data_6TD3
# 
_entry.id   6TD3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.333 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6TD3         
WWPDB D_1292105251 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6TD3 
_pdbx_database_status.recvd_initial_deposition_date   2019-11-07 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bunker, R.D.' 1 ? 
'Petzold, G.'  2 ? 
'Kozicka, Z.'  3 ? 
'Thoma, N.H.'  4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            585 
_citation.language                  ? 
_citation.page_first                293 
_citation.page_last                 297 
_citation.title                     'The CDK inhibitor CR8 acts as a molecular glue degrader that depletes cyclin K.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41586-020-2374-x 
_citation.pdbx_database_id_PubMed   32494016 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Slabicki, M.'   1  ? 
primary 'Kozicka, Z.'    2  ? 
primary 'Petzold, G.'    3  ? 
primary 'Li, Y.D.'       4  ? 
primary 'Manojkumar, M.' 5  ? 
primary 'Bunker, R.D.'   6  ? 
primary 'Donovan, K.A.'  7  ? 
primary 'Sievers, Q.L.'  8  ? 
primary 'Koeppel, J.'    9  ? 
primary 'Suchyta, D.'    10 ? 
primary 'Sperling, A.S.' 11 ? 
primary 'Fink, E.C.'     12 ? 
primary 'Gasser, J.A.'   13 ? 
primary 'Wang, L.R.'     14 ? 
primary 'Corsello, S.M.' 15 ? 
primary 'Sellar, R.S.'   16 ? 
primary 'Jan, M.'        17 ? 
primary 'Gillingham, D.' 18 ? 
primary 'Scholl, C.'     19 ? 
primary 'Frohling, S.'   20 ? 
primary 'Golub, T.R.'    21 ? 
primary 'Fischer, E.S.'  22 ? 
primary 'Thoma, N.H.'    23 ? 
primary 'Ebert, B.L.'    24 ? 
# 
_cell.angle_alpha                  90 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6TD3 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     250.749 
_cell.length_a_esd                 ? 
_cell.length_b                     250.749 
_cell.length_b_esd                 ? 
_cell.length_c                     217.92 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        18 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6TD3 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA damage-binding protein 1,DNA damage-binding protein 1'                                 93675.438 3 ? ?     
? ? 
2 polymer     man 'Cyclin-dependent kinase 12'                                                                40143.328 3 
2.7.11.22,2.7.11.23 K965R ? ? 
3 polymer     man Cyclin-K                                                                                    31700.471 3 ? ?     
? ? 
4 non-polymer syn '(2R)-2-({9-(1-methylethyl)-6-[(4-pyridin-2-ylbenzyl)amino]-9H-purin-2-yl}amino)butan-1-ol' 431.533   3 ? ?     
? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;DDB p127 subunit,DNA damage-binding protein a,DDBa,Damage-specific DNA-binding protein 1,HBV X-associated protein 1,XAP-1,UV-damaged DNA-binding factor,UV-damaged DNA-binding protein 1,UV-DDB 1,XPE-binding factor,XPE-BF,Xeroderma pigmentosum group E-complementing protein,XPCe,DDB p127 subunit,DNA damage-binding protein a,DDBa,Damage-specific DNA-binding protein 1,HBV X-associated protein 1,XAP-1,UV-damaged DNA-binding factor,UV-damaged DNA-binding protein 1,UV-DDB 1,XPE-binding factor,XPE-BF,Xeroderma pigmentosum group E-complementing protein,XPCe
;
2 
;Cdc2-related kinase,arginine/serine-rich,CrkRS,Cell division cycle 2-related protein kinase 7,CDC2-related protein kinase 7,Cell division protein kinase 12,hCDK12
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;GGGRMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDL
LFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFN
IRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQES
ITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTY
LDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGG
NGNSGEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHET
SFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQT
VAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEG
NFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGET
STPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDI
SRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
;
;GGGRMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDL
LFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFN
IRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQES
ITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTY
LDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGG
NGNSGEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHET
SFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQT
VAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEG
NFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGET
STPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDI
SRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
;
A,D,G ? 
2 'polypeptide(L)' no yes 
;GGGRRQTESDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVN
MKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLN
NSGQIKLADFGLARLYNSEESRPY(TPO)NKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQ
LELISRLCGSPCPAVWPDVIRLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVE
LSKMAPPDLPHWQDCHELWSKKRRRQRQ
;
;GGGRRQTESDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVN
MKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLN
NSGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELI
SRLCGSPCPAVWPDVIRLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKM
APPDLPHWQDCHELWSKKRRRQRQ
;
B,E,H ? 
3 'polypeptide(L)' no no  
;GGGRMKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDTLATGII
YFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEVMVLERILLQTIKFDLQ
VEHPYQFLLKYAKQLKGDKNKIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEWTSKPMYRRWWE
QFVQDVPVDVLEDICHQILDLYSQGKQQMPH
;
;GGGRMKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDTLATGII
YFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEVMVLERILLQTIKFDLQ
VEHPYQFLLKYAKQLKGDKNKIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEWTSKPMYRRWWE
QFVQDVPVDVLEDICHQILDLYSQGKQQMPH
;
C,F,I ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   GLY n 
1 3   GLY n 
1 4   ARG n 
1 5   MET n 
1 6   SER n 
1 7   TYR n 
1 8   ASN n 
1 9   TYR n 
1 10  VAL n 
1 11  VAL n 
1 12  THR n 
1 13  ALA n 
1 14  GLN n 
1 15  LYS n 
1 16  PRO n 
1 17  THR n 
1 18  ALA n 
1 19  VAL n 
1 20  ASN n 
1 21  GLY n 
1 22  CYS n 
1 23  VAL n 
1 24  THR n 
1 25  GLY n 
1 26  HIS n 
1 27  PHE n 
1 28  THR n 
1 29  SER n 
1 30  ALA n 
1 31  GLU n 
1 32  ASP n 
1 33  LEU n 
1 34  ASN n 
1 35  LEU n 
1 36  LEU n 
1 37  ILE n 
1 38  ALA n 
1 39  LYS n 
1 40  ASN n 
1 41  THR n 
1 42  ARG n 
1 43  LEU n 
1 44  GLU n 
1 45  ILE n 
1 46  TYR n 
1 47  VAL n 
1 48  VAL n 
1 49  THR n 
1 50  ALA n 
1 51  GLU n 
1 52  GLY n 
1 53  LEU n 
1 54  ARG n 
1 55  PRO n 
1 56  VAL n 
1 57  LYS n 
1 58  GLU n 
1 59  VAL n 
1 60  GLY n 
1 61  MET n 
1 62  TYR n 
1 63  GLY n 
1 64  LYS n 
1 65  ILE n 
1 66  ALA n 
1 67  VAL n 
1 68  MET n 
1 69  GLU n 
1 70  LEU n 
1 71  PHE n 
1 72  ARG n 
1 73  PRO n 
1 74  LYS n 
1 75  GLY n 
1 76  GLU n 
1 77  SER n 
1 78  LYS n 
1 79  ASP n 
1 80  LEU n 
1 81  LEU n 
1 82  PHE n 
1 83  ILE n 
1 84  LEU n 
1 85  THR n 
1 86  ALA n 
1 87  LYS n 
1 88  TYR n 
1 89  ASN n 
1 90  ALA n 
1 91  CYS n 
1 92  ILE n 
1 93  LEU n 
1 94  GLU n 
1 95  TYR n 
1 96  LYS n 
1 97  GLN n 
1 98  SER n 
1 99  GLY n 
1 100 GLU n 
1 101 SER n 
1 102 ILE n 
1 103 ASP n 
1 104 ILE n 
1 105 ILE n 
1 106 THR n 
1 107 ARG n 
1 108 ALA n 
1 109 HIS n 
1 110 GLY n 
1 111 ASN n 
1 112 VAL n 
1 113 GLN n 
1 114 ASP n 
1 115 ARG n 
1 116 ILE n 
1 117 GLY n 
1 118 ARG n 
1 119 PRO n 
1 120 SER n 
1 121 GLU n 
1 122 THR n 
1 123 GLY n 
1 124 ILE n 
1 125 ILE n 
1 126 GLY n 
1 127 ILE n 
1 128 ILE n 
1 129 ASP n 
1 130 PRO n 
1 131 GLU n 
1 132 CYS n 
1 133 ARG n 
1 134 MET n 
1 135 ILE n 
1 136 GLY n 
1 137 LEU n 
1 138 ARG n 
1 139 LEU n 
1 140 TYR n 
1 141 ASP n 
1 142 GLY n 
1 143 LEU n 
1 144 PHE n 
1 145 LYS n 
1 146 VAL n 
1 147 ILE n 
1 148 PRO n 
1 149 LEU n 
1 150 ASP n 
1 151 ARG n 
1 152 ASP n 
1 153 ASN n 
1 154 LYS n 
1 155 GLU n 
1 156 LEU n 
1 157 LYS n 
1 158 ALA n 
1 159 PHE n 
1 160 ASN n 
1 161 ILE n 
1 162 ARG n 
1 163 LEU n 
1 164 GLU n 
1 165 GLU n 
1 166 LEU n 
1 167 HIS n 
1 168 VAL n 
1 169 ILE n 
1 170 ASP n 
1 171 VAL n 
1 172 LYS n 
1 173 PHE n 
1 174 LEU n 
1 175 TYR n 
1 176 GLY n 
1 177 CYS n 
1 178 GLN n 
1 179 ALA n 
1 180 PRO n 
1 181 THR n 
1 182 ILE n 
1 183 CYS n 
1 184 PHE n 
1 185 VAL n 
1 186 TYR n 
1 187 GLN n 
1 188 ASP n 
1 189 PRO n 
1 190 GLN n 
1 191 GLY n 
1 192 ARG n 
1 193 HIS n 
1 194 VAL n 
1 195 LYS n 
1 196 THR n 
1 197 TYR n 
1 198 GLU n 
1 199 VAL n 
1 200 SER n 
1 201 LEU n 
1 202 ARG n 
1 203 GLU n 
1 204 LYS n 
1 205 GLU n 
1 206 PHE n 
1 207 ASN n 
1 208 LYS n 
1 209 GLY n 
1 210 PRO n 
1 211 TRP n 
1 212 LYS n 
1 213 GLN n 
1 214 GLU n 
1 215 ASN n 
1 216 VAL n 
1 217 GLU n 
1 218 ALA n 
1 219 GLU n 
1 220 ALA n 
1 221 SER n 
1 222 MET n 
1 223 VAL n 
1 224 ILE n 
1 225 ALA n 
1 226 VAL n 
1 227 PRO n 
1 228 GLU n 
1 229 PRO n 
1 230 PHE n 
1 231 GLY n 
1 232 GLY n 
1 233 ALA n 
1 234 ILE n 
1 235 ILE n 
1 236 ILE n 
1 237 GLY n 
1 238 GLN n 
1 239 GLU n 
1 240 SER n 
1 241 ILE n 
1 242 THR n 
1 243 TYR n 
1 244 HIS n 
1 245 ASN n 
1 246 GLY n 
1 247 ASP n 
1 248 LYS n 
1 249 TYR n 
1 250 LEU n 
1 251 ALA n 
1 252 ILE n 
1 253 ALA n 
1 254 PRO n 
1 255 PRO n 
1 256 ILE n 
1 257 ILE n 
1 258 LYS n 
1 259 GLN n 
1 260 SER n 
1 261 THR n 
1 262 ILE n 
1 263 VAL n 
1 264 CYS n 
1 265 HIS n 
1 266 ASN n 
1 267 ARG n 
1 268 VAL n 
1 269 ASP n 
1 270 PRO n 
1 271 ASN n 
1 272 GLY n 
1 273 SER n 
1 274 ARG n 
1 275 TYR n 
1 276 LEU n 
1 277 LEU n 
1 278 GLY n 
1 279 ASP n 
1 280 MET n 
1 281 GLU n 
1 282 GLY n 
1 283 ARG n 
1 284 LEU n 
1 285 PHE n 
1 286 MET n 
1 287 LEU n 
1 288 LEU n 
1 289 LEU n 
1 290 GLU n 
1 291 LYS n 
1 292 GLU n 
1 293 GLU n 
1 294 GLN n 
1 295 MET n 
1 296 ASP n 
1 297 GLY n 
1 298 THR n 
1 299 VAL n 
1 300 THR n 
1 301 LEU n 
1 302 LYS n 
1 303 ASP n 
1 304 LEU n 
1 305 ARG n 
1 306 VAL n 
1 307 GLU n 
1 308 LEU n 
1 309 LEU n 
1 310 GLY n 
1 311 GLU n 
1 312 THR n 
1 313 SER n 
1 314 ILE n 
1 315 ALA n 
1 316 GLU n 
1 317 CYS n 
1 318 LEU n 
1 319 THR n 
1 320 TYR n 
1 321 LEU n 
1 322 ASP n 
1 323 ASN n 
1 324 GLY n 
1 325 VAL n 
1 326 VAL n 
1 327 PHE n 
1 328 VAL n 
1 329 GLY n 
1 330 SER n 
1 331 ARG n 
1 332 LEU n 
1 333 GLY n 
1 334 ASP n 
1 335 SER n 
1 336 GLN n 
1 337 LEU n 
1 338 VAL n 
1 339 LYS n 
1 340 LEU n 
1 341 ASN n 
1 342 VAL n 
1 343 ASP n 
1 344 SER n 
1 345 ASN n 
1 346 GLU n 
1 347 GLN n 
1 348 GLY n 
1 349 SER n 
1 350 TYR n 
1 351 VAL n 
1 352 VAL n 
1 353 ALA n 
1 354 MET n 
1 355 GLU n 
1 356 THR n 
1 357 PHE n 
1 358 THR n 
1 359 ASN n 
1 360 LEU n 
1 361 GLY n 
1 362 PRO n 
1 363 ILE n 
1 364 VAL n 
1 365 ASP n 
1 366 MET n 
1 367 CYS n 
1 368 VAL n 
1 369 VAL n 
1 370 ASP n 
1 371 LEU n 
1 372 GLU n 
1 373 ARG n 
1 374 GLN n 
1 375 GLY n 
1 376 GLN n 
1 377 GLY n 
1 378 GLN n 
1 379 LEU n 
1 380 VAL n 
1 381 THR n 
1 382 CYS n 
1 383 SER n 
1 384 GLY n 
1 385 ALA n 
1 386 PHE n 
1 387 LYS n 
1 388 GLU n 
1 389 GLY n 
1 390 SER n 
1 391 LEU n 
1 392 ARG n 
1 393 ILE n 
1 394 ILE n 
1 395 ARG n 
1 396 ASN n 
1 397 GLY n 
1 398 ILE n 
1 399 GLY n 
1 400 GLY n 
1 401 ASN n 
1 402 GLY n 
1 403 ASN n 
1 404 SER n 
1 405 GLY n 
1 406 GLU n 
1 407 ILE n 
1 408 GLN n 
1 409 LYS n 
1 410 LEU n 
1 411 HIS n 
1 412 ILE n 
1 413 ARG n 
1 414 THR n 
1 415 VAL n 
1 416 PRO n 
1 417 LEU n 
1 418 TYR n 
1 419 GLU n 
1 420 SER n 
1 421 PRO n 
1 422 ARG n 
1 423 LYS n 
1 424 ILE n 
1 425 CYS n 
1 426 TYR n 
1 427 GLN n 
1 428 GLU n 
1 429 VAL n 
1 430 SER n 
1 431 GLN n 
1 432 CYS n 
1 433 PHE n 
1 434 GLY n 
1 435 VAL n 
1 436 LEU n 
1 437 SER n 
1 438 SER n 
1 439 ARG n 
1 440 ILE n 
1 441 GLU n 
1 442 VAL n 
1 443 GLN n 
1 444 ASP n 
1 445 THR n 
1 446 SER n 
1 447 GLY n 
1 448 GLY n 
1 449 THR n 
1 450 THR n 
1 451 ALA n 
1 452 LEU n 
1 453 ARG n 
1 454 PRO n 
1 455 SER n 
1 456 ALA n 
1 457 SER n 
1 458 THR n 
1 459 GLN n 
1 460 ALA n 
1 461 LEU n 
1 462 SER n 
1 463 SER n 
1 464 SER n 
1 465 VAL n 
1 466 SER n 
1 467 SER n 
1 468 SER n 
1 469 LYS n 
1 470 LEU n 
1 471 PHE n 
1 472 SER n 
1 473 SER n 
1 474 SER n 
1 475 THR n 
1 476 ALA n 
1 477 PRO n 
1 478 HIS n 
1 479 GLU n 
1 480 THR n 
1 481 SER n 
1 482 PHE n 
1 483 GLY n 
1 484 GLU n 
1 485 GLU n 
1 486 VAL n 
1 487 GLU n 
1 488 VAL n 
1 489 HIS n 
1 490 ASN n 
1 491 LEU n 
1 492 LEU n 
1 493 ILE n 
1 494 ILE n 
1 495 ASP n 
1 496 GLN n 
1 497 HIS n 
1 498 THR n 
1 499 PHE n 
1 500 GLU n 
1 501 VAL n 
1 502 LEU n 
1 503 HIS n 
1 504 ALA n 
1 505 HIS n 
1 506 GLN n 
1 507 PHE n 
1 508 LEU n 
1 509 GLN n 
1 510 ASN n 
1 511 GLU n 
1 512 TYR n 
1 513 ALA n 
1 514 LEU n 
1 515 SER n 
1 516 LEU n 
1 517 VAL n 
1 518 SER n 
1 519 CYS n 
1 520 LYS n 
1 521 LEU n 
1 522 GLY n 
1 523 LYS n 
1 524 ASP n 
1 525 PRO n 
1 526 ASN n 
1 527 THR n 
1 528 TYR n 
1 529 PHE n 
1 530 ILE n 
1 531 VAL n 
1 532 GLY n 
1 533 THR n 
1 534 ALA n 
1 535 MET n 
1 536 VAL n 
1 537 TYR n 
1 538 PRO n 
1 539 GLU n 
1 540 GLU n 
1 541 ALA n 
1 542 GLU n 
1 543 PRO n 
1 544 LYS n 
1 545 GLN n 
1 546 GLY n 
1 547 ARG n 
1 548 ILE n 
1 549 VAL n 
1 550 VAL n 
1 551 PHE n 
1 552 GLN n 
1 553 TYR n 
1 554 SER n 
1 555 ASP n 
1 556 GLY n 
1 557 LYS n 
1 558 LEU n 
1 559 GLN n 
1 560 THR n 
1 561 VAL n 
1 562 ALA n 
1 563 GLU n 
1 564 LYS n 
1 565 GLU n 
1 566 VAL n 
1 567 LYS n 
1 568 GLY n 
1 569 ALA n 
1 570 VAL n 
1 571 TYR n 
1 572 SER n 
1 573 MET n 
1 574 VAL n 
1 575 GLU n 
1 576 PHE n 
1 577 ASN n 
1 578 GLY n 
1 579 LYS n 
1 580 LEU n 
1 581 LEU n 
1 582 ALA n 
1 583 SER n 
1 584 ILE n 
1 585 ASN n 
1 586 SER n 
1 587 THR n 
1 588 VAL n 
1 589 ARG n 
1 590 LEU n 
1 591 TYR n 
1 592 GLU n 
1 593 TRP n 
1 594 THR n 
1 595 THR n 
1 596 GLU n 
1 597 LYS n 
1 598 GLU n 
1 599 LEU n 
1 600 ARG n 
1 601 THR n 
1 602 GLU n 
1 603 CYS n 
1 604 ASN n 
1 605 HIS n 
1 606 TYR n 
1 607 ASN n 
1 608 ASN n 
1 609 ILE n 
1 610 MET n 
1 611 ALA n 
1 612 LEU n 
1 613 TYR n 
1 614 LEU n 
1 615 LYS n 
1 616 THR n 
1 617 LYS n 
1 618 GLY n 
1 619 ASP n 
1 620 PHE n 
1 621 ILE n 
1 622 LEU n 
1 623 VAL n 
1 624 GLY n 
1 625 ASP n 
1 626 LEU n 
1 627 MET n 
1 628 ARG n 
1 629 SER n 
1 630 VAL n 
1 631 LEU n 
1 632 LEU n 
1 633 LEU n 
1 634 ALA n 
1 635 TYR n 
1 636 LYS n 
1 637 PRO n 
1 638 MET n 
1 639 GLU n 
1 640 GLY n 
1 641 ASN n 
1 642 PHE n 
1 643 GLU n 
1 644 GLU n 
1 645 ILE n 
1 646 ALA n 
1 647 ARG n 
1 648 ASP n 
1 649 PHE n 
1 650 ASN n 
1 651 PRO n 
1 652 ASN n 
1 653 TRP n 
1 654 MET n 
1 655 SER n 
1 656 ALA n 
1 657 VAL n 
1 658 GLU n 
1 659 ILE n 
1 660 LEU n 
1 661 ASP n 
1 662 ASP n 
1 663 ASP n 
1 664 ASN n 
1 665 PHE n 
1 666 LEU n 
1 667 GLY n 
1 668 ALA n 
1 669 GLU n 
1 670 ASN n 
1 671 ALA n 
1 672 PHE n 
1 673 ASN n 
1 674 LEU n 
1 675 PHE n 
1 676 VAL n 
1 677 CYS n 
1 678 GLN n 
1 679 LYS n 
1 680 ASP n 
1 681 SER n 
1 682 ALA n 
1 683 ALA n 
1 684 THR n 
1 685 THR n 
1 686 ASP n 
1 687 GLU n 
1 688 GLU n 
1 689 ARG n 
1 690 GLN n 
1 691 HIS n 
1 692 LEU n 
1 693 GLN n 
1 694 GLU n 
1 695 VAL n 
1 696 GLY n 
1 697 LEU n 
1 698 PHE n 
1 699 HIS n 
1 700 LEU n 
1 701 GLY n 
1 702 GLU n 
1 703 PHE n 
1 704 VAL n 
1 705 ASN n 
1 706 VAL n 
1 707 PHE n 
1 708 CYS n 
1 709 HIS n 
1 710 GLY n 
1 711 SER n 
1 712 LEU n 
1 713 VAL n 
1 714 MET n 
1 715 GLN n 
1 716 ASN n 
1 717 LEU n 
1 718 GLY n 
1 719 GLU n 
1 720 THR n 
1 721 SER n 
1 722 THR n 
1 723 PRO n 
1 724 THR n 
1 725 GLN n 
1 726 GLY n 
1 727 SER n 
1 728 VAL n 
1 729 LEU n 
1 730 PHE n 
1 731 GLY n 
1 732 THR n 
1 733 VAL n 
1 734 ASN n 
1 735 GLY n 
1 736 MET n 
1 737 ILE n 
1 738 GLY n 
1 739 LEU n 
1 740 VAL n 
1 741 THR n 
1 742 SER n 
1 743 LEU n 
1 744 SER n 
1 745 GLU n 
1 746 SER n 
1 747 TRP n 
1 748 TYR n 
1 749 ASN n 
1 750 LEU n 
1 751 LEU n 
1 752 LEU n 
1 753 ASP n 
1 754 MET n 
1 755 GLN n 
1 756 ASN n 
1 757 ARG n 
1 758 LEU n 
1 759 ASN n 
1 760 LYS n 
1 761 VAL n 
1 762 ILE n 
1 763 LYS n 
1 764 SER n 
1 765 VAL n 
1 766 GLY n 
1 767 LYS n 
1 768 ILE n 
1 769 GLU n 
1 770 HIS n 
1 771 SER n 
1 772 PHE n 
1 773 TRP n 
1 774 ARG n 
1 775 SER n 
1 776 PHE n 
1 777 HIS n 
1 778 THR n 
1 779 GLU n 
1 780 ARG n 
1 781 LYS n 
1 782 THR n 
1 783 GLU n 
1 784 PRO n 
1 785 ALA n 
1 786 THR n 
1 787 GLY n 
1 788 PHE n 
1 789 ILE n 
1 790 ASP n 
1 791 GLY n 
1 792 ASP n 
1 793 LEU n 
1 794 ILE n 
1 795 GLU n 
1 796 SER n 
1 797 PHE n 
1 798 LEU n 
1 799 ASP n 
1 800 ILE n 
1 801 SER n 
1 802 ARG n 
1 803 PRO n 
1 804 LYS n 
1 805 MET n 
1 806 GLN n 
1 807 GLU n 
1 808 VAL n 
1 809 VAL n 
1 810 ALA n 
1 811 ASN n 
1 812 LEU n 
1 813 GLN n 
1 814 TYR n 
1 815 ASP n 
1 816 ASP n 
1 817 GLY n 
1 818 SER n 
1 819 GLY n 
1 820 MET n 
1 821 LYS n 
1 822 ARG n 
1 823 GLU n 
1 824 ALA n 
1 825 THR n 
1 826 ALA n 
1 827 ASP n 
1 828 ASP n 
1 829 LEU n 
1 830 ILE n 
1 831 LYS n 
1 832 VAL n 
1 833 VAL n 
1 834 GLU n 
1 835 GLU n 
1 836 LEU n 
1 837 THR n 
1 838 ARG n 
1 839 ILE n 
1 840 HIS n 
2 1   GLY n 
2 2   GLY n 
2 3   GLY n 
2 4   ARG n 
2 5   ARG n 
2 6   GLN n 
2 7   THR n 
2 8   GLU n 
2 9   SER n 
2 10  ASP n 
2 11  TRP n 
2 12  GLY n 
2 13  LYS n 
2 14  ARG n 
2 15  CYS n 
2 16  VAL n 
2 17  ASP n 
2 18  LYS n 
2 19  PHE n 
2 20  ASP n 
2 21  ILE n 
2 22  ILE n 
2 23  GLY n 
2 24  ILE n 
2 25  ILE n 
2 26  GLY n 
2 27  GLU n 
2 28  GLY n 
2 29  THR n 
2 30  TYR n 
2 31  GLY n 
2 32  GLN n 
2 33  VAL n 
2 34  TYR n 
2 35  LYS n 
2 36  ALA n 
2 37  LYS n 
2 38  ASP n 
2 39  LYS n 
2 40  ASP n 
2 41  THR n 
2 42  GLY n 
2 43  GLU n 
2 44  LEU n 
2 45  VAL n 
2 46  ALA n 
2 47  LEU n 
2 48  LYS n 
2 49  LYS n 
2 50  VAL n 
2 51  ARG n 
2 52  LEU n 
2 53  ASP n 
2 54  ASN n 
2 55  GLU n 
2 56  LYS n 
2 57  GLU n 
2 58  GLY n 
2 59  PHE n 
2 60  PRO n 
2 61  ILE n 
2 62  THR n 
2 63  ALA n 
2 64  ILE n 
2 65  ARG n 
2 66  GLU n 
2 67  ILE n 
2 68  LYS n 
2 69  ILE n 
2 70  LEU n 
2 71  ARG n 
2 72  GLN n 
2 73  LEU n 
2 74  ILE n 
2 75  HIS n 
2 76  ARG n 
2 77  SER n 
2 78  VAL n 
2 79  VAL n 
2 80  ASN n 
2 81  MET n 
2 82  LYS n 
2 83  GLU n 
2 84  ILE n 
2 85  VAL n 
2 86  THR n 
2 87  ASP n 
2 88  LYS n 
2 89  GLN n 
2 90  ASP n 
2 91  ALA n 
2 92  LEU n 
2 93  ASP n 
2 94  PHE n 
2 95  LYS n 
2 96  LYS n 
2 97  ASP n 
2 98  LYS n 
2 99  GLY n 
2 100 ALA n 
2 101 PHE n 
2 102 TYR n 
2 103 LEU n 
2 104 VAL n 
2 105 PHE n 
2 106 GLU n 
2 107 TYR n 
2 108 MET n 
2 109 ASP n 
2 110 HIS n 
2 111 ASP n 
2 112 LEU n 
2 113 MET n 
2 114 GLY n 
2 115 LEU n 
2 116 LEU n 
2 117 GLU n 
2 118 SER n 
2 119 GLY n 
2 120 LEU n 
2 121 VAL n 
2 122 HIS n 
2 123 PHE n 
2 124 SER n 
2 125 GLU n 
2 126 ASP n 
2 127 HIS n 
2 128 ILE n 
2 129 LYS n 
2 130 SER n 
2 131 PHE n 
2 132 MET n 
2 133 LYS n 
2 134 GLN n 
2 135 LEU n 
2 136 MET n 
2 137 GLU n 
2 138 GLY n 
2 139 LEU n 
2 140 GLU n 
2 141 TYR n 
2 142 CYS n 
2 143 HIS n 
2 144 LYS n 
2 145 LYS n 
2 146 ASN n 
2 147 PHE n 
2 148 LEU n 
2 149 HIS n 
2 150 ARG n 
2 151 ASP n 
2 152 ILE n 
2 153 LYS n 
2 154 CYS n 
2 155 SER n 
2 156 ASN n 
2 157 ILE n 
2 158 LEU n 
2 159 LEU n 
2 160 ASN n 
2 161 ASN n 
2 162 SER n 
2 163 GLY n 
2 164 GLN n 
2 165 ILE n 
2 166 LYS n 
2 167 LEU n 
2 168 ALA n 
2 169 ASP n 
2 170 PHE n 
2 171 GLY n 
2 172 LEU n 
2 173 ALA n 
2 174 ARG n 
2 175 LEU n 
2 176 TYR n 
2 177 ASN n 
2 178 SER n 
2 179 GLU n 
2 180 GLU n 
2 181 SER n 
2 182 ARG n 
2 183 PRO n 
2 184 TYR n 
2 185 TPO n 
2 186 ASN n 
2 187 LYS n 
2 188 VAL n 
2 189 ILE n 
2 190 THR n 
2 191 LEU n 
2 192 TRP n 
2 193 TYR n 
2 194 ARG n 
2 195 PRO n 
2 196 PRO n 
2 197 GLU n 
2 198 LEU n 
2 199 LEU n 
2 200 LEU n 
2 201 GLY n 
2 202 GLU n 
2 203 GLU n 
2 204 ARG n 
2 205 TYR n 
2 206 THR n 
2 207 PRO n 
2 208 ALA n 
2 209 ILE n 
2 210 ASP n 
2 211 VAL n 
2 212 TRP n 
2 213 SER n 
2 214 CYS n 
2 215 GLY n 
2 216 CYS n 
2 217 ILE n 
2 218 LEU n 
2 219 GLY n 
2 220 GLU n 
2 221 LEU n 
2 222 PHE n 
2 223 THR n 
2 224 LYS n 
2 225 LYS n 
2 226 PRO n 
2 227 ILE n 
2 228 PHE n 
2 229 GLN n 
2 230 ALA n 
2 231 ASN n 
2 232 LEU n 
2 233 GLU n 
2 234 LEU n 
2 235 ALA n 
2 236 GLN n 
2 237 LEU n 
2 238 GLU n 
2 239 LEU n 
2 240 ILE n 
2 241 SER n 
2 242 ARG n 
2 243 LEU n 
2 244 CYS n 
2 245 GLY n 
2 246 SER n 
2 247 PRO n 
2 248 CYS n 
2 249 PRO n 
2 250 ALA n 
2 251 VAL n 
2 252 TRP n 
2 253 PRO n 
2 254 ASP n 
2 255 VAL n 
2 256 ILE n 
2 257 ARG n 
2 258 LEU n 
2 259 PRO n 
2 260 TYR n 
2 261 PHE n 
2 262 ASN n 
2 263 THR n 
2 264 MET n 
2 265 LYS n 
2 266 PRO n 
2 267 LYS n 
2 268 LYS n 
2 269 GLN n 
2 270 TYR n 
2 271 ARG n 
2 272 ARG n 
2 273 ARG n 
2 274 LEU n 
2 275 ARG n 
2 276 GLU n 
2 277 GLU n 
2 278 PHE n 
2 279 SER n 
2 280 PHE n 
2 281 ILE n 
2 282 PRO n 
2 283 SER n 
2 284 ALA n 
2 285 ALA n 
2 286 LEU n 
2 287 ASP n 
2 288 LEU n 
2 289 LEU n 
2 290 ASP n 
2 291 HIS n 
2 292 MET n 
2 293 LEU n 
2 294 THR n 
2 295 LEU n 
2 296 ASP n 
2 297 PRO n 
2 298 SER n 
2 299 LYS n 
2 300 ARG n 
2 301 CYS n 
2 302 THR n 
2 303 ALA n 
2 304 GLU n 
2 305 GLN n 
2 306 THR n 
2 307 LEU n 
2 308 GLN n 
2 309 SER n 
2 310 ASP n 
2 311 PHE n 
2 312 LEU n 
2 313 LYS n 
2 314 ASP n 
2 315 VAL n 
2 316 GLU n 
2 317 LEU n 
2 318 SER n 
2 319 LYS n 
2 320 MET n 
2 321 ALA n 
2 322 PRO n 
2 323 PRO n 
2 324 ASP n 
2 325 LEU n 
2 326 PRO n 
2 327 HIS n 
2 328 TRP n 
2 329 GLN n 
2 330 ASP n 
2 331 CYS n 
2 332 HIS n 
2 333 GLU n 
2 334 LEU n 
2 335 TRP n 
2 336 SER n 
2 337 LYS n 
2 338 LYS n 
2 339 ARG n 
2 340 ARG n 
2 341 ARG n 
2 342 GLN n 
2 343 ARG n 
2 344 GLN n 
3 1   GLY n 
3 2   GLY n 
3 3   GLY n 
3 4   ARG n 
3 5   MET n 
3 6   LYS n 
3 7   GLU n 
3 8   ASN n 
3 9   LYS n 
3 10  GLU n 
3 11  ASN n 
3 12  SER n 
3 13  SER n 
3 14  PRO n 
3 15  SER n 
3 16  VAL n 
3 17  THR n 
3 18  SER n 
3 19  ALA n 
3 20  ASN n 
3 21  LEU n 
3 22  ASP n 
3 23  HIS n 
3 24  THR n 
3 25  LYS n 
3 26  PRO n 
3 27  CYS n 
3 28  TRP n 
3 29  TYR n 
3 30  TRP n 
3 31  ASP n 
3 32  LYS n 
3 33  LYS n 
3 34  ASP n 
3 35  LEU n 
3 36  ALA n 
3 37  HIS n 
3 38  THR n 
3 39  PRO n 
3 40  SER n 
3 41  GLN n 
3 42  LEU n 
3 43  GLU n 
3 44  GLY n 
3 45  LEU n 
3 46  ASP n 
3 47  PRO n 
3 48  ALA n 
3 49  THR n 
3 50  GLU n 
3 51  ALA n 
3 52  ARG n 
3 53  TYR n 
3 54  ARG n 
3 55  ARG n 
3 56  GLU n 
3 57  GLY n 
3 58  ALA n 
3 59  ARG n 
3 60  PHE n 
3 61  ILE n 
3 62  PHE n 
3 63  ASP n 
3 64  VAL n 
3 65  GLY n 
3 66  THR n 
3 67  ARG n 
3 68  LEU n 
3 69  GLY n 
3 70  LEU n 
3 71  HIS n 
3 72  TYR n 
3 73  ASP n 
3 74  THR n 
3 75  LEU n 
3 76  ALA n 
3 77  THR n 
3 78  GLY n 
3 79  ILE n 
3 80  ILE n 
3 81  TYR n 
3 82  PHE n 
3 83  HIS n 
3 84  ARG n 
3 85  PHE n 
3 86  TYR n 
3 87  MET n 
3 88  PHE n 
3 89  HIS n 
3 90  SER n 
3 91  PHE n 
3 92  LYS n 
3 93  GLN n 
3 94  PHE n 
3 95  PRO n 
3 96  ARG n 
3 97  TYR n 
3 98  VAL n 
3 99  THR n 
3 100 GLY n 
3 101 ALA n 
3 102 CYS n 
3 103 CYS n 
3 104 LEU n 
3 105 PHE n 
3 106 LEU n 
3 107 ALA n 
3 108 GLY n 
3 109 LYS n 
3 110 VAL n 
3 111 GLU n 
3 112 GLU n 
3 113 THR n 
3 114 PRO n 
3 115 LYS n 
3 116 LYS n 
3 117 CYS n 
3 118 LYS n 
3 119 ASP n 
3 120 ILE n 
3 121 ILE n 
3 122 LYS n 
3 123 THR n 
3 124 ALA n 
3 125 ARG n 
3 126 SER n 
3 127 LEU n 
3 128 LEU n 
3 129 ASN n 
3 130 ASP n 
3 131 VAL n 
3 132 GLN n 
3 133 PHE n 
3 134 GLY n 
3 135 GLN n 
3 136 PHE n 
3 137 GLY n 
3 138 ASP n 
3 139 ASP n 
3 140 PRO n 
3 141 LYS n 
3 142 GLU n 
3 143 GLU n 
3 144 VAL n 
3 145 MET n 
3 146 VAL n 
3 147 LEU n 
3 148 GLU n 
3 149 ARG n 
3 150 ILE n 
3 151 LEU n 
3 152 LEU n 
3 153 GLN n 
3 154 THR n 
3 155 ILE n 
3 156 LYS n 
3 157 PHE n 
3 158 ASP n 
3 159 LEU n 
3 160 GLN n 
3 161 VAL n 
3 162 GLU n 
3 163 HIS n 
3 164 PRO n 
3 165 TYR n 
3 166 GLN n 
3 167 PHE n 
3 168 LEU n 
3 169 LEU n 
3 170 LYS n 
3 171 TYR n 
3 172 ALA n 
3 173 LYS n 
3 174 GLN n 
3 175 LEU n 
3 176 LYS n 
3 177 GLY n 
3 178 ASP n 
3 179 LYS n 
3 180 ASN n 
3 181 LYS n 
3 182 ILE n 
3 183 GLN n 
3 184 LYS n 
3 185 LEU n 
3 186 VAL n 
3 187 GLN n 
3 188 MET n 
3 189 ALA n 
3 190 TRP n 
3 191 THR n 
3 192 PHE n 
3 193 VAL n 
3 194 ASN n 
3 195 ASP n 
3 196 SER n 
3 197 LEU n 
3 198 CYS n 
3 199 THR n 
3 200 THR n 
3 201 LEU n 
3 202 SER n 
3 203 LEU n 
3 204 GLN n 
3 205 TRP n 
3 206 GLU n 
3 207 PRO n 
3 208 GLU n 
3 209 ILE n 
3 210 ILE n 
3 211 ALA n 
3 212 VAL n 
3 213 ALA n 
3 214 VAL n 
3 215 MET n 
3 216 TYR n 
3 217 LEU n 
3 218 ALA n 
3 219 GLY n 
3 220 ARG n 
3 221 LEU n 
3 222 CYS n 
3 223 LYS n 
3 224 PHE n 
3 225 GLU n 
3 226 ILE n 
3 227 GLN n 
3 228 GLU n 
3 229 TRP n 
3 230 THR n 
3 231 SER n 
3 232 LYS n 
3 233 PRO n 
3 234 MET n 
3 235 TYR n 
3 236 ARG n 
3 237 ARG n 
3 238 TRP n 
3 239 TRP n 
3 240 GLU n 
3 241 GLN n 
3 242 PHE n 
3 243 VAL n 
3 244 GLN n 
3 245 ASP n 
3 246 VAL n 
3 247 PRO n 
3 248 VAL n 
3 249 ASP n 
3 250 VAL n 
3 251 LEU n 
3 252 GLU n 
3 253 ASP n 
3 254 ILE n 
3 255 CYS n 
3 256 HIS n 
3 257 GLN n 
3 258 ILE n 
3 259 LEU n 
3 260 ASP n 
3 261 LEU n 
3 262 TYR n 
3 263 SER n 
3 264 GLN n 
3 265 GLY n 
3 266 LYS n 
3 267 GLN n 
3 268 GLN n 
3 269 MET n 
3 270 PRO n 
3 271 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   407 Human ? 'DDB1, XAP1'                   ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'cabbage looper' 'Trichoplusia ni' 7111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 408 840 Human ? 'DDB1, XAP1'                   ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'cabbage looper' 'Trichoplusia ni' 7111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1   344 Human ? 'CDK12, CRK7, CRKRS, KIAA0904' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'cabbage looper' 'Trichoplusia ni' 7111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1   271 Human ? 'CCNK, CPR4'                   ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'cabbage looper' 'Trichoplusia ni' 7111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP DDB1_HUMAN  Q16531 ?        1 
;MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFIL
TAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLE
ELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYH
NGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNG
VVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIG
;
1   
2 UNP DDB1_HUMAN  Q16531 ?        1 
;QKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVE
VHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVK
GAVYSMVEFNGKLLASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIAR
DFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGS
VLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQE
VVANLQYDDGSGMKREATADDLIKVVEELTRIH
;
708 
3 UNP CDK12_HUMAN Q9NYV4 Q9NYV4-3 2 
;RRQTESDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKE
IVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSG
QIKLADFGLARLYNSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRL
CGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPP
DLPHWQDCHELWSKKRRRQR
;
712 
4 UNP CCNK_HUMAN  O75909 O75909-4 3 
;MKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDTLATGIIYFHR
FYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEVMVLERILLQTIKFDLQVEHP
YQFLLKYAKQLKGDKNKIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEWTSKPMYRRWWEQFVQ
DVPVDVLEDICHQILDLYSQGKQQMPH
;
1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6TD3 A 5   ? 399 ? Q16531 1   ? 395  ? 1   699  
2  2 6TD3 A 408 ? 840 ? Q16531 708 ? 1140 ? 708 1140 
3  3 6TD3 B 4   ? 343 ? Q9NYV4 712 ? 1051 ? 712 1051 
4  4 6TD3 C 5   ? 271 ? O75909 1   ? 267  ? 1   267  
5  1 6TD3 D 5   ? 399 ? Q16531 1   ? 395  ? 1   699  
6  2 6TD3 D 408 ? 840 ? Q16531 708 ? 1140 ? 708 1140 
7  3 6TD3 E 4   ? 343 ? Q9NYV4 712 ? 1051 ? 712 1051 
8  4 6TD3 F 5   ? 271 ? O75909 1   ? 267  ? 1   267  
9  1 6TD3 G 5   ? 399 ? Q16531 1   ? 395  ? 1   699  
10 2 6TD3 G 408 ? 840 ? Q16531 708 ? 1140 ? 708 1140 
11 3 6TD3 H 4   ? 343 ? Q9NYV4 712 ? 1051 ? 712 1051 
12 4 6TD3 I 5   ? 271 ? O75909 1   ? 267  ? 1   267  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  6TD3 GLY A 1   ? UNP Q16531 ?   ?   'expression tag'      -3   1  
1  6TD3 GLY A 2   ? UNP Q16531 ?   ?   'expression tag'      -2   2  
1  6TD3 GLY A 3   ? UNP Q16531 ?   ?   'expression tag'      -1   3  
1  6TD3 ARG A 4   ? UNP Q16531 ?   ?   'expression tag'      0    4  
1  6TD3 GLY A 400 ? UNP Q16531 ?   ?   linker                700  5  
1  6TD3 ASN A 401 ? UNP Q16531 ?   ?   linker                701  6  
1  6TD3 GLY A 402 ? UNP Q16531 ?   ?   linker                702  7  
1  6TD3 ASN A 403 ? UNP Q16531 ?   ?   linker                703  8  
1  6TD3 SER A 404 ? UNP Q16531 ?   ?   linker                704  9  
1  6TD3 GLY A 405 ? UNP Q16531 ?   ?   linker                705  10 
1  6TD3 GLU A 406 ? UNP Q16531 ?   ?   linker                706  11 
1  6TD3 ILE A 407 ? UNP Q16531 ?   ?   linker                707  12 
3  6TD3 GLY B 1   ? UNP Q9NYV4 ?   ?   'expression tag'      709  13 
3  6TD3 GLY B 2   ? UNP Q9NYV4 ?   ?   'expression tag'      710  14 
3  6TD3 GLY B 3   ? UNP Q9NYV4 ?   ?   'expression tag'      711  15 
3  6TD3 ARG B 257 ? UNP Q9NYV4 LYS 965 'engineered mutation' 965  16 
3  6TD3 GLN B 344 ? UNP Q9NYV4 ?   ?   'expression tag'      1052 17 
4  6TD3 GLY C 1   ? UNP O75909 ?   ?   'expression tag'      -3   18 
4  6TD3 GLY C 2   ? UNP O75909 ?   ?   'expression tag'      -2   19 
4  6TD3 GLY C 3   ? UNP O75909 ?   ?   'expression tag'      -1   20 
4  6TD3 ARG C 4   ? UNP O75909 ?   ?   'expression tag'      0    21 
5  6TD3 GLY D 1   ? UNP Q16531 ?   ?   'expression tag'      -3   22 
5  6TD3 GLY D 2   ? UNP Q16531 ?   ?   'expression tag'      -2   23 
5  6TD3 GLY D 3   ? UNP Q16531 ?   ?   'expression tag'      -1   24 
5  6TD3 ARG D 4   ? UNP Q16531 ?   ?   'expression tag'      0    25 
5  6TD3 GLY D 400 ? UNP Q16531 ?   ?   linker                700  26 
5  6TD3 ASN D 401 ? UNP Q16531 ?   ?   linker                701  27 
5  6TD3 GLY D 402 ? UNP Q16531 ?   ?   linker                702  28 
5  6TD3 ASN D 403 ? UNP Q16531 ?   ?   linker                703  29 
5  6TD3 SER D 404 ? UNP Q16531 ?   ?   linker                704  30 
5  6TD3 GLY D 405 ? UNP Q16531 ?   ?   linker                705  31 
5  6TD3 GLU D 406 ? UNP Q16531 ?   ?   linker                706  32 
5  6TD3 ILE D 407 ? UNP Q16531 ?   ?   linker                707  33 
7  6TD3 GLY E 1   ? UNP Q9NYV4 ?   ?   'expression tag'      709  34 
7  6TD3 GLY E 2   ? UNP Q9NYV4 ?   ?   'expression tag'      710  35 
7  6TD3 GLY E 3   ? UNP Q9NYV4 ?   ?   'expression tag'      711  36 
7  6TD3 ARG E 257 ? UNP Q9NYV4 LYS 965 'engineered mutation' 965  37 
7  6TD3 GLN E 344 ? UNP Q9NYV4 ?   ?   'expression tag'      1052 38 
8  6TD3 GLY F 1   ? UNP O75909 ?   ?   'expression tag'      -3   39 
8  6TD3 GLY F 2   ? UNP O75909 ?   ?   'expression tag'      -2   40 
8  6TD3 GLY F 3   ? UNP O75909 ?   ?   'expression tag'      -1   41 
8  6TD3 ARG F 4   ? UNP O75909 ?   ?   'expression tag'      0    42 
9  6TD3 GLY G 1   ? UNP Q16531 ?   ?   'expression tag'      -3   43 
9  6TD3 GLY G 2   ? UNP Q16531 ?   ?   'expression tag'      -2   44 
9  6TD3 GLY G 3   ? UNP Q16531 ?   ?   'expression tag'      -1   45 
9  6TD3 ARG G 4   ? UNP Q16531 ?   ?   'expression tag'      0    46 
9  6TD3 GLY G 400 ? UNP Q16531 ?   ?   linker                700  47 
9  6TD3 ASN G 401 ? UNP Q16531 ?   ?   linker                701  48 
9  6TD3 GLY G 402 ? UNP Q16531 ?   ?   linker                702  49 
9  6TD3 ASN G 403 ? UNP Q16531 ?   ?   linker                703  50 
9  6TD3 SER G 404 ? UNP Q16531 ?   ?   linker                704  51 
9  6TD3 GLY G 405 ? UNP Q16531 ?   ?   linker                705  52 
9  6TD3 GLU G 406 ? UNP Q16531 ?   ?   linker                706  53 
9  6TD3 ILE G 407 ? UNP Q16531 ?   ?   linker                707  54 
11 6TD3 GLY H 1   ? UNP Q9NYV4 ?   ?   'expression tag'      709  55 
11 6TD3 GLY H 2   ? UNP Q9NYV4 ?   ?   'expression tag'      710  56 
11 6TD3 GLY H 3   ? UNP Q9NYV4 ?   ?   'expression tag'      711  57 
11 6TD3 ARG H 257 ? UNP Q9NYV4 LYS 965 'engineered mutation' 965  58 
11 6TD3 GLN H 344 ? UNP Q9NYV4 ?   ?   'expression tag'      1052 59 
12 6TD3 GLY I 1   ? UNP O75909 ?   ?   'expression tag'      -3   60 
12 6TD3 GLY I 2   ? UNP O75909 ?   ?   'expression tag'      -2   61 
12 6TD3 GLY I 3   ? UNP O75909 ?   ?   'expression tag'      -1   62 
12 6TD3 ARG I 4   ? UNP O75909 ?   ?   'expression tag'      0    63 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                     ? 
