEU A CD2 1 
ATOM   4071 N N   . ARG A 1 525 ? 14.68179  7.20014   0.19472   1.000 40.64675  ? 525 ARG A N   1 
ATOM   4072 C CA  . ARG A 1 525 ? 15.13070  7.69966   -1.10682  1.000 51.06887  ? 525 ARG A CA  1 
ATOM   4073 C C   . ARG A 1 525 ? 15.62840  6.56866   -1.99384  1.000 54.85417  ? 525 ARG A C   1 
ATOM   4074 O O   . ARG A 1 525 ? 16.79094  6.58840   -2.41897  1.000 62.61727  ? 525 ARG A O   1 
ATOM   4075 C CB  . ARG A 1 525 ? 16.24873  8.73851   -0.96330  1.000 53.47868  ? 525 ARG A CB  1 
ATOM   4076 C CG  . ARG A 1 525 ? 15.85760  9.96992   -0.20089  1.000 57.27279  ? 525 ARG A CG  1 
ATOM   4077 C CD  . ARG A 1 525 ? 16.13434  11.24649  -0.97455  1.000 55.02982  ? 525 ARG A CD  1 
ATOM   4078 N NE  . ARG A 1 525 ? 16.26058  12.39128  -0.07069  1.000 63.75771  ? 525 ARG A NE  1 
ATOM   4079 C CZ  . ARG A 1 525 ? 15.27330  12.87165  0.68824   1.000 81.15897  ? 525 ARG A CZ  1 
ATOM   4080 N NH1 . ARG A 1 525 ? 15.49477  13.92276  1.47675   1.000 82.97887  ? 525 ARG A NH1 1 
ATOM   4081 N NH2 . ARG A 1 525 ? 14.06357  12.30744  0.66939   1.000 88.21077  ? 525 ARG A NH2 1 
ATOM   4082 N N   . ALA A 1 526 ? 14.77300  5.57508   -2.25694  1.000 41.41453  ? 526 ALA A N   1 
ATOM   4083 C CA  . ALA A 1 526 ? 15.24537  4.32593   -2.85013  1.000 51.22494  ? 526 ALA A CA  1 
ATOM   4084 C C   . ALA A 1 526 ? 15.93460  4.55725   -4.20178  1.000 55.00227  ? 526 ALA A C   1 
ATOM   4085 O O   . ALA A 1 526 ? 17.09497  4.16942   -4.38201  1.000 59.02825  ? 526 ALA A O   1 
ATOM   4086 C CB  . ALA A 1 526 ? 14.08823  3.33433   -2.96823  1.000 44.04062  ? 526 ALA A CB  1 
ATOM   4087 N N   . GLN A 1 527 ? 15.25251  5.21661   -5.15353  1.000 43.67867  ? 527 GLN A N   1 
ATOM   4088 C CA  . GLN A 1 527 ? 15.82437  5.39535   -6.49254  1.000 55.52235  ? 527 GLN A CA  1 
ATOM   4089 C C   . GLN A 1 527 ? 17.16318  6.12322   -6.44434  1.000 55.60774  ? 527 GLN A C   1 
ATOM   4090 O O   . GLN A 1 527 ? 18.15027  5.67135   -7.03863  1.000 61.57403  ? 527 GLN A O   1 
ATOM   4091 C CB  . GLN A 1 527 ? 14.86163  6.16281   -7.40670  1.000 60.09079  ? 527 GLN A CB  1 
ATOM   4092 C CG  . GLN A 1 527 ? 13.73817  5.34895   -8.03338  1.000 60.81664  ? 527 GLN A CG  1 
ATOM   4093 C CD  . GLN A 1 527 ? 14.21247  4.05935   -8.67380  1.000 64.51544  ? 527 GLN A CD  1 
ATOM   4094 O OE1 . GLN A 1 527 ? 13.85039  2.97094   -8.22693  1.000 67.92158  ? 527 GLN A OE1 1 
ATOM   4095 N NE2 . GLN A 1 527 ? 15.00656  4.17062   -9.73130  1.000 67.23929  ? 527 GLN A NE2 1 
ATOM   4096 N N   . THR A 1 528 ? 17.20709  7.27062   -5.76205  1.000 50.17854  ? 528 THR A N   1 
ATOM   4097 C CA  . THR A 1 528 ? 18.43065  8.06945   -5.70893  1.000 48.74182  ? 528 THR A CA  1 
ATOM   4098 C C   . THR A 1 528 ? 19.54529  7.38417   -4.92155  1.000 47.63830  ? 528 THR A C   1 
ATOM   4099 O O   . THR A 1 528 ? 20.72453  7.63777   -5.17734  1.000 56.33837  ? 528 THR A O   1 
ATOM   4100 C CB  . THR A 1 528 ? 18.13494  9.43410   -5.09265  1.000 47.51622  ? 528 THR A CB  1 
ATOM   4101 O OG1 . THR A 1 528 ? 16.96062  9.99129   -5.69228  1.000 43.63112  ? 528 THR A OG1 1 
ATOM   4102 C CG2 . THR A 1 528 ? 19.30377  10.37800  -5.26483  1.000 42.02692  ? 528 THR A CG2 1 
ATOM   4103 N N   . CYS A 1 529 ? 19.21810  6.54310   -3.94943  1.000 42.34127  ? 529 CYS A N   1 
ATOM   4104 C CA  . CYS A 1 529 ? 20.29055  5.85369   -3.24500  1.000 48.17532  ? 529 CYS A CA  1 
ATOM   4105 C C   . CYS A 1 529 ? 20.74276  4.59584   -3.96960  1.000 47.62020  ? 529 CYS A C   1 
ATOM   4106 O O   . CYS A 1 529 ? 21.85729  4.11649   -3.72686  1.000 42.73258  ? 529 CYS A O   1 
ATOM   4107 C CB  . CYS A 1 529 ? 19.87273  5.52577   -1.80682  1.000 49.19003  ? 529 CYS A CB  1 
ATOM   4108 S SG  . CYS A 1 529 ? 19.80924  7.00100   -0.74284  1.000 52.33482  ? 529 CYS A SG  1 
ATOM   4109 N N   . ALA A 1 530 ? 19.91930  4.05981   -4.86954  1.000 52.92155  ? 530 ALA A N   1 
ATOM   4110 C CA  . ALA A 1 530 ? 20.44745  3.09925   -5.82855  1.000 42.72787  ? 530 ALA A CA  1 
ATOM   4111 C C   . ALA A 1 530 ? 21.57356  3.73102   -6.62406  1.000 46.58984  ? 530 ALA A C   1 
ATOM   4112 O O   . ALA A 1 530 ? 22.58674  3.08173   -6.90735  1.000 49.29043  ? 530 ALA A O   1 
ATOM   4113 C CB  . ALA A 1 530 ? 19.34118  2.60833   -6.74935  1.000 42.28006  ? 530 ALA A CB  1 
ATOM   4114 N N   . PHE A 1 531 ? 21.43253  5.01997   -6.94578  1.000 40.76884  ? 531 PHE A N   1 
ATOM   4115 C CA  . PHE A 1 531 ? 22.47602  5.72409   -7.68030  1.000 44.85872  ? 531 PHE A CA  1 
ATOM   4116 C C   . PHE A 1 531 ? 23.77104  5.78764   -6.87951  1.000 44.56810  ? 531 PHE A C   1 
ATOM   4117 O O   . PHE A 1 531 ? 24.84935  5.44681   -7.38185  1.000 47.20768  ? 531 PHE A O   1 
ATOM   4118 C CB  . PHE A 1 531 ? 22.00082  7.12998   -8.03983  1.000 47.60799  ? 531 PHE A CB  1 
ATOM   4119 C CG  . PHE A 1 531 ? 23.06813  7.98407   -8.66046  1.000 51.06041  ? 531 PHE A CG  1 
ATOM   4120 C CD1 . PHE A 1 531 ? 23.73047  8.94373   -7.90704  1.000 47.20229  ? 531 PHE A CD1 1 
ATOM   4121 C CD2 . PHE A 1 531 ? 23.42203  7.81384   -9.99726  1.000 44.04107  ? 531 PHE A CD2 1 
ATOM   4122 C CE1 . PHE A 1 531 ? 24.71639  9.72368   -8.47598  1.000 50.98687  ? 531 PHE A CE1 1 
ATOM   4123 C CE2 . PHE A 1 531 ? 24.40615  8.58593   -10.57374 1.000 45.27611  ? 531 PHE A CE2 1 
ATOM   4124 C CZ  . PHE A 1 531 ? 25.05777  9.54281   -9.82235  1.000 56.33895  ? 531 PHE A CZ  1 
ATOM   4125 N N   . TRP A 1 532 ? 23.68673  6.22479   -5.62940  1.000 42.76411  ? 532 TRP A N   1 
ATOM   4126 C CA  . TRP A 1 532 ? 24.90660  6.42369   -4.85360  1.000 51.28243  ? 532 TRP A CA  1 
ATOM   4127 C C   . TRP A 1 532 ? 25.48548  5.11181   -4.35801  1.000 52.97721  ? 532 TRP A C   1 
ATOM   4128 O O   . TRP A 1 532 ? 26.70867  4.95287   -4.31284  1.000 52.02572  ? 532 TRP A O   1 
ATOM   4129 C CB  . TRP A 1 532 ? 24.64166  7.32483   -3.66202  1.000 40.20049  ? 532 TRP A CB  1 
ATOM   4130 C CG  . TRP A 1 532 ? 24.29101  8.71248   -3.99583  1.000 40.66331  ? 532 TRP A CG  1 
ATOM   4131 C CD1 . TRP A 1 532 ? 23.03817  9.24854   -4.05915  1.000 40.35814  ? 532 TRP A CD1 1 
ATOM   4132 C CD2 . TRP A 1 532 ? 25.20217  9.77654   -4.26635  1.000 42.14932  ? 532 TRP A CD2 1 
ATOM   4133 N NE1 . TRP A 1 532 ? 23.11551  10.58320  -4.36637  1.000 41.59192  ? 532 TRP A NE1 1 
ATOM   4134 C CE2 . TRP A 1 532 ? 24.43459  10.93174  -4.49905  1.000 42.72873  ? 532 TRP A CE2 1 
ATOM   4135 C CE3 . TRP A 1 532 ? 26.59535  9.86493   -4.33525  1.000 43.55553  ? 532 TRP A CE3 1 
ATOM   4136 C CZ2 . TRP A 1 532 ? 25.01189  12.15738  -4.80441  1.000 44.71508  ? 532 TRP A CZ2 1 
ATOM   4137 C CZ3 . TRP A 1 532 ? 27.16747  11.08180  -4.62836  1.000 45.48013  ? 532 TRP A CZ3 1 
ATOM   4138 C CH2 . TRP A 1 532 ? 26.37689  12.21366  -4.85955  1.000 46.06411  ? 532 TRP A CH2 1 
ATOM   4139 N N   . ASN A 1 533 ? 24.63215  4.16972   -3.96755  1.000 51.88402  ? 533 ASN A N   1 
ATOM   4140 C CA  . ASN A 1 533 ? 25.12863  2.97055   -3.31492  1.000 52.47626  ? 533 ASN A CA  1 
ATOM   4141 C C   . ASN A 1 533 ? 25.44946  1.84986   -4.28769  1.000 55.26931  ? 533 ASN A C   1 
ATOM   4142 O O   . ASN A 1 533 ? 26.29173  1.00425   -3.96800  1.000 59.98679  ? 533 ASN A O   1 
ATOM   4143 C CB  . ASN A 1 533 ? 24.12271  2.47969   -2.27197  1.000 49.59474  ? 533 ASN A CB  1 
ATOM   4144 C CG  . ASN A 1 533 ? 23.80549  3.53442   -1.22936  1.000 47.96984  ? 533 ASN A CG  1 
ATOM   4145 O OD1 . ASN A 1 533 ? 24.59146  4.45020   -0.99860  1.000 46.38875  ? 533 ASN A OD1 1 
ATOM   4146 N ND2 . ASN A 1 533 ? 22.64067  3.41438   -0.60077  1.000 53.14816  ? 533 ASN A ND2 1 
ATOM   4147 N N   . ARG A 1 534 ? 24.83210  1.83696   -5.47080  1.000 56.33444  ? 534 ARG A N   1 
ATOM   4148 C CA  . ARG A 1 534 ? 25.05357  0.77989   -6.45118  1.000 57.05005  ? 534 ARG A CA  1 
ATOM   4149 C C   . ARG A 1 534 ? 25.83918  1.24871   -7.67086  1.000 59.69363  ? 534 ARG A C   1 
ATOM   4150 O O   . ARG A 1 534 ? 26.90862  0.70300   -7.95672  1.000 64.60323  ? 534 ARG A O   1 
ATOM   4151 C CB  . ARG A 1 534 ? 23.71088  0.18252   -6.88060  1.000 55.59550  ? 534 ARG A CB  1 
ATOM   4152 C CG  . ARG A 1 534 ? 23.01407  -0.58929  -5.78564  1.000 49.46926  ? 534 ARG A CG  1 
ATOM   4153 C CD  . ARG A 1 534 ? 21.51744  -0.70793  -6.03784  1.000 53.60016  ? 534 ARG A CD  1 
ATOM   4154 N NE  . ARG A 1 534 ? 20.80823  -1.31157  -4.90678  1.000 64.07372  ? 534 ARG A NE  1 
ATOM   4155 C CZ  . ARG A 1 534 ? 20.81049  -2.61561  -4.63142  1.000 64.80994  ? 534 ARG A CZ  1 
ATOM   4156 N NH1 . ARG A 1 534 ? 21.50459  -3.45326  -5.39763  1.000 70.32921  ? 534 ARG A NH1 1 
ATOM   4157 N NH2 . ARG A 1 534 ? 20.13366  -3.08216  -3.58704  1.000 51.23941  ? 534 ARG A NH2 1 
ATOM   4158 N N   . PHE A 1 535 ? 25.34184  2.23969   -8.41463  1.000 53.19302  ? 535 PHE A N   1 
ATOM   4159 C CA  . PHE A 1 535 ? 25.99084  2.58652   -9.67420  1.000 46.91192  ? 535 PHE A CA  1 
ATOM   4160 C C   . PHE A 1 535 ? 27.30932  3.31342   -9.44829  1.000 51.49579  ? 535 PHE A C   1 
ATOM   4161 O O   . PHE A 1 535 ? 28.31859  2.98260   -10.07553 1.000 59.34455  ? 535 PHE A O   1 
ATOM   4162 C CB  . PHE A 1 535 ? 25.07431  3.43485   -10.53478 1.000 43.24928  ? 535 PHE A CB  1 
ATOM   4163 C CG  . PHE A 1 535 ? 25.71112  3.87567   -11.81384 1.000 47.61531  ? 535 PHE A CG  1 
ATOM   4164 C CD1 . PHE A 1 535 ? 26.05482  5.20265   -12.01530 1.000 58.70055  ? 535 PHE A CD1 1 
ATOM   4165 C CD2 . PHE A 1 535 ? 25.98373  2.96180   -12.81580 1.000 45.65476  ? 535 PHE A CD2 1 
ATOM   4166 C CE1 . PHE A 1 535 ? 26.64883  5.61217   -13.21181 1.000 58.13043  ? 535 PHE A CE1 1 
ATOM   4167 C CE2 . PHE A 1 535 ? 26.58033  3.36357   -13.98887 1.000 46.24945  ? 535 PHE A CE2 1 
ATOM   4168 C CZ  . PHE A 1 535 ? 26.91205  4.69259   -14.18465 1.000 46.84096  ? 535 PHE A CZ  1 
ATOM   4169 N N   . LEU A 1 536 ? 27.32521  4.31089   -8.56550  1.000 51.00299  ? 536 LEU A N   1 
ATOM   4170 C CA  . LEU A 1 536 ? 28.52999  5.12587   -8.41337  1.000 53.71733  ? 536 LEU A CA  1 
ATOM   4171 C C   . LEU A 1 536 ? 29.78136  4.34489   -8.03070  1.000 60.70558  ? 536 LEU A C   1 
ATOM   4172 O O   . LEU A 1 536 ? 30.84709  4.63697   -8.60495  1.000 65.53027  ? 536 LEU A O   1 
ATOM   4173 C CB  . LEU A 1 536 ? 28.27984  6.24880   -7.41059  1.000 53.06794  ? 536 LEU A CB  1 
ATOM   4174 C CG  . LEU A 1 536 ? 28.14548  7.54906   -8.18749  1.000 64.73702  ? 536 LEU A CG  1 
ATOM   4175 C CD1 . LEU A 1 536 ? 27.63913  8.66965   -7.32898  1.000 71.68117  ? 536 LEU A CD1 1 
ATOM   4176 C CD2 . LEU A 1 536 ? 29.50523  7.89421   -8.74231  1.000 71.07998  ? 536 LEU A CD2 1 
ATOM   4177 N N   . PRO A 1 537 ? 29.74855  3.37697   -7.10156  1.000 57.70230  ? 537 PRO A N   1 
ATOM   4178 C CA  . PRO A 1 537 ? 30.94897  2.54816   -6.89215  1.000 61.16724  ? 537 PRO A CA  1 
ATOM   4179 C C   . PRO A 1 537 ? 31.45110  1.88170   -8.16390  1.000 67.91032  ? 537 PRO A C   1 
ATOM   4180 O O   . PRO A 1 537 ? 32.66782  1.84138   -8.38705  1.000 77.03117  ? 537 PRO A O   1 
ATOM   4181 C CB  . PRO A 1 537 ? 30.48876  1.51583   -5.85546  1.000 50.97049  ? 537 PRO A CB  1 
ATOM   4182 C CG  . PRO A 1 537 ? 29.38055  2.15133   -5.15857  1.000 49.19144  ? 537 PRO A CG  1 
ATOM   4183 C CD  . PRO A 1 537 ? 28.67751  3.01951   -6.15531  1.000 49.95288  ? 537 PRO A CD  1 
ATOM   4184 N N   . LYS A 1 538 ? 30.55104  1.37263   -9.01328  1.000 62.53549  ? 538 LYS A N   1 
ATOM   4185 C CA  . LYS A 1 538 ? 30.98374  0.70839   -10.24091 1.000 62.55635  ? 538 LYS A CA  1 
ATOM   4186 C C   . LYS A 1 538 ? 31.55704  1.68355   -11.26776 1.000 59.68150  ? 538 LYS A C   1 
ATOM   4187 O O   . LYS A 1 538 ? 32.30981  1.26066   -12.14711 1.000 54.64090  ? 538 LYS A O   1 
ATOM   4188 C CB  . LYS A 1 538 ? 29.82661  -0.08565  -10.85713 1.000 60.24537  ? 538 LYS A CB  1 
ATOM   4189 C CG  . LYS A 1 538 ? 29.33582  -1.24035  -9.98881  1.000 67.56929  ? 538 LYS A CG  1 
ATOM   4190 C CD  . LYS A 1 538 ? 28.70577  -2.35111  -10.83034 1.000 76.09886  ? 538 LYS A CD  1 
ATOM   4191 C CE  . LYS A 1 538 ? 28.60239  -3.65183  -10.02588 1.000 79.51733  ? 538 LYS A CE  1 
ATOM   4192 N NZ  . LYS A 1 538 ? 29.30001  -4.80485  -10.67995 1.000 78.86042  ? 538 LYS A NZ  1 
ATOM   4193 N N   . LEU A 1 539 ? 31.25002  2.97546   -11.16602 1.000 66.92176  ? 539 LEU A N   1 
ATOM   4194 C CA  . LEU A 1 539 ? 31.72688  3.93547   -12.15562 1.000 68.08525  ? 539 LEU A CA  1 
ATOM   4195 C C   . LEU A 1 539 ? 33.13927  4.42744   -11.85276 1.000 85.15961  ? 539 LEU A C   1 
ATOM   4196 O O   . LEU A 1 539 ? 33.91766  4.66772   -12.78285 1.000 89.50509  ? 539 LEU A O   1 
ATOM   4197 C CB  . LEU A 1 539 ? 30.76247  5.12122   -12.24428 1.000 61.21793  ? 539 LEU A CB  1 
ATOM   4198 C CG  . LEU A 1 539 ? 31.18689  6.29455   -13.12004 1.000 49.79614  ? 539 LEU A CG  1 
ATOM   4199 C CD1 . LEU A 1 539 ? 31.27532  5.85227   -14.56906 1.000 50.53737  ? 539 LEU A CD1 1 
ATOM   4200 C CD2 . LEU A 1 539 ? 30.19493  7.41575   -12.97803 1.000 49.57256  ? 539 LEU A CD2 1 
ATOM   4201 N N   . LEU A 1 540 ? 33.49326  4.59608   -10.57017 1.000 102.45408 ? 540 LEU A N   1 
ATOM   4202 C CA  . LEU A 1 540 ? 34.89742  4.83132   -10.22750 1.000 118.88998 ? 540 LEU A CA  1 
ATOM   4203 C C   . LEU A 1 540 ? 35.69804  3.54118   -10.12267 1.000 122.33540 ? 540 LEU A C   1 
ATOM   4204 O O   . LEU A 1 540 ? 36.91209  3.59811   -9.90986  1.000 123.61764 ? 540 LEU A O   1 
ATOM   4205 C CB  . LEU A 1 540 ? 35.02023  5.66412   -8.93980  1.000 120.14400 ? 540 LEU A CB  1 
ATOM   4206 C CG  . LEU A 1 540 ? 34.03272  6.82527   -8.98975  1.000 119.42234 ? 540 LEU A CG  1 
ATOM   4207 C CD1 . LEU A 1 540 ? 33.88855  7.58738   -7.65802  1.000 117.46551 ? 540 LEU A CD1 1 
ATOM   4208 C CD2 . LEU A 1 540 ? 34.42249  7.73648   -10.15010 1.000 125.39636 ? 540 LEU A CD2 1 
ATOM   4209 N N   . SER A 1 541 ? 35.04282  2.39339   -10.27888 1.000 119.55417 ? 541 SER A N   1 
ATOM   4210 C CA  . SER A 1 541 ? 35.67504  1.11191   -10.56334 1.000 111.87860 ? 541 SER A CA  1 
ATOM   4211 C C   . SER A 1 541 ? 35.94824  0.92960   -12.06112 1.000 110.62210 ? 541 SER A C   1 
ATOM   4212 O O   . SER A 1 541 ? 35.87046  -0.19824  -12.58029 1.000 114.18348 ? 541 SER A O   1 
ATOM   4213 C CB  . SER A 1 541 ? 34.78448  -0.01586  -10.03012 1.000 102.10502 ? 541 SER A CB  1 
ATOM   4214 O OG  . SER A 1 541 ? 35.51300  -1.15624  -9.61771  1.000 96.64051  ? 541 SER A OG  1 
ATOM   4215 N N   . ALA A 1 542 ? 36.24206  2.02300   -12.76728 1.000 101.76603 ? 542 ALA A N   1 
ATOM   4216 C CA  . ALA A 1 542 ? 36.44881  2.02430   -14.21235 1.000 84.95806  ? 542 ALA A CA  1 
ATOM   4217 C C   . ALA A 1 542 ? 36.85081  3.43123   -14.68489 1.000 72.78459  ? 542 ALA A C   1 
ATOM   4218 O O   . ALA A 1 542 ? 37.22003  4.30333   -13.87873 1.000 62.62374  ? 542 ALA A O   1 
ATOM   4219 C CB  . ALA A 1 542 ? 35.18898  1.54855   -14.93113 1.000 54.27698  ? 542 ALA A CB  1 
ATOM   4220 N N   . GLU B 1 4   ? -17.22274 5.75404   -70.03023 1.000 120.49323 ? 4   GLU B N   1 
ATOM   4221 C CA  . GLU B 1 4   ? -15.96476 6.45741   -69.80933 1.000 114.25153 ? 4   GLU B CA  1 
ATOM   4222 C C   . GLU B 1 4   ? -16.14905 7.72922   -68.96797 1.000 109.06061 ? 4   GLU B C   1 
ATOM   4223 O O   . GLU B 1 4   ? -16.52259 8.77470   -69.50051 1.000 114.23071 ? 4   GLU B O   1 
ATOM   4224 C CB  . GLU B 1 4   ? -15.31911 6.79994   -71.15648 1.000 116.98484 ? 4   GLU B CB  1 
ATOM   4225 C CG  . GLU B 1 4   ? -13.88935 7.31416   -71.05361 1.000 117.84905 ? 4   GLU B CG  1 
ATOM   4226 C CD  . GLU B 1 4   ? -12.86836 6.20753   -70.82223 1.000 117.45612 ? 4   GLU B CD  1 
ATOM   4227 O OE1 . GLU B 1 4   ? -13.24677 5.13040   -70.31106 1.000 118.41832 ? 4   GLU B OE1 1 
ATOM   4228 O OE2 . GLU B 1 4   ? -11.67904 6.41351   -71.15461 1.000 112.96885 ? 4   GLU B OE2 1 
ATOM   4229 N N   . ASP B 1 5   ? -15.87021 7.63347   -67.65318 1.000 100.44925 ? 5   ASP B N   1 
ATOM   4230 C CA  . ASP B 1 5   ? -16.03190 8.72382   -66.68692 1.000 91.94532  ? 5   ASP B CA  1 
ATOM   4231 C C   . ASP B 1 5   ? -14.86680 9.70392   -66.76419 1.000 86.18727  ? 5   ASP B C   1 
ATOM   4232 O O   . ASP B 1 5   ? -13.75541 9.37066   -66.33378 1.000 77.14979  ? 5   ASP B O   1 
ATOM   4233 C CB  . ASP B 1 5   ? -16.13049 8.16837   -65.26163 1.000 82.92333  ? 5   ASP B CB  1 
ATOM   4234 C CG  . ASP B 1 5   ? -16.51358 9.22799   -64.23009 1.000 80.77485  ? 5   ASP B CG  1 
ATOM   4235 O OD1 . ASP B 1 5   ? -16.39086 10.44365  -64.51716 1.000 84.06573  ? 5   ASP B OD1 1 
ATOM   4236 O OD2 . ASP B 1 5   ? -16.95191 8.82947   -63.12415 1.000 70.83622  ? 5   ASP B OD2 1 
ATOM   4237 N N   . PRO B 1 6   ? -15.08388 10.92791  -67.25740 1.000 84.84406  ? 6   PRO B N   1 
ATOM   4238 C CA  . PRO B 1 6   ? -13.95706 11.86607  -67.41098 1.000 81.69358  ? 6   PRO B CA  1 
ATOM   4239 C C   . PRO B 1 6   ? -13.26777 12.20981  -66.10682 1.000 76.57147  ? 6   PRO B C   1 
ATOM   4240 O O   . PRO B 1 6   ? -12.11279 12.65233  -66.13515 1.000 81.63103  ? 6   PRO B O   1 
ATOM   4241 C CB  . PRO B 1 6   ? -14.60607 13.10399  -68.04914 1.000 83.06466  ? 6   PRO B CB  1 
ATOM   4242 C CG  . PRO B 1 6   ? -16.06694 12.96703  -67.77346 1.000 84.29556  ? 6   PRO B CG  1 
ATOM   4243 C CD  . PRO B 1 6   ? -16.34821 11.49615  -67.75052 1.000 84.40763  ? 6   PRO B CD  1 
ATOM   4244 N N   . GLN B 1 7   ? -13.92656 12.00876  -64.96496 1.000 71.38003  ? 7   GLN B N   1 
ATOM   4245 C CA  . GLN B 1 7   ? -13.26224 12.22568  -63.68458 1.000 68.38069  ? 7   GLN B CA  1 
ATOM   4246 C C   . GLN B 1 7   ? -12.12560 11.23590  -63.45814 1.000 65.14064  ? 7   GLN B C   1 
ATOM   4247 O O   . GLN B 1 7   ? -11.17660 11.53971  -62.72963 1.000 69.85549  ? 7   GLN B O   1 
ATOM   4248 C CB  . GLN B 1 7   ? -14.27390 12.12889  -62.54584 1.000 72.61545  ? 7   GLN B CB  1 
ATOM   4249 C CG  . GLN B 1 7   ? -15.16957 13.33955  -62.44494 1.000 83.80276  ? 7   GLN B CG  1 
ATOM   4250 C CD  . GLN B 1 7   ? -14.38951 14.58948  -62.12542 1.000 90.92264  ? 7   GLN B CD  1 
ATOM   4251 O OE1 . GLN B 1 7   ? -13.67764 14.64421  -61.12048 1.000 99.31192  ? 7   GLN B OE1 1 
ATOM   4252 N NE2 . GLN B 1 7   ? -14.50708 15.60093  -62.98083 1.000 89.85319  ? 7   GLN B NE2 1 
ATOM   4253 N N   . LEU B 1 8   ? -12.19559 10.05833  -64.06379 1.000 63.36680  ? 8   LEU B N   1 
ATOM   4254 C CA  . LEU B 1 8   ? -11.17607 9.03966   -63.87664 1.000 60.43312  ? 8   LEU B CA  1 
ATOM   4255 C C   . LEU B 1 8   ? -10.09698 9.06837   -64.95035 1.000 63.57591  ? 8   LEU B C   1 
ATOM   4256 O O   . LEU B 1 8   ? -9.16115  8.26353   -64.89112 1.000 65.09395  ? 8   LEU B O   1 
ATOM   4257 C CB  . LEU B 1 8   ? -11.82461 7.65537   -63.81824 1.000 58.82357  ? 8   LEU B CB  1 
ATOM   4258 C CG  . LEU B 1 8   ? -13.09890 7.55804   -62.98283 1.000 57.10446  ? 8   LEU B CG  1 
ATOM   4259 C CD1 . LEU B 1 8   ? -13.48999 6.09252   -62.80451 1.000 55.43444  ? 8   LEU B CD1 1 
ATOM   4260 C CD2 . LEU B 1 8   ? -12.88153 8.23414   -61.62666 1.000 52.39138  ? 8   LEU B CD2 1 
ATOM   4261 N N   . LEU B 1 9   ? -10.18726 9.98298   -65.91018 1.000 61.84624  ? 9   LEU B N   1 
ATOM   4262 C CA  . LEU B 1 9   ? -9.15696  10.15728  -66.92424 1.000 61.19257  ? 9   LEU B CA  1 
ATOM   4263 C C   . LEU B 1 9   ? -8.24899  11.32034  -66.54112 1.000 61.53451  ? 9   LEU B C   1 
ATOM   4264 O O   . LEU B 1 9   ? -8.71481  12.45939  -66.40653 1.000 70.30762  ? 9   LEU B O   1 
ATOM   4265 C CB  . LEU B 1 9   ? -9.78914  10.39162  -68.29204 1.000 66.33243  ? 9   LEU B CB  1 
ATOM   4266 C CG  . LEU B 1 9   ? -9.90433  9.06153   -69.01891 1.000 67.75705  ? 9   LEU B CG  1 
ATOM   4267 C CD1 . LEU B 1 9   ? -10.65851 9.23857   -70.32677 1.000 65.99162  ? 9   LEU B CD1 1 
ATOM   4268 C CD2 . LEU B 1 9   ? -8.49113  8.46933   -69.21336 1.000 55.99168  ? 9   LEU B CD2 1 
ATOM   4269 N N   . VAL B 1 10  ? -6.96080  11.03340  -66.35890 1.000 49.21002  ? 10  VAL B N   1 
ATOM   4270 C CA  . VAL B 1 10  ? -5.96606  12.05631  -66.07230 1.000 48.16003  ? 10  VAL B CA  1 
ATOM   4271 C C   . VAL B 1 10  ? -4.78593  11.89780  -67.01702 1.000 64.57187  ? 10  VAL B C   1 
ATOM   4272 O O   . VAL B 1 10  ? -4.34235  10.77561  -67.28796 1.000 64.08101  ? 10  VAL B O   1 
ATOM   4273 C CB  . VAL B 1 10  ? -5.48376  11.98441  -64.61654 1.000 53.39154  ? 10  VAL B CB  1 
ATOM   4274 C CG1 . VAL B 1 10  ? -4.58556  13.15582  -64.31979 1.000 50.64597  ? 10  VAL B CG1 1 
ATOM   4275 C CG2 . VAL B 1 10  ? -6.66907  11.98165  -63.68572 1.000 57.62953  ? 10  VAL B CG2 1 
ATOM   4276 N N   . ARG B 1 11  ? -4.26522  13.02678  -67.50500 1.000 61.23549  ? 11  ARG B N   1 
ATOM   4277 C CA  . ARG B 1 11  ? -3.07222  13.04361  -68.34575 1.000 63.55317  ? 11  ARG B CA  1 
ATOM   4278 C C   . ARG B 1 11  ? -1.89250  13.56489  -67.52567 1.000 62.37100  ? 11  ARG B C   1 
ATOM   4279 O O   . ARG B 1 11  ? -1.85259  14.74476  -67.15198 1.000 58.34908  ? 11  ARG B O   1 
ATOM   4280 C CB  . ARG B 1 11  ? -3.28217  13.88975  -69.60178 1.000 58.32862  ? 11  ARG B CB  1 
ATOM   4281 C CG  . ARG B 1 11  ? -2.00220  14.08823  -70.41245 1.000 59.13255  ? 11  ARG B CG  1 
ATOM   4282 C CD  . ARG B 1 11  ? -2.24469  14.72860  -71.78830 1.000 75.78083  ? 11  ARG B CD  1 
ATOM   4283 N NE  . ARG B 1 11  ? -2.06997  13.78320  -72.89849 1.000 86.25136  ? 11  ARG B NE  1 
ATOM   4284 C CZ  . ARG B 1 11  ? -0.93342  13.13841  -73.17851 1.000 90.35183  ? 11  ARG B CZ  1 
ATOM   4285 N NH1 . ARG B 1 11  ? 0.15849   13.31620  -72.42361 1.000 86.99473  ? 11  ARG B NH1 1 
ATOM   4286 N NH2 . ARG B 1 11  ? -0.88744  12.30119  -74.21399 1.000 83.35427  ? 11  ARG B NH2 1 
ATOM   4287 N N   . VAL B 1 12  ? -0.93433  12.68484  -67.26228 1.000 59.43917  ? 12  VAL B N   1 
ATOM   4288 C CA  . VAL B 1 12  ? 0.29566   13.05239  -66.59679 1.000 58.92686  ? 12  VAL B CA  1 
ATOM   4289 C C   . VAL B 1 12  ? 1.37839   13.22703  -67.65433 1.000 56.67736  ? 12  VAL B C   1 
ATOM   4290 O O   . VAL B 1 12  ? 1.21178   12.85479  -68.80927 1.000 54.66689  ? 12  VAL B O   1 
ATOM   4291 C CB  . VAL B 1 12  ? 0.71441   12.00369  -65.53672 1.000 49.84739  ? 12  VAL B CB  1 
ATOM   4292 C CG1 . VAL B 1 12  ? -0.28838  11.97955  -64.40812 1.000 39.26073  ? 12  VAL B CG1 1 
ATOM   4293 C CG2 . VAL B 1 12  ? 0.88171   10.62266  -66.16786 1.000 50.49049  ? 12  VAL B CG2 1 
ATOM   4294 N N   . ARG B 1 13  ? 2.52534   13.77207  -67.24502 1.000 54.37179  ? 13  ARG B N   1 
ATOM   4295 C CA  . ARG B 1 13  ? 3.62828   14.01103  -68.16444 1.000 46.55511  ? 13  ARG B CA  1 
ATOM   4296 C C   . ARG B 1 13  ? 4.10388   12.75353  -68.87136 1.000 44.21310  ? 13  ARG B C   1 
ATOM   4297 O O   . ARG B 1 13  ? 4.87260   12.86492  -69.82707 1.000 58.65826  ? 13  ARG B O   1 
ATOM   4298 C CB  . ARG B 1 13  ? 4.80968   14.64005  -67.42495 1.000 53.26491  ? 13  ARG B CB  1 
ATOM   4299 C CG  . ARG B 1 13  ? 4.92422   16.13766  -67.60928 1.000 64.03023  ? 13  ARG B CG  1 
ATOM   4300 C CD  . ARG B 1 13  ? 5.91245   16.74064  -66.62593 1.000 77.43570  ? 13  ARG B CD  1 
ATOM   4301 N NE  . ARG B 1 13  ? 5.51240   18.09373  -66.23320 1.000 92.81581  ? 13  ARG B NE  1 
ATOM   4302 C CZ  . ARG B 1 13  ? 6.33359   19.00984  -65.71747 1.000 93.90151  ? 13  ARG B CZ  1 
ATOM   4303 N NH1 . ARG B 1 13  ? 7.62002   18.72396  -65.52690 1.000 92.26362  ? 13  ARG B NH1 1 
ATOM   4304 N NH2 . ARG B 1 13  ? 5.86709   20.21499  -65.39005 1.000 90.89491  ? 13  ARG B NH2 1 
ATOM   4305 N N   . GLY B 1 14  ? 3.66912   11.57471  -68.45418 1.000 43.87986  ? 14  GLY B N   1 
ATOM   4306 C CA  . GLY B 1 14  ? 4.18464   10.35291  -69.03958 1.000 44.36554  ? 14  GLY B CA  1 
ATOM   4307 C C   . GLY B 1 14  ? 3.16613   9.62228   -69.88082 1.000 48.42425  ? 14  GLY B C   1 
ATOM   4308 O O   . GLY B 1 14  ? 3.47292   8.59966   -70.49386 1.000 61.83516  ? 14  GLY B O   1 
ATOM   4309 N N   . GLY B 1 15  ? 1.95528   10.14098  -69.91532 1.000 48.06777  ? 15  GLY B N   1 
ATOM   4310 C CA  . GLY B 1 15  ? 0.88739   9.56500   -70.69929 1.000 53.51879  ? 15  GLY B CA  1 
ATOM   4311 C C   . GLY B 1 15  ? -0.43439  9.75423   -69.98664 1.000 52.71829  ? 15  GLY B C   1 
ATOM   4312 O O   . GLY B 1 15  ? -0.57848  10.65069  -69.15776 1.000 56.46868  ? 15  GLY B O   1 
ATOM   4313 N N   . GLN B 1 16  ? -1.38637  8.88005   -70.30591 1.000 46.50621  ? 16  GLN B N   1 
ATOM   4314 C CA  . GLN B 1 16  ? -2.71689  8.94974   -69.72178 1.000 52.40752  ? 16  GLN B CA  1 
ATOM   4315 C C   . GLN B 1 16  ? -3.01853  7.74644   -68.82737 1.000 53.50092  ? 16  GLN B C   1 
ATOM   4316 O O   . GLN B 1 16  ? -2.59360  6.61942   -69.10013 1.000 55.78507  ? 16  GLN B O   1 
ATOM   4317 C CB  . GLN B 1 16  ? -3.77398  9.09405   -70.81497 1.000 50.98721  ? 16  GLN B CB  1 
ATOM   4318 C CG  . GLN B 1 16  ? -3.85694  10.52296  -71.30501 1.000 65.00243  ? 16  GLN B CG  1 
ATOM   4319 C CD  . GLN B 1 16  ? -5.21736  10.87822  -71.87775 1.000 80.15140  ? 16  GLN B CD  1 
ATOM   4320 O OE1 . GLN B 1 16  ? -5.91993  11.74591  -71.34207 1.000 83.57276  ? 16  GLN B OE1 1 
ATOM   4321 N NE2 . GLN B 1 16  ? -5.58564  10.23413  -72.99146 1.000 83.47829  ? 16  GLN B NE2 1 
ATOM   4322 N N   . LEU B 1 17  ? -3.75543  8.01245   -67.74357 1.000 44.15200  ? 17  LEU B N   1 
ATOM   4323 C CA  . LEU B 1 17  ? -4.13149  7.02836   -66.73882 1.000 43.91549  ? 17  LEU B CA  1 
ATOM   4324 C C   . LEU B 1 17  ? -5.64420  6.91552   -66.64731 1.000 46.51162  ? 17  LEU B C   1 
ATOM   4325 O O   . LEU B 1 17  ? -6.36531  7.87743   -66.92290 1.000 56.87041  ? 17  LEU B O   1 
ATOM   4326 C CB  . LEU B 1 17  ? -3.61076  7.43256   -65.35371 1.000 49.09941  ? 17  LEU B CB  1 
ATOM   4327 C CG  . LEU B 1 17  ? -2.14783  7.83771   -65.33141 1.000 52.14362  ? 17  LEU B CG  1 
ATOM   4328 C CD1 . LEU B 1 17  ? -1.91355  8.86549   -64.28006 1.000 40.71511  ? 17  LEU B CD1 1 
ATOM   4329 C CD2 . LEU B 1 17  ? -1.30057  6.60932   -65.07567 1.000 58.97472  ? 17  LEU B CD2 1 
ATOM   4330 N N   . ARG B 1 18  ? -6.12069  5.74624   -66.21981 1.000 45.42987  ? 18  ARG B N   1 
ATOM   4331 C CA  . ARG B 1 18  ? -7.49921  5.58253   -65.76293 1.000 52.86580  ? 18  ARG B CA  1 
ATOM   4332 C C   . ARG B 1 18  ? -7.50482  5.16808   -64.29606 1.000 54.02137  ? 18  ARG B C   1 
ATOM   4333 O O   . ARG B 1 18  ? -6.92508  4.13705   -63.93128 1.000 51.14372  ? 18  ARG B O   1 
ATOM   4334 C CB  . ARG B 1 18  ? -8.27138  4.55962   -66.59946 1.000 50.09364  ? 18  ARG B CB  1 
ATOM   4335 C CG  . ARG B 1 18  ? -9.78142  4.80170   -66.54445 1.000 60.93612  ? 18  ARG B CG  1 
ATOM   4336 C CD  . ARG B 1 18  ? -10.57765 3.81763   -67.38895 1.000 71.59743  ? 18  ARG B CD  1 
ATOM   4337 N NE  . ARG B 1 18  ? -9.74067  3.16299   -68.38973 1.000 80.75626  ? 18  ARG B NE  1 
ATOM   4338 C CZ  . ARG B 1 18  ? -9.69150  3.50214   -69.67476 1.000 91.01284  ? 18  ARG B CZ  1 
ATOM   4339 N NH1 . ARG B 1 18  ? -10.44803 4.48961   -70.14188 1.000 98.50163  ? 18  ARG B NH1 1 
ATOM   4340 N NH2 . ARG B 1 18  ? -8.88203  2.84642   -70.49704 1.000 92.16453  ? 18  ARG B NH2 1 
ATOM   4341 N N   . GLY B 1 19  ? -8.15982  5.97046   -63.45894 1.000 51.74735  ? 19  GLY B N   1 
ATOM   4342 C CA  . GLY B 1 19  ? -8.41185  5.60399   -62.08523 1.000 44.78845  ? 19  GLY B CA  1 
ATOM   4343 C C   . GLY B 1 19  ? -9.70323  4.82572   -61.93209 1.000 50.35285  ? 19  GLY B C   1 
ATOM   4344 O O   . GLY B 1 19  ? -10.31597 4.35807   -62.89549 1.000 54.65018  ? 19  GLY B O   1 
ATOM   4345 N N   . ILE B 1 20  ? -10.12488 4.69586   -60.68178 1.000 49.13039  ? 20  ILE B N   1 
ATOM   4346 C CA  . ILE B 1 20  ? -11.31579 3.93065   -60.35255 1.000 56.75577  ? 20  ILE B CA  1 
ATOM   4347 C C   . ILE B 1 20  ? -12.09503 4.71430   -59.30941 1.000 58.42544  ? 20  ILE B C   1 
ATOM   4348 O O   . ILE B 1 20  ? -11.51403 5.44690   -58.50735 1.000 68.41335  ? 20  ILE B O   1 
ATOM   4349 C CB  . ILE B 1 20  ? -10.93169 2.51550   -59.86620 1.000 53.66492  ? 20  ILE B CB  1 
ATOM   4350 C CG1 . ILE B 1 20  ? -12.15244 1.72457   -59.41241 1.000 50.66044  ? 20  ILE B CG1 1 
ATOM   4351 C CG2 . ILE B 1 20  ? -9.90334  2.60758   -58.76846 1.000 48.31854  ? 20  ILE B CG2 1 
ATOM   4352 C CD1 . ILE B 1 20  ? -12.04554 0.25046   -59.70812 1.000 52.41737  ? 20  ILE B CD1 1 
ATOM   4353 N N   . ARG B 1 21  ? -13.42061 4.60173   -59.35574 1.000 60.30356  ? 21  ARG B N   1 
ATOM   4354 C CA  . ARG B 1 21  ? -14.28950 5.23739   -58.37170 1.000 62.82649  ? 21  ARG B CA  1 
ATOM   4355 C C   . ARG B 1 21  ? -14.58680 4.23938   -57.26191 1.000 63.85377  ? 21  ARG B C   1 
ATOM   4356 O O   . ARG B 1 21  ? -15.16435 3.17154   -57.51490 1.000 63.16162  ? 21  ARG B O   1 
ATOM   4357 C CB  . ARG B 1 21  ? -15.58917 5.72981   -59.01012 1.000 69.08556  ? 21  ARG B CB  1 
ATOM   4358 C CG  . ARG B 1 21  ? -16.69475 6.03798   -58.00780 1.000 68.64123  ? 21  ARG B CG  1 
ATOM   4359 C CD  . ARG B 1 21  ? -17.97376 6.44273   -58.71077 1.000 75.36488  ? 21  ARG B CD  1 
ATOM   4360 N NE  . ARG B 1 21  ? -19.02688 5.44667   -58.62929 1.000 86.44905  ? 21  ARG B NE  1 
ATOM   4361 C CZ  . ARG B 1 21  ? -20.07074 5.54133   -57.81431 1.000 99.03700  ? 21  ARG B CZ  1 
ATOM   4362 N NH1 . ARG B 1 21  ? -20.18644 6.59173   -57.00382 1.000 95.18516  ? 21  ARG B NH1 1 
ATOM   4363 N NH2 . ARG B 1 21  ? -20.99866 4.58668   -57.81051 1.000 107.88220 ? 21  ARG B NH2 1 
ATOM   4364 N N   . LEU B 1 22  ? -14.18356 4.58355   -56.04070 1.000 62.86297  ? 22  LEU B N   1 
ATOM   4365 C CA  . LEU B 1 22  ? -14.40395 3.74506   -54.87661 1.000 58.21470  ? 22  LEU B CA  1 
ATOM   4366 C C   . LEU B 1 22  ? -15.44523 4.38208   -53.98017 1.000 63.49832  ? 22  LEU B C   1 
ATOM   4367 O O   . LEU B 1 22  ? -15.60336 5.60597   -53.97650 1.000 63.70914  ? 22  LEU B O   1 
ATOM   4368 C CB  . LEU B 1 22  ? -13.12636 3.54268   -54.07432 1.000 51.79119  ? 22  LEU B CB  1 
ATOM   4369 C CG  . LEU B 1 22  ? -11.83528 3.13190   -54.76535 1.000 55.38096  ? 22  LEU B CG  1 
ATOM   4370 C CD1 . LEU B 1 22  ? -10.69526 3.57835   -53.87831 1.000 63.14816  ? 22  LEU B CD1 1 
ATOM   4371 C CD2 . LEU B 1 22  ? -11.79173 1.63601   -54.98463 1.000 54.13288  ? 22  LEU B CD2 1 
ATOM   4372 N N   . LYS B 1 23  ? -16.14465 3.53433   -53.21602 1.000 69.65415  ? 23  LYS B N   1 
ATOM   4373 C CA  . LYS B 1 23  ? -17.05739 3.98174   -52.16582 1.000 67.75886  ? 23  LYS B CA  1 
ATOM   4374 C C   . LYS B 1 23  ? -16.29914 4.07486   -50.84594 1.000 64.66150  ? 23  LYS B C   1 
ATOM   4375 O O   . LYS B 1 23  ? -15.69058 3.09567   -50.39799 1.000 63.94367  ? 23  LYS B O   1 
ATOM   4376 C CB  . LYS B 1 23  ? -18.25478 3.03881   -52.02387 1.000 60.69884  ? 23  LYS B CB  1 
ATOM   4377 N N   . ALA B 1 24  ? -16.30796 5.25451   -50.25549 1.000 66.72769  ? 24  ALA B N   1 
ATOM   4378 C CA  . ALA B 1 24  ? -15.99881 5.54729   -48.86599 1.000 53.85290  ? 24  ALA B CA  1 
ATOM   4379 C C   . ALA B 1 24  ? -17.30748 5.81194   -48.12753 1.000 66.90520  ? 24  ALA B C   1 
ATOM   4380 O O   . ALA B 1 24  ? -18.33723 6.03502   -48.76696 1.000 65.96130  ? 24  ALA B O   1 
ATOM   4381 C CB  . ALA B 1 24  ? -15.06187 6.75720   -48.78991 1.000 51.50702  ? 24  ALA B CB  1 
ATOM   4382 N N   . PRO B 1 25  ? -17.34005 5.78961   -46.78420 1.000 70.25928  ? 25  PRO B N   1 
ATOM   4383 C CA  . PRO B 1 25  ? -18.65729 5.72446   -46.12134 1.000 65.20077  ? 25  PRO B CA  1 
ATOM   4384 C C   . PRO B 1 25  ? -19.57719 6.87431   -46.48911 1.000 67.94796  ? 25  PRO B C   1 
ATOM   4385 O O   . PRO B 1 25  ? -20.78423 6.66966   -46.68698 1.000 69.86638  ? 25  PRO B O   1 
ATOM   4386 C CB  . PRO B 1 25  ? -18.30314 5.73980   -44.62993 1.000 61.71669  ? 25  PRO B CB  1 
ATOM   4387 C CG  . PRO B 1 25  ? -16.85230 5.48096   -44.55998 1.000 64.84473  ? 25  PRO B CG  1 
ATOM   4388 C CD  . PRO B 1 25  ? -16.27159 6.03026   -45.79726 1.000 64.84057  ? 25  PRO B CD  1 
ATOM   4389 N N   . GLY B 1 26  ? -19.02937 8.07680   -46.62184 1.000 69.62462  ? 26  GLY B N   1 
ATOM   4390 C CA  . GLY B 1 26  ? -19.81849 9.26065   -46.87316 1.000 74.66296  ? 26  GLY B CA  1 
ATOM   4391 C C   . GLY B 1 26  ? -19.84091 9.74770   -48.30042 1.000 68.70968  ? 26  GLY B C   1 
ATOM   4392 O O   . GLY B 1 26  ? -20.45011 10.78867  -48.57090 1.000 64.93163  ? 26  GLY B O   1 
ATOM   4393 N N   . GLY B 1 27  ? -19.19487 9.03624   -49.22222 1.000 64.12244  ? 27  GLY B N   1 
ATOM   4394 C CA  . GLY B 1 27  ? -19.23015 9.39932   -50.61950 1.000 70.04359  ? 27  GLY B CA  1 
ATOM   4395 C C   . GLY B 1 27  ? -18.19107 8.69283   -51.47025 1.000 69.16540  ? 27  GLY B C   1 
ATOM   4396 O O   . GLY B 1 27  ? -17.47204 7.79357   -51.01982 1.000 70.86315  ? 27  GLY B O   1 
ATOM   4397 N N   . PRO B 1 28  ? -18.10758 9.07910   -52.73483 1.000 66.99416  ? 28  PRO B N   1 
ATOM   4398 C CA  . PRO B 1 28  ? -17.10192 8.48938   -53.61977 1.000 60.91564  ? 28  PRO B CA  1 
ATOM   4399 C C   . PRO B 1 28  ? -15.75176 9.18542   -53.50858 1.000 55.37126  ? 28  PRO B C   1 
ATOM   4400 O O   . PRO B 1 28  ? -15.63277 10.30936  -53.01115 1.000 54.61972  ? 28  PRO B O   1 
ATOM   4401 C CB  . PRO B 1 28  ? -17.71206 8.67426   -55.01370 1.000 62.31414  ? 28  PRO B CB  1 
ATOM   4402 C CG  . PRO B 1 28  ? -18.62694 9.83621   -54.87631 1.000 60.99944  ? 28  PRO B CG  1 
ATOM   4403 C CD  . PRO B 1 28  ? -19.13672 9.83102   -53.47339 1.000 66.88942  ? 28  PRO B CD  1 
ATOM   4404 N N   . VAL B 1 29  ? -14.71992 8.46504   -53.96343 1.000 50.42601  ? 29  VAL B N   1 
ATOM   4405 C CA  . VAL B 1 29  ? -13.36961 8.99881   -54.11516 1.000 53.56657  ? 29  VAL B CA  1 
ATOM   4406 C C   . VAL B 1 29  ? -12.80948 8.52044   -55.44957 1.000 51.94862  ? 29  VAL B C   1 
ATOM   4407 O O   . VAL B 1 29  ? -13.13032 7.42547   -55.92391 1.000 50.76747  ? 29  VAL B O   1 
ATOM   4408 C CB  . VAL B 1 29  ? -12.40539 8.57909   -52.97008 1.000 45.77798  ? 29  VAL B CB  1 
ATOM   4409 C CG1 . VAL B 1 29  ? -12.81323 9.20053   -51.67548 1.000 46.52210  ? 29  VAL B CG1 1 
ATOM   4410 C CG2 . VAL B 1 29  ? -12.32475 7.06260   -52.84599 1.000 53.77861  ? 29  VAL B CG2 1 
ATOM   4411 N N   . SER B 1 30  ? -11.96514 9.35488   -56.05303 1.000 47.22247  ? 30  SER B N   1 
ATOM   4412 C CA  . SER B 1 30  ? -11.15223 8.95573   -57.19459 1.000 47.99002  ? 30  SER B CA  1 
ATOM   4413 C C   . SER B 1 30  ? -9.84084  8.37085   -56.67673 1.000 50.06080  ? 30  SER B C   1 
ATOM   4414 O O   . SER B 1 30  ? -9.09938  9.04023   -55.94603 1.000 63.31573  ? 30  SER B O   1 
ATOM   4415 C CB  . SER B 1 30  ? -10.86554 10.14566  -58.11743 1.000 56.70758  ? 30  SER B CB  1 
ATOM   4416 O OG  . SER B 1 30  ? -12.03473 10.81408  -58.56476 1.000 65.51773  ? 30  SER B OG  1 
ATOM   4417 N N   . ALA B 1 31  ? -9.53659  7.14059   -57.05807 1.000 42.16495  ? 31  ALA B N   1 
ATOM   4418 C CA  . ALA B 1 31  ? -8.25670  6.54666   -56.70446 1.000 46.18745  ? 31  ALA B CA  1 
ATOM   4419 C C   . ALA B 1 31  ? -7.49224  6.17063   -57.96516 1.000 46.51165  ? 31  ALA B C   1 
ATOM   4420 O O   . ALA B 1 31  ? -8.06401  5.63764   -58.91784 1.000 45.07250  ? 31  ALA B O   1 
ATOM   4421 C CB  . ALA B 1 31  ? -8.43440  5.31630   -55.81158 1.000 45.12303  ? 31  ALA B CB  1 
ATOM   4422 N N   . PHE B 1 32  ? -6.19551  6.44495   -57.96038 1.000 47.35995  ? 32  PHE B N   1 
ATOM   4423 C CA  . PHE B 1 32  ? -5.31272  6.09867   -59.06907 1.000 44.69036  ? 32  PHE B CA  1 
ATOM   4424 C C   . PHE B 1 32  ? -4.16882  5.29197   -58.47861 1.000 40.76542  ? 32  PHE B C   1 
ATOM   4425 O O   . PHE B 1 32  ? -3.20564  5.85789   -57.96159 1.000 47.05288  ? 32  PHE B O   1 
ATOM   4426 C CB  . PHE B 1 32  ? -4.81078  7.34212   -59.77912 1.000 46.09871  ? 32  PHE B CB  1 
ATOM   4427 C CG  . PHE B 1 32  ? -5.90764  8.24773   -60.23487 1.000 50.41164  ? 32  PHE B CG  1 
ATOM   4428 C CD1 . PHE B 1 32  ? -6.43152  9.20599   -59.38619 1.000 49.16191  ? 32  PHE B CD1 1 
ATOM   4429 C CD2 . PHE B 1 32  ? -6.41427  8.14231   -61.51510 1.000 53.38149  ? 32  PHE B CD2 1 
ATOM   4430 C CE1 . PHE B 1 32  ? -7.44047  10.04087  -59.80649 1.000 47.92812  ? 32  PHE B CE1 1 
ATOM   4431 C CE2 . PHE B 1 32  ? -7.42314  8.96737   -61.94177 1.000 53.42543  ? 32  PHE B CE2 1 
ATOM   4432 C CZ  . PHE B 1 32  ? -7.93530  9.92320   -61.07816 1.000 53.97214  ? 32  PHE B CZ  1 
ATOM   4433 N N   . LEU B 1 33  ? -4.28115  3.97790   -58.55707 1.000 37.38691  ? 33  LEU B N   1 
ATOM   4434 C CA  . LEU B 1 33  ? -3.35942  3.06778   -57.90543 1.000 40.37025  ? 33  LEU B CA  1 
ATOM   4435 C C   . LEU B 1 33  ? -2.44852  2.38998   -58.92313 1.000 45.14793  ? 33  LEU B C   1 
ATOM   4436 O O   . LEU B 1 33  ? -2.88795  2.01923   -60.01541 1.000 51.18780  ? 33  LEU B O   1 
ATOM   4437 C CB  . LEU B 1 33  ? -4.14789  2.02084   -57.11671 1.000 43.12213  ? 33  LEU B CB  1 
ATOM   4438 C CG  . LEU B 1 33  ? -5.40279  2.56981   -56.43933 1.000 45.63094  ? 33  LEU B CG  1 
ATOM   4439 C CD1 . LEU B 1 33  ? -6.33983  1.43718   -56.07079 1.000 40.56244  ? 33  LEU B CD1 1 
ATOM   4440 C CD2 . LEU B 1 33  ? -5.01554  3.38664   -55.19355 1.000 49.53752  ? 33  LEU B CD2 1 
ATOM   4441 N N   . GLY B 1 34  ? -1.18296  2.21913   -58.55217 1.000 44.06788  ? 34  GLY B N   1 
ATOM   4442 C CA  . GLY B 1 34  ? -0.22960  1.50616   -59.37843 1.000 42.54211  ? 34  GLY B CA  1 
ATOM   4443 C C   . GLY B 1 34  ? 0.47363   2.34142   -60.42078 1.000 40.69567  ? 34  GLY B C   1 
ATOM   4444 O O   . GLY B 1 34  ? 0.94046   1.78924   -61.42133 1.000 47.87990  ? 34  GLY B O   1 
ATOM   4445 N N   . ILE B 1 35  ? 0.55414   3.65258   -60.23143 1.000 37.03746  ? 35  ILE B N   1 
ATOM   4446 C CA  . ILE B 1 35  ? 1.14656   4.54291   -61.22346 1.000 40.24155  ? 35  ILE B CA  1 
ATOM   4447 C C   . ILE B 1 35  ? 2.65385   4.35304   -61.21191 1.000 42.17267  ? 35  ILE B C   1 
ATOM   4448 O O   . ILE B 1 35  ? 3.28021   4.52914   -60.16164 1.000 46.82906  ? 35  ILE B O   1 
ATOM   4449 C CB  . ILE B 1 35  ? 0.80694   6.01355   -60.94193 1.000 41.60319  ? 35  ILE B CB  1 
ATOM   4450 C CG1 . ILE B 1 35  ? -0.69068  6.26889   -61.11818 1.000 37.54121  ? 35  ILE B CG1 1 
ATOM   4451 C CG2 . ILE B 1 35  ? 1.64935   6.92903   -61.83874 1.000 42.59910  ? 35  ILE B CG2 1 
ATOM   4452 C CD1 . ILE B 1 35  ? -1.19567  7.49372   -60.36001 1.000 35.95451  ? 35  ILE B CD1 1 
ATOM   4453 N N   . PRO B 1 36  ? 3.27648   4.02298   -62.33913 1.000 44.63346  ? 36  PRO B N   1 
ATOM   4454 C CA  . PRO B 1 36  ? 4.73796   3.88601   -62.36173 1.000 41.44400  ? 36  PRO B CA  1 
ATOM   4455 C C   . PRO B 1 36  ? 5.40143   5.24868   -62.28470 1.000 44.45853  ? 36  PRO B C   1 
ATOM   4456 O O   . PRO B 1 36  ? 5.04265   6.16448   -63.03092 1.000 53.30785  ? 36  PRO B O   1 
ATOM   4457 C CB  . PRO B 1 36  ? 5.00402   3.21408   -63.70898 1.000 46.28329  ? 36  PRO B CB  1 
ATOM   4458 C CG  . PRO B 1 36  ? 3.87371   3.65357   -64.56887 1.000 48.10723  ? 36  PRO B CG  1 
ATOM   4459 C CD  . PRO B 1 36  ? 2.67312   3.77263   -63.65717 1.000 46.14041  ? 36  PRO B CD  1 
ATOM   4460 N N   . PHE B 1 37  ? 6.36662   5.38988   -61.37367 1.000 33.01815  ? 37  PHE B N   1 
ATOM   4461 C CA  . PHE B 1 37  ? 7.14605   6.61873   -61.31898 1.000 34.77726  ? 37  PHE B CA  1 
ATOM   4462 C C   . PHE B 1 37  ? 8.60639   6.38964   -61.66216 1.000 37.09249  ? 37  PHE B C   1 
ATOM   4463 O O   . PHE B 1 37  ? 9.36818   7.35733   -61.75353 1.000 43.06917  ? 37  PHE B O   1 
ATOM   4464 C CB  . PHE B 1 37  ? 7.01255   7.30770   -59.94258 1.000 47.51750  ? 37  PHE B CB  1 
ATOM   4465 C CG  . PHE B 1 37  ? 7.63591   6.55116   -58.78236 1.000 47.02215  ? 37  PHE B CG  1 
ATOM   4466 C CD1 . PHE B 1 37  ? 8.93241   6.82389   -58.37489 1.000 43.95086  ? 37  PHE B CD1 1 
ATOM   4467 C CD2 . PHE B 1 37  ? 6.90778   5.61050   -58.07101 1.000 43.66799  ? 37  PHE B CD2 1 
ATOM   4468 C CE1 . PHE B 1 37  ? 9.50285   6.14813   -57.30013 1.000 40.91680  ? 37  PHE B CE1 1 
ATOM   4469 C CE2 . PHE B 1 37  ? 7.47803   4.92494   -56.99461 1.000 37.91561  ? 37  PHE B CE2 1 
ATOM   4470 C CZ  . PHE B 1 37  ? 8.77644   5.19392   -56.61394 1.000 34.95648  ? 37  PHE B CZ  1 
ATOM   4471 N N   . ALA B 1 38  ? 9.01144   5.14359   -61.89262 1.000 35.02469  ? 38  ALA B N   1 
ATOM   4472 C CA  . ALA B 1 38  ? 10.39935  4.87252   -62.22873 1.000 42.54394  ? 38  ALA B CA  1 
ATOM   4473 C C   . ALA B 1 38  ? 10.48189  3.62763   -63.09310 1.000 46.51283  ? 38  ALA B C   1 
ATOM   4474 O O   . ALA B 1 38  ? 9.58686   2.77350   -63.06929 1.000 47.52746  ? 38  ALA B O   1 
ATOM   4475 C CB  . ALA B 1 38  ? 11.25886  4.69416   -60.97402 1.000 43.51131  ? 38  ALA B CB  1 
ATOM   4476 N N   . GLU B 1 39  ? 11.57190  3.54753   -63.86410 1.000 42.53946  ? 39  GLU B N   1 
ATOM   4477 C CA  . GLU B 1 39  ? 11.88654  2.33264   -64.60938 1.000 38.93708  ? 39  GLU B CA  1 
ATOM   4478 C C   . GLU B 1 39  ? 12.08818  1.17803   -63.63365 1.000 43.61305  ? 39  GLU B C   1 
ATOM   4479 O O   . GLU B 1 39  ? 12.76959  1.33867   -62.60391 1.000 48.26635  ? 39  GLU B O   1 
ATOM   4480 C CB  . GLU B 1 39  ? 13.15736  2.50515   -65.44751 1.000 33.80438  ? 39  GLU B CB  1 
ATOM   4481 C CG  . GLU B 1 39  ? 13.02425  3.47448   -66.60422 1.000 46.22189  ? 39  GLU B CG  1 
ATOM   4482 C CD  . GLU B 1 39  ? 11.96748  3.07273   -67.62577 1.000 52.42491  ? 39  GLU B CD  1 
ATOM   4483 O OE1 . GLU B 1 39  ? 11.97481  1.91194   -68.11125 1.000 53.17543  ? 39  GLU B OE1 1 
ATOM   4484 O OE2 . GLU B 1 39  ? 11.07617  3.91183   -67.87462 1.000 58.94133  ? 39  GLU B OE2 1 
ATOM   4485 N N   . PRO B 1 40  ? 11.53085  0.01040   -63.92688 1.000 41.81959  ? 40  PRO B N   1 
ATOM   4486 C CA  . PRO B 1 40  ? 11.64933  -1.13816  -63.01717 1.000 49.58832  ? 40  PRO B CA  1 
ATOM   4487 C C   . PRO B 1 40  ? 13.10039  -1.46071  -62.70937 1.000 53.56228  ? 40  PRO B C   1 
ATOM   4488 O O   . PRO B 1 40  ? 13.86019  -1.85341  -63.60750 1.000 44.93341  ? 40  PRO B O   1 
ATOM   4489 C CB  . PRO B 1 40  ? 10.97657  -2.27499  -63.80251 1.000 48.16176  ? 40  PRO B CB  1 
ATOM   4490 C CG  . PRO B 1 40  ? 9.99172   -1.56554  -64.68931 1.000 40.78502  ? 40  PRO B CG  1 
ATOM   4491 C CD  . PRO B 1 40  ? 10.62530  -0.25204  -65.05470 1.000 40.58562  ? 40  PRO B CD  1 
ATOM   4492 N N   . PRO B 1 41  ? 13.51824  -1.35352  -61.40417 1.000 54.73321  ? 41  PRO B N   1 
ATOM   4493 C CA  . PRO B 1 41  ? 14.92459  -1.51956  -61.00828 1.000 53.09492  ? 41  PRO B CA  1 
ATOM   4494 C C   . PRO B 1 41  ? 15.37570  -2.97679  -60.98706 1.000 52.43073  ? 41  PRO B C   1 
ATOM   4495 O O   . PRO B 1 41  ? 15.96206  -3.44253  -60.00940 1.000 47.46398  ? 41  PRO B O   1 
ATOM   4496 C CB  . PRO B 1 41  ? 14.94837  -0.91363  -59.60860 1.000 45.13194  ? 41  PRO B CB  1 
ATOM   4497 C CG  . PRO B 1 41  ? 13.63058  -1.32163  -59.05340 1.000 38.80770  ? 41  PRO B CG  1 
ATOM   4498 C CD  . PRO B 1 41  ? 12.64702  -1.29110  -60.21527 1.000 41.40785  ? 41  PRO B CD  1 
ATOM   4499 N N   . VAL B 1 42  ? 15.11697  -3.69402  -62.07219 1.000 56.76072  ? 42  VAL B N   1 
ATOM   4500 C CA  . VAL B 1 42  ? 15.36393  -5.12221  -62.12597 1.000 58.07662  ? 42  VAL B CA  1 
ATOM   4501 C C   . VAL B 1 42  ? 16.65992  -5.40520  -62.87471 1.000 53.23205  ? 42  VAL B C   1 
ATOM   4502 O O   . VAL B 1 42  ? 17.27237  -4.52382  -63.47189 1.000 43.96746  ? 42  VAL B O   1 
ATOM   4503 C CB  . VAL B 1 42  ? 14.18168  -5.88835  -62.75769 1.000 57.24758  ? 42  VAL B CB  1 
ATOM   4504 C CG1 . VAL B 1 42  ? 13.05464  -6.05459  -61.73481 1.000 55.67182  ? 42  VAL B CG1 1 
ATOM   4505 C CG2 . VAL B 1 42  ? 13.70147  -5.15946  -63.98120 1.000 42.02079  ? 42  VAL B CG2 1 
ATOM   4506 N N   . GLY B 1 43  ? 17.09533  -6.65513  -62.81885 1.000 55.64525  ? 43  GLY B N   1 
ATOM   4507 C CA  . GLY B 1 43  ? 18.28557  -7.08274  -63.51613 1.000 53.52921  ? 43  GLY B CA  1 
ATOM   4508 C C   . GLY B 1 43  ? 19.51863  -6.32312  -63.09202 1.000 60.31140  ? 43  GLY B C   1 
ATOM   4509 O O   . GLY B 1 43  ? 19.95638  -6.40161  -61.93533 1.000 64.86920  ? 43  GLY B O   1 
ATOM   4510 N N   . SER B 1 44  ? 20.08819  -5.58211  -64.03472 1.000 59.77945  ? 44  SER B N   1 
ATOM   4511 C CA  . SER B 1 44  ? 21.33282  -4.87764  -63.79043 1.000 57.65493  ? 44  SER B CA  1 
ATOM   4512 C C   . SER B 1 44  ? 21.10295  -3.53234  -63.13207 1.000 50.05499  ? 44  SER B C   1 
ATOM   4513 O O   . SER B 1 44  ? 22.06565  -2.89736  -62.69266 1.000 57.03416  ? 44  SER B O   1 
ATOM   4514 C CB  . SER B 1 44  ? 22.10607  -4.67565  -65.09679 1.000 51.30154  ? 44  SER B CB  1 
ATOM   4515 O OG  . SER B 1 44  ? 21.79229  -3.40002  -65.63361 1.000 52.59766  ? 44  SER B OG  1 
ATOM   4516 N N   . ARG B 1 45  ? 19.86285  -3.07572  -63.06836 1.000 45.19220  ? 45  ARG B N   1 
ATOM   4517 C CA  . ARG B 1 45  ? 19.55175  -1.85549  -62.34718 1.000 50.41678  ? 45  ARG B CA  1 
ATOM   4518 C C   . ARG B 1 45  ? 19.31639  -2.09935  -60.84796 1.000 54.11920  ? 45  ARG B C   1 
ATOM   4519 O O   . ARG B 1 45  ? 18.89355  -1.18362  -60.13953 1.000 61.07910  ? 45  ARG B O   1 
ATOM   4520 C CB  . ARG B 1 45  ? 18.34722  -1.16581  -62.99701 1.000 40.78996  ? 45  ARG B CB  1 
ATOM   4521 C CG  . ARG B 1 45  ? 18.76407  -0.11228  -64.01454 1.000 48.36050  ? 45  ARG B CG  1 
ATOM   4522 C CD  . ARG B 1 45  ? 19.21219  1.17721   -63.33700 1.000 60.91266  ? 45  ARG B CD  1 
ATOM   4523 N NE  . ARG B 1 45  ? 20.35062  1.81962   -63.99445 1.000 71.92216  ? 45  ARG B NE  1 
ATOM   4524 C CZ  . ARG B 1 45  ? 20.92843  2.94146   -63.56016 1.000 82.38948  ? 45  ARG B CZ  1 
ATOM   4525 N NH1 . ARG B 1 45  ? 20.47123  3.55175   -62.46295 1.000 75.49423  ? 45  ARG B NH1 1 
ATOM   4526 N NH2 . ARG B 1 45  ? 21.96530  3.45548   -64.22276 1.000 86.45334  ? 45  ARG B NH2 1 
ATOM   4527 N N   . ARG B 1 46  ? 19.58234  -3.30718  -60.35893 1.000 45.75478  ? 46  ARG B N   1 
ATOM   4528 C CA  . ARG B 1 46  ? 19.49088  -3.60242  -58.93653 1.000 45.03520  ? 46  ARG B CA  1 
ATOM   4529 C C   . ARG B 1 46  ? 20.57427  -2.85032  -58.16868 1.000 47.65227  ? 46  ARG B C   1 
ATOM   4530 O O   . ARG B 1 46  ? 21.69075  -2.65103  -58.66212 1.000 48.93758  ? 46  ARG B O   1 
ATOM   4531 C CB  . ARG B 1 46  ? 19.62432  -5.11167  -58.70664 1.000 51.52953  ? 46  ARG B CB  1 
ATOM   4532 C CG  . ARG B 1 46  ? 19.71540  -5.55080  -57.27237 1.000 45.69590  ? 46  ARG B CG  1 
ATOM   4533 C CD  . ARG B 1 46  ? 19.91569  -7.06709  -57.13869 1.000 49.53090  ? 46  ARG B CD  1 
ATOM   4534 N NE  . ARG B 1 46  ? 18.68783  -7.86657  -57.22146 1.000 48.98329  ? 46  ARG B NE  1 
ATOM   4535 C CZ  . ARG B 1 46  ? 18.67532  -9.19962  -57.17915 1.000 47.55575  ? 46  ARG B CZ  1 
ATOM   4536 N NH1 . ARG B 1 46  ? 19.81254  -9.86411  -57.05572 1.000 49.27181  ? 46  ARG B NH1 1 
ATOM   4537 N NH2 . ARG B 1 46  ? 17.54077  -9.87728  -57.27134 1.000 47.22676  ? 46  ARG B NH2 1 
ATOM   4538 N N   . PHE B 1 47  ? 20.22866  -2.42358  -56.94861 1.000 50.55258  ? 47  PHE B N   1 
ATOM   4539 C CA  . PHE B 1 47  ? 21.02516  -1.56166  -56.07377 1.000 44.51769  ? 47  PHE B CA  1 
ATOM   4540 C C   . PHE B 1 47  ? 21.31454  -0.17971  -56.66101 1.000 56.72093  ? 47  PHE B C   1 
ATOM   4541 O O   . PHE B 1 47  ? 22.02689  0.60460   -56.01967 1.000 60.56495  ? 47  PHE B O   1 
ATOM   4542 C CB  . PHE B 1 47  ? 22.37904  -2.17392  -55.66448 1.000 47.13744  ? 47  PHE B CB  1 
ATOM   4543 C CG  . PHE B 1 47  ? 22.34322  -3.65389  -55.39457 1.000 52.99939  ? 47  PHE B CG  1 
ATOM   4544 C CD1 . PHE B 1 47  ? 21.59259  -4.16660  -54.34448 1.000 55.63668  ? 47  PHE B CD1 1 
ATOM   4545 C CD2 . PHE B 1 47  ? 23.14436  -4.52101  -56.11967 1.000 56.18939  ? 47  PHE B CD2 1 
ATOM   4546 C CE1 . PHE B 1 47  ? 21.57718  -5.52653  -54.07381 1.000 56.13097  ? 47  PHE B CE1 1 
ATOM   4547 C CE2 . PHE B 1 47  ? 23.14455  -5.88892  -55.84742 1.000 61.86763  ? 47  PHE B CE2 1 
ATOM   4548 C CZ  . PHE B 1 47  ? 22.36126  -6.39011  -54.82694 1.000 60.47244  ? 47  PHE B CZ  1 
ATOM   4549 N N   . MET B 1 48  ? 20.80105  0.15042   -57.84535 1.000 54.22753  ? 48  MET B N   1 
ATOM   4550 C CA  . MET B 1 48  ? 21.13144  1.39040   -58.53177 1.000 50.06126  ? 48  MET B CA  1 
ATOM   4551 C C   . MET B 1 48  ? 20.11508  2.48320   -58.21900 1.000 47.28597  ? 48  MET B C   1 
ATOM   4552 O O   . MET B 1 48  ? 18.97212  2.20032   -57.83584 1.000 41.82621  ? 48  MET B O   1 
ATOM   4553 C CB  . MET B 1 48  ? 21.18549  1.15406   -60.04488 1.000 57.51981  ? 48  MET B CB  1 
ATOM   4554 C CG  . MET B 1 48  ? 22.34410  0.26948   -60.52853 1.000 66.93379  ? 48  MET B CG  1 
ATOM   4555 S SD  . MET B 1 48  ? 23.99727  0.99548   -60.35848 1.000 64.69338  ? 48  MET B SD  1 
ATOM   4556 C CE  . MET B 1 48  ? 23.83969  2.49348   -61.33077 1.000 56.60175  ? 48  MET B CE  1 
ATOM   4557 N N   . PRO B 1 49  ? 20.50240  3.74918   -58.35334 1.000 45.92491  ? 49  PRO B N   1 
ATOM   4558 C CA  . PRO B 1 49  ? 19.52738  4.82564   -58.20887 1.000 45.56490  ? 49  PRO B CA  1 
ATOM   4559 C C   . PRO B 1 49  ? 18.41028  4.67161   -59.23812 1.000 47.19355  ? 49  PRO B C   1 
ATOM   4560 O O   . PRO B 1 49  ? 18.65032  4.20188   -60.36241 1.000 52.38213  ? 49  PRO B O   1 
ATOM   4561 C CB  . PRO B 1 49  ? 20.34974  6.09454   -58.46243 1.000 43.55715  ? 49  PRO B CB  1 
ATOM   4562 C CG  . PRO B 1 49  ? 21.73753  5.70203   -58.13125 1.000 45.11385  ? 49  PRO B CG  1 
ATOM   4563 C CD  . PRO B 1 49  ? 21.87650  4.25813   -58.49589 1.000 45.44723  ? 49  PRO B CD  1 
ATOM   4564 N N   . PRO B 1 50  ? 17.19418  5.05813   -58.87655 1.000 45.61733  ? 50  PRO B N   1 
ATOM   4565 C CA  . PRO B 1 50  ? 16.06301  4.87520   -59.79505 1.000 39.94479  ? 50  PRO B CA  1 
ATOM   4566 C C   . PRO B 1 50  ? 16.14655  5.80616   -60.98573 1.000 45.47255  ? 50  PRO B C   1 
ATOM   4567 O O   . PRO B 1 50  ? 16.68625  6.91186   -60.89832 1.000 50.87883  ? 50  PRO B O   1 
ATOM   4568 C CB  . PRO B 1 50  ? 14.84506  5.21589   -58.92746 1.000 38.48252  ? 50  PRO B CB  1 
ATOM   4569 C CG  . PRO B 1 50  ? 15.38300  6.13023   -57.88760 1.000 47.67688  ? 50  PRO B CG  1 
ATOM   4570 C CD  . PRO B 1 50  ? 16.77124  5.62556   -57.58776 1.000 48.20428  ? 50  PRO B CD  1 
ATOM   4571 N N   . GLU B 1 51  ? 15.57971  5.34273   -62.12687 1.000 41.34234  ? 51  GLU B N   1 
ATOM   4572 C CA  . GLU B 1 51  ? 15.51408  6.27530   -63.23914 1.000 45.37064  ? 51  GLU B CA  1 
ATOM   4573 C C   . GLU B 1 51  ? 14.06950  6.65260   -63.53977 1.000 45.20560  ? 51  GLU B C   1 
ATOM   4574 O O   . GLU B 1 51  ? 13.16265  5.83084   -63.36259 1.000 47.47028  ? 51  GLU B O   1 
ATOM   4575 C CB  . GLU B 1 51  ? 16.16919  5.68173   -64.48891 1.000 46.83059  ? 51  GLU B CB  1 
ATOM   4576 C CG  . GLU B 1 51  ? 17.67392  5.55771   -64.33187 1.000 59.69383  ? 51  GLU B CG  1 
ATOM   4577 C CD  . GLU B 1 51  ? 18.29499  4.57454   -65.30165 1.000 77.02260  ? 51  GLU B CD  1 
ATOM   4578 O OE1 . GLU B 1 51  ? 17.69929  3.49059   -65.51805 1.000 79.81549  ? 51  GLU B OE1 1 
ATOM   4579 O OE2 . GLU B 1 51  ? 19.38452  4.88734   -65.83966 1.000 82.03886  ? 51  GLU B OE2 1 
ATOM   4580 N N   . PRO B 1 52  ? 13.82639  7.88985   -63.96386 1.000 47.34199  ? 52  PRO B N   1 
ATOM   4581 C CA  . PRO B 1 52  ? 12.45927  8.30319   -64.32751 1.000 52.44324  ? 52  PRO B CA  1 
ATOM   4582 C C   . PRO B 1 52  ? 11.82426  7.39043   -65.37252 1.000 46.67892  ? 52  PRO B C   1 
ATOM   4583 O O   . PRO B 1 52  ? 12.47966  6.95328   -66.32174 1.000 51.25632  ? 52  PRO B O   1 
ATOM   4584 C CB  . PRO B 1 52  ? 12.65135  9.72690   -64.87120 1.000 42.29910  ? 52  PRO B CB  1 
ATOM   4585 C CG  . PRO B 1 52  ? 14.15877  9.92416   -65.00805 1.000 44.24028  ? 52  PRO B CG  1 
ATOM   4586 C CD  . PRO B 1 52  ? 14.78334  9.00723   -64.00230 1.000 42.63588  ? 52  PRO B CD  1 
ATOM   4587 N N   . LYS B 1 53  ? 10.52767  7.11941   -65.19592 1.000 41.13920  ? 53  LYS B N   1 
ATOM   4588 C CA  . LYS B 1 53  ? 9.80715   6.20289   -66.07815 1.000 51.21224  ? 53  LYS B CA  1 
ATOM   4589 C C   . LYS B 1 53  ? 9.63127   6.79497   -67.47992 1.000 53.97471  ? 53  LYS B C   1 
ATOM   4590 O O   . LYS B 1 53  ? 9.27387   7.96765   -67.64271 1.000 59.12887  ? 53  LYS B O   1 
ATOM   4591 C CB  . LYS B 1 53  ? 8.43465   5.85041   -65.48722 1.000 40.86501  ? 53  LYS B CB  1 
ATOM   4592 C CG  . LYS B 1 53  ? 7.47724   5.12885   -66.45174 1.000 47.35930  ? 53  LYS B CG  1 
ATOM   4593 C CD  . LYS B 1 53  ? 7.47964   3.60857   -66.21038 1.000 49.75209  ? 53  LYS B CD  1 
ATOM   4594 C CE  . LYS B 1 53  ? 6.71790   2.81253   -67.26679 1.000 49.31584  ? 53  LYS B CE  1 
ATOM   4595 N NZ  . LYS B 1 53  ? 6.83626   3.37766   -68.63868 1.000 44.14345  ? 53  LYS B NZ  1 
ATOM   4596 N N   . ARG B 1 54  ? 9.87631   5.97467   -68.50141 1.000 46.79018  ? 54  ARG B N   1 
ATOM   4597 C CA  . ARG B 1 54  ? 9.66161   6.44333   -69.86005 1.000 56.13045  ? 54  ARG B CA  1 
ATOM   4598 C C   . ARG B 1 54  ? 8.16541   6.61153   -70.13582 1.000 57.90410  ? 54  ARG B C   1 
ATOM   4599 O O   . ARG B 1 54  ? 7.32725   5.94688   -69.51959 1.000 50.63163  ? 54  ARG B O   1 
ATOM   4600 C CB  . ARG B 1 54  ? 10.28354  5.49115   -70.88418 1.000 46.94804  ? 54  ARG B CB  1 
ATOM   4601 C CG  . ARG B 1 54  ? 11.67057  5.02465   -70.53885 1.000 46.95438  ? 54  ARG B CG  1 
ATOM   4602 C CD  . ARG B 1 54  ? 12.14981  3.95980   -71.47604 1.000 48.24710  ? 54  ARG B CD  1 
ATOM   4603 N NE  . ARG B 1 54  ? 11.53216  2.67491   -71.16059 1.000 59.02459  ? 54  ARG B NE  1 
ATOM   4604 C CZ  . ARG B 1 54  ? 10.68517  2.02164   -71.96220 1.000 64.35953  ? 54  ARG B CZ  1 
ATOM   4605 N NH1 . ARG B 1 54  ? 10.17244  0.86146   -71.57386 1.000 61.46654  ? 54  ARG B NH1 1 
ATOM   4606 N NH2 . ARG B 1 54  ? 10.35571  2.51115   -73.16116 1.000 66.26025  ? 54  ARG B NH2 1 
ATOM   4607 N N   . PRO B 1 55  ? 7.80592   7.50740   -71.05264 1.000 60.31091  ? 55  PRO B N   1 
ATOM   4608 C CA  . PRO B 1 55  ? 6.39032   7.69294   -71.38714 1.000 58.80396  ? 55  PRO B CA  1 
ATOM   4609 C C   . PRO B 1 55  ? 5.79653   6.42467   -71.97780 1.000 56.76234  ? 55  PRO B C   1 
ATOM   4610 O O   . PRO B 1 55  ? 6.50566   5.51235   -72.40609 1.000 63.24736  ? 55  PRO B O   1 
ATOM   4611 C CB  . PRO B 1 55  ? 6.41236   8.83268   -72.41207 1.000 59.20602  ? 55  PRO B CB  1 
ATOM   4612 C CG  . PRO B 1 55  ? 7.71541   9.54624   -72.14702 1.000 59.79265  ? 55  PRO B CG  1 
ATOM   4613 C CD  . PRO B 1 55  ? 8.67428   8.47516   -71.74527 1.000 55.69033  ? 55  PRO B CD  1 
ATOM   4614 N N   . TRP B 1 56  ? 4.46810   6.37360   -71.99292 1.000 53.13241  ? 56  TRP B N   1 
ATOM   4615 C CA  . TRP B 1 56  ? 3.74283   5.19490   -72.44119 1.000 49.44604  ? 56  TRP B CA  1 
ATOM   4616 C C   . TRP B 1 56  ? 2.64762   5.57501   -73.43407 1.000 54.97113  ? 56  TRP B C   1 
ATOM   4617 O O   . TRP B 1 56  ? 2.13668   6.70189   -73.43336 1.000 51.20089  ? 56  TRP B O   1 
ATOM   4618 C CB  . TRP B 1 56  ? 3.14179   4.43435   -71.25446 1.000 47.91871  ? 56  TRP B CB  1 
ATOM   4619 C CG  . TRP B 1 56  ? 2.19852   5.25461   -70.42657 1.000 53.60317  ? 56  TRP B CG  1 
ATOM   4620 C CD1 . TRP B 1 56  ? 0.88192   5.50735   -70.69319 1.000 59.61060  ? 56  TRP B CD1 1 
ATOM   4621 C CD2 . TRP B 1 56  ? 2.49242   5.92931   -69.19314 1.000 51.39852  ? 56  TRP B CD2 1 
ATOM   4622 N NE1 . TRP B 1 56  ? 0.34016   6.29837   -69.70453 1.000 59.67835  ? 56  TRP B NE1 1 
ATOM   4623 C CE2 . TRP B 1 56  ? 1.30859   6.56989   -68.77305 1.000 54.95331  ? 56  TRP B CE2 1 
ATOM   4624 C CE3 . TRP B 1 56  ? 3.63959   6.05266   -68.40433 1.000 50.14135  ? 56  TRP B CE3 1 
ATOM   4625 C CZ2 . TRP B 1 56  ? 1.24079   7.31818   -67.59776 1.000 50.72597  ? 56  TRP B CZ2 1 
ATOM   4626 C CZ3 . TRP B 1 56  ? 3.57077   6.79732   -67.23805 1.000 48.64684  ? 56  TRP B CZ3 1 
ATOM   4627 C CH2 . TRP B 1 56  ? 2.38036   7.42086   -66.84688 1.000 48.24482  ? 56  TRP B CH2 1 
ATOM   4628 N N   . SER B 1 57  ? 2.31139   4.60656   -74.28677 1.000 54.75023  ? 57  SER B N   1 
ATOM   4629 C CA  . SER B 1 57  ? 1.24258   4.67448   -75.27095 1.000 57.78476  ? 57  SER B CA  1 
ATOM   4630 C C   . SER B 1 57  ? -0.12469  4.45566   -74.62199 1.000 57.68053  ? 57  SER B C   1 
ATOM   4631 O O   . SER B 1 57  ? -0.23804  3.96626   -73.49123 1.000 58.05123  ? 57  SER B O   1 
ATOM   4632 C CB  . SER B 1 57  ? 1.46636   3.62097   -76.35350 1.000 55.74242  ? 57  SER B CB  1 
ATOM   4633 O OG  . SER B 1 57  ? 0.75201   2.43701   -76.04965 1.000 55.90543  ? 57  SER B OG  1 
ATOM   4634 N N   . GLY B 1 58  ? -1.17111  4.82954   -75.35670 1.000 55.98644  ? 58  GLY B N   1 
ATOM   4635 C CA  . GLY B 1 58  ? -2.53318  4.59709   -74.91439 1.000 56.52606  ? 58  GLY B CA  1 
ATOM   4636 C C   . GLY B 1 58  ? -2.87809  5.12408   -73.53049 1.000 71.44360  ? 58  GLY B C   1 
ATOM   4637 O O   . GLY B 1 58  ? -2.23693  6.04893   -73.01524 1.000 57.31803  ? 58  GLY B O   1 
ATOM   4638 N N   . VAL B 1 59  ? -3.90043  4.54126   -72.91457 1.000 64.25069  ? 59  VAL B N   1 
ATOM   4639 C CA  . VAL B 1 59  ? -4.33694  4.93923   -71.58383 1.000 68.48638  ? 59  VAL B CA  1 
ATOM   4640 C C   . VAL B 1 59  ? -3.98542  3.79759   -70.63753 1.000 65.30430  ? 59  VAL B C   1 
ATOM   4641 O O   . VAL B 1 59  ? -4.51733  2.68325   -70.75397 1.000 60.83072  ? 59  VAL B O   1 
ATOM   4642 C CB  . VAL B 1 59  ? -5.83575  5.26518   -71.53701 1.000 68.90709  ? 59  VAL B CB  1 
ATOM   4643 C CG1 . VAL B 1 59  ? -6.36157  5.18800   -70.08314 1.000 63.09506  ? 59  VAL B CG1 1 
ATOM   4644 C CG2 . VAL B 1 59  ? -6.10719  6.62556   -72.18372 1.000 69.47143  ? 59  VAL B CG2 1 
ATOM   4645 N N   . LEU B 1 60  ? -3.09452  4.08393   -69.69267 1.000 60.77789  ? 60  LEU B N   1 
ATOM   4646 C CA  . LEU B 1 60  ? -2.57090  3.07045   -68.79042 1.000 58.18351  ? 60  LEU B CA  1 
ATOM   4647 C C   . LEU B 1 60  ? -3.54898  2.83264   -67.64367 1.000 55.00810  ? 60  LEU B C   1 
ATOM   4648 O O   . LEU B 1 60  ? -4.08279  3.78103   -67.05563 1.000 54.66931  ? 60  LEU B O   1 
ATOM   4649 C CB  . LEU B 1 60  ? -1.20329  3.50218   -68.26409 1.000 47.06791  ? 60  LEU B CB  1 
ATOM   4650 C CG  . LEU B 1 60  ? -0.66720  2.74693   -67.05870 1.000 47.28803  ? 60  LEU B CG  1 
ATOM   4651 C CD1 . LEU B 1 60  ? -0.02111  1.45752   -67.53619 1.000 46.70476  ? 60  LEU B CD1 1 
ATOM   4652 C CD2 . LEU B 1 60  ? 0.34165   3.60514   -66.33129 1.000 49.14062  ? 60  LEU B CD2 1 
ATOM   4653 N N   . ASP B 1 61  ? -3.79615  1.56158   -67.34711 1.000 48.89968  ? 61  ASP B N   1 
ATOM   4654 C CA  . ASP B 1 61  ? -4.77892  1.17144   -66.34516 1.000 56.01259  ? 61  ASP B CA  1 
ATOM   4655 C C   . ASP B 1 61  ? -4.17564  1.29490   -64.94992 1.000 58.77769  ? 61  ASP B C   1 
ATOM   4656 O O   . ASP B 1 61  ? -3.19867  0.60348   -64.62386 1.000 57.29101  ? 61  ASP B O   1 
ATOM   4657 C CB  . ASP B 1 61  ? -5.24841  -0.25586  -66.60648 1.000 55.03641  ? 61  ASP B CB  1 
ATOM   4658 C CG  . ASP B 1 61  ? -6.31362  -0.70287  -65.64247 1.000 62.98559  ? 61  ASP B CG  1 
ATOM   4659 O OD1 . ASP B 1 61  ? -7.51919  -0.54639  -65.96670 1.000 69.45100  ? 61  ASP B OD1 1 
ATOM   4660 O OD2 . ASP B 1 61  ? -5.93791  -1.21461  -64.56496 1.000 65.68279  ? 61  ASP B OD2 1 
ATOM   4661 N N   . ALA B 1 62  ? -4.75983  2.17567   -64.13374 1.000 55.24142  ? 62  ALA B N   1 
ATOM   4662 C CA  . ALA B 1 62  ? -4.31297  2.47006   -62.77102 1.000 55.65941  ? 62  ALA B CA  1 
ATOM   4663 C C   . ALA B 1 62  ? -5.46348  2.28351   -61.79182 1.000 56.65519  ? 62  ALA B C   1 
ATOM   4664 O O   . ALA B 1 62  ? -5.78571  3.15573   -60.98442 1.000 45.14776  ? 62  ALA B O   1 
ATOM   4665 C CB  . ALA B 1 62  ? -3.75170  3.88453   -62.66395 1.000 43.71267  ? 62  ALA B CB  1 
ATOM   4666 N N   . THR B 1 63  ? -6.11731  1.13150   -61.87592 1.000 62.76419  ? 63  THR B N   1 
ATOM   4667 C CA  . THR B 1 63  ? -7.24067  0.81128   -61.01428 1.000 62.78868  ? 63  THR B CA  1 
ATOM   4668 C C   . THR B 1 63  ? -6.89622  -0.22149  -59.94924 1.000 66.24544  ? 63  THR B C   1 
ATOM   4669 O O   . THR B 1 63  ? -7.76594  -0.57047  -59.14315 1.000 59.30315  ? 63  THR B O   1 
ATOM   4670 C CB  . THR B 1 63  ? -8.41482  0.31556   -61.86380 1.000 62.89046  ? 63  THR B CB  1 
ATOM   4671 O OG1 . THR B 1 63  ? -8.13495  -1.00170  -62.35023 1.000 50.56669  ? 63  THR B OG1 1 
ATOM   4672 C CG2 . THR B 1 63  ? -8.62472  1.24368   -63.02771 1.000 55.08878  ? 63  THR B CG2 1 
ATOM   4673 N N   . THR B 1 64  ? -5.64975  -0.69521  -59.90741 1.000 66.66961  ? 64  THR B N   1 
ATOM   4674 C CA  . THR B 1 64  ? -5.26131  -1.83335  -59.09301 1.000 62.20630  ? 64  THR B CA  1 
ATOM   4675 C C   . THR B 1 64  ? -3.95300  -1.52412  -58.37049 1.000 57.66749  ? 64  THR B C   1 
ATOM   4676 O O   . THR B 1 64  ? -3.15692  -0.69326  -58.81874 1.000 52.72014  ? 64  THR B O   1 
ATOM   4677 C CB  . THR B 1 64  ? -5.13749  -3.09493  -59.98593 1.000 69.71688  ? 64  THR B CB  1 
ATOM   4678 O OG1 . THR B 1 64  ? -5.30052  -4.26754  -59.18679 1.000 84.61788  ? 64  THR B OG1 1 
ATOM   4679 C CG2 . THR B 1 64  ? -3.77952  -3.15113  -60.70996 1.000 66.91053  ? 64  THR B CG2 1 
ATOM   4680 N N   . PHE B 1 65  ? -3.73273  -2.17082  -57.23042 1.000 56.08145  ? 65  PHE B N   1 
ATOM   4681 C CA  . PHE B 1 65  ? -2.48579  -1.94100  -56.51025 1.000 51.69764  ? 65  PHE B CA  1 
ATOM   4682 C C   . PHE B 1 65  ? -1.37759  -2.73068  -57.17730 1.000 53.11646  ? 65  PHE B C   1 
ATOM   4683 O O   . PHE B 1 65  ? -1.55580  -3.90600  -57.51798 1.000 57.14814  ? 65  PHE B O   1 
ATOM   4684 C CB  . PHE B 1 65  ? -2.59267  -2.35807  -55.04338 1.000 50.68775  ? 65  PHE B CB  1 
ATOM   4685 C CG  . PHE B 1 65  ? -3.08761  -1.27741  -54.13489 1.000 51.45245  ? 65  PHE B CG  1 
ATOM   4686 C CD1 . PHE B 1 65  ? -2.39193  -0.08704  -54.00673 1.000 50.28580  ? 65  PHE B CD1 1 
ATOM   4687 C CD2 . PHE B 1 65  ? -4.24620  -1.46350  -53.38630 1.000 52.79799  ? 65  PHE B CD2 1 
ATOM   4688 C CE1 . PHE B 1 65  ? -2.84830  0.90279   -53.15466 1.000 48.36273  ? 65  PHE B CE1 1 
ATOM   4689 C CE2 . PHE B 1 65  ? -4.71214  -0.47964  -52.54392 1.000 40.33046  ? 65  PHE B CE2 1 
ATOM   4690 C CZ  . PHE B 1 65  ? -4.01244  0.70240   -52.42415 1.000 47.58125  ? 65  PHE B CZ  1 
ATOM   4691 N N   . GLN B 1 66  ? -0.22787  -2.09205  -57.35441 1.000 47.09539  ? 66  GLN B N   1 
ATOM   4692 C CA  . GLN B 1 66  ? 0.88283   -2.80281  -57.96521 1.000 52.14521  ? 66  GLN B CA  1 
ATOM   4693 C C   . GLN B 1 66  ? 1.64098   -3.61256  -56.90876 1.000 58.51800  ? 66  GLN B C   1 
ATOM   4694 O O   . GLN B 1 66  ? 1.34324   -3.56385  -55.70935 1.000 65.73005  ? 66  GLN B O   1 
ATOM   4695 C CB  . GLN B 1 66  ? 1.79984   -1.82810  -58.69859 1.000 51.53176  ? 66  GLN B CB  1 
ATOM   4696 C CG  . GLN B 1 66  ? 1.45766   -1.65212  -60.15492 1.000 57.01364  ? 66  GLN B CG  1 
ATOM   4697 C CD  . GLN B 1 66  ? 2.10459   -2.69852  -61.02710 1.000 63.86347  ? 66  GLN B CD  1 
ATOM   4698 O OE1 . GLN B 1 66  ? 2.63265   -3.69952  -60.54089 1.000 66.74720  ? 66  GLN B OE1 1 
ATOM   4699 N NE2 . GLN B 1 66  ? 2.07369   -2.47187  -62.32640 1.000 66.32013  ? 66  GLN B NE2 1 
ATOM   4700 N N   . ASN B 1 67  ? 2.63847   -4.37040  -57.36686 1.000 52.78808  ? 67  ASN B N   1 
ATOM   4701 C CA  . ASN B 1 67  ? 3.33283   -5.32152  -56.50852 1.000 42.01347  ? 67  ASN B CA  1 
ATOM   4702 C C   . ASN B 1 67  ? 4.10613   -4.61671  -55.40333 1.000 54.43721  ? 67  ASN B C   1 
ATOM   4703 O O   . ASN B 1 67  ? 4.53171   -3.46573  -55.54118 1.000 63.22698  ? 67  ASN B O   1 
ATOM   4704 C CB  . ASN B 1 67  ? 4.27642   -6.19951  -57.33973 1.000 47.18238  ? 67  ASN B CB  1 
ATOM   4705 C CG  . ASN B 1 67  ? 3.53552   -7.02495  -58.40390 1.000 52.79116  ? 67  ASN B CG  1 
ATOM   4706 O OD1 . ASN B 1 67  ? 2.56764   -7.70834  -58.07203 1.000 50.95699  ? 67  ASN B OD1 1 
ATOM   4707 N ND2 . ASN B 1 67  ? 4.00745   -6.99047  -59.67041 1.000 52.34233  ? 67  ASN B ND2 1 
ATOM   4708 N N   . VAL B 1 68  ? 4.27566   -5.31957  -54.28268 1.000 53.34371  ? 68  VAL B N   1 
ATOM   4709 C CA  . VAL B 1 68  ? 5.03937   -4.78247  -53.16470 1.000 48.79725  ? 68  VAL B CA  1 
ATOM   4710 C C   . VAL B 1 68  ? 6.50531   -5.12727  -53.38695 1.000 48.41119  ? 68  VAL B C   1 
ATOM   4711 O O   . VAL B 1 68  ? 6.83831   -6.12904  -54.03101 1.000 50.69222  ? 68  VAL B O   1 
ATOM   4712 C CB  . VAL B 1 68  ? 4.51610   -5.30768  -51.80496 1.000 54.50443  ? 68  VAL B CB  1 
ATOM   4713 C CG1 . VAL B 1 68  ? 2.98613   -5.26984  -51.75899 1.000 54.55324  ? 68  VAL B CG1 1 
ATOM   4714 C CG2 . VAL B 1 68  ? 5.02868   -6.68110  -51.51231 1.000 54.44952  ? 68  VAL B CG2 1 
ATOM   4715 N N   . CYS B 1 69  ? 7.39650   -4.27923  -52.87914 1.000 46.96823  ? 69  CYS B N   1 
ATOM   4716 C CA  . CYS B 1 69  ? 8.81348   -4.47783  -53.13545 1.000 46.55276  ? 69  CYS B CA  1 
ATOM   4717 C C   . CYS B 1 69  ? 9.29214   -5.75523  -52.45718 1.000 53.62179  ? 69  CYS B C   1 
ATOM   4718 O O   . CYS B 1 69  ? 8.73931   -6.18727  -51.44004 1.000 54.17476  ? 69  CYS B O   1 
ATOM   4719 C CB  . CYS B 1 69  ? 9.61350   -3.27224  -52.65438 1.000 45.30738  ? 69  CYS B CB  1 
ATOM   4720 S SG  . CYS B 1 69  ? 9.41526   -1.77760  -53.67098 1.000 54.46777  ? 69  CYS B SG  1 
ATOM   4721 N N   . TYR B 1 70  ? 10.31511  -6.38273  -53.03771 1.000 54.22226  ? 70  TYR B N   1 
ATOM   4722 C CA  . TYR B 1 70  ? 10.76828  -7.64723  -52.47536 1.000 48.38682  ? 70  TYR B CA  1 
ATOM   4723 C C   . TYR B 1 70  ? 11.34571  -7.41976  -51.08603 1.000 43.69224  ? 70  TYR B C   1 
ATOM   4724 O O   . TYR B 1 70  ? 12.19415  -6.54066  -50.88423 1.000 39.03729  ? 70  TYR B O   1 
ATOM   4725 C CB  . TYR B 1 70  ? 11.78864  -8.34130  -53.37920 1.000 50.11791  ? 70  TYR B CB  1 
ATOM   4726 C CG  . TYR B 1 70  ? 11.68765  -9.84733  -53.23028 1.000 51.62844  ? 70  TYR B CG  1 
ATOM   4727 C CD1 . TYR B 1 70  ? 10.79473  -10.58334 -53.99788 1.000 49.73509  ? 70  TYR B CD1 1 
ATOM   4728 C CD2 . TYR B 1 70  ? 12.44871  -10.52711 -52.28937 1.000 54.07193  ? 70  TYR B CD2 1 
ATOM   4729 C CE1 . TYR B 1 70  ? 10.67707  -11.95490 -53.84682 1.000 47.59084  ? 70  TYR B CE1 1 
ATOM   4730 C CE2 . TYR B 1 70  ? 12.34043  -11.90695 -52.13790 1.000 54.82085  ? 70  TYR B CE2 1 
ATOM   4731 C CZ  . TYR B 1 70  ? 11.44600  -12.61249 -52.91437 1.000 48.22521  ? 70  TYR B CZ  1 
ATOM   4732 O OH  . TYR B 1 70  ? 11.32899  -13.97718 -52.75807 1.000 47.15658  ? 70  TYR B OH  1 
ATOM   4733 N N   . GLN B 1 71  ? 10.86691  -8.21956  -50.13202 1.000 45.94551  ? 71  GLN B N   1 
ATOM   4734 C CA  . GLN B 1 71  ? 11.12506  -8.00024  -48.71697 1.000 45.14460  ? 71  GLN B CA  1 
ATOM   4735 C C   . GLN B 1 71  ? 10.90992  -9.29098  -47.94323 1.000 42.96255  ? 71  GLN B C   1 
ATOM   4736 O O   . GLN B 1 71  ? 10.22286  -10.20570 -48.39624 1.000 43.53155  ? 71  GLN B O   1 
ATOM   4737 C CB  . GLN B 1 71  ? 10.21580  -6.91110  -48.15443 1.000 44.01282  ? 71  GLN B CB  1 
ATOM   4738 C CG  . GLN B 1 71  ? 8.77110   -7.34419  -47.98223 1.000 42.63088  ? 71  GLN B CG  1 
ATOM   4739 C CD  . GLN B 1 71  ? 7.85797   -6.15392  -47.80537 1.000 49.73934  ? 71  GLN B CD  1 
ATOM   4740 O OE1 . GLN B 1 71  ? 7.13362   -6.03627  -46.80331 1.000 56.15236  ? 71  GLN B OE1 1 
ATOM   4741 N NE2 . GLN B 1 71  ? 7.91169   -5.23433  -48.76923 1.000 44.42726  ? 71  GLN B NE2 1 
ATOM   4742 N N   . TYR B 1 72  ? 11.50313  -9.34164  -46.75761 1.000 48.77023  ? 72  TYR B N   1 
ATOM   4743 C CA  . TYR B 1 72  ? 11.26845  -10.45122 -45.84649 1.000 50.56250  ? 72  TYR B CA  1 
ATOM   4744 C C   . TYR B 1 72  ? 9.81863   -10.44345 -45.36328 1.000 54.12712  ? 72  TYR B C   1 
ATOM   4745 O O   . TYR B 1 72  ? 9.22188   -9.38433  -45.14033 1.000 56.99785  ? 72  TYR B O   1 
ATOM   4746 C CB  . TYR B 1 72  ? 12.23741  -10.34507 -44.67589 1.000 47.68523  ? 72  TYR B CB  1 
ATOM   4747 C CG  . TYR B 1 72  ? 11.97593  -11.27478 -43.52662 1.000 55.08293  ? 72  TYR B CG  1 
ATOM   4748 C CD1 . TYR B 1 72  ? 11.23312  -10.85680 -42.43757 1.000 59.53498  ? 72  TYR B CD1 1 
ATOM   4749 C CD2 . TYR B 1 72  ? 12.50168  -12.55915 -43.50944 1.000 58.00467  ? 72  TYR B CD2 1 
ATOM   4750 C CE1 . TYR B 1 72  ? 11.00159  -11.68938 -41.37350 1.000 65.65634  ? 72  TYR B CE1 1 
ATOM   4751 C CE2 . TYR B 1 72  ? 12.27207  -13.40476 -42.44777 1.000 62.14259  ? 72  TYR B CE2 1 
ATOM   4752 C CZ  . TYR B 1 72  ? 11.52142  -12.96237 -41.37286 1.000 68.17974  ? 72  TYR B CZ  1 
ATOM   4753 O OH  . TYR B 1 72  ? 11.27784  -13.78395 -40.28264 1.000 74.12772  ? 72  TYR B OH  1 
ATOM   4754 N N   . VAL B 1 73  ? 9.24078   -11.63111 -45.21132 1.000 55.84053  ? 73  VAL B N   1 
ATOM   4755 C CA  . VAL B 1 73  ? 7.86412   -11.77745 -44.74685 1.000 53.55171  ? 73  VAL B CA  1 
ATOM   4756 C C   . VAL B 1 73  ? 7.86538   -12.47636 -43.39282 1.000 55.22210  ? 73  VAL B C   1 
ATOM   4757 O O   . VAL B 1 73  ? 8.54030   -13.49894 -43.21083 1.000 59.74657  ? 73  VAL B O   1 
ATOM   4758 C CB  . VAL B 1 73  ? 7.00286   -12.53881 -45.76655 1.000 44.51251  ? 73  VAL B CB  1 
ATOM   4759 C CG1 . VAL B 1 73  ? 5.59383   -12.69773 -45.24821 1.000 44.96014  ? 73  VAL B CG1 1 
ATOM   4760 C CG2 . VAL B 1 73  ? 6.98709   -11.79032 -47.09061 1.000 43.44325  ? 73  VAL B CG2 1 
ATOM   4761 N N   . ASP B 1 74  ? 7.08492   -11.94089 -42.45614 1.000 49.60808  ? 74  ASP B N   1 
ATOM   4762 C CA  . ASP B 1 74  ? 7.13501   -12.39910 -41.08090 1.000 57.39765  ? 74  ASP B CA  1 
ATOM   4763 C C   . ASP B 1 74  ? 6.41429   -13.72862 -40.90552 1.000 61.48954  ? 74  ASP B C   1 
ATOM   4764 O O   . ASP B 1 74  ? 5.40837   -14.01259 -41.56467 1.000 51.36300  ? 74  ASP B O   1 
ATOM   4765 C CB  . ASP B 1 74  ? 6.53136   -11.36573 -40.13837 1.000 65.82493  ? 74  ASP B CB  1 
ATOM   4766 C CG  . ASP B 1 74  ? 6.83626   -11.67647 -38.70931 1.000 66.60944  ? 74  ASP B CG  1 
ATOM   4767 O OD1 . ASP B 1 74  ? 5.89882   -11.98930 -37.93632 1.000 67.56852  ? 74  ASP B OD1 1 
ATOM   4768 O OD2 . ASP B 1 74  ? 8.04164   -11.65362 -38.39150 1.000 66.48809  ? 74  ASP B OD2 1 
ATOM   4769 N N   . THR B 1 75  ? 6.93143   -14.53353 -39.96699 1.000 69.19184  ? 75  THR B N   1 
ATOM   4770 C CA  . THR B 1 75  ? 6.56777   -15.93922 -39.85490 1.000 71.10219  ? 75  THR B CA  1 
ATOM   4771 C C   . THR B 1 75  ? 6.18041   -16.34145 -38.44892 1.000 71.91316  ? 75  THR B C   1 
ATOM   4772 O O   . THR B 1 75  ? 5.73650   -17.47889 -38.24973 1.000 69.75823  ? 75  THR B O   1 
ATOM   4773 C CB  . THR B 1 75  ? 7.73388   -16.83896 -40.30661 1.000 69.81800  ? 75  THR B CB  1 
ATOM   4774 O OG1 . THR B 1 75  ? 8.95786   -16.40592 -39.68076 1.000 69.47608  ? 75  THR B OG1 1 
ATOM   4775 C CG2 . THR B 1 75  ? 7.88381   -16.75542 -41.82161 1.000 51.54781  ? 75  THR B CG2 1 
ATOM   4776 N N   . LEU B 1 76  ? 6.32119   -15.45183 -37.47400 1.000 71.10242  ? 76  LEU B N   1 
ATOM   4777 C CA  . LEU B 1 76  ? 6.34092   -15.91231 -36.09619 1.000 67.19425  ? 76  LEU B CA  1 
ATOM   4778 C C   . LEU B 1 76  ? 4.94173   -16.29044 -35.61514 1.000 71.67529  ? 76  LEU B C   1 
ATOM   4779 O O   . LEU B 1 76  ? 4.76844   -17.32630 -34.96454 1.000 79.60800  ? 76  LEU B O   1 
ATOM   4780 C CB  . LEU B 1 76  ? 7.01460   -14.85651 -35.22120 1.000 60.19135  ? 76  LEU B CB  1 
ATOM   4781 C CG  . LEU B 1 76  ? 7.22192   -15.21589 -33.75975 1.000 66.63195  ? 76  LEU B CG  1 
ATOM   4782 C CD1 . LEU B 1 76  ? 8.72181   -15.18412 -33.40372 1.000 71.17210  ? 76  LEU B CD1 1 
ATOM   4783 C CD2 . LEU B 1 76  ? 6.44810   -14.20400 -32.97541 1.000 62.87970  ? 76  LEU B CD2 1 
ATOM   4784 N N   . TYR B 1 77  ? 3.91951   -15.51213 -35.97091 1.000 70.12032  ? 77  TYR B N   1 
ATOM   4785 C CA  . TYR B 1 77  ? 2.53301   -15.86789 -35.67653 1.000 68.08993  ? 77  TYR B CA  1 
ATOM   4786 C C   . TYR B 1 77  ? 1.78877   -16.01682 -36.99978 1.000 70.20059  ? 77  TYR B C   1 
ATOM   4787 O O   . TYR B 1 77  ? 1.18744   -15.05082 -37.49708 1.000 68.09927  ? 77  TYR B O   1 
ATOM   4788 C CB  . TYR B 1 77  ? 1.87359   -14.83357 -34.76786 1.000 64.11662  ? 77  TYR B CB  1 
ATOM   4789 C CG  . TYR B 1 77  ? 2.48083   -14.75641 -33.37827 1.000 76.45537  ? 77  TYR B CG  1 
ATOM   4790 C CD1 . TYR B 1 77  ? 2.59338   -15.89117 -32.58533 1.000 82.88726  ? 77  TYR B CD1 1 
ATOM   4791 C CD2 . TYR B 1 77  ? 2.84924   -13.53362 -32.81711 1.000 78.99287  ? 77  TYR B CD2 1 
ATOM   4792 C CE1 . TYR B 1 77  ? 3.12193   -15.82558 -31.29824 1.000 85.98900  ? 77  TYR B CE1 1 
ATOM   4793 C CE2 . TYR B 1 77  ? 3.37310   -13.45246 -31.52148 1.000 77.74022  ? 77  TYR B CE2 1 
ATOM   4794 C CZ  . TYR B 1 77  ? 3.51695   -14.60693 -30.77089 1.000 84.91369  ? 77  TYR B CZ  1 
ATOM   4795 O OH  . TYR B 1 77  ? 4.03554   -14.55954 -29.48136 1.000 82.10124  ? 77  TYR B OH  1 
ATOM   4796 N N   . PRO B 1 78  ? 1.82032   -17.20733 -37.60745 1.000 77.96557  ? 78  PRO B N   1 
ATOM   4797 C CA  . PRO B 1 78  ? 1.22295   -17.37342 -38.94557 1.000 78.09801  ? 78  PRO B CA  1 
ATOM   4798 C C   . PRO B 1 78  ? -0.28871  -17.20387 -38.89688 1.000 73.86718  ? 78  PRO B C   1 
ATOM   4799 O O   . PRO B 1 78  ? -0.96506  -17.79554 -38.05206 1.000 68.76577  ? 78  PRO B O   1 
ATOM   4800 C CB  . PRO B 1 78  ? 1.61786   -18.80377 -39.34609 1.000 75.22315  ? 78  PRO B CB  1 
ATOM   4801 C CG  . PRO B 1 78  ? 2.76868   -19.16236 -38.45210 1.000 79.01576  ? 78  PRO B CG  1 
ATOM   4802 C CD  . PRO B 1 78  ? 2.51115   -18.42785 -37.15892 1.000 80.30682  ? 78  PRO B CD  1 
ATOM   4803 N N   . GLY B 1 79  ? -0.80993  -16.37105 -39.80064 1.000 67.40322  ? 79  GLY B N   1 
ATOM   4804 C CA  . GLY B 1 79  ? -2.24181  -16.15339 -39.88247 1.000 63.28344  ? 79  GLY B CA  1 
ATOM   4805 C C   . GLY B 1 79  ? -2.85895  -15.41365 -38.71451 1.000 63.77610  ? 79  GLY B C   1 
ATOM   4806 O O   . GLY B 1 79  ? -4.07945  -15.47422 -38.52984 1.000 59.24630  ? 79  GLY B O   1 
ATOM   4807 N N   . PHE B 1 80  ? -2.05000  -14.71879 -37.91604 1.000 58.61192  ? 80  PHE B N   1 
ATOM   4808 C CA  . PHE B 1 80  ? -2.54408  -13.89877 -36.82229 1.000 56.23015  ? 80  PHE B CA  1 