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                                                    ? 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                  ? 
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                             ? 
'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                    ? 
'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                                   ? 
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                             ? 
'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                                                     ? 
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                   ? 
'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                                                  ? 
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                     ? 
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                                      ? 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                                                  ? 
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                               ? 
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                                                     ? 
'C5 H9 N O2'     115.130 
RC8 non-polymer         . '(2R)-2-({9-(1-methylethyl)-6-[(4-pyridin-2-ylbenzyl)amino]-9H-purin-2-yl}amino)butan-1-ol' ? 
'C24 H29 N7 O'   431.533 
SER 'L-peptide linking' y SERINE                                                                                      ? 
'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                                                   ? 
'C4 H9 N O3'     119.119 
TPO 'L-peptide linking' n PHOSPHOTHREONINE                                                                            
PHOSPHONOTHREONINE 'C4 H10 N O6 P'  199.099 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                  ? 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                    ? 
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                                      ? 
'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6TD3 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.11 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         70.04 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.9 M ammonium citrate tribasic' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 16M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2019-07-14 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6TD3 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.46 
_reflns.d_resolution_low                 54 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       89203 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             95.1 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  12.0 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            7.2 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.318 
_reflns.pdbx_Rpim_I_all                  0.092 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.416 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.46 
_reflns_shell.d_res_low                   3.63 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         0.9 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           4460 
_reflns_shell.percent_possible_all        68.3 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             11.6 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.416 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            4.0043 
_refine.aniso_B[1][2]                            0 
_refine.aniso_B[1][3]                            0 
_refine.aniso_B[2][2]                            4.0043 
_refine.aniso_B[2][3]                            0 
_refine.aniso_B[3][3]                            -8.0085 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               80.62 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.733 
_refine.correlation_coeff_Fo_to_Fc_free          0.708 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6TD3 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.46 
_refine.ls_d_res_low                             54 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     89183 
_refine.ls_number_reflns_R_free                  4439 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    86.5 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1951 
_refine.ls_R_factor_R_free                       0.22 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1938 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      '6H0F, 4NST' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.473 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        6TD3 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    0.47 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       3.46 
_refine_hist.d_res_low                        54 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               33877 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        33781 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         96 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.009 ? 68300  ? t_bond_d                  2  HARMONIC     
'X-RAY DIFFRACTION' ? 1.01  ? 123593 ? t_angle_deg               2  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 20468  ? t_dihedral_angle_d        2  SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?     ? 10733  ? t_gen_planes              5  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 34489  ? t_it                      10 HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 5      ? t_nbd                     5  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?     ? 4434   ? t_chiral_improper_torsion 5  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?     ? 48152  ? t_ideal_dist_contact      4  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? 2.87  ? ?      ? t_omega_torsion           ?  ?            
'X-RAY DIFFRACTION' ? 15.25 ? ?      ? t_other_torsion           ?  ?            
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       3.46 
_refine_ls_shell.d_res_low                        4 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                1784 
_refine_ls_shell.number_reflns_R_free             80 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.percent_reflns_obs               22.52 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     0.2435 
_refine_ls_shell.R_factor_R_free                  0.2586 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.2428 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_R_complete                  ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     6TD3 
_struct.title                        'Structure of DDB1 bound to CR8-engaged CDK12-cyclinK' 
_struct.pdbx_descriptor              
'DNA damage-binding protein 1,DNA damage-binding protein 1, Cyclin-dependent kinase 12 (E.C.2.7.11.22,2.7.11.23), Cyclin-K' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6TD3 
_struct_keywords.text            'ubiquitin ligase kinase cyclin CDK, LIGASE' 
_struct_keywords.pdbx_keywords   LIGASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 1 ? 
H N N 2 ? 
I N N 3 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 PRO A 254 ? GLN A 259 ? PRO A 250  GLN A 255  1 ? 6  
HELX_P HELX_P2   AA2 ALA A 385 ? GLU A 388 ? ALA A 381  GLU A 384  5 ? 4  
HELX_P HELX_P3   AA3 THR A 685 ? GLN A 690 ? THR A 985  GLN A 990  1 ? 6  
HELX_P HELX_P4   AA4 SER A 744 ? ILE A 762 ? SER A 1044 ILE A 1062 1 ? 19 
HELX_P HELX_P5   AA5 SER A 764 ? ILE A 768 ? SER A 1064 ILE A 1068 5 ? 5  
HELX_P HELX_P6   AA6 GLU A 769 ? SER A 775 ? GLU A 1069 SER A 1075 1 ? 7  
HELX_P HELX_P7   AA7 GLY A 791 ? SER A 796 ? GLY A 1091 SER A 1096 1 ? 6  
HELX_P HELX_P8   AA8 PHE A 797 ? ILE A 800 ? PHE A 1097 ILE A 1100 5 ? 4  
HELX_P HELX_P9   AA9 SER A 801 ? ALA A 810 ? SER A 1101 ALA A 1110 1 ? 10 
HELX_P HELX_P10  AB1 THR A 825 ? ARG A 838 ? THR A 1125 ARG A 1138 1 ? 14 
HELX_P HELX_P11  AB2 CYS B 15  ? ASP B 17  ? CYS B 723  ASP B 725  5 ? 3  
HELX_P HELX_P12  AB3 PRO B 60  ? LEU B 73  ? PRO B 768  LEU B 781  1 ? 14 
HELX_P HELX_P13  AB4 LEU B 112 ? SER B 118 ? LEU B 820  SER B 826  1 ? 7  
HELX_P HELX_P14  AB5 SER B 124 ? LYS B 145 ? SER B 832  LYS B 853  1 ? 22 
HELX_P HELX_P15  AB6 LYS B 153 ? SER B 155 ? LYS B 861  SER B 863  5 ? 3  
HELX_P HELX_P16  AB7 ASP B 169 ? ALA B 173 ? ASP B 877  ALA B 881  5 ? 5  
HELX_P HELX_P17  AB8 THR B 190 ? ARG B 194 ? THR B 898  ARG B 902  5 ? 5  
HELX_P HELX_P18  AB9 PRO B 195 ? LEU B 200 ? PRO B 903  LEU B 908  1 ? 6  
HELX_P HELX_P19  AC1 PRO B 207 ? LYS B 224 ? PRO B 915  LYS B 932  1 ? 18 
HELX_P HELX_P20  AC2 LEU B 232 ? GLY B 245 ? LEU B 940  GLY B 953  1 ? 14 
HELX_P HELX_P21  AC3 TRP B 252 ? LEU B 258 ? TRP B 960  LEU B 966  5 ? 7  
HELX_P HELX_P22  AC4 ARG B 273 ? PHE B 278 ? ARG B 981  PHE B 986  1 ? 6  
HELX_P HELX_P23  AC5 PRO B 282 ? LEU B 293 ? PRO B 990  LEU B 1001 1 ? 12 
HELX_P HELX_P24  AC6 THR B 302 ? GLN B 308 ? THR B 1010 GLN B 1016 1 ? 7  
HELX_P HELX_P25  AC7 TRP B 335 ? ARG B 339 ? TRP B 1043 ARG B 1047 5 ? 5  
HELX_P HELX_P26  AC8 ASP C 31  ? HIS C 37  ? ASP C 27   HIS C 33   5 ? 7  
HELX_P HELX_P27  AC9 THR C 38  ? GLU C 43  ? THR C 34   GLU C 39   1 ? 6  
HELX_P HELX_P28  AD1 ASP C 46  ? GLY C 69  ? ASP C 42   GLY C 65   1 ? 24 
HELX_P HELX_P29  AD2 HIS C 71  ? HIS C 89  ? HIS C 67   HIS C 85   1 ? 19 
HELX_P HELX_P30  AD3 PRO C 95  ? GLU C 111 ? PRO C 91   GLU C 107  1 ? 17 
HELX_P HELX_P31  AD4 LYS C 116 ? LEU C 128 ? LYS C 112  LEU C 124  1 ? 13 
HELX_P HELX_P32  AD5 ASN C 129 ? GLY C 134 ? ASN C 125  GLY C 130  1 ? 6  
HELX_P HELX_P33  AD6 GLN C 135 ? GLY C 137 ? GLN C 131  GLY C 133  5 ? 3  
HELX_P HELX_P34  AD7 ASP C 139 ? ILE C 155 ? ASP C 135  ILE C 151  1 ? 17 
HELX_P HELX_P35  AD8 HIS C 163 ? GLN C 174 ? HIS C 159  GLN C 170  1 ? 12 
HELX_P HELX_P36  AD9 ASP C 178 ? SER C 196 ? ASP C 174  SER C 192  1 ? 19 
HELX_P HELX_P37  AE1 LEU C 197 ? CYS C 198 ? LEU C 193  CYS C 194  5 ? 2  
HELX_P HELX_P38  AE2 THR C 199 ? GLN C 204 ? THR C 195  GLN C 200  5 ? 6  
HELX_P HELX_P39  AE3 GLU C 206 ? LYS C 223 ? GLU C 202  LYS C 219  1 ? 18 
HELX_P HELX_P40  AE4 GLU C 225 ? THR C 230 ? GLU C 221  THR C 226  1 ? 6  
HELX_P HELX_P41  AE5 ARG C 237 ? PHE C 242 ? ARG C 233  PHE C 238  5 ? 6  
HELX_P HELX_P42  AE6 PRO C 247 ? GLY C 265 ? PRO C 243  GLY C 261  1 ? 19 
HELX_P HELX_P43  AE7 PRO D 254 ? GLN D 259 ? PRO D 250  GLN D 255  1 ? 6  
HELX_P HELX_P44  AE8 ALA D 385 ? GLU D 388 ? ALA D 381  GLU D 384  5 ? 4  
HELX_P HELX_P45  AE9 GLU D 428 ? SER D 430 ? GLU D 728  SER D 730  5 ? 3  
HELX_P HELX_P46  AF1 THR D 685 ? GLN D 690 ? THR D 985  GLN D 990  1 ? 6  
HELX_P HELX_P47  AF2 SER D 744 ? ILE D 762 ? SER D 1044 ILE D 1062 1 ? 19 
HELX_P HELX_P48  AF3 SER D 764 ? ILE D 768 ? SER D 1064 ILE D 1068 5 ? 5  
HELX_P HELX_P49  AF4 GLU D 769 ? SER D 775 ? GLU D 1069 SER D 1075 1 ? 7  
HELX_P HELX_P50  AF5 GLY D 791 ? SER D 796 ? GLY D 1091 SER D 1096 1 ? 6  
HELX_P HELX_P51  AF6 PHE D 797 ? ILE D 800 ? PHE D 1097 ILE D 1100 5 ? 4  
HELX_P HELX_P52  AF7 SER D 801 ? ALA D 810 ? SER D 1101 ALA D 1110 1 ? 10 
HELX_P HELX_P53  AF8 THR D 825 ? ARG D 838 ? THR D 1125 ARG D 1138 1 ? 14 
HELX_P HELX_P54  AF9 CYS E 15  ? ASP E 17  ? CYS E 723  ASP E 725  5 ? 3  
HELX_P HELX_P55  AG1 PRO E 60  ? LEU E 73  ? PRO E 768  LEU E 781  1 ? 14 
HELX_P HELX_P56  AG2 LEU E 112 ? SER E 118 ? LEU E 820  SER E 826  1 ? 7  
HELX_P HELX_P57  AG3 SER E 124 ? LYS E 145 ? SER E 832  LYS E 853  1 ? 22 
HELX_P HELX_P58  AG4 LYS E 153 ? SER E 155 ? LYS E 861  SER E 863  5 ? 3  
HELX_P HELX_P59  AG5 THR E 190 ? ARG E 194 ? THR E 898  ARG E 902  5 ? 5  
HELX_P HELX_P60  AG6 PRO E 195 ? LEU E 200 ? PRO E 903  LEU E 908  1 ? 6  
HELX_P HELX_P61  AG7 PRO E 207 ? LYS E 224 ? PRO E 915  LYS E 932  1 ? 18 
HELX_P HELX_P62  AG8 LEU E 232 ? GLY E 245 ? LEU E 940  GLY E 953  1 ? 14 
HELX_P HELX_P63  AG9 TRP E 252 ? LEU E 258 ? TRP E 960  LEU E 966  5 ? 7  
HELX_P HELX_P64  AH1 ARG E 273 ? PHE E 278 ? ARG E 981  PHE E 986  1 ? 6  
HELX_P HELX_P65  AH2 PRO E 282 ? LEU E 293 ? PRO E 990  LEU E 1001 1 ? 12 
HELX_P HELX_P66  AH3 THR E 302 ? GLN E 308 ? THR E 1010 GLN E 1016 1 ? 7  
HELX_P HELX_P67  AH4 LEU E 334 ? ARG E 339 ? LEU E 1042 ARG E 1047 1 ? 6  
HELX_P HELX_P68  AH5 ASP F 31  ? HIS F 37  ? ASP F 27   HIS F 33   5 ? 7  
HELX_P HELX_P69  AH6 THR F 38  ? GLU F 43  ? THR F 34   GLU F 39   1 ? 6  
HELX_P HELX_P70  AH7 ASP F 46  ? GLY F 69  ? ASP F 42   GLY F 65   1 ? 24 
HELX_P HELX_P71  AH8 HIS F 71  ? HIS F 89  ? HIS F 67   HIS F 85   1 ? 19 
HELX_P HELX_P72  AH9 PRO F 95  ? GLU F 111 ? PRO F 91   GLU F 107  1 ? 17 
HELX_P HELX_P73  AI1 LYS F 116 ? LEU F 128 ? LYS F 112  LEU F 124  1 ? 13 
HELX_P HELX_P74  AI2 ASN F 129 ? GLY F 134 ? ASN F 125  GLY F 130  1 ? 6  
HELX_P HELX_P75  AI3 GLN F 135 ? GLY F 137 ? GLN F 131  GLY F 133  5 ? 3  
HELX_P HELX_P76  AI4 ASP F 139 ? ILE F 155 ? ASP F 135  ILE F 151  1 ? 17 
HELX_P HELX_P77  AI5 HIS F 163 ? GLN F 174 ? HIS F 159  GLN F 170  1 ? 12 
HELX_P HELX_P78  AI6 ASP F 178 ? SER F 196 ? ASP F 174  SER F 192  1 ? 19 
HELX_P HELX_P79  AI7 LEU F 197 ? CYS F 198 ? LEU F 193  CYS F 194  5 ? 2  
HELX_P HELX_P80  AI8 THR F 199 ? GLN F 204 ? THR F 195  GLN F 200  5 ? 6  
HELX_P HELX_P81  AI9 GLU F 206 ? LYS F 223 ? GLU F 202  LYS F 219  1 ? 18 
HELX_P HELX_P82  AJ1 GLU F 225 ? THR F 230 ? GLU F 221  THR F 226  5 ? 6  
HELX_P HELX_P83  AJ2 ARG F 237 ? PHE F 242 ? ARG F 233  PHE F 238  5 ? 6  
HELX_P HELX_P84  AJ3 PRO F 247 ? LYS F 266 ? PRO F 243  LYS F 262  1 ? 20 
HELX_P HELX_P85  AJ4 PRO G 254 ? SER G 260 ? PRO G 250  SER G 256  5 ? 7  
HELX_P HELX_P86  AJ5 ALA G 385 ? GLU G 388 ? ALA G 381  GLU G 384  5 ? 4  
HELX_P HELX_P87  AJ6 GLU G 428 ? SER G 430 ? GLU G 728  SER G 730  5 ? 3  
HELX_P HELX_P88  AJ7 THR G 685 ? GLN G 690 ? THR G 985  GLN G 990  1 ? 6  
HELX_P HELX_P89  AJ8 SER G 744 ? ILE G 762 ? SER G 1044 ILE G 1062 1 ? 19 
HELX_P HELX_P90  AJ9 SER G 764 ? ILE G 768 ? SER G 1064 ILE G 1068 5 ? 5  
HELX_P HELX_P91  AK1 GLU G 769 ? SER G 775 ? GLU G 1069 SER G 1075 1 ? 7  
HELX_P HELX_P92  AK2 GLY G 791 ? SER G 796 ? GLY G 1091 SER G 1096 1 ? 6  
HELX_P HELX_P93  AK3 PHE G 797 ? ILE G 800 ? PHE G 1097 ILE G 1100 5 ? 4  
HELX_P HELX_P94  AK4 SER G 801 ? ALA G 810 ? SER G 1101 ALA G 1110 1 ? 10 
HELX_P HELX_P95  AK5 THR G 825 ? ARG G 838 ? THR G 1125 ARG G 1138 1 ? 14 
HELX_P HELX_P96  AK6 CYS H 15  ? ASP H 17  ? CYS H 723  ASP H 725  5 ? 3  
HELX_P HELX_P97  AK7 PRO H 60  ? LEU H 73  ? PRO H 768  LEU H 781  1 ? 14 
HELX_P HELX_P98  AK8 LEU H 112 ? SER H 118 ? LEU H 820  SER H 826  1 ? 7  
HELX_P HELX_P99  AK9 SER H 124 ? LYS H 145 ? SER H 832  LYS H 853  1 ? 22 
HELX_P HELX_P100 AL1 LYS H 153 ? SER H 155 ? LYS H 861  SER H 863  5 ? 3  
HELX_P HELX_P101 AL2 PRO H 195 ? LEU H 200 ? PRO H 903  LEU H 908  1 ? 6  
HELX_P HELX_P102 AL3 PRO H 207 ? LYS H 224 ? PRO H 915  LYS H 932  1 ? 18 
HELX_P HELX_P103 AL4 LEU H 232 ? GLY H 245 ? LEU H 940  GLY H 953  1 ? 14 
HELX_P HELX_P104 AL5 TRP H 252 ? LEU H 258 ? TRP H 960  LEU H 966  5 ? 7  
HELX_P HELX_P105 AL6 ARG H 273 ? PHE H 278 ? ARG H 981  PHE H 986  1 ? 6  
HELX_P HELX_P106 AL7 PRO H 282 ? LEU H 293 ? PRO H 990  LEU H 1001 1 ? 12 
HELX_P HELX_P107 AL8 THR H 302 ? GLN H 308 ? THR H 1010 GLN H 1016 1 ? 7  
HELX_P HELX_P108 AL9 ASP I 31  ? HIS I 37  ? ASP I 27   HIS I 33   5 ? 7  
HELX_P HELX_P109 AM1 THR I 38  ? GLU I 43  ? THR I 34   GLU I 39   1 ? 6  
HELX_P HELX_P110 AM2 ASP I 46  ? GLY I 69  ? ASP I 42   GLY I 65   1 ? 24 
HELX_P HELX_P111 AM3 HIS I 71  ? HIS I 89  ? HIS I 67   HIS I 85   1 ? 19 
HELX_P HELX_P112 AM4 PRO I 95  ? GLU I 111 ? PRO I 91   GLU I 107  1 ? 17 
HELX_P HELX_P113 AM5 LYS I 116 ? LEU I 128 ? LYS I 112  LEU I 124  1 ? 13 
HELX_P HELX_P114 AM6 ASN I 129 ? GLY I 134 ? ASN I 125  GLY I 130  1 ? 6  
HELX_P HELX_P115 AM7 GLN I 135 ? GLY I 137 ? GLN I 131  GLY I 133  5 ? 3  
HELX_P HELX_P116 AM8 ASP I 139 ? ILE I 155 ? ASP I 135  ILE I 151  1 ? 17 
HELX_P HELX_P117 AM9 HIS I 163 ? GLN I 174 ? HIS I 159  GLN I 170  1 ? 12 
HELX_P HELX_P118 AN1 ASP I 178 ? SER I 196 ? ASP I 174  SER I 192  1 ? 19 
HELX_P HELX_P119 AN2 LEU I 197 ? CYS I 198 ? LEU I 193  CYS I 194  5 ? 2  
HELX_P HELX_P120 AN3 THR I 199 ? GLN I 204 ? THR I 195  GLN I 200  5 ? 6  
HELX_P HELX_P121 AN4 GLU I 206 ? LYS I 223 ? GLU I 202  LYS I 219  1 ? 18 
HELX_P HELX_P122 AN5 GLU I 225 ? THR I 230 ? GLU I 221  THR I 226  5 ? 6  
HELX_P HELX_P123 AN6 ARG I 237 ? PHE I 242 ? ARG I 233  PHE I 238  5 ? 6  
HELX_P HELX_P124 AN7 PRO I 247 ? SER I 263 ? PRO I 243  SER I 259  1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? B TYR 184 C ? ? ? 1_555 B TPO 185 N ? ? B TYR 892 B TPO 893 1_555 ? ? ? ? ? ? ? 1.352 ? ? 
covale2 covale both ? B TPO 185 C ? ? ? 1_555 B ASN 186 N ? ? B TPO 893 B ASN 894 1_555 ? ? ? ? ? ? ? 1.351 ? ? 
covale3 covale both ? E TYR 184 C ? ? ? 1_555 E TPO 185 N ? ? E TYR 892 E TPO 893 1_555 ? ? ? ? ? ? ? 1.346 ? ? 
covale4 covale both ? E TPO 185 C ? ? ? 1_555 E ASN 186 N ? ? E TPO 893 E ASN 894 1_555 ? ? ? ? ? ? ? 1.355 ? ? 
covale5 covale both ? H TYR 184 C ? ? ? 1_555 H TPO 185 N ? ? H TYR 892 H TPO 893 1_555 ? ? ? ? ? ? ? 1.346 ? ? 
covale6 covale both ? H TPO 185 C ? ? ? 1_555 H ASN 186 N ? ? H TPO 893 H ASN 894 1_555 ? ? ? ? ? ? ? 1.332 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 228 A . ? GLU 224 A PRO 229 A ? PRO 225 A 1 3.30 
2 GLU 228 D . ? GLU 224 D PRO 229 D ? PRO 225 D 1 3.19 
3 GLU 228 G . ? GLU 224 G PRO 229 G ? PRO 225 G 1 4.07 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 4 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 4 ? 
AA9 ? 4 ? 
AB1 ? 4 ? 
AB2 ? 3 ? 
AB3 ? 5 ? 
AB4 ? 4 ? 
AB5 ? 4 ? 
AB6 ? 4 ? 
AB7 ? 4 ? 
AB8 ? 2 ? 
AB9 ? 5 ? 
AC1 ? 3 ? 
AC2 ? 2 ? 
AC3 ? 5 ? 
AC4 ? 4 ? 
AC5 ? 4 ? 
AC6 ? 4 ? 
AC7 ? 4 ? 
AC8 ? 4 ? 
AC9 ? 4 ? 
AD1 ? 4 ? 
AD2 ? 4 ? 
AD3 ? 4 ? 
AD4 ? 3 ? 
AD5 ? 5 ? 
AD6 ? 4 ? 
AD7 ? 4 ? 
AD8 ? 4 ? 
AD9 ? 4 ? 
AE1 ? 2 ? 
AE2 ? 2 ? 
AE3 ? 5 ? 
AE4 ? 3 ? 
AE5 ? 2 ? 
AE6 ? 5 ? 
AE7 ? 4 ? 
AE8 ? 4 ? 
AE9 ? 4 ? 
AF1 ? 4 ? 
AF2 ? 4 ? 
AF3 ? 4 ? 
AF4 ? 4 ? 
AF5 ? 4 ? 
AF6 ? 4 ? 
AF7 ? 3 ? 
AF8 ? 5 ? 
AF9 ? 4 ? 
AG1 ? 4 ? 
AG2 ? 4 ? 
AG3 ? 4 ? 
AG4 ? 2 ? 
AG5 ? 2 ? 
AG6 ? 5 ? 
AG7 ? 3 ? 
AG8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB3 4 5 ? parallel      
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AB9 4 5 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC3 4 5 ? parallel      
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC8 3 4 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD2 3 4 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD3 3 4 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD5 3 4 ? anti-parallel 
AD5 4 5 ? parallel      
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD6 3 4 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD7 3 4 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? anti-parallel 
AD8 3 4 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AD9 3 4 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE3 3 4 ? anti-parallel 
AE3 4 5 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE6 2 3 ? anti-parallel 
AE6 3 4 ? anti-parallel 
AE6 4 5 ? parallel      
AE7 1 2 ? anti-parallel 
AE7 2 3 ? anti-parallel 
AE7 3 4 ? anti-parallel 
AE8 1 2 ? anti-parallel 
AE8 2 3 ? anti-parallel 
AE8 3 4 ? anti-parallel 
AE9 1 2 ? anti-parallel 
AE9 2 3 ? anti-parallel 
AE9 3 4 ? anti-parallel 
AF1 1 2 ? anti-parallel 
AF1 2 3 ? anti-parallel 
AF1 3 4 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF2 2 3 ? anti-parallel 
AF2 3 4 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF3 2 3 ? anti-parallel 
AF3 3 4 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF4 2 3 ? anti-parallel 
AF4 3 4 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF5 2 3 ? anti-parallel 
AF5 3 4 ? anti-parallel 
AF6 1 2 ? anti-parallel 
AF6 2 3 ? anti-parallel 
AF6 3 4 ? anti-parallel 
AF7 1 2 ? anti-parallel 
AF7 2 3 ? anti-parallel 
AF8 1 2 ? anti-parallel 
AF8 2 3 ? anti-parallel 
AF8 3 4 ? anti-parallel 
AF8 4 5 ? parallel      
AF9 1 2 ? anti-parallel 
AF9 2 3 ? anti-parallel 
AF9 3 4 ? anti-parallel 
AG1 1 2 ? anti-parallel 
AG1 2 3 ? anti-parallel 
AG1 3 4 ? anti-parallel 
AG2 1 2 ? anti-parallel 
AG2 2 3 ? anti-parallel 
AG2 3 4 ? anti-parallel 
AG3 1 2 ? anti-parallel 
AG3 2 3 ? anti-parallel 
AG3 3 4 ? anti-parallel 
AG4 1 2 ? anti-parallel 
AG5 1 2 ? anti-parallel 
AG6 1 2 ? anti-parallel 
AG6 2 3 ? anti-parallel 
AG6 3 4 ? anti-parallel 
AG6 4 5 ? anti-parallel 
AG7 1 2 ? anti-parallel 
AG7 2 3 ? anti-parallel 
AG8 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 704 ? HIS A 709 ? VAL A 1004 HIS A 1009 
AA1 2 GLN A 725 ? THR A 732 ? GLN A 1025 THR A 1032 
AA1 3 ILE A 737 ? SER A 742 ? ILE A 1037 SER A 1042 
AA1 4 ASN A 8   ? GLN A 14  ? ASN A 4    GLN A 10   
AA1 5 PHE A 788 ? ASP A 790 ? PHE A 1088 ASP A 1090 
AA2 1 GLY A 21  ? GLY A 25  ? GLY A 17   GLY A 21   
AA2 2 ASN A 34  ? LYS A 39  ? ASN A 30   LYS A 35   
AA2 3 ARG A 42  ? VAL A 48  ? ARG A 38   VAL A 44   
AA2 4 LEU A 53  ? GLY A 60  ? LEU A 49   GLY A 56   
AA3 1 ILE A 65  ? PHE A 71  ? ILE A 61   PHE A 67   
AA3 2 LEU A 80  ? THR A 85  ? LEU A 76   THR A 81   
AA3 3 ASN A 89  ? SER A 98  ? ASN A 85   SER A 94   
AA3 4 SER A 101 ? ASN A 111 ? SER A 97   ASN A 107  
AA4 1 ILE A 125 ? ILE A 128 ? ILE A 121  ILE A 124  
AA4 2 MET A 134 ? ARG A 138 ? MET A 130  ARG A 134  
AA4 3 LEU A 143 ? PRO A 148 ? LEU A 139  PRO A 144  
AA4 4 PHE A 159 ? ARG A 162 ? PHE A 155  ARG A 158  
AA5 1 HIS A 167 ? PHE A 173 ? HIS A 163  PHE A 169  
AA5 2 THR A 181 ? ASP A 188 ? THR A 177  ASP A 184  
AA5 3 GLY A 191 ? SER A 200 ? GLY A 187  SER A 196  
AA5 4 GLU A 205 ? LYS A 208 ? GLU A 201  LYS A 204  
AA6 1 HIS A 167 ? PHE A 173 ? HIS A 163  PHE A 169  
AA6 2 THR A 181 ? ASP A 188 ? THR A 177  ASP A 184  
AA6 3 GLY A 191 ? SER A 200 ? GLY A 187  SER A 196  
AA6 4 GLU A 214 ? VAL A 216 ? GLU A 210  VAL A 212  
AA7 1 MET A 222 ? ALA A 225 ? MET A 218  ALA A 221  
AA7 2 ALA A 233 ? ILE A 236 ? ALA A 229  ILE A 232  
AA7 3 ILE A 241 ? ASN A 245 ? ILE A 237  ASN A 241  
AA7 4 LYS A 248 ? ILE A 252 ? LYS A 244  ILE A 248  
AA8 1 ILE A 262 ? ARG A 267 ? ILE A 258  ARG A 263  
AA8 2 ARG A 274 ? ASP A 279 ? ARG A 270  ASP A 275  
AA8 3 ARG A 283 ? GLU A 293 ? ARG A 279  GLU A 289  
AA8 4 VAL A 299 ? GLU A 311 ? VAL A 295  GLU A 307  
AA9 1 ALA A 315 ? ASP A 322 ? ALA A 311  ASP A 318  
AA9 2 VAL A 325 ? SER A 330 ? VAL A 321  SER A 326  
AA9 3 SER A 335 ? LEU A 340 ? SER A 331  LEU A 336  
AA9 4 VAL A 351 ? PHE A 357 ? VAL A 347  PHE A 353  
AB1 1 ILE A 363 ? VAL A 369 ? ILE A 359  VAL A 365  
AB1 2 GLN A 378 ? SER A 383 ? GLN A 374  SER A 379  
AB1 3 SER A 390 ? ARG A 395 ? SER A 386  ARG A 391  
AB1 4 HIS A 411 ? PRO A 416 ? HIS A 711  PRO A 716  
AB2 1 SER A 420 ? GLN A 427 ? SER A 720  GLN A 727  
AB2 2 CYS A 432 ? GLN A 443 ? CYS A 732  GLN A 743  
AB2 3 THR A 449 ? ALA A 451 ? THR A 749  ALA A 751  
AB3 1 SER A 420 ? GLN A 427 ? SER A 720  GLN A 727  
AB3 2 CYS A 432 ? GLN A 443 ? CYS A 732  GLN A 743  
AB3 3 GLU A 485 ? ASP A 495 ? GLU A 785  ASP A 795  
AB3 4 VAL A 501 ? GLN A 506 ? VAL A 801  GLN A 806  
AB3 5 SER A 462 ? VAL A 465 ? SER A 762  VAL A 765  
AB4 1 GLU A 511 ? CYS A 519 ? GLU A 811  CYS A 819  
AB4 2 TYR A 528 ? MET A 535 ? TYR A 828  MET A 835  
AB4 3 GLY A 546 ? SER A 554 ? GLY A 846  SER A 854  
AB4 4 LYS A 557 ? VAL A 566 ? LYS A 857  VAL A 866  
AB5 1 VAL A 574 ? PHE A 576 ? VAL A 874  PHE A 876  
AB5 2 LYS A 579 ? ILE A 584 ? LYS A 879  ILE A 884  
AB5 3 THR A 587 ? TRP A 593 ? THR A 887  TRP A 893  
AB5 4 LEU A 599 ? HIS A 605 ? LEU A 899  HIS A 905  
AB6 1 ALA A 611 ? LYS A 617 ? ALA A 911  LYS A 917  
AB6 2 PHE A 620 ? ASP A 625 ? PHE A 920  ASP A 925  
AB6 3 VAL A 630 ? LYS A 636 ? VAL A 930  LYS A 936  
AB6 4 ASN A 641 ? ARG A 647 ? ASN A 941  ARG A 947  
AB7 1 MET A 654 ? ILE A 659 ? MET A 954  ILE A 959  
AB7 2 ASN A 664 ? GLU A 669 ? ASN A 964  GLU A 969  
AB7 3 ASN A 673 ? LYS A 679 ? ASN A 973  LYS A 979  
AB7 4 LEU A 692 ? HIS A 699 ? LEU A 992  HIS A 999  
AB8 1 PHE A 776 ? HIS A 777 ? PHE A 1076 HIS A 1077 
AB8 2 THR A 782 ? GLU A 783 ? THR A 1082 GLU A 1083 
AB9 1 PHE B 19  ? GLU B 27  ? PHE B 727  GLU B 735  
AB9 2 GLN B 32  ? ASP B 38  ? GLN B 740  ASP B 746  
AB9 3 LEU B 44  ? ARG B 51  ? LEU B 752  ARG B 759  
AB9 4 ALA B 100 ? GLU B 106 ? ALA B 808  GLU B 814  
AB9 5 MET B 81  ? THR B 86  ? MET B 789  THR B 794  
AC1 1 HIS B 110 ? ASP B 111 ? HIS B 818  ASP B 819  
AC1 2 ILE B 157 ? LEU B 159 ? ILE B 865  LEU B 867  
AC1 3 ILE B 165 ? LEU B 167 ? ILE B 873  LEU B 875  
AC2 1 PHE B 147 ? LEU B 148 ? PHE B 855  LEU B 856  
AC2 2 ARG B 174 ? LEU B 175 ? ARG B 882  LEU B 883  
AC3 1 VAL D 704 ? HIS D 709 ? VAL D 1004 HIS D 1009 
AC3 2 THR D 724 ? THR D 732 ? THR D 1024 THR D 1032 
AC3 3 ILE D 737 ? LEU D 743 ? ILE D 1037 LEU D 1043 
AC3 4 ASN D 8   ? GLN D 14  ? ASN D 4    GLN D 10   
AC3 5 PHE D 788 ? ASP D 790 ? PHE D 1088 ASP D 1090 
AC4 1 GLY D 21  ? GLY D 25  ? GLY D 17   GLY D 21   
AC4 2 ASN D 34  ? LYS D 39  ? ASN D 30   LYS D 35   
AC4 3 ARG D 42  ? VAL D 48  ? ARG D 38   VAL D 44   
AC4 4 LEU D 53  ? GLY D 60  ? LEU D 49   GLY D 56   
AC5 1 ILE D 65  ? PHE D 71  ? ILE D 61   PHE D 67   
AC5 2 LEU D 80  ? THR D 85  ? LEU D 76   THR D 81   
AC5 3 ASN D 89  ? SER D 98  ? ASN D 85   SER D 94   
AC5 4 SER D 101 ? ASN D 111 ? SER D 97   ASN D 107  
AC6 1 ILE D 125 ? ILE D 128 ? ILE D 121  ILE D 124  
AC6 2 MET D 134 ? ARG D 138 ? MET D 130  ARG D 134  
AC6 3 LEU D 143 ? PRO D 148 ? LEU D 139  PRO D 144  
AC6 4 PHE D 159 ? ARG D 162 ? PHE D 155  ARG D 158  
AC7 1 HIS D 167 ? PHE D 173 ? HIS D 163  PHE D 169  
AC7 2 THR D 181 ? ASP D 188 ? THR D 177  ASP D 184  
AC7 3 GLY D 191 ? SER D 200 ? GLY D 187  SER D 196  
AC7 4 GLU D 205 ? LYS D 208 ? GLU D 201  LYS D 204  
AC8 1 HIS D 167 ? PHE D 173 ? HIS D 163  PHE D 169  
AC8 2 THR D 181 ? ASP D 188 ? THR D 177  ASP D 184  
AC8 3 GLY D 191 ? SER D 200 ? GLY D 187  SER D 196  
AC8 4 GLU D 214 ? VAL D 216 ? GLU D 210  VAL D 212  
AC9 1 MET D 222 ? ALA D 225 ? MET D 218  ALA D 221  
AC9 2 ALA D 233 ? ILE D 236 ? ALA D 229  ILE D 232  
AC9 3 ILE D 241 ? ASN D 245 ? ILE D 237  ASN D 241  
AC9 4 LYS D 248 ? ILE D 252 ? LYS D 244  ILE D 248  
AD1 1 ILE D 262 ? ARG D 267 ? ILE D 258  ARG D 263  
AD1 2 ARG D 274 ? ASP D 279 ? ARG D 270  ASP D 275  
AD1 3 ARG D 283 ? GLU D 293 ? ARG D 279  GLU D 289  
AD1 4 VAL D 299 ? GLU D 311 ? VAL D 295  GLU D 307  
AD2 1 ALA D 315 ? TYR D 320 ? ALA D 311  TYR D 316  
AD2 2 VAL D 325 ? SER D 330 ? VAL D 321  SER D 326  
AD2 3 SER D 335 ? LEU D 340 ? SER D 331  LEU D 336  
AD2 4 VAL D 351 ? PHE D 357 ? VAL D 347  PHE D 353  
AD3 1 ILE D 363 ? VAL D 369 ? ILE D 359  VAL D 365  
AD3 2 GLN D 378 ? SER D 383 ? GLN D 374  SER D 379  
AD3 3 SER D 390 ? ASN D 396 ? SER D 386  ASN D 392  
AD3 4 LEU D 410 ? PRO D 416 ? LEU D 710  PRO D 716  
AD4 1 SER D 420 ? GLN D 427 ? SER D 720  GLN D 727  
AD4 2 CYS D 432 ? GLN D 443 ? CYS D 732  GLN D 743  
AD4 3 THR D 449 ? ALA D 451 ? THR D 749  ALA D 751  
AD5 1 SER D 420 ? GLN D 427 ? SER D 720  GLN D 727  
AD5 2 CYS D 432 ? GLN D 443 ? CYS D 732  GLN D 743  
AD5 3 GLU D 485 ? ASP D 495 ? GLU D 785  ASP D 795  
AD5 4 VAL D 501 ? GLN D 506 ? VAL D 801  GLN D 806  
AD5 5 SER D 462 ? VAL D 465 ? SER D 762  VAL D 765  
AD6 1 GLU D 511 ? CYS D 519 ? GLU D 811  CYS D 819  
AD6 2 TYR D 528 ? MET D 535 ? TYR D 828  MET D 835  
AD6 3 GLY D 546 ? SER D 554 ? GLY D 846  SER D 854  
AD6 4 LYS D 557 ? VAL D 566 ? LYS D 857  VAL D 866  
AD7 1 VAL D 570 ? PHE D 576 ? VAL D 870  PHE D 876  
AD7 2 LYS D 579 ? ILE D 584 ? LYS D 879  ILE D 884  
AD7 3 THR D 587 ? TRP D 593 ? THR D 887  TRP D 893  
AD7 4 LEU D 599 ? HIS D 605 ? LEU D 899  HIS D 905  
AD8 1 ALA D 611 ? LYS D 617 ? ALA D 911  LYS D 917  
AD8 2 PHE D 620 ? ASP D 625 ? PHE D 920  ASP D 925  
AD8 3 VAL D 630 ? LYS D 636 ? VAL D 930  LYS D 936  
AD8 4 ASN D 641 ? ARG D 647 ? ASN D 941  ARG D 947  
AD9 1 MET D 654 ? ILE D 659 ? MET D 954  ILE D 959  
AD9 2 ASN D 664 ? GLU D 669 ? ASN D 964  GLU D 969  
AD9 3 ASN D 673 ? LYS D 679 ? ASN D 973  LYS D 979  
AD9 4 LEU D 692 ? HIS D 699 ? LEU D 992  HIS D 999  
AE1 1 PHE D 776 ? HIS D 777 ? PHE D 1076 HIS D 1077 
AE1 2 THR D 782 ? GLU D 783 ? THR D 1082 GLU D 1083 
AE2 1 GLN D 813 ? TYR D 814 ? GLN D 1113 TYR D 1114 
AE2 2 ARG D 822 ? GLU D 823 ? ARG D 1122 GLU D 1123 
AE3 1 PHE E 19  ? GLU E 27  ? PHE E 727  GLU E 735  
AE3 2 GLN E 32  ? ASP E 38  ? GLN E 740  ASP E 746  
AE3 3 LEU E 44  ? ARG E 51  ? LEU E 752  ARG E 759  
AE3 4 ALA E 100 ? GLU E 106 ? ALA E 808  GLU E 814  
AE3 5 MET E 81  ? THR E 86  ? MET E 789  THR E 794  
AE4 1 HIS E 110 ? ASP E 111 ? HIS E 818  ASP E 819  
AE4 2 ILE E 157 ? LEU E 159 ? ILE E 865  LEU E 867  
AE4 3 ILE E 165 ? LEU E 167 ? ILE E 873  LEU E 875  
AE5 1 PHE E 147 ? LEU E 148 ? PHE E 855  LEU E 856  
AE5 2 ARG E 174 ? LEU E 175 ? ARG E 882  LEU E 883  
AE6 1 VAL G 704 ? HIS G 709 ? VAL G 1004 HIS G 1009 
AE6 2 THR G 724 ? THR G 732 ? THR G 1024 THR G 1032 
AE6 3 ILE G 737 ? LEU G 743 ? ILE G 1037 LEU G 1043 
AE6 4 ASN G 8   ? GLN G 14  ? ASN G 4    GLN G 10   
AE6 5 PHE G 788 ? ASP G 790 ? PHE G 1088 ASP G 1090 
AE7 1 VAL G 19  ? GLY G 25  ? VAL G 15   GLY G 21   
AE7 2 ASN G 34  ? LYS G 39  ? ASN G 30   LYS G 35   
AE7 3 ARG G 42  ? VAL G 48  ? ARG G 38   VAL G 44   
AE7 4 LEU G 53  ? GLY G 60  ? LEU G 49   GLY G 56   
AE8 1 ILE G 65  ? PHE G 71  ? ILE G 61   PHE G 67   
AE8 2 LEU G 80  ? THR G 85  ? LEU G 76   THR G 81   
AE8 3 ASN G 89  ? SER G 98  ? ASN G 85   SER G 94   
AE8 4 SER G 101 ? ASN G 111 ? SER G 97   ASN G 107  
AE9 1 ILE G 125 ? ILE G 128 ? ILE G 121  ILE G 124  
AE9 2 MET G 134 ? ARG G 138 ? MET G 130  ARG G 134  
AE9 3 LEU G 143 ? PRO G 148 ? LEU G 139  PRO G 144  
AE9 4 PHE G 159 ? ARG G 162 ? PHE G 155  ARG G 158  
AF1 1 HIS G 167 ? PHE G 173 ? HIS G 163  PHE G 169  
AF1 2 THR G 181 ? ASP G 188 ? THR G 177  ASP G 184  
AF1 3 GLY G 191 ? SER G 200 ? GLY G 187  SER G 196  
AF1 4 GLU G 205 ? LYS G 208 ? GLU G 201  LYS G 204  
AF2 1 HIS G 167 ? PHE G 173 ? HIS G 163  PHE G 169  
AF2 2 THR G 181 ? ASP G 188 ? THR G 177  ASP G 184  
AF2 3 GLY G 191 ? SER G 200 ? GLY G 187  SER G 196  
AF2 4 GLU G 214 ? VAL G 216 ? GLU G 210  VAL G 212  
AF3 1 MET G 222 ? ALA G 225 ? MET G 218  ALA G 221  
AF3 2 ALA G 233 ? ILE G 236 ? ALA G 229  ILE G 232  
AF3 3 ILE G 241 ? ASN G 245 ? ILE G 237  ASN G 241  
AF3 4 LYS G 248 ? ILE G 252 ? LYS G 244  ILE G 248  
AF4 1 ILE G 262 ? ARG G 267 ? ILE G 258  ARG G 263  
AF4 2 ARG G 274 ? ASP G 279 ? ARG G 270  ASP G 275  
AF4 3 ARG G 283 ? GLU G 293 ? ARG G 279  GLU G 289  
AF4 4 VAL G 299 ? GLU G 311 ? VAL G 295  GLU G 307  
AF5 1 ALA G 315 ? TYR G 320 ? ALA G 311  TYR G 316  
AF5 2 VAL G 325 ? SER G 330 ? VAL G 321  SER G 326  
AF5 3 SER G 335 ? LEU G 340 ? SER G 331  LEU G 336  
AF5 4 VAL G 351 ? PHE G 357 ? VAL G 347  PHE G 353  
AF6 1 ILE G 363 ? VAL G 369 ? ILE G 359  VAL G 365  
AF6 2 GLN G 378 ? SER G 383 ? GLN G 374  SER G 379  
AF6 3 SER G 390 ? ASN G 396 ? SER G 386  ASN G 392  
AF6 4 LEU G 410 ? PRO G 416 ? LEU G 710  PRO G 716  
AF7 1 SER G 420 ? GLN G 427 ? SER G 720  GLN G 727  
AF7 2 CYS G 432 ? GLN G 443 ? CYS G 732  GLN G 743  
AF7 3 THR G 449 ? THR G 450 ? THR G 749  THR G 750  
AF8 1 SER G 420 ? GLN G 427 ? SER G 720  GLN G 727  
AF8 2 CYS G 432 ? GLN G 443 ? CYS G 732  GLN G 743  
AF8 3 GLU G 485 ? ASP G 495 ? GLU G 785  ASP G 795  
AF8 4 VAL G 501 ? GLN G 506 ? VAL G 801  GLN G 806  
AF8 5 SER G 462 ? VAL G 465 ? SER G 762  VAL G 765  
AF9 1 GLU G 511 ? CYS G 519 ? GLU G 811  CYS G 819  
AF9 2 TYR G 528 ? MET G 535 ? TYR G 828  MET G 835  
AF9 3 GLY G 546 ? SER G 554 ? GLY G 846  SER G 854  
AF9 4 LYS G 557 ? VAL G 566 ? LYS G 857  VAL G 866  
AG1 1 VAL G 570 ? PHE G 576 ? VAL G 870  PHE G 876  
AG1 2 LYS G 579 ? ILE G 584 ? LYS G 879  ILE G 884  
AG1 3 THR G 587 ? TRP G 593 ? THR G 887  TRP G 893  
AG1 4 LEU G 599 ? HIS G 605 ? LEU G 899  HIS G 905  
AG2 1 ALA G 611 ? LYS G 617 ? ALA G 911  LYS G 917  
AG2 2 PHE G 620 ? ASP G 625 ? PHE G 920  ASP G 925  
AG2 3 VAL G 630 ? LYS G 636 ? VAL G 930  LYS G 936  
AG2 4 ASN G 641 ? ARG G 647 ? ASN G 941  ARG G 947  
AG3 1 MET G 654 ? ASP G 661 ? MET G 954  ASP G 961  
AG3 2 ASN G 664 ? GLU G 669 ? ASN G 964  GLU G 969  
AG3 3 ASN G 673 ? LYS G 679 ? ASN G 973  LYS G 979  
AG3 4 LEU G 692 ? HIS G 699 ? LEU G 992  HIS G 999  
AG4 1 PHE G 776 ? HIS G 777 ? PHE G 1076 HIS G 1077 
AG4 2 THR G 782 ? GLU G 783 ? THR G 1082 GLU G 1083 
AG5 1 GLN G 813 ? ASP G 815 ? GLN G 1113 ASP G 1115 
AG5 2 LYS G 821 ? GLU G 823 ? LYS G 1121 GLU G 1123 
AG6 1 PHE H 19  ? GLU H 27  ? PHE H 727  GLU H 735  
AG6 2 GLN H 32  ? ASP H 38  ? GLN H 740  ASP H 746  
AG6 3 LEU H 44  ? ARG H 51  ? LEU H 752  ARG H 759  
AG6 4 ALA H 100 ? GLU H 106 ? ALA H 808  GLU H 814  
AG6 5 MET H 81  ? THR H 86  ? MET H 789  THR H 794  
AG7 1 HIS H 110 ? ASP H 111 ? HIS H 818  ASP H 819  
AG7 2 ILE H 157 ? LEU H 159 ? ILE H 865  LEU H 867  
AG7 3 ILE H 165 ? LEU H 167 ? ILE H 873  LEU H 875  
AG8 1 PHE H 147 ? LEU H 148 ? PHE H 855  LEU H 856  
AG8 2 ARG H 174 ? LEU H 175 ? ARG H 882  LEU H 883  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N CYS A 708 ? N CYS A 1008 O LEU A 729 ? O LEU A 1029 
AA1 2 3 N VAL A 728 ? N VAL A 1028 O VAL A 740 ? O VAL A 1040 
AA1 3 4 O THR A 741 ? O THR A 1041 N TYR A 9   ? N TYR A 5    
AA1 4 5 N VAL A 10  ? N VAL A 6    O ILE A 789 ? O ILE A 1089 
AA2 1 2 N GLY A 25  ? N GLY A 21   O ASN A 34  ? O ASN A 30   
AA2 2 3 N ILE A 37  ? N ILE A 33   O GLU A 44  ? O GLU A 40   
AA2 3 4 N ILE A 45  ? N ILE A 41   O LYS A 57  ? O LYS A 53   
AA3 1 2 N PHE A 71  ? N PHE A 67   O LEU A 80  ? O LEU A 76   
AA3 2 3 N ILE A 83  ? N ILE A 79   O CYS A 91  ? O CYS A 87   
AA3 3 4 N ALA A 90  ? N ALA A 86   O GLY A 110 ? O GLY A 106  
AA4 1 2 N ILE A 127 ? N ILE A 123  O GLY A 136 ? O GLY A 132  
AA4 2 3 N LEU A 137 ? N LEU A 133  O LYS A 145 ? O LYS A 141  
AA4 3 4 N PHE A 144 ? N PHE A 140  O ILE A 161 ? O ILE A 157  
AA5 1 2 N HIS A 167 ? N HIS A 163  O GLN A 187 ? O GLN A 183  
AA5 2 3 N TYR A 186 ? N TYR A 182  O HIS A 193 ? O HIS A 189  
AA5 3 4 N GLU A 198 ? N GLU A 194  O ASN A 207 ? O ASN A 203  
AA6 1 2 N HIS A 167 ? N HIS A 163  O GLN A 187 ? O GLN A 183  
AA6 2 3 N TYR A 186 ? N TYR A 182  O HIS A 193 ? O HIS A 189  
AA6 3 4 N VAL A 194 ? N VAL A 190  O GLU A 214 ? O GLU A 210  
AA7 1 2 N ILE A 224 ? N ILE A 220  O ILE A 234 ? O ILE A 230  
AA7 2 3 N ALA A 233 ? N ALA A 229  O HIS A 244 ? O HIS A 240  
AA7 3 4 N ILE A 241 ? N ILE A 237  O ILE A 252 ? O ILE A 248  
AA8 1 2 N CYS A 264 ? N CYS A 260  O GLY A 278 ? O GLY A 274  
AA8 2 3 N TYR A 275 ? N TYR A 271  O LEU A 287 ? O LEU A 283  
AA8 3 4 N LEU A 284 ? N LEU A 280  O GLY A 310 ? O GLY A 306  
AA9 1 2 N GLU A 316 ? N GLU A 312  O GLY A 329 ? O GLY A 325  
AA9 2 3 N VAL A 326 ? N VAL A 322  O VAL A 338 ? O VAL A 334  
AA9 3 4 N LYS A 339 ? N LYS A 335  O VAL A 352 ? O VAL A 348  
AB1 1 2 N ASP A 365 ? N ASP A 361  O CYS A 382 ? O CYS A 378  
AB1 2 3 N LEU A 379 ? N LEU A 375  O ILE A 394 ? O ILE A 390  
AB1 3 4 N ARG A 395 ? N ARG A 391  O HIS A 411 ? O HIS A 711  
AB2 1 2 N ARG A 422 ? N ARG A 722  O LEU A 436 ? O LEU A 736  
AB2 2 3 N VAL A 442 ? N VAL A 742  O THR A 450 ? O THR A 750  
AB3 1 2 N ARG A 422 ? N ARG A 722  O LEU A 436 ? O LEU A 736  
AB3 2 3 N VAL A 435 ? N VAL A 735  O LEU A 492 ? O LEU A 792  
AB3 3 4 N ILE A 493 ? N ILE A 793  O HIS A 503 ? O HIS A 803  
AB3 4 5 O GLN A 506 ? O GLN A 806  N SER A 464 ? N SER A 764  
AB4 1 2 N VAL A 517 ? N VAL A 817  O ILE A 530 ? O ILE A 830  
AB4 2 3 N PHE A 529 ? N PHE A 829  O PHE A 551 ? O PHE A 851  
AB4 3 4 N VAL A 550 ? N VAL A 850  O ALA A 562 ? O ALA A 862  
AB5 1 2 N PHE A 576 ? N PHE A 876  O LYS A 579 ? O LYS A 879  
AB5 2 3 N LEU A 580 ? N LEU A 880  O TYR A 591 ? O TYR A 891  
AB5 3 4 N LEU A 590 ? N LEU A 890  O GLU A 602 ? O GLU A 902  
AB6 1 2 N LYS A 615 ? N LYS A 915  O LEU A 622 ? O LEU A 922  
AB6 2 3 N VAL A 623 ? N VAL A 923  O LEU A 631 ? O LEU A 931  
AB6 3 4 N LYS A 636 ? N LYS A 936  O ASN A 641 ? O ASN A 941  
AB7 1 2 N ALA A 656 ? N ALA A 956  O ALA A 668 ? O ALA A 968  
AB7 2 3 N GLY A 667 ? N GLY A 967  O PHE A 675 ? O PHE A 975  
AB7 3 4 N VAL A 676 ? N VAL A 976  O VAL A 695 ? O VAL A 995  
AB8 1 2 N PHE A 776 ? N PHE A 1076 O GLU A 783 ? O GLU A 1083 
AB9 1 2 N GLY B 23  ? N GLY B 731  O LYS B 35  ? O LYS B 743  
AB9 2 3 N ALA B 36  ? N ALA B 744  O VAL B 45  ? O VAL B 753  
AB9 3 4 N VAL B 50  ? N VAL B 758  O PHE B 101 ? O PHE B 809  
AB9 4 5 O VAL B 104 ? O VAL B 812  N GLU B 83  ? N GLU B 791  
AC1 1 2 N HIS B 110 ? N HIS B 818  O LEU B 159 ? O LEU B 867  
AC1 2 3 N LEU B 158 ? N LEU B 866  O LYS B 166 ? O LYS B 874  
AC2 1 2 N LEU B 148 ? N LEU B 856  O ARG B 174 ? O ARG B 882  
AC3 1 2 N CYS D 708 ? N CYS D 1008 O LEU D 729 ? O LEU D 1029 
AC3 2 3 N VAL D 728 ? N VAL D 1028 O VAL D 740 ? O VAL D 1040 
AC3 3 4 O THR D 741 ? O THR D 1041 N TYR D 9   ? N TYR D 5    
AC3 4 5 N VAL D 10  ? N VAL D 6    O ILE D 789 ? O ILE D 1089 
AC4 1 2 N GLY D 25  ? N GLY D 21   O ASN D 34  ? O ASN D 30   
AC4 2 3 N ILE D 37  ? N ILE D 33   O GLU D 44  ? O GLU D 40   
AC4 3 4 N VAL D 47  ? N VAL D 43   O ARG D 54  ? O ARG D 50   
AC5 1 2 N PHE D 71  ? N PHE D 67   O LEU D 80  ? O LEU D 76   
AC5 2 3 N LEU D 81  ? N LEU D 77   O LEU D 93  ? O LEU D 89   
AC5 3 4 N ALA D 90  ? N ALA D 86   O GLY D 110 ? O GLY D 106  
AC6 1 2 N ILE D 127 ? N ILE D 123  O GLY D 136 ? O GLY D 132  
AC6 2 3 N LEU D 137 ? N LEU D 133  O LYS D 145 ? O LYS D 141  
AC6 3 4 N PHE D 144 ? N PHE D 140  O ILE D 161 ? O ILE D 157  
AC7 1 2 N HIS D 167 ? N HIS D 163  O GLN D 187 ? O GLN D 183  
AC7 2 3 N TYR D 186 ? N TYR D 182  O HIS D 193 ? O HIS D 189  
AC7 3 4 N GLU D 198 ? N GLU D 194  O ASN D 207 ? O ASN D 203  
AC8 1 2 N HIS D 167 ? N HIS D 163  O GLN D 187 ? O GLN D 183  
AC8 2 3 N TYR D 186 ? N TYR D 182  O HIS D 193 ? O HIS D 189  
AC8 3 4 N VAL D 194 ? N VAL D 190  O GLU D 214 ? O GLU D 210  
AC9 1 2 N ILE D 224 ? N ILE D 220  O ILE D 234 ? O ILE D 230  
AC9 2 3 N ILE D 235 ? N ILE D 231  O THR D 242 ? O THR D 238  
AC9 3 4 N ILE D 241 ? N ILE D 237  O ILE D 252 ? O ILE D 248  
AD1 1 2 N CYS D 264 ? N CYS D 260  O GLY D 278 ? O GLY D 274  
AD1 2 3 N TYR D 275 ? N TYR D 271  O LEU D 287 ? O LEU D 283  
AD1 3 4 N GLU D 290 ? N GLU D 286  O ASP D 303 ? O ASP D 299  
AD2 1 2 N THR D 319 ? N THR D 315  O PHE D 327 ? O PHE D 323  
AD2 2 3 N VAL D 326 ? N VAL D 322  O VAL D 338 ? O VAL D 334  
AD2 3 4 N LYS D 339 ? N LYS D 335  O VAL D 352 ? O VAL D 348  
AD3 1 2 N VAL D 369 ? N VAL D 365  O GLN D 378 ? O GLN D 374  
AD3 2 3 N LEU D 379 ? N LEU D 375  O ILE D 394 ? O ILE D 390  
AD3 3 4 N ILE D 393 ? N ILE D 389  O ARG D 413 ? O ARG D 713  
AD4 1 2 N ARG D 422 ? N ARG D 722  O LEU D 436 ? O LEU D 736  
AD4 2 3 N VAL D 442 ? N VAL D 742  O THR D 450 ? O THR D 750  
AD5 1 2 N ARG D 422 ? N ARG D 722  O LEU D 436 ? O LEU D 736  
AD5 2 3 N VAL D 435 ? N VAL D 735  O LEU D 492 ? O LEU D 792  
AD5 3 4 N LEU D 491 ? N LEU D 791  O HIS D 505 ? O HIS D 805  
AD5 4 5 O GLN D 506 ? O GLN D 806  N SER D 464 ? N SER D 764  
AD6 1 2 N VAL D 517 ? N VAL D 817  O ILE D 530 ? O ILE D 830  
AD6 2 3 N PHE D 529 ? N PHE D 829  O PHE D 551 ? O PHE D 851  
AD6 3 4 N VAL D 550 ? N VAL D 850  O ALA D 562 ? O ALA D 862  
AD7 1 2 N PHE D 576 ? N PHE D 876  O LYS D 579 ? O LYS D 879  
AD7 2 3 N LEU D 580 ? N LEU D 880  O TYR D 591 ? O TYR D 891  
AD7 3 4 N LEU D 590 ? N LEU D 890  O GLU D 602 ? O GLU D 902  
AD8 1 2 N LYS D 615 ? N LYS D 915  O LEU D 622 ? O LEU D 922  
AD8 2 3 N ILE D 621 ? N ILE D 921  O LEU D 633 ? O LEU D 933  
AD8 3 4 N LYS D 636 ? N LYS D 936  O ASN D 641 ? O ASN D 941  
AD9 1 2 N ALA D 656 ? N ALA D 956  O ALA D 668 ? O ALA D 968  
AD9 2 3 N GLU D 669 ? N GLU D 969  O ASN D 673 ? O ASN D 973  
AD9 3 4 N LEU D 674 ? N LEU D 974  O PHE D 698 ? O PHE D 998  
AE1 1 2 N PHE D 776 ? N PHE D 1076 O GLU D 783 ? O GLU D 1083 
AE2 1 2 N TYR D 814 ? N TYR D 1114 O ARG D 822 ? O ARG D 1122 
AE3 1 2 N GLY E 23  ? N GLY E 731  O LYS E 35  ? O LYS E 743  
AE3 2 3 N ALA E 36  ? N ALA E 744  O VAL E 45  ? O VAL E 753  
AE3 3 4 N VAL E 50  ? N VAL E 758  O PHE E 101 ? O PHE E 809  
AE3 4 5 O VAL E 104 ? O VAL E 812  N GLU E 83  ? N GLU E 791  
AE4 1 2 N HIS E 110 ? N HIS E 818  O LEU E 159 ? O LEU E 867  
AE4 2 3 N LEU E 158 ? N LEU E 866  O LYS E 166 ? O LYS E 874  
AE5 1 2 N LEU E 148 ? N LEU E 856  O ARG E 174 ? O ARG E 882  
AE6 1 2 N CYS G 708 ? N CYS G 1008 O LEU G 729 ? O LEU G 1029 
AE6 2 3 N GLN G 725 ? N GLN G 1025 O SER G 742 ? O SER G 1042 
AE6 3 4 O THR G 741 ? O THR G 1041 N TYR G 9   ? N TYR G 5    
AE6 4 5 N VAL G 10  ? N VAL G 6    O ILE G 789 ? O ILE G 1089 
AE7 1 2 N GLY G 25  ? N GLY G 21   O ASN G 34  ? O ASN G 30   
AE7 2 3 N ILE G 37  ? N ILE G 33   O GLU G 44  ? O GLU G 40   
AE7 3 4 N LEU G 43  ? N LEU G 39   O VAL G 59  ? O VAL G 55   
AE8 1 2 N PHE G 71  ? N PHE G 67   O LEU G 80  ? O LEU G 76   
AE8 2 3 N LEU G 81  ? N LEU G 77   O LEU G 93  ? O LEU G 89   
AE8 3 4 N ALA G 90  ? N ALA G 86   O GLY G 110 ? O GLY G 106  
AE9 1 2 N ILE G 127 ? N ILE G 123  O GLY G 136 ? O GLY G 132  
AE9 2 3 N LEU G 137 ? N LEU G 133  O LYS G 145 ? O LYS G 141  
AE9 3 4 N PHE G 144 ? N PHE G 140  O ILE G 161 ? O ILE G 157  
AF1 1 2 N HIS G 167 ? N HIS G 163  O GLN G 187 ? O GLN G 183  
AF1 2 3 N TYR G 186 ? N TYR G 182  O HIS G 193 ? O HIS G 189  
AF1 3 4 N GLU G 198 ? N GLU G 194  O ASN G 207 ? O ASN G 203  
AF2 1 2 N HIS G 167 ? N HIS G 163  O GLN G 187 ? O GLN G 183  
AF2 2 3 N TYR G 186 ? N TYR G 182  O HIS G 193 ? O HIS G 189  
AF2 3 4 N VAL G 194 ? N VAL G 190  O GLU G 214 ? O GLU G 210  
AF3 1 2 N ILE G 224 ? N ILE G 220  O ILE G 234 ? O ILE G 230  
AF3 2 3 N ALA G 233 ? N ALA G 229  O HIS G 244 ? O HIS G 240  
AF3 3 4 N ILE G 241 ? N ILE G 237  O ILE G 252 ? O ILE G 248  
AF4 1 2 N VAL G 263 ? N VAL G 259  O GLY G 278 ? O GLY G 274  
AF4 2 3 N TYR G 275 ? N TYR G 271  O LEU G 287 ? O LEU G 283  
AF4 3 4 N LEU G 284 ? N LEU G 280  O LEU G 309 ? O LEU G 305  
AF5 1 2 N THR G 319 ? N THR G 315  O PHE G 327 ? O PHE G 323  
AF5 2 3 N VAL G 328 ? N VAL G 324  O GLN G 336 ? O GLN G 332  
AF5 3 4 N LYS G 339 ? N LYS G 335  O VAL G 352 ? O VAL G 348  
AF6 1 2 N VAL G 369 ? N VAL G 365  O GLN G 378 ? O GLN G 374  
AF6 2 3 N LEU G 379 ? N LEU G 375  O ILE G 394 ? O ILE G 390  
AF6 3 4 N ILE G 393 ? N ILE G 389  O ARG G 413 ? O ARG G 713  
AF7 1 2 N CYS G 425 ? N CYS G 725  O GLY G 434 ? O GLY G 734  
AF7 2 3 N VAL G 442 ? N VAL G 742  O THR G 450 ? O THR G 750  
AF8 1 2 N CYS G 425 ? N CYS G 725  O GLY G 434 ? O GLY G 734  
AF8 2 3 N VAL G 435 ? N VAL G 735  O LEU G 492 ? O LEU G 792  
AF8 3 4 N ILE G 493 ? N ILE G 793  O HIS G 503 ? O HIS G 803  
AF8 4 5 O GLN G 506 ? O GLN G 806  N SER G 464 ? N SER G 764  
AF9 1 2 N VAL G 517 ? N VAL G 817  O ILE G 530 ? O ILE G 830  
AF9 2 3 N PHE G 529 ? N PHE G 829  O PHE G 551 ? O PHE G 851  
AF9 3 4 N VAL G 550 ? N VAL G 850  O ALA G 562 ? O ALA G 862  
AG1 1 2 N PHE G 576 ? N PHE G 876  O LYS G 579 ? O LYS G 879  
AG1 2 3 N LEU G 580 ? N LEU G 880  O TYR G 591 ? O TYR G 891  
AG1 3 4 N GLU G 592 ? N GLU G 892  O ARG G 600 ? O ARG G 900  
AG2 1 2 N LYS G 615 ? N LYS G 915  O LEU G 622 ? O LEU G 922  
AG2 2 3 N VAL G 623 ? N VAL G 923  O LEU G 631 ? O LEU G 931  
AG2 3 4 N LYS G 636 ? N LYS G 936  O ASN G 641 ? O ASN G 941  
AG3 1 2 N ALA G 656 ? N ALA G 956  O ALA G 668 ? O ALA G 968  
AG3 2 3 N PHE G 665 ? N PHE G 965  O CYS G 677 ? O CYS G 977  
AG3 3 4 N VAL G 676 ? N VAL G 976  O VAL G 695 ? O VAL G 995  
AG4 1 2 N PHE G 776 ? N PHE G 1076 O GLU G 783 ? O GLU G 1083 
AG5 1 2 N TYR G 814 ? N TYR G 1114 O ARG G 822 ? O ARG G 1122 
AG6 1 2 N ASP H 20  ? N ASP H 728  O LYS H 37  ? O LYS H 745  
AG6 2 3 N ALA H 36  ? N ALA H 744  O VAL H 45  ? O VAL H 753  
AG6 3 4 N VAL H 50  ? N VAL H 758  O PHE H 101 ? O PHE H 809  
AG6 4 5 O VAL H 104 ? O VAL H 812  N GLU H 83  ? N GLU H 791  
AG7 1 2 N HIS H 110 ? N HIS H 818  O LEU H 159 ? O LEU H 867  
AG7 2 3 N LEU H 158 ? N LEU H 866  O LYS H 166 ? O LYS H 874  
AG8 1 2 N LEU H 148 ? N LEU H 856  O ARG H 174 ? O ARG H 882  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B RC8 1101 ? 13 'binding site for residue RC8 B 1101' 
AC2 Software E RC8 1101 ? 13 'binding site for residue RC8 E 1101' 
AC3 Software H RC8 1101 ? 14 'binding site for residue RC8 H 1101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 ASN A 607 ? ASN A 907 . ? 1_555 ? 