ATOM   4809 C C   . PHE B 1 80  ? -2.70201  -12.46490 -37.32183 1.000 53.14639  ? 80  PHE B C   1 
ATOM   4810 O O   . PHE B 1 80  ? -1.78172  -11.91468 -37.93717 1.000 57.33019  ? 80  PHE B O   1 
ATOM   4811 C CB  . PHE B 1 80  ? -1.57280  -13.97710 -35.63997 1.000 58.77978  ? 80  PHE B CB  1 
ATOM   4812 C CG  . PHE B 1 80  ? -1.77214  -12.91067 -34.61009 1.000 52.79443  ? 80  PHE B CG  1 
ATOM   4813 C CD1 . PHE B 1 80  ? -0.72386  -12.07335 -34.27434 1.000 51.01303  ? 80  PHE B CD1 1 
ATOM   4814 C CD2 . PHE B 1 80  ? -2.98255  -12.77172 -33.94520 1.000 56.72820  ? 80  PHE B CD2 1 
ATOM   4815 C CE1 . PHE B 1 80  ? -0.88282  -11.08931 -33.31832 1.000 59.60663  ? 80  PHE B CE1 1 
ATOM   4816 C CE2 . PHE B 1 80  ? -3.15327  -11.78692 -32.98157 1.000 53.36533  ? 80  PHE B CE2 1 
ATOM   4817 C CZ  . PHE B 1 80  ? -2.10019  -10.94794 -32.66481 1.000 55.27916  ? 80  PHE B CZ  1 
ATOM   4818 N N   . GLU B 1 81  ? -3.86961  -11.86424 -37.05265 1.000 53.07164  ? 81  GLU B N   1 
ATOM   4819 C CA  . GLU B 1 81  ? -4.20900  -10.56820 -37.64260 1.000 55.01138  ? 81  GLU B CA  1 
ATOM   4820 C C   . GLU B 1 81  ? -3.23181  -9.47910  -37.23430 1.000 54.81913  ? 81  GLU B C   1 
ATOM   4821 O O   . GLU B 1 81  ? -2.94029  -8.58601  -38.03188 1.000 59.21039  ? 81  GLU B O   1 
ATOM   4822 C CB  . GLU B 1 81  ? -5.63234  -10.15505 -37.25891 1.000 69.97725  ? 81  GLU B CB  1 
ATOM   4823 C CG  . GLU B 1 81  ? -6.68829  -11.25200 -37.46275 1.000 94.50120  ? 81  GLU B CG  1 
ATOM   4824 C CD  . GLU B 1 81  ? -7.33471  -11.71589 -36.15035 1.000 105.87889 ? 81  GLU B CD  1 
ATOM   4825 O OE1 . GLU B 1 81  ? -6.72183  -12.53664 -35.42180 1.000 104.55082 ? 81  GLU B OE1 1 
ATOM   4826 O OE2 . GLU B 1 81  ? -8.46027  -11.25646 -35.85118 1.000 109.40995 ? 81  GLU B OE2 1 
ATOM   4827 N N   . GLY B 1 82  ? -2.71056  -9.52968  -36.00827 1.000 54.22514  ? 82  GLY B N   1 
ATOM   4828 C CA  . GLY B 1 82  ? -1.82265  -8.47352  -35.55557 1.000 49.97679  ? 82  GLY B CA  1 
ATOM   4829 C C   . GLY B 1 82  ? -0.52771  -8.37840  -36.33246 1.000 52.05250  ? 82  GLY B C   1 
ATOM   4830 O O   . GLY B 1 82  ? 0.07592   -7.29879  -36.38154 1.000 54.71281  ? 82  GLY B O   1 
ATOM   4831 N N   . THR B 1 83  ? -0.08265  -9.48206  -36.93375 1.000 47.95557  ? 83  THR B N   1 
ATOM   4832 C CA  . THR B 1 83  ? 1.14652   -9.50042  -37.71209 1.000 44.64213  ? 83  THR B CA  1 
ATOM   4833 C C   . THR B 1 83  ? 0.87888   -9.50248  -39.21326 1.000 48.98406  ? 83  THR B C   1 
ATOM   4834 O O   . THR B 1 83  ? 1.54977   -8.78007  -39.96842 1.000 42.69070  ? 83  THR B O   1 
ATOM   4835 C CB  . THR B 1 83  ? 1.98386   -10.72761 -37.34065 1.000 53.27353  ? 83  THR B CB  1 
ATOM   4836 O OG1 . THR B 1 83  ? 1.14258   -11.88484 -37.30765 1.000 61.40652  ? 83  THR B OG1 1 
ATOM   4837 C CG2 . THR B 1 83  ? 2.61022   -10.55013 -35.97208 1.000 46.16529  ? 83  THR B CG2 1 
ATOM   4838 N N   . GLU B 1 84  ? -0.10396  -10.30024 -39.64705 1.000 47.32297  ? 84  GLU B N   1 
ATOM   4839 C CA  . GLU B 1 84  ? -0.47425  -10.34696 -41.05184 1.000 57.54928  ? 84  GLU B CA  1 
ATOM   4840 C C   . GLU B 1 84  ? -0.86612  -8.97100  -41.57192 1.000 65.58524  ? 84  GLU B C   1 
ATOM   4841 O O   . GLU B 1 84  ? -0.66557  -8.67418  -42.75940 1.000 69.31219  ? 84  GLU B O   1 
ATOM   4842 C CB  . GLU B 1 84  ? -1.62277  -11.33476 -41.25520 1.000 67.12508  ? 84  GLU B CB  1 
ATOM   4843 C CG  . GLU B 1 84  ? -1.30451  -12.76965 -40.85562 1.000 76.09945  ? 84  GLU B CG  1 
ATOM   4844 C CD  . GLU B 1 84  ? -0.25608  -13.42447 -41.73870 1.000 80.60457  ? 84  GLU B CD  1 
ATOM   4845 O OE1 . GLU B 1 84  ? -0.13664  -13.04436 -42.93511 1.000 76.94917  ? 84  GLU B OE1 1 
ATOM   4846 O OE2 . GLU B 1 84  ? 0.44170   -14.32890 -41.22147 1.000 80.12823  ? 84  GLU B OE2 1 
ATOM   4847 N N   . MET B 1 85  ? -1.41383  -8.11562  -40.70086 1.000 58.57203  ? 85  MET B N   1 
ATOM   4848 C CA  . MET B 1 85  ? -1.87181  -6.79988  -41.13455 1.000 51.69378  ? 85  MET B CA  1 
ATOM   4849 C C   . MET B 1 85  ? -0.72610  -5.91362  -41.62391 1.000 48.51318  ? 85  MET B C   1 
ATOM   4850 O O   . MET B 1 85  ? -0.97635  -4.94252  -42.35439 1.000 44.34465  ? 85  MET B O   1 
ATOM   4851 C CB  . MET B 1 85  ? -2.62564  -6.11458  -39.99752 1.000 45.03458  ? 85  MET B CB  1 
ATOM   4852 C CG  . MET B 1 85  ? -1.73815  -5.75480  -38.81286 1.000 50.50876  ? 85  MET B CG  1 
ATOM   4853 S SD  . MET B 1 85  ? -2.54901  -4.78819  -37.51848 1.000 57.62901  ? 85  MET B SD  1 
ATOM   4854 C CE  . MET B 1 85  ? -2.66964  -3.16216  -38.26048 1.000 40.47724  ? 85  MET B CE  1 
ATOM   4855 N N   . TRP B 1 86  ? 0.51727   -6.22838  -41.24158 1.000 42.44633  ? 86  TRP B N   1 
ATOM   4856 C CA  . TRP B 1 86  ? 1.70540   -5.54715  -41.74106 1.000 45.95921  ? 86  TRP B CA  1 
ATOM   4857 C C   . TRP B 1 86  ? 2.38094   -6.28262  -42.89354 1.000 51.74588  ? 86  TRP B C   1 
ATOM   4858 O O   . TRP B 1 86  ? 3.29835   -5.72788  -43.50569 1.000 53.76193  ? 86  TRP B O   1 
ATOM   4859 C CB  . TRP B 1 86  ? 2.70481   -5.35432  -40.59742 1.000 47.32469  ? 86  TRP B CB  1 
ATOM   4860 C CG  . TRP B 1 86  ? 2.03626   -4.71551  -39.44776 1.000 56.93594  ? 86  TRP B CG  1 
ATOM   4861 C CD1 . TRP B 1 86  ? 1.62448   -5.31734  -38.28937 1.000 58.43981  ? 86  TRP B CD1 1 
ATOM   4862 C CD2 . TRP B 1 86  ? 1.63303   -3.34612  -39.35460 1.000 53.15289  ? 86  TRP B CD2 1 
ATOM   4863 N NE1 . TRP B 1 86  ? 1.00512   -4.39926  -37.47865 1.000 49.45846  ? 86  TRP B NE1 1 
ATOM   4864 C CE2 . TRP B 1 86  ? 0.99832   -3.18201  -38.10873 1.000 45.35590  ? 86  TRP B CE2 1 
ATOM   4865 C CE3 . TRP B 1 86  ? 1.75935   -2.23916  -40.20083 1.000 49.56093  ? 86  TRP B CE3 1 
ATOM   4866 C CZ2 . TRP B 1 86  ? 0.49939   -1.95552  -37.68531 1.000 45.66545  ? 86  TRP B CZ2 1 
ATOM   4867 C CZ3 . TRP B 1 86  ? 1.25832   -1.02226  -39.78471 1.000 45.40041  ? 86  TRP B CZ3 1 
ATOM   4868 C CH2 . TRP B 1 86  ? 0.63681   -0.88877  -38.53649 1.000 48.99597  ? 86  TRP B CH2 1 
ATOM   4869 N N   . ASN B 1 87  ? 1.94638   -7.50434  -43.19878 1.000 46.71316  ? 87  ASN B N   1 
ATOM   4870 C CA  . ASN B 1 87  ? 2.55907   -8.35090  -44.20425 1.000 45.79087  ? 87  ASN B CA  1 
ATOM   4871 C C   . ASN B 1 87  ? 2.09343   -7.94506  -45.60420 1.000 48.81478  ? 87  ASN B C   1 
ATOM   4872 O O   . ASN B 1 87  ? 1.04096   -7.31760  -45.75794 1.000 52.52706  ? 87  ASN B O   1 
ATOM   4873 C CB  . ASN B 1 87  ? 2.21080   -9.81139  -43.91305 1.000 52.28106  ? 87  ASN B CB  1 
ATOM   4874 C CG  . ASN B 1 87  ? 3.30845   -10.53553 -43.14383 1.000 58.45009  ? 87  ASN B CG  1 
ATOM   4875 O OD1 . ASN B 1 87  ? 4.44244   -10.06139 -43.07649 1.000 65.44250  ? 87  ASN B OD1 1 
ATOM   4876 N ND2 . ASN B 1 87  ? 2.97934   -11.69508 -42.57265 1.000 56.08816  ? 87  ASN B ND2 1 
ATOM   4877 N N   . PRO B 1 88  ? 2.86351   -8.29045  -46.64418 1.000 51.89774  ? 88  PRO B N   1 
ATOM   4878 C CA  . PRO B 1 88  ? 2.49131   -7.88375  -48.00730 1.000 45.68647  ? 88  PRO B CA  1 
ATOM   4879 C C   . PRO B 1 88  ? 1.15082   -8.47384  -48.42738 1.000 50.75168  ? 88  PRO B C   1 
ATOM   4880 O O   . PRO B 1 88  ? 0.87217   -9.65182  -48.18188 1.000 56.55844  ? 88  PRO B O   1 
ATOM   4881 C CB  . PRO B 1 88  ? 3.63684   -8.43442  -48.86787 1.000 40.31263  ? 88  PRO B CB  1 
ATOM   4882 C CG  . PRO B 1 88  ? 4.75227   -8.68971  -47.95450 1.000 40.40956  ? 88  PRO B CG  1 
ATOM   4883 C CD  . PRO B 1 88  ? 4.11593   -9.06843  -46.64302 1.000 54.90985  ? 88  PRO B CD  1 
ATOM   4884 N N   . ASN B 1 89  ? 0.31841   -7.63477  -49.06559 1.000 47.02498  ? 89  ASN B N   1 
ATOM   4885 C CA  . ASN B 1 89  ? -1.01234  -8.02249  -49.52552 1.000 41.50375  ? 89  ASN B CA  1 
ATOM   4886 C C   . ASN B 1 89  ? -1.14191  -8.01491  -51.04746 1.000 59.81709  ? 89  ASN B C   1 
ATOM   4887 O O   . ASN B 1 89  ? -2.26309  -8.09842  -51.56159 1.000 68.46426  ? 89  ASN B O   1 
ATOM   4888 C CB  . ASN B 1 89  ? -2.08967  -7.12613  -48.90366 1.000 40.89431  ? 89  ASN B CB  1 
ATOM   4889 C CG  . ASN B 1 89  ? -1.94249  -5.67986  -49.30653 1.000 46.34289  ? 89  ASN B CG  1 
ATOM   4890 O OD1 . ASN B 1 89  ? -0.90776  -5.28184  -49.82671 1.000 54.05997  ? 89  ASN B OD1 1 
ATOM   4891 N ND2 . ASN B 1 89  ? -2.97655  -4.88160  -49.07189 1.000 43.59318  ? 89  ASN B ND2 1 
ATOM   4892 N N   . ARG B 1 90  ? -0.03187  -7.89923  -51.78014 1.000 52.82775  ? 90  ARG B N   1 
ATOM   4893 C CA  . ARG B 1 90  ? 0.02935   -8.22265  -53.20447 1.000 47.53986  ? 90  ARG B CA  1 
ATOM   4894 C C   . ARG B 1 90  ? 1.26514   -9.08881  -53.45051 1.000 52.08380  ? 90  ARG B C   1 
ATOM   4895 O O   . ARG B 1 90  ? 1.95454   -9.49806  -52.51187 1.000 57.43192  ? 90  ARG B O   1 
ATOM   4896 C CB  . ARG B 1 90  ? 0.01925   -6.96072  -54.08020 1.000 42.05439  ? 90  ARG B CB  1 
ATOM   4897 C CG  . ARG B 1 90  ? -1.20340  -6.05989  -53.86783 1.000 46.19892  ? 90  ARG B CG  1 
ATOM   4898 C CD  . ARG B 1 90  ? -2.37857  -6.36222  -54.84737 1.000 51.20053  ? 90  ARG B CD  1 
ATOM   4899 N NE  . ARG B 1 90  ? -3.58330  -5.60477  -54.49412 1.000 62.12307  ? 90  ARG B NE  1 
ATOM   4900 C CZ  . ARG B 1 90  ? -4.33557  -5.82345  -53.41627 1.000 69.42596  ? 90  ARG B CZ  1 
ATOM   4901 N NH1 . ARG B 1 90  ? -4.03337  -6.80315  -52.57343 1.000 77.38984  ? 90  ARG B NH1 1 
ATOM   4902 N NH2 . ARG B 1 90  ? -5.39846  -5.06117  -53.17869 1.000 67.74645  ? 90  ARG B NH2 1 
ATOM   4903 N N   . GLU B 1 91  ? 1.53406   -9.41477  -54.71182 1.000 54.29276  ? 91  GLU B N   1 
ATOM   4904 C CA  . GLU B 1 91  ? 2.68117   -10.26116 -55.00941 1.000 54.96579  ? 91  GLU B CA  1 
ATOM   4905 C C   . GLU B 1 91  ? 3.97826   -9.51278  -54.72563 1.000 54.28086  ? 91  GLU B C   1 
ATOM   4906 O O   . GLU B 1 91  ? 4.03433   -8.28205  -54.77607 1.000 51.99350  ? 91  GLU B O   1 
ATOM   4907 C CB  . GLU B 1 91  ? 2.64187   -10.72458 -56.46231 1.000 59.87317  ? 91  GLU B CB  1 
ATOM   4908 C CG  . GLU B 1 91  ? 1.61304   -11.81939 -56.72994 1.000 72.40390  ? 91  GLU B CG  1 
ATOM   4909 C CD  . GLU B 1 91  ? 2.10954   -13.19433 -56.31856 1.000 84.47679  ? 91  GLU B CD  1 
ATOM   4910 O OE1 . GLU B 1 91  ? 3.32635   -13.46329 -56.46515 1.000 90.82187  ? 91  GLU B OE1 1 
ATOM   4911 O OE2 . GLU B 1 91  ? 1.28500   -14.00373 -55.84143 1.000 84.82911  ? 91  GLU B OE2 1 
ATOM   4912 N N   . LEU B 1 92  ? 5.01979   -10.26401 -54.38143 1.000 55.99877  ? 92  LEU B N   1 
ATOM   4913 C CA  . LEU B 1 92  ? 6.34700   -9.68916  -54.20328 1.000 48.71350  ? 92  LEU B CA  1 
ATOM   4914 C C   . LEU B 1 92  ? 7.04604   -9.62576  -55.55631 1.000 45.46216  ? 92  LEU B C   1 
ATOM   4915 O O   . LEU B 1 92  ? 7.05525   -10.61167 -56.30074 1.000 46.31425  ? 92  LEU B O   1 
ATOM   4916 C CB  . LEU B 1 92  ? 7.18306   -10.52027 -53.22640 1.000 44.37859  ? 92  LEU B CB  1 
ATOM   4917 C CG  . LEU B 1 92  ? 6.80282   -10.69025 -51.75218 1.000 43.97955  ? 92  LEU B CG  1 
ATOM   4918 C CD1 . LEU B 1 92  ? 7.63221   -11.79471 -51.11545 1.000 45.48439  ? 92  LEU B CD1 1 
ATOM   4919 C CD2 . LEU B 1 92  ? 7.03053   -9.41530  -50.99991 1.000 42.02816  ? 92  LEU B CD2 1 
ATOM   4920 N N   . SER B 1 93  ? 7.63752   -8.47517  -55.86735 1.000 45.21313  ? 93  SER B N   1 
ATOM   4921 C CA  . SER B 1 93  ? 8.41402   -8.30495  -57.09069 1.000 47.53260  ? 93  SER B CA  1 
ATOM   4922 C C   . SER B 1 93  ? 9.49008   -7.25608  -56.84685 1.000 45.42048  ? 93  SER B C   1 
ATOM   4923 O O   . SER B 1 93  ? 9.32243   -6.36204  -56.01365 1.000 55.98007  ? 93  SER B O   1 
ATOM   4924 C CB  . SER B 1 93  ? 7.51547   -7.88916  -58.27207 1.000 51.34588  ? 93  SER B CB  1 
ATOM   4925 O OG  . SER B 1 93  ? 8.25161   -7.67221  -59.46448 1.000 55.13922  ? 93  SER B OG  1 
ATOM   4926 N N   . GLU B 1 94  ? 10.60954  -7.37296  -57.56268 1.000 45.21090  ? 94  GLU B N   1 
ATOM   4927 C CA  . GLU B 1 94  ? 11.52881  -6.23868  -57.59572 1.000 49.28144  ? 94  GLU B CA  1 
ATOM   4928 C C   . GLU B 1 94  ? 10.98667  -5.11847  -58.45948 1.000 47.43692  ? 94  GLU B C   1 
ATOM   4929 O O   . GLU B 1 94  ? 11.40595  -3.96530  -58.30843 1.000 45.56250  ? 94  GLU B O   1 
ATOM   4930 C CB  . GLU B 1 94  ? 12.91141  -6.64252  -58.10684 1.000 44.52298  ? 94  GLU B CB  1 
ATOM   4931 C CG  . GLU B 1 94  ? 13.54836  -7.72036  -57.28484 1.000 50.03724  ? 94  GLU B CG  1 
ATOM   4932 C CD  . GLU B 1 94  ? 14.96686  -8.01825  -57.68882 1.000 52.82714  ? 94  GLU B CD  1 
ATOM   4933 O OE1 . GLU B 1 94  ? 15.83474  -7.13070  -57.52962 1.000 51.88676  ? 94  GLU B OE1 1 
ATOM   4934 O OE2 . GLU B 1 94  ? 15.19240  -9.13778  -58.21488 1.000 59.65741  ? 94  GLU B OE2 1 
ATOM   4935 N N   . ASP B 1 95  ? 10.06685  -5.43238  -59.35891 1.000 46.48785  ? 95  ASP B N   1 
ATOM   4936 C CA  . ASP B 1 95  ? 9.44138   -4.39907  -60.15923 1.000 43.42441  ? 95  ASP B CA  1 
ATOM   4937 C C   . ASP B 1 95  ? 8.28418   -3.86190  -59.34355 1.000 45.00460  ? 95  ASP B C   1 
ATOM   4938 O O   . ASP B 1 95  ? 7.16398   -4.36102  -59.40675 1.000 55.74251  ? 95  ASP B O   1 
ATOM   4939 C CB  . ASP B 1 95  ? 9.03698   -4.94579  -61.52084 1.000 47.78940  ? 95  ASP B CB  1 
ATOM   4940 C CG  . ASP B 1 95  ? 8.18231   -3.98466  -62.29666 1.000 50.08821  ? 95  ASP B CG  1 
ATOM   4941 O OD1 . ASP B 1 95  ? 8.23631   -2.77375  -61.98515 1.000 60.67450  ? 95  ASP B OD1 1 
ATOM   4942 O OD2 . ASP B 1 95  ? 7.58772   -4.41211  -63.30982 1.000 51.84575  ? 95  ASP B OD2 1 
ATOM   4943 N N   . CYS B 1 96  ? 8.57463   -2.81134  -58.56939 1.000 46.31692  ? 96  CYS B N   1 
ATOM   4944 C CA  . CYS B 1 96  ? 7.63983   -2.33973  -57.55031 1.000 46.09726  ? 96  CYS B CA  1 
ATOM   4945 C C   . CYS B 1 96  ? 7.59190   -0.82613  -57.39614 1.000 41.61914  ? 96  CYS B C   1 
ATOM   4946 O O   . CYS B 1 96  ? 6.92252   -0.35145  -56.47303 1.000 36.77574  ? 96  CYS B O   1 
ATOM   4947 C CB  . CYS B 1 96  ? 7.98938   -2.91977  -56.17543 1.000 45.88642  ? 96  CYS B CB  1 
ATOM   4948 S SG  . CYS B 1 96  ? 9.64063   -2.43401  -55.60355 1.000 53.57710  ? 96  CYS B SG  1 
ATOM   4949 N N   . LEU B 1 97  ? 8.26595   -0.05077  -58.24181 1.000 41.15231  ? 97  LEU B N   1 
ATOM   4950 C CA  . LEU B 1 97  ? 8.30213   1.39696   -58.07254 1.000 38.71496  ? 97  LEU B CA  1 
ATOM   4951 C C   . LEU B 1 97  ? 7.05514   2.02375   -58.70170 1.000 47.86687  ? 97  LEU B C   1 
ATOM   4952 O O   . LEU B 1 97  ? 7.03531   2.50217   -59.84330 1.000 57.23193  ? 97  LEU B O   1 
ATOM   4953 C CB  . LEU B 1 97  ? 9.60627   1.95508   -58.61812 1.000 37.91413  ? 97  LEU B CB  1 
ATOM   4954 C CG  . LEU B 1 97  ? 10.77993  1.29471   -57.89417 1.000 37.64506  ? 97  LEU B CG  1 
ATOM   4955 C CD1 . LEU B 1 97  ? 12.12116  1.82160   -58.38183 1.000 38.28032  ? 97  LEU B CD1 1 
ATOM   4956 C CD2 . LEU B 1 97  ? 10.61748  1.49733   -56.38058 1.000 36.09175  ? 97  LEU B CD2 1 
ATOM   4957 N N   . TYR B 1 98  ? 5.98838   2.02826   -57.90374 1.000 43.05396  ? 98  TYR B N   1 
ATOM   4958 C CA  . TYR B 1 98  ? 4.70138   2.58514   -58.29003 1.000 44.90660  ? 98  TYR B CA  1 
ATOM   4959 C C   . TYR B 1 98  ? 4.13580   3.36347   -57.11081 1.000 46.46023  ? 98  TYR B C   1 
ATOM   4960 O O   . TYR B 1 98  ? 4.49210   3.12583   -55.94690 1.000 35.12039  ? 98  TYR B O   1 
ATOM   4961 C CB  . TYR B 1 98  ? 3.71014   1.49826   -58.72867 1.000 38.83630  ? 98  TYR B CB  1 
ATOM   4962 C CG  . TYR B 1 98  ? 4.25852   0.57465   -59.78713 1.000 48.58499  ? 98  TYR B CG  1 
ATOM   4963 C CD1 . TYR B 1 98  ? 4.96530   -0.57026  -59.44752 1.000 51.24496  ? 98  TYR B CD1 1 
ATOM   4964 C CD2 . TYR B 1 98  ? 4.06225   0.83974   -61.13636 1.000 51.24239  ? 98  TYR B CD2 1 
ATOM   4965 C CE1 . TYR B 1 98  ? 5.46784   -1.42414  -60.42821 1.000 53.20209  ? 98  TYR B CE1 1 
ATOM   4966 C CE2 . TYR B 1 98  ? 4.55276   0.00178   -62.10628 1.000 47.30069  ? 98  TYR B CE2 1 
ATOM   4967 C CZ  . TYR B 1 98  ? 5.25242   -1.12834  -61.75734 1.000 50.41285  ? 98  TYR B CZ  1 
ATOM   4968 O OH  . TYR B 1 98  ? 5.73848   -1.95195  -62.74876 1.000 55.42148  ? 98  TYR B OH  1 
ATOM   4969 N N   . LEU B 1 99  ? 3.24465   4.30043   -57.42344 1.000 39.13488  ? 99  LEU B N   1 
ATOM   4970 C CA  . LEU B 1 99  ? 2.63800   5.11853   -56.39398 1.000 43.07651  ? 99  LEU B CA  1 
ATOM   4971 C C   . LEU B 1 99  ? 1.13182   5.16629   -56.58860 1.000 52.07488  ? 99  LEU B C   1 
ATOM   4972 O O   . LEU B 1 99  ? 0.59525   4.77580   -57.62828 1.000 46.81940  ? 99  LEU B O   1 
ATOM   4973 C CB  . LEU B 1 99  ? 3.22883   6.53552   -56.36738 1.000 42.23037  ? 99  LEU B CB  1 
ATOM   4974 C CG  . LEU B 1 99  ? 3.18264   7.48076   -57.56190 1.000 41.41411  ? 99  LEU B CG  1 
ATOM   4975 C CD1 . LEU B 1 99  ? 1.82298   8.13980   -57.72339 1.000 39.27211  ? 99  LEU B CD1 1 
ATOM   4976 C CD2 . LEU B 1 99  ? 4.25022   8.52629   -57.34630 1.000 40.63558  ? 99  LEU B CD2 1 
ATOM   4977 N N   . ASN B 1 100 ? 0.45736   5.66025   -55.55494 1.000 48.95798  ? 100 ASN B N   1 
ATOM   4978 C CA  . ASN B 1 100 ? -0.99102  5.69431   -55.50286 1.000 40.61903  ? 100 ASN B CA  1 
ATOM   4979 C C   . ASN B 1 100 ? -1.42501  7.10469   -55.14053 1.000 44.73173  ? 100 ASN B C   1 
ATOM   4980 O O   . ASN B 1 100 ? -0.82393  7.73711   -54.26394 1.000 52.79353  ? 100 ASN B O   1 
ATOM   4981 C CB  . ASN B 1 100 ? -1.51581  4.71951   -54.46580 1.000 36.25218  ? 100 ASN B CB  1 
ATOM   4982 C CG  . ASN B 1 100 ? -0.81300  3.37378   -54.50540 1.000 39.32670  ? 100 ASN B CG  1 
ATOM   4983 O OD1 . ASN B 1 100 ? -0.36180  2.89389   -53.47182 1.000 44.35059  ? 100 ASN B OD1 1 
ATOM   4984 N ND2 . ASN B 1 100 ? -0.77849  2.72318   -55.67484 1.000 37.37366  ? 100 ASN B ND2 1 
ATOM   4985 N N   . VAL B 1 101 ? -2.48707  7.58034   -55.78356 1.000 43.22020  ? 101 VAL B N   1 
ATOM   4986 C CA  . VAL B 1 101 ? -3.08478  8.87002   -55.47423 1.000 44.72931  ? 101 VAL B CA  1 
ATOM   4987 C C   . VAL B 1 101 ? -4.56627  8.66936   -55.19231 1.000 55.95866  ? 101 VAL B C   1 
ATOM   4988 O O   . VAL B 1 101 ? -5.27716  8.06269   -56.01012 1.000 60.45970  ? 101 VAL B O   1 
ATOM   4989 C CB  . VAL B 1 101 ? -2.89438  9.87266   -56.62635 1.000 49.14552  ? 101 VAL B CB  1 
ATOM   4990 C CG1 . VAL B 1 101 ? -3.88249  11.03728  -56.45784 1.000 41.60553  ? 101 VAL B CG1 1 
ATOM   4991 C CG2 . VAL B 1 101 ? -1.44307  10.35091  -56.69464 1.000 53.41860  ? 101 VAL B CG2 1 
ATOM   4992 N N   . TRP B 1 102 ? -5.03968  9.20537   -54.05806 1.000 50.26573  ? 102 TRP B N   1 
ATOM   4993 C CA  . TRP B 1 102 ? -6.46738  9.33092   -53.79528 1.000 43.19573  ? 102 TRP B CA  1 
ATOM   4994 C C   . TRP B 1 102 ? -6.85198  10.80212  -53.81455 1.000 45.18014  ? 102 TRP B C   1 
ATOM   4995 O O   . TRP B 1 102 ? -6.08748  11.65945  -53.35621 1.000 39.96629  ? 102 TRP B O   1 
ATOM   4996 C CB  . TRP B 1 102 ? -6.86366  8.74622   -52.45702 1.000 39.28917  ? 102 TRP B CB  1 
ATOM   4997 C CG  . TRP B 1 102 ? -6.76709  7.27060   -52.27082 1.000 38.90972  ? 102 TRP B CG  1 
ATOM   4998 C CD1 . TRP B 1 102 ? -7.78727  6.35751   -52.36412 1.000 40.17592  ? 102 TRP B CD1 1 
ATOM   4999 C CD2 . TRP B 1 102 ? -5.60380  6.53425   -51.88442 1.000 37.36375  ? 102 TRP B CD2 1 
ATOM   5000 N NE1 . TRP B 1 102 ? -7.31901  5.09263   -52.07661 1.000 39.50326  ? 102 TRP B NE1 1 
ATOM   5001 C CE2 . TRP B 1 102 ? -5.98101  5.17736   -51.78317 1.000 37.80560  ? 102 TRP B CE2 1 
ATOM   5002 C CE3 . TRP B 1 102 ? -4.27758  6.88841   -51.62642 1.000 35.86979  ? 102 TRP B CE3 1 
ATOM   5003 C CZ2 . TRP B 1 102 ? -5.07797  4.17781   -51.43406 1.000 46.36527  ? 102 TRP B CZ2 1 
ATOM   5004 C CZ3 . TRP B 1 102 ? -3.37611  5.89203   -51.28843 1.000 43.71739  ? 102 TRP B CZ3 1 
ATOM   5005 C CH2 . TRP B 1 102 ? -3.78151  4.55094   -51.19202 1.000 44.53955  ? 102 TRP B CH2 1 
ATOM   5006 N N   . THR B 1 103 ? -8.06072  11.07629  -54.30871 1.000 43.11935  ? 103 THR B N   1 
ATOM   5007 C CA  . THR B 1 103 ? -8.56815  12.40237  -54.62601 1.000 50.22712  ? 103 THR B CA  1 
ATOM   5008 C C   . THR B 1 103 ? -10.08011 12.37566  -54.47736 1.000 60.46504  ? 103 THR B C   1 
ATOM   5009 O O   . THR B 1 103 ? -10.71430 11.40619  -54.92113 1.000 66.07564  ? 103 THR B O   1 
ATOM   5010 C CB  . THR B 1 103 ? -8.18712  12.79888  -56.05819 1.000 54.93575  ? 103 THR B CB  1 
ATOM   5011 O OG1 . THR B 1 103 ? -6.83559  13.25480  -56.08737 1.000 62.30268  ? 103 THR B OG1 1 
ATOM   5012 C CG2 . THR B 1 103 ? -9.08868  13.86793  -56.60757 1.000 55.70456  ? 103 THR B CG2 1 
ATOM   5013 N N   . PRO B 1 104 ? -10.68489 13.39790  -53.87088 1.000 47.24408  ? 104 PRO B N   1 
ATOM   5014 C CA  . PRO B 1 104 ? -12.15292 13.46199  -53.83226 1.000 49.50331  ? 104 PRO B CA  1 
ATOM   5015 C C   . PRO B 1 104 ? -12.77591 13.37891  -55.22239 1.000 62.78612  ? 104 PRO B C   1 
ATOM   5016 O O   . PRO B 1 104 ? -12.19810 13.80462  -56.22490 1.000 65.37401  ? 104 PRO B O   1 
ATOM   5017 C CB  . PRO B 1 104 ? -12.43660 14.81845  -53.18074 1.000 50.00460  ? 104 PRO B CB  1 
ATOM   5018 C CG  . PRO B 1 104 ? -11.16157 15.58440  -53.31753 1.000 48.63753  ? 104 PRO B CG  1 
ATOM   5019 C CD  . PRO B 1 104 ? -10.06575 14.57759  -53.25716 1.000 46.30509  ? 104 PRO B CD  1 
ATOM   5020 N N   . TYR B 1 105 ? -13.96836 12.79988  -55.26372 1.000 61.21914  ? 105 TYR B N   1 
ATOM   5021 C CA  . TYR B 1 105 ? -14.79248 12.70882  -56.45865 1.000 56.97378  ? 105 TYR B CA  1 
ATOM   5022 C C   . TYR B 1 105 ? -15.98700 13.63393  -56.26562 1.000 71.79608  ? 105 TYR B C   1 
ATOM   5023 O O   . TYR B 1 105 ? -16.83184 13.36657  -55.39607 1.000 76.79980  ? 105 TYR B O   1 
ATOM   5024 C CB  . TYR B 1 105 ? -15.24377 11.25975  -56.67125 1.000 57.39060  ? 105 TYR B CB  1 
ATOM   5025 C CG  . TYR B 1 105 ? -16.06088 10.98031  -57.91314 1.000 66.99240  ? 105 TYR B CG  1 
ATOM   5026 C CD1 . TYR B 1 105 ? -16.40183 11.98933  -58.79735 1.000 74.42698  ? 105 TYR B CD1 1 
ATOM   5027 C CD2 . TYR B 1 105 ? -16.47755 9.69896   -58.20993 1.000 68.58180  ? 105 TYR B CD2 1 
ATOM   5028 C CE1 . TYR B 1 105 ? -17.13543 11.73809  -59.92545 1.000 80.09478  ? 105 TYR B CE1 1 
ATOM   5029 C CE2 . TYR B 1 105 ? -17.21739 9.44319   -59.34526 1.000 76.02375  ? 105 TYR B CE2 1 
ATOM   5030 C CZ  . TYR B 1 105 ? -17.54329 10.45941  -60.19896 1.000 79.31344  ? 105 TYR B CZ  1 
ATOM   5031 O OH  . TYR B 1 105 ? -18.28220 10.19744  -61.33393 1.000 83.06244  ? 105 TYR B OH  1 
ATOM   5032 N N   . PRO B 1 106 ? -16.12357 14.71935  -57.04460 1.000 70.55313  ? 106 PRO B N   1 
ATOM   5033 C CA  . PRO B 1 106 ? -15.25483 15.10599  -58.16216 1.000 75.60069  ? 106 PRO B CA  1 
ATOM   5034 C C   . PRO B 1 106 ? -13.92944 15.71696  -57.72841 1.000 74.96439  ? 106 PRO B C   1 
ATOM   5035 O O   . PRO B 1 106 ? -13.79172 16.11890  -56.57570 1.000 73.51355  ? 106 PRO B O   1 
ATOM   5036 C CB  . PRO B 1 106 ? -16.10445 16.12761  -58.92220 1.000 74.53885  ? 106 PRO B CB  1 
ATOM   5037 C CG  . PRO B 1 106 ? -16.99072 16.70831  -57.89370 1.000 72.31361  ? 106 PRO B CG  1 
ATOM   5038 C CD  . PRO B 1 106 ? -17.27542 15.62535  -56.90261 1.000 69.25042  ? 106 PRO B CD  1 
ATOM   5039 N N   . ARG B 1 107 ? -12.97286 15.76845  -58.65367 1.000 76.87975  ? 107 ARG B N   1 
ATOM   5040 C CA  . ARG B 1 107 ? -11.64483 16.27025  -58.33529 1.000 76.17487  ? 107 ARG B CA  1 
ATOM   5041 C C   . ARG B 1 107 ? -11.73161 17.70548  -57.82429 1.000 69.06701  ? 107 ARG B C   1 
ATOM   5042 O O   . ARG B 1 107 ? -12.57402 18.47925  -58.29186 1.000 70.32567  ? 107 ARG B O   1 
ATOM   5043 C CB  . ARG B 1 107 ? -10.73885 16.19801  -59.56415 1.000 79.81012  ? 107 ARG B CB  1 
ATOM   5044 C CG  . ARG B 1 107 ? -10.28200 14.78538  -59.89211 1.000 84.95987  ? 107 ARG B CG  1 
ATOM   5045 C CD  . ARG B 1 107 ? -8.92893  14.81026  -60.56144 1.000 88.44675  ? 107 ARG B CD  1 
ATOM   5046 N NE  . ARG B 1 107 ? -8.96763  15.59948  -61.78958 1.000 94.84133  ? 107 ARG B NE  1 
ATOM   5047 C CZ  . ARG B 1 107 ? -9.27252  15.09829  -62.98245 1.000 98.13558  ? 107 ARG B CZ  1 
ATOM   5048 N NH1 . ARG B 1 107 ? -9.56585  13.81009  -63.10266 1.000 94.01564  ? 107 ARG B NH1 1 
ATOM   5049 N NH2 . ARG B 1 107 ? -9.28750  15.88081  -64.05439 1.000 106.81528 ? 107 ARG B NH2 1 
ATOM   5050 N N   . PRO B 1 108 ? -10.88781 18.08723  -56.86919 1.000 60.84307  ? 108 PRO B N   1 
ATOM   5051 C CA  . PRO B 1 108 ? -10.97442 19.43193  -56.28489 1.000 62.35273  ? 108 PRO B CA  1 
ATOM   5052 C C   . PRO B 1 108 ? -10.99637 20.52839  -57.34164 1.000 69.97379  ? 108 PRO B C   1 
ATOM   5053 O O   . PRO B 1 108 ? -10.21667 20.51542  -58.29948 1.000 68.59570  ? 108 PRO B O   1 
ATOM   5054 C CB  . PRO B 1 108 ? -9.71257  19.51940  -55.42231 1.000 52.31280  ? 108 PRO B CB  1 
ATOM   5055 C CG  . PRO B 1 108 ? -9.35405  18.10804  -55.11856 1.000 53.11272  ? 108 PRO B CG  1 
ATOM   5056 C CD  . PRO B 1 108 ? -9.79714  17.28805  -56.28589 1.000 55.25988  ? 108 PRO B CD  1 
ATOM   5057 N N   . ALA B 1 109 ? -11.90875 21.48698  -57.15665 1.000 74.40710  ? 109 ALA B N   1 
ATOM   5058 C CA  . ALA B 1 109 ? -11.97462 22.65413  -58.02780 1.000 75.18178  ? 109 ALA B CA  1 
ATOM   5059 C C   . ALA B 1 109 ? -10.81771 23.61968  -57.79609 1.000 78.80047  ? 109 ALA B C   1 
ATOM   5060 O O   . ALA B 1 109 ? -10.49324 24.40483  -58.69340 1.000 82.16775  ? 109 ALA B O   1 
ATOM   5061 C CB  . ALA B 1 109 ? -13.30288 23.38443  -57.82694 1.000 70.55280  ? 109 ALA B CB  1 
ATOM   5062 N N   . SER B 1 110 ? -10.19893 23.58637  -56.61653 1.000 73.85666  ? 110 SER B N   1 
ATOM   5063 C CA  . SER B 1 110 ? -9.09208  24.44968  -56.25375 1.000 66.87811  ? 110 SER B CA  1 
ATOM   5064 C C   . SER B 1 110 ? -7.88053  23.60596  -55.88817 1.000 69.67423  ? 110 SER B C   1 
ATOM   5065 O O   . SER B 1 110 ? -8.02735  22.45870  -55.45250 1.000 75.07500  ? 110 SER B O   1 
ATOM   5066 C CB  . SER B 1 110 ? -9.45083  25.35117  -55.06518 1.000 70.43391  ? 110 SER B CB  1 
ATOM   5067 O OG  . SER B 1 110 ? -10.76495 25.87352  -55.17949 1.000 82.81455  ? 110 SER B OG  1 
ATOM   5068 N N   . PRO B 1 111 ? -6.67301  24.13913  -56.06372 1.000 66.80188  ? 111 PRO B N   1 
ATOM   5069 C CA  . PRO B 1 111 ? -5.47521  23.42945  -55.59522 1.000 51.24479  ? 111 PRO B CA  1 
ATOM   5070 C C   . PRO B 1 111 ? -5.56284  23.05536  -54.12231 1.000 64.79340  ? 111 PRO B C   1 
ATOM   5071 O O   . PRO B 1 111 ? -5.64220  23.92664  -53.24721 1.000 72.92065  ? 111 PRO B O   1 
ATOM   5072 C CB  . PRO B 1 111 ? -4.35070  24.43924  -55.85933 1.000 51.60929  ? 111 PRO B CB  1 
ATOM   5073 C CG  . PRO B 1 111 ? -4.85369  25.28182  -56.97601 1.000 54.93794  ? 111 PRO B CG  1 
ATOM   5074 C CD  . PRO B 1 111 ? -6.34210  25.37845  -56.78927 1.000 62.32150  ? 111 PRO B CD  1 
ATOM   5075 N N   . THR B 1 112 ? -5.54979  21.74825  -53.84217 1.000 60.55695  ? 112 THR B N   1 
ATOM   5076 C CA  . THR B 1 112 ? -5.76950  21.17891  -52.52319 1.000 52.71303  ? 112 THR B CA  1 
ATOM   5077 C C   . THR B 1 112 ? -4.46473  20.69993  -51.91109 1.000 56.36839  ? 112 THR B C   1 
ATOM   5078 O O   . THR B 1 112 ? -3.64387  20.10413  -52.61744 1.000 61.01564  ? 112 THR B O   1 
ATOM   5079 C CB  . THR B 1 112 ? -6.74602  20.00385  -52.59241 1.000 54.65530  ? 112 THR B CB  1 
ATOM   5080 O OG1 . THR B 1 112 ? -8.01791  20.47149  -53.05087 1.000 57.85176  ? 112 THR B OG1 1 
ATOM   5081 C CG2 . THR B 1 112 ? -6.91242  19.37681  -51.22918 1.000 64.45461  ? 112 THR B CG2 1 
ATOM   5082 N N   . PRO B 1 113 ? -4.23981  20.95853  -50.61701 1.000 49.31888  ? 113 PRO B N   1 
ATOM   5083 C CA  . PRO B 1 113 ? -3.02808  20.45687  -49.96085 1.000 39.51737  ? 113 PRO B CA  1 
ATOM   5084 C C   . PRO B 1 113 ? -2.82365  18.96488  -50.18461 1.000 40.52722  ? 113 PRO B C   1 
ATOM   5085 O O   . PRO B 1 113 ? -3.76958  18.17413  -50.16908 1.000 44.69088  ? 113 PRO B O   1 
ATOM   5086 C CB  . PRO B 1 113 ? -3.27789  20.78377  -48.48736 1.000 38.96594  ? 113 PRO B CB  1 
ATOM   5087 C CG  . PRO B 1 113 ? -4.01896  22.08225  -48.56854 1.000 42.58718  ? 113 PRO B CG  1 
ATOM   5088 C CD  . PRO B 1 113 ? -4.92555  21.96514  -49.78429 1.000 43.82213  ? 113 PRO B CD  1 
ATOM   5089 N N   . VAL B 1 114 ? -1.56702  18.59539  -50.39650 1.000 36.88502  ? 114 VAL B N   1 
ATOM   5090 C CA  . VAL B 1 114 ? -1.15012  17.23158  -50.68517 1.000 35.82517  ? 114 VAL B CA  1 
ATOM   5091 C C   . VAL B 1 114 ? -0.52178  16.62979  -49.43857 1.000 42.59754  ? 114 VAL B C   1 
ATOM   5092 O O   . VAL B 1 114 ? 0.27947   17.28131  -48.75493 1.000 51.23924  ? 114 VAL B O   1 
ATOM   5093 C CB  . VAL B 1 114 ? -0.15024  17.22303  -51.85722 1.000 36.12305  ? 114 VAL B CB  1 
ATOM   5094 C CG1 . VAL B 1 114 ? 0.21949   15.81148  -52.24942 1.000 35.34197  ? 114 VAL B CG1 1 
ATOM   5095 C CG2 . VAL B 1 114 ? -0.72326  17.99606  -53.03612 1.000 47.49582  ? 114 VAL B CG2 1 
ATOM   5096 N N   . LEU B 1 115 ? -0.86560  15.37769  -49.15066 1.000 38.22077  ? 115 LEU B N   1 
ATOM   5097 C CA  . LEU B 1 115 ? -0.25102  14.60294  -48.07811 1.000 40.26319  ? 115 LEU B CA  1 
ATOM   5098 C C   . LEU B 1 115 ? 0.43686   13.38827  -48.68406 1.000 43.58278  ? 115 LEU B C   1 
ATOM   5099 O O   . LEU B 1 115 ? -0.22326  12.53667  -49.28592 1.000 54.20543  ? 115 LEU B O   1 
ATOM   5100 C CB  . LEU B 1 115 ? -1.29402  14.14958  -47.05205 1.000 47.22084  ? 115 LEU B CB  1 
ATOM   5101 C CG  . LEU B 1 115 ? -1.61087  15.10840  -45.89680 1.000 54.46794  ? 115 LEU B CG  1 
ATOM   5102 C CD1 . LEU B 1 115 ? -2.69556  16.10722  -46.30606 1.000 61.78609  ? 115 LEU B CD1 1 
ATOM   5103 C CD2 . LEU B 1 115 ? -1.98890  14.35062  -44.63470 1.000 44.77338  ? 115 LEU B CD2 1 
ATOM   5104 N N   . ILE B 1 116 ? 1.74936   13.29346  -48.52170 1.000 37.43458  ? 116 ILE B N   1 
ATOM   5105 C CA  . ILE B 1 116 ? 2.50326   12.14458  -49.01355 1.000 38.77738  ? 116 ILE B CA  1 
ATOM   5106 C C   . ILE B 1 116 ? 2.84719   11.23908  -47.83928 1.000 41.89104  ? 116 ILE B C   1 
ATOM   5107 O O   . ILE B 1 116 ? 3.39832   11.70064  -46.83399 1.000 50.41707  ? 116 ILE B O   1 
ATOM   5108 C CB  . ILE B 1 116 ? 3.77349   12.58291  -49.76077 1.000 40.84543  ? 116 ILE B CB  1 
ATOM   5109 C CG1 . ILE B 1 116 ? 3.46843   13.75042  -50.70125 1.000 42.95621  ? 116 ILE B CG1 1 
ATOM   5110 C CG2 . ILE B 1 116 ? 4.36770   11.40926  -50.51341 1.000 33.31363  ? 116 ILE B CG2 1 
ATOM   5111 C CD1 . ILE B 1 116 ? 4.59158   14.05644  -51.67896 1.000 42.32286  ? 116 ILE B CD1 1 
ATOM   5112 N N   . TRP B 1 117 ? 2.54846   9.94933   -47.96996 1.000 37.74182  ? 117 TRP B N   1 
ATOM   5113 C CA  . TRP B 1 117 ? 2.75505   8.97762   -46.90245 1.000 37.88322  ? 117 TRP B CA  1 
ATOM   5114 C C   . TRP B 1 117 ? 3.92285   8.05197   -47.22431 1.000 41.42797  ? 117 TRP B C   1 
ATOM   5115 O O   . TRP B 1 117 ? 3.94715   7.42332   -48.29006 1.000 43.94627  ? 117 TRP B O   1 
ATOM   5116 C CB  . TRP B 1 117 ? 1.49710   8.14686   -46.67804 1.000 38.12331  ? 117 TRP B CB  1 
ATOM   5117 C CG  . TRP B 1 117 ? 1.72998   6.93857   -45.82641 1.000 37.23871  ? 117 TRP B CG  1 
ATOM   5118 C CD1 . TRP B 1 117 ? 1.86614   5.64216   -46.24349 1.000 36.77253  ? 117 TRP B CD1 1 
ATOM   5119 C CD2 . TRP B 1 117 ? 1.83385   6.91395   -44.40564 1.000 41.96662  ? 117 TRP B CD2 1 
ATOM   5120 N NE1 . TRP B 1 117 ? 2.05389   4.81213   -45.16126 1.000 36.28411  ? 117 TRP B NE1 1 
ATOM   5121 C CE2 . TRP B 1 117 ? 2.03407   5.57259   -44.02159 1.000 40.92835  ? 117 TRP B CE2 1 
ATOM   5122 C CE3 . TRP B 1 117 ? 1.77764   7.89901   -43.41553 1.000 40.44594  ? 117 TRP B CE3 1 
ATOM   5123 C CZ2 . TRP B 1 117 ? 2.17934   5.19676   -42.69137 1.000 42.28882  ? 117 TRP B CZ2 1 
ATOM   5124 C CZ3 . TRP B 1 117 ? 1.92700   7.52774   -42.10910 1.000 34.72311  ? 117 TRP B CZ3 1 
ATOM   5125 C CH2 . TRP B 1 117 ? 2.12705   6.18639   -41.75345 1.000 38.93426  ? 117 TRP B CH2 1 
ATOM   5126 N N   . ILE B 1 118 ? 4.86405   7.94186   -46.28543 1.000 35.34840  ? 118 ILE B N   1 
ATOM   5127 C CA  . ILE B 1 118 ? 6.04278   7.09019   -46.42149 1.000 34.06183  ? 118 ILE B CA  1 
ATOM   5128 C C   . ILE B 1 118 ? 5.94428   5.99609   -45.36729 1.000 49.05589  ? 118 ILE B C   1 
ATOM   5129 O O   . ILE B 1 118 ? 6.17746   6.24905   -44.17784 1.000 54.95476  ? 118 ILE B O   1 
ATOM   5130 C CB  . ILE B 1 118 ? 7.34407   7.88149   -46.24863 1.000 33.37106  ? 118 ILE B CB  1 
ATOM   5131 C CG1 . ILE B 1 118 ? 7.43670   9.02240   -47.25576 1.000 28.39376  ? 118 ILE B CG1 1 
ATOM   5132 C CG2 . ILE B 1 118 ? 8.53211   6.95124   -46.32309 1.000 28.56244  ? 118 ILE B CG2 1 
ATOM   5133 C CD1 . ILE B 1 118 ? 8.53005   10.02275  -46.94256 1.000 28.38256  ? 118 ILE B CD1 1 
ATOM   5134 N N   . TYR B 1 119 ? 5.63046   4.77512   -45.79127 1.000 46.18964  ? 119 TYR B N   1 
ATOM   5135 C CA  . TYR B 1 119 ? 5.40224   3.71378   -44.82593 1.000 44.22810  ? 119 TYR B CA  1 
ATOM   5136 C C   . TYR B 1 119 ? 6.68626   3.36907   -44.08278 1.000 43.57413  ? 119 TYR B C   1 
ATOM   5137 O O   . TYR B 1 119 ? 7.78414   3.81949   -44.42132 1.000 42.91910  ? 119 TYR B O   1 
ATOM   5138 C CB  . TYR B 1 119 ? 4.84310   2.45547   -45.49561 1.000 47.83654  ? 119 TYR B CB  1 
ATOM   5139 C CG  . TYR B 1 119 ? 5.63950   1.89264   -46.66836 1.000 49.00602  ? 119 TYR B CG  1 
ATOM   5140 C CD1 . TYR B 1 119 ? 6.81380   1.16894   -46.47210 1.000 49.61483  ? 119 TYR B CD1 1 
ATOM   5141 C CD2 . TYR B 1 119 ? 5.18267   2.04775   -47.96390 1.000 49.34349  ? 119 TYR B CD2 1 
ATOM   5142 C CE1 . TYR B 1 119 ? 7.51974   0.63491   -47.54210 1.000 51.80850  ? 119 TYR B CE1 1 
ATOM   5143 C CE2 . TYR B 1 119 ? 5.88288   1.52974   -49.04572 1.000 57.57074  ? 119 TYR B CE2 1 
ATOM   5144 C CZ  . TYR B 1 119 ? 7.05052   0.82158   -48.83923 1.000 53.61022  ? 119 TYR B CZ  1 
ATOM   5145 O OH  . TYR B 1 119 ? 7.73307   0.30720   -49.93560 1.000 37.91877  ? 119 TYR B OH  1 
ATOM   5146 N N   . GLY B 1 120 ? 6.52132   2.55045   -43.04486 1.000 44.91426  ? 120 GLY B N   1 
ATOM   5147 C CA  . GLY B 1 120 ? 7.60947   1.99732   -42.29554 1.000 49.46404  ? 120 GLY B CA  1 
ATOM   5148 C C   . GLY B 1 120 ? 7.72709   0.50013   -42.47915 1.000 54.72193  ? 120 GLY B C   1 
ATOM   5149 O O   . GLY B 1 120 ? 7.16349   -0.09159  -43.41063 1.000 59.22884  ? 120 GLY B O   1 
ATOM   5150 N N   . GLY B 1 121 ? 8.45246   -0.12769  -41.56171 1.000 52.94895  ? 121 GLY B N   1 
ATOM   5151 C CA  . GLY B 1 121 ? 8.81992   -1.51528  -41.74378 1.000 53.95485  ? 121 GLY B CA  1 
ATOM   5152 C C   . GLY B 1 121 ? 10.31612  -1.70418  -41.61383 1.000 57.56859  ? 121 GLY B C   1 
ATOM   5153 O O   . GLY B 1 121 ? 10.90333  -2.51728  -42.33265 1.000 54.87708  ? 121 GLY B O   1 
ATOM   5154 N N   . GLY B 1 122 ? 10.93759  -0.92764  -40.71540 1.000 54.33457  ? 122 GLY B N   1 
ATOM   5155 C CA  . GLY B 1 122 ? 12.35032  -1.02996  -40.38874 1.000 45.45888  ? 122 GLY B CA  1 
ATOM   5156 C C   . GLY B 1 122 ? 13.32884  -0.96639  -41.54680 1.000 45.52448  ? 122 GLY B C   1 
ATOM   5157 O O   . GLY B 1 122 ? 14.40979  -1.56793  -41.49343 1.000 47.61897  ? 122 GLY B O   1 
ATOM   5158 N N   . PHE B 1 123 ? 12.96659  -0.24397  -42.60442 1.000 46.45538  ? 123 PHE B N   1 
ATOM   5159 C CA  . PHE B 1 123 ? 13.71735  -0.20725  -43.85687 1.000 42.50546  ? 123 PHE B CA  1 
ATOM   5160 C C   . PHE B 1 123 ? 13.89686  -1.58673  -44.45976 1.000 40.86312  ? 123 PHE B C   1 
ATOM   5161 O O   . PHE B 1 123 ? 14.67910  -1.74135  -45.39512 1.000 45.14228  ? 123 PHE B O   1 
ATOM   5162 C CB  . PHE B 1 123 ? 15.08646  0.46019   -43.67518 1.000 36.53086  ? 123 PHE B CB  1 
ATOM   5163 C CG  . PHE B 1 123 ? 15.00193  1.94082   -43.39962 1.000 35.32785  ? 123 PHE B CG  1 
ATOM   5164 C CD1 . PHE B 1 123 ? 14.62528  2.83371   -44.39577 1.000 37.41192  ? 123 PHE B CD1 1 
ATOM   5165 C CD2 . PHE B 1 123 ? 15.29029  2.43980   -42.14940 1.000 25.01838  ? 123 PHE B CD2 1 
ATOM   5166 C CE1 . PHE B 1 123 ? 14.54279  4.18868   -44.14806 1.000 26.54218  ? 123 PHE B CE1 1 
ATOM   5167 C CE2 . PHE B 1 123 ? 15.21389  3.78779   -41.90564 1.000 24.69866  ? 123 PHE B CE2 1 
ATOM   5168 C CZ  . PHE B 1 123 ? 14.83724  4.66361   -42.90886 1.000 25.36499  ? 123 PHE B CZ  1 
ATOM   5169 N N   . TYR B 1 124 ? 13.18316  -2.59346  -43.94118 1.000 41.10431  ? 124 TYR B N   1 
ATOM   5170 C CA  . TYR B 1 124 ? 13.30300  -3.97958  -44.37206 1.000 45.39949  ? 124 TYR B CA  1 
ATOM   5171 C C   . TYR B 1 124 ? 12.01394  -4.55116  -44.95266 1.000 49.41537  ? 124 TYR B C   1 
ATOM   5172 O O   . TYR B 1 124 ? 12.05248  -5.63789  -45.54585 1.000 52.86781  ? 124 TYR B O   1 
ATOM   5173 C CB  . TYR B 1 124 ? 13.76990  -4.87013  -43.19723 1.000 46.09183  ? 124 TYR B CB  1 
ATOM   5174 C CG  . TYR B 1 124 ? 12.66305  -5.34954  -42.25252 1.000 44.20725  ? 124 TYR B CG  1 
ATOM   5175 C CD1 . TYR B 1 124 ? 11.96646  -6.52044  -42.51022 1.000 31.84527  ? 124 TYR B CD1 1 
ATOM   5176 C CD2 . TYR B 1 124 ? 12.33838  -4.63941  -41.08515 1.000 42.59298  ? 124 TYR B CD2 1 
ATOM   5177 C CE1 . TYR B 1 124 ? 10.96079  -6.95845  -41.67444 1.000 36.00708  ? 124 TYR B CE1 1 
ATOM   5178 C CE2 . TYR B 1 124 ? 11.31739  -5.07515  -40.22583 1.000 35.14731  ? 124 TYR B CE2 1 
ATOM   5179 C CZ  . TYR B 1 124 ? 10.64036  -6.23982  -40.52933 1.000 40.38801  ? 124 TYR B CZ  1 
ATOM   5180 O OH  . TYR B 1 124 ? 9.63486   -6.71165  -39.71776 1.000 43.47453  ? 124 TYR B OH  1 
ATOM   5181 N N   . SER B 1 125 ? 10.88350  -3.86329  -44.80326 1.000 44.05450  ? 125 SER B N   1 
ATOM   5182 C CA  . SER B 1 125 ? 9.58213   -4.40591  -45.17559 1.000 35.32031  ? 125 SER B CA  1 
ATOM   5183 C C   . SER B 1 125 ? 8.62849   -3.24024  -45.40003 1.000 36.25622  ? 125 SER B C   1 
ATOM   5184 O O   . SER B 1 125 ? 9.02804   -2.07296  -45.34640 1.000 29.96233  ? 125 SER B O   1 
ATOM   5185 C CB  . SER B 1 125 ? 9.04963   -5.34913  -44.10045 1.000 40.11984  ? 125 SER B CB  1 
ATOM   5186 O OG  . SER B 1 125 ? 8.96711   -4.66149  -42.85704 1.000 54.11119  ? 125 SER B OG  1 
ATOM   5187 N N   . GLY B 1 126 ? 7.36897   -3.57038  -45.67470 1.000 42.89683  ? 126 GLY B N   1 
ATOM   5188 C CA  . GLY B 1 126 ? 6.30342   -2.60302  -45.85317 1.000 44.63300  ? 126 GLY B CA  1 
ATOM   5189 C C   . GLY B 1 126 ? 5.88248   -2.46122  -47.31046 1.000 38.78273  ? 126 GLY B C   1 
ATOM   5190 O O   . GLY B 1 126 ? 6.56079   -2.90310  -48.23885 1.000 44.59168  ? 126 GLY B O   1 
ATOM   5191 N N   . ALA B 1 127 ? 4.72469   -1.81192  -47.48675 1.000 36.26652  ? 127 ALA B N   1 
ATOM   5192 C CA  . ALA B 1 127 ? 4.13042   -1.50218  -48.78641 1.000 44.04932  ? 127 ALA B CA  1 
ATOM   5193 C C   . ALA B 1 127 ? 3.03171   -0.47448  -48.56790 1.000 45.71583  ? 127 ALA B C   1 
ATOM   5194 O O   . ALA B 1 127 ? 2.61895   -0.22120  -47.43630 1.000 46.02602  ? 127 ALA B O   1 
ATOM   5195 C CB  . ALA B 1 127 ? 3.55918   -2.73442  -49.47906 1.000 31.59803  ? 127 ALA B CB  1 
ATOM   5196 N N   . ALA B 1 128 ? 2.54744   0.10532   -49.67152 1.000 41.64402  ? 128 ALA B N   1 
ATOM   5197 C CA  . ALA B 1 128 ? 1.52841   1.14813   -49.61133 1.000 38.88375  ? 128 ALA B CA  1 
ATOM   5198 C C   . ALA B 1 128 ? 0.12088   0.61938   -49.83460 1.000 42.97528  ? 128 ALA B C   1 
ATOM   5199 O O   . ALA B 1 128 ? -0.84016  1.37806   -49.68323 1.000 46.29732  ? 128 ALA B O   1 
ATOM   5200 C CB  . ALA B 1 128 ? 1.82616   2.24986   -50.63959 1.000 40.36919  ? 128 ALA B CB  1 
ATOM   5201 N N   . SER B 1 129 ? -0.02324  -0.65459  -50.18120 1.000 47.19560  ? 129 SER B N   1 
ATOM   5202 C CA  . SER B 1 129 ? -1.32056  -1.26046  -50.44890 1.000 51.55617  ? 129 SER B CA  1 
ATOM   5203 C C   . SER B 1 129 ? -1.97598  -1.83541  -49.19924 1.000 47.78293  ? 129 SER B C   1 
ATOM   5204 O O   . SER B 1 129 ? -3.11850  -2.31815  -49.27278 1.000 34.54270  ? 129 SER B O   1 
ATOM   5205 C CB  . SER B 1 129 ? -1.16333  -2.34514  -51.52423 1.000 53.99112  ? 129 SER B CB  1 
ATOM   5206 O OG  . SER B 1 129 ? 0.02888   -3.09239  -51.34406 1.000 50.72219  ? 129 SER B OG  1 
ATOM   5207 N N   . LEU B 1 130 ? -1.27290  -1.79272  -48.06727 1.000 45.30183  ? 130 LEU B N   1 
ATOM   5208 C CA  . LEU B 1 130 ? -1.82066  -2.25014  -46.80133 1.000 43.08954  ? 130 LEU B CA  1 
ATOM   5209 C C   . LEU B 1 130 ? -3.09420  -1.48596  -46.47768 1.000 48.61940  ? 130 LEU B C   1 
ATOM   5210 O O   . LEU B 1 130 ? -3.21887  -0.28805  -46.75865 1.000 50.17669  ? 130 LEU B O   1 
ATOM   5211 C CB  . LEU B 1 130 ? -0.80734  -2.04640  -45.68255 1.000 43.53830  ? 130 LEU B CB  1 
ATOM   5212 C CG  . LEU B 1 130 ? 0.56020   -2.71260  -45.79051 1.000 42.83612  ? 130 LEU B CG  1 
ATOM   5213 C CD1 . LEU B 1 130 ? 1.28074   -2.57622  -44.43488 1.000 34.82830  ? 130 LEU B CD1 1 
ATOM   5214 C CD2 . LEU B 1 130 ? 0.41607   -4.17415  -46.19675 1.000 38.18942  ? 130 LEU B CD2 1 
ATOM   5215 N N   . ASP B 1 131 ? -4.04878  -2.18248  -45.86625 1.000 51.91484  ? 131 ASP B N   1 
ATOM   5216 C CA  . ASP B 1 131 ? -5.33259  -1.53164  -45.65235 1.000 52.82621  ? 131 ASP B CA  1 
ATOM   5217 C C   . ASP B 1 131 ? -5.26118  -0.39688  -44.62702 1.000 51.67506  ? 131 ASP B C   1 
ATOM   5218 O O   . ASP B 1 131 ? -6.10834  0.49877   -44.67779 1.000 56.07710  ? 131 ASP B O   1 
ATOM   5219 C CB  . ASP B 1 131 ? -6.39033  -2.56958  -45.27460 1.000 53.93745  ? 131 ASP B CB  1 
ATOM   5220 C CG  . ASP B 1 131 ? -6.55130  -3.63554  -46.34013 1.000 63.68363  ? 131 ASP B CG  1 
ATOM   5221 O OD1 . ASP B 1 131 ? -6.59588  -4.82834  -45.99435 1.000 66.58698  ? 131 ASP B OD1 1 
ATOM   5222 O OD2 . ASP B 1 131 ? -6.59079  -3.27754  -47.53699 1.000 72.36352  ? 131 ASP B OD2 1 
ATOM   5223 N N   A VAL B 1 132 ? -4.27121  -0.39669  -43.72568 0.500 46.80627  ? 132 VAL B N   1 
ATOM   5224 N N   B VAL B 1 132 ? -4.27115  -0.39663  -43.72573 0.500 46.80847  ? 132 VAL B N   1 
ATOM   5225 C CA  A VAL B 1 132 ? -4.13497  0.69758   -42.76349 0.500 44.51823  ? 132 VAL B CA  1 
ATOM   5226 C CA  B VAL B 1 132 ? -4.13495  0.69759   -42.76345 0.500 44.51789  ? 132 VAL B CA  1 
ATOM   5227 C C   A VAL B 1 132 ? -3.64564  1.98940   -43.39631 0.500 47.62317  ? 132 VAL B C   1 
ATOM   5228 C C   B VAL B 1 132 ? -3.64468  1.98922   -43.39594 0.500 47.62382  ? 132 VAL B C   1 
ATOM   5229 O O   A VAL B 1 132 ? -3.67779  3.03764   -42.73957 0.500 47.94147  ? 132 VAL B O   1 
ATOM   5230 O O   B VAL B 1 132 ? -3.67516  3.03714   -42.73860 0.500 47.94043  ? 132 VAL B O   1 
ATOM   5231 C CB  A VAL B 1 132 ? -3.17771  0.35403   -41.60087 0.500 39.54832  ? 132 VAL B CB  1 
ATOM   5232 C CB  B VAL B 1 132 ? -3.17850  0.35366   -41.60025 0.500 39.55587  ? 132 VAL B CB  1 
ATOM   5233 C CG1 A VAL B 1 132 ? -3.85117  -0.56739  -40.61230 0.500 39.55159  ? 132 VAL B CG1 1 
ATOM   5234 C CG1 B VAL B 1 132 ? -3.85285  -0.56763  -40.61213 0.500 39.55568  ? 132 VAL B CG1 1 
ATOM   5235 C CG2 A VAL B 1 132 ? -1.89275  -0.26339  -42.11677 0.500 40.04552  ? 132 VAL B CG2 1 
ATOM   5236 C CG2 B VAL B 1 132 ? -1.89333  -0.26402  -42.11537 0.500 40.03602  ? 132 VAL B CG2 1 
ATOM   5237 N N   . TYR B 1 133 ? -3.17501  1.94630   -44.64361 1.000 49.95479  ? 133 TYR B N   1 
ATOM   5238 C CA  . TYR B 1 133 ? -2.77493  3.14894   -45.35994 1.000 50.80528  ? 133 TYR B CA  1 
ATOM   5239 C C   . TYR B 1 133 ? -3.79681  3.54302   -46.41445 1.000 51.14346  ? 133 TYR B C   1 
ATOM   5240 O O   . TYR B 1 133 ? -3.48282  4.33134   -47.30950 1.000 58.14573  ? 133 TYR B O   1 
ATOM   5241 C CB  . TYR B 1 133 ? -1.40264  2.96765   -46.00692 1.000 50.09175  ? 133 TYR B CB  1 
ATOM   5242 C CG  . TYR B 1 133 ? -0.35076  2.38263   -45.10391 1.000 47.30505  ? 133 TYR B CG  1 
ATOM   5243 C CD1 . TYR B 1 133 ? -0.35270  2.62610   -43.73125 1.000 50.57650  ? 133 TYR B CD1 1 
ATOM   5244 C CD2 . TYR B 1 133 ? 0.65188   1.59037   -45.62414 1.000 40.79279  ? 133 TYR B CD2 1 
ATOM   5245 C CE1 . TYR B 1 133 ? 0.61414   2.07803   -42.90760 1.000 45.08065  ? 133 TYR B CE1 1 
ATOM   5246 C CE2 . TYR B 1 133 ? 1.61842   1.04444   -44.81209 1.000 44.43867  ? 133 TYR B CE2 1 
ATOM   5247 C CZ  . TYR B 1 133 ? 1.59755   1.28503   -43.46033 1.000 45.34809  ? 133 TYR B CZ  1 
ATOM   5248 O OH  . TYR B 1 133 ? 2.57619   0.72395   -42.67857 1.000 45.38557  ? 133 TYR B OH  1 
ATOM   5249 N N   . ASP B 1 134 ? -5.00255  2.98504   -46.33852 1.000 46.40954  ? 134 ASP B N   1 
ATOM   5250 C CA  . ASP B 1 134 ? -6.09749  3.31153   -47.24503 1.000 43.62777  ? 134 ASP B CA  1 
ATOM   5251 C C   . ASP B 1 134 ? -6.40348  4.80820   -47.21819 1.000 46.06230  ? 134 ASP B C   1 
ATOM   5252 O O   . ASP B 1 134 ? -6.85680  5.35099   -46.20179 1.000 42.77234  ? 134 ASP B O   1 
ATOM   5253 C CB  . ASP B 1 134 ? -7.32317  2.48184   -46.86299 1.000 46.22215  ? 134 ASP B CB  1 
ATOM   5254 C CG  . ASP B 1 134 ? -8.44788  2.59885   -47.85248 1.000 51.71731  ? 134 ASP B CG  1 
ATOM   5255 O OD1 . ASP B 1 134 ? -8.56938  3.64149   -48.53124 1.000 52.45972  ? 134 ASP B OD1 1 
ATOM   5256 O OD2 . ASP B 1 134 ? -9.22897  1.62852   -47.94232 1.000 56.34328  ? 134 ASP B OD2 1 
ATOM   5257 N N   . GLY B 1 135 ? -6.16739  5.48148   -48.34293 1.000 52.33370  ? 135 GLY B N   1 
ATOM   5258 C CA  . GLY B 1 135 ? -6.30363  6.92210   -48.43833 1.000 51.38764  ? 135 GLY B CA  1 
ATOM   5259 C C   . GLY B 1 135 ? -7.69897  7.45517   -48.67369 1.000 48.50475  ? 135 GLY B C   1 
ATOM   5260 O O   . GLY B 1 135 ? -7.87341  8.67445   -48.71332 1.000 46.55524  ? 135 GLY B O   1 
ATOM   5261 N N   . ARG B 1 136 ? -8.70660  6.58856   -48.81249 1.000 44.95521  ? 136 ARG B N   1 
ATOM   5262 C CA  . ARG B 1 136 ? -10.03318 7.06445   -49.19238 1.000 44.85107  ? 136 ARG B CA  1 
ATOM   5263 C C   . ARG B 1 136 ? -10.63758 7.96891   -48.11957 1.000 50.51420  ? 136 ARG B C   1 
ATOM   5264 O O   . ARG B 1 136 ? -11.30403 8.95855   -48.44647 1.000 50.82572  ? 136 ARG B O   1 
ATOM   5265 C CB  . ARG B 1 136 ? -10.95877 5.87745   -49.49074 1.000 38.96538  ? 136 ARG B CB  1 
ATOM   5266 C CG  . ARG B 1 136 ? -11.46308 5.15230   -48.25173 1.000 47.86015  ? 136 ARG B CG  1 
ATOM   5267 C CD  . ARG B 1 136 ? -12.26834 3.92573   -48.61260 1.000 55.79371  ? 136 ARG B CD  1 
ATOM   5268 N NE  . ARG B 1 136 ? -11.48003 3.03464   -49.44942 1.000 60.27288  ? 136 ARG B NE  1 
ATOM   5269 C CZ  . ARG B 1 136 ? -12.00173 2.16573   -50.30530 1.000 67.95983  ? 136 ARG B CZ  1 
ATOM   5270 N NH1 . ARG B 1 136 ? -11.20685 1.39449   -51.03766 1.000 70.09701  ? 136 ARG B NH1 1 
ATOM   5271 N NH2 . ARG B 1 136 ? -13.32007 2.07398   -50.42882 1.000 70.86714  ? 136 ARG B NH2 1 
ATOM   5272 N N   . PHE B 1 137 ? -10.40887 7.66232   -46.83691 1.000 45.58443  ? 137 PHE B N   1 
ATOM   5273 C CA  . PHE B 1 137 ? -11.12538 8.37563   -45.78156 1.000 42.10997  ? 137 PHE B CA  1 
ATOM   5274 C C   . PHE B 1 137 ? -10.67909 9.82846   -45.71110 1.000 45.38247  ? 137 PHE B C   1 
ATOM   5275 O O   . PHE B 1 137 ? -11.51309 10.74723  -45.70626 1.000 41.52090  ? 137 PHE B O   1 
ATOM   5276 C CB  . PHE B 1 137 ? -10.93346 7.67302   -44.43126 1.000 37.53384  ? 137 PHE B CB  1 
ATOM   5277 C CG  . PHE B 1 137 ? -11.30569 6.23442   -44.46059 1.000 36.82621  ? 137 PHE B CG  1 
ATOM   5278 C CD1 . PHE B 1 137 ? -12.62387 5.85083   -44.35456 1.000 37.89128  ? 137 PHE B CD1 1 
ATOM   5279 C CD2 . PHE B 1 137 ? -10.34042 5.26259   -44.65621 1.000 47.75974  ? 137 PHE B CD2 1 
ATOM   5280 C CE1 . PHE B 1 137 ? -12.97438 4.51889   -44.41864 1.000 47.41252  ? 137 PHE B CE1 1 
ATOM   5281 C CE2 . PHE B 1 137 ? -10.67946 3.92192   -44.72692 1.000 47.91421  ? 137 PHE B CE2 1 
ATOM   5282 C CZ  . PHE B 1 137 ? -11.99630 3.55023   -44.60808 1.000 50.50685  ? 137 PHE B CZ  1 
ATOM   5283 N N   . LEU B 1 138 ? -9.36103  10.05228  -45.67507 1.000 45.93984  ? 138 LEU B N   1 
ATOM   5284 C CA  . LEU B 1 138 ? -8.83325  11.41329  -45.64789 1.000 45.10204  ? 138 LEU B CA  1 
ATOM   5285 C C   . LEU B 1 138 ? -9.25458  12.20113  -46.88842 1.000 49.49610  ? 138 LEU B C   1 
ATOM   5286 O O   . LEU B 1 138 ? -9.55776  13.39687  -46.80561 1.000 51.44176  ? 138 LEU B O   1 
ATOM   5287 C CB  . LEU B 1 138 ? -7.30901  11.36883  -45.52099 1.000 41.91178  ? 138 LEU B CB  1 
ATOM   5288 C CG  . LEU B 1 138 ? -6.76445  11.04693  -44.12509 1.000 38.66445  ? 138 LEU B CG  1 
ATOM   5289 C CD1 . LEU B 1 138 ? -5.28247  10.70944  -44.13781 1.000 30.67312  ? 138 LEU B CD1 1 
ATOM   5290 C CD2 . LEU B 1 138 ? -7.00967  12.21669  -43.21180 1.000 35.15237  ? 138 LEU B CD2 1 
ATOM   5291 N N   . ALA B 1 139 ? -9.28919  11.54753  -48.04827 1.000 46.21045  ? 139 ALA B N   1 
ATOM   5292 C CA  . ALA B 1 139 ? -9.71384  12.24193  -49.25923 1.000 44.67819  ? 139 ALA B CA  1 
ATOM   5293 C C   . ALA B 1 139 ? -11.21679 12.50170  -49.24477 1.000 43.60595  ? 139 ALA B C   1 
ATOM   5294 O O   . ALA B 1 139 ? -11.67595 13.58531  -49.63425 1.000 43.63303  ? 139 ALA B O   1 
ATOM   5295 C CB  . ALA B 1 139 ? -9.30886  11.43621  -50.49950 1.000 41.10479  ? 139 ALA B CB  1 
ATOM   5296 N N   . GLN B 1 140 ? -12.00058 11.52727  -48.78649 1.000 38.58502  ? 140 GLN B N   1 
ATOM   5297 C CA  . GLN B 1 140 ? -13.44364 11.70744  -48.80723 1.000 45.52656  ? 140 GLN B CA  1 
ATOM   5298 C C   . GLN B 1 140 ? -13.91052 12.70096  -47.74851 1.000 51.89176  ? 140 GLN B C   1 
ATOM   5299 O O   . GLN B 1 140 ? -14.82476 13.48844  -48.00828 1.000 53.59022  ? 140 GLN B O   1 
ATOM   5300 C CB  . GLN B 1 140 ? -14.14752 10.36742  -48.62805 1.000 52.76246  ? 140 GLN B CB  1 
ATOM   5301 C CG  . GLN B 1 140 ? -15.61035 10.39640  -49.05880 1.000 58.28694  ? 140 GLN B CG  1 
ATOM   5302 C CD  . GLN B 1 140 ? -16.50435 11.00846  -47.99688 1.000 64.56017  ? 140 GLN B CD  1 
ATOM   5303 O OE1 . GLN B 1 140 ? -17.27100 11.93380  -48.27894 1.000 62.79955  ? 140 GLN B OE1 1 
ATOM   5304 N NE2 . GLN B 1 140 ? -16.38962 10.51041  -46.75499 1.000 66.31709  ? 140 GLN B NE2 1 
ATOM   5305 N N   . VAL B 1 141 ? -13.31079 12.68621  -46.55338 1.000 51.29009  ? 141 VAL B N   1 
ATOM   5306 C CA  . VAL B 1 141 ? -13.86128 13.45372  -45.43621 1.000 53.04871  ? 141 VAL B CA  1 
ATOM   5307 C C   . VAL B 1 141 ? -13.25452 14.84620  -45.34014 1.000 50.82121  ? 141 VAL B C   1 
ATOM   5308 O O   . VAL B 1 141 ? -13.98315 15.84403  -45.31666 1.000 50.53334  ? 141 VAL B O   1 
ATOM   5309 C CB  . VAL B 1 141 ? -13.68856 12.70452  -44.10317 1.000 53.35236  ? 141 VAL B CB  1 
ATOM   5310 C CG1 . VAL B 1 141 ? -14.28567 13.51847  -42.97374 1.000 46.05421  ? 141 VAL B CG1 1 
ATOM   5311 C CG2 . VAL B 1 141 ? -14.36430 11.35648  -44.18262 1.000 56.94767  ? 141 VAL B CG2 1 
ATOM   5312 N N   . GLU B 1 142 ? -11.93008 14.92496  -45.24198 1.000 48.43572  ? 142 GLU B N   1 
ATOM   5313 C CA  . GLU B 1 142 ? -11.24740 16.21311  -45.21037 1.000 54.41610  ? 142 GLU B CA  1 
ATOM   5314 C C   . GLU B 1 142 ? -10.97900 16.79299  -46.59873 1.000 62.10441  ? 142 GLU B C   1 
ATOM   5315 O O   . GLU B 1 142 ? -10.50644 17.93332  -46.69808 1.000 69.16317  ? 142 GLU B O   1 
ATOM   5316 C CB  . GLU B 1 142 ? -9.92574  16.09670  -44.45119 1.000 44.41560  ? 142 GLU B CB  1 
ATOM   5317 C CG  . GLU B 1 142 ? -10.10549 15.65796  -43.03857 1.000 59.65105  ? 142 GLU B CG  1 
ATOM   5318 C CD  . GLU B 1 142 ? -10.87829 16.68209  -42.20717 1.000 74.87121  ? 142 GLU B CD  1 
ATOM   5319 O OE1 . GLU B 1 142 ? -10.66779 17.90007  -42.41196 1.000 75.71081  ? 142 GLU B OE1 1 
ATOM   5320 O OE2 . GLU B 1 142 ? -11.68196 16.26902  -41.33679 1.000 76.95084  ? 142 GLU B OE2 1 
ATOM   5321 N N   . GLY B 1 143 ? -11.25618 16.04695  -47.66354 1.000 59.23918  ? 143 GLY B N   1 
ATOM   5322 C CA  . GLY B 1 143 ? -11.04885 16.56047  -49.00509 1.000 65.58245  ? 143 GLY B CA  1 
ATOM   5323 C C   . GLY B 1 143 ? -9.60084  16.69309  -49.41976 1.000 67.64818  ? 143 GLY B C   1 
ATOM   5324 O O   . GLY B 1 143 ? -9.28158  17.54758  -50.25150 1.000 69.07965  ? 143 GLY B O   1 
ATOM   5325 N N   . ALA B 1 144 ? -8.71765  15.86079  -48.87016 1.000 61.93146  ? 144 ALA B N   1 
ATOM   5326 C CA  . ALA B 1 144 ? -7.29415  15.92486  -49.16746 1.000 52.00445  ? 144 ALA B CA  1 
ATOM   5327 C C   . ALA B 1 144 ? -6.94895  15.15522  -50.43817 1.000 51.88548  ? 144 ALA B C   1 
ATOM   5328 O O   . ALA B 1 144 ? -7.64624  14.21762  -50.83715 1.000 57.42308  ? 144 ALA B O   1 
ATOM   5329 C CB  . ALA B 1 144 ? -6.48620  15.35033  -48.00780 1.000 36.06675  ? 144 ALA B CB  1 
ATOM   5330 N N   . VAL B 1 145 ? -5.85332  15.55416  -51.07253 1.000 43.48495  ? 145 VAL B N   1 
ATOM   5331 C CA  . VAL B 1 145 ? -5.17912  14.70888  -52.04931 1.000 46.83635  ? 145 VAL B CA  1 
ATOM   5332 C C   . VAL B 1 145 ? -4.04556  13.98512  -51.32940 1.000 51.07998  ? 145 VAL B C   1 
ATOM   5333 O O   . VAL B 1 145 ? -3.15143  14.62104  -50.75484 1.000 42.19063  ? 145 VAL B O   1 
ATOM   5334 C CB  . VAL B 1 145 ? -4.65340  15.51441  -53.24307 1.000 43.26317  ? 145 VAL B CB  1 
ATOM   5335 C CG1 . VAL B 1 145 ? -3.76540  14.63590  -54.09406 1.000 36.79070  ? 145 VAL B CG1 1 
ATOM   5336 C CG2 . VAL B 1 145 ? -5.81040  16.05401  -54.05777 1.000 52.24892  ? 145 VAL B CG2 1 
ATOM   5337 N N   . LEU B 1 146 ? -4.08128  12.65678  -51.37264 1.000 46.27718  ? 146 LEU B N   1 
ATOM   5338 C CA  . LEU B 1 146 ? -3.17844  11.80904  -50.61810 1.000 41.51347  ? 146 LEU B CA  1 
ATOM   5339 C C   . LEU B 1 146 ? -2.39365  10.92012  -51.56596 1.000 51.88576  ? 146 LEU B C   1 
ATOM   5340 O O   . LEU B 1 146 ? -2.97423  10.25811  -52.43620 1.000 64.27997  ? 146 LEU B O   1 
ATOM   5341 C CB  . LEU B 1 146 ? -3.94698  10.95142  -49.61285 1.000 44.38709  ? 146 LEU B CB  1 
ATOM   5342 C CG  . LEU B 1 146 ? -3.08436  10.40066  -48.46953 1.000 54.46336  ? 146 LEU B CG  1 
ATOM   5343 C CD1 . LEU B 1 146 ? -3.83578  10.39886  -47.18157 1.000 55.47004  ? 146 LEU B CD1 1 
ATOM   5344 C CD2 . LEU B 1 146 ? -2.58880  8.99797   -48.77632 1.000 57.25177  ? 146 LEU B CD2 1 
ATOM   5345 N N   . VAL B 1 147 ? -1.07883  10.88978  -51.37037 1.000 47.21997  ? 147 VAL B N   1 
ATOM   5346 C CA  . VAL B 1 147 ? -0.15001  10.15586  -52.22092 1.000 46.70633  ? 147 VAL B CA  1 
ATOM   5347 C C   . VAL B 1 147 ? 0.67282   9.21322   -51.35946 1.000 50.54338  ? 147 VAL B C   1 
ATOM   5348 O O   . VAL B 1 147 ? 1.22813   9.63115   -50.34040 1.000 63.41069  ? 147 VAL B O   1 
ATOM   5349 C CB  . VAL B 1 147 ? 0.78316   11.10978  -52.98880 1.000 41.95720  ? 147 VAL B CB  1 
ATOM   5350 C CG1 . VAL B 1 147 ? 1.62360   10.34590  -53.96884 1.000 32.60586  ? 147 VAL B CG1 1 
ATOM   5351 C CG2 . VAL B 1 147 ? -0.01812  12.16912  -53.70514 1.000 39.16673  ? 147 VAL B CG2 1 
ATOM   5352 N N   . SER B 1 148 ? 0.77238   7.95323   -51.77586 1.000 47.87171  ? 148 SER B N   1 
ATOM   5353 C CA  . SER B 1 148 ? 1.71410   7.01030   -51.18318 1.000 47.84530  ? 148 SER B CA  1 
ATOM   5354 C C   . SER B 1 148 ? 2.46941   6.28048   -52.28269 1.000 48.04163  ? 148 SER B C   1 
ATOM   5355 O O   . SER B 1 148 ? 1.89872   5.96702   -53.34029 1.000 46.80417  ? 148 SER B O   1 
ATOM   5356 C CB  . SER B 1 148 ? 1.01932   5.98913   -50.29011 1.000 46.67538  ? 148 SER B CB  1 
ATOM   5357 O OG  . SER B 1 148 ? 0.20841   5.11945   -51.05611 1.000 50.42852  ? 148 SER B OG  1 
ATOM   5358 N N   . MET B 1 149 ? 3.74848   5.99978   -52.01627 1.000 44.03949  ? 149 MET B N   1 
ATOM   5359 C CA  . MET B 1 149 ? 4.64090   5.32153   -52.95403 1.000 44.36291  ? 149 MET B CA  1 
ATOM   5360 C C   . MET B 1 149 ? 5.21710   4.05721   -52.32603 1.000 47.26429  ? 149 MET B C   1 
ATOM   5361 O O   . MET B 1 149 ? 5.21545   3.86658   -51.10623 1.000 57.20585  ? 149 MET B O   1 
ATOM   5362 C CB  . MET B 1 149 ? 5.80305   6.23005   -53.39817 1.000 39.94959  ? 149 MET B CB  1 
ATOM   5363 C CG  . MET B 1 149 ? 7.00074   6.19493   -52.44688 1.000 41.53965  ? 149 MET B CG  1 
ATOM   5364 S SD  . MET B 1 149 ? 6.67168   7.00751   -50.86051 1.000 32.69185  ? 149 MET B SD  1 
ATOM   5365 C CE  . MET B 1 149 ? 6.90618   8.72486   -51.33732 1.000 29.09647  ? 149 MET B CE  1 
ATOM   5366 N N   . ASN B 1 150 ? 5.70912   3.18424   -53.18800 1.000 38.79962  ? 150 ASN B N   1 
ATOM   5367 C CA  . ASN B 1 150 ? 6.54437   2.07809   -52.77172 1.000 37.23511  ? 150 ASN B CA  1 
ATOM   5368 C C   . ASN B 1 150 ? 7.98986   2.52783   -52.88865 1.000 37.16404  ? 150 ASN B C   1 
ATOM   5369 O O   . ASN B 1 150 ? 8.32999   3.28058   -53.80057 1.000 48.80185  ? 150 ASN B O   1 
ATOM   5370 C CB  . ASN B 1 150 ? 6.28350   0.84500   -53.63385 1.000 39.18639  ? 150 ASN B CB  1 
ATOM   5371 C CG  . ASN B 1 150 ? 5.21160   -0.04504  -53.05233 1.000 55.48150  ? 150 ASN B CG  1 
ATOM   5372 O OD1 . ASN B 1 150 ? 5.41984   -0.65847  -52.00305 1.000 73.72773  ? 150 ASN B OD1 1 
ATOM   5373 N ND2 . ASN B 1 150 ? 4.06656   -0.13441  -53.72293 1.000 40.44946  ? 150 ASN B ND2 1 
ATOM   5374 N N   . TYR B 1 151 ? 8.82940   2.11821   -51.94220 1.000 29.82820  ? 151 TYR B N   1 
ATOM   5375 C CA  . TYR B 1 151 ? 10.26302  2.31172   -52.08234 1.000 36.54188  ? 151 TYR B CA  1 
ATOM   5376 C C   . TYR B 1 151 ? 10.95859  0.99186   -51.77788 1.000 38.40506  ? 151 TYR B C   1 
ATOM   5377 O O   . TYR B 1 151 ? 10.47078  0.19654   -50.97411 1.000 40.94859  ? 151 TYR B O   1 
ATOM   5378 C CB  . TYR B 1 151 ? 10.78287  3.45924   -51.18695 1.000 35.90107  ? 151 TYR B CB  1 
ATOM   5379 C CG  . TYR B 1 151 ? 10.58616  3.23401   -49.70895 1.000 42.71441  ? 151 TYR B CG  1 
ATOM   5380 C CD1 . TYR B 1 151 ? 9.39443   3.57452   -49.08164 1.000 42.54064  ? 151 TYR B CD1 1 
ATOM   5381 C CD2 . TYR B 1 151 ? 11.59186  2.67304   -48.93860 1.000 46.32621  ? 151 TYR B CD2 1 
ATOM   5382 C CE1 . TYR B 1 151 ? 9.21464   3.35502   -47.73291 1.000 40.07835  ? 151 TYR B CE1 1 
ATOM   5383 C CE2 . TYR B 1 151 ? 11.41890  2.45038   -47.58364 1.000 42.24930  ? 151 TYR B CE2 1 
ATOM   5384 C CZ  . TYR B 1 151 ? 10.23122  2.78660   -46.98989 1.000 39.64883  ? 151 TYR B CZ  1 
ATOM   5385 O OH  . TYR B 1 151 ? 10.07841  2.56338   -45.64442 1.000 41.18431  ? 151 TYR B OH  1 
ATOM   5386 N N   . ARG B 1 152 ? 12.07221  0.74025   -52.47191 1.000 40.11616  ? 152 ARG B N   1 
ATOM   5387 C CA  . ARG B 1 152 ? 12.81394  -0.50353  -52.28107 1.000 41.73550  ? 152 ARG B CA  1 
ATOM   5388 C C   . ARG B 1 152 ? 13.27726  -0.62627  -50.82974 1.000 42.94776  ? 152 ARG B C   1 
ATOM   5389 O O   . ARG B 1 152 ? 13.74500  0.34193   -50.21594 1.000 34.87841  ? 152 ARG B O   1 
ATOM   5390 C CB  . ARG B 1 152 ? 14.02173  -0.56456  -53.22849 1.000 33.68518  ? 152 ARG B CB  1 
ATOM   5391 C CG  . ARG B 1 152 ? 13.69725  -0.85632  -54.69147 1.000 37.18056  ? 152 ARG B CG  1 
ATOM   5392 C CD  . ARG B 1 152 ? 14.93959  -0.74417  -55.59074 1.000 39.55443  ? 152 ARG B CD  1 
ATOM   5393 N NE  . ARG B 1 152 ? 15.22004  0.64634   -55.95369 1.000 40.35464  ? 152 ARG B NE  1 
ATOM   5394 C CZ  . ARG B 1 152 ? 16.30758  1.05277   -56.60310 1.000 43.51640  ? 152 ARG B CZ  1 
ATOM   5395 N NH1 . ARG B 1 152 ? 17.24496  0.18323   -56.96553 1.000 40.65768  ? 152 ARG B NH1 1 
ATOM   5396 N NH2 . ARG B 1 152 ? 16.46333  2.33911   -56.87718 1.000 45.91807  ? 152 ARG B NH2 1 
ATOM   5397 N N   . VAL B 1 153 ? 13.12821  -1.82472  -50.27327 1.000 42.00028  ? 153 VAL B N   1 
ATOM   5398 C CA  . VAL B 1 153 ? 13.49969  -2.09396  -48.89259 1.000 31.73860  ? 153 VAL B CA  1 
ATOM   5399 C C   . VAL B 1 153 ? 14.55540  -3.18951  -48.88598 1.000 42.48660  ? 153 VAL B C   1 
ATOM   5400 O O   . VAL B 1 153 ? 14.84848  -3.80880  -49.91440 1.000 59.73659  ? 153 VAL B O   1 
ATOM   5401 C CB  . VAL B 1 153 ? 12.28975  -2.49937  -48.02692 1.000 30.72168  ? 153 VAL B CB  1 
ATOM   5402 C CG1 . VAL B 1 153 ? 11.33741  -1.32219  -47.85542 1.000 31.55651  ? 153 VAL B CG1 1 
ATOM   5403 C CG2 . VAL B 1 153 ? 11.55314  -3.67827  -48.64723 1.000 31.14405  ? 153 VAL B CG2 1 
ATOM   5404 N N   . GLY B 1 154 ? 15.12033  -3.42944  -47.70035 1.000 38.73970  ? 154 GLY B N   1 
ATOM   5405 C CA  . GLY B 1 154 ? 16.07688  -4.51082  -47.53696 1.000 43.98313  ? 154 GLY B CA  1 
ATOM   5406 C C   . GLY B 1 154 ? 17.34159  -4.28808  -48.35064 1.000 43.70631  ? 154 GLY B C   1 
ATOM   5407 O O   . GLY B 1 154 ? 17.73800  -3.15123  -48.63179 1.000 42.71650  ? 154 GLY B O   1 
ATOM   5408 N N   . THR B 1 155 ? 17.98754  -5.39963  -48.73471 1.000 44.78639  ? 155 THR B N   1 
ATOM   5409 C CA  . THR B 1 155 ? 19.18683  -5.30989  -49.56695 1.000 48.92458  ? 155 THR B CA  1 
ATOM   5410 C C   . THR B 1 155 ? 18.92969  -4.50748  -50.83622 1.000 48.04977  ? 155 THR B C   1 
ATOM   5411 O O   . THR B 1 155 ? 19.80834  -3.77271  -51.30872 1.000 48.91153  ? 155 THR B O   1 
ATOM   5412 C CB  . THR B 1 155 ? 19.67273  -6.70122  -49.96027 1.000 47.49371  ? 155 THR B CB  1 
ATOM   5413 O OG1 . THR B 1 155 ? 18.56086  -7.45172  -50.45095 1.000 45.22012  ? 155 THR B OG1 1 
ATOM   5414 C CG2 . THR B 1 155 ? 20.31703  -7.42686  -48.77350 1.000 37.58307  ? 155 THR B CG2 1 
ATOM   5415 N N   . PHE B 1 156 ? 17.72501  -4.61518  -51.38679 1.000 39.27423  ? 156 PHE B N   1 
ATOM   5416 C CA  . PHE B 1 156 ? 17.44308  -3.96211  -52.65551 1.000 42.67529  ? 156 PHE B CA  1 
ATOM   5417 C C   . PHE B 1 156 ? 17.41326  -2.45013  -52.53081 1.000 45.18082  ? 156 PHE B C   1 
ATOM   5418 O O   . PHE B 1 156 ? 17.71572  -1.75179  -53.50256 1.000 52.65766  ? 156 PHE B O   1 
ATOM   5419 C CB  . PHE B 1 156 ? 16.13043  -4.49048  -53.20545 1.000 44.08463  ? 156 PHE B CB  1 
ATOM   5420 C CG  . PHE B 1 156 ? 16.05884  -5.98068  -53.19461 1.000 45.83541  ? 156 PHE B CG  1 
ATOM   5421 C CD1 . PHE B 1 156 ? 16.62330  -6.72017  -54.22420 1.000 43.08406  ? 156 PHE B CD1 1 
ATOM   5422 C CD2 . PHE B 1 156 ? 15.47865  -6.64791  -52.13190 1.000 46.58838  ? 156 PHE B CD2 1 
ATOM   5423 C CE1 . PHE B 1 156 ? 16.58015  -8.09995  -54.21252 1.000 45.01935  ? 156 PHE B CE1 1 
ATOM   5424 C CE2 . PHE B 1 156 ? 15.43342  -8.02837  -52.11682 1.000 52.71783  ? 156 PHE B CE2 1 
ATOM   5425 C CZ  . PHE B 1 156 ? 15.98936  -8.75800  -53.15806 1.000 48.35631  ? 156 PHE B CZ  1 
ATOM   5426 N N   . GLY B 1 157 ? 17.05629  -1.92712  -51.36334 1.000 44.92766  ? 157 GLY B N   1 
ATOM   5427 C CA  . GLY B 1 157 ? 16.95507  -0.49023  -51.19380 1.000 43.79489  ? 157 GLY B CA  1 
ATOM   5428 C C   . GLY B 1 157 ? 18.18443  0.15217   -50.58139 1.000 48.57212  ? 157 GLY B C   1 
ATOM   5429 O O   . GLY B 1 157 ? 18.49218  1.32273   -50.85470 1.000 45.54762  ? 157 GLY B O   1 
ATOM   5430 N N   . PHE B 1 158 ? 18.90992  -0.61188  -49.75250 1.000 46.18844  ? 158 PHE B N   1 
ATOM   5431 C CA  . PHE B 1 158 ? 19.90717  -0.00038  -48.89264 1.000 38.28171  ? 158 PHE B CA  1 
ATOM   5432 C C   . PHE B 1 158 ? 21.21823  -0.75716  -48.78061 1.000 40.53077  ? 158 PHE B C   1 
ATOM   5433 O O   . PHE B 1 158 ? 22.10631  -0.28676  -48.05975 1.000 42.89193  ? 158 PHE B O   1 
ATOM   5434 C CB  . PHE B 1 158 ? 19.30738  0.22704   -47.49826 1.000 38.01538  ? 158 PHE B CB  1 
ATOM   5435 C CG  . PHE B 1 158 ? 18.12523  1.15473   -47.51164 1.000 37.64592  ? 158 PHE B CG  1 
ATOM   5436 C CD1 . PHE B 1 158 ? 18.30548  2.53000   -47.53852 1.000 38.71489  ? 158 PHE B CD1 1 
ATOM   5437 C CD2 . PHE B 1 158 ? 16.83745  0.65669   -47.54081 1.000 34.98591  ? 158 PHE B CD2 1 
ATOM   5438 C CE1 . PHE B 1 158 ? 17.21514  3.38759   -47.57311 1.000 39.59018  ? 158 PHE B CE1 1 
ATOM   5439 C CE2 . PHE B 1 158 ? 15.74549  1.51398   -47.57333 1.000 35.47598  ? 158 PHE B CE2 1 
ATOM   5440 C CZ  . PHE B 1 158 ? 15.93291  2.87413   -47.59447 1.000 33.94777  ? 158 PHE B CZ  1 
ATOM   5441 N N   . LEU B 1 159 ? 21.39381  -1.88088  -49.47585 1.000 38.37320  ? 159 LEU B N   1 
ATOM   5442 C CA  . LEU B 1 159 ? 22.72105  -2.48425  -49.53216 1.000 39.26351  ? 159 LEU B CA  1 
ATOM   5443 C C   . LEU B 1 159 ? 23.68654  -1.53538  -50.23241 1.000 46.92800  ? 159 LEU B C   1 
ATOM   5444 O O   . LEU B 1 159 ? 23.44259  -1.11866  -51.36852 1.000 64.80523  ? 159 LEU B O   1 
ATOM   5445 C CB  . LEU B 1 159 ? 22.67563  -3.82282  -50.25305 1.000 38.37621  ? 159 LEU B CB  1 
ATOM   5446 C CG  . LEU B 1 159 ? 24.02295  -4.54438  -50.33500 1.000 45.54729  ? 159 LEU B CG  1 
ATOM   5447 C CD1 . LEU B 1 159 ? 23.89004  -6.01495  -49.89231 1.000 49.08104  ? 159 LEU B CD1 1 
ATOM   5448 C CD2 . LEU B 1 159 ? 24.60787  -4.44915  -51.73519 1.000 40.85805  ? 159 LEU B CD2 1 
ATOM   5449 N N   . ALA B 1 160 ? 24.77718  -1.18735  -49.55058 1.000 49.29477  ? 160 ALA B N   1 
ATOM   5450 C CA  . ALA B 1 160 ? 25.72993  -0.18860  -50.02469 1.000 49.66915  ? 160 ALA B CA  1 
ATOM   5451 C C   . ALA B 1 160 ? 27.15170  -0.70536  -49.89782 1.000 54.96051  ? 160 ALA B C   1 
ATOM   5452 O O   . ALA B 1 160 ? 27.55741  -1.16197  -48.82421 1.000 63.14182  ? 160 ALA B O   1 
ATOM   5453 C CB  . ALA B 1 160 ? 25.62212  1.12054   -49.23667 1.000 45.89222  ? 160 ALA B CB  1 
ATOM   5454 N N   . LEU B 1 161 ? 27.89439  -0.64162  -50.99106 1.000 53.82984  ? 161 LEU B N   1 
ATOM   5455 C CA  . LEU B 1 161 ? 29.34190  -0.63326  -50.89616 1.000 52.76882  ? 161 LEU B CA  1 
ATOM   5456 C C   . LEU B 1 161 ? 29.78422  0.80449   -51.11590 1.000 52.35840  ? 161 LEU B C   1 
ATOM   5457 O O   . LEU B 1 161 ? 30.03690  1.21057   -52.25648 1.000 47.30298  ? 161 LEU B O   1 
ATOM   5458 C CB  . LEU B 1 161 ? 29.96600  -1.60160  -51.89410 1.000 48.37586  ? 161 LEU B CB  1 
ATOM   5459 C CG  . LEU B 1 161 ? 29.65384  -2.98742  -51.33742 1.000 54.00399  ? 161 LEU B CG  1 
ATOM   5460 C CD1 . LEU B 1 161 ? 28.92199  -3.87584  -52.30014 1.000 55.48591  ? 161 LEU B CD1 1 
ATOM   5461 C CD2 . LEU B 1 161 ? 30.91547  -3.65316  -50.83552 1.000 62.39460  ? 161 LEU B CD2 1 
ATOM   5462 N N   . PRO B 1 162 ? 29.87202  1.59791   -50.04530 1.000 52.96820  ? 162 PRO B N   1 
ATOM   5463 C CA  . PRO B 1 162 ? 30.00109  3.05508   -50.19691 1.000 50.35591  ? 162 PRO B CA  1 
ATOM   5464 C C   . PRO B 1 162 ? 31.12389  3.43817   -51.14266 1.000 48.46905  ? 162 PRO B C   1 
ATOM   5465 O O   . PRO B 1 162 ? 32.16527  2.78743   -51.18790 1.000 47.87927  ? 162 PRO B O   1 
ATOM   5466 C CB  . PRO B 1 162 ? 30.28161  3.53173   -48.76823 1.000 43.22535  ? 162 PRO B CB  1 
ATOM   5467 C CG  . PRO B 1 162 ? 29.61895  2.48981   -47.90747 1.000 40.39774  ? 162 PRO B CG  1 
ATOM   5468 C CD  . PRO B 1 162 ? 29.82603  1.18619   -48.63228 1.000 43.73862  ? 162 PRO B CD  1 
ATOM   5469 N N   . GLY B 1 163 ? 30.88874  4.49023   -51.92586 1.000 55.62531  ? 163 GLY B N   1 
ATOM   5470 C CA  . GLY B 1 163 ? 31.87384  4.98089   -52.87056 1.000 55.72279  ? 163 GLY B CA  1 
ATOM   5471 C C   . GLY B 1 163 ? 32.05880  4.12643   -54.10232 1.000 60.94158  ? 163 GLY B C   1 
ATOM   5472 O O   . GLY B 1 163 ? 32.85139  4.49537   -54.98849 1.000 54.05054  ? 163 GLY B O   1 
ATOM   5473 N N   . SER B 1 164 ? 31.40165  2.97432   -54.16739 1.000 61.66302  ? 164 SER B N   1 
ATOM   5474 C CA  . SER B 1 164 ? 31.24475  2.29488   -55.43607 1.000 68.56265  ? 164 SER B CA  1 
ATOM   5475 C C   . SER B 1 164 ? 30.23622  3.05613   -56.27678 1.000 61.58673  ? 164 SER B C   1 
ATOM   5476 O O   . SER B 1 164 ? 29.48256  3.89717   -55.77149 1.000 60.17738  ? 164 SER B O   1 
ATOM   5477 C CB  . SER B 1 164 ? 30.75473  0.86459   -55.23548 1.000 69.81338  ? 164 SER B CB  1 
ATOM   5478 O OG  . SER B 1 164 ? 29.46539  0.86590   -54.64321 1.000 63.61117  ? 164 SER B OG  1 
ATOM   5479 N N   . ARG B 1 165 ? 30.21474  2.75121   -57.57071 1.000 57.84912  ? 165 ARG B N   1 
ATOM   5480 C CA  . ARG B 1 165 ? 29.19105  3.32272   -58.42851 1.000 67.35956  ? 165 ARG B CA  1 
ATOM   5481 C C   . ARG B 1 165 ? 28.06550  2.34393   -58.74096 1.000 63.26850  ? 165 ARG B C   1 
ATOM   5482 O O   . ARG B 1 165 ? 27.01470  2.77465   -59.23018 1.000 67.26462  ? 165 ARG B O   1 
ATOM   5483 C CB  . ARG B 1 165 ? 29.81244  3.85679   -59.72937 1.000 84.47908  ? 165 ARG B CB  1 
ATOM   5484 C CG  . ARG B 1 165 ? 30.08756  5.38162   -59.70287 1.000 93.33333  ? 165 ARG B CG  1 
ATOM   5485 C CD  . ARG B 1 165 ? 30.88069  5.83317   -58.44000 1.000 90.64092  ? 165 ARG B CD  1 
ATOM   5486 N NE  . ARG B 1 165 ? 31.61669  7.08565   -58.65733 1.000 95.97746  ? 165 ARG B NE  1 
ATOM   5487 C CZ  . ARG B 1 165 ? 32.92796  7.16974   -58.91214 1.000 97.52156  ? 165 ARG B CZ  1 
ATOM   5488 N NH1 . ARG B 1 165 ? 33.68112  6.07391   -58.97332 1.000 93.27089  ? 165 ARG B NH1 1 
ATOM   5489 N NH2 . ARG B 1 165 ? 33.49578  8.35726   -59.10913 1.000 96.35668  ? 165 ARG B NH2 1 
ATOM   5490 N N   . GLU B 1 166 ? 28.23537  1.05561   -58.43062 1.000 58.20203  ? 166 GLU B N   1 
ATOM   5491 C CA  . GLU B 1 166 ? 27.21408  0.05070   -58.71351 1.000 65.65456  ? 166 GLU B CA  1 
ATOM   5492 C C   . GLU B 1 166 ? 26.24124  -0.17196  -57.55890 1.000 63.64768  ? 166 GLU B C   1 
ATOM   5493 O O   . GLU B 1 166 ? 25.21686  -0.84022  -57.75095 1.000 69.73516  ? 166 GLU B O   1 
ATOM   5494 C CB  . GLU B 1 166 ? 27.88140  -1.28006  -59.08211 1.000 68.64916  ? 166 GLU B CB  1 
ATOM   5495 C CG  . GLU B 1 166 ? 28.78976  -1.19124  -60.29881 1.000 76.50253  ? 166 GLU B CG  1 
ATOM   5496 C CD  . GLU B 1 166 ? 30.20834  -0.77270  -59.93528 1.000 83.05500  ? 166 GLU B CD  1 
ATOM   5497 O OE1 . GLU B 1 166 ? 31.10664  -0.96456  -60.77663 1.000 85.66525  ? 166 GLU B OE1 1 
ATOM   5498 O OE2 . GLU B 1 166 ? 30.42494  -0.25589  -58.81047 1.000 79.22885  ? 166 GLU B OE2 1 
ATOM   5499 N N   . ALA B 1 167 ? 26.53419  0.37310   -56.38211 1.000 55.77841  ? 167 ALA B N   1 
ATOM   5500 C CA  . ALA B 1 167 ? 25.80122  0.14039   -55.14527 1.000 58.97151  ? 167 ALA B CA  1 
ATOM   5501 C C   . ALA B 1 167 ? 26.14779  1.25174   -54.16339 1.000 60.74613  ? 167 ALA B C   1 
ATOM   5502 O O   . ALA B 1 167 ? 26.73528  0.99149   -53.10428 1.000 51.32418  ? 167 ALA B O   1 
ATOM   5503 C CB  . ALA B 1 167 ? 26.14940  -1.22400  -54.55225 1.000 56.26747  ? 167 ALA B CB  1 
ATOM   5504 N N   . PRO B 1 168 ? 25.79523  2.50121   -54.47412 1.000 64.05617  ? 168 PRO B N   1 
ATOM   5505 C CA  . PRO B 1 168 ? 26.34524  3.63628   -53.73124 1.000 57.87747  ? 168 PRO B CA  1 
ATOM   5506 C C   . PRO B 1 168 ? 25.59341  3.93938   -52.44965 1.000 52.38771  ? 168 PRO B C   1 
ATOM   5507 O O   . PRO B 1 168 ? 25.96387  4.88331   -51.73964 1.000 39.56644  ? 168 PRO B O   1 
ATOM   5508 C CB  . PRO B 1 168 ? 26.19289  4.77731   -54.74307 1.000 52.37012  ? 168 PRO B CB  1 
ATOM   5509 C CG  . PRO B 1 168 ? 24.88323  4.45396   -55.41574 1.000 51.99416  ? 168 PRO B CG  1 
ATOM   5510 C CD  . PRO B 1 168 ? 24.73029  2.93558   -55.39611 1.000 58.96348  ? 168 PRO B CD  1 
ATOM   5511 N N   . GLY B 1 169 ? 24.53661  3.18542   -52.18524 1.000 45.60246  ? 169 GLY B N   1 
ATOM   5512 C CA  . GLY B 1 169 ? 23.67611  3.29072   -51.02615 1.000 43.22331  ? 169 GLY B CA  1 
ATOM   5513 C C   . GLY B 1 169 ? 22.51941  4.25094   -51.21496 1.000 44.00046  ? 169 GLY B C   1 
ATOM   5514 O O   . GLY B 1 169 ? 22.54203  5.15946   -52.04880 1.000 47.66458  ? 169 GLY B O   1 
ATOM   5515 N N   . ASN B 1 170 ? 21.48493  4.03243   -50.40710 1.000 35.81079  ? 170 ASN B N   1 
ATOM   5516 C CA  . ASN B 1 170 ? 20.36811  4.93488   -50.14947 1.000 42.03626  ? 170 ASN B CA  1 
ATOM   5517 C C   . ASN B 1 170 ? 19.40605  4.99352   -51.32208 1.000 44.16829  ? 170 ASN B C   1 
ATOM   5518 O O   . ASN B 1 170 ? 18.55638  5.91473   -51.38026 1.000 41.36234  ? 170 ASN B O   1 
ATOM   5519 C CB  . ASN B 1 170 ? 20.82430  6.35800   -49.80055 1.000 48.90305  ? 170 ASN B CB  1 
ATOM   5520 C CG  . ASN B 1 170 ? 21.63354  6.41741   -48.51347 1.000 47.97787  ? 170 ASN B CG  1 
ATOM   5521 O OD1 . ASN B 1 170 ? 21.47467  5.57802   -47.62473 1.000 50.94353  ? 170 ASN B OD1 1 
ATOM   5522 N ND2 . ASN B 1 170 ? 22.53567  7.39282   -48.42651 1.000 42.62795  ? 170 ASN B ND2 1 
ATOM   5523 N N   . VAL B 1 171 ? 19.48498  4.04385   -52.25319 1.000 43.41742  ? 171 VAL B N   1 
ATOM   5524 C CA  . VAL B 1 171 ? 18.59837  4.12338   -53.40661 1.000 39.95038  ? 171 VAL B CA  1 
ATOM   5525 C C   . VAL B 1 171 ? 17.14606  4.04256   -52.96616 1.000 39.73781  ? 171 VAL B C   1 
ATOM   5526 O O   . VAL B 1 171 ? 16.26782  4.63770   -53.59745 1.000 39.50784  ? 171 VAL B O   1 
ATOM   5527 C CB  . VAL B 1 171 ? 18.95247  3.03913   -54.43288 1.000 37.96747  ? 171 VAL B CB  1 
ATOM   5528 C CG1 . VAL B 1 171 ? 20.43515  3.11329   -54.76751 1.000 35.00734  ? 171 VAL B CG1 1 
ATOM   5529 C CG2 . VAL B 1 171 ? 18.54960  1.67501   -53.91729 1.000 32.98560  ? 171 VAL B CG2 1 
ATOM   5530 N N   . GLY B 1 172 ? 16.87347  3.36359   -51.85091 1.000 40.24807  ? 172 GLY B N   1 
ATOM   5531 C CA  . GLY B 1 172 ? 15.52768  3.38752   -51.30596 1.000 35.03286  ? 172 GLY B CA  1 
ATOM   5532 C C   . GLY B 1 172 ? 15.04603  4.79751   -51.02157 1.000 32.67289  ? 172 GLY B C   1 
ATOM   5533 O O   . GLY B 1 172 ? 13.87977  5.12384   -51.24542 1.000 28.08823  ? 172 GLY B O   1 
ATOM   5534 N N   . LEU B 1 173 ? 15.93627  5.65906   -50.53322 1.000 33.73504  ? 173 LEU B N   1 
ATOM   5535 C CA  . LEU B 1 173 ? 15.52098  7.03852   -50.31809 1.000 33.47244  ? 173 LEU B CA  1 
ATOM   5536 C C   . LEU B 1 173 ? 15.44097  7.78591   -51.63979 1.000 49.62793  ? 173 LEU B C   1 
ATOM   5537 O O   . LEU B 1 173 ? 14.51962  8.58303   -51.84651 1.000 61.69534  ? 173 LEU B O   1 
ATOM   5538 C CB  . LEU B 1 173 ? 16.47230  7.73930   -49.34390 1.000 35.42109  ? 173 LEU B CB  1 
ATOM   5539 C CG  . LEU B 1 173 ? 16.45104  7.21789   -47.89469 1.000 34.49247  ? 173 LEU B CG  1 
ATOM   5540 C CD1 . LEU B 1 173 ? 17.72662  7.55278   -47.19371 1.000 30.89645  ? 173 LEU B CD1 1 
ATOM   5541 C CD2 . LEU B 1 173 ? 15.27066  7.76434   -47.11368 1.000 35.41433  ? 173 LEU B CD2 1 
ATOM   5542 N N   . LEU B 1 174 ? 16.37654  7.52566   -52.55937 1.000 45.55138  ? 174 LEU B N   1 
ATOM   5543 C CA  . LEU B 1 174 ? 16.25447  8.10222   -53.89143 1.000 40.14378  ? 174 LEU B CA  1 
ATOM   5544 C C   . LEU B 1 174 ? 14.97404  7.65622   -54.59579 1.000 39.63312  ? 174 LEU B C   1 
ATOM   5545 O O   . LEU B 1 174 ? 14.51614  8.33698   -55.52004 1.000 40.47429  ? 174 LEU B O   1 
ATOM   5546 C CB  . LEU B 1 174 ? 17.48102  7.74453   -54.72763 1.000 33.76855  ? 174 LEU B CB  1 