2  AC1 13 ARG A 628 ? ARG A 928 . ? 1_555 ? 
3  AC1 13 ARG A 647 ? ARG A 947 . ? 1_555 ? 
4  AC1 13 ILE B 25  ? ILE B 733 . ? 1_555 ? 
5  AC1 13 ALA B 46  ? ALA B 754 . ? 1_555 ? 
6  AC1 13 PHE B 105 ? PHE B 813 . ? 1_555 ? 
7  AC1 13 GLU B 106 ? GLU B 814 . ? 1_555 ? 
8  AC1 13 TYR B 107 ? TYR B 815 . ? 1_555 ? 
9  AC1 13 MET B 108 ? MET B 816 . ? 1_555 ? 
10 AC1 13 ASP B 109 ? ASP B 817 . ? 1_555 ? 
11 AC1 13 HIS B 110 ? HIS B 818 . ? 1_555 ? 
12 AC1 13 ASP B 111 ? ASP B 819 . ? 1_555 ? 
13 AC1 13 LEU B 158 ? LEU B 866 . ? 1_555 ? 
14 AC2 13 ASN D 607 ? ASN D 907 . ? 1_555 ? 
15 AC2 13 ARG D 628 ? ARG D 928 . ? 1_555 ? 
16 AC2 13 ARG D 647 ? ARG D 947 . ? 1_555 ? 
17 AC2 13 ILE E 25  ? ILE E 733 . ? 1_555 ? 
18 AC2 13 ALA E 46  ? ALA E 754 . ? 1_555 ? 
19 AC2 13 PHE E 105 ? PHE E 813 . ? 1_555 ? 
20 AC2 13 GLU E 106 ? GLU E 814 . ? 1_555 ? 
21 AC2 13 TYR E 107 ? TYR E 815 . ? 1_555 ? 
22 AC2 13 MET E 108 ? MET E 816 . ? 1_555 ? 
23 AC2 13 ASP E 109 ? ASP E 817 . ? 1_555 ? 
24 AC2 13 HIS E 110 ? HIS E 818 . ? 1_555 ? 
25 AC2 13 ASP E 111 ? ASP E 819 . ? 1_555 ? 
26 AC2 13 LEU E 158 ? LEU E 866 . ? 1_555 ? 
27 AC3 14 ASN G 607 ? ASN G 907 . ? 1_555 ? 
28 AC3 14 ARG G 628 ? ARG G 928 . ? 1_555 ? 
29 AC3 14 ARG G 647 ? ARG G 947 . ? 1_555 ? 
30 AC3 14 ILE H 25  ? ILE H 733 . ? 1_555 ? 
31 AC3 14 ALA H 46  ? ALA H 754 . ? 1_555 ? 
32 AC3 14 PHE H 105 ? PHE H 813 . ? 1_555 ? 
33 AC3 14 GLU H 106 ? GLU H 814 . ? 1_555 ? 
34 AC3 14 TYR H 107 ? TYR H 815 . ? 1_555 ? 
35 AC3 14 MET H 108 ? MET H 816 . ? 1_555 ? 
36 AC3 14 ASP H 109 ? ASP H 817 . ? 1_555 ? 
37 AC3 14 HIS H 110 ? HIS H 818 . ? 1_555 ? 
38 AC3 14 ASP H 111 ? ASP H 819 . ? 1_555 ? 
39 AC3 14 LEU H 158 ? LEU H 866 . ? 1_555 ? 
40 AC3 14 ASP H 169 ? ASP H 877 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6TD3 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.003988 
_atom_sites.fract_transf_matrix[1][2]   0.002303 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004605 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004589 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N      . MET A 1 5   ? -49.729  36.146  16.415  1    87.33  ? 1    MET A N      1 
ATOM   2     C CA     . MET A 1 5   ? -49.408  36.791  17.687  1    88.98  ? 1    MET A CA     1 
ATOM   3     C C      . MET A 1 5   ? -50.557  36.685  18.727  1    87.36  ? 1    MET A C      1 
ATOM   4     O O      . MET A 1 5   ? -51.072  37.707  19.191  1    89.07  ? 1    MET A O      1 
ATOM   5     C CB     . MET A 1 5   ? -49.008  38.263  17.447  1    92.93  ? 1    MET A CB     1 
ATOM   6     C CG     . MET A 1 5   ? -50.027  39.063  16.638  1    93.91  ? 1    MET A CG     1 
ATOM   7     S SD     . MET A 1 5   ? -49.77   40.855  16.744  1    98.88  ? 1    MET A SD     1 
ATOM   8     C CE     . MET A 1 5   ? -51.061  41.44   15.669  1    99.26  ? 1    MET A CE     1 
ATOM   9     H HA     . MET A 1 5   ? -48.535  36.29   18.103  0    165.64 ? 1    MET A HA     1 
ATOM   10    H HB2    . MET A 1 5   ? -48.858  38.763  18.403  0    175.68 ? 1    MET A HB2    1 
ATOM   11    H HB3    . MET A 1 5   ? -48.075  38.273  16.886  0    175.77 ? 1    MET A HB3    1 
ATOM   12    H HG2    . MET A 1 5   ? -49.96   38.776  15.59   0    175.98 ? 1    MET A HG2    1 
ATOM   13    H HG3    . MET A 1 5   ? -51.026  38.858  17.016  0    175.17 ? 1    MET A HG3    1 
ATOM   14    H HE1    . MET A 1 5   ? -50.923  42.507  15.498  0    191.17 ? 1    MET A HE1    1 
ATOM   15    H HE2    . MET A 1 5   ? -51.009  40.901  14.724  0    187.1  ? 1    MET A HE2    1 
ATOM   16    H HE3    . MET A 1 5   ? -52.024  41.262  16.145  0    186.58 ? 1    MET A HE3    1 
ATOM   17    N N      . SER A 1 6   ? -50.947  35.444  19.091  1    84.23  ? 2    SER A N      1 
ATOM   18    C CA     . SER A 1 6   ? -51.985  35.18   20.106  1    82.5   ? 2    SER A CA     1 
ATOM   19    C C      . SER A 1 6   ? -51.328  34.547  21.312  1    82.09  ? 2    SER A C      1 
ATOM   20    O O      . SER A 1 6   ? -50.504  33.64   21.157  1    81.14  ? 2    SER A O      1 
ATOM   21    C CB     . SER A 1 6   ? -53.063  34.224  19.592  1    79.32  ? 2    SER A CB     1 
ATOM   22    O OG     . SER A 1 6   ? -52.635  32.87   19.482  1    77.1   ? 2    SER A OG     1 
ATOM   23    H H      . SER A 1 6   ? -50.55   34.597  18.698  0    153.95 ? 2    SER A H      1 
ATOM   24    H HA     . SER A 1 6   ? -52.474  36.103  20.411  0    153.06 ? 2    SER A HA     1 
ATOM   25    H HB2    . SER A 1 6   ? -53.897  34.253  20.291  0    143.75 ? 2    SER A HB2    1 
ATOM   26    H HB3    . SER A 1 6   ? -53.405  34.579  18.623  0    144.95 ? 2    SER A HB3    1 
ATOM   27    H HG     . SER A 1 6   ? -53.387  32.298  19.174  0    137.71 ? 2    SER A HG     1 
ATOM   28    N N      . TYR A 1 7   ? -51.738  34.964  22.507  1    82.99  ? 3    TYR A N      1 
ATOM   29    C CA     . TYR A 1 7   ? -51.165  34.433  23.731  1    83     ? 3    TYR A CA     1 
ATOM   30    C C      . TYR A 1 7   ? -52.285  34.001  24.683  1    81.27  ? 3    TYR A C      1 
ATOM   31    O O      . TYR A 1 7   ? -52.978  34.863  25.215  1    82.44  ? 3    TYR A O      1 
ATOM   32    C CB     . TYR A 1 7   ? -50.285  35.504  24.374  1    86.61  ? 3    TYR A CB     1 
ATOM   33    C CG     . TYR A 1 7   ? -49.285  36.164  23.444  1    88.78  ? 3    TYR A CG     1 
ATOM   34    C CD1    . TYR A 1 7   ? -49.359  37.513  23.145  1    91.43  ? 3    TYR A CD1    1 
ATOM   35    C CD2    . TYR A 1 7   ? -48.301  35.413  22.808  1    88.11  ? 3    TYR A CD2    1 
ATOM   36    C CE1    . TYR A 1 7   ? -48.471  38.118  22.265  1    93.53  ? 3    TYR A CE1    1 
ATOM   37    C CE2    . TYR A 1 7   ? -47.419  36.003  21.907  1    90.17  ? 3    TYR A CE2    1 
ATOM   38    C CZ     . TYR A 1 7   ? -47.498  37.359  21.645  1    92.9   ? 3    TYR A CZ     1 
ATOM   39    O OH     . TYR A 1 7   ? -46.618  37.97   20.78   1    95.23  ? 3    TYR A OH     1 
ATOM   40    H H      . TYR A 1 7   ? -52.462  35.657  22.661  0    153.17 ? 3    TYR A H      1 
ATOM   41    H HA     . TYR A 1 7   ? -50.538  33.565  23.535  0    151.45 ? 3    TYR A HA     1 
ATOM   42    H HB2    . TYR A 1 7   ? -50.918  36.294  24.783  0    161.53 ? 3    TYR A HB2    1 
ATOM   43    H HB3    . TYR A 1 7   ? -49.757  35.005  25.176  0    160.48 ? 3    TYR A HB3    1 
ATOM   44    H HD1    . TYR A 1 7   ? -50.117  38.121  23.617  0    171.88 ? 3    TYR A HD1    1 
ATOM   45    H HD2    . TYR A 1 7   ? -48.236  34.357  22.999  0    161.95 ? 3    TYR A HD2    1 
ATOM   46    H HE1    . TYR A 1 7   ? -48.544  39.174  22.068  0    178.28 ? 3    TYR A HE1    1 
ATOM   47    H HE2    . TYR A 1 7   ? -46.65   35.408  21.441  0    168.33 ? 3    TYR A HE2    1 
ATOM   48    H HH     . TYR A 1 7   ? -46.458  38.911  21.053  0    182.36 ? 3    TYR A HH     1 
ATOM   49    N N      . ASN A 1 8   ? -52.486  32.681  24.877  1    78.61  ? 4    ASN A N      1 
ATOM   50    C CA     . ASN A 1 8   ? -53.548  32.185  25.751  1    76.9   ? 4    ASN A CA     1 
ATOM   51    C C      . ASN A 1 8   ? -53.037  31.181  26.788  1    76.15  ? 4    ASN A C      1 
ATOM   52    O O      . ASN A 1 8   ? -52.03   30.515  26.575  1    75.91  ? 4    ASN A O      1 
ATOM   53    C CB     . ASN A 1 8   ? -54.66   31.545  24.919  1    74.17  ? 4    ASN A CB     1 
ATOM   54    C CG     . ASN A 1 8   ? -55.202  32.422  23.828  1    74.92  ? 4    ASN A CG     1 
ATOM   55    O OD1    . ASN A 1 8   ? -54.878  32.254  22.651  1    74.57  ? 4    ASN A OD1    1 
ATOM   56    N ND2    . ASN A 1 8   ? -56.038  33.376  24.192  1    76.17  ? 4    ASN A ND2    1 
ATOM   57    H H      . ASN A 1 8   ? -51.938  31.945  24.443  0    141.87 ? 4    ASN A H      1 
ATOM   58    H HA     . ASN A 1 8   ? -53.995  33.01   26.303  0    140.51 ? 4    ASN A HA     1 
ATOM   59    H HB2    . ASN A 1 8   ? -54.27   30.642  24.452  0    131.55 ? 4    ASN A HB2    1 
ATOM   60    H HB3    . ASN A 1 8   ? -55.486  31.287  25.58   0    132.11 ? 4    ASN A HB3    1 
ATOM   61    H HD21   . ASN A 1 8   ? -56.434  33.997  23.494  0    138.26 ? 4    ASN A HD21   1 
ATOM   62    H HD22   . ASN A 1 8   ? -56.287  33.487  25.169  0    138.02 ? 4    ASN A HD22   1 
ATOM   63    N N      . TYR A 1 9   ? -53.77   31.069  27.899  1    75.95  ? 5    TYR A N      1 
ATOM   64    C CA     . TYR A 1 9   ? -53.515  30.171  29.028  1    75.52  ? 5    TYR A CA     1 
ATOM   65    C C      . TYR A 1 9   ? -54.706  29.2    29.119  1    72.75  ? 5    TYR A C      1 
ATOM   66    O O      . TYR A 1 9   ? -55.838  29.615  28.873  1    72.39  ? 5    TYR A O      1 
ATOM   67    C CB     . TYR A 1 9   ? -53.421  31.028  30.31   1    78.38  ? 5    TYR A CB     1 
ATOM   68    C CG     . TYR A 1 9   ? -53.063  30.311  31.599  1    78.74  ? 5    TYR A CG     1 
ATOM   69    C CD1    . TYR A 1 9   ? -51.739  30.181  32      1    80.36  ? 5    TYR A CD1    1 
ATOM   70    C CD2    . TYR A 1 9   ? -54.046  29.953  32.512  1    78.09  ? 5    TYR A CD2    1 
ATOM   71    C CE1    . TYR A 1 9   ? -51.404  29.588  33.214  1    81.1   ? 5    TYR A CE1    1 
ATOM   72    C CE2    . TYR A 1 9   ? -53.724  29.363  33.731  1    78.78  ? 5    TYR A CE2    1 
ATOM   73    C CZ     . TYR A 1 9   ? -52.402  29.199  34.089  1    80.37  ? 5    TYR A CZ     1 
ATOM   74    O OH     . TYR A 1 9   ? -52.081  28.591  35.28   1    81.31  ? 5    TYR A OH     1 
ATOM   75    H H      . TYR A 1 9   ? -54.607  31.623  28.052  0    137.3  ? 5    TYR A H      1 
ATOM   76    H HA     . TYR A 1 9   ? -52.596  29.603  28.896  0    135.89 ? 5    TYR A HA     1 
ATOM   77    H HB2    . TYR A 1 9   ? -52.672  31.803  30.15   0    144.29 ? 5    TYR A HB2    1 
ATOM   78    H HB3    . TYR A 1 9   ? -54.392  31.494  30.468  0    142.27 ? 5    TYR A HB3    1 
ATOM   79    H HD1    . TYR A 1 9   ? -50.954  30.488  31.33   0    147.42 ? 5    TYR A HD1    1 
ATOM   80    H HD2    . TYR A 1 9   ? -55.082  30.08   32.249  0    140.5  ? 5    TYR A HD2    1 
ATOM   81    H HE1    . TYR A 1 9   ? -50.37   29.451  33.48   0    149.69 ? 5    TYR A HE1    1 
ATOM   82    H HE2    . TYR A 1 9   ? -54.513  29.046  34.392  0    142.58 ? 5    TYR A HE2    1 
ATOM   83    H HH     . TYR A 1 9   ? -52.893  28.414  35.823  0    148.36 ? 5    TYR A HH     1 
ATOM   84    N N      . VAL A 1 10  ? -54.469  27.922  29.439  1    70.96  ? 6    VAL A N      1 
ATOM   85    C CA     . VAL A 1 10  ? -55.553  26.952  29.56   1    68.51  ? 6    VAL A CA     1 
ATOM   86    C C      . VAL A 1 10  ? -55.303  26.033  30.746  1    68.58  ? 6    VAL A C      1 
ATOM   87    O O      . VAL A 1 10  ? -54.326  25.287  30.747  1    68.98  ? 6    VAL A O      1 
ATOM   88    C CB     . VAL A 1 10  ? -55.769  26.18   28.241  1    66.01  ? 6    VAL A CB     1 
ATOM   89    C CG1    . VAL A 1 10  ? -54.493  25.491  27.764  1    65.85  ? 6    VAL A CG1    1 
ATOM   90    C CG2    . VAL A 1 10  ? -56.91   25.183  28.369  1    63.71  ? 6    VAL A CG2    1 
ATOM   91    H H      . VAL A 1 10  ? -53.549  27.535  29.621  0    126.57 ? 6    VAL A H      1 
ATOM   92    H HA     . VAL A 1 10  ? -56.483  27.481  29.763  0    120.78 ? 6    VAL A HA     1 
ATOM   93    H HB     . VAL A 1 10  ? -56.055  26.896  27.472  0    115.41 ? 6    VAL A HB     1 
ATOM   94    H HG11   . VAL A 1 10  ? -54.714  24.959  26.84   0    113.26 ? 6    VAL A HG11   1 
ATOM   95    H HG12   . VAL A 1 10  ? -53.722  26.235  27.577  0    116.63 ? 6    VAL A HG12   1 
ATOM   96    H HG13   . VAL A 1 10  ? -54.154  24.778  28.514  0    114.83 ? 6    VAL A HG13   1 
ATOM   97    H HG21   . VAL A 1 10  ? -57.188  24.843  27.372  0    108.59 ? 6    VAL A HG21   1 
ATOM   98    H HG22   . VAL A 1 10  ? -56.586  24.326  28.958  0    109.74 ? 6    VAL A HG22   1 
ATOM   99    H HG23   . VAL A 1 10  ? -57.758  25.669  28.848  0    110.43 ? 6    VAL A HG23   1 
ATOM   100   N N      . VAL A 1 11  ? -56.184  26.082  31.755  1    68.44  ? 7    VAL A N      1 
ATOM   101   C CA     . VAL A 1 11  ? -56.037  25.28   32.968  1    68.87  ? 7    VAL A CA     1 
ATOM   102   C C      . VAL A 1 11  ? -57.277  24.464  33.242  1    67.09  ? 7    VAL A C      1 
ATOM   103   O O      . VAL A 1 11  ? -58.381  24.884  32.911  1    66.47  ? 7    VAL A O      1 
ATOM   104   C CB     . VAL A 1 11  ? -55.696  26.166  34.198  1    72     ? 7    VAL A CB     1 
ATOM   105   C CG1    . VAL A 1 11  ? -56.855  27.088  34.573  1    72.88  ? 7    VAL A CG1    1 
ATOM   106   C CG2    . VAL A 1 11  ? -55.281  25.314  35.401  1    72.9   ? 7    VAL A CG2    1 
ATOM   107   H H      . VAL A 1 11  ? -57.023  26.652  31.752  0    120.61 ? 7    VAL A H      1 
ATOM   108   H HA     . VAL A 1 11  ? -55.221  24.571  32.832  0    121.25 ? 7    VAL A HA     1 
ATOM   109   H HB     . VAL A 1 11  ? -54.855  26.81   33.947  0    129.84 ? 7    VAL A HB     1 
ATOM   110   H HG11   . VAL A 1 11  ? -56.482  27.843  35.263  0    132.71 ? 7    VAL A HG11   1 
ATOM   111   H HG12   . VAL A 1 11  ? -57.248  27.573  33.681  0    129.78 ? 7    VAL A HG12   1 
ATOM   112   H HG13   . VAL A 1 11  ? -57.639  26.515  35.065  0    129.31 ? 7    VAL A HG13   1 
ATOM   113   H HG21   . VAL A 1 11  ? -54.871  25.972  36.166  0    132.83 ? 7    VAL A HG21   1 
ATOM   114   H HG22   . VAL A 1 11  ? -56.152  24.797  35.801  0    129.35 ? 7    VAL A HG22   1 
ATOM   115   H HG23   . VAL A 1 11  ? -54.527  24.593  35.088  0    129.95 ? 7    VAL A HG23   1 
ATOM   116   N N      . THR A 1 12  ? -57.093  23.322  33.908  1    66.56  ? 8    THR A N      1 
ATOM   117   C CA     . THR A 1 12  ? -58.178  22.429  34.278  1    65.07  ? 8    THR A CA     1 
ATOM   118   C C      . THR A 1 12  ? -58.791  22.888  35.588  1    66.91  ? 8    THR A C      1 
ATOM   119   O O      . THR A 1 12  ? -58.067  23.028  36.572  1    69.02  ? 8    THR A O      1 
ATOM   120   C CB     . THR A 1 12  ? -57.642  20.999  34.417  1    64.06  ? 8    THR A CB     1 
ATOM   121   O OG1    . THR A 1 12  ? -57.003  20.615  33.199  1    62.73  ? 8    THR A OG1    1 
ATOM   122   C CG2    . THR A 1 12  ? -58.72   19.998  34.77   1    62.56  ? 8    THR A CG2    1 
ATOM   123   H H      . THR A 1 12  ? -56.185  22.987  34.215  0    117.29 ? 8    THR A H      1 
ATOM   124   H HA     . THR A 1 12  ? -58.943  22.446  33.505  0    111.64 ? 8    THR A HA     1 
ATOM   125   H HB     . THR A 1 12  ? -56.909  20.979  35.222  0    112.64 ? 8    THR A HB     1 
ATOM   126   H HG1    . THR A 1 12  ? -56.075  20.965  33.167  0    109.12 ? 8    THR A HG1    1 
ATOM   127   H HG21   . THR A 1 12  ? -58.371  18.991  34.549  0    106.94 ? 8    THR A HG21   1 
ATOM   128   H HG22   . THR A 1 12  ? -58.95   20.053  35.833  0    108.96 ? 8    THR A HG22   1 
ATOM   129   H HG23   . THR A 1 12  ? -59.627  20.198  34.203  0    106.28 ? 8    THR A HG23   1 
ATOM   130   N N      . ALA A 1 13  ? -60.115  23.11   35.609  1    66.35  ? 9    ALA A N      1 
ATOM   131   C CA     . ALA A 1 13  ? -60.859  23.511  36.803  1    68.13  ? 9    ALA A CA     1 
ATOM   132   C C      . ALA A 1 13  ? -61.402  22.276  37.518  1    67.34  ? 9    ALA A C      1 
ATOM   133   O O      . ALA A 1 13  ? -61.365  22.216  38.744  1    69.18  ? 9    ALA A O      1 
ATOM   134   C CB     . ALA A 1 13  ? -62.001  24.43   36.421  1    68.19  ? 9    ALA A CB     1 
ATOM   135   H H      . ALA A 1 13  ? -60.714  23.014  34.795  0    114.46 ? 9    ALA A H      1 
ATOM   136   H HA     . ALA A 1 13  ? -60.213  24.051  37.493  0    121.96 ? 9    ALA A HA     1 
ATOM   137   H HB1    . ALA A 1 13  ? -62.515  24.755  37.324  0    121.53 ? 9    ALA A HB1    1 
ATOM   138   H HB2    . ALA A 1 13  ? -61.602  25.293  35.89   0    120.72 ? 9    ALA A HB2    1 
ATOM   139   H HB3    . ALA A 1 13  ? -62.693  23.889  35.779  0    118.08 ? 9    ALA A HB3    1 
ATOM   140   N N      . GLN A 1 14  ? -61.905  21.297  36.755  1    64.8   ? 10   GLN A N      1 
ATOM   141   C CA     . GLN A 1 14  ? -62.383  20.034  37.29   1    63.95  ? 10   GLN A CA     1 
ATOM   142   C C      . GLN A 1 14  ? -61.735  18.947  36.462  1    61.93  ? 10   GLN A C      1 
ATOM   143   O O      . GLN A 1 14  ? -61.891  18.961  35.252  1    60.25  ? 10   GLN A O      1 
ATOM   144   C CB     . GLN A 1 14  ? -63.916  19.936  37.183  1    63.08  ? 10   GLN A CB     1 
ATOM   145   C CG     . GLN A 1 14  ? -64.513  18.584  37.599  1    62.07  ? 10   GLN A CG     1 
ATOM   146   C CD     . GLN A 1 14  ? -64.076  18.111  38.977  1    63.84  ? 10   GLN A CD     1 
ATOM   147   O OE1    . GLN A 1 14  ? -64.273  18.788  39.991  1    66.22  ? 10   GLN A OE1    1 
ATOM   148   N NE2    . GLN A 1 14  ? -63.442  16.952  39.055  1    62.99  ? 10   GLN A NE2    1 
ATOM   149   H H      . GLN A 1 14  ? -62.01   21.359  35.747  0    111.08 ? 10   GLN A H      1 
ATOM   150   H HA     . GLN A 1 14  ? -62.083  19.916  38.33   0    112.27 ? 10   GLN A HA     1 
ATOM   151   H HB2    . GLN A 1 14  ? -64.364  20.702  37.813  0    110.37 ? 10   GLN A HB2    1 
ATOM   152   H HB3    . GLN A 1 14  ? -64.201  20.095  36.145  0    107.31 ? 10   GLN A HB3    1 
ATOM   153   H HG2    . GLN A 1 14  ? -65.595  18.704  37.636  0    106.52 ? 10   GLN A HG2    1 
ATOM   154   H HG3    . GLN A 1 14  ? -64.262  17.83   36.855  0    104.81 ? 10   GLN A HG3    1 
ATOM   155   H HE21   . GLN A 1 14  ? -63.26   16.403  38.222  0    106.99 ? 10   GLN A HE21   1 
ATOM   156   H HE22   . GLN A 1 14  ? -63.137  16.608  39.96   0    110.13 ? 10   GLN A HE22   1 
ATOM   157   N N      . LYS A 1 15  ? -60.981  18.033  37.095  1    62.35  ? 11   LYS A N      1 
ATOM   158   C CA     . LYS A 1 15  ? -60.343  16.907  36.409  1    60.79  ? 11   LYS A CA     1 
ATOM   159   C C      . LYS A 1 15  ? -61.399  16.024  35.716  1    58.46  ? 11   LYS A C      1 
ATOM   160   O O      . LYS A 1 15  ? -62.539  15.978  36.188  1    58.44  ? 11   LYS A O      1 
ATOM   161   C CB     . LYS A 1 15  ? -59.6    16.029  37.424  1    62.18  ? 11   LYS A CB     1 
ATOM   162   C CG     . LYS A 1 15  ? -58.329  16.633  37.965  1    64.54  ? 11   LYS A CG     1 
ATOM   163   C CD     . LYS A 1 15  ? -57.93   15.944  39.251  1    66.57  ? 11   LYS A CD     1 
ATOM   164   C CE     . LYS A 1 15  ? -56.443  15.858  39.421  1    68.12  ? 11   LYS A CE     1 
ATOM   165   N NZ     . LYS A 1 15  ? -56.077  15.443  40.803  1    70.67  ? 11   LYS A NZ     1 
ATOM   166   H H      . LYS A 1 15  ? -60.797  18.056  38.092  0    108.91 ? 11   LYS A H      1 
ATOM   167   H HA     . LYS A 1 15  ? -59.633  17.286  35.676  0    103.57 ? 11   LYS A HA     1 
ATOM   168   H HB2    . LYS A 1 15  ? -60.261  15.833  38.267  0    107.52 ? 11   LYS A HB2    1 
ATOM   169   H HB3    . LYS A 1 15  ? -59.335  15.086  36.948  0    105.68 ? 11   LYS A HB3    1 
ATOM   170   H HG2    . LYS A 1 15  ? -57.524  16.501  37.243  0    111.54 ? 11   LYS A HG2    1 
ATOM   171   H HG3    . LYS A 1 15  ? -58.487  17.692  38.169  0    113.05 ? 11   LYS A HG3    1 
ATOM   172   H HD2    . LYS A 1 15  ? -58.333  16.51   40.089  0    118    ? 11   LYS A HD2    1 
ATOM   173   H HD3    . LYS A 1 15  ? -58.325  14.929  39.258  0    115.48 ? 11   LYS A HD3    1 
ATOM   174   H HE2    . LYS A 1 15  ? -56.043  15.123  38.724  0    118.67 ? 11   LYS A HE2    1 
ATOM   175   H HE3    . LYS A 1 15  ? -56.003  16.836  39.231  0    120.85 ? 11   LYS A HE3    1 
ATOM   176   H HZ1    . LYS A 1 15  ? -55.067  15.379  40.889  0    126.78 ? 11   LYS A HZ1    1 
ATOM   177   H HZ2    . LYS A 1 15  ? -56.416  16.126  41.474  0    126.95 ? 11   LYS A HZ2    1 
ATOM   178   H HZ3    . LYS A 1 15  ? -56.485  14.539  41.014  0    124.91 ? 11   LYS A HZ3    1 
ATOM   179   N N      . PRO A 1 16  ? -61.064  15.291  34.625  1    56.68  ? 12   PRO A N      1 
ATOM   180   C CA     . PRO A 1 16  ? -62.073  14.409  34.004  1    54.7   ? 12   PRO A CA     1 
ATOM   181   C C      . PRO A 1 16  ? -62.61   13.377  34.991  1    55.07  ? 12   PRO A C      1 
ATOM   182   O O      . PRO A 1 16  ? -61.837  12.599  35.54   1    55.94  ? 12   PRO A O      1 
ATOM   183   C CB     . PRO A 1 16  ? -61.31   13.738  32.855  1    53.37  ? 12   PRO A CB     1 
ATOM   184   C CG     . PRO A 1 16  ? -59.871  13.945  33.151  1    54.84  ? 12   PRO A CG     1 
ATOM   185   C CD     . PRO A 1 16  ? -59.765  15.203  33.929  1    56.64  ? 12   PRO A CD     1 
ATOM   186   H HA     . PRO A 1 16  ? -62.914  14.98   33.611  0    89.84  ? 12   PRO A HA     1 
ATOM   187   H HB2    . PRO A 1 16  ? -61.544  12.675  32.842  0    86.66  ? 12   PRO A HB2    1 
ATOM   188   H HB3    . PRO A 1 16  ? -61.58   14.195  31.904  0    86.51  ? 12   PRO A HB3    1 
ATOM   189   H HG2    . PRO A 1 16  ? -59.505  13.105  33.74   0    91.21  ? 12   PRO A HG2    1 
ATOM   190   H HG3    . PRO A 1 16  ? -59.32   14.028  32.217  0    90.05  ? 12   PRO A HG3    1 
ATOM   191   H HD2    . PRO A 1 16  ? -58.949  15.13   34.646  0    96.14  ? 12   PRO A HD2    1 
ATOM   192   H HD3    . PRO A 1 16  ? -59.633  16.05   33.258  0    94.45  ? 12   PRO A HD3    1 
ATOM   193   N N      . THR A 1 17  ? -63.921  13.393  35.246  1    54.71  ? 13   THR A N      1 
ATOM   194   C CA     . THR A 1 17  ? -64.547  12.501  36.217  1    55.29  ? 13   THR A CA     1 
ATOM   195   C C      . THR A 1 17  ? -65.029  11.151  35.628  1    53.63  ? 13   THR A C      1 
ATOM   196   O O      . THR A 1 17  ? -65.338  10.232  36.395  1    54.21  ? 13   THR A O      1 
ATOM   197   C CB     . THR A 1 17  ? -65.7    13.246  36.887  1    56.29  ? 13   THR A CB     1 
ATOM   198   O OG1    . THR A 1 17  ? -66.635  13.655  35.889  1    54.89  ? 13   THR A OG1    1 
ATOM   199   C CG2    . THR A 1 17  ? -65.251  14.461  37.65   1    58.32  ? 13   THR A CG2    1 
ATOM   200   H H      . THR A 1 17  ? -64.582  14.009  34.784  0    90.01  ? 13   THR A H      1 
ATOM   201   H HA     . THR A 1 17  ? -63.837  12.259  37.007  0    93.02  ? 13   THR A HA     1 
ATOM   202   H HB     . THR A 1 17  ? -66.141  12.571  37.617  0    94.47  ? 13   THR A HB     1 
ATOM   203   H HG1    . THR A 1 17  ? -67.284  12.93   35.695  0    90.03  ? 13   THR A HG1    1 
ATOM   204   H HG21   . THR A 1 17  ? -66.095  14.895  38.185  0    99.16  ? 13   THR A HG21   1 
ATOM   205   H HG22   . THR A 1 17  ? -64.483  14.179  38.369  0    99.61  ? 13   THR A HG22   1 
ATOM   206   H HG23   . THR A 1 17  ? -64.85   15.209  36.968  0    98     ? 13   THR A HG23   1 
ATOM   207   N N      . ALA A 1 18  ? -65.119  11.027  34.289  1    51.8   ? 14   ALA A N      1 
ATOM   208   C CA     . ALA A 1 18  ? -65.599  9.795   33.66   1    50.37  ? 14   ALA A CA     1 
ATOM   209   C C      . ALA A 1 18  ? -64.585  8.655   33.7    1    50.47  ? 14   ALA A C      1 
ATOM   210   O O      . ALA A 1 18  ? -63.444  8.844   33.263  1    50.51  ? 14   ALA A O      1 
ATOM   211   C CB     . ALA A 1 18  ? -65.984  10.066  32.218  1    48.73  ? 14   ALA A CB     1 
ATOM   212   H H      . ALA A 1 18  ? -64.888  11.751  33.616  0    83.63  ? 14   ALA A H      1 
ATOM   213   H HA     . ALA A 1 18  ? -66.505  9.474   34.173  0    81.19  ? 14   ALA A HA     1 
ATOM   214   H HB1    . ALA A 1 18  ? -66.34   9.131   31.79   0    76.42  ? 14   ALA A HB1    1 
ATOM   215   H HB2    . ALA A 1 18  ? -66.773  10.816  32.193  0    77.39  ? 14   ALA A HB2    1 
ATOM   216   H HB3    . ALA A 1 18  ? -65.11   10.419  31.672  0    77.12  ? 14   ALA A HB3    1 
ATOM   217   N N      . VAL A 1 19  ? -65.039  7.444   34.125  1    50.66  ? 15   VAL A N      1 
ATOM   218   C CA     . VAL A 1 19  ? -64.216  6.229   34.199  1    51     ? 15   VAL A CA     1 
ATOM   219   C C      . VAL A 1 19  ? -64.117  5.529   32.834  1    49.36  ? 15   VAL A C      1 
ATOM   220   O O      . VAL A 1 19  ? -65.122  5.07    32.286  1    48.42  ? 15   VAL A O      1 
ATOM   221   C CB     . VAL A 1 19  ? -64.762  5.253   35.263  1    52.2   ? 15   VAL A CB     1 
ATOM   222   C CG1    . VAL A 1 19  ? -63.974  3.946   35.269  1    52.6   ? 15   VAL A CG1    1 
ATOM   223   C CG2    . VAL A 1 19  ? -64.732  5.887   36.641  1    54.19  ? 15   VAL A CG2    1 
ATOM   224   H H      . VAL A 1 19  ? -65.995  7.281   34.425  0    81.59  ? 15   VAL A H      1 
ATOM   225   H HA     . VAL A 1 19  ? -63.212  6.513   34.511  0    83.14  ? 15   VAL A HA     1 
ATOM   226   H HB     . VAL A 1 19  ? -65.798  5.012   35.029  0    83.98  ? 15   VAL A HB     1 
ATOM   227   H HG11   . VAL A 1 19  ? -64.114  3.459   36.233  0    86.92  ? 15   VAL A HG11   1 
ATOM   228   H HG12   . VAL A 1 19  ? -64.346  3.291   34.482  0    84.42  ? 15   VAL A HG12   1 
ATOM   229   H HG13   . VAL A 1 19  ? -62.919  4.163   35.112  0    85.92  ? 15   VAL A HG13   1 
ATOM   230   H HG21   . VAL A 1 19  ? -65.238  5.225   37.342  0    89.88  ? 15   VAL A HG21   1 
ATOM   231   H HG22   . VAL A 1 19  ? -63.69   5.998   36.935  0    90.05  ? 15   VAL A HG22   1 
ATOM   232   H HG23   . VAL A 1 19  ? -65.226  6.857   36.627  0    88.98  ? 15   VAL A HG23   1 
ATOM   233   N N      . ASN A 1 20  ? -62.887  5.417   32.316  1    49.3   ? 16   ASN A N      1 
ATOM   234   C CA     . ASN A 1 20  ? -62.596  4.783   31.028  1    48.07  ? 16   ASN A CA     1 
ATOM   235   C C      . ASN A 1 20  ? -62.101  3.351   31.182  1    48.67  ? 16   ASN A C      1 
ATOM   236   O O      . ASN A 1 20  ? -62.236  2.582   30.243  1    47.77  ? 16   ASN A O      1 
ATOM   237   C CB     . ASN A 1 20  ? -61.54   5.586   30.275  1    47.95  ? 16   ASN A CB     1 
ATOM   238   C CG     . ASN A 1 20  ? -61.864  7.065   30.159  1    47.67  ? 16   ASN A CG     1 
ATOM   239   O OD1    . ASN A 1 20  ? -61.916  7.803   31.167  1    48.81  ? 16   ASN A OD1    1 
ATOM   240   N ND2    . ASN A 1 20  ? -62.064  7.559   28.936  1    46.36  ? 16   ASN A ND2    1 
ATOM   241   H H      . ASN A 1 20  ? -62.049  5.761   32.772  0    79.49  ? 16   ASN A H      1 
ATOM   242   H HA     . ASN A 1 20  ? -63.49   4.763   30.408  0    74.67  ? 16   ASN A HA     1 
ATOM   243   H HB2    . ASN A 1 20  ? -60.595  5.503   30.811  0    76.65  ? 16   ASN A HB2    1 
ATOM   244   H HB3    . ASN A 1 20  ? -61.429  5.167   29.276  0    74.63  ? 16   ASN A HB3    1 
ATOM   245   H HD21   . ASN A 1 20  ? -62.286  8.543   28.827  0    72.05  ? 16   ASN A HD21   1 
ATOM   246   H HD22   . ASN A 1 20  ? -62.01   6.964   28.116  0    71.31  ? 16   ASN A HD22   1 
ATOM   247   N N      . GLY A 1 21  ? -61.489  3.017   32.316  1    50.37  ? 17   GLY A N      1 
ATOM   248   C CA     . GLY A 1 21  ? -60.976  1.679   32.572  1    51.39  ? 17   GLY A CA     1 
ATOM   249   C C      . GLY A 1 21  ? -60.653  1.46    34.037  1    53.45  ? 17   GLY A C      1 
ATOM   250   O O      . GLY A 1 21  ? -60.409  2.422   34.77   1    54.36  ? 17   GLY A O      1 
ATOM   251   H H      . GLY A 1 21  ? -61.286  3.662   33.073  0    81.69  ? 17   GLY A H      1 
ATOM   252   H HA2    . GLY A 1 21  ? -61.698  0.922   32.267  0    82.33  ? 17   GLY A HA2    1 
ATOM   253   H HA3    . GLY A 1 21  ? -60.067  1.537   31.991  0    83.09  ? 17   GLY A HA3    1 
ATOM   254   N N      . CYS A 1 22  ? -60.67   0.197   34.486  1    54.42  ? 18   CYS A N      1 
ATOM   255   C CA     . CYS A 1 22  ? -60.33   -0.122  35.87   1    56.73  ? 18   CYS A CA     1 
ATOM   256   C C      . CYS A 1 22  ? -59.938  -1.603  36.041  1    58.05  ? 18   CYS A C      1 
ATOM   257   O O      . CYS A 1 22  ? -60.681  -2.497  35.625  1    57.23  ? 18   CYS A O      1 
ATOM   258   C CB     . CYS A 1 22  ? -61.411  0.321   36.86   1    57.04  ? 18   CYS A CB     1 
ATOM   259   S SG     . CYS A 1 22  ? -63.045  -0.409  36.587  1    56.03  ? 18   CYS A SG     1 
ATOM   260   H H      . CYS A 1 22  ? -60.911  -0.61   33.92   0    89.17  ? 18   CYS A H      1 
ATOM   261   H HA     . CYS A 1 22  ? -59.451  0.459   36.139  0    95.8   ? 18   CYS A HA     1 
ATOM   262   H HB2    . CYS A 1 22  ? -61.095  0.042   37.865  0    97.52  ? 18   CYS A HB2    1 
ATOM   263   H HB3    . CYS A 1 22  ? -61.523  1.403   36.801  0    94.99  ? 18   CYS A HB3    1 
ATOM   264   H HG     . CYS A 1 22  ? -63.346  -0.283  35.29   0    91.05  ? 18   CYS A HG     1 
ATOM   265   N N      . VAL A 1 23  ? -58.733  -1.84   36.625  1    60.3   ? 19   VAL A N      1 
ATOM   266   C CA     . VAL A 1 23  ? -58.157  -3.172  36.86   1    62.07  ? 19   VAL A CA     1 
ATOM   267   C C      . VAL A 1 23  ? -57.899  -3.42   38.349  1    64.97  ? 19   VAL A C      1 
ATOM   268   O O      . VAL A 1 23  ? -57.779  -2.477  39.127  1    65.95  ? 19   VAL A O      1 
ATOM   269   C CB     . VAL A 1 23  ? -56.867  -3.413  36.023  1    62.29  ? 19   VAL A CB     1 
ATOM   270   C CG1    . VAL A 1 23  ? -57.169  -3.345  34.536  1    59.74  ? 19   VAL A CG1    1 
ATOM   271   C CG2    . VAL A 1 23  ? -55.751  -2.441  36.386  1    63.4   ? 19   VAL A CG2    1 
ATOM   272   H H      . VAL A 1 23  ? -58.139  -1.098  36.982  0    103.46 ? 19   VAL A H      1 
ATOM   273   H HA     . VAL A 1 23  ? -58.874  -3.929  36.545  0    105.9  ? 19   VAL A HA     1 
ATOM   274   H HB     . VAL A 1 23  ? -56.509  -4.42   36.23   0    108.58 ? 19   VAL A HB     1 
ATOM   275   H HG11   . VAL A 1 23  ? -56.274  -3.608  33.975  0    101.85 ? 19   VAL A HG11   1 
ATOM   276   H HG12   . VAL A 1 23  ? -57.97   -4.046  34.305  0    100.87 ? 19   VAL A HG12   1 
ATOM   277   H HG13   . VAL A 1 23  ? -57.479  -2.333  34.279  0    100.06 ? 19   VAL A HG13   1 
ATOM   278   H HG21   . VAL A 1 23  ? -54.936  -2.576  35.675  0    109.62 ? 19   VAL A HG21   1 
ATOM   279   H HG22   . VAL A 1 23  ? -56.117  -1.418  36.326  0    108.42 ? 19   VAL A HG22   1 
ATOM   280   H HG23   . VAL A 1 23  ? -55.393  -2.652  37.392  0    111.77 ? 19   VAL A HG23   1 
ATOM   281   N N      . THR A 1 24  ? -57.822  -4.704  38.736  1    66.6   ? 20   THR A N      1 
ATOM   282   C CA     . THR A 1 24  ? -57.549  -5.138  40.11   1    69.73  ? 20   THR A CA     1 
ATOM   283   C C      . THR A 1 24  ? -56.35   -6.079  40.112  1    72.06  ? 20   THR A C      1 
ATOM   284   O O      . THR A 1 24  ? -56.156  -6.833  39.165  1    71.33  ? 20   THR A O      1 
ATOM   285   C CB     . THR A 1 24  ? -58.783  -5.825  40.727  1    70.18  ? 20   THR A CB     1 
ATOM   286   O OG1    . THR A 1 24  ? -59.295  -6.794  39.815  1    68.86  ? 20   THR A OG1    1 
ATOM   287   C CG2    . THR A 1 24  ? -59.88   -4.846  41.084  1    68.99  ? 20   THR A CG2    1 
ATOM   288   H H      . THR A 1 24  ? -57.952  -5.483  38.099  0    115.96 ? 20   THR A H      1 
ATOM   289   H HA     . THR A 1 24  ? -57.288  -4.282  40.729  0    124.21 ? 20   THR A HA     1 
ATOM   290   H HB     . THR A 1 24  ? -58.481  -6.335  41.64   0    127.04 ? 20   THR A HB     1 
ATOM   291   H HG1    . THR A 1 24  ? -60.012  -7.326  40.249  0    122    ? 20   THR A HG1    1 
ATOM   292   H HG21   . THR A 1 24  ? -60.756  -5.388  41.437  0    122.14 ? 20   THR A HG21   1 
ATOM   293   H HG22   . THR A 1 24  ? -59.538  -4.175  41.87   0    123.16 ? 20   THR A HG22   1 
ATOM   294   H HG23   . THR A 1 24  ? -60.155  -4.258  40.209  0    119.46 ? 20   THR A HG23   1 
ATOM   295   N N      . GLY A 1 25  ? -55.553  -6.027  41.164  1    75.05  ? 21   GLY A N      1 
ATOM   296   C CA     . GLY A 1 25  ? -54.378  -6.876  41.273  1    77.72  ? 21   GLY A CA     1 
ATOM   297   C C      . GLY A 1 25  ? -53.619  -6.624  42.552  1    81.23  ? 21   GLY A C      1 
ATOM   298   O O      . GLY A 1 25  ? -54.222  -6.263  43.561  1    82.2   ? 21   GLY A O      1 
ATOM   299   H H      . GLY A 1 25  ? -55.692  -5.417  41.962  0    135.98 ? 21   GLY A H      1 
ATOM   300   H HA2    . GLY A 1 25  ? -54.688  -7.92   41.266  0    141.63 ? 21   GLY A HA2    1 
ATOM   301   H HA3    . GLY A 1 25  ? -53.72   -6.709  40.422  0    140.21 ? 21   GLY A HA3    1 
ATOM   302   N N      . HIS A 1 26  ? -52.295  -6.832  42.525  1    83.45  ? 22   HIS A N      1 
ATOM   303   C CA     . HIS A 1 26  ? -51.417  -6.644  43.683  1    87.24  ? 22   HIS A CA     1 
ATOM   304   C C      . HIS A 1 26  ? -50.241  -5.783  43.245  1    87.49  ? 22   HIS A C      1 
ATOM   305   O O      . HIS A 1 26  ? -49.111  -6.247  43.158  1    89.79  ? 22   HIS A O      1 
ATOM   306   C CB     . HIS A 1 26  ? -50.946  -8.006  44.2    1    90.62  ? 22   HIS A CB     1 
ATOM   307   C CG     . HIS A 1 26  ? -52.063  -8.885  44.669  1    90.71  ? 22   HIS A CG     1 
ATOM   308   N ND1    . HIS A 1 26  ? -52.548  -8.813  45.964  1    92.64  ? 22   HIS A ND1    1 
ATOM   309   C CD2    . HIS A 1 26  ? -52.764  -9.824  43.993  1    89.23  ? 22   HIS A CD2    1 
ATOM   310   C CE1    . HIS A 1 26  ? -53.521  -9.705  46.038  1    92.29  ? 22   HIS A CE1    1 
ATOM   311   N NE2    . HIS A 1 26  ? -53.688  -10.339 44.874  1    90.27  ? 22   HIS A NE2    1 
ATOM   312   H H      . HIS A 1 26  ? -51.793  -7.14   41.698  0    153.02 ? 22   HIS A H      1 
ATOM   313   H HA     . HIS A 1 26  ? -51.931  -6.127  44.492  0    162.27 ? 22   HIS A HA     1 
ATOM   314   H HB2    . HIS A 1 26  ? -50.463  -8.517  43.37   0    169.15 ? 22   HIS A HB2    1 
ATOM   315   H HB3    . HIS A 1 26  ? -50.249  -7.867  45.025  0    172.34 ? 22   HIS A HB3    1 
ATOM   316   H HD1    . HIS A 1 26  ? -52.222  -8.2    46.705  0    175.46 ? 22   HIS A HD1    1 
ATOM   317   H HD2    . HIS A 1 26  ? -52.621  -10.117 42.965  0    164.86 ? 22   HIS A HD2    1 
ATOM   318   H HE1    . HIS A 1 26  ? -54.108  -9.895  46.919  0    174.57 ? 22   HIS A HE1    1 
ATOM   319   N N      . PHE A 1 27  ? -50.54   -4.523  42.973  1    85.31  ? 23   PHE A N      1 
ATOM   320   C CA     . PHE A 1 27  ? -49.616  -3.529  42.447  1    85     ? 23   PHE A CA     1 
ATOM   321   C C      . PHE A 1 27  ? -48.726  -2.816  43.487  1    88.26  ? 23   PHE A C      1 
ATOM   322   O O      . PHE A 1 27  ? -47.529  -2.67   43.244  1    89.87  ? 23   PHE A O      1 
ATOM   323   C CB     . PHE A 1 27  ? -50.438  -2.498  41.663  1    81.1   ? 23   PHE A CB     1 
ATOM   324   C CG     . PHE A 1 27  ? -49.646  -1.436  40.953  1    80.44  ? 23   PHE A CG     1 
ATOM   325   C CD1    . PHE A 1 27  ? -48.541  -1.769  40.187  1    81.09  ? 23   PHE A CD1    1 
ATOM   326   C CD2    . PHE A 1 27  ? -50.063  -0.116  40.966  1    79.27  ? 23   PHE A CD2    1 
ATOM   327   C CE1    . PHE A 1 27  ? -47.825  -0.791  39.517  1    80.74  ? 23   PHE A CE1    1 
ATOM   328   C CE2    . PHE A 1 27  ? -49.349  0.858   40.29   1    78.89  ? 23   PHE A CE2    1 
ATOM   329   C CZ     . PHE A 1 27  ? -48.239  0.515   39.564  1    79.59  ? 23   PHE A CZ     1 
ATOM   330   H H      . PHE A 1 27  ? -51.472  -4.154  43.133  0    156.1  ? 23   PHE A H      1 
ATOM   331   H HA     . PHE A 1 27  ? -48.958  -4.031  41.74   0    157.22 ? 23   PHE A HA     1 
ATOM   332   H HB2    . PHE A 1 27  ? -51.031  -3.025  40.917  0    146.36 ? 23   PHE A HB2    1 
ATOM   333   H HB3    . PHE A 1 27  ? -51.104  -1.991  42.36   0    148.35 ? 23   PHE A HB3    1 
ATOM   334   H HD1    . PHE A 1 27  ? -48.207  -2.791  40.136  0    149.59 ? 23   PHE A HD1    1 
ATOM   335   H HD2    . PHE A 1 27  ? -50.92   0.172   41.548  0    143.84 ? 23   PHE A HD2    1 
ATOM   336   H HE1    . PHE A 1 27  ? -46.959  -1.061  38.936  0    148.31 ? 23   PHE A HE1    1 
ATOM   337   H HE2    . PHE A 1 27  ? -49.67   1.885   40.331  0    142.54 ? 23   PHE A HE2    1 
ATOM   338   H HZ     . PHE A 1 27  ? -47.69   1.273   39.031  0    144.7  ? 23   PHE A HZ     1 
ATOM   339   N N      . THR A 1 28  ? -49.304  -2.323  44.607  1    89.36  ? 24   THR A N      1 
ATOM   340   C CA     . THR A 1 28  ? -48.557  -1.606  45.651  1    92.63  ? 24   THR A CA     1 
ATOM   341   C C      . THR A 1 28  ? -47.679  -2.569  46.466  1    97     ? 24   THR A C      1 
ATOM   342   O O      . THR A 1 28  ? -46.522  -2.252  46.755  1    99.83  ? 24   THR A O      1 
ATOM   343   C CB     . THR A 1 28  ? -49.507  -0.793  46.541  1    92.53  ? 24   THR A CB     1 
ATOM   344   O OG1    . THR A 1 28  ? -50.462  -1.663  47.158  1    93.3   ? 24   THR A OG1    1 
ATOM   345   C CG2    . THR A 1 28  ? -50.217  0.313   45.773  1    88.66  ? 24   THR A CG2    1 
ATOM   346   H H      . THR A 1 28  ? -50.295  -2.41   44.806  0    165.25 ? 24   THR A H      1 
ATOM   347   H HA     . THR A 1 28  ? -47.888  -0.894  45.17   0    173.39 ? 24   THR A HA     1 
ATOM   348   H HB     . THR A 1 28  ? -48.919  -0.313  47.321  0    176.07 ? 24   THR A HB     1 
ATOM   349   H HG1    . THR A 1 28  ? -50.942  -1.177  47.88   0    175.48 ? 24   THR A HG1    1 
ATOM   350   H HG21   . THR A 1 28  ? -50.825  0.909   46.452  0    165.19 ? 24   THR A HG21   1 
ATOM   351   H HG22   . THR A 1 28  ? -49.487  0.96    45.288  0    164.75 ? 24   THR A HG22   1 
ATOM   352   H HG23   . THR A 1 28  ? -50.862  -0.118  45.008  0    162.36 ? 24   THR A HG23   1 
ATOM   353   N N      . SER A 1 29  ? -48.228  -3.736  46.838  1    97.8   ? 25   SER A N      1 
ATOM   354   C CA     . SER A 1 29  ? -47.496  -4.801  47.541  1    101.96 ? 25   SER A CA     1 
ATOM   355   C C      . SER A 1 29  ? -48.135  -6.165  47.207  1    101.08 ? 25   SER A C      1 
ATOM   356   O O      . SER A 1 29  ? -49.287  -6.216  46.772  1    97.68  ? 25   SER A O      1 
ATOM   357   C CB     . SER A 1 29  ? -47.457  -4.548  49.05   1    105.58 ? 25   SER A CB     1 
ATOM   358   O OG     . SER A 1 29  ? -48.511  -5.174  49.765  1    105.45 ? 25   SER A OG     1 
ATOM   359   H H      . SER A 1 29  ? -49.203  -3.972  46.678  0    183.05 ? 25   SER A H      1 
ATOM   360   H HA     . SER A 1 29  ? -46.468  -4.83   47.183  0    195.56 ? 25   SER A HA     1 
ATOM   361   H HB2    . SER A 1 29  ? -46.511  -4.923  49.436  0    205.63 ? 25   SER A HB2    1 
ATOM   362   H HB3    . SER A 1 29  ? -47.522  -3.474  49.221  0    201.51 ? 25   SER A HB3    1 
ATOM   363   H HG     . SER A 1 29  ? -48.577  -4.791  50.678  0    204.18 ? 25   SER A HG     1 
ATOM   364   N N      . ALA A 1 30  ? -47.4    -7.258  47.406  1    104.32 ? 26   ALA A N      1 
ATOM   365   C CA     . ALA A 1 30  ? -47.917  -8.593  47.111  1    104    ? 26   ALA A CA     1 
ATOM   366   C C      . ALA A 1 30  ? -49.175  -8.947  47.916  1    104.01 ? 26   ALA A C      1 
ATOM   367   O O      . ALA A 1 30  ? -50.019  -9.688  47.413  1    102.3  ? 26   ALA A O      1 
ATOM   368   C CB     . ALA A 1 30  ? -46.842  -9.625  47.372  1    108.11 ? 26   ALA A CB     1 
ATOM   369   H H      . ALA A 1 30  ? -46.453  -7.248  47.77   0    202.42 ? 26   ALA A H      1 
ATOM   370   H HA     . ALA A 1 30  ? -48.177  -8.638  46.055  0    195.75 ? 26   ALA A HA     1 
ATOM   371   H HB1    . ALA A 1 30  ? -47.235  -10.613 47.137  0    207.81 ? 26   ALA A HB1    1 
ATOM   372   H HB2    . ALA A 1 30  ? -45.984  -9.404  46.739  0    207.88 ? 26   ALA A HB2    1 
ATOM   373   H HB3    . ALA A 1 30  ? -46.55   -9.579  48.42   0    211.21 ? 26   ALA A HB3    1 
ATOM   374   N N      . GLU A 1 31  ? -49.337  -8.349  49.116  1    105.88 ? 27   GLU A N      1 
ATOM   375   C CA     . GLU A 1 31  ? -50.452  -8.623  50.024  1    106.54 ? 27   GLU A CA     1 
ATOM   376   C C      . GLU A 1 31  ? -51.694  -7.781  49.711  1    102.45 ? 27   GLU A C      1 
ATOM   377   O O      . GLU A 1 31  ? -52.798  -8.322  49.655  1    100.96 ? 27   GLU A O      1 
ATOM   378   C CB     . GLU A 1 31  ? -50.036  -8.38   51.488  1    111.05 ? 27   GLU A CB     1 
ATOM   379   C CG     . GLU A 1 31  ? -48.664  -8.916  51.876  1    115.59 ? 27   GLU A CG     1 
ATOM   380   C CD     . GLU A 1 31  ? -47.467  -8.032  51.562  1    116.15 ? 27   GLU A CD     1 
ATOM   381   O OE1    . GLU A 1 31  ? -47.604  -6.788  51.621  1    114.44 ? 27   GLU A OE1    1 
ATOM   382   O OE2    . GLU A 1 31  ? -46.385  -8.588  51.264  1    118.56 ? 27   GLU A OE2    1 
ATOM   383   H H      . GLU A 1 31  ? -48.721  -7.624  49.468  0    204.34 ? 27   GLU A H      1 
ATOM   384   H HA     . GLU A 1 31  ? -50.734  -9.671  49.936  0    205.11 ? 27   GLU A HA     1 
ATOM   385   H HB2    . GLU A 1 31  ? -50.066  -7.309  51.686  0    213.73 ? 27   GLU A HB2    1 
ATOM   386   H HB3    . GLU A 1 31  ? -50.764  -8.876  52.129  0    215.5  ? 27   GLU A HB3    1 
ATOM   387   H HG2    . GLU A 1 31  ? -48.66   -9.087  52.952  0    227.73 ? 27   GLU A HG2    1 
ATOM   388   H HG3    . GLU A 1 31  ? -48.509  -9.862  51.36   0    224.63 ? 27   GLU A HG3    1 
ATOM   389   N N      . ASP A 1 32  ? -51.52   -6.459  49.54   1    100.89 ? 28   ASP A N      1 
ATOM   390   C CA     . ASP A 1 32  ? -52.626  -5.529  49.273  1    97.38  ? 28   ASP A CA     1 
ATOM   391   C C      . ASP A 1 32  ? -53.407  -5.872  48.008  1    93.26  ? 28   ASP A C      1 
ATOM   392   O O      . ASP A 1 32  ? -52.786  -6.074  46.969  1    91.9   ? 28   ASP A O      1 
ATOM   393   C CB     . ASP A 1 32  ? -52.084  -4.086  49.083  1    96.44  ? 28   ASP A CB     1 
ATOM   394   C CG     . ASP A 1 32  ? -51.546  -3.41   50.331  1    100.03 ? 28   ASP A CG     1 
ATOM   395   O OD1    . ASP A 1 32  ? -52.346  -2.794  51.064  1    100.66 ? 28   ASP A OD1    1 
ATOM   396   O OD2    . ASP A 1 32  ? -50.322  -3.474  50.558  1    102.34 ? 28   ASP A OD2    1 
ATOM   397   H H      . ASP A 1 32  ? -50.612  -6.007  49.585  0    193.51 ? 28   ASP A H      1 
ATOM   398   H HA     . ASP A 1 32  ? -53.311  -5.531  50.119  0    185.55 ? 28   ASP A HA     1 
ATOM   399   H HB2    . ASP A 1 32  ? -51.276  -4.112  48.353  0    182.06 ? 28   ASP A HB2    1 
ATOM   400   H HB3    . ASP A 1 32  ? -52.892  -3.465  48.7    0    179.6  ? 28   ASP A HB3    1 
ATOM   401   N N      . LEU A 1 33  ? -54.754  -5.878  48.064  1    91.45  ? 29   LEU A N      1 
ATOM   402   C CA     . LEU A 1 33  ? -55.549  -6.003  46.84   1    87.57  ? 29   LEU A CA     1 
ATOM   403   C C      . LEU A 1 33  ? -55.801  -4.57   46.358  1    84.67  ? 29   LEU A C      1 
ATOM   404   O O      . LEU A 1 33  ? -56.375  -3.781  47.104  1    84.82  ? 29   LEU A O      1 
ATOM   405   C CB     . LEU A 1 33  ? -56.888  -6.705  47.089  1    87.47  ? 29   LEU A CB     1 
ATOM   406   C CG     . LEU A 1 33  ? -57.889  -6.692  45.923  1    83.61  ? 29   LEU A CG     1 
ATOM   407   C CD1    . LEU A 1 33  ? -57.322  -7.397  44.709  1    81.88  ? 29   LEU A CD1    1 
ATOM   408   C CD2    . LEU A 1 33  ? -59.197  -7.325  46.339  1    84.12  ? 29   LEU A CD2    1 
ATOM   409   H H      . LEU A 1 33  ? -55.314  -5.78   48.905  0    172.67 ? 29   LEU A H      1 
ATOM   410   H HA     . LEU A 1 33  ? -54.998  -6.55   46.077  0    162.14 ? 29   LEU A HA     1 
ATOM   411   H HB2    . LEU A 1 33  ? -56.683  -7.747  47.33   0    164.15 ? 29   LEU A HB2    1 
ATOM   412   H HB3    . LEU A 1 33  ? -57.377  -6.229  47.936  0    163.19 ? 29   LEU A HB3    1 
ATOM   413   H HG     . LEU A 1 33  ? -58.119  -5.668  45.635  0    151.61 ? 29   LEU A HG     1 
ATOM   414   H HD11   . LEU A 1 33  ? -58.104  -7.495  43.958  0    147.73 ? 29   LEU A HD11   1 
ATOM   415   H HD12   . LEU A 1 33  ? -56.496  -6.815  44.304  0    149.72 ? 29   LEU A HD12   1 
ATOM   416   H HD13   . LEU A 1 33  ? -56.969  -8.383  45.008  0    152.39 ? 29   LEU A HD13   1 
ATOM   417   H HD21   . LEU A 1 33  ? -59.906  -7.254  45.515  0    151.74 ? 29   LEU A HD21   1 
ATOM   418   H HD22   . LEU A 1 33  ? -59.02   -8.371  46.586  0    156.3  ? 29   LEU A HD22   1 
ATOM   419   H HD23   . LEU A 1 33  ? -59.583  -6.801  47.211  0    155.72 ? 29   LEU A HD23   1 
ATOM   420   N N      . ASN A 1 34  ? -55.399  -4.24   45.13   1    82.35  ? 30   ASN A N      1 
ATOM   421   C CA     . ASN A 1 34  ? -55.54   -2.894  44.588  1    79.89  ? 30   ASN A CA     1 
ATOM   422   C C      . ASN A 1 34  ? -56.659  -2.766  43.572  1    76.12  ? 30   ASN A C      1 
ATOM   423   O O      . ASN A 1 34  ? -57.149  -3.766  43.054  1    75.06  ? 30   ASN A O      1 
ATOM   424   C CB     . ASN A 1 34  ? -54.224  -2.48   43.933  1    80.04  ? 30   ASN A CB     1 
ATOM   425   C CG     . ASN A 1 34  ? -53.097  -2.359  44.909  1    83.81  ? 30   ASN A CG     1 
ATOM   426   O OD1    . ASN A 1 34  ? -52.122  -3.107  44.861  1    85.79  ? 30   ASN A OD1    1 
ATOM   427   N ND2    . ASN A 1 34  ? -53.204  -1.414  45.831  1    85.1   ? 30   ASN A ND2    1 
ATOM   428   H H      . ASN A 1 34  ? -54.97   -4.892  44.481  0    150.7  ? 30   ASN A H      1 
ATOM   429   H HA     . ASN A 1 34  ? -55.744  -2.184  45.388  0    146.68 ? 30   ASN A HA     1 
ATOM   430   H HB2    . ASN A 1 34  ? -53.941  -3.221  43.188  0    145.31 ? 30   ASN A HB2    1 
ATOM   431   H HB3    . ASN A 1 34  ? -54.355  -1.51   43.457  0    144.13 ? 30   ASN A HB3    1 
ATOM   432   H HD21   . ASN A 1 34  ? -52.466  -1.288  46.517  0    159.78 ? 30   ASN A HD21   1 
ATOM   433   H HD22   . ASN A 1 34  ? -54.023  -0.815  45.856  0    155.52 ? 30   ASN A HD22   1 
ATOM   434   N N      . LEU A 1 35  ? -57.064  -1.515  43.302  1    74.29  ? 31   LEU A N      1 
ATOM   435   C CA     . LEU A 1 35  ? -58.034  -1.158  42.275  1    70.85  ? 31   LEU A CA     1 
ATOM   436   C C      . LEU A 1 35  ? -57.505  0.104   41.611  1    69.49  ? 31   LEU A C      1 
ATOM   437   O O      . LEU A 1 35  ? -57.471  1.153   42.249  1    70.51  ? 31   LEU A O      1 
ATOM   438   C CB     . LEU A 1 35  ? -59.444  -0.899  42.849  1    70.41  ? 31   LEU A CB     1 
ATOM   439   C CG     . LEU A 1 35  ? -60.465  -0.276  41.871  1    67.21  ? 31   LEU A CG     1 
ATOM   440   C CD1    . LEU A 1 35  ? -60.691  -1.161  40.669  1    65.21  ? 31   LEU A CD1    1 
ATOM   441   C CD2    . LEU A 1 35  ? -61.769  0.035   42.561  1    67.39  ? 31   LEU A CD2    1 
ATOM   442   H H      . LEU A 1 35  ? -56.726  -0.711  43.82   0    134.38 ? 31   LEU A H      1 
ATOM   443   H HA     . LEU A 1 35  ? -58.094  -1.952  41.533  0    124.73 ? 31   LEU A HA     1 
ATOM   444   H HB2    . LEU A 1 35  ? -59.857  -1.849  43.186  0    125.6  ? 31   LEU A HB2    1 
ATOM   445   H HB3    . LEU A 1 35  ? -59.353  -0.22   43.695  0    126.27 ? 31   LEU A HB3    1 
ATOM   446   H HG     . LEU A 1 35  ? -60.085  0.674   41.502  0    116.9  ? 31   LEU A HG     1 
ATOM   447   H HD11   . LEU A 1 35  ? -61.45   -0.692  40.046  0    111.31 ? 31   LEU A HD11   1 
ATOM   448   H HD12   . LEU A 1 35  ? -59.77   -1.259  40.097  0    113.2  ? 31   LEU A HD12   1 
ATOM   449   H HD13   . LEU A 1 35  ? -61.031  -2.139  41.005  0    114.26 ? 31   LEU A HD13   1 
ATOM   450   H HD21   . LEU A 1 35  ? -62.505  0.341   41.819  0    115.87 ? 31   LEU A HD21   1 
ATOM   451   H HD22   . LEU A 1 35  ? -62.113  -0.848  43.095  0    119.22 ? 31   LEU A HD22   1 
ATOM   452   H HD23   . LEU A 1 35  ? -61.6    0.853   43.26   0    119.21 ? 31   LEU A HD23   1 
ATOM   453   N N      . LEU A 1 36  ? -57.104  0.012   40.343  1    67.42  ? 32   LEU A N      1 
ATOM   454   C CA     . LEU A 1 36  ? -56.599  1.156   39.587  1    66.08  ? 32   LEU A CA     1 
ATOM   455   C C      . LEU A 1 36  ? -57.696  1.638   38.662  1    63.1   ? 32   LEU A C      1 
ATOM   456   O O      . LEU A 1 36  ? -58.248  0.827   37.94   1    61.72  ? 32   LEU A O      1 
ATOM   457   C CB     . LEU A 1 36  ? -55.381  0.745   38.753  1    66.21  ? 32   LEU A CB     1 
ATOM   458   C CG     . LEU A 1 36  ? -54.017  0.745   39.441  1    69.19  ? 32   LEU A CG     1 
ATOM   459   C CD1    . LEU A 1 36  ? -54.033  0.006   40.787  1    72.01  ? 32   LEU A CD1    1 
ATOM   460   C CD2    . LEU A 1 36  ? -52.994  0.126   38.541  1    69.31  ? 32   LEU A CD2    1 
ATOM   461   H H      . LEU A 1 36  ? -57.139  -0.846  39.803  0    117.65 ? 32   LEU A H      1 
ATOM   462   H HA     . LEU A 1 36  ? -56.317  1.971   40.251  0    116.6  ? 32   LEU A HA     1 
ATOM   463   H HB2    . LEU A 1 36  ? -55.544  -0.256  38.357  0    115.29 ? 32   LEU A HB2    1 
ATOM   464   H HB3    . LEU A 1 36  ? -55.308  1.441   37.919  0    114.08 ? 32   LEU A HB3    1 
ATOM   465   H HG     . LEU A 1 36  ? -53.72   1.776   39.628  0    122.65 ? 32   LEU A HG     1 
ATOM   466   H HD11   . LEU A 1 36  ? -53.02   -0.032  41.183  0    130.7  ? 32   LEU A HD11   1 
ATOM   467   H HD12   . LEU A 1 36  ? -54.678  0.537   41.485  0    128.74 ? 32   LEU A HD12   1 
ATOM   468   H HD13   . LEU A 1 36  ? -54.408  -1.005  40.632  0    128.18 ? 32   LEU A HD13   1 
ATOM   469   H HD21   . LEU A 1 36  ? -52.018  0.18    39.021  0    124.83 ? 32   LEU A HD21   1 
ATOM   470   H HD22   . LEU A 1 36  ? -53.26   -0.915  38.361  0    122.38 ? 32   LEU A HD22   1 
ATOM   471   H HD23   . LEU A 1 36  ? -52.976  0.671   37.599  0    120.73 ? 32   LEU A HD23   1 
ATOM   472   N N      . ILE A 1 37  ? -57.997  2.94    38.661  1    62.48  ? 33   ILE A N      1 
ATOM   473   C CA     . ILE A 1 37  ? -59.045  3.51    37.82   1    59.94  ? 33   ILE A CA     1 
ATOM   474   C C      . ILE A 1 37  ? -58.425  4.587   36.964  1    59.15  ? 33   ILE A C      1 
ATOM   475   O O      . ILE A 1 37  ? -57.845  5.527   37.499  1    60.51  ? 33   ILE A O      1 
ATOM   476   C CB     . ILE A 1 37  ? -60.179  4.098   38.689  1    60.33  ? 33   ILE A CB     1 
ATOM   477   C CG1    . ILE A 1 37  ? -60.707  3.039   39.674  1    61.58  ? 33   ILE A CG1    1 
ATOM   478   C CG2    . ILE A 1 37  ? -61.3    4.643   37.796  1    58.04  ? 33   ILE A CG2    1 
ATOM   479   C CD1    . ILE A 1 37  ? -61.624  3.548   40.692  1    62.29  ? 33   ILE A CD1    1 
ATOM   480   H H      . ILE A 1 37  ? -57.528  3.634   39.235  0    108.55 ? 33   ILE A H      1 
ATOM   481   H HA     . ILE A 1 37  ? -59.482  2.754   37.17   0    100.44 ? 33   ILE A HA     1 
ATOM   482   H HB     . ILE A 1 37  ? -59.771  4.926   39.267  0    103.92 ? 33   ILE A HB     1 
ATOM   483   H HG12   . ILE A 1 37  ? -61.231  2.269   39.11   0    104.24 ? 33   ILE A HG12   1 
ATOM   484   H HG13   . ILE A 1 37  ? -59.871  2.593   40.212  0    107.22 ? 33   ILE A HG13   1 
ATOM   485   H HG21   . ILE A 1 37  ? -62.119  5.002   38.417  0    98.05  ? 33   ILE A HG21   1 
ATOM   486   H HG22   . ILE A 1 37  ? -60.931  5.474   37.196  0    96.76  ? 33   ILE A HG22   1 
ATOM   487   H HG23   . ILE A 1 37  ? -61.653  3.844   37.146  0    96.34  ? 33   ILE A HG23   1 
ATOM   488   H HD11   . ILE A 1 37  ? -61.674  2.83    41.509  0    108.99 ? 33   ILE A HD11   1 
ATOM   489   H HD12   . ILE A 1 37  ? -61.27   4.511   41.054  0    108.39 ? 33   ILE A HD12   1 
ATOM   490   H HD13   . ILE A 1 37  ? -62.613  3.66    40.249  0    105.95 ? 33   ILE A HD13   1 
ATOM   491   N N      . ALA A 1 38  ? -58.553  4.472   35.644  1    57.21  ? 34   ALA A N      1 
ATOM   492   C CA     . ALA A 1 38  ? -58.02   5.476   34.733  1    56.57  ? 34   ALA A CA     1 
ATOM   493   C C      . ALA A 1 38  ? -59.168  6.339   34.229  1    54.53  ? 34   ALA A C      1 
ATOM   494   O O      . ALA A 1 38  ? -60.11   5.823   33.627  1    52.85  ? 34   ALA A O      1 
ATOM   495   C CB     . ALA A 1 38  ? -57.313  4.812   33.571  1    56.31  ? 34   ALA A CB     1 
ATOM   496   H H      . ALA A 1 38  ? -59.02   3.703   35.174  0    94.61  ? 34   ALA A H      1 
ATOM   497   H HA     . ALA A 1 38  ? -57.29   6.109   35.234  0    95.43  ? 34   ALA A HA     1 
ATOM   498   H HB1    . ALA A 1 38  ? -56.996  5.579   32.867  0    92.51  ? 34   ALA A HB1    1 
ATOM   499   H HB2    . ALA A 1 38  ? -56.442  4.278   33.95   0    94.81  ? 34   ALA A HB2    1 
ATOM   500   H HB3    . ALA A 1 38  ? -57.993  4.116   33.083  0    92.09  ? 34   ALA A HB3    1 
ATOM   501   N N      . LYS A 1 39  ? -59.103  7.647   34.514  1    54.91  ? 35   LYS A N      1 
ATOM   502   C CA     . LYS A 1 39  ? -60.111  8.612   34.103  1    53.34  ? 35   LYS A CA     1 
ATOM   503   C C      . LYS A 1 39  ? -59.45   9.529   33.078  1    53.01  ? 35   LYS A C      1 
ATOM   504   O O      . LYS A 1 39  ? -59.002  10.629  33.391  1    54.45  ? 35   LYS A O      1 
ATOM   505   C CB     . LYS A 1 39  ? -60.663  9.396   35.318  1    54.34  ? 35   LYS A CB     1 
ATOM   506   C CG     . LYS A 1 39  ? -61.19   8.511   36.46   1    55.6   ? 35   LYS A CG     1 
ATOM   507   C CD     . LYS A 1 39  ? -61.945  9.312   37.532  1    56.94  ? 35   LYS A CD     1 
ATOM   508   C CE     . LYS A 1 39  ? -62.396  8.438   38.678  1    58.35  ? 35   LYS A CE     1 
ATOM   509   N NZ     . LYS A 1 39  ? -62.967  9.22    39.805  1    59.87  ? 35   LYS A NZ     1 
ATOM   510   H H      . LYS A 1 39  ? -58.342  8.077   35.031  0    92.1   ? 35   LYS A H      1 
ATOM   511   H HA     . LYS A 1 39  ? -60.951  8.117   33.619  0    86.13  ? 35   LYS A HA     1 
ATOM   512   H HB2    . LYS A 1 39  ? -59.869  10.014  35.735  0    91.21  ? 35   LYS A HB2    1 
ATOM   513   H HB3    . LYS A 1 39  ? -61.485  10.023  34.976  0    89     ? 35   LYS A HB3    1 
ATOM   514   H HG2    . LYS A 1 39  ? -61.866  7.762   36.051  0    91.58  ? 35   LYS A HG2    1 
ATOM   515   H HG3    . LYS A 1 39  ? -60.343  8.024   36.943  0    93.97  ? 35   LYS A HG3    1 
ATOM   516   H HD2    . LYS A 1 39  ? -61.289  10.083  37.935  0    96.71  ? 35   LYS A HD2    1 
ATOM   517   H HD3    . LYS A 1 39  ? -62.827  9.767   37.085  0    94.36  ? 35   LYS A HD3    1 
ATOM   518   H HE2    . LYS A 1 39  ? -63.167  7.755   38.326  0    97.49  ? 35   LYS A HE2    1 
ATOM   519   H HE3    . LYS A 1 39  ? -61.541  7.88    39.057  0    99.85  ? 35   LYS A HE3    1 
ATOM   520   H HZ1    . LYS A 1 39  ? -63.21   8.601   40.571  0    102.99 ? 35   LYS A HZ1    1 
ATOM   521   H HZ2    . LYS A 1 39  ? -62.294  9.906   40.129  0    103.03 ? 35   LYS A HZ2    1 
ATOM   522   H HZ3    . LYS A 1 39  ? -63.804  9.706   39.496  0    100.92 ? 35   LYS A HZ3    1 
ATOM   523   N N      . ASN A 1 40  ? -59.346  9.021   31.855  1    51.4   ? 36   ASN A N      1 
ATOM   524   C CA     . ASN A 1 40  ? -58.777  9.699   30.691  1    51.2   ? 36   ASN A CA     1 
ATOM   525   C C      . ASN A 1 40  ? -57.242  9.907   30.857  1    52.79  ? 36   ASN A C      1 
ATOM   526   O O      . ASN A 1 40  ? -56.483  8.984   30.577  1    53.09  ? 36   ASN A O      1 
ATOM   527   C CB     . ASN A 1 40  ? -59.574  10.996  30.356  1    51.31  ? 36   ASN A CB     1 
ATOM   528   C CG     . ASN A 1 40  ? -59.064  11.709  29.127  1    50.51  ? 36   ASN A CG     1 
ATOM   529   O OD1    . ASN A 1 40  ? -58.715  11.085  28.114  1    49.8   ? 36   ASN A OD1    1 
ATOM   530   N ND2    . ASN A 1 40  ? -59.001  13.031  29.176  1    50.82  ? 36   ASN A ND2    1 
ATOM   531   H H      . ASN A 1 40  ? -59.663  8.084   31.626  0    82.35  ? 36   ASN A H      1 
ATOM   532   H HA     . ASN A 1 40  ? -58.903  9.034   29.838  0    81.42  ? 36   ASN A HA     1 
ATOM   533   H HB2    . ASN A 1 40  ? -60.614  10.73   30.173  0    81.41  ? 36   ASN A HB2    1 
ATOM   534   H HB3    . ASN A 1 40  ? -59.516  11.679  31.202  0    83.62  ? 36   ASN A HB3    1 
ATOM   535   H HD21   . ASN A 1 40  ? -58.666  13.546  28.368  0    81.73  ? 36   ASN A HD21   1 
ATOM   536   H HD22   . ASN A 1 40  ? -59.294  13.538  30.005  0    82.69  ? 36   ASN A HD22   1 
ATOM   537   N N      . THR A 1 41  ? -56.797  11.06   31.332  1    53.92  ? 37   THR A N      1 
ATOM   538   C CA     . THR A 1 41  ? -55.384  11.346  31.527  1    55.82  ? 37   THR A CA     1 
ATOM   539   C C      . THR A 1 41  ? -54.911  11.052  32.964  1    57.6   ? 37   THR A C      1 
ATOM   540   O O      . THR A 1 41  ? -53.713  10.916  33.205  1    58.98  ? 37   THR A O      1 
ATOM   541   C CB     . THR A 1 41  ? -55.095  12.785  31.11   1    56.75  ? 37   THR A CB     1 
ATOM   542   O OG1    . THR A 1 41  ? -53.702  13.025  31.265  1    58.89  ? 37   THR A OG1    1 
ATOM   543   C CG2    . THR A 1 41  ? -55.903  13.834  31.905  1    57.12  ? 37   THR A CG2    1 
ATOM   544   H H      . THR A 1 41  ? -57.412  11.812  31.625  0    88.46  ? 37   THR A H      1 
ATOM   545   H HA     . THR A 1 41  ? -54.793  10.711  30.87   0    92.63  ? 37   THR A HA     1 
ATOM   546   H HB     . THR A 1 41  ? -55.352  12.901  30.058  0    93.54  ? 37   THR A HB     1 
ATOM   547   H HG1    . THR A 1 41  ? -53.186  12.466  30.628  0    99.13  ? 37   THR A HG1    1 
ATOM   548   H HG21   . THR A 1 41  ? -55.408  14.802  31.839  0    96.85  ? 37   THR A HG21   1 
ATOM   549   H HG22   . THR A 1 41  ? -56.899  13.932  31.477  0    94.25  ? 37   THR A HG22   1 
ATOM   550   H HG23   . THR A 1 41  ? -55.995  13.564  32.955  0    96.47  ? 37   THR A HG23   1 
ATOM   551   N N      . ARG A 1 42  ? -55.834  10.974  33.91   1    57.87  ? 38   ARG A N      1 
ATOM   552   C CA     . ARG A 1 42  ? -55.519  10.703  35.3    1    59.89  ? 38   ARG A CA     1 
ATOM   553   C C      . ARG A 1 42  ? -55.499  9.17    35.566  1    59.93  ? 38   ARG A C      1 
ATOM   554   O O      . ARG A 1 42  ? -56.13   8.396   34.839  1    58.04  ? 38   ARG A O      1 
ATOM   555   C CB     . ARG A 1 42  ? -56.59   11.378  36.182  1    60.13  ? 38   ARG A CB     1 
ATOM   556   C CG     . ARG A 1 42  ? -56.91   12.856  35.846  1    60.2   ? 38   ARG A CG     1 
ATOM   557   C CD     . ARG A 1 42  ? -55.702  13.758  35.832  1    62.3   ? 38   ARG A CD     1 
ATOM   558   N NE     . ARG A 1 42  ? -54.981  13.708  37.096  1    64.73  ? 38   ARG A NE     1 
ATOM   559   C CZ     . ARG A 1 42  ? -53.85   14.352  37.343  1    67.08  ? 38   ARG A CZ     1 
ATOM   560   N NH1    . ARG A 1 42  ? -53.259  14.241  38.527  1    69.43  ? 38   ARG A NH1    1 
ATOM   561   N NH2    . ARG A 1 42  ? -53.294  15.119  36.406  1    67.28  ? 38   ARG A NH2    1 
ATOM   562   H H      . ARG A 1 42  ? -56.829  11.095  33.752  0    96.22  ? 38   ARG A H      1 
ATOM   563   H HA     . ARG A 1 42  ? -54.55   11.122  35.569  0    103.54 ? 38   ARG A HA     1 
ATOM   564   H HB2    . ARG A 1 42  ? -57.52   10.824  36.057  0    101.18 ? 38   ARG A HB2    1 
ATOM   565   H HB3    . ARG A 1 42  ? -56.278  11.32   37.223  0    104.38 ? 38   ARG A HB3    1 
ATOM   566   H HG2    . ARG A 1 42  ? -57.38   12.914  34.866  0    100.9  ? 38   ARG A HG2    1 
ATOM   567   H HG3    . ARG A 1 42  ? -57.595  13.242  36.6    0    103.24 ? 38   ARG A HG3    1 
ATOM   568   H HD2    . ARG A 1 42  ? -55.012  13.453  35.046  0    106.55 ? 38   ARG A HD2    1 
ATOM   569   H HD3    . ARG A 1 42  ? -56.022  14.786  35.668  0    107.15 ? 38   ARG A HD3    1 
ATOM   570   H HE     . ARG A 1 42  ? -55.377  13.155  37.851  0    112.92 ? 38   ARG A HE     1 
ATOM   571   H HH11   . ARG A 1 42  ? -53.676  13.667  39.255  0    123.27 ? 38   ARG A HH11   1 
ATOM   572   H HH12   . ARG A 1 42  ? -52.393  14.733  38.719  0    124.84 ? 38   ARG A HH12   1 
ATOM   573   H HH21   . ARG A 1 42  ? -53.705  15.225  35.485  0    115.96 ? 38   ARG A HH21   1 
ATOM   574   H HH22   . ARG A 1 42  ? -52.421  15.598  36.608  0    119.55 ? 38   ARG A HH22   1 
ATOM   575   N N      . LEU A 1 43  ? -54.788  8.756   36.629  1    62.27  ? 39   LEU A N      1 
ATOM   576   C CA     . LEU A 1 43  ? -54.7    7.367   37.086  1    62.98  ? 39   LEU A CA     1 
ATOM   577   C C      . LEU A 1 43  ? -54.805  7.374   38.611  1    65.33  ? 39   LEU A C      1 
ATOM   578   O O      . LEU A 1 43  ? -53.916  7.901   39.287  1    67.49  ? 39   LEU A O      1 
ATOM   579   C CB     . LEU A 1 43  ? -53.368  6.719   36.657  1    64.05  ? 39   LEU A CB     1 
ATOM   580   C CG     . LEU A 1 43  ? -52.991  5.381   37.343  1    65.57  ? 39   LEU A CG     1 
ATOM   581   C CD1    . LEU A 1 43  ? -54.081  4.338   37.149  1    63.95  ? 39   LEU A CD1    1 
ATOM   582   C CD2    . LEU A 1 43  ? -51.66   4.865   36.842  1    66.45  ? 39   LEU A CD2    1 
ATOM   583   H H      . LEU A 1 43  ? -54.249  9.391   37.21   0    108.78 ? 39   LEU A H      1 
ATOM   584   H HA     . LEU A 1 43  ? -55.518  6.779   36.675  0    107    ? 39   LEU A HA     1 
ATOM   585   H HB2    . LEU A 1 43  ? -53.415  6.529   35.586  0    109.23 ? 39   LEU A HB2    1 
ATOM   586   H HB3    . LEU A 1 43  ? -52.565  7.425   36.861  0    112.4  ? 39   LEU A HB3    1 
ATOM   587   H HG     . LEU A 1 43  ? -52.872  5.539   38.413  0    116.32 ? 39   LEU A HG     1 
ATOM   588   H HD11   . LEU A 1 43  ? -53.718  3.376   37.508  0    112.07 ? 39   LEU A HD11   1 
ATOM   589   H HD12   . LEU A 1 43  ? -54.962  4.63    37.718  0    110.41 ? 39   LEU A HD12   1 
ATOM   590   H HD13   . LEU A 1 43  ? -54.327  4.274   36.09   0    108.85 ? 39   LEU A HD13   1 
ATOM   591   H HD21   . LEU A 1 43  ? -51.414  3.943   37.365  0    117.73 ? 39   LEU A HD21   1 
ATOM   592   H HD22   . LEU A 1 43  ? -51.734  4.679   35.772  0    114.58 ? 39   LEU A HD22   1 
ATOM   593   H HD23   . LEU A 1 43  ? -50.896  5.618   37.035  0    117.77 ? 39   LEU A HD23   1 
ATOM   594   N N      . GLU A 1 44  ? -55.871  6.765   39.145  1    65.13  ? 40   GLU A N      1 
ATOM   595   C CA     . GLU A 1 44  ? -56.107  6.66    40.585  1    67.41  ? 40   GLU A CA     1 
ATOM   596   C C      . GLU A 1 44  ? -55.717  5.259   41.06   1    68.83  ? 40   GLU A C      1 
ATOM   597   O O      . GLU A 1 44  ? -56.053  4.285   40.389  1    67.33  ? 40   GLU A O      1 
ATOM   598   C CB     . GLU A 1 44  ? -57.596  6.899   40.903  1    66.3   ? 40   GLU A CB     1 
ATOM   599   C CG     . GLU A 1 44  ? -58.196  8.136   40.261  1    64.75  ? 40   GLU A CG     1 
ATOM   600   C CD     . GLU A 1 44  ? -59.55   8.546   40.812  1    64.22  ? 40   GLU A CD     1 
ATOM   601   O OE1    . GLU A 1 44  ? -60.389  7.651   41.073  1    63.78  ? 40   GLU A OE1    1 
ATOM   602   O OE2    . GLU A 1 44  ? -59.777  9.77    40.966  1    64.45  ? 40   GLU A OE2    1 
ATOM   603   H H      . GLU A 1 44  ? -56.612  6.341   38.596  0    111.53 ? 40   GLU A H      1 
ATOM   604   H HA     . GLU A 1 44  ? -55.519  7.396   41.13   0    120.03 ? 40   GLU A HA     1 
ATOM   605   H HB2    . GLU A 1 44  ? -58.167  6.04    40.554  0    114.61 ? 40   GLU A HB2    1 
ATOM   606   H HB3    . GLU A 1 44  ? -57.706  7.003   41.981  0    117.82 ? 40   GLU A HB3    1 
ATOM   607   H HG2    . GLU A 1 44  ? -57.513  8.972   40.398  0    113.63 ? 40   GLU A HG2    1 
ATOM   608   H HG3    . GLU A 1 44  ? -58.325  7.948   39.195  0    110.45 ? 40   GLU A HG3    1 
ATOM   609   N N      . ILE A 1 45  ? -55.032  5.156   42.213  1    71.94  ? 41   ILE A N      1 
ATOM   610   C CA     . ILE A 1 45  ? -54.626  3.888   42.817  1    73.93  ? 41   ILE A CA     1 
ATOM   611   C C      . ILE A 1 45  ? -55.3    3.82    44.182  1    76.09  ? 41   ILE A C      1 
ATOM   612   O O      . ILE A 1 45  ? -55.198  4.766   44.964  1    78.07  ? 41   ILE A O      1 
ATOM   613   C CB     . ILE A 1 45  ? -53.088  3.774   42.969  1    76.3   ? 41   ILE A CB     1 
ATOM   614   C CG1    . ILE A 1 45  ? -52.356  4.04    41.639  1    74.51  ? 41   ILE A CG1    1 
ATOM   615   C CG2    . ILE A 1 45  ? -52.709  2.393   43.5    1    78.39  ? 41   ILE A CG2    1 
ATOM   616   C CD1    . ILE A 1 45  ? -50.953  4.574   41.772  1    76.8   ? 41   ILE A CD1    1 
ATOM   617   H H      . ILE A 1 45  ? -54.74   5.957   42.763  0    129.63 ? 41   ILE A H      1 
ATOM   618   H HA     . ILE A 1 45  ? -54.973  3.052   42.211  0    131.11 ? 41   ILE A HA     1 
ATOM   619   H HB     . ILE A 1 45  ? -52.781  4.514   43.706  0    139.76 ? 41   ILE A HB     1 
ATOM   620   H HG12   . ILE A 1 45  ? -52.276  3.098   41.101  0    133.37 ? 41   ILE A HG12   1 
ATOM   621   H HG13   . ILE A 1 45  ? -52.912  4.759   41.039  0    132    ? 41   ILE A HG13   1 
ATOM   622   H HG21   . ILE A 1 45  ? -51.631  2.262   43.42   0    144.19 ? 41   ILE A HG21   1 
ATOM   623   H HG22   . ILE A 1 45  ? -53      2.313   44.546  0    144.25 ? 41   ILE A HG22   1 
ATOM   624   H HG23   . ILE A 1 45  ? -53.213  1.63    42.911  0    140.8  ? 41   ILE A HG23   1 
ATOM   625   H HD11   . ILE A 1 45  ? -50.47   4.54    40.797  0    137.99 ? 41   ILE A HD11   1 
ATOM   626   H HD12   . ILE A 1 45  ? -51.002  5.607   42.113  0    139.82 ? 41   ILE A HD12   1 
ATOM   627   H HD13   . ILE A 1 45  ? -50.389  3.973   42.484  0    141.61 ? 41   ILE A HD13   1 
ATOM   628   N N      . TYR A 1 46  ? -55.994  2.711   44.452  1    75.86  ? 42   TYR A N      1 
ATOM   629   C CA     . TYR A 1 46  ? -56.686  2.489   45.719  1    77.97  ? 42   TYR A CA     1 
ATOM   630   C C      . TYR A 1 46  ? -56.303  1.132   46.313  1    80.17  ? 42   TYR A C      1 
ATOM   631   O O      . TYR A 1 46  ? -55.899  0.226   45.58   1    79.21  ? 42   TYR A O      1 
ATOM   632   C CB     . TYR A 1 46  ? -58.215  2.495   45.521  1    75.87  ? 42   TYR A CB     1 
ATOM   633   C CG     . TYR A 1 46  ? -58.813  3.805   45.065  1    73.81  ? 42   TYR A CG     1 
ATOM   634   C CD1    . TYR A 1 46  ? -59.313  4.716   45.983  1    75.22  ? 42   TYR A CD1    1 
ATOM   635   C CD2    . TYR A 1 46  ? -59.025  4.061   43.719  1    70.64  ? 42   TYR A CD2    1 
ATOM   636   C CE1    . TYR A 1 46  ? -59.888  5.91    45.573  1    73.58  ? 42   TYR A CE1    1 
ATOM   637   C CE2    . TYR A 1 46  ? -59.635  5.233   43.296  1    68.97  ? 42   TYR A CE2    1 
ATOM   638   C CZ     . TYR A 1 46  ? -60.047  6.167   44.227  1    70.46  ? 42   TYR A CZ     1 
ATOM   639   O OH     . TYR A 1 46  ? -60.649  7.336   43.83   1    69.06  ? 42   TYR A OH     1 
ATOM   640   H H      . TYR A 1 46  ? -56.099  1.934   43.807  0    135.37 ? 42   TYR A H      1 
ATOM   641   H HA     . TYR A 1 46  ? -56.433  3.259   46.447  0    143.12 ? 42   TYR A HA     1 