ATOM   5547 C CG  . LEU B 1 174 ? 18.73191  8.45374   -54.20563 1.000 38.23519  ? 174 LEU B CG  1 
ATOM   5548 C CD1 . LEU B 1 174 ? 19.94139  8.06369   -55.01370 1.000 38.81142  ? 174 LEU B CD1 1 
ATOM   5549 C CD2 . LEU B 1 174 ? 18.57055  9.97299   -54.17931 1.000 37.12893  ? 174 LEU B CD2 1 
ATOM   5550 N N   . ASP B 1 175 ? 14.39494  6.52383   -54.19135 1.000 33.35486  ? 175 ASP B N   1 
ATOM   5551 C CA  . ASP B 1 175 ? 13.07898  6.14150   -54.69149 1.000 34.82577  ? 175 ASP B CA  1 
ATOM   5552 C C   . ASP B 1 175 ? 12.00751  7.10416   -54.19597 1.000 41.47237  ? 175 ASP B C   1 
ATOM   5553 O O   . ASP B 1 175 ? 11.23834  7.66042   -54.99478 1.000 43.57238  ? 175 ASP B O   1 
ATOM   5554 C CB  . ASP B 1 175 ? 12.74910  4.71180   -54.26646 1.000 29.29006  ? 175 ASP B CB  1 
ATOM   5555 C CG  . ASP B 1 175 ? 13.57352  3.65839   -55.00637 1.000 46.64536  ? 175 ASP B CG  1 
ATOM   5556 O OD1 . ASP B 1 175 ? 14.34761  3.99842   -55.93564 1.000 42.18515  ? 175 ASP B OD1 1 
ATOM   5557 O OD2 . ASP B 1 175 ? 13.44821  2.46499   -54.62950 1.000 49.03113  ? 175 ASP B OD2 1 
ATOM   5558 N N   . GLN B 1 176 ? 11.92657  7.28341   -52.87220 1.000 45.84102  ? 176 GLN B N   1 
ATOM   5559 C CA  . GLN B 1 176 ? 11.03422  8.27593   -52.28659 1.000 38.14266  ? 176 GLN B CA  1 
ATOM   5560 C C   . GLN B 1 176 ? 11.23323  9.64693   -52.92725 1.000 41.43687  ? 176 GLN B C   1 
ATOM   5561 O O   . GLN B 1 176 ? 10.26677  10.30904  -53.32050 1.000 39.52431  ? 176 GLN B O   1 
ATOM   5562 C CB  . GLN B 1 176 ? 11.28070  8.35014   -50.78380 1.000 34.34690  ? 176 GLN B CB  1 
ATOM   5563 C CG  . GLN B 1 176 ? 11.39012  6.99572   -50.09276 1.000 47.10388  ? 176 GLN B CG  1 
ATOM   5564 C CD  . GLN B 1 176 ? 11.60930  7.14051   -48.59069 1.000 46.99530  ? 176 GLN B CD  1 
ATOM   5565 O OE1 . GLN B 1 176 ? 11.72130  8.26018   -48.07869 1.000 43.90645  ? 176 GLN B OE1 1 
ATOM   5566 N NE2 . GLN B 1 176 ? 11.67746  6.01215   -47.88183 1.000 39.35086  ? 176 GLN B NE2 1 
ATOM   5567 N N   . ARG B 1 177 ? 12.49096  10.08503  -53.04171 1.000 43.76182  ? 177 ARG B N   1 
ATOM   5568 C CA  . ARG B 1 177 ? 12.78405  11.40100  -53.60644 1.000 43.62665  ? 177 ARG B CA  1 
ATOM   5569 C C   . ARG B 1 177 ? 12.14976  11.57019  -54.98027 1.000 47.74696  ? 177 ARG B C   1 
ATOM   5570 O O   . ARG B 1 177 ? 11.52905  12.60264  -55.26949 1.000 44.21759  ? 177 ARG B O   1 
ATOM   5571 C CB  . ARG B 1 177 ? 14.30062  11.60670  -53.69082 1.000 34.91838  ? 177 ARG B CB  1 
ATOM   5572 C CG  . ARG B 1 177 ? 14.75171  13.06431  -53.66898 1.000 31.26496  ? 177 ARG B CG  1 
ATOM   5573 C CD  . ARG B 1 177 ? 16.07608  13.32039  -54.37371 1.000 43.61098  ? 177 ARG B CD  1 
ATOM   5574 N NE  . ARG B 1 177 ? 17.28844  13.17728  -53.55090 1.000 61.71726  ? 177 ARG B NE  1 
ATOM   5575 C CZ  . ARG B 1 177 ? 17.57630  13.87694  -52.45197 1.000 74.01443  ? 177 ARG B CZ  1 
ATOM   5576 N NH1 . ARG B 1 177 ? 16.74651  14.78758  -51.98120 1.000 84.15530  ? 177 ARG B NH1 1 
ATOM   5577 N NH2 . ARG B 1 177 ? 18.71111  13.65746  -51.80935 1.000 92.70597  ? 177 ARG B NH2 1 
ATOM   5578 N N   . LEU B 1 178 ? 12.29725  10.56137  -55.84036 1.000 45.83052  ? 178 LEU B N   1 
ATOM   5579 C CA  . LEU B 1 178 ? 11.74059  10.64239  -57.18398 1.000 45.23820  ? 178 LEU B CA  1 
ATOM   5580 C C   . LEU B 1 178 ? 10.21759  10.70157  -57.13933 1.000 48.72890  ? 178 LEU B C   1 
ATOM   5581 O O   . LEU B 1 178 ? 9.59091   11.44905  -57.90288 1.000 43.64670  ? 178 LEU B O   1 
ATOM   5582 C CB  . LEU B 1 178 ? 12.23593  9.45358   -58.00586 1.000 40.40777  ? 178 LEU B CB  1 
ATOM   5583 C CG  . LEU B 1 178 ? 11.78776  9.25586   -59.44934 1.000 39.95828  ? 178 LEU B CG  1 
ATOM   5584 C CD1 . LEU B 1 178 ? 12.12796  10.44982  -60.33336 1.000 39.90161  ? 178 LEU B CD1 1 
ATOM   5585 C CD2 . LEU B 1 178 ? 12.42938  7.99491   -59.98070 1.000 38.01221  ? 178 LEU B CD2 1 
ATOM   5586 N N   . ALA B 1 179 ? 9.60197   9.94004   -56.23230 1.000 49.56278  ? 179 ALA B N   1 
ATOM   5587 C CA  . ALA B 1 179 ? 8.16489   10.07661  -56.03481 1.000 39.59614  ? 179 ALA B CA  1 
ATOM   5588 C C   . ALA B 1 179 ? 7.79559   11.50738  -55.66599 1.000 39.89127  ? 179 ALA B C   1 
ATOM   5589 O O   . ALA B 1 179 ? 6.81009   12.04981  -56.17288 1.000 48.13040  ? 179 ALA B O   1 
ATOM   5590 C CB  . ALA B 1 179 ? 7.69191   9.10299   -54.96445 1.000 41.81179  ? 179 ALA B CB  1 
ATOM   5591 N N   . LEU B 1 180 ? 8.58125   12.14124  -54.79314 1.000 42.32297  ? 180 LEU B N   1 
ATOM   5592 C CA  . LEU B 1 180 ? 8.30083   13.52471  -54.41790 1.000 42.09503  ? 180 LEU B CA  1 
ATOM   5593 C C   . LEU B 1 180 ? 8.40902   14.45156  -55.61908 1.000 47.64376  ? 180 LEU B C   1 
ATOM   5594 O O   . LEU B 1 180 ? 7.64151   15.41551  -55.73467 1.000 56.38807  ? 180 LEU B O   1 
ATOM   5595 C CB  . LEU B 1 180 ? 9.25514   13.97703  -53.31712 1.000 38.46284  ? 180 LEU B CB  1 
ATOM   5596 C CG  . LEU B 1 180 ? 8.93109   13.62442  -51.86916 1.000 37.27245  ? 180 LEU B CG  1 
ATOM   5597 C CD1 . LEU B 1 180 ? 8.25823   12.27313  -51.71485 1.000 40.49832  ? 180 LEU B CD1 1 
ATOM   5598 C CD2 . LEU B 1 180 ? 10.21892  13.66287  -51.08749 1.000 36.08045  ? 180 LEU B CD2 1 
ATOM   5599 N N   . GLN B 1 181 ? 9.38035   14.18843  -56.50877 1.000 44.00098  ? 181 GLN B N   1 
ATOM   5600 C CA  A GLN B 1 181 ? 9.51275   14.99039  -57.71994 0.508 42.92684  ? 181 GLN B CA  1 
ATOM   5601 C CA  B GLN B 1 181 ? 9.52070   14.97812  -57.73117 0.492 42.96875  ? 181 GLN B CA  1 
ATOM   5602 C C   . GLN B 1 181 ? 8.35927   14.71679  -58.68220 1.000 48.12147  ? 181 GLN B C   1 
ATOM   5603 O O   . GLN B 1 181 ? 7.86823   15.64234  -59.34626 1.000 47.13168  ? 181 GLN B O   1 
ATOM   5604 C CB  A GLN B 1 181 ? 10.86795  14.72201  -58.38246 0.508 43.62469  ? 181 GLN B CB  1 
ATOM   5605 C CB  B GLN B 1 181 ? 10.86068  14.66266  -58.40413 0.492 43.60180  ? 181 GLN B CB  1 
ATOM   5606 C CG  A GLN B 1 181 ? 12.08831  15.22468  -57.57702 0.508 46.51852  ? 181 GLN B CG  1 
ATOM   5607 C CG  B GLN B 1 181 ? 11.12318  15.35456  -59.74680 0.492 43.15902  ? 181 GLN B CG  1 
ATOM   5608 C CD  A GLN B 1 181 ? 13.42098  14.64379  -58.07026 0.508 47.29350  ? 181 GLN B CD  1 
ATOM   5609 C CD  B GLN B 1 181 ? 11.75307  16.73091  -59.59386 0.492 47.42679  ? 181 GLN B CD  1 
ATOM   5610 O OE1 A GLN B 1 181 ? 13.45580  13.88110  -59.03850 0.508 43.40917  ? 181 GLN B OE1 1 
ATOM   5611 O OE1 B GLN B 1 181 ? 11.29696  17.69743  -60.20246 0.492 48.44509  ? 181 GLN B OE1 1 
ATOM   5612 N NE2 A GLN B 1 181 ? 14.51685  15.00574  -57.40136 0.508 36.14751  ? 181 GLN B NE2 1 
ATOM   5613 N NE2 B GLN B 1 181 ? 12.80202  16.82701  -58.77625 0.492 47.11844  ? 181 GLN B NE2 1 
ATOM   5614 N N   . TRP B 1 182 ? 7.89740   13.45543  -58.75381 1.000 47.59751  ? 182 TRP B N   1 
ATOM   5615 C CA  . TRP B 1 182 ? 6.71630   13.13591  -59.55440 1.000 38.81431  ? 182 TRP B CA  1 
ATOM   5616 C C   . TRP B 1 182 ? 5.50243   13.90627  -59.06191 1.000 41.81196  ? 182 TRP B C   1 
ATOM   5617 O O   . TRP B 1 182 ? 4.74058   14.45638  -59.86627 1.000 44.52860  ? 182 TRP B O   1 
ATOM   5618 C CB  . TRP B 1 182 ? 6.42959   11.63532  -59.52277 1.000 39.63298  ? 182 TRP B CB  1 
ATOM   5619 C CG  . TRP B 1 182 ? 5.30506   11.20519  -60.46083 1.000 40.44913  ? 182 TRP B CG  1 
ATOM   5620 C CD1 . TRP B 1 182 ? 5.44413   10.70315  -61.71670 1.000 37.85611  ? 182 TRP B CD1 1 
ATOM   5621 C CD2 . TRP B 1 182 ? 3.89195   11.22088  -60.19358 1.000 44.48571  ? 182 TRP B CD2 1 
ATOM   5622 N NE1 . TRP B 1 182 ? 4.21427   10.42225  -62.26191 1.000 44.64383  ? 182 TRP B NE1 1 
ATOM   5623 C CE2 . TRP B 1 182 ? 3.24348   10.73450  -61.35395 1.000 46.92448  ? 182 TRP B CE2 1 
ATOM   5624 C CE3 . TRP B 1 182 ? 3.11389   11.61188  -59.09859 1.000 35.42040  ? 182 TRP B CE3 1 
ATOM   5625 C CZ2 . TRP B 1 182 ? 1.85882   10.62289  -61.44852 1.000 50.43155  ? 182 TRP B CZ2 1 
ATOM   5626 C CZ3 . TRP B 1 182 ? 1.74265   11.50016  -59.19197 1.000 36.26889  ? 182 TRP B CZ3 1 
ATOM   5627 C CH2 . TRP B 1 182 ? 1.12357   11.00746  -60.35773 1.000 48.31685  ? 182 TRP B CH2 1 
ATOM   5628 N N   . VAL B 1 183 ? 5.30862   13.95915  -57.73821 1.000 46.65850  ? 183 VAL B N   1 
ATOM   5629 C CA  . VAL B 1 183 ? 4.22513   14.75769  -57.16917 1.000 45.13080  ? 183 VAL B CA  1 
ATOM   5630 C C   . VAL B 1 183 ? 4.35825   16.21746  -57.59264 1.000 49.08103  ? 183 VAL B C   1 
ATOM   5631 O O   . VAL B 1 183 ? 3.36963   16.86603  -57.94578 1.000 51.86641  ? 183 VAL B O   1 
ATOM   5632 C CB  . VAL B 1 183 ? 4.18846   14.60086  -55.63778 1.000 39.42604  ? 183 VAL B CB  1 
ATOM   5633 C CG1 . VAL B 1 183 ? 3.34244   15.72193  -54.99526 1.000 39.67149  ? 183 VAL B CG1 1 
ATOM   5634 C CG2 . VAL B 1 183 ? 3.65114   13.21802  -55.27524 1.000 33.78228  ? 183 VAL B CG2 1 
ATOM   5635 N N   . GLN B 1 184 ? 5.58079   16.74933  -57.60137 1.000 47.59226  ? 184 GLN B N   1 
ATOM   5636 C CA  . GLN B 1 184 ? 5.76248   18.14504  -57.98783 1.000 50.33999  ? 184 GLN B CA  1 
ATOM   5637 C C   . GLN B 1 184 ? 5.37558   18.36059  -59.44274 1.000 55.73480  ? 184 GLN B C   1 
ATOM   5638 O O   . GLN B 1 184 ? 4.64806   19.30790  -59.77753 1.000 52.93017  ? 184 GLN B O   1 
ATOM   5639 C CB  . GLN B 1 184 ? 7.21073   18.56295  -57.75220 1.000 56.62902  ? 184 GLN B CB  1 
ATOM   5640 C CG  . GLN B 1 184 ? 7.48932   19.01384  -56.34176 1.000 72.03182  ? 184 GLN B CG  1 
ATOM   5641 C CD  . GLN B 1 184 ? 7.37906   20.50893  -56.21678 1.000 74.68664  ? 184 GLN B CD  1 
ATOM   5642 O OE1 . GLN B 1 184 ? 6.56081   21.02399  -55.44214 1.000 65.94597  ? 184 GLN B OE1 1 
ATOM   5643 N NE2 . GLN B 1 184 ? 8.19503   21.22646  -57.00091 1.000 71.34828  ? 184 GLN B NE2 1 
ATOM   5644 N N   . GLU B 1 185 ? 5.85153   17.47896  -60.32258 1.000 59.02793  ? 185 GLU B N   1 
ATOM   5645 C CA  . GLU B 1 185 ? 5.62700   17.65469  -61.74920 1.000 60.79427  ? 185 GLU B CA  1 
ATOM   5646 C C   . GLU B 1 185 ? 4.18174   17.40051  -62.15167 1.000 59.47964  ? 185 GLU B C   1 
ATOM   5647 O O   . GLU B 1 185 ? 3.74748   17.91773  -63.18400 1.000 67.67677  ? 185 GLU B O   1 
ATOM   5648 C CB  . GLU B 1 185 ? 6.55954   16.73633  -62.54293 1.000 63.33926  ? 185 GLU B CB  1 
ATOM   5649 C CG  . GLU B 1 185 ? 8.03265   17.09036  -62.39335 1.000 70.63835  ? 185 GLU B CG  1 
ATOM   5650 C CD  . GLU B 1 185 ? 8.94604   16.01237  -62.93667 1.000 76.58538  ? 185 GLU B CD  1 
ATOM   5651 O OE1 . GLU B 1 185 ? 8.41438   15.01581  -63.48378 1.000 86.43256  ? 185 GLU B OE1 1 
ATOM   5652 O OE2 . GLU B 1 185 ? 10.18488  16.15765  -62.79882 1.000 67.96480  ? 185 GLU B OE2 1 
ATOM   5653 N N   . ASN B 1 186 ? 3.41970   16.65388  -61.35538 1.000 53.39945  ? 186 ASN B N   1 
ATOM   5654 C CA  . ASN B 1 186 ? 2.17396   16.08169  -61.84822 1.000 45.53634  ? 186 ASN B CA  1 
ATOM   5655 C C   . ASN B 1 186 ? 0.96273   16.33530  -60.96727 1.000 49.24002  ? 186 ASN B C   1 
ATOM   5656 O O   . ASN B 1 186 ? -0.16139  16.26862  -61.47051 1.000 48.90401  ? 186 ASN B O   1 
ATOM   5657 C CB  . ASN B 1 186 ? 2.33846   14.57552  -62.01944 1.000 43.14131  ? 186 ASN B CB  1 
ATOM   5658 C CG  . ASN B 1 186 ? 3.22579   14.21070  -63.18783 1.000 50.59557  ? 186 ASN B CG  1 
ATOM   5659 O OD1 . ASN B 1 186 ? 3.11081   14.75464  -64.31275 1.000 52.87486  ? 186 ASN B OD1 1 
ATOM   5660 N ND2 . ASN B 1 186 ? 4.20219   13.35147  -62.90059 1.000 48.22193  ? 186 ASN B ND2 1 
ATOM   5661 N N   . ILE B 1 187 ? 1.15626   16.59908  -59.66683 1.000 49.27493  ? 187 ILE B N   1 
ATOM   5662 C CA  . ILE B 1 187 ? 0.01899   16.54840  -58.74786 1.000 41.70721  ? 187 ILE B CA  1 
ATOM   5663 C C   . ILE B 1 187 ? -1.04763  17.57036  -59.12427 1.000 44.41623  ? 187 ILE B C   1 
ATOM   5664 O O   . ILE B 1 187 ? -2.24204  17.32633  -58.91223 1.000 43.36099  ? 187 ILE B O   1 
ATOM   5665 C CB  . ILE B 1 187 ? 0.48152   16.71090  -57.28416 1.000 46.17830  ? 187 ILE B CB  1 
ATOM   5666 C CG1 . ILE B 1 187 ? -0.49048  15.97930  -56.37154 1.000 43.82905  ? 187 ILE B CG1 1 
ATOM   5667 C CG2 . ILE B 1 187 ? 0.60300   18.18735  -56.88908 1.000 52.95780  ? 187 ILE B CG2 1 
ATOM   5668 C CD1 . ILE B 1 187 ? -0.74856  14.55889  -56.83898 1.000 36.26841  ? 187 ILE B CD1 1 
ATOM   5669 N N   . ALA B 1 188 ? -0.65305  18.69739  -59.73669 1.000 48.78596  ? 188 ALA B N   1 
ATOM   5670 C CA  . ALA B 1 188 ? -1.63039  19.71221  -60.12928 1.000 44.35618  ? 188 ALA B CA  1 
ATOM   5671 C C   . ALA B 1 188 ? -2.66906  19.15432  -61.09212 1.000 53.06111  ? 188 ALA B C   1 
ATOM   5672 O O   . ALA B 1 188 ? -3.79144  19.66919  -61.15862 1.000 51.34785  ? 188 ALA B O   1 
ATOM   5673 C CB  . ALA B 1 188 ? -0.93173  20.92275  -60.75852 1.000 45.87703  ? 188 ALA B CB  1 
ATOM   5674 N N   . ALA B 1 189 ? -2.32055  18.10525  -61.84491 1.000 53.77621  ? 189 ALA B N   1 
ATOM   5675 C CA  . ALA B 1 189 ? -3.26249  17.51204  -62.78611 1.000 56.24427  ? 189 ALA B CA  1 
ATOM   5676 C C   . ALA B 1 189 ? -4.41477  16.81999  -62.07630 1.000 61.81684  ? 189 ALA B C   1 
ATOM   5677 O O   . ALA B 1 189 ? -5.49243  16.67067  -62.66212 1.000 73.67702  ? 189 ALA B O   1 
ATOM   5678 C CB  . ALA B 1 189 ? -2.54011  16.52480  -63.70502 1.000 48.37898  ? 189 ALA B CB  1 
ATOM   5679 N N   . PHE B 1 190 ? -4.20880  16.39688  -60.83509 1.000 55.64030  ? 190 PHE B N   1 
ATOM   5680 C CA  . PHE B 1 190 ? -5.23853  15.76694  -60.02473 1.000 60.28471  ? 190 PHE B CA  1 
ATOM   5681 C C   . PHE B 1 190 ? -5.98971  16.76212  -59.14740 1.000 60.17862  ? 190 PHE B C   1 
ATOM   5682 O O   . PHE B 1 190 ? -6.89753  16.35852  -58.41528 1.000 62.53684  ? 190 PHE B O   1 
ATOM   5683 C CB  . PHE B 1 190 ? -4.60378  14.68145  -59.15400 1.000 58.99140  ? 190 PHE B CB  1 
ATOM   5684 C CG  . PHE B 1 190 ? -3.88098  13.62135  -59.93995 1.000 51.16078  ? 190 PHE B CG  1 
ATOM   5685 C CD1 . PHE B 1 190 ? -2.58137  13.82278  -60.37108 1.000 47.41536  ? 190 PHE B CD1 1 
ATOM   5686 C CD2 . PHE B 1 190 ? -4.49435  12.41646  -60.23038 1.000 49.14533  ? 190 PHE B CD2 1 
ATOM   5687 C CE1 . PHE B 1 190 ? -1.90555  12.84677  -61.08209 1.000 43.29937  ? 190 PHE B CE1 1 
ATOM   5688 C CE2 . PHE B 1 190 ? -3.81925  11.43246  -60.94665 1.000 51.40819  ? 190 PHE B CE2 1 
ATOM   5689 C CZ  . PHE B 1 190 ? -2.52232  11.65227  -61.37155 1.000 43.93576  ? 190 PHE B CZ  1 
ATOM   5690 N N   . GLY B 1 191 ? -5.64841  18.04976  -59.22596 1.000 54.85011  ? 191 GLY B N   1 
ATOM   5691 C CA  . GLY B 1 191 ? -6.15780  19.05422  -58.32443 1.000 48.92136  ? 191 GLY B CA  1 
ATOM   5692 C C   . GLY B 1 191 ? -5.27122  19.30933  -57.12636 1.000 48.61331  ? 191 GLY B C   1 
ATOM   5693 O O   . GLY B 1 191 ? -5.56228  20.22478  -56.34147 1.000 43.71548  ? 191 GLY B O   1 
ATOM   5694 N N   . GLY B 1 192 ? -4.20831  18.52390  -56.95645 1.000 44.71829  ? 192 GLY B N   1 
ATOM   5695 C CA  . GLY B 1 192 ? -3.28303  18.76355  -55.87051 1.000 42.13614  ? 192 GLY B CA  1 
ATOM   5696 C C   . GLY B 1 192 ? -2.55014  20.08467  -56.02014 1.000 47.03849  ? 192 GLY B C   1 
ATOM   5697 O O   . GLY B 1 192 ? -2.33268  20.58708  -57.12155 1.000 54.88333  ? 192 GLY B O   1 
ATOM   5698 N N   . ASP B 1 193 ? -2.16780  20.65863  -54.87441 1.000 45.44210  ? 193 ASP B N   1 
ATOM   5699 C CA  . ASP B 1 193 ? -1.42638  21.90882  -54.80222 1.000 43.36074  ? 193 ASP B CA  1 
ATOM   5700 C C   . ASP B 1 193 ? 0.04560   21.57083  -54.62147 1.000 49.90367  ? 193 ASP B C   1 
ATOM   5701 O O   . ASP B 1 193 ? 0.45547   21.20217  -53.51019 1.000 53.81339  ? 193 ASP B O   1 
ATOM   5702 C CB  . ASP B 1 193 ? -1.93699  22.75973  -53.63634 1.000 49.94369  ? 193 ASP B CB  1 
ATOM   5703 C CG  . ASP B 1 193 ? -1.39520  24.17849  -53.65422 1.000 56.91764  ? 193 ASP B CG  1 
ATOM   5704 O OD1 . ASP B 1 193 ? -1.77825  24.98727  -52.75193 1.000 59.91336  ? 193 ASP B OD1 1 
ATOM   5705 O OD2 . ASP B 1 193 ? -0.58432  24.47022  -54.56234 1.000 47.09574  ? 193 ASP B OD2 1 
ATOM   5706 N N   . PRO B 1 194 ? 0.88042   21.65198  -55.66555 1.000 50.90344  ? 194 PRO B N   1 
ATOM   5707 C CA  . PRO B 1 194 ? 2.28610   21.24720  -55.49740 1.000 48.68823  ? 194 PRO B CA  1 
ATOM   5708 C C   . PRO B 1 194 ? 3.04242   22.14364  -54.54172 1.000 54.53417  ? 194 PRO B C   1 
ATOM   5709 O O   . PRO B 1 194 ? 4.12221   21.75566  -54.07702 1.000 57.42435  ? 194 PRO B O   1 
ATOM   5710 C CB  . PRO B 1 194 ? 2.85856   21.31728  -56.91793 1.000 49.68035  ? 194 PRO B CB  1 
ATOM   5711 C CG  . PRO B 1 194 ? 1.95989   22.27589  -57.65037 1.000 48.80992  ? 194 PRO B CG  1 
ATOM   5712 C CD  . PRO B 1 194 ? 0.59791   22.17136  -57.01985 1.000 47.99739  ? 194 PRO B CD  1 
ATOM   5713 N N   . MET B 1 195 ? 2.49113   23.30557  -54.20128 1.000 54.46348  ? 195 MET B N   1 
ATOM   5714 C CA  . MET B 1 195 ? 3.12713   24.24016  -53.28864 1.000 56.73843  ? 195 MET B CA  1 
ATOM   5715 C C   . MET B 1 195 ? 2.65411   24.09426  -51.84784 1.000 55.55469  ? 195 MET B C   1 
ATOM   5716 O O   . MET B 1 195 ? 3.03666   24.90387  -50.99884 1.000 60.27856  ? 195 MET B O   1 
ATOM   5717 C CB  . MET B 1 195 ? 2.89554   25.66310  -53.76308 1.000 56.10426  ? 195 MET B CB  1 
ATOM   5718 C CG  . MET B 1 195 ? 3.53084   25.94594  -55.08593 1.000 56.78331  ? 195 MET B CG  1 
ATOM   5719 S SD  . MET B 1 195 ? 3.47412   27.70562  -55.43019 1.000 73.64309  ? 195 MET B SD  1 
ATOM   5720 C CE  . MET B 1 195 ? 2.28067   28.30173  -54.21931 1.000 75.08993  ? 195 MET B CE  1 
ATOM   5721 N N   . SER B 1 196 ? 1.84995   23.08035  -51.54801 1.000 49.55298  ? 196 SER B N   1 
ATOM   5722 C CA  . SER B 1 196 ? 1.50639   22.73231  -50.16921 1.000 47.83500  ? 196 SER B CA  1 
ATOM   5723 C C   . SER B 1 196 ? 1.58541   21.21114  -50.09421 1.000 49.68891  ? 196 SER B C   1 
ATOM   5724 O O   . SER B 1 196 ? 0.58493   20.50895  -50.27010 1.000 55.11654  ? 196 SER B O   1 
ATOM   5725 C CB  . SER B 1 196 ? 0.13352   23.25161  -49.77095 1.000 49.80363  ? 196 SER B CB  1 
ATOM   5726 O OG  . SER B 1 196 ? -0.08840  23.07517  -48.38033 1.000 55.66675  ? 196 SER B OG  1 
ATOM   5727 N N   . VAL B 1 197 ? 2.78557   20.70416  -49.85159 1.000 46.69712  ? 197 VAL B N   1 
ATOM   5728 C CA  . VAL B 1 197 ? 3.02083   19.27001  -49.76786 1.000 45.32664  ? 197 VAL B CA  1 
ATOM   5729 C C   . VAL B 1 197 ? 3.56162   18.96229  -48.38359 1.000 42.00409  ? 197 VAL B C   1 
ATOM   5730 O O   . VAL B 1 197 ? 4.58876   19.51659  -47.97454 1.000 52.10469  ? 197 VAL B O   1 
ATOM   5731 C CB  . VAL B 1 197 ? 3.97876   18.79345  -50.86844 1.000 38.74571  ? 197 VAL B CB  1 
ATOM   5732 C CG1 . VAL B 1 197 ? 4.51085   17.40219  -50.55898 1.000 29.47588  ? 197 VAL B CG1 1 
ATOM   5733 C CG2 . VAL B 1 197 ? 3.24351   18.83543  -52.20395 1.000 32.05929  ? 197 VAL B CG2 1 
ATOM   5734 N N   . THR B 1 198 ? 2.86223   18.09755  -47.66004 1.000 36.64357  ? 198 THR B N   1 
ATOM   5735 C CA  . THR B 1 198 ? 3.26017   17.64090  -46.32998 1.000 32.71218  ? 198 THR B CA  1 
ATOM   5736 C C   . THR B 1 198 ? 3.65880   16.17174  -46.39970 1.000 35.53610  ? 198 THR B C   1 
ATOM   5737 O O   . THR B 1 198 ? 2.82848   15.32504  -46.75965 1.000 38.65476  ? 198 THR B O   1 
ATOM   5738 C CB  . THR B 1 198 ? 2.10485   17.80827  -45.34339 1.000 36.56333  ? 198 THR B CB  1 
ATOM   5739 O OG1 . THR B 1 198 ? 1.67714   19.17468  -45.31511 1.000 44.44294  ? 198 THR B OG1 1 
ATOM   5740 C CG2 . THR B 1 198 ? 2.51434   17.36742  -43.95336 1.000 35.52384  ? 198 THR B CG2 1 
ATOM   5741 N N   . LEU B 1 199 ? 4.91279   15.86250  -46.06044 1.000 26.47597  ? 199 LEU B N   1 
ATOM   5742 C CA  . LEU B 1 199 ? 5.30921   14.46730  -45.86580 1.000 34.97834  ? 199 LEU B CA  1 
ATOM   5743 C C   . LEU B 1 199 ? 4.84242   13.97929  -44.49480 1.000 35.52760  ? 199 LEU B C   1 
ATOM   5744 O O   . LEU B 1 199 ? 4.93251   14.71411  -43.50727 1.000 50.03574  ? 199 LEU B O   1 
ATOM   5745 C CB  . LEU B 1 199 ? 6.82908   14.31887  -45.96141 1.000 25.44841  ? 199 LEU B CB  1 
ATOM   5746 C CG  . LEU B 1 199 ? 7.52251   14.95679  -47.16698 1.000 29.82835  ? 199 LEU B CG  1 
ATOM   5747 C CD1 . LEU B 1 199 ? 9.02630   14.72433  -47.08582 1.000 29.48334  ? 199 LEU B CD1 1 
ATOM   5748 C CD2 . LEU B 1 199 ? 6.96512   14.45402  -48.51610 1.000 26.35067  ? 199 LEU B CD2 1 
ATOM   5749 N N   . PHE B 1 200 ? 4.34307   12.74244  -44.42413 1.000 25.31045  ? 200 PHE B N   1 
ATOM   5750 C CA  . PHE B 1 200 ? 4.10530   12.13151  -43.11952 1.000 39.96783  ? 200 PHE B CA  1 
ATOM   5751 C C   . PHE B 1 200 ? 4.32818   10.62645  -43.18374 1.000 39.43535  ? 200 PHE B C   1 
ATOM   5752 O O   . PHE B 1 200 ? 3.96209   9.97444   -44.16306 1.000 46.63761  ? 200 PHE B O   1 
ATOM   5753 C CB  . PHE B 1 200 ? 2.70587   12.48914  -42.56403 1.000 42.88298  ? 200 PHE B CB  1 
ATOM   5754 C CG  . PHE B 1 200 ? 1.54395   11.71032  -43.14702 1.000 35.39134  ? 200 PHE B CG  1 
ATOM   5755 C CD1 . PHE B 1 200 ? 1.23232   11.78219  -44.48547 1.000 35.88628  ? 200 PHE B CD1 1 
ATOM   5756 C CD2 . PHE B 1 200 ? 0.69971   10.98908  -42.31908 1.000 34.84760  ? 200 PHE B CD2 1 
ATOM   5757 C CE1 . PHE B 1 200 ? 0.13043   11.08979  -44.99625 1.000 39.42469  ? 200 PHE B CE1 1 
ATOM   5758 C CE2 . PHE B 1 200 ? -0.40716  10.30877  -42.82381 1.000 35.59688  ? 200 PHE B CE2 1 
ATOM   5759 C CZ  . PHE B 1 200 ? -0.68651  10.35008  -44.15974 1.000 32.16998  ? 200 PHE B CZ  1 
ATOM   5760 N N   . GLY B 1 201 ? 4.95605   10.09181  -42.13797 1.000 38.24492  ? 201 GLY B N   1 
ATOM   5761 C CA  . GLY B 1 201 ? 5.34627   8.69310   -42.09939 1.000 39.47567  ? 201 GLY B CA  1 
ATOM   5762 C C   . GLY B 1 201 ? 5.58328   8.21789   -40.68202 1.000 43.54585  ? 201 GLY B C   1 
ATOM   5763 O O   . GLY B 1 201 ? 5.61192   9.00262   -39.72971 1.000 48.99206  ? 201 GLY B O   1 
ATOM   5764 N N   . GLU B 1 202 ? 5.76565   6.90146   -40.55760 1.000 43.13662  ? 202 GLU B N   1 
ATOM   5765 C CA  . GLU B 1 202 ? 5.83674   6.23623   -39.26379 1.000 39.81208  ? 202 GLU B CA  1 
ATOM   5766 C C   . GLU B 1 202 ? 6.93858   5.18019   -39.25560 1.000 43.51144  ? 202 GLU B C   1 
ATOM   5767 O O   . GLU B 1 202 ? 7.17705   4.52299   -40.26787 1.000 50.23511  ? 202 GLU B O   1 
ATOM   5768 C CB  . GLU B 1 202 ? 4.48706   5.60775   -38.91983 1.000 30.15930  ? 202 GLU B CB  1 
ATOM   5769 C CG  . GLU B 1 202 ? 4.41289   5.02436   -37.53057 1.000 34.59901  ? 202 GLU B CG  1 
ATOM   5770 C CD  . GLU B 1 202 ? 4.74465   3.56582   -37.52698 1.000 39.96227  ? 202 GLU B CD  1 
ATOM   5771 O OE1 . GLU B 1 202 ? 5.06059   3.04232   -38.60620 1.000 39.80398  ? 202 GLU B OE1 1 
ATOM   5772 O OE2 . GLU B 1 202 ? 4.69710   2.94219   -36.45212 1.000 46.62530  ? 202 GLU B OE2 1 
ATOM   5773 N N   . SER B 1 203 ? 7.59963   5.01753   -38.10721 1.000 43.96002  ? 203 SER B N   1 
ATOM   5774 C CA  . SER B 1 203 ? 8.74095   4.09386   -37.91984 1.000 42.25739  ? 203 SER B CA  1 
ATOM   5775 C C   . SER B 1 203 ? 9.82019   4.44092   -38.94790 1.000 46.68219  ? 203 SER B C   1 
ATOM   5776 O O   . SER B 1 203 ? 10.21059  5.61779   -39.04311 1.000 40.05819  ? 203 SER B O   1 
ATOM   5777 C CB  . SER B 1 203 ? 8.23614   2.66239   -37.95916 1.000 43.06577  ? 203 SER B CB  1 
ATOM   5778 O OG  . SER B 1 203 ? 9.25170   1.76142   -37.54129 1.000 54.24205  ? 203 SER B OG  1 
ATOM   5779 N N   . ALA B 1 204 ? 10.32914  3.47523   -39.72807 1.000 47.02369  ? 204 ALA B N   1 
ATOM   5780 C CA  . ALA B 1 204 ? 11.30701  3.79309   -40.76777 1.000 46.40661  ? 204 ALA B CA  1 
ATOM   5781 C C   . ALA B 1 204 ? 10.81090  4.88552   -41.70752 1.000 44.48619  ? 204 ALA B C   1 
ATOM   5782 O O   . ALA B 1 204 ? 11.61799  5.64367   -42.26653 1.000 39.15440  ? 204 ALA B O   1 
ATOM   5783 C CB  . ALA B 1 204 ? 11.65465  2.54275   -41.57151 1.000 48.28809  ? 204 ALA B CB  1 
ATOM   5784 N N   . GLY B 1 205 ? 9.49268   4.99117   -41.88514 1.000 40.16587  ? 205 GLY B N   1 
ATOM   5785 C CA  . GLY B 1 205 ? 8.95055   6.08919   -42.67378 1.000 47.62177  ? 205 GLY B CA  1 
ATOM   5786 C C   . GLY B 1 205 ? 9.15502   7.44324   -42.01743 1.000 47.19253  ? 205 GLY B C   1 
ATOM   5787 O O   . GLY B 1 205 ? 9.60660   8.39428   -42.66557 1.000 41.18527  ? 205 GLY B O   1 
ATOM   5788 N N   . ALA B 1 206 ? 8.80990   7.55250   -40.72340 1.000 45.70869  ? 206 ALA B N   1 
ATOM   5789 C CA  . ALA B 1 206 ? 9.10334   8.77427   -39.97797 1.000 36.15686  ? 206 ALA B CA  1 
ATOM   5790 C C   . ALA B 1 206 ? 10.58833  9.10462   -40.04283 1.000 32.53636  ? 206 ALA B C   1 
ATOM   5791 O O   . ALA B 1 206 ? 10.96772  10.27140  -40.20909 1.000 26.23098  ? 206 ALA B O   1 
ATOM   5792 C CB  . ALA B 1 206 ? 8.64551   8.63183   -38.52850 1.000 37.31793  ? 206 ALA B CB  1 
ATOM   5793 N N   . ALA B 1 207 ? 11.44273  8.07835   -39.95275 1.000 35.66414  ? 207 ALA B N   1 
ATOM   5794 C CA  . ALA B 1 207 ? 12.87941  8.27690   -40.12439 1.000 32.59508  ? 207 ALA B CA  1 
ATOM   5795 C C   . ALA B 1 207 ? 13.21349  8.82260   -41.50695 1.000 38.92960  ? 207 ALA B C   1 
ATOM   5796 O O   . ALA B 1 207 ? 14.04585  9.73302   -41.63156 1.000 36.63786  ? 207 ALA B O   1 
ATOM   5797 C CB  . ALA B 1 207 ? 13.62083  6.96548   -39.89271 1.000 29.84863  ? 207 ALA B CB  1 
ATOM   5798 N N   . SER B 1 208 ? 12.60670  8.25220   -42.56518 1.000 40.98658  ? 208 SER B N   1 
ATOM   5799 C CA  A SER B 1 208 ? 12.87363  8.72268   -43.92723 0.642 29.24243  ? 208 SER B CA  1 
ATOM   5800 C CA  B SER B 1 208 ? 12.89671  8.72607   -43.91515 0.358 30.02111  ? 208 SER B CA  1 
ATOM   5801 C C   . SER B 1 208 ? 12.47486  10.17978  -44.07642 1.000 33.16711  ? 208 SER B C   1 
ATOM   5802 O O   . SER B 1 208 ? 13.23691  10.99799  -44.60596 1.000 40.16438  ? 208 SER B O   1 
ATOM   5803 C CB  A SER B 1 208 ? 12.12347  7.86906   -44.94776 0.642 24.99158  ? 208 SER B CB  1 
ATOM   5804 C CB  B SER B 1 208 ? 12.20707  7.84037   -44.94746 0.358 25.67219  ? 208 SER B CB  1 
ATOM   5805 O OG  A SER B 1 208 ? 12.57433  6.52749   -44.95180 0.642 26.36446  ? 208 SER B OG  1 
ATOM   5806 O OG  B SER B 1 208 ? 11.02545  8.45166   -45.41478 0.358 24.46767  ? 208 SER B OG  1 
ATOM   5807 N N   . VAL B 1 209 ? 11.26847  10.52091  -43.60202 1.000 34.35867  ? 209 VAL B N   1 
ATOM   5808 C CA  . VAL B 1 209 ? 10.82391  11.91340  -43.58391 1.000 31.28563  ? 209 VAL B CA  1 
ATOM   5809 C C   . VAL B 1 209 ? 11.88680  12.79691  -42.94451 1.000 42.23375  ? 209 VAL B C   1 
ATOM   5810 O O   . VAL B 1 209 ? 12.23400  13.86738  -43.46736 1.000 49.52711  ? 209 VAL B O   1 
ATOM   5811 C CB  . VAL B 1 209 ? 9.47844   12.03146  -42.85106 1.000 26.80144  ? 209 VAL B CB  1 
ATOM   5812 C CG1 . VAL B 1 209 ? 9.15099   13.48095  -42.58271 1.000 33.52407  ? 209 VAL B CG1 1 
ATOM   5813 C CG2 . VAL B 1 209 ? 8.37758   11.36445  -43.65182 1.000 24.29536  ? 209 VAL B CG2 1 
ATOM   5814 N N   . GLY B 1 210 ? 12.45447  12.34273  -41.82842 1.000 40.41096  ? 210 GLY B N   1 
ATOM   5815 C CA  . GLY B 1 210 ? 13.54709  13.08669  -41.22203 1.000 43.20122  ? 210 GLY B CA  1 
ATOM   5816 C C   . GLY B 1 210 ? 14.74523  13.23350  -42.13952 1.000 39.47488  ? 210 GLY B C   1 
ATOM   5817 O O   . GLY B 1 210 ? 15.39780  14.28257  -42.16535 1.000 37.54252  ? 210 GLY B O   1 
ATOM   5818 N N   . MET B 1 211 ? 15.05136  12.18995  -42.91260 1.000 39.28191  ? 211 MET B N   1 
ATOM   5819 C CA  . MET B 1 211 ? 16.20141  12.29026  -43.80033 1.000 39.20539  ? 211 MET B CA  1 
ATOM   5820 C C   . MET B 1 211 ? 15.92609  13.17944  -45.00733 1.000 40.26387  ? 211 MET B C   1 
ATOM   5821 O O   . MET B 1 211 ? 16.87194  13.71591  -45.60000 1.000 41.92436  ? 211 MET B O   1 
ATOM   5822 C CB  . MET B 1 211 ? 16.65484  10.90336  -44.22597 1.000 30.41522  ? 211 MET B CB  1 
ATOM   5823 C CG  . MET B 1 211 ? 17.57283  10.28935  -43.20772 1.000 36.49367  ? 211 MET B CG  1 
ATOM   5824 S SD  . MET B 1 211 ? 17.33737  8.52642   -43.17580 1.000 56.59164  ? 211 MET B SD  1 
ATOM   5825 C CE  . MET B 1 211 ? 17.65303  8.16221   -41.45788 1.000 58.97170  ? 211 MET B CE  1 
ATOM   5826 N N   . HIS B 1 212 ? 14.66186  13.39193  -45.36740 1.000 33.88373  ? 212 HIS B N   1 
ATOM   5827 C CA  . HIS B 1 212 ? 14.40900  14.39788  -46.38678 1.000 38.04936  ? 212 HIS B CA  1 
ATOM   5828 C C   . HIS B 1 212 ? 14.57120  15.80191  -45.80892 1.000 39.41609  ? 212 HIS B C   1 
ATOM   5829 O O   . HIS B 1 212 ? 15.08504  16.69527  -46.48925 1.000 49.86741  ? 212 HIS B O   1 
ATOM   5830 C CB  . HIS B 1 212 ? 13.03213  14.17667  -47.01892 1.000 39.30861  ? 212 HIS B CB  1 
ATOM   5831 C CG  . HIS B 1 212 ? 12.95160  12.92076  -47.83805 1.000 39.07737  ? 212 HIS B CG  1 
ATOM   5832 N ND1 . HIS B 1 212 ? 13.61026  12.77335  -49.04305 1.000 33.44608  ? 212 HIS B ND1 1 
ATOM   5833 C CD2 . HIS B 1 212 ? 12.31767  11.74289  -47.61024 1.000 34.64721  ? 212 HIS B CD2 1 
ATOM   5834 C CE1 . HIS B 1 212 ? 13.37753  11.56432  -49.52511 1.000 33.58106  ? 212 HIS B CE1 1 
ATOM   5835 N NE2 . HIS B 1 212 ? 12.60042  10.91685  -48.67377 1.000 31.97504  ? 212 HIS B NE2 1 
ATOM   5836 N N   . ILE B 1 213 ? 14.18426  16.01017  -44.54419 1.000 36.77056  ? 213 ILE B N   1 
ATOM   5837 C CA  . ILE B 1 213 ? 14.48287  17.28102  -43.87509 1.000 41.18855  ? 213 ILE B CA  1 
ATOM   5838 C C   . ILE B 1 213 ? 15.97719  17.60179  -43.94429 1.000 43.80460  ? 213 ILE B C   1 
ATOM   5839 O O   . ILE B 1 213 ? 16.37739  18.75876  -44.14503 1.000 37.11275  ? 213 ILE B O   1 
ATOM   5840 C CB  . ILE B 1 213 ? 13.98871  17.24897  -42.41489 1.000 39.77160  ? 213 ILE B CB  1 
ATOM   5841 C CG1 . ILE B 1 213 ? 12.46356  17.23765  -42.36883 1.000 43.25491  ? 213 ILE B CG1 1 
ATOM   5842 C CG2 . ILE B 1 213 ? 14.50029  18.45617  -41.65526 1.000 31.19631  ? 213 ILE B CG2 1 
ATOM   5843 C CD1 . ILE B 1 213 ? 11.88796  16.50223  -41.20780 1.000 38.69707  ? 213 ILE B CD1 1 
ATOM   5844 N N   . LEU B 1 214 ? 16.82393  16.58107  -43.79768 1.000 46.02246  ? 214 LEU B N   1 
ATOM   5845 C CA  . LEU B 1 214 ? 18.26246  16.77072  -43.65806 1.000 40.65461  ? 214 LEU B CA  1 
ATOM   5846 C C   . LEU B 1 214 ? 19.03139  16.66551  -44.97460 1.000 46.24405  ? 214 LEU B C   1 
ATOM   5847 O O   . LEU B 1 214 ? 20.24046  16.92320  -44.98250 1.000 60.62254  ? 214 LEU B O   1 
ATOM   5848 C CB  . LEU B 1 214 ? 18.81082  15.75746  -42.63709 1.000 35.17450  ? 214 LEU B CB  1 
ATOM   5849 C CG  . LEU B 1 214 ? 18.16590  15.85437  -41.23537 1.000 35.88413  ? 214 LEU B CG  1 
ATOM   5850 C CD1 . LEU B 1 214 ? 18.62204  14.76129  -40.26571 1.000 31.22598  ? 214 LEU B CD1 1 
ATOM   5851 C CD2 . LEU B 1 214 ? 18.46004  17.22613  -40.62326 1.000 32.69165  ? 214 LEU B CD2 1 
ATOM   5852 N N   . SER B 1 215 ? 18.38039  16.30552  -46.08771 1.000 40.00737  ? 215 SER B N   1 
ATOM   5853 C CA  . SER B 1 215 ? 19.04764  16.20071  -47.38793 1.000 42.97039  ? 215 SER B CA  1 
ATOM   5854 C C   . SER B 1 215 ? 18.61687  17.36733  -48.27862 1.000 42.87916  ? 215 SER B C   1 
ATOM   5855 O O   . SER B 1 215 ? 17.47662  17.39740  -48.75571 1.000 43.38486  ? 215 SER B O   1 
ATOM   5856 C CB  . SER B 1 215 ? 18.72930  14.86189  -48.04863 1.000 46.69144  ? 215 SER B CB  1 
ATOM   5857 O OG  . SER B 1 215 ? 19.55540  14.63428  -49.17664 1.000 51.93494  ? 215 SER B OG  1 
ATOM   5858 N N   . LEU B 1 216 ? 19.52241  18.32182  -48.51120 1.000 41.91985  ? 216 LEU B N   1 
ATOM   5859 C CA  . LEU B 1 216 ? 19.10212  19.57191  -49.14067 1.000 50.15357  ? 216 LEU B CA  1 
ATOM   5860 C C   . LEU B 1 216 ? 18.35879  19.37687  -50.46258 1.000 53.57225  ? 216 LEU B C   1 
ATOM   5861 O O   . LEU B 1 216 ? 17.35845  20.08096  -50.67976 1.000 55.85575  ? 216 LEU B O   1 
ATOM   5862 C CB  . LEU B 1 216 ? 20.30239  20.51135  -49.33218 1.000 58.89283  ? 216 LEU B CB  1 
ATOM   5863 C CG  . LEU B 1 216 ? 19.99352  21.67852  -50.29939 1.000 62.80445  ? 216 LEU B CG  1 
ATOM   5864 C CD1 . LEU B 1 216 ? 19.11889  22.77975  -49.64635 1.000 50.84836  ? 216 LEU B CD1 1 
ATOM   5865 C CD2 . LEU B 1 216 ? 21.25509  22.26015  -50.95973 1.000 65.26022  ? 216 LEU B CD2 1 
ATOM   5866 N N   . PRO B 1 217 ? 18.75668  18.47060  -51.36239 1.000 51.37889  ? 217 PRO B N   1 
ATOM   5867 C CA  . PRO B 1 217 ? 17.96428  18.26261  -52.58634 1.000 45.48382  ? 217 PRO B CA  1 
ATOM   5868 C C   . PRO B 1 217 ? 16.49760  17.91188  -52.35054 1.000 46.81942  ? 217 PRO B C   1 
ATOM   5869 O O   . PRO B 1 217 ? 15.69463  18.06806  -53.27961 1.000 50.08551  ? 217 PRO B O   1 
ATOM   5870 C CB  . PRO B 1 217 ? 18.70034  17.10892  -53.27449 1.000 38.60759  ? 217 PRO B CB  1 
ATOM   5871 C CG  . PRO B 1 217 ? 20.09915  17.28969  -52.85660 1.000 43.78478  ? 217 PRO B CG  1 
ATOM   5872 C CD  . PRO B 1 217 ? 20.04600  17.75907  -51.43838 1.000 50.47947  ? 217 PRO B CD  1 
ATOM   5873 N N   . SER B 1 218 ? 16.11717  17.43144  -51.15799 1.000 48.20423  ? 218 SER B N   1 
ATOM   5874 C CA  . SER B 1 218 ? 14.72036  17.07716  -50.90330 1.000 46.38080  ? 218 SER B CA  1 
ATOM   5875 C C   . SER B 1 218 ? 13.87306  18.27469  -50.51612 1.000 55.58296  ? 218 SER B C   1 
ATOM   5876 O O   . SER B 1 218 ? 12.65045  18.23030  -50.69328 1.000 55.15821  ? 218 SER B O   1 
ATOM   5877 C CB  . SER B 1 218 ? 14.60646  16.03045  -49.79143 1.000 37.98369  ? 218 SER B CB  1 
ATOM   5878 O OG  . SER B 1 218 ? 14.79537  14.70690  -50.26166 1.000 38.59138  ? 218 SER B OG  1 
ATOM   5879 N N   . ARG B 1 219 ? 14.50669  19.33912  -50.01018 1.000 59.40252  ? 219 ARG B N   1 
ATOM   5880 C CA  . ARG B 1 219 ? 13.78730  20.46211  -49.41605 1.000 56.91215  ? 219 ARG B CA  1 
ATOM   5881 C C   . ARG B 1 219 ? 12.91996  21.20843  -50.42729 1.000 56.40267  ? 219 ARG B C   1 
ATOM   5882 O O   . ARG B 1 219 ? 11.91380  21.81594  -50.04614 1.000 56.56479  ? 219 ARG B O   1 
ATOM   5883 C CB  . ARG B 1 219 ? 14.78901  21.41120  -48.75115 1.000 59.13461  ? 219 ARG B CB  1 
ATOM   5884 C CG  . ARG B 1 219 ? 15.57166  20.76703  -47.59583 1.000 61.05041  ? 219 ARG B CG  1 
ATOM   5885 C CD  . ARG B 1 219 ? 14.66974  20.35496  -46.41229 1.000 60.60064  ? 219 ARG B CD  1 
ATOM   5886 N NE  . ARG B 1 219 ? 13.98434  21.47045  -45.74192 1.000 66.14375  ? 219 ARG B NE  1 
ATOM   5887 C CZ  . ARG B 1 219 ? 14.51377  22.22538  -44.77403 1.000 73.00247  ? 219 ARG B CZ  1 
ATOM   5888 N NH1 . ARG B 1 219 ? 15.76108  22.00879  -44.35192 1.000 71.20090  ? 219 ARG B NH1 1 
ATOM   5889 N NH2 . ARG B 1 219 ? 13.79264  23.20553  -44.22587 1.000 74.97667  ? 219 ARG B NH2 1 
ATOM   5890 N N   . SER B 1 220 ? 13.26841  21.17546  -51.71193 1.000 59.18813  ? 220 SER B N   1 
ATOM   5891 C CA  . SER B 1 220 ? 12.44660  21.88644  -52.68577 1.000 58.77474  ? 220 SER B CA  1 
ATOM   5892 C C   . SER B 1 220 ? 11.19793  21.10619  -53.08246 1.000 51.44602  ? 220 SER B C   1 
ATOM   5893 O O   . SER B 1 220 ? 10.43599  21.57462  -53.93822 1.000 52.57686  ? 220 SER B O   1 
ATOM   5894 C CB  . SER B 1 220 ? 13.27991  22.24953  -53.92090 1.000 64.27762  ? 220 SER B CB  1 
ATOM   5895 O OG  . SER B 1 220 ? 14.26065  21.26369  -54.19178 1.000 73.30420  ? 220 SER B OG  1 
ATOM   5896 N N   . LEU B 1 221 ? 10.94553  19.96035  -52.44875 1.000 44.09450  ? 221 LEU B N   1 
ATOM   5897 C CA  . LEU B 1 221 ? 9.83288   19.09405  -52.80465 1.000 42.98180  ? 221 LEU B CA  1 
ATOM   5898 C C   . LEU B 1 221 ? 8.78973   18.96540  -51.70829 1.000 47.98397  ? 221 LEU B C   1 
ATOM   5899 O O   . LEU B 1 221 ? 7.83182   18.20086  -51.88095 1.000 54.74763  ? 221 LEU B O   1 
ATOM   5900 C CB  . LEU B 1 221 ? 10.34605  17.69272  -53.14566 1.000 40.10313  ? 221 LEU B CB  1 
ATOM   5901 C CG  . LEU B 1 221 ? 11.57646  17.69006  -54.03593 1.000 36.64427  ? 221 LEU B CG  1 
ATOM   5902 C CD1 . LEU B 1 221 ? 12.09420  16.26490  -54.17191 1.000 34.71784  ? 221 LEU B CD1 1 
ATOM   5903 C CD2 . LEU B 1 221 ? 11.22143  18.30834  -55.36970 1.000 35.12437  ? 221 LEU B CD2 1 
ATOM   5904 N N   . PHE B 1 222 ? 8.95915   19.64362  -50.57529 1.000 46.65057  ? 222 PHE B N   1 
ATOM   5905 C CA  . PHE B 1 222 ? 7.91077   19.65037  -49.56335 1.000 45.35854  ? 222 PHE B CA  1 
ATOM   5906 C C   . PHE B 1 222 ? 8.05743   20.88999  -48.68914 1.000 42.53828  ? 222 PHE B C   1 
ATOM   5907 O O   . PHE B 1 222 ? 9.04341   21.62618  -48.77682 1.000 46.27404  ? 222 PHE B O   1 
ATOM   5908 C CB  . PHE B 1 222 ? 7.91720   18.36073  -48.73827 1.000 40.58233  ? 222 PHE B CB  1 
ATOM   5909 C CG  . PHE B 1 222 ? 9.14266   18.16286  -47.89767 1.000 39.59369  ? 222 PHE B CG  1 
ATOM   5910 C CD1 . PHE B 1 222 ? 10.33050  17.74378  -48.46648 1.000 36.29269  ? 222 PHE B CD1 1 
ATOM   5911 C CD2 . PHE B 1 222 ? 9.08789   18.34251  -46.51695 1.000 41.58157  ? 222 PHE B CD2 1 
ATOM   5912 C CE1 . PHE B 1 222 ? 11.45654  17.52443  -47.68585 1.000 37.24278  ? 222 PHE B CE1 1 
ATOM   5913 C CE2 . PHE B 1 222 ? 10.20703  18.13551  -45.72492 1.000 39.91623  ? 222 PHE B CE2 1 
ATOM   5914 C CZ  . PHE B 1 222 ? 11.39855  17.72283  -46.31170 1.000 43.31659  ? 222 PHE B CZ  1 
ATOM   5915 N N   . HIS B 1 223 ? 7.02708   21.13737  -47.87501 1.000 39.89516  ? 223 HIS B N   1 
ATOM   5916 C CA  . HIS B 1 223 ? 6.98511   22.30716  -47.00406 1.000 46.03510  ? 223 HIS B CA  1 
ATOM   5917 C C   . HIS B 1 223 ? 6.69928   21.99733  -45.53613 1.000 43.98911  ? 223 HIS B C   1 
ATOM   5918 O O   . HIS B 1 223 ? 7.08520   22.80426  -44.68063 1.000 53.91222  ? 223 HIS B O   1 
ATOM   5919 C CB  . HIS B 1 223 ? 5.94942   23.31360  -47.52570 1.000 58.85834  ? 223 HIS B CB  1 
ATOM   5920 C CG  . HIS B 1 223 ? 5.93851   23.42900  -49.01970 1.000 59.97477  ? 223 HIS B CG  1 
ATOM   5921 N ND1 . HIS B 1 223 ? 5.20010   22.58777  -49.82499 1.000 59.42289  ? 223 HIS B ND1 1 
ATOM   5922 C CD2 . HIS B 1 223 ? 6.60339   24.26277  -49.85519 1.000 61.70130  ? 223 HIS B CD2 1 
ATOM   5923 C CE1 . HIS B 1 223 ? 5.41267   22.89848  -51.09165 1.000 60.97948  ? 223 HIS B CE1 1 
ATOM   5924 N NE2 . HIS B 1 223 ? 6.25499   23.91530  -51.13745 1.000 60.32207  ? 223 HIS B NE2 1 
ATOM   5925 N N   . ARG B 1 224 ? 6.07002   20.86475  -45.20979 1.000 31.45988  ? 224 ARG B N   1 
ATOM   5926 C CA  . ARG B 1 224 ? 5.87423   20.44341  -43.82507 1.000 38.36185  ? 224 ARG B CA  1 
ATOM   5927 C C   . ARG B 1 224 ? 6.17932   18.95473  -43.70422 1.000 40.09946  ? 224 ARG B C   1 
ATOM   5928 O O   . ARG B 1 224 ? 6.28702   18.23158  -44.70114 1.000 45.14325  ? 224 ARG B O   1 
ATOM   5929 C CB  . ARG B 1 224 ? 4.44763   20.72503  -43.33746 1.000 39.12091  ? 224 ARG B CB  1 
ATOM   5930 C CG  . ARG B 1 224 ? 4.07981   22.18334  -43.37393 1.000 45.35815  ? 224 ARG B CG  1 
ATOM   5931 C CD  . ARG B 1 224 ? 2.57087   22.42757  -43.44664 1.000 47.74816  ? 224 ARG B CD  1 
ATOM   5932 N NE  . ARG B 1 224 ? 2.08457   22.73609  -44.79088 1.000 46.74190  ? 224 ARG B NE  1 
ATOM   5933 C CZ  . ARG B 1 224 ? 2.43181   23.81628  -45.48487 1.000 55.31030  ? 224 ARG B CZ  1 
ATOM   5934 N NH1 . ARG B 1 224 ? 3.29016   24.69439  -44.98156 1.000 50.38199  ? 224 ARG B NH1 1 
ATOM   5935 N NH2 . ARG B 1 224 ? 1.93287   24.01506  -46.70007 1.000 66.92013  ? 224 ARG B NH2 1 
ATOM   5936 N N   . ALA B 1 225 ? 6.29871   18.49434  -42.46215 1.000 29.16869  ? 225 ALA B N   1 
ATOM   5937 C CA  . ALA B 1 225 ? 6.65849   17.11311  -42.19600 1.000 29.00643  ? 225 ALA B CA  1 
ATOM   5938 C C   . ALA B 1 225 ? 5.97357   16.63298  -40.92575 1.000 34.74680  ? 225 ALA B C   1 
ATOM   5939 O O   . ALA B 1 225 ? 5.70794   17.40560  -40.00073 1.000 39.08228  ? 225 ALA B O   1 
ATOM   5940 C CB  . ALA B 1 225 ? 8.17908   16.94472  -42.05846 1.000 30.06938  ? 225 ALA B CB  1 
ATOM   5941 N N   . VAL B 1 226 ? 5.69420   15.34226  -40.89780 1.000 28.59002  ? 226 VAL B N   1 
ATOM   5942 C CA  . VAL B 1 226 ? 5.16252   14.67163  -39.72823 1.000 30.83271  ? 226 VAL B CA  1 
ATOM   5943 C C   . VAL B 1 226 ? 5.97384   13.40795  -39.56107 1.000 37.70257  ? 226 VAL B C   1 
ATOM   5944 O O   . VAL B 1 226 ? 6.16209   12.66042  -40.52751 1.000 42.61717  ? 226 VAL B O   1 
ATOM   5945 C CB  . VAL B 1 226 ? 3.66841   14.33828  -39.87307 1.000 33.93491  ? 226 VAL B CB  1 
ATOM   5946 C CG1 . VAL B 1 226 ? 3.14847   13.64798  -38.59420 1.000 42.47494  ? 226 VAL B CG1 1 
ATOM   5947 C CG2 . VAL B 1 226 ? 2.86449   15.60247  -40.21411 1.000 27.99853  ? 226 VAL B CG2 1 
ATOM   5948 N N   . LEU B 1 227 ? 6.47962   13.18697  -38.35528 1.000 30.97635  ? 227 LEU B N   1 
ATOM   5949 C CA  . LEU B 1 227 ? 7.35346   12.05465  -38.07102 1.000 33.62522  ? 227 LEU B CA  1 
ATOM   5950 C C   . LEU B 1 227 ? 6.69158   11.30268  -36.93172 1.000 41.01158  ? 227 LEU B C   1 
ATOM   5951 O O   . LEU B 1 227 ? 6.75842   11.74732  -35.78214 1.000 46.58041  ? 227 LEU B O   1 
ATOM   5952 C CB  . LEU B 1 227 ? 8.76300   12.50554  -37.68934 1.000 31.59644  ? 227 LEU B CB  1 
ATOM   5953 C CG  . LEU B 1 227 ? 9.64834   13.15691  -38.75681 1.000 33.94997  ? 227 LEU B CG  1 
ATOM   5954 C CD1 . LEU B 1 227 ? 9.32513   14.62448  -38.88077 1.000 26.01052  ? 227 LEU B CD1 1 
ATOM   5955 C CD2 . LEU B 1 227 ? 11.13755  12.97627  -38.43158 1.000 29.09269  ? 227 LEU B CD2 1 
ATOM   5956 N N   . GLN B 1 228 ? 6.05272   10.18129  -37.24165 1.000 35.77660  ? 228 GLN B N   1 
ATOM   5957 C CA  . GLN B 1 228 ? 5.32513   9.40859   -36.24184 1.000 39.84492  ? 228 GLN B CA  1 
ATOM   5958 C C   . GLN B 1 228 ? 6.19251   8.24728   -35.76727 1.000 42.32894  ? 228 GLN B C   1 
ATOM   5959 O O   . GLN B 1 228 ? 6.44157   7.30318   -36.52456 1.000 39.13573  ? 228 GLN B O   1 
ATOM   5960 C CB  . GLN B 1 228 ? 4.00524   8.90332   -36.81001 1.000 37.24981  ? 228 GLN B CB  1 
ATOM   5961 C CG  . GLN B 1 228 ? 3.07020   9.99449   -37.23395 1.000 39.56140  ? 228 GLN B CG  1 
ATOM   5962 C CD  . GLN B 1 228 ? 1.87480   9.44721   -37.98160 1.000 45.78761  ? 228 GLN B CD  1 
ATOM   5963 O OE1 . GLN B 1 228 ? 1.38180   10.07434  -38.91882 1.000 41.74851  ? 228 GLN B OE1 1 
ATOM   5964 N NE2 . GLN B 1 228 ? 1.40804   8.25953   -37.58136 1.000 42.03834  ? 228 GLN B NE2 1 
ATOM   5965 N N   . SER B 1 229 ? 6.65326   8.32045   -34.51136 1.000 35.37252  ? 229 SER B N   1 
ATOM   5966 C CA  . SER B 1 229 ? 7.29452   7.18478   -33.84088 1.000 33.26373  ? 229 SER B CA  1 
ATOM   5967 C C   . SER B 1 229 ? 8.57832   6.74661   -34.54005 1.000 35.29254  ? 229 SER B C   1 
ATOM   5968 O O   . SER B 1 229 ? 8.85701   5.55210   -34.66093 1.000 35.86714  ? 229 SER B O   1 
ATOM   5969 C CB  . SER B 1 229 ? 6.33525   5.99710   -33.72019 1.000 38.83189  ? 229 SER B CB  1 
ATOM   5970 O OG  . SER B 1 229 ? 5.15919   6.35764   -33.01805 1.000 47.59377  ? 229 SER B OG  1 
ATOM   5971 N N   . GLY B 1 230 ? 9.37162   7.71244   -34.99190 1.000 33.82593  ? 230 GLY B N   1 
ATOM   5972 C CA  . GLY B 1 230 ? 10.58172  7.40259   -35.72318 1.000 27.27667  ? 230 GLY B CA  1 
ATOM   5973 C C   . GLY B 1 230 ? 11.32940  8.66790   -36.07706 1.000 37.45375  ? 230 GLY B C   1 
ATOM   5974 O O   . GLY B 1 230 ? 10.71519  9.72899   -36.21190 1.000 44.18457  ? 230 GLY B O   1 
ATOM   5975 N N   . THR B 1 231 ? 12.64813  8.57608   -36.22595 1.000 37.41127  ? 231 THR B N   1 
ATOM   5976 C CA  . THR B 1 231 ? 13.51568  9.74073   -36.32755 1.000 36.32229  ? 231 THR B CA  1 
ATOM   5977 C C   . THR B 1 231 ? 14.70988  9.38589   -37.18741 1.000 33.88037  ? 231 THR B C   1 
ATOM   5978 O O   . THR B 1 231 ? 15.07352  8.21240   -37.29281 1.000 36.29879  ? 231 THR B O   1 
ATOM   5979 C CB  . THR B 1 231 ? 14.03765  10.19121  -34.95529 1.000 41.83494  ? 231 THR B CB  1 
ATOM   5980 O OG1 . THR B 1 231 ? 14.85108  9.14423   -34.39992 1.000 29.47238  ? 231 THR B OG1 1 
ATOM   5981 C CG2 . THR B 1 231 ? 12.90617  10.57635  -34.00682 1.000 32.33120  ? 231 THR B CG2 1 
ATOM   5982 N N   . PRO B 1 232 ? 15.36789  10.38048  -37.78602 1.000 38.84166  ? 232 PRO B N   1 
ATOM   5983 C CA  . PRO B 1 232 ? 16.64577  10.09646  -38.46291 1.000 39.27274  ? 232 PRO B CA  1 
ATOM   5984 C C   . PRO B 1 232 ? 17.78816  9.87583   -37.49719 1.000 50.52288  ? 232 PRO B C   1 
ATOM   5985 O O   . PRO B 1 232 ? 18.71161  9.10758   -37.80414 1.000 50.05647  ? 232 PRO B O   1 
ATOM   5986 C CB  . PRO B 1 232 ? 16.87639  11.34642  -39.32044 1.000 37.03418  ? 232 PRO B CB  1 
ATOM   5987 C CG  . PRO B 1 232 ? 16.08343  12.43626  -38.62470 1.000 28.36638  ? 232 PRO B CG  1 
ATOM   5988 C CD  . PRO B 1 232 ? 14.87581  11.74499  -38.05969 1.000 38.07418  ? 232 PRO B CD  1 
ATOM   5989 N N   . ASN B 1 233 ? 17.76248  10.54333  -36.34513 1.000 51.12256  ? 233 ASN B N   1 
ATOM   5990 C CA  . ASN B 1 233 ? 18.77596  10.32922  -35.33202 1.000 46.37056  ? 233 ASN B CA  1 
ATOM   5991 C C   . ASN B 1 233 ? 18.50030  9.00618   -34.62908 1.000 40.83802  ? 233 ASN B C   1 
ATOM   5992 O O   . ASN B 1 233 ? 17.51267  8.31236   -34.90761 1.000 37.74846  ? 233 ASN B O   1 
ATOM   5993 C CB  . ASN B 1 233 ? 18.81594  11.50278  -34.35061 1.000 43.85369  ? 233 ASN B CB  1 
ATOM   5994 C CG  . ASN B 1 233 ? 17.43621  11.91517  -33.86047 1.000 45.70912  ? 233 ASN B CG  1 
ATOM   5995 O OD1 . ASN B 1 233 ? 16.49223  12.04485  -34.63932 1.000 45.14862  ? 233 ASN B OD1 1 
ATOM   5996 N ND2 . ASN B 1 233 ? 17.31730  12.12732  -32.55509 1.000 54.22110  ? 233 ASN B ND2 1 
ATOM   5997 N N   . GLY B 1 234 ? 19.39565  8.63372   -33.72345 1.000 34.45177  ? 234 GLY B N   1 
ATOM   5998 C CA  . GLY B 1 234 ? 19.14478  7.49241   -32.88388 1.000 41.52748  ? 234 GLY B CA  1 
ATOM   5999 C C   . GLY B 1 234 ? 19.90223  6.27215   -33.33802 1.000 46.02188  ? 234 GLY B C   1 
ATOM   6000 O O   . GLY B 1 234 ? 20.70669  6.31923   -34.26943 1.000 53.55642  ? 234 GLY B O   1 
ATOM   6001 N N   . PRO B 1 235 ? 19.65003  5.14041   -32.68364 1.000 46.23657  ? 235 PRO B N   1 
ATOM   6002 C CA  . PRO B 1 235 ? 20.55318  3.99134   -32.84648 1.000 56.02287  ? 235 PRO B CA  1 
ATOM   6003 C C   . PRO B 1 235 ? 20.27168  3.11799   -34.06185 1.000 57.89302  ? 235 PRO B C   1 
ATOM   6004 O O   . PRO B 1 235 ? 21.19358  2.43789   -34.53447 1.000 60.49598  ? 235 PRO B O   1 
ATOM   6005 C CB  . PRO B 1 235 ? 20.36048  3.20807   -31.53788 1.000 60.81057  ? 235 PRO B CB  1 
ATOM   6006 C CG  . PRO B 1 235 ? 18.97749  3.58280   -31.07259 1.000 57.66627  ? 235 PRO B CG  1 
ATOM   6007 C CD  . PRO B 1 235 ? 18.66201  4.95368   -31.60587 1.000 46.49446  ? 235 PRO B CD  1 
ATOM   6008 N N   . TRP B 1 236 ? 19.05986  3.13251   -34.61585 1.000 53.18197  ? 236 TRP B N   1 
ATOM   6009 C CA  . TRP B 1 236 ? 18.68909  2.11235   -35.58180 1.000 42.20003  ? 236 TRP B CA  1 
ATOM   6010 C C   . TRP B 1 236 ? 18.51989  2.61024   -37.01355 1.000 46.07998  ? 236 TRP B C   1 
ATOM   6011 O O   . TRP B 1 236 ? 18.53191  1.78523   -37.92757 1.000 47.08043  ? 236 TRP B O   1 
ATOM   6012 C CB  . TRP B 1 236 ? 17.39192  1.41962   -35.13480 1.000 36.66271  ? 236 TRP B CB  1 
ATOM   6013 C CG  . TRP B 1 236 ? 16.22970  2.35929   -34.98875 1.000 39.71378  ? 236 TRP B CG  1 
ATOM   6014 C CD1 . TRP B 1 236 ? 15.81910  2.98188   -33.85418 1.000 43.09250  ? 236 TRP B CD1 1 
ATOM   6015 C CD2 . TRP B 1 236 ? 15.33201  2.78569   -36.02488 1.000 50.22690  ? 236 TRP B CD2 1 
ATOM   6016 N NE1 . TRP B 1 236 ? 14.72235  3.77355   -34.10894 1.000 46.60995  ? 236 TRP B NE1 1 
ATOM   6017 C CE2 . TRP B 1 236 ? 14.40355  3.67285   -35.43594 1.000 48.48924  ? 236 TRP B CE2 1 
ATOM   6018 C CE3 . TRP B 1 236 ? 15.22139  2.50361   -37.39019 1.000 40.60315  ? 236 TRP B CE3 1 
ATOM   6019 C CZ2 . TRP B 1 236 ? 13.37642  4.27447   -36.16533 1.000 37.44806  ? 236 TRP B CZ2 1 
ATOM   6020 C CZ3 . TRP B 1 236 ? 14.20940  3.10652   -38.10549 1.000 40.78450  ? 236 TRP B CZ3 1 
ATOM   6021 C CH2 . TRP B 1 236 ? 13.29458  3.97486   -37.49094 1.000 39.12417  ? 236 TRP B CH2 1 
ATOM   6022 N N   . ALA B 1 237 ? 18.37871  3.91630   -37.24934 1.000 45.82233  ? 237 ALA B N   1 
ATOM   6023 C CA  . ALA B 1 237 ? 17.95621  4.37397   -38.57252 1.000 43.32014  ? 237 ALA B CA  1 
ATOM   6024 C C   . ALA B 1 237 ? 19.10562  4.59246   -39.56692 1.000 43.99906  ? 237 ALA B C   1 
ATOM   6025 O O   . ALA B 1 237 ? 18.84534  4.73296   -40.77005 1.000 40.52106  ? 237 ALA B O   1 
ATOM   6026 C CB  . ALA B 1 237 ? 17.12170  5.66223   -38.45017 1.000 34.76712  ? 237 ALA B CB  1 
ATOM   6027 N N   . THR B 1 238 ? 20.35983  4.63136   -39.12056 1.000 39.52309  ? 238 THR B N   1 
ATOM   6028 C CA  . THR B 1 238 ? 21.47951  4.82242   -40.03285 1.000 38.78924  ? 238 THR B CA  1 
ATOM   6029 C C   . THR B 1 238 ? 22.62170  3.89172   -39.65568 1.000 45.51078  ? 238 THR B C   1 
ATOM   6030 O O   . THR B 1 238 ? 22.68693  3.36366   -38.54745 1.000 46.79079  ? 238 THR B O   1 
ATOM   6031 C CB  . THR B 1 238 ? 22.01311  6.26171   -40.02744 1.000 36.24811  ? 238 THR B CB  1 
ATOM   6032 O OG1 . THR B 1 238 ? 22.56767  6.56230   -38.73962 1.000 43.97812  ? 238 THR B OG1 1 
ATOM   6033 C CG2 . THR B 1 238 ? 20.92064  7.24122   -40.34406 1.000 31.44125  ? 238 THR B CG2 1 
ATOM   6034 N N   . VAL B 1 239 ? 23.54593  3.70968   -40.59102 1.000 47.20037  ? 239 VAL B N   1 
ATOM   6035 C CA  . VAL B 1 239 ? 24.79800  3.03711   -40.29437 1.000 42.49118  ? 239 VAL B CA  1 
ATOM   6036 C C   . VAL B 1 239 ? 25.91264  3.91541   -40.83247 1.000 38.17479  ? 239 VAL B C   1 
ATOM   6037 O O   . VAL B 1 239 ? 25.68493  4.80979   -41.64959 1.000 37.50892  ? 239 VAL B O   1 
ATOM   6038 C CB  . VAL B 1 239 ? 24.86767  1.63415   -40.91634 1.000 47.19084  ? 239 VAL B CB  1 
ATOM   6039 C CG1 . VAL B 1 239 ? 24.03117  0.66842   -40.11857 1.000 38.19639  ? 239 VAL B CG1 1 
ATOM   6040 C CG2 . VAL B 1 239 ? 24.40103  1.68093   -42.35089 1.000 51.60944  ? 239 VAL B CG2 1 
ATOM   6041 N N   . SER B 1 240 ? 27.12083  3.67191   -40.34134 1.000 40.29161  ? 240 SER B N   1 
ATOM   6042 C CA  . SER B 1 240 ? 28.28064  4.28884   -40.95058 1.000 49.37365  ? 240 SER B CA  1 
ATOM   6043 C C   . SER B 1 240 ? 28.59662  3.57994   -42.25818 1.000 63.45055  ? 240 SER B C   1 
ATOM   6044 O O   . SER B 1 240 ? 28.20672  2.42517   -42.47719 1.000 58.82564  ? 240 SER B O   1 
ATOM   6045 C CB  . SER B 1 240 ? 29.49204  4.17631   -40.05580 1.000 44.51520  ? 240 SER B CB  1 
ATOM   6046 O OG  . SER B 1 240 ? 29.74759  2.80054   -39.87321 1.000 53.48653  ? 240 SER B OG  1 
ATOM   6047 N N   . ALA B 1 241 ? 29.33614  4.28130   -43.12361 1.000 64.57430  ? 241 ALA B N   1 
ATOM   6048 C CA  . ALA B 1 241 ? 29.82366  3.65582   -44.34771 1.000 58.82955  ? 241 ALA B CA  1 
ATOM   6049 C C   . ALA B 1 241 ? 30.66853  2.42836   -44.03593 1.000 57.13982  ? 241 ALA B C   1 
ATOM   6050 O O   . ALA B 1 241 ? 30.54372  1.39787   -44.70959 1.000 49.56201  ? 241 ALA B O   1 
ATOM   6051 C CB  . ALA B 1 241 ? 30.62633  4.66296   -45.16790 1.000 62.49682  ? 241 ALA B CB  1 
ATOM   6052 N N   . GLY B 1 242 ? 31.52809  2.51931   -43.00734 1.000 60.23540  ? 242 GLY B N   1 
ATOM   6053 C CA  . GLY B 1 242 ? 32.33498  1.37280   -42.61907 1.000 54.14078  ? 242 GLY B CA  1 
ATOM   6054 C C   . GLY B 1 242 ? 31.49368  0.14951   -42.30851 1.000 56.24690  ? 242 GLY B C   1 
ATOM   6055 O O   . GLY B 1 242 ? 31.81485  -0.96674  -42.73682 1.000 56.14951  ? 242 GLY B O   1 
ATOM   6056 N N   . GLU B 1 243 ? 30.37724  0.35062   -41.59948 1.000 52.00374  ? 243 GLU B N   1 
ATOM   6057 C CA  . GLU B 1 243 ? 29.55368  -0.77053  -41.15698 1.000 55.73067  ? 243 GLU B CA  1 
ATOM   6058 C C   . GLU B 1 243 ? 28.64752  -1.30152  -42.27030 1.000 51.87900  ? 243 GLU B C   1 
ATOM   6059 O O   . GLU B 1 243 ? 28.40135  -2.51247  -42.33511 1.000 47.96838  ? 243 GLU B O   1 
ATOM   6060 C CB  . GLU B 1 243 ? 28.74019  -0.36254  -39.91570 1.000 58.97308  ? 243 GLU B CB  1 
ATOM   6061 C CG  . GLU B 1 243 ? 27.59605  -1.31679  -39.54258 1.000 53.02891  ? 243 GLU B CG  1 
ATOM   6062 C CD  . GLU B 1 243 ? 28.07460  -2.61979  -38.89581 1.000 54.55568  ? 243 GLU B CD  1 
ATOM   6063 O OE1 . GLU B 1 243 ? 29.29717  -2.79723  -38.68182 1.000 47.42213  ? 243 GLU B OE1 1 
ATOM   6064 O OE2 . GLU B 1 243 ? 27.21492  -3.48483  -38.62518 1.000 53.65780  ? 243 GLU B OE2 1 
ATOM   6065 N N   . ALA B 1 244 ? 28.13315  -0.42470  -43.14556 1.000 54.27865  ? 244 ALA B N   1 
ATOM   6066 C CA  . ALA B 1 244 ? 27.35543  -0.89328  -44.30004 1.000 49.78724  ? 244 ALA B CA  1 
ATOM   6067 C C   . ALA B 1 244 ? 28.21103  -1.77018  -45.19585 1.000 49.94010  ? 244 ALA B C   1 
ATOM   6068 O O   . ALA B 1 244 ? 27.79370  -2.85379  -45.62080 1.000 55.66866  ? 244 ALA B O   1 
ATOM   6069 C CB  . ALA B 1 244 ? 26.81047  0.28578   -45.10875 1.000 39.95484  ? 244 ALA B CB  1 
ATOM   6070 N N   . ARG B 1 245 ? 29.42605  -1.30677  -45.48415 1.000 52.47299  ? 245 ARG B N   1 
ATOM   6071 C CA  . ARG B 1 245 ? 30.35679  -2.09506  -46.27011 1.000 47.11700  ? 245 ARG B CA  1 
ATOM   6072 C C   . ARG B 1 245 ? 30.60992  -3.44175  -45.62747 1.000 62.67795  ? 245 ARG B C   1 
ATOM   6073 O O   . ARG B 1 245 ? 30.73305  -4.44886  -46.33330 1.000 61.62751  ? 245 ARG B O   1 
ATOM   6074 C CB  . ARG B 1 245 ? 31.65700  -1.31469  -46.48668 1.000 49.28235  ? 245 ARG B CB  1 
ATOM   6075 C CG  . ARG B 1 245 ? 32.72272  -2.11114  -47.18340 1.000 51.88754  ? 245 ARG B CG  1 
ATOM   6076 C CD  . ARG B 1 245 ? 33.95812  -1.27672  -47.42706 1.000 54.25286  ? 245 ARG B CD  1 
ATOM   6077 N NE  . ARG B 1 245 ? 33.75486  -0.23131  -48.44842 1.000 70.10655  ? 245 ARG B NE  1 
ATOM   6078 C CZ  . ARG B 1 245 ? 33.62161  -0.42891  -49.77283 1.000 70.31618  ? 245 ARG B CZ  1 
ATOM   6079 N NH1 . ARG B 1 245 ? 33.44501  0.61125   -50.58673 1.000 70.78520  ? 245 ARG B NH1 1 
ATOM   6080 N NH2 . ARG B 1 245 ? 33.67405  -1.64722  -50.30735 1.000 54.62497  ? 245 ARG B NH2 1 
ATOM   6081 N N   . ARG B 1 246 ? 30.65647  -3.48767  -44.28863 1.000 61.42974  ? 246 ARG B N   1 
ATOM   6082 C CA  . ARG B 1 246 ? 30.91464  -4.75544  -43.61238 1.000 58.23564  ? 246 ARG B CA  1 
ATOM   6083 C C   . ARG B 1 246 ? 29.82165  -5.77629  -43.92118 1.000 56.03777  ? 246 ARG B C   1 
ATOM   6084 O O   . ARG B 1 246 ? 30.10636  -6.93489  -44.26034 1.000 50.21638  ? 246 ARG B O   1 
ATOM   6085 C CB  . ARG B 1 246 ? 31.02106  -4.55412  -42.10554 1.000 50.33271  ? 246 ARG B CB  1 
ATOM   6086 C CG  . ARG B 1 246 ? 31.13691  -5.89331  -41.36096 1.000 51.87231  ? 246 ARG B CG  1 
ATOM   6087 C CD  . ARG B 1 246 ? 31.09237  -5.76414  -39.85724 1.000 52.32228  ? 246 ARG B CD  1 
ATOM   6088 N NE  . ARG B 1 246 ? 29.72267  -5.60169  -39.36636 1.000 56.34822  ? 246 ARG B NE  1 
ATOM   6089 C CZ  . ARG B 1 246 ? 28.85324  -6.59446  -39.18161 1.000 53.64264  ? 246 ARG B CZ  1 
ATOM   6090 N NH1 . ARG B 1 246 ? 29.19675  -7.85608  -39.42421 1.000 51.31640  ? 246 ARG B NH1 1 
ATOM   6091 N NH2 . ARG B 1 246 ? 27.63114  -6.31841  -38.73966 1.000 54.17002  ? 246 ARG B NH2 1 
ATOM   6092 N N   . ARG B 1 247 ? 28.55683  -5.36140  -43.81287 1.000 53.20629  ? 247 ARG B N   1 
ATOM   6093 C CA  . ARG B 1 247 ? 27.47053  -6.32083  -43.96725 1.000 55.34550  ? 247 ARG B CA  1 
ATOM   6094 C C   . ARG B 1 247 ? 27.23875  -6.65931  -45.42599 1.000 62.12951  ? 247 ARG B C   1 
ATOM   6095 O O   . ARG B 1 247 ? 26.90028  -7.80407  -45.74767 1.000 74.99257  ? 247 ARG B O   1 
ATOM   6096 C CB  . ARG B 1 247 ? 26.18751  -5.80640  -43.31553 1.000 52.66395  ? 247 ARG B CB  1 
ATOM   6097 C CG  . ARG B 1 247 ? 26.40166  -5.07863  -41.99015 1.000 51.44520  ? 247 ARG B CG  1 
ATOM   6098 C CD  . ARG B 1 247 ? 25.27222  -4.10136  -41.71490 1.000 46.39805  ? 247 ARG B CD  1 
ATOM   6099 N NE  . ARG B 1 247 ? 25.23223  -3.66519  -40.32257 1.000 47.66030  ? 247 ARG B NE  1 
ATOM   6100 C CZ  . ARG B 1 247 ? 24.13231  -3.27130  -39.67575 1.000 49.06694  ? 247 ARG B CZ  1 
ATOM   6101 N NH1 . ARG B 1 247 ? 22.94816  -3.25661  -40.28939 1.000 37.96545  ? 247 ARG B NH1 1 
ATOM   6102 N NH2 . ARG B 1 247 ? 24.22017  -2.88245  -38.40252 1.000 42.54132  ? 247 ARG B NH2 1 
ATOM   6103 N N   . ALA B 1 248 ? 27.42493  -5.68663  -46.32402 1.000 59.92889  ? 248 ALA B N   1 
ATOM   6104 C CA  . ALA B 1 248 ? 27.42195  -5.99401  -47.75242 1.000 51.16466  ? 248 ALA B CA  1 
ATOM   6105 C C   . ALA B 1 248 ? 28.43775  -7.08706  -48.07338 1.000 47.62096  ? 248 ALA B C   1 
ATOM   6106 O O   . ALA B 1 248 ? 28.07240  -8.14970  -48.58646 1.000 48.61666  ? 248 ALA B O   1 
ATOM   6107 C CB  . ALA B 1 248 ? 27.69355  -4.73092  -48.56759 1.000 46.43656  ? 248 ALA B CB  1 
ATOM   6108 N N   . THR B 1 249 ? 29.71745  -6.87656  -47.73518 1.000 49.47493  ? 249 THR B N   1 
ATOM   6109 C CA  . THR B 1 249 ? 30.66703  -7.93127  -48.06346 1.000 58.42079  ? 249 THR B CA  1 
ATOM   6110 C C   . THR B 1 249 ? 30.41881  -9.19542  -47.24874 1.000 64.21802  ? 249 THR B C   1 
ATOM   6111 O O   . THR B 1 249 ? 30.84681  -10.27445 -47.66865 1.000 72.13600  ? 249 THR B O   1 
ATOM   6112 C CB  . THR B 1 249 ? 32.12047  -7.48644  -47.88384 1.000 54.39251  ? 249 THR B CB  1 
ATOM   6113 O OG1 . THR B 1 249 ? 32.51555  -7.70960  -46.54075 1.000 77.97134  ? 249 THR B OG1 1 
ATOM   6114 C CG2 . THR B 1 249 ? 32.31907  -6.03319  -48.24139 1.000 53.63143  ? 249 THR B CG2 1 
ATOM   6115 N N   . LEU B 1 250 ? 29.71600  -9.10178  -46.11324 1.000 62.87126  ? 250 LEU B N   1 
ATOM   6116 C CA  . LEU B 1 250 ? 29.40389  -10.31257 -45.35597 1.000 63.84833  ? 250 LEU B CA  1 
ATOM   6117 C C   . LEU B 1 250 ? 28.28271  -11.09634 -46.02099 1.000 60.07531  ? 250 LEU B C   1 
ATOM   6118 O O   . LEU B 1 250 ? 28.36293  -12.32520 -46.13375 1.000 64.20359  ? 250 LEU B O   1 
ATOM   6119 C CB  . LEU B 1 250 ? 29.03223  -9.97422  -43.90711 1.000 63.22215  ? 250 LEU B CB  1 
ATOM   6120 C CG  . LEU B 1 250 ? 28.51424  -11.09998 -42.98047 1.000 62.62987  ? 250 LEU B CG  1 
ATOM   6121 C CD1 . LEU B 1 250 ? 29.33022  -12.39916 -43.05786 1.000 55.64486  ? 250 LEU B CD1 1 
ATOM   6122 C CD2 . LEU B 1 250 ? 28.42140  -10.63004 -41.55451 1.000 52.40054  ? 250 LEU B CD2 1 
ATOM   6123 N N   . LEU B 1 251 ? 27.23817  -10.40343 -46.47591 1.000 53.90948  ? 251 LEU B N   1 
ATOM   6124 C CA  . LEU B 1 251 ? 26.16111  -11.08441 -47.18629 1.000 55.92286  ? 251 LEU B CA  1 
ATOM   6125 C C   . LEU B 1 251 ? 26.66941  -11.71031 -48.47545 1.000 67.63163  ? 251 LEU B C   1 
ATOM   6126 O O   . LEU B 1 251 ? 26.29217  -12.83673 -48.82025 1.000 71.53846  ? 251 LEU B O   1 
ATOM   6127 C CB  . LEU B 1 251 ? 25.02534  -10.10824 -47.47140 1.000 46.37464  ? 251 LEU B CB  1 
ATOM   6128 C CG  . LEU B 1 251 ? 23.78202  -10.71135 -48.10837 1.000 47.76526  ? 251 LEU B CG  1 
ATOM   6129 C CD1 . LEU B 1 251 ? 22.81741  -11.12455 -47.02445 1.000 45.10974  ? 251 LEU B CD1 1 
ATOM   6130 C CD2 . LEU B 1 251 ? 23.13987  -9.69101  -49.05309 1.000 50.01136  ? 251 LEU B CD2 1 
ATOM   6131 N N   . ALA B 1 252 ? 27.54025  -10.99682 -49.19370 1.000 69.63262  ? 252 ALA B N   1 
ATOM   6132 C CA  . ALA B 1 252 ? 28.11244  -11.54034 -50.41930 1.000 61.13991  ? 252 ALA B CA  1 
ATOM   6133 C C   . ALA B 1 252 ? 28.92022  -12.79778 -50.13386 1.000 60.64054  ? 252 ALA B C   1 
ATOM   6134 O O   . ALA B 1 252 ? 28.87115  -13.75947 -50.90922 1.000 61.80930  ? 252 ALA B O   1 
ATOM   6135 C CB  . ALA B 1 252 ? 28.97785  -10.48774 -51.10551 1.000 56.63212  ? 252 ALA B CB  1 
ATOM   6136 N N   . ARG B 1 253 ? 29.67319  -12.81323 -49.02768 1.000 56.31130  ? 253 ARG B N   1 
ATOM   6137 C CA  . ARG B 1 253 ? 30.35001  -14.04649 -48.63930 1.000 64.90293  ? 253 ARG B CA  1 
ATOM   6138 C C   . ARG B 1 253 ? 29.34125  -15.16723 -48.42630 1.000 70.26036  ? 253 ARG B C   1 
ATOM   6139 O O   . ARG B 1 253 ? 29.57465  -16.31288 -48.83345 1.000 61.43902  ? 253 ARG B O   1 
ATOM   6140 C CB  . ARG B 1 253 ? 31.18307  -13.83382 -47.36850 1.000 63.89423  ? 253 ARG B CB  1 
ATOM   6141 C CG  . ARG B 1 253 ? 32.03817  -15.05499 -46.96185 1.000 68.19587  ? 253 ARG B CG  1 
ATOM   6142 C CD  . ARG B 1 253 ? 32.36643  -15.09188 -45.47328 1.000 80.00572  ? 253 ARG B CD  1 
ATOM   6143 N NE  . ARG B 1 253 ? 32.20070  -16.41752 -44.85583 1.000 91.72314  ? 253 ARG B NE  1 
ATOM   6144 C CZ  . ARG B 1 253 ? 31.81865  -16.62300 -43.58936 1.000 90.90075  ? 253 ARG B CZ  1 
ATOM   6145 N NH1 . ARG B 1 253 ? 31.70086  -17.85903 -43.11735 1.000 93.20513  ? 253 ARG B NH1 1 
ATOM   6146 N NH2 . ARG B 1 253 ? 31.55138  -15.59520 -42.78832 1.000 81.20717  ? 253 ARG B NH2 1 
ATOM   6147 N N   . LEU B 1 254 ? 28.19738  -14.84184 -47.81275 1.000 73.76545  ? 254 LEU B N   1 
ATOM   6148 C CA  . LEU B 1 254 ? 27.21689  -15.83978 -47.39690 1.000 71.67029  ? 254 LEU B CA  1 
ATOM   6149 C C   . LEU B 1 254 ? 26.42722  -16.43923 -48.55969 1.000 64.35875  ? 254 LEU B C   1 
ATOM   6150 O O   . LEU B 1 254 ? 25.86644  -17.53111 -48.41040 1.000 60.87598  ? 254 LEU B O   1 
ATOM   6151 C CB  . LEU B 1 254 ? 26.25043  -15.22290 -46.37878 1.000 65.44013  ? 254 LEU B CB  1 
ATOM   6152 C CG  . LEU B 1 254 ? 26.75680  -15.04141 -44.94353 1.000 60.80247  ? 254 LEU B CG  1 
ATOM   6153 C CD1 . LEU B 1 254 ? 25.81891  -14.15756 -44.11281 1.000 53.21956  ? 254 LEU B CD1 1 
ATOM   6154 C CD2 . LEU B 1 254 ? 26.92857  -16.40120 -44.29622 1.000 58.32652  ? 254 LEU B CD2 1 
ATOM   6155 N N   . VAL B 1 255 ? 26.35120  -15.75986 -49.69859 1.000 58.72811  ? 255 VAL B N   1 
ATOM   6156 C CA  . VAL B 1 255 ? 25.65064  -16.29715 -50.85914 1.000 66.78608  ? 255 VAL B CA  1 
ATOM   6157 C C   . VAL B 1 255 ? 26.62715  -16.63702 -51.98274 1.000 71.04611  ? 255 VAL B C   1 
ATOM   6158 O O   . VAL B 1 255 ? 26.21905  -16.75094 -53.13521 1.000 78.67694  ? 255 VAL B O   1 
ATOM   6159 C CB  . VAL B 1 255 ? 24.54158  -15.34819 -51.35064 1.000 60.28702  ? 255 VAL B CB  1 
ATOM   6160 C CG1 . VAL B 1 255 ? 23.38389  -15.34155 -50.38157 1.000 52.54010  ? 255 VAL B CG1 1 
ATOM   6161 C CG2 . VAL B 1 255 ? 25.07714  -13.93973 -51.52880 1.000 57.72740  ? 255 VAL B CG2 1 
ATOM   6162 N N   . GLY B 1 256 ? 27.91864  -16.75385 -51.65771 1.000 62.85212  ? 256 GLY B N   1 
ATOM   6163 C CA  . GLY B 1 256 ? 28.91877  -17.30942 -52.55707 1.000 66.20452  ? 256 GLY B CA  1 
ATOM   6164 C C   . GLY B 1 256 ? 29.65873  -16.35059 -53.47139 1.000 68.22140  ? 256 GLY B C   1 
ATOM   6165 O O   . GLY B 1 256 ? 30.20839  -16.79715 -54.48703 1.000 71.32744  ? 256 GLY B O   1 
ATOM   6166 N N   . CYS B 1 257 ? 29.74230  -15.06848 -53.12541 1.000 60.95854  ? 257 CYS B N   1 
ATOM   6167 C CA  . CYS B 1 257 ? 30.23436  -14.04933 -54.04145 1.000 67.89218  ? 257 CYS B CA  1 
ATOM   6168 C C   . CYS B 1 257 ? 31.64299  -13.58740 -53.61484 1.000 71.67746  ? 257 CYS B C   1 
ATOM   6169 O O   . CYS B 1 257 ? 32.63090  -13.78446 -54.33557 1.000 74.78545  ? 257 CYS B O   1 
ATOM   6170 C CB  . CYS B 1 257 ? 29.27499  -12.87376 -54.05416 1.000 70.80701  ? 257 CYS B CB  1 
ATOM   6171 S SG  . CYS B 1 257 ? 27.80870  -13.17154 -55.05192 1.000 91.53948  ? 257 CYS B SG  1 
ATOM   6172 N N   . ASN B 1 265 ? 37.57050  -6.64494  -54.98503 1.000 68.84526  ? 265 ASN B N   1 
ATOM   6173 C CA  . ASN B 1 265 ? 37.09414  -5.64159  -55.95024 1.000 94.02536  ? 265 ASN B CA  1 
ATOM   6174 C C   . ASN B 1 265 ? 35.56690  -5.43809  -55.85577 1.000 89.06787  ? 265 ASN B C   1 
ATOM   6175 O O   . ASN B 1 265 ? 34.81551  -6.39933  -55.68341 1.000 91.43097  ? 265 ASN B O   1 
ATOM   6176 C CB  . ASN B 1 265 ? 37.51443  -6.05092  -57.37803 1.000 100.18999 ? 265 ASN B CB  1 
ATOM   6177 C CG  . ASN B 1 265 ? 36.77986  -5.27829  -58.46833 1.000 101.79825 ? 265 ASN B CG  1 
ATOM   6178 O OD1 . ASN B 1 265 ? 35.60081  -5.51664  -58.72486 1.000 105.54733 ? 265 ASN B OD1 1 
ATOM   6179 N ND2 . ASN B 1 265 ? 37.48910  -4.36734  -59.13538 1.000 101.10726 ? 265 ASN B ND2 1 
ATOM   6180 N N   . ASP B 1 266 ? 35.11351  -4.18506  -55.98876 1.000 82.00590  ? 266 ASP B N   1 
ATOM   6181 C CA  . ASP B 1 266 ? 33.70908  -3.85875  -55.72878 1.000 79.79173  ? 266 ASP B CA  1 
ATOM   6182 C C   . ASP B 1 266 ? 32.79112  -4.24454  -56.88807 1.000 75.62453  ? 266 ASP B C   1 
ATOM   6183 O O   . ASP B 1 266 ? 31.68338  -4.75277  -56.66490 1.000 59.24638  ? 266 ASP B O   1 
ATOM   6184 C CB  . ASP B 1 266 ? 33.56448  -2.36419  -55.43190 1.000 79.05890  ? 266 ASP B CB  1 
ATOM   6185 C CG  . ASP B 1 266 ? 33.64158  -2.05428  -53.95270 1.000 77.16628  ? 266 ASP B CG  1 
ATOM   6186 O OD1 . ASP B 1 266 ? 34.11360  -2.92868  -53.18930 1.000 81.21632  ? 266 ASP B OD1 1 
ATOM   6187 O OD2 . ASP B 1 266 ? 33.22497  -0.93997  -53.55852 1.000 71.86125  ? 266 ASP B OD2 1 
ATOM   6188 N N   . THR B 1 267 ? 33.23710  -3.99773  -58.12587 1.000 80.67044  ? 267 THR B N   1 
ATOM   6189 C CA  . THR B 1 267 ? 32.39847  -4.19670  -59.30943 1.000 72.85571  ? 267 THR B CA  1 
ATOM   6190 C C   . THR B 1 267 ? 32.03678  -5.66137  -59.50740 1.000 69.98782  ? 267 THR B C   1 
ATOM   6191 O O   . THR B 1 267 ? 30.87922  -5.99655  -59.79694 1.000 62.68691  ? 267 THR B O   1 
ATOM   6192 C CB  . THR B 1 267 ? 33.12602  -3.67179  -60.54508 1.000 68.04646  ? 267 THR B CB  1 
ATOM   6193 O OG1 . THR B 1 267 ? 33.60759  -2.35213  -60.28551 1.000 70.61290  ? 267 THR B OG1 1 
ATOM   6194 C CG2 . THR B 1 267 ? 32.21209  -3.67031  -61.76050 1.000 66.58525  ? 267 THR B CG2 1 
ATOM   6195 N N   . GLU B 1 268 ? 33.03475  -6.54445  -59.40820 1.000 74.56723  ? 268 GLU B N   1 
ATOM   6196 C CA  . GLU B 1 268 ? 32.77642  -7.97333  -59.53053 1.000 75.07704  ? 268 GLU B CA  1 
ATOM   6197 C C   . GLU B 1 268 ? 31.87641  -8.45536  -58.40084 1.000 71.92284  ? 268 GLU B C   1 
ATOM   6198 O O   . GLU B 1 268 ? 30.93432  -9.22380  -58.63102 1.000 71.30938  ? 268 GLU B O   1 
ATOM   6199 C CB  . GLU B 1 268 ? 34.10107  -8.74781  -59.56006 1.000 74.25648  ? 268 GLU B CB  1 
ATOM   6200 N N   . LEU B 1 269 ? 32.12557  -7.98227  -57.17743 1.000 70.05299  ? 269 LEU B N   1 
ATOM   6201 C CA  . LEU B 1 269 ? 31.30378  -8.40833  -56.05249 1.000 64.15306  ? 269 LEU B CA  1 
ATOM   6202 C C   . LEU B 1 269 ? 29.84687  -8.01567  -56.25215 1.000 63.67299  ? 269 LEU B C   1 
ATOM   6203 O O   . LEU B 1 269 ? 28.94255  -8.82810  -56.02034 1.000 67.17529  ? 269 LEU B O   1 
ATOM   6204 C CB  . LEU B 1 269 ? 31.83941  -7.82448  -54.74923 1.000 59.65152  ? 269 LEU B CB  1 
ATOM   6205 C CG  . LEU B 1 269 ? 31.18987  -8.47638  -53.53163 1.000 56.21119  ? 269 LEU B CG  1 
ATOM   6206 C CD1 . LEU B 1 269 ? 32.24801  -9.06789  -52.60284 1.000 59.51834  ? 269 LEU B CD1 1 
ATOM   6207 C CD2 . LEU B 1 269 ? 30.31339  -7.46979  -52.81460 1.000 53.75808  ? 269 LEU B CD2 1 
ATOM   6208 N N   . ILE B 1 270 ? 29.59387  -6.77643  -56.68306 1.000 56.23037  ? 270 ILE B N   1 
ATOM   6209 C CA  . ILE B 1 270 ? 28.21284  -6.36558  -56.90821 1.000 60.17277  ? 270 ILE B CA  1 
ATOM   6210 C C   . ILE B 1 270 ? 27.62425  -7.05114  -58.13818 1.000 62.43079  ? 270 ILE B C   1 
ATOM   6211 O O   . ILE B 1 270 ? 26.40124  -7.21118  -58.23015 1.000 61.79784  ? 270 ILE B O   1 
ATOM   6212 C CB  . ILE B 1 270 ? 28.11821  -4.83093  -57.01403 1.000 61.72258  ? 270 ILE B CB  1 
ATOM   6213 C CG1 . ILE B 1 270 ? 28.57487  -4.18712  -55.70477 1.000 67.43750  ? 270 ILE B CG1 1 
ATOM   6214 C CG2 . ILE B 1 270 ? 26.69387  -4.38530  -57.30531 1.000 53.04729  ? 270 ILE B CG2 1 
ATOM   6215 C CD1 . ILE B 1 270 ? 29.15460  -2.78632  -55.86558 1.000 69.10990  ? 270 ILE B CD1 1 
ATOM   6216 N N   . ALA B 1 271 ? 28.46396  -7.48688  -59.07958 1.000 58.28622  ? 271 ALA B N   1 
ATOM   6217 C CA  . ALA B 1 271 ? 27.95118  -8.19027  -60.24667 1.000 56.96807  ? 271 ALA B CA  1 
ATOM   6218 C C   . ALA B 1 271 ? 27.31293  -9.51233  -59.84489 1.000 59.83350  ? 271 ALA B C   1 
ATOM   6219 O O   . ALA B 1 271 ? 26.12750  -9.74776  -60.11111 1.000 64.72533  ? 271 ALA B O   1 
ATOM   6220 C CB  . ALA B 1 271 ? 29.07467  -8.41785  -61.25328 1.000 58.87726  ? 271 ALA B CB  1 
ATOM   6221 N N   . CYS B 1 272 ? 28.10913  -10.38769 -59.21653 1.000 65.46966  ? 272 CYS B N   1 
ATOM   6222 C CA  . CYS B 1 272 ? 27.64799  -11.66419 -58.67335 1.000 61.60512  ? 272 CYS B CA  1 
ATOM   6223 C C   . CYS B 1 272 ? 26.32180  -11.52487 -57.92936 1.000 66.86016  ? 272 CYS B C   1 
ATOM   6224 O O   . CYS B 1 272 ? 25.38608  -12.29556 -58.18655 1.000 64.55984  ? 272 CYS B O   1 
ATOM   6225 C CB  . CYS B 1 272 ? 28.74923  -12.22695 -57.77101 1.000 62.47575  ? 272 CYS B CB  1 
ATOM   6226 S SG  . CYS B 1 272 ? 28.46292  -13.80143 -56.94316 1.000 99.64737  ? 272 CYS B SG  1 
ATOM   6227 N N   . LEU B 1 273 ? 26.21236  -10.53448 -57.02833 1.000 61.88178  ? 273 LEU B N   1 
ATOM   6228 C CA  . LEU B 1 273 ? 24.97060  -10.31349 -56.29050 1.000 55.31335  ? 273 LEU B CA  1 
ATOM   6229 C C   . LEU B 1 273 ? 23.79756  -10.06257 -57.23508 1.000 54.40708  ? 273 LEU B C   1 
ATOM   6230 O O   . LEU B 1 273 ? 22.66804  -10.47631 -56.94968 1.000 53.94124  ? 273 LEU B O   1 
ATOM   6231 C CB  . LEU B 1 273 ? 25.14250  -9.13949  -55.31775 1.000 53.50567  ? 273 LEU B CB  1 
ATOM   6232 C CG  . LEU B 1 273 ? 25.92035  -9.36233  -54.00888 1.000 52.04445  ? 273 LEU B CG  1 
ATOM   6233 C CD1 . LEU B 1 273 ? 26.06941  -8.06429  -53.25783 1.000 46.99207  ? 273 LEU B CD1 1 
ATOM   6234 C CD2 . LEU B 1 273 ? 25.28725  -10.39783 -53.10062 1.000 48.47219  ? 273 LEU B CD2 1 
ATOM   6235 N N   . ARG B 1 274 ? 24.04141  -9.38363  -58.36558 1.000 52.50132  ? 274 ARG B N   1 
ATOM   6236 C CA  . ARG B 1 274 ? 22.96267  -9.13882  -59.32370 1.000 52.29002  ? 274 ARG B CA  1 
ATOM   6237 C C   . ARG B 1 274 ? 22.43619  -10.43886 -59.91458 1.000 51.48823  ? 274 ARG B C   1 
ATOM   6238 O O   . ARG B 1 274 ? 21.23684  -10.55029 -60.18977 1.000 54.24637  ? 274 ARG B O   1 
ATOM   6239 C CB  . ARG B 1 274 ? 23.43295  -8.19849  -60.43395 1.000 53.99858  ? 274 ARG B CB  1 
ATOM   6240 C CG  . ARG B 1 274 ? 23.82225  -6.80976  -59.96543 1.000 60.44272  ? 274 ARG B CG  1 
ATOM   6241 C CD  . ARG B 1 274 ? 23.48918  -5.79641  -61.02445 1.000 71.49385  ? 274 ARG B CD  1 
ATOM   6242 N NE  . ARG B 1 274 ? 24.10726  -4.49601  -60.79225 1.000 81.74981  ? 274 ARG B NE  1 
ATOM   6243 C CZ  . ARG B 1 274 ? 25.27945  -4.13035  -61.30542 1.000 87.75414  ? 274 ARG B CZ  1 
ATOM   6244 N NH1 . ARG B 1 274 ? 25.76250  -2.91966  -61.05118 1.000 95.21201  ? 274 ARG B NH1 1 
ATOM   6245 N NH2 . ARG B 1 274 ? 25.97425  -4.97733  -62.06124 1.000 77.33647  ? 274 ARG B NH2 1 
ATOM   6246 N N   . THR B 1 275 ? 23.30837  -11.43007 -60.08141 1.000 53.09611  ? 275 THR B N   1 
ATOM   6247 C CA  . THR B 1 275 ? 23.00198  -12.73677 -60.66616 1.000 55.11890  ? 275 THR B CA  1 
ATOM   6248 C C   . THR B 1 275 ? 22.54232  -13.72923 -59.60643 1.000 62.30508  ? 275 THR B C   1 
ATOM   6249 O O   . THR B 1 275 ? 23.02364  -14.86196 -59.53627 1.000 65.04528  ? 275 THR B O   1 
ATOM   6250 C CB  . THR B 1 275 ? 24.23049  -13.27869 -61.39199 1.000 74.05122  ? 275 THR B CB  1 
ATOM   6251 O OG1 . THR B 1 275 ? 25.05192  -13.99586 -60.45375 1.000 75.13470  ? 275 THR B OG1 1 
ATOM   6252 C CG2 . THR B 1 275 ? 25.04894  -12.14978 -62.03554 1.000 66.14901  ? 275 THR B CG2 1 
ATOM   6253 N N   . ARG B 1 276 ? 21.63174  -13.29836 -58.75004 1.000 60.48913  ? 276 ARG B N   1 
ATOM   6254 C CA  . ARG B 1 276 ? 21.18270  -14.10983 -57.62614 1.000 57.33390  ? 276 ARG B CA  1 
ATOM   6255 C C   . ARG B 1 276 ? 19.68557  -13.91075 -57.42540 1.000 57.72712  ? 276 ARG B C   1 
ATOM   6256 O O   . ARG B 1 276 ? 19.22892  -12.76702 -57.25536 1.000 48.96338  ? 276 ARG B O   1 
ATOM   6257 C CB  . ARG B 1 276 ? 21.94522  -13.74846 -56.34140 1.000 51.63434  ? 276 ARG B CB  1 
ATOM   6258 C CG  . ARG B 1 276 ? 23.40211  -14.22911 -56.26020 1.000 56.65634  ? 276 ARG B CG  1 
ATOM   6259 C CD  . ARG B 1 276 ? 23.51919  -15.73006 -55.96618 1.000 55.88017  ? 276 ARG B CD  1 
ATOM   6260 N NE  . ARG B 1 276 ? 24.89308  -16.15060 -55.68829 1.000 57.76657  ? 276 ARG B NE  1 
ATOM   6261 C CZ  . ARG B 1 276 ? 25.81967  -16.40296 -56.61595 1.000 72.28473  ? 276 ARG B CZ  1 
ATOM   6262 N NH1 . ARG B 1 276 ? 25.53034  -16.27212 -57.90811 1.000 73.80611  ? 276 ARG B NH1 1 
ATOM   6263 N NH2 . ARG B 1 276 ? 27.04638  -16.77950 -56.25214 1.000 61.69682  ? 276 ARG B NH2 1 
ATOM   6264 N N   . PRO B 1 277 ? 18.89713  -14.98877 -57.43426 1.000 52.38858  ? 277 PRO B N   1 
ATOM   6265 C CA  . PRO B 1 277 ? 17.45602  -14.86048 -57.16864 1.000 51.32194  ? 277 PRO B CA  1 
ATOM   6266 C C   . PRO B 1 277 ? 17.19102  -14.03363 -55.91619 1.000 49.42729  ? 277 PRO B C   1 
ATOM   6267 O O   . PRO B 1 277 ? 17.99264  -14.01760 -54.97416 1.000 51.07684  ? 277 PRO B O   1 
ATOM   6268 C CB  . PRO B 1 277 ? 16.99582  -16.31133 -56.99073 1.000 53.82358  ? 277 PRO B CB  1 
ATOM   6269 C CG  . PRO B 1 277 ? 18.03070  -17.13613 -57.67047 1.000 56.89184  ? 277 PRO B CG  1 
ATOM   6270 C CD  . PRO B 1 277 ? 19.32658  -16.38857 -57.57789 1.000 55.11494  ? 277 PRO B CD  1 
ATOM   6271 N N   . ALA B 1 278 ? 16.05303  -13.33409 -55.91029 1.000 50.88107  ? 278 ALA B N   1 
ATOM   6272 C CA  . ALA B 1 278 ? 15.78695  -12.37887 -54.83256 1.000 52.31959  ? 278 ALA B CA  1 
ATOM   6273 C C   . ALA B 1 278 ? 15.81274  -13.05650 -53.46662 1.000 53.94080  ? 278 ALA B C   1 
ATOM   6274 O O   . ALA B 1 278 ? 16.50118  -12.59771 -52.54773 1.000 52.95773  ? 278 ALA B O   1 
ATOM   6275 C CB  . ALA B 1 278 ? 14.44619  -11.67755 -55.05293 1.000 43.97323  ? 278 ALA B CB  1 
ATOM   6276 N N   . GLN B 1 279 ? 15.07767  -14.16293 -53.32139 1.000 54.94123  ? 279 GLN B N   1 
ATOM   6277 C CA  . GLN B 1 279 ? 14.95726  -14.80762 -52.01955 1.000 57.21384  ? 279 GLN B CA  1 
ATOM   6278 C C   . GLN B 1 279 ? 16.30571  -15.30707 -51.50706 1.000 60.59668  ? 279 GLN B C   1 
ATOM   6279 O O   . GLN B 1 279 ? 16.50197  -15.40002 -50.29250 1.000 64.55700  ? 279 GLN B O   1 
ATOM   6280 C CB  . GLN B 1 279 ? 13.92922  -15.94316 -52.09447 1.000 59.84250  ? 279 GLN B CB  1 
ATOM   6281 C CG  . GLN B 1 279 ? 13.53369  -16.55171 -50.74275 1.000 61.09169  ? 279 GLN B CG  1 
ATOM   6282 C CD  . GLN B 1 279 ? 12.74856  -15.60879 -49.84104 1.000 60.61882  ? 279 GLN B CD  1 
ATOM   6283 O OE1 . GLN B 1 279 ? 12.29280  -14.54494 -50.26065 1.000 48.72013  ? 279 GLN B OE1 1 
ATOM   6284 N NE2 . GLN B 1 279 ? 12.59896  -15.99965 -48.58021 1.000 73.84924  ? 279 GLN B NE2 1 