ATOM   642   H HB2    . TYR A 1 46  ? -58.485  1.729   44.795  0    135.09 ? 42   TYR A HB2    1 
ATOM   643   H HB3    . TYR A 1 46  ? -58.659  2.267   46.488  0    138.54 ? 42   TYR A HB3    1 
ATOM   644   H HD1    . TYR A 1 46  ? -59.172  4.537   47.035  0    137.98 ? 42   TYR A HD1    1 
ATOM   645   H HD2    . TYR A 1 46  ? -58.688  3.347   42.987  0    124.29 ? 42   TYR A HD2    1 
ATOM   646   H HE1    . TYR A 1 46  ? -60.228  6.626   46.303  0    133.21 ? 42   TYR A HE1    1 
ATOM   647   H HE2    . TYR A 1 46  ? -59.735  5.43    42.243  0    119.51 ? 42   TYR A HE2    1 
ATOM   648   H HH     . TYR A 1 46  ? -60.605  7.442   42.844  0    119.96 ? 42   TYR A HH     1 
ATOM   649   N N      . VAL A 1 47  ? -56.483  0.986   47.638  1    83.25  ? 43   VAL A N      1 
ATOM   650   C CA     . VAL A 1 47  ? -56.284  -0.265  48.351  1    85.85  ? 43   VAL A CA     1 
ATOM   651   C C      . VAL A 1 47  ? -57.667  -0.692  48.848  1    85.82  ? 43   VAL A C      1 
ATOM   652   O O      . VAL A 1 47  ? -58.375  0.091   49.48   1    86.62  ? 43   VAL A O      1 
ATOM   653   C CB     . VAL A 1 47  ? -55.246  -0.141  49.495  1    90.02  ? 43   VAL A CB     1 
ATOM   654   C CG1    . VAL A 1 47  ? -55.357  -1.308  50.473  1    93.21  ? 43   VAL A CG1    1 
ATOM   655   C CG2    . VAL A 1 47  ? -53.829  -0.053  48.936  1    90.58  ? 43   VAL A CG2    1 
ATOM   656   H H      . VAL A 1 47  ? -56.777  1.744   48.246  0    154.12 ? 43   VAL A H      1 
ATOM   657   H HA     . VAL A 1 47  ? -55.942  -1.033  47.659  0    157.99 ? 43   VAL A HA     1 
ATOM   658   H HB     . VAL A 1 47  ? -55.439  0.774   50.052  0    168.84 ? 43   VAL A HB     1 
ATOM   659   H HG11   . VAL A 1 47  ? -54.438  -1.36   51.055  0    178.02 ? 43   VAL A HG11   1 
ATOM   660   H HG12   . VAL A 1 47  ? -56.195  -1.14   51.149  0    175.45 ? 43   VAL A HG12   1 
ATOM   661   H HG13   . VAL A 1 47  ? -55.496  -2.235  49.919  0    174.08 ? 43   VAL A HG13   1 
ATOM   662   H HG21   . VAL A 1 47  ? -53.137  0.155   49.751  0    172.46 ? 43   VAL A HG21   1 
ATOM   663   H HG22   . VAL A 1 47  ? -53.574  -1.003  48.467  0    169.12 ? 43   VAL A HG22   1 
ATOM   664   H HG23   . VAL A 1 47  ? -53.788  0.747   48.198  0    167.19 ? 43   VAL A HG23   1 
ATOM   665   N N      . VAL A 1 48  ? -58.051  -1.931  48.53   1    85.16  ? 44   VAL A N      1 
ATOM   666   C CA     . VAL A 1 48  ? -59.348  -2.484  48.896  1    85.23  ? 44   VAL A CA     1 
ATOM   667   C C      . VAL A 1 48  ? -59.353  -2.834  50.377  1    89.35  ? 44   VAL A C      1 
ATOM   668   O O      . VAL A 1 48  ? -58.464  -3.553  50.834  1    92.26  ? 44   VAL A O      1 
ATOM   669   C CB     . VAL A 1 48  ? -59.671  -3.729  48.039  1    84.05  ? 44   VAL A CB     1 
ATOM   670   C CG1    . VAL A 1 48  ? -60.961  -4.397  48.508  1    84.54  ? 44   VAL A CG1    1 
ATOM   671   C CG2    . VAL A 1 48  ? -59.745  -3.368  46.558  1    80.2   ? 44   VAL A CG2    1 
ATOM   672   H H      . VAL A 1 48  ? -57.465  -2.588  48.024  0    157.54 ? 44   VAL A H      1 
ATOM   673   H HA     . VAL A 1 48  ? -60.119  -1.741  48.701  0    155.68 ? 44   VAL A HA     1 
ATOM   674   H HB     . VAL A 1 48  ? -58.868  -4.454  48.162  0    156.55 ? 44   VAL A HB     1 
ATOM   675   H HG11   . VAL A 1 48  ? -61.186  -5.23   47.845  0    154.62 ? 44   VAL A HG11   1 
ATOM   676   H HG12   . VAL A 1 48  ? -60.84   -4.795  49.514  0    158.67 ? 44   VAL A HG12   1 
ATOM   677   H HG13   . VAL A 1 48  ? -61.771  -3.669  48.488  0    154.24 ? 44   VAL A HG13   1 
ATOM   678   H HG21   . VAL A 1 48  ? -60.129  -4.22   45.999  0    145.29 ? 44   VAL A HG21   1 
ATOM   679   H HG22   . VAL A 1 48  ? -60.396  -2.505  46.434  0    144.49 ? 44   VAL A HG22   1 
ATOM   680   H HG23   . VAL A 1 48  ? -58.744  -3.123  46.205  0    146.28 ? 44   VAL A HG23   1 
ATOM   681   N N      . THR A 1 49  ? -60.371  -2.354  51.111  1    89.76  ? 45   THR A N      1 
ATOM   682   C CA     . THR A 1 49  ? -60.543  -2.615  52.543  1    93.79  ? 45   THR A CA     1 
ATOM   683   C C      . THR A 1 49  ? -61.951  -3.187  52.805  1    93.72  ? 45   THR A C      1 
ATOM   684   O O      . THR A 1 49  ? -62.811  -3.167  51.91   1    90.46  ? 45   THR A O      1 
ATOM   685   C CB     . THR A 1 49  ? -60.3    -1.322  53.346  1    95.29  ? 45   THR A CB     1 
ATOM   686   O OG1    . THR A 1 49  ? -61.289  -0.348  53.001  1    92.38  ? 45   THR A OG1    1 
ATOM   687   C CG2    . THR A 1 49  ? -58.912  -0.758  53.13   1    96.05  ? 45   THR A CG2    1 
ATOM   688   H H      . THR A 1 49  ? -61.11   -1.765  50.739  0    165.45 ? 45   THR A H      1 
ATOM   689   H HA     . THR A 1 49  ? -59.824  -3.358  52.884  0    178.53 ? 45   THR A HA     1 
ATOM   690   H HB     . THR A 1 49  ? -60.398  -1.554  54.406  0    183.17 ? 45   THR A HB     1 
ATOM   691   H HG1    . THR A 1 49  ? -61.133  0.001   52.085  0    171.3  ? 45   THR A HG1    1 
ATOM   692   H HG21   . THR A 1 49  ? -58.757  0.107   53.773  0    182.63 ? 45   THR A HG21   1 
ATOM   693   H HG22   . THR A 1 49  ? -58.165  -1.513  53.371  0    183.54 ? 45   THR A HG22   1 
ATOM   694   H HG23   . THR A 1 49  ? -58.782  -0.452  52.093  0    178.38 ? 45   THR A HG23   1 
ATOM   695   N N      . ALA A 1 50  ? -62.177  -3.72   54.024  1    97.4   ? 46   ALA A N      1 
ATOM   696   C CA     . ALA A 1 50  ? -63.476  -4.261  54.405  1    97.78  ? 46   ALA A CA     1 
ATOM   697   C C      . ALA A 1 50  ? -64.552  -3.167  54.363  1    96.06  ? 46   ALA A C      1 
ATOM   698   O O      . ALA A 1 50  ? -65.677  -3.435  53.919  1    93.94  ? 46   ALA A O      1 
ATOM   699   C CB     . ALA A 1 50  ? -63.397  -4.865  55.796  1    102.47 ? 46   ALA A CB     1 
ATOM   700   H H      . ALA A 1 50  ? -61.476  -3.79   54.754  0    187.01 ? 46   ALA A H      1 
ATOM   701   H HA     . ALA A 1 50  ? -63.76   -5.045  53.705  0    183.35 ? 46   ALA A HA     1 
ATOM   702   H HB1    . ALA A 1 50  ? -64.374  -5.264  56.064  0    195.75 ? 46   ALA A HB1    1 
ATOM   703   H HB2    . ALA A 1 50  ? -62.661  -5.668  55.789  0    196.59 ? 46   ALA A HB2    1 
ATOM   704   H HB3    . ALA A 1 50  ? -63.102  -4.094  56.506  0    197.27 ? 46   ALA A HB3    1 
ATOM   705   N N      . GLU A 1 51  ? -64.194  -1.93   54.785  1    97.09  ? 47   GLU A N      1 
ATOM   706   C CA     . GLU A 1 51  ? -65.123  -0.798  54.775  1    95.93  ? 47   GLU A CA     1 
ATOM   707   C C      . GLU A 1 51  ? -65.499  -0.417  53.325  1    91.34  ? 47   GLU A C      1 
ATOM   708   O O      . GLU A 1 51  ? -66.683  -0.315  52.999  1    89.84  ? 47   GLU A O      1 
ATOM   709   C CB     . GLU A 1 51  ? -64.532  0.424   55.513  1    98.17  ? 47   GLU A CB     1 
ATOM   710   C CG     . GLU A 1 51  ? -64.274  0.252   57.002  1    103.02 ? 47   GLU A CG     1 
ATOM   711   C CD     . GLU A 1 51  ? -63.028  -0.526  57.387  1    105.22 ? 47   GLU A CD     1 
ATOM   712   O OE1    . GLU A 1 51  ? -62.921  -0.919  58.57   1    109.45 ? 47   GLU A OE1    1 
ATOM   713   O OE2    . GLU A 1 51  ? -62.164  -0.757  56.509  1    102.9  ? 47   GLU A OE2    1 
ATOM   714   H H      . GLU A 1 51  ? -63.275  -1.688  55.144  0    184.98 ? 47   GLU A H      1 
ATOM   715   H HA     . GLU A 1 51  ? -66.038  -1.097  55.283  0    182.08 ? 47   GLU A HA     1 
ATOM   716   H HB2    . GLU A 1 51  ? -63.593  0.678   55.027  0    184.95 ? 47   GLU A HB2    1 
ATOM   717   H HB3    . GLU A 1 51  ? -65.232  1.245   55.374  0    184.96 ? 47   GLU A HB3    1 
ATOM   718   H HG2    . GLU A 1 51  ? -64.185  1.244   57.444  0    197.88 ? 47   GLU A HG2    1 
ATOM   719   H HG3    . GLU A 1 51  ? -65.122  -0.263  57.449  0    197.41 ? 47   GLU A HG3    1 
ATOM   720   N N      . GLY A 1 52  ? -64.498  -0.237  52.474  1    89.43  ? 48   GLY A N      1 
ATOM   721   C CA     . GLY A 1 52  ? -64.725  0.12    51.084  1    85.32  ? 48   GLY A CA     1 
ATOM   722   C C      . GLY A 1 52  ? -63.422  0.227   50.317  1    84.08  ? 48   GLY A C      1 
ATOM   723   O O      . GLY A 1 52  ? -62.719  -0.775  50.151  1    84.8   ? 48   GLY A O      1 
ATOM   724   H H      . GLY A 1 52  ? -63.518  -0.326  52.722  0    167.97 ? 48   GLY A H      1 
ATOM   725   H HA2    . GLY A 1 52  ? -65.348  -0.639  50.614  0    156.23 ? 48   GLY A HA2    1 
ATOM   726   H HA3    . GLY A 1 52  ? -65.254  1.071   51.039  0    156.87 ? 48   GLY A HA3    1 
ATOM   727   N N      . LEU A 1 53  ? -63.084  1.447   49.861  1    82.41  ? 49   LEU A N      1 
ATOM   728   C CA     . LEU A 1 53  ? -61.852  1.727   49.123  1    81.3   ? 49   LEU A CA     1 
ATOM   729   C C      . LEU A 1 53  ? -61.062  2.78    49.858  1    83.38  ? 49   LEU A C      1 
ATOM   730   O O      . LEU A 1 53  ? -61.636  3.8     50.227  1    83.48  ? 49   LEU A O      1 
ATOM   731   C CB     . LEU A 1 53  ? -62.177  2.288   47.734  1    77.35  ? 49   LEU A CB     1 
ATOM   732   C CG     . LEU A 1 53  ? -62.572  1.297   46.662  1    75.27  ? 49   LEU A CG     1 
ATOM   733   C CD1    . LEU A 1 53  ? -63.104  2.025   45.446  1    71.6   ? 49   LEU A CD1    1 
ATOM   734   C CD2    . LEU A 1 53  ? -61.398  0.405   46.259  1    76.49  ? 49   LEU A CD2    1 
ATOM   735   H H      . LEU A 1 53  ? -63.657  2.275   49.996  0    150.27 ? 49   LEU A H      1 
ATOM   736   H HA     . LEU A 1 53  ? -61.234  0.836   49.034  0    149.29 ? 49   LEU A HA     1 
ATOM   737   H HB2    . LEU A 1 53  ? -63.002  2.993   47.837  0    139.32 ? 49   LEU A HB2    1 
ATOM   738   H HB3    . LEU A 1 53  ? -61.3    2.82    47.367  0    139.62 ? 49   LEU A HB3    1 
ATOM   739   H HG     . LEU A 1 53  ? -63.369  0.66    47.043  0    135.87 ? 49   LEU A HG     1 
ATOM   740   H HD11   . LEU A 1 53  ? -63.43   1.294   44.707  0    125.9  ? 49   LEU A HD11   1 
ATOM   741   H HD12   . LEU A 1 53  ? -63.943  2.657   45.734  0    127.2  ? 49   LEU A HD12   1 
ATOM   742   H HD13   . LEU A 1 53  ? -62.307  2.637   45.027  0    126.67 ? 49   LEU A HD13   1 
ATOM   743   H HD21   . LEU A 1 53  ? -61.665  -0.14   45.356  0    135.06 ? 49   LEU A HD21   1 
ATOM   744   H HD22   . LEU A 1 53  ? -60.524  1.022   46.063  0    137.36 ? 49   LEU A HD22   1 
ATOM   745   H HD23   . LEU A 1 53  ? -61.188  -0.308  47.054  0    139.41 ? 49   LEU A HD23   1 
ATOM   746   N N      . ARG A 1 54  ? -59.746  2.574   50.041  1    85.16  ? 50   ARG A N      1 
ATOM   747   C CA     . ARG A 1 54  ? -58.896  3.579   50.673  1    87.43  ? 50   ARG A CA     1 
ATOM   748   C C      . ARG A 1 54  ? -57.937  4.147   49.618  1    85.51  ? 50   ARG A C      1 
ATOM   749   O O      . ARG A 1 54  ? -57.161  3.386   49.043  1    84.94  ? 50   ARG A O      1 
ATOM   750   C CB     . ARG A 1 54  ? -58.088  2.999   51.841  1    91.61  ? 50   ARG A CB     1 
ATOM   751   C CG     . ARG A 1 54  ? -57.493  4.1     52.716  1    94.74  ? 50   ARG A CG     1 
ATOM   752   C CD     . ARG A 1 54  ? -56.551  3.588   53.77   1    98.99  ? 50   ARG A CD     1 
ATOM   753   N NE     . ARG A 1 54  ? -55.254  3.219   53.195  1    99.21  ? 50   ARG A NE     1 
ATOM   754   C CZ     . ARG A 1 54  ? -54.767  1.985   53.033  1    99.64  ? 50   ARG A CZ     1 
ATOM   755   N NH1    . ARG A 1 54  ? -55.471  0.92    53.417  1    99.91  ? 50   ARG A NH1    1 
ATOM   756   N NH2    . ARG A 1 54  ? -53.566  1.806   52.499  1    100.04 ? 50   ARG A NH2    1 
ATOM   757   H H      . ARG A 1 54  ? -59.244  1.736   49.764  0    157.34 ? 50   ARG A H      1 
ATOM   758   H HA     . ARG A 1 54  ? -59.531  4.37    51.068  0    162.4  ? 50   ARG A HA     1 
ATOM   759   H HB2    . ARG A 1 54  ? -58.747  2.393   52.46   0    172.44 ? 50   ARG A HB2    1 
ATOM   760   H HB3    . ARG A 1 54  ? -57.272  2.39    51.455  0    171.46 ? 50   ARG A HB3    1 
ATOM   761   H HG2    . ARG A 1 54  ? -56.936  4.803   52.098  0    176.91 ? 50   ARG A HG2    1 
ATOM   762   H HG3    . ARG A 1 54  ? -58.307  4.621   53.218  0    178.48 ? 50   ARG A HG3    1 
ATOM   763   H HD2    . ARG A 1 54  ? -56.358  4.414   54.453  0    189.59 ? 50   ARG A HD2    1 
ATOM   764   H HD3    . ARG A 1 54  ? -57.03   2.788   54.33   0    188.73 ? 50   ARG A HD3    1 
ATOM   765   H HE     . ARG A 1 54  ? -54.667  3.99    52.893  0    187.86 ? 50   ARG A HE     1 
ATOM   766   H HH11   . ARG A 1 54  ? -56.401  0.963   53.818  0    189.73 ? 50   ARG A HH11   1 
ATOM   767   H HH12   . ARG A 1 54  ? -55.071  -0.001  53.272  0    190.48 ? 50   ARG A HH12   1 
ATOM   768   H HH21   . ARG A 1 54  ? -53.009  2.606   52.214  0    189.89 ? 50   ARG A HH21   1 
ATOM   769   H HH22   . ARG A 1 54  ? -53.189  0.872   52.371  0    190.69 ? 50   ARG A HH22   1 
ATOM   770   N N      . PRO A 1 55  ? -57.961  5.465   49.346  1    84.78  ? 51   PRO A N      1 
ATOM   771   C CA     . PRO A 1 55  ? -57.045  6.016   48.336  1    83.12  ? 51   PRO A CA     1 
ATOM   772   C C      . PRO A 1 55  ? -55.592  6       48.8    1    86.01  ? 51   PRO A C      1 
ATOM   773   O O      . PRO A 1 55  ? -55.349  6.201   49.991  1    89.06  ? 51   PRO A O      1 
ATOM   774   C CB     . PRO A 1 55  ? -57.57   7.438   48.135  1    82.14  ? 51   PRO A CB     1 
ATOM   775   C CG     . PRO A 1 55  ? -58.209  7.788   49.422  1    85.03  ? 51   PRO A CG     1 
ATOM   776   C CD     . PRO A 1 55  ? -58.798  6.522   49.95   1    85.74  ? 51   PRO A CD     1 
ATOM   777   H HA     . PRO A 1 55  ? -57.14   5.474   47.397  0    150.55 ? 51   PRO A HA     1 
ATOM   778   H HB2    . PRO A 1 55  ? -56.74   8.113   47.931  0    151.57 ? 51   PRO A HB2    1 
ATOM   779   H HB3    . PRO A 1 55  ? -58.3    7.46    47.327  0    148.26 ? 51   PRO A HB3    1 
ATOM   780   H HG2    . PRO A 1 55  ? -57.456  8.172   50.108  0    159.74 ? 51   PRO A HG2    1 
ATOM   781   H HG3    . PRO A 1 55  ? -58.986  8.532   49.255  0    156.05 ? 51   PRO A HG3    1 
ATOM   782   H HD2    . PRO A 1 55  ? -58.71   6.51    51.036  0    161.46 ? 51   PRO A HD2    1 
ATOM   783   H HD3    . PRO A 1 55  ? -59.835  6.425   49.633  0    156.71 ? 51   PRO A HD3    1 
ATOM   784   N N      . VAL A 1 56  ? -54.631  5.721   47.882  1    85.21  ? 52   VAL A N      1 
ATOM   785   C CA     . VAL A 1 56  ? -53.198  5.663   48.224  1    87.99  ? 52   VAL A CA     1 
ATOM   786   C C      . VAL A 1 56  ? -52.291  6.498   47.302  1    86.86  ? 52   VAL A C      1 
ATOM   787   O O      . VAL A 1 56  ? -51.177  6.805   47.716  1    89.56  ? 52   VAL A O      1 
ATOM   788   C CB     . VAL A 1 56  ? -52.687  4.212   48.327  1    89.27  ? 52   VAL A CB     1 
ATOM   789   C CG1    . VAL A 1 56  ? -53.515  3.425   49.33   1    90.55  ? 52   VAL A CG1    1 
ATOM   790   C CG2    . VAL A 1 56  ? -52.679  3.52    46.97   1    86.23  ? 52   VAL A CG2    1 
ATOM   791   H H      . VAL A 1 56  ? -54.828  5.517   46.908  0    154.88 ? 52   VAL A H      1 
ATOM   792   H HA     . VAL A 1 56  ? -53.062  6.094   49.215  0    166.35 ? 52   VAL A HA     1 
ATOM   793   H HB     . VAL A 1 56  ? -51.661  4.232   48.692  0    168.96 ? 52   VAL A HB     1 
ATOM   794   H HG11   . VAL A 1 56  ? -53.006  2.487   49.549  0    170.99 ? 52   VAL A HG11   1 
ATOM   795   H HG12   . VAL A 1 56  ? -53.626  4.011   50.241  0    171.56 ? 52   VAL A HG12   1 
ATOM   796   H HG13   . VAL A 1 56  ? -54.494  3.218   48.9    0    166.96 ? 52   VAL A HG13   1 
ATOM   797   H HG21   . VAL A 1 56  ? -52.575  2.448   47.13   0    160.48 ? 52   VAL A HG21   1 
ATOM   798   H HG22   . VAL A 1 56  ? -53.612  3.726   46.448  0    156.94 ? 52   VAL A HG22   1 
ATOM   799   H HG23   . VAL A 1 56  ? -51.835  3.879   46.383  0    159.37 ? 52   VAL A HG23   1 
ATOM   800   N N      . LYS A 1 57  ? -52.715  6.831   46.068  1    83.2   ? 53   LYS A N      1 
ATOM   801   C CA     . LYS A 1 57  ? -51.913  7.683   45.179  1    82.31  ? 53   LYS A CA     1 
ATOM   802   C C      . LYS A 1 57  ? -52.697  8.001   43.901  1    78.42  ? 53   LYS A C      1 
ATOM   803   O O      . LYS A 1 57  ? -53.478  7.169   43.447  1    76.3   ? 53   LYS A O      1 
ATOM   804   C CB     . LYS A 1 57  ? -50.577  6.983   44.842  1    83.56  ? 53   LYS A CB     1 
ATOM   805   C CG     . LYS A 1 57  ? -49.632  7.738   43.909  1    83.22  ? 53   LYS A CG     1 
ATOM   806   C CD     . LYS A 1 57  ? -49.095  9.015   44.534  1    85.83  ? 53   LYS A CD     1 
ATOM   807   C CE     . LYS A 1 57  ? -47.98   9.616   43.717  1    86.27  ? 53   LYS A CE     1 
ATOM   808   N NZ     . LYS A 1 57  ? -47.291  10.718  44.437  1    89.38  ? 53   LYS A NZ     1 
ATOM   809   H H      . LYS A 1 57  ? -53.551  6.457   45.63   0    151.12 ? 53   LYS A H      1 
ATOM   810   H HA     . LYS A 1 57  ? -51.698  8.624   45.684  0    152.9  ? 53   LYS A HA     1 
ATOM   811   H HB2    . LYS A 1 57  ? -50.032  6.818   45.77   0    157.21 ? 53   LYS A HB2    1 
ATOM   812   H HB3    . LYS A 1 57  ? -50.797  6.021   44.383  0    152.82 ? 53   LYS A HB3    1 
ATOM   813   H HG2    . LYS A 1 57  ? -48.784  7.091   43.69   0    154.3  ? 53   LYS A HG2    1 
ATOM   814   H HG3    . LYS A 1 57  ? -50.142  7.995   42.983  0    150.53 ? 53   LYS A HG3    1 
ATOM   815   H HD2    . LYS A 1 57  ? -49.898  9.747   44.604  0    157.88 ? 53   LYS A HD2    1 
ATOM   816   H HD3    . LYS A 1 57  ? -48.706  8.794   45.527  0    161.84 ? 53   LYS A HD3    1 
ATOM   817   H HE2    . LYS A 1 57  ? -47.239  8.852   43.485  0    160.54 ? 53   LYS A HE2    1 
ATOM   818   H HE3    . LYS A 1 57  ? -48.401  10.025  42.8    0    157.11 ? 53   LYS A HE3    1 
ATOM   819   H HZ1    . LYS A 1 57  ? -46.653  11.194  43.807  0    166.46 ? 53   LYS A HZ1    1 
ATOM   820   H HZ2    . LYS A 1 57  ? -47.974  11.386  44.781  0    166.24 ? 53   LYS A HZ2    1 
ATOM   821   H HZ3    . LYS A 1 57  ? -46.762  10.351  45.222  0    169.25 ? 53   LYS A HZ3    1 
ATOM   822   N N      . GLU A 1 58  ? -52.5    9.202   43.332  1    77.72  ? 54   GLU A N      1 
ATOM   823   C CA     . GLU A 1 58  ? -53.158  9.619   42.087  1    74.35  ? 54   GLU A CA     1 
ATOM   824   C C      . GLU A 1 58  ? -52.124  10.377  41.268  1    74.42  ? 54   GLU A C      1 
ATOM   825   O O      . GLU A 1 58  ? -51.475  11.287  41.797  1    76.66  ? 54   GLU A O      1 
ATOM   826   C CB     . GLU A 1 58  ? -54.391  10.503  42.378  1    73.57  ? 54   GLU A CB     1 
ATOM   827   C CG     . GLU A 1 58  ? -55.443  10.541  41.269  1    70.16  ? 54   GLU A CG     1 
ATOM   828   C CD     . GLU A 1 58  ? -55.478  11.745  40.341  1    68.76  ? 54   GLU A CD     1 
ATOM   829   O OE1    . GLU A 1 58  ? -54.562  12.595  40.42   1    70.03  ? 54   GLU A OE1    1 
ATOM   830   O OE2    . GLU A 1 58  ? -56.431  11.84   39.533  1    66.57  ? 54   GLU A OE2    1 
ATOM   831   H H      . GLU A 1 58  ? -51.882  9.911   43.713  0    142.96 ? 54   GLU A H      1 
ATOM   832   H HA     . GLU A 1 58  ? -53.459  8.739   41.522  0    131.98 ? 54   GLU A HA     1 
ATOM   833   H HB2    . GLU A 1 58  ? -54.882  10.1    43.262  0    133.07 ? 54   GLU A HB2    1 
ATOM   834   H HB3    . GLU A 1 58  ? -54.058  11.518  42.592  0    133.07 ? 54   GLU A HB3    1 
ATOM   835   H HG2    . GLU A 1 58  ? -55.311  9.666   40.635  0    123.16 ? 54   GLU A HG2    1 
ATOM   836   H HG3    . GLU A 1 58  ? -56.418  10.493  41.752  0    124.24 ? 54   GLU A HG3    1 
ATOM   837   N N      . VAL A 1 59  ? -51.949  9.983   39.996  1    72.21  ? 55   VAL A N      1 
ATOM   838   C CA     . VAL A 1 59  ? -50.947  10.572  39.114  1    72.32  ? 55   VAL A CA     1 
ATOM   839   C C      . VAL A 1 59  ? -51.532  10.952  37.789  1    69.3   ? 55   VAL A C      1 
ATOM   840   O O      . VAL A 1 59  ? -52.508  10.364  37.34   1    66.97  ? 55   VAL A O      1 
ATOM   841   C CB     . VAL A 1 59  ? -49.747  9.618   38.895  1    73.72  ? 55   VAL A CB     1 
ATOM   842   C CG1    . VAL A 1 59  ? -49.006  9.37    40.195  1    77.3   ? 55   VAL A CG1    1 
ATOM   843   C CG2    . VAL A 1 59  ? -50.175  8.31    38.238  1    71.81  ? 55   VAL A CG2    1 
ATOM   844   H H      . VAL A 1 59  ? -52.504  9.267   39.541  0    127.18 ? 55   VAL A H      1 
ATOM   845   H HA     . VAL A 1 59  ? -50.556  11.484  39.563  0    130.78 ? 55   VAL A HA     1 
ATOM   846   H HB     . VAL A 1 59  ? -49.046  10.105  38.219  0    132.36 ? 55   VAL A HB     1 
ATOM   847   H HG11   . VAL A 1 59  ? -48.24   8.617   40.018  0    141.16 ? 55   VAL A HG11   1 
ATOM   848   H HG12   . VAL A 1 59  ? -48.539  10.303  40.507  0    141.62 ? 55   VAL A HG12   1 
ATOM   849   H HG13   . VAL A 1 59  ? -49.704  9.028   40.956  0    140.29 ? 55   VAL A HG13   1 
ATOM   850   H HG21   . VAL A 1 59  ? -49.324  7.632   38.224  0    129.49 ? 55   VAL A HG21   1 
ATOM   851   H HG22   . VAL A 1 59  ? -50.991  7.866   38.808  0    127.71 ? 55   VAL A HG22   1 
ATOM   852   H HG23   . VAL A 1 59  ? -50.493  8.498   37.214  0    125.87 ? 55   VAL A HG23   1 
ATOM   853   N N      . GLY A 1 60  ? -50.885  11.909  37.149  1    69.6   ? 56   GLY A N      1 
ATOM   854   C CA     . GLY A 1 60  ? -51.253  12.359  35.824  1    67.24  ? 56   GLY A CA     1 
ATOM   855   C C      . GLY A 1 60  ? -50.206  11.924  34.826  1    67.11  ? 56   GLY A C      1 
ATOM   856   O O      . GLY A 1 60  ? -49.012  11.856  35.151  1    69.41  ? 56   GLY A O      1 
ATOM   857   H H      . GLY A 1 60  ? -50.078  12.401  37.523  0    125.19 ? 56   GLY A H      1 
ATOM   858   H HA2    . GLY A 1 60  ? -52.225  11.968  35.529  0    115.93 ? 56   GLY A HA2    1 
ATOM   859   H HA3    . GLY A 1 60  ? -51.301  13.447  35.816  0    118.39 ? 56   GLY A HA3    1 
ATOM   860   N N      . MET A 1 61  ? -50.652  11.65   33.602  1    64.66  ? 57   MET A N      1 
ATOM   861   C CA     . MET A 1 61  ? -49.79   11.25   32.499  1    64.43  ? 57   MET A CA     1 
ATOM   862   C C      . MET A 1 61  ? -49.858  12.274  31.399  1    63.31  ? 57   MET A C      1 
ATOM   863   O O      . MET A 1 61  ? -50.865  12.975  31.278  1    61.83  ? 57   MET A O      1 
ATOM   864   C CB     . MET A 1 61  ? -50.283  9.932   31.949  1    62.71  ? 57   MET A CB     1 
ATOM   865   C CG     . MET A 1 61  ? -50.202  8.839   32.956  1    64     ? 57   MET A CG     1 
ATOM   866   S SD     . MET A 1 61  ? -49.98   7.233   32.202  1    63.2   ? 57   MET A SD     1 
ATOM   867   C CE     . MET A 1 61  ? -48.327  7.4     31.555  1    65.09  ? 57   MET A CE     1 
ATOM   868   H H      . MET A 1 61  ? -51.628  11.711  33.334  0    110.53 ? 57   MET A H      1 
ATOM   869   H HA     . MET A 1 61  ? -48.755  11.131  32.816  0    113.79 ? 57   MET A HA     1 
ATOM   870   H HB2    . MET A 1 61  ? -51.33   10.044  31.672  0    106.11 ? 57   MET A HB2    1 
ATOM   871   H HB3    . MET A 1 61  ? -49.7    9.695   31.061  0    107.65 ? 57   MET A HB3    1 
ATOM   872   H HG2    . MET A 1 61  ? -49.365  9.019   33.629  0    113    ? 57   MET A HG2    1 
ATOM   873   H HG3    . MET A 1 61  ? -51.132  8.811   33.521  0    110.22 ? 57   MET A HG3    1 
ATOM   874   H HE1    . MET A 1 61  ? -47.883  6.41    31.463  0    113.62 ? 57   MET A HE1    1 
ATOM   875   H HE2    . MET A 1 61  ? -48.378  7.87    30.575  0    112.2  ? 57   MET A HE2    1 
ATOM   876   H HE3    . MET A 1 61  ? -47.731  8.008   32.233  0    115.28 ? 57   MET A HE3    1 
ATOM   877   N N      . TYR A 1 62  ? -48.814  12.349  30.569  1    64.14  ? 58   TYR A N      1 
ATOM   878   C CA     . TYR A 1 62  ? -48.839  13.264  29.434  1    63.32  ? 58   TYR A CA     1 
ATOM   879   C C      . TYR A 1 62  ? -49.385  12.488  28.208  1    61.02  ? 58   TYR A C      1 
ATOM   880   O O      . TYR A 1 62  ? -48.757  12.438  27.159  1    61.22  ? 58   TYR A O      1 
ATOM   881   C CB     . TYR A 1 62  ? -47.454  13.896  29.208  1    65.73  ? 58   TYR A CB     1 
ATOM   882   C CG     . TYR A 1 62  ? -46.975  14.854  30.285  1    68.11  ? 58   TYR A CG     1 
ATOM   883   C CD1    . TYR A 1 62  ? -47.858  15.722  30.921  1    67.72  ? 58   TYR A CD1    1 
ATOM   884   C CD2    . TYR A 1 62  ? -45.619  15.031  30.528  1    70.9   ? 58   TYR A CD2    1 
ATOM   885   C CE1    . TYR A 1 62  ? -47.417  16.631  31.876  1    70.1   ? 58   TYR A CE1    1 
ATOM   886   C CE2    . TYR A 1 62  ? -45.165  15.943  31.475  1    73.29  ? 58   TYR A CE2    1 
ATOM   887   C CZ     . TYR A 1 62  ? -46.069  16.745  32.147  1    72.87  ? 58   TYR A CZ     1 
ATOM   888   O OH     . TYR A 1 62  ? -45.653  17.643  33.099  1    75.41  ? 58   TYR A OH     1 
ATOM   889   H H      . TYR A 1 62  ? -47.964  11.801  30.657  0    112.38 ? 58   TYR A H      1 
ATOM   890   H HA     . TYR A 1 62  ? -49.56   14.061  29.597  0    108.68 ? 58   TYR A HA     1 
ATOM   891   H HB2    . TYR A 1 62  ? -46.713  13.105  29.112  0    115.5  ? 58   TYR A HB2    1 
ATOM   892   H HB3    . TYR A 1 62  ? -47.487  14.479  28.292  0    114.05 ? 58   TYR A HB3    1 
ATOM   893   H HD1    . TYR A 1 62  ? -48.916  15.664  30.755  0    117.14 ? 58   TYR A HD1    1 
ATOM   894   H HD2    . TYR A 1 62  ? -44.905  14.412  30.007  0    126.53 ? 58   TYR A HD2    1 
ATOM   895   H HE1    . TYR A 1 62  ? -48.129  17.248  32.403  0    124.18 ? 58   TYR A HE1    1 
ATOM   896   H HE2    . TYR A 1 62  ? -44.111  16.018  31.677  0    133.63 ? 58   TYR A HE2    1 
ATOM   897   H HH     . TYR A 1 62  ? -44.666  17.752  33.07   0    137.95 ? 58   TYR A HH     1 
ATOM   898   N N      . GLY A 1 63  ? -50.57   11.893  28.368  1    59.05  ? 59   GLY A N      1 
ATOM   899   C CA     . GLY A 1 63  ? -51.218  11.108  27.322  1    57     ? 59   GLY A CA     1 
ATOM   900   C C      . GLY A 1 63  ? -52.576  10.574  27.734  1    55.3   ? 59   GLY A C      1 
ATOM   901   O O      . GLY A 1 63  ? -52.851  10.427  28.93   1    55.95  ? 59   GLY A O      1 
ATOM   902   H H      . GLY A 1 63  ? -51.115  11.945  29.222  0    99.92  ? 59   GLY A H      1 
ATOM   903   H HA2    . GLY A 1 63  ? -51.346  11.722  26.433  0    94.8   ? 59   GLY A HA2    1 
ATOM   904   H HA3    . GLY A 1 63  ? -50.583  10.263  27.059  0    95.93  ? 59   GLY A HA3    1 
ATOM   905   N N      . LYS A 1 64  ? -53.441  10.274  26.748  1    53.33  ? 60   LYS A N      1 
ATOM   906   C CA     . LYS A 1 64  ? -54.761  9.696   27.025  1    51.81  ? 60   LYS A CA     1 
ATOM   907   C C      . LYS A 1 64  ? -54.552  8.21    27.282  1    51.92  ? 60   LYS A C      1 
ATOM   908   O O      . LYS A 1 64  ? -54.03   7.537   26.407  1    51.81  ? 60   LYS A O      1 
ATOM   909   C CB     . LYS A 1 64  ? -55.707  9.889   25.832  1    50.01  ? 60   LYS A CB     1 
ATOM   910   C CG     . LYS A 1 64  ? -56.122  11.333  25.625  1    50     ? 60   LYS A CG     1 
ATOM   911   C CD     . LYS A 1 64  ? -56.915  11.534  24.352  1    48.62  ? 60   LYS A CD     1 
ATOM   912   C CE     . LYS A 1 64  ? -58.318  10.977  24.382  1    47.14  ? 60   LYS A CE     1 
ATOM   913   N NZ     . LYS A 1 64  ? -59.179  11.624  25.406  1    47.19  ? 60   LYS A NZ     1 
ATOM   914   H H      . LYS A 1 64  ? -53.253  10.433  25.764  0    86.96  ? 60   LYS A H      1 
ATOM   915   H HA     . LYS A 1 64  ? -55.212  10.16   27.901  0    84.35  ? 60   LYS A HA     1 
ATOM   916   H HB2    . LYS A 1 64  ? -55.221  9.537   24.923  0    79.94  ? 60   LYS A HB2    1 
ATOM   917   H HB3    . LYS A 1 64  ? -56.605  9.303   26.021  0    79.09  ? 60   LYS A HB3    1 
ATOM   918   H HG2    . LYS A 1 64  ? -56.733  11.655  26.466  0    80.01  ? 60   LYS A HG2    1 
ATOM   919   H HG3    . LYS A 1 64  ? -55.228  11.953  25.558  0    81.17  ? 60   LYS A HG3    1 
ATOM   920   H HD2    . LYS A 1 64  ? -56.99   12.604  24.16   0    77.33  ? 60   LYS A HD2    1 
ATOM   921   H HD3    . LYS A 1 64  ? -56.386  11.054  23.53   0    76.91  ? 60   LYS A HD3    1 
ATOM   922   H HE2    . LYS A 1 64  ? -58.777  11.158  23.411  0    73.01  ? 60   LYS A HE2    1 
ATOM   923   H HE3    . LYS A 1 64  ? -58.292  9.907   24.578  0    73.46  ? 60   LYS A HE3    1 
ATOM   924   H HZ1    . LYS A 1 64  ? -60.154  11.403  25.226  0    73.03  ? 60   LYS A HZ1    1 
ATOM   925   H HZ2    . LYS A 1 64  ? -58.93   11.283  26.328  0    74.4   ? 60   LYS A HZ2    1 
ATOM   926   H HZ3    . LYS A 1 64  ? -59.057  12.632  25.382  0    74.59  ? 60   LYS A HZ3    1 
ATOM   927   N N      . ILE A 1 65  ? -54.932  7.695   28.461  1    52.37  ? 61   ILE A N      1 
ATOM   928   C CA     . ILE A 1 65  ? -54.707  6.281   28.794  1    52.84  ? 61   ILE A CA     1 
ATOM   929   C C      . ILE A 1 65  ? -55.61   5.352   27.97   1    51.13  ? 61   ILE A C      1 
ATOM   930   O O      . ILE A 1 65  ? -56.808  5.281   28.243  1    50.05  ? 61   ILE A O      1 
ATOM   931   C CB     . ILE A 1 65  ? -54.878  6.048   30.319  1    54.04  ? 61   ILE A CB     1 
ATOM   932   C CG1    . ILE A 1 65  ? -53.82   6.855   31.104  1    56.19  ? 61   ILE A CG1    1 
ATOM   933   C CG2    . ILE A 1 65  ? -54.761  4.552   30.653  1    54.67  ? 61   ILE A CG2    1 
ATOM   934   C CD1    . ILE A 1 65  ? -54.181  7.176   32.505  1    57.17  ? 61   ILE A CD1    1 
ATOM   935   H H      . ILE A 1 65  ? -55.403  8.221   29.19   0    85.43  ? 61   ILE A H      1 
ATOM   936   H HA     . ILE A 1 65  ? -53.673  6.035   28.56   0    87.36  ? 61   ILE A HA     1 
ATOM   937   H HB     . ILE A 1 65  ? -55.874  6.386   30.603  0    88.1   ? 61   ILE A HB     1 
ATOM   938   H HG12   . ILE A 1 65  ? -52.904  6.267   31.133  0    94.91  ? 61   ILE A HG12   1 
ATOM   939   H HG13   . ILE A 1 65  ? -53.628  7.801   30.599  0    93.48  ? 61   ILE A HG13   1 
ATOM   940   H HG21   . ILE A 1 65  ? -54.568  4.433   31.718  0    91.5   ? 61   ILE A HG21   1 
ATOM   941   H HG22   . ILE A 1 65  ? -55.699  4.053   30.41   0    88.91  ? 61   ILE A HG22   1 
ATOM   942   H HG23   . ILE A 1 65  ? -53.946  4.12    30.074  0    91.02  ? 61   ILE A HG23   1 
ATOM   943   H HD11   . ILE A 1 65  ? -53.421  7.837   32.916  0    97.61  ? 61   ILE A HD11   1 
ATOM   944   H HD12   . ILE A 1 65  ? -55.152  7.671   32.518  0    94.94  ? 61   ILE A HD12   1 
ATOM   945   H HD13   . ILE A 1 65  ? -54.222  6.259   33.09   0    96.64  ? 61   ILE A HD13   1 
ATOM   946   N N      . ALA A 1 66  ? -55.033  4.635   26.975  1    51.1   ? 62   ALA A N      1 
ATOM   947   C CA     . ALA A 1 66  ? -55.778  3.722   26.097  1    49.77  ? 62   ALA A CA     1 
ATOM   948   C C      . ALA A 1 66  ? -55.804  2.274   26.638  1    50.47  ? 62   ALA A C      1 
ATOM   949   O O      . ALA A 1 66  ? -56.888  1.695   26.758  1    49.57  ? 62   ALA A O      1 
ATOM   950   C CB     . ALA A 1 66  ? -55.206  3.766   24.678  1    49.62  ? 62   ALA A CB     1 
ATOM   951   H H      . ALA A 1 66  ? -54.043  4.67    26.755  0    83.44  ? 62   ALA A H      1 
ATOM   952   H HA     . ALA A 1 66  ? -56.81   4.063   26.023  0    78.28  ? 62   ALA A HA     1 
ATOM   953   H HB1    . ALA A 1 66  ? -55.783  3.093   24.046  0    78.28  ? 62   ALA A HB1    1 
ATOM   954   H HB2    . ALA A 1 66  ? -55.277  4.785   24.299  0    78.71  ? 62   ALA A HB2    1 
ATOM   955   H HB3    . ALA A 1 66  ? -54.165  3.449   24.707  0    80.47  ? 62   ALA A HB3    1 
ATOM   956   N N      . VAL A 1 67  ? -54.63   1.701   26.978  1    52.28  ? 63   VAL A N      1 
ATOM   957   C CA     . VAL A 1 67  ? -54.542  0.353   27.547  1    53.37  ? 63   VAL A CA     1 
ATOM   958   C C      . VAL A 1 67  ? -54.006  0.464   28.969  1    55.24  ? 63   VAL A C      1 
ATOM   959   O O      . VAL A 1 67  ? -53.131  1.285   29.239  1    56.32  ? 63   VAL A O      1 
ATOM   960   C CB     . VAL A 1 67  ? -53.638  -0.591  26.724  1    54.39  ? 63   VAL A CB     1 
ATOM   961   C CG1    . VAL A 1 67  ? -53.69   -2.016  27.268  1    55.59  ? 63   VAL A CG1    1 
ATOM   962   C CG2    . VAL A 1 67  ? -54.016  -0.565  25.251  1    52.85  ? 63   VAL A CG2    1 
ATOM   963   H H      . VAL A 1 67  ? -53.73   2.156   26.868  0    85.97  ? 63   VAL A H      1 
ATOM   964   H HA     . VAL A 1 67  ? -55.534  -0.094  27.595  0    86.46  ? 63   VAL A HA     1 
ATOM   965   H HB     . VAL A 1 67  ? -52.606  -0.262  26.824  0    91.03  ? 63   VAL A HB     1 
ATOM   966   H HG11   . VAL A 1 67  ? -52.896  -2.591  26.795  0    93.28  ? 63   VAL A HG11   1 
ATOM   967   H HG12   . VAL A 1 67  ? -53.532  -2.026  28.345  0    93.59  ? 63   VAL A HG12   1 
ATOM   968   H HG13   . VAL A 1 67  ? -54.661  -2.451  27.033  0    91.14  ? 63   VAL A HG13   1 
ATOM   969   H HG21   . VAL A 1 67  ? -53.427  -1.314  24.723  0    87.24  ? 63   VAL A HG21   1 
ATOM   970   H HG22   . VAL A 1 67  ? -55.076  -0.794  25.156  0    85.08  ? 63   VAL A HG22   1 
ATOM   971   H HG23   . VAL A 1 67  ? -53.809  0.421   24.836  0    85.84  ? 63   VAL A HG23   1 
ATOM   972   N N      . MET A 1 68  ? -54.52   -0.378  29.869  1    55.82  ? 64   MET A N      1 
ATOM   973   C CA     . MET A 1 68  ? -54.077  -0.432  31.262  1    57.89  ? 64   MET A CA     1 
ATOM   974   C C      . MET A 1 68  ? -54.259  -1.86   31.736  1    59     ? 64   MET A C      1 
ATOM   975   O O      . MET A 1 68  ? -55.405  -2.298  31.834  1    57.96  ? 64   MET A O      1 
ATOM   976   C CB     . MET A 1 68  ? -54.906  0.52    32.137  1    57.35  ? 64   MET A CB     1 
ATOM   977   C CG     . MET A 1 68  ? -54.521  0.477   33.605  1    59.7   ? 64   MET A CG     1 
ATOM   978   S SD     . MET A 1 68  ? -55.411  1.655   34.659  1    59.54  ? 64   MET A SD     1 
ATOM   979   C CE     . MET A 1 68  ? -57.029  1.035   34.543  1    57.66  ? 64   MET A CE     1 
ATOM   980   H H      . MET A 1 68  ? -55.271  -1.024  29.652  0    92.04  ? 64   MET A H      1 
ATOM   981   H HA     . MET A 1 68  ? -53.028  -0.151  31.344  0    98.79  ? 64   MET A HA     1 
ATOM   982   H HB2    . MET A 1 68  ? -54.753  1.539   31.784  0    95.5   ? 64   MET A HB2    1 
ATOM   983   H HB3    . MET A 1 68  ? -55.958  0.256   32.047  0    94.94  ? 64   MET A HB3    1 
ATOM   984   H HG2    . MET A 1 68  ? -54.7    -0.516  34.016  0    102.17 ? 64   MET A HG2    1 
ATOM   985   H HG3    . MET A 1 68  ? -53.462  0.724   33.669  0    102.71 ? 64   MET A HG3    1 
ATOM   986   H HE1    . MET A 1 68  ? -57.628  1.539   35.299  0    97.01  ? 64   MET A HE1    1 
ATOM   987   H HE2    . MET A 1 68  ? -57.423  1.261   33.553  0    95.04  ? 64   MET A HE2    1 
ATOM   988   H HE3    . MET A 1 68  ? -57.029  -0.042  34.707  0    97.47  ? 64   MET A HE3    1 
ATOM   989   N N      . GLU A 1 69  ? -53.15   -2.596  31.995  1    61.27  ? 65   GLU A N      1 
ATOM   990   C CA     . GLU A 1 69  ? -53.218  -3.991  32.437  1    62.76  ? 65   GLU A CA     1 
ATOM   991   C C      . GLU A 1 69  ? -52.129  -4.328  33.437  1    65.95  ? 65   GLU A C      1 
ATOM   992   O O      . GLU A 1 69  ? -50.953  -4.075  33.176  1    67.25  ? 65   GLU A O      1 
ATOM   993   C CB     . GLU A 1 69  ? -53.069  -4.942  31.239  1    62.34  ? 65   GLU A CB     1 
ATOM   994   C CG     . GLU A 1 69  ? -54.227  -4.923  30.253  1    59.6   ? 65   GLU A CG     1 
ATOM   995   C CD     . GLU A 1 69  ? -55.564  -5.401  30.786  1    58.73  ? 65   GLU A CD     1 
ATOM   996   O OE1    . GLU A 1 69  ? -56.607  -4.983  30.229  1    56.53  ? 65   GLU A OE1    1 
ATOM   997   O OE2    . GLU A 1 69  ? -55.569  -6.172  31.774  1    60.46  ? 65   GLU A OE2    1 
ATOM   998   H H      . GLU A 1 69  ? -52.201  -2.247  31.904  0    105.83 ? 65   GLU A H      1 
ATOM   999   H HA     . GLU A 1 69  ? -54.177  -4.179  32.915  0    107.47 ? 65   GLU A HA     1 
ATOM   1000  H HB2    . GLU A 1 69  ? -52.172  -4.66   30.688  0    107.64 ? 65   GLU A HB2    1 
ATOM   1001  H HB3    . GLU A 1 69  ? -52.956  -5.96   31.61   0    108.63 ? 65   GLU A HB3    1 
ATOM   1002  H HG2    . GLU A 1 69  ? -54.366  -3.9    29.907  0    99.77  ? 65   GLU A HG2    1 
ATOM   1003  H HG3    . GLU A 1 69  ? -53.966  -5.558  29.408  0    101.17 ? 65   GLU A HG3    1 
ATOM   1004  N N      . LEU A 1 70  ? -52.517  -4.947  34.559  1    67.43  ? 66   LEU A N      1 
ATOM   1005  C CA     . LEU A 1 70  ? -51.564  -5.414  35.56   1    70.82  ? 66   LEU A CA     1 
ATOM   1006  C C      . LEU A 1 70  ? -51.141  -6.829  35.195  1    72.42  ? 66   LEU A C      1 
ATOM   1007  O O      . LEU A 1 70  ? -51.926  -7.591  34.637  1    71.14  ? 66   LEU A O      1 
ATOM   1008  C CB     . LEU A 1 70  ? -52.18   -5.434  36.969  1    72.01  ? 66   LEU A CB     1 
ATOM   1009  C CG     . LEU A 1 70  ? -52.357  -4.092  37.655  1    71.7   ? 66   LEU A CG     1 
ATOM   1010  C CD1    . LEU A 1 70  ? -53.268  -4.217  38.858  1    72.43  ? 66   LEU A CD1    1 
ATOM   1011  C CD2    . LEU A 1 70  ? -51.034  -3.537  38.126  1    74.18  ? 66   LEU A CD2    1 
ATOM   1012  H H      . LEU A 1 70  ? -53.484  -5.143  34.798  0    117.38 ? 66   LEU A H      1 
ATOM   1013  H HA     . LEU A 1 70  ? -50.677  -4.784  35.559  0    126.67 ? 66   LEU A HA     1 
ATOM   1014  H HB2    . LEU A 1 70  ? -53.156  -5.914  36.913  0    127.24 ? 66   LEU A HB2    1 
ATOM   1015  H HB3    . LEU A 1 70  ? -51.534  -6.035  37.606  0    131.07 ? 66   LEU A HB3    1 
ATOM   1016  H HG     . LEU A 1 70  ? -52.797  -3.381  36.957  0    125.37 ? 66   LEU A HG     1 
ATOM   1017  H HD11   . LEU A 1 70  ? -53.5    -3.217  39.223  0    128.96 ? 66   LEU A HD11   1 
ATOM   1018  H HD12   . LEU A 1 70  ? -54.185  -4.732  38.578  0    127.92 ? 66   LEU A HD12   1 
ATOM   1019  H HD13   . LEU A 1 70  ? -52.744  -4.773  39.633  0    132.01 ? 66   LEU A HD13   1 
ATOM   1020  H HD21   . LEU A 1 70  ? -51.218  -2.591  38.634  0    133.17 ? 66   LEU A HD21   1 
ATOM   1021  H HD22   . LEU A 1 70  ? -50.579  -4.244  38.818  0    135.78 ? 66   LEU A HD22   1 
ATOM   1022  H HD23   . LEU A 1 70  ? -50.365  -3.363  37.285  0    132.79 ? 66   LEU A HD23   1 
ATOM   1023  N N      . PHE A 1 71  ? -49.909  -7.189  35.528  1    75.43  ? 67   PHE A N      1 
ATOM   1024  C CA     . PHE A 1 71  ? -49.387  -8.524  35.25   1    77.49  ? 67   PHE A CA     1 
ATOM   1025  C C      . PHE A 1 71  ? -48.208  -8.817  36.17   1    81.5   ? 67   PHE A C      1 
ATOM   1026  O O      . PHE A 1 71  ? -47.453  -7.908  36.514  1    82.46  ? 67   PHE A O      1 
ATOM   1027  C CB     . PHE A 1 71  ? -48.966  -8.634  33.776  1    76.24  ? 67   PHE A CB     1 
ATOM   1028  C CG     . PHE A 1 71  ? -47.783  -7.77   33.399  1    76.98  ? 67   PHE A CG     1 
ATOM   1029  C CD1    . PHE A 1 71  ? -47.929  -6.407  33.216  1    75.1   ? 67   PHE A CD1    1 
ATOM   1030  C CD2    . PHE A 1 71  ? -46.525  -8.324  33.226  1    79.7   ? 67   PHE A CD2    1 
ATOM   1031  C CE1    . PHE A 1 71  ? -46.837  -5.612  32.892  1    76.01  ? 67   PHE A CE1    1 
ATOM   1032  C CE2    . PHE A 1 71  ? -45.438  -7.527  32.89   1    80.57  ? 67   PHE A CE2    1 
ATOM   1033  C CZ     . PHE A 1 71  ? -45.6    -6.177  32.727  1    78.72  ? 67   PHE A CZ     1 
ATOM   1034  H H      . PHE A 1 71  ? -49.244  -6.572  35.986  0    137.09 ? 67   PHE A H      1 
ATOM   1035  H HA     . PHE A 1 71  ? -50.156  -9.27   35.445  0    140.21 ? 67   PHE A HA     1 
ATOM   1036  H HB2    . PHE A 1 71  ? -48.703  -9.67   33.567  0    139.1  ? 67   PHE A HB2    1 
ATOM   1037  H HB3    . PHE A 1 71  ? -49.801  -8.34   33.143  0    134.94 ? 67   PHE A HB3    1 
ATOM   1038  H HD1    . PHE A 1 71  ? -48.894  -5.953  33.363  0    133.11 ? 67   PHE A HD1    1 
ATOM   1039  H HD2    . PHE A 1 71  ? -46.388  -9.386  33.346  0    147.13 ? 67   PHE A HD2    1 
ATOM   1040  H HE1    . PHE A 1 71  ? -46.963  -4.551  32.759  0    135.8  ? 67   PHE A HE1    1 
ATOM   1041  H HE2    . PHE A 1 71  ? -44.472  -7.973  32.736  0    149.77 ? 67   PHE A HE2    1 
ATOM   1042  H HZ     . PHE A 1 71  ? -44.759  -5.563  32.454  0    144.09 ? 67   PHE A HZ     1 
ATOM   1043  N N      . ARG A 1 72  ? -48.058  -10.076 36.57   1    84.06  ? 68   ARG A N      1 
ATOM   1044  C CA     . ARG A 1 72  ? -46.979  -10.5   37.458  1    88.31  ? 68   ARG A CA     1 
ATOM   1045  C C      . ARG A 1 72  ? -45.971  -11.359 36.674  1    90.33  ? 68   ARG A C      1 
ATOM   1046  O O      . ARG A 1 72  ? -46.174  -12.574 36.577  1    91.58  ? 68   ARG A O      1 
ATOM   1047  C CB     . ARG A 1 72  ? -47.572  -11.305 38.632  1    90.18  ? 68   ARG A CB     1 
ATOM   1048  C CG     . ARG A 1 72  ? -46.548  -11.846 39.636  1    94.93  ? 68   ARG A CG     1 
ATOM   1049  C CD     . ARG A 1 72  ? -46.118  -10.793 40.628  1    96.31  ? 68   ARG A CD     1 
ATOM   1050  N NE     . ARG A 1 72  ? -47.185  -10.469 41.578  1    95.75  ? 68   ARG A NE     1 
ATOM   1051  C CZ     . ARG A 1 72  ? -47.468  -11.156 42.684  1    98.72  ? 68   ARG A CZ     1 
ATOM   1052  N NH1    . ARG A 1 72  ? -46.751  -12.228 43.016  1    102.6  ? 68   ARG A NH1    1 
ATOM   1053  N NH2    . ARG A 1 72  ? -48.459  -10.769 43.477  1    98.12  ? 68   ARG A NH2    1 
ATOM   1054  H H      . ARG A 1 72  ? -48.668  -10.838 36.292  0    154.23 ? 68   ARG A H      1 
ATOM   1055  H HA     . ARG A 1 72  ? -46.464  -9.637  37.878  0    164.86 ? 68   ARG A HA     1 
ATOM   1056  H HB2    . ARG A 1 72  ? -48.256  -10.653 39.172  0    167.02 ? 68   ARG A HB2    1 
ATOM   1057  H HB3    . ARG A 1 72  ? -48.128  -12.153 38.236  0    167.71 ? 68   ARG A HB3    1 
ATOM   1058  H HG2    . ARG A 1 72  ? -47.012  -12.656 40.196  0    180.07 ? 68   ARG A HG2    1 
ATOM   1059  H HG3    . ARG A 1 72  ? -45.656  -12.217 39.133  0    180.38 ? 68   ARG A HG3    1 
ATOM   1060  H HD2    . ARG A 1 72  ? -45.224  -11.113 41.159  0    185.27 ? 68   ARG A HD2    1 
ATOM   1061  H HD3    . ARG A 1 72  ? -45.892  -9.874  40.09   0    179.93 ? 68   ARG A HD3    1 
ATOM   1062  H HE     . ARG A 1 72  ? -47.756  -9.656  41.366  0    177.72 ? 68   ARG A HE     1 
ATOM   1063  H HH11   . ARG A 1 72  ? -45.992  -12.582 42.444  0    196.16 ? 68   ARG A HH11   1 
ATOM   1064  H HH12   . ARG A 1 72  ? -46.99   -12.739 43.86   0    197.46 ? 68   ARG A HH12   1 
ATOM   1065  H HH21   . ARG A 1 72  ? -49.006  -9.953  43.231  0    182.55 ? 68   ARG A HH21   1 
ATOM   1066  H HH22   . ARG A 1 72  ? -48.681  -11.288 44.321  0    187.53 ? 68   ARG A HH22   1 
ATOM   1067  N N      . PRO A 1 73  ? -44.873  -10.784 36.129  1    91.02  ? 69   PRO A N      1 
ATOM   1068  C CA     . PRO A 1 73  ? -43.915  -11.627 35.388  1    93.21  ? 69   PRO A CA     1 
ATOM   1069  C C      . PRO A 1 73  ? -43.08   -12.541 36.278  1    98.01  ? 69   PRO A C      1 
ATOM   1070  O O      . PRO A 1 73  ? -43.049  -12.382 37.497  1    99.84  ? 69   PRO A O      1 
ATOM   1071  C CB     . PRO A 1 73  ? -43.058  -10.625 34.607  1    92.54  ? 69   PRO A CB     1 
ATOM   1072  C CG     . PRO A 1 73  ? -43.247  -9.327  35.255  1    91.36  ? 69   PRO A CG     1 
ATOM   1073  C CD     . PRO A 1 73  ? -44.46   -9.366  36.144  1    89.96  ? 69   PRO A CD     1 
ATOM   1074  H HA     . PRO A 1 73  ? -44.447  -12.245 34.666  0    173.54 ? 69   PRO A HA     1 
ATOM   1075  H HB2    . PRO A 1 73  ? -42.011  -10.923 34.66   0    176.4  ? 69   PRO A HB2    1 
ATOM   1076  H HB3    . PRO A 1 73  ? -43.391  -10.589 33.571  0    171.05 ? 69   PRO A HB3    1 
ATOM   1077  H HG2    . PRO A 1 73  ? -42.346  -9.105  35.823  0    173.45 ? 69   PRO A HG2    1 
ATOM   1078  H HG3    . PRO A 1 73  ? -43.38   -8.572  34.482  0    168.26 ? 69   PRO A HG3    1 
ATOM   1079  H HD2    . PRO A 1 73  ? -44.21   -9.057  37.158  0    169.56 ? 69   PRO A HD2    1 
ATOM   1080  H HD3    . PRO A 1 73  ? -45.247  -8.742  35.724  0    164.55 ? 69   PRO A HD3    1 
ATOM   1081  N N      . LYS A 1 74  ? -42.41   -13.516 35.656  1    100.21 ? 70   LYS A N      1 
ATOM   1082  C CA     . LYS A 1 74  ? -41.571  -14.48  36.357  1    105.09 ? 70   LYS A CA     1 
ATOM   1083  C C      . LYS A 1 74  ? -40.478  -13.761 37.15   1    108.01 ? 70   LYS A C      1 
ATOM   1084  O O      . LYS A 1 74  ? -39.807  -12.889 36.6    1    107.39 ? 70   LYS A O      1 
ATOM   1085  C CB     . LYS A 1 74  ? -40.941  -15.452 35.345  1    106.71 ? 70   LYS A CB     1 
ATOM   1086  C CG     . LYS A 1 74  ? -39.998  -16.473 35.963  1    112.09 ? 70   LYS A CG     1 
ATOM   1087  C CD     . LYS A 1 74  ? -39.903  -17.738 35.12   1    113.27 ? 70   LYS A CD     1 
ATOM   1088  C CE     . LYS A 1 74  ? -38.928  -18.736 35.695  1    118.89 ? 70   LYS A CE     1 
ATOM   1089  N NZ     . LYS A 1 74  ? -37.524  -18.449 35.291  1    121.52 ? 70   LYS A NZ     1 
ATOM   1090  H H      . LYS A 1 74  ? -42.436  -13.651 34.651  0    188.87 ? 70   LYS A H      1 
ATOM   1091  H HA     . LYS A 1 74  ? -42.188  -15.056 37.044  0    201.61 ? 70   LYS A HA     1 
ATOM   1092  H HB2    . LYS A 1 74  ? -41.737  -15.993 34.836  0    202.65 ? 70   LYS A HB2    1 
ATOM   1093  H HB3    . LYS A 1 74  ? -40.364  -14.874 34.624  0    204.08 ? 70   LYS A HB3    1 
ATOM   1094  H HG2    . LYS A 1 74  ? -39.001  -16.041 36.037  0    218.52 ? 70   LYS A HG2    1 
ATOM   1095  H HG3    . LYS A 1 74  ? -40.365  -16.744 36.952  0    217.57 ? 70   LYS A HG3    1 
ATOM   1096  H HD2    . LYS A 1 74  ? -40.885  -18.206 35.08   0    217.17 ? 70   LYS A HD2    1 
ATOM   1097  H HD3    . LYS A 1 74  ? -39.57   -17.48  34.115  0    217.75 ? 70   LYS A HD3    1 
ATOM   1098  H HE2    . LYS A 1 74  ? -38.982  -18.699 36.782  0    232.99 ? 70   LYS A HE2    1 
ATOM   1099  H HE3    . LYS A 1 74  ? -39.186  -19.734 35.341  0    231.95 ? 70   LYS A HE3    1 
ATOM   1100  H HZ1    . LYS A 1 74  ? -36.898  -19.121 35.722  0    241.1  ? 70   LYS A HZ1    1 
ATOM   1101  H HZ2    . LYS A 1 74  ? -37.434  -18.52  34.283  0    235.87 ? 70   LYS A HZ2    1 
ATOM   1102  H HZ3    . LYS A 1 74  ? -37.258  -17.515 35.585  0    236.73 ? 70   LYS A HZ3    1 
ATOM   1103  N N      . GLY A 1 75  ? -40.373  -14.072 38.439  1    111.22 ? 71   GLY A N      1 
ATOM   1104  C CA     . GLY A 1 75  ? -39.371  -13.488 39.32   1    114.59 ? 71   GLY A CA     1 
ATOM   1105  C C      . GLY A 1 75  ? -39.783  -12.244 40.082  1    112.98 ? 71   GLY A C      1 
ATOM   1106  O O      . GLY A 1 75  ? -39.039  -11.82  40.968  1    116.11 ? 71   GLY A O      1 
ATOM   1107  H H      . GLY A 1 75  ? -40.976  -14.736 38.913  0    214.82 ? 71   GLY A H      1 
ATOM   1108  H HA2    . GLY A 1 75  ? -39.093  -14.238 40.058  0    225.36 ? 71   GLY A HA2    1 
ATOM   1109  H HA3    . GLY A 1 75  ? -38.474  -13.246 38.751  0    222.95 ? 71   GLY A HA3    1 
ATOM   1110  N N      . GLU A 1 76  ? -40.945  -11.634 39.764  1    108.37 ? 72   GLU A N      1 
ATOM   1111  C CA     . GLU A 1 76  ? -41.387  -10.43  40.472  1    106.86 ? 72   GLU A CA     1 
ATOM   1112  C C      . GLU A 1 76  ? -42.198  -10.814 41.697  1    107.85 ? 72   GLU A C      1 
ATOM   1113  O O      . GLU A 1 76  ? -43.018  -11.73  41.63   1    107.3  ? 72   GLU A O      1 
ATOM   1114  C CB     . GLU A 1 76  ? -42.232  -9.506  39.57   1    101.72 ? 72   GLU A CB     1 
ATOM   1115  C CG     . GLU A 1 76  ? -41.487  -8.871  38.406  1    100.48 ? 72   GLU A CG     1 
ATOM   1116  C CD     . GLU A 1 76  ? -40.289  -7.994  38.722  1    102.9  ? 72   GLU A CD     1 
ATOM   1117  O OE1    . GLU A 1 76  ? -39.653  -7.501  37.763  1    104.16 ? 72   GLU A OE1    1 
ATOM   1118  O OE2    . GLU A 1 76  ? -39.974  -7.807  39.92   1    103.69 ? 72   GLU A OE2    1 
ATOM   1119  H H      . GLU A 1 76  ? -41.594  -11.943 39.048  0    205.77 ? 72   GLU A H      1 
ATOM   1120  H HA     . GLU A 1 76  ? -40.521  -9.857  40.8    0    207.03 ? 72   GLU A HA     1 
ATOM   1121  H HB2    . GLU A 1 76  ? -43.054  -10.088 39.153  0    191.62 ? 72   GLU A HB2    1 
ATOM   1122  H HB3    . GLU A 1 76  ? -42.628  -8.695  40.179  0    192.77 ? 72   GLU A HB3    1 
ATOM   1123  H HG2    . GLU A 1 76  ? -41.148  -9.662  37.739  0    191.54 ? 72   GLU A HG2    1 
ATOM   1124  H HG3    . GLU A 1 76  ? -42.192  -8.22   37.895  0    187.46 ? 72   GLU A HG3    1 
ATOM   1125  N N      . SER A 1 77  ? -41.969  -10.109 42.818  1    109.44 ? 73   SER A N      1 
ATOM   1126  C CA     . SER A 1 77  ? -42.68   -10.351 44.073  1    110.81 ? 73   SER A CA     1 
ATOM   1127  C C      . SER A 1 77  ? -44.101  -9.774  44.031  1    106.51 ? 73   SER A C      1 
ATOM   1128  O O      . SER A 1 77  ? -44.987  -10.323 44.68   1    106.68 ? 73   SER A O      1 
ATOM   1129  C CB     . SER A 1 77  ? -41.907  -9.75   45.246  1    114.58 ? 73   SER A CB     1 
ATOM   1130  O OG     . SER A 1 77  ? -41.651  -8.369  45.045  1    112.79 ? 73   SER A OG     1 
ATOM   1131  H H      . SER A 1 77  ? -41.29   -9.357  42.89   0    211.61 ? 73   SER A H      1 
ATOM   1132  H HA     . SER A 1 77  ? -42.755  -11.423 44.246  0    215.59 ? 73   SER A HA     1 
ATOM   1133  H HB2    . SER A 1 77  ? -42.494  -9.867  46.155  0    223.03 ? 73   SER A HB2    1 
ATOM   1134  H HB3    . SER A 1 77  ? -40.958  -10.271 45.355  0    225.59 ? 73   SER A HB3    1 
ATOM   1135  H HG     . SER A 1 77  ? -41.235  -7.977  45.858  0    220.98 ? 73   SER A HG     1 
ATOM   1136  N N      . LYS A 1 78  ? -44.312  -8.666  43.293  1    102.95 ? 74   LYS A N      1 
ATOM   1137  C CA     . LYS A 1 78  ? -45.609  -7.998  43.156  1    98.89  ? 74   LYS A CA     1 
ATOM   1138  C C      . LYS A 1 78  ? -45.866  -7.633  41.678  1    94.79  ? 74   LYS A C      1 
ATOM   1139  O O      . LYS A 1 78  ? -44.934  -7.663  40.872  1    95.27  ? 74   LYS A O      1 
ATOM   1140  C CB     . LYS A 1 78  ? -45.633  -6.734  44.027  1    99.3   ? 74   LYS A CB     1 
ATOM   1141  C CG     . LYS A 1 78  ? -44.639  -5.666  43.569  1    99.48  ? 74   LYS A CG     1 
ATOM   1142  C CD     . LYS A 1 78  ? -44.599  -4.475  44.504  1    100.41 ? 74   LYS A CD     1 
ATOM   1143  C CE     . LYS A 1 78  ? -43.845  -3.304  43.912  1    99.58  ? 74   LYS A CE     1 
ATOM   1144  N NZ     . LYS A 1 78  ? -44.561  -2.681  42.757  1    94.9   ? 74   LYS A NZ     1 
ATOM   1145  H H      . LYS A 1 78  ? -43.583  -8.187  42.775  0    196.56 ? 74   LYS A H      1 
ATOM   1146  H HA     . LYS A 1 78  ? -46.416  -8.652  43.483  0    187.33 ? 74   LYS A HA     1 
ATOM   1147  H HB2    . LYS A 1 78  ? -46.63   -6.299  43.992  0    185.7  ? 74   LYS A HB2    1 
ATOM   1148  H HB3    . LYS A 1 78  ? -45.384  -7.005  45.052  0    191.59 ? 74   LYS A HB3    1 
ATOM   1149  H HG2    . LYS A 1 78  ? -43.638  -6.092  43.532  0    191.51 ? 74   LYS A HG2    1 
ATOM   1150  H HG3    . LYS A 1 78  ? -44.924  -5.294  42.587  0    185.67 ? 74   LYS A HG3    1 
ATOM   1151  H HD2    . LYS A 1 78  ? -45.617  -4.155  44.72   0    188.8  ? 74   LYS A HD2    1 
ATOM   1152  H HD3    . LYS A 1 78  ? -44.098  -4.764  45.427  0    194.42 ? 74   LYS A HD3    1 
ATOM   1153  H HE2    . LYS A 1 78  ? -43.72   -2.54   44.678  0    190.42 ? 74   LYS A HE2    1 
ATOM   1154  H HE3    . LYS A 1 78  ? -42.871  -3.645  43.563  0    190.88 ? 74   LYS A HE3    1 
ATOM   1155  H HZ1    . LYS A 1 78  ? -44.208  -1.743  42.596  0    178.43 ? 74   LYS A HZ1    1 
ATOM   1156  H HZ2    . LYS A 1 78  ? -44.418  -3.236  41.919  0    177.87 ? 74   LYS A HZ2    1 
ATOM   1157  H HZ3    . LYS A 1 78  ? -45.556  -2.625  42.949  0    176.98 ? 74   LYS A HZ3    1 
ATOM   1158  N N      . ASP A 1 79  ? -47.131  -7.292  41.325  1    91     ? 75   ASP A N      1 
ATOM   1159  C CA     . ASP A 1 79  ? -47.546  -6.932  39.956  1    87.17  ? 75   ASP A CA     1 
ATOM   1160  C C      . ASP A 1 79  ? -46.941  -5.604  39.457  1    86.09  ? 75   ASP A C      1 
ATOM   1161  O O      . ASP A 1 79  ? -46.699  -4.68   40.236  1    87.22  ? 75   ASP A O      1 
ATOM   1162  C CB     . ASP A 1 79  ? -49.085  -6.822  39.85   1    83.81  ? 75   ASP A CB     1 
ATOM   1163  C CG     . ASP A 1 79  ? -49.855  -8.127  39.943  1    84.23  ? 75   ASP A CG     1 
ATOM   1164  O OD1    . ASP A 1 79  ? -49.411  -9.028  40.68   1    87.63  ? 75   ASP A OD1    1 
ATOM   1165  O OD2    . ASP A 1 79  ? -50.921  -8.232  39.3    1    81.36  ? 75   ASP A OD2    1 
ATOM   1166  H H      . ASP A 1 79  ? -47.897  -7.272  41.99   0    169.99 ? 75   ASP A H      1 
ATOM   1167  H HA     . ASP A 1 79  ? -47.227  -7.726  39.282  0    162.13 ? 75   ASP A HA     1 
ATOM   1168  H HB2    . ASP A 1 79  ? -49.445  -6.17   40.643  0    154.48 ? 75   ASP A HB2    1 
ATOM   1169  H HB3    . ASP A 1 79  ? -49.325  -6.378  38.884  0    151.77 ? 75   ASP A HB3    1 
ATOM   1170  N N      . LEU A 1 80  ? -46.733  -5.522  38.139  1    84.03  ? 76   LEU A N      1 
ATOM   1171  C CA     . LEU A 1 80  ? -46.248  -4.332  37.44   1    82.71  ? 76   LEU A CA     1 
ATOM   1172  C C      . LEU A 1 80  ? -47.377  -3.857  36.517  1    78.48  ? 76   LEU A C      1 
ATOM   1173  O O      . LEU A 1 80  ? -48.195  -4.668  36.072  1    76.94  ? 76   LEU A O      1 
ATOM   1174  C CB     . LEU A 1 80  ? -45.006  -4.657  36.604  1    84.26  ? 76   LEU A CB     1 
ATOM   1175  C CG     . LEU A 1 80  ? -43.857  -5.325  37.347  1    88.71  ? 76   LEU A CG     1 
ATOM   1176  C CD1    . LEU A 1 80  ? -42.759  -5.699  36.394  1    90.1   ? 76   LEU A CD1    1 
ATOM   1177  C CD2    . LEU A 1 80  ? -43.314  -4.428  38.441  1    91.02  ? 76   LEU A CD2    1 
ATOM   1178  H H      . LEU A 1 80  ? -46.901  -6.294  37.502  0    154.35 ? 76   LEU A H      1 
ATOM   1179  H HA     . LEU A 1 80  ? -46.005  -3.526  38.131  0    152.99 ? 76   LEU A HA     1 
ATOM   1180  H HB2    . LEU A 1 80  ? -45.302  -5.325  35.797  0    154.04 ? 76   LEU A HB2    1 
ATOM   1181  H HB3    . LEU A 1 80  ? -44.626  -3.728  36.182  0    154.65 ? 76   LEU A HB3    1 
ATOM   1182  H HG     . LEU A 1 80  ? -44.21   -6.245  37.811  0    166.09 ? 76   LEU A HG     1 
ATOM   1183  H HD11   . LEU A 1 80  ? -41.922  -6.116  36.953  0    171.47 ? 76   LEU A HD11   1 
ATOM   1184  H HD12   . LEU A 1 80  ? -43.145  -6.432  35.688  0    166.73 ? 76   LEU A HD12   1 
ATOM   1185  H HD13   . LEU A 1 80  ? -42.442  -4.803  35.862  0    167.18 ? 76   LEU A HD13   1 
ATOM   1186  H HD21   . LEU A 1 80  ? -42.432  -4.894  38.878  0    173.55 ? 76   LEU A HD21   1 
ATOM   1187  H HD22   . LEU A 1 80  ? -43.052  -3.463  38.007  0    169.23 ? 76   LEU A HD22   1 
ATOM   1188  H HD23   . LEU A 1 80  ? -44.073  -4.295  39.209  0    169.78 ? 76   LEU A HD23   1 
ATOM   1189  N N      . LEU A 1 81  ? -47.433  -2.554  36.226  1    76.82  ? 77   LEU A N      1 
ATOM   1190  C CA     . LEU A 1 81  ? -48.493  -2      35.386  1    73.11  ? 77   LEU A CA     1 
ATOM   1191  C C      . LEU A 1 81  ? -48.018  -1.73   33.978  1    71.75  ? 77   LEU A C      1 
ATOM   1192  O O      . LEU A 1 81  ? -46.869  -1.364  33.782  1    73.34  ? 77   LEU A O      1 
ATOM   1193  C CB     . LEU A 1 81  ? -48.989  -0.697  36.016  1    72.29  ? 77   LEU A CB     1 
ATOM   1194  C CG     . LEU A 1 81  ? -50.218  -0.041  35.408  1    68.83  ? 77   LEU A CG     1 
ATOM   1195  C CD1    . LEU A 1 81  ? -51.406  -0.986  35.428  1    67.45  ? 77   LEU A CD1    1 
ATOM   1196  C CD2    . LEU A 1 81  ? -50.534  1.235   36.144  1    68.72  ? 77   LEU A CD2    1 
ATOM   1197  H H      . LEU A 1 81  ? -46.76   -1.867  36.551  0    140.36 ? 77   LEU A H      1 
ATOM   1198  H HA     . LEU A 1 81  ? -49.324  -2.7    35.332  0    129.83 ? 77   LEU A HA     1 
ATOM   1199  H HB2    . LEU A 1 81  ? -49.216  -0.905  37.061  0    130.41 ? 77   LEU A HB2    1 
ATOM   1200  H HB3    . LEU A 1 81  ? -48.181  0.03    35.965  0    130.11 ? 77   LEU A HB3    1 
ATOM   1201  H HG     . LEU A 1 81  ? -50.015  0.224   34.371  0    120.22 ? 77   LEU A HG     1 
ATOM   1202  H HD11   . LEU A 1 81  ? -52.33   -0.428  35.293  0    116.41 ? 77   LEU A HD11   1 
ATOM   1203  H HD12   . LEU A 1 81  ? -51.3    -1.708  34.619  0    117.97 ? 77   LEU A HD12   1 
ATOM   1204  H HD13   . LEU A 1 81  ? -51.431  -1.504  36.386  0    120.09 ? 77   LEU A HD13   1 
ATOM   1205  H HD21   . LEU A 1 81  ? -51.537  1.572   35.889  0    119.08 ? 77   LEU A HD21   1 
ATOM   1206  H HD22   . LEU A 1 81  ? -50.473  1.048   37.215  0    123.05 ? 77   LEU A HD22   1 
ATOM   1207  H HD23   . LEU A 1 81  ? -49.806  1.995   35.862  0    121.87 ? 77   LEU A HD23   1 
ATOM   1208  N N      . PHE A 1 82  ? -48.901  -1.906  32.997  1    69.04  ? 78   PHE A N      1 
ATOM   1209  C CA     . PHE A 1 82  ? -48.598  -1.593  31.61   1    67.61  ? 78   PHE A CA     1 
ATOM   1210  C C      . PHE A 1 82  ? -49.628  -0.576  31.132  1    64.61  ? 78   PHE A C      1 
ATOM   1211  O O      . PHE A 1 82  ? -50.821  -0.799  31.317  1    62.91  ? 78   PHE A O      1 
ATOM   1212  C CB     . PHE A 1 82  ? -48.647  -2.839  30.715  1    67.37  ? 78   PHE A CB     1 
ATOM   1213  C CG     . PHE A 1 82  ? -48.49   -2.471  29.253  1    65.82  ? 78   PHE A CG     1 
ATOM   1214  C CD1    . PHE A 1 82  ? -47.301  -1.948  28.781  1    67.2   ? 78   PHE A CD1    1 
ATOM   1215  C CD2    . PHE A 1 82  ? -49.578  -2.484  28.397  1    63.1   ? 78   PHE A CD2    1 
ATOM   1216  C CE1    . PHE A 1 82  ? -47.184  -1.52   27.464  1    65.93  ? 78   PHE A CE1    1 
ATOM   1217  C CE2    . PHE A 1 82  ? -49.454  -2.06   27.077  1    61.87  ? 78   PHE A CE2    1 
ATOM   1218  C CZ     . PHE A 1 82  ? -48.258  -1.587  26.618  1    63.29  ? 78   PHE A CZ     1 
ATOM   1219  H H      . PHE A 1 82  ? -49.839  -2.269  33.129  0    120.62 ? 78   PHE A H      1 
ATOM   1220  H HA     . PHE A 1 82  ? -47.607  -1.152  31.514  0    120.15 ? 78   PHE A HA     1 
ATOM   1221  H HB2    . PHE A 1 82  ? -47.831  -3.508  30.985  0    120.51 ? 78   PHE A HB2    1 
ATOM   1222  H HB3    . PHE A 1 82  ? -49.605  -3.34   30.848  0    117.02 ? 78   PHE A HB3    1 
ATOM   1223  H HD1    . PHE A 1 82  ? -46.448  -1.889  29.438  0    120.07 ? 78   PHE A HD1    1 
ATOM   1224  H HD2    . PHE A 1 82  ? -50.53   -2.849  28.747  0    107.81 ? 78   PHE A HD2    1 
ATOM   1225  H HE1    . PHE A 1 82  ? -46.233  -1.167  27.103  0    116.33 ? 78   PHE A HE1    1 
ATOM   1226  H HE2    . PHE A 1 82  ? -50.297  -2.118  26.41   0    104.24 ? 78   PHE A HE2    1 
ATOM   1227  H HZ     . PHE A 1 82  ? -48.154  -1.276  25.59   0    108.48 ? 78   PHE A HZ     1 
ATOM   1228  N N      . ILE A 1 83  ? -49.169  0.507   30.485  1    64.16  ? 79   ILE A N      1 
ATOM   1229  C CA     . ILE A 1 83  ? -50.038  1.54    29.933  1    61.62  ? 79   ILE A CA     1 
ATOM   1230  C C      . ILE A 1 83  ? -49.578  1.911   28.53   1    60.89  ? 79   ILE A C      1 
ATOM   1231  O O      . ILE A 1 83  ? -48.388  1.906   28.231  1    62.71  ? 79   ILE A O      1 
ATOM   1232  C CB     . ILE A 1 83  ? -50.14   2.781   30.88   1    61.99  ? 79   ILE A CB     1 
ATOM   1233  C CG1    . ILE A 1 83  ? -51.079  2.459   32.057  1    62.04  ? 79   ILE A CG1    1 
ATOM   1234  C CG2    . ILE A 1 83  ? -50.63   4.046   30.131  1    60.01  ? 79   ILE A CG2    1 
ATOM   1235  C CD1    . ILE A 1 83  ? -50.97   3.335   33.212  1    63.31  ? 79   ILE A CD1    1 
ATOM   1236  H H      . ILE A 1 83  ? -48.185  0.695   30.322  0    112.62 ? 79   ILE A H      1 
ATOM   1237  H HA     . ILE A 1 83  ? -51.036  1.122   29.807  0    104    ? 79   ILE A HA     1 
ATOM   1238  H HB     . ILE A 1 83  ? -49.152  3.006   31.28   0    108.44 ? 79   ILE A HB     1 
ATOM   1239  H HG12   . ILE A 1 83  ? -52.107  2.518   31.703  0    104.51 ? 79   ILE A HG12   1 
ATOM   1240  H HG13   . ILE A 1 83  ? -50.871  1.447   32.4    0    107.7  ? 79   ILE A HG13   1 
ATOM   1241  H HG21   . ILE A 1 83  ? -50.827  4.851   30.836  0    102.45 ? 79   ILE A HG21   1 
ATOM   1242  H HG22   . ILE A 1 83  ? -49.859  4.387   29.441  0    102.43 ? 79   ILE A HG22   1 
ATOM   1243  H HG23   . ILE A 1 83  ? -51.539  3.804   29.584  0    100.2  ? 79   ILE A HG23   1 
ATOM   1244  H HD11   . ILE A 1 83  ? -51.556  2.907   34.023  0    109.41 ? 79   ILE A HD11   1 
ATOM   1245  H HD12   . ILE A 1 83  ? -49.924  3.41    33.506  0    111.43 ? 79   ILE A HD12   1 
ATOM   1246  H HD13   . ILE A 1 83  ? -51.368  4.32    32.977  0    108.22 ? 79   ILE A HD13   1 
ATOM   1247  N N      . LEU A 1 84  ? -50.535  2.248   27.684  1    58.44  ? 80   LEU A N      1 
ATOM   1248  C CA     . LEU A 1 84  ? -50.283  2.688   26.325  1    57.62  ? 80   LEU A CA     1 
ATOM   1249  C C      . LEU A 1 84  ? -51.189  3.892   26.093  1    55.77  ? 80   LEU A C      1 
ATOM   1250  O O      . LEU A 1 84  ? -52.372  3.812   26.398  1    54.24  ? 80   LEU A O      1 
ATOM   1251  C CB     . LEU A 1 84  ? -50.609  1.548   25.355  1    56.75  ? 80   LEU A CB     1 
ATOM   1252  C CG     . LEU A 1 84  ? -50.433  1.808   23.871  1    56.02  ? 80   LEU A CG     1 
ATOM   1253  C CD1    . LEU A 1 84  ? -49.02   2.11    23.528  1    58.02  ? 80   LEU A CD1    1 
ATOM   1254  C CD2    . LEU A 1 84  ? -50.869  0.605   23.077  1    55.35  ? 80   LEU A CD2    1 
ATOM   1255  H H      . LEU A 1 84  ? -51.524  2.227   27.914  0    97.27  ? 80   LEU A H      1 
ATOM   1256  H HA     . LEU A 1 84  ? -49.247  2.999   26.21   0    98.31  ? 80   LEU A HA     1 
ATOM   1257  H HB2    . LEU A 1 84  ? -50      0.683   25.615  0    96.47  ? 80   LEU A HB2    1 
ATOM   1258  H HB3    . LEU A 1 84  ? -51.662  1.31    25.486  0    93.54  ? 80   LEU A HB3    1 
ATOM   1259  H HG     . LEU A 1 84  ? -51.05   2.651   23.563  0    91.96  ? 80   LEU A HG     1 
ATOM   1260  H HD11   . LEU A 1 84  ? -48.958  2.204   22.446  0    97.31  ? 80   LEU A HD11   1 
ATOM   1261  H HD12   . LEU A 1 84  ? -48.707  3.046   23.987  0    98.21  ? 80   LEU A HD12   1 
ATOM   1262  H HD13   . LEU A 1 84  ? -48.406  1.282   23.876  0    99.3   ? 80   LEU A HD13   1 
ATOM   1263  H HD21   . LEU A 1 84  ? -50.771  0.817   22.013  0    91.46  ? 80   LEU A HD21   1 
ATOM   1264  H HD22   . LEU A 1 84  ? -50.237  -0.239  23.35   0    93.5   ? 80   LEU A HD22   1 
ATOM   1265  H HD23   . LEU A 1 84  ? -51.908  0.38    23.315  0    90.67  ? 80   LEU A HD23   1 
ATOM   1266  N N      . THR A 1 85  ? -50.64   5.016   25.627  1    56.11  ? 81   THR A N      1 
ATOM   1267  C CA     . THR A 1 85  ? -51.44   6.22    25.396  1    54.67  ? 81   THR A CA     1 
ATOM   1268  C C      . THR A 1 85  ? -52.04   6.222   23.989  1    52.97  ? 81   THR A C      1 
ATOM   1269  O O      . THR A 1 85  ? -51.633  5.431   23.141  1    53.13  ? 81   THR A O      1 
ATOM   1270  C CB     . THR A 1 85  ? -50.619  7.506   25.673  1    56.06  ? 81   THR A CB     1 
ATOM   1271  O OG1    . THR A 1 85  ? -49.749  7.777   24.576  1    56.69  ? 81   THR A OG1    1 
ATOM   1272  C CG2    . THR A 1 85  ? -49.85   7.443   26.979  1    58.22  ? 81   THR A CG2    1 
ATOM   1273  H H      . THR A 1 85  ? -49.656  5.124   25.403  0    94.8   ? 81   THR A H      1 
ATOM   1274  H HA     . THR A 1 85  ? -52.272  6.233   26.099  0    89.6   ? 81   THR A HA     1 
ATOM   1275  H HB     . THR A 1 85  ? -51.312  8.343   25.757  0    92.5   ? 81   THR A HB     1 
ATOM   1276  H HG1    . THR A 1 85  ? -49.218  8.597   24.757  0    95.89  ? 81   THR A HG1    1 
ATOM   1277  H HG21   . THR A 1 85  ? -49.285  8.363   27.116  0    99.16  ? 81   THR A HG21   1 
ATOM   1278  H HG22   . THR A 1 85  ? -50.545  7.334   27.81   0    97.7   ? 81   THR A HG22   1 
ATOM   1279  H HG23   . THR A 1 85  ? -49.158  6.603   26.988  0    99.23  ? 81   THR A HG23   1 
ATOM   1280  N N      . ALA A 1 86  ? -52.997  7.125   23.735  1    51.6   ? 82   ALA A N      1 
ATOM   1281  C CA     . ALA A 1 86  ? -53.607  7.275   22.419  1    50.26  ? 82   ALA A CA     1 
ATOM   1282  C C      . ALA A 1 86  ? -52.56   7.636   21.365  1    51.27  ? 82   ALA A C      1 
ATOM   1283  O O      . ALA A 1 86  ? -52.71   7.232   20.214  1    50.73  ? 82   ALA A O      1 
ATOM   1284  C CB     . ALA A 1 86  ? -54.671  8.355   22.463  1    49.13  ? 82   ALA A CB     1 
ATOM   1285  H H      . ALA A 1 86  ? -53.365  7.765   24.431  0    83.53  ? 82   ALA A H      1 
ATOM   1286  H HA     . ALA A 1 86  ? -54.081  6.338   22.13   0    79.85  ? 82   ALA A HA     1 
ATOM   1287  H HB1    . ALA A 1 86  ? -55.078  8.492   21.463  0    77.32  ? 82   ALA A HB1    1 
ATOM   1288  H HB2    . ALA A 1 86  ? -55.461  8.044   23.147  0    77.48  ? 82   ALA A HB2    1 
ATOM   1289  H HB3    . ALA A 1 86  ? -54.221  9.284   22.81   0    78.94  ? 82   ALA A HB3    1 
ATOM   1290  N N      . LYS A 1 87  ? -51.502  8.39    21.753  1    52.92  ? 83   LYS A N      1 
ATOM   1291  C CA     . LYS A 1 87  ? -50.407  8.769   20.845  1    54.27  ? 83   LYS A CA     1 
ATOM   1292  C C      . LYS A 1 87  ? -49.337  7.641   20.676  1    55.75  ? 83   LYS A C      1 
ATOM   1293  O O      . LYS A 1 87  ? -48.296  7.876   20.056  1    57.31  ? 83   LYS A O      1 
ATOM   1294  C CB     . LYS A 1 87  ? -49.77   10.087  21.323  1    55.61  ? 83   LYS A CB     1 
ATOM   1295  C CG     . LYS A 1 87  ? -50.798  11.212  21.504  1    54.49  ? 83   LYS A CG     1 
ATOM   1296  C CD     . LYS A 1 87  ? -50.168  12.577  21.734  1    56.04  ? 83   LYS A CD     1 
ATOM   1297  C CE     . LYS A 1 87  ? -50.617  13.585  20.707  1    55.6   ? 83   LYS A CE     1 
ATOM   1298  N NZ     . LYS A 1 87  ? -49.933  14.884  20.881  1    57.33  ? 83   LYS A NZ     1 
ATOM   1299  H H      . LYS A 1 87  ? -51.377  8.754   22.691  0    87.01  ? 83   LYS A H      1 
ATOM   1300  H HA     . LYS A 1 87  ? -50.823  8.966   19.858  0    88.61  ? 83   LYS A HA     1 
ATOM   1301  H HB2    . LYS A 1 87  ? -49.284  9.92    22.282  0    93.36  ? 83   LYS A HB2    1 
ATOM   1302  H HB3    . LYS A 1 87  ? -49.04   10.413  20.584  0    93.4   ? 83   LYS A HB3    1 
ATOM   1303  H HG2    . LYS A 1 87  ? -51.411  11.273  20.607  0    88.93  ? 83   LYS A HG2    1 