ATOM   6285 N N   . ASP B 1 280 ? 17.25055  -15.60465 -52.40975 1.000 64.70646  ? 280 ASP B N   1 
ATOM   6286 C CA  . ASP B 1 280 ? 18.60411  -15.99493 -52.01084 1.000 62.07391  ? 280 ASP B CA  1 
ATOM   6287 C C   . ASP B 1 280 ? 19.30676  -14.90439 -51.20939 1.000 54.28549  ? 280 ASP B C   1 
ATOM   6288 O O   . ASP B 1 280 ? 20.21830  -15.20921 -50.43283 1.000 51.66691  ? 280 ASP B O   1 
ATOM   6289 C CB  . ASP B 1 280 ? 19.44520  -16.34973 -53.25017 1.000 52.39951  ? 280 ASP B CB  1 
ATOM   6290 C CG  . ASP B 1 280 ? 19.06894  -17.69035 -53.84565 1.000 58.70092  ? 280 ASP B CG  1 
ATOM   6291 O OD1 . ASP B 1 280 ? 17.89827  -18.11268 -53.70063 1.000 60.39786  ? 280 ASP B OD1 1 
ATOM   6292 O OD2 . ASP B 1 280 ? 19.94740  -18.33594 -54.45315 1.000 63.09819  ? 280 ASP B OD2 1 
ATOM   6293 N N   . LEU B 1 281 ? 18.91531  -13.64360 -51.39756 1.000 48.80449  ? 281 LEU B N   1 
ATOM   6294 C CA  . LEU B 1 281 ? 19.48126  -12.50891 -50.68342 1.000 50.09948  ? 281 LEU B CA  1 
ATOM   6295 C C   . LEU B 1 281 ? 18.74238  -12.25792 -49.36887 1.000 59.64907  ? 281 LEU B C   1 
ATOM   6296 O O   . LEU B 1 281 ? 19.36771  -12.04144 -48.32444 1.000 61.62172  ? 281 LEU B O   1 
ATOM   6297 C CB  . LEU B 1 281 ? 19.42425  -11.26333 -51.57901 1.000 43.51634  ? 281 LEU B CB  1 
ATOM   6298 C CG  . LEU B 1 281 ? 20.64874  -10.82872 -52.39657 1.000 44.10848  ? 281 LEU B CG  1 
ATOM   6299 C CD1 . LEU B 1 281 ? 21.27972  -11.95978 -53.17833 1.000 46.52553  ? 281 LEU B CD1 1 
ATOM   6300 C CD2 . LEU B 1 281 ? 20.28222  -9.70996  -53.32989 1.000 42.85535  ? 281 LEU B CD2 1 
ATOM   6301 N N   . VAL B 1 282 ? 17.41048  -12.30563 -49.41152 1.000 53.26217  ? 282 VAL B N   1 
ATOM   6302 C CA  . VAL B 1 282 ? 16.58852  -12.15623 -48.22171 1.000 46.83918  ? 282 VAL B CA  1 
ATOM   6303 C C   . VAL B 1 282 ? 16.79948  -13.32480 -47.24918 1.000 55.74353  ? 282 VAL B C   1 
ATOM   6304 O O   . VAL B 1 282 ? 16.66694  -13.16093 -46.02735 1.000 56.66125  ? 282 VAL B O   1 
ATOM   6305 C CB  . VAL B 1 282 ? 15.13080  -11.99343 -48.69004 1.000 42.09869  ? 282 VAL B CB  1 
ATOM   6306 C CG1 . VAL B 1 282 ? 14.13485  -12.45376 -47.64924 1.000 50.26431  ? 282 VAL B CG1 1 
ATOM   6307 C CG2 . VAL B 1 282 ? 14.89041  -10.55024 -49.06186 1.000 39.90104  ? 282 VAL B CG2 1 
ATOM   6308 N N   . ASP B 1 283 ? 17.15713  -14.50739 -47.76326 1.000 56.52742  ? 283 ASP B N   1 
ATOM   6309 C CA  . ASP B 1 283 ? 17.45014  -15.65788 -46.90601 1.000 58.03440  ? 283 ASP B CA  1 
ATOM   6310 C C   . ASP B 1 283 ? 18.50554  -15.32243 -45.85097 1.000 63.86451  ? 283 ASP B C   1 
ATOM   6311 O O   . ASP B 1 283 ? 18.39581  -15.73273 -44.68891 1.000 66.58808  ? 283 ASP B O   1 
ATOM   6312 C CB  . ASP B 1 283 ? 17.94622  -16.84308 -47.75428 1.000 57.82274  ? 283 ASP B CB  1 
ATOM   6313 C CG  . ASP B 1 283 ? 16.81880  -17.74876 -48.28772 1.000 58.88711  ? 283 ASP B CG  1 
ATOM   6314 O OD1 . ASP B 1 283 ? 15.61988  -17.47875 -48.03459 1.000 52.09270  ? 283 ASP B OD1 1 
ATOM   6315 O OD2 . ASP B 1 283 ? 17.15970  -18.75539 -48.96743 1.000 64.76805  ? 283 ASP B OD2 1 
ATOM   6316 N N   . HIS B 1 284 ? 19.55152  -14.60386 -46.25023 1.000 63.23759  ? 284 HIS B N   1 
ATOM   6317 C CA  . HIS B 1 284 ? 20.66370  -14.26348 -45.38006 1.000 57.99502  ? 284 HIS B CA  1 
ATOM   6318 C C   . HIS B 1 284 ? 20.57448  -12.84235 -44.84752 1.000 61.65455  ? 284 HIS B C   1 
ATOM   6319 O O   . HIS B 1 284 ? 21.55624  -12.34452 -44.28548 1.000 60.05939  ? 284 HIS B O   1 
ATOM   6320 C CB  . HIS B 1 284 ? 21.98191  -14.44857 -46.12886 1.000 55.56323  ? 284 HIS B CB  1 
ATOM   6321 C CG  . HIS B 1 284 ? 22.42139  -15.87211 -46.23448 1.000 58.13645  ? 284 HIS B CG  1 
ATOM   6322 N ND1 . HIS B 1 284 ? 22.77742  -16.62418 -45.13446 1.000 62.39135  ? 284 HIS B ND1 1 
ATOM   6323 C CD2 . HIS B 1 284 ? 22.56687  -16.68145 -47.30785 1.000 57.13181  ? 284 HIS B CD2 1 
ATOM   6324 C CE1 . HIS B 1 284 ? 23.12538  -17.83620 -45.52900 1.000 63.39047  ? 284 HIS B CE1 1 
ATOM   6325 N NE2 . HIS B 1 284 ? 23.00919  -17.89523 -46.84346 1.000 62.00354  ? 284 HIS B NE2 1 
ATOM   6326 N N   . GLU B 1 285 ? 19.42096  -12.18231 -45.01250 1.000 63.71886  ? 285 GLU B N   1 
ATOM   6327 C CA  . GLU B 1 285 ? 19.30972  -10.76605 -44.67041 1.000 58.82188  ? 285 GLU B CA  1 
ATOM   6328 C C   . GLU B 1 285 ? 19.66018  -10.51514 -43.21483 1.000 60.31144  ? 285 GLU B C   1 
ATOM   6329 O O   . GLU B 1 285 ? 20.39606  -9.57189  -42.90319 1.000 59.86452  ? 285 GLU B O   1 
ATOM   6330 C CB  . GLU B 1 285 ? 17.89738  -10.24957 -44.95677 1.000 52.61471  ? 285 GLU B CB  1 
ATOM   6331 C CG  . GLU B 1 285 ? 17.86484  -8.80117  -45.42498 1.000 54.20820  ? 285 GLU B CG  1 
ATOM   6332 C CD  . GLU B 1 285 ? 16.55066  -8.09916  -45.15389 1.000 59.39539  ? 285 GLU B CD  1 
ATOM   6333 O OE1 . GLU B 1 285 ? 16.53148  -7.10946  -44.37742 1.000 62.84405  ? 285 GLU B OE1 1 
ATOM   6334 O OE2 . GLU B 1 285 ? 15.53500  -8.54392  -45.72589 1.000 62.95144  ? 285 GLU B OE2 1 
ATOM   6335 N N   . TRP B 1 286 ? 19.14587  -11.34971 -42.31244 1.000 62.40179  ? 286 TRP B N   1 
ATOM   6336 C CA  . TRP B 1 286 ? 19.25205  -11.12147 -40.87705 1.000 60.08836  ? 286 TRP B CA  1 
ATOM   6337 C C   . TRP B 1 286 ? 20.54160  -11.65747 -40.27926 1.000 65.32754  ? 286 TRP B C   1 
ATOM   6338 O O   . TRP B 1 286 ? 20.78721  -11.44414 -39.08647 1.000 76.32603  ? 286 TRP B O   1 
ATOM   6339 C CB  . TRP B 1 286 ? 18.05646  -11.75246 -40.15209 1.000 56.68446  ? 286 TRP B CB  1 
ATOM   6340 C CG  . TRP B 1 286 ? 16.75178  -11.10659 -40.49993 1.000 57.65220  ? 286 TRP B CG  1 
ATOM   6341 C CD1 . TRP B 1 286 ? 15.79943  -11.58498 -41.35266 1.000 52.63637  ? 286 TRP B CD1 1 
ATOM   6342 C CD2 . TRP B 1 286 ? 16.26083  -9.85092  -40.01416 1.000 61.53195  ? 286 TRP B CD2 1 
ATOM   6343 N NE1 . TRP B 1 286 ? 14.74148  -10.71169 -41.41584 1.000 47.00710  ? 286 TRP B NE1 1 
ATOM   6344 C CE2 . TRP B 1 286 ? 15.00327  -9.63603  -40.60880 1.000 50.42293  ? 286 TRP B CE2 1 
ATOM   6345 C CE3 . TRP B 1 286 ? 16.75976  -8.89327  -39.12663 1.000 68.37736  ? 286 TRP B CE3 1 
ATOM   6346 C CZ2 . TRP B 1 286 ? 14.24270  -8.50078  -40.35266 1.000 52.63704  ? 286 TRP B CZ2 1 
ATOM   6347 C CZ3 . TRP B 1 286 ? 16.00148  -7.76730  -38.87239 1.000 66.81037  ? 286 TRP B CZ3 1 
ATOM   6348 C CH2 . TRP B 1 286 ? 14.75897  -7.57861  -39.48666 1.000 61.22152  ? 286 TRP B CH2 1 
ATOM   6349 N N   . HIS B 1 287 ? 21.37103  -12.34035 -41.06168 1.000 55.25205  ? 287 HIS B N   1 
ATOM   6350 C CA  . HIS B 1 287 ? 22.55239  -12.98935 -40.51502 1.000 51.81748  ? 287 HIS B CA  1 
ATOM   6351 C C   . HIS B 1 287 ? 23.78852  -12.09509 -40.51955 1.000 58.72894  ? 287 HIS B C   1 
ATOM   6352 O O   . HIS B 1 287 ? 24.87593  -12.57695 -40.18725 1.000 67.11944  ? 287 HIS B O   1 
ATOM   6353 C CB  . HIS B 1 287 ? 22.84720  -14.27936 -41.27993 1.000 51.41195  ? 287 HIS B CB  1 
ATOM   6354 C CG  . HIS B 1 287 ? 21.72686  -15.27118 -41.25353 1.000 61.66933  ? 287 HIS B CG  1 
ATOM   6355 N ND1 . HIS B 1 287 ? 21.80415  -16.49300 -41.88576 1.000 70.86017  ? 287 HIS B ND1 1 
ATOM   6356 C CD2 . HIS B 1 287 ? 20.50137  -15.22289 -40.68018 1.000 66.08333  ? 287 HIS B CD2 1 
ATOM   6357 C CE1 . HIS B 1 287 ? 20.67783  -17.15757 -41.69664 1.000 72.59962  ? 287 HIS B CE1 1 
ATOM   6358 N NE2 . HIS B 1 287 ? 19.87011  -16.40949 -40.96700 1.000 67.81510  ? 287 HIS B NE2 1 
ATOM   6359 N N   . VAL B 1 288 ? 23.65476  -10.81367 -40.87450 1.000 56.02911  ? 288 VAL B N   1 
ATOM   6360 C CA  . VAL B 1 288 ? 24.79338  -9.89839  -40.94340 1.000 55.37450  ? 288 VAL B CA  1 
ATOM   6361 C C   . VAL B 1 288 ? 24.75283  -8.83611  -39.84890 1.000 56.85175  ? 288 VAL B C   1 
ATOM   6362 O O   . VAL B 1 288 ? 25.54544  -7.89026  -39.88454 1.000 57.59290  ? 288 VAL B O   1 
ATOM   6363 C CB  . VAL B 1 288 ? 24.91308  -9.24194  -42.32889 1.000 45.62949  ? 288 VAL B CB  1 
ATOM   6364 C CG1 . VAL B 1 288 ? 24.94531  -10.30101 -43.40378 1.000 61.05140  ? 288 VAL B CG1 1 
ATOM   6365 C CG2 . VAL B 1 288 ? 23.77722  -8.27176  -42.55882 1.000 43.07529  ? 288 VAL B CG2 1 
ATOM   6366 N N   . LEU B 1 289 ? 23.84974  -8.95807  -38.88198 1.000 54.98881  ? 289 LEU B N   1 
ATOM   6367 C CA  . LEU B 1 289 ? 23.86777  -8.05410  -37.74374 1.000 47.74213  ? 289 LEU B CA  1 
ATOM   6368 C C   . LEU B 1 289 ? 25.03066  -8.41840  -36.81589 1.000 55.95850  ? 289 LEU B C   1 
ATOM   6369 O O   . LEU B 1 289 ? 25.32477  -9.60598  -36.62211 1.000 60.47902  ? 289 LEU B O   1 
ATOM   6370 C CB  . LEU B 1 289 ? 22.53658  -8.12775  -36.99835 1.000 44.59816  ? 289 LEU B CB  1 
ATOM   6371 C CG  . LEU B 1 289 ? 21.34939  -7.37671  -37.60414 1.000 42.12081  ? 289 LEU B CG  1 
ATOM   6372 C CD1 . LEU B 1 289 ? 20.04779  -7.69196  -36.88356 1.000 41.99818  ? 289 LEU B CD1 1 
ATOM   6373 C CD2 . LEU B 1 289 ? 21.62430  -5.89491  -37.55804 1.000 40.67848  ? 289 LEU B CD2 1 
ATOM   6374 N N   . PRO B 1 290 ? 25.72344  -7.42470  -36.23861 1.000 54.78986  ? 290 PRO B N   1 
ATOM   6375 C CA  . PRO B 1 290 ? 26.93952  -7.72850  -35.45980 1.000 59.34542  ? 290 PRO B CA  1 
ATOM   6376 C C   . PRO B 1 290 ? 26.67472  -8.29777  -34.07549 1.000 61.31631  ? 290 PRO B C   1 
ATOM   6377 O O   . PRO B 1 290 ? 27.57482  -8.93573  -33.50628 1.000 59.98357  ? 290 PRO B O   1 
ATOM   6378 C CB  . PRO B 1 290 ? 27.63836  -6.36380  -35.36551 1.000 55.05860  ? 290 PRO B CB  1 
ATOM   6379 C CG  . PRO B 1 290 ? 26.51066  -5.38954  -35.36474 1.000 51.05152  ? 290 PRO B CG  1 
ATOM   6380 C CD  . PRO B 1 290 ? 25.45215  -5.97826  -36.28621 1.000 50.83196  ? 290 PRO B CD  1 
ATOM   6381 N N   . GLN B 1 291 ? 25.48502  -8.07371  -33.51652 1.000 59.08792  ? 291 GLN B N   1 
ATOM   6382 C CA  . GLN B 1 291 ? 25.10719  -8.60019  -32.21318 1.000 61.52292  ? 291 GLN B CA  1 
ATOM   6383 C C   . GLN B 1 291 ? 23.68249  -9.14211  -32.28882 1.000 64.14342  ? 291 GLN B C   1 
ATOM   6384 O O   . GLN B 1 291 ? 22.90026  -8.77659  -33.17290 1.000 64.75046  ? 291 GLN B O   1 
ATOM   6385 C CB  . GLN B 1 291 ? 25.20407  -7.52046  -31.11122 1.000 61.56709  ? 291 GLN B CB  1 
ATOM   6386 C CG  . GLN B 1 291 ? 26.57425  -6.84271  -30.97084 1.000 66.52225  ? 291 GLN B CG  1 
ATOM   6387 C CD  . GLN B 1 291 ? 26.64865  -5.44676  -31.60690 1.000 72.08517  ? 291 GLN B CD  1 
ATOM   6388 O OE1 . GLN B 1 291 ? 25.62421  -4.81956  -31.92455 1.000 73.26251  ? 291 GLN B OE1 1 
ATOM   6389 N NE2 . GLN B 1 291 ? 27.87562  -4.96248  -31.80505 1.000 67.79248  ? 291 GLN B NE2 1 
ATOM   6390 N N   . GLU B 1 292 ? 23.35641  -10.03637 -31.35524 1.000 65.38764  ? 292 GLU B N   1 
ATOM   6391 C CA  . GLU B 1 292 ? 21.95980  -10.36029 -31.08327 1.000 62.85453  ? 292 GLU B CA  1 
ATOM   6392 C C   . GLU B 1 292 ? 21.21721  -9.07401  -30.71445 1.000 59.68059  ? 292 GLU B C   1 
ATOM   6393 O O   . GLU B 1 292 ? 21.65293  -8.32109  -29.84239 1.000 68.98962  ? 292 GLU B O   1 
ATOM   6394 C CB  . GLU B 1 292 ? 21.88817  -11.39524 -29.95561 1.000 62.99508  ? 292 GLU B CB  1 
ATOM   6395 C CG  . GLU B 1 292 ? 20.62490  -12.25429 -29.88339 1.000 69.38785  ? 292 GLU B CG  1 
ATOM   6396 C CD  . GLU B 1 292 ? 20.55319  -13.09517 -28.59230 1.000 86.44408  ? 292 GLU B CD  1 
ATOM   6397 O OE1 . GLU B 1 292 ? 19.42693  -13.34937 -28.10662 1.000 90.90920  ? 292 GLU B OE1 1 
ATOM   6398 O OE2 . GLU B 1 292 ? 21.61753  -13.50656 -28.06204 1.000 90.04736  ? 292 GLU B OE2 1 
ATOM   6399 N N   . SER B 1 293 ? 20.12113  -8.79065  -31.40914 1.000 53.30394  ? 293 SER B N   1 
ATOM   6400 C CA  . SER B 1 293 ? 19.49738  -7.48030  -31.32078 1.000 49.00166  ? 293 SER B CA  1 
ATOM   6401 C C   . SER B 1 293 ? 17.98211  -7.62776  -31.32448 1.000 48.22242  ? 293 SER B C   1 
ATOM   6402 O O   . SER B 1 293 ? 17.43765  -8.67039  -31.69434 1.000 52.96592  ? 293 SER B O   1 
ATOM   6403 C CB  . SER B 1 293 ? 19.89907  -6.56978  -32.49317 1.000 52.79137  ? 293 SER B CB  1 
ATOM   6404 O OG  . SER B 1 293 ? 21.27341  -6.63445  -32.85350 1.000 54.86198  ? 293 SER B OG  1 
ATOM   6405 N N   . ILE B 1 294 ? 17.30570  -6.57039  -30.87656 1.000 44.90193  ? 294 ILE B N   1 
ATOM   6406 C CA  . ILE B 1 294 ? 15.93763  -6.27250  -31.27108 1.000 43.43795  ? 294 ILE B CA  1 
ATOM   6407 C C   . ILE B 1 294 ? 15.91883  -4.79440  -31.60886 1.000 49.24656  ? 294 ILE B C   1 
ATOM   6408 O O   . ILE B 1 294 ? 16.75990  -4.02441  -31.14639 1.000 52.90463  ? 294 ILE B O   1 
ATOM   6409 C CB  . ILE B 1 294 ? 14.86777  -6.59490  -30.20917 1.000 44.87838  ? 294 ILE B CB  1 
ATOM   6410 C CG1 . ILE B 1 294 ? 15.22350  -5.95500  -28.86986 1.000 51.31156  ? 294 ILE B CG1 1 
ATOM   6411 C CG2 . ILE B 1 294 ? 14.66413  -8.09979  -30.09857 1.000 49.47774  ? 294 ILE B CG2 1 
ATOM   6412 C CD1 . ILE B 1 294 ? 14.08869  -5.97914  -27.86494 1.000 56.18350  ? 294 ILE B CD1 1 
ATOM   6413 N N   . PHE B 1 295 ? 14.96494  -4.40811  -32.45453 1.000 48.47719  ? 295 PHE B N   1 
ATOM   6414 C CA  . PHE B 1 295 ? 14.91161  -3.04804  -32.97260 1.000 39.76836  ? 295 PHE B CA  1 
ATOM   6415 C C   . PHE B 1 295 ? 16.22490  -2.70366  -33.65650 1.000 46.07607  ? 295 PHE B C   1 
ATOM   6416 O O   . PHE B 1 295 ? 16.76132  -1.60995  -33.48238 1.000 53.95371  ? 295 PHE B O   1 
ATOM   6417 C CB  . PHE B 1 295 ? 14.59140  -2.03924  -31.86534 1.000 37.40124  ? 295 PHE B CB  1 
ATOM   6418 C CG  . PHE B 1 295 ? 13.67696  -0.92371  -32.29307 1.000 38.37035  ? 295 PHE B CG  1 
ATOM   6419 C CD1 . PHE B 1 295 ? 13.83891  -0.30032  -33.52756 1.000 35.95098  ? 295 PHE B CD1 1 
ATOM   6420 C CD2 . PHE B 1 295 ? 12.64759  -0.50399  -31.46390 1.000 35.93243  ? 295 PHE B CD2 1 
ATOM   6421 C CE1 . PHE B 1 295 ? 12.99914  0.73048   -33.91580 1.000 32.46858  ? 295 PHE B CE1 1 
ATOM   6422 C CE2 . PHE B 1 295 ? 11.80289  0.52599   -31.84205 1.000 39.70743  ? 295 PHE B CE2 1 
ATOM   6423 C CZ  . PHE B 1 295 ? 11.96728  1.13583   -33.07792 1.000 39.07220  ? 295 PHE B CZ  1 
ATOM   6424 N N   . ARG B 1 296 ? 16.75995  -3.66067  -34.41747 1.000 47.28270  ? 296 ARG B N   1 
ATOM   6425 C CA  . ARG B 1 296 ? 17.96490  -3.45299  -35.21197 1.000 48.31939  ? 296 ARG B CA  1 
ATOM   6426 C C   . ARG B 1 296 ? 17.75259  -4.07697  -36.58931 1.000 52.41295  ? 296 ARG B C   1 
ATOM   6427 O O   . ARG B 1 296 ? 17.22644  -5.18804  -36.68894 1.000 60.30042  ? 296 ARG B O   1 
ATOM   6428 C CB  . ARG B 1 296 ? 19.18290  -4.05722  -34.49911 1.000 48.55393  ? 296 ARG B CB  1 
ATOM   6429 C CG  . ARG B 1 296 ? 20.32030  -3.08041  -34.15538 1.000 44.34346  ? 296 ARG B CG  1 
ATOM   6430 C CD  . ARG B 1 296 ? 19.79769  -1.76650  -33.61958 1.000 38.31762  ? 296 ARG B CD  1 
ATOM   6431 N NE  . ARG B 1 296 ? 20.46656  -1.30935  -32.40509 1.000 45.27871  ? 296 ARG B NE  1 
ATOM   6432 C CZ  . ARG B 1 296 ? 19.86142  -0.59397  -31.45519 1.000 54.24005  ? 296 ARG B CZ  1 
ATOM   6433 N NH1 . ARG B 1 296 ? 20.53424  -0.20708  -30.37798 1.000 59.97240  ? 296 ARG B NH1 1 
ATOM   6434 N NH2 . ARG B 1 296 ? 18.57302  -0.27293  -31.57016 1.000 42.50705  ? 296 ARG B NH2 1 
ATOM   6435 N N   . PHE B 1 297 ? 18.14914  -3.37103  -37.65170 1.000 49.10942  ? 297 PHE B N   1 
ATOM   6436 C CA  . PHE B 1 297 ? 17.84484  -3.79605  -39.01982 1.000 48.06301  ? 297 PHE B CA  1 
ATOM   6437 C C   . PHE B 1 297 ? 19.09735  -3.84933  -39.89816 1.000 46.88037  ? 297 PHE B C   1 
ATOM   6438 O O   . PHE B 1 297 ? 20.00065  -3.01933  -39.76462 1.000 46.49723  ? 297 PHE B O   1 
ATOM   6439 C CB  . PHE B 1 297 ? 16.78131  -2.87049  -39.63127 1.000 45.20497  ? 297 PHE B CB  1 
ATOM   6440 C CG  . PHE B 1 297 ? 15.63137  -2.57561  -38.69550 1.000 39.37735  ? 297 PHE B CG  1 
ATOM   6441 C CD1 . PHE B 1 297 ? 15.41525  -1.28911  -38.21572 1.000 35.21103  ? 297 PHE B CD1 1 
ATOM   6442 C CD2 . PHE B 1 297 ? 14.79360  -3.59622  -38.26278 1.000 41.87671  ? 297 PHE B CD2 1 
ATOM   6443 C CE1 . PHE B 1 297 ? 14.36851  -1.01923  -37.34574 1.000 33.86762  ? 297 PHE B CE1 1 
ATOM   6444 C CE2 . PHE B 1 297 ? 13.74113  -3.33649  -37.38480 1.000 33.54004  ? 297 PHE B CE2 1 
ATOM   6445 C CZ  . PHE B 1 297 ? 13.52809  -2.05049  -36.93479 1.000 32.52611  ? 297 PHE B CZ  1 
ATOM   6446 N N   . SER B 1 298 ? 19.13052  -4.82141  -40.82134 1.000 47.41178  ? 298 SER B N   1 
ATOM   6447 C CA  . SER B 1 298 ? 20.37128  -5.16022  -41.52500 1.000 51.74996  ? 298 SER B CA  1 
ATOM   6448 C C   . SER B 1 298 ? 20.76185  -4.13437  -42.59679 1.000 49.24957  ? 298 SER B C   1 
ATOM   6449 O O   . SER B 1 298 ? 21.95517  -3.88299  -42.80790 1.000 54.07575  ? 298 SER B O   1 
ATOM   6450 C CB  . SER B 1 298 ? 20.24269  -6.54600  -42.14444 1.000 56.08758  ? 298 SER B CB  1 
ATOM   6451 O OG  . SER B 1 298 ? 20.22040  -7.51962  -41.12028 1.000 62.10453  ? 298 SER B OG  1 
ATOM   6452 N N   . PHE B 1 299 ? 19.80209  -3.54981  -43.30707 1.000 34.25246  ? 299 PHE B N   1 
ATOM   6453 C CA  . PHE B 1 299 ? 20.15469  -2.64862  -44.40190 1.000 42.77430  ? 299 PHE B CA  1 
ATOM   6454 C C   . PHE B 1 299 ? 19.26499  -1.42007  -44.33502 1.000 45.71523  ? 299 PHE B C   1 
ATOM   6455 O O   . PHE B 1 299 ? 18.06862  -1.48856  -44.63291 1.000 51.37156  ? 299 PHE B O   1 
ATOM   6456 C CB  . PHE B 1 299 ? 20.07383  -3.36227  -45.75919 1.000 41.17864  ? 299 PHE B CB  1 
ATOM   6457 C CG  . PHE B 1 299 ? 21.12903  -4.42896  -45.91785 1.000 39.51027  ? 299 PHE B CG  1 
ATOM   6458 C CD1 . PHE B 1 299 ? 22.43448  -4.08109  -46.25354 1.000 42.90572  ? 299 PHE B CD1 1 
ATOM   6459 C CD2 . PHE B 1 299 ? 20.83963  -5.76314  -45.65664 1.000 36.92015  ? 299 PHE B CD2 1 
ATOM   6460 C CE1 . PHE B 1 299 ? 23.41980  -5.04947  -46.35866 1.000 38.82368  ? 299 PHE B CE1 1 
ATOM   6461 C CE2 . PHE B 1 299 ? 21.81999  -6.73979  -45.75188 1.000 38.80868  ? 299 PHE B CE2 1 
ATOM   6462 C CZ  . PHE B 1 299 ? 23.10499  -6.38842  -46.11111 1.000 39.73354  ? 299 PHE B CZ  1 
ATOM   6463 N N   . VAL B 1 300 ? 19.86946  -0.30767  -43.92807 1.000 38.99645  ? 300 VAL B N   1 
ATOM   6464 C CA  . VAL B 1 300 ? 19.20350  0.94290   -43.56345 1.000 34.44834  ? 300 VAL B CA  1 
ATOM   6465 C C   . VAL B 1 300 ? 19.98117  2.07171   -44.22650 1.000 38.23837  ? 300 VAL B C   1 
ATOM   6466 O O   . VAL B 1 300 ? 21.07140  1.81507   -44.76499 1.000 43.40982  ? 300 VAL B O   1 
ATOM   6467 C CB  . VAL B 1 300 ? 19.16568  1.13104   -42.03843 1.000 36.71002  ? 300 VAL B CB  1 
ATOM   6468 C CG1 . VAL B 1 300 ? 18.45912  -0.02844  -41.35880 1.000 38.93989  ? 300 VAL B CG1 1 
ATOM   6469 C CG2 . VAL B 1 300 ? 20.59488  1.27316   -41.50424 1.000 33.16397  ? 300 VAL B CG2 1 
ATOM   6470 N N   . PRO B 1 301 ? 19.47525  3.31306   -44.23193 1.000 38.12105  ? 301 PRO B N   1 
ATOM   6471 C CA  . PRO B 1 301 ? 20.22964  4.41035   -44.84192 1.000 30.34799  ? 301 PRO B CA  1 
ATOM   6472 C C   . PRO B 1 301 ? 21.65374  4.46718   -44.32635 1.000 47.39780  ? 301 PRO B C   1 
ATOM   6473 O O   . PRO B 1 301 ? 21.94290  4.08587   -43.18554 1.000 53.63593  ? 301 PRO B O   1 
ATOM   6474 C CB  . PRO B 1 301 ? 19.43330  5.65027   -44.43428 1.000 29.38872  ? 301 PRO B CB  1 
ATOM   6475 C CG  . PRO B 1 301 ? 18.04768  5.16698   -44.44700 1.000 32.01212  ? 301 PRO B CG  1 
ATOM   6476 C CD  . PRO B 1 301 ? 18.10209  3.74490   -43.91238 1.000 37.68049  ? 301 PRO B CD  1 
ATOM   6477 N N   . VAL B 1 302 ? 22.54746  4.92975   -45.19712 1.000 41.14334  ? 302 VAL B N   1 
ATOM   6478 C CA  . VAL B 1 302 ? 23.97795  4.95945   -44.92290 1.000 38.05278  ? 302 VAL B CA  1 
ATOM   6479 C C   . VAL B 1 302 ? 24.45755  6.40004   -44.88129 1.000 41.48349  ? 302 VAL B C   1 
ATOM   6480 O O   . VAL B 1 302 ? 23.90070  7.27682   -45.54807 1.000 56.60840  ? 302 VAL B O   1 
ATOM   6481 C CB  . VAL B 1 302 ? 24.76071  4.12789   -45.95474 1.000 38.03125  ? 302 VAL B CB  1 
ATOM   6482 C CG1 . VAL B 1 302 ? 24.88184  4.89322   -47.28968 1.000 42.81899  ? 302 VAL B CG1 1 
ATOM   6483 C CG2 . VAL B 1 302 ? 26.12598  3.78949   -45.38626 1.000 38.02479  ? 302 VAL B CG2 1 
ATOM   6484 N N   . VAL B 1 303 ? 25.45404  6.65425   -44.05569 1.000 36.91152  ? 303 VAL B N   1 
ATOM   6485 C CA  . VAL B 1 303 ? 26.00110  7.99660   -43.98230 1.000 48.90568  ? 303 VAL B CA  1 
ATOM   6486 C C   . VAL B 1 303 ? 27.05583  8.05518   -45.06760 1.000 54.36229  ? 303 VAL B C   1 
ATOM   6487 O O   . VAL B 1 303 ? 28.20875  7.65584   -44.86172 1.000 61.78683  ? 303 VAL B O   1 
ATOM   6488 C CB  . VAL B 1 303 ? 26.56164  8.32563   -42.58602 1.000 46.36828  ? 303 VAL B CB  1 
ATOM   6489 C CG1 . VAL B 1 303 ? 27.10377  9.73371   -42.55238 1.000 40.41727  ? 303 VAL B CG1 1 
ATOM   6490 C CG2 . VAL B 1 303 ? 25.46158  8.17959   -41.55191 1.000 37.36885  ? 303 VAL B CG2 1 
ATOM   6491 N N   . ASP B 1 304 ? 26.64982  8.53914   -46.23806 1.000 52.27059  ? 304 ASP B N   1 
ATOM   6492 C CA  . ASP B 1 304 ? 27.44058  8.42638   -47.45222 1.000 50.04600  ? 304 ASP B CA  1 
ATOM   6493 C C   . ASP B 1 304 ? 28.24850  9.67099   -47.77371 1.000 45.84066  ? 304 ASP B C   1 
ATOM   6494 O O   . ASP B 1 304 ? 29.08075  9.61765   -48.68471 1.000 47.56053  ? 304 ASP B O   1 
ATOM   6495 C CB  . ASP B 1 304 ? 26.52805  8.11427   -48.63797 1.000 47.33922  ? 304 ASP B CB  1 
ATOM   6496 C CG  . ASP B 1 304 ? 25.38903  9.10368   -48.76654 1.000 48.39529  ? 304 ASP B CG  1 
ATOM   6497 O OD1 . ASP B 1 304 ? 25.15337  9.87674   -47.80360 1.000 42.69850  ? 304 ASP B OD1 1 
ATOM   6498 O OD2 . ASP B 1 304 ? 24.73870  9.10923   -49.83954 1.000 45.52423  ? 304 ASP B OD2 1 
ATOM   6499 N N   . GLY B 1 305 ? 28.03755  10.77007  -47.05025 1.000 43.74552  ? 305 GLY B N   1 
ATOM   6500 C CA  . GLY B 1 305 ? 28.60459  12.04355  -47.44448 1.000 50.77824  ? 305 GLY B CA  1 
ATOM   6501 C C   . GLY B 1 305 ? 27.94100  12.65290  -48.65899 1.000 59.80626  ? 305 GLY B C   1 
ATOM   6502 O O   . GLY B 1 305 ? 28.54673  13.48861  -49.33873 1.000 59.33314  ? 305 GLY B O   1 
ATOM   6503 N N   . ASP B 1 306 ? 26.70235  12.25185  -48.94991 1.000 59.01300  ? 306 ASP B N   1 
ATOM   6504 C CA  . ASP B 1 306 ? 26.00130  12.65849  -50.15968 1.000 52.38571  ? 306 ASP B CA  1 
ATOM   6505 C C   . ASP B 1 306 ? 24.53775  12.94714  -49.83572 1.000 50.56961  ? 306 ASP B C   1 
ATOM   6506 O O   . ASP B 1 306 ? 24.15235  14.10846  -49.63442 1.000 47.37302  ? 306 ASP B O   1 
ATOM   6507 C CB  . ASP B 1 306 ? 26.13296  11.56004  -51.21469 1.000 52.93008  ? 306 ASP B CB  1 
ATOM   6508 C CG  . ASP B 1 306 ? 25.62810  11.98317  -52.57869 1.000 55.76689  ? 306 ASP B CG  1 
ATOM   6509 O OD1 . ASP B 1 306 ? 25.24485  13.16717  -52.73465 1.000 53.74327  ? 306 ASP B OD1 1 
ATOM   6510 O OD2 . ASP B 1 306 ? 25.60974  11.11583  -53.48968 1.000 53.09277  ? 306 ASP B OD2 1 
ATOM   6511 N N   . PHE B 1 307 ? 23.70825  11.89975  -49.79084 1.000 45.88138  ? 307 PHE B N   1 
ATOM   6512 C CA  . PHE B 1 307 ? 22.34994  12.07841  -49.29067 1.000 44.51458  ? 307 PHE B CA  1 
ATOM   6513 C C   . PHE B 1 307 ? 22.38140  12.60824  -47.86893 1.000 51.73498  ? 307 PHE B C   1 
ATOM   6514 O O   . PHE B 1 307 ? 21.64614  13.53636  -47.51947 1.000 60.61315  ? 307 PHE B O   1 
ATOM   6515 C CB  . PHE B 1 307 ? 21.57267  10.76349  -49.35590 1.000 42.22204  ? 307 PHE B CB  1 
ATOM   6516 C CG  . PHE B 1 307 ? 20.07857  10.94830  -49.33322 1.000 48.47769  ? 307 PHE B CG  1 
ATOM   6517 C CD1 . PHE B 1 307 ? 19.42708  11.30148  -48.16289 1.000 49.10499  ? 307 PHE B CD1 1 
ATOM   6518 C CD2 . PHE B 1 307 ? 19.32265  10.77354  -50.48374 1.000 48.45912  ? 307 PHE B CD2 1 
ATOM   6519 C CE1 . PHE B 1 307 ? 18.05615  11.47114  -48.14185 1.000 48.50749  ? 307 PHE B CE1 1 
ATOM   6520 C CE2 . PHE B 1 307 ? 17.94557  10.94519  -50.46426 1.000 41.71387  ? 307 PHE B CE2 1 
ATOM   6521 C CZ  . PHE B 1 307 ? 17.31685  11.29345  -49.30021 1.000 46.97682  ? 307 PHE B CZ  1 
ATOM   6522 N N   . LEU B 1 308 ? 23.24297  12.03520  -47.04001 1.000 51.34125  ? 308 LEU B N   1 
ATOM   6523 C CA  . LEU B 1 308 ? 23.49791  12.50868  -45.68688 1.000 48.17456  ? 308 LEU B CA  1 
ATOM   6524 C C   . LEU B 1 308 ? 24.90858  13.09294  -45.69027 1.000 51.79910  ? 308 LEU B C   1 
ATOM   6525 O O   . LEU B 1 308 ? 25.89815  12.35216  -45.70156 1.000 51.42412  ? 308 LEU B O   1 
ATOM   6526 C CB  . LEU B 1 308 ? 23.35046  11.36497  -44.68580 1.000 45.51409  ? 308 LEU B CB  1 
ATOM   6527 C CG  . LEU B 1 308 ? 22.00136  10.62911  -44.67663 1.000 42.01026  ? 308 LEU B CG  1 
ATOM   6528 C CD1 . LEU B 1 308 ? 22.03155  9.40359   -43.77338 1.000 33.09791  ? 308 LEU B CD1 1 
ATOM   6529 C CD2 . LEU B 1 308 ? 20.86444  11.55675  -44.27207 1.000 35.50901  ? 308 LEU B CD2 1 
ATOM   6530 N N   . SER B 1 309 ? 25.00161  14.42459  -45.70880 1.000 50.83538  ? 309 SER B N   1 
ATOM   6531 C CA  . SER B 1 309 ? 26.31496  15.06579  -45.74513 1.000 48.98657  ? 309 SER B CA  1 
ATOM   6532 C C   . SER B 1 309 ? 27.14593  14.69670  -44.52297 1.000 59.03071  ? 309 SER B C   1 
ATOM   6533 O O   . SER B 1 309 ? 28.36441  14.51020  -44.62235 1.000 66.65900  ? 309 SER B O   1 
ATOM   6534 C CB  . SER B 1 309 ? 26.15390  16.58023  -45.83915 1.000 54.57502  ? 309 SER B CB  1 
ATOM   6535 O OG  . SER B 1 309 ? 25.27870  17.06655  -44.83494 1.000 60.44081  ? 309 SER B OG  1 
ATOM   6536 N N   . ASP B 1 310 ? 26.50423  14.59833  -43.36091 1.000 59.66601  ? 310 ASP B N   1 
ATOM   6537 C CA  . ASP B 1 310 ? 27.12794  14.12461  -42.12962 1.000 59.90971  ? 310 ASP B CA  1 
ATOM   6538 C C   . ASP B 1 310 ? 26.13736  13.17346  -41.46312 1.000 56.62805  ? 310 ASP B C   1 
ATOM   6539 O O   . ASP B 1 310 ? 25.13706  12.78632  -42.07124 1.000 55.91168  ? 310 ASP B O   1 
ATOM   6540 C CB  . ASP B 1 310 ? 27.52640  15.30549  -41.23441 1.000 59.88936  ? 310 ASP B CB  1 
ATOM   6541 C CG  . ASP B 1 310 ? 28.58185  14.93515  -40.22041 1.000 56.50454  ? 310 ASP B CG  1 
ATOM   6542 O OD1 . ASP B 1 310 ? 28.66297  13.73639  -39.86753 1.000 53.35780  ? 310 ASP B OD1 1 
ATOM   6543 O OD2 . ASP B 1 310 ? 29.32597  15.84096  -39.78266 1.000 57.76990  ? 310 ASP B OD2 1 
ATOM   6544 N N   . THR B 1 311 ? 26.40357  12.78052  -40.21409 1.000 54.61348  ? 311 THR B N   1 
ATOM   6545 C CA  . THR B 1 311 ? 25.45341  11.92790  -39.51560 1.000 48.30212  ? 311 THR B CA  1 
ATOM   6546 C C   . THR B 1 311 ? 24.20112  12.72843  -39.17078 1.000 42.95483  ? 311 THR B C   1 
ATOM   6547 O O   . THR B 1 311 ? 24.25401  13.95409  -39.05560 1.000 50.07190  ? 311 THR B O   1 
ATOM   6548 C CB  . THR B 1 311 ? 26.06980  11.34487  -38.24440 1.000 52.30172  ? 311 THR B CB  1 
ATOM   6549 O OG1 . THR B 1 311 ? 26.19377  12.36073  -37.23269 1.000 44.42588  ? 311 THR B OG1 1 
ATOM   6550 C CG2 . THR B 1 311 ? 27.43590  10.74437  -38.55642 1.000 55.46375  ? 311 THR B CG2 1 
ATOM   6551 N N   . PRO B 1 312 ? 23.05266  12.06819  -39.03074 1.000 41.03579  ? 312 PRO B N   1 
ATOM   6552 C CA  . PRO B 1 312 ? 21.84982  12.81729  -38.62662 1.000 45.65529  ? 312 PRO B CA  1 
ATOM   6553 C C   . PRO B 1 312 ? 22.04543  13.52351  -37.30716 1.000 49.64893  ? 312 PRO B C   1 
ATOM   6554 O O   . PRO B 1 312 ? 21.60263  14.66496  -37.13018 1.000 51.44513  ? 312 PRO B O   1 
ATOM   6555 C CB  . PRO B 1 312 ? 20.76687  11.73486  -38.53333 1.000 42.79679  ? 312 PRO B CB  1 
ATOM   6556 C CG  . PRO B 1 312 ? 21.26463  10.64203  -39.39294 1.000 45.09326  ? 312 PRO B CG  1 
ATOM   6557 C CD  . PRO B 1 312 ? 22.76737  10.64411  -39.23641 1.000 42.98875  ? 312 PRO B CD  1 
ATOM   6558 N N   . GLU B 1 313 ? 22.72161  12.86925  -36.37022 1.000 53.91353  ? 313 GLU B N   1 
ATOM   6559 C CA  A GLU B 1 313 ? 22.97520  13.51846  -35.09054 0.587 60.40792  ? 313 GLU B CA  1 
ATOM   6560 C CA  B GLU B 1 313 ? 23.00845  13.49679  -35.08782 0.413 60.13336  ? 313 GLU B CA  1 
ATOM   6561 C C   . GLU B 1 313 ? 23.77221  14.80095  -35.28545 1.000 58.56323  ? 313 GLU B C   1 
ATOM   6562 O O   . GLU B 1 313 ? 23.49384  15.80780  -34.62757 1.000 57.79417  ? 313 GLU B O   1 
ATOM   6563 C CB  A GLU B 1 313 ? 23.68289  12.56025  -34.12880 0.587 63.18257  ? 313 GLU B CB  1 
ATOM   6564 C CB  B GLU B 1 313 ? 23.78930  12.51550  -34.20936 0.413 63.64696  ? 313 GLU B CB  1 
ATOM   6565 C CG  A GLU B 1 313 ? 23.01020  11.18240  -34.03396 0.587 64.27014  ? 313 GLU B CG  1 
ATOM   6566 C CG  B GLU B 1 313 ? 23.18425  11.08827  -34.15572 0.413 64.30962  ? 313 GLU B CG  1 
ATOM   6567 C CD  A GLU B 1 313 ? 22.27782  10.94216  -32.71835 0.587 64.31219  ? 313 GLU B CD  1 
ATOM   6568 C CD  B GLU B 1 313 ? 23.37097  10.27301  -35.44574 0.413 60.34012  ? 313 GLU B CD  1 
ATOM   6569 O OE1 A GLU B 1 313 ? 22.01736  11.92253  -31.98300 0.587 67.12658  ? 313 GLU B OE1 1 
ATOM   6570 O OE1 B GLU B 1 313 ? 24.52547  9.99798   -35.83418 0.413 59.98379  ? 313 GLU B OE1 1 
ATOM   6571 O OE2 A GLU B 1 313 ? 21.96913  9.76299   -32.42348 0.587 59.44999  ? 313 GLU B OE2 1 
ATOM   6572 O OE2 B GLU B 1 313 ? 22.35419  9.90806   -36.07168 0.413 53.62652  ? 313 GLU B OE2 1 
ATOM   6573 N N   . ALA B 1 314 ? 24.72501  14.80592  -36.22118 1.000 55.34427  ? 314 ALA B N   1 
ATOM   6574 C CA  . ALA B 1 314 ? 25.49982  16.01845  -36.47640 1.000 54.59215  ? 314 ALA B CA  1 
ATOM   6575 C C   . ALA B 1 314 ? 24.66817  17.08224  -37.19198 1.000 59.79762  ? 314 ALA B C   1 
ATOM   6576 O O   . ALA B 1 314 ? 24.81551  18.27819  -36.91328 1.000 62.56682  ? 314 ALA B O   1 
ATOM   6577 C CB  . ALA B 1 314 ? 26.75274  15.68552  -37.28834 1.000 49.04773  ? 314 ALA B CB  1 
ATOM   6578 N N   . LEU B 1 315 ? 23.78405  16.67216  -38.11294 1.000 57.57033  ? 315 LEU B N   1 
ATOM   6579 C CA  . LEU B 1 315 ? 23.02058  17.64417  -38.89293 1.000 51.37782  ? 315 LEU B CA  1 
ATOM   6580 C C   . LEU B 1 315 ? 21.89407  18.28368  -38.09536 1.000 53.39589  ? 315 LEU B C   1 
ATOM   6581 O O   . LEU B 1 315 ? 21.63704  19.48447  -38.24567 1.000 48.13241  ? 315 LEU B O   1 
ATOM   6582 C CB  . LEU B 1 315 ? 22.44449  17.00478  -40.14573 1.000 51.66188  ? 315 LEU B CB  1 
ATOM   6583 C CG  . LEU B 1 315 ? 23.46944  16.43119  -41.10679 1.000 48.77533  ? 315 LEU B CG  1 
ATOM   6584 C CD1 . LEU B 1 315 ? 22.73140  15.58695  -42.12799 1.000 36.68758  ? 315 LEU B CD1 1 
ATOM   6585 C CD2 . LEU B 1 315 ? 24.27403  17.55561  -41.74529 1.000 40.78066  ? 315 LEU B CD2 1 
ATOM   6586 N N   . ILE B 1 316 ? 21.18336  17.51269  -37.26864 1.000 59.88222  ? 316 ILE B N   1 
ATOM   6587 C CA  . ILE B 1 316 ? 20.19513  18.16142  -36.41707 1.000 53.53813  ? 316 ILE B CA  1 
ATOM   6588 C C   . ILE B 1 316 ? 20.89382  19.07436  -35.42430 1.000 48.93540  ? 316 ILE B C   1 
ATOM   6589 O O   . ILE B 1 316 ? 20.42819  20.18775  -35.16643 1.000 48.61913  ? 316 ILE B O   1 
ATOM   6590 C CB  . ILE B 1 316 ? 19.26823  17.14074  -35.72394 1.000 50.02621  ? 316 ILE B CB  1 
ATOM   6591 C CG1 . ILE B 1 316 ? 20.01054  16.23878  -34.74234 1.000 55.04495  ? 316 ILE B CG1 1 
ATOM   6592 C CG2 . ILE B 1 316 ? 18.54225  16.29527  -36.74249 1.000 40.04123  ? 316 ILE B CG2 1 
ATOM   6593 C CD1 . ILE B 1 316 ? 19.07451  15.24351  -34.05860 1.000 52.47457  ? 316 ILE B CD1 1 
ATOM   6594 N N   . ASN B 1 317 ? 22.06336  18.66388  -34.91693 1.000 54.56044  ? 317 ASN B N   1 
ATOM   6595 C CA  . ASN B 1 317 ? 22.78152  19.50264  -33.95292 1.000 65.68721  ? 317 ASN B CA  1 
ATOM   6596 C C   . ASN B 1 317 ? 23.23940  20.82943  -34.55732 1.000 68.95121  ? 317 ASN B C   1 
ATOM   6597 O O   . ASN B 1 317 ? 23.73475  21.68115  -33.81226 1.000 79.98729  ? 317 ASN B O   1 
ATOM   6598 C CB  . ASN B 1 317 ? 24.01944  18.77147  -33.37168 1.000 62.23318  ? 317 ASN B CB  1 
ATOM   6599 C CG  . ASN B 1 317 ? 23.69857  17.83868  -32.17388 1.000 59.01258  ? 317 ASN B CG  1 
ATOM   6600 O OD1 . ASN B 1 317 ? 22.53888  17.59826  -31.82019 1.000 60.43183  ? 317 ASN B OD1 1 
ATOM   6601 N ND2 . ASN B 1 317 ? 24.75172  17.28680  -31.57267 1.000 46.05089  ? 317 ASN B ND2 1 
ATOM   6602 N N   . THR B 1 318 ? 23.07624  21.03379  -35.87057 1.000 63.78527  ? 318 THR B N   1 
ATOM   6603 C CA  . THR B 1 318 ? 23.71218  22.16286  -36.54995 1.000 67.00955  ? 318 THR B CA  1 
ATOM   6604 C C   . THR B 1 318 ? 22.88629  22.83494  -37.64791 1.000 66.93075  ? 318 THR B C   1 
ATOM   6605 O O   . THR B 1 318 ? 23.26050  23.93682  -38.06047 1.000 68.98205  ? 318 THR B O   1 
ATOM   6606 C CB  . THR B 1 318 ? 25.05146  21.72194  -37.15746 1.000 75.01146  ? 318 THR B CB  1 
ATOM   6607 O OG1 . THR B 1 318 ? 25.92417  22.85175  -37.24247 1.000 89.36312  ? 318 THR B OG1 1 
ATOM   6608 C CG2 . THR B 1 318 ? 24.85965  21.12979  -38.56584 1.000 63.59799  ? 318 THR B CG2 1 
ATOM   6609 N N   . GLY B 1 319 ? 21.79499  22.24936  -38.14499 1.000 81.75498  ? 319 GLY B N   1 
ATOM   6610 C CA  . GLY B 1 319 ? 21.09103  22.83306  -39.27393 1.000 80.14097  ? 319 GLY B CA  1 
ATOM   6611 C C   . GLY B 1 319 ? 20.32222  24.09731  -38.91851 1.000 75.84636  ? 319 GLY B C   1 
ATOM   6612 O O   . GLY B 1 319 ? 20.17176  24.46883  -37.75652 1.000 76.87040  ? 319 GLY B O   1 
ATOM   6613 N N   . ASP B 1 320 ? 19.82087  24.77147  -39.95682 1.000 74.51828  ? 320 ASP B N   1 
ATOM   6614 C CA  . ASP B 1 320 ? 18.95704  25.94271  -39.81436 1.000 71.22761  ? 320 ASP B CA  1 
ATOM   6615 C C   . ASP B 1 320 ? 17.54785  25.58940  -40.29449 1.000 70.35561  ? 320 ASP B C   1 
ATOM   6616 O O   . ASP B 1 320 ? 17.34757  25.26731  -41.47390 1.000 64.96259  ? 320 ASP B O   1 
ATOM   6617 C CB  . ASP B 1 320 ? 19.53116  27.12741  -40.58973 1.000 78.20678  ? 320 ASP B CB  1 
ATOM   6618 C CG  . ASP B 1 320 ? 18.60399  28.33517  -40.60981 1.000 81.76349  ? 320 ASP B CG  1 
ATOM   6619 O OD1 . ASP B 1 320 ? 17.55138  28.29801  -39.94022 1.000 76.43277  ? 320 ASP B OD1 1 
ATOM   6620 O OD2 . ASP B 1 320 ? 18.93809  29.33262  -41.29908 1.000 86.29186  ? 320 ASP B OD2 1 
ATOM   6621 N N   . PHE B 1 321 ? 16.56699  25.68135  -39.38155 1.000 67.24857  ? 321 PHE B N   1 
ATOM   6622 C CA  . PHE B 1 321 ? 15.22458  25.15420  -39.61248 1.000 63.29235  ? 321 PHE B CA  1 
ATOM   6623 C C   . PHE B 1 321 ? 14.12900  26.20657  -39.45959 1.000 61.54542  ? 321 PHE B C   1 
ATOM   6624 O O   . PHE B 1 321 ? 13.01858  25.86822  -39.04976 1.000 60.94672  ? 321 PHE B O   1 
ATOM   6625 C CB  . PHE B 1 321 ? 14.92692  23.98878  -38.66930 1.000 46.77515  ? 321 PHE B CB  1 
ATOM   6626 C CG  . PHE B 1 321 ? 15.87398  22.83182  -38.79592 1.000 62.10463  ? 321 PHE B CG  1 
ATOM   6627 C CD1 . PHE B 1 321 ? 15.82684  21.98965  -39.89423 1.000 64.40372  ? 321 PHE B CD1 1 
ATOM   6628 C CD2 . PHE B 1 321 ? 16.80642  22.57463  -37.80639 1.000 64.62076  ? 321 PHE B CD2 1 
ATOM   6629 C CE1 . PHE B 1 321 ? 16.70311  20.90928  -40.00718 1.000 63.53655  ? 321 PHE B CE1 1 
ATOM   6630 C CE2 . PHE B 1 321 ? 17.68192  21.49977  -37.91457 1.000 68.60128  ? 321 PHE B CE2 1 
ATOM   6631 C CZ  . PHE B 1 321 ? 17.62813  20.66607  -39.01746 1.000 62.94148  ? 321 PHE B CZ  1 
ATOM   6632 N N   . GLN B 1 322 ? 14.39143  27.46974  -39.82138 1.000 64.83879  ? 322 GLN B N   1 
ATOM   6633 C CA  . GLN B 1 322 ? 13.44456  28.53348  -39.48064 1.000 67.84768  ? 322 GLN B CA  1 
ATOM   6634 C C   . GLN B 1 322 ? 12.12759  28.39815  -40.23977 1.000 79.72103  ? 322 GLN B C   1 
ATOM   6635 O O   . GLN B 1 322 ? 11.04520  28.47770  -39.64327 1.000 84.11495  ? 322 GLN B O   1 
ATOM   6636 C CB  . GLN B 1 322 ? 14.06457  29.90726  -39.71861 1.000 69.05182  ? 322 GLN B CB  1 
ATOM   6637 C CG  . GLN B 1 322 ? 14.94674  30.36773  -38.57195 1.000 79.59935  ? 322 GLN B CG  1 
ATOM   6638 C CD  . GLN B 1 322 ? 16.05256  31.30276  -39.02300 1.000 97.88397  ? 322 GLN B CD  1 
ATOM   6639 O OE1 . GLN B 1 322 ? 16.69183  31.07841  -40.05688 1.000 106.44978 ? 322 GLN B OE1 1 
ATOM   6640 N NE2 . GLN B 1 322 ? 16.31511  32.33538  -38.22752 1.000 98.37388  ? 322 GLN B NE2 1 
ATOM   6641 N N   . ASP B 1 323 ? 12.18634  28.20060  -41.55348 1.000 85.03407  ? 323 ASP B N   1 
ATOM   6642 C CA  . ASP B 1 323 ? 10.96432  28.13404  -42.34506 1.000 89.99829  ? 323 ASP B CA  1 
ATOM   6643 C C   . ASP B 1 323 ? 10.35476  26.73759  -42.35794 1.000 77.18531  ? 323 ASP B C   1 
ATOM   6644 O O   . ASP B 1 323 ? 9.76406   26.33194  -43.36848 1.000 84.16542  ? 323 ASP B O   1 
ATOM   6645 C CB  . ASP B 1 323 ? 11.23195  28.63541  -43.76756 1.000 103.43074 ? 323 ASP B CB  1 
ATOM   6646 C CG  . ASP B 1 323 ? 11.39695  30.16013  -43.83242 1.000 109.56845 ? 323 ASP B CG  1 
ATOM   6647 O OD1 . ASP B 1 323 ? 10.80404  30.85708  -42.97625 1.000 107.94566 ? 323 ASP B OD1 1 
ATOM   6648 O OD2 . ASP B 1 323 ? 12.11781  30.65830  -44.73239 1.000 110.07774 ? 323 ASP B OD2 1 
ATOM   6649 N N   . LEU B 1 324 ? 10.46371  26.00370  -41.25020 1.000 56.33754  ? 324 LEU B N   1 
ATOM   6650 C CA  . LEU B 1 324 ? 10.07021  24.60379  -41.16936 1.000 49.49108  ? 324 LEU B CA  1 
ATOM   6651 C C   . LEU B 1 324 ? 9.03324   24.40347  -40.08093 1.000 53.96869  ? 324 LEU B C   1 
ATOM   6652 O O   . LEU B 1 324 ? 9.12881   25.00276  -39.00600 1.000 63.11751  ? 324 LEU B O   1 
ATOM   6653 C CB  . LEU B 1 324 ? 11.26156  23.70592  -40.85884 1.000 48.82249  ? 324 LEU B CB  1 
ATOM   6654 C CG  . LEU B 1 324 ? 10.93582  22.22052  -41.01537 1.000 47.31933  ? 324 LEU B CG  1 
ATOM   6655 C CD1 . LEU B 1 324 ? 10.60638  21.93639  -42.46827 1.000 41.56170  ? 324 LEU B CD1 1 
ATOM   6656 C CD2 . LEU B 1 324 ? 12.09387  21.35347  -40.54487 1.000 49.60505  ? 324 LEU B CD2 1 
ATOM   6657 N N   . GLN B 1 325 ? 8.05417   23.54348  -40.34952 1.000 45.76465  ? 325 GLN B N   1 
ATOM   6658 C CA  . GLN B 1 325 ? 7.04129   23.19364  -39.36196 1.000 42.92451  ? 325 GLN B CA  1 
ATOM   6659 C C   . GLN B 1 325 ? 6.91715   21.68115  -39.32821 1.000 43.66797  ? 325 GLN B C   1 
ATOM   6660 O O   . GLN B 1 325 ? 6.88853   21.03459  -40.38058 1.000 54.29482  ? 325 GLN B O   1 
ATOM   6661 C CB  . GLN B 1 325 ? 5.70462   23.87131  -39.67712 1.000 34.56895  ? 325 GLN B CB  1 
ATOM   6662 C CG  . GLN B 1 325 ? 5.89898   25.31306  -40.15874 1.000 46.67285  ? 325 GLN B CG  1 
ATOM   6663 C CD  . GLN B 1 325 ? 5.05975   25.63766  -41.36642 1.000 50.24290  ? 325 GLN B CD  1 
ATOM   6664 O OE1 . GLN B 1 325 ? 4.74425   24.75482  -42.15412 1.000 56.61923  ? 325 GLN B OE1 1 
ATOM   6665 N NE2 . GLN B 1 325 ? 4.71902   26.91024  -41.54016 1.000 48.15293  ? 325 GLN B NE2 1 
ATOM   6666 N N   . VAL B 1 326 ? 6.88872   21.12095  -38.11860 1.000 39.22370  ? 326 VAL B N   1 
ATOM   6667 C CA  . VAL B 1 326 ? 7.05955   19.69017  -37.90335 1.000 37.14327  ? 326 VAL B CA  1 
ATOM   6668 C C   . VAL B 1 326 ? 6.05792   19.23343  -36.85784 1.000 35.03385  ? 326 VAL B C   1 
ATOM   6669 O O   . VAL B 1 326 ? 5.71587   19.97507  -35.93659 1.000 40.87350  ? 326 VAL B O   1 
ATOM   6670 C CB  . VAL B 1 326 ? 8.49222   19.32160  -37.43837 1.000 38.31262  ? 326 VAL B CB  1 
ATOM   6671 C CG1 . VAL B 1 326 ? 8.69944   17.85492  -37.54485 1.000 42.39033  ? 326 VAL B CG1 1 
ATOM   6672 C CG2 . VAL B 1 326 ? 9.55784   20.02415  -38.25575 1.000 43.95915  ? 326 VAL B CG2 1 
ATOM   6673 N N   . LEU B 1 327 ? 5.59889   17.99481  -36.99705 1.000 35.86542  ? 327 LEU B N   1 
ATOM   6674 C CA  . LEU B 1 327 ? 4.70103   17.36420  -36.03986 1.000 37.43851  ? 327 LEU B CA  1 
ATOM   6675 C C   . LEU B 1 327 ? 5.28610   16.00295  -35.68812 1.000 40.80761  ? 327 LEU B C   1 
ATOM   6676 O O   . LEU B 1 327 ? 5.46222   15.15621  -36.57281 1.000 45.03698  ? 327 LEU B O   1 
ATOM   6677 C CB  . LEU B 1 327 ? 3.28654   17.23768  -36.61376 1.000 35.83915  ? 327 LEU B CB  1 
ATOM   6678 C CG  . LEU B 1 327 ? 2.32328   16.38257  -35.79801 1.000 40.27253  ? 327 LEU B CG  1 
ATOM   6679 C CD1 . LEU B 1 327 ? 1.92759   17.14628  -34.56274 1.000 45.57717  ? 327 LEU B CD1 1 
ATOM   6680 C CD2 . LEU B 1 327 ? 1.09742   16.02009  -36.60691 1.000 40.46889  ? 327 LEU B CD2 1 
ATOM   6681 N N   . VAL B 1 328 ? 5.61757   15.80455  -34.40571 1.000 34.84009  ? 328 VAL B N   1 
ATOM   6682 C CA  . VAL B 1 328 ? 6.35394   14.62751  -33.95981 1.000 30.80353  ? 328 VAL B CA  1 
ATOM   6683 C C   . VAL B 1 328 ? 5.64975   14.02122  -32.76324 1.000 36.09114  ? 328 VAL B C   1 
ATOM   6684 O O   . VAL B 1 328 ? 5.05717   14.72781  -31.94088 1.000 46.99601  ? 328 VAL B O   1 
ATOM   6685 C CB  . VAL B 1 328 ? 7.81231   14.94783  -33.57975 1.000 27.17931  ? 328 VAL B CB  1 
ATOM   6686 C CG1 . VAL B 1 328 ? 8.58678   15.42104  -34.79366 1.000 38.51067  ? 328 VAL B CG1 1 
ATOM   6687 C CG2 . VAL B 1 328 ? 7.84881   15.98077  -32.50668 1.000 25.05857  ? 328 VAL B CG2 1 
ATOM   6688 N N   . GLY B 1 329 ? 5.73709   12.70476  -32.64858 1.000 28.43639  ? 329 GLY B N   1 
ATOM   6689 C CA  . GLY B 1 329 ? 5.00784   12.07376  -31.57208 1.000 35.13352  ? 329 GLY B CA  1 
ATOM   6690 C C   . GLY B 1 329 ? 5.35062   10.61235  -31.44478 1.000 43.71384  ? 329 GLY B C   1 
ATOM   6691 O O   . GLY B 1 329 ? 6.03540   10.02728  -32.28753 1.000 48.36402  ? 329 GLY B O   1 
ATOM   6692 N N   . VAL B 1 330 ? 4.83424   10.03094  -30.36529 1.000 40.18740  ? 330 VAL B N   1 
ATOM   6693 C CA  . VAL B 1 330 ? 5.09127   8.65383   -29.97909 1.000 37.43398  ? 330 VAL B CA  1 
ATOM   6694 C C   . VAL B 1 330 ? 3.77691   8.05428   -29.49184 1.000 35.89351  ? 330 VAL B C   1 
ATOM   6695 O O   . VAL B 1 330 ? 2.80942   8.76384   -29.21173 1.000 37.65808  ? 330 VAL B O   1 
ATOM   6696 C CB  . VAL B 1 330 ? 6.16186   8.57515   -28.87137 1.000 43.66610  ? 330 VAL B CB  1 
ATOM   6697 C CG1 . VAL B 1 330 ? 7.48682   9.13090   -29.36663 1.000 47.12644  ? 330 VAL B CG1 1 
ATOM   6698 C CG2 . VAL B 1 330 ? 5.68395   9.36285   -27.63233 1.000 34.19526  ? 330 VAL B CG2 1 
ATOM   6699 N N   . VAL B 1 331 ? 3.75150   6.73080   -29.37520 1.000 34.44404  ? 331 VAL B N   1 
ATOM   6700 C CA  . VAL B 1 331 ? 2.62426   6.06574   -28.73384 1.000 35.35815  ? 331 VAL B CA  1 
ATOM   6701 C C   . VAL B 1 331 ? 3.03647   5.61692   -27.33675 1.000 44.50929  ? 331 VAL B C   1 
ATOM   6702 O O   . VAL B 1 331 ? 4.19521   5.79344   -26.93193 1.000 47.30805  ? 331 VAL B O   1 
ATOM   6703 C CB  . VAL B 1 331 ? 2.10995   4.89723   -29.58949 1.000 36.97396  ? 331 VAL B CB  1 
ATOM   6704 C CG1 . VAL B 1 331 ? 1.63117   5.42325   -30.94114 1.000 40.19614  ? 331 VAL B CG1 1 
ATOM   6705 C CG2 . VAL B 1 331 ? 3.19907   3.85276   -29.77301 1.000 25.19010  ? 331 VAL B CG2 1 
ATOM   6706 N N   . LYS B 1 332 ? 2.08978   5.03772   -26.58545 1.000 46.06575  ? 332 LYS B N   1 
ATOM   6707 C CA  . LYS B 1 332 ? 2.30279   4.84203   -25.14975 1.000 49.84055  ? 332 LYS B CA  1 
ATOM   6708 C C   . LYS B 1 332 ? 3.33241   3.75341   -24.86785 1.000 49.57448  ? 332 LYS B C   1 
ATOM   6709 O O   . LYS B 1 332 ? 4.06477   3.84167   -23.87440 1.000 55.47444  ? 332 LYS B O   1 
ATOM   6710 C CB  . LYS B 1 332 ? 0.97233   4.52543   -24.44619 1.000 55.28424  ? 332 LYS B CB  1 
ATOM   6711 C CG  . LYS B 1 332 ? 1.04812   4.38766   -22.91468 1.000 59.52657  ? 332 LYS B CG  1 
ATOM   6712 C CD  . LYS B 1 332 ? -0.33165  4.38886   -22.25401 1.000 62.60513  ? 332 LYS B CD  1 
ATOM   6713 C CE  . LYS B 1 332 ? -0.37662  3.42075   -21.06678 1.000 70.52053  ? 332 LYS B CE  1 
ATOM   6714 N NZ  . LYS B 1 332 ? -0.50386  1.96849   -21.45950 1.000 68.26874  ? 332 LYS B NZ  1 
ATOM   6715 N N   . ASP B 1 333 ? 3.43011   2.74478   -25.73415 1.000 45.52396  ? 333 ASP B N   1 
ATOM   6716 C CA  . ASP B 1 333 ? 4.22723   1.55141   -25.46034 1.000 44.88344  ? 333 ASP B CA  1 
ATOM   6717 C C   . ASP B 1 333 ? 5.08693   1.17421   -26.67021 1.000 42.21304  ? 333 ASP B C   1 
ATOM   6718 O O   . ASP B 1 333 ? 4.94944   0.09297   -27.23661 1.000 43.85853  ? 333 ASP B O   1 
ATOM   6719 C CB  . ASP B 1 333 ? 3.29925   0.41653   -25.06770 1.000 47.01613  ? 333 ASP B CB  1 
ATOM   6720 C CG  . ASP B 1 333 ? 2.57479   0.69759   -23.78614 1.000 47.28770  ? 333 ASP B CG  1 
ATOM   6721 O OD1 . ASP B 1 333 ? 1.41160   1.16053   -23.83513 1.000 46.08436  ? 333 ASP B OD1 1 
ATOM   6722 O OD2 . ASP B 1 333 ? 3.19702   0.47400   -22.72911 1.000 50.73207  ? 333 ASP B OD2 1 
ATOM   6723 N N   . GLU B 1 334 ? 6.01952   2.05784   -27.03404 1.000 41.19435  ? 334 GLU B N   1 
ATOM   6724 C CA  A GLU B 1 334 ? 6.78279   1.86080   -28.26199 0.503 37.00530  ? 334 GLU B CA  1 
ATOM   6725 C CA  B GLU B 1 334 ? 6.79255   1.86544   -28.25853 0.497 36.98622  ? 334 GLU B CA  1 
ATOM   6726 C C   . GLU B 1 334 ? 7.48514   0.50937   -28.27376 1.000 43.52963  ? 334 GLU B C   1 
ATOM   6727 O O   . GLU B 1 334 ? 7.36597   -0.25242  -29.24179 1.000 58.81187  ? 334 GLU B O   1 
ATOM   6728 C CB  A GLU B 1 334 ? 7.78489   2.99852   -28.44485 0.503 34.21189  ? 334 GLU B CB  1 
ATOM   6729 C CB  B GLU B 1 334 ? 7.81104   2.99255   -28.41245 0.497 34.17967  ? 334 GLU B CB  1 
ATOM   6730 C CG  A GLU B 1 334 ? 7.12754   4.35328   -28.68270 0.503 37.08177  ? 334 GLU B CG  1 
ATOM   6731 C CG  B GLU B 1 334 ? 7.17791   4.32800   -28.75177 0.497 37.18414  ? 334 GLU B CG  1 
ATOM   6732 C CD  A GLU B 1 334 ? 6.51481   4.49021   -30.08015 0.503 38.70600  ? 334 GLU B CD  1 
ATOM   6733 C CD  B GLU B 1 334 ? 6.87504   4.46864   -30.23955 0.497 38.47122  ? 334 GLU B CD  1 
ATOM   6734 O OE1 A GLU B 1 334 ? 6.49059   3.49136   -30.83172 0.503 36.79173  ? 334 GLU B OE1 1 
ATOM   6735 O OE1 B GLU B 1 334 ? 7.58041   3.83348   -31.04922 0.497 34.97175  ? 334 GLU B OE1 1 
ATOM   6736 O OE2 A GLU B 1 334 ? 6.05261   5.60382   -30.42136 0.503 38.81411  ? 334 GLU B OE2 1 
ATOM   6737 O OE2 B GLU B 1 334 ? 5.93200   5.21087   -30.59386 0.497 38.75674  ? 334 GLU B OE2 1 
ATOM   6738 N N   . GLY B 1 335 ? 8.19138   0.17719   -27.19157 1.000 47.52997  ? 335 GLY B N   1 
ATOM   6739 C CA  . GLY B 1 335 ? 9.05164   -0.99740  -27.18648 1.000 49.31199  ? 335 GLY B CA  1 
ATOM   6740 C C   . GLY B 1 335 ? 8.34734   -2.34245  -27.15757 1.000 48.51926  ? 335 GLY B C   1 
ATOM   6741 O O   . GLY B 1 335 ? 8.93203   -3.33636  -27.60483 1.000 47.77136  ? 335 GLY B O   1 
ATOM   6742 N N   . SER B 1 336 ? 7.11246   -2.40191  -26.64922 1.000 47.69873  ? 336 SER B N   1 
ATOM   6743 C CA  . SER B 1 336 ? 6.53212   -3.69469  -26.29028 1.000 46.70584  ? 336 SER B CA  1 
ATOM   6744 C C   . SER B 1 336 ? 6.46928   -4.64348  -27.48607 1.000 49.57662  ? 336 SER B C   1 
ATOM   6745 O O   . SER B 1 336 ? 6.73605   -5.84391  -27.34322 1.000 47.52309  ? 336 SER B O   1 
ATOM   6746 C CB  . SER B 1 336 ? 5.14751   -3.50209  -25.66394 1.000 47.54109  ? 336 SER B CB  1 
ATOM   6747 O OG  . SER B 1 336 ? 4.15246   -3.18271  -26.62197 1.000 48.70249  ? 336 SER B OG  1 
ATOM   6748 N N   . TYR B 1 337 ? 6.14922   -4.12309  -28.67693 1.000 53.31923  ? 337 TYR B N   1 
ATOM   6749 C CA  . TYR B 1 337 ? 6.04227   -4.97653  -29.86332 1.000 47.51267  ? 337 TYR B CA  1 
ATOM   6750 C C   . TYR B 1 337 ? 7.29298   -5.83142  -30.06687 1.000 42.38578  ? 337 TYR B C   1 
ATOM   6751 O O   . TYR B 1 337 ? 7.19528   -7.02132  -30.38133 1.000 44.82783  ? 337 TYR B O   1 
ATOM   6752 C CB  . TYR B 1 337 ? 5.78004   -4.10428  -31.08522 1.000 47.24367  ? 337 TYR B CB  1 
ATOM   6753 C CG  . TYR B 1 337 ? 5.29827   -4.81968  -32.31178 1.000 55.37653  ? 337 TYR B CG  1 
ATOM   6754 C CD1 . TYR B 1 337 ? 4.06979   -4.51003  -32.87303 1.000 61.07108  ? 337 TYR B CD1 1 
ATOM   6755 C CD2 . TYR B 1 337 ? 6.08225   -5.77356  -32.94614 1.000 62.68630  ? 337 TYR B CD2 1 
ATOM   6756 C CE1 . TYR B 1 337 ? 3.61762   -5.15786  -34.02112 1.000 64.67376  ? 337 TYR B CE1 1 
ATOM   6757 C CE2 . TYR B 1 337 ? 5.63977   -6.42113  -34.08650 1.000 65.18871  ? 337 TYR B CE2 1 
ATOM   6758 C CZ  . TYR B 1 337 ? 4.40836   -6.10933  -34.62489 1.000 69.07139  ? 337 TYR B CZ  1 
ATOM   6759 O OH  . TYR B 1 337 ? 3.96570   -6.75163  -35.76908 1.000 81.12462  ? 337 TYR B OH  1 
ATOM   6760 N N   . PHE B 1 338 ? 8.47497   -5.25511  -29.84836 1.000 37.11813  ? 338 PHE B N   1 
ATOM   6761 C CA  . PHE B 1 338 ? 9.72508   -5.88200  -30.25690 1.000 37.88456  ? 338 PHE B CA  1 
ATOM   6762 C C   . PHE B 1 338 ? 10.21093  -6.96001  -29.30801 1.000 41.17565  ? 338 PHE B C   1 
ATOM   6763 O O   . PHE B 1 338 ? 11.13818  -7.69836  -29.66129 1.000 45.92307  ? 338 PHE B O   1 
ATOM   6764 C CB  . PHE B 1 338 ? 10.82261  -4.83165  -30.39199 1.000 41.07446  ? 338 PHE B CB  1 
ATOM   6765 C CG  . PHE B 1 338 ? 10.48931  -3.73501  -31.35216 1.000 48.32304  ? 338 PHE B CG  1 
ATOM   6766 C CD1 . PHE B 1 338 ? 9.75589   -2.62843  -30.93516 1.000 45.70871  ? 338 PHE B CD1 1 
ATOM   6767 C CD2 . PHE B 1 338 ? 10.89951  -3.80949  -32.67674 1.000 45.53381  ? 338 PHE B CD2 1 
ATOM   6768 C CE1 . PHE B 1 338 ? 9.43908   -1.61485  -31.82120 1.000 43.35536  ? 338 PHE B CE1 1 
ATOM   6769 C CE2 . PHE B 1 338 ? 10.59721  -2.79182  -33.56154 1.000 45.04835  ? 338 PHE B CE2 1 
ATOM   6770 C CZ  . PHE B 1 338 ? 9.86387   -1.69743  -33.14057 1.000 44.66415  ? 338 PHE B CZ  1 
ATOM   6771 N N   . LEU B 1 339 ? 9.64378   -7.06017  -28.11111 1.000 44.04046  ? 339 LEU B N   1 
ATOM   6772 C CA  . LEU B 1 339 ? 10.20273  -8.00600  -27.15593 1.000 48.84835  ? 339 LEU B CA  1 
ATOM   6773 C C   . LEU B 1 339 ? 9.90438   -9.44041  -27.56421 1.000 50.00848  ? 339 LEU B C   1 
ATOM   6774 O O   . LEU B 1 339 ? 10.73331  -10.33029 -27.34106 1.000 56.87494  ? 339 LEU B O   1 
ATOM   6775 C CB  . LEU B 1 339 ? 9.67873   -7.70262  -25.75222 1.000 46.07968  ? 339 LEU B CB  1 
ATOM   6776 C CG  . LEU B 1 339 ? 9.83528   -6.22984  -25.35599 1.000 42.85847  ? 339 LEU B CG  1 
ATOM   6777 C CD1 . LEU B 1 339 ? 9.13276   -5.93189  -24.03601 1.000 45.26204  ? 339 LEU B CD1 1 
ATOM   6778 C CD2 . LEU B 1 339 ? 11.30383  -5.83846  -25.28993 1.000 36.22434  ? 339 LEU B CD2 1 
ATOM   6779 N N   . VAL B 1 340 ? 8.75082   -9.67716  -28.19532 1.000 46.91429  ? 340 VAL B N   1 
ATOM   6780 C CA  . VAL B 1 340 ? 8.36458   -11.02976 -28.58604 1.000 62.34757  ? 340 VAL B CA  1 
ATOM   6781 C C   . VAL B 1 340 ? 9.21230   -11.56242 -29.73044 1.000 69.02685  ? 340 VAL B C   1 
ATOM   6782 O O   . VAL B 1 340 ? 9.11652   -12.75249 -30.07726 1.000 67.55677  ? 340 VAL B O   1 
ATOM   6783 C CB  . VAL B 1 340 ? 6.87124   -11.05610 -28.97374 1.000 64.05513  ? 340 VAL B CB  1 
ATOM   6784 C CG1 . VAL B 1 340 ? 6.05439   -10.24080 -27.99473 1.000 56.75640  ? 340 VAL B CG1 1 
ATOM   6785 C CG2 . VAL B 1 340 ? 6.68459   -10.50507 -30.37221 1.000 67.32776  ? 340 VAL B CG2 1 
ATOM   6786 N N   . TYR B 1 341 ? 10.04430  -10.70100 -30.31553 1.000 66.97034  ? 341 TYR B N   1 
ATOM   6787 C CA  . TYR B 1 341 ? 10.84733  -11.00036 -31.49352 1.000 63.98020  ? 341 TYR B CA  1 
ATOM   6788 C C   . TYR B 1 341 ? 12.32119  -11.18571 -31.14102 1.000 70.46400  ? 341 TYR B C   1 
ATOM   6789 O O   . TYR B 1 341 ? 13.20907  -10.71685 -31.84943 1.000 72.92702  ? 341 TYR B O   1 
ATOM   6790 C CB  . TYR B 1 341 ? 10.68051  -9.89526  -32.53490 1.000 59.57483  ? 341 TYR B CB  1 
ATOM   6791 C CG  . TYR B 1 341 ? 9.40868   -10.00203 -33.35865 1.000 60.86039  ? 341 TYR B CG  1 
ATOM   6792 C CD1 . TYR B 1 341 ? 8.36025   -9.10719  -33.18539 1.000 62.26947  ? 341 TYR B CD1 1 
ATOM   6793 C CD2 . TYR B 1 341 ? 9.26174   -10.99961 -34.31312 1.000 61.63307  ? 341 TYR B CD2 1 
ATOM   6794 C CE1 . TYR B 1 341 ? 7.20263   -9.20950  -33.94354 1.000 65.13982  ? 341 TYR B CE1 1 
ATOM   6795 C CE2 . TYR B 1 341 ? 8.11043   -11.10758 -35.07035 1.000 67.90382  ? 341 TYR B CE2 1 
ATOM   6796 C CZ  . TYR B 1 341 ? 7.08506   -10.21115 -34.89090 1.000 67.77511  ? 341 TYR B CZ  1 
ATOM   6797 O OH  . TYR B 1 341 ? 5.94297   -10.33223 -35.65765 1.000 66.54229  ? 341 TYR B OH  1 
ATOM   6798 N N   . GLY B 1 342 ? 12.60681  -11.85923 -30.03347 1.000 82.84786  ? 342 GLY B N   1 
ATOM   6799 C CA  . GLY B 1 342 ? 13.99340  -12.07554 -29.68032 1.000 79.11208  ? 342 GLY B CA  1 
ATOM   6800 C C   . GLY B 1 342 ? 14.30985  -12.16959 -28.20416 1.000 69.90290  ? 342 GLY B C   1 
ATOM   6801 O O   . GLY B 1 342 ? 15.29073  -12.82595 -27.84279 1.000 71.04369  ? 342 GLY B O   1 
ATOM   6802 N N   . VAL B 1 343 ? 13.51737  -11.54021 -27.33973 1.000 62.82006  ? 343 VAL B N   1 
ATOM   6803 C CA  . VAL B 1 343 ? 13.85462  -11.40501 -25.92592 1.000 55.74520  ? 343 VAL B CA  1 
ATOM   6804 C C   . VAL B 1 343 ? 13.28455  -12.60063 -25.17584 1.000 54.68745  ? 343 VAL B C   1 
ATOM   6805 O O   . VAL B 1 343 ? 12.04988  -12.73657 -25.10201 1.000 50.43072  ? 343 VAL B O   1 
ATOM   6806 C CB  . VAL B 1 343 ? 13.32278  -10.09947 -25.32846 1.000 56.37132  ? 343 VAL B CB  1 
ATOM   6807 C CG1 . VAL B 1 343 ? 13.46319  -10.13221 -23.78773 1.000 54.41243  ? 343 VAL B CG1 1 
ATOM   6808 C CG2 . VAL B 1 343 ? 14.03682  -8.91479  -25.93024 1.000 60.95977  ? 343 VAL B CG2 1 
ATOM   6809 N N   . PRO B 1 344 ? 14.11807  -13.46210 -24.58175 1.000 62.49874  ? 344 PRO B N   1 
ATOM   6810 C CA  . PRO B 1 344 ? 13.59697  -14.63773 -23.87665 1.000 53.73221  ? 344 PRO B CA  1 
ATOM   6811 C C   . PRO B 1 344 ? 12.63155  -14.23586 -22.77477 1.000 52.91389  ? 344 PRO B C   1 
ATOM   6812 O O   . PRO B 1 344 ? 12.83538  -13.23546 -22.08798 1.000 56.43370  ? 344 PRO B O   1 
ATOM   6813 C CB  . PRO B 1 344 ? 14.85664  -15.29907 -23.31076 1.000 55.90002  ? 344 PRO B CB  1 
ATOM   6814 C CG  . PRO B 1 344 ? 15.95568  -14.82115 -24.16199 1.000 55.06100  ? 344 PRO B CG  1 
ATOM   6815 C CD  . PRO B 1 344 ? 15.59024  -13.41892 -24.54864 1.000 58.19739  ? 344 PRO B CD  1 
ATOM   6816 N N   . GLY B 1 345 ? 11.54782  -15.00727 -22.64449 1.000 55.10376  ? 345 GLY B N   1 
ATOM   6817 C CA  . GLY B 1 345 ? 10.50525  -14.75298 -21.67416 1.000 57.74588  ? 345 GLY B CA  1 
ATOM   6818 C C   . GLY B 1 345 ? 9.27287   -14.02997 -22.20074 1.000 61.93359  ? 345 GLY B C   1 
ATOM   6819 O O   . GLY B 1 345 ? 8.23419   -14.04502 -21.52690 1.000 66.53278  ? 345 GLY B O   1 
ATOM   6820 N N   . PHE B 1 346 ? 9.34612   -13.39700 -23.36925 1.000 57.89617  ? 346 PHE B N   1 
ATOM   6821 C CA  . PHE B 1 346 ? 8.23976   -12.59529 -23.87166 1.000 54.81720  ? 346 PHE B CA  1 
ATOM   6822 C C   . PHE B 1 346 ? 7.50413   -13.32067 -24.99331 1.000 66.55002  ? 346 PHE B C   1 
ATOM   6823 O O   . PHE B 1 346 ? 8.11921   -13.98390 -25.83658 1.000 68.89079  ? 346 PHE B O   1 
ATOM   6824 C CB  . PHE B 1 346 ? 8.72662   -11.23210 -24.35930 1.000 49.75279  ? 346 PHE B CB  1 
ATOM   6825 C CG  . PHE B 1 346 ? 9.10212   -10.28845 -23.24500 1.000 61.58110  ? 346 PHE B CG  1 
ATOM   6826 C CD1 . PHE B 1 346 ? 10.34679  -10.37984 -22.63197 1.000 56.01853  ? 346 PHE B CD1 1 
ATOM   6827 C CD2 . PHE B 1 346 ? 8.22136   -9.30181  -22.81645 1.000 64.29224  ? 346 PHE B CD2 1 
ATOM   6828 C CE1 . PHE B 1 346 ? 10.70770  -9.51446  -21.62973 1.000 43.06410  ? 346 PHE B CE1 1 
ATOM   6829 C CE2 . PHE B 1 346 ? 8.57833   -8.43475  -21.79098 1.000 54.96710  ? 346 PHE B CE2 1 
ATOM   6830 C CZ  . PHE B 1 346 ? 9.82288   -8.54336  -21.20667 1.000 47.19117  ? 346 PHE B CZ  1 
ATOM   6831 N N   . SER B 1 347 ? 6.18005   -13.17890 -24.99057 1.000 67.72877  ? 347 SER B N   1 
ATOM   6832 C CA  . SER B 1 347 ? 5.29894   -13.82228 -25.95122 1.000 62.48964  ? 347 SER B CA  1 
ATOM   6833 C C   . SER B 1 347 ? 3.98256   -13.06187 -25.99236 1.000 65.21965  ? 347 SER B C   1 
ATOM   6834 O O   . SER B 1 347 ? 3.61140   -12.37845 -25.03640 1.000 63.54651  ? 347 SER B O   1 
ATOM   6835 C CB  . SER B 1 347 ? 5.04323   -15.28085 -25.59100 1.000 60.64171  ? 347 SER B CB  1 
ATOM   6836 O OG  . SER B 1 347 ? 3.73093   -15.63442 -25.98055 1.000 65.16134  ? 347 SER B OG  1 
ATOM   6837 N N   . LYS B 1 348 ? 3.27912   -13.18418 -27.11832 1.000 65.15291  ? 348 LYS B N   1 
ATOM   6838 C CA  . LYS B 1 348 ? 1.94568   -12.60841 -27.20732 1.000 60.68854  ? 348 LYS B CA  1 
ATOM   6839 C C   . LYS B 1 348 ? 0.90732   -13.45272 -26.49025 1.000 66.65134  ? 348 LYS B C   1 
ATOM   6840 O O   . LYS B 1 348 ? -0.20352  -12.97124 -26.24600 1.000 72.99727  ? 348 LYS B O   1 
ATOM   6841 C CB  . LYS B 1 348 ? 1.53140   -12.42749 -28.67517 1.000 62.33484  ? 348 LYS B CB  1 
ATOM   6842 C CG  . LYS B 1 348 ? 0.60272   -13.52716 -29.21276 1.000 69.22152  ? 348 LYS B CG  1 
ATOM   6843 C CD  . LYS B 1 348 ? 0.10446   -13.23446 -30.61367 1.000 64.22198  ? 348 LYS B CD  1 
ATOM   6844 C CE  . LYS B 1 348 ? -0.71243  -14.39366 -31.14504 1.000 70.20471  ? 348 LYS B CE  1 
ATOM   6845 N NZ  . LYS B 1 348 ? -2.11976  -14.32345 -30.68806 1.000 73.17836  ? 348 LYS B NZ  1 
ATOM   6846 N N   . ASP B 1 349 ? 1.24644   -14.68634 -26.12918 1.000 61.75269  ? 349 ASP B N   1 
ATOM   6847 C CA  . ASP B 1 349 ? 0.25366   -15.66045 -25.71288 1.000 67.80124  ? 349 ASP B CA  1 
ATOM   6848 C C   . ASP B 1 349 ? 0.20853   -15.91760 -24.20898 1.000 73.23451  ? 349 ASP B C   1 
ATOM   6849 O O   . ASP B 1 349 ? -0.70602  -16.61234 -23.74921 1.000 75.13422  ? 349 ASP B O   1 
ATOM   6850 C CB  . ASP B 1 349 ? 0.48290   -16.97281 -26.47349 1.000 66.52854  ? 349 ASP B CB  1 
ATOM   6851 C CG  . ASP B 1 349 ? 0.06353   -16.86548 -27.92688 1.000 67.39673  ? 349 ASP B CG  1 
ATOM   6852 O OD1 . ASP B 1 349 ? -0.85749  -16.05828 -28.19407 1.000 62.08582  ? 349 ASP B OD1 1 
ATOM   6853 O OD2 . ASP B 1 349 ? 0.63567   -17.58015 -28.78724 1.000 71.20998  ? 349 ASP B OD2 1 
ATOM   6854 N N   . ASN B 1 350 ? 1.15776   -15.38704 -23.43447 1.000 69.60215  ? 350 ASN B N   1 
ATOM   6855 C CA  . ASN B 1 350 ? 1.02640   -15.34503 -21.98270 1.000 68.18022  ? 350 ASN B CA  1 
ATOM   6856 C C   . ASN B 1 350 ? 1.28486   -13.91068 -21.53374 1.000 71.73597  ? 350 ASN B C   1 
ATOM   6857 O O   . ASN B 1 350 ? 1.40325   -13.01647 -22.37577 1.000 67.27456  ? 350 ASN B O   1 
ATOM   6858 C CB  . ASN B 1 350 ? 1.95735   -16.36788 -21.29124 1.000 71.36764  ? 350 ASN B CB  1 
ATOM   6859 C CG  . ASN B 1 350 ? 3.43838   -16.21617 -21.66816 1.000 73.61755  ? 350 ASN B CG  1 
ATOM   6860 O OD1 . ASN B 1 350 ? 3.95909   -15.10361 -21.78301 1.000 77.81990  ? 350 ASN B OD1 1 
ATOM   6861 N ND2 . ASN B 1 350 ? 4.12764   -17.35167 -21.83038 1.000 69.55013  ? 350 ASN B ND2 1 
ATOM   6862 N N   . GLU B 1 351 ? 1.35566   -13.66520 -20.22662 1.000 78.72258  ? 351 GLU B N   1 
ATOM   6863 C CA  . GLU B 1 351 ? 1.53272   -12.31246 -19.70692 1.000 72.14225  ? 351 GLU B CA  1 
ATOM   6864 C C   . GLU B 1 351 ? 2.99156   -11.86785 -19.67998 1.000 63.55388  ? 351 GLU B C   1 
ATOM   6865 O O   . GLU B 1 351 ? 3.26663   -10.71764 -19.30924 1.000 58.68008  ? 351 GLU B O   1 
ATOM   6866 C CB  . GLU B 1 351 ? 0.93653   -12.20220 -18.29891 1.000 77.88314  ? 351 GLU B CB  1 
ATOM   6867 C CG  . GLU B 1 351 ? -0.51109  -11.72269 -18.25233 1.000 81.93174  ? 351 GLU B CG  1 
ATOM   6868 C CD  . GLU B 1 351 ? -1.23348  -12.17014 -16.97491 1.000 88.91017  ? 351 GLU B CD  1 
ATOM   6869 O OE1 . GLU B 1 351 ? -0.57662  -12.26113 -15.90783 1.000 85.07625  ? 351 GLU B OE1 1 
ATOM   6870 O OE2 . GLU B 1 351 ? -2.45657  -12.44477 -17.04305 1.000 91.67778  ? 351 GLU B OE2 1 
ATOM   6871 N N   . SER B 1 352 ? 3.92633   -12.74686 -20.04997 1.000 60.31324  ? 352 SER B N   1 
ATOM   6872 C CA  . SER B 1 352 ? 5.33738   -12.38433 -20.19410 1.000 63.31902  ? 352 SER B CA  1 
ATOM   6873 C C   . SER B 1 352 ? 5.89051   -11.76049 -18.91392 1.000 63.99544  ? 352 SER B C   1 
ATOM   6874 O O   . SER B 1 352 ? 6.67637   -10.80855 -18.94654 1.000 57.37049  ? 352 SER B O   1 
ATOM   6875 C CB  . SER B 1 352 ? 5.54345   -11.44618 -21.38516 1.000 60.81117  ? 352 SER B CB  1 
ATOM   6876 O OG  . SER B 1 352 ? 4.65394   -11.77595 -22.43217 1.000 58.83511  ? 352 SER B OG  1 
ATOM   6877 N N   . LEU B 1 353 ? 5.45786   -12.28215 -17.77233 1.000 68.00921  ? 353 LEU B N   1 
ATOM   6878 C CA  . LEU B 1 353 ? 6.06802   -11.88481 -16.51492 1.000 62.05083  ? 353 LEU B CA  1 
ATOM   6879 C C   . LEU B 1 353 ? 7.45038   -12.51568 -16.42637 1.000 61.49737  ? 353 LEU B C   1 
ATOM   6880 O O   . LEU B 1 353 ? 7.60419   -13.71832 -16.65568 1.000 65.32928  ? 353 LEU B O   1 
ATOM   6881 C CB  . LEU B 1 353 ? 5.19148   -12.30774 -15.33726 1.000 65.93767  ? 353 LEU B CB  1 
ATOM   6882 C CG  . LEU B 1 353 ? 3.76802   -11.73295 -15.35413 1.000 64.31559  ? 353 LEU B CG  1 
ATOM   6883 C CD1 . LEU B 1 353 ? 2.86886   -12.44635 -14.35898 1.000 62.49299  ? 353 LEU B CD1 1 
ATOM   6884 C CD2 . LEU B 1 353 ? 3.76322   -10.22922 -15.10293 1.000 63.11027  ? 353 LEU B CD2 1 
ATOM   6885 N N   . ILE B 1 354 ? 8.46532   -11.70350 -16.12333 1.000 59.54511  ? 354 ILE B N   1 
ATOM   6886 C CA  . ILE B 1 354 ? 9.84860   -12.14740 -16.22470 1.000 60.76711  ? 354 ILE B CA  1 
ATOM   6887 C C   . ILE B 1 354 ? 10.58821  -11.93750 -14.90980 1.000 64.24718  ? 354 ILE B C   1 
ATOM   6888 O O   . ILE B 1 354 ? 10.23106  -11.09271 -14.08575 1.000 64.35096  ? 354 ILE B O   1 
ATOM   6889 C CB  . ILE B 1 354 ? 10.59743  -11.43899 -17.36854 1.000 55.61514  ? 354 ILE B CB  1 
ATOM   6890 C CG1 . ILE B 1 354 ? 10.43378  -9.92421  -17.24292 1.000 55.22505  ? 354 ILE B CG1 1 
ATOM   6891 C CG2 . ILE B 1 354 ? 10.06344  -11.91725 -18.69356 1.000 55.83358  ? 354 ILE B CG2 1 
ATOM   6892 C CD1 . ILE B 1 354 ? 11.44311  -9.12086  -18.02733 1.000 47.22303  ? 354 ILE B CD1 1 
ATOM   6893 N N   . SER B 1 355 ? 11.64149  -12.73094 -14.73474 1.000 61.90188  ? 355 SER B N   1 
ATOM   6894 C CA  . SER B 1 355 ? 12.52637  -12.65922 -13.58920 1.000 58.77220  ? 355 SER B CA  1 
ATOM   6895 C C   . SER B 1 355 ? 13.50263  -11.49388 -13.72825 1.000 67.61744  ? 355 SER B C   1 
ATOM   6896 O O   . SER B 1 355 ? 13.57599  -10.81882 -14.75981 1.000 77.20620  ? 355 SER B O   1 
ATOM   6897 C CB  . SER B 1 355 ? 13.30900  -13.95523 -13.45310 1.000 65.44412  ? 355 SER B CB  1 
ATOM   6898 O OG  . SER B 1 355 ? 14.25394  -14.04213 -14.50548 1.000 69.03795  ? 355 SER B OG  1 
ATOM   6899 N N   . ARG B 1 356 ? 14.28337  -11.28201 -12.66846 1.000 67.54668  ? 356 ARG B N   1 
ATOM   6900 C CA  . ARG B 1 356 ? 15.30763  -10.24312 -12.68703 1.000 68.92666  ? 356 ARG B CA  1 
ATOM   6901 C C   . ARG B 1 356 ? 16.43801  -10.59958 -13.64607 1.000 70.85646  ? 356 ARG B C   1 
ATOM   6902 O O   . ARG B 1 356 ? 16.97043  -9.72857  -14.34766 1.000 68.86854  ? 356 ARG B O   1 
ATOM   6903 C CB  . ARG B 1 356 ? 15.85042  -10.03807 -11.27313 1.000 69.39787  ? 356 ARG B CB  1 
ATOM   6904 C CG  . ARG B 1 356 ? 17.02009  -9.09126  -11.18374 1.000 66.71728  ? 356 ARG B CG  1 
ATOM   6905 C CD  . ARG B 1 356 ? 16.60467  -7.79410  -10.54926 1.000 69.36301  ? 356 ARG B CD  1 
ATOM   6906 N NE  . ARG B 1 356 ? 17.73118  -6.87413  -10.45871 1.000 74.61719  ? 356 ARG B NE  1 
ATOM   6907 C CZ  . ARG B 1 356 ? 17.64506  -5.56669  -10.68307 1.000 69.76173  ? 356 ARG B CZ  1 
ATOM   6908 N NH1 . ARG B 1 356 ? 16.47849  -5.03208  -11.02065 1.000 59.01171  ? 356 ARG B NH1 1 
ATOM   6909 N NH2 . ARG B 1 356 ? 18.72503  -4.79808  -10.57332 1.000 67.85021  ? 356 ARG B NH2 1 
ATOM   6910 N N   . ALA B 1 357 ? 16.82345  -11.87728 -13.67961 1.000 69.40213  ? 357 ALA B N   1 
ATOM   6911 C CA  . ALA B 1 357 ? 17.91801  -12.29743 -14.54296 1.000 65.95672  ? 357 ALA B CA  1 
ATOM   6912 C C   . ALA B 1 357 ? 17.52327  -12.17769 -16.00083 1.000 67.71783  ? 357 ALA B C   1 
ATOM   6913 O O   . ALA B 1 357 ? 18.31937  -11.73014 -16.83479 1.000 66.25694  ? 357 ALA B O   1 
ATOM   6914 C CB  . ALA B 1 357 ? 18.32321  -13.73127 -14.21329 1.000 59.78805  ? 357 ALA B CB  1 
ATOM   6915 N N   . GLN B 1 358 ? 16.29218  -12.58342 -16.31414 1.000 67.87727  ? 358 GLN B N   1 
ATOM   6916 C CA  . GLN B 1 358 ? 15.73867  -12.38419 -17.64023 1.000 59.69992  ? 358 GLN B CA  1 
ATOM   6917 C C   . GLN B 1 358 ? 15.73959  -10.91546 -18.03570 1.000 60.17028  ? 358 GLN B C   1 
ATOM   6918 O O   . GLN B 1 358 ? 15.88990  -10.59572 -19.22455 1.000 52.73025  ? 358 GLN B O   1 
ATOM   6919 C CB  . GLN B 1 358 ? 14.32288  -12.94579 -17.68791 1.000 60.25453  ? 358 GLN B CB  1 
ATOM   6920 C CG  . GLN B 1 358 ? 14.26329  -14.44469 -17.84679 1.000 68.40905  ? 358 GLN B CG  1 
ATOM   6921 C CD  . GLN B 1 358 ? 12.84916  -14.96744 -17.75284 1.000 72.21391  ? 358 GLN B CD  1 
ATOM   6922 O OE1 . GLN B 1 358 ? 12.02946  -14.41799 -17.01687 1.000 82.21822  ? 358 GLN B OE1 1 
ATOM   6923 N NE2 . GLN B 1 358 ? 12.54042  -16.01109 -18.52604 1.000 59.48295  ? 358 GLN B NE2 1 
ATOM   6924 N N   . PHE B 1 359 ? 15.56844  -10.00868 -17.06399 1.000 57.47235  ? 359 PHE B N   1 
ATOM   6925 C CA  . PHE B 1 359 ? 15.56562  -8.58416  -17.38655 1.000 54.22790  ? 359 PHE B CA  1 
ATOM   6926 C C   . PHE B 1 359 ? 16.97925  -8.07349  -17.63898 1.000 57.83899  ? 359 PHE B C   1 
ATOM   6927 O O   . PHE B 1 359 ? 17.18460  -7.21694  -18.50547 1.000 61.04868  ? 359 PHE B O   1 
ATOM   6928 C CB  . PHE B 1 359 ? 14.88130  -7.79663  -16.27026 1.000 58.65208  ? 359 PHE B CB  1 
ATOM   6929 C CG  . PHE B 1 359 ? 15.14664  -6.30953  -16.30334 1.000 61.60233  ? 359 PHE B CG  1 
ATOM   6930 C CD1 . PHE B 1 359 ? 16.10195  -5.73727  -15.47009 1.000 69.32759  ? 359 PHE B CD1 1 
ATOM   6931 C CD2 . PHE B 1 359 ? 14.40990  -5.47557  -17.11890 1.000 55.26180  ? 359 PHE B CD2 1 
ATOM   6932 C CE1 . PHE B 1 359 ? 16.33938  -4.36443  -15.49518 1.000 61.51293  ? 359 PHE B CE1 1 
ATOM   6933 C CE2 . PHE B 1 359 ? 14.63965  -4.09373  -17.13219 1.000 51.00648  ? 359 PHE B CE2 1 
ATOM   6934 C CZ  . PHE B 1 359 ? 15.60513  -3.54545  -16.33302 1.000 41.52348  ? 359 PHE B CZ  1 
ATOM   6935 N N   . LEU B 1 360 ? 17.96593  -8.58913  -16.90002 1.000 62.41504  ? 360 LEU B N   1 
ATOM   6936 C CA  . LEU B 1 360 ? 19.35810  -8.27758  -17.21151 1.000 63.86393  ? 360 LEU B CA  1 
ATOM   6937 C C   . LEU B 1 360 ? 19.69825  -8.70981  -18.62387 1.000 69.86059  ? 360 LEU B C   1 
ATOM   6938 O O   . LEU B 1 360 ? 20.32937  -7.96068  -19.37823 1.000 71.38525  ? 360 LEU B O   1 
ATOM   6939 C CB  . LEU B 1 360 ? 20.29031  -8.97329  -16.22636 1.000 71.77895  ? 360 LEU B CB  1 
ATOM   6940 C CG  . LEU B 1 360 ? 20.91305  -8.13538  -15.10917 1.000 79.28032  ? 360 LEU B CG  1 
ATOM   6941 C CD1 . LEU B 1 360 ? 21.88752  -7.11890  -15.71119 1.000 88.15697  ? 360 LEU B CD1 1 
ATOM   6942 C CD2 . LEU B 1 360 ? 19.84341  -7.46603  -14.23606 1.000 71.70820  ? 360 LEU B CD2 1 
ATOM   6943 N N   . ALA B 1 361 ? 19.26687  -9.91910  -18.99850 1.000 71.71971  ? 361 ALA B N   1 
ATOM   6944 C CA  . ALA B 1 361 ? 19.59756  -10.47982 -20.30313 1.000 68.84739  ? 361 ALA B CA  1 
ATOM   6945 C C   . ALA B 1 361 ? 18.93494  -9.69571  -21.42670 1.000 68.23919  ? 361 ALA B C   1 
ATOM   6946 O O   . ALA B 1 361 ? 19.52992  -9.51216  -22.49748 1.000 68.01638  ? 361 ALA B O   1 
ATOM   6947 C CB  . ALA B 1 361 ? 19.18641  -11.95168 -20.35752 1.000 51.96118  ? 361 ALA B CB  1 
ATOM   6948 N N   . GLY B 1 362 ? 17.70533  -9.22255  -21.19938 1.000 60.24463  ? 362 GLY B N   1 
ATOM   6949 C CA  . GLY B 1 362 ? 17.00451  -8.47340  -22.22700 1.000 54.33468  ? 362 GLY B CA  1 
ATOM   6950 C C   . GLY B 1 362 ? 17.63330  -7.12770  -22.51769 1.000 58.07867  ? 362 GLY B C   1 
ATOM   6951 O O   . GLY B 1 362 ? 17.60343  -6.66333  -23.65946 1.000 61.65278  ? 362 GLY B O   1 
ATOM   6952 N N   . VAL B 1 363 ? 18.22652  -6.49465  -21.50077 1.000 59.05275  ? 363 VAL B N   1 
ATOM   6953 C CA  . VAL B 1 363 ? 18.86615  -5.19196  -21.67758 1.000 53.42342  ? 363 VAL B CA  1 
ATOM   6954 C C   . VAL B 1 363 ? 20.06743  -5.27964  -22.62716 1.000 57.14996  ? 363 VAL B C   1 
ATOM   6955 O O   . VAL B 1 363 ? 20.32317  -4.33986  -23.39228 1.000 59.93633  ? 363 VAL B O   1 
ATOM   6956 C CB  . VAL B 1 363 ? 19.22562  -4.60864  -20.28410 1.000 46.62751  ? 363 VAL B CB  1 
ATOM   6957 C CG1 . VAL B 1 363 ? 20.21754  -3.43893  -20.35923 1.000 40.38011  ? 363 VAL B CG1 1 
ATOM   6958 C CG2 . VAL B 1 363 ? 17.95396  -4.15308  -19.58379 1.000 40.46011  ? 363 VAL B CG2 1 
ATOM   6959 N N   . ARG B 1 364 ? 20.80353  -6.40372  -22.62816 1.000 51.95145  ? 364 ARG B N   1 
ATOM   6960 C CA  . ARG B 1 364 ? 21.93027  -6.54808  -23.55231 1.000 49.83145  ? 364 ARG B CA  1 
ATOM   6961 C C   . ARG B 1 364 ? 21.48872  -6.75893  -24.99713 1.000 65.06565  ? 364 ARG B C   1 
ATOM   6962 O O   . ARG B 1 364 ? 22.33635  -6.74762  -25.89801 1.000 74.65388  ? 364 ARG B O   1 
ATOM   6963 C CB  . ARG B 1 364 ? 22.83336  -7.71142  -23.15314 1.000 46.27174  ? 364 ARG B CB  1 
ATOM   6964 C CG  . ARG B 1 364 ? 23.41191  -7.65588  -21.76001 1.000 55.60399  ? 364 ARG B CG  1 
ATOM   6965 C CD  . ARG B 1 364 ? 23.98689  -6.29673  -21.42632 1.000 65.91498  ? 364 ARG B CD  1 
ATOM   6966 N NE  . ARG B 1 364 ? 25.31706  -6.03857  -21.97857 1.000 75.39653  ? 364 ARG B NE  1 
ATOM   6967 C CZ  . ARG B 1 364 ? 26.45624  -6.46682  -21.44024 1.000 77.87350  ? 364 ARG B CZ  1 
ATOM   6968 N NH1 . ARG B 1 364 ? 26.44033  -7.19313  -20.32988 1.000 79.43543  ? 364 ARG B NH1 1 
ATOM   6969 N NH2 . ARG B 1 364 ? 27.61656  -6.17278  -22.01701 1.000 81.18122  ? 364 ARG B NH2 1 
ATOM   6970 N N   . ILE B 1 365 ? 20.20073  -6.98067  -25.23716 1.000 60.22231  ? 365 ILE B N   1 
ATOM   6971 C CA  . ILE B 1 365 ? 19.67099  -7.11675  -26.58434 1.000 56.83334  ? 365 ILE B CA  1 
ATOM   6972 C C   . ILE B 1 365 ? 18.84111  -5.90845  -26.98490 1.000 59.93873  ? 365 ILE B C   1 
ATOM   6973 O O   . ILE B 1 365 ? 18.85422  -5.50792  -28.14988 1.000 68.53700  ? 365 ILE B O   1 
ATOM   6974 C CB  . ILE B 1 365 ? 18.84828  -8.41350  -26.72388 1.000 58.31588  ? 365 ILE B CB  1 
ATOM   6975 C CG1 . ILE B 1 365 ? 19.48382  -9.55876  -25.94252 1.000 50.17269  ? 365 ILE B CG1 1 
ATOM   6976 C CG2 . ILE B 1 365 ? 18.65523  -8.77535  -28.17480 1.000 64.06847  ? 365 ILE B CG2 1 
ATOM   6977 C CD1 . ILE B 1 365 ? 18.69908  -10.84986 -26.06254 1.000 47.44020  ? 365 ILE B CD1 1 
ATOM   6978 N N   . GLY B 1 366 ? 18.09235  -5.33650  -26.03674 1.000 48.51644  ? 366 GLY B N   1 
ATOM   6979 C CA  . GLY B 1 366 ? 17.45678  -4.05753  -26.29420 1.000 37.01895  ? 366 GLY B CA  1 
ATOM   6980 C C   . GLY B 1 366 ? 18.47909  -2.96656  -26.51291 1.000 44.85684  ? 366 GLY B C   1 
ATOM   6981 O O   . GLY B 1 366 ? 18.23583  -2.01431  -27.25514 1.000 54.59461  ? 366 GLY B O   1 
ATOM   6982 N N   . VAL B 1 367 ? 19.64177  -3.10043  -25.88880 1.000 39.50726  ? 367 VAL B N   1 
ATOM   6983 C CA  . VAL B 1 367 ? 20.71650  -2.12630  -26.01878 1.000 43.25292  ? 367 VAL B CA  1 
ATOM   6984 C C   . VAL B 1 367 ? 21.96278  -2.88674  -26.44990 1.000 45.06635  ? 367 VAL B C   1 
ATOM   6985 O O   . VAL B 1 367 ? 22.96297  -2.92451  -25.71655 1.000 47.85838  ? 367 VAL B O   1 
ATOM   6986 C CB  . VAL B 1 367 ? 20.93599  -1.34878  -24.71318 1.000 36.72096  ? 367 VAL B CB  1 
ATOM   6987 C CG1 . VAL B 1 367 ? 21.68403  -0.07958  -24.99735 1.000 36.39130  ? 367 VAL B CG1 1 
ATOM   6988 C CG2 . VAL B 1 367 ? 19.60844  -1.01948  -24.05547 1.000 35.71626  ? 367 VAL B CG2 1 
ATOM   6989 N N   . PRO B 1 368 ? 21.94742  -3.47459  -27.64525 1.000 45.87552  ? 368 PRO B N   1 
ATOM   6990 C CA  . PRO B 1 368 ? 23.01240  -4.41827  -28.03279 1.000 50.74898  ? 368 PRO B CA  1 
ATOM   6991 C C   . PRO B 1 368 ? 24.40020  -3.80686  -28.09314 1.000 51.04494  ? 368 PRO B C   1 
ATOM   6992 O O   . PRO B 1 368 ? 25.39912  -4.54102  -27.97534 1.000 43.57237  ? 368 PRO B O   1 
ATOM   6993 C CB  . PRO B 1 368 ? 22.55987  -4.89014  -29.41939 1.000 47.26538  ? 368 PRO B CB  1 
ATOM   6994 C CG  . PRO B 1 368 ? 21.78545  -3.72634  -29.95316 1.000 48.74568  ? 368 PRO B CG  1 
ATOM   6995 C CD  . PRO B 1 368 ? 21.03966  -3.17312  -28.75937 1.000 44.73878  ? 368 PRO B CD  1 
ATOM   6996 N N   . GLN B 1 369 ? 24.49056  -2.49129  -28.27985 1.000 47.50068  ? 369 GLN B N   1 
ATOM   6997 C CA  . GLN B 1 369 ? 25.76762  -1.81201  -28.43239 1.000 54.93621  ? 369 GLN B CA  1 
ATOM   6998 C C   . GLN B 1 369 ? 26.44511  -1.52050  -27.11027 1.000 62.92670  ? 369 GLN B C   1 
ATOM   6999 O O   . GLN B 1 369 ? 27.63101  -1.17994  -27.11373 1.000 73.28182  ? 369 GLN B O   1 
ATOM   7000 C CB  . GLN B 1 369 ? 25.57707  -0.49423  -29.18576 1.000 61.05699  ? 369 GLN B CB  1 
ATOM   7001 C CG  . GLN B 1 369 ? 25.02408  0.64581   -28.32684 1.000 69.87129  ? 369 GLN B CG  1 
ATOM   7002 C CD  . GLN B 1 369 ? 23.52719  0.89932   -28.53039 1.000 79.40889  ? 369 GLN B CD  1 
ATOM   7003 O OE1 . GLN B 1 369 ? 22.68767  0.04115   -28.23659 1.000 82.49422  ? 369 GLN B OE1 1 
ATOM   7004 N NE2 . GLN B 1 369 ? 23.19131  2.09120   -29.02779 1.000 82.35849  ? 369 GLN B NE2 1 
ATOM   7005 N N   . ALA B 1 370 ? 25.73113  -1.64949  -25.99392 1.000 62.50463  ? 370 ALA B N   1 
ATOM   7006 C CA  . ALA B 1 370 ? 26.18880  -1.08896  -24.73263 1.000 55.45625  ? 370 ALA B CA  1 
ATOM   7007 C C   . ALA B 1 370 ? 27.20652  -1.99388  -24.05313 1.000 51.92867  ? 370 ALA B C   1 
ATOM   7008 O O   . ALA B 1 370 ? 27.13759  -3.22501  -24.14039 1.000 55.49416  ? 370 ALA B O   1 
ATOM   7009 C CB  . ALA B 1 370 ? 25.00562  -0.84571  -23.79755 1.000 54.53025  ? 370 ALA B CB  1 
ATOM   7010 N N   . SER B 1 371 ? 28.15366  -1.35858  -23.36316 1.000 50.95881  ? 371 SER B N   1 
ATOM   7011 C CA  . SER B 1 371 ? 29.15638  -2.05004  -22.56370 1.000 55.63950  ? 371 SER B CA  1 
ATOM   7012 C C   . SER B 1 371 ? 28.52422  -2.65628  -21.31468 1.000 58.74515  ? 371 SER B C   1 
ATOM   7013 O O   . SER B 1 371 ? 27.36522  -2.39158  -20.97749 1.000 61.38150  ? 371 SER B O   1 
ATOM   7014 C CB  . SER B 1 371 ? 30.27320  -1.08940  -22.15277 1.000 58.77023  ? 371 SER B CB  1 
ATOM   7015 O OG  . SER B 1 371 ? 29.80330  -0.15201  -21.18933 1.000 64.57707  ? 371 SER B OG  1 
ATOM   7016 N N   . ASP B 1 372 ? 29.31447  -3.48274  -20.61955 1.000 66.53562  ? 372 ASP B N   1 
ATOM   7017 C CA  . ASP B 1 372 ? 28.88491  -4.01624  -19.32954 1.000 67.95041  ? 372 ASP B CA  1 
ATOM   7018 C C   . ASP B 1 372 ? 28.43965  -2.88779  -18.40641 1.000 61.60313  ? 372 ASP B C   1 
ATOM   7019 O O   . ASP B 1 372 ? 27.33456  -2.91916  -17.84627 1.000 52.54914  ? 372 ASP B O   1 
ATOM   7020 C CB  . ASP B 1 372 ? 30.01734  -4.81993  -18.68873 1.000 72.99205  ? 372 ASP B CB  1 
ATOM   7021 C CG  . ASP B 1 372 ? 30.47338  -5.98380  -19.54886 1.000 82.41303  ? 372 ASP B CG  1 
ATOM   7022 O OD1 . ASP B 1 372 ? 30.67737  -5.78144  -20.76864 1.000 83.03570  ? 372 ASP B OD1 1 
ATOM   7023 O OD2 . ASP B 1 372 ? 30.64855  -7.09699  -18.99777 1.000 87.18133  ? 372 ASP B OD2 1 