ATOM   1304  H HG3    . LYS A 1 87  ? -51.426  10.992  22.366  0    89.09  ? 83   LYS A HG3    1 
ATOM   1305  H HD2    . LYS A 1 87  ? -50.461  12.941  22.718  0    93.38  ? 83   LYS A HD2    1 
ATOM   1306  H HD3    . LYS A 1 87  ? -49.084  12.492  21.674  0    94.87  ? 83   LYS A HD3    1 
ATOM   1307  H HE2    . LYS A 1 87  ? -50.387  13.214  19.71   0    92.41  ? 83   LYS A HE2    1 
ATOM   1308  H HE3    . LYS A 1 87  ? -51.689  13.745  20.813  0    90.96  ? 83   LYS A HE3    1 
ATOM   1309  H HZ1    . LYS A 1 87  ? -50.246  15.54   20.172  0    96     ? 83   LYS A HZ1    1 
ATOM   1310  H HZ2    . LYS A 1 87  ? -50.147  15.265  21.798  0    96.23  ? 83   LYS A HZ2    1 
ATOM   1311  H HZ3    . LYS A 1 87  ? -48.929  14.763  20.8    0    97.61  ? 83   LYS A HZ3    1 
ATOM   1312  N N      . TYR A 1 88  ? -49.645  6.412   21.183  1    55.37  ? 84   TYR A N      1 
ATOM   1313  C CA     . TYR A 1 88  ? -48.865  5.178   21.12   1    56.72  ? 84   TYR A CA     1 
ATOM   1314  C C      . TYR A 1 88  ? -47.661  5.14    22.065  1    59.13  ? 84   TYR A C      1 
ATOM   1315  O O      . TYR A 1 88  ? -46.721  4.405   21.786  1    60.79  ? 84   TYR A O      1 
ATOM   1316  C CB     . TYR A 1 88  ? -48.444  4.852   19.677  1    57.08  ? 84   TYR A CB     1 
ATOM   1317  C CG     . TYR A 1 88  ? -49.616  4.787   18.721  1    55.05  ? 84   TYR A CG     1 
ATOM   1318  C CD1    . TYR A 1 88  ? -50.49   3.713   18.728  1    53.86  ? 84   TYR A CD1    1 
ATOM   1319  C CD2    . TYR A 1 88  ? -49.856  5.813   17.815  1    54.56  ? 84   TYR A CD2    1 
ATOM   1320  C CE1    . TYR A 1 88  ? -51.587  3.661   17.871  1    52.23  ? 84   TYR A CE1    1 
ATOM   1321  C CE2    . TYR A 1 88  ? -50.942  5.768   16.943  1    52.99  ? 84   TYR A CE2    1 
ATOM   1322  C CZ     . TYR A 1 88  ? -51.81   4.694   16.977  1    51.82  ? 84   TYR A CZ     1 
ATOM   1323  O OH     . TYR A 1 88  ? -52.888  4.638   16.122  1    50.49  ? 84   TYR A OH     1 
ATOM   1324  H H      . TYR A 1 88  ? -50.51   6.235   21.683  0    90.6   ? 84   TYR A H      1 
ATOM   1325  H HA     . TYR A 1 88  ? -49.522  4.371   21.437  0    93.97  ? 84   TYR A HA     1 
ATOM   1326  H HB2    . TYR A 1 88  ? -47.75   5.618   19.339  0    96.64  ? 84   TYR A HB2    1 
ATOM   1327  H HB3    . TYR A 1 88  ? -47.964  3.873   19.651  0    96.55  ? 84   TYR A HB3    1 
ATOM   1328  H HD1    . TYR A 1 88  ? -50.331  2.907   19.428  0    89.04  ? 84   TYR A HD1    1 
ATOM   1329  H HD2    . TYR A 1 88  ? -49.195  6.661   17.788  0    91.06  ? 84   TYR A HD2    1 
ATOM   1330  H HE1    . TYR A 1 88  ? -52.254  2.815   17.9    0    84.2   ? 84   TYR A HE1    1 
ATOM   1331  H HE2    . TYR A 1 88  ? -51.1    6.585   16.258  0    86.41  ? 84   TYR A HE2    1 
ATOM   1332  H HH     . TYR A 1 88  ? -52.925  5.446   15.546  0    81.08  ? 84   TYR A HH     1 
ATOM   1333  N N      . ASN A 1 89  ? -47.713  5.834   23.218  1    59.54  ? 85   ASN A N      1 
ATOM   1334  C CA     . ASN A 1 89  ? -46.611  5.785   24.183  1    62.07  ? 85   ASN A CA     1 
ATOM   1335  C C      . ASN A 1 89  ? -46.82   4.6     25.114  1    62.35  ? 85   ASN A C      1 
ATOM   1336  O O      . ASN A 1 89  ? -47.72   4.635   25.941  1    61.15  ? 85   ASN A O      1 
ATOM   1337  C CB     . ASN A 1 89  ? -46.512  7.067   25.004  1    62.75  ? 85   ASN A CB     1 
ATOM   1338  C CG     . ASN A 1 89  ? -46.294  8.296   24.183  1    62.51  ? 85   ASN A CG     1 
ATOM   1339  O OD1    . ASN A 1 89  ? -47.167  9.162   24.114  1    60.73  ? 85   ASN A OD1    1 
ATOM   1340  N ND2    . ASN A 1 89  ? -45.132  8.408   23.554  1    64.53  ? 85   ASN A ND2    1 
ATOM   1341  H H      . ASN A 1 89  ? -48.486  6.421   23.515  0    99.72  ? 85   ASN A H      1 
ATOM   1342  H HA     . ASN A 1 89  ? -45.658  5.67    23.669  0    108    ? 85   ASN A HA     1 
ATOM   1343  H HB2    . ASN A 1 89  ? -47.437  7.212   25.56   0    106.69 ? 85   ASN A HB2    1 
ATOM   1344  H HB3    . ASN A 1 89  ? -45.677  6.977   25.698  0    110.02 ? 85   ASN A HB3    1 
ATOM   1345  H HD21   . ASN A 1 89  ? -44.938  9.229   22.988  0    112.01 ? 85   ASN A HD21   1 
ATOM   1346  H HD22   . ASN A 1 89  ? -44.43   7.681   23.649  0    113.43 ? 85   ASN A HD22   1 
ATOM   1347  N N      . ALA A 1 90  ? -46.002  3.557   24.979  1    64.09  ? 86   ALA A N      1 
ATOM   1348  C CA     . ALA A 1 90  ? -46.062  2.366   25.826  1    64.86  ? 86   ALA A CA     1 
ATOM   1349  C C      . ALA A 1 90  ? -45.09   2.5     26.999  1    67.64  ? 86   ALA A C      1 
ATOM   1350  O O      . ALA A 1 90  ? -44.025  3.106   26.851  1    69.55  ? 86   ALA A O      1 
ATOM   1351  C CB     . ALA A 1 90  ? -45.689  1.145   25.007  1    65.51  ? 86   ALA A CB     1 
ATOM   1352  H H      . ALA A 1 90  ? -45.27   3.501   24.279  0    112.04 ? 86   ALA A H      1 
ATOM   1353  H HA     . ALA A 1 90  ? -47.066  2.212   26.217  0    111.13 ? 86   ALA A HA     1 
ATOM   1354  H HB1    . ALA A 1 90  ? -46.041  0.249   25.516  0    114.54 ? 86   ALA A HB1    1 
ATOM   1355  H HB2    . ALA A 1 90  ? -46.139  1.222   24.02   0    112.63 ? 86   ALA A HB2    1 
ATOM   1356  H HB3    . ALA A 1 90  ? -44.604  1.109   24.912  0    116.29 ? 86   ALA A HB3    1 
ATOM   1357  N N      . CYS A 1 91  ? -45.437  1.917   28.155  1    68.09  ? 87   CYS A N      1 
ATOM   1358  C CA     . CYS A 1 91  ? -44.558  1.957   29.317  1    70.98  ? 87   CYS A CA     1 
ATOM   1359  C C      . CYS A 1 91  ? -44.97   0.957   30.392  1    71.72  ? 87   CYS A C      1 
ATOM   1360  O O      . CYS A 1 91  ? -46.16   0.734   30.608  1    69.68  ? 87   CYS A O      1 
ATOM   1361  C CB     . CYS A 1 91  ? -44.464  3.369   29.885  1    71.19  ? 87   CYS A CB     1 
ATOM   1362  S SG     . CYS A 1 91  ? -46.036  4.013   30.498  1    68.68  ? 87   CYS A SG     1 
ATOM   1363  H H      . CYS A 1 91  ? -46.306  1.415   28.311  0    118.4  ? 87   CYS A H      1 
ATOM   1364  H HA     . CYS A 1 91  ? -43.559  1.667   28.996  0    128.13 ? 87   CYS A HA     1 
ATOM   1365  H HB2    . CYS A 1 91  ? -43.767  3.355   30.723  0    129.16 ? 87   CYS A HB2    1 
ATOM   1366  H HB3    . CYS A 1 91  ? -44.097  4.053   29.122  0    126.46 ? 87   CYS A HB3    1 
ATOM   1367  H HG     . CYS A 1 91  ? -46.538  3.188   31.426  0    120.73 ? 87   CYS A HG     1 
ATOM   1368  N N      . ILE A 1 92  ? -43.972  0.366   31.071  1    74.9   ? 88   ILE A N      1 
ATOM   1369  C CA     . ILE A 1 92  ? -44.187  -0.574  32.162  1    76.37  ? 88   ILE A CA     1 
ATOM   1370  C C      . ILE A 1 92  ? -43.777  0.16    33.422  1    78.53  ? 88   ILE A C      1 
ATOM   1371  O O      . ILE A 1 92  ? -42.609  0.507   33.568  1    81.06  ? 88   ILE A O      1 
ATOM   1372  C CB     . ILE A 1 92  ? -43.372  -1.875  31.98   1    78.81  ? 88   ILE A CB     1 
ATOM   1373  C CG1    . ILE A 1 92  ? -43.649  -2.502  30.595  1    77.01  ? 88   ILE A CG1    1 
ATOM   1374  C CG2    . ILE A 1 92  ? -43.699  -2.861  33.12   1    80.28  ? 88   ILE A CG2    1 
ATOM   1375  C CD1    . ILE A 1 92  ? -42.78   -3.686  30.231  1    79.55  ? 88   ILE A CD1    1 
ATOM   1376  H H      . ILE A 1 92  ? -42.988  0.529   30.886  0    136.7  ? 88   ILE A H      1 
ATOM   1377  H HA     . ILE A 1 92  ? -45.239  -0.845  32.232  0    136.01 ? 88   ILE A HA     1 
ATOM   1378  H HB     . ILE A 1 92  ? -42.312  -1.631  32.035  0    145.65 ? 88   ILE A HB     1 
ATOM   1379  H HG12   . ILE A 1 92  ? -44.685  -2.839  30.571  0    137.41 ? 88   ILE A HG12   1 
ATOM   1380  H HG13   . ILE A 1 92  ? -43.493  -1.755  29.817  0    138.1  ? 88   ILE A HG13   1 
ATOM   1381  H HG21   . ILE A 1 92  ? -43.103  -3.765  33.009  0    148.57 ? 88   ILE A HG21   1 
ATOM   1382  H HG22   . ILE A 1 92  ? -43.465  -2.41   34.082  0    148.04 ? 88   ILE A HG22   1 
ATOM   1383  H HG23   . ILE A 1 92  ? -44.759  -3.107  33.078  0    144.4  ? 88   ILE A HG23   1 
ATOM   1384  H HD11   . ILE A 1 92  ? -42.944  -3.934  29.183  0    143.55 ? 88   ILE A HD11   1 
ATOM   1385  H HD12   . ILE A 1 92  ? -41.736  -3.426  30.398  0    147.21 ? 88   ILE A HD12   1 
ATOM   1386  H HD13   . ILE A 1 92  ? -43.057  -4.541  30.845  0    145.82 ? 88   ILE A HD13   1 
ATOM   1387  N N      . LEU A 1 93  ? -44.727  0.403   34.323  1    77.7   ? 89   LEU A N      1 
ATOM   1388  C CA     . LEU A 1 93  ? -44.483  1.128   35.563  1    79.57  ? 89   LEU A CA     1 
ATOM   1389  C C      . LEU A 1 93  ? -44.441  0.19    36.782  1    82.01  ? 89   LEU A C      1 
ATOM   1390  O O      . LEU A 1 93  ? -44.954  -0.926  36.726  1    81.4   ? 89   LEU A O      1 
ATOM   1391  C CB     . LEU A 1 93  ? -45.59   2.17    35.755  1    76.97  ? 89   LEU A CB     1 
ATOM   1392  C CG     . LEU A 1 93  ? -45.826  3.144   34.602  1    74.54  ? 89   LEU A CG     1 
ATOM   1393  C CD1    . LEU A 1 93  ? -47.095  3.934   34.826  1    72.11  ? 89   LEU A CD1    1 
ATOM   1394  C CD2    . LEU A 1 93  ? -44.63   4.057   34.393  1    76.54  ? 89   LEU A CD2    1 
ATOM   1395  H H      . LEU A 1 93  ? -45.692  0.104   34.228  0    138.92 ? 89   LEU A H      1 
ATOM   1396  H HA     . LEU A 1 93  ? -43.534  1.661   35.52   0    146.8  ? 89   LEU A HA     1 
ATOM   1397  H HB2    . LEU A 1 93  ? -46.525  1.639   35.922  0    137.96 ? 89   LEU A HB2    1 
ATOM   1398  H HB3    . LEU A 1 93  ? -45.355  2.759   36.64   0    140.99 ? 89   LEU A HB3    1 
ATOM   1399  H HG     . LEU A 1 93  ? -45.968  2.58    33.681  0    132.59 ? 89   LEU A HG     1 
ATOM   1400  H HD11   . LEU A 1 93  ? -47.262  4.592   33.974  0    126.91 ? 89   LEU A HD11   1 
ATOM   1401  H HD12   . LEU A 1 93  ? -47.932  3.244   34.926  0    127.21 ? 89   LEU A HD12   1 
ATOM   1402  H HD13   . LEU A 1 93  ? -46.99   4.524   35.735  0    129.84 ? 89   LEU A HD13   1 
ATOM   1403  H HD21   . LEU A 1 93  ? -44.954  4.959   33.877  0    136.54 ? 89   LEU A HD21   1 
ATOM   1404  H HD22   . LEU A 1 93  ? -44.187  4.312   35.355  0    140.41 ? 89   LEU A HD22   1 
ATOM   1405  H HD23   . LEU A 1 93  ? -43.907  3.529   33.773  0    139.09 ? 89   LEU A HD23   1 
ATOM   1406  N N      . GLU A 1 94  ? -43.828  0.656   37.884  1    84.93  ? 90   GLU A N      1 
ATOM   1407  C CA     . GLU A 1 94  ? -43.726  -0.085  39.142  1    87.8   ? 90   GLU A CA     1 
ATOM   1408  C C      . GLU A 1 94  ? -44.013  0.871   40.307  1    88.9   ? 90   GLU A C      1 
ATOM   1409  O O      . GLU A 1 94  ? -43.505  1.995   40.321  1    89.82  ? 90   GLU A O      1 
ATOM   1410  C CB     . GLU A 1 94  ? -42.312  -0.675  39.296  1    91.72  ? 90   GLU A CB     1 
ATOM   1411  C CG     . GLU A 1 94  ? -42.132  -1.569  40.515  1    94.94  ? 90   GLU A CG     1 
ATOM   1412  C CD     . GLU A 1 94  ? -40.691  -1.869  40.871  1    99.49  ? 90   GLU A CD     1 
ATOM   1413  O OE1    . GLU A 1 94  ? -39.856  -1.958  39.943  1    99.99  ? 90   GLU A OE1    1 
ATOM   1414  O OE2    . GLU A 1 94  ? -40.395  -2.009  42.081  1    102.76 ? 90   GLU A OE2    1 
ATOM   1415  H H      . GLU A 1 94  ? -43.37   1.561   37.923  0    157.51 ? 90   GLU A H      1 
ATOM   1416  H HA     . GLU A 1 94  ? -44.447  -0.901  39.172  0    162.15 ? 90   GLU A HA     1 
ATOM   1417  H HB2    . GLU A 1 94  ? -42.086  -1.268  38.412  0    171.13 ? 90   GLU A HB2    1 
ATOM   1418  H HB3    . GLU A 1 94  ? -41.602  0.147   39.379  0    173.25 ? 90   GLU A HB3    1 
ATOM   1419  H HG2    . GLU A 1 94  ? -42.572  -1.098  41.391  0    179.32 ? 90   GLU A HG2    1 
ATOM   1420  H HG3    . GLU A 1 94  ? -42.626  -2.52   40.322  0    178.06 ? 90   GLU A HG3    1 
ATOM   1421  N N      . TYR A 1 95  ? -44.818  0.422   41.285  1    89.11  ? 91   TYR A N      1 
ATOM   1422  C CA     . TYR A 1 95  ? -45.111  1.193   42.497  1    90.56  ? 91   TYR A CA     1 
ATOM   1423  C C      . TYR A 1 95  ? -43.955  0.938   43.481  1    95.29  ? 91   TYR A C      1 
ATOM   1424  O O      . TYR A 1 95  ? -43.569  -0.222  43.661  1    97.26  ? 91   TYR A O      1 
ATOM   1425  C CB     . TYR A 1 95  ? -46.432  0.708   43.129  1    89.44  ? 91   TYR A CB     1 
ATOM   1426  C CG     . TYR A 1 95  ? -46.948  1.579   44.253  1    90.49  ? 91   TYR A CG     1 
ATOM   1427  C CD1    . TYR A 1 95  ? -46.568  1.358   45.565  1    94.3   ? 91   TYR A CD1    1 
ATOM   1428  C CD2    . TYR A 1 95  ? -47.867  2.59    44.006  1    87.86  ? 91   TYR A CD2    1 
ATOM   1429  C CE1    . TYR A 1 95  ? -47.064  2.136   46.603  1    95.43  ? 91   TYR A CE1    1 
ATOM   1430  C CE2    . TYR A 1 95  ? -48.363  3.381   45.033  1    88.96  ? 91   TYR A CE2    1 
ATOM   1431  C CZ     . TYR A 1 95  ? -47.968  3.148   46.333  1    92.75  ? 91   TYR A CZ     1 
ATOM   1432  O OH     . TYR A 1 95  ? -48.479  3.94    47.338  1    94.11  ? 91   TYR A OH     1 
ATOM   1433  H H      . TYR A 1 95  ? -45.297  -0.473  41.261  0    165.84 ? 91   TYR A H      1 
ATOM   1434  H HA     . TYR A 1 95  ? -45.187  2.258   42.28   0    168.35 ? 91   TYR A HA     1 
ATOM   1435  H HB2    . TYR A 1 95  ? -47.197  0.677   42.357  0    163.84 ? 91   TYR A HB2    1 
ATOM   1436  H HB3    . TYR A 1 95  ? -46.28   -0.293  43.533  0    168.75 ? 91   TYR A HB3    1 
ATOM   1437  H HD1    . TYR A 1 95  ? -45.867  0.569   45.785  0    180.13 ? 91   TYR A HD1    1 
ATOM   1438  H HD2    . TYR A 1 95  ? -48.186  2.775   42.997  0    160.5  ? 91   TYR A HD2    1 
ATOM   1439  H HE1    . TYR A 1 95  ? -46.739  1.946   47.612  0    183.49 ? 91   TYR A HE1    1 
ATOM   1440  H HE2    . TYR A 1 95  ? -49.07   4.164   44.819  0    163.82 ? 91   TYR A HE2    1 
ATOM   1441  H HH     . TYR A 1 95  ? -48.084  3.696   48.217  0    180.21 ? 91   TYR A HH     1 
ATOM   1442  N N      . LYS A 1 96  ? -43.388  1.987   44.101  1    97.38  ? 92   LYS A N      1 
ATOM   1443  C CA     . LYS A 1 96  ? -42.301  1.786   45.057  1    102.2  ? 92   LYS A CA     1 
ATOM   1444  C C      . LYS A 1 96  ? -42.384  2.862   46.123  1    104.1  ? 92   LYS A C      1 
ATOM   1445  O O      . LYS A 1 96  ? -42.287  4.046   45.812  1    103.27 ? 92   LYS A O      1 
ATOM   1446  C CB     . LYS A 1 96  ? -40.937  1.778   44.336  1    103.87 ? 92   LYS A CB     1 
ATOM   1447  C CG     . LYS A 1 96  ? -39.871  0.929   45.015  1    108.74 ? 92   LYS A CG     1 
ATOM   1448  C CD     . LYS A 1 96  ? -38.754  0.555   44.076  1    109.81 ? 92   LYS A CD     1 
ATOM   1449  C CE     . LYS A 1 96  ? -37.742  -0.306  44.778  1    114.56 ? 92   LYS A CE     1 
ATOM   1450  N NZ     . LYS A 1 96  ? -36.493  -0.423  43.994  1    116.53 ? 92   LYS A NZ     1 
ATOM   1451  H H      . LYS A 1 96  ? -43.657  2.956   43.966  0    183.12 ? 92   LYS A H      1 
ATOM   1452  H HA     . LYS A 1 96  ? -42.46   0.825   45.543  0    196.42 ? 92   LYS A HA     1 
ATOM   1453  H HB2    . LYS A 1 96  ? -41.079  1.387   43.329  0    196.32 ? 92   LYS A HB2    1 
ATOM   1454  H HB3    . LYS A 1 96  ? -40.558  2.797   44.278  0    198.84 ? 92   LYS A HB3    1 
ATOM   1455  H HG2    . LYS A 1 96  ? -39.441  1.5     45.838  0    212.01 ? 92   LYS A HG2    1 
ATOM   1456  H HG3    . LYS A 1 96  ? -40.315  0.009   45.391  0    209.88 ? 92   LYS A HG3    1 
ATOM   1457  H HD2    . LYS A 1 96  ? -39.158  -0.004  43.234  0    208.86 ? 92   LYS A HD2    1 
ATOM   1458  H HD3    . LYS A 1 96  ? -38.255  1.459   43.729  0    211.85 ? 92   LYS A HD3    1 
ATOM   1459  H HE2    . LYS A 1 96  ? -37.498  0.136   45.743  0    224.86 ? 92   LYS A HE2    1 
ATOM   1460  H HE3    . LYS A 1 96  ? -38.156  -1.304  44.914  0    221.79 ? 92   LYS A HE3    1 
ATOM   1461  H HZ1    . LYS A 1 96  ? -35.843  -1.041  44.469  0    229.77 ? 92   LYS A HZ1    1 
ATOM   1462  H HZ2    . LYS A 1 96  ? -36.697  -0.803  43.075  0    223.98 ? 92   LYS A HZ2    1 
ATOM   1463  H HZ3    . LYS A 1 96  ? -36.064  0.49    43.886  0    226.89 ? 92   LYS A HZ3    1 
ATOM   1464  N N      . GLN A 1 97  ? -42.623  2.447   47.374  1    106.78 ? 93   GLN A N      1 
ATOM   1465  C CA     . GLN A 1 97  ? -42.784  3.343   48.507  1    109.02 ? 93   GLN A CA     1 
ATOM   1466  C C      . GLN A 1 97  ? -41.648  3.151   49.49   1    114.47 ? 93   GLN A C      1 
ATOM   1467  O O      . GLN A 1 97  ? -41.28   2.02    49.79   1    116.71 ? 93   GLN A O      1 
ATOM   1468  C CB     . GLN A 1 97  ? -44.121  3.047   49.19   1    107.95 ? 93   GLN A CB     1 
ATOM   1469  C CG     . GLN A 1 97  ? -44.468  4.03    50.298  1    109.72 ? 93   GLN A CG     1 
ATOM   1470  C CD     . GLN A 1 97  ? -45.924  3.966   50.703  1    108.07 ? 93   GLN A CD     1 
ATOM   1471  O OE1    . GLN A 1 97  ? -46.798  3.468   49.972  1    104.65 ? 93   GLN A OE1    1 
ATOM   1472  N NE2    . GLN A 1 97  ? -46.222  4.493   51.882  1    110.65 ? 93   GLN A NE2    1 
ATOM   1473  H H      . GLN A 1 97  ? -42.7    1.47    47.638  0    206.04 ? 93   GLN A H      1 
ATOM   1474  H HA     . GLN A 1 97  ? -42.802  4.383   48.186  0    208.77 ? 93   GLN A HA     1 
ATOM   1475  H HB2    . GLN A 1 97  ? -44.898  3.089   48.429  0    203.91 ? 93   GLN A HB2    1 
ATOM   1476  H HB3    . GLN A 1 97  ? -44.082  2.051   49.629  0    209.44 ? 93   GLN A HB3    1 
ATOM   1477  H HG2    . GLN A 1 97  ? -43.869  3.801   51.177  0    215.43 ? 93   GLN A HG2    1 
ATOM   1478  H HG3    . GLN A 1 97  ? -44.258  5.043   49.956  0    210.52 ? 93   GLN A HG3    1 
ATOM   1479  H HE21   . GLN A 1 97  ? -45.493  4.907   52.454  0    216.32 ? 93   GLN A HE21   1 
ATOM   1480  H HE22   . GLN A 1 97  ? -47.181  4.485   52.214  0    212.5  ? 93   GLN A HE22   1 
ATOM   1481  N N      . SER A 1 98  ? -41.094  4.255   49.985  1    116.8  ? 94   SER A N      1 
ATOM   1482  C CA     . SER A 1 98  ? -40.014  4.235   50.96   1    122.27 ? 94   SER A CA     1 
ATOM   1483  C C      . SER A 1 98  ? -40.474  5.033   52.171  1    124.32 ? 94   SER A C      1 
ATOM   1484  O O      . SER A 1 98  ? -40.175  6.221   52.294  1    125.3  ? 94   SER A O      1 
ATOM   1485  C CB     . SER A 1 98  ? -38.752  4.836   50.356  1    123.62 ? 94   SER A CB     1 
ATOM   1486  O OG     . SER A 1 98  ? -38.326  4.045   49.258  1    122.43 ? 94   SER A OG     1 
ATOM   1487  H H      . SER A 1 98  ? -41.359  5.198   49.719  0    225.41 ? 94   SER A H      1 
ATOM   1488  H HA     . SER A 1 98  ? -39.787  3.222   51.288  0    241.1  ? 94   SER A HA     1 
ATOM   1489  H HB2    . SER A 1 98  ? -38.965  5.842   49.997  0    239.94 ? 94   SER A HB2    1 
ATOM   1490  H HB3    . SER A 1 98  ? -37.97   4.864   51.113  0    246.25 ? 94   SER A HB3    1 
ATOM   1491  H HG     . SER A 1 98  ? -37.447  4.372   48.929  0    240.51 ? 94   SER A HG     1 
ATOM   1492  N N      . GLY A 1 99  ? -41.246  4.371   53.027  1    124.98 ? 95   GLY A N      1 
ATOM   1493  C CA     . GLY A 1 99  ? -41.831  4.988   54.206  1    126.94 ? 95   GLY A CA     1 
ATOM   1494  C C      . GLY A 1 99  ? -43.039  5.802   53.799  1    122.67 ? 95   GLY A C      1 
ATOM   1495  O O      . GLY A 1 99  ? -44.148  5.272   53.715  1    119.8  ? 95   GLY A O      1 
ATOM   1496  H H      . GLY A 1 99  ? -41.487  3.391   52.925  0    244.34 ? 95   GLY A H      1 
ATOM   1497  H HA2    . GLY A 1 99  ? -42.15   4.217   54.905  0    251    ? 95   GLY A HA2    1 
ATOM   1498  H HA3    . GLY A 1 99  ? -41.109  5.633   54.703  0    252.55 ? 95   GLY A HA3    1 
ATOM   1499  N N      . GLU A 1 100 ? -42.803  7.08    53.475  1    122.36 ? 96   GLU A N      1 
ATOM   1500  C CA     . GLU A 1 100 ? -43.828  8.032   53.036  1    118.64 ? 96   GLU A CA     1 
ATOM   1501  C C      . GLU A 1 100 ? -43.687  8.375   51.542  1    114.58 ? 96   GLU A C      1 
ATOM   1502  O O      . GLU A 1 100 ? -44.691  8.662   50.885  1    110.64 ? 96   GLU A O      1 
ATOM   1503  C CB     . GLU A 1 100 ? -43.711  9.325   53.857  1    121.39 ? 96   GLU A CB     1 
ATOM   1504  C CG     . GLU A 1 100 ? -44.14   9.18    55.308  1    124.71 ? 96   GLU A CG     1 
ATOM   1505  C CD     . GLU A 1 100 ? -45.641  9.19    55.553  1    122.05 ? 96   GLU A CD     1 
ATOM   1506  O OE1    . GLU A 1 100 ? -46.419  9.316   54.576  1    117.43 ? 96   GLU A OE1    1 
ATOM   1507  O OE2    . GLU A 1 100 ? -46.038  9.077   56.735  1    124.84 ? 96   GLU A OE2    1 
ATOM   1508  H H      . GLU A 1 100 ? -41.876  7.493   53.511  0    241.43 ? 96   GLU A H      1 
ATOM   1509  H HA     . GLU A 1 100 ? -44.824  7.624   53.199  0    229.13 ? 96   GLU A HA     1 
ATOM   1510  H HB2    . GLU A 1 100 ? -42.67   9.646   53.85   0    239.45 ? 96   GLU A HB2    1 
ATOM   1511  H HB3    . GLU A 1 100 ? -44.32   10.099  53.393  0    234.2  ? 96   GLU A HB3    1 
ATOM   1512  H HG2    . GLU A 1 100 ? -43.747  8.242   55.699  0    246.35 ? 96   GLU A HG2    1 
ATOM   1513  H HG3    . GLU A 1 100 ? -43.715  10.008  55.873  0    246.9  ? 96   GLU A HG3    1 
ATOM   1514  N N      . SER A 1 101 ? -42.437  8.39    51.026  1    115.83 ? 97   SER A N      1 
ATOM   1515  C CA     . SER A 1 101 ? -42.125  8.735   49.633  1    112.61 ? 97   SER A CA     1 
ATOM   1516  C C      . SER A 1 101 ? -42.751  7.763   48.625  1    108.71 ? 97   SER A C      1 
ATOM   1517  O O      . SER A 1 101 ? -42.186  6.695   48.372  1    109.82 ? 97   SER A O      1 
ATOM   1518  C CB     . SER A 1 101 ? -40.613  8.788   49.425  1    115.66 ? 97   SER A CB     1 
ATOM   1519  O OG     . SER A 1 101 ? -39.994  9.587   50.418  1    119.76 ? 97   SER A OG     1 
ATOM   1520  H H      . SER A 1 101 ? -41.609  8.18    51.574  0    228.34 ? 97   SER A H      1 
ATOM   1521  H HA     . SER A 1 101 ? -42.516  9.731   49.429  0    216.26 ? 97   SER A HA     1 
ATOM   1522  H HB2    . SER A 1 101 ? -40.196  7.784   49.492  0    226.06 ? 97   SER A HB2    1 
ATOM   1523  H HB3    . SER A 1 101 ? -40.402  9.218   48.448  0    222.4  ? 97   SER A HB3    1 
ATOM   1524  H HG     . SER A 1 101 ? -39.048  9.767   50.176  0    235.57 ? 97   SER A HG     1 
ATOM   1525  N N      . ILE A 1 102 ? -43.913  8.144   48.042  1    104.37 ? 98   ILE A N      1 
ATOM   1526  C CA     . ILE A 1 102 ? -44.616  7.321   47.055  1    100.56 ? 98   ILE A CA     1 
ATOM   1527  C C      . ILE A 1 102 ? -44.226  7.769   45.647  1    98.1   ? 98   ILE A C      1 
ATOM   1528  O O      . ILE A 1 102 ? -44.465  8.919   45.287  1    96.98  ? 98   ILE A O      1 
ATOM   1529  C CB     . ILE A 1 102 ? -46.143  7.383   47.265  1    97.67  ? 98   ILE A CB     1 
ATOM   1530  C CG1    . ILE A 1 102 ? -46.528  6.755   48.619  1    100.33 ? 98   ILE A CG1    1 
ATOM   1531  C CG2    . ILE A 1 102 ? -46.85   6.658   46.12   1    93.74  ? 98   ILE A CG2    1 
ATOM   1532  C CD1    . ILE A 1 102 ? -47.896  7.146   49.153  1    98.7   ? 98   ILE A CD1    1 
ATOM   1533  H H      . ILE A 1 102 ? -44.384  9.02    48.244  0    199.12 ? 98   ILE A H      1 
ATOM   1534  H HA     . ILE A 1 102 ? -44.329  6.278   47.181  0    192.42 ? 98   ILE A HA     1 
ATOM   1535  H HB     . ILE A 1 102 ? -46.457  8.426   47.264  0    184.31 ? 98   ILE A HB     1 
ATOM   1536  H HG12   . ILE A 1 102 ? -46.522  5.671   48.508  0    190.82 ? 98   ILE A HG12   1 
ATOM   1537  H HG13   . ILE A 1 102 ? -45.8    7.04    49.377  0    194.32 ? 98   ILE A HG13   1 
ATOM   1538  H HG21   . ILE A 1 102 ? -47.854  6.374   46.429  0    174.73 ? 98   ILE A HG21   1 
ATOM   1539  H HG22   . ILE A 1 102 ? -46.92   7.32    45.258  0    174.2  ? 98   ILE A HG22   1 
ATOM   1540  H HG23   . ILE A 1 102 ? -46.284  5.764   45.859  0    177.01 ? 98   ILE A HG23   1 
ATOM   1541  H HD11   . ILE A 1 102 ? -47.98   6.797   50.181  0    189.99 ? 98   ILE A HD11   1 
ATOM   1542  H HD12   . ILE A 1 102 ? -47.997  8.23    49.117  0    187.41 ? 98   ILE A HD12   1 
ATOM   1543  H HD13   . ILE A 1 102 ? -48.675  6.678   48.555  0    184.45 ? 98   ILE A HD13   1 
ATOM   1544  N N      . ASP A 1 103 ? -43.647  6.847   44.851  1    97.5   ? 99   ASP A N      1 
ATOM   1545  C CA     . ASP A 1 103 ? -43.174  7.106   43.489  1    95.63  ? 99   ASP A CA     1 
ATOM   1546  C C      . ASP A 1 103 ? -43.641  6.033   42.52   1    92.65  ? 99   ASP A C      1 
ATOM   1547  O O      . ASP A 1 103 ? -43.794  4.875   42.905  1    93.46  ? 99   ASP A O      1 
ATOM   1548  C CB     . ASP A 1 103 ? -41.638  7.099   43.467  1    99.25  ? 99   ASP A CB     1 
ATOM   1549  C CG     . ASP A 1 103 ? -41.001  8.077   44.43   1    102.9  ? 99   ASP A CG     1 
ATOM   1550  O OD1    . ASP A 1 103 ? -41.373  9.275   44.388  1    101.92 ? 99   ASP A OD1    1 
ATOM   1551  O OD2    . ASP A 1 103 ? -40.114  7.645   45.228  1    106.96 ? 99   ASP A OD2    1 
ATOM   1552  H H      . ASP A 1 103 ? -43.485  5.886   45.134  0    185.68 ? 99   ASP A H      1 
ATOM   1553  H HA     . ASP A 1 103 ? -43.518  8.075   43.133  0    178.75 ? 99   ASP A HA     1 
ATOM   1554  H HB2    . ASP A 1 103 ? -41.287  6.101   43.727  0    189.77 ? 99   ASP A HB2    1 
ATOM   1555  H HB3    . ASP A 1 103 ? -41.297  7.352   42.464  0    186.82 ? 99   ASP A HB3    1 
ATOM   1556  N N      . ILE A 1 104 ? -43.795  6.409   41.243  1    89.51  ? 100  ILE A N      1 
ATOM   1557  C CA     . ILE A 1 104 ? -44.181  5.493   40.169  1    86.66  ? 100  ILE A CA     1 
ATOM   1558  C C      . ILE A 1 104 ? -42.99   5.413   39.2    1    87.46  ? 100  ILE A C      1 
ATOM   1559  O O      . ILE A 1 104 ? -42.819  6.276   38.337  1    85.93  ? 100  ILE A O      1 
ATOM   1560  C CB     . ILE A 1 104 ? -45.497  5.96    39.475  1    82.58  ? 100  ILE A CB     1 
ATOM   1561  C CG1    . ILE A 1 104 ? -46.663  6.11    40.49   1    82.15  ? 100  ILE A CG1    1 
ATOM   1562  C CG2    . ILE A 1 104 ? -45.884  5.009   38.346  1    79.9   ? 100  ILE A CG2    1 
ATOM   1563  C CD1    . ILE A 1 104 ? -47.016  4.871   41.293  1    83.3   ? 100  ILE A CD1    1 
ATOM   1564  H H      . ILE A 1 104 ? -43.658  7.359   40.914  0    166.48 ? 100  ILE A H      1 
ATOM   1565  H HA     . ILE A 1 104 ? -44.354  4.49    40.556  0    161.22 ? 100  ILE A HA     1 
ATOM   1566  H HB     . ILE A 1 104 ? -45.318  6.94    39.037  0    151.14 ? 100  ILE A HB     1 
ATOM   1567  H HG12   . ILE A 1 104 ? -46.414  6.899   41.197  0    152.45 ? 100  ILE A HG12   1 
ATOM   1568  H HG13   . ILE A 1 104 ? -47.559  6.394   39.941  0    147.94 ? 100  ILE A HG13   1 
ATOM   1569  H HG21   . ILE A 1 104 ? -46.9    5.235   38.025  0    143.16 ? 100  ILE A HG21   1 
ATOM   1570  H HG22   . ILE A 1 104 ? -45.202  5.141   37.508  0    145.81 ? 100  ILE A HG22   1 
ATOM   1571  H HG23   . ILE A 1 104 ? -45.83   3.986   38.714  0    146.68 ? 100  ILE A HG23   1 
ATOM   1572  H HD11   . ILE A 1 104 ? -47.918  5.077   41.866  0    152.79 ? 100  ILE A HD11   1 
ATOM   1573  H HD12   . ILE A 1 104 ? -47.188  4.033   40.62   0    151.91 ? 100  ILE A HD12   1 
ATOM   1574  H HD13   . ILE A 1 104 ? -46.198  4.64    41.974  0    156.39 ? 100  ILE A HD13   1 
ATOM   1575  N N      . ILE A 1 105 ? -42.146  4.393   39.382  1    90.04  ? 101  ILE A N      1 
ATOM   1576  C CA     . ILE A 1 105 ? -40.946  4.193   38.573  1    91.59  ? 101  ILE A CA     1 
ATOM   1577  C C      . ILE A 1 105 ? -41.33   3.752   37.18   1    88.43  ? 101  ILE A C      1 
ATOM   1578  O O      . ILE A 1 105 ? -42.237  2.943   37.026  1    86.33  ? 101  ILE A O      1 
ATOM   1579  C CB     . ILE A 1 105 ? -40.009  3.146   39.244  1    95.57  ? 101  ILE A CB     1 
ATOM   1580  C CG1    . ILE A 1 105 ? -39.379  3.715   40.526  1    99.5   ? 101  ILE A CG1    1 
ATOM   1581  C CG2    . ILE A 1 105 ? -38.902  2.673   38.287  1    96.8   ? 101  ILE A CG2    1 
ATOM   1582  C CD1    . ILE A 1 105 ? -40.336  4.149   41.609  1    99.19  ? 101  ILE A CD1    1 
ATOM   1583  H H      . ILE A 1 105 ? -42.277  3.681   40.092  0    169.34 ? 101  ILE A H      1 
ATOM   1584  H HA     . ILE A 1 105 ? -40.405  5.135   38.504  0    172.4  ? 101  ILE A HA     1 
ATOM   1585  H HB     . ILE A 1 105 ? -40.594  2.268   39.512  0    179.65 ? 101  ILE A HB     1 
ATOM   1586  H HG12   . ILE A 1 105 ? -38.736  2.953   40.963  0    191.67 ? 101  ILE A HG12   1 
ATOM   1587  H HG13   . ILE A 1 105 ? -38.778  4.583   40.257  0    189.49 ? 101  ILE A HG13   1 
ATOM   1588  H HG21   . ILE A 1 105 ? -38.126  2.171   38.862  0    186.17 ? 101  ILE A HG21   1 
ATOM   1589  H HG22   . ILE A 1 105 ? -39.313  1.969   37.565  0    180.76 ? 101  ILE A HG22   1 
ATOM   1590  H HG23   . ILE A 1 105 ? -38.482  3.534   37.768  0    182.92 ? 101  ILE A HG23   1 
ATOM   1591  H HD11   . ILE A 1 105 ? -39.763  4.388   42.504  0    191.38 ? 101  ILE A HD11   1 
ATOM   1592  H HD12   . ILE A 1 105 ? -40.875  5.035   41.278  0    185.96 ? 101  ILE A HD12   1 
ATOM   1593  H HD13   . ILE A 1 105 ? -41.032  3.337   41.813  0    186.88 ? 101  ILE A HD13   1 
ATOM   1594  N N      . THR A 1 106 ? -40.593  4.226   36.174  1    88.37  ? 102  THR A N      1 
ATOM   1595  C CA     . THR A 1 106 ? -40.82   3.828   34.789  1    85.87  ? 102  THR A CA     1 
ATOM   1596  C C      . THR A 1 106 ? -39.773  2.777   34.428  1    88.31  ? 102  THR A C      1 
ATOM   1597  O O      . THR A 1 106 ? -38.673  3.123   33.992  1    90.47  ? 102  THR A O      1 
ATOM   1598  C CB     . THR A 1 106 ? -40.784  5.051   33.872  1    84.48  ? 102  THR A CB     1 
ATOM   1599  O OG1    . THR A 1 106 ? -41.859  5.922   34.235  1    82.48  ? 102  THR A OG1    1 
ATOM   1600  C CG2    . THR A 1 106 ? -40.895  4.678   32.402  1    82.18  ? 102  THR A CG2    1 
ATOM   1601  H H      . THR A 1 106 ? -39.827  4.882   36.286  0    166.25 ? 102  THR A H      1 
ATOM   1602  H HA     . THR A 1 106 ? -41.8    3.369   34.68   0    156.38 ? 102  THR A HA     1 
ATOM   1603  H HB     . THR A 1 106 ? -39.84   5.575   34.014  0    158.08 ? 102  THR A HB     1 
ATOM   1604  H HG1    . THR A 1 106 ? -41.659  6.847   33.936  0    150.7  ? 102  THR A HG1    1 
ATOM   1605  H HG21   . THR A 1 106 ? -41.08   5.574   31.811  0    149.47 ? 102  THR A HG21   1 
ATOM   1606  H HG22   . THR A 1 106 ? -39.97   4.223   32.05   0    152.44 ? 102  THR A HG22   1 
ATOM   1607  H HG23   . THR A 1 106 ? -41.716  3.977   32.255  0    148.48 ? 102  THR A HG23   1 
ATOM   1608  N N      . ARG A 1 107 ? -40.115  1.49    34.645  1    88.23  ? 103  ARG A N      1 
ATOM   1609  C CA     . ARG A 1 107 ? -39.227  0.353   34.38   1    90.7   ? 103  ARG A CA     1 
ATOM   1610  C C      . ARG A 1 107 ? -38.842  0.182   32.891  1    89.69  ? 103  ARG A C      1 
ATOM   1611  O O      . ARG A 1 107 ? -37.725  -0.243  32.601  1    92.58  ? 103  ARG A O      1 
ATOM   1612  C CB     . ARG A 1 107 ? -39.857  -0.952  34.905  1    90.54  ? 103  ARG A CB     1 
ATOM   1613  C CG     . ARG A 1 107 ? -39.787  -1.143  36.427  1    93.21  ? 103  ARG A CG     1 
ATOM   1614  C CD     . ARG A 1 107 ? -38.452  -1.725  36.894  1    97.91  ? 103  ARG A CD     1 
ATOM   1615  N NE     . ARG A 1 107 ? -38.208  -3.082  36.393  1    98.91  ? 103  ARG A NE     1 
ATOM   1616  C CZ     . ARG A 1 107 ? -38.753  -4.197  36.881  1    99.35  ? 103  ARG A CZ     1 
ATOM   1617  N NH1    . ARG A 1 107 ? -39.612  -4.14   37.895  1    98.84  ? 103  ARG A NH1    1 
ATOM   1618  N NH2    . ARG A 1 107 ? -38.455  -5.377  36.348  1    100.47 ? 103  ARG A NH2    1 
ATOM   1619  H H      . ARG A 1 107 ? -41.014  1.213   35.027  0    162.46 ? 103  ARG A H      1 
ATOM   1620  H HA     . ARG A 1 107 ? -38.301  0.521   34.928  0    172.69 ? 103  ARG A HA     1 
ATOM   1621  H HB2    . ARG A 1 107 ? -40.906  -0.99   34.617  0    166.19 ? 103  ARG A HB2    1 
ATOM   1622  H HB3    . ARG A 1 107 ? -39.336  -1.786  34.438  0    170.51 ? 103  ARG A HB3    1 
ATOM   1623  H HG2    . ARG A 1 107 ? -39.924  -0.182  36.919  0    174.85 ? 103  ARG A HG2    1 
ATOM   1624  H HG3    . ARG A 1 107 ? -40.57   -1.837  36.729  0    174.11 ? 103  ARG A HG3    1 
ATOM   1625  H HD2    . ARG A 1 107 ? -37.652  -1.091  36.513  0    186.57 ? 103  ARG A HD2    1 
ATOM   1626  H HD3    . ARG A 1 107 ? -38.416  -1.734  37.982  0    187.42 ? 103  ARG A HD3    1 
ATOM   1627  H HE     . ARG A 1 107 ? -37.555  -3.173  35.616  0    188.25 ? 103  ARG A HE     1 
ATOM   1628  H HH11   . ARG A 1 107 ? -39.877  -3.262  38.326  0    186.73 ? 103  ARG A HH11   1 
ATOM   1629  H HH12   . ARG A 1 107 ? -40.023  -4.998  38.25   0    187.93 ? 103  ARG A HH12   1 
ATOM   1630  H HH21   . ARG A 1 107 ? -37.801  -5.437  35.575  0    191.69 ? 103  ARG A HH21   1 
ATOM   1631  H HH22   . ARG A 1 107 ? -38.874  -6.226  36.717  0    191.55 ? 103  ARG A HH22   1 
ATOM   1632  N N      . ALA A 1 108 ? -39.753  0.486   31.962  1    85.87  ? 104  ALA A N      1 
ATOM   1633  C CA     . ALA A 1 108 ? -39.508  0.366   30.517  1    84.86  ? 104  ALA A CA     1 
ATOM   1634  C C      . ALA A 1 108 ? -40.402  1.354   29.757  1    81.25  ? 