ATOM   7024 N N   . LEU B 1 373 ? 29.28120  -1.85589  -18.27833 1.000 59.25084  ? 373 LEU B N   1 
ATOM   7025 C CA  . LEU B 1 373 ? 28.97871  -0.75302  -17.37683 1.000 59.74771  ? 373 LEU B CA  1 
ATOM   7026 C C   . LEU B 1 373 ? 27.72803  -0.00477  -17.80049 1.000 57.30727  ? 373 LEU B C   1 
ATOM   7027 O O   . LEU B 1 373 ? 26.99194  0.50483   -16.94757 1.000 61.59388  ? 373 LEU B O   1 
ATOM   7028 C CB  . LEU B 1 373 ? 30.16529  0.20310   -17.31139 1.000 62.25424  ? 373 LEU B CB  1 
ATOM   7029 C CG  . LEU B 1 373 ? 30.06742  1.34777   -16.30649 1.000 59.15805  ? 373 LEU B CG  1 
ATOM   7030 C CD1 . LEU B 1 373 ? 29.44341  0.86740   -15.01068 1.000 62.13159  ? 373 LEU B CD1 1 
ATOM   7031 C CD2 . LEU B 1 373 ? 31.44863  1.91914   -16.05044 1.000 57.19707  ? 373 LEU B CD2 1 
ATOM   7032 N N   . ALA B 1 374 ? 27.46838  0.07572   -19.10150 1.000 50.55979  ? 374 ALA B N   1 
ATOM   7033 C CA  . ALA B 1 374 ? 26.33985  0.87176   -19.55658 1.000 49.80270  ? 374 ALA B CA  1 
ATOM   7034 C C   . ALA B 1 374 ? 25.01832  0.13060   -19.40555 1.000 48.59371  ? 374 ALA B C   1 
ATOM   7035 O O   . ALA B 1 374 ? 23.97501  0.76570   -19.22393 1.000 46.18103  ? 374 ALA B O   1 
ATOM   7036 C CB  . ALA B 1 374 ? 26.55913  1.29992   -21.00523 1.000 51.64287  ? 374 ALA B CB  1 
ATOM   7037 N N   . ALA B 1 375 ? 25.03024  -1.19746  -19.49023 1.000 49.86065  ? 375 ALA B N   1 
ATOM   7038 C CA  . ALA B 1 375 ? 23.79801  -1.93816  -19.26353 1.000 47.47410  ? 375 ALA B CA  1 
ATOM   7039 C C   . ALA B 1 375 ? 23.52148  -2.03794  -17.78060 1.000 56.33892  ? 375 ALA B C   1 
ATOM   7040 O O   . ALA B 1 375 ? 22.36356  -2.00708  -17.35023 1.000 60.68506  ? 375 ALA B O   1 
ATOM   7041 C CB  . ALA B 1 375 ? 23.88828  -3.32610  -19.88557 1.000 43.34157  ? 375 ALA B CB  1 
ATOM   7042 N N   . GLU B 1 376 ? 24.58453  -2.16981  -16.99132 1.000 63.52607  ? 376 GLU B N   1 
ATOM   7043 C CA  . GLU B 1 376 ? 24.50071  -1.90356  -15.56622 1.000 66.20591  ? 376 GLU B CA  1 
ATOM   7044 C C   . GLU B 1 376 ? 23.74380  -0.59929  -15.31845 1.000 58.21891  ? 376 GLU B C   1 
ATOM   7045 O O   . GLU B 1 376 ? 22.66721  -0.59003  -14.71191 1.000 61.88226  ? 376 GLU B O   1 
ATOM   7046 C CB  . GLU B 1 376 ? 25.91669  -1.85251  -14.98350 1.000 77.34033  ? 376 GLU B CB  1 
ATOM   7047 C CG  . GLU B 1 376 ? 26.00664  -2.31083  -13.54560 1.000 91.95521  ? 376 GLU B CG  1 
ATOM   7048 C CD  . GLU B 1 376 ? 25.24176  -3.58668  -13.32557 1.000 95.95817  ? 376 GLU B CD  1 
ATOM   7049 O OE1 . GLU B 1 376 ? 25.50521  -4.56053  -14.07119 1.000 92.54631  ? 376 GLU B OE1 1 
ATOM   7050 O OE2 . GLU B 1 376 ? 24.36246  -3.59896  -12.43101 1.000 95.29202  ? 376 GLU B OE2 1 
ATOM   7051 N N   . ALA B 1 377 ? 24.28417  0.50672   -15.83127 1.000 51.46040  ? 377 ALA B N   1 
ATOM   7052 C CA  . ALA B 1 377 ? 23.62356  1.80135   -15.71101 1.000 48.16394  ? 377 ALA B CA  1 
ATOM   7053 C C   . ALA B 1 377 ? 22.15038  1.74741   -16.12563 1.000 51.51992  ? 377 ALA B C   1 
ATOM   7054 O O   . ALA B 1 377 ? 21.29014  2.32945   -15.45993 1.000 55.42628  ? 377 ALA B O   1 
ATOM   7055 C CB  . ALA B 1 377 ? 24.38068  2.83437   -16.54708 1.000 41.04480  ? 377 ALA B CB  1 
ATOM   7056 N N   . VAL B 1 378 ? 21.83494  1.05826   -17.22254 1.000 52.80712  ? 378 VAL B N   1 
ATOM   7057 C CA  . VAL B 1 378 ? 20.44919  1.02069   -17.68038 1.000 45.89292  ? 378 VAL B CA  1 
ATOM   7058 C C   . VAL B 1 378 ? 19.59166  0.21041   -16.71909 1.000 50.16976  ? 378 VAL B C   1 
ATOM   7059 O O   . VAL B 1 378 ? 18.48898  0.63157   -16.35166 1.000 56.68355  ? 378 VAL B O   1 
ATOM   7060 C CB  . VAL B 1 378 ? 20.37079  0.48601   -19.12382 1.000 42.70469  ? 378 VAL B CB  1 
ATOM   7061 C CG1 . VAL B 1 378 ? 18.95481  0.03326   -19.46988 1.000 40.91299  ? 378 VAL B CG1 1 
ATOM   7062 C CG2 . VAL B 1 378 ? 20.80417  1.57185   -20.09392 1.000 36.36077  ? 378 VAL B CG2 1 
ATOM   7063 N N   . VAL B 1 379 ? 20.09530  -0.94088  -16.26646 1.000 50.06477  ? 379 VAL B N   1 
ATOM   7064 C CA  . VAL B 1 379 ? 19.34518  -1.77100  -15.32338 1.000 53.45384  ? 379 VAL B CA  1 
ATOM   7065 C C   . VAL B 1 379 ? 19.09961  -1.03147  -14.00847 1.000 47.70997  ? 379 VAL B C   1 
ATOM   7066 O O   . VAL B 1 379 ? 17.99399  -1.06818  -13.45369 1.000 50.28030  ? 379 VAL B O   1 
ATOM   7067 C CB  . VAL B 1 379 ? 20.08592  -3.09809  -15.09067 1.000 54.38273  ? 379 VAL B CB  1 
ATOM   7068 C CG1 . VAL B 1 379 ? 19.43170  -3.87458  -13.94218 1.000 46.63455  ? 379 VAL B CG1 1 
ATOM   7069 C CG2 . VAL B 1 379 ? 20.13185  -3.91251  -16.38614 1.000 43.79088  ? 379 VAL B CG2 1 
ATOM   7070 N N   . LEU B 1 380 ? 20.12404  -0.35445  -13.48965 1.000 44.23388  ? 380 LEU B N   1 
ATOM   7071 C CA  . LEU B 1 380 ? 19.96808  0.39418   -12.24899 1.000 46.14312  ? 380 LEU B CA  1 
ATOM   7072 C C   . LEU B 1 380 ? 18.96782  1.53222   -12.39661 1.000 55.02983  ? 380 LEU B C   1 
ATOM   7073 O O   . LEU B 1 380 ? 18.26049  1.87408   -11.44414 1.000 62.29487  ? 380 LEU B O   1 
ATOM   7074 C CB  . LEU B 1 380 ? 21.32611  0.92285   -11.79651 1.000 44.65112  ? 380 LEU B CB  1 
ATOM   7075 C CG  . LEU B 1 380 ? 22.34235  -0.18837  -11.49731 1.000 61.63304  ? 380 LEU B CG  1 
ATOM   7076 C CD1 . LEU B 1 380 ? 23.41487  0.29383   -10.54125 1.000 72.53008  ? 380 LEU B CD1 1 
ATOM   7077 C CD2 . LEU B 1 380 ? 21.68012  -1.42153  -10.90533 1.000 69.66794  ? 380 LEU B CD2 1 
ATOM   7078 N N   . HIS B 1 381 ? 18.88263  2.12320   -13.57842 1.000 57.74906  ? 381 HIS B N   1 
ATOM   7079 C CA  . HIS B 1 381 ? 17.97307  3.24474   -13.77478 1.000 53.62861  ? 381 HIS B CA  1 
ATOM   7080 C C   . HIS B 1 381 ? 16.51941  2.78888   -13.81631 1.000 48.04967  ? 381 HIS B C   1 
ATOM   7081 O O   . HIS B 1 381 ? 15.64929  3.42116   -13.20345 1.000 52.22864  ? 381 HIS B O   1 
ATOM   7082 C CB  . HIS B 1 381 ? 18.34856  3.96855   -15.06281 1.000 47.99134  ? 381 HIS B CB  1 
ATOM   7083 C CG  . HIS B 1 381 ? 17.49512  5.15541   -15.36797 1.000 44.20900  ? 381 HIS B CG  1 
ATOM   7084 N ND1 . HIS B 1 381 ? 17.73774  6.40273   -14.83637 1.000 49.58200  ? 381 HIS B ND1 1 
ATOM   7085 C CD2 . HIS B 1 381 ? 16.40327  5.28767   -16.15788 1.000 42.58808  ? 381 HIS B CD2 1 
ATOM   7086 C CE1 . HIS B 1 381 ? 16.82670  7.25141   -15.28060 1.000 43.78252  ? 381 HIS B CE1 1 
ATOM   7087 N NE2 . HIS B 1 381 ? 16.00588  6.59995   -16.08501 1.000 40.62857  ? 381 HIS B NE2 1 
ATOM   7088 N N   . TYR B 1 382 ? 16.24052  1.68800   -14.52262 1.000 38.97473  ? 382 TYR B N   1 
ATOM   7089 C CA  . TYR B 1 382 ? 14.86944  1.27627   -14.81062 1.000 48.00431  ? 382 TYR B CA  1 
ATOM   7090 C C   . TYR B 1 382 ? 14.27778  0.34953   -13.75542 1.000 49.80527  ? 382 TYR B C   1 
ATOM   7091 O O   . TYR B 1 382 ? 13.04900  0.16312   -13.72279 1.000 51.47835  ? 382 TYR B O   1 
ATOM   7092 C CB  . TYR B 1 382 ? 14.79075  0.60011   -16.19581 1.000 47.81265  ? 382 TYR B CB  1 
ATOM   7093 C CG  . TYR B 1 382 ? 14.67936  1.59365   -17.32703 1.000 40.91498  ? 382 TYR B CG  1 
ATOM   7094 C CD1 . TYR B 1 382 ? 15.81411  2.13495   -17.92000 1.000 40.21435  ? 382 TYR B CD1 1 
ATOM   7095 C CD2 . TYR B 1 382 ? 13.43745  2.02512   -17.77680 1.000 47.15587  ? 382 TYR B CD2 1 
ATOM   7096 C CE1 . TYR B 1 382 ? 15.71220  3.07037   -18.95146 1.000 42.97589  ? 382 TYR B CE1 1 
ATOM   7097 C CE2 . TYR B 1 382 ? 13.32152  2.95260   -18.81481 1.000 47.56505  ? 382 TYR B CE2 1 
ATOM   7098 C CZ  . TYR B 1 382 ? 14.46264  3.47527   -19.39505 1.000 44.51954  ? 382 TYR B CZ  1 
ATOM   7099 O OH  . TYR B 1 382 ? 14.35159  4.40231   -20.41411 1.000 40.34471  ? 382 TYR B OH  1 
ATOM   7100 N N   . THR B 1 383 ? 15.11008  -0.22666  -12.89529 1.000 48.29212  ? 383 THR B N   1 
ATOM   7101 C CA  . THR B 1 383 ? 14.59027  -0.98559  -11.76892 1.000 49.51754  ? 383 THR B CA  1 
ATOM   7102 C C   . THR B 1 383 ? 13.80481  -0.07689  -10.82820 1.000 50.73939  ? 383 THR B C   1 
ATOM   7103 O O   . THR B 1 383 ? 14.19638  1.06581   -10.56431 1.000 43.76578  ? 383 THR B O   1 
ATOM   7104 C CB  . THR B 1 383 ? 15.74000  -1.66178  -11.03268 1.000 50.68741  ? 383 THR B CB  1 
ATOM   7105 O OG1 . THR B 1 383 ? 16.32210  -2.64733  -11.89380 1.000 49.40569  ? 383 THR B OG1 1 
ATOM   7106 C CG2 . THR B 1 383 ? 15.24710  -2.32704  -9.75721  1.000 58.70591  ? 383 THR B CG2 1 
ATOM   7107 N N   . ASP B 1 384 ? 12.66613  -0.58056  -10.35119 1.000 58.68418  ? 384 ASP B N   1 
ATOM   7108 C CA  . ASP B 1 384 ? 11.87318  0.10659   -9.32983  1.000 67.92190  ? 384 ASP B CA  1 
ATOM   7109 C C   . ASP B 1 384 ? 12.35736  -0.38818  -7.96399  1.000 68.12396  ? 384 ASP B C   1 
ATOM   7110 O O   . ASP B 1 384 ? 11.88845  -1.40116  -7.43881  1.000 69.64120  ? 384 ASP B O   1 
ATOM   7111 C CB  . ASP B 1 384 ? 10.38425  -0.14586  -9.55441  1.000 73.45486  ? 384 ASP B CB  1 
ATOM   7112 C CG  . ASP B 1 384 ? 9.49868   0.66523   -8.62342  1.000 85.65503  ? 384 ASP B CG  1 
ATOM   7113 O OD1 . ASP B 1 384 ? 9.96258   1.70423   -8.11442  1.000 94.30075  ? 384 ASP B OD1 1 
ATOM   7114 O OD2 . ASP B 1 384 ? 8.34024   0.25589   -8.38482  1.000 89.87686  ? 384 ASP B OD2 1 
ATOM   7115 N N   . TRP B 1 385 ? 13.30190  0.34426   -7.36545  1.000 64.25177  ? 385 TRP B N   1 
ATOM   7116 C CA  . TRP B 1 385 ? 14.00265  -0.14709  -6.17744  1.000 71.96962  ? 385 TRP B CA  1 
ATOM   7117 C C   . TRP B 1 385 ? 13.07151  -0.33172  -4.98282  1.000 71.71165  ? 385 TRP B C   1 
ATOM   7118 O O   . TRP B 1 385 ? 13.50346  -0.79779  -3.92662  1.000 77.90408  ? 385 TRP B O   1 
ATOM   7119 C CB  . TRP B 1 385 ? 15.19398  0.77151   -5.84544  1.000 50.63696  ? 385 TRP B CB  1 
ATOM   7120 C CG  . TRP B 1 385 ? 16.20197  0.61105   -6.91556  1.000 57.31386  ? 385 TRP B CG  1 
ATOM   7121 C CD1 . TRP B 1 385 ? 16.41450  1.44045   -7.99549  1.000 60.17168  ? 385 TRP B CD1 1 
ATOM   7122 C CD2 . TRP B 1 385 ? 17.05361  -0.51101  -7.10437  1.000 53.93916  ? 385 TRP B CD2 1 
ATOM   7123 N NE1 . TRP B 1 385 ? 17.38318  0.91422   -8.81993  1.000 52.30534  ? 385 TRP B NE1 1 
ATOM   7124 C CE2 . TRP B 1 385 ? 17.78666  -0.28850  -8.30220  1.000 54.25375  ? 385 TRP B CE2 1 
ATOM   7125 C CE3 . TRP B 1 385 ? 17.27567  -1.68188  -6.38320  1.000 52.39013  ? 385 TRP B CE3 1 
ATOM   7126 C CZ2 . TRP B 1 385 ? 18.73561  -1.19313  -8.77774  1.000 53.43454  ? 385 TRP B CZ2 1 
ATOM   7127 C CZ3 . TRP B 1 385 ? 18.21389  -2.57976  -6.85943  1.000 56.71911  ? 385 TRP B CZ3 1 
ATOM   7128 C CH2 . TRP B 1 385 ? 18.93266  -2.33259  -8.04804  1.000 54.90095  ? 385 TRP B CH2 1 
ATOM   7129 N N   . LEU B 1 386 ? 11.78522  -0.02026  -5.14454  1.000 73.56401  ? 386 LEU B N   1 
ATOM   7130 C CA  . LEU B 1 386 ? 10.80839  -0.43492  -4.14161  1.000 85.13626  ? 386 LEU B CA  1 
ATOM   7131 C C   . LEU B 1 386 ? 10.33481  -1.86434  -4.37487  1.000 84.93729  ? 386 LEU B C   1 
ATOM   7132 O O   . LEU B 1 386 ? 10.02771  -2.57788  -3.41032  1.000 77.40877  ? 386 LEU B O   1 
ATOM   7133 C CB  . LEU B 1 386 ? 9.61685   0.52458   -4.14503  1.000 86.96488  ? 386 LEU B CB  1 
ATOM   7134 C CG  . LEU B 1 386 ? 9.94725   1.91714   -3.60989  1.000 79.57112  ? 386 LEU B CG  1 
ATOM   7135 C CD1 . LEU B 1 386 ? 9.07320   3.03422   -4.23013  1.000 65.79106  ? 386 LEU B CD1 1 
ATOM   7136 C CD2 . LEU B 1 386 ? 9.82655   1.85671   -2.10191  1.000 71.38925  ? 386 LEU B CD2 1 
ATOM   7137 N N   . HIS B 1 387 ? 10.28059  -2.28513  -5.64416  1.000 84.86191  ? 387 HIS B N   1 
ATOM   7138 C CA  . HIS B 1 387 ? 9.82243   -3.61819  -6.04423  1.000 83.46510  ? 387 HIS B CA  1 
ATOM   7139 C C   . HIS B 1 387 ? 10.79353  -4.17131  -7.07509  1.000 75.33767  ? 387 HIS B C   1 
ATOM   7140 O O   . HIS B 1 387 ? 10.43578  -4.38955  -8.23718  1.000 80.23987  ? 387 HIS B O   1 
ATOM   7141 C CB  . HIS B 1 387 ? 8.40422   -3.56301  -6.61899  1.000 87.64416  ? 387 HIS B CB  1 
ATOM   7142 C CG  . HIS B 1 387 ? 7.52930   -2.51925  -5.99347  1.000 92.76148  ? 387 HIS B CG  1 
ATOM   7143 N ND1 . HIS B 1 387 ? 7.34739   -1.26815  -6.54715  1.000 93.01981  ? 387 HIS B ND1 1 
ATOM   7144 C CD2 . HIS B 1 387 ? 6.77341   -2.54657  -4.86961  1.000 92.68990  ? 387 HIS B CD2 1 
ATOM   7145 C CE1 . HIS B 1 387 ? 6.52697   -0.56699  -5.78291  1.000 90.91727  ? 387 HIS B CE1 1 
ATOM   7146 N NE2 . HIS B 1 387 ? 6.16312   -1.32056  -4.76126  1.000 90.39737  ? 387 HIS B NE2 1 
ATOM   7147 N N   . PRO B 1 388 ? 12.04251  -4.42440  -6.67708  1.000 67.95802  ? 388 PRO B N   1 
ATOM   7148 C CA  . PRO B 1 388 ? 13.08690  -4.73546  -7.66843  1.000 66.78504  ? 388 PRO B CA  1 
ATOM   7149 C C   . PRO B 1 388 ? 12.97240  -6.11117  -8.30135  1.000 67.85100  ? 388 PRO B C   1 
ATOM   7150 O O   . PRO B 1 388 ? 13.67221  -6.37036  -9.29043  1.000 66.45752  ? 388 PRO B O   1 
ATOM   7151 C CB  . PRO B 1 388 ? 14.37323  -4.62496  -6.85046  1.000 69.49443  ? 388 PRO B CB  1 
ATOM   7152 C CG  . PRO B 1 388 ? 13.95138  -5.05362  -5.48794  1.000 57.05128  ? 388 PRO B CG  1 
ATOM   7153 C CD  . PRO B 1 388 ? 12.55301  -4.51445  -5.30088  1.000 56.75082  ? 388 PRO B CD  1 
ATOM   7154 N N   . GLU B 1 389 ? 12.15299  -7.00706  -7.75465  1.000 71.72085  ? 389 GLU B N   1 
ATOM   7155 C CA  . GLU B 1 389 ? 11.98126  -8.34408  -8.30604  1.000 72.87673  ? 389 GLU B CA  1 
ATOM   7156 C C   . GLU B 1 389 ? 10.58083  -8.57406  -8.84674  1.000 68.27236  ? 389 GLU B C   1 
ATOM   7157 O O   . GLU B 1 389 ? 10.30299  -9.65837  -9.37386  1.000 64.05106  ? 389 GLU B O   1 
ATOM   7158 C CB  . GLU B 1 389 ? 12.30725  -9.40588  -7.24914  1.000 76.76814  ? 389 GLU B CB  1 
ATOM   7159 C CG  . GLU B 1 389 ? 13.62784  -9.17260  -6.52413  1.000 87.52544  ? 389 GLU B CG  1 
ATOM   7160 C CD  . GLU B 1 389 ? 14.73419  -10.12105 -6.97332  1.000 93.70925  ? 389 GLU B CD  1 
ATOM   7161 O OE1 . GLU B 1 389 ? 14.49094  -10.96775 -7.86421  1.000 91.79615  ? 389 GLU B OE1 1 
ATOM   7162 O OE2 . GLU B 1 389 ? 15.85408  -10.01611 -6.42763  1.000 96.57627  ? 389 GLU B OE2 1 
ATOM   7163 N N   . ASP B 1 390 ? 9.70240   -7.58536  -8.73788  1.000 65.03404  ? 390 ASP B N   1 
ATOM   7164 C CA  . ASP B 1 390 ? 8.32000   -7.74831  -9.14670  1.000 62.10457  ? 390 ASP B CA  1 
ATOM   7165 C C   . ASP B 1 390 ? 8.24493   -8.12658  -10.61878 1.000 69.48797  ? 390 ASP B C   1 
ATOM   7166 O O   . ASP B 1 390 ? 8.73317   -7.36832  -11.47612 1.000 72.85256  ? 390 ASP B O   1 
ATOM   7167 C CB  . ASP B 1 390 ? 7.52884   -6.47588  -8.88604  1.000 54.89184  ? 390 ASP B CB  1 
ATOM   7168 C CG  . ASP B 1 390 ? 6.10919   -6.56707  -9.39856  1.000 65.09476  ? 390 ASP B CG  1 
ATOM   7169 O OD1 . ASP B 1 390 ? 5.39292   -7.51745  -9.01456  1.000 65.04032  ? 390 ASP B OD1 1 
ATOM   7170 O OD2 . ASP B 1 390 ? 5.71204   -5.68360  -10.19008 1.000 68.29326  ? 390 ASP B OD2 1 
ATOM   7171 N N   . PRO B 1 391 ? 7.67311   -9.28182  -10.95429 1.000 69.51452  ? 391 PRO B N   1 
ATOM   7172 C CA  . PRO B 1 391 ? 7.57559   -9.66731  -12.37306 1.000 67.59532  ? 391 PRO B CA  1 
ATOM   7173 C C   . PRO B 1 391 ? 6.94888   -8.60599  -13.26353 1.000 70.30150  ? 391 PRO B C   1 
ATOM   7174 O O   . PRO B 1 391 ? 7.45387   -8.38941  -14.37065 1.000 81.34398  ? 391 PRO B O   1 
ATOM   7175 C CB  . PRO B 1 391 ? 6.73811   -10.95438 -12.33148 1.000 71.68903  ? 391 PRO B CB  1 
ATOM   7176 C CG  . PRO B 1 391 ? 6.25297   -11.09019 -10.87035 1.000 77.26771  ? 391 PRO B CG  1 
ATOM   7177 C CD  . PRO B 1 391 ? 7.22839   -10.34774 -10.04536 1.000 67.08724  ? 391 PRO B CD  1 
ATOM   7178 N N   . THR B 1 392 ? 5.89570   -7.90845  -12.81871 1.000 70.66100  ? 392 THR B N   1 
ATOM   7179 C CA  . THR B 1 392 ? 5.21711   -6.96772  -13.71790 1.000 67.26743  ? 392 THR B CA  1 
ATOM   7180 C C   . THR B 1 392 ? 6.03709   -5.69643  -13.93911 1.000 69.25960  ? 392 THR B C   1 
ATOM   7181 O O   . THR B 1 392 ? 6.05635   -5.15336  -15.04964 1.000 67.75101  ? 392 THR B O   1 
ATOM   7182 C CB  . THR B 1 392 ? 3.82128   -6.62107  -13.18809 1.000 57.90129  ? 392 THR B CB  1 
ATOM   7183 O OG1 . THR B 1 392 ? 2.95172   -7.74469  -13.35391 1.000 60.82896  ? 392 THR B OG1 1 
ATOM   7184 C CG2 . THR B 1 392 ? 3.23384   -5.46255  -13.95291 1.000 49.00915  ? 392 THR B CG2 1 
ATOM   7185 N N   . HIS B 1 393 ? 6.71866   -5.19644  -12.90442 1.000 70.47562  ? 393 HIS B N   1 
ATOM   7186 C CA  . HIS B 1 393 ? 7.51294   -3.98936  -13.10714 1.000 69.68228  ? 393 HIS B CA  1 
ATOM   7187 C C   . HIS B 1 393 ? 8.68107   -4.25901  -14.04263 1.000 63.78921  ? 393 HIS B C   1 
ATOM   7188 O O   . HIS B 1 393 ? 9.05431   -3.39283  -14.84001 1.000 57.67996  ? 393 HIS B O   1 
ATOM   7189 C CB  . HIS B 1 393 ? 8.00629   -3.43497  -11.77470 1.000 71.73836  ? 393 HIS B CB  1 
ATOM   7190 C CG  . HIS B 1 393 ? 6.94696   -2.72127  -10.99468 1.000 90.91720  ? 393 HIS B CG  1 
ATOM   7191 N ND1 . HIS B 1 393 ? 6.39723   -3.23519  -9.83649  1.000 96.65470  ? 393 HIS B ND1 1 
ATOM   7192 C CD2 . HIS B 1 393 ? 6.32679   -1.53672  -11.20974 1.000 94.20149  ? 393 HIS B CD2 1 
ATOM   7193 C CE1 . HIS B 1 393 ? 5.49290   -2.39465  -9.36641  1.000 94.23073  ? 393 HIS B CE1 1 
ATOM   7194 N NE2 . HIS B 1 393 ? 5.42907   -1.35655  -10.18113 1.000 95.71892  ? 393 HIS B NE2 1 
ATOM   7195 N N   . LEU B 1 394 ? 9.25814   -5.45949  -13.97300 1.000 62.15522  ? 394 LEU B N   1 
ATOM   7196 C CA  . LEU B 1 394 ? 10.36949  -5.79969  -14.85649 1.000 60.32429  ? 394 LEU B CA  1 
ATOM   7197 C C   . LEU B 1 394 ? 9.89752   -5.96217  -16.30024 1.000 67.90931  ? 394 LEU B C   1 
ATOM   7198 O O   . LEU B 1 394 ? 10.53439  -5.46274  -17.23832 1.000 69.76491  ? 394 LEU B O   1 
ATOM   7199 C CB  . LEU B 1 394 ? 11.05489  -7.06874  -14.35273 1.000 56.03561  ? 394 LEU B CB  1 
ATOM   7200 C CG  . LEU B 1 394 ? 11.68102  -6.93414  -12.96504 1.000 55.40763  ? 394 LEU B CG  1 
ATOM   7201 C CD1 . LEU B 1 394 ? 12.11873  -8.28441  -12.41978 1.000 51.62932  ? 394 LEU B CD1 1 
ATOM   7202 C CD2 . LEU B 1 394 ? 12.85332  -5.96916  -13.04918 1.000 47.57098  ? 394 LEU B CD2 1 
ATOM   7203 N N   . ARG B 1 395 ? 8.77600   -6.65552  -16.49723 1.000 64.75279  ? 395 ARG B N   1 
ATOM   7204 C CA  . ARG B 1 395 ? 8.18588   -6.74893  -17.82564 1.000 54.28407  ? 395 ARG B CA  1 
ATOM   7205 C C   . ARG B 1 395 ? 7.95597   -5.36189  -18.41356 1.000 52.77784  ? 395 ARG B C   1 
ATOM   7206 O O   . ARG B 1 395 ? 8.40900   -5.06388  -19.51966 1.000 59.82735  ? 395 ARG B O   1 
ATOM   7207 C CB  . ARG B 1 395 ? 6.88696   -7.54973  -17.74211 1.000 53.88911  ? 395 ARG B CB  1 
ATOM   7208 C CG  . ARG B 1 395 ? 6.17762   -7.76442  -19.04098 1.000 51.44240  ? 395 ARG B CG  1 
ATOM   7209 C CD  . ARG B 1 395 ? 4.92507   -6.92214  -19.05193 1.000 56.58956  ? 395 ARG B CD  1 
ATOM   7210 N NE  . ARG B 1 395 ? 3.71853   -7.61669  -18.60084 1.000 46.95393  ? 395 ARG B NE  1 
ATOM   7211 C CZ  . ARG B 1 395 ? 2.72332   -7.01730  -17.94487 1.000 51.79298  ? 395 ARG B CZ  1 
ATOM   7212 N NH1 . ARG B 1 395 ? 2.80709   -5.72226  -17.63847 1.000 45.65633  ? 395 ARG B NH1 1 
ATOM   7213 N NH2 . ARG B 1 395 ? 1.64754   -7.71376  -17.58019 1.000 54.28584  ? 395 ARG B NH2 1 
ATOM   7214 N N   . ASP B 1 396 ? 7.29483   -4.48067  -17.66140 1.000 53.24544  ? 396 ASP B N   1 
ATOM   7215 C CA  . ASP B 1 396 ? 7.00544   -3.13786  -18.16279 1.000 49.31703  ? 396 ASP B CA  1 
ATOM   7216 C C   . ASP B 1 396 ? 8.27191   -2.30823  -18.34637 1.000 48.83403  ? 396 ASP B C   1 
ATOM   7217 O O   . ASP B 1 396 ? 8.31068   -1.42522  -19.21481 1.000 51.55683  ? 396 ASP B O   1 
ATOM   7218 C CB  . ASP B 1 396 ? 6.03250   -2.41913  -17.22084 1.000 49.64486  ? 396 ASP B CB  1 
ATOM   7219 C CG  . ASP B 1 396 ? 4.60175   -2.91981  -17.36072 1.000 60.59246  ? 396 ASP B CG  1 
ATOM   7220 O OD1 . ASP B 1 396 ? 4.36530   -3.77948  -18.23472 1.000 64.12336  ? 396 ASP B OD1 1 
ATOM   7221 O OD2 . ASP B 1 396 ? 3.71835   -2.47165  -16.59398 1.000 62.26025  ? 396 ASP B OD2 1 
ATOM   7222 N N   . ALA B 1 397 ? 9.30957   -2.56319  -17.54437 1.000 49.31998  ? 397 ALA B N   1 
ATOM   7223 C CA  . ALA B 1 397 ? 10.54377  -1.79019  -17.66531 1.000 46.14771  ? 397 ALA B CA  1 
ATOM   7224 C C   . ALA B 1 397 ? 11.34150  -2.20521  -18.89150 1.000 46.73178  ? 397 ALA B C   1 
ATOM   7225 O O   . ALA B 1 397 ? 11.92899  -1.35448  -19.57042 1.000 41.11550  ? 397 ALA B O   1 
ATOM   7226 C CB  . ALA B 1 397 ? 11.40459  -1.94269  -16.41235 1.000 39.22998  ? 397 ALA B CB  1 
ATOM   7227 N N   . MET B 1 398 ? 11.39026  -3.51033  -19.17008 1.000 50.72020  ? 398 MET B N   1 
ATOM   7228 C CA  . MET B 1 398 ? 12.03310  -3.99091  -20.38893 1.000 49.65948  ? 398 MET B CA  1 
ATOM   7229 C C   . MET B 1 398 ? 11.42192  -3.33595  -21.62896 1.000 48.90209  ? 398 MET B C   1 
ATOM   7230 O O   . MET B 1 398 ? 12.14838  -2.89451  -22.52528 1.000 58.61443  ? 398 MET B O   1 
ATOM   7231 C CB  . MET B 1 398 ? 11.92096  -5.51799  -20.45482 1.000 48.87674  ? 398 MET B CB  1 
ATOM   7232 C CG  . MET B 1 398 ? 12.63458  -6.17677  -21.61838 1.000 53.22078  ? 398 MET B CG  1 
ATOM   7233 S SD  . MET B 1 398 ? 14.42318  -6.08675  -21.48707 1.000 56.25105  ? 398 MET B SD  1 
ATOM   7234 C CE  . MET B 1 398 ? 14.79710  -4.78320  -22.65910 1.000 49.88067  ? 398 MET B CE  1 
ATOM   7235 N N   . SER B 1 399 ? 10.08655  -3.24654  -21.68370 1.000 40.93758  ? 399 SER B N   1 
ATOM   7236 C CA  . SER B 1 399 ? 9.41054   -2.58317  -22.79451 1.000 42.33347  ? 399 SER B CA  1 
ATOM   7237 C C   . SER B 1 399 ? 9.71938   -1.09289  -22.83970 1.000 45.67733  ? 399 SER B C   1 
ATOM   7238 O O   . SER B 1 399 ? 9.79306   -0.50481  -23.92707 1.000 54.07958  ? 399 SER B O   1 
ATOM   7239 C CB  . SER B 1 399 ? 7.89992   -2.81339  -22.69197 1.000 47.31125  ? 399 SER B CB  1 
ATOM   7240 O OG  . SER B 1 399 ? 7.15245   -1.70477  -23.17576 1.000 50.35095  ? 399 SER B OG  1 
ATOM   7241 N N   . ALA B 1 400 ? 9.89030   -0.46546  -21.67684 1.000 42.03081  ? 400 ALA B N   1 
ATOM   7242 C CA  . ALA B 1 400 ? 10.23371  0.95263   -21.63496 1.000 39.29231  ? 400 ALA B CA  1 
ATOM   7243 C C   . ALA B 1 400 ? 11.67522  1.18658   -22.07100 1.000 42.47400  ? 400 ALA B C   1 
ATOM   7244 O O   . ALA B 1 400 ? 11.96232  2.16333   -22.76947 1.000 40.70685  ? 400 ALA B O   1 
ATOM   7245 C CB  . ALA B 1 400 ? 10.00127  1.50784   -20.22454 1.000 40.63441  ? 400 ALA B CB  1 
ATOM   7246 N N   . VAL B 1 401 ? 12.60444  0.32872   -21.63437 1.000 45.28366  ? 401 VAL B N   1 
ATOM   7247 C CA  . VAL B 1 401 ? 13.98247  0.43786   -22.10706 1.000 44.28492  ? 401 VAL B CA  1 
ATOM   7248 C C   . VAL B 1 401 ? 14.00686  0.42504   -23.62545 1.000 43.10155  ? 401 VAL B C   1 
ATOM   7249 O O   . VAL B 1 401 ? 14.59205  1.30552   -24.26334 1.000 44.97161  ? 401 VAL B O   1 
ATOM   7250 C CB  . VAL B 1 401 ? 14.85253  -0.69259  -21.53078 1.000 46.46130  ? 401 VAL B CB  1 
ATOM   7251 C CG1 . VAL B 1 401 ? 16.23410  -0.67024  -22.16451 1.000 34.51660  ? 401 VAL B CG1 1 
ATOM   7252 C CG2 . VAL B 1 401 ? 14.97239  -0.53846  -20.05470 1.000 49.72305  ? 401 VAL B CG2 1 
ATOM   7253 N N   . VAL B 1 402 ? 13.34228  -0.56237  -24.22635 1.000 40.33091  ? 402 VAL B N   1 
ATOM   7254 C CA  . VAL B 1 402 ? 13.37053  -0.67765  -25.67722 1.000 42.09211  ? 402 VAL B CA  1 
ATOM   7255 C C   . VAL B 1 402 ? 12.66913  0.51077   -26.32077 1.000 44.20070  ? 402 VAL B C   1 
ATOM   7256 O O   . VAL B 1 402 ? 13.15105  1.05755   -27.32144 1.000 34.34881  ? 402 VAL B O   1 
ATOM   7257 C CB  . VAL B 1 402 ? 12.75761  -2.01378  -26.12552 1.000 37.64515  ? 402 VAL B CB  1 
ATOM   7258 C CG1 . VAL B 1 402 ? 12.53069  -1.98818  -27.61800 1.000 37.14671  ? 402 VAL B CG1 1 
ATOM   7259 C CG2 . VAL B 1 402 ? 13.67979  -3.16389  -25.75367 1.000 34.79155  ? 402 VAL B CG2 1 
ATOM   7260 N N   . GLY B 1 403 ? 11.54177  0.94711   -25.74124 1.000 44.65522  ? 403 GLY B N   1 
ATOM   7261 C CA  . GLY B 1 403 ? 10.79226  2.05455   -26.32158 1.000 36.05615  ? 403 GLY B CA  1 
ATOM   7262 C C   . GLY B 1 403 ? 11.50648  3.38701   -26.19546 1.000 39.03526  ? 403 GLY B C   1 
ATOM   7263 O O   . GLY B 1 403 ? 11.51977  4.18701   -27.13274 1.000 41.43016  ? 403 GLY B O   1 
ATOM   7264 N N   . ASP B 1 404 ? 12.12239  3.63715   -25.04485 1.000 40.74780  ? 404 ASP B N   1 
ATOM   7265 C CA  . ASP B 1 404 ? 12.78808  4.91149   -24.81583 1.000 38.02428  ? 404 ASP B CA  1 
ATOM   7266 C C   . ASP B 1 404 ? 14.08730  5.00858   -25.59572 1.000 44.71918  ? 404 ASP B C   1 
ATOM   7267 O O   . ASP B 1 404 ? 14.37913  6.03726   -26.21747 1.000 52.94248  ? 404 ASP B O   1 
ATOM   7268 C CB  . ASP B 1 404 ? 13.06505  5.08563   -23.32874 1.000 39.19188  ? 404 ASP B CB  1 
ATOM   7269 C CG  . ASP B 1 404 ? 11.81572  5.14908   -22.52304 1.000 44.13786  ? 404 ASP B CG  1 
ATOM   7270 O OD1 . ASP B 1 404 ? 10.71288  5.09636   -23.13138 1.000 48.84956  ? 404 ASP B OD1 1 
ATOM   7271 O OD2 . ASP B 1 404 ? 11.94426  5.26523   -21.28397 1.000 51.53665  ? 404 ASP B OD2 1 
ATOM   7272 N N   . HIS B 1 405 ? 14.90165  3.96046   -25.53341 1.000 39.63100  ? 405 HIS B N   1 
ATOM   7273 C CA  . HIS B 1 405 ? 16.16849  3.96419   -26.24450 1.000 38.35832  ? 405 HIS B CA  1 
ATOM   7274 C C   . HIS B 1 405 ? 15.96809  4.19225   -27.74029 1.000 43.24389  ? 405 HIS B C   1 
ATOM   7275 O O   . HIS B 1 405 ? 16.76819  4.89297   -28.36924 1.000 48.18294  ? 405 HIS B O   1 
ATOM   7276 C CB  . HIS B 1 405 ? 16.88251  2.64401   -25.96991 1.000 38.96783  ? 405 HIS B CB  1 
ATOM   7277 C CG  . HIS B 1 405 ? 18.11164  2.40734   -26.79387 1.000 46.81922  ? 405 HIS B CG  1 
ATOM   7278 N ND1 . HIS B 1 405 ? 19.14645  3.31994   -26.87932 1.000 44.41528  ? 405 HIS B ND1 1 
ATOM   7279 C CD2 . HIS B 1 405 ? 18.50006  1.32565   -27.51521 1.000 41.05528  ? 405 HIS B CD2 1 
ATOM   7280 C CE1 . HIS B 1 405 ? 20.10851  2.81635   -27.63318 1.000 41.80858  ? 405 HIS B CE1 1 
ATOM   7281 N NE2 . HIS B 1 405 ? 19.74029  1.60989   -28.03379 1.000 45.23699  ? 405 HIS B NE2 1 
ATOM   7282 N N   . ASN B 1 406 ? 14.89310  3.65702   -28.32334 1.000 43.68041  ? 406 ASN B N   1 
ATOM   7283 C CA  . ASN B 1 406 ? 14.78648  3.63382   -29.77957 1.000 45.30907  ? 406 ASN B CA  1 
ATOM   7284 C C   . ASN B 1 406 ? 13.81975  4.64562   -30.36691 1.000 45.19419  ? 406 ASN B C   1 
ATOM   7285 O O   . ASN B 1 406 ? 14.02189  5.05543   -31.51178 1.000 51.49416  ? 406 ASN B O   1 
ATOM   7286 C CB  . ASN B 1 406 ? 14.39727  2.23817   -30.27840 1.000 32.80550  ? 406 ASN B CB  1 
ATOM   7287 C CG  . ASN B 1 406 ? 15.56653  1.26841   -30.24813 1.000 39.11541  ? 406 ASN B CG  1 
ATOM   7288 O OD1 . ASN B 1 406 ? 16.57924  1.48377   -30.91208 1.000 50.68469  ? 406 ASN B OD1 1 
ATOM   7289 N ND2 . ASN B 1 406 ? 15.43006  0.18993   -29.48342 1.000 33.33973  ? 406 ASN B ND2 1 
ATOM   7290 N N   . VAL B 1 407 ? 12.78562  5.06947   -29.63674 1.000 30.60308  ? 407 VAL B N   1 
ATOM   7291 C CA  . VAL B 1 407 ? 11.87377  6.06644   -30.19509 1.000 27.59323  ? 407 VAL B CA  1 
ATOM   7292 C C   . VAL B 1 407 ? 11.73509  7.30040   -29.29687 1.000 36.49868  ? 407 VAL B C   1 
ATOM   7293 O O   . VAL B 1 407 ? 12.15560  8.39983   -29.69183 1.000 34.29833  ? 407 VAL B O   1 
ATOM   7294 C CB  . VAL B 1 407 ? 10.50440  5.43991   -30.49740 1.000 33.86928  ? 407 VAL B CB  1 
ATOM   7295 C CG1 . VAL B 1 407 ? 9.61974   6.45231   -31.15279 1.000 40.40978  ? 407 VAL B CG1 1 
ATOM   7296 C CG2 . VAL B 1 407 ? 10.66721  4.21433   -31.39125 1.000 26.95629  ? 407 VAL B CG2 1 
ATOM   7297 N N   . VAL B 1 408 ? 11.17770  7.13501   -28.08131 1.000 35.92667  ? 408 VAL B N   1 
ATOM   7298 C CA  . VAL B 1 408 ? 10.81694  8.29615   -27.25317 1.000 32.23239  ? 408 VAL B CA  1 
ATOM   7299 C C   . VAL B 1 408 ? 11.99317  9.25677   -27.09366 1.000 34.11683  ? 408 VAL B C   1 
ATOM   7300 O O   . VAL B 1 408 ? 11.83447  10.48052  -27.18222 1.000 38.61775  ? 408 VAL B O   1 
ATOM   7301 C CB  . VAL B 1 408 ? 10.28606  7.87391   -25.86325 1.000 35.95383  ? 408 VAL B CB  1 
ATOM   7302 C CG1 . VAL B 1 408 ? 9.69925   9.08551   -25.16138 1.000 26.09994  ? 408 VAL B CG1 1 
ATOM   7303 C CG2 . VAL B 1 408 ? 9.26425   6.75536   -25.93033 1.000 34.31330  ? 408 VAL B CG2 1 
ATOM   7304 N N   . CYS B 1 409 ? 13.17719  8.73738   -26.83908 1.000 35.03448  ? 409 CYS B N   1 
ATOM   7305 C CA  . CYS B 1 409 ? 14.22212  9.68821   -26.49883 1.000 34.78081  ? 409 CYS B CA  1 
ATOM   7306 C C   . CYS B 1 409 ? 14.79577  10.34332  -27.75206 1.000 43.91988  ? 409 CYS B C   1 
ATOM   7307 O O   . CYS B 1 409 ? 15.00564  11.56798  -27.74150 1.000 48.11667  ? 409 CYS B O   1 
ATOM   7308 C CB  . CYS B 1 409 ? 15.29222  9.01208   -25.64144 1.000 40.82457  ? 409 CYS B CB  1 
ATOM   7309 S SG  . CYS B 1 409 ? 14.71011  8.73490   -23.93004 1.000 46.46573  ? 409 CYS B SG  1 
ATOM   7310 N N   . PRO B 1 410 ? 15.04210  9.59817   -28.85267 1.000 36.27658  ? 410 PRO B N   1 
ATOM   7311 C CA  . PRO B 1 410 ? 15.34394  10.27885  -30.12675 1.000 30.39539  ? 410 PRO B CA  1 
ATOM   7312 C C   . PRO B 1 410 ? 14.28305  11.28665  -30.54445 1.000 35.06745  ? 410 PRO B C   1 
ATOM   7313 O O   . PRO B 1 410 ? 14.62737  12.38272  -31.02073 1.000 37.93084  ? 410 PRO B O   1 
ATOM   7314 C CB  . PRO B 1 410 ? 15.44627  9.12400   -31.12826 1.000 30.98218  ? 410 PRO B CB  1 
ATOM   7315 C CG  . PRO B 1 410 ? 15.85447  7.97213   -30.33646 1.000 35.65082  ? 410 PRO B CG  1 
ATOM   7316 C CD  . PRO B 1 410 ? 15.26822  8.14654   -28.95398 1.000 37.97594  ? 410 PRO B CD  1 
ATOM   7317 N N   . VAL B 1 411 ? 12.99862  10.95879  -30.38041 1.000 25.11117  ? 411 VAL B N   1 
ATOM   7318 C CA  . VAL B 1 411 ? 11.97184  11.94027  -30.72290 1.000 31.21043  ? 411 VAL B CA  1 
ATOM   7319 C C   . VAL B 1 411 ? 12.11190  13.17993  -29.84059 1.000 36.47948  ? 411 VAL B C   1 
ATOM   7320 O O   . VAL B 1 411 ? 11.93356  14.31336  -30.29927 1.000 40.26110  ? 411 VAL B O   1 
ATOM   7321 C CB  . VAL B 1 411 ? 10.56930  11.30695  -30.63664 1.000 25.93952  ? 411 VAL B CB  1 
ATOM   7322 C CG1 . VAL B 1 411 ? 9.52077   12.37074  -30.55076 1.000 25.50918  ? 411 VAL B CG1 1 
ATOM   7323 C CG2 . VAL B 1 411 ? 10.30177  10.42139  -31.85278 1.000 24.55285  ? 411 VAL B CG2 1 
ATOM   7324 N N   . ALA B 1 412 ? 12.50678  12.99733  -28.58082 1.000 37.59432  ? 412 ALA B N   1 
ATOM   7325 C CA  . ALA B 1 412 ? 12.66353  14.15562  -27.70733 1.000 32.83295  ? 412 ALA B CA  1 
ATOM   7326 C C   . ALA B 1 412 ? 13.91761  14.95291  -28.03383 1.000 31.73393  ? 412 ALA B C   1 
ATOM   7327 O O   . ALA B 1 412 ? 13.90886  16.18599  -27.92087 1.000 38.47046  ? 412 ALA B O   1 
ATOM   7328 C CB  . ALA B 1 412 ? 12.67652  13.71897  -26.24818 1.000 32.56889  ? 412 ALA B CB  1 
ATOM   7329 N N   . GLN B 1 413 ? 14.98957  14.28030  -28.45836 1.000 29.51838  ? 413 GLN B N   1 
ATOM   7330 C CA  . GLN B 1 413 ? 16.18517  14.99747  -28.90293 1.000 37.95735  ? 413 GLN B CA  1 
ATOM   7331 C C   . GLN B 1 413 ? 15.94939  15.74315  -30.22926 1.000 48.86444  ? 413 GLN B C   1 
ATOM   7332 O O   . GLN B 1 413 ? 16.42240  16.87689  -30.40293 1.000 46.81004  ? 413 GLN B O   1 
ATOM   7333 C CB  . GLN B 1 413 ? 17.34909  14.01484  -29.02504 1.000 38.42642  ? 413 GLN B CB  1 
ATOM   7334 C CG  . GLN B 1 413 ? 18.60561  14.60859  -29.59210 1.000 52.24705  ? 413 GLN B CG  1 
ATOM   7335 C CD  . GLN B 1 413 ? 19.73176  13.59597  -29.69382 1.000 77.10513  ? 413 GLN B CD  1 
ATOM   7336 O OE1 . GLN B 1 413 ? 20.90235  13.95720  -29.61735 1.000 97.28267  ? 413 GLN B OE1 1 
ATOM   7337 N NE2 . GLN B 1 413 ? 19.38363  12.32187  -29.89294 1.000 84.25729  ? 413 GLN B NE2 1 
ATOM   7338 N N   . LEU B 1 414 ? 15.22534  15.13370  -31.18729 1.000 47.49058  ? 414 LEU B N   1 
ATOM   7339 C CA  . LEU B 1 414 ? 14.97114  15.84523  -32.43898 1.000 45.18422  ? 414 LEU B CA  1 
ATOM   7340 C C   . LEU B 1 414 ? 14.03796  17.02687  -32.20676 1.000 49.99789  ? 414 LEU B C   1 
ATOM   7341 O O   . LEU B 1 414 ? 14.27135  18.12003  -32.73569 1.000 49.53714  ? 414 LEU B O   1 
ATOM   7342 C CB  . LEU B 1 414 ? 14.40561  14.90244  -33.50580 1.000 41.09476  ? 414 LEU B CB  1 
ATOM   7343 C CG  . LEU B 1 414 ? 13.80020  15.47433  -34.80823 1.000 38.19114  ? 414 LEU B CG  1 
ATOM   7344 C CD1 . LEU B 1 414 ? 14.87270  15.81832  -35.83821 1.000 27.15276  ? 414 LEU B CD1 1 
ATOM   7345 C CD2 . LEU B 1 414 ? 12.81911  14.49889  -35.42147 1.000 33.34119  ? 414 LEU B CD2 1 
ATOM   7346 N N   . ALA B 1 415 ? 12.99248  16.83800  -31.39608 1.000 44.64373  ? 415 ALA B N   1 
ATOM   7347 C CA  . ALA B 1 415 ? 12.09464  17.94597  -31.10403 1.000 36.27124  ? 415 ALA B CA  1 
ATOM   7348 C C   . ALA B 1 415 ? 12.85085  19.08892  -30.45456 1.000 49.13261  ? 415 ALA B C   1 
ATOM   7349 O O   . ALA B 1 415 ? 12.64721  20.25918  -30.79910 1.000 52.49618  ? 415 ALA B O   1 
ATOM   7350 C CB  . ALA B 1 415 ? 10.96136  17.48249  -30.20175 1.000 28.57955  ? 415 ALA B CB  1 
ATOM   7351 N N   . GLY B 1 416 ? 13.73942  18.76588  -29.51653 1.000 52.52494  ? 416 GLY B N   1 
ATOM   7352 C CA  . GLY B 1 416 ? 14.50715  19.80772  -28.86110 1.000 49.81985  ? 416 GLY B CA  1 
ATOM   7353 C C   . GLY B 1 416 ? 15.39391  20.56060  -29.83168 1.000 49.67855  ? 416 GLY B C   1 
ATOM   7354 O O   . GLY B 1 416 ? 15.43118  21.79260  -29.82693 1.000 50.21975  ? 416 GLY B O   1 
ATOM   7355 N N   . ARG B 1 417 ? 16.11246  19.82851  -30.69187 1.000 45.18524  ? 417 ARG B N   1 
ATOM   7356 C CA  . ARG B 1 417 ? 17.02047  20.49347  -31.62234 1.000 43.33182  ? 417 ARG B CA  1 
ATOM   7357 C C   . ARG B 1 417 ? 16.25205  21.31478  -32.65460 1.000 43.51555  ? 417 ARG B C   1 
ATOM   7358 O O   . ARG B 1 417 ? 16.62065  22.46101  -32.94125 1.000 39.66449  ? 417 ARG B O   1 
ATOM   7359 C CB  . ARG B 1 417 ? 17.92428  19.47360  -32.30691 1.000 43.13452  ? 417 ARG B CB  1 
ATOM   7360 C CG  . ARG B 1 417 ? 18.94872  18.82450  -31.39527 1.000 52.49144  ? 417 ARG B CG  1 
ATOM   7361 C CD  . ARG B 1 417 ? 19.46312  19.77562  -30.31972 1.000 62.74113  ? 417 ARG B CD  1 
ATOM   7362 N NE  . ARG B 1 417 ? 20.39964  20.76802  -30.84270 1.000 72.14472  ? 417 ARG B NE  1 
ATOM   7363 C CZ  . ARG B 1 417 ? 21.64238  20.94628  -30.39286 1.000 78.71951  ? 417 ARG B CZ  1 
ATOM   7364 N NH1 . ARG B 1 417 ? 22.12334  20.19429  -29.39875 1.000 75.88599  ? 417 ARG B NH1 1 
ATOM   7365 N NH2 . ARG B 1 417 ? 22.40881  21.88197  -30.94357 1.000 80.03756  ? 417 ARG B NH2 1 
ATOM   7366 N N   . LEU B 1 418 ? 15.16481  20.76351  -33.20245 1.000 42.18746  ? 418 LEU B N   1 
ATOM   7367 C CA  . LEU B 1 418 ? 14.37542  21.51447  -34.17454 1.000 43.20429  ? 418 LEU B CA  1 
ATOM   7368 C C   . LEU B 1 418 ? 13.80166  22.79113  -33.55875 1.000 48.99334  ? 418 LEU B C   1 
ATOM   7369 O O   . LEU B 1 418 ? 14.00851  23.88987  -34.08852 1.000 52.84647  ? 418 LEU B O   1 
ATOM   7370 C CB  . LEU B 1 418 ? 13.26176  20.63656  -34.75763 1.000 39.44647  ? 418 LEU B CB  1 
ATOM   7371 C CG  . LEU B 1 418 ? 13.65902  19.47028  -35.67382 1.000 36.80309  ? 418 LEU B CG  1 
ATOM   7372 C CD1 . LEU B 1 418 ? 12.42859  18.70903  -36.11873 1.000 37.44889  ? 418 LEU B CD1 1 
ATOM   7373 C CD2 . LEU B 1 418 ? 14.45218  19.94047  -36.86637 1.000 35.93901  ? 418 LEU B CD2 1 
ATOM   7374 N N   . ALA B 1 419 ? 13.08615  22.67077  -32.43152 1.000 50.51436  ? 419 ALA B N   1 
ATOM   7375 C CA  . ALA B 1 419 ? 12.47164  23.85001  -31.81490 1.000 53.73281  ? 419 ALA B CA  1 
ATOM   7376 C C   . ALA B 1 419 ? 13.51103  24.91709  -31.49063 1.000 50.61221  ? 419 ALA B C   1 
ATOM   7377 O O   . ALA B 1 419 ? 13.28134  26.11384  -31.71187 1.000 52.78144  ? 419 ALA B O   1 
ATOM   7378 C CB  . ALA B 1 419 ? 11.70636  23.45426  -30.55267 1.000 45.80498  ? 419 ALA B CB  1 
ATOM   7379 N N   . ALA B 1 420 ? 14.67314  24.49435  -30.99724 1.000 45.60053  ? 420 ALA B N   1 
ATOM   7380 C CA  . ALA B 1 420 ? 15.71669  25.43944  -30.62331 1.000 46.33356  ? 420 ALA B CA  1 
ATOM   7381 C C   . ALA B 1 420 ? 16.25973  26.18451  -31.83398 1.000 52.87042  ? 420 ALA B C   1 
ATOM   7382 O O   . ALA B 1 420 ? 16.58313  27.37408  -31.73906 1.000 54.02109  ? 420 ALA B O   1 
ATOM   7383 C CB  . ALA B 1 420 ? 16.84673  24.70520  -29.89881 1.000 40.53302  ? 420 ALA B CB  1 
ATOM   7384 N N   . GLN B 1 421 ? 16.37302  25.50616  -32.97928 1.000 53.15747  ? 421 GLN B N   1 
ATOM   7385 C CA  . GLN B 1 421 ? 17.00128  26.11737  -34.14096 1.000 48.74923  ? 421 GLN B CA  1 
ATOM   7386 C C   . GLN B 1 421 ? 15.98590  26.54558  -35.19843 1.000 48.82220  ? 421 GLN B C   1 
ATOM   7387 O O   . GLN B 1 421 ? 16.17206  26.27981  -36.38980 1.000 61.16620  ? 421 GLN B O   1 
ATOM   7388 C CB  . GLN B 1 421 ? 18.03386  25.15887  -34.72550 1.000 56.27129  ? 421 GLN B CB  1 
ATOM   7389 C CG  . GLN B 1 421 ? 19.28863  25.06074  -33.87094 1.000 69.13980  ? 421 GLN B CG  1 
ATOM   7390 C CD  . GLN B 1 421 ? 19.85234  23.65076  -33.80171 1.000 74.04702  ? 421 GLN B CD  1 
ATOM   7391 O OE1 . GLN B 1 421 ? 20.21128  23.15686  -32.72389 1.000 72.94673  ? 421 GLN B OE1 1 
ATOM   7392 N NE2 . GLN B 1 421 ? 19.94134  22.99707  -34.95534 1.000 72.35698  ? 421 GLN B NE2 1 
ATOM   7393 N N   . GLY B 1 422 ? 14.91245  27.21651  -34.77573 1.000 46.02413  ? 422 GLY B N   1 
ATOM   7394 C CA  . GLY B 1 422 ? 14.06162  27.98347  -35.66552 1.000 44.88383  ? 422 GLY B CA  1 
ATOM   7395 C C   . GLY B 1 422 ? 12.77550  27.30603  -36.09331 1.000 43.39771  ? 422 GLY B C   1 
ATOM   7396 O O   . GLY B 1 422 ? 11.87781  27.98629  -36.61980 1.000 34.85090  ? 422 GLY B O   1 
ATOM   7397 N N   . ALA B 1 423 ? 12.65022  26.00202  -35.87800 1.000 42.37804  ? 423 ALA B N   1 
ATOM   7398 C CA  . ALA B 1 423 ? 11.49774  25.29718  -36.40041 1.000 44.51366  ? 423 ALA B CA  1 
ATOM   7399 C C   . ALA B 1 423 ? 10.30701  25.44426  -35.46805 1.000 48.33028  ? 423 ALA B C   1 
ATOM   7400 O O   . ALA B 1 423 ? 10.42597  25.81731  -34.29793 1.000 58.60753  ? 423 ALA B O   1 
ATOM   7401 C CB  . ALA B 1 423 ? 11.81318  23.81678  -36.61953 1.000 49.10325  ? 423 ALA B CB  1 
ATOM   7402 N N   . ARG B 1 424 ? 9.14907   25.14962  -36.01922 1.000 46.10781  ? 424 ARG B N   1 
ATOM   7403 C CA  . ARG B 1 424 ? 7.87816   25.19755  -35.32304 1.000 40.76238  ? 424 ARG B CA  1 
ATOM   7404 C C   . ARG B 1 424 ? 7.45828   23.75222  -35.08904 1.000 42.49868  ? 424 ARG B C   1 
ATOM   7405 O O   . ARG B 1 424 ? 7.14979   23.03262  -36.04389 1.000 39.89213  ? 424 ARG B O   1 
ATOM   7406 C CB  . ARG B 1 424 ? 6.87597   25.95792  -36.17224 1.000 43.20213  ? 424 ARG B CB  1 
ATOM   7407 C CG  . ARG B 1 424 ? 5.54556   26.15633  -35.56785 1.000 60.06001  ? 424 ARG B CG  1 
ATOM   7408 C CD  . ARG B 1 424 ? 4.88726   27.32149  -36.25930 1.000 66.87783  ? 424 ARG B CD  1 
ATOM   7409 N NE  . ARG B 1 424 ? 3.82208   27.90989  -35.46138 1.000 64.16804  ? 424 ARG B NE  1 
ATOM   7410 C CZ  . ARG B 1 424 ? 4.01044   28.62753  -34.36270 1.000 47.69735  ? 424 ARG B CZ  1 
ATOM   7411 N NH1 . ARG B 1 424 ? 5.23024   28.85943  -33.89390 1.000 47.37642  ? 424 ARG B NH1 1 
ATOM   7412 N NH2 . ARG B 1 424 ? 2.96215   29.11512  -33.73945 1.000 47.87971  ? 424 ARG B NH2 1 
ATOM   7413 N N   . VAL B 1 425 ? 7.47955   23.31761  -33.82917 1.000 40.89407  ? 425 VAL B N   1 
ATOM   7414 C CA  . VAL B 1 425 ? 7.31989   21.91209  -33.47899 1.000 37.35517  ? 425 VAL B CA  1 
ATOM   7415 C C   . VAL B 1 425 ? 6.02743   21.72901  -32.70396 1.000 37.43580  ? 425 VAL B C   1 
ATOM   7416 O O   . VAL B 1 425 ? 5.70408   22.52162  -31.81427 1.000 42.99424  ? 425 VAL B O   1 
ATOM   7417 C CB  . VAL B 1 425 ? 8.51420   21.39049  -32.65555 1.000 39.24702  ? 425 VAL B CB  1 
ATOM   7418 C CG1 . VAL B 1 425 ? 8.48488   19.85873  -32.59108 1.000 31.30205  ? 425 VAL B CG1 1 
ATOM   7419 C CG2 . VAL B 1 425 ? 9.82843   21.91040  -33.24029 1.000 38.70562  ? 425 VAL B CG2 1 
ATOM   7420 N N   . TYR B 1 426 ? 5.29306   20.67809  -33.04675 1.000 37.42560  ? 426 TYR B N   1 
ATOM   7421 C CA  . TYR B 1 426 ? 4.08878   20.27401  -32.33433 1.000 35.97535  ? 426 TYR B CA  1 
ATOM   7422 C C   . TYR B 1 426 ? 4.26749   18.80850  -31.96824 1.000 44.84340  ? 426 TYR B C   1 
ATOM   7423 O O   . TYR B 1 426 ? 4.50817   17.97312  -32.85056 1.000 46.32144  ? 426 TYR B O   1 
ATOM   7424 C CB  . TYR B 1 426 ? 2.83918   20.48133  -33.19664 1.000 31.76494  ? 426 TYR B CB  1 
ATOM   7425 C CG  . TYR B 1 426 ? 2.41511   21.93049  -33.36022 1.000 38.37862  ? 426 TYR B CG  1 
ATOM   7426 C CD1 . TYR B 1 426 ? 2.70444   22.66570  -34.53799 1.000 29.98090  ? 426 TYR B CD1 1 
ATOM   7427 C CD2 . TYR B 1 426 ? 1.71033   22.56779  -32.34075 1.000 39.13312  ? 426 TYR B CD2 1 
ATOM   7428 C CE1 . TYR B 1 426 ? 2.29296   24.02141  -34.66544 1.000 30.63874  ? 426 TYR B CE1 1 
ATOM   7429 C CE2 . TYR B 1 426 ? 1.30791   23.89073  -32.45279 1.000 45.80750  ? 426 TYR B CE2 1 
ATOM   7430 C CZ  . TYR B 1 426 ? 1.59283   24.62231  -33.60145 1.000 44.51898  ? 426 TYR B CZ  1 
ATOM   7431 O OH  . TYR B 1 426 ? 1.15964   25.94022  -33.62519 1.000 43.68472  ? 426 TYR B OH  1 
ATOM   7432 N N   . ALA B 1 427 ? 4.18562   18.49453  -30.67747 1.000 35.32405  ? 427 ALA B N   1 
ATOM   7433 C CA  . ALA B 1 427 ? 4.53087   17.16273  -30.20914 1.000 32.73698  ? 427 ALA B CA  1 
ATOM   7434 C C   . ALA B 1 427 ? 3.34443   16.52224  -29.51306 1.000 38.01556  ? 427 ALA B C   1 
ATOM   7435 O O   . ALA B 1 427 ? 2.57969   17.19845  -28.81437 1.000 40.38834  ? 427 ALA B O   1 
ATOM   7436 C CB  . ALA B 1 427 ? 5.73286   17.20649  -29.27545 1.000 34.70317  ? 427 ALA B CB  1 
ATOM   7437 N N   . TYR B 1 428 ? 3.19586   15.21460  -29.70576 1.000 35.21545  ? 428 TYR B N   1 
ATOM   7438 C CA  . TYR B 1 428 ? 2.06895   14.47944  -29.14860 1.000 41.34980  ? 428 TYR B CA  1 
ATOM   7439 C C   . TYR B 1 428 ? 2.56658   13.20159  -28.48974 1.000 37.32970  ? 428 TYR B C   1 
ATOM   7440 O O   . TYR B 1 428 ? 3.70673   12.77625  -28.68535 1.000 35.99930  ? 428 TYR B O   1 
ATOM   7441 C CB  . TYR B 1 428 ? 1.00982   14.13100  -30.22633 1.000 42.15390  ? 428 TYR B CB  1 
ATOM   7442 C CG  . TYR B 1 428 ? 1.45397   13.11373  -31.26932 1.000 32.57659  ? 428 TYR B CG  1 
ATOM   7443 C CD1 . TYR B 1 428 ? 1.48708   11.75128  -30.98487 1.000 26.04750  ? 428 TYR B CD1 1 
ATOM   7444 C CD2 . TYR B 1 428 ? 1.83002   13.52285  -32.54574 1.000 41.09983  ? 428 TYR B CD2 1 
ATOM   7445 C CE1 . TYR B 1 428 ? 1.90735   10.82970  -31.93000 1.000 27.76842  ? 428 TYR B CE1 1 
ATOM   7446 C CE2 . TYR B 1 428 ? 2.25009   12.60389  -33.51789 1.000 31.06080  ? 428 TYR B CE2 1 
ATOM   7447 C CZ  . TYR B 1 428 ? 2.28691   11.26433  -33.19829 1.000 35.48123  ? 428 TYR B CZ  1 
ATOM   7448 O OH  . TYR B 1 428 ? 2.70408   10.36306  -34.15127 1.000 45.67050  ? 428 TYR B OH  1 
ATOM   7449 N N   . ILE B 1 429 ? 1.66877   12.57300  -27.73034 1.000 34.11778  ? 429 ILE B N   1 
ATOM   7450 C CA  . ILE B 1 429 ? 1.81757   11.19040  -27.28773 1.000 30.66485  ? 429 ILE B CA  1 
ATOM   7451 C C   . ILE B 1 429 ? 0.45685   10.50881  -27.41371 1.000 35.02915  ? 429 ILE B C   1 
ATOM   7452 O O   . ILE B 1 429 ? -0.52743  10.94535  -26.80212 1.000 42.16655  ? 429 ILE B O   1 
ATOM   7453 C CB  . ILE B 1 429 ? 2.36516   11.08861  -25.85110 1.000 32.11448  ? 429 ILE B CB  1 
ATOM   7454 C CG1 . ILE B 1 429 ? 2.41665   9.63651   -25.39450 1.000 34.37177  ? 429 ILE B CG1 1 
ATOM   7455 C CG2 . ILE B 1 429 ? 1.54169   11.91120  -24.87955 1.000 31.40196  ? 429 ILE B CG2 1 
ATOM   7456 C CD1 . ILE B 1 429 ? 3.31979   9.43088   -24.20820 1.000 42.92554  ? 429 ILE B CD1 1 
ATOM   7457 N N   . PHE B 1 430 ? 0.39272   9.45895   -28.22507 1.000 31.48426  ? 430 PHE B N   1 
ATOM   7458 C CA  . PHE B 1 430 ? -0.86379  8.79526   -28.55081 1.000 37.94807  ? 430 PHE B CA  1 
ATOM   7459 C C   . PHE B 1 430 ? -1.12105  7.68516   -27.53621 1.000 35.70762  ? 430 PHE B C   1 
ATOM   7460 O O   . PHE B 1 430 ? -0.37841  6.69625   -27.49920 1.000 34.64702  ? 430 PHE B O   1 
ATOM   7461 C CB  . PHE B 1 430 ? -0.79026  8.24077   -29.97436 1.000 39.78501  ? 430 PHE B CB  1 
ATOM   7462 C CG  . PHE B 1 430 ? -2.06772  7.63595   -30.47096 1.000 40.83788  ? 430 PHE B CG  1 
ATOM   7463 C CD1 . PHE B 1 430 ? -2.33635  6.29337   -30.27531 1.000 41.79826  ? 430 PHE B CD1 1 
ATOM   7464 C CD2 . PHE B 1 430 ? -2.98748  8.40588   -31.16541 1.000 43.07066  ? 430 PHE B CD2 1 
ATOM   7465 C CE1 . PHE B 1 430 ? -3.50984  5.73448   -30.75507 1.000 49.48370  ? 430 PHE B CE1 1 
ATOM   7466 C CE2 . PHE B 1 430 ? -4.16346  7.85053   -31.64524 1.000 43.57624  ? 430 PHE B CE2 1 
ATOM   7467 C CZ  . PHE B 1 430 ? -4.42344  6.51363   -31.44603 1.000 44.78775  ? 430 PHE B CZ  1 
ATOM   7468 N N   . GLU B 1 431 ? -2.18011  7.83109   -26.73122 1.000 33.97398  ? 431 GLU B N   1 
ATOM   7469 C CA  . GLU B 1 431 ? -2.37907  6.97445   -25.55974 1.000 41.20692  ? 431 GLU B CA  1 
ATOM   7470 C C   . GLU B 1 431 ? -3.58787  6.05288   -25.63763 1.000 42.55680  ? 431 GLU B C   1 
ATOM   7471 O O   . GLU B 1 431 ? -3.90100  5.39708   -24.64408 1.000 46.05629  ? 431 GLU B O   1 
ATOM   7472 C CB  . GLU B 1 431 ? -2.50845  7.82455   -24.28849 1.000 43.22047  ? 431 GLU B CB  1 
ATOM   7473 C CG  . GLU B 1 431 ? -1.19402  8.18986   -23.61160 1.000 40.16034  ? 431 GLU B CG  1 
ATOM   7474 C CD  . GLU B 1 431 ? -1.39543  9.07559   -22.39971 1.000 53.64440  ? 431 GLU B CD  1 
ATOM   7475 O OE1 . GLU B 1 431 ? -2.48591  9.67469   -22.25790 1.000 58.20294  ? 431 GLU B OE1 1 
ATOM   7476 O OE2 . GLU B 1 431 ? -0.45836  9.17328   -21.58040 1.000 62.23287  ? 431 GLU B OE2 1 
ATOM   7477 N N   . HIS B 1 432 ? -4.28329  5.98077   -26.76272 1.000 50.89432  ? 432 HIS B N   1 
ATOM   7478 C CA  . HIS B 1 432 ? -5.49536  5.17937   -26.85433 1.000 47.02172  ? 432 HIS B CA  1 
ATOM   7479 C C   . HIS B 1 432 ? -5.19206  3.81635   -27.46123 1.000 48.73220  ? 432 HIS B C   1 
ATOM   7480 O O   . HIS B 1 432 ? -4.51926  3.72591   -28.49053 1.000 56.36965  ? 432 HIS B O   1 
ATOM   7481 C CB  . HIS B 1 432 ? -6.55097  5.88238   -27.69503 1.000 43.14156  ? 432 HIS B CB  1 
ATOM   7482 C CG  . HIS B 1 432 ? -7.73299  5.02235   -27.97843 1.000 47.82617  ? 432 HIS B CG  1 
ATOM   7483 N ND1 . HIS B 1 432 ? -8.75408  4.84572   -27.07208 1.000 54.77590  ? 432 HIS B ND1 1 
ATOM   7484 C CD2 . HIS B 1 432 ? -8.03938  4.25294   -29.04735 1.000 52.63754  ? 432 HIS B CD2 1 
ATOM   7485 C CE1 . HIS B 1 432 ? -9.65294  4.02203   -27.58165 1.000 58.82795  ? 432 HIS B CE1 1 
ATOM   7486 N NE2 . HIS B 1 432 ? -9.24456  3.64974   -28.78121 1.000 56.54135  ? 432 HIS B NE2 1 
ATOM   7487 N N   . ARG B 1 433 ? -5.70864  2.76457   -26.84085 1.000 50.35003  ? 433 ARG B N   1 
ATOM   7488 C CA  . ARG B 1 433 ? -5.52064  1.39935   -27.31639 1.000 44.63458  ? 433 ARG B CA  1 
ATOM   7489 C C   . ARG B 1 433 ? -6.76756  0.94908   -28.06560 1.000 48.49976  ? 433 ARG B C   1 
ATOM   7490 O O   . ARG B 1 433 ? -7.87514  0.99145   -27.51905 1.000 47.03909  ? 433 ARG B O   1 
ATOM   7491 C CB  . ARG B 1 433 ? -5.24335  0.45470   -26.15348 1.000 51.40409  ? 433 ARG B CB  1 
ATOM   7492 C CG  . ARG B 1 433 ? -4.68944  -0.87527  -26.56960 1.000 53.74391  ? 433 ARG B CG  1 
ATOM   7493 C CD  . ARG B 1 433 ? -5.17089  -1.94353  -25.62833 1.000 51.42795  ? 433 ARG B CD  1 
ATOM   7494 N NE  . ARG B 1 433 ? -4.29893  -3.10208  -25.63794 1.000 45.26976  ? 433 ARG B NE  1 
ATOM   7495 C CZ  . ARG B 1 433 ? -4.74454  -4.32044  -25.87927 1.000 55.37929  ? 433 ARG B CZ  1 
ATOM   7496 N NH1 . ARG B 1 433 ? -6.03529  -4.50693  -26.16830 1.000 53.15593  ? 433 ARG B NH1 1 
ATOM   7497 N NH2 . ARG B 1 433 ? -3.90067  -5.33770  -25.86350 1.000 66.66318  ? 433 ARG B NH2 1 
ATOM   7498 N N   . ALA B 1 434 ? -6.58046  0.50761   -29.30594 1.000 56.47915  ? 434 ALA B N   1 
ATOM   7499 C CA  . ALA B 1 434 ? -7.69686  0.11162   -30.14894 1.000 50.04786  ? 434 ALA B CA  1 
ATOM   7500 C C   . ALA B 1 434 ? -8.54791  -0.93840  -29.45344 1.000 47.77751  ? 434 ALA B C   1 
ATOM   7501 O O   . ALA B 1 434 ? -8.02566  -1.88301  -28.85974 1.000 53.05487  ? 434 ALA B O   1 
ATOM   7502 C CB  . ALA B 1 434 ? -7.17337  -0.42452  -31.48229 1.000 52.97625  ? 434 ALA B CB  1 
ATOM   7503 N N   . SER B 1 435 ? -9.86947  -0.75528  -29.51257 1.000 50.16290  ? 435 SER B N   1 
ATOM   7504 C CA  . SER B 1 435 ? -10.78054 -1.74678  -28.95581 1.000 51.73377  ? 435 SER B CA  1 
ATOM   7505 C C   . SER B 1 435 ? -10.76305 -3.04488  -29.74524 1.000 60.89337  ? 435 SER B C   1 
ATOM   7506 O O   . SER B 1 435 ? -11.18320 -4.08345  -29.21760 1.000 64.83182  ? 435 SER B O   1 
ATOM   7507 C CB  . SER B 1 435 ? -12.20431 -1.18996  -28.90890 1.000 52.76690  ? 435 SER B CB  1 
ATOM   7508 O OG  . SER B 1 435 ? -12.75470 -1.04401  -30.20731 1.000 53.08054  ? 435 SER B OG  1 
ATOM   7509 N N   . THR B 1 436 ? -10.29837 -3.00115  -30.99868 1.000 65.90081  ? 436 THR B N   1 
ATOM   7510 C CA  . THR B 1 436 ? -10.19629 -4.17419  -31.86038 1.000 69.00372  ? 436 THR B CA  1 
ATOM   7511 C C   . THR B 1 436 ? -8.83840  -4.85689  -31.77632 1.000 64.01289  ? 436 THR B C   1 
ATOM   7512 O O   . THR B 1 436 ? -8.66752  -5.92538  -32.37453 1.000 60.67946  ? 436 THR B O   1 
ATOM   7513 C CB  . THR B 1 436 ? -10.46388 -3.79511  -33.32570 1.000 67.93927  ? 436 THR B CB  1 
ATOM   7514 O OG1 . THR B 1 436 ? -9.52108  -2.79287  -33.74920 1.000 70.85181  ? 436 THR B OG1 1 
ATOM   7515 C CG2 . THR B 1 436 ? -11.89196 -3.28863  -33.50059 1.000 65.17658  ? 436 THR B CG2 1 
ATOM   7516 N N   . LEU B 1 437 ? -7.88679  -4.27668  -31.04235 1.000 46.34283  ? 437 LEU B N   1 
ATOM   7517 C CA  . LEU B 1 437 ? -6.51396  -4.75511  -31.06909 1.000 45.30548  ? 437 LEU B CA  1 
ATOM   7518 C C   . LEU B 1 437 ? -6.43423  -6.22818  -30.69438 1.000 47.43386  ? 437 LEU B C   1 
ATOM   7519 O O   . LEU B 1 437 ? -7.12764  -6.69580  -29.79323 1.000 60.49493  ? 437 LEU B O   1 
ATOM   7520 C CB  . LEU B 1 437 ? -5.65019  -3.91029  -30.13389 1.000 51.78455  ? 437 LEU B CB  1 
ATOM   7521 C CG  . LEU B 1 437 ? -4.18788  -3.97597  -30.54647 1.000 48.77433  ? 437 LEU B CG  1 
ATOM   7522 C CD1 . LEU B 1 437 ? -4.02530  -3.06791  -31.70745 1.000 50.39443  ? 437 LEU B CD1 1 
ATOM   7523 C CD2 . LEU B 1 437 ? -3.29683  -3.51154  -29.43535 1.000 40.50730  ? 437 LEU B CD2 1 
ATOM   7524 N N   . THR B 1 438 ? -5.58952  -6.96220  -31.41381 1.000 50.85059  ? 438 THR B N   1 
ATOM   7525 C CA  . THR B 1 438 ? -5.49491  -8.40989  -31.28230 1.000 50.11510  ? 438 THR B CA  1 
ATOM   7526 C C   . THR B 1 438 ? -4.28455  -8.84436  -30.47473 1.000 49.25188  ? 438 THR B C   1 
ATOM   7527 O O   . THR B 1 438 ? -4.18486  -10.02674 -30.12286 1.000 51.27473  ? 438 THR B O   1 
ATOM   7528 C CB  . THR B 1 438 ? -5.45164  -9.06961  -32.67275 1.000 53.34253  ? 438 THR B CB  1 
ATOM   7529 O OG1 . THR B 1 438 ? -4.64065  -8.28436  -33.56310 1.000 48.43039  ? 438 THR B OG1 1 
ATOM   7530 C CG2 . THR B 1 438 ? -6.84581  -9.16722  -33.24843 1.000 52.44619  ? 438 THR B CG2 1 
ATOM   7531 N N   . TRP B 1 439 ? -3.36847  -7.91615  -30.18289 1.000 54.81840  ? 439 TRP B N   1 
ATOM   7532 C CA  . TRP B 1 439 ? -2.25621  -8.17922  -29.27695 1.000 57.63711  ? 439 TRP B CA  1 
ATOM   7533 C C   . TRP B 1 439 ? -2.73863  -8.24976  -27.82357 1.000 59.68844  ? 439 TRP B C   1 
ATOM   7534 O O   . TRP B 1 439 ? -3.80616  -7.72863  -27.48065 1.000 54.00258  ? 439 TRP B O   1 
ATOM   7535 C CB  . TRP B 1 439 ? -1.18044  -7.10136  -29.42474 1.000 52.20729  ? 439 TRP B CB  1 
ATOM   7536 C CG  . TRP B 1 439 ? -0.50162  -7.08931  -30.79321 1.000 55.50390  ? 439 TRP B CG  1 
ATOM   7537 C CD1 . TRP B 1 439 ? -0.75488  -6.22551  -31.82385 1.000 50.46278  ? 439 TRP B CD1 1 
ATOM   7538 C CD2 . TRP B 1 439 ? 0.53619   -7.97534  -31.26235 1.000 58.18347  ? 439 TRP B CD2 1 
ATOM   7539 N NE1 . TRP B 1 439 ? 0.05695   -6.51733  -32.89699 1.000 54.22661  ? 439 TRP B NE1 1 
ATOM   7540 C CE2 . TRP B 1 439 ? 0.85298   -7.58727  -32.58121 1.000 57.66771  ? 439 TRP B CE2 1 
ATOM   7541 C CE3 . TRP B 1 439 ? 1.22643   -9.05438  -30.69435 1.000 61.57777  ? 439 TRP B CE3 1 
ATOM   7542 C CZ2 . TRP B 1 439 ? 1.82777   -8.24061  -33.34123 1.000 57.98080  ? 439 TRP B CZ2 1 
ATOM   7543 C CZ3 . TRP B 1 439 ? 2.19106   -9.70169  -31.44922 1.000 59.63979  ? 439 TRP B CZ3 1 
ATOM   7544 C CH2 . TRP B 1 439 ? 2.48407   -9.29091  -32.75892 1.000 58.02280  ? 439 TRP B CH2 1 
ATOM   7545 N N   . PRO B 1 440 ? -1.96832  -8.90625  -26.95467 1.000 62.68378  ? 440 PRO B N   1 
ATOM   7546 C CA  . PRO B 1 440 ? -2.37167  -9.04996  -25.54827 1.000 63.14852  ? 440 PRO B CA  1 
ATOM   7547 C C   . PRO B 1 440 ? -2.37947  -7.72140  -24.80556 1.000 54.73187  ? 440 PRO B C   1 
ATOM   7548 O O   . PRO B 1 440 ? -1.79949  -6.71670  -25.22800 1.000 47.55294  ? 440 PRO B O   1 
ATOM   7549 C CB  . PRO B 1 440 ? -1.31190  -9.99319  -24.97128 1.000 67.91829  ? 440 PRO B CB  1 
ATOM   7550 C CG  . PRO B 1 440 ? -0.13748  -9.83709  -25.88227 1.000 66.43831  ? 440 PRO B CG  1 
ATOM   7551 C CD  . PRO B 1 440 ? -0.74378  -9.66938  -27.24394 1.000 65.10182  ? 440 PRO B CD  1 
ATOM   7552 N N   . LEU B 1 441 ? -3.04073  -7.74035  -23.64689 1.000 55.07583  ? 441 LEU B N   1 
ATOM   7553 C CA  . LEU B 1 441 ? -3.25853  -6.50574  -22.90526 1.000 57.77481  ? 441 LEU B CA  1 
ATOM   7554 C C   . LEU B 1 441 ? -1.95617  -5.89144  -22.40688 1.000 56.05713  ? 441 LEU B C   1 
ATOM   7555 O O   . LEU B 1 441 ? -1.85554  -4.66216  -22.28568 1.000 53.71082  ? 441 LEU B O   1 
ATOM   7556 C CB  . LEU B 1 441 ? -4.20833  -6.76620  -21.74014 1.000 60.82808  ? 441 LEU B CB  1 
ATOM   7557 C CG  . LEU B 1 441 ? -5.63828  -6.33649  -22.05915 1.000 60.35169  ? 441 LEU B CG  1 
ATOM   7558 C CD1 . LEU B 1 441 ? -6.52109  -6.52301  -20.85485 1.000 61.36686  ? 441 LEU B CD1 1 
ATOM   7559 C CD2 . LEU B 1 441 ? -5.67991  -4.88075  -22.55066 1.000 52.60872  ? 441 LEU B CD2 1 
ATOM   7560 N N   . TRP B 1 442 ? -0.94747  -6.71450  -22.12843 1.000 52.93742  ? 442 TRP B N   1 
ATOM   7561 C CA  . TRP B 1 442 ? 0.25975   -6.17966  -21.51317 1.000 52.13448  ? 442 TRP B CA  1 
ATOM   7562 C C   . TRP B 1 442 ? 1.10479   -5.37443  -22.48128 1.000 55.35994  ? 442 TRP B C   1 
ATOM   7563 O O   . TRP B 1 442 ? 1.98715   -4.63297  -22.03539 1.000 49.78755  ? 442 TRP B O   1 
ATOM   7564 C CB  . TRP B 1 442 ? 1.10543   -7.30195  -20.91606 1.000 56.04165  ? 442 TRP B CB  1 
ATOM   7565 C CG  . TRP B 1 442 ? 1.74786   -8.22058  -21.91488 1.000 59.03670  ? 442 TRP B CG  1 
ATOM   7566 C CD1 . TRP B 1 442 ? 1.31169   -9.46345  -22.28310 1.000 57.91630  ? 442 TRP B CD1 1 
ATOM   7567 C CD2 . TRP B 1 442 ? 2.95873   -7.98454  -22.65173 1.000 58.21419  ? 442 TRP B CD2 1 
ATOM   7568 N NE1 . TRP B 1 442 ? 2.17196   -10.00874 -23.20472 1.000 58.17967  ? 442 TRP B NE1 1 
ATOM   7569 C CE2 . TRP B 1 442 ? 3.18736   -9.12077  -23.45188 1.000 57.02296  ? 442 TRP B CE2 1 
ATOM   7570 C CE3 . TRP B 1 442 ? 3.87160   -6.92356  -22.71004 1.000 55.99759  ? 442 TRP B CE3 1 
ATOM   7571 C CZ2 . TRP B 1 442 ? 4.28944   -9.22640  -24.30110 1.000 52.49582  ? 442 TRP B CZ2 1 
ATOM   7572 C CZ3 . TRP B 1 442 ? 4.95833   -7.02572  -23.56710 1.000 51.90941  ? 442 TRP B CZ3 1 
ATOM   7573 C CH2 . TRP B 1 442 ? 5.16008   -8.17067  -24.34374 1.000 50.03161  ? 442 TRP B CH2 1 
ATOM   7574 N N   . MET B 1 443 ? 0.88707   -5.52242  -23.78746 1.000 60.03214  ? 443 MET B N   1 
ATOM   7575 C CA  . MET B 1 443 ? 1.66778   -4.75560  -24.74293 1.000 51.98160  ? 443 MET B CA  1 
ATOM   7576 C C   . MET B 1 443 ? 1.18644   -3.32057  -24.86038 1.000 49.89328  ? 443 MET B C   1 
ATOM   7577 O O   . MET B 1 443 ? 1.80758   -2.54019  -25.59824 1.000 48.81978  ? 443 MET B O   1 
ATOM   7578 C CB  . MET B 1 443 ? 1.64728   -5.43015  -26.11111 1.000 51.40783  ? 443 MET B CB  1 
ATOM   7579 C CG  . MET B 1 443 ? 2.18784   -6.85174  -26.10718 1.000 58.37189  ? 443 MET B CG  1 
ATOM   7580 S SD  . MET B 1 443 ? 2.26134   -7.53156  -27.78239 1.000 59.43957  ? 443 MET B SD  1 
ATOM   7581 C CE  . MET B 1 443 ? 3.96391   -7.21765  -28.19753 1.000 60.13222  ? 443 MET B CE  1 
ATOM   7582 N N   . GLY B 1 444 ? 0.10851   -2.96172  -24.15328 1.000 45.01907  ? 444 GLY B N   1 
ATOM   7583 C CA  . GLY B 1 444 ? -0.34106  -1.57509  -24.13164 1.000 51.20513  ? 444 GLY B CA  1 
ATOM   7584 C C   . GLY B 1 444 ? -0.81799  -1.09919  -25.49526 1.000 52.27770  ? 444 GLY B C   1 
ATOM   7585 O O   . GLY B 1 444 ? -1.60282  -1.77065  -26.17925 1.000 51.13580  ? 444 GLY B O   1 
ATOM   7586 N N   . VAL B 1 445 ? -0.36195  0.09325   -25.87411 1.000 51.27827  ? 445 VAL B N   1 
ATOM   7587 C CA  . VAL B 1 445 ? -0.50697  0.65248   -27.21955 1.000 48.77962  ? 445 VAL B CA  1 
ATOM   7588 C C   . VAL B 1 445 ? 0.81711   0.44485   -27.95212 1.000 50.28169  ? 445 VAL B C   1 
ATOM   7589 O O   . VAL B 1 445 ? 1.77026   1.20034   -27.71296 1.000 51.53881  ? 445 VAL B O   1 
ATOM   7590 C CB  . VAL B 1 445 ? -0.88849  2.14478   -27.16667 1.000 47.15220  ? 445 VAL B CB  1 
ATOM   7591 C CG1 . VAL B 1 445 ? -1.13835  2.70220   -28.56994 1.000 45.12182  ? 445 VAL B CG1 1 
ATOM   7592 C CG2 . VAL B 1 445 ? -2.09857  2.36407   -26.27732 1.000 46.96802  ? 445 VAL B CG2 1 
ATOM   7593 N N   . PRO B 1 446 ? 0.94351   -0.55572  -28.82306 1.000 49.41920  ? 446 PRO B N   1 
ATOM   7594 C CA  . PRO B 1 446 ? 2.25581   -0.87136  -29.40106 1.000 42.51037  ? 446 PRO B CA  1 
ATOM   7595 C C   . PRO B 1 446 ? 2.62686   0.05896   -30.54085 1.000 47.39785  ? 446 PRO B C   1 
ATOM   7596 O O   . PRO B 1 446 ? 1.79426   0.78202   -31.09055 1.000 55.87854  ? 446 PRO B O   1 
ATOM   7597 C CB  . PRO B 1 446 ? 2.09538   -2.31081  -29.90738 1.000 35.42184  ? 446 PRO B CB  1 
ATOM   7598 C CG  . PRO B 1 446 ? 0.81729   -2.83143  -29.24651 1.000 39.62856  ? 446 PRO B CG  1 
ATOM   7599 C CD  . PRO B 1 446 ? -0.04476  -1.60916  -29.10417 1.000 47.08071  ? 446 PRO B CD  1 
ATOM   7600 N N   . HIS B 1 447 ? 3.92180   0.04040   -30.86072 1.000 51.61091  ? 447 HIS B N   1 
ATOM   7601 C CA  . HIS B 1 447 ? 4.47331   0.65198   -32.06764 1.000 46.67483  ? 447 HIS B CA  1 
ATOM   7602 C C   . HIS B 1 447 ? 3.54851   0.43442   -33.25932 1.000 45.19500  ? 447 HIS B C   1 
ATOM   7603 O O   . HIS B 1 447 ? 3.26608   -0.70663  -33.64307 1.000 40.79444  ? 447 HIS B O   1 
ATOM   7604 C CB  . HIS B 1 447 ? 5.85648   0.03687   -32.34111 1.000 42.54870  ? 447 HIS B CB  1 
ATOM   7605 C CG  . HIS B 1 447 ? 6.67589   0.75241   -33.37453 1.000 46.72353  ? 447 HIS B CG  1 
ATOM   7606 N ND1 . HIS B 1 447 ? 6.72867   2.12603   -33.47690 1.000 47.70134  ? 447 HIS B ND1 1 
ATOM   7607 C CD2 . HIS B 1 447 ? 7.51964   0.27521   -34.32234 1.000 50.31468  ? 447 HIS B CD2 1 
ATOM   7608 C CE1 . HIS B 1 447 ? 7.55678   2.46388   -34.44979 1.000 45.44345  ? 447 HIS B CE1 1 
ATOM   7609 N NE2 . HIS B 1 447 ? 8.05054   1.35897   -34.97860 1.000 49.54944  ? 447 HIS B NE2 1 
ATOM   7610 N N   . GLY B 1 448 ? 3.02828   1.52750   -33.81321 1.000 44.05725  ? 448 GLY B N   1 
ATOM   7611 C CA  . GLY B 1 448 ? 2.32837   1.47008   -35.08055 1.000 40.02439  ? 448 GLY B CA  1 
ATOM   7612 C C   . GLY B 1 448 ? 0.81783   1.46047   -35.02965 1.000 42.69990  ? 448 GLY B C   1 
ATOM   7613 O O   . GLY B 1 448 ? 0.19187   1.37368   -36.09079 1.000 52.61150  ? 448 GLY B O   1 
ATOM   7614 N N   . TYR B 1 449 ? 0.19981   1.56470   -33.85248 1.000 43.67923  ? 449 TYR B N   1 
ATOM   7615 C CA  . TYR B 1 449 ? -1.25337  1.45579   -33.76672 1.000 39.62536  ? 449 TYR B CA  1 
ATOM   7616 C C   . TYR B 1 449 ? -1.95721  2.78873   -33.53644 1.000 34.51370  ? 449 TYR B C   1 
ATOM   7617 O O   . TYR B 1 449 ? -3.14013  2.80377   -33.18213 1.000 34.07663  ? 449 TYR B O   1 
ATOM   7618 C CB  . TYR B 1 449 ? -1.63249  0.42994   -32.70968 1.000 31.80750  ? 449 TYR B CB  1 
ATOM   7619 C CG  . TYR B 1 449 ? -1.34243  -0.92642  -33.24631 1.000 31.65161  ? 449 TYR B CG  1 
ATOM   7620 C CD1 . TYR B 1 449 ? -0.11267  -1.52202  -33.03814 1.000 31.82684  ? 449 TYR B CD1 1 
ATOM   7621 C CD2 . TYR B 1 449 ? -2.26419  -1.57818  -34.05201 1.000 39.52711  ? 449 TYR B CD2 1 
ATOM   7622 C CE1 . TYR B 1 449 ? 0.17547   -2.77432  -33.57500 1.000 44.17550  ? 449 TYR B CE1 1 
ATOM   7623 C CE2 . TYR B 1 449 ? -1.99744  -2.83647  -34.59408 1.000 40.13434  ? 449 TYR B CE2 1 
ATOM   7624 C CZ  . TYR B 1 449 ? -0.77154  -3.42379  -34.35584 1.000 45.02239  ? 449 TYR B CZ  1 
ATOM   7625 O OH  . TYR B 1 449 ? -0.49753  -4.66163  -34.89379 1.000 48.60093  ? 449 TYR B OH  1 
ATOM   7626 N N   . GLU B 1 450 ? -1.26983  3.90411   -33.76432 1.000 28.05678  ? 450 GLU B N   1 
ATOM   7627 C CA  . GLU B 1 450 ? -1.94986  5.15183   -34.06956 1.000 37.57935  ? 450 GLU B CA  1 
ATOM   7628 C C   . GLU B 1 450 ? -2.35944  5.24605   -35.53866 1.000 47.16205  ? 450 GLU B C   1 
ATOM   7629 O O   . GLU B 1 450 ? -3.26080  6.02992   -35.87585 1.000 42.28775  ? 450 GLU B O   1 
ATOM   7630 C CB  . GLU B 1 450 ? -1.04033  6.32831   -33.72650 1.000 36.52487  ? 450 GLU B CB  1 
ATOM   7631 C CG  . GLU B 1 450 ? -0.05569  6.72324   -34.83257 1.000 34.72595  ? 450 GLU B CG  1 
ATOM   7632 C CD  . GLU B 1 450 ? 1.19668   5.86212   -34.86965 1.000 35.58789  ? 450 GLU B CD  1 
ATOM   7633 O OE1 . GLU B 1 450 ? 1.10594   4.65119   -34.58142 1.000 37.63126  ? 450 GLU B OE1 1 
ATOM   7634 O OE2 . GLU B 1 450 ? 2.28075   6.40487   -35.17724 1.000 37.89911  ? 450 GLU B OE2 1 
ATOM   7635 N N   . ILE B 1 451 ? -1.72233  4.46154   -36.41453 1.000 45.97765  ? 451 ILE B N   1 
ATOM   7636 C CA  . ILE B 1 451 ? -1.86876  4.68951   -37.84524 1.000 42.39938  ? 451 ILE B CA  1 
ATOM   7637 C C   . ILE B 1 451 ? -3.30776  4.47185   -38.28015 1.000 46.90108  ? 451 ILE B C   1 
ATOM   7638 O O   . ILE B 1 451 ? -3.86995  5.28723   -39.02159 1.000 50.74646  ? 451 ILE B O   1 
ATOM   7639 C CB  . ILE B 1 451 ? -0.89591  3.80136   -38.63983 1.000 38.05583  ? 451 ILE B CB  1 
ATOM   7640 C CG1 . ILE B 1 451 ? 0.55314   4.11980   -38.25471 1.000 34.10706  ? 451 ILE B CG1 1 
ATOM   7641 C CG2 . ILE B 1 451 ? -1.09490  4.02703   -40.12926 1.000 33.62151  ? 451 ILE B CG2 1 
ATOM   7642 C CD1 . ILE B 1 451 ? 1.56026   3.25938   -38.96412 1.000 28.19458  ? 451 ILE B CD1 1 
ATOM   7643 N N   . GLU B 1 452 ? -3.93680  3.38401   -37.81889 1.000 46.14232  ? 452 GLU B N   1 
ATOM   7644 C CA  . GLU B 1 452 ? -5.30960  3.11509   -38.24207 1.000 45.67189  ? 452 GLU B CA  1 
ATOM   7645 C C   . GLU B 1 452 ? -6.24601  4.28076   -37.92772 1.000 46.67254  ? 452 GLU B C   1 
ATOM   7646 O O   . GLU B 1 452 ? -7.23390  4.48076   -38.64254 1.000 49.85532  ? 452 GLU B O   1 
ATOM   7647 C CB  . GLU B 1 452 ? -5.83898  1.82892   -37.60147 1.000 47.74589  ? 452 GLU B CB  1 
ATOM   7648 C CG  . GLU B 1 452 ? -5.28756  1.49078   -36.23501 1.000 52.03158  ? 452 GLU B CG  1 
ATOM   7649 C CD  . GLU B 1 452 ? -5.71580  0.10479   -35.75930 1.000 62.70363  ? 452 GLU B CD  1 
ATOM   7650 O OE1 . GLU B 1 452 ? -6.88443  -0.05855  -35.32486 1.000 66.39465  ? 452 GLU B OE1 1 
ATOM   7651 O OE2 . GLU B 1 452 ? -4.88474  -0.82926  -35.83026 1.000 64.55278  ? 452 GLU B OE2 1 
ATOM   7652 N N   . PHE B 1 453 ? -5.94828  5.06784   -36.88331 1.000 40.75489  ? 453 PHE B N   1 
ATOM   7653 C CA  . PHE B 1 453 ? -6.79273  6.19711   -36.50097 1.000 40.23627  ? 453 PHE B CA  1 
ATOM   7654 C C   . PHE B 1 453 ? -6.48973  7.46842   -37.28457 1.000 46.30457  ? 453 PHE B C   1 
ATOM   7655 O O   . PHE B 1 453 ? -7.41214  8.24075   -37.56137 1.000 52.51654  ? 453 PHE B O   1 
ATOM   7656 C CB  . PHE B 1 453 ? -6.66087  6.49408   -34.99814 1.000 40.11718  ? 453 PHE B CB  1 
ATOM   7657 C CG  . PHE B 1 453 ? -7.21848  5.41367   -34.11622 1.000 43.24049  ? 453 PHE B CG  1 
ATOM   7658 C CD1 . PHE B 1 453 ? -8.57989  5.33961   -33.86096 1.000 52.84287  ? 453 PHE B CD1 1 
ATOM   7659 C CD2 . PHE B 1 453 ? -6.38466  4.45742   -33.56074 1.000 45.96424  ? 453 PHE B CD2 1 
ATOM   7660 C CE1 . PHE B 1 453 ? -9.10278  4.33171   -33.05532 1.000 56.11029  ? 453 PHE B CE1 1 
ATOM   7661 C CE2 . PHE B 1 453 ? -6.89669  3.44536   -32.76276 1.000 53.65566  ? 453 PHE B CE2 1 
ATOM   7662 C CZ  . PHE B 1 453 ? -8.26096  3.38366   -32.50746 1.000 56.51690  ? 453 PHE B CZ  1 
ATOM   7663 N N   . ILE B 1 454 ? -5.22459  7.71722   -37.63825 1.000 48.73361  ? 454 ILE B N   1 
ATOM   7664 C CA  . ILE B 1 454 ? -4.89315  8.86098   -38.49015 1.000 43.95254  ? 454 ILE B CA  1 
ATOM   7665 C C   . ILE B 1 454 ? -5.44921  8.66944   -39.90556 1.000 51.68331  ? 454 ILE B C   1 
ATOM   7666 O O   . ILE B 1 454 ? -5.84925  9.63901   -40.56204 1.000 53.22585  ? 454 ILE B O   1 
ATOM   7667 C CB  . ILE B 1 454 ? -3.36727  9.07854   -38.51882 1.000 40.49550  ? 454 ILE B CB  1 
ATOM   7668 C CG1 . ILE B 1 454 ? -2.76293  9.00827   -37.10083 1.000 48.90328  ? 454 ILE B CG1 1 
ATOM   7669 C CG2 . ILE B 1 454 ? -3.00927  10.38414  -39.24133 1.000 27.69958  ? 454 ILE B CG2 1 
ATOM   7670 C CD1 . ILE B 1 454 ? -3.15282  10.15446  -36.17010 1.000 45.88883  ? 454 ILE B CD1 1 
ATOM   7671 N N   . PHE B 1 455 ? -5.48677  7.43588   -40.40567 1.000 47.54221  ? 455 PHE B N   1 
ATOM   7672 C CA  . PHE B 1 455 ? -6.03194  7.21392   -41.73848 1.000 48.25154  ? 455 PHE B CA  1 
ATOM   7673 C C   . PHE B 1 455 ? -7.54777  7.06519   -41.73272 1.000 53.78089  ? 455 PHE B C   1 
ATOM   7674 O O   . PHE B 1 455 ? -8.14735  6.94114   -42.81064 1.000 63.14095  ? 455 PHE B O   1 
ATOM   7675 C CB  . PHE B 1 455 ? -5.36320  5.99538   -42.39072 1.000 41.63356  ? 455 PHE B CB  1 
ATOM   7676 C CG  . PHE B 1 455 ? -4.05203  6.32181   -43.04854 1.000 41.20972  ? 455 PHE B CG  1 
ATOM   7677 C CD1 . PHE B 1 455 ? -2.88087  6.38674   -42.30129 1.000 35.86224  ? 455 PHE B CD1 1 
ATOM   7678 C CD2 . PHE B 1 455 ? -3.99216  6.59820   -44.41218 1.000 45.66027  ? 455 PHE B CD2 1 
ATOM   7679 C CE1 . PHE B 1 455 ? -1.66866  6.71389   -42.90525 1.000 44.07334  ? 455 PHE B CE1 1 
ATOM   7680 C CE2 . PHE B 1 455 ? -2.77911  6.91924   -45.02870 1.000 42.76416  ? 455 PHE B CE2 1 
ATOM   7681 C CZ  . PHE B 1 455 ? -1.61788  6.98275   -44.28069 1.000 42.26824  ? 455 PHE B CZ  1 
ATOM   7682 N N   . GLY B 1 456 ? -8.17379  7.09282   -40.55662 1.000 47.49012  ? 456 GLY B N   1 
ATOM   7683 C CA  . GLY B 1 456 ? -9.61976  7.16717   -40.45690 1.000 48.57793  ? 456 GLY B CA  1 
ATOM   7684 C C   . GLY B 1 456 ? -10.37458 5.86182   -40.56386 1.000 49.09092  ? 456 GLY B C   1 
ATOM   7685 O O   . GLY B 1 456 ? -11.59164 5.88902   -40.79168 1.000 48.74468  ? 456 GLY B O   1 
ATOM   7686 N N   . LEU B 1 457 ? -9.70325  4.72534   -40.38773 1.000 45.99726  ? 457 LEU B N   1 
ATOM   7687 C CA  . LEU B 1 457 ? -10.35732 3.42606   -40.53427 1.000 50.56965  ? 457 LEU B CA  1 
ATOM   7688 C C   . LEU B 1 457 ? -11.62092 3.24090   -39.68934 1.000 57.44839  ? 457 LEU B C   1 
ATOM   7689 O O   . LEU B 1 457 ? -12.56607 2.60953   -40.18956 1.000 69.86696  ? 457 LEU B O   1 
ATOM   7690 C CB  . LEU B 1 457 ? -9.33732  2.31693   -40.23408 1.000 49.16397  ? 457 LEU B CB  1 
ATOM   7691 C CG  . LEU B 1 457 ? -8.76027  1.61787   -41.46347 1.000 45.82052  ? 457 LEU B CG  1 
ATOM   7692 C CD1 . LEU B 1 457 ? -7.76341  2.51406   -42.19617 1.000 38.57756  ? 457 LEU B CD1 1 
ATOM   7693 C CD2 . LEU B 1 457 ? -8.12627  0.30244   -41.06845 1.000 47.00387  ? 457 LEU B CD2 1 
ATOM   7694 N N   . PRO B 1 458 ? -11.71016 3.71801   -38.42787 1.000 49.68921  ? 458 PRO B N   1 
ATOM   7695 C CA  . PRO B 1 458 ? -12.96680 3.58010   -37.67014 1.000 52.26382  ? 458 PRO B CA  1 
ATOM   7696 C C   . PRO B 1 458 ? -14.23858 4.05315   -38.36762 1.000 60.05193  ? 458 PRO B C   1 
ATOM   7697 O O   . PRO B 1 458 ? -15.34601 3.63586   -38.00396 1.000 63.05026  ? 458 PRO B O   1 
ATOM   7698 C CB  . PRO B 1 458 ? -12.69725 4.41079   -36.41278 1.000 52.93649  ? 458 PRO B CB  1 
ATOM   7699 C CG  . PRO B 1 458 ? -11.17900 4.63061   -36.38782 1.000 50.96905  ? 458 PRO B CG  1 
ATOM   7700 C CD  . PRO B 1 458 ? -10.56962 3.93856   -37.52429 1.000 42.85191  ? 458 PRO B CD  1 
ATOM   7701 N N   . LEU B 1 459 ? -14.09765 4.91745   -39.36993 1.000 54.24867  ? 459 LEU B N   1 
ATOM   7702 C CA  . LEU B 1 459 ? -15.25662 5.38710   -40.11198 1.000 53.84427  ? 459 LEU B CA  1 
ATOM   7703 C C   . LEU B 1 459 ? -15.88497 4.28438   -40.95454 1.000 59.99775  ? 459 LEU B C   1 
ATOM   7704 O O   . LEU B 1 459 ? -17.06858 4.37628   -41.30656 1.000 67.50286  ? 459 LEU B O   1 
ATOM   7705 C CB  . LEU B 1 459 ? -14.84860 6.56145   -40.99035 1.000 48.23958  ? 459 LEU B CB  1 
ATOM   7706 C CG  . LEU B 1 459 ? -14.83056 7.92904   -40.31552 1.000 54.98077  ? 459 LEU B CG  1 
ATOM   7707 C CD1 . LEU B 1 459 ? -13.69012 8.05199   -39.32903 1.000 55.88844  ? 459 LEU B CD1 1 
ATOM   7708 C CD2 . LEU B 1 459 ? -14.71331 8.99665   -41.37191 1.000 56.96758  ? 459 LEU B CD2 1 
ATOM   7709 N N   . ASP B 1 460 ? -15.11970 3.26522   -41.29972 1.000 63.26758  ? 460 ASP B N   1 
ATOM   7710 C CA  . ASP B 1 460 ? -15.65341 2.06116   -41.91135 1.000 69.48706  ? 460 ASP B CA  1 
ATOM   7711 C C   . ASP B 1 460 ? -16.48123 1.31815   -40.86805 1.000 75.79430  ? 460 ASP B C   1 
ATOM   7712 O O   . ASP B 1 460 ? -15.91318 0.82502   -39.88289 1.000 74.61718  ? 460 ASP B O   1 
ATOM   7713 C CB  . ASP B 1 460 ? -14.49636 1.20791   -42.42617 1.000 65.34753  ? 460 ASP B CB  1 
ATOM   7714 C CG  . ASP B 1 460 ? -14.95032 -0.02423  -43.18864 1.000 73.97036  ? 460 ASP B CG  1 
ATOM   7715 O OD1 . ASP B 1 460 ? -16.11618 -0.46501  -43.04799 1.000 67.85956  ? 460 ASP B OD1 1 
ATOM   7716 O OD2 . ASP B 1 460 ? -14.10760 -0.55868  -43.94120 1.000 84.21286  ? 460 ASP B OD2 1 
ATOM   7717 N N   . PRO B 1 461 ? -17.80431 1.21500   -41.02791 1.000 80.25939  ? 461 PRO B N   1 
ATOM   7718 C CA  . PRO B 1 461 ? -18.62499 0.63312   -39.94918 1.000 84.06189  ? 461 PRO B CA  1 
ATOM   7719 C C   . PRO B 1 461 ? -18.45702 -0.86949  -39.80364 1.000 83.48327  ? 461 PRO B C   1 
ATOM   7720 O O   . PRO B 1 461 ? -18.70692 -1.41155  -38.71667 1.000 80.23994  ? 461 PRO B O   1 
ATOM   7721 C CB  . PRO B 1 461 ? -20.06315 1.00036   -40.35531 1.000 87.77337  ? 461 PRO B CB  1 
ATOM   7722 C CG  . PRO B 1 461 ? -19.93977 1.91846   -41.55808 1.000 85.87428  ? 461 PRO B CG  1 
ATOM   7723 C CD  . PRO B 1 461 ? -18.61453 1.63453   -42.18085 1.000 81.80757  ? 461 PRO B CD  1 
ATOM   7724 N N   . SER B 1 462 ? -18.06401 -1.55870  -40.87753 1.000 84.48287  ? 462 SER B N   1 
ATOM   7725 C CA  . SER B 1 462 ? -17.83389 -2.99688  -40.84611 1.000 81.99591  ? 462 SER B CA  1 
ATOM   7726 C C   . SER B 1 462 ? -16.56993 -3.36231  -40.08443 1.000 78.96987  ? 462 SER B C   1 
ATOM   7727 O O   . SER B 1 462 ? -16.31777 -4.55405  -39.86546 1.000 79.38369  ? 462 SER B O   1 
ATOM   7728 C CB  . SER B 1 462 ? -17.74360 -3.53353  -42.27041 1.000 74.56780  ? 462 SER B CB  1 
ATOM   7729 O OG  . SER B 1 462 ? -16.73286 -2.82813  -42.97756 1.000 69.59670  ? 462 SER B OG  1 
ATOM   7730 N N   . LEU B 1 463 ? -15.76960 -2.37564  -39.69159 1.000 60.94891  ? 463 LEU B N   1 
ATOM   7731 C CA  . LEU B 1 463 ? -14.57834 -2.63076  -38.90232 1.000 70.88032  ? 463 LEU B CA  1 
ATOM   7732 C C   . LEU B 1 463 ? -14.86454 -2.70097  -37.40823 1.000 78.88349  ? 463 LEU B C   1 
ATOM   7733 O O   . LEU B 1 463 ? -13.93087 -2.90030  -36.62053 1.000 76.77498  ? 463 LEU B O   1 
ATOM   7734 C CB  . LEU B 1 463 ? -13.51993 -1.56938  -39.18941 1.000 65.90663  ? 463 LEU B CB  1 
ATOM   7735 C CG  . LEU B 1 463 ? -12.76154 -1.76489  -40.50508 1.000 61.85844  ? 463 LEU B CG  1 
ATOM   7736 C CD1 . LEU B 1 463 ? -11.74739 -0.63429  -40.70955 1.000 57.32482  ? 463 LEU B CD1 1 
ATOM   7737 C CD2 . LEU B 1 463 ? -12.09409 -3.14003  -40.55234 1.000 52.36847  ? 463 LEU B CD2 1 
ATOM   7738 N N   . ASN B 1 464 ? -16.12802 -2.54660  -37.00789 1.000 83.73600  ? 464 ASN B N   1 
ATOM   7739 C CA  . ASN B 1 464 ? -16.58253 -2.86543  -35.65571 1.000 86.66927  ? 464 ASN B CA  1 
ATOM   7740 C C   . ASN B 1 464 ? -15.84117 -2.04983  -34.58533 1.000 81.82562  ? 464 ASN B C   1 
ATOM   7741 O O   . ASN B 1 464 ? -15.67573 -2.49714  -33.44590 1.000 84.67267  ? 464 ASN B O   1 
ATOM   7742 C CB  . ASN B 1 464 ? -16.47646 -4.37802  -35.39954 1.000 87.98139  ? 464 ASN B CB  1 
ATOM   7743 C CG  . ASN B 1 464 ? -17.40876 -5.20279  -36.31271 1.000 92.21133  ? 464 ASN B CG  1 
ATOM   7744 O OD1 . ASN B 1 464 ? -18.42048 -4.69515  -36.80251 1.000 96.45308  ? 464 ASN B OD1 1 
ATOM   7745 N ND2 . ASN B 1 464 ? -17.07419 -6.47937  -36.52385 1.000 89.63306  ? 464 ASN B ND2 1 
ATOM   7746 N N   . TYR B 1 465 ? -15.39372 -0.84458  -34.94433 1.000 69.50779  ? 465 TYR B N   1 
ATOM   7747 C CA  . TYR B 1 465 ? -14.90937 0.12165   -33.96850 1.000 60.43549  ? 465 TYR B CA  1 
ATOM   7748 C C   . TYR B 1 465 ? -16.07098 0.73609   -33.18785 1.000 64.57743  ? 465 TYR B C   1 
ATOM   7749 O O   . TYR B 1 465 ? -17.21323 0.77473   -33.65694 1.000 70.89764  ? 465 TYR B O   1 
ATOM   7750 C CB  . TYR B 1 465 ? -14.14479 1.24300   -34.65899 1.000 57.73816  ? 465 TYR B CB  1 
ATOM   7751 C CG  . TYR B 1 465 ? -12.80610 0.87075   -35.23720 1.000 58.77291  ? 465 TYR B CG  1 
ATOM   7752 C CD1 . TYR B 1 465 ? -11.67938 0.83942   -34.43597 1.000 57.40078  ? 465 TYR B CD1 1 
ATOM   7753 C CD2 . TYR B 1 465 ? -12.66444 0.55532   -36.58764 1.000 60.68793  ? 465 TYR B CD2 1 
ATOM   7754 C CE1 . TYR B 1 465 ? -10.44065 0.51626   -34.95340 1.000 58.74801  ? 465 TYR B CE1 1 
ATOM   7755 C CE2 . TYR B 1 465 ? -11.42663 0.23336   -37.11979 1.000 55.50175  ? 465 TYR B CE2 1 
ATOM   7756 C CZ  . TYR B 1 465 ? -10.31479 0.21044   -36.28447 1.000 54.96760  ? 465 TYR B CZ  1 
ATOM   7757 O OH  . TYR B 1 465 ? -9.05658  -0.10421  -36.74635 1.000 47.10490  ? 465 TYR B OH  1 
ATOM   7758 N N   . THR B 1 466 ? -15.75791 1.26032   -31.99832 1.000 62.05532  ? 466 THR B N   1 
ATOM   7759 C CA  . THR B 1 466 ? -16.75046 1.90141   -31.13785 1.000 60.61719  ? 466 THR B CA  1 
ATOM   7760 C C   . THR B 1 466 ? -17.05711 3.32589   -31.60534 1.000 60.22334  ? 466 THR B C   1 
ATOM   7761 O O   . THR B 1 466 ? -16.24567 3.98282   -32.26150 1.000 66.87954  ? 466 THR B O   1 
ATOM   7762 C CB  . THR B 1 466 ? -16.27424 1.94499   -29.67987 1.000 68.93521  ? 466 THR B CB  1 
ATOM   7763 O OG1 . THR B 1 466 ? -15.28365 2.97187   -29.52380 1.000 61.24611  ? 466 THR B OG1 1 
ATOM   7764 C CG2 . THR B 1 466 ? -15.70117 0.59346   -29.23432 1.000 59.95927  ? 466 THR B CG2 1 
ATOM   7765 N N   . THR B 1 467 ? -18.24410 3.81134   -31.23034 1.000 64.51147  ? 467 THR B N   1 
ATOM   7766 C CA  . THR B 1 467 ? -18.68697 5.12730   -31.68771 1.000 65.02441  ? 467 THR B CA  1 
ATOM   7767 C C   . THR B 1 467 ? -17.71280 6.22640   -31.28898 1.000 76.64270  ? 467 THR B C   1 
ATOM   7768 O O   . THR B 1 467 ? -17.43846 7.13784   -32.07681 1.000 70.10280  ? 467 THR B O   1 
ATOM   7769 C CB  . THR B 1 467 ? -20.06539 5.44990   -31.12859 1.000 70.80699  ? 467 THR B CB  1 
ATOM   7770 O OG1 . THR B 1 467 ? -20.90048 4.28749   -31.20655 1.000 86.02733  ? 467 THR B OG1 1 
ATOM   7771 C CG2 . THR B 1 467 ? -20.68185 6.59822   -31.91749 1.000 72.07091  ? 467 THR B CG2 1 
ATOM   7772 N N   . GLU B 1 468 ? -17.20719 6.17986   -30.05452 1.000 77.57602  ? 468 GLU B N   1 
ATOM   7773 C CA  . GLU B 1 468 ? -16.24132 7.18222   -29.62370 1.000 70.36844  ? 468 GLU B CA  1 
ATOM   7774 C C   . GLU B 1 468 ? -14.94968 7.08353   -30.42581 1.000 60.24445  ? 468 GLU B C   1 
ATOM   7775 O O   . GLU B 1 468 ? -14.28665 8.09996   -30.65782 1.000 55.73659  ? 468 GLU B O   1 
ATOM   7776 C CB  . GLU B 1 468 ? -15.95940 7.03116   -28.12918 1.000 74.75701  ? 468 GLU B CB  1 
ATOM   7777 C CG  . GLU B 1 468 ? -17.19653 7.03977   -27.26646 1.000 87.92168  ? 468 GLU B CG  1 
ATOM   7778 C CD  . GLU B 1 468 ? -17.68978 5.64003   -26.95874 1.000 100.54793 ? 468 GLU B CD  1 
ATOM   7779 O OE1 . GLU B 1 468 ? -18.88319 5.36004   -27.21971 1.000 105.26389 ? 468 GLU B OE1 1 
ATOM   7780 O OE2 . GLU B 1 468 ? -16.87864 4.82108   -26.46568 1.000 101.76901 ? 468 GLU B OE2 1 
ATOM   7781 N N   . GLU B 1 469 ? -14.57996 5.87365   -30.86198 1.000 53.78159  ? 469 GLU B N   1 
ATOM   7782 C CA  . GLU B 1 469 ? -13.37854 5.71876   -31.67434 1.000 54.73794  ? 469 GLU B CA  1 
ATOM   7783 C C   . GLU B 1 469 ? -13.55135 6.33538   -33.05799 1.000 58.39518  ? 469 GLU B C   1 
ATOM   7784 O O   . GLU B 1 469 ? -12.58735 6.86798   -33.62502 1.000 54.60777  ? 469 GLU B O   1 
ATOM   7785 C CB  . GLU B 1 469 ? -13.01108 4.24282   -31.78478 1.000 51.53993  ? 469 GLU B CB  1 
ATOM   7786 C CG  . GLU B 1 469 ? -12.38079 3.70288   -30.53071 1.000 54.47371  ? 469 GLU B CG  1 
ATOM   7787 C CD  . GLU B 1 469 ? -12.07701 2.22889   -30.63316 1.000 59.88287  ? 469 GLU B CD  1 
ATOM   7788 O OE1 . GLU B 1 469 ? -12.94846 1.47710   -31.12611 1.000 62.75234  ? 469 GLU B OE1 1 
ATOM   7789 O OE2 . GLU B 1 469 ? -10.97337 1.82229   -30.20981 1.000 56.12617  ? 469 GLU B OE2 1 
ATOM   7790 N N   . ARG B 1 470 ? -14.76016 6.26121   -33.61895 1.000 56.28626  ? 470 ARG B N   1 
ATOM   7791 C CA  . ARG B 1 470 ? -15.05622 7.00814   -34.83297 1.000 51.86763  ? 470 ARG B CA  1 
ATOM   7792 C C   . ARG B 1 470 ? -14.86670 8.50461   -34.59614 1.000 55.73144  ? 470 ARG B C   1 
ATOM   7793 O O   . ARG B 1 470 ? -14.12813 9.17116   -35.32804 1.000 58.21703  ? 470 ARG B O   1 
ATOM   7794 C CB  . ARG B 1 470 ? -16.47918 6.68021   -35.30247 1.000 56.56809  ? 470 ARG B CB  1 
ATOM   7795 C CG  . ARG B 1 470 ? -16.92018 7.36698   -36.58233 1.000 62.31702  ? 470 ARG B CG  1 
ATOM   7796 C CD  . ARG B 1 470 ? -18.30071 6.89034   -37.04135 1.000 78.43999  ? 470 ARG B CD  1 
ATOM   7797 N NE  . ARG B 1 470 ? -19.36284 7.26592   -36.10803 1.000 94.59308  ? 470 ARG B NE  1 
ATOM   7798 C CZ  . ARG B 1 470 ? -19.93289 8.46990   -36.05873 1.000 97.03692  ? 470 ARG B CZ  1 
ATOM   7799 N NH1 . ARG B 1 470 ? -19.53719 9.42741   -36.89039 1.000 95.86311  ? 470 ARG B NH1 1 
ATOM   7800 N NH2 . ARG B 1 470 ? -20.89479 8.71974   -35.17310 1.000 92.93607  ? 470 ARG B NH2 1 
ATOM   7801 N N   . ILE B 1 471 ? -15.48173 9.03897   -33.53643 1.000 64.99109  ? 471 ILE B N   1 
ATOM   7802 C CA  . ILE B 1 471 ? -15.34005 10.46159  -33.21409 1.000 63.86710  ? 471 ILE B CA  1 
ATOM   7803 C C   . ILE B 1 471 ? -13.87415 10.82670  -32.99519 1.000 59.26724  ? 471 ILE B C   1 
ATOM   7804 O O   . ILE B 1 471 ? -13.41263 11.89484  -33.41993 1.000 57.13000  ? 471 ILE B O   1 
ATOM   7805 C CB  . ILE B 1 471 ? -16.19893 10.82223  -31.98545 1.000 59.66783  ? 471 ILE B CB  1 
ATOM   7806 C CG1 . ILE B 1 471 ? -17.69056 10.76457  -32.34312 1.000 60.06076  ? 471 ILE B CG1 1 
ATOM   7807 C CG2 . ILE B 1 471 ? -15.81477 12.19651  -31.47776 1.000 55.37021  ? 471 ILE B CG2 1 
ATOM   7808 C CD1 . ILE B 1 471 ? -18.63192 10.96250  -31.16873 1.000 65.17756  ? 471 ILE B CD1 1 
ATOM   7809 N N   . PHE B 1 472 ? -13.11937 9.94111   -32.33989 1.000 52.04772  ? 472 PHE B N   1 
ATOM   7810 C CA  . PHE B 1 472 ? -11.71514 10.21352  -32.05777 1.000 42.82996  ? 472 PHE B CA  1 
ATOM   7811 C C   . PHE B 1 472 ? -10.89345 10.24463  -33.33721 1.000 54.44739  ? 472 PHE B C   1 
ATOM   7812 O O   . PHE B 1 472 ? -10.00103 11.08877  -33.49179 1.000 53.48928  ? 472 PHE B O   1 
ATOM   7813 C CB  . PHE B 1 472 ? -11.18501 9.15707   -31.09476 1.000 44.30545  ? 472 PHE B CB  1 
ATOM   7814 C CG  . PHE B 1 472 ? -9.72803  9.28181   -30.77527 1.000 42.66206  ? 472 PHE B CG  1 
ATOM   7815 C CD1 . PHE B 1 472 ? -9.20418  10.46606  -30.29584 1.000 51.07512  ? 472 PHE B CD1 1 
ATOM   7816 C CD2 . PHE B 1 472 ? -8.88266  8.19422   -30.92399 1.000 41.08831  ? 472 PHE B CD2 1 
ATOM   7817 C CE1 . PHE B 1 472 ? -7.85183  10.57322  -30.00025 1.000 51.83160  ? 472 PHE B CE1 1 
ATOM   7818 C CE2 . PHE B 1 472 ? -7.53211  8.29215   -30.61800 1.000 44.08530  ? 472 PHE B CE2 1 
ATOM   7819 C CZ  . PHE B 1 472 ? -7.01816  9.48503   -30.15804 1.000 47.45049  ? 472 PHE B CZ  1 
ATOM   7820 N N   . ALA B 1 473 ? -11.18176 9.33491   -34.27115 1.000 54.02188  ? 473 ALA B N   1 
ATOM   7821 C CA  . ALA B 1 473 ? -10.44562 9.32732   -35.52762 1.000 47.23449  ? 473 ALA B CA  1 
ATOM   7822 C C   . ALA B 1 473 ? -10.70464 10.59953  -36.32032 1.000 44.95854  ? 473 ALA B C   1 
ATOM   7823 O O   . ALA B 1 473 ? -9.78591  11.15306  -36.93767 1.000 42.26544  ? 473 ALA B O   1 
ATOM   7824 C CB  . ALA B 1 473 ? -10.81312 8.09791   -36.34652 1.000 37.87159  ? 473 ALA B CB  1 
ATOM   7825 N N   . GLN B 1 474 ? -11.94600 11.09018  -36.31123 1.000 42.94711  ? 474 GLN B N   1 
ATOM   7826 C CA  . GLN B 1 474 ? -12.22025 12.32429  -37.04092 1.000 50.80246  ? 474 GLN B CA  1 
ATOM   7827 C C   . GLN B 1 474 ? -11.49030 13.50145  -36.41445 1.000 56.71464  ? 474 GLN B C   1 
ATOM   7828 O O   . GLN B 1 474 ? -11.08622 14.42982  -37.12419 1.000 65.85596  ? 474 GLN B O   1 
ATOM   7829 C CB  . GLN B 1 474 ? -13.72248 12.60032  -37.10027 1.000 44.75036  ? 474 GLN B CB  1 
ATOM   7830 C CG  . GLN B 1 474 ? -14.55683 11.46438  -37.65240 1.000 52.32764  ? 474 GLN B CG  1 
ATOM   7831 C CD  . GLN B 1 474 ? -16.01534 11.83407  -37.76116 1.000 61.13496  ? 474 GLN B CD  1 
ATOM   7832 O OE1 . GLN B 1 474 ? -16.88771 11.15942  -37.20352 1.000 61.80030  ? 474 GLN B OE1 1 
ATOM   7833 N NE2 . GLN B 1 474 ? -16.29233 12.92014  -38.47440 1.000 69.60718  ? 474 GLN B NE2 1 
ATOM   7834 N N   . ARG B 1 475 ? -11.30368 13.47505  -35.09314 1.000 53.25659  ? 475 ARG B N   1 
ATOM   7835 C CA  . ARG B 1 475 ? -10.51605 14.51276  -34.44514 1.000 50.48833  ? 475 ARG B CA  1 
ATOM   7836 C C   . ARG B 1 475 ? -9.08133  14.47660  -34.93142 1.000 46.93936  ? 475 ARG B C   1 
ATOM   7837 O O   . ARG B 1 475 ? -8.50706  15.52267  -35.24742 1.000 53.29671  ? 475 ARG B O   1 
ATOM   7838 C CB  . ARG B 1 475 ? -10.56798 14.35514  -32.92402 1.000 52.70614  ? 475 ARG B CB  1 
ATOM   7839 C CG  . ARG B 1 475 ? -10.71484 15.67689  -32.17627 1.000 56.90007  ? 475 ARG B CG  1 
ATOM   7840 C CD  . ARG B 1 475 ? -11.05443 15.46111  -30.70842 1.000 59.52787  ? 475 ARG B CD  1 
ATOM   7841 N NE  . ARG B 1 475 ? -9.84583  15.36781  -29.89371 1.000 60.34968  ? 475 ARG B NE  1 
ATOM   7842 C CZ  . ARG B 1 475 ? -9.56812  14.35829  -29.07497 1.000 57.77672  ? 475 ARG B CZ  1 
ATOM   7843 N NH1 . ARG B 1 475 ? -10.41531 13.34104  -28.95228 1.000 59.51834  ? 475 ARG B NH1 1 
ATOM   7844 N NH2 . ARG B 1 475 ? -8.44573  14.37275  -28.37083 1.000 52.96787  ? 475 ARG B NH2 1 
ATOM   7845 N N   . LEU B 1 476 ? -8.49231  13.27996  -35.01463 1.000 43.67046  ? 476 LEU B N   1 
ATOM   7846 C CA  . LEU B 1 476 ? -7.09681  13.17723  -35.42929 1.000 48.56609  ? 476 LEU B CA  1 
ATOM   7847 C C   . LEU B 1 476 ? -6.92513  13.54713  -36.89552 1.000 50.55401  ? 476 LEU B C   1 
ATOM   7848 O O   . LEU B 1 476 ? -5.94814  14.21426  -37.26657 1.000 49.12325  ? 476 LEU B O   1 
ATOM   7849 C CB  . LEU B 1 476 ? -6.56476  11.77069  -35.17547 1.000 45.99494  ? 476 LEU B CB  1 
ATOM   7850 C CG  . LEU B 1 476 ? -6.50981  11.34722  -33.71489 1.000 48.89097  ? 476 LEU B CG  1 
ATOM   7851 C CD1 . LEU B 1 476 ? -6.25219  9.85528   -33.65966 1.000 47.53902  ? 476 LEU B CD1 1 
ATOM   7852 C CD2 . LEU B 1 476 ? -5.43768  12.13727  -32.97977 1.000 46.32561  ? 476 LEU B CD2 1 
ATOM   7853 N N   . MET B 1 477 ? -7.85526  13.11341  -37.74740 1.000 50.30068  ? 477 MET B N   1 
ATOM   7854 C CA  . MET B 1 477 ? -7.78000  13.49582  -39.15064 1.000 43.69212  ? 477 MET B CA  1 
ATOM   7855 C C   . MET B 1 477 ? -7.73902  15.01237  -39.28939 1.000 52.26089  ? 477 MET B C   1 
ATOM   7856 O O   . MET B 1 477 ? -6.98621  15.54673  -40.11052 1.000 55.45467  ? 477 MET B O   1 
ATOM   7857 C CB  . MET B 1 477 ? -8.95414  12.89378  -39.92670 1.000 39.96977  ? 477 MET B CB  1 
ATOM   7858 C CG  . MET B 1 477 ? -8.79518  11.40497  -40.24177 1.000 42.35356  ? 477 MET B CG  1 
ATOM   7859 S SD  . MET B 1 477 ? -10.32251 10.56195  -40.75431 1.000 53.13116  ? 477 MET B SD  1 
ATOM   7860 C CE  . MET B 1 477 ? -10.67313 11.35141  -42.31461 1.000 55.34642  ? 477 MET B CE  1 
ATOM   7861 N N   . LYS B 1 478 ? -8.50462  15.72826  -38.45922 1.000 57.28227  ? 478 LYS B N   1 
ATOM   7862 C CA  . LYS B 1 478 ? -8.47359  17.18621  -38.52281 1.000 48.96125  ? 478 LYS B CA  1 
ATOM   7863 C C   . LYS B 1 478 ? -7.12211  17.73370  -38.07404 1.000 45.28826  ? 478 LYS B C   1 
ATOM   7864 O O   . LYS B 1 478 ? -6.59713  18.66397  -38.68907 1.000 48.18767  ? 478 LYS B O   1 
ATOM   7865 C CB  . LYS B 1 478 ? -9.60426  17.78836  -37.68941 1.000 38.90682  ? 478 LYS B CB  1 
ATOM   7866 C CG  . LYS B 1 478 ? -10.89990 17.98364  -38.44279 1.000 41.09332  ? 478 LYS B CG  1 
ATOM   7867 C CD  . LYS B 1 478 ? -11.36437 19.44357  -38.45947 1.000 43.55577  ? 478 LYS B CD  1 
ATOM   7868 C CE  . LYS B 1 478 ? -12.67200 19.59110  -39.25875 1.000 66.42752  ? 478 LYS B CE  1 
ATOM   7869 N NZ  . LYS B 1 478 ? -12.52911 19.34926  -40.75748 1.000 69.61062  ? 478 LYS B NZ  1 
ATOM   7870 N N   . TYR B 1 479 ? -6.54226  17.18458  -37.00547 1.000 46.28161  ? 479 TYR B N   1 
ATOM   7871 C CA  . TYR B 1 479 ? -5.23546  17.66880  -36.56985 1.000 46.41145  ? 479 TYR B CA  1 
ATOM   7872 C C   . TYR B 1 479 ? -4.22683  17.56399  -37.70636 1.000 45.01899  ? 479 TYR B C   1 
ATOM   7873 O O   . TYR B 1 479 ? -3.50939  18.52969  -38.00389 1.000 45.88643  ? 479 TYR B O   1 
ATOM   7874 C CB  . TYR B 1 479 ? -4.74066  16.88148  -35.35460 1.000 41.36454  ? 479 TYR B CB  1 
ATOM   7875 C CG  . TYR B 1 479 ? -5.50486  17.10019  -34.06894 1.000 46.81810  ? 479 TYR B CG  1 
ATOM   7876 C CD1 . TYR B 1 479 ? -5.94179  18.35954  -33.69604 1.000 52.29349  ? 479 TYR B CD1 1 
ATOM   7877 C CD2 . TYR B 1 479 ? -5.77426  16.03714  -33.21607 1.000 45.70133  ? 479 TYR B CD2 1 
ATOM   7878 C CE1 . TYR B 1 479 ? -6.63445  18.55273  -32.50259 1.000 55.32495  ? 479 TYR B CE1 1 
ATOM   7879 C CE2 . TYR B 1 479 ? -6.46505  16.22201  -32.03139 1.000 46.81664  ? 479 TYR B CE2 1 
ATOM   7880 C CZ  . TYR B 1 479 ? -6.89591  17.47604  -31.67661 1.000 53.58948  ? 479 TYR B CZ  1 
ATOM   7881 O OH  . TYR B 1 479 ? -7.58857  17.64681  -30.48987 1.000 57.24500  ? 479 TYR B OH  1 
ATOM   7882 N N   . TRP B 1 480 ? -4.19142  16.40030  -38.37834 1.000 33.94195  ? 480 TRP B N   1 
ATOM   7883 C CA  . TRP B 1 480 ? -3.19366  16.15912  -39.42162 1.000 41.22843  ? 480 TRP B CA  1 
ATOM   7884 C C   . TRP B 1 480 ? -3.46366  17.01679  -40.65431 1.000 41.94823  ? 480 TRP B C   1 
ATOM   7885 O O   . TRP B 1 480 ? -2.54917  17.67246  -41.16514 1.000 39.23033  ? 480 TRP B O   1 
ATOM   7886 C CB  . TRP B 1 480 ? -3.14298  14.66877  -39.79313 1.000 34.18302  ? 480 TRP B CB  1 
ATOM   7887 C CG  . TRP B 1 480 ? -2.05689  13.83177  -39.06327 1.000 40.27921  ? 480 TRP B CG  1 
ATOM   7888 C CD1 . TRP B 1 480 ? -1.05357  13.10389  -39.64196 1.000 42.09147  ? 480 TRP B CD1 1 
ATOM   7889 C CD2 . TRP B 1 480 ? -1.90079  13.65068  -37.64137 1.000 46.12246  ? 480 TRP B CD2 1 
ATOM   7890 N NE1 . TRP B 1 480 ? -0.28093  12.49022  -38.67805 1.000 43.30161  ? 480 TRP B NE1 1 
ATOM   7891 C CE2 . TRP B 1 480 ? -0.78112  12.80665  -37.44371 1.000 46.36148  ? 480 TRP B CE2 1 
ATOM   7892 C CE3 . TRP B 1 480 ? -2.59711  14.11813  -36.51997 1.000 48.60712  ? 480 TRP B CE3 1 
ATOM   7893 C CZ2 . TRP B 1 480 ? -0.35272  12.41398  -36.17330 1.000 43.02367  ? 480 TRP B CZ2 1 
ATOM   7894 C CZ3 . TRP B 1 480 ? -2.16226  13.73262  -35.25823 1.000 46.86559  ? 480 TRP B CZ3 1 
ATOM   7895 C CH2 . TRP B 1 480 ? -1.05169  12.89015  -35.09907 1.000 42.61953  ? 480 TRP B CH2 1 
ATOM   7896 N N   . THR B 1 481 ? -4.71889  17.05591  -41.13004 1.000 39.87841  ? 481 THR B N   1 
ATOM   7897 C CA  . THR B 1 481 ? -5.00700  17.84237  -42.32569 1.000 39.61114  ? 481 THR B CA  1 
ATOM   7898 C C   . THR B 1 481 ? -4.86438  19.33310  -42.03571 1.000 50.23231  ? 481 THR B C   1 
ATOM   7899 O O   . THR B 1 481 ? -4.30829  20.07764  -42.85107 1.000 49.63645  ? 481 THR B O   1 
ATOM   7900 C CB  . THR B 1 481 ? -6.40135  17.53781  -42.85547 1.000 39.92470  ? 481 THR B CB  1 
ATOM   7901 O OG1 . THR B 1 481 ? -7.34818  17.61934  -41.78482 1.000 47.35953  ? 481 THR B OG1 1 
ATOM   7902 C CG2 . THR B 1 481 ? -6.42717  16.11615  -43.41926 1.000 32.37002  ? 481 THR B CG2 1 
ATOM   7903 N N   . ASN B 1 482 ? -5.33398  19.78542  -40.86718 1.000 56.09787  ? 482 ASN B N   1 
ATOM   7904 C CA  . ASN B 1 482 ? -5.10192  21.17375  -40.47083 1.000 53.55970  ? 482 ASN B CA  1 
ATOM   7905 C C   . ASN B 1 482 ? -3.61678  21.46227  -40.40956 1.000 46.55482  ? 482 ASN B C   1 
ATOM   7906 O O   . ASN B 1 482 ? -3.17351  22.56634  -40.74532 1.000 45.48298  ? 482 ASN B O   1 
ATOM   7907 C CB  . ASN B 1 482 ? -5.74137  21.48126  -39.11333 1.000 48.78721  ? 482 ASN B CB  1 
ATOM   7908 C CG  . ASN B 1 482 ? -7.19470  21.87065  -39.22357 1.000 57.18578  ? 482 ASN B CG  1 
ATOM   7909 O OD1 . ASN B 1 482 ? -7.58628  22.65843  -40.08636 1.000 60.53952  ? 482 ASN B OD1 1 
ATOM   7910 N ND2 . ASN B 1 482 ? -8.01323  21.30691  -38.34800 1.000 68.07984  ? 482 ASN B ND2 1 
ATOM   7911 N N   . PHE B 1 483 ? -2.82640  20.48100  -39.98639 1.000 40.79721  ? 483 PHE B N   1 
ATOM   7912 C CA  . PHE B 1 483 ? -1.39347  20.70424  -40.00290 1.000 44.50854  ? 483 PHE B CA  1 
ATOM   7913 C C   . PHE B 1 483 ? -0.90130  20.89583  -41.42900 1.000 53.92805  ? 483 PHE B C   1 
ATOM   7914 O O   . PHE B 1 483 ? -0.14198  21.83293  -41.70786 1.000 58.63825  ? 483 PHE B O   1 
ATOM   7915 C CB  . PHE B 1 483 ? -0.65047  19.56165  -39.32339 1.000 37.69902  ? 483 PHE B CB  1 
ATOM   7916 C CG  . PHE B 1 483 ? 0.82408   19.75966  -39.31861 1.000 36.49882  ? 483 PHE B CG  1 
ATOM   7917 C CD1 . PHE B 1 483 ? 1.37310   20.89342  -38.72889 1.000 35.16164  ? 483 PHE B CD1 1 
ATOM   7918 C CD2 . PHE B 1 483 ? 1.66086   18.84889  -39.94579 1.000 34.12632  ? 483 PHE B CD2 1 
ATOM   7919 C CE1 . PHE B 1 483 ? 2.72997   21.10200  -38.73999 1.000 39.85270  ? 483 PHE B CE1 1 
ATOM   7920 C CE2 . PHE B 1 483 ? 3.02401   19.04626  -39.95799 1.000 41.30697  ? 483 PHE B CE2 1 
ATOM   7921 C CZ  . PHE B 1 483 ? 3.56527   20.17212  -39.35007 1.000 43.53482  ? 483 PHE B CZ  1 
ATOM   7922 N N   . ALA B 1 484 ? -1.36440  20.04467  -42.35352 1.000 49.53292  ? 484 ALA B N   1 
ATOM   7923 C CA  . ALA B 1 484 ? -0.95451  20.14904  -43.75222 1.000 38.52064  ? 484 ALA B CA  1 
ATOM   7924 C C   . ALA B 1 484 ? -1.31691  21.50962  -44.35334 1.000 40.07243  ? 484 ALA B C   1 
ATOM   7925 O O   . ALA B 1 484 ? -0.48405  22.14188  -45.01938 1.000 41.33036  ? 484 ALA B O   1 
ATOM   7926 C CB  . ALA B 1 484 ? -1.57968  19.01266  -44.55599 1.000 32.35919  ? 484 ALA B CB  1 
ATOM   7927 N N   . ARG B 1 485 ? -2.54148  21.99555  -44.11034 1.000 35.84658  ? 485 ARG B N   1 
ATOM   7928 C CA  . ARG B 1 485 ? -2.94639  23.24939  -44.74263 1.000 41.51724  ? 485 ARG B CA  1 
ATOM   7929 C C   . ARG B 1 485 ? -2.25697  24.46003  -44.15201 1.000 43.59480  ? 485 ARG B C   1 
ATOM   7930 O O   . ARG B 1 485 ? -2.17173  25.49757  -44.81942 1.000 46.74592  ? 485 ARG B O   1 
ATOM   7931 C CB  . ARG B 1 485 ? -4.45352  23.47942  -44.66209 1.000 46.47105  ? 485 ARG B CB  1 
ATOM   7932 C CG  . ARG B 1 485 ? -5.27545  22.24992  -44.66989 1.000 58.38973  ? 485 ARG B CG  1 
ATOM   7933 C CD  . ARG B 1 485 ? -6.74065  22.60792  -44.72853 1.000 70.69752  ? 485 ARG B CD  1 
ATOM   7934 N NE  . ARG B 1 485 ? -7.56135  21.40499  -44.77058 1.000 81.11493  ? 485 ARG B NE  1 
ATOM   7935 C CZ  . ARG B 1 485 ? -8.15462  20.89200  -43.70406 1.000 83.55917  ? 485 ARG B CZ  1 
ATOM   7936 N NH1 . ARG B 1 485 ? -8.00033  21.49610  -42.53146 1.000 81.24817  ? 485 ARG B NH1 1 
ATOM   7937 N NH2 . ARG B 1 485 ? -8.88886  19.78584  -43.80884 1.000 83.64691  ? 485 ARG B NH2 1 
ATOM   7938 N N   . THR B 1 486 ? -1.79272  24.37708  -42.91160 1.000 47.45290  ? 486 THR B N   1 
ATOM   7939 C CA  . THR B 1 486 ? -1.41809  25.58457  -42.18909 1.000 49.85380  ? 486 THR B CA  1 
ATOM   7940 C C   . THR B 1 486 ? -0.07063  25.50780  -41.50429 1.000 49.69845  ? 486 THR B C   1 
ATOM   7941 O O   . THR B 1 486 ? 0.52118   26.56122  -41.24472 1.000 54.38430  ? 486 THR B O   1 
ATOM   7942 C CB  . THR B 1 486 ? -2.47496  25.92486  -41.12589 1.000 55.96177  ? 486 THR B CB  1 
ATOM   7943 O OG1 . THR B 1 486 ? -2.85920  24.72783  -40.42983 1.000 60.78468  ? 486 THR B OG1 1 
ATOM   7944 C CG2 . THR B 1 486 ? -3.71279  26.57522  -41.76915 1.000 44.05750  ? 486 THR B CG2 1 
ATOM   7945 N N   . GLY B 1 487 ? 0.44336   24.31832  -41.21584 1.000 40.65517  ? 487 GLY B N   1 
ATOM   7946 C CA  . GLY B 1 487 ? 1.53715   24.20318  -40.28125 1.000 50.70698  ? 487 GLY B CA  1 
ATOM   7947 C C   . GLY B 1 487 ? 1.12266   24.18974  -38.82045 1.000 49.56951  ? 487 GLY B C   1 
ATOM   7948 O O   . GLY B 1 487 ? 1.99259   24.06234  -37.95357 1.000 44.62032  ? 487 GLY B O   1 
ATOM   7949 N N   . ASP B 1 488 ? -0.17510  24.29505  -38.52673 1.000 49.79865  ? 488 ASP B N   1 
ATOM   7950 C CA  . ASP B 1 488 ? -0.69146  24.38682  -37.16333 1.000 50.35298  ? 488 ASP B CA  1 
ATOM   7951 C C   . ASP B 1 488 ? -1.86457  23.42225  -37.03851 1.000 49.51044  ? 488 ASP B C   1 
ATOM   7952 O O   . ASP B 1 488 ? -2.89991  23.62083  -37.70934 1.000 51.66195  ? 488 ASP B O   1 
ATOM   7953 C CB  . ASP B 1 488 ? -1.10197  25.83654  -36.86197 1.000 54.21518  ? 488 ASP B CB  1 
ATOM   7954 C CG  . ASP B 1 488 ? -1.61335  26.04323  -35.43407 1.000 48.98962  ? 488 ASP B CG  1 
ATOM   7955 O OD1 . ASP B 1 488 ? -1.70939  25.05497  -34.68043 1.000 52.55834  ? 488 ASP B OD1 1 
ATOM   7956 O OD2 . ASP B 1 488 ? -1.94545  27.20395  -35.07663 1.000 44.43647  ? 488 ASP B OD2 1 
ATOM   7957 N N   . PRO B 1 489 ? -1.77213  22.38850  -36.19106 1.000 46.48149  ? 489 PRO B N   1 
ATOM   7958 C CA  . PRO B 1 489 ? -2.83302  21.36903  -36.13282 1.000 42.08823  ? 489 PRO B CA  1 
ATOM   7959 C C   . PRO B 1 489 ? -4.10878  21.83995  -35.45847 1.000 47.17080  ? 489 PRO B C   1 
ATOM   7960 O O   . PRO B 1 489 ? -5.03507  21.03598  -35.27922 1.000 51.20603  ? 489 PRO B O   1 
ATOM   7961 C CB  . PRO B 1 489 ? -2.17851  20.23904  -35.32061 1.000 36.49218  ? 489 PRO B CB  1 
ATOM   7962 C CG  . PRO B 1 489 ? -1.20330  20.91734  -34.46015 1.000 33.33180  ? 489 PRO B CG  1 
ATOM   7963 C CD  . PRO B 1 489 ? -0.69785  22.12404  -35.21215 1.000 34.44579  ? 489 PRO B CD  1 
ATOM   7964 N N   . ASN B 1 490 ? -4.19634  23.10846  -35.08738 1.000 42.48444  ? 490 ASN B N   1 
ATOM   7965 C CA  . ASN B 1 490 ? -5.34493  23.60362  -34.35656 1.000 47.38929  ? 490 ASN B CA  1 
ATOM   7966 C C   . ASN B 1 490 ? -6.42431  24.03974  -35.33043 1.000 60.57193  ? 490 ASN B C   1 
ATOM   7967 O O   . ASN B 1 490 ? -6.15793  24.80852  -36.25992 1.000 66.97888  ? 490 ASN B O   1 
ATOM   7968 C CB  . ASN B 1 490 ? -4.94448  24.76219  -33.44549 1.000 52.89078  ? 490 ASN B CB  1 
ATOM   7969 C CG  . ASN B 1 490 ? -4.27669  24.28707  -32.16025 1.000 60.08719  ? 490 ASN B CG  1 
ATOM   7970 O OD1 . ASN B 1 490 ? -4.92084  23.68791  -31.29267 1.000 59.24589  ? 490 ASN B OD1 1 
ATOM   7971 N ND2 . ASN B 1 490 ? -2.98072  24.55432  -32.03147 1.000 59.48568  ? 490 ASN B ND2 1 
ATOM   7972 N N   . ASP B 1 491 ? -7.62998  23.52477  -35.12254 1.000 65.98340  ? 491 ASP B N   1 
ATOM   7973 C CA  . ASP B 1 491 ? -8.82583  23.99839  -35.79658 1.000 67.90737  ? 491 ASP B CA  1 
ATOM   7974 C C   . ASP B 1 491 ? -8.89732  25.52558  -35.71496 1.000 71.74483  ? 491 ASP B C   1 
ATOM   7975 O O   . ASP B 1 491 ? -8.94813  26.07804  -34.60468 1.000 77.40574  ? 491 ASP B O   1 
ATOM   7976 C CB  . ASP B 1 491 ? -10.05558 23.36432  -35.13994 1.000 72.49646  ? 491 ASP B CB  1 
ATOM   7977 C CG  . ASP B 1 491 ? -11.15501 23.00391  -36.13851 1.000 80.70586  ? 491 ASP B CG  1 
ATOM   7978 O OD1 . ASP B 1 491 ? -11.40829 23.78966  -37.08574 1.000 87.29910  ? 491 ASP B OD1 1 
ATOM   7979 O OD2 . ASP B 1 491 ? -11.77109 21.92560  -35.96589 1.000 75.68520  ? 491 ASP B OD2 1 
ATOM   7980 N N   . PRO B 1 492 ? -8.89466  26.23655  -36.84569 1.000 78.57869  ? 492 PRO B N   1 
ATOM   7981 C CA  . PRO B 1 492 ? -9.03005  27.69874  -36.80605 1.000 84.23502  ? 492 PRO B CA  1 
ATOM   7982 C C   . PRO B 1 492 ? -10.44744 28.16549  -36.52058 1.000 85.44987  ? 492 PRO B C   1 
ATOM   7983 O O   . PRO B 1 492 ? -10.69429 29.37865  -36.51703 1.000 83.31862  ? 492 PRO B O   1 
ATOM   7984 C CB  . PRO B 1 492 ? -8.58786  28.11326  -38.21569 1.000 76.02484  ? 492 PRO B CB  1 
ATOM   7985 C CG  . PRO B 1 492 ? -9.08003  26.99106  -39.06138 1.000 68.16246  ? 492 PRO B CG  1 
ATOM   7986 C CD  . PRO B 1 492 ? -8.95061  25.72527  -38.22699 1.000 70.49162  ? 492 PRO B CD  1 
ATOM   7987 N N   . ARG B 1 493 ? -11.36454 27.22206  -36.29621 1.000 87.27431  ? 493 ARG B N   1 
ATOM   7988 C CA  . ARG B 1 493 ? -12.76166 27.46127  -35.95198 1.000 99.96083  ? 493 ARG B CA  1 
ATOM   7989 C C   . ARG B 1 493 ? -13.07765 27.14984  -34.49398 1.000 102.51876 ? 493 ARG B C   1 
ATOM   7990 O O   . ARG B 1 493 ? -13.78446 27.92458  -33.84283 1.000 101.26404 ? 493 ARG B O   1 
ATOM   7991 C CB  . ARG B 1 493 ? -13.66814 26.62423  -36.87329 1.000 103.12337 ? 493 ARG B CB  1 
ATOM   7992 C CG  . ARG B 1 493 ? -15.17090 26.63595  -36.55515 1.000 110.03239 ? 493 ARG B CG  1 
ATOM   7993 C CD  . ARG B 1 493 ? -15.78374 28.04893  -36.47584 1.000 115.22153 ? 493 ARG B CD  1 
ATOM   7994 N NE  . ARG B 1 493 ? -15.98160 28.50246  -35.09699 1.000 114.92098 ? 493 ARG B NE  1 
ATOM   7995 C CZ  . ARG B 1 493 ? -16.37764 29.72535  -34.74746 1.000 114.13891 ? 493 ARG B CZ  1 
ATOM   7996 N NH1 . ARG B 1 493 ? -16.63887 30.64508  -35.67422 1.000 110.34456 ? 493 ARG B NH1 1 
ATOM   7997 N NH2 . ARG B 1 493 ? -16.52284 30.02503  -33.46143 1.000 115.84863 ? 493 ARG B NH2 1 
ATOM   7998 N N   . ASP B 1 494 ? -12.56773 26.03571  -33.95953 1.000 101.21921 ? 494 ASP B N   1 
ATOM   7999 C CA  . ASP B 1 494 ? -12.72607 25.72042  -32.54465 1.000 100.89922 ? 494 ASP B CA  1 
ATOM   8000 C C   . ASP B 1 494 ? -12.18246 26.85565  -31.68648 1.000 100.48534 ? 494 ASP B C   1 
ATOM   8001 O O   . ASP B 1 494 ? -10.97335 27.12388  -31.68375 1.000 100.02386 ? 494 ASP B O   1 
ATOM   8002 C CB  . ASP B 1 494 ? -12.02093 24.40756  -32.18989 1.000 99.61432  ? 494 ASP B CB  1 
ATOM   8003 C CG  . ASP B 1 494 ? -12.03181 24.12362  -30.69350 1.000 108.09594 ? 494 ASP B CG  1 
ATOM   8004 O OD1 . ASP B 1 494 ? -13.10052 23.75174  -30.16724 1.000 113.58418 ? 494 ASP B OD1 1 
ATOM   8005 O OD2 . ASP B 1 494 ? -10.97622 24.27309  -30.03839 1.000 108.75053 ? 494 ASP B OD2 1 
ATOM   8006 N N   . SER B 1 495 ? -13.08052 27.53370  -30.96968 1.000 95.57905  ? 495 SER B N   1 
ATOM   8007 C CA  . SER B 1 495 ? -12.73581 28.61970  -30.06190 1.000 92.09642  ? 495 SER B CA  1 
ATOM   8008 C C   . SER B 1 495 ? -12.63240 28.15608  -28.60549 1.000 91.92922  ? 495 SER B C   1 
ATOM   8009 O O   . SER B 1 495 ? -12.63937 28.99393  -27.69414 1.000 81.54317  ? 495 SER B O   1 
ATOM   8010 C CB  . SER B 1 495 ? -13.76007 29.75747  -30.18479 1.000 91.58036  ? 495 SER B CB  1 
ATOM   8011 O OG  . SER B 1 495 ? -13.53665 30.57016  -31.32851 1.000 86.65851  ? 495 SER B OG  1 
ATOM   8012 N N   . LYS B 1 496 ? -12.52606 26.84584  -28.37236 1.000 100.01082 ? 496 LYS B N   1 
ATOM   8013 C CA  . LYS B 1 496 ? -12.53974 26.26548  -27.03561 1.000 113.99395 ? 496 LYS B CA  1 
ATOM   8014 C C   . LYS B 1 496 ? -11.11089 26.09711  -26.51606 1.000 122.12253 ? 496 LYS B C   1 
ATOM   8015 O O   . LYS B 1 496 ? -10.18489 25.80173  -27.28009 1.000 111.81865 ? 496 LYS B O   1 
ATOM   8016 C CB  . LYS B 1 496 ? -13.28319 24.92273  -27.04348 1.000 117.03231 ? 496 LYS B CB  1 
ATOM   8017 C CG  . LYS B 1 496 ? -13.21613 24.12819  -25.73987 1.000 122.62485 ? 496 LYS B CG  1 
ATOM   8018 C CD  . LYS B 1 496 ? -13.58607 22.66040  -25.94748 1.000 119.75095 ? 496 LYS B CD  1 
ATOM   8019 C CE  . LYS B 1 496 ? -13.21762 21.81318  -24.73182 1.000 112.50984 ? 496 LYS B CE  1 
ATOM   8020 N NZ  . LYS B 1 496 ? -13.45005 20.36157  -24.96803 1.000 106.95362 ? 496 LYS B NZ  1 
ATOM   8021 N N   . SER B 1 497 ? -10.95975 26.24257  -25.18460 1.000 135.04204 ? 497 SER B N   1 
ATOM   8022 C CA  . SER B 1 497 ? -9.67474  26.60495  -24.58184 1.000 139.29767 ? 497 SER B CA  1 
ATOM   8023 C C   . SER B 1 497 ? -8.53853  25.61955  -24.84233 1.000 142.06657 ? 497 SER B C   1 
ATOM   8024 O O   . SER B 1 497 ? -7.49690  26.04406  -25.37505 1.000 151.49743 ? 497 SER B O   1 
ATOM   8025 C CB  . SER B 1 497 ? -9.86023  26.84146  -23.08235 1.000 141.89263 ? 497 SER B CB  1 
ATOM   8026 O OG  . SER B 1 497 ? -8.60061  26.83319  -22.43408 1.000 139.38166 ? 497 SER B OG  1 
ATOM   8027 N N   . PRO B 1 498 ? -8.62486  24.31629  -24.45194 1.000 119.80589 ? 498 PRO B N   1 
ATOM   8028 C CA  . PRO B 1 498 ? -7.47020  23.43915  -24.70179 1.000 92.71804  ? 498 PRO B CA  1 
ATOM   8029 C C   . PRO B 1 498 ? -7.07516  23.45020  -26.17817 1.000 69.78951  ? 498 PRO B C   1 
ATOM   8030 O O   . PRO B 1 498 ? -7.75924  22.88449  -27.03770 1.000 59.87609  ? 498 PRO B O   1 
ATOM   8031 C CB  . PRO B 1 498 ? -7.94970  22.05958  -24.22159 1.000 88.64226  ? 498 PRO B CB  1 
ATOM   8032 C CG  . PRO B 1 498 ? -9.42362  22.14221  -24.21138 1.000 101.72746 ? 498 PRO B CG  1 
ATOM   8033 C CD  . PRO B 1 498 ? -9.74485  23.56624  -23.85152 1.000 113.69383 ? 498 PRO B CD  1 
ATOM   8034 N N   . GLN B 1 499 ? -5.99865  24.17869  -26.47020 1.000 62.31204  ? 499 GLN B N   1 
ATOM   8035 C CA  . GLN B 1 499 ? -5.36078  24.20784  -27.77466 1.000 47.04753  ? 499 GLN B CA  1 
ATOM   8036 C C   . GLN B 1 499 ? -4.02343  23.48858  -27.69195 1.000 43.90018  ? 499 GLN B C   1 
ATOM   8037 O O   . GLN B 1 499 ? -3.40927  23.40478  -26.62810 1.000 44.08879  ? 499 GLN B O   1 
ATOM   8038 C CB  . GLN B 1 499 ? -5.12949  25.63897  -28.26624 1.000 48.51249  ? 499 GLN B CB  1 
ATOM   8039 C CG  . GLN B 1 499 ? -6.37044  26.50209  -28.34947 1.000 52.03126  ? 499 GLN B CG  1 
ATOM   8040 C CD  . GLN B 1 499 ? -6.86419  26.74711  -29.78301 1.000 69.22633  ? 499 GLN B CD  1 
ATOM   8041 O OE1 . GLN B 1 499 ? -8.03777  26.49895  -30.09653 1.000 74.77368  ? 499 GLN B OE1 1 
ATOM   8042 N NE2 . GLN B 1 499 ? -5.97458  27.25257  -30.65288 1.000 66.03423  ? 499 GLN B NE2 1 
ATOM   8043 N N   . TRP B 1 500 ? -3.57526  22.97449  -28.82422 1.000 47.84036  ? 500 TRP B N   1 
ATOM   8044 C CA  . TRP B 1 500 ? -2.28453  22.30974  -28.92913 1.000 41.02089  ? 500 TRP B CA  1 
ATOM   8045 C C   . TRP B 1 500 ? -1.19266  23.37071  -29.00146 1.000 42.43030  ? 500 TRP B C   1 
ATOM   8046 O O   . TRP B 1 500 ? -1.16210  24.15299  -29.95941 1.000 39.17288  ? 500 TRP B O   1 
ATOM   8047 C CB  . TRP B 1 500 ? -2.27636  21.41246  -30.16394 1.000 42.61205  ? 500 TRP B CB  1 
ATOM   8048 C CG  . TRP B 1 500 ? -1.16097  20.44530  -30.23462 1.000 41.11496  ? 500 TRP B CG  1 
ATOM   8049 C CD1 . TRP B 1 500 ? 0.06106   20.54891  -29.63460 1.000 42.17089  ? 500 TRP B CD1 1 
ATOM   8050 C CD2 . TRP B 1 500 ? -1.15322  19.21519  -30.96174 1.000 39.58639  ? 500 TRP B CD2 1 
ATOM   8051 N NE1 . TRP B 1 500 ? 0.82992   19.45336  -29.94812 1.000 46.96359  ? 500 TRP B NE1 1 
ATOM   8052 C CE2 . TRP B 1 500 ? 0.10930   18.62180  -30.76463 1.000 43.95490  ? 500 TRP B CE2 1 
ATOM   8053 C CE3 . TRP B 1 500 ? -2.09097  18.55909  -31.76520 1.000 44.57251  ? 500 TRP B CE3 1 
ATOM   8054 C CZ2 . TRP B 1 500 ? 0.45737   17.39865  -31.33567 1.000 49.14691  ? 500 TRP B CZ2 1 
ATOM   8055 C CZ3 . TRP B 1 500 ? -1.74621  17.34527  -32.33370 1.000 48.82396  ? 500 TRP B CZ3 1 
ATOM   8056 C CH2 . TRP B 1 500 ? -0.48335  16.77601  -32.11529 1.000 51.21679  ? 500 TRP B CH2 1 
ATOM   8057 N N   . PRO B 1 501 ? -0.32336  23.47832  -27.99800 1.000 51.36051  ? 501 PRO B N   1 
ATOM   8058 C CA  . PRO B 1 501 ? 0.70738   24.51106  -28.03073 1.000 49.51504  ? 501 PRO B CA  1 
ATOM   8059 C C   . PRO B 1 501 ? 1.96282   23.99774  -28.70375 1.000 45.18640  ? 501 PRO B C   1 
ATOM   8060 O O   . PRO B 1 501 ? 2.22551   22.78397  -28.69087 1.000 34.73255  ? 501 PRO B O   1 
ATOM   8061 C CB  . PRO B 1 501 ? 0.95169   24.81073  -26.54360 1.000 41.19322  ? 501 PRO B CB  1 
ATOM   8062 C CG  . PRO B 1 501 ? 0.68697   23.54689  -25.88039 1.000 40.14611  ? 501 PRO B CG  1 
ATOM   8063 C CD  . PRO B 1 501 ? -0.41792  22.86515  -26.65918 1.000 52.12075  ? 501 PRO B CD  1 
ATOM   8064 N N   . PRO B 1 502 ? 2.74455   24.89145  -29.31508 1.000 43.32082  ? 502 PRO B N   1 
ATOM   8065 C CA  . PRO B 1 502 ? 4.03713   24.48757  -29.89074 1.000 41.18060  ? 502 PRO B CA  1 
ATOM   8066 C C   . PRO B 1 502 ? 4.98120   23.94080  -28.82868 1.000 46.65393  ? 502 PRO B C   1 
ATOM   8067 O O   . PRO B 1 502 ? 5.07455   24.47452  -27.71866 1.000 59.58145  ? 502 PRO B O   1 
ATOM   8068 C CB  . PRO B 1 502 ? 4.58336   25.78712  -30.49492 1.000 37.26166  ? 502 PRO B CB  1 
ATOM   8069 C CG  . PRO B 1 502 ? 3.37679   26.65967  -30.70934 1.000 39.40567  ? 502 PRO B CG  1 
ATOM   8070 C CD  . PRO B 1 502 ? 2.38670   26.28266  -29.63899 1.000 39.89046  ? 502 PRO B CD  1 
ATOM   8071 N N   . TYR B 1 503 ? 5.68161   22.86313  -29.18297 1.000 37.03262  ? 503 TYR B N   1 
ATOM   8072 C CA  . TYR B 1 503 ? 6.77166   22.36296  -28.35848 1.000 31.96971  ? 503 TYR B CA  1 
ATOM   8073 C C   . TYR B 1 503 ? 7.91281   23.36705  -28.38182 1.000 42.28469  ? 503 TYR B C   1 
ATOM   8074 O O   . TYR B 1 503 ? 8.31744   23.83946  -29.44376 1.000 45.32996  ? 503 TYR B O   1 
ATOM   8075 C CB  . TYR B 1 503 ? 7.25431   20.99361  -28.85133 1.000 39.88133  ? 503 TYR B CB  1 
ATOM   8076 C CG  . TYR B 1 503 ? 8.36494   20.37962  -28.01048 1.000 41.15715  ? 503 TYR B CG  1 
ATOM   8077 C CD1 . TYR B 1 503 ? 9.70360   20.57220  -28.33920 1.000 43.73744  ? 503 TYR B CD1 1 
ATOM   8078 C CD2 . TYR B 1 503 ? 8.07027   19.61418  -26.87038 1.000 39.11895  ? 503 TYR B CD2 1 
ATOM   8079 C CE1 . TYR B 1 503 ? 10.71856  20.01975  -27.55314 1.000 50.92087  ? 503 TYR B CE1 1 
ATOM   8080 C CE2 . TYR B 1 503 ? 9.08373   19.07164  -26.06768 1.000 33.54279  ? 503 TYR B CE2 1 
ATOM   8081 C CZ  . TYR B 1 503 ? 10.40065  19.27489  -26.41835 1.000 41.12760  ? 503 TYR B CZ  1 
ATOM   8082 O OH  . TYR B 1 503 ? 11.41014  18.73611  -25.65915 1.000 36.74445  ? 503 TYR B OH  1 
ATOM   8083 N N   . THR B 1 504 ? 8.41346   23.70484  -27.20590 1.000 51.20155  ? 504 THR B N   1 
ATOM   8084 C CA  . THR B 1 504 ? 9.44385   24.70726  -27.03501 1.000 53.17557  ? 504 THR B CA  1 
ATOM   8085 C C   . THR B 1 504 ? 10.57605  24.10296  -26.22387 1.000 56.11142  ? 504 THR B C   1 
ATOM   8086 O O   . THR B 1 504 ? 10.40882  23.07940  -25.56228 1.000 61.28299  ? 504 THR B O   1 
ATOM   8087 C CB  . THR B 1 504 ? 8.87846   25.92696  -26.32393 1.000 57.12060  ? 504 THR B CB  1 
ATOM   8088 O OG1 . THR B 1 504 ? 7.96989   25.48586  -25.30053 1.000 62.61171  ? 504 THR B OG1 1 
ATOM   8089 C CG2 . THR B 1 504 ? 8.13347   26.77863  -27.33157 1.000 44.37545  ? 504 THR B CG2 1 
ATOM   8090 N N   . THR B 1 505 ? 11.74721  24.72284  -26.28676 1.000 57.45267  ? 505 THR B N   1 
ATOM   8091 C CA  . THR B 1 505 ? 12.80270  24.25500  -25.40402 1.000 57.87275  ? 505 THR B CA  1 
ATOM   8092 C C   . THR B 1 505 ? 12.53339  24.68678  -23.97372 1.000 57.40189  ? 505 THR B C   1 
ATOM   8093 O O   . THR B 1 505 ? 12.80642  23.92025  -23.04474 1.000 61.31571  ? 505 THR B O   1 
ATOM   8094 C CB  . THR B 1 505 ? 14.16871  24.74896  -25.87848 1.000 62.90218  ? 505 THR B CB  1 
ATOM   8095 O OG1 . THR B 1 505 ? 14.05240  26.08213  -26.40307 1.000 71.15981  ? 505 THR B OG1 1 
ATOM   8096 C CG2 . THR B 1 505 ? 14.70832  23.81506  -26.95478 1.000 51.94554  ? 505 THR B CG2 1 
ATOM   8097 N N   . ALA B 1 506 ? 11.94583  25.87574  -23.78208 1.000 54.51144  ? 506 ALA B N   1 
ATOM   8098 C CA  . ALA B 1 506 ? 11.74551  26.40960  -22.43391 1.000 55.24876  ? 506 ALA B CA  1 
ATOM   8099 C C   . ALA B 1 506 ? 10.66689  25.63785  -21.67889 1.000 62.07510  ? 506 ALA B C   1 
ATOM   8100 O O   . ALA B 1 506 ? 10.90566  25.12778  -20.57337 1.000 67.36149  ? 506 ALA B O   1 
ATOM   8101 C CB  . ALA B 1 506 ? 11.38980  27.89545  -22.49936 1.000 48.95132  ? 506 ALA B CB  1 
ATOM   8102 N N   . ALA B 1 507 ? 9.46984   25.53216  -22.26821 1.000 54.73532  ? 507 ALA B N   1 
ATOM   8103 C CA  . ALA B 1 507 ? 8.33086   24.92570  -21.59178 1.000 46.44622  ? 507 ALA B CA  1 
ATOM   8104 C C   . ALA B 1 507 ? 8.09801   23.45838  -21.95256 1.000 45.14056  ? 507 ALA B C   1 
ATOM   8105 O O   . ALA B 1 507 ? 7.39411   22.76633  -21.21382 1.000 50.86293  ? 507 ALA B O   1 
ATOM   8106 C CB  . ALA B 1 507 ? 7.06153   25.73219  -21.88199 1.000 45.71916  ? 507 ALA B CB  1 
ATOM   8107 N N   . GLN B 1 508 ? 8.65771   22.96927  -23.05278 1.000 38.40318  ? 508 GLN B N   1 
ATOM   8108 C CA  . GLN B 1 508 ? 8.60878   21.54778  -23.41614 1.000 45.74264  ? 508 GLN B CA  1 
ATOM   8109 C C   . GLN B 1 508 ? 7.19071   20.96582  -23.36463 1.000 43.52481  ? 508 GLN B C   1 
ATOM   8110 O O   . GLN B 1 508 ? 6.96095   19.86186  -22.86748 1.000 39.61155  ? 508 GLN B O   1 
ATOM   8111 C CB  . GLN B 1 508 ? 9.57711   20.73807  -22.54704 1.000 42.67843  ? 508 GLN B CB  1 
ATOM   8112 C CG  . GLN B 1 508 ? 10.99702  21.32706  -22.49629 1.000 49.15864  ? 508 GLN B CG  1 
ATOM   8113 C CD  . GLN B 1 508 ? 11.93108  20.58703  -21.53964 1.000 52.89401  ? 508 GLN B CD  1 
ATOM   8114 O OE1 . GLN B 1 508 ? 12.40143  21.16358  -20.55288 1.000 61.82512  ? 508 GLN B OE1 1 
ATOM   8115 N NE2 . GLN B 1 508 ? 12.22197  19.31965  -21.83950 1.000 40.13988  ? 508 GLN B NE2 1 
ATOM   8116 N N   . GLN B 1 509 ? 6.23762   21.69398  -23.94700 1.000 42.55081  ? 509 GLN B N   1 
ATOM   8117 C CA  . GLN B 1 509 ? 4.84041   21.26187  -23.97898 1.000 39.02612  ? 509 GLN B CA  1 
ATOM   8118 C C   . GLN B 1 509 ? 4.54373   20.27804  -25.11593 1.000 38.24608  ? 509 GLN B C   1 
ATOM   8119 O O   . GLN B 1 509 ? 4.93159   20.50350  -26.27053 1.000 39.41742  ? 509 GLN B O   1 
ATOM   8120 C CB  . GLN B 1 509 ? 3.91259   22.47288  -24.10881 1.000 39.54875  ? 509 GLN B CB  1 
ATOM   8121 C CG  . GLN B 1 509 ? 3.79254   23.33179  -22.86801 1.000 44.88299  ? 509 GLN B CG  1 
ATOM   8122 C CD  . GLN B 1 509 ? 3.39250   24.76165  -23.18154 1.000 45.83168  ? 509 GLN B CD  1 
ATOM   8123 O OE1 . GLN B 1 509 ? 4.11420   25.48686  -23.86397 1.000 48.07220  ? 509 GLN B OE1 1 
ATOM   8124 N NE2 . GLN B 1 509 ? 2.22743   25.16559  -22.70161 1.000 48.29895  ? 509 GLN B NE2 1 
ATOM   8125 N N   . TYR B 1 510 ? 3.82097   19.20615  -24.78618 1.000 36.24873  ? 510 TYR B N   1 
ATOM   8126 C CA  . TYR B 1 510 ? 3.23380   18.28915  -25.75758 1.000 31.06302  ? 510 TYR B CA  1 
ATOM   8127 C C   . TYR B 1 510 ? 1.81696   17.95914  -25.30126 1.000 45.55789  ? 510 TYR B C   1 
ATOM   8128 O O   . TYR B 1 510 ? 1.43551   18.22050  -24.15823 1.000 45.47255  ? 510 TYR B O   1 
ATOM   8129 C CB  . TYR B 1 510 ? 4.05916   17.01015  -25.90306 1.000 29.03518  ? 510 TYR B CB  1 
ATOM   8130 C CG  . TYR B 1 510 ? 4.09942   16.18499  -24.64564 1.000 36.93495  ? 510 TYR B CG  1 
ATOM   8131 C CD1 . TYR B 1 510 ? 3.23719   15.10952  -24.47989 1.000 40.66076  ? 510 TYR B CD1 1 
ATOM   8132 C CD2 . TYR B 1 510 ? 5.00394   16.46747  -23.61708 1.000 33.60676  ? 510 TYR B CD2 1 
ATOM   8133 C CE1 . TYR B 1 510 ? 3.25424   14.35425  -23.31462 1.000 46.18098  ? 510 TYR B CE1 1 
ATOM   8134 C CE2 . TYR B 1 510 ? 5.02521   15.70320  -22.44787 1.000 31.96804  ? 510 TYR B CE2 1 
ATOM   8135 C CZ  . TYR B 1 510 ? 4.14770   14.64651  -22.30567 1.000 43.07325  ? 510 TYR B CZ  1 
ATOM   8136 O OH  . TYR B 1 510 ? 4.13695   13.85260  -21.16426 1.000 50.13289  ? 510 TYR B OH  1 
ATOM   8137 N N   . VAL B 1 511 ? 1.01586   17.38676  -26.19255 1.000 42.73451  ? 511 VAL B N   1 
ATOM   8138 C CA  . VAL B 1 511 ? -0.34992  17.03952  -25.82739 1.000 33.40067  ? 511 VAL B CA  1 
ATOM   8139 C C   . VAL B 1 511 ? -0.49915  15.53127  -25.89076 1.000 37.42253  ? 511 VAL B C   1 
ATOM   8140 O O   . VAL B 1 511 ? 0.30854   14.81892  -26.48994 1.000 48.88645  ? 511 VAL B O   1 
ATOM   8141 C CB  . VAL B 1 511 ? -1.39887  17.71391  -26.73043 1.000 37.50340  ? 511 VAL B CB  1 
ATOM   8142 C CG1 . VAL B 1 511 ? -1.21903  19.21264  -26.72298 1.000 38.37206  ? 511 VAL B CG1 1 
ATOM   8143 C CG2 . VAL B 1 511 ? -1.32381  17.15914  -28.14638 1.000 46.45224  ? 511 VAL B CG2 1 
ATOM   8144 N N   . SER B 1 512 ? -1.56319  15.04665  -25.27956 1.000 36.96149  ? 512 SER B N   1 
ATOM   8145 C CA  . SER B 1 512 ? -1.87645  13.62975  -25.28886 1.000 40.22353  ? 512 SER B CA  1 
ATOM   8146 C C   . SER B 1 512 ? -3.08783  13.39629  -26.17657 1.000 48.20884  ? 512 SER B C   1 
ATOM   8147 O O   . SER B 1 512 ? -4.11190  14.07435  -26.02937 1.000 46.47186  ? 512 SER B O   1 
ATOM   8148 C CB  . SER B 1 512 ? -2.15879  13.13193  -23.87545 1.000 37.01512  ? 512 SER B CB  1 
ATOM   8149 O OG  . SER B 1 512 ? -3.34945  13.72128  -23.40089 1.000 45.04781  ? 512 SER B OG  1 
ATOM   8150 N N   . LEU B 1 513 ? -2.97286  12.44157  -27.09169 1.000 50.60730  ? 513 LEU B N   1 
ATOM   8151 C CA  . LEU B 1 513 ? -4.08272  12.04755  -27.94792 1.000 47.31158  ? 513 LEU B CA  1 
ATOM   8152 C C   . LEU B 1 513 ? -4.70822  10.79055  -27.36104 1.000 46.75246  ? 513 LEU B C   1 
ATOM   8153 O O   . LEU B 1 513 ? -4.02309  9.77333   -27.19451 1.000 54.30111  ? 513 LEU B O   1 
ATOM   8154 C CB  . LEU B 1 513 ? -3.60988  11.81262  -29.38037 1.000 43.10229  ? 513 LEU B CB  1 
ATOM   8155 C CG  . LEU B 1 513 ? -2.86780  12.99289  -30.00531 1.000 38.75951  ? 513 LEU B CG  1 
ATOM   8156 C CD1 . LEU B 1 513 ? -2.09436  12.55613  -31.25305 1.000 47.91240  ? 513 LEU B CD1 1 
ATOM   8157 C CD2 . LEU B 1 513 ? -3.87535  14.06686  -30.34841 1.000 33.14718  ? 513 LEU B CD2 1 
ATOM   8158 N N   . ASN B 1 514 ? -5.98126  10.88444  -26.99970 1.000 39.63423  ? 514 ASN B N   1 
ATOM   8159 C CA  . ASN B 1 514 ? -6.77757  9.76329   -26.50817 1.000 45.05382  ? 514 ASN B CA  1 
ATOM   8160 C C   . ASN B 1 514 ? -8.23225  10.21861  -26.50732 1.000 52.13880  ? 514 ASN B C   1 
ATOM   8161 O O   . ASN B 1 514 ? -8.56293  11.27787  -27.05322 1.000 57.31343  ? 514 ASN B O   1 
ATOM   8162 C CB  . ASN B 1 514 ? -6.30938  9.29321   -25.12748 1.000 50.33163  ? 514 ASN B CB  1 
ATOM   8163 C CG  . ASN B 1 514 ? -6.61203  10.29098  -24.03032 1.000 58.95264  ? 514 ASN B CG  1 
ATOM   8164 O OD1 . ASN B 1 514 ? -7.76254  10.66940  -23.81048 1.000 62.89000  ? 514 ASN B OD1 1 
ATOM   8165 N ND2 . ASN B 1 514 ? -5.57221  10.71314  -23.31895 1.000 63.06232  ? 514 ASN B ND2 1 
ATOM   8166 N N   . LEU B 1 515 ? -9.10265  9.43937   -25.85680 1.000 52.60680  ? 515 LEU B N   1 
ATOM   8167 C CA  . LEU B 1 515 ? -10.53477 9.68227   -25.98575 1.000 44.39868  ? 515 LEU B CA  1 
ATOM   8168 C C   . LEU B 1 515 ? -10.96634 10.98222  -25.31802 1.000 56.41885  ? 515 LEU B C   1 
ATOM   8169 O O   . LEU B 1 515 ? -11.88228 11.64643  -25.81747 1.000 63.61939  ? 515 LEU B O   1 
ATOM   8170 C CB  . LEU B 1 515 ? -11.31114 8.50562   -25.41683 1.000 47.49627  ? 515 LEU B CB  1 
ATOM   8171 C CG  . LEU B 1 515 ? -11.18541 7.22347   -26.22833 1.000 47.13768  ? 515 LEU B CG  1 
ATOM   8172 C CD1 . LEU B 1 515 ? -12.26877 6.23964   -25.84996 1.000 50.78996  ? 515 LEU B CD1 1 
ATOM   8173 C CD2 . LEU B 1 515 ? -11.23793 7.53182   -27.73147 1.000 57.64970  ? 515 LEU B CD2 1 
ATOM   8174 N N   . LYS B 1 516 ? -10.32912 11.36421  -24.19835 1.000 53.17208  ? 516 LYS B N   1 
ATOM   8175 C CA  . LYS B 1 516 ? -10.66644 12.59810  -23.49644 1.000 51.99354  ? 516 LYS B CA  1 
ATOM   8176 C C   . LYS B 1 516 ? -10.10230 13.79254  -24.25498 1.000 54.97948  ? 516 LYS B C   1 
ATOM   8177 O O   . LYS B 1 516 ? -9.19221  13.63955  -25.07175 1.000 59.19820  ? 516 LYS B O   1 
ATOM   8178 C CB  . LYS B 1 516 ? -10.12102 12.57712  -22.06778 1.000 53.69238  ? 516 LYS B CB  1 
ATOM   8179 C CG  . LYS B 1 516 ? -10.12581 11.21102  -21.38022 1.000 61.56626  ? 516 LYS B CG  1 
ATOM   8180 C CD  . LYS B 1 516 ? -9.55127  11.31224  -19.96550 1.000 78.86430  ? 516 LYS B CD  1 
ATOM   8181 C CE  . LYS B 1 516 ? -8.86775  10.01476  -19.51093 1.000 91.40480  ? 516 LYS B CE  1 
ATOM   8182 N NZ  . LYS B 1 516 ? -7.53011  9.78228   -20.16037 1.000 89.50102  ? 516 LYS B NZ  1 
ATOM   8183 N N   . PRO B 1 517 ? -10.64856 15.00123  -24.02672 1.000 57.87570  ? 517 PRO B N   1 
ATOM   8184 C CA  . PRO B 1 517 ? -10.12969 16.18909  -24.72644 1.000 56.22725  ? 517 PRO B CA  1 
ATOM   8185 C C   . PRO B 1 517 ? -8.62545  16.35942  -24.57825 1.000 58.37741  ? 517 PRO B C   1 
ATOM   8186 O O   . PRO B 1 517 ? -8.01173  15.78307  -23.67339 1.000 55.79232  ? 517 PRO B O   1 
ATOM   8187 C CB  . PRO B 1 517 ? -10.88904 17.35038  -24.06626 1.000 53.36995  ? 517 PRO B CB  1 
ATOM   8188 C CG  . PRO B 1 517 ? -12.15932 16.75432  -23.60461 1.000 51.70224  ? 517 PRO B CG  1 
ATOM   8189 C CD  . PRO B 1 517 ? -11.87864 15.29771  -23.27162 1.000 56.82655  ? 517 PRO B CD  1 
ATOM   8190 N N   . LEU B 1 518 ? -8.02453  17.12287  -25.48924 1.000 59.33350  ? 518 LEU B N   1 
ATOM   8191 C CA  . LEU B 1 518 ? -6.60141  17.43137  -25.41903 1.000 51.73421  ? 518 LEU B CA  1 
ATOM   8192 C C   . LEU B 1 518 ? -6.20471  17.86592  -24.02103 1.000 51.90320  ? 518 LEU B C   1 
ATOM   8193 O O   . LEU B 1 518 ? -6.88121  18.69381  -23.40712 1.000 66.65728  ? 518 LEU B O   1 
ATOM   8194 C CB  . LEU B 1 518 ? -6.26874  18.55108  -26.40137 1.000 49.72943  ? 518 LEU B CB  1 
ATOM   8195 C CG  . LEU B 1 518 ? -5.82113  18.16433  -27.79616 1.000 51.59306  ? 518 LEU B CG  1 
ATOM   8196 C CD1 . LEU B 1 518 ? -5.12315  19.34616  -28.37916 1.000 56.66029  ? 518 LEU B CD1 1 
ATOM   8197 C CD2 . LEU B 1 518 ? -4.87708  16.99531  -27.72194 1.000 53.56830  ? 518 LEU B CD2 1 
ATOM   8198 N N   . GLU B 1 519 ? -5.10210  17.30791  -23.52204 1.000 53.08956  ? 519 GLU B N   1 
ATOM   8199 C CA  . GLU B 1 519 ? -4.48624  17.74487  -22.27111 1.000 55.22087  ? 519 GLU B CA  1 
ATOM   8200 C C   . GLU B 1 519 ? -3.01499  18.05421  -22.52848 1.000 51.05784  ? 519 GLU B C   1 
ATOM   8201 O O   . GLU B 1 519 ? -2.34337  17.34249  -23.28044 1.000 53.90663  ? 519 GLU B O   1 
ATOM   8202 C CB  . GLU B 1 519 ? -4.65207  16.68863  -21.16762 1.000 58.68573  ? 519 GLU B CB  1 
ATOM   8203 C CG  . GLU B 1 519 ? -3.53138  16.64498  -20.13941 1.000 71.96792  ? 519 GLU B CG  1 
ATOM   8204 C CD  . GLU B 1 519 ? -3.58331  15.39859  -19.27018 1.000 74.68693  ? 519 GLU B CD  1 
ATOM   8205 O OE1 . GLU B 1 519 ? -4.70068  15.03530  -18.84035 1.000 76.62180  ? 519 GLU B OE1 1 
ATOM   8206 O OE2 . GLU B 1 519 ? -2.51645  14.78102  -19.03440 1.000 67.81300  ? 519 GLU B OE2 1 
ATOM   8207 N N   . VAL B 1 520 ? -2.52905  19.13703  -21.93829 1.000 42.05199  ? 520 VAL B N   1 
ATOM   8208 C CA  . VAL B 1 520 ? -1.18877  19.64382  -22.20065 1.000 40.91703  ? 520 VAL B CA  1 
ATOM   8209 C C   . VAL B 1 520 ? -0.27544  19.23649  -21.04980 1.000 47.14133  ? 520 VAL B C   1 
ATOM   8210 O O   . VAL B 1 520 ? -0.51910  19.59308  -19.88594 1.000 47.58522  ? 520 VAL B O   1 
ATOM   8211 C CB  . VAL B 1 520 ? -1.20256  21.16992  -22.38518 1.000 42.72037  ? 520 VAL B CB  1 
ATOM   8212 C CG1 . VAL B 1 520 ? 0.21159   21.71415  -22.54224 1.000 42.18769  ? 520 VAL B CG1 1 
ATOM   8213 C CG2 . VAL B 1 520 ? -2.08819  21.55528  -23.57056 1.000 42.58089  ? 520 VAL B CG2 1 
ATOM   8214 N N   . ARG B 1 521 ? 0.78076   18.50083  -21.37266 1.000 39.02354  ? 521 ARG B N   1 
ATOM   8215 C CA  . ARG B 1 521 ? 1.80364   18.12261  -20.41514 1.000 39.06689  ? 521 ARG B CA  1 
ATOM   8216 C C   . ARG B 1 521 ? 3.15253   18.71229  -20.79026 1.000 44.48739  ? 521 ARG B C   1 
ATOM   8217 O O   . ARG B 1 521 ? 3.40319   19.06986  -21.94282 1.000 60.55828  ? 521 ARG B O   1 
ATOM   8218 C CB  . ARG B 1 521 ? 1.91277   16.61173  -20.28789 1.000 37.89845  ? 521 ARG B CB  1 
ATOM   8219 C CG  . ARG B 1 521 ? 0.60155   15.92155  -20.49600 1.000 38.29577  ? 521 ARG B CG  1 
ATOM   8220 C CD  . ARG B 1 521 ? 0.72594   14.44648  -20.25830 1.000 39.73384  ? 521 ARG B CD  1 
ATOM   8221 N NE  . ARG B 1 521 ? -0.58900  13.81989  -20.24152 1.000 41.57413  ? 521 ARG B NE  1 
ATOM   8222 C CZ  . ARG B 1 521 ? -0.77698  12.54016  -20.53206 1.000 43.65110  ? 521 ARG B CZ  1 
ATOM   8223 N NH1 . ARG B 1 521 ? 0.27128   11.79269  -20.87073 1.000 37.26159  ? 521 ARG B NH1 1 
ATOM   8224 N NH2 . ARG B 1 521 ? -1.99782  12.01998  -20.51504 1.000 41.47093  ? 521 ARG B NH2 1 
ATOM   8225 N N   . ARG B 1 522 ? 4.01580   18.83571  -19.78535 1.000 50.26657  ? 522 ARG B N   1 
ATOM   8226 C CA  . ARG B 1 522 ? 5.34819   19.39270  -19.95117 1.000 49.16832  ? 522 ARG B CA  1 
ATOM   8227 C C   . ARG B 1 522 ? 6.38637   18.30273  -19.74449 1.000 53.01020  ? 522 ARG B C   1 
ATOM   8228 O O   . ARG B 1 522 ? 6.21221   17.41881  -18.90130 1.000 57.15603  ? 522 ARG B O   1 
ATOM   8229 C CB  . ARG B 1 522 ? 5.58530   20.55150  -18.99035 1.000 41.28832  ? 522 ARG B CB  1 
ATOM   8230 C CG  . ARG B 1 522 ? 4.71141   21.75076  -19.29865 1.000 43.19561  ? 522 ARG B CG  1 
ATOM   8231 C CD  . ARG B 1 522 ? 4.91515   22.93168  -18.35252 1.000 55.19490  ? 522 ARG B CD  1 
ATOM   8232 N NE  . ARG B 1 522 ? 6.24143   23.52423  -18.49198 1.000 58.93141  ? 522 ARG B NE  1 
ATOM   8233 C CZ  . ARG B 1 522 ? 6.61812   24.65732  -17.91026 1.000 56.24813  ? 522 ARG B CZ  1 
ATOM   8234 N NH1 . ARG B 1 522 ? 5.73757   25.35593  -17.20806 1.000 52.33325  ? 522 ARG B NH1 1 
ATOM   8235 N NH2 . ARG B 1 522 ? 7.85304   25.11815  -18.08721 1.000 52.91020  ? 522 ARG B NH2 1 
ATOM   8236 N N   . GLY B 1 523 ? 7.43712   18.34819  -20.56192 1.000 51.38571  ? 523 GLY B N   1 
ATOM   8237 C CA  . GLY B 1 523 ? 8.55895   17.44260  -20.45739 1.000 42.83014  ? 523 GLY B CA  1 
ATOM   8238 C C   . GLY B 1 523 ? 8.24597   16.06130  -20.96959 1.000 44.48364  ? 523 GLY B C   1 
ATOM   8239 O O   . GLY B 1 523 ? 7.47018   15.32028  -20.35599 1.000 56.54883  ? 523 GLY B O   1 
ATOM   8240 N N   . LEU B 1 524 ? 8.86479   15.69734  -22.08833 1.000 47.87493  ? 524 LEU B N   1 
ATOM   8241 C CA  . LEU B 1 524 ? 8.57718   14.43339  -22.76272 1.000 48.30039  ? 524 LEU B CA  1 
ATOM   8242 C C   . LEU B 1 524 ? 9.57788   13.40170  -22.25983 1.000 51.51753  ? 524 LEU B C   1 
ATOM   8243 O O   . LEU B 1 524 ? 10.65540  13.21833  -22.83180 1.000 50.08367  ? 524 LEU B O   1 
ATOM   8244 C CB  . LEU B 1 524 ? 8.62810   14.62177  -24.27404 1.000 50.01627  ? 524 LEU B CB  1 
ATOM   8245 C CG  . LEU B 1 524 ? 8.27778   13.41590  -25.14745 1.000 47.19785  ? 524 LEU B CG  1 
ATOM   8246 C CD1 . LEU B 1 524 ? 7.01008   12.71054  -24.65392 1.000 45.22769  ? 524 LEU B CD1 1 
ATOM   8247 C CD2 . LEU B 1 524 ? 8.12111   13.88238  -26.58532 1.000 37.66514  ? 524 LEU B CD2 1 
ATOM   8248 N N   . ARG B 1 525 ? 9.21287   12.73190  -21.15973 1.000 55.51540  ? 525 ARG B N   1 
ATOM   8249 C CA  . ARG B 1 525 ? 10.08385  11.79301  -20.44852 1.000 43.16266  ? 525 ARG B CA  1 
ATOM   8250 C C   . ARG B 1 525 ? 11.45722  12.42439  -20.18730 1.000 45.71748  ? 525 ARG B C   1 
ATOM   8251 O O   . ARG B 1 525 ? 12.50177  11.91752  -20.59746 1.000 50.97130  ? 525 ARG B O   1 
ATOM   8252 C CB  . ARG B 1 525 ? 10.19928  10.47830  -21.22579 1.000 38.68195  ? 525 ARG B CB  1 
ATOM   8253 C CG  . ARG B 1 525 ? 10.30097  9.24288   -20.34909 1.000 49.47110  ? 525 ARG B CG  1 
ATOM   8254 C CD  . ARG B 1 525 ? 9.64606   8.03189   -21.00351 1.000 55.72537  ? 525 ARG B CD  1 
ATOM   8255 N NE  . ARG B 1 525 ? 8.22018   8.22833   -21.25581 1.000 56.27930  ? 525 ARG B NE  1 
ATOM   8256 C CZ  . ARG B 1 525 ? 7.41876   7.29634   -21.76850 1.000 68.21241  ? 525 ARG B CZ  1 
ATOM   8257 N NH1 . ARG B 1 525 ? 7.90587   6.09711   -22.08943 1.000 64.94541  ? 525 ARG B NH1 1 
ATOM   8258 N NH2 . ARG B 1 525 ? 6.12567   7.56016   -21.95795 1.000 72.77466  ? 525 ARG B NH2 1 
ATOM   8259 N N   . ALA B 1 526 ? 11.43552  13.55577  -19.47997 1.000 44.04340  ? 526 ALA B N   1 
ATOM   8260 C CA  . ALA B 1 526 ? 12.59034  14.44839  -19.47732 1.000 41.31164  ? 526 ALA B CA  1 
ATOM   8261 C C   . ALA B 1 526 ? 13.77488  13.84941  -18.72390 1.000 53.08524  ? 526 ALA B C   1 
ATOM   8262 O O   . ALA B 1 526 ? 14.88824  13.78291  -19.25871 1.000 68.31163  ? 526 ALA B O   1 
ATOM   8263 C CB  . ALA B 1 526 ? 12.19952  15.80627  -18.89679 1.000 35.44097  ? 526 ALA B CB  1 
ATOM   8264 N N   . GLN B 1 527 ? 13.56915  13.42471  -17.47171 1.000 42.83158  ? 527 GLN B N   1 
ATOM   8265 C CA  . GLN B 1 527 ? 14.70069  12.92495  -16.68939 1.000 44.59779  ? 527 GLN B CA  1 
ATOM   8266 C C   . GLN B 1 527 ? 15.30525  11.68771  -17.33407 1.000 43.76559  ? 527 GLN B C   1 
ATOM   8267 O O   . GLN B 1 527 ? 16.52845  11.51437  -17.33749 1.000 47.27573  ? 527 GLN B O   1 
ATOM   8268 C CB  . GLN B 1 527 ? 14.28281  12.59426  -15.24820 1.000 49.05015  ? 527 GLN B CB  1 
ATOM   8269 C CG  . GLN B 1 527 ? 13.92937  13.77151  -14.36766 1.000 50.85170  ? 527 GLN B CG  1 
ATOM   8270 C CD  . GLN B 1 527 ? 14.99814  14.83505  -14.37318 1.000 60.31212  ? 527 GLN B CD  1 
ATOM   8271 O OE1 . GLN B 1 527 ? 14.80123  15.92626  -14.92405 1.000 59.80042  ? 527 GLN B OE1 1 
ATOM   8272 N NE2 . GLN B 1 527 ? 16.14555  14.52787  -13.75709 1.000 60.65970  ? 527 GLN B NE2 1 
ATOM   8273 N N   . THR B 1 528 ? 14.45737  10.80449  -17.86652 1.000 39.52308  ? 528 THR B N   1 
ATOM   8274 C CA  . THR B 1 528 ? 14.94008  9.54961   -18.43126 1.000 44.19199  ? 528 THR B CA  1 
ATOM   8275 C C   . THR B 1 528 ? 15.65196  9.76956   -19.77084 1.000 47.63615  ? 528 THR B C   1 
ATOM   8276 O O   . THR B 1 528 ? 16.60776  9.05455   -20.09678 1.000 52.52797  ? 528 THR B O   1 
ATOM   8277 C CB  . THR B 1 528 ? 13.75960  8.57810   -18.57529 1.000 50.91717  ? 528 THR B CB  1 
ATOM   8278 O OG1 . THR B 1 528 ? 13.31165  8.13990   -17.28184 1.000 38.56186  ? 528 THR B OG1 1 
ATOM   8279 C CG2 . THR B 1 528 ? 14.13105  7.36355   -19.42218 1.000 60.46461  ? 528 THR B CG2 1 
ATOM   8280 N N   . CYS B 1 529 ? 15.23192  10.75772  -20.55356 1.000 40.15214  ? 529 CYS B N   1 
ATOM   8281 C CA  . CYS B 1 529 ? 15.93405  10.98814  -21.80563 1.000 48.14133  ? 529 CYS B CA  1 
ATOM   8282 C C   . CYS B 1 529 ? 17.19130  11.81560  -21.61008 1.000 46.97958  ? 529 CYS B C   1 
ATOM   8283 O O   . CYS B 1 529 ? 18.12542  11.69852  -22.41040 1.000 48.87793  ? 529 CYS B O   1 
ATOM   8284 C CB  . CYS B 1 529 ? 14.99936  11.63065  -22.83553 1.000 47.93586  ? 529 CYS B CB  1 
ATOM   8285 S SG  . CYS B 1 529 ? 13.72075  10.45774  -23.44182 1.000 51.23242  ? 529 CYS B SG  1 
ATOM   8286 N N   . ALA B 1 530 ? 17.25758  12.62150  -20.55330 1.000 45.76536  ? 530 ALA B N   1 
ATOM   8287 C CA  . ALA B 1 530 ? 18.54770  13.18927  -20.18919 1.000 51.33241  ? 530 ALA B CA  1 
ATOM   8288 C C   . ALA B 1 530 ? 19.55220  12.07926  -19.92668 1.000 46.59456  ? 530 ALA B C   1 
ATOM   8289 O O   . ALA B 1 530 ? 20.70370  12.14811  -20.37145 1.000 45.33597  ? 530 ALA B O   1 
ATOM   8290 C CB  . ALA B 1 530 ? 18.40836  14.09342  -18.97063 1.000 50.39356  ? 530 ALA B CB  1 
ATOM   8291 N N   . PHE B 1 531 ? 19.11971  11.02961  -19.22982 1.000 44.21371  ? 531 PHE B N   1 
ATOM   8292 C CA  . PHE B 1 531 ? 19.96259  9.85187   -19.05758 1.000 44.98856  ? 531 PHE B CA  1 
ATOM   8293 C C   . PHE B 1 531 ? 20.40947  9.28602   -20.40611 1.000 49.20999  ? 531 PHE B C   1 
ATOM   8294 O O   . PHE B 1 531 ? 21.59831  8.99948   -20.60664 1.000 47.40774  ? 531 PHE B O   1 
ATOM   8295 C CB  . PHE B 1 531 ? 19.21295  8.78271   -18.27011 1.000 38.83693  ? 531 PHE B CB  1 
ATOM   8296 C CG  . PHE B 1 531 ? 19.93768  7.47423   -18.21436 1.000 52.49164  ? 531 PHE B CG  1 
ATOM   8297 C CD1 . PHE B 1 531 ? 19.34932  6.32241   -18.72005 1.000 57.72308  ? 531 PHE B CD1 1 
ATOM   8298 C CD2 . PHE B 1 531 ? 21.19436  7.38001   -17.63433 1.000 51.34362  ? 531 PHE B CD2 1 
ATOM   8299 C CE1 . PHE B 1 531 ? 20.01779  5.10161   -18.67570 1.000 57.61869  ? 531 PHE B CE1 1 
ATOM   8300 C CE2 . PHE B 1 531 ? 21.86630  6.16017   -17.57702 1.000 54.38824  ? 531 PHE B CE2 1 
ATOM   8301 C CZ  . PHE B 1 531 ? 21.27528  5.01925   -18.09399 1.000 56.57074  ? 531 PHE B CZ  1 
ATOM   8302 N N   . TRP B 1 532 ? 19.46411  9.10827   -21.34439 1.000 43.94728  ? 532 TRP B N   1 
ATOM   8303 C CA  . TRP B 1 532 ? 19.79602  8.45427   -22.61009 1.000 40.85776  ? 532 TRP B CA  1 
ATOM   8304 C C   . TRP B 1 532 ? 20.56971  9.38265   -23.52969 1.000 41.96260  ? 532 TRP B C   1 
ATOM   8305 O O   . TRP B 1 532 ? 21.56148  8.97065   -24.13541 1.000 45.63411  ? 532 TRP B O   1 
ATOM   8306 C CB  . TRP B 1 532 ? 18.54081  7.95705   -23.32021 1.000 40.13295  ? 532 TRP B CB  1 
ATOM   8307 C CG  . TRP B 1 532 ? 18.01136  6.66071   -22.81977 1.000 40.41137  ? 532 TRP B CG  1 
ATOM   8308 C CD1 . TRP B 1 532 ? 16.91593  6.48647   -22.03871 1.000 39.24082  ? 532 TRP B CD1 1 
ATOM   8309 C CD2 . TRP B 1 532 ? 18.52666  5.34426   -23.08393 1.000 42.55036  ? 532 TRP B CD2 1 
ATOM   8310 N NE1 . TRP B 1 532 ? 16.71750  5.15050   -21.78522 1.000 40.51905  ? 532 TRP B NE1 1 
ATOM   8311 C CE2 . TRP B 1 532 ? 17.69330  4.42813   -22.41479 1.000 42.54045  ? 532 TRP B CE2 1 
ATOM   8312 C CE3 . TRP B 1 532 ? 19.60323  4.85030   -23.82718 1.000 45.51291  ? 532 TRP B CE3 1 
ATOM   8313 C CZ2 . TRP B 1 532 ? 17.90311  3.04810   -22.46373 1.000 45.21008  ? 532 TRP B CZ2 1 
ATOM   8314 C CZ3 . TRP B 1 532 ? 19.81828  3.46514   -23.86261 1.000 47.22581  ? 532 TRP B CZ3 1 
ATOM   8315 C CH2 . TRP B 1 532 ? 18.96935  2.58900   -23.19534 1.000 47.12243  ? 532 TRP B CH2 1 
ATOM   8316 N N   . ASN B 1 533 ? 20.12552  10.63754  -23.66525 1.000 40.97029  ? 533 ASN B N   1 
ATOM   8317 C CA  . ASN B 1 533 ? 20.71756  11.51722  -24.67722 1.000 46.13150  ? 533 ASN B CA  1 
ATOM   8318 C C   . ASN B 1 533 ? 21.94850  12.25585  -24.17498 1.000 47.34542  ? 533 ASN B C   1 
ATOM   8319 O O   . ASN B 1 533 ? 22.80677  12.63911  -24.98362 1.000 51.05302  ? 533 ASN B O   1 
ATOM   8320 C CB  . ASN B 1 533 ? 19.72690  12.57823  -25.18345 1.000 50.35800  ? 533 ASN B CB  1 
ATOM   8321 C CG  . ASN B 1 533 ? 18.38971  12.01962  -25.59101 1.000 49.77042  ? 533 ASN B CG  1 
ATOM   8322 O OD1 . ASN B 1 533 ? 18.26642  10.86462  -26.00753 1.000 53.13186  ? 533 ASN B OD1 1 
ATOM   8323 N ND2 . ASN B 1 533 ? 17.35610  12.84647  -25.43589 1.000 42.66839  ? 533 ASN B ND2 1 
ATOM   8324 N N   . ARG B 1 534 ? 22.03678  12.51037  -22.87128 1.000 48.63506  ? 534 ARG B N   1 
ATOM   8325 C CA  . ARG B 1 534 ? 23.16056  13.26921  -22.34371 1.000 47.13684  ? 534 ARG B CA  1 
ATOM   8326 C C   . ARG B 1 534 ? 24.22325  12.38312  -21.70146 1.000 47.80127  ? 534 ARG B C   1 
ATOM   8327 O O   . ARG B 1 534 ? 25.39273  12.49110  -22.07216 1.000 47.67946  ? 534 ARG B O   1 
ATOM   8328 C CB  . ARG B 1 534 ? 22.66701  14.34209  -21.36065 1.000 55.57865  ? 534 ARG B CB  1 
ATOM   8329 C CG  . ARG B 1 534 ? 22.29687  15.66205  -22.04407 1.000 60.00135  ? 534 ARG B CG  1 
ATOM   8330 C CD  . ARG B 1 534 ? 21.70747  16.68241  -21.08415 1.000 60.76876  ? 534 ARG B CD  1 
ATOM   8331 N NE  . ARG B 1 534 ? 20.39845  17.16222  -21.53172 1.000 63.21748  ? 534 ARG B NE  1 
ATOM   8332 C CZ  . ARG B 1 534 ? 20.16871  18.37422  -22.03574 1.000 65.08003  ? 534 ARG B CZ  1 
ATOM   8333 N NH1 . ARG B 1 534 ? 21.15712  19.25909  -22.15856 1.000 65.28728  ? 534 ARG B NH1 1 
ATOM   8334 N NH2 . ARG B 1 534 ? 18.93929  18.70637  -22.40581 1.000 62.85687  ? 534 ARG B NH2 1 
ATOM   8335 N N   . PHE B 1 535 ? 23.85002  11.47765  -20.78032 1.000 54.32206  ? 535 PHE B N   1 
ATOM   8336 C CA  . PHE B 1 535 ? 24.86259  10.80837  -19.95665 1.000 51.20748  ? 535 PHE B CA  1 
ATOM   8337 C C   . PHE B 1 535 ? 25.40412  9.53668   -20.60744 1.000 53.44478  ? 535 PHE B C   1 
ATOM   8338 O O   . PHE B 1 535 ? 26.61213  9.27525   -20.55996 1.000 55.51000  ? 535 PHE B O   1 
ATOM   8339 C CB  . PHE B 1 535 ? 24.31233  10.45507  -18.58330 1.000 43.67610  ? 535 PHE B CB  1 
ATOM   8340 C CG  . PHE B 1 535 ? 25.21090  9.52874   -17.81148 1.000 44.88077  ? 535 PHE B CG  1 
ATOM   8341 C CD1 . PHE B 1 535 ? 24.88125  8.19348   -17.65676 1.000 45.08373  ? 535 PHE B CD1 1 
ATOM   8342 C CD2 . PHE B 1 535 ? 26.38110  10.00377  -17.21834 1.000 46.10095  ? 535 PHE B CD2 1 
ATOM   8343 C CE1 . PHE B 1 535 ? 25.70849  7.34367   -16.95036 1.000 52.76059  ? 535 PHE B CE1 1 
ATOM   8344 C CE2 . PHE B 1 535 ? 27.20329  9.16603   -16.51033 1.000 47.31890  ? 535 PHE B CE2 1 
ATOM   8345 C CZ  . PHE B 1 535 ? 26.87071  7.83457   -16.36987 1.000 53.93312  ? 535 PHE B CZ  1 
ATOM   8346 N N   . LEU B 1 536 ? 24.53172  8.70071   -21.16136 1.000 46.35655  ? 536 LEU B N   1 
ATOM   8347 C CA  . LEU B 1 536 ? 25.01825  7.43446   -21.69618 1.000 51.24905  ? 536 LEU B CA  1 
ATOM   8348 C C   . LEU B 1 536 ? 26.06974  7.61426   -22.78613 1.000 61.18449  ? 536 LEU B C   1 
ATOM   8349 O O   . LEU B 1 536 ? 27.06906  6.87279   -22.76520 1.000 63.35335  ? 536 LEU B O   1 
ATOM   8350 C CB  . LEU B 1 536 ? 23.83941  6.58693   -22.18541 1.000 47.75670  ? 536 LEU B CB  1 
ATOM   8351 C CG  . LEU B 1 536 ? 23.36894  5.57923   -21.13905 1.000 50.22415  ? 536 LEU B CG  1 
ATOM   8352 C CD1 . LEU B 1 536 ? 22.14781  4.84175   -21.59720 1.000 46.73963  ? 536 LEU B CD1 1 
ATOM   8353 C CD2 . LEU B 1 536 ? 24.48716  4.58700   -20.78486 1.000 54.32216  ? 536 LEU B CD2 1 
ATOM   8354 N N   . PRO B 1 537 ? 25.92263  8.54068   -23.74582 1.000 66.92630  ? 537 PRO B N   1 
ATOM   8355 C CA  . PRO B 1 537 ? 27.03804  8.82760   -24.66150 1.000 66.33750  ? 537 PRO B CA  1 
ATOM   8356 C C   . PRO B 1 537 ? 28.37092  9.09569   -23.96913 1.000 70.71902  ? 537 PRO B C   1 
ATOM   8357 O O   . PRO B 1 537 ? 29.40320  8.57603   -24.41897 1.000 76.78380  ? 537 PRO B O   1 
ATOM   8358 C CB  . PRO B 1 537 ? 26.53063  10.06367  -25.40803 1.000 54.44712  ? 537 PRO B CB  1 
ATOM   8359 C CG  . PRO B 1 537 ? 25.08649  9.87707   -25.45027 1.000 51.54970  ? 537 PRO B CG  1 
ATOM   8360 C CD  . PRO B 1 537 ? 24.70499  9.27091   -24.15157 1.000 59.15809  ? 537 PRO B CD  1 
ATOM   8361 N N   . LYS B 1 538 ? 28.38638  9.90473   -22.89823 1.000 63.47731  ? 538 LYS B N   1 
ATOM   8362 C CA  . LYS B 1 538 ? 29.64000  10.16423  -22.19171 1.000 62.03903  ? 538 LYS B CA  1 
ATOM   8363 C C   . LYS B 1 538 ? 30.24079  8.87237   -21.66731 1.000 63.37813  ? 538 LYS B C   1 
ATOM   8364 O O   . LYS B 1 538 ? 31.46834  8.74726   -21.56300 1.000 66.78432  ? 538 LYS B O   1 
ATOM   8365 C CB  . LYS B 1 538 ? 29.42105  11.14500  -21.03328 1.000 58.62852  ? 538 LYS B CB  1 
ATOM   8366 C CG  . LYS B 1 538 ? 28.99107  12.55590  -21.43833 1.000 66.81848  ? 538 LYS B CG  1 
ATOM   8367 C CD  . LYS B 1 538 ? 30.13253  13.55626  -21.29859 1.000 83.26225  ? 538 LYS B CD  1 
ATOM   8368 C CE  . LYS B 1 538 ? 29.70938  14.97382  -21.70198 1.000 88.03492  ? 538 LYS B CE  1 
ATOM   8369 N NZ  . LYS B 1 538 ? 30.79565  15.97298  -21.43557 1.000 91.56784  ? 538 LYS B NZ  1 
ATOM   8370 N N   . LEU B 1 539 ? 29.38773  7.89235   -21.37545 1.000 59.13522  ? 539 LEU B N   1 
ATOM   8371 C CA  . LEU B 1 539 ? 29.80600  6.68419   -20.68153 1.000 66.33402  ? 539 LEU B CA  1 
ATOM   8372 C C   . LEU B 1 539 ? 30.58129  5.75020   -21.59496 1.000 80.22631  ? 539 LEU B C   1 
ATOM   8373 O O   . LEU B 1 539 ? 31.74849  5.43979   -21.33421 1.000 90.69827  ? 539 LEU B O   1 
ATOM   8374 C CB  . LEU B 1 539 ? 28.58487  5.97061   -20.11547 1.000 62.04655  ? 539 LEU B CB  1 
ATOM   8375 C CG  . LEU B 1 539 ? 28.88567  4.73944   -19.28516 1.000 58.30267  ? 539 LEU B CG  1 
ATOM   8376 C CD1 . LEU B 1 539 ? 30.04919  5.04032   -18.37032 1.000 56.78002  ? 539 LEU B CD1 1 
ATOM   8377 C CD2 . LEU B 1 539 ? 27.64818  4.37070   -18.48871 1.000 54.99157  ? 539 LEU B CD2 1 
ATOM   8378 N N   . LEU B 1 540 ? 29.93189  5.26754   -22.65404 1.000 87.01031  ? 540 LEU B N   1 
ATOM   8379 C CA  . LEU B 1 540 ? 30.57620  4.31889   -23.55616 1.000 100.66281 ? 540 LEU B CA  1 
ATOM   8380 C C   . LEU B 1 540 ? 31.90264  4.86693   -24.08134 1.000 104.21299 ? 540 LEU B C   1 
ATOM   8381 O O   . LEU B 1 540 ? 32.92133  4.16319   -24.09084 1.000 109.96552 ? 540 LEU B O   1 
ATOM   8382 C CB  . LEU B 1 540 ? 29.62260  3.97542   -24.70574 1.000 108.37258 ? 540 LEU B CB  1 
ATOM   8383 C CG  . LEU B 1 540 ? 28.43115  3.07253   -24.35813 1.000 107.85099 ? 540 LEU B CG  1 
ATOM   8384 C CD1 . LEU B 1 540 ? 27.09897  3.62504   -24.88488 1.000 101.78914 ? 540 LEU B CD1 1 
ATOM   8385 C CD2 . LEU B 1 540 ? 28.67895  1.67012   -24.88704 1.000 111.79466 ? 540 LEU B CD2 1 
ATOM   8386 N N   . SER B 1 541 ? 31.91603  6.14138   -24.48219 1.000 101.43494 ? 541 SER B N   1 
ATOM   8387 C CA  . SER B 1 541 ? 33.10834  6.78435   -25.02854 1.000 105.84967 ? 541 SER B CA  1 
ATOM   8388 C C   . SER B 1 541 ? 34.12183  7.14930   -23.94319 1.000 111.91871 ? 541 SER B C   1 
ATOM   8389 O O   . SER B 1 541 ? 34.63250  8.27633   -23.91909 1.000 113.76026 ? 541 SER B O   1 
ATOM   8390 C CB  . SER B 1 541 ? 32.70583  8.03226   -25.81879 1.000 101.64361 ? 541 SER B CB  1 
ATOM   8391 O OG  . SER B 1 541 ? 31.93039  8.90809   -25.01860 1.000 95.65868  ? 541 SER B OG  1 
ATOM   8392 N N   . ALA B 1 542 ? 34.42973  6.19715   -23.05892 1.000 108.65096 ? 542 ALA B N   1 
ATOM   8393 C CA  . ALA B 1 542 ? 35.32744  6.41070   -21.92446 1.000 95.37760  ? 542 ALA B CA  1 
ATOM   8394 C C   . ALA B 1 542 ? 35.51196  5.10483   -21.15632 1.000 89.07034  ? 542 ALA B C   1 
ATOM   8395 O O   . ALA B 1 542 ? 34.58457  4.29631   -21.05828 1.000 79.37095  ? 542 ALA B O   1 
ATOM   8396 C CB  . ALA B 1 542 ? 34.78646  7.50124   -21.00118 1.000 87.43292  ? 542 ALA B CB  1 
HETATM 8397 C C1  . NAG C 2 .   ? 24.85550  35.62450  -1.09205  1.000 99.09966  ? 601 NAG A C1  1 
HETATM 8398 C C2  . NAG C 2 .   ? 25.11375  35.89084  -2.53199  1.000 114.95879 ? 601 NAG A C2  1 
HETATM 8399 C C3  . NAG C 2 .   ? 26.44329  35.19464  -2.98608  1.000 110.92767 ? 601 NAG A C3  1 
HETATM 8400 C C4  . NAG C 2 .   ? 27.61880  35.63918  -2.11145  1.000 110.15973 ? 601 NAG A C4  1 
HETATM 8401 C C5  . NAG C 2 .   ? 27.28484  35.26981  -0.67094  1.000 103.13296 ? 601 NAG A C5  1 
HETATM 8402 C C6  . NAG C 2 .   ? 28.39789  35.58846  0.31839   1.000 92.31426  ? 601 NAG A C6  1 
HETATM 8403 C C7  . NAG C 2 .   ? 22.84886  36.09578  -3.63536  1.000 122.74615 ? 601 NAG A C7  1 
HETATM 8404 C C8  . NAG C 2 .   ? 21.90858  35.31778  -4.53880  1.000 117.78315 ? 601 NAG A C8  1 
HETATM 8405 N N2  . NAG C 2 .   ? 23.97522  35.45236  -3.34170  1.000 123.79664 ? 601 NAG A N2  1 
HETATM 8406 O O3  . NAG C 2 .   ? 26.77212  35.38508  -4.36268  1.000 103.25529 ? 601 NAG A O3  1 
HETATM 8407 O O4  . NAG C 2 .   ? 28.84921  35.05477  -2.53868  1.000 111.82514 ? 601 NAG A O4  1 
HETATM 8408 O O5  . NAG C 2 .   ? 26.09137  35.98970  -0.30305  1.000 104.86410 ? 601 NAG A O5  1 
HETATM 8409 O O6  . NAG C 2 .   ? 28.34900  36.93819  0.76002   1.000 82.64657  ? 601 NAG A O6  1 
HETATM 8410 O O7  . NAG C 2 .   ? 22.61375  37.20718  -3.23394  1.000 123.72745 ? 601 NAG A O7  1 
HETATM 8411 C C1  . NAG D 2 .   ? 11.95553  34.13106  25.50299  1.000 93.03127  ? 602 NAG A C1  1 
HETATM 8412 C C2  . NAG D 2 .   ? 13.32907  34.83725  25.38429  1.000 104.11807 ? 602 NAG A C2  1 
HETATM 8413 C C3  . NAG D 2 .   ? 13.42588  35.98172  26.40337  1.000 106.74980 ? 602 NAG A C3  1 
HETATM 8414 C C4  . NAG D 2 .   ? 12.26926  36.95293  26.20080  1.000 104.31357 ? 602 NAG A C4  1 
HETATM 8415 C C5  . NAG D 2 .   ? 10.95305  36.19879  26.37836  1.000 102.99964 ? 602 NAG A C5  1 
HETATM 8416 C C6  . NAG D 2 .   ? 9.73156   37.06625  26.16655  1.000 101.52745 ? 602 NAG A C6  1 
HETATM 8417 C C7  . NAG D 2 .   ? 15.01743  33.25695  24.53520  1.000 100.86156 ? 602 NAG A C7  1 
HETATM 8418 C C8  . NAG D 2 .   ? 16.12989  32.31773  24.90205  1.000 94.81943  ? 602 NAG A C8  1 
HETATM 8419 N N2  . NAG D 2 .   ? 14.42847  33.89679  25.55477  1.000 104.02490 ? 602 NAG A N2  1 
HETATM 8420 O O3  . NAG D 2 .   ? 14.67426  36.66241  26.31191  1.000 105.68667 ? 602 NAG A O3  1 
HETATM 8421 O O4  . NAG D 2 .   ? 12.35378  38.05230  27.10348  1.000 99.94194  ? 602 NAG A O4  1 
HETATM 8422 O O5  . NAG D 2 .   ? 10.87715  35.12625  25.42224  1.000 101.25269 ? 602 NAG A O5  1 
HETATM 8423 O O6  . NAG D 2 .   ? 8.54031   36.40835  26.57953  1.000 98.11579  ? 602 NAG A O6  1 
HETATM 8424 O O7  . NAG D 2 .   ? 14.66734  33.42721  23.36818  1.000 100.28148 ? 602 NAG A O7  1 
HETATM 8425 N N12 . N2K E 3 .   ? 29.80085  20.68185  13.00985  1.000 59.77470  ? 603 N2K A N12 1 
HETATM 8426 C C13 . N2K E 3 .   ? 28.64426  21.19709  13.73062  1.000 53.07949  ? 603 N2K A C13 1 
HETATM 8427 C C14 . N2K E 3 .   ? 27.96846  20.24800  14.70082  1.000 43.08076  ? 603 N2K A C14 1 
HETATM 8428 C C17 . N2K E 3 .   ? 25.18061  21.14767  13.50115  1.000 42.31196  ? 603 N2K A C17 1 
HETATM 8429 C C18 . N2K E 3 .   ? 26.93721  18.05351  14.73359  1.000 41.74210  ? 603 N2K A C18 1 
HETATM 8430 C C19 . N2K E 3 .   ? 27.03312  17.93891  16.22688  1.000 44.03975  ? 603 N2K A C19 1 
HETATM 8431 O O20 . N2K E 3 .   ? 28.17841  19.04670  11.86218  1.000 60.30812  ? 603 N2K A O20 1 
HETATM 8432 C C02 . N2K E 3 .   ? 34.12184  24.46100  10.26085  1.000 70.35705  ? 603 N2K A C02 1 
HETATM 8433 C C05 . N2K E 3 .   ? 32.85404  23.57298  10.22117  1.000 63.68731  ? 603 N2K A C05 1 
HETATM 8434 C C06 . N2K E 3 .   ? 32.79408  22.44323  9.36005   1.000 55.28592  ? 603 N2K A C06 1 
HETATM 8435 C C07 . N2K E 3 .   ? 31.65153  21.62386  9.36712   1.000 55.62871  ? 603 N2K A C07 1 
HETATM 8436 C C08 . N2K E 3 .   ? 30.55390  21.91708  10.23659  1.000 61.73006  ? 603 N2K A C08 1 
HETATM 8437 C C09 . N2K E 3 .   ? 29.31016  21.00413  10.29823  1.000 59.47949  ? 603 N2K A C09 1 
HETATM 8438 C C16 . N2K E 3 .   ? 25.63015  20.06152  14.48126  1.000 40.87709  ? 603 N2K A C16 1 
HETATM 8439 C C21 . N2K E 3 .   ? 30.62463  23.04188  11.11066  1.000 68.91652  ? 603 N2K A C21 1 
HETATM 8440 C C22 . N2K E 3 .   ? 31.76201  23.86081  11.10628  1.000 69.10474  ? 603 N2K A C22 1 
HETATM 8441 F F01 . N2K E 3 .   ? 33.95835  25.69389  9.77178   1.000 75.29777  ? 603 N2K A F01 1 
HETATM 8442 F F03 . N2K E 3 .   ? 34.46462  24.59986  11.54416  1.000 72.24281  ? 603 N2K A F03 1 
HETATM 8443 F F04 . N2K E 3 .   ? 35.08158  23.79687  9.62056   1.000 69.33160  ? 603 N2K A F04 1 
HETATM 8444 N N15 . N2K E 3 .   ? 26.85978  19.44797  14.19386  1.000 44.97674  ? 603 N2K A N15 1 
HETATM 8445 O O11 . N2K E 3 .   ? 30.32504  18.72247  11.51309  1.000 60.00945  ? 603 N2K A O11 1 
HETATM 8446 S S10 . N2K E 3 .   ? 29.36850  19.83595  11.68383  1.000 60.84847  ? 603 N2K A S10 1 
HETATM 8447 C C1  . EDO F 4 .   ? 35.47937  4.87462   1.33973   1.000 81.24340  ? 604 EDO A C1  1 
HETATM 8448 O O1  . EDO F 4 .   ? 35.88195  5.02161   2.67739   1.000 82.54229  ? 604 EDO A O1  1 
HETATM 8449 C C2  . EDO F 4 .   ? 34.26555  3.90015   1.32505   1.000 79.15492  ? 604 EDO A C2  1 
HETATM 8450 O O2  . EDO F 4 .   ? 34.77958  2.61771   1.53649   1.000 77.68317  ? 604 EDO A O2  1 
HETATM 8451 C C1  . EDO G 4 .   ? 14.14117  24.64457  34.11430  1.000 73.33847  ? 605 EDO A C1  1 
HETATM 8452 O O1  . EDO G 4 .   ? 13.90324  24.50267  35.49396  1.000 71.41750  ? 605 EDO A O1  1 
HETATM 8453 C C2  . EDO G 4 .   ? 15.68746  24.69760  33.88943  1.000 67.07176  ? 605 EDO A C2  1 
HETATM 8454 O O2  . EDO G 4 .   ? 16.03872  23.57477  33.12454  1.000 59.24823  ? 605 EDO A O2  1 
HETATM 8455 C C1  . EDO H 4 .   ? 13.39773  23.98194  1.93448   1.000 49.54868  ? 606 EDO A C1  1 
HETATM 8456 O O1  . EDO H 4 .   ? 12.53084  25.07721  2.01817   1.000 50.29286  ? 606 EDO A O1  1 
HETATM 8457 C C2  . EDO H 4 .   ? 12.76157  23.02036  0.87991   1.000 52.73955  ? 606 EDO A C2  1 
HETATM 8458 O O2  . EDO H 4 .   ? 13.61356  21.91145  0.75237   1.000 43.70538  ? 606 EDO A O2  1 
HETATM 8459 C C5  . PG0 I 5 .   ? 46.51859  -4.86457  9.20917   1.000 91.67343  ? 607 PG0 A C5  1 
HETATM 8460 O O2  . PG0 I 5 .   ? 46.39837  -4.50207  7.87619   1.000 90.41158  ? 607 PG0 A O2  1 
HETATM 8461 C C4  . PG0 I 5 .   ? 46.20076  -3.17865  7.52347   1.000 77.31551  ? 607 PG0 A C4  1 
HETATM 8462 C C3  . PG0 I 5 .   ? 44.81268  -2.78237  7.90870   1.000 66.12427  ? 607 PG0 A C3  1 
HETATM 8463 O O1  . PG0 I 5 .   ? 43.88636  -3.25392  6.99242   1.000 64.44697  ? 607 PG0 A O1  1 
HETATM 8464 C C2  . PG0 I 5 .   ? 43.26503  -4.47633  7.18596   1.000 60.03739  ? 607 PG0 A C2  1 
HETATM 8465 C C1  . PG0 I 5 .   ? 42.29831  -4.75128  6.08068   1.000 58.40250  ? 607 PG0 A C1  1 
HETATM 8466 O OTT . PG0 I 5 .   ? 42.23495  -6.11201  5.82577   1.000 60.08841  ? 607 PG0 A OTT 1 
HETATM 8467 C C5  . PG0 J 5 .   ? 13.12128  16.72005  -10.48975 1.000 72.11830  ? 608 PG0 A C5  1 
HETATM 8468 O O2  . PG0 J 5 .   ? 14.42228  16.28163  -10.31143 1.000 75.83740  ? 608 PG0 A O2  1 
HETATM 8469 C C4  . PG0 J 5 .   ? 14.70687  14.93125  -10.22555 1.000 72.91945  ? 608 PG0 A C4  1 
HETATM 8470 C C3  . PG0 J 5 .   ? 16.03238  14.79111  -9.55857  1.000 74.41388  ? 608 PG0 A C3  1 
HETATM 8471 O O1  . PG0 J 5 .   ? 15.89988  14.09875  -8.36962  1.000 78.63346  ? 608 PG0 A O1  1 
HETATM 8472 C C2  . PG0 J 5 .   ? 16.46140  14.60829  -7.21024  1.000 78.28789  ? 608 PG0 A C2  1 
HETATM 8473 C C1  . PG0 J 5 .   ? 16.05248  13.78311  -6.03217  1.000 82.93166  ? 608 PG0 A C1  1 
HETATM 8474 O OTT . PG0 J 5 .   ? 16.42311  14.39469  -4.84650  1.000 88.64160  ? 608 PG0 A OTT 1 
HETATM 8475 C C5  . PG0 K 5 .   ? 42.53691  27.42274  8.88880   1.000 73.74425  ? 609 PG0 A C5  1 
HETATM 8476 O O2  . PG0 K 5 .   ? 41.17225  27.62268  8.96495   1.000 80.59432  ? 609 PG0 A O2  1 
HETATM 8477 C C4  . PG0 K 5 .   ? 40.33337  27.21764  7.94188   1.000 79.57156  ? 609 PG0 A C4  1 
HETATM 8478 C C3  . PG0 K 5 .   ? 39.05226  26.69495  8.51526   1.000 77.10693  ? 609 PG0 A C3  1 
HETATM 8479 O O1  . PG0 K 5 .   ? 38.11827  26.50629  7.51668   1.000 75.32478  ? 609 PG0 A O1  1 
HETATM 8480 C C2  . PG0 K 5 .   ? 37.51296  25.27697  7.31999   1.000 70.29930  ? 609 PG0 A C2  1 
HETATM 8481 C C1  . PG0 K 5 .   ? 36.81614  25.31235  5.99585   1.000 78.46404  ? 609 PG0 A C1  1 
HETATM 8482 O OTT . PG0 K 5 .   ? 36.67529  24.05074  5.43377   1.000 83.61001  ? 609 PG0 A OTT 1 
HETATM 8483 O O1  . PE4 L 6 .   ? 12.41360  9.13633   -13.20138 1.000 63.18567  ? 610 PE4 A O1  1 
HETATM 8484 C C1  . PE4 L 6 .   ? 13.70379  8.71239   -13.47664 1.000 74.14606  ? 610 PE4 A C1  1 
HETATM 8485 C C2  . PE4 L 6 .   ? 14.07120  7.49801   -12.67212 1.000 88.46334  ? 610 PE4 A C2  1 
HETATM 8486 O O2  . PE4 L 6 .   ? 15.39681  7.56344   -12.25083 1.000 87.62044  ? 610 PE4 A O2  1 
HETATM 8487 C C3  . PE4 L 6 .   ? 16.06717  6.44383   -11.77940 1.000 77.37032  ? 610 PE4 A C3  1 
HETATM 8488 C C4  . PE4 L 6 .   ? 17.46143  6.80124   -11.36337 1.000 74.28102  ? 610 PE4 A C4  1 
HETATM 8489 O O3  . PE4 L 6 .   ? 18.11587  5.69113   -10.86381 1.000 74.41220  ? 610 PE4 A O3  1 
HETATM 8490 C C5  . PE4 L 6 .   ? 19.48183  5.70870   -10.67762 1.000 73.34259  ? 610 PE4 A C5  1 
HETATM 8491 C C6  . PE4 L 6 .   ? 20.06139  4.43497   -11.19863 1.000 73.99886  ? 610 PE4 A C6  1 
HETATM 8492 O O4  . PE4 L 6 .   ? 21.27566  4.64731   -11.82358 1.000 73.49280  ? 610 PE4 A O4  1 
HETATM 8493 C C7  . PE4 L 6 .   ? 21.40529  5.60231   -12.81551 1.000 65.25798  ? 610 PE4 A C7  1 
HETATM 8494 C C8  . PE4 L 6 .   ? 22.73963  5.41189   -13.46552 1.000 55.75741  ? 610 PE4 A C8  1 
HETATM 8495 O O5  . PE4 L 6 .   ? 23.37072  6.61409   -13.71948 1.000 49.23789  ? 610 PE4 A O5  1 
HETATM 8496 C C9  . PE4 L 6 .   ? 22.67618  7.80101   -13.61572 1.000 52.52808  ? 610 PE4 A C9  1 
HETATM 8497 C C10 . PE4 L 6 .   ? 23.23065  8.77375   -14.59934 1.000 58.99710  ? 610 PE4 A C10 1 
HETATM 8498 O O6  . PE4 L 6 .   ? 22.47542  9.92820   -14.54833 1.000 75.57751  ? 610 PE4 A O6  1 
HETATM 8499 C C11 . PE4 L 6 .   ? 21.47818  10.18209  -15.47710 1.000 83.40814  ? 610 PE4 A C11 1 
HETATM 8500 C C12 . PE4 L 6 .   ? 20.44884  11.11182  -14.90777 1.000 88.18661  ? 610 PE4 A C12 1 
HETATM 8501 O O7  . PE4 L 6 .   ? 19.19299  10.52586  -14.81839 1.000 87.82032  ? 610 PE4 A O7  1 
HETATM 8502 C C13 . PE4 L 6 .   ? 18.67379  10.15876  -13.58962 1.000 89.33794  ? 610 PE4 A C13 1 
HETATM 8503 C C14 . PE4 L 6 .   ? 17.38083  10.87414  -13.34219 1.000 92.90584  ? 610 PE4 A C14 1 
HETATM 8504 O O8  . PE4 L 6 .   ? 16.97707  10.75227  -12.02070 1.000 94.14445  ? 610 PE4 A O8  1 
HETATM 8505 C C15 . PE4 L 6 .   ? 15.84640  11.41364  -11.56922 1.000 92.14348  ? 610 PE4 A C15 1 
HETATM 8506 N N12 . N2K M 3 .   ? 7.89457   -4.11658  -38.14471 1.000 57.44746  ? 601 N2K B N12 1 
HETATM 8507 C C13 . N2K M 3 .   ? 6.51623   -4.45992  -37.82802 1.000 50.67720  ? 601 N2K B C13 1 
HETATM 8508 C C14 . N2K M 3 .   ? 5.48311   -3.49372  -38.37455 1.000 47.08295  ? 601 N2K B C14 1 
HETATM 8509 C C17 . N2K M 3 .   ? 3.86124   -2.56998  -36.25307 1.000 41.76314  ? 601 N2K B C17 1 
HETATM 8510 C C18 . N2K M 3 .   ? 6.03365   -1.22199  -39.10660 1.000 47.87934  ? 601 N2K B C18 1 
HETATM 8511 C C19 . N2K M 3 .   ? 4.89520   -0.58268  -39.85404 1.000 42.93601  ? 601 N2K B C19 1 
HETATM 8512 O O20 . N2K M 3 .   ? 8.19414   -2.27932  -36.46939 1.000 72.27939  ? 601 N2K B O20 1 
HETATM 8513 C C02 . N2K M 3 .   ? 11.14200  -9.76645  -37.69368 1.000 72.95870  ? 601 N2K B C02 1 
HETATM 8514 C C05 . N2K M 3 .   ? 10.56714  -8.46620  -37.08132 1.000 67.12305  ? 601 N2K B C05 1 
HETATM 8515 C C06 . N2K M 3 .   ? 11.40990  -7.43027  -36.59833 1.000 56.64630  ? 601 N2K B C06 1 
HETATM 8516 C C07 . N2K M 3 .   ? 10.83285  -6.25299  -36.09019 1.000 52.20384  ? 601 N2K B C07 1 
HETATM 8517 C C08 . N2K M 3 .   ? 9.41690   -6.10787  -36.05201 1.000 54.77335  ? 601 N2K B C08 1 
HETATM 8518 C C09 . N2K M 3 .   ? 8.76632   -4.81176  -35.54530 1.000 61.06903  ? 601 N2K B C09 1 
HETATM 8519 C C16 . N2K M 3 .   ? 4.58224   -1.61482  -37.21251 1.000 46.68668  ? 601 N2K B C16 1 
HETATM 8520 C C21 . N2K M 3 .   ? 8.57455   -7.14052  -36.54373 1.000 61.43694  ? 601 N2K B C21 1 
HETATM 8521 C C22 . N2K M 3 .   ? 9.14228   -8.30987  -37.05220 1.000 68.19004  ? 601 N2K B C22 1 
HETATM 8522 F F01 . N2K M 3 .   ? 11.11812  -10.79401 -36.85279 1.000 78.71040  ? 601 N2K B F01 1 
HETATM 8523 F F03 . N2K M 3 .   ? 10.39703  -10.05245 -38.76423 1.000 73.68613  ? 601 N2K B F03 1 
HETATM 8524 F F04 . N2K M 3 .   ? 12.38678  -9.56627  -38.09001 1.000 73.78686  ? 601 N2K B F04 1 
HETATM 8525 N N15 . N2K M 3 .   ? 5.67530   -2.10732  -37.95509 1.000 48.91326  ? 601 N2K B N15 1 
HETATM 8526 O O11 . N2K M 3 .   ? 10.09821  -3.22004  -37.22920 1.000 70.66108  ? 601 N2K B O11 1 
HETATM 8527 S S10 . N2K M 3 .   ? 8.70992   -3.56179  -36.85132 1.000 68.52039  ? 601 N2K B S10 1 
HETATM 8528 C C1  . EDO N 4 .   ? -20.32010 7.73712   -23.12827 1.000 76.89516  ? 602 EDO B C1  1 
HETATM 8529 O O1  . EDO N 4 .   ? -21.59782 8.08836   -22.64990 1.000 75.71441  ? 602 EDO B O1  1 
HETATM 8530 C C2  . EDO N 4 .   ? -20.37704 6.21908   -23.50247 1.000 77.56170  ? 602 EDO B C2  1 
HETATM 8531 O O2  . EDO N 4 .   ? -19.06517 5.73225   -23.47752 1.000 76.24357  ? 602 EDO B O2  1 
HETATM 8532 C C1  . EDO O 4 .   ? -7.52052  19.14252  -47.58726 1.000 65.89108  ? 603 EDO B C1  1 
HETATM 8533 O O1  . EDO O 4 .   ? -6.15979  19.07655  -47.21451 1.000 63.57699  ? 603 EDO B O1  1 
HETATM 8534 C C2  . EDO O 4 .   ? -7.85121  20.62100  -47.97553 1.000 67.15862  ? 603 EDO B C2  1 
HETATM 8535 O O2  . EDO O 4 .   ? -9.22521  20.79850  -47.78973 1.000 66.14092  ? 603 EDO B O2  1 
HETATM 8536 C C1  . EDO P 4 .   ? 14.80096  -12.93852 -37.31659 1.000 71.68817  ? 604 EDO B C1  1 
HETATM 8537 O O1  . EDO P 4 .   ? 14.22638  -13.93960 -38.11100 1.000 68.54272  ? 604 EDO B O1  1 
HETATM 8538 C C2  . EDO P 4 .   ? 14.46716  -13.29531 -35.83390 1.000 72.06848  ? 604 EDO B C2  1 
HETATM 8539 O O2  . EDO P 4 .   ? 14.68933  -12.14119 -35.07318 1.000 66.71722  ? 604 EDO B O2  1 
HETATM 8540 C C5  . PG0 Q 5 .   ? -2.35179  -3.09270  -18.02503 1.000 72.30304  ? 605 PG0 B C5  1 
HETATM 8541 O O2  . PG0 Q 5 .   ? -1.49467  -2.51671  -18.95335 1.000 75.93072  ? 605 PG0 B O2  1 
HETATM 8542 C C4  . PG0 Q 5 .   ? -0.18724  -2.27460  -18.59622 1.000 68.88948  ? 605 PG0 B C4  1 
HETATM 8543 C C3  . PG0 Q 5 .   ? 0.55442   -1.56268  -19.67006 1.000 62.73042  ? 605 PG0 B C3  1 
HETATM 8544 O O1  . PG0 Q 5 .   ? 1.65523   -1.00555  -19.05799 1.000 72.03717  ? 605 PG0 B O1  1 
HETATM 8545 C C2  . PG0 Q 5 .   ? 2.52998   -0.22590  -19.77760 1.000 77.20216  ? 605 PG0 B C2  1 
HETATM 8546 C C1  . PG0 Q 5 .   ? 2.57894   1.16071   -19.22419 1.000 80.73252  ? 605 PG0 B C1  1 
HETATM 8547 O OTT . PG0 Q 5 .   ? 2.47668   2.08475   -20.25594 1.000 74.95654  ? 605 PG0 B OTT 1 
HETATM 8548 C C5  . PG0 R 5 .   ? 32.44076  14.78129  -42.34684 1.000 75.80231  ? 606 PG0 B C5  1 
HETATM 8549 O O2  . PG0 R 5 .   ? 32.09781  13.43895  -42.39397 1.000 82.59185  ? 606 PG0 B O2  1 
HETATM 8550 C C4  . PG0 R 5 .   ? 31.42903  12.93107  -43.49955 1.000 81.52107  ? 606 PG0 B C4  1 
HETATM 8551 C C3  . PG0 R 5 .   ? 31.44310  11.43130  -43.52205 1.000 78.14601  ? 606 PG0 B C3  1 
HETATM 8552 O O1  . PG0 R 5 .   ? 31.19630  10.97088  -44.80602 1.000 76.16447  ? 606 PG0 B O1  1 
HETATM 8553 C C2  . PG0 R 5 .   ? 31.81417  9.83735   -45.30039 1.000 69.70918  ? 606 PG0 B C2  1 
HETATM 8554 C C1  . PG0 R 5 .   ? 32.19850  10.10115  -46.71843 1.000 67.45285  ? 606 PG0 B C1  1 
HETATM 8555 O OTT . PG0 R 5 .   ? 33.52866  9.78074   -46.92114 1.000 68.52573  ? 606 PG0 B OTT 1 
HETATM 8556 O OH2 . ETE S 7 .   ? 9.32017   8.94086   -11.45266 1.000 91.37609  ? 607 ETE B OH2 1 
HETATM 8557 C C12 . ETE S 7 .   ? 9.64024   7.69809   -11.00890 1.000 92.00415  ? 607 ETE B C12 1 
HETATM 8558 C C22 . ETE S 7 .   ? 8.61116   7.17841   -10.03285 1.000 88.04639  ? 607 ETE B C22 1 
HETATM 8559 O OH3 . ETE S 7 .   ? 8.64848   5.79017   -10.01127 1.000 85.45452  ? 607 ETE B OH3 1 
HETATM 8560 C C13 . ETE S 7 .   ? 10.21289  4.08196   -10.58501 1.000 77.12144  ? 607 ETE B C13 1 
HETATM 8561 C C23 . ETE S 7 .   ? 9.78689   5.14490   -9.60191  1.000 80.72943  ? 607 ETE B C23 1 
HETATM 8562 O OH4 . ETE S 7 .   ? 11.27281  4.59744   -11.40436 1.000 76.20700  ? 607 ETE B OH4 1 
HETATM 8563 C C14 . ETE S 7 .   ? 11.58563  4.60691   -13.71873 1.000 88.16911  ? 607 ETE B C14 1 
HETATM 8564 C C24 . ETE S 7 .   ? 11.77470  3.85824   -12.46862 1.000 77.12008  ? 607 ETE B C24 1 
HETATM 8565 O OH5 . ETE S 7 .   ? 11.45757  3.65664   -14.83769 1.000 98.57529  ? 607 ETE B OH5 1 
HETATM 8566 C C15 . ETE S 7 .   ? 9.85183   2.20244   -15.93709 1.000 90.99103  ? 607 ETE B C15 1 
HETATM 8567 C C25 . ETE S 7 .   ? 10.32580  3.64919   -15.68988 1.000 93.89452  ? 607 ETE B C25 1 
HETATM 8568 O OH6 . ETE S 7 .   ? 8.57134   2.16629   -16.31699 1.000 86.89782  ? 607 ETE B OH6 1 
HETATM 8569 C C26 . ETE S 7 .   ? 7.73371   1.14649   -15.86460 1.000 86.65056  ? 607 ETE B C26 1 
HETATM 8570 O O   . HOH T 8 .   ? 21.54528  15.56141  12.50973  1.000 40.14231  ? 701 HOH A O   1 
HETATM 8571 O O   . HOH T 8 .   ? 18.57955  11.86583  13.16575  1.000 41.12136  ? 702 HOH A O   1 
HETATM 8572 O O   . HOH T 8 .   ? 33.60982  4.26389   5.79541   1.000 55.29751  ? 703 HOH A O   1 
HETATM 8573 O O   . HOH T 8 .   ? 19.16988  19.95791  18.03399  1.000 41.10747  ? 704 HOH A O   1 
HETATM 8574 O O   . HOH T 8 .   ? 23.92591  9.03441   48.18116  1.000 35.73651  ? 705 HOH A O   1 
HETATM 8575 O O   . HOH T 8 .   ? 25.95382  15.37126  17.93551  1.000 43.78825  ? 706 HOH A O   1 
HETATM 8576 O O   . HOH T 8 .   ? 15.18098  2.21216   1.14489   1.000 32.63867  ? 707 HOH A O   1 
HETATM 8577 O O   . HOH T 8 .   ? 30.18213  16.53579  0.86076   1.000 38.57337  ? 708 HOH A O   1 
HETATM 8578 O O   . HOH T 8 .   ? 39.74523  20.17486  16.04189  1.000 37.52363  ? 709 HOH A O   1 
HETATM 8579 O O   . HOH T 8 .   ? 28.86599  17.80782  19.85378  1.000 37.80450  ? 710 HOH A O   1 
HETATM 8580 O O   . HOH T 8 .   ? 27.40122  -1.10220  37.34880  1.000 39.07503  ? 711 HOH A O   1 
HETATM 8581 O O   . HOH T 8 .   ? 32.44108  17.19772  32.51338  1.000 54.21614  ? 712 HOH A O   1 
HETATM 8582 O O   . HOH T 8 .   ? 35.38760  27.99251  11.37030  1.000 53.67613  ? 713 HOH A O   1 
HETATM 8583 O O   . HOH T 8 .   ? 8.09147   11.87536  27.94303  1.000 44.35261  ? 714 HOH A O   1 
HETATM 8584 O O   . HOH T 8 .   ? 29.39783  12.28202  24.61164  1.000 37.33427  ? 715 HOH A O   1 
HETATM 8585 O O   . HOH T 8 .   ? 46.28681  14.43608  24.02316  1.000 45.38239  ? 716 HOH A O   1 
HETATM 8586 O O   . HOH T 8 .   ? 21.98973  20.35851  7.17787   1.000 25.06691  ? 717 HOH A O   1 
HETATM 8587 O O   . HOH T 8 .   ? 28.40395  -0.47231  29.60207  1.000 41.89597  ? 718 HOH A O   1 
HETATM 8588 O O   . HOH T 8 .   ? 3.06940   6.47218   18.19527  1.000 47.91848  ? 719 HOH A O   1 
HETATM 8589 O O   . HOH T 8 .   ? 37.89202  8.49568   47.29528  1.000 54.14347  ? 720 HOH A O   1 
HETATM 8590 O O   . HOH T 8 .   ? 18.45762  15.26173  4.01287   1.000 30.76425  ? 721 HOH A O   1 
HETATM 8591 O O   . HOH T 8 .   ? 34.35686  17.90190  38.81518  1.000 59.49259  ? 722 HOH A O   1 
HETATM 8592 O O   . HOH T 8 .   ? 43.25999  9.73163   11.10464  1.000 47.12611  ? 723 HOH A O   1 
HETATM 8593 O O   . HOH T 8 .   ? 29.43602  20.58683  19.05090  1.000 33.83268  ? 724 HOH A O   1 
HETATM 8594 O O   . HOH T 8 .   ? 63.86785  3.72677   16.63045  1.000 54.80615  ? 725 HOH A O   1 
HETATM 8595 O O   . HOH T 8 .   ? 18.85009  -5.74591  28.39846  1.000 36.94883  ? 726 HOH A O   1 
HETATM 8596 O O   . HOH T 8 .   ? 35.20711  17.28036  24.21900  1.000 35.10067  ? 727 HOH A O   1 
HETATM 8597 O O   . HOH T 8 .   ? 9.77571   25.66335  25.66472  1.000 53.58338  ? 728 HOH A O   1 
HETATM 8598 O O   . HOH T 8 .   ? 40.32704  -2.46253  23.80043  1.000 40.02545  ? 729 HOH A O   1 
HETATM 8599 O O   . HOH T 8 .   ? 14.30934  21.47085  14.08010  1.000 35.20063  ? 730 HOH A O   1 
HETATM 8600 O O   . HOH T 8 .   ? 36.46967  12.77387  6.80004   1.000 45.01133  ? 731 HOH A O   1 
HETATM 8601 O O   . HOH T 8 .   ? 27.59111  32.16366  -11.53126 1.000 42.12271  ? 732 HOH A O   1 
HETATM 8602 O O   . HOH T 8 .   ? 46.94693  7.78589   17.84883  1.000 46.70662  ? 733 HOH A O   1 
HETATM 8603 O O   . HOH T 8 .   ? 43.23831  15.78836  24.74032  1.000 37.79837  ? 734 HOH A O   1 
HETATM 8604 O O   . HOH T 8 .   ? 36.40082  1.53277   36.85635  1.000 44.94130  ? 735 HOH A O   1 
HETATM 8605 O O   . HOH T 8 .   ? 11.11440  18.41233  33.89239  1.000 40.08517  ? 736 HOH A O   1 
HETATM 8606 O O   . HOH T 8 .   ? 46.42186  10.45689  10.72312  1.000 32.65614  ? 737 HOH A O   1 
HETATM 8607 O O   . HOH T 8 .   ? 50.57599  17.08920  25.82147  1.000 36.11346  ? 738 HOH A O   1 
HETATM 8608 O O   . HOH T 8 .   ? 52.33955  16.04117  24.16995  1.000 33.41502  ? 739 HOH A O   1 
HETATM 8609 O O   . HOH T 8 .   ? 30.81921  20.89291  16.53802  1.000 54.18217  ? 740 HOH A O   1 
HETATM 8610 O O   . HOH T 8 .   ? 31.80267  16.77323  29.32415  1.000 29.81295  ? 741 HOH A O   1 
HETATM 8611 O O   . HOH T 8 .   ? 38.93662  15.70048  12.59418  1.000 43.27719  ? 742 HOH A O   1 
HETATM 8612 O O   . HOH T 8 .   ? 30.58791  8.29808   6.31920   1.000 41.25349  ? 743 HOH A O   1 
HETATM 8613 O O   . HOH T 8 .   ? 19.27174  15.09974  1.64086   1.000 37.30645  ? 744 HOH A O   1 
HETATM 8614 O O   . HOH T 8 .   ? 35.04001  16.15612  -7.73854  1.000 47.77441  ? 745 HOH A O   1 
HETATM 8615 O O   . HOH T 8 .   ? 45.55147  7.96231   29.41818  1.000 44.83493  ? 746 HOH A O   1 
HETATM 8616 O O   . HOH T 8 .   ? 29.01399  2.49710   45.86346  1.000 36.97841  ? 747 HOH A O   1 
HETATM 8617 O O   . HOH T 8 .   ? 33.15734  14.50733  16.88377  1.000 28.93478  ? 748 HOH A O   1 
HETATM 8618 O O   . HOH T 8 .   ? 36.61684  -6.35776  15.72813  1.000 55.52296  ? 749 HOH A O   1 
HETATM 8619 O O   . HOH T 8 .   ? 10.75052  26.98091  -7.93401  1.000 45.35167  ? 750 HOH A O   1 
HETATM 8620 O O   . HOH T 8 .   ? 17.51148  21.99666  -12.10900 1.000 48.10730  ? 751 HOH A O   1 
HETATM 8621 O O   . HOH T 8 .   ? 15.28509  31.22164  3.00301   1.000 48.85422  ? 752 HOH A O   1 
HETATM 8622 O O   . HOH T 8 .   ? 17.00353  25.74949  17.83416  1.000 31.39130  ? 753 HOH A O   1 
HETATM 8623 O O   . HOH T 8 .   ? 41.34580  16.71374  22.00504  1.000 43.84352  ? 754 HOH A O   1 
HETATM 8624 O O   . HOH T 8 .   ? 24.81017  22.03899  30.10512  1.000 38.49372  ? 755 HOH A O   1 
HETATM 8625 O O   . HOH T 8 .   ? 44.23660  11.52820  9.10703   1.000 32.04985  ? 756 HOH A O   1 
HETATM 8626 O O   . HOH T 8 .   ? 19.82158  17.85439  2.38950   1.000 28.81920  ? 757 HOH A O   1 
HETATM 8627 O O   . HOH T 8 .   ? 43.28725  18.78934  16.28722  1.000 51.24551  ? 758 HOH A O   1 
HETATM 8628 O O   . HOH T 8 .   ? 13.93116  7.79549   -4.68629  1.000 36.55015  ? 759 HOH A O   1 
HETATM 8629 O O   . HOH T 8 .   ? 33.13500  18.98196  28.82914  1.000 33.73701  ? 760 HOH A O   1 
HETATM 8630 O O   . HOH T 8 .   ? 36.51108  23.83369  33.75636  1.000 48.06530  ? 761 HOH A O   1 
HETATM 8631 O O   . HOH T 8 .   ? 21.81555  34.76953  17.15417  1.000 48.66965  ? 762 HOH A O   1 
HETATM 8632 O O   . HOH T 8 .   ? 46.77910  8.19368   27.10380  1.000 53.16992  ? 763 HOH A O   1 
HETATM 8633 O O   . HOH T 8 .   ? 12.08960  28.83118  12.17804  1.000 44.55253  ? 764 HOH A O   1 
HETATM 8634 O O   . HOH T 8 .   ? 40.80324  12.68914  33.08702  1.000 54.98012  ? 765 HOH A O   1 
HETATM 8635 O O   . HOH T 8 .   ? 5.44152   5.33637   0.72608   1.000 49.56089  ? 766 HOH A O   1 
HETATM 8636 O O   . HOH T 8 .   ? 32.75606  20.93554  6.15462   1.000 42.10315  ? 767 HOH A O   1 
HETATM 8637 O O   . HOH T 8 .   ? 31.63472  26.49973  -12.70809 1.000 23.84171  ? 768 HOH A O   1 
HETATM 8638 O O   . HOH T 8 .   ? 37.50121  10.60731  4.33408   1.000 26.70857  ? 769 HOH A O   1 
HETATM 8639 O O   . HOH T 8 .   ? 39.86949  28.09150  16.53857  1.000 37.10426  ? 770 HOH A O   1 
HETATM 8640 O O   . HOH T 8 .   ? 24.228    19.404    61.769    1.000 43.59696  ? 771 HOH A O   1 
HETATM 8641 O O   . HOH T 8 .   ? 42.83287  6.47898   -0.00982  1.000 23.91857  ? 772 HOH A O   1 
HETATM 8642 O O   . HOH T 8 .   ? 5.80094   20.29090  11.63081  1.000 43.15585  ? 773 HOH A O   1 
HETATM 8643 O O   . HOH T 8 .   ? 51.22459  7.66868   3.06542   1.000 30.29875  ? 774 HOH A O   1 
HETATM 8644 O O   . HOH T 8 .   ? 39.88005  14.90578  45.83910  1.000 39.02615  ? 775 HOH A O   1 
HETATM 8645 O O   . HOH T 8 .   ? 11.56089  28.17786  1.92301   1.000 42.72008  ? 776 HOH A O   1 
HETATM 8646 O O   . HOH T 8 .   ? 32.86115  -2.76559  -8.58043  1.000 51.25454  ? 777 HOH A O   1 
HETATM 8647 O O   . HOH T 8 .   ? 42.83307  0.39493   5.24799   1.000 40.50604  ? 778 HOH A O   1 
HETATM 8648 O O   . HOH T 8 .   ? 45.16526  11.52599  -1.45675  1.000 30.60535  ? 779 HOH A O   1 
HETATM 8649 O O   . HOH T 8 .   ? 19.60790  23.84691  38.39482  1.000 27.81190  ? 780 HOH A O   1 
HETATM 8650 O O   . HOH T 8 .   ? 47.39758  9.16574   -0.50077  1.000 52.63594  ? 781 HOH A O   1 
HETATM 8651 O O   . HOH T 8 .   ? 43.69995  1.09687   18.40868  1.000 33.15497  ? 782 HOH A O   1 
HETATM 8652 O O   . HOH T 8 .   ? 11.12718  25.16701  37.33092  1.000 50.56756  ? 783 HOH A O   1 
HETATM 8653 O O   . HOH T 8 .   ? 13.34111  30.72404  1.26374   1.000 42.84403  ? 784 HOH A O   1 
HETATM 8654 O O   . HOH T 8 .   ? 49.39988  5.79368   27.70188  1.000 48.58141  ? 785 HOH A O   1 
HETATM 8655 O O   . HOH T 8 .   ? 14.92173  26.97311  -16.40800 1.000 52.67545  ? 786 HOH A O   1 
HETATM 8656 O O   . HOH T 8 .   ? 8.39991   11.43932  37.70329  1.000 45.97713  ? 787 HOH A O   1 
HETATM 8657 O O   . HOH T 8 .   ? 64.34835  5.95071   17.55453  1.000 59.35373  ? 788 HOH A O   1 
HETATM 8658 O O   . HOH T 8 .   ? 39.57452  23.36832  35.59713  1.000 38.79094  ? 789 HOH A O   1 
HETATM 8659 O O   . HOH T 8 .   ? 6.38468   25.14436  26.73037  1.000 37.70810  ? 790 HOH A O   1 
HETATM 8660 O O   . HOH T 8 .   ? 47.93366  -3.80072  13.22766  1.000 57.97552  ? 791 HOH A O   1 
HETATM 8661 O O   . HOH T 8 .   ? 56.56745  14.73741  25.61603  1.000 39.06305  ? 792 HOH A O   1 
HETATM 8662 O O   . HOH T 8 .   ? 37.37057  2.52524   34.29620  1.000 46.41966  ? 793 HOH A O   1 
HETATM 8663 O O   . HOH T 8 .   ? 9.05528   8.63716   36.80837  1.000 52.52252  ? 794 HOH A O   1 
HETATM 8664 O O   . HOH T 8 .   ? 19.61108  18.45971  52.03061  1.000 32.75628  ? 795 HOH A O   1 
HETATM 8665 O O   . HOH T 8 .   ? 7.99081   37.70308  22.35928  1.000 49.79674  ? 796 HOH A O   1 
HETATM 8666 O O   . HOH T 8 .   ? 5.73402   8.10328   0.98429   1.000 50.15679  ? 797 HOH A O   1 
HETATM 8667 O O   . HOH T 8 .   ? 39.71360  15.17564  39.16413  1.000 30.93399  ? 798 HOH A O   1 
HETATM 8668 O O   . HOH U 8 .   ? 13.57441  -7.85260  -46.74055 1.000 62.86172  ? 701 HOH B O   1 
HETATM 8669 O O   . HOH U 8 .   ? 2.96977   8.09668   -33.46366 1.000 46.12099  ? 702 HOH B O   1 
HETATM 8670 O O   . HOH U 8 .   ? 3.79154   -3.71723  -20.77126 1.000 56.46089  ? 703 HOH B O   1 
HETATM 8671 O O   . HOH U 8 .   ? 4.27589   5.08965   -48.70085 1.000 44.61535  ? 704 HOH B O   1 
HETATM 8672 O O   . HOH U 8 .   ? -6.96269  13.37119  -26.65233 1.000 38.35761  ? 705 HOH B O   1 
HETATM 8673 O O   . HOH U 8 .   ? 16.45544  -2.12126  -28.98277 1.000 37.29710  ? 706 HOH B O   1 
HETATM 8674 O O   . HOH U 8 .   ? 11.06636  17.59639  -23.21867 1.000 38.24510  ? 707 HOH B O   1 
HETATM 8675 O O   . HOH U 8 .   ? -0.08596  7.85425   -73.15912 1.000 37.11379  ? 708 HOH B O   1 
HETATM 8676 O O   . HOH U 8 .   ? 3.99410   2.34145   -41.34057 1.000 35.20248  ? 709 HOH B O   1 
HETATM 8677 O O   . HOH U 8 .   ? 15.67851  -4.58572  -57.37230 1.000 43.40056  ? 710 HOH B O   1 
HETATM 8678 O O   . HOH U 8 .   ? 17.74645  -2.65814  -56.27300 1.000 51.10619  ? 711 HOH B O   1 
HETATM 8679 O O   . HOH U 8 .   ? 1.87137   -1.40214  -53.14669 1.000 31.74976  ? 712 HOH B O   1 
HETATM 8680 O O   . HOH U 8 .   ? 38.91158  -5.14742  -61.19022 1.000 53.38441  ? 713 HOH B O   1 
HETATM 8681 O O   . HOH U 8 .   ? 20.86316  7.17608   -36.82178 1.000 55.10282  ? 714 HOH B O   1 
HETATM 8682 O O   . HOH U 8 .   ? 0.14743   20.24587  -47.21009 1.000 42.70718  ? 715 HOH B O   1 
HETATM 8683 O O   . HOH U 8 .   ? 4.42659   -3.34072  -43.14066 1.000 43.88743  ? 716 HOH B O   1 
HETATM 8684 O O   . HOH U 8 .   ? 1.87713   7.94127   -21.01222 1.000 35.59261  ? 717 HOH B O   1 
HETATM 8685 O O   . HOH U 8 .   ? -1.33175  4.09078   -48.93375 1.000 52.42971  ? 718 HOH B O   1 
HETATM 8686 O O   . HOH U 8 .   ? 3.77863   4.26995   -34.21357 1.000 35.11270  ? 719 HOH B O   1 
HETATM 8687 O O   . HOH U 8 .   ? 13.65112  -6.39719  -33.77604 1.000 44.38227  ? 720 HOH B O   1 
HETATM 8688 O O   . HOH U 8 .   ? 19.25362  -0.80762  -37.49149 1.000 38.71643  ? 721 HOH B O   1 
HETATM 8689 O O   . HOH U 8 .   ? 3.57622   20.35870  -28.63206 1.000 47.92935  ? 722 HOH B O   1 
HETATM 8690 O O   . HOH U 8 .   ? 12.02500  26.64796  -28.21083 1.000 48.46315  ? 723 HOH B O   1 
HETATM 8691 O O   . HOH U 8 .   ? 22.55030  0.96152   -52.93854 1.000 58.80900  ? 724 HOH B O   1 
HETATM 8692 O O   . HOH U 8 .   ? 10.59144  0.34433   -44.07560 1.000 27.90164  ? 725 HOH B O   1 
HETATM 8693 O O   . HOH U 8 .   ? -4.07188  0.96586   -49.07268 1.000 52.08792  ? 726 HOH B O   1 
HETATM 8694 O O   . HOH U 8 .   ? -9.94746  22.14653  -51.97408 1.000 46.99538  ? 727 HOH B O   1 
HETATM 8695 O O   . HOH U 8 .   ? 8.33205   25.17929  -31.88827 1.000 39.08424  ? 728 HOH B O   1 
HETATM 8696 O O   . HOH U 8 .   ? 12.57948  15.23717  -22.82559 1.000 24.62673  ? 729 HOH B O   1 
HETATM 8697 O O   . HOH U 8 .   ? 22.20534  2.50746   -48.11738 1.000 46.52660  ? 730 HOH B O   1 
HETATM 8698 O O   . HOH U 8 .   ? 13.44895  6.85575   -33.58567 1.000 39.90111  ? 731 HOH B O   1 
HETATM 8699 O O   . HOH U 8 .   ? 5.39105   -8.49937  -37.72624 1.000 53.36023  ? 732 HOH B O   1 
HETATM 8700 O O   . HOH U 8 .   ? -5.16658  -6.75847  -47.58916 1.000 39.28962  ? 733 HOH B O   1 
HETATM 8701 O O   . HOH U 8 .   ? -5.90909  9.69717   -17.76555 1.000 38.71342  ? 734 HOH B O   1 
HETATM 8702 O O   . HOH U 8 .   ? 6.61777   12.83312  -19.14755 1.000 53.11973  ? 735 HOH B O   1 
HETATM 8703 O O   . HOH U 8 .   ? 16.96558  -4.20521  -43.50823 1.000 49.53712  ? 736 HOH B O   1 
HETATM 8704 O O   . HOH U 8 .   ? -2.71117  -0.33366  -61.75611 1.000 39.46767  ? 737 HOH B O   1 
HETATM 8705 O O   . HOH U 8 .   ? -3.12950  1.24004   -22.56250 1.000 45.61342  ? 738 HOH B O   1 
HETATM 8706 O O   . HOH U 8 .   ? 24.23136  -8.35177  -27.48565 1.000 43.53434  ? 739 HOH B O   1 
HETATM 8707 O O   . HOH U 8 .   ? 3.18537   -11.63643 -50.88392 1.000 42.63433  ? 740 HOH B O   1 
HETATM 8708 O O   . HOH U 8 .   ? 13.13020  -3.99248  -55.90502 1.000 43.78591  ? 741 HOH B O   1 
HETATM 8709 O O   . HOH U 8 .   ? 5.23760   8.98111   -64.67316 1.000 28.92385  ? 742 HOH B O   1 
HETATM 8710 O O   . HOH U 8 .   ? 8.51121   0.22171   -61.85104 1.000 46.85552  ? 743 HOH B O   1 
HETATM 8711 O O   . HOH U 8 .   ? 6.32354   0.10330   -64.94501 1.000 38.16484  ? 744 HOH B O   1 
HETATM 8712 O O   . HOH U 8 .   ? 3.00393   28.76613  -43.29036 1.000 50.67464  ? 745 HOH B O   1 
HETATM 8713 O O   . HOH U 8 .   ? 31.49186  -3.15133  -36.54036 1.000 38.27214  ? 746 HOH B O   1 
HETATM 8714 O O   . HOH U 8 .   ? 9.88662   -6.26051  -64.25595 1.000 27.08057  ? 747 HOH B O   1 
HETATM 8715 O O   . HOH U 8 .   ? -3.96872  21.66800  -20.82238 1.000 32.14795  ? 748 HOH B O   1 
HETATM 8716 O O   . HOH U 8 .   ? 23.20551  1.10572   -32.43935 1.000 22.64074  ? 749 HOH B O   1 
HETATM 8717 O O   . HOH U 8 .   ? 7.17188   4.31784   -24.98357 1.000 41.82976  ? 750 HOH B O   1 
HETATM 8718 O O   . HOH U 8 .   ? -2.08150  27.35096  -30.01263 1.000 48.17997  ? 751 HOH B O   1 
HETATM 8719 O O   . HOH U 8 .   ? 10.90090  -14.36992 -46.13783 1.000 37.67336  ? 752 HOH B O   1 
HETATM 8720 O O   . HOH U 8 .   ? 9.26913   -0.74392  -12.79006 1.000 43.94981  ? 753 HOH B O   1 
HETATM 8721 O O   . HOH U 8 .   ? 15.47080  16.36538  -21.41638 1.000 33.18875  ? 754 HOH B O   1 
HETATM 8722 O O   . HOH U 8 .   ? 11.59664  28.73219  -25.63773 1.000 30.63395  ? 755 HOH B O   1 
HETATM 8723 O O   . HOH U 8 .   ? 23.27699  -4.19328  -34.37171 1.000 42.50787  ? 756 HOH B O   1 
HETATM 8724 O O   . HOH U 8 .   ? 24.18512  -1.67510  -31.88260 1.000 32.03187  ? 757 HOH B O   1 
HETATM 8725 O O   . HOH U 8 .   ? -8.57918  6.50332   -24.03221 1.000 49.98537  ? 758 HOH B O   1 
HETATM 8726 O O   . HOH U 8 .   ? 22.12201  5.97952   -30.35037 1.000 32.48574  ? 759 HOH B O   1 
HETATM 8727 O O   . HOH U 8 .   ? -14.59322 1.58680   -46.75513 1.000 27.85889  ? 760 HOH B O   1 
HETATM 8728 O O   . HOH U 8 .   ? 24.30241  6.41583   -35.29188 1.000 40.68345  ? 761 HOH B O   1 
HETATM 8729 O O   . HOH U 8 .   ? 30.49264  1.30287   -36.64139 1.000 40.78865  ? 762 HOH B O   1 
HETATM 8730 O O   . HOH U 8 .   ? -2.96938  -5.66547  -45.44404 1.000 47.58824  ? 763 HOH B O   1 
HETATM 8731 O O   . HOH U 8 .   ? -1.89684  -11.08451 -45.59491 1.000 39.86503  ? 764 HOH B O   1 
HETATM 8732 O O   . HOH U 8 .   ? 16.05098  -16.11117 -40.69640 1.000 45.56738  ? 765 HOH B O   1 
HETATM 8733 O O   . HOH U 8 .   ? 1.46130   28.08576  -44.72985 1.000 46.25728  ? 766 HOH B O   1 
HETATM 8734 O O   . HOH U 8 .   ? -9.97768  -0.74123  -44.92677 1.000 37.05064  ? 767 HOH B O   1 
HETATM 8735 O O   . HOH U 8 .   ? 28.31919  1.89360   -62.86746 1.000 41.90815  ? 768 HOH B O   1 
HETATM 8736 O O   . HOH U 8 .   ? -10.53413 -2.26244  -48.29507 1.000 49.33124  ? 769 HOH B O   1 
HETATM 8737 O O   . HOH U 8 .   ? -4.31393  -11.96499 -25.48964 1.000 45.02606  ? 770 HOH B O   1 
HETATM 8738 O O   . HOH U 8 .   ? 21.70193  17.30285  -26.40858 1.000 34.76557  ? 771 HOH B O   1 
HETATM 8739 O O   . HOH U 8 .   ? -5.21987  -8.37522  -42.59697 1.000 37.60344  ? 772 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLU A 1   ? 1.22803 1.14929 0.59720 0.15719  -0.07066 -0.06768 1   GLU A N   
2    C CA  . GLU A 1   ? 1.26757 1.15893 0.65781 0.14976  -0.05881 -0.07370 1   GLU A CA  
3    C C   . GLU A 1   ? 1.34424 1.22527 0.70733 0.16492  -0.05000 -0.09478 1   GLU A C   
4    O O   . GLU A 1   ? 1.43262 1.28341 0.80272 0.15929  -0.05403 -0.11721 1   GLU A O   
5    C CB  . GLU A 1   ? 1.12782 1.02396 0.55261 0.14631  -0.03195 -0.03852 1   GLU A CB  
6    C CG  . GLU A 1   ? 1.12355 1.02954 0.56830 0.13918  -0.03355 -0.01185 1   GLU A CG  
7    C CD  . GLU A 1   ? 1.13878 1.04042 0.61060 0.13400  -0.00649 0.02016  1   GLU A CD  
8    O OE1 . GLU A 1   ? 0.93836 0.84978 0.39336 0.14566  0.01634  0.03593  1   GLU A OE1 
9    O OE2 . GLU A 1   ? 1.20064 1.08960 0.71007 0.11708  -0.00815 0.02880  1   GLU A OE2 
10   N N   . GLY A 2   ? 1.27978 1.18642 0.61826 0.18429  -0.03621 -0.08449 2   GLY A N   
11   C CA  . GLY A 2   ? 1.32024 1.22439 0.63427 0.20143  -0.02781 -0.10236 2   GLY A CA  
12   C C   . GLY A 2   ? 1.35495 1.24841 0.67841 0.21123  -0.00508 -0.10053 2   GLY A C   
13   O O   . GLY A 2   ? 0.97797 0.89736 0.30451 0.22341  0.02108  -0.07445 2   GLY A O   
14   N N   . ARG A 3   ? 1.32344 1.18094 0.65454 0.20514  -0.01435 -0.12635 3   ARG A N   
15   C CA  . ARG A 3   ? 1.28341 1.13135 0.61663 0.22127  0.00446  -0.13112 3   ARG A CA  
16   C C   . ARG A 3   ? 1.21127 1.03843 0.57655 0.20947  0.00737  -0.12834 3   ARG A C   
17   O O   . ARG A 3   ? 1.23692 1.04302 0.60585 0.21936  0.01323  -0.14128 3   ARG A O   
18   C CB  . ARG A 3   ? 1.37943 1.19892 0.68580 0.23267  -0.00513 -0.16429 3   ARG A CB  
19   C CG  . ARG A 3   ? 1.49298 1.32884 0.76351 0.24130  -0.01318 -0.17340 3   ARG A CG  
20   C CD  . ARG A 3   ? 1.53900 1.35334 0.80242 0.21800  -0.04494 -0.19848 3   ARG A CD  
21   N NE  . ARG A 3   ? 1.62298 1.46600 0.85636 0.22277  -0.05374 -0.20052 3   ARG A NE  
22   C CZ  . ARG A 3   ? 1.59685 1.44111 0.79181 0.24140  -0.05144 -0.21721 3   ARG A CZ  
23   N NH1 . ARG A 3   ? 1.56643 1.43998 0.73491 0.24451  -0.06071 -0.21736 3   ARG A NH1 
24   N NH2 . ARG A 3   ? 1.53558 1.35284 0.71705 0.25905  -0.03965 -0.23295 3   ARG A NH2 
25   N N   . GLU A 4   ? 1.18261 1.01880 0.58495 0.18581  0.00379  -0.10787 4   GLU A N   
26   C CA  . GLU A 4   ? 1.11645 0.94465 0.57237 0.16731  0.00707  -0.09886 4   GLU A CA  
27   C C   . GLU A 4   ? 1.05369 0.91775 0.53545 0.17274  0.03547  -0.07133 4   GLU A C   
28   O O   . GLU A 4   ? 1.02791 0.92291 0.49058 0.18697  0.05318  -0.05524 4   GLU A O   
29   C CB  . GLU A 4   ? 1.16939 0.99421 0.66059 0.13810  -0.00888 -0.08914 4   GLU A CB  
30   C CG  . GLU A 4   ? 1.28049 1.09302 0.74909 0.13066  -0.03506 -0.10604 4   GLU A CG  
31   C CD  . GLU A 4   ? 1.38337 1.19319 0.89306 0.10406  -0.04956 -0.09816 4   GLU A CD  
32   O OE1 . GLU A 4   ? 1.44235 1.26818 0.94755 0.09891  -0.06083 -0.09063 4   GLU A OE1 
33   O OE2 . GLU A 4   ? 1.37913 1.17454 0.92488 0.09119  -0.04836 -0.09775 4   GLU A OE2 
34   N N   . ASP A 5   ? 1.01301 0.87657 0.53952 0.15978  0.03948  -0.06488 5   ASP A N   
35   C CA  . ASP A 5   ? 0.89308 0.79624 0.45381 0.15550  0.06237  -0.03823 5   ASP A CA  
36   C C   . ASP A 5   ? 0.85893 0.77456 0.43817 0.13294  0.06430  -0.01452 5   ASP A C   
37   O O   . ASP A 5   ? 0.85622 0.75148 0.45497 0.11255  0.04842  -0.01598 5   ASP A O   
38   C CB  . ASP A 5   ? 0.90984 0.81210 0.51155 0.14716  0.06261  -0.03912 5   ASP A CB  
39   C CG  . ASP A 5   ? 0.93865 0.89027 0.57740 0.14058  0.08433  -0.01386 5   ASP A CG  
40   O OD1 . ASP A 5   ? 0.87244 0.83497 0.54368 0.13693  0.08577  -0.01280 5   ASP A OD1 
41   O OD2 . ASP A 5   ? 0.90468 0.88621 0.54086 0.13761  0.09968  0.00599  5   ASP A OD2 
42   N N   . PRO A 6   ? 0.87926 0.82535 0.45066 0.13723  0.08422  0.00839  6   PRO A N   
43   C CA  . PRO A 6   ? 0.90300 0.85036 0.48814 0.11702  0.08788  0.03228  6   PRO A CA  
44   C C   . PRO A 6   ? 0.94472 0.89779 0.57999 0.08911  0.09380  0.04632  6   PRO A C   
45   O O   . PRO A 6   ? 0.99725 0.94431 0.64281 0.07193  0.09906  0.06557  6   PRO A O   
46   C CB  . PRO A 6   ? 0.84936 0.82604 0.40769 0.13178  0.11020  0.05363  6   PRO A CB  
47   C CG  . PRO A 6   ? 0.79021 0.79604 0.34406 0.15159  0.12437  0.04738  6   PRO A CG  
48   C CD  . PRO A 6   ? 0.80563 0.78271 0.34855 0.16357  0.10460  0.01373  6   PRO A CD  
49   N N   . GLN A 7   ? 0.94735 0.91085 0.61169 0.08482  0.09357  0.03777  7   GLN A N   
50   C CA  . GLN A 7   ? 0.97411 0.94316 0.68314 0.05705  0.09468  0.04703  7   GLN A CA  
51   C C   . GLN A 7   ? 0.88182 0.81941 0.60585 0.04626  0.07269  0.03096  7   GLN A C   
52   O O   . GLN A 7   ? 0.87752 0.81737 0.63470 0.02505  0.07119  0.03518  7   GLN A O   
53   C CB  . GLN A 7   ? 1.03913 1.05255 0.77581 0.05702  0.10940  0.05293  7   GLN A CB  
54   C CG  . GLN A 7   ? 1.13578 1.18490 0.89211 0.03820  0.13066  0.07914  7   GLN A CG  
55   C CD  . GLN A 7   ? 1.18601 1.22206 0.97491 0.00226  0.12659  0.08636  7   GLN A CD  
56   O OE1 . GLN A 7   ? 1.23344 1.25406 1.04070 -0.00681 0.11096  0.07257  7   GLN A OE1 
57   N NE2 . GLN A 7   ? 1.21944 1.25912 1.01324 -0.01807 0.14154  0.10814  7   GLN A NE2 
58   N N   . LEU A 8   ? 0.90594 0.81624 0.60563 0.05880  0.05556  0.01288  8   LEU A N   
59   C CA  . LEU A 8   ? 0.78526 0.67001 0.49938 0.04873  0.03550  -0.00076 8   LEU A CA  
60   C C   . LEU A 8   ? 0.83006 0.69391 0.53216 0.04280  0.02173  -0.00058 8   LEU A C   
61   O O   . LEU A 8   ? 0.83584 0.68331 0.54831 0.03527  0.00472  -0.01107 8   LEU A O   
62   C CB  . LEU A 8   ? 0.67078 0.54066 0.37258 0.06386  0.02555  -0.02208 8   LEU A CB  
63   C CG  . LEU A 8   ? 0.73280 0.62450 0.45031 0.07361  0.03860  -0.02072 8   LEU A CG  
64   C CD1 . LEU A 8   ? 0.79983 0.66832 0.49462 0.09551  0.03300  -0.04067 8   LEU A CD1 
65   C CD2 . LEU A 8   ? 0.71529 0.61883 0.47556 0.05402  0.03720  -0.01303 8   LEU A CD2 
66   N N   . LEU A 9   ? 0.77210 0.63958 0.45325 0.04734  0.02936  0.01338  9   LEU A N   
67   C CA  . LEU A 9   ? 0.69066 0.54448 0.36068 0.04596  0.01786  0.01750  9   LEU A CA  
68   C C   . LEU A 9   ? 0.71807 0.56568 0.40478 0.03258  0.02925  0.03885  9   LEU A C   
69   O O   . LEU A 9   ? 0.60622 0.46063 0.28932 0.03092  0.04849  0.05637  9   LEU A O   
70   C CB  . LEU A 9   ? 0.68918 0.54857 0.31650 0.06556  0.01577  0.01712  9   LEU A CB  
71   C CG  . LEU A 9   ? 0.84476 0.70497 0.44893 0.07954  0.00814  -0.00642 9   LEU A CG  
72   C CD1 . LEU A 9   ? 0.70938 0.58064 0.26496 0.10133  0.00956  -0.00682 9   LEU A CD1 
73   C CD2 . LEU A 9   ? 0.72578 0.56752 0.34064 0.07053  -0.01546 -0.02907 9   LEU A CD2 
74   N N   . VAL A 10  ? 0.68442 0.51755 0.38844 0.02282  0.01824  0.03742  10  VAL A N   
75   C CA  . VAL A 10  ? 0.67695 0.49415 0.39474 0.01077  0.02747  0.05275  10  VAL A CA  
76   C C   . VAL A 10  ? 0.69771 0.50225 0.40928 0.01767  0.01493  0.05492  10  VAL A C   
77   O O   . VAL A 10  ? 0.68371 0.49610 0.40142 0.01972  -0.00318 0.04100  10  VAL A O   
78   C CB  . VAL A 10  ? 0.70471 0.52274 0.45706 -0.00888 0.02957  0.04649  10  VAL A CB  
79   C CG1 . VAL A 10  ? 0.72845 0.52252 0.49072 -0.02201 0.03604  0.05645  10  VAL A CG1 
80   C CG2 . VAL A 10  ? 0.66874 0.50971 0.43063 -0.01424 0.04263  0.04730  10  VAL A CG2 
81   N N   . ARG A 11  ? 0.66871 0.45420 0.36858 0.02163  0.02536  0.07388  11  ARG A N   
82   C CA  . ARG A 11  ? 0.61865 0.39355 0.31442 0.03178  0.01669  0.07917  11  ARG A CA  
83   C C   . ARG A 11  ? 0.71510 0.46565 0.43233 0.01893  0.02135  0.07919  11  ARG A C   
84   O O   . ARG A 11  ? 0.75766 0.48623 0.47970 0.00472  0.03702  0.08562  11  ARG A O   
85   C CB  . ARG A 11  ? 0.64473 0.40974 0.30875 0.05115  0.02540  0.10150  11  ARG A CB  
86   C CG  . ARG A 11  ? 0.65483 0.41517 0.31333 0.06804  0.01693  0.10942  11  ARG A CG  
87   C CD  . ARG A 11  ? 0.87410 0.64045 0.49783 0.09416  0.01945  0.12991  11  ARG A CD  
88   N NE  . ARG A 11  ? 0.92636 0.73462 0.53570 0.10390  0.00199  0.11918  11  ARG A NE  
89   C CZ  . ARG A 11  ? 0.95542 0.79480 0.55923 0.11859  -0.01730 0.11657  11  ARG A CZ  
90   N NH1 . ARG A 11  ? 1.00380 0.87815 0.59246 0.12275  -0.03410 0.10318  11  ARG A NH1 
91   N NH2 . ARG A 11  ? 0.95501 0.79268 0.56774 0.12933  -0.02006 0.12655  11  ARG A NH2 
92   N N   . VAL A 12  ? 0.67369 0.43045 0.40305 0.02310  0.00754  0.07150  12  VAL A N   
93   C CA  . VAL A 12  ? 0.70199 0.43574 0.44357 0.01839  0.01152  0.07175  12  VAL A CA  
94   C C   . VAL A 12  ? 0.72723 0.45786 0.45569 0.04161  0.00749  0.08279  12  VAL A C   
95   O O   . VAL A 12  ? 0.85011 0.60274 0.56371 0.05837  -0.00038 0.08967  12  VAL A O   
96   C CB  . VAL A 12  ? 0.56540 0.31561 0.33621 0.00379  0.00149  0.05391  12  VAL A CB  
97   C CG1 . VAL A 12  ? 0.51246 0.26755 0.29561 -0.01514 0.00734  0.04620  12  VAL A CG1 
98   C CG2 . VAL A 12  ? 0.58700 0.37092 0.36600 0.01002  -0.01731 0.04577  12  VAL A CG2 
99   N N   . ARG A 13  ? 0.67045 0.37736 0.40312 0.04457  0.01239  0.08381  13  ARG A N   
100  C CA  . ARG A 13  ? 0.71708 0.41862 0.43514 0.07182  0.01254  0.09728  13  ARG A CA  
101  C C   . ARG A 13  ? 0.68526 0.44114 0.41302 0.08487  -0.00716 0.09550  13  ARG A C   
102  O O   . ARG A 13  ? 0.62230 0.39123 0.33592 0.11041  -0.00954 0.11003  13  ARG A O   
103  C CB  . ARG A 13  ? 0.72301 0.39080 0.44368 0.07379  0.02074  0.09398  13  ARG A CB  
104  C CG  . ARG A 13  ? 0.77999 0.44629 0.48700 0.10688  0.02167  0.10742  13  ARG A CG  
105  C CD  . ARG A 13  ? 0.80610 0.42022 0.47938 0.12438  0.03942  0.12774  13  ARG A CD  
106  N NE  . ARG A 13  ? 0.88118 0.49252 0.53805 0.16250  0.04217  0.14354  13  ARG A NE  
107  C CZ  . ARG A 13  ? 0.91802 0.58668 0.57833 0.18613  0.02887  0.15323  13  ARG A CZ  
108  N NH1 . ARG A 13  ? 0.70759 0.43442 0.38481 0.17300  0.01085  0.14619  13  ARG A NH1 
109  N NH2 . ARG A 13  ? 0.96677 0.63454 0.61236 0.22363  0.03354  0.16969  13  ARG A NH2 
110  N N   . GLY A 14  ? 0.59331 0.38195 0.34481 0.06730  -0.02138 0.07906  14  GLY A N   
111  C CA  . GLY A 14  ? 0.60927 0.44714 0.37420 0.07207  -0.04069 0.07569  14  GLY A CA  
112  C C   . GLY A 14  ? 0.80073 0.66339 0.55401 0.07085  -0.05273 0.07242  14  GLY A C   
113  O O   . GLY A 14  ? 0.87552 0.77963 0.63344 0.07603  -0.06974 0.07164  14  GLY A O   
114  N N   . GLY A 15  ? 0.78234 0.62377 0.52030 0.06351  -0.04455 0.06962  15  GLY A N   
115  C CA  . GLY A 15  ? 0.77911 0.64032 0.49958 0.06495  -0.05435 0.06419  15  GLY A CA  
116  C C   . GLY A 15  ? 0.79366 0.63683 0.51030 0.05092  -0.04605 0.05403  15  GLY A C   
117  O O   . GLY A 15  ? 0.93768 0.75522 0.66261 0.04152  -0.03075 0.05626  15  GLY A O   
118  N N   . GLN A 16  ? 0.73499 0.59462 0.43814 0.05027  -0.05692 0.04200  16  GLN A N   
119  C CA  . GLN A 16  ? 0.81569 0.66420 0.50998 0.04393  -0.04895 0.03269  16  GLN A CA  
120  C C   . GLN A 16  ? 0.75420 0.60050 0.47276 0.02679  -0.05651 0.01364  16  GLN A C   
121  O O   . GLN A 16  ? 0.86798 0.72605 0.60083 0.01938  -0.07355 0.00345  16  GLN A O   
122  C CB  . GLN A 16  ? 0.90527 0.76866 0.56462 0.05693  -0.05541 0.02818  16  GLN A CB  
123  C CG  . GLN A 16  ? 0.95309 0.81045 0.58340 0.07237  -0.03658 0.04779  16  GLN A CG  
124  C CD  . GLN A 16  ? 1.06834 0.94889 0.66095 0.09076  -0.04621 0.04762  16  GLN A CD  
125  O OE1 . GLN A 16  ? 1.03338 0.93747 0.62266 0.09561  -0.06618 0.04286  16  GLN A OE1 
126  N NE2 . GLN A 16  ? 1.16687 1.04699 0.73075 0.10126  -0.03233 0.05328  16  GLN A NE2 
127  N N   . LEU A 17  ? 0.60903 0.44280 0.33287 0.02072  -0.04312 0.01094  17  LEU A N   
128  C CA  . LEU A 17  ? 0.63543 0.46603 0.37870 0.00940  -0.04790 -0.00414 17  LEU A CA  
129  C C   . LEU A 17  ? 0.70011 0.52791 0.42561 0.01589  -0.04127 -0.01301 17  LEU A C   
130  O O   . LEU A 17  ? 0.81394 0.64461 0.52485 0.02351  -0.02561 -0.00311 17  LEU A O   
131  C CB  . LEU A 17  ? 0.57746 0.40291 0.35046 -0.00236 -0.03849 0.00110  17  LEU A CB  
132  C CG  . LEU A 17  ? 0.56060 0.38426 0.34653 -0.00494 -0.03864 0.01115  17  LEU A CG  
133  C CD1 . LEU A 17  ? 0.53330 0.34611 0.33180 -0.01362 -0.02325 0.01761  17  LEU A CD1 
134  C CD2 . LEU A 17  ? 0.52729 0.36173 0.33335 -0.01097 -0.05412 0.00446  17  LEU A CD2 
135  N N   . ARG A 18  ? 0.65737 0.47820 0.38369 0.01357  -0.05169 -0.03047 18  ARG A N   
136  C CA  . ARG A 18  ? 0.72873 0.54312 0.44063 0.02294  -0.04382 -0.04021 18  ARG A CA  
137  C C   . ARG A 18  ? 0.79724 0.60618 0.53731 0.01592  -0.04022 -0.04256 18  ARG A C   
138  O O   . ARG A 18  ? 0.83188 0.62787 0.58373 0.00782  -0.05292 -0.05155 18  ARG A O   
139  C CB  . ARG A 18  ? 0.74209 0.54440 0.42232 0.03069  -0.05778 -0.06033 18  ARG A CB  
140  C CG  . ARG A 18  ? 0.72386 0.51581 0.38230 0.04658  -0.04767 -0.07151 18  ARG A CG  
141  C CD  . ARG A 18  ? 0.80645 0.57061 0.44055 0.04834  -0.06428 -0.09716 18  ARG A CD  
142  N NE  . ARG A 18  ? 1.01582 0.78740 0.61771 0.05153  -0.07714 -0.10521 18  ARG A NE  
143  C CZ  . ARG A 18  ? 0.96825 0.74033 0.57225 0.03629  -0.09929 -0.11357 18  ARG A CZ  
144  N NH1 . ARG A 18  ? 0.84137 0.62921 0.41450 0.04172  -0.11097 -0.11983 18  ARG A NH1 
145  N NH2 . ARG A 18  ? 0.86908 0.63145 0.50633 0.01601  -0.10959 -0.11437 18  ARG A NH2 
146  N N   . GLY A 19  ? 0.77793 0.60011 0.52888 0.01867  -0.02290 -0.03303 19  GLY A N   
147  C CA  . GLY A 19  ? 0.76511 0.59123 0.54023 0.01630  -0.01841 -0.03345 19  GLY A CA  
148  C C   . GLY A 19  ? 0.82991 0.64834 0.58929 0.03400  -0.01426 -0.04422 19  GLY A C   
149  O O   . GLY A 19  ? 0.82505 0.62660 0.55233 0.04632  -0.01845 -0.05686 19  GLY A O   
150  N N   . ILE A 20  ? 0.79974 0.63231 0.57995 0.03739  -0.00551 -0.03934 20  ILE A N   
151  C CA  . ILE A 20  ? 0.75067 0.57272 0.52047 0.05741  -0.00141 -0.04768 20  ILE A CA  
152  C C   . ILE A 20  ? 0.72186 0.58589 0.50675 0.06779  0.01695  -0.03540 20  ILE A C   
153  O O   . ILE A 20  ? 0.70433 0.60074 0.51795 0.05234  0.02182  -0.02232 20  ILE A O   
154  C CB  . ILE A 20  ? 0.76674 0.56327 0.55099 0.05201  -0.01269 -0.05196 20  ILE A CB  
155  C CG1 . ILE A 20  ? 0.57895 0.34499 0.34360 0.07437  -0.01045 -0.06270 20  ILE A CG1 
156  C CG2 . ILE A 20  ? 0.70107 0.52803 0.52261 0.04077  -0.00931 -0.03733 20  ILE A CG2 
157  C CD1 . ILE A 20  ? 0.76591 0.48287 0.50124 0.07282  -0.02409 -0.08152 20  ILE A CD1 
158  N N   . ARG A 21  ? 0.71114 0.57637 0.47626 0.09410  0.02699  -0.04043 21  ARG A N   
159  C CA  . ARG A 21  ? 0.65155 0.56657 0.43130 0.10761  0.04540  -0.02772 21  ARG A CA  
160  C C   . ARG A 21  ? 0.72982 0.64435 0.52091 0.12541  0.04672  -0.02775 21  ARG A C   
161  O O   . ARG A 21  ? 0.82678 0.71462 0.59112 0.15377  0.05035  -0.03788 21  ARG A O   
162  C CB  . ARG A 21  ? 0.62172 0.54831 0.37022 0.12987  0.05927  -0.02965 21  ARG A CB  
163  C CG  . ARG A 21  ? 0.65566 0.64511 0.42141 0.14325  0.08030  -0.01360 21  ARG A CG  
164  C CD  . ARG A 21  ? 0.74952 0.74603 0.47903 0.17950  0.09551  -0.01862 21  ARG A CD  
165  N NE  . ARG A 21  ? 0.87426 0.91187 0.61858 0.20589  0.10981  -0.01069 21  ARG A NE  
166  C CZ  . ARG A 21  ? 1.07725 1.16414 0.81484 0.23155  0.13071  -0.00146 21  ARG A CZ  
167  N NH1 . ARG A 21  ? 0.97909 1.10796 0.73354 0.25746  0.14252  0.00703  21  ARG A NH1 
168  N NH2 . ARG A 21  ? 1.20747 1.30650 0.92142 0.23368  0.14074  0.00141  21  ARG A NH2 
169  N N   . LEU A 22  ? 0.68311 0.62562 0.51078 0.11068  0.04417  -0.01640 22  LEU A N   
170  C CA  . LEU A 22  ? 0.67425 0.61970 0.51535 0.12621  0.04401  -0.01231 22  LEU A CA  
171  C C   . LEU A 22  ? 0.69968 0.70777 0.55644 0.14760  0.06036  0.00053  22  LEU A C   
172  O O   . LEU A 22  ? 0.77450 0.83799 0.64986 0.13533  0.06893  0.01039  22  LEU A O   
173  C CB  . LEU A 22  ? 0.52863 0.47995 0.39926 0.10151  0.03240  -0.00590 22  LEU A CB  
174  C CG  . LEU A 22  ? 0.50173 0.40319 0.36529 0.08087  0.01650  -0.01450 22  LEU A CG  
175  C CD1 . LEU A 22  ? 0.44160 0.36733 0.33487 0.05744  0.00990  -0.00612 22  LEU A CD1 
176  C CD2 . LEU A 22  ? 0.58057 0.42728 0.42575 0.09544  0.01031  -0.02227 22  LEU A CD2 
177  N N   . LYS A 23  ? 0.66435 0.66478 0.51511 0.17916  0.06488  0.00207  23  LYS A N   
178  C CA  . LYS A 23  ? 0.70555 0.77303 0.57452 0.20417  0.07956  0.01669  23  LYS A CA  
179  C C   . LYS A 23  ? 0.75819 0.87241 0.66647 0.18993  0.07331  0.03055  23  LYS A C   
180  O O   . LYS A 23  ? 0.85319 0.93229 0.76166 0.19119  0.06359  0.03071  23  LYS A O   
181  C CB  . LYS A 23  ? 0.79453 0.83089 0.63427 0.25168  0.08921  0.01297  23  LYS A CB  
182  C CG  . LYS A 23  ? 0.94472 0.95829 0.74498 0.27435  0.10014  0.00029  23  LYS A CG  
183  C CD  . LYS A 23  ? 1.07766 1.05180 0.84415 0.32450  0.11032  -0.00589 23  LYS A CD  
184  C CE  . LYS A 23  ? 1.15625 1.07020 0.87008 0.33991  0.11286  -0.02883 23  LYS A CE  
185  N NZ  . LYS A 23  ? 1.11255 0.95278 0.80932 0.30622  0.09217  -0.04729 23  LYS A NZ  
186  N N   . ALA A 24  ? 0.65950 0.85330 0.60013 0.17421  0.07847  0.04213  24  ALA A N   
187  C CA  . ALA A 24  ? 0.58675 0.84426 0.56284 0.16966  0.07502  0.05537  24  ALA A CA  
188  C C   . ALA A 24  ? 0.63776 0.96782 0.62616 0.20420  0.09024  0.06946  24  ALA A C   
189  O O   . ALA A 24  ? 0.66966 1.01055 0.64417 0.22359  0.10476  0.06955  24  ALA A O   
190  C CB  . ALA A 24  ? 0.44672 0.74492 0.45174 0.12332  0.06768  0.05633  24  ALA A CB  
191  N N   . PRO A 25  ? 0.63486 1.02032 0.64808 0.21591  0.08791  0.08267  25  PRO A N   
192  C CA  . PRO A 25  ? 0.58794 1.04545 0.61205 0.25679  0.10271  0.09826  25  PRO A CA  
193  C C   . PRO A 25  ? 0.59074 1.12100 0.63083 0.25158  0.11697  0.10423  25  PRO A C   
194  O O   . PRO A 25  ? 0.63639 1.19854 0.66880 0.29383  0.13389  0.11258  25  PRO A O   
195  C CB  . PRO A 25  ? 0.45324 0.97849 0.51073 0.25308  0.09330  0.11182  25  PRO A CB  
196  C CG  . PRO A 25  ? 0.57711 1.02811 0.62198 0.23488  0.07725  0.10322  25  PRO A CG  
197  C CD  . PRO A 25  ? 0.60996 0.98995 0.63646 0.20081  0.07236  0.08488  25  PRO A CD  
198  N N   . GLY A 26  ? 0.44078 0.99671 0.50158 0.20243  0.11216  0.10142  26  GLY A N   
199  C CA  . GLY A 26  ? 0.43568 1.07256 0.51977 0.19094  0.12587  0.11195  26  GLY A CA  
200  C C   . GLY A 26  ? 0.63126 1.22494 0.69476 0.17057  0.13307  0.10449  26  GLY A C   
201  O O   . GLY A 26  ? 0.58147 1.23601 0.66592 0.14982  0.14388  0.11469  26  GLY A O   
202  N N   . GLY A 27  ? 0.58491 1.07704 0.60790 0.17575  0.12723  0.08835  27  GLY A N   
203  C CA  . GLY A 27  ? 0.57258 1.01989 0.57077 0.16074  0.13218  0.08123  27  GLY A CA  
204  C C   . GLY A 27  ? 0.61996 0.96657 0.58757 0.14912  0.11655  0.06314  27  GLY A C   
205  O O   . GLY A 27  ? 0.64689 0.95952 0.61613 0.14723  0.10209  0.05696  27  GLY A O   
206  N N   . PRO A 28  ? 0.60098 0.90357 0.54047 0.14214  0.11958  0.05612  28  PRO A N   
207  C CA  . PRO A 28  ? 0.57815 0.79573 0.49157 0.12879  0.10408  0.04021  28  PRO A CA  
208  C C   . PRO A 28  ? 0.55718 0.77008 0.49146 0.08343  0.09334  0.04152  28  PRO A C   
209  O O   . PRO A 28  ? 0.63860 0.90071 0.59871 0.05782  0.09974  0.05271  28  PRO A O   
210  C CB  . PRO A 28  ? 0.60892 0.79535 0.48294 0.14367  0.11281  0.03399  28  PRO A CB  
211  C CG  . PRO A 28  ? 0.55551 0.81503 0.44597 0.14236  0.13232  0.05137  28  PRO A CG  
212  C CD  . PRO A 28  ? 0.51146 0.84368 0.43834 0.15260  0.13836  0.06362  28  PRO A CD  
213  N N   . VAL A 29  ? 0.52573 0.67605 0.44701 0.07367  0.07729  0.02957  29  VAL A N   
214  C CA  . VAL A 29  ? 0.50493 0.63704 0.43702 0.03735  0.06710  0.02818  29  VAL A CA  
215  C C   . VAL A 29  ? 0.54475 0.61017 0.44525 0.03697  0.05866  0.01740  29  VAL A C   
216  O O   . VAL A 29  ? 0.60550 0.63478 0.48001 0.05988  0.05520  0.00766  29  VAL A O   
217  C CB  . VAL A 29  ? 0.47025 0.61043 0.42658 0.02438  0.05444  0.02689  29  VAL A CB  
218  C CG1 . VAL A 29  ? 0.38308 0.59669 0.37389 0.01125  0.05969  0.03708  29  VAL A CG1 
219  C CG2 . VAL A 29  ? 0.49699 0.61014 0.44303 0.05119  0.04772  0.02186  29  VAL A CG2 
220  N N   . SER A 30  ? 0.57264 0.62204 0.47472 0.01059  0.05510  0.01891  30  SER A N   
221  C CA  . SER A 30  ? 0.62093 0.61682 0.49850 0.00799  0.04520  0.01101  30  SER A CA  
222  C C   . SER A 30  ? 0.58895 0.56246 0.47868 -0.00437 0.02978  0.00509  30  SER A C   
223  O O   . SER A 30  ? 0.65882 0.65236 0.57212 -0.02236 0.02851  0.00875  30  SER A O   
224  C CB  . SER A 30  ? 0.69744 0.68804 0.56641 -0.00765 0.05247  0.01938  30  SER A CB  
225  O OG  . SER A 30  ? 0.72923 0.73737 0.58119 0.00594  0.06717  0.02640  30  SER A OG  
226  N N   . ALA A 31  ? 0.53535 0.47044 0.40887 0.00444  0.01810  -0.00436 31  ALA A N   
227  C CA  . ALA A 31  ? 0.55480 0.47208 0.43951 -0.00683 0.00487  -0.00743 31  ALA A CA  
228  C C   . ALA A 31  ? 0.70093 0.58337 0.56701 -0.00990 -0.00503 -0.01288 31  ALA A C   
229  O O   . ALA A 31  ? 0.79982 0.66378 0.64176 0.00187  -0.00712 -0.01958 31  ALA A O   
230  C CB  . ALA A 31  ? 0.50241 0.41583 0.39453 0.00474  -0.00060 -0.01004 31  ALA A CB  
231  N N   . PHE A 32  ? 0.59395 0.47101 0.46993 -0.02431 -0.01123 -0.01052 32  PHE A N   
232  C CA  . PHE A 32  ? 0.60543 0.45969 0.46949 -0.02630 -0.02174 -0.01333 32  PHE A CA  
233  C C   . PHE A 32  ? 0.64939 0.50165 0.53106 -0.03318 -0.03209 -0.01388 32  PHE A C   
234  O O   . PHE A 32  ? 0.62349 0.48440 0.51841 -0.04194 -0.03117 -0.00958 32  PHE A O   
235  C CB  . PHE A 32  ? 0.54980 0.40072 0.40517 -0.03171 -0.01638 -0.00647 32  PHE A CB  
236  C CG  . PHE A 32  ? 0.65363 0.50939 0.49254 -0.02598 -0.00402 -0.00182 32  PHE A CG  
237  C CD1 . PHE A 32  ? 0.70613 0.55112 0.51835 -0.01533 -0.00579 -0.00225 32  PHE A CD1 
238  C CD2 . PHE A 32  ? 0.63968 0.51664 0.49015 -0.03169 0.00931  0.00406  32  PHE A CD2 
239  C CE1 . PHE A 32  ? 0.82952 0.68229 0.62473 -0.00810 0.00712  0.00404  32  PHE A CE1 
240  C CE2 . PHE A 32  ? 0.62706 0.51414 0.46469 -0.02712 0.02246  0.01127  32  PHE A CE2 
241  C CZ  . PHE A 32  ? 0.71102 0.58484 0.52007 -0.01431 0.02232  0.01194  32  PHE A CZ  
242  N N   . LEU A 33  ? 0.57056 0.40968 0.45062 -0.02943 -0.04110 -0.01918 33  LEU A N   
243  C CA  . LEU A 33  ? 0.51811 0.35779 0.41622 -0.03581 -0.04868 -0.01641 33  LEU A CA  
244  C C   . LEU A 33  ? 0.62182 0.45315 0.51830 -0.04288 -0.06097 -0.01768 33  LEU A C   
245  O O   . LEU A 33  ? 0.72093 0.53836 0.60013 -0.04139 -0.06780 -0.02514 33  LEU A O   
246  C CB  . LEU A 33  ? 0.53862 0.36752 0.43875 -0.02841 -0.04867 -0.01790 33  LEU A CB  
247  C CG  . LEU A 33  ? 0.48106 0.32510 0.38087 -0.01608 -0.03650 -0.01630 33  LEU A CG  
248  C CD1 . LEU A 33  ? 0.47137 0.29603 0.36526 -0.00196 -0.03574 -0.01810 33  LEU A CD1 
249  C CD2 . LEU A 33  ? 0.38758 0.26672 0.30842 -0.02185 -0.03079 -0.00815 33  LEU A CD2 
250  N N   . GLY A 34  ? 0.49706 0.34227 0.41104 -0.04990 -0.06395 -0.01057 34  GLY A N   
251  C CA  . GLY A 34  ? 0.48207 0.33123 0.40069 -0.05651 -0.07506 -0.00879 34  GLY A CA  
252  C C   . GLY A 34  ? 0.48969 0.34738 0.39880 -0.05295 -0.07614 -0.00704 34  GLY A C   
253  O O   . GLY A 34  ? 0.58388 0.44702 0.48977 -0.05545 -0.08700 -0.00816 34  GLY A O   
254  N N   . ILE A 35  ? 0.49579 0.35459 0.39972 -0.04748 -0.06546 -0.00377 35  ILE A N   
255  C CA  . ILE A 35  ? 0.50274 0.36253 0.39471 -0.04053 -0.06393 0.00081  35  ILE A CA  
256  C C   . ILE A 35  ? 0.63912 0.51624 0.54466 -0.03883 -0.06718 0.00785  35  ILE A C   
257  O O   . ILE A 35  ? 0.72500 0.60611 0.64102 -0.03996 -0.06127 0.00965  35  ILE A O   
258  C CB  . ILE A 35  ? 0.46101 0.30727 0.34124 -0.03754 -0.04987 0.00266  35  ILE A CB  
259  C CG1 . ILE A 35  ? 0.47084 0.31023 0.34175 -0.03836 -0.04439 -0.00194 35  ILE A CG1 
260  C CG2 . ILE A 35  ? 0.48319 0.32200 0.34694 -0.02747 -0.04690 0.01005  35  ILE A CG2 
261  C CD1 . ILE A 35  ? 0.46317 0.29437 0.32601 -0.04015 -0.02971 0.00226  35  ILE A CD1 
262  N N   . PRO A 36  ? 0.65779 0.55064 0.56287 -0.03473 -0.07640 0.01198  36  PRO A N   
263  C CA  . PRO A 36  ? 0.69187 0.60912 0.61079 -0.02929 -0.07776 0.02085  36  PRO A CA  
264  C C   . PRO A 36  ? 0.69533 0.59975 0.60021 -0.01383 -0.06551 0.02567  36  PRO A C   
265  O O   . PRO A 36  ? 0.77125 0.65952 0.65555 -0.00423 -0.06146 0.02805  36  PRO A O   
266  C CB  . PRO A 36  ? 0.72958 0.67335 0.65174 -0.02964 -0.09210 0.02393  36  PRO A CB  
267  C CG  . PRO A 36  ? 0.70310 0.62886 0.60107 -0.02739 -0.09475 0.01715  36  PRO A CG  
268  C CD  . PRO A 36  ? 0.69573 0.59132 0.58790 -0.03449 -0.08703 0.00821  36  PRO A CD  
269  N N   . PHE A 37  ? 0.63738 0.54592 0.55054 -0.01064 -0.05896 0.02726  37  PHE A N   
270  C CA  . PHE A 37  ? 0.55608 0.44250 0.45232 0.00333  -0.04681 0.02850  37  PHE A CA  
271  C C   . PHE A 37  ? 0.54294 0.45132 0.44296 0.02136  -0.04530 0.03662  37  PHE A C   
272  O O   . PHE A 37  ? 0.56335 0.44789 0.44383 0.03863  -0.03513 0.03846  37  PHE A O   
273  C CB  . PHE A 37  ? 0.62673 0.49009 0.51989 -0.00693 -0.03804 0.01867  37  PHE A CB  
274  C CG  . PHE A 37  ? 0.64243 0.52842 0.55199 -0.01089 -0.03932 0.01627  37  PHE A CG  
275  C CD1 . PHE A 37  ? 0.66034 0.54702 0.56362 0.00155  -0.03290 0.01551  37  PHE A CD1 
276  C CD2 . PHE A 37  ? 0.63595 0.53969 0.56338 -0.02448 -0.04549 0.01520  37  PHE A CD2 
277  C CE1 . PHE A 37  ? 0.54475 0.45619 0.45996 -0.00011 -0.03326 0.01426  37  PHE A CE1 
278  C CE2 . PHE A 37  ? 0.62653 0.55244 0.56710 -0.02626 -0.04549 0.01635  37  PHE A CE2 
279  C CZ  . PHE A 37  ? 0.51478 0.44772 0.44946 -0.01442 -0.03960 0.01608  37  PHE A CZ  
280  N N   . ALA A 38  ? 0.52353 0.47549 0.44726 0.01856  -0.05400 0.04263  38  ALA A N   
281  C CA  . ALA A 38  ? 0.50705 0.49479 0.43891 0.03691  -0.05320 0.05368  38  ALA A CA  
282  C C   . ALA A 38  ? 0.49766 0.53375 0.45183 0.03009  -0.06779 0.06300  38  ALA A C   
283  O O   . ALA A 38  ? 0.50283 0.53990 0.46685 0.00820  -0.07854 0.05826  38  ALA A O   
284  C CB  . ALA A 38  ? 0.55417 0.55804 0.49674 0.03837  -0.04702 0.05343  38  ALA A CB  
285  N N   . GLU A 39  ? 0.41693 0.49408 0.37845 0.04913  -0.06829 0.07574  39  GLU A N   
286  C CA  . GLU A 39  ? 0.45937 0.59575 0.44972 0.03790  -0.08289 0.08532  39  GLU A CA  
287  C C   . GLU A 39  ? 0.57633 0.73500 0.59508 0.01557  -0.08514 0.08727  39  GLU A C   
288  O O   . GLU A 39  ? 0.49637 0.64970 0.51484 0.02251  -0.07341 0.08795  39  GLU A O   
289  C CB  . GLU A 39  ? 0.50509 0.69235 0.50113 0.06534  -0.08166 0.10123  39  GLU A CB  
290  C CG  . GLU A 39  ? 0.67528 0.85577 0.64846 0.08538  -0.08444 0.10467  39  GLU A CG  
291  C CD  . GLU A 39  ? 0.67418 0.87774 0.65504 0.06417  -0.10441 0.10166  39  GLU A CD  
292  O OE1 . GLU A 39  ? 0.65857 0.92390 0.66970 0.04960  -0.11854 0.10804  39  GLU A OE1 
293  O OE2 . GLU A 39  ? 0.66823 0.82897 0.62397 0.06107  -0.10587 0.09240  39  GLU A OE2 
294  N N   . PRO A 40  ? 0.59732 0.77683 0.63770 -0.01166 -0.09977 0.08781  40  PRO A N   
295  C CA  . PRO A 40  ? 0.51478 0.71316 0.58256 -0.03365 -0.10107 0.09389  40  PRO A CA  
296  C C   . PRO A 40  ? 0.44863 0.69885 0.53481 -0.01872 -0.09168 0.11070  40  PRO A C   
297  O O   . PRO A 40  ? 0.49924 0.80534 0.60096 -0.00916 -0.09542 0.12324  40  PRO A O   
298  C CB  . PRO A 40  ? 0.44792 0.66878 0.53538 -0.06212 -0.11988 0.09408  40  PRO A CB  
299  C CG  . PRO A 40  ? 0.33223 0.52127 0.39321 -0.05864 -0.12740 0.07989  40  PRO A CG  
300  C CD  . PRO A 40  ? 0.33639 0.51881 0.37365 -0.02411 -0.11585 0.08211  40  PRO A CD  
301  N N   . PRO A 41  ? 0.46180 0.70107 0.54608 -0.01441 -0.07947 0.11196  41  PRO A N   
302  C CA  . PRO A 41  ? 0.44065 0.72991 0.53729 0.00419  -0.06839 0.12725  41  PRO A CA  
303  C C   . PRO A 41  ? 0.41407 0.75906 0.55061 -0.01962 -0.07363 0.14609  41  PRO A C   
304  O O   . PRO A 41  ? 0.48745 0.83816 0.63425 -0.02819 -0.06673 0.15422  41  PRO A O   
305  C CB  . PRO A 41  ? 0.38711 0.63660 0.45984 0.01607  -0.05485 0.11733  41  PRO A CB  
306  C CG  . PRO A 41  ? 0.36884 0.57477 0.43999 -0.01022 -0.06131 0.10750  41  PRO A CG  
307  C CD  . PRO A 41  ? 0.49327 0.68113 0.56390 -0.02443 -0.07500 0.10045  41  PRO A CD  
308  N N   . VAL A 42  ? 0.42392 0.81303 0.58375 -0.03218 -0.08657 0.15432  42  VAL A N   
309  C CA  . VAL A 42  ? 0.38075 0.81742 0.58074 -0.06491 -0.09522 0.17044  42  VAL A CA  
310  C C   . VAL A 42  ? 0.31783 0.84443 0.54619 -0.05345 -0.09547 0.19059  42  VAL A C   
311  O O   . VAL A 42  ? 0.34569 0.89123 0.55978 -0.01960 -0.09147 0.19020  42  VAL A O   
312  C CB  . VAL A 42  ? 0.29900 0.70477 0.50317 -0.10096 -0.11458 0.15846  42  VAL A CB  
313  C CG1 . VAL A 42  ? 0.40158 0.72289 0.57543 -0.10488 -0.11259 0.13905  42  VAL A CG1 
314  C CG2 . VAL A 42  ? 0.30630 0.73282 0.50457 -0.09387 -0.12782 0.15141  42  VAL A CG2 
315  N N   . GLY A 43  ? 0.28747 0.87037 0.55696 -0.08195 -0.09952 0.21007  43  GLY A N   
316  C CA  . GLY A 43  ? 0.29845 0.95732 0.58820 -0.07246 -0.09504 0.22728  43  GLY A CA  
317  C C   . GLY A 43  ? 0.51793 1.20760 0.79460 -0.02444 -0.07452 0.23671  43  GLY A C   
318  O O   . GLY A 43  ? 0.57914 1.26002 0.84964 -0.01136 -0.06038 0.24156  43  GLY A O   
319  N N   . SER A 44  ? 0.53297 1.25502 0.80093 0.00452  -0.07229 0.23776  44  SER A N   
320  C CA  . SER A 44  ? 0.52207 1.27028 0.77269 0.05291  -0.05170 0.24548  44  SER A CA  
321  C C   . SER A 44  ? 0.44952 1.13850 0.66312 0.08745  -0.04317 0.23062  44  SER A C   
322  O O   . SER A 44  ? 0.47301 1.16594 0.66365 0.12964  -0.02509 0.23201  44  SER A O   
323  C CB  . SER A 44  ? 0.56593 1.35540 0.81401 0.07435  -0.05250 0.24982  44  SER A CB  
324  O OG  . SER A 44  ? 0.60525 1.35454 0.83517 0.07806  -0.06635 0.23366  44  SER A OG  
325  N N   . ARG A 45  ? 0.37672 0.99567 0.57472 0.06833  -0.05379 0.21248  45  ARG A N   
326  C CA  . ARG A 45  ? 0.39916 0.93391 0.54985 0.09007  -0.04293 0.19115  45  ARG A CA  
327  C C   . ARG A 45  ? 0.42058 0.92094 0.56507 0.07529  -0.03528 0.18555  45  ARG A C   
328  O O   . ARG A 45  ? 0.31676 0.75379 0.42451 0.08929  -0.02716 0.16718  45  ARG A O   
329  C CB  . ARG A 45  ? 0.35680 0.82487 0.48323 0.08125  -0.05460 0.17168  45  ARG A CB  
330  C CG  . ARG A 45  ? 0.39351 0.86908 0.50294 0.11416  -0.05452 0.17319  45  ARG A CG  
331  C CD  . ARG A 45  ? 0.71656 1.11036 0.79005 0.11295  -0.05860 0.15341  45  ARG A CD  
332  N NE  . ARG A 45  ? 0.80243 1.20821 0.88691 0.09071  -0.07798 0.15250  45  ARG A NE  
333  C CZ  . ARG A 45  ? 0.90522 1.33185 0.98152 0.11094  -0.08363 0.15832  45  ARG A CZ  
334  N NH1 . ARG A 45  ? 0.85465 1.28941 0.91278 0.15565  -0.07013 0.16754  45  ARG A NH1 
335  N NH2 . ARG A 45  ? 1.05510 1.49381 1.13862 0.08850  -0.10268 0.15487  45  ARG A NH2 
336  N N   . ARG A 46  ? 0.47637 0.80126 0.60244 0.08331  -0.06816 0.04614  46  ARG A N   
337  C CA  . ARG A 46  ? 0.44532 0.74135 0.56072 0.07006  -0.05715 0.03918  46  ARG A CA  
338  C C   . ARG A 46  ? 0.33901 0.62622 0.45974 0.08255  -0.04123 0.04032  46  ARG A C   
339  O O   . ARG A 46  ? 0.32559 0.64217 0.46925 0.09450  -0.03690 0.04351  46  ARG A O   
340  C CB  . ARG A 46  ? 0.44892 0.76522 0.57683 0.04795  -0.05943 0.03302  46  ARG A CB  
341  C CG  . ARG A 46  ? 0.36940 0.66084 0.48840 0.03463  -0.04798 0.02855  46  ARG A CG  
342  C CD  . ARG A 46  ? 0.27985 0.59700 0.41699 0.01487  -0.04817 0.02557  46  ARG A CD  
343  N NE  . ARG A 46  ? 0.37372 0.68227 0.50286 -0.00329 -0.05895 0.02049  46  ARG A NE  
344  C CZ  . ARG A 46  ? 0.38840 0.71178 0.53033 -0.02375 -0.06050 0.01711  46  ARG A CZ  
345  N NH1 . ARG A 46  ? 0.28563 0.63788 0.45002 -0.02870 -0.05221 0.01950  46  ARG A NH1 
346  N NH2 . ARG A 46  ? 0.39944 0.70945 0.53237 -0.03947 -0.06976 0.01088  46  ARG A NH2 
347  N N   . PHE A 47  ? 0.32981 0.57789 0.42947 0.07984  -0.03249 0.03683  47  PHE A N   
348  C CA  . PHE A 47  ? 0.41107 0.64167 0.50779 0.08992  -0.01739 0.03519  47  PHE A CA  
349  C C   . PHE A 47  ? 0.40628 0.62367 0.50112 0.11210  -0.01449 0.04055  47  PHE A C   
350  O O   . PHE A 47  ? 0.38003 0.58680 0.47688 0.12292  -0.00151 0.03826  47  PHE A O   
351  C CB  . PHE A 47  ? 0.36744 0.62629 0.48534 0.08986  -0.00676 0.03273  47  PHE A CB  
352  C CG  . PHE A 47  ? 0.32264 0.60099 0.44809 0.06862  -0.00861 0.03005  47  PHE A CG  
353  C CD1 . PHE A 47  ? 0.32499 0.57795 0.43131 0.05199  -0.00699 0.02655  47  PHE A CD1 
354  C CD2 . PHE A 47  ? 0.31770 0.64074 0.47097 0.06553  -0.01125 0.03181  47  PHE A CD2 
355  C CE1 . PHE A 47  ? 0.28183 0.54867 0.39480 0.03278  -0.00766 0.02579  47  PHE A CE1 
356  C CE2 . PHE A 47  ? 0.32566 0.66455 0.48654 0.04419  -0.01170 0.02981  47  PHE A CE2 
357  C CZ  . PHE A 47  ? 0.31137 0.61967 0.45123 0.02790  -0.00954 0.02723  47  PHE A CZ  
358  N N   . MET A 48  ? 0.43174 0.64766 0.52154 0.11927  -0.02533 0.04761  48  MET A N   
359  C CA  . MET A 48  ? 0.38814 0.59315 0.47882 0.14153  -0.02198 0.05545  48  MET A CA  
360  C C   . MET A 48  ? 0.45122 0.61586 0.51581 0.14264  -0.02298 0.05852  48  MET A C   
361  O O   . MET A 48  ? 0.45129 0.60357 0.49887 0.12754  -0.02904 0.05531  48  MET A O   
362  C CB  . MET A 48  ? 0.33817 0.58300 0.44987 0.15468  -0.03234 0.06513  48  MET A CB  
363  C CG  . MET A 48  ? 0.50469 0.78229 0.64444 0.16051  -0.02450 0.06256  48  MET A CG  
364  S SD  . MET A 48  ? 0.70709 1.02422 0.87577 0.18697  -0.02893 0.07480  48  MET A SD  
365  C CE  . MET A 48  ? 0.61048 0.88881 0.77585 0.20997  -0.00988 0.07534  48  MET A CE  
366  N N   . PRO A 49  ? 0.43635 0.57771 0.49770 0.15989  -0.01533 0.06409  49  PRO A N   
367  C CA  . PRO A 49  ? 0.45386 0.55704 0.49172 0.16020  -0.01492 0.06825  49  PRO A CA  
368  C C   . PRO A 49  ? 0.50672 0.62143 0.53563 0.15791  -0.02962 0.07687  49  PRO A C   
369  O O   . PRO A 49  ? 0.53090 0.67902 0.57301 0.16629  -0.03960 0.08452  49  PRO A O   
370  C CB  . PRO A 49  ? 0.44794 0.53096 0.49029 0.18188  -0.00502 0.07527  49  PRO A CB  
371  C CG  . PRO A 49  ? 0.52233 0.62247 0.58559 0.18877  0.00470  0.06808  49  PRO A CG  
372  C CD  . PRO A 49  ? 0.37673 0.52323 0.45628 0.17951  -0.00476 0.06600  49  PRO A CD  
373  N N   . PRO A 50  ? 0.50548 0.59615 0.51216 0.14651  -0.03132 0.07527  50  PRO A N   
374  C CA  . PRO A 50  ? 0.56959 0.67067 0.56447 0.14356  -0.04400 0.08171  50  PRO A CA  
375  C C   . PRO A 50  ? 0.61817 0.71811 0.61069 0.16255  -0.04674 0.09813  50  PRO A C   
376  O O   . PRO A 50  ? 0.56498 0.63491 0.55315 0.17345  -0.03669 0.10447  50  PRO A O   
377  C CB  . PRO A 50  ? 0.59786 0.66961 0.57073 0.12914  -0.04086 0.07570  50  PRO A CB  
378  C CG  . PRO A 50  ? 0.60232 0.64243 0.57349 0.13054  -0.02656 0.07185  50  PRO A CG  
379  C CD  . PRO A 50  ? 0.57884 0.63409 0.57039 0.13615  -0.02139 0.06714  50  PRO A CD  
380  N N   . GLU A 51  ? 0.69267 0.82573 0.68803 0.16622  -0.06066 0.10519  51  GLU A N   
381  C CA  . GLU A 51  ? 0.69510 0.82836 0.68255 0.18291  -0.06566 0.12308  51  GLU A CA  
382  C C   . GLU A 51  ? 0.69324 0.81153 0.65206 0.17331  -0.06982 0.12575  51  GLU A C   
383  O O   . GLU A 51  ? 0.72758 0.85515 0.67801 0.15611  -0.07560 0.11422  51  GLU A O   
384  C CB  . GLU A 51  ? 0.73339 0.91483 0.73833 0.19356  -0.07945 0.13080  51  GLU A CB  
385  C CG  . GLU A 51  ? 0.89309 1.09675 0.92966 0.20400  -0.07511 0.12858  51  GLU A CG  
386  C CD  . GLU A 51  ? 1.05731 1.30613 1.11276 0.22171  -0.08737 0.14191  51  GLU A CD  
387  O OE1 . GLU A 51  ? 1.18182 1.45861 1.22889 0.21684  -0.10319 0.14587  51  GLU A OE1 
388  O OE2 . GLU A 51  ? 1.00200 1.25975 1.08057 0.24097  -0.08126 0.14803  51  GLU A OE2 
389  N N   . PRO A 52  ? 0.75529 0.84838 0.69890 0.18398  -0.06542 0.14055  52  PRO A N   
390  C CA  . PRO A 52  ? 0.69817 0.77938 0.61407 0.17544  -0.06783 0.14445  52  PRO A CA  
391  C C   . PRO A 52  ? 0.58566 0.70529 0.49336 0.17127  -0.08435 0.14475  52  PRO A C   
392  O O   . PRO A 52  ? 0.47146 0.62467 0.39009 0.18263  -0.09549 0.15298  52  PRO A O   
393  C CB  . PRO A 52  ? 0.76665 0.82006 0.67235 0.19136  -0.06089 0.16476  52  PRO A CB  
394  C CG  . PRO A 52  ? 0.86218 0.89509 0.78761 0.20196  -0.04923 0.16382  52  PRO A CG  
395  C CD  . PRO A 52  ? 0.81790 0.88648 0.76866 0.20307  -0.05519 0.15313  52  PRO A CD  
396  N N   . LYS A 53  ? 0.49251 0.60750 0.38061 0.15511  -0.08562 0.13519  53  LYS A N   
397  C CA  . LYS A 53  ? 0.47670 0.62407 0.35476 0.14671  -0.09977 0.12906  53  LYS A CA  
398  C C   . LYS A 53  ? 0.58120 0.74631 0.44316 0.15930  -0.10928 0.14762  53  LYS A C   
399  O O   . LYS A 53  ? 0.70787 0.84886 0.55099 0.16398  -0.10229 0.16054  53  LYS A O   
400  C CB  . LYS A 53  ? 0.48393 0.61585 0.34436 0.12876  -0.09566 0.11422  53  LYS A CB  
401  C CG  . LYS A 53  ? 0.56193 0.71720 0.40267 0.12062  -0.10702 0.10822  53  LYS A CG  
402  C CD  . LYS A 53  ? 0.59758 0.79249 0.45130 0.11652  -0.12225 0.09951  53  LYS A CD  
403  C CE  . LYS A 53  ? 0.53878 0.74270 0.37775 0.09953  -0.12824 0.08081  53  LYS A CE  
404  N NZ  . LYS A 53  ? 0.54903 0.78997 0.40068 0.09232  -0.14289 0.07069  53  LYS A NZ  
405  N N   . ARG A 54  ? 0.48948 0.69253 0.36248 0.15974  -0.12293 0.14598  54  ARG A N   
406  C CA  . ARG A 54  ? 0.61015 0.82625 0.47260 0.16510  -0.13032 0.15798  54  ARG A CA  
407  C C   . ARG A 54  ? 0.60460 0.81590 0.43483 0.15292  -0.13178 0.15351  54  ARG A C   
408  O O   . ARG A 54  ? 0.63171 0.84543 0.45360 0.13832  -0.13281 0.13607  54  ARG A O   
409  C CB  . ARG A 54  ? 0.60296 0.86267 0.48494 0.16560  -0.14486 0.15451  54  ARG A CB  
410  C CG  . ARG A 54  ? 0.62083 0.89107 0.53545 0.18049  -0.14330 0.16158  54  ARG A CG  
411  C CD  . ARG A 54  ? 0.79636 1.11328 0.73025 0.18175  -0.15782 0.16066  54  ARG A CD  
412  N NE  . ARG A 54  ? 1.07565 1.41561 1.04179 0.17984  -0.15843 0.15053  54  ARG A NE  
413  C CZ  . ARG A 54  ? 1.27903 1.60922 1.26782 0.19265  -0.14800 0.15487  54  ARG A CZ  
414  N NH1 . ARG A 54  ? 1.38057 1.67481 1.36424 0.20861  -0.13596 0.16850  54  ARG A NH1 
415  N NH2 . ARG A 54  ? 1.26865 1.62455 1.28562 0.18872  -0.14869 0.14478  54  ARG A NH2 
416  N N   . PRO A 55  ? 0.59203 0.79523 0.40353 0.15904  -0.13084 0.16899  55  PRO A N   
417  C CA  . PRO A 55  ? 0.63106 0.83088 0.41101 0.14814  -0.13061 0.16524  55  PRO A CA  
418  C C   . PRO A 55  ? 0.59461 0.82799 0.36861 0.13555  -0.14433 0.14818  55  PRO A C   
419  O O   . PRO A 55  ? 0.68624 0.94960 0.47729 0.13701  -0.15638 0.14556  55  PRO A O   
420  C CB  . PRO A 55  ? 0.62023 0.81041 0.38589 0.15912  -0.12870 0.18784  55  PRO A CB  
421  C CG  . PRO A 55  ? 0.63704 0.80948 0.42403 0.17479  -0.12230 0.20245  55  PRO A CG  
422  C CD  . PRO A 55  ? 0.59178 0.78360 0.40928 0.17657  -0.12756 0.19103  55  PRO A CD  
423  N N   . TRP A 56  ? 0.58469 0.81239 0.33474 0.12273  -0.14162 0.13569  56  TRP A N   
424  C CA  . TRP A 56  ? 0.64296 0.89506 0.38346 0.10889  -0.15221 0.11622  56  TRP A CA  
425  C C   . TRP A 56  ? 0.81632 1.07165 0.52445 0.10601  -0.15328 0.11961  56  TRP A C   
426  O O   . TRP A 56  ? 0.82307 1.05863 0.51444 0.11202  -0.14360 0.13511  56  TRP A O   
427  C CB  . TRP A 56  ? 0.64656 0.88875 0.38787 0.09574  -0.14749 0.09395  56  TRP A CB  
428  C CG  . TRP A 56  ? 0.74986 0.96308 0.47136 0.09375  -0.13284 0.09371  56  TRP A CG  
429  C CD1 . TRP A 56  ? 0.81540 1.02530 0.50945 0.08586  -0.12889 0.08529  56  TRP A CD1 
430  C CD2 . TRP A 56  ? 0.73055 0.91586 0.45895 0.09941  -0.11962 0.10141  56  TRP A CD2 
431  N NE1 . TRP A 56  ? 0.75140 0.93546 0.43673 0.08634  -0.11386 0.08779  56  TRP A NE1 
432  C CE2 . TRP A 56  ? 0.73564 0.90391 0.44128 0.09408  -0.10843 0.09776  56  TRP A CE2 
433  C CE3 . TRP A 56  ? 0.83189 1.00541 0.58336 0.10832  -0.11565 0.11025  56  TRP A CE3 
434  C CZ2 . TRP A 56  ? 0.83153 0.97277 0.53755 0.09649  -0.09423 0.10312  56  TRP A CZ2 
435  C CZ3 . TRP A 56  ? 0.84111 0.98281 0.59280 0.10950  -0.10086 0.11394  56  TRP A CZ3 
436  C CH2 . TRP A 56  ? 0.79712 0.92223 0.52866 0.10212  -0.09025 0.10987  56  TRP A CH2 
437  N N   . SER A 57  ? 0.87672 1.15690 0.57553 0.09581  -0.16469 0.10456  57  SER A N   
438  C CA  . SER A 57  ? 0.81008 1.09773 0.47729 0.09277  -0.16714 0.10599  57  SER A CA  
439  C C   . SER A 57  ? 0.74548 1.02461 0.39190 0.07834  -0.16133 0.08316  57  SER A C   
440  O O   . SER A 57  ? 0.73284 1.01085 0.39077 0.06842  -0.16202 0.06233  57  SER A O   
441  C CB  . SER A 57  ? 0.79890 1.12184 0.46710 0.09305  -0.18444 0.10679  57  SER A CB  
442  O OG  . SER A 57  ? 0.76468 1.10638 0.44153 0.07911  -0.19389 0.08250  57  SER A OG  
443  N N   . GLY A 58  ? 0.70517 0.97707 0.32105 0.07779  -0.15451 0.08772  58  GLY A N   
444  C CA  . GLY A 58  ? 0.71019 0.97294 0.30488 0.06650  -0.14637 0.06746  58  GLY A CA  
445  C C   . GLY A 58  ? 0.82285 1.05796 0.42348 0.06611  -0.13024 0.06421  58  GLY A C   
446  O O   . GLY A 58  ? 0.65955 0.88009 0.27775 0.07413  -0.12445 0.07881  58  GLY A O   
447  N N   . VAL A 59  ? 0.77914 1.00721 0.36450 0.05695  -0.12259 0.04397  59  VAL A N   
448  C CA  . VAL A 59  ? 0.72864 0.93409 0.31870 0.05620  -0.10744 0.03829  59  VAL A CA  
449  C C   . VAL A 59  ? 0.68471 0.88708 0.29889 0.05129  -0.11180 0.02036  59  VAL A C   
450  O O   . VAL A 59  ? 0.70547 0.91520 0.31797 0.04177  -0.11839 -0.00200 59  VAL A O   
451  C CB  . VAL A 59  ? 0.72766 0.92762 0.29166 0.05059  -0.09541 0.02547  59  VAL A CB  
452  C CG1 . VAL A 59  ? 0.79028 0.97018 0.36234 0.05133  -0.07970 0.02146  59  VAL A CG1 
453  C CG2 . VAL A 59  ? 0.71611 0.92055 0.25522 0.05427  -0.09129 0.04363  59  VAL A CG2 
454  N N   . LEU A 60  ? 0.72136 0.91157 0.35743 0.05733  -0.10808 0.03024  60  LEU A N   
455  C CA  . LEU A 60  ? 0.56816 0.75342 0.22627 0.05326  -0.11062 0.01527  60  LEU A CA  
456  C C   . LEU A 60  ? 0.67129 0.83993 0.32220 0.04871  -0.09878 -0.00257 60  LEU A C   
457  O O   . LEU A 60  ? 0.68496 0.83877 0.32996 0.05276  -0.08492 0.00558  60  LEU A O   
458  C CB  . LEU A 60  ? 0.57573 0.75324 0.25731 0.06231  -0.10968 0.03219  60  LEU A CB  
459  C CG  . LEU A 60  ? 0.51112 0.67609 0.22259 0.05673  -0.10919 0.01947  60  LEU A CG  
460  C CD1 . LEU A 60  ? 0.49601 0.66812 0.23217 0.06334  -0.11562 0.03312  60  LEU A CD1 
461  C CD2 . LEU A 60  ? 0.57057 0.70506 0.28999 0.05547  -0.09312 0.01651  60  LEU A CD2 
462  N N   . ASP A 61  ? 0.57819 0.74604 0.23394 0.03939  -0.10289 -0.02681 61  ASP A N   
463  C CA  . ASP A 61  ? 0.60282 0.74775 0.26099 0.03548  -0.09008 -0.04374 61  ASP A CA  
464  C C   . ASP A 61  ? 0.60880 0.73007 0.29728 0.03785  -0.08189 -0.03699 61  ASP A C   
465  O O   . ASP A 61  ? 0.62260 0.74138 0.33446 0.03552  -0.08850 -0.03622 61  ASP A O   
466  C CB  . ASP A 61  ? 0.61857 0.76394 0.27396 0.02498  -0.09611 -0.07113 61  ASP A CB  
467  C CG  . ASP A 61  ? 0.84014 0.96289 0.49399 0.02374  -0.08244 -0.08869 61  ASP A CG  
468  O OD1 . ASP A 61  ? 0.87875 1.00706 0.50644 0.02241  -0.07855 -0.10263 61  ASP A OD1 
469  O OD2 . ASP A 61  ? 0.98488 1.08572 0.66347 0.02493  -0.07550 -0.08828 61  ASP A OD2 
470  N N   . ALA A 62  ? 0.55665 0.66322 0.24434 0.04173  -0.06741 -0.03248 62  ALA A N   
471  C CA  . ALA A 62  ? 0.55778 0.64518 0.27063 0.04383  -0.05959 -0.02495 62  ALA A CA  
472  C C   . ALA A 62  ? 0.60598 0.67812 0.32501 0.04241  -0.04861 -0.03903 62  ALA A C   
473  O O   . ALA A 62  ? 0.58912 0.65313 0.31457 0.04539  -0.03747 -0.03142 62  ALA A O   
474  C CB  . ALA A 62  ? 0.53314 0.61877 0.24350 0.04993  -0.05277 -0.00246 62  ALA A CB  
475  N N   . THR A 63  ? 0.60859 0.67681 0.32700 0.03788  -0.05163 -0.05954 63  THR A N   
476  C CA  . THR A 63  ? 0.64958 0.70376 0.37231 0.03904  -0.04118 -0.07367 63  THR A CA  
477  C C   . THR A 63  ? 0.72682 0.76239 0.47327 0.03632  -0.04336 -0.08259 63  THR A C   
478  O O   . THR A 63  ? 0.76555 0.78803 0.51894 0.03938  -0.03500 -0.09202 63  THR A O   
479  C CB  . THR A 63  ? 0.62504 0.68598 0.32230 0.03795  -0.03882 -0.09185 63  THR A CB  
480  O OG1 . THR A 63  ? 0.62314 0.68346 0.31728 0.03044  -0.05023 -0.10767 63  THR A OG1 
481  C CG2 . THR A 63  ? 0.69590 0.77771 0.36588 0.03996  -0.03761 -0.08119 63  THR A CG2 
482  N N   . THR A 64  ? 0.74845 0.78349 0.50788 0.03132  -0.05373 -0.07885 64  THR A N   
483  C CA  . THR A 64  ? 0.67160 0.68947 0.45249 0.02764  -0.05559 -0.08413 64  THR A CA  
484  C C   . THR A 64  ? 0.67840 0.69603 0.47839 0.02886  -0.05683 -0.06666 64  THR A C   
485  O O   . THR A 64  ? 0.63733 0.66792 0.43456 0.03103  -0.05939 -0.05305 64  THR A O   
486  C CB  . THR A 64  ? 0.76505 0.78314 0.54480 0.01780  -0.06601 -0.09783 64  THR A CB  
487  O OG1 . THR A 64  ? 0.97057 1.01174 0.74449 0.01473  -0.07644 -0.09008 64  THR A OG1 
488  C CG2 . THR A 64  ? 0.74886 0.76155 0.51025 0.01577  -0.06355 -0.11897 64  THR A CG2 
489  N N   . PHE A 65  ? 0.62008 0.62200 0.43857 0.02818  -0.05443 -0.06682 65  PHE A N   
490  C CA  . PHE A 65  ? 0.50910 0.51150 0.34418 0.02751  -0.05650 -0.05332 65  PHE A CA  
491  C C   . PHE A 65  ? 0.50730 0.51824 0.34773 0.02020  -0.06671 -0.05431 65  PHE A C   
492  O O   . PHE A 65  ? 0.66889 0.67645 0.50789 0.01303  -0.07152 -0.06721 65  PHE A O   
493  C CB  . PHE A 65  ? 0.55673 0.54286 0.40769 0.02868  -0.05148 -0.05217 65  PHE A CB  
494  C CG  . PHE A 65  ? 0.62421 0.60985 0.47645 0.03553  -0.04268 -0.04573 65  PHE A CG  
495  C CD1 . PHE A 65  ? 0.57272 0.56714 0.42445 0.03735  -0.04039 -0.03325 65  PHE A CD1 
496  C CD2 . PHE A 65  ? 0.60987 0.58657 0.46514 0.04009  -0.03642 -0.05235 65  PHE A CD2 
497  C CE1 . PHE A 65  ? 0.54437 0.53957 0.39842 0.04092  -0.03232 -0.02823 65  PHE A CE1 
498  C CE2 . PHE A 65  ? 0.47821 0.45984 0.33722 0.04541  -0.02878 -0.04670 65  PHE A CE2 
499  C CZ  . PHE A 65  ? 0.55114 0.54252 0.40940 0.04449  -0.02687 -0.03502 65  PHE A CZ  
500  N N   . GLN A 66  ? 0.41869 0.44133 0.26614 0.02179  -0.06960 -0.04131 66  GLN A N   
501  C CA  . GLN A 66  ? 0.47564 0.51174 0.33223 0.01597  -0.07865 -0.04066 66  GLN A CA  
502  C C   . GLN A 66  ? 0.60739 0.63400 0.48361 0.01054  -0.07766 -0.03953 66  GLN A C   
503  O O   . GLN A 66  ? 0.36018 0.36888 0.24147 0.01140  -0.07117 -0.03942 66  GLN A O   
504  C CB  . GLN A 66  ? 0.53411 0.58889 0.38990 0.02234  -0.08187 -0.02714 66  GLN A CB  
505  C CG  . GLN A 66  ? 0.67429 0.74707 0.51182 0.02416  -0.08848 -0.02830 66  GLN A CG  
506  C CD  . GLN A 66  ? 0.78952 0.88186 0.62944 0.01559  -0.10064 -0.03728 66  GLN A CD  
507  O OE1 . GLN A 66  ? 0.86262 0.95313 0.71878 0.00685  -0.10326 -0.04349 66  GLN A OE1 
508  N NE2 . GLN A 66  ? 0.75140 0.86407 0.57461 0.01714  -0.10821 -0.03753 66  GLN A NE2 
509  N N   . ASN A 67  ? 0.59525 0.63695 0.48276 0.00487  -0.08437 -0.03796 67  ASN A N   
510  C CA  . ASN A 67  ? 0.47779 0.51362 0.38257 -0.00279 -0.08362 -0.03764 67  ASN A CA  
511  C C   . ASN A 67  ? 0.42271 0.45089 0.33573 0.00301  -0.07600 -0.02633 67  ASN A C   
512  O O   . ASN A 67  ? 0.39124 0.42508 0.30192 0.01173  -0.07314 -0.01757 67  ASN A O   
513  C CB  . ASN A 67  ? 0.44753 0.50731 0.36428 -0.01025 -0.09177 -0.03781 67  ASN A CB  
514  C CG  . ASN A 67  ? 0.52711 0.59590 0.43633 -0.01946 -0.10060 -0.05140 67  ASN A CG  
515  O OD1 . ASN A 67  ? 0.63440 0.68388 0.53358 -0.02422 -0.09927 -0.06357 67  ASN A OD1 
516  N ND2 . ASN A 67  ? 0.56043 0.65923 0.47536 -0.02215 -0.10969 -0.05025 67  ASN A ND2 
517  N N   . VAL A 68  ? 0.49567 0.50964 0.41720 -0.00243 -0.07262 -0.02672 68  VAL A N   
518  C CA  . VAL A 68  ? 0.42691 0.43641 0.35576 0.00065  -0.06642 -0.01717 68  VAL A CA  
519  C C   . VAL A 68  ? 0.43440 0.46206 0.37650 -0.00246 -0.06756 -0.01163 68  VAL A C   
520  O O   . VAL A 68  ? 0.52907 0.56743 0.47968 -0.01137 -0.07239 -0.01539 68  VAL A O   
521  C CB  . VAL A 68  ? 0.43184 0.42063 0.36279 -0.00316 -0.06289 -0.01812 68  VAL A CB  
522  C CG1 . VAL A 68  ? 0.48504 0.47255 0.42095 -0.00081 -0.05752 -0.00852 68  VAL A CG1 
523  C CG2 . VAL A 68  ? 0.41821 0.39228 0.33851 0.00223  -0.06118 -0.02413 68  VAL A CG2 
524  N N   . CYS A 69  ? 0.39314 0.42545 0.33773 0.00454  -0.06266 -0.00365 69  CYS A N   
525  C CA  . CYS A 69  ? 0.40399 0.45377 0.36198 0.00378  -0.06151 0.00126  69  CYS A CA  
526  C C   . CYS A 69  ? 0.41276 0.46082 0.38049 -0.00716 -0.05963 0.00130  69  CYS A C   
527  O O   . CYS A 69  ? 0.52154 0.55103 0.48456 -0.01024 -0.05643 0.00181  69  CYS A O   
528  C CB  . CYS A 69  ? 0.35581 0.40404 0.31240 0.01319  -0.05462 0.00761  69  CYS A CB  
529  S SG  . CYS A 69  ? 0.61437 0.66579 0.56217 0.02530  -0.05618 0.01070  69  CYS A SG  
530  N N   . TYR A 70  ? 0.37953 0.44847 0.36154 -0.01301 -0.06155 0.00182  70  TYR A N   
531  C CA  . TYR A 70  ? 0.47019 0.53848 0.46183 -0.02583 -0.05930 0.00253  70  TYR A CA  
532  C C   . TYR A 70  ? 0.47591 0.53387 0.46483 -0.02435 -0.05048 0.00944  70  TYR A C   
533  O O   . TYR A 70  ? 0.53671 0.60253 0.52558 -0.01585 -0.04540 0.01309  70  TYR A O   
534  C CB  . TYR A 70  ? 0.43962 0.53820 0.44970 -0.03217 -0.06161 0.00267  70  TYR A CB  
535  C CG  . TYR A 70  ? 0.48820 0.58665 0.50660 -0.04974 -0.06511 -0.00206 70  TYR A CG  
536  C CD1 . TYR A 70  ? 0.46753 0.57625 0.48842 -0.05641 -0.07469 -0.01084 70  TYR A CD1 
537  C CD2 . TYR A 70  ? 0.47191 0.55878 0.49430 -0.06068 -0.05873 0.00225  70  TYR A CD2 
538  C CE1 . TYR A 70  ? 0.55433 0.66039 0.58279 -0.07459 -0.07763 -0.01704 70  TYR A CE1 
539  C CE2 . TYR A 70  ? 0.45357 0.53620 0.48385 -0.07831 -0.06098 -0.00162 70  TYR A CE2 
540  C CZ  . TYR A 70  ? 0.61026 0.70163 0.64412 -0.08574 -0.07035 -0.01222 70  TYR A CZ  
541  O OH  . TYR A 70  ? 0.76223 0.84740 0.80388 -0.10521 -0.07256 -0.01814 70  TYR A OH  
542  N N   . GLN A 71  ? 0.43116 0.47065 0.41681 -0.03244 -0.04865 0.01118  71  GLN A N   
543  C CA  . GLN A 71  ? 0.54802 0.57759 0.52703 -0.03030 -0.04189 0.01833  71  GLN A CA  
544  C C   . GLN A 71  ? 0.54685 0.56159 0.52629 -0.04117 -0.04008 0.02337  71  GLN A C   
545  O O   . GLN A 71  ? 0.53336 0.53676 0.51602 -0.04937 -0.04388 0.01980  71  GLN A O   
546  C CB  . GLN A 71  ? 0.57249 0.58736 0.53794 -0.01967 -0.04213 0.01755  71  GLN A CB  
547  C CG  . GLN A 71  ? 0.52150 0.51709 0.48088 -0.01936 -0.04687 0.01301  71  GLN A CG  
548  C CD  . GLN A 71  ? 0.54208 0.53001 0.49125 -0.00899 -0.04663 0.01177  71  GLN A CD  
549  O OE1 . GLN A 71  ? 0.60954 0.58480 0.55355 -0.00663 -0.04542 0.01490  71  GLN A OE1 
550  N NE2 . GLN A 71  ? 0.47610 0.47320 0.42303 -0.00269 -0.04766 0.00831  71  GLN A NE2 
551  N N   . TYR A 72  ? 0.52587 0.53950 0.50057 -0.04122 -0.03394 0.03176  72  TYR A N   
552  C CA  . TYR A 72  ? 0.51225 0.50949 0.48390 -0.04922 -0.03162 0.04024  72  TYR A CA  
553  C C   . TYR A 72  ? 0.49904 0.46993 0.46176 -0.04359 -0.03582 0.03985  72  TYR A C   
554  O O   . TYR A 72  ? 0.60886 0.57806 0.56443 -0.03263 -0.03788 0.03639  72  TYR A O   
555  C CB  . TYR A 72  ? 0.42749 0.43300 0.39241 -0.04886 -0.02457 0.04965  72  TYR A CB  
556  C CG  . TYR A 72  ? 0.48378 0.47239 0.44260 -0.05552 -0.02238 0.06165  72  TYR A CG  
557  C CD1 . TYR A 72  ? 0.49341 0.46596 0.43952 -0.04794 -0.02452 0.06776  72  TYR A CD1 
558  C CD2 . TYR A 72  ? 0.46445 0.45403 0.43108 -0.06943 -0.01822 0.06805  72  TYR A CD2 
559  C CE1 . TYR A 72  ? 0.57612 0.53268 0.51636 -0.05227 -0.02300 0.08132  72  TYR A CE1 
560  C CE2 . TYR A 72  ? 0.58023 0.55146 0.54035 -0.07557 -0.01559 0.08137  72  TYR A CE2 
561  C CZ  . TYR A 72  ? 0.68006 0.63395 0.62638 -0.06613 -0.01820 0.08876  72  TYR A CZ  
562  O OH  . TYR A 72  ? 0.66049 0.59567 0.60027 -0.07105 -0.01583 0.10464  72  TYR A OH  
563  N N   . VAL A 73  ? 0.49533 0.44517 0.45942 -0.05094 -0.03632 0.04349  73  VAL A N   
564  C CA  . VAL A 73  ? 0.61048 0.53420 0.56817 -0.04389 -0.03931 0.04307  73  VAL A CA  
565  C C   . VAL A 73  ? 0.60434 0.51155 0.55663 -0.04428 -0.03640 0.05788  73  VAL A C   
566  O O   . VAL A 73  ? 0.56045 0.46028 0.51627 -0.05592 -0.03298 0.06576  73  VAL A O   
567  C CB  . VAL A 73  ? 0.52913 0.43621 0.49182 -0.04927 -0.04288 0.03217  73  VAL A CB  
568  C CG1 . VAL A 73  ? 0.43301 0.31243 0.38976 -0.03998 -0.04413 0.03141  73  VAL A CG1 
569  C CG2 . VAL A 73  ? 0.38068 0.30691 0.34573 -0.04737 -0.04684 0.01939  73  VAL A CG2 
570  N N   . ASP A 74  ? 0.59321 0.49508 0.53746 -0.03175 -0.03805 0.06220  74  ASP A N   
571  C CA  . ASP A 74  ? 0.66156 0.55319 0.59905 -0.02892 -0.03681 0.07809  74  ASP A CA  
572  C C   . ASP A 74  ? 0.72688 0.58546 0.66728 -0.03166 -0.03644 0.08412  74  ASP A C   
573  O O   . ASP A 74  ? 0.65884 0.49832 0.60271 -0.02606 -0.03877 0.07535  74  ASP A O   
574  C CB  . ASP A 74  ? 0.70640 0.60525 0.63721 -0.01457 -0.04012 0.07961  74  ASP A CB  
575  C CG  . ASP A 74  ? 0.85381 0.74832 0.77688 -0.01053 -0.04051 0.09710  74  ASP A CG  
576  O OD1 . ASP A 74  ? 0.85917 0.76479 0.77572 -0.01790 -0.03727 0.10672  74  ASP A OD1 
577  O OD2 . ASP A 74  ? 0.95459 0.83586 0.87803 0.00058  -0.04384 0.10175  74  ASP A OD2 
578  N N   . THR A 75  ? 0.74614 0.59682 0.68405 -0.04008 -0.03256 0.09951  75  THR A N   
579  C CA  . THR A 75  ? 0.69230 0.50810 0.63275 -0.04530 -0.03053 0.10804  75  THR A CA  
580  C C   . THR A 75  ? 0.72929 0.53274 0.66050 -0.03767 -0.03001 0.12976  75  THR A C   
581  O O   . THR A 75  ? 0.77208 0.54510 0.70389 -0.04255 -0.02702 0.14159  75  THR A O   
582  C CB  . THR A 75  ? 0.65756 0.47240 0.60515 -0.06595 -0.02545 0.10830  75  THR A CB  
583  O OG1 . THR A 75  ? 0.69711 0.54319 0.64120 -0.07221 -0.02151 0.11550  75  THR A OG1 
584  C CG2 . THR A 75  ? 0.71441 0.53396 0.67263 -0.07322 -0.02774 0.08755  75  THR A CG2 
585  N N   . LEU A 76  ? 0.74486 0.57089 0.66725 -0.02632 -0.03310 0.13572  76  LEU A N   
586  C CA  . LEU A 76  ? 0.76134 0.58206 0.67348 -0.01926 -0.03398 0.15772  76  LEU A CA  
587  C C   . LEU A 76  ? 0.81731 0.60478 0.73352 -0.00586 -0.03672 0.16428  76  LEU A C   
588  O O   . LEU A 76  ? 0.99626 0.75656 0.90999 -0.00718 -0.03419 0.18188  76  LEU A O   
589  C CB  . LEU A 76  ? 0.81116 0.66623 0.71325 -0.01081 -0.03804 0.15960  76  LEU A CB  
590  C CG  . LEU A 76  ? 0.80901 0.66577 0.69767 -0.00578 -0.03973 0.18365  76  LEU A CG  
591  C CD1 . LEU A 76  ? 0.70360 0.55167 0.58530 -0.02093 -0.03233 0.19903  76  LEU A CD1 
592  C CD2 . LEU A 76  ? 0.65415 0.54680 0.53141 0.00052  -0.04462 0.18420  76  LEU A CD2 
593  N N   . TYR A 77  ? 0.79196 0.58048 0.71463 0.00774  -0.04098 0.15100  77  TYR A N   
594  C CA  . TYR A 77  ? 0.84859 0.60755 0.77730 0.02303  -0.04253 0.15435  77  TYR A CA  
595  C C   . TYR A 77  ? 0.93877 0.67901 0.87729 0.02147  -0.04059 0.13198  77  TYR A C   
596  O O   . TYR A 77  ? 0.91250 0.66927 0.85463 0.02949  -0.04303 0.11622  77  TYR A O   
597  C CB  . TYR A 77  ? 0.77156 0.55204 0.69973 0.04236  -0.04880 0.15937  77  TYR A CB  
598  C CG  . TYR A 77  ? 0.73545 0.54072 0.65175 0.04341  -0.05234 0.17882  77  TYR A CG  
599  C CD1 . TYR A 77  ? 0.70984 0.49756 0.62003 0.04793  -0.05269 0.20356  77  TYR A CD1 
600  C CD2 . TYR A 77  ? 0.67662 0.52177 0.58650 0.04008  -0.05527 0.17248  77  TYR A CD2 
601  C CE1 . TYR A 77  ? 0.70920 0.52177 0.60592 0.04900  -0.05657 0.22148  77  TYR A CE1 
602  C CE2 . TYR A 77  ? 0.75288 0.62157 0.64975 0.04035  -0.05875 0.18808  77  TYR A CE2 
603  C CZ  . TYR A 77  ? 0.83152 0.68562 0.72100 0.04466  -0.05973 0.21278  77  TYR A CZ  
604  O OH  . TYR A 77  ? 0.94566 0.82534 0.81913 0.04463  -0.06374 0.22925  77  TYR A OH  
605  N N   . PRO A 78  ? 0.97023 0.67641 0.91234 0.01023  -0.03601 0.12962  78  PRO A N   
606  C CA  . PRO A 78  ? 0.98184 0.67186 0.93086 0.00670  -0.03467 0.10635  78  PRO A CA  
607  C C   . PRO A 78  ? 1.05656 0.72509 1.01015 0.02679  -0.03494 0.10064  78  PRO A C   
608  O O   . PRO A 78  ? 1.01285 0.65307 0.96788 0.03787  -0.03349 0.11531  78  PRO A O   
609  C CB  . PRO A 78  ? 0.99992 0.65902 0.95124 -0.01282 -0.02973 0.10774  78  PRO A CB  
610  C CG  . PRO A 78  ? 0.95259 0.62261 0.89814 -0.02217 -0.02782 0.13027  78  PRO A CG  
611  C CD  . PRO A 78  ? 0.96894 0.65295 0.90795 -0.00310 -0.03149 0.14701  78  PRO A CD  
612  N N   . GLY A 79  ? 1.02321 0.70603 0.97914 0.03229  -0.03621 0.07982  79  GLY A N   
613  C CA  . GLY A 79  ? 0.99731 0.66493 0.95813 0.05092  -0.03496 0.07065  79  GLY A CA  
614  C C   . GLY A 79  ? 0.98412 0.67726 0.94781 0.07151  -0.03819 0.07996  79  GLY A C   
615  O O   . GLY A 79  ? 1.02309 0.71630 0.99238 0.08684  -0.03683 0.06936  79  GLY A O   
616  N N   . PHE A 80  ? 0.93248 0.64886 0.89258 0.07163  -0.04217 0.09890  80  PHE A N   
617  C CA  . PHE A 80  ? 0.72769 0.47600 0.69036 0.08741  -0.04678 0.10695  80  PHE A CA  
618  C C   . PHE A 80  ? 0.63342 0.41456 0.59720 0.08687  -0.04766 0.08873  80  PHE A C   
619  O O   . PHE A 80  ? 0.50121 0.29841 0.45900 0.07185  -0.04781 0.08041  80  PHE A O   
620  C CB  . PHE A 80  ? 0.73479 0.50307 0.68933 0.08203  -0.05098 0.12772  80  PHE A CB  
621  C CG  . PHE A 80  ? 0.66210 0.46806 0.61776 0.09419  -0.05713 0.13541  80  PHE A CG  
622  C CD1 . PHE A 80  ? 0.67762 0.48265 0.64219 0.11523  -0.05998 0.14582  80  PHE A CD1 
623  C CD2 . PHE A 80  ? 0.57880 0.42154 0.52750 0.08440  -0.06006 0.13198  80  PHE A CD2 
624  C CE1 . PHE A 80  ? 0.67159 0.51583 0.63889 0.12492  -0.06668 0.15259  80  PHE A CE1 
625  C CE2 . PHE A 80  ? 0.66202 0.53949 0.61159 0.09292  -0.06605 0.13765  80  PHE A CE2 
626  C CZ  . PHE A 80  ? 0.67897 0.55934 0.63825 0.11250  -0.06991 0.14792  80  PHE A CZ  
627  N N   . GLU A 81  ? 0.67339 0.46489 0.64567 0.10391  -0.04765 0.08354  81  GLU A N   
628  C CA  . GLU A 81  ? 0.67739 0.49739 0.65080 0.10336  -0.04708 0.06712  81  GLU A CA  
629  C C   . GLU A 81  ? 0.65679 0.51313 0.62448 0.09379  -0.05140 0.07149  81  GLU A C   
630  O O   . GLU A 81  ? 0.74333 0.61384 0.70652 0.08368  -0.05025 0.05917  81  GLU A O   
631  C CB  . GLU A 81  ? 0.77295 0.60174 0.75831 0.12364  -0.04545 0.06345  81  GLU A CB  
632  C CG  . GLU A 81  ? 0.93005 0.79513 0.91769 0.12369  -0.04486 0.05160  81  GLU A CG  
633  C CD  . GLU A 81  ? 1.12100 0.97684 1.10518 0.12037  -0.03858 0.03031  81  GLU A CD  
634  O OE1 . GLU A 81  ? 1.23030 1.05580 1.21611 0.12705  -0.03391 0.02244  81  GLU A OE1 
635  O OE2 . GLU A 81  ? 1.06031 0.93831 1.03906 0.11116  -0.03816 0.02156  81  GLU A OE2 
636  N N   . GLY A 82  ? 0.60260 0.47330 0.56928 0.09685  -0.05631 0.08893  82  GLY A N   
637  C CA  . GLY A 82  ? 0.60087 0.50583 0.56159 0.08855  -0.06005 0.09096  82  GLY A CA  
638  C C   . GLY A 82  ? 0.56847 0.47342 0.51867 0.07031  -0.05809 0.08552  82  GLY A C   
639  O O   . GLY A 82  ? 0.53092 0.46027 0.47713 0.06340  -0.05875 0.07973  82  GLY A O   
640  N N   . THR A 83  ? 0.53189 0.41033 0.47877 0.06228  -0.05526 0.08709  83  THR A N   
641  C CA  . THR A 83  ? 0.58071 0.46211 0.52130 0.04607  -0.05293 0.08054  83  THR A CA  
642  C C   . THR A 83  ? 0.60181 0.47394 0.54527 0.04178  -0.05006 0.06275  83  THR A C   
643  O O   . THR A 83  ? 0.55757 0.44587 0.49821 0.03417  -0.04945 0.05404  83  THR A O   
644  C CB  . THR A 83  ? 0.64540 0.51086 0.58117 0.03637  -0.05143 0.09319  83  THR A CB  
645  O OG1 . THR A 83  ? 0.78453 0.61878 0.72435 0.04308  -0.05067 0.10139  83  THR A OG1 
646  C CG2 . THR A 83  ? 0.67003 0.55637 0.59718 0.03444  -0.05363 0.10712  83  THR A CG2 
647  N N   . GLU A 84  ? 0.58853 0.43509 0.53669 0.04709  -0.04827 0.05687  84  GLU A N   
648  C CA  . GLU A 84  ? 0.65251 0.49228 0.60059 0.04195  -0.04625 0.03906  84  GLU A CA  
649  C C   . GLU A 84  ? 0.65067 0.51503 0.59767 0.04624  -0.04627 0.02860  84  GLU A C   
650  O O   . GLU A 84  ? 0.67526 0.54538 0.61874 0.03902  -0.04580 0.01729  84  GLU A O   
651  C CB  . GLU A 84  ? 0.65038 0.45813 0.60203 0.04782  -0.04364 0.03191  84  GLU A CB  
652  C CG  . GLU A 84  ? 0.94291 0.71859 0.89611 0.04347  -0.04240 0.04210  84  GLU A CG  
653  C CD  . GLU A 84  ? 0.98312 0.75097 0.93415 0.02359  -0.04190 0.03855  84  GLU A CD  
654  O OE1 . GLU A 84  ? 0.79333 0.58174 0.74220 0.01455  -0.04326 0.02781  84  GLU A OE1 
655  O OE2 . GLU A 84  ? 1.07858 0.82049 1.03100 0.01711  -0.04004 0.04784  84  GLU A OE2 
656  N N   . MET A 85  ? 0.58197 0.46253 0.53226 0.05731  -0.04695 0.03303  85  MET A N   
657  C CA  . MET A 85  ? 0.55376 0.45629 0.50364 0.05985  -0.04574 0.02384  85  MET A CA  
658  C C   . MET A 85  ? 0.56331 0.48273 0.50691 0.04853  -0.04636 0.02203  85  MET A C   
659  O O   . MET A 85  ? 0.61618 0.54755 0.55742 0.04806  -0.04461 0.01377  85  MET A O   
660  C CB  . MET A 85  ? 0.52131 0.44230 0.47818 0.07123  -0.04661 0.02987  85  MET A CB  
661  C CG  . MET A 85  ? 0.52672 0.46574 0.48240 0.06803  -0.05078 0.04237  85  MET A CG  
662  S SD  . MET A 85  ? 0.69310 0.65940 0.65914 0.08033  -0.05360 0.04867  85  MET A SD  
663  C CE  . MET A 85  ? 0.57068 0.56075 0.53538 0.07296  -0.05046 0.03660  85  MET A CE  
664  N N   . TRP A 86  ? 0.47899 0.39879 0.41969 0.04003  -0.04792 0.02995  86  TRP A N   
665  C CA  . TRP A 86  ? 0.42169 0.35600 0.35779 0.03104  -0.04749 0.02829  86  TRP A CA  
666  C C   . TRP A 86  ? 0.39815 0.32454 0.33334 0.02196  -0.04709 0.02339  86  TRP A C   
667  O O   . TRP A 86  ? 0.49450 0.43307 0.42769 0.01726  -0.04646 0.01975  86  TRP A O   
668  C CB  . TRP A 86  ? 0.49838 0.44396 0.43156 0.02779  -0.04848 0.03899  86  TRP A CB  
669  C CG  . TRP A 86  ? 0.42664 0.38452 0.36121 0.03529  -0.05065 0.04429  86  TRP A CG  
670  C CD1 . TRP A 86  ? 0.49369 0.44948 0.42971 0.04092  -0.05363 0.05565  86  TRP A CD1 
671  C CD2 . TRP A 86  ? 0.41979 0.39587 0.35551 0.03758  -0.05037 0.03906  86  TRP A CD2 
672  N NE1 . TRP A 86  ? 0.51045 0.48588 0.44940 0.04696  -0.05624 0.05731  86  TRP A NE1 
673  C CE2 . TRP A 86  ? 0.46784 0.45568 0.40712 0.04387  -0.05391 0.04653  86  TRP A CE2 
674  C CE3 . TRP A 86  ? 0.44938 0.43300 0.38373 0.03453  -0.04742 0.02977  86  TRP A CE3 
675  C CZ2 . TRP A 86  ? 0.46446 0.47364 0.40752 0.04544  -0.05463 0.04338  86  TRP A CZ2 
676  C CZ3 . TRP A 86  ? 0.40310 0.40341 0.33989 0.03588  -0.04702 0.02749  86  TRP A CZ3 
677  C CH2 . TRP A 86  ? 0.42164 0.43568 0.36349 0.04043  -0.05063 0.03345  86  TRP A CH2 
678  N N   . ASN A 87  ? 0.37061 0.27724 0.30826 0.01940  -0.04744 0.02315  87  ASN A N   
679  C CA  . ASN A 87  ? 0.44617 0.34787 0.38505 0.00860  -0.04778 0.01819  87  ASN A CA  
680  C C   . ASN A 87  ? 0.55000 0.45721 0.48662 0.00857  -0.04889 0.00467  87  ASN A C   
681  O O   . ASN A 87  ? 0.57906 0.48607 0.51267 0.01698  -0.04819 -0.00129 87  ASN A O   
682  C CB  . ASN A 87  ? 0.49395 0.36976 0.43600 0.00471  -0.04744 0.02074  87  ASN A CB  
683  C CG  . ASN A 87  ? 0.57315 0.44499 0.51573 0.00152  -0.04625 0.03648  87  ASN A CG  
684  O OD1 . ASN A 87  ? 0.68338 0.57348 0.62425 -0.00331 -0.04543 0.04268  87  ASN A OD1 
685  N ND2 . ASN A 87  ? 0.55779 0.40487 0.50180 0.00479  -0.04553 0.04334  87  ASN A ND2 
686  N N   . PRO A 88  ? 0.61766 0.53234 0.55573 -0.00072 -0.05064 0.00019  88  PRO A N   
687  C CA  . PRO A 88  ? 0.54614 0.46944 0.48012 -0.00038 -0.05293 -0.01098 88  PRO A CA  
688  C C   . PRO A 88  ? 0.55641 0.46193 0.48661 0.00114  -0.05342 -0.02213 88  PRO A C   
689  O O   . PRO A 88  ? 0.66761 0.55223 0.60106 -0.00312 -0.05299 -0.02345 88  PRO A O   
690  C CB  . PRO A 88  ? 0.52996 0.46615 0.46925 -0.01110 -0.05577 -0.01190 88  PRO A CB  
691  C CG  . PRO A 88  ? 0.51140 0.44848 0.45745 -0.01654 -0.05320 -0.00100 88  PRO A CG  
692  C CD  . PRO A 88  ? 0.58371 0.50055 0.52785 -0.01224 -0.05072 0.00520  88  PRO A CD  
693  N N   . ASN A 89  ? 0.61872 0.53143 0.54106 0.00701  -0.05349 -0.03043 89  ASN A N   
694  C CA  . ASN A 89  ? 0.51179 0.40990 0.42800 0.00996  -0.05253 -0.04328 89  ASN A CA  
695  C C   . ASN A 89  ? 0.56863 0.47623 0.47617 0.00409  -0.05657 -0.05562 89  ASN A C   
696  O O   . ASN A 89  ? 0.79236 0.69118 0.69127 0.00654  -0.05532 -0.06841 89  ASN A O   
697  C CB  . ASN A 89  ? 0.39102 0.28964 0.30426 0.02321  -0.04758 -0.04303 89  ASN A CB  
698  C CG  . ASN A 89  ? 0.65370 0.57511 0.56122 0.02682  -0.04677 -0.04022 89  ASN A CG  
699  O OD1 . ASN A 89  ? 0.56583 0.50118 0.47278 0.02173  -0.04973 -0.03558 89  ASN A OD1 
700  N ND2 . ASN A 89  ? 0.59516 0.52021 0.49929 0.03597  -0.04196 -0.04266 89  ASN A ND2 
701  N N   . ARG A 90  ? 0.52778 0.45512 0.43691 -0.00256 -0.06129 -0.05228 90  ARG A N   
702  C CA  A ARG A 90  ? 0.57613 0.51508 0.47928 -0.01009 -0.06741 -0.06267 90  ARG A CA  
703  C CA  B ARG A 90  ? 0.57683 0.51634 0.47994 -0.00996 -0.06743 -0.06245 90  ARG A CA  
704  C C   . ARG A 90  ? 0.55589 0.50522 0.47117 -0.02199 -0.07220 -0.05878 90  ARG A C   
705  O O   . ARG A 90  ? 0.56993 0.51756 0.49597 -0.02338 -0.06957 -0.04785 90  ARG A O   
706  C CB  A ARG A 90  ? 0.58368 0.54430 0.47566 -0.00322 -0.06884 -0.06155 90  ARG A CB  
707  C CB  B ARG A 90  ? 0.58194 0.54372 0.47446 -0.00313 -0.06892 -0.06060 90  ARG A CB  
708  C CG  A ARG A 90  ? 0.57281 0.52758 0.45339 0.00760  -0.06263 -0.06439 90  ARG A CG  
709  C CG  B ARG A 90  ? 0.56897 0.52603 0.44895 0.00729  -0.06323 -0.06422 90  ARG A CG  
710  C CD  A ARG A 90  ? 0.59960 0.54484 0.46755 0.00654  -0.06236 -0.08157 90  ARG A CD  
711  C CD  B ARG A 90  ? 0.60197 0.54447 0.47207 0.00602  -0.06219 -0.08121 90  ARG A CD  
712  N NE  A ARG A 90  ? 0.63064 0.57188 0.49064 0.01755  -0.05447 -0.08379 90  ARG A NE  
713  N NE  B ARG A 90  ? 0.61465 0.56979 0.47279 -0.00115 -0.06900 -0.09238 90  ARG A NE  
714  C CZ  A ARG A 90  ? 0.60199 0.52392 0.46163 0.02222  -0.04876 -0.09351 90  ARG A CZ  
715  C CZ  B ARG A 90  ? 0.66173 0.62681 0.50184 0.00297  -0.06835 -0.09951 90  ARG A CZ  
716  N NH1 A ARG A 90  ? 0.65231 0.55217 0.51745 0.01645  -0.05006 -0.10193 90  ARG A NH1 
717  N NH1 B ARG A 90  ? 0.71366 0.67734 0.54740 0.01384  -0.06005 -0.09648 90  ARG A NH1 
718  N NH2 A ARG A 90  ? 0.47371 0.39824 0.32843 0.03283  -0.04103 -0.09463 90  ARG A NH2 
719  N NH2 B ARG A 90  ? 0.63922 0.61826 0.46744 -0.00444 -0.07603 -0.10942 90  ARG A NH2 
720  N N   . GLU A 91  ? 0.56735 0.53005 0.48080 -0.03113 -0.07921 -0.06816 91  GLU A N   
721  C CA  . GLU A 91  ? 0.49738 0.47436 0.42494 -0.04386 -0.08393 -0.06599 91  GLU A CA  
722  C C   . GLU A 91  ? 0.58931 0.58679 0.52745 -0.03885 -0.08243 -0.05051 91  GLU A C   
723  O O   . GLU A 91  ? 0.48203 0.49152 0.41455 -0.02722 -0.08155 -0.04408 91  GLU A O   
724  C CB  . GLU A 91  ? 0.52821 0.52545 0.45149 -0.05230 -0.09319 -0.07784 91  GLU A CB  
725  C CG  . GLU A 91  ? 0.62960 0.65208 0.56948 -0.06402 -0.09905 -0.07500 91  GLU A CG  
726  C CD  . GLU A 91  ? 0.70955 0.75024 0.64553 -0.07529 -0.10933 -0.08940 91  GLU A CD  
727  O OE1 . GLU A 91  ? 0.69490 0.71755 0.61550 -0.07812 -0.11010 -0.10447 91  GLU A OE1 
728  O OE2 . GLU A 91  ? 0.66761 0.74213 0.61588 -0.08074 -0.11653 -0.08617 91  GLU A OE2 
729  N N   . LEU A 92  ? 0.63444 0.63396 0.58754 -0.04802 -0.08094 -0.04471 92  LEU A N   
730  C CA  . LEU A 92  ? 0.58089 0.60131 0.54500 -0.04458 -0.07863 -0.03239 92  LEU A CA  
731  C C   . LEU A 92  ? 0.54584 0.60034 0.51858 -0.04775 -0.08593 -0.03398 92  LEU A C   
732  O O   . LEU A 92  ? 0.55389 0.61743 0.53249 -0.06085 -0.09220 -0.04273 92  LEU A O   
733  C CB  . LEU A 92  ? 0.56836 0.58000 0.54387 -0.05329 -0.07307 -0.02530 92  LEU A CB  
734  C CG  . LEU A 92  ? 0.55814 0.54508 0.52774 -0.04713 -0.06578 -0.01753 92  LEU A CG  
735  C CD1 . LEU A 92  ? 0.36819 0.34561 0.34680 -0.05860 -0.06158 -0.01099 92  LEU A CD1 
736  C CD2 . LEU A 92  ? 0.66204 0.66031 0.62867 -0.03455 -0.06208 -0.00921 92  LEU A CD2 
737  N N   . SER A 93  ? 0.43328 0.50679 0.40753 -0.03577 -0.08527 -0.02562 93  SER A N   
738  C CA  . SER A 93  ? 0.42227 0.52979 0.40456 -0.03398 -0.09255 -0.02471 93  SER A CA  
739  C C   . SER A 93  ? 0.41413 0.53414 0.40178 -0.01986 -0.08773 -0.01290 93  SER A C   
740  O O   . SER A 93  ? 0.44591 0.54790 0.42317 -0.00967 -0.08128 -0.00810 93  SER A O   
741  C CB  . SER A 93  ? 0.44600 0.55966 0.41314 -0.03078 -0.10101 -0.03192 93  SER A CB  
742  O OG  . SER A 93  ? 0.38726 0.53723 0.36286 -0.03012 -0.11017 -0.03058 93  SER A OG  
743  N N   . GLU A 94  ? 0.40321 0.55507 0.40795 -0.01930 -0.09090 -0.00906 94  GLU A N   
744  C CA  . GLU A 94  ? 0.38115 0.54501 0.39083 -0.00343 -0.08677 0.00102  94  GLU A CA  
745  C C   . GLU A 94  ? 0.40578 0.57055 0.40110 0.00978  -0.09155 0.00417  94  GLU A C   
746  O O   . GLU A 94  ? 0.49866 0.65630 0.49019 0.02362  -0.08573 0.01224  94  GLU A O   
747  C CB  . GLU A 94  ? 0.30303 0.50291 0.33704 -0.00418 -0.08819 0.00459  94  GLU A CB  
748  C CG  . GLU A 94  ? 0.29682 0.49657 0.34451 -0.01133 -0.07847 0.00644  94  GLU A CG  
749  C CD  . GLU A 94  ? 0.48262 0.72280 0.55638 -0.01088 -0.07873 0.00984  94  GLU A CD  
750  O OE1 . GLU A 94  ? 0.41251 0.66184 0.49394 0.00343  -0.07148 0.01644  94  GLU A OE1 
751  O OE2 . GLU A 94  ? 0.42794 0.69146 0.51530 -0.02494 -0.08601 0.00508  94  GLU A OE2 
752  N N   . ASP A 95  ? 0.39615 0.56872 0.38221 0.00509  -0.10155 -0.00215 95  ASP A N   
753  C CA  . ASP A 95  ? 0.50312 0.67318 0.47032 0.01588  -0.10526 0.00099  95  ASP A CA  
754  C C   . ASP A 95  ? 0.53541 0.67036 0.48373 0.01597  -0.09799 -0.00236 95  ASP A C   
755  O O   . ASP A 95  ? 0.57659 0.69926 0.51576 0.00621  -0.09985 -0.01311 95  ASP A O   
756  C CB  . ASP A 95  ? 0.55372 0.74734 0.51554 0.00978  -0.11852 -0.00577 95  ASP A CB  
757  C CG  . ASP A 95  ? 0.62467 0.81681 0.56391 0.02011  -0.12196 -0.00173 95  ASP A CG  
758  O OD1 . ASP A 95  ? 0.69889 0.87978 0.63263 0.03419  -0.11528 0.01007  95  ASP A OD1 
759  O OD2 . ASP A 95  ? 0.70409 0.90610 0.63031 0.01330  -0.13090 -0.01060 95  ASP A OD2 
760  N N   . CYS A 96  ? 0.49628 0.61544 0.43976 0.02699  -0.08939 0.00620  96  CYS A N   
761  C CA  . CYS A 96  ? 0.49768 0.58746 0.42921 0.02628  -0.08139 0.00376  96  CYS A CA  
762  C C   . CYS A 96  ? 0.46827 0.54614 0.39080 0.03789  -0.07457 0.01285  96  CYS A C   
763  O O   . CYS A 96  ? 0.41448 0.47189 0.32925 0.03739  -0.06776 0.01162  96  CYS A O   
764  C CB  . CYS A 96  ? 0.49659 0.57425 0.43885 0.01910  -0.07526 0.00144  96  CYS A CB  
765  S SG  . CYS A 96  ? 0.46395 0.54651 0.42082 0.02552  -0.06739 0.01035  96  CYS A SG  
766  N N   . LEU A 97  ? 0.41305 0.50356 0.33732 0.04822  -0.07632 0.02232  97  LEU A N   
767  C CA  . LEU A 97  ? 0.45282 0.52848 0.37001 0.05858  -0.06880 0.03183  97  LEU A CA  
768  C C   . LEU A 97  ? 0.57765 0.64722 0.47413 0.06062  -0.06986 0.03398  97  LEU A C   
769  O O   . LEU A 97  ? 0.77058 0.84919 0.65938 0.06894  -0.07348 0.04311  97  LEU A O   
770  C CB  . LEU A 97  ? 0.46973 0.55777 0.39888 0.07026  -0.06879 0.04189  97  LEU A CB  
771  C CG  . LEU A 97  ? 0.48729 0.57740 0.43517 0.06853  -0.06333 0.03909  97  LEU A CG  
772  C CD1 . LEU A 97  ? 0.32492 0.42425 0.28633 0.08215  -0.06009 0.04769  97  LEU A CD1 
773  C CD2 . LEU A 97  ? 0.55338 0.61809 0.49643 0.06245  -0.05378 0.03418  97  LEU A CD2 
774  N N   . TYR A 98  ? 0.49727 0.55234 0.38454 0.05352  -0.06613 0.02622  98  TYR A N   
775  C CA  . TYR A 98  ? 0.57433 0.62419 0.44230 0.05417  -0.06475 0.02638  98  TYR A CA  
776  C C   . TYR A 98  ? 0.53088 0.55998 0.39598 0.05303  -0.05401 0.02701  98  TYR A C   
777  O O   . TYR A 98  ? 0.46686 0.48674 0.34336 0.05006  -0.04969 0.02450  98  TYR A O   
778  C CB  . TYR A 98  ? 0.60293 0.66013 0.46287 0.04663  -0.07089 0.01363  98  TYR A CB  
779  C CG  . TYR A 98  ? 0.62689 0.70720 0.49063 0.04441  -0.08259 0.01057  98  TYR A CG  
780  C CD1 . TYR A 98  ? 0.66473 0.76258 0.51396 0.04807  -0.08993 0.01392  98  TYR A CD1 
781  C CD2 . TYR A 98  ? 0.58025 0.66740 0.46216 0.03797  -0.08641 0.00517  98  TYR A CD2 
782  C CE1 . TYR A 98  ? 0.62620 0.74988 0.48007 0.04518  -0.10201 0.01078  98  TYR A CE1 
783  C CE2 . TYR A 98  ? 0.62885 0.74061 0.51690 0.03418  -0.09717 0.00207  98  TYR A CE2 
784  C CZ  . TYR A 98  ? 0.61494 0.74589 0.48955 0.03771  -0.10553 0.00432  98  TYR A CZ  
785  O OH  . TYR A 98  ? 0.66767 0.82731 0.54967 0.03291  -0.11750 0.00061  98  TYR A OH  
786  N N   . LEU A 99  ? 0.43759 0.46180 0.28728 0.05473  -0.04965 0.03069  99  LEU A N   
787  C CA  . LEU A 99  ? 0.45374 0.46291 0.30214 0.05191  -0.03972 0.03048  99  LEU A CA  
788  C C   . LEU A 99  ? 0.54637 0.55824 0.38093 0.04952  -0.03731 0.02504  99  LEU A C   
789  O O   . LEU A 99  ? 0.61028 0.63331 0.43224 0.05065  -0.04247 0.02264  99  LEU A O   
790  C CB  . LEU A 99  ? 0.36305 0.36017 0.20992 0.05581  -0.03235 0.04276  99  LEU A CB  
791  C CG  . LEU A 99  ? 0.47506 0.47438 0.30897 0.06321  -0.03308 0.05604  99  LEU A CG  
792  C CD1 . LEU A 99  ? 0.52777 0.52517 0.34472 0.06080  -0.02708 0.05917  99  LEU A CD1 
793  C CD2 . LEU A 99  ? 0.45221 0.43695 0.29258 0.06901  -0.02809 0.06705  99  LEU A CD2 
794  N N   . ASN A 100 ? 0.43580 0.43959 0.27292 0.04618  -0.02918 0.02252  100 ASN A N   
795  C CA  . ASN A 100 ? 0.50613 0.51379 0.33363 0.04474  -0.02456 0.01657  100 ASN A CA  
796  C C   . ASN A 100 ? 0.55370 0.55693 0.37772 0.04314  -0.01403 0.02440  100 ASN A C   
797  O O   . ASN A 100 ? 0.59002 0.58377 0.42304 0.04097  -0.01015 0.03034  100 ASN A O   
798  C CB  . ASN A 100 ? 0.55940 0.56581 0.39719 0.04235  -0.02503 0.00404  100 ASN A CB  
799  C CG  . ASN A 100 ? 0.57566 0.58127 0.42197 0.04117  -0.03390 -0.00176 100 ASN A CG  
800  O OD1 . ASN A 100 ? 0.64324 0.65513 0.48243 0.04101  -0.04047 -0.00655 100 ASN A OD1 
801  N ND2 . ASN A 100 ? 0.58055 0.57985 0.44162 0.03913  -0.03401 -0.00150 100 ASN A ND2 
802  N N   . VAL A 101 ? 0.55862 0.56918 0.36913 0.04315  -0.00876 0.02344  101 VAL A N   
803  C CA  . VAL A 101 ? 0.51733 0.52661 0.32259 0.04017  0.00219  0.03193  101 VAL A CA  
804  C C   . VAL A 101 ? 0.59662 0.61753 0.39833 0.03904  0.00915  0.02320  101 VAL A C   
805  O O   . VAL A 101 ? 0.74202 0.77201 0.52819 0.04206  0.00814  0.01803  101 VAL A O   
806  C CB  . VAL A 101 ? 0.52980 0.53753 0.31681 0.04282  0.00328  0.04633  101 VAL A CB  
807  C CG1 . VAL A 101 ? 0.61508 0.61847 0.39783 0.03759  0.01599  0.05614  101 VAL A CG1 
808  C CG2 . VAL A 101 ? 0.41802 0.41630 0.20949 0.04713  -0.00380 0.05487  101 VAL A CG2 
809  N N   . TRP A 102 ? 0.54922 0.57197 0.36511 0.03485  0.01643  0.02109  102 TRP A N   
810  C CA  . TRP A 102 ? 0.50837 0.54526 0.32388 0.03434  0.02568  0.01523  102 TRP A CA  
811  C C   . TRP A 102 ? 0.44643 0.48607 0.25813 0.02755  0.03717  0.02666  102 TRP A C   
812  O O   . TRP A 102 ? 0.44108 0.46986 0.26052 0.02153  0.03856  0.03518  102 TRP A O   
813  C CB  . TRP A 102 ? 0.50331 0.54584 0.34039 0.03498  0.02581  0.00535  102 TRP A CB  
814  C CG  . TRP A 102 ? 0.47869 0.51652 0.32056 0.04096  0.01673  -0.00540 102 TRP A CG  
815  C CD1 . TRP A 102 ? 0.48838 0.53087 0.32810 0.04713  0.01734  -0.01758 102 TRP A CD1 
816  C CD2 . TRP A 102 ? 0.52004 0.54602 0.37009 0.04072  0.00691  -0.00512 102 TRP A CD2 
817  N NE1 . TRP A 102 ? 0.52695 0.55856 0.37309 0.04985  0.00814  -0.02413 102 TRP A NE1 
818  C CE2 . TRP A 102 ? 0.55134 0.57452 0.40387 0.04565  0.00169  -0.01606 102 TRP A CE2 
819  C CE3 . TRP A 102 ? 0.54175 0.55856 0.39712 0.03672  0.00307  0.00285  102 TRP A CE3 
820  C CZ2 . TRP A 102 ? 0.50033 0.51319 0.36053 0.04541  -0.00718 -0.01757 102 TRP A CZ2 
821  C CZ3 . TRP A 102 ? 0.46446 0.47354 0.32723 0.03766  -0.00550 0.00030  102 TRP A CZ3 
822  C CH2 . TRP A 102 ? 0.44091 0.44877 0.30610 0.04135  -0.01054 -0.00902 102 TRP A CH2 
823  N N   . THR A 103 ? 0.46665 0.51992 0.26581 0.02772  0.04627  0.02639  103 THR A N   
824  C CA  . THR A 103 ? 0.44370 0.50183 0.23903 0.01978  0.05915  0.03755  103 THR A CA  
825  C C   . THR A 103 ? 0.47705 0.55834 0.27241 0.02044  0.07008  0.02963  103 THR A C   
826  O O   . THR A 103 ? 0.55636 0.64593 0.34430 0.02866  0.06794  0.01747  103 THR A O   
827  C CB  . THR A 103 ? 0.46871 0.51714 0.23958 0.01920  0.06069  0.05337  103 THR A CB  
828  O OG1 . THR A 103 ? 0.73249 0.79516 0.48080 0.02415  0.06322  0.05033  103 THR A OG1 
829  C CG2 . THR A 103 ? 0.48598 0.51599 0.25351 0.02393  0.04827  0.05906  103 THR A CG2 
830  N N   . PRO A 104 ? 0.49136 0.58380 0.29566 0.01155  0.08260  0.03536  104 PRO A N   
831  C CA  . PRO A 104 ? 0.54666 0.66469 0.34934 0.01223  0.09560  0.02986  104 PRO A CA  
832  C C   . PRO A 104 ? 0.58382 0.70598 0.35557 0.01827  0.09836  0.02945  104 PRO A C   
833  O O   . PRO A 104 ? 0.58891 0.69607 0.33934 0.01862  0.09246  0.03958  104 PRO A O   
834  C CB  . PRO A 104 ? 0.51021 0.63487 0.32117 -0.00190 0.10844  0.04215  104 PRO A CB  
835  C CG  . PRO A 104 ? 0.49596 0.60286 0.32491 -0.00893 0.10067  0.04583  104 PRO A CG  
836  C CD  . PRO A 104 ? 0.45315 0.53619 0.27146 -0.00038 0.08576  0.04538  104 PRO A CD  
837  N N   . TYR A 105 ? 0.53908 0.68260 0.30778 0.02378  0.10698  0.01745  105 TYR A N   
838  C CA  . TYR A 105 ? 0.56016 0.71036 0.29721 0.02893  0.11035  0.01406  105 TYR A CA  
839  C C   . TYR A 105 ? 0.67905 0.85529 0.41294 0.02527  0.12976  0.01511  105 TYR A C   
840  O O   . TYR A 105 ? 0.78744 0.98236 0.54315 0.02886  0.13741  0.00299  105 TYR A O   
841  C CB  . TYR A 105 ? 0.59196 0.73996 0.32471 0.04052  0.10149  -0.00641 105 TYR A CB  
842  C CG  . TYR A 105 ? 0.68008 0.83950 0.38072 0.04501  0.10691  -0.01490 105 TYR A CG  
843  C CD1 . TYR A 105 ? 0.70499 0.85519 0.37719 0.04600  0.09600  -0.01300 105 TYR A CD1 
844  C CD2 . TYR A 105 ? 0.74767 0.92980 0.44629 0.04833  0.12296  -0.02544 105 TYR A CD2 
845  C CE1 . TYR A 105 ? 0.74330 0.90609 0.38338 0.04898  0.10012  -0.02189 105 TYR A CE1 
846  C CE2 . TYR A 105 ? 0.69852 0.89164 0.36491 0.05205  0.12880  -0.03491 105 TYR A CE2 
847  C CZ  . TYR A 105 ? 0.69399 0.87682 0.33022 0.05179  0.11672  -0.03342 105 TYR A CZ  
848  O OH  . TYR A 105 ? 0.80905 1.00420 0.41088 0.05428  0.12112  -0.04341 105 TYR A OH  
849  N N   . PRO A 106 ? 0.68657 0.86674 0.39479 0.01868  0.13890  0.03023  106 PRO A N   
850  C CA  . PRO A 106 ? 0.69791 0.85854 0.38040 0.01571  0.13143  0.04816  106 PRO A CA  
851  C C   . PRO A 106 ? 0.70534 0.84223 0.40558 0.00854  0.12463  0.06261  106 PRO A C   
852  O O   . PRO A 106 ? 0.67939 0.81927 0.40820 0.00167  0.12960  0.06135  106 PRO A O   
853  C CB  . PRO A 106 ? 0.69028 0.86591 0.34773 0.00915  0.14817  0.06210  106 PRO A CB  
854  C CG  . PRO A 106 ? 0.67149 0.87093 0.35287 0.00348  0.16508  0.05614  106 PRO A CG  
855  C CD  . PRO A 106 ? 0.61870 0.82634 0.32193 0.01442  0.15916  0.03150  106 PRO A CD  
856  N N   . ARG A 107 ? 0.71371 0.82926 0.39817 0.01063  0.11337  0.07484  107 ARG A N   
857  C CA  . ARG A 107 ? 0.70805 0.79877 0.40762 0.00515  0.10828  0.08761  107 ARG A CA  
858  C C   . ARG A 107 ? 0.85300 0.94187 0.55775 -0.00865 0.12423  0.10317  107 ARG A C   
859  O O   . ARG A 107 ? 0.98378 1.08497 0.66947 -0.01289 0.13722  0.11272  107 ARG A O   
860  C CB  . ARG A 107 ? 0.63500 0.70616 0.31555 0.01159  0.09574  0.10010  107 ARG A CB  
861  C CG  . ARG A 107 ? 0.67282 0.74863 0.34485 0.02298  0.08003  0.08630  107 ARG A CG  
862  C CD  . ARG A 107 ? 0.72739 0.78542 0.39066 0.02851  0.06708  0.09998  107 ARG A CD  
863  N NE  . ARG A 107 ? 0.79392 0.85670 0.42446 0.03155  0.06794  0.11661  107 ARG A NE  
864  C CZ  . ARG A 107 ? 0.89620 0.97910 0.50140 0.03614  0.06456  0.10970  107 ARG A CZ  
865  N NH1 . ARG A 107 ? 0.92370 1.02005 0.53379 0.03839  0.06045  0.08525  107 ARG A NH1 
866  N NH2 . ARG A 107 ? 0.87227 0.96068 0.44620 0.03856  0.06510  0.12733  107 ARG A NH2 
867  N N   . PRO A 108 ? 0.92855 1.00245 0.65818 -0.01710 0.12399  0.10550  108 PRO A N   
868  C CA  . PRO A 108 ? 0.97597 1.05369 0.71847 -0.03325 0.13968  0.11370  108 PRO A CA  
869  C C   . PRO A 108 ? 1.01588 1.07726 0.73569 -0.04088 0.15011  0.13800  108 PRO A C   
870  O O   . PRO A 108 ? 0.98463 1.02699 0.68109 -0.03303 0.14359  0.15118  108 PRO A O   
871  C CB  . PRO A 108 ? 0.95443 1.01671 0.72587 -0.03974 0.13324  0.10817  108 PRO A CB  
872  C CG  . PRO A 108 ? 0.80501 0.84818 0.57282 -0.02671 0.11558  0.10369  108 PRO A CG  
873  C CD  . PRO A 108 ? 0.77949 0.83838 0.52947 -0.01309 0.10970  0.09595  108 PRO A CD  
874  N N   . ALA A 109 ? 1.09049 1.16110 0.81893 -0.05682 0.16688  0.14474  109 ALA A N   
875  C CA  . ALA A 109 ? 1.16437 1.22160 0.87179 -0.06658 0.18044  0.16897  109 ALA A CA  
876  C C   . ALA A 109 ? 1.15127 1.16670 0.86432 -0.07468 0.17911  0.18338  109 ALA A C   
877  O O   . ALA A 109 ? 1.12464 1.11323 0.81431 -0.06969 0.17787  0.20321  109 ALA A O   
878  C CB  . ALA A 109 ? 1.20033 1.28641 0.91618 -0.08198 0.20044  0.16989  109 ALA A CB  
879  N N   . SER A 110 ? 1.10371 1.11364 0.84749 -0.08694 0.17961  0.17345  110 SER A N   
880  C CA  . SER A 110 ? 0.98914 0.95940 0.74265 -0.09487 0.17752  0.17994  110 SER A CA  
881  C C   . SER A 110 ? 0.92851 0.88350 0.68707 -0.07927 0.15860  0.16898  110 SER A C   
882  O O   . SER A 110 ? 0.87987 0.85827 0.64397 -0.06752 0.14768  0.15241  110 SER A O   
883  C CB  . SER A 110 ? 0.98556 0.96290 0.76915 -0.11670 0.18613  0.17087  110 SER A CB  
884  O OG  . SER A 110 ? 1.06237 1.06429 0.84671 -0.13174 0.20382  0.17762  110 SER A OG  
885  N N   . PRO A 111 ? 0.88676 0.80173 0.64423 -0.07878 0.15524  0.17769  111 PRO A N   
886  C CA  . PRO A 111 ? 0.87479 0.77749 0.64040 -0.06548 0.13884  0.16618  111 PRO A CA  
887  C C   . PRO A 111 ? 0.86160 0.77795 0.65607 -0.07383 0.13440  0.14396  111 PRO A C   
888  O O   . PRO A 111 ? 0.88758 0.79672 0.69772 -0.09193 0.14248  0.14117  111 PRO A O   
889  C CB  . PRO A 111 ? 0.80773 0.66380 0.56585 -0.06426 0.14055  0.18231  111 PRO A CB  
890  C CG  . PRO A 111 ? 0.72251 0.56565 0.46319 -0.07356 0.15610  0.20529  111 PRO A CG  
891  C CD  . PRO A 111 ? 0.75062 0.62825 0.49910 -0.08952 0.16720  0.19881  111 PRO A CD  
892  N N   . THR A 112 ? 0.76628 0.70263 0.56714 -0.06111 0.12111  0.12847  112 THR A N   
893  C CA  . THR A 112 ? 0.71819 0.67589 0.54317 -0.06459 0.11494  0.10837  112 THR A CA  
894  C C   . THR A 112 ? 0.68983 0.62717 0.52380 -0.05996 0.10361  0.10011  112 THR A C   
895  O O   . THR A 112 ? 0.71208 0.63396 0.53467 -0.04565 0.09528  0.10415  112 THR A O   
896  C CB  . THR A 112 ? 0.75780 0.74943 0.58220 -0.05267 0.10907  0.09786  112 THR A CB  
897  O OG1 . THR A 112 ? 0.91552 0.92600 0.72833 -0.05551 0.12080  0.10519  112 THR A OG1 
898  C CG2 . THR A 112 ? 0.66793 0.68328 0.51773 -0.05561 0.10409  0.08010  112 THR A CG2 
899  N N   . PRO A 113 ? 0.59345 0.53370 0.44772 -0.07226 0.10330  0.08837  113 PRO A N   
900  C CA  . PRO A 113 ? 0.50157 0.42553 0.36330 -0.06875 0.09345  0.07892  113 PRO A CA  
901  C C   . PRO A 113 ? 0.58274 0.52150 0.44396 -0.05143 0.07996  0.07087  113 PRO A C   
902  O O   . PRO A 113 ? 0.65245 0.62029 0.51795 -0.04693 0.07706  0.06466  113 PRO A O   
903  C CB  . PRO A 113 ? 0.61096 0.54772 0.49351 -0.08639 0.09532  0.06644  113 PRO A CB  
904  C CG  . PRO A 113 ? 0.60271 0.54964 0.48822 -0.10218 0.10882  0.07329  113 PRO A CG  
905  C CD  . PRO A 113 ? 0.60394 0.56478 0.47498 -0.09097 0.11225  0.08344  113 PRO A CD  
906  N N   . VAL A 114 ? 0.59416 0.51192 0.45126 -0.04194 0.07252  0.07065  114 VAL A N   
907  C CA  . VAL A 114 ? 0.59928 0.52637 0.45468 -0.02646 0.06029  0.06517  114 VAL A CA  
908  C C   . VAL A 114 ? 0.63957 0.57148 0.50977 -0.02858 0.05294  0.05130  114 VAL A C   
909  O O   . VAL A 114 ? 0.71665 0.63233 0.59238 -0.03718 0.05545  0.04781  114 VAL A O   
910  C CB  . VAL A 114 ? 0.57676 0.48242 0.41821 -0.01371 0.05717  0.07600  114 VAL A CB  
911  C CG1 . VAL A 114 ? 0.52045 0.43980 0.36027 0.00026  0.04496  0.07085  114 VAL A CG1 
912  C CG2 . VAL A 114 ? 0.63502 0.53388 0.45972 -0.01283 0.06498  0.09241  114 VAL A CG2 
913  N N   . LEU A 115 ? 0.58177 0.53476 0.45699 -0.02100 0.04424  0.04335  115 LEU A N   
914  C CA  . LEU A 115 ? 0.45944 0.41805 0.34552 -0.02042 0.03612  0.03275  115 LEU A CA  
915  C C   . LEU A 115 ? 0.47583 0.43105 0.35662 -0.00688 0.02726  0.03263  115 LEU A C   
916  O O   . LEU A 115 ? 0.61559 0.58144 0.49112 0.00131  0.02378  0.03361  115 LEU A O   
917  C CB  . LEU A 115 ? 0.53000 0.51676 0.42891 -0.02342 0.03359  0.02474  115 LEU A CB  
918  C CG  . LEU A 115 ? 0.58527 0.58634 0.49728 -0.03784 0.03840  0.02051  115 LEU A CG  
919  C CD1 . LEU A 115 ? 0.60284 0.63510 0.52729 -0.03416 0.03477  0.01517  115 LEU A CD1 
920  C CD2 . LEU A 115 ? 0.63353 0.62533 0.55046 -0.04617 0.03538  0.01413  115 LEU A CD2 
921  N N   . ILE A 116 ? 0.43699 0.37898 0.31960 -0.00541 0.02406  0.03017  116 ILE A N   
922  C CA  . ILE A 116 ? 0.49386 0.43461 0.37428 0.00571  0.01640  0.03009  116 ILE A CA  
923  C C   . ILE A 116 ? 0.52622 0.47714 0.41586 0.00444  0.01014  0.02088  116 ILE A C   
924  O O   . ILE A 116 ? 0.48597 0.43158 0.37980 -0.00223 0.01175  0.01602  116 ILE A O   
925  C CB  . ILE A 116 ? 0.51346 0.43279 0.38914 0.01075  0.01871  0.03608  116 ILE A CB  
926  C CG1 . ILE A 116 ? 0.50075 0.40712 0.36621 0.01212  0.02538  0.04807  116 ILE A CG1 
927  C CG2 . ILE A 116 ? 0.39083 0.31535 0.26669 0.02172  0.01088  0.03647  116 ILE A CG2 
928  C CD1 . ILE A 116 ? 0.45879 0.34308 0.32080 0.01994  0.02766  0.05575  116 ILE A CD1 
929  N N   . TRP A 117 ? 0.50744 0.47132 0.39871 0.01060  0.00322  0.01861  117 TRP A N   
930  C CA  . TRP A 117 ? 0.49050 0.46312 0.38915 0.01050  -0.00283 0.01264  117 TRP A CA  
931  C C   . TRP A 117 ? 0.54861 0.51556 0.44678 0.01561  -0.00706 0.01280  117 TRP A C   
932  O O   . TRP A 117 ? 0.67889 0.64420 0.57335 0.02215  -0.00946 0.01620  117 TRP A O   
933  C CB  . TRP A 117 ? 0.44691 0.43346 0.34868 0.01418  -0.00675 0.01033  117 TRP A CB  
934  C CG  . TRP A 117 ? 0.48523 0.47781 0.39365 0.01536  -0.01302 0.00695  117 TRP A CG  
935  C CD1 . TRP A 117 ? 0.47554 0.46688 0.38393 0.02056  -0.01849 0.00640  117 TRP A CD1 
936  C CD2 . TRP A 117 ? 0.49108 0.49206 0.40635 0.01043  -0.01449 0.00467  117 TRP A CD2 
937  N NE1 . TRP A 117 ? 0.54442 0.54035 0.45874 0.01968  -0.02239 0.00539  117 TRP A NE1 
938  C CE2 . TRP A 117 ? 0.54159 0.54485 0.45952 0.01424  -0.02060 0.00466  117 TRP A CE2 
939  C CE3 . TRP A 117 ? 0.46062 0.46846 0.37972 0.00217  -0.01159 0.00275  117 TRP A CE3 
940  C CZ2 . TRP A 117 ? 0.45433 0.46697 0.37706 0.01176  -0.02416 0.00451  117 TRP A CZ2 
941  C CZ3 . TRP A 117 ? 0.43495 0.45479 0.35953 -0.00100 -0.01605 0.00074  117 TRP A CZ3 
942  C CH2 . TRP A 117 ? 0.43527 0.45760 0.36082 0.00460  -0.02240 0.00246  117 TRP A CH2 
943  N N   . ILE A 118 ? 0.54136 0.50865 0.44340 0.01217  -0.00815 0.00893  118 ILE A N   
944  C CA  . ILE A 118 ? 0.50737 0.47339 0.41061 0.01600  -0.01103 0.00866  118 ILE A CA  
945  C C   . ILE A 118 ? 0.59311 0.56971 0.50038 0.01410  -0.01625 0.00622  118 ILE A C   
946  O O   . ILE A 118 ? 0.53378 0.51440 0.44168 0.00849  -0.01588 0.00325  118 ILE A O   
947  C CB  . ILE A 118 ? 0.40010 0.35507 0.30201 0.01456  -0.00558 0.00677  118 ILE A CB  
948  C CG1 . ILE A 118 ? 0.35320 0.29308 0.25108 0.01586  0.00076  0.01044  118 ILE A CG1 
949  C CG2 . ILE A 118 ? 0.40966 0.36648 0.31428 0.02047  -0.00720 0.00756  118 ILE A CG2 
950  C CD1 . ILE A 118 ? 0.34112 0.26525 0.23827 0.01811  0.00700  0.00893  118 ILE A CD1 
951  N N   . TYR A 119 ? 0.47131 0.45195 0.38059 0.01819  -0.02124 0.00771  119 TYR A N   
952  C CA  . TYR A 119 ? 0.46121 0.44798 0.37397 0.01693  -0.02562 0.00750  119 TYR A CA  
953  C C   . TYR A 119 ? 0.61636 0.60473 0.52895 0.01374  -0.02519 0.00759  119 TYR A C   
954  O O   . TYR A 119 ? 0.58200 0.56724 0.49364 0.01417  -0.02181 0.00685  119 TYR A O   
955  C CB  . TYR A 119 ? 0.46000 0.44624 0.37473 0.02049  -0.03005 0.00816  119 TYR A CB  
956  C CG  . TYR A 119 ? 0.54775 0.53296 0.46301 0.02186  -0.03131 0.00881  119 TYR A CG  
957  C CD1 . TYR A 119 ? 0.63218 0.62003 0.55107 0.01957  -0.03154 0.01019  119 TYR A CD1 
958  C CD2 . TYR A 119 ? 0.50829 0.49334 0.42067 0.02529  -0.03246 0.00832  119 TYR A CD2 
959  C CE1 . TYR A 119 ? 0.68259 0.67462 0.60531 0.02070  -0.03283 0.01080  119 TYR A CE1 
960  C CE2 . TYR A 119 ? 0.62253 0.61166 0.53700 0.02665  -0.03509 0.00919  119 TYR A CE2 
961  C CZ  . TYR A 119 ? 0.67621 0.66969 0.59742 0.02441  -0.03531 0.01029  119 TYR A CZ  
962  O OH  . TYR A 119 ? 0.55884 0.56123 0.48513 0.02581  -0.03808 0.01119  119 TYR A OH  
963  N N   . GLY A 120 ? 0.63870 0.63295 0.55201 0.01152  -0.02831 0.00908  120 GLY A N   
964  C CA  . GLY A 120 ? 0.58944 0.58749 0.50017 0.00807  -0.02803 0.01025  120 GLY A CA  
965  C C   . GLY A 120 ? 0.64537 0.64284 0.55892 0.00891  -0.03090 0.01510  120 GLY A C   
966  O O   . GLY A 120 ? 0.71343 0.70613 0.63121 0.01163  -0.03296 0.01561  120 GLY A O   
967  N N   . GLY A 121 ? 0.73092 0.73336 0.64109 0.00535  -0.03080 0.01848  121 GLY A N   
968  C CA  . GLY A 121 ? 0.61621 0.61723 0.52885 0.00392  -0.03205 0.02429  121 GLY A CA  
969  C C   . GLY A 121 ? 0.50900 0.51624 0.41990 0.00014  -0.02692 0.02429  121 GLY A C   
970  O O   . GLY A 121 ? 0.47884 0.48662 0.39599 -0.00126 -0.02590 0.02605  121 GLY A O   
971  N N   . GLY A 122 ? 0.40230 0.41573 0.30523 -0.00201 -0.02322 0.02108  122 GLY A N   
972  C CA  . GLY A 122 ? 0.43716 0.45838 0.33607 -0.00536 -0.01706 0.02057  122 GLY A CA  
973  C C   . GLY A 122 ? 0.49263 0.51579 0.39989 -0.00275 -0.01148 0.01690  122 GLY A C   
974  O O   . GLY A 122 ? 0.57536 0.60768 0.48279 -0.00505 -0.00581 0.01764  122 GLY A O   
975  N N   . PHE A 123 ? 0.50309 0.52011 0.41752 0.00255  -0.01288 0.01379  123 PHE A N   
976  C CA  . PHE A 123 ? 0.44479 0.46586 0.36916 0.00723  -0.00970 0.01210  123 PHE A CA  
977  C C   . PHE A 123 ? 0.45580 0.48599 0.39045 0.00421  -0.01195 0.01711  123 PHE A C   
978  O O   . PHE A 123 ? 0.36027 0.39986 0.30567 0.00750  -0.01033 0.01639  123 PHE A O   
979  C CB  . PHE A 123 ? 0.37764 0.40272 0.30024 0.00989  -0.00056 0.00662  123 PHE A CB  
980  C CG  . PHE A 123 ? 0.47487 0.48762 0.38933 0.01215  0.00243  -0.00013 123 PHE A CG  
981  C CD1 . PHE A 123 ? 0.48710 0.48989 0.40576 0.01905  0.00283  -0.00138 123 PHE A CD1 
982  C CD2 . PHE A 123 ? 0.52956 0.54085 0.43153 0.00630  0.00452  -0.00478 123 PHE A CD2 
983  C CE1 . PHE A 123 ? 0.53614 0.52468 0.44770 0.01928  0.00662  -0.00708 123 PHE A CE1 
984  C CE2 . PHE A 123 ? 0.49983 0.49939 0.39513 0.00572  0.00736  -0.01240 123 PHE A CE2 
985  C CZ  . PHE A 123 ? 0.53592 0.52261 0.43647 0.01175  0.00903  -0.01350 123 PHE A CZ  
986  N N   . TYR A 124 ? 0.53195 0.55968 0.46465 -0.00206 -0.01578 0.02248  124 TYR A N   
987  C CA  . TYR A 124 ? 0.51536 0.54735 0.45769 -0.00752 -0.01809 0.02670  124 TYR A CA  
988  C C   . TYR A 124 ? 0.53223 0.55230 0.47652 -0.00782 -0.02583 0.02663  124 TYR A C   
989  O O   . TYR A 124 ? 0.63707 0.65754 0.58907 -0.01367 -0.02835 0.02811  124 TYR A O   
990  C CB  . TYR A 124 ? 0.43952 0.47444 0.37780 -0.01550 -0.01481 0.03392  124 TYR A CB  
991  C CG  . TYR A 124 ? 0.41333 0.43436 0.34204 -0.01679 -0.01944 0.03952  124 TYR A CG  
992  C CD1 . TYR A 124 ? 0.44521 0.45424 0.37804 -0.02055 -0.02401 0.04450  124 TYR A CD1 
993  C CD2 . TYR A 124 ? 0.40813 0.42821 0.32463 -0.01382 -0.01947 0.03930  124 TYR A CD2 
994  C CE1 . TYR A 124 ? 0.40550 0.40111 0.33140 -0.01885 -0.02798 0.05044  124 TYR A CE1 
995  C CE2 . TYR A 124 ? 0.36621 0.37768 0.27633 -0.01311 -0.02467 0.04550  124 TYR A CE2 
996  C CZ  . TYR A 124 ? 0.39037 0.38924 0.30573 -0.01436 -0.02864 0.05167  124 TYR A CZ  
997  O OH  . TYR A 124 ? 0.35306 0.34274 0.26412 -0.01099 -0.03334 0.05849  124 TYR A OH  
998  N N   . SER A 125 ? 0.45705 0.46686 0.39471 -0.00262 -0.02894 0.02413  125 SER A N   
999  C CA  . SER A 125 ? 0.45310 0.45130 0.39108 -0.00222 -0.03469 0.02325  125 SER A CA  
1000 C C   . SER A 125 ? 0.40430 0.39834 0.33723 0.00478  -0.03596 0.01888  125 SER A C   
1001 O O   . SER A 125 ? 0.35046 0.34817 0.27985 0.00787  -0.03261 0.01736  125 SER A O   
1002 C CB  . SER A 125 ? 0.49282 0.48064 0.42772 -0.00544 -0.03601 0.02948  125 SER A CB  
1003 O OG  . SER A 125 ? 0.46489 0.45464 0.39175 -0.00295 -0.03461 0.03277  125 SER A OG  
1004 N N   . GLY A 126 ? 0.44818 0.43362 0.38062 0.00664  -0.03985 0.01634  126 GLY A N   
1005 C CA  . GLY A 126 ? 0.48814 0.47117 0.41590 0.01245  -0.04001 0.01287  126 GLY A CA  
1006 C C   . GLY A 126 ? 0.53241 0.51528 0.45950 0.01462  -0.04252 0.00785  126 GLY A C   
1007 O O   . GLY A 126 ? 0.59849 0.58721 0.52937 0.01217  -0.04460 0.00670  126 GLY A O   
1008 N N   . ALA A 127 ? 0.57299 0.55215 0.49524 0.01893  -0.04241 0.00482  127 ALA A N   
1009 C CA  . ALA A 127 ? 0.56810 0.54869 0.48581 0.02121  -0.04425 0.00010  127 ALA A CA  
1010 C C   . ALA A 127 ? 0.59990 0.58020 0.51162 0.02589  -0.04084 -0.00071 127 ALA A C   
1011 O O   . ALA A 127 ? 0.63208 0.60998 0.54556 0.02728  -0.03885 -0.00035 127 ALA A O   
1012 C CB  . ALA A 127 ? 0.41548 0.38950 0.33337 0.01873  -0.04812 -0.00604 127 ALA A CB  
1013 N N   . ALA A 128 ? 0.47290 0.45755 0.37813 0.02828  -0.04016 -0.00076 128 ALA A N   
1014 C CA  . ALA A 128 ? 0.51242 0.49759 0.41167 0.03118  -0.03561 -0.00053 128 ALA A CA  
1015 C C   . ALA A 128 ? 0.52364 0.50767 0.41884 0.03350  -0.03549 -0.00709 128 ALA A C   
1016 O O   . ALA A 128 ? 0.68467 0.67178 0.57632 0.03581  -0.03061 -0.00747 128 ALA A O   
1017 C CB  . ALA A 128 ? 0.54612 0.53432 0.43817 0.03323  -0.03392 0.00397  128 ALA A CB  
1018 N N   . SER A 129 ? 0.35988 0.33907 0.25635 0.03240  -0.03975 -0.01286 129 SER A N   
1019 C CA  . SER A 129 ? 0.43342 0.40849 0.32475 0.03495  -0.03922 -0.02178 129 SER A CA  
1020 C C   . SER A 129 ? 0.46911 0.43459 0.36858 0.03775  -0.03775 -0.02429 129 SER A C   
1021 O O   . SER A 129 ? 0.48600 0.44443 0.38260 0.04090  -0.03661 -0.03297 129 SER A O   
1022 C CB  . SER A 129 ? 0.47720 0.45127 0.36293 0.03109  -0.04496 -0.02880 129 SER A CB  
1023 O OG  . SER A 129 ? 0.39536 0.36387 0.29016 0.02537  -0.04936 -0.02825 129 SER A OG  
1024 N N   . LEU A 130 ? 0.51608 0.48079 0.42481 0.03732  -0.03782 -0.01702 130 LEU A N   
1025 C CA  . LEU A 130 ? 0.46579 0.42332 0.38242 0.04188  -0.03710 -0.01637 130 LEU A CA  
1026 C C   . LEU A 130 ? 0.51173 0.47721 0.42999 0.04943  -0.03195 -0.01882 130 LEU A C   
1027 O O   . LEU A 130 ? 0.65506 0.63276 0.56940 0.04892  -0.02836 -0.01839 130 LEU A O   
1028 C CB  . LEU A 130 ? 0.54402 0.50369 0.46757 0.03946  -0.03895 -0.00670 130 LEU A CB  
1029 C CG  . LEU A 130 ? 0.47862 0.43623 0.40164 0.03174  -0.04199 -0.00301 130 LEU A CG  
1030 C CD1 . LEU A 130 ? 0.45765 0.42058 0.38423 0.02983  -0.04222 0.00550  130 LEU A CD1 
1031 C CD2 . LEU A 130 ? 0.55174 0.49474 0.47619 0.02877  -0.04462 -0.00617 130 LEU A CD2 
1032 N N   . ASP A 131 ? 0.51655 0.47508 0.44188 0.05676  -0.03095 -0.02057 131 ASP A N   
1033 C CA  . ASP A 131 ? 0.43943 0.40765 0.36877 0.06552  -0.02526 -0.02434 131 ASP A CA  
1034 C C   . ASP A 131 ? 0.58574 0.57459 0.52304 0.06542  -0.02381 -0.01675 131 ASP A C   
1035 O O   . ASP A 131 ? 0.63713 0.64090 0.57555 0.06761  -0.01813 -0.01928 131 ASP A O   
1036 C CB  . ASP A 131 ? 0.41121 0.36579 0.34814 0.07556  -0.02431 -0.02771 131 ASP A CB  
1037 C CG  . ASP A 131 ? 0.63826 0.57420 0.56605 0.07599  -0.02274 -0.04057 131 ASP A CG  
1038 O OD1 . ASP A 131 ? 0.61860 0.53783 0.55136 0.08425  -0.02076 -0.04543 131 ASP A OD1 
1039 O OD2 . ASP A 131 ? 0.77728 0.71531 0.69258 0.06822  -0.02360 -0.04603 131 ASP A OD2 
1040 N N   . VAL A 132 ? 0.61286 0.60408 0.55516 0.06165  -0.02852 -0.00802 132 VAL A N   
1041 C CA  . VAL A 132 ? 0.46365 0.47510 0.41280 0.05929  -0.02821 -0.00248 132 VAL A CA  
1042 C C   . VAL A 132 ? 0.48030 0.49889 0.42231 0.05025  -0.02499 -0.00322 132 VAL A C   
1043 O O   . VAL A 132 ? 0.50899 0.54317 0.45615 0.04604  -0.02353 -0.00073 132 VAL A O   
1044 C CB  . VAL A 132 ? 0.43506 0.44715 0.38791 0.05693  -0.03438 0.00604  132 VAL A CB  
1045 C CG1 . VAL A 132 ? 0.47403 0.48203 0.43592 0.06765  -0.03709 0.01018  132 VAL A CG1 
1046 C CG2 . VAL A 132 ? 0.39496 0.39234 0.33842 0.04922  -0.03703 0.00751  132 VAL A CG2 
1047 N N   . TYR A 133 ? 0.41540 0.42309 0.34605 0.04696  -0.02405 -0.00625 133 TYR A N   
1048 C CA  . TYR A 133 ? 0.53826 0.54924 0.46148 0.04040  -0.02062 -0.00503 133 TYR A CA  
1049 C C   . TYR A 133 ? 0.60128 0.61588 0.51728 0.04271  -0.01469 -0.00902 133 TYR A C   
1050 O O   . TYR A 133 ? 0.68446 0.69687 0.59052 0.03891  -0.01244 -0.00703 133 TYR A O   
1051 C CB  . TYR A 133 ? 0.58024 0.58003 0.49622 0.03600  -0.02416 -0.00294 133 TYR A CB  
1052 C CG  . TYR A 133 ? 0.59692 0.59407 0.51757 0.03298  -0.02850 0.00082  133 TYR A CG  
1053 C CD1 . TYR A 133 ? 0.57957 0.58592 0.50723 0.03157  -0.02913 0.00352  133 TYR A CD1 
1054 C CD2 . TYR A 133 ? 0.60425 0.59276 0.52215 0.03108  -0.03199 0.00171  133 TYR A CD2 
1055 C CE1 . TYR A 133 ? 0.58197 0.58749 0.51070 0.02858  -0.03286 0.00720  133 TYR A CE1 
1056 C CE2 . TYR A 133 ? 0.59421 0.58191 0.51513 0.02796  -0.03453 0.00550  133 TYR A CE2 
1057 C CZ  . TYR A 133 ? 0.55889 0.55437 0.48368 0.02685  -0.03482 0.00833  133 TYR A CZ  
1058 O OH  . TYR A 133 ? 0.46662 0.46302 0.39128 0.02350  -0.03709 0.01233  133 TYR A OH  
1059 N N   . ASP A 134 ? 0.52482 0.54517 0.44509 0.04973  -0.01159 -0.01407 134 ASP A N   
1060 C CA  . ASP A 134 ? 0.52891 0.55259 0.43972 0.05269  -0.00545 -0.01960 134 ASP A CA  
1061 C C   . ASP A 134 ? 0.53705 0.57657 0.44878 0.04835  0.00236  -0.01576 134 ASP A C   
1062 O O   . ASP A 134 ? 0.52055 0.57568 0.44612 0.04922  0.00572  -0.01502 134 ASP A O   
1063 C CB  . ASP A 134 ? 0.52520 0.54760 0.44092 0.06267  -0.00371 -0.02795 134 ASP A CB  
1064 C CG  . ASP A 134 ? 0.57069 0.59515 0.47359 0.06611  0.00280  -0.03658 134 ASP A CG  
1065 O OD1 . ASP A 134 ? 0.62519 0.66573 0.53127 0.06906  0.01120  -0.03797 134 ASP A OD1 
1066 O OD2 . ASP A 134 ? 0.77478 0.78679 0.66419 0.06539  -0.00035 -0.04269 134 ASP A OD2 
1067 N N   . GLY A 135 ? 0.52516 0.56155 0.42286 0.04333  0.00513  -0.01235 135 GLY A N   
1068 C CA  . GLY A 135 ? 0.54004 0.58689 0.43712 0.03702  0.01327  -0.00684 135 GLY A CA  
1069 C C   . GLY A 135 ? 0.50376 0.56601 0.39850 0.04006  0.02293  -0.01041 135 GLY A C   
1070 O O   . GLY A 135 ? 0.45806 0.52980 0.35195 0.03344  0.03104  -0.00504 135 GLY A O   
1071 N N   . ARG A 136 ? 0.43806 0.50237 0.33193 0.04943  0.02337  -0.01974 136 ARG A N   
1072 C CA  . ARG A 136 ? 0.43280 0.51233 0.32218 0.05324  0.03403  -0.02465 136 ARG A CA  
1073 C C   . ARG A 136 ? 0.51848 0.62139 0.42702 0.05127  0.04194  -0.02219 136 ARG A C   
1074 O O   . ARG A 136 ? 0.55857 0.67729 0.46331 0.04888  0.05298  -0.02137 136 ARG A O   
1075 C CB  . ARG A 136 ? 0.37600 0.45064 0.26184 0.06437  0.03361  -0.03757 136 ARG A CB  
1076 C CG  . ARG A 136 ? 0.40606 0.48837 0.31344 0.07413  0.03487  -0.04315 136 ARG A CG  
1077 C CD  . ARG A 136 ? 0.50280 0.57317 0.40417 0.08499  0.03554  -0.05677 136 ARG A CD  
1078 N NE  . ARG A 136 ? 0.61897 0.66537 0.50588 0.08151  0.02595  -0.05953 136 ARG A NE  
1079 C CZ  . ARG A 136 ? 0.68670 0.72052 0.55873 0.08486  0.02592  -0.07218 136 ARG A CZ  
1080 N NH1 . ARG A 136 ? 0.64241 0.65835 0.50408 0.07943  0.01631  -0.07402 136 ARG A NH1 
1081 N NH2 . ARG A 136 ? 0.71384 0.75428 0.58174 0.09313  0.03584  -0.08411 136 ARG A NH2 
1082 N N   . PHE A 137 ? 0.47454 0.58269 0.40348 0.05130  0.03648  -0.02043 137 PHE A N   
1083 C CA  . PHE A 137 ? 0.41916 0.55508 0.36900 0.04946  0.04255  -0.01898 137 PHE A CA  
1084 C C   . PHE A 137 ? 0.45436 0.59623 0.40519 0.03350  0.04601  -0.01060 137 PHE A C   
1085 O O   . PHE A 137 ? 0.46984 0.63365 0.42803 0.02786  0.05624  -0.00905 137 PHE A O   
1086 C CB  . PHE A 137 ? 0.36898 0.51196 0.33966 0.05631  0.03455  -0.01982 137 PHE A CB  
1087 C CG  . PHE A 137 ? 0.50482 0.63397 0.47452 0.07112  0.03050  -0.02652 137 PHE A CG  
1088 C CD1 . PHE A 137 ? 0.48362 0.62380 0.45962 0.08404  0.03824  -0.03442 137 PHE A CD1 
1089 C CD2 . PHE A 137 ? 0.48905 0.59307 0.45190 0.07184  0.01996  -0.02540 137 PHE A CD2 
1090 C CE1 . PHE A 137 ? 0.49864 0.62102 0.47376 0.09756  0.03531  -0.04162 137 PHE A CE1 
1091 C CE2 . PHE A 137 ? 0.42710 0.51505 0.38936 0.08363  0.01685  -0.03139 137 PHE A CE2 
1092 C CZ  . PHE A 137 ? 0.45629 0.55133 0.42438 0.09652  0.02444  -0.03980 137 PHE A CZ  
1093 N N   . LEU A 138 ? 0.36835 0.49045 0.31247 0.02574  0.03860  -0.00561 138 LEU A N   
1094 C CA  . LEU A 138 ? 0.50452 0.62521 0.44759 0.01053  0.04268  0.00129  138 LEU A CA  
1095 C C   . LEU A 138 ? 0.59912 0.71670 0.52581 0.00622  0.05351  0.00620  138 LEU A C   
1096 O O   . LEU A 138 ? 0.63960 0.76627 0.57019 -0.00571 0.06234  0.01130  138 LEU A O   
1097 C CB  . LEU A 138 ? 0.54463 0.64132 0.48134 0.00582  0.03384  0.00425  138 LEU A CB  
1098 C CG  . LEU A 138 ? 0.47763 0.58299 0.43084 0.00346  0.02579  0.00178  138 LEU A CG  
1099 C CD1 . LEU A 138 ? 0.48625 0.56883 0.43161 0.00098  0.01779  0.00303  138 LEU A CD1 
1100 C CD2 . LEU A 138 ? 0.37010 0.49622 0.33763 -0.00967 0.03108  0.00246  138 LEU A CD2 
1101 N N   . ALA A 139 ? 0.53926 0.64525 0.44703 0.01500  0.05308  0.00491  139 ALA A N   
1102 C CA  . ALA A 139 ? 0.50569 0.61093 0.39464 0.01213  0.06272  0.01061  139 ALA A CA  
1103 C C   . ALA A 139 ? 0.63252 0.76580 0.52837 0.01271  0.07521  0.00728  139 ALA A C   
1104 O O   . ALA A 139 ? 0.71459 0.85728 0.60957 0.00219  0.08614  0.01466  139 ALA A O   
1105 C CB  . ALA A 139 ? 0.46013 0.54975 0.32641 0.02097  0.05726  0.00900  139 ALA A CB  
1106 N N   . GLN A 140 ? 0.61831 0.76493 0.52218 0.02495  0.07475  -0.00369 140 GLN A N   
1107 C CA  . GLN A 140 ? 0.55279 0.72733 0.46262 0.02832  0.08794  -0.00828 140 GLN A CA  
1108 C C   . GLN A 140 ? 0.63512 0.83647 0.57129 0.01898  0.09423  -0.00491 140 GLN A C   
1109 O O   . GLN A 140 ? 0.66537 0.88677 0.60262 0.01150  0.10778  -0.00116 140 GLN A O   
1110 C CB  . GLN A 140 ? 0.50945 0.68884 0.42398 0.04529  0.08622  -0.02185 140 GLN A CB  
1111 C CG  . GLN A 140 ? 0.59729 0.80011 0.50928 0.05187  0.10106  -0.02896 140 GLN A CG  
1112 C CD  . GLN A 140 ? 0.65921 0.89784 0.60023 0.05045  0.11069  -0.02849 140 GLN A CD  
1113 O OE1 . GLN A 140 ? 0.68202 0.92999 0.64895 0.05310  0.10379  -0.02891 140 GLN A OE1 
1114 N NE2 . GLN A 140 ? 0.67977 0.94145 0.61661 0.04588  0.12670  -0.02696 140 GLN A NE2 
1115 N N   . VAL A 141 ? 0.61051 0.81494 0.56799 0.01842  0.08450  -0.00612 141 VAL A N   
1116 C CA  . VAL A 141 ? 0.51073 0.74767 0.49627 0.01125  0.08859  -0.00546 141 VAL A CA  
1117 C C   . VAL A 141 ? 0.52054 0.75409 0.50656 -0.01010 0.09160  0.00339  141 VAL A C   
1118 O O   . VAL A 141 ? 0.60963 0.86929 0.60901 -0.02142 0.10233  0.00595  141 VAL A O   
1119 C CB  . VAL A 141 ? 0.47550 0.72102 0.48272 0.02050  0.07642  -0.01015 141 VAL A CB  
1120 C CG1 . VAL A 141 ? 0.34342 0.62947 0.38124 0.01440  0.07946  -0.00982 141 VAL A CG1 
1121 C CG2 . VAL A 141 ? 0.54612 0.78757 0.55154 0.04163  0.07455  -0.01842 141 VAL A CG2 
1122 N N   . GLU A 142 ? 0.47843 0.67961 0.45065 -0.01630 0.08329  0.00778  142 GLU A N   
1123 C CA  . GLU A 142 ? 0.54780 0.73951 0.52021 -0.03592 0.08621  0.01477  142 GLU A CA  
1124 C C   . GLU A 142 ? 0.60085 0.76758 0.54812 -0.04225 0.09471  0.02466  142 GLU A C   
1125 O O   . GLU A 142 ? 0.62922 0.78418 0.57561 -0.05869 0.09968  0.03156  142 GLU A O   
1126 C CB  . GLU A 142 ? 0.56224 0.73502 0.53748 -0.03924 0.07295  0.01299  142 GLU A CB  
1127 C CG  . GLU A 142 ? 0.56736 0.76775 0.56812 -0.03933 0.06520  0.00648  142 GLU A CG  
1128 C CD  . GLU A 142 ? 0.66696 0.90107 0.68940 -0.05479 0.07313  0.00636  142 GLU A CD  
1129 O OE1 . GLU A 142 ? 0.73705 0.96225 0.75464 -0.07237 0.08217  0.01123  142 GLU A OE1 
1130 O OE2 . GLU A 142 ? 0.67589 0.94599 0.72146 -0.04946 0.07033  0.00190  142 GLU A OE2 
1131 N N   . GLY A 143 ? 0.61616 0.77397 0.54253 -0.02995 0.09632  0.02569  143 GLY A N   
1132 C CA  . GLY A 143 ? 0.59519 0.73226 0.49612 -0.03409 0.10316  0.03694  143 GLY A CA  
1133 C C   . GLY A 143 ? 0.59831 0.69897 0.48463 -0.03369 0.09401  0.04292  143 GLY A C   
1134 O O   . GLY A 143 ? 0.70304 0.78456 0.57038 -0.03756 0.09915  0.05484  143 GLY A O   
1135 N N   . ALA A 144 ? 0.60186 0.69336 0.49639 -0.02813 0.08110  0.03591  144 ALA A N   
1136 C CA  . ALA A 144 ? 0.56051 0.62090 0.44638 -0.02898 0.07370  0.04056  144 ALA A CA  
1137 C C   . ALA A 144 ? 0.59458 0.64032 0.46001 -0.01540 0.06698  0.04280  144 ALA A C   
1138 O O   . ALA A 144 ? 0.65098 0.70905 0.51128 -0.00505 0.06455  0.03654  144 ALA A O   
1139 C CB  . ALA A 144 ? 0.42285 0.48285 0.32594 -0.03038 0.06383  0.03214  144 ALA A CB  
1140 N N   . VAL A 145 ? 0.52083 0.54043 0.37517 -0.01568 0.06421  0.05131  145 VAL A N   
1141 C CA  . VAL A 145 ? 0.51840 0.52595 0.35811 -0.00359 0.05510  0.05313  145 VAL A CA  
1142 C C   . VAL A 145 ? 0.58486 0.58373 0.43648 -0.00063 0.04443  0.04584  145 VAL A C   
1143 O O   . VAL A 145 ? 0.60565 0.58985 0.46433 -0.00719 0.04499  0.04764  145 VAL A O   
1144 C CB  . VAL A 145 ? 0.53643 0.52365 0.35788 -0.00319 0.05851  0.06876  145 VAL A CB  
1145 C CG1 . VAL A 145 ? 0.46742 0.44757 0.27723 0.00962  0.04726  0.07035  145 VAL A CG1 
1146 C CG2 . VAL A 145 ? 0.46887 0.46476 0.27617 -0.00764 0.07052  0.07833  145 VAL A CG2 
1147 N N   . LEU A 146 ? 0.54152 0.54846 0.39463 0.00841  0.03560  0.03717  146 LEU A N   
1148 C CA  . LEU A 146 ? 0.54801 0.54900 0.41143 0.01103  0.02617  0.03105  146 LEU A CA  
1149 C C   . LEU A 146 ? 0.64145 0.63291 0.49450 0.01961  0.01808  0.03321  146 LEU A C   
1150 O O   . LEU A 146 ? 0.64040 0.63816 0.48149 0.02545  0.01604  0.03280  146 LEU A O   
1151 C CB  . LEU A 146 ? 0.46210 0.47920 0.33856 0.01354  0.02252  0.02039  146 LEU A CB  
1152 C CG  . LEU A 146 ? 0.46511 0.47684 0.35270 0.01315  0.01472  0.01639  146 LEU A CG  
1153 C CD1 . LEU A 146 ? 0.50362 0.53012 0.40745 0.00768  0.01596  0.01198  146 LEU A CD1 
1154 C CD2 . LEU A 146 ? 0.45096 0.46128 0.33695 0.02180  0.00612  0.01146  146 LEU A CD2 
1155 N N   . VAL A 147 ? 0.54992 0.52836 0.40771 0.01991  0.01376  0.03477  147 VAL A N   
1156 C CA  . VAL A 147 ? 0.48368 0.45635 0.33598 0.02764  0.00626  0.03741  147 VAL A CA  
1157 C C   . VAL A 147 ? 0.58729 0.55943 0.45191 0.02809  -0.00029 0.03024  147 VAL A C   
1158 O O   . VAL A 147 ? 0.63831 0.60282 0.51082 0.02353  0.00200  0.02939  147 VAL A O   
1159 C CB  . VAL A 147 ? 0.56021 0.51698 0.40544 0.02966  0.00951  0.04940  147 VAL A CB  
1160 C CG1 . VAL A 147 ? 0.48644 0.44321 0.32945 0.03903  0.00101  0.05230  147 VAL A CG1 
1161 C CG2 . VAL A 147 ? 0.71767 0.67345 0.54885 0.02844  0.01685  0.05928  147 VAL A CG2 
1162 N N   . SER A 148 ? 0.61610 0.59575 0.48124 0.03257  -0.00795 0.02494  148 SER A N   
1163 C CA  . SER A 148 ? 0.55167 0.53056 0.42690 0.03279  -0.01374 0.02045  148 SER A CA  
1164 C C   . SER A 148 ? 0.50911 0.49058 0.38175 0.03801  -0.02067 0.02191  148 SER A C   
1165 O O   . SER A 148 ? 0.69448 0.68298 0.55882 0.04065  -0.02430 0.02083  148 SER A O   
1166 C CB  . SER A 148 ? 0.67506 0.66061 0.55786 0.03111  -0.01624 0.01235  148 SER A CB  
1167 O OG  . SER A 148 ? 0.72360 0.71422 0.60171 0.03447  -0.01999 0.00744  148 SER A OG  
1168 N N   . MET A 149 ? 0.51728 0.49535 0.39735 0.03900  -0.02228 0.02355  149 MET A N   
1169 C CA  . MET A 149 ? 0.42797 0.41175 0.31055 0.04381  -0.02807 0.02593  149 MET A CA  
1170 C C   . MET A 149 ? 0.49469 0.48421 0.38775 0.04069  -0.03271 0.01968  149 MET A C   
1171 O O   . MET A 149 ? 0.58087 0.56651 0.47928 0.03624  -0.03048 0.01607  149 MET A O   
1172 C CB  . MET A 149 ? 0.55022 0.52572 0.43557 0.04842  -0.02391 0.03310  149 MET A CB  
1173 C CG  . MET A 149 ? 0.55803 0.52888 0.45337 0.04462  -0.02089 0.02816  149 MET A CG  
1174 S SD  . MET A 149 ? 0.87280 0.82515 0.76838 0.04549  -0.01129 0.03101  149 MET A SD  
1175 C CE  . MET A 149 ? 0.77578 0.71904 0.66279 0.03852  -0.00582 0.03192  149 MET A CE  
1176 N N   . ASN A 150 ? 0.43974 0.44000 0.33567 0.04247  -0.03932 0.01934  150 ASN A N   
1177 C CA  . ASN A 150 ? 0.35352 0.36019 0.26109 0.03933  -0.04248 0.01630  150 ASN A CA  
1178 C C   . ASN A 150 ? 0.49710 0.50662 0.41253 0.04433  -0.03968 0.02159  150 ASN A C   
1179 O O   . ASN A 150 ? 0.46398 0.47441 0.37678 0.05188  -0.03909 0.02803  150 ASN A O   
1180 C CB  . ASN A 150 ? 0.30456 0.32341 0.21319 0.03669  -0.05077 0.01202  150 ASN A CB  
1181 C CG  . ASN A 150 ? 0.33319 0.34550 0.23784 0.03093  -0.05225 0.00397  150 ASN A CG  
1182 O OD1 . ASN A 150 ? 0.30267 0.30432 0.20571 0.03018  -0.04758 0.00283  150 ASN A OD1 
1183 N ND2 . ASN A 150 ? 0.31358 0.33273 0.21646 0.02738  -0.05880 -0.00212 150 ASN A ND2 
1184 N N   . TYR A 151 ? 0.47985 0.49002 0.40419 0.04097  -0.03709 0.01939  151 TYR A N   
1185 C CA  . TYR A 151 ? 0.39667 0.41132 0.32964 0.04611  -0.03322 0.02230  151 TYR A CA  
1186 C C   . TYR A 151 ? 0.47523 0.50221 0.41917 0.04057  -0.03447 0.01943  151 TYR A C   
1187 O O   . TYR A 151 ? 0.51188 0.53590 0.45459 0.03234  -0.03573 0.01606  151 TYR A O   
1188 C CB  . TYR A 151 ? 0.42760 0.42614 0.35659 0.04771  -0.02428 0.02226  151 TYR A CB  
1189 C CG  . TYR A 151 ? 0.54836 0.54095 0.47487 0.03914  -0.02142 0.01694  151 TYR A CG  
1190 C CD1 . TYR A 151 ? 0.46593 0.45108 0.38498 0.03431  -0.02210 0.01519  151 TYR A CD1 
1191 C CD2 . TYR A 151 ? 0.52505 0.52233 0.45674 0.03645  -0.01792 0.01429  151 TYR A CD2 
1192 C CE1 . TYR A 151 ? 0.53691 0.52029 0.45459 0.02783  -0.02084 0.01177  151 TYR A CE1 
1193 C CE2 . TYR A 151 ? 0.38640 0.38060 0.31378 0.02910  -0.01638 0.01098  151 TYR A CE2 
1194 C CZ  . TYR A 151 ? 0.47712 0.46478 0.39795 0.02516  -0.01855 0.01011  151 TYR A CZ  
1195 O OH  . TYR A 151 ? 0.39696 0.38503 0.31436 0.01902  -0.01832 0.00811  151 TYR A OH  
1196 N N   . ARG A 152 ? 0.41891 0.46058 0.37442 0.04553  -0.03383 0.02178  152 ARG A N   
1197 C CA  . ARG A 152 ? 0.42954 0.48726 0.39707 0.03902  -0.03491 0.01993  152 ARG A CA  
1198 C C   . ARG A 152 ? 0.46687 0.51685 0.43251 0.03340  -0.02760 0.01762  152 ARG A C   
1199 O O   . ARG A 152 ? 0.47670 0.51730 0.43797 0.03779  -0.02025 0.01682  152 ARG A O   
1200 C CB  . ARG A 152 ? 0.44999 0.52996 0.43287 0.04648  -0.03509 0.02314  152 ARG A CB  
1201 C CG  . ARG A 152 ? 0.50309 0.60359 0.49300 0.04468  -0.04568 0.02394  152 ARG A CG  
1202 C CD  . ARG A 152 ? 0.38809 0.51264 0.39289 0.05602  -0.04713 0.02916  152 ARG A CD  
1203 N NE  . ARG A 152 ? 0.34097 0.45238 0.34011 0.07091  -0.04216 0.03481  152 ARG A NE  
1204 C CZ  . ARG A 152 ? 0.44832 0.57230 0.46037 0.08466  -0.03887 0.04008  152 ARG A CZ  
1205 N NH1 . ARG A 152 ? 0.39916 0.55392 0.43205 0.08520  -0.03992 0.03998  152 ARG A NH1 
1206 N NH2 . ARG A 152 ? 0.31951 0.42477 0.32481 0.09790  -0.03360 0.04559  152 ARG A NH2 
1207 N N   . VAL A 153 ? 0.40641 0.45938 0.37410 0.02318  -0.02959 0.01657  153 VAL A N   
1208 C CA  . VAL A 153 ? 0.39192 0.44040 0.35612 0.01773  -0.02346 0.01637  153 VAL A CA  
1209 C C   . VAL A 153 ? 0.48125 0.54818 0.45784 0.01246  -0.02063 0.01795  153 VAL A C   
1210 O O   . VAL A 153 ? 0.59949 0.68363 0.58925 0.01265  -0.02399 0.01853  153 VAL A O   
1211 C CB  . VAL A 153 ? 0.33916 0.37308 0.29362 0.01101  -0.02667 0.01648  153 VAL A CB  
1212 C CG1 . VAL A 153 ? 0.29672 0.31690 0.24094 0.01584  -0.02748 0.01472  153 VAL A CG1 
1213 C CG2 . VAL A 153 ? 0.28124 0.31637 0.24072 0.00449  -0.03341 0.01654  153 VAL A CG2 
1214 N N   . GLY A 154 ? 0.45295 0.51906 0.42532 0.00714  -0.01446 0.01898  154 GLY A N   
1215 C CA  . GLY A 154 ? 0.47573 0.55917 0.45854 -0.00014 -0.01063 0.02167  154 GLY A CA  
1216 C C   . GLY A 154 ? 0.48348 0.58902 0.48062 0.00680  -0.00471 0.02030  154 GLY A C   
1217 O O   . GLY A 154 ? 0.54403 0.64724 0.53968 0.01822  -0.00049 0.01729  154 GLY A O   
1218 N N   . THR A 155 ? 0.41006 0.53727 0.42257 -0.00040 -0.00376 0.02273  155 THR A N   
1219 C CA  . THR A 155 ? 0.44895 0.60331 0.47989 0.00678  0.00116  0.02197  155 THR A CA  
1220 C C   . THR A 155 ? 0.55843 0.71522 0.59528 0.02005  -0.00514 0.02083  155 THR A C   
1221 O O   . THR A 155 ? 0.67139 0.83469 0.71390 0.03372  0.00073  0.01982  155 THR A O   
1222 C CB  . THR A 155 ? 0.45493 0.63534 0.50448 -0.00531 0.00074  0.02490  155 THR A CB  
1223 O OG1 . THR A 155 ? 0.38340 0.55656 0.43342 -0.01549 -0.01058 0.02535  155 THR A OG1 
1224 C CG2 . THR A 155 ? 0.29548 0.47822 0.34052 -0.01591 0.01066  0.02804  155 THR A CG2 
1225 N N   . PHE A 156 ? 0.49214 0.64198 0.52611 0.01687  -0.01658 0.02120  156 PHE A N   
1226 C CA  . PHE A 156 ? 0.44344 0.59933 0.48171 0.02836  -0.02365 0.02199  156 PHE A CA  
1227 C C   . PHE A 156 ? 0.49751 0.63180 0.52285 0.04198  -0.01943 0.02208  156 PHE A C   
1228 O O   . PHE A 156 ? 0.54956 0.69035 0.58086 0.05555  -0.02033 0.02491  156 PHE A O   
1229 C CB  . PHE A 156 ? 0.33021 0.48174 0.36355 0.02056  -0.03587 0.02081  156 PHE A CB  
1230 C CG  . PHE A 156 ? 0.36532 0.52488 0.40590 0.00327  -0.03898 0.01903  156 PHE A CG  
1231 C CD1 . PHE A 156 ? 0.28137 0.47193 0.34170 -0.00266 -0.04402 0.01862  156 PHE A CD1 
1232 C CD2 . PHE A 156 ? 0.38792 0.52413 0.41647 -0.00734 -0.03687 0.01834  156 PHE A CD2 
1233 C CE1 . PHE A 156 ? 0.28619 0.48158 0.35374 -0.02085 -0.04599 0.01663  156 PHE A CE1 
1234 C CE2 . PHE A 156 ? 0.28851 0.42715 0.32351 -0.02344 -0.03878 0.01783  156 PHE A CE2 
1235 C CZ  . PHE A 156 ? 0.29093 0.45779 0.34522 -0.03120 -0.04289 0.01652  156 PHE A CZ  
1236 N N   . GLY A 157 ? 0.47594 0.58494 0.48418 0.03823  -0.01503 0.01965  157 GLY A N   
1237 C CA  . GLY A 157 ? 0.45330 0.54049 0.44931 0.04738  -0.01021 0.01843  157 GLY A CA  
1238 C C   . GLY A 157 ? 0.44787 0.53446 0.44583 0.05415  0.00192  0.01521  157 GLY A C   
1239 O O   . GLY A 157 ? 0.48931 0.56397 0.48532 0.06577  0.00642  0.01475  157 GLY A O   
1240 N N   . PHE A 158 ? 0.40642 0.50431 0.40718 0.04704  0.00827  0.01284  158 PHE A N   
1241 C CA  . PHE A 158 ? 0.44698 0.53936 0.44264 0.05141  0.02066  0.00704  158 PHE A CA  
1242 C C   . PHE A 158 ? 0.45416 0.57217 0.46312 0.05199  0.02980  0.00572  158 PHE A C   
1243 O O   . PHE A 158 ? 0.38962 0.50428 0.39422 0.05716  0.04145  -0.00077 158 PHE A O   
1244 C CB  . PHE A 158 ? 0.34211 0.41461 0.31685 0.04151  0.02173  0.00321  158 PHE A CB  
1245 C CG  . PHE A 158 ? 0.33820 0.38803 0.30179 0.04170  0.01510  0.00356  158 PHE A CG  
1246 C CD1 . PHE A 158 ? 0.40331 0.43390 0.36028 0.04908  0.01999  -0.00066 158 PHE A CD1 
1247 C CD2 . PHE A 158 ? 0.31362 0.36104 0.27445 0.03466  0.00490  0.00796  158 PHE A CD2 
1248 C CE1 . PHE A 158 ? 0.40670 0.41856 0.35458 0.04796  0.01494  0.00049  158 PHE A CE1 
1249 C CE2 . PHE A 158 ? 0.29757 0.32748 0.24924 0.03526  0.00008  0.00816  158 PHE A CE2 
1250 C CZ  . PHE A 158 ? 0.30731 0.32099 0.25283 0.04130  0.00506  0.00503  158 PHE A CZ  
1251 N N   . LEU A 159 ? 0.33501 0.51412 0.44529 0.04230  0.00103  -0.00654 159 LEU A N   
1252 C CA  . LEU A 159 ? 0.27937 0.49187 0.41067 0.04369  0.01023  -0.00761 159 LEU A CA  
1253 C C   . LEU A 159 ? 0.26680 0.50007 0.41639 0.06995  0.01273  0.00023  159 LEU A C   
1254 O O   . LEU A 159 ? 0.49215 0.75041 0.65336 0.07944  0.00254  0.00782  159 LEU A O   
1255 C CB  . LEU A 159 ? 0.31934 0.57357 0.46496 0.02336  0.00563  -0.01014 159 LEU A CB  
1256 C CG  . LEU A 159 ? 0.34574 0.64502 0.51710 0.02095  0.01526  -0.01074 159 LEU A CG  
1257 C CD1 . LEU A 159 ? 0.41574 0.72149 0.58132 -0.01042 0.01800  -0.01843 159 LEU A CD1 
1258 C CD2 . LEU A 159 ? 0.23482 0.59462 0.43878 0.03476  0.00873  -0.00199 159 LEU A CD2 
1259 N N   . ALA A 160 ? 0.32776 0.54877 0.47715 0.08270  0.02710  -0.00102 160 ALA A N   
1260 C CA  . ALA A 160 ? 0.34248 0.57109 0.50317 0.11158  0.03367  0.00643  160 ALA A CA  
1261 C C   . ALA A 160 ? 0.40221 0.66161 0.58341 0.12011  0.04981  0.00529  160 ALA A C   
1262 O O   . ALA A 160 ? 0.44140 0.68620 0.61274 0.10731  0.06086  -0.00313 160 ALA A O   
1263 C CB  . ALA A 160 ? 0.38443 0.55227 0.51512 0.12308  0.03903  0.00583  160 ALA A CB  
1264 N N   . LEU A 161 ? 0.37103 0.67641 0.58125 0.14262  0.05142  0.01501  161 LEU A N   
1265 C CA  . LEU A 161 ? 0.45048 0.77487 0.67716 0.16377  0.07116  0.01660  161 LEU A CA  
1266 C C   . LEU A 161 ? 0.46817 0.75632 0.68218 0.19796  0.07862  0.02411  161 LEU A C   
1267 O O   . LEU A 161 ? 0.38518 0.70573 0.61951 0.22181  0.07320  0.03750  161 LEU A O   
1268 C CB  . LEU A 161 ? 0.37640 0.78635 0.64835 0.16599  0.07030  0.02348  161 LEU A CB  
1269 C CG  . LEU A 161 ? 0.40915 0.84108 0.68417 0.12670  0.06532  0.01402  161 LEU A CG  
1270 C CD1 . LEU A 161 ? 0.37321 0.88395 0.68332 0.11377  0.05208  0.02001  161 LEU A CD1 
1271 C CD2 . LEU A 161 ? 0.51619 0.93766 0.78582 0.11809  0.08610  0.00478  161 LEU A CD2 
1272 N N   . PRO A 162 ? 0.48188 0.70043 0.65892 0.20006  0.09054  0.01647  162 PRO A N   
1273 C CA  . PRO A 162 ? 0.45235 0.62105 0.60633 0.22558  0.09606  0.02225  162 PRO A CA  
1274 C C   . PRO A 162 ? 0.49592 0.68929 0.67097 0.26495  0.11088  0.03348  162 PRO A C   
1275 O O   . PRO A 162 ? 0.55119 0.78331 0.74973 0.27288  0.12466  0.03254  162 PRO A O   
1276 C CB  . PRO A 162 ? 0.40824 0.50627 0.51941 0.21379  0.10867  0.00920  162 PRO A CB  
1277 C CG  . PRO A 162 ? 0.40308 0.50902 0.51126 0.17872  0.09817  0.00003  162 PRO A CG  
1278 C CD  . PRO A 162 ? 0.34855 0.52696 0.49746 0.17331  0.09473  0.00277  162 PRO A CD  
1279 N N   . GLY A 163 ? 0.54946 0.71894 0.71399 0.28621  0.10654  0.04471  163 GLY A N   
1280 C CA  . GLY A 163 ? 0.54726 0.72910 0.72242 0.31154  0.11235  0.05576  163 GLY A CA  
1281 C C   . GLY A 163 ? 0.52969 0.78835 0.74485 0.31501  0.09440  0.06942  163 GLY A C   
1282 O O   . GLY A 163 ? 0.61752 0.88425 0.83827 0.33826  0.09547  0.08207  163 GLY A O   
1283 N N   . SER A 164 ? 0.44958 0.76328 0.68951 0.29141  0.07833  0.06725  164 SER A N   
1284 C CA  . SER A 164 ? 0.54120 0.92845 0.81501 0.28767  0.06027  0.07813  164 SER A CA  
1285 C C   . SER A 164 ? 0.56642 0.94438 0.82751 0.28657  0.03964  0.08757  164 SER A C   
1286 O O   . SER A 164 ? 0.47512 0.79768 0.70567 0.28246  0.03710  0.08419  164 SER A O   
1287 C CB  . SER A 164 ? 0.48881 0.93570 0.78942 0.25735  0.05334  0.06998  164 SER A CB  
1288 O OG  . SER A 164 ? 0.41382 0.85151 0.70209 0.23361  0.03796  0.06458  164 SER A OG  
1289 N N   . ARG A 165 ? 0.58279 1.01717 0.86654 0.28908  0.02502  0.09965  165 ARG A N   
1290 C CA  . ARG A 165 ? 0.62944 1.06137 0.90097 0.28541  0.00508  0.10848  165 ARG A CA  
1291 C C   . ARG A 165 ? 0.54374 1.01167 0.82219 0.25111  -0.01411 0.10176  165 ARG A C   
1292 O O   . ARG A 165 ? 0.58196 1.02340 0.83841 0.24229  -0.02638 0.10231  165 ARG A O   
1293 C CB  . ARG A 165 ? 0.77097 1.23851 1.05603 0.30682  -0.00103 0.12597  165 ARG A CB  
1294 C CG  . ARG A 165 ? 0.98118 1.41075 1.23870 0.31827  -0.01085 0.13743  165 ARG A CG  
1295 C CD  . ARG A 165 ? 1.13853 1.48095 1.35914 0.33830  0.00616  0.13734  165 ARG A CD  
1296 N NE  . ARG A 165 ? 1.29139 1.62166 1.51223 0.37121  0.02275  0.14723  165 ARG A NE  
1297 C CZ  . ARG A 165 ? 1.28685 1.58407 1.50141 0.38369  0.04544  0.14011  165 ARG A CZ  
1298 N NH1 . ARG A 165 ? 1.15794 1.43114 1.36552 0.36574  0.05385  0.12318  165 ARG A NH1 
1299 N NH2 . ARG A 165 ? 1.30116 1.58803 1.51413 0.41460  0.06047  0.15010  165 ARG A NH2 
1300 N N   . GLU A 166 ? 0.37247 0.89530 0.67723 0.22973  -0.01548 0.09452  166 GLU A N   
1301 C CA  . GLU A 166 ? 0.30486 0.86152 0.61291 0.19419  -0.03281 0.08757  166 GLU A CA  
1302 C C   . GLU A 166 ? 0.38640 0.90788 0.67731 0.17358  -0.03012 0.07292  166 GLU A C   
1303 O O   . GLU A 166 ? 0.45124 0.99039 0.73841 0.14318  -0.04319 0.06577  166 GLU A O   
1304 C CB  . GLU A 166 ? 0.30189 0.93034 0.64147 0.17578  -0.03511 0.08604  166 GLU A CB  
1305 C CG  . GLU A 166 ? 0.49005 1.16199 0.85182 0.19845  -0.03546 0.10099  166 GLU A CG  
1306 C CD  . GLU A 166 ? 0.65103 1.31655 1.02672 0.22588  -0.01263 0.10288  166 GLU A CD  
1307 O OE1 . GLU A 166 ? 0.66220 1.26526 1.01769 0.24406  0.00244  0.09924  166 GLU A OE1 
1308 O OE2 . GLU A 166 ? 0.68962 1.41195 1.09449 0.22873  -0.00923 0.10788  166 GLU A OE2 
1309 N N   . ALA A 167 ? 0.34767 0.81472 0.62316 0.18697  -0.01303 0.06738  167 ALA A N   
1310 C CA  . ALA A 167 ? 0.36972 0.77728 0.61449 0.16014  -0.00886 0.05091  167 ALA A CA  
1311 C C   . ALA A 167 ? 0.44634 0.78346 0.66469 0.17753  0.00668  0.04823  167 ALA A C   
1312 O O   . ALA A 167 ? 0.52285 0.83898 0.73600 0.17339  0.02202  0.03879  167 ALA A O   
1313 C CB  . ALA A 167 ? 0.36340 0.79588 0.62042 0.13405  -0.00211 0.03909  167 ALA A CB  
1314 N N   . PRO A 168 ? 0.45883 0.75660 0.65668 0.19466  0.00359  0.05605  168 PRO A N   
1315 C CA  . PRO A 168 ? 0.48896 0.72146 0.66032 0.21099  0.01965  0.05419  168 PRO A CA  
1316 C C   . PRO A 168 ? 0.45288 0.62876 0.59215 0.18597  0.02121  0.04073  168 PRO A C   
1317 O O   . PRO A 168 ? 0.43203 0.55260 0.54495 0.19255  0.03312  0.03739  168 PRO A O   
1318 C CB  . PRO A 168 ? 0.50198 0.71756 0.66272 0.23523  0.01420  0.06920  168 PRO A CB  
1319 C CG  . PRO A 168 ? 0.47266 0.71314 0.63456 0.21522  -0.00742 0.07144  168 PRO A CG  
1320 C CD  . PRO A 168 ? 0.43767 0.74143 0.62866 0.19456  -0.01437 0.06541  168 PRO A CD  
1321 N N   . GLY A 169 ? 0.39953 0.58803 0.53879 0.15784  0.00973  0.03368  169 GLY A N   
1322 C CA  . GLY A 169 ? 0.46118 0.60535 0.57409 0.13640  0.01006  0.02349  169 GLY A CA  
1323 C C   . GLY A 169 ? 0.41018 0.51432 0.49802 0.13562  0.00335  0.02698  169 GLY A C   
1324 O O   . GLY A 169 ? 0.49961 0.59760 0.58393 0.15280  0.00061  0.03714  169 GLY A O   
1325 N N   . ASN A 170 ? 0.39159 0.46961 0.46153 0.11542  0.00127  0.01949  170 ASN A N   
1326 C CA  . ASN A 170 ? 0.50818 0.55358 0.55589 0.10905  -0.00426 0.02143  170 ASN A CA  
1327 C C   . ASN A 170 ? 0.52257 0.58642 0.57356 0.10921  -0.01719 0.02874  170 ASN A C   
1328 O O   . ASN A 170 ? 0.50898 0.54799 0.54225 0.10737  -0.02039 0.03258  170 ASN A O   
1329 C CB  . ASN A 170 ? 0.51193 0.51361 0.53841 0.12042  0.00482  0.02413  170 ASN A CB  
1330 C CG  . ASN A 170 ? 0.53700 0.51103 0.54933 0.11370  0.01670  0.01496  170 ASN A CG  
1331 O OD1 . ASN A 170 ? 0.57648 0.55460 0.58759 0.09663  0.01526  0.00795  170 ASN A OD1 
1332 N ND2 . ASN A 170 ? 0.48929 0.43197 0.48729 0.12776  0.02930  0.01539  170 ASN A ND2 
1333 N N   . VAL A 171 ? 0.40717 0.51467 0.47807 0.10864  -0.02463 0.03050  171 VAL A N   
1334 C CA  . VAL A 171 ? 0.35558 0.47962 0.42496 0.10879  -0.03707 0.03771  171 VAL A CA  
1335 C C   . VAL A 171 ? 0.38014 0.48674 0.43207 0.09022  -0.04157 0.03254  171 VAL A C   
1336 O O   . VAL A 171 ? 0.47383 0.57651 0.51426 0.09033  -0.04852 0.03813  171 VAL A O   
1337 C CB  . VAL A 171 ? 0.34396 0.52311 0.43658 0.10867  -0.04548 0.04053  171 VAL A CB  
1338 C CG1 . VAL A 171 ? 0.27437 0.47998 0.39022 0.12858  -0.03878 0.04595  171 VAL A CG1 
1339 C CG2 . VAL A 171 ? 0.25123 0.44614 0.34605 0.08322  -0.04806 0.02923  171 VAL A CG2 
1340 N N   . GLY A 172 ? 0.38727 0.48289 0.43571 0.07586  -0.03668 0.02300  172 GLY A N   
1341 C CA  . GLY A 172 ? 0.36797 0.44422 0.39993 0.06384  -0.03793 0.01999  172 GLY A CA  
1342 C C   . GLY A 172 ? 0.36802 0.41593 0.38496 0.06850  -0.03632 0.02540  172 GLY A C   
1343 O O   . GLY A 172 ? 0.42092 0.46283 0.42648 0.06422  -0.03967 0.02797  172 GLY A O   
1344 N N   . LEU A 173 ? 0.38656 0.41516 0.40069 0.07554  -0.02986 0.02665  173 LEU A N   
1345 C CA  . LEU A 173 ? 0.45698 0.45577 0.45340 0.07624  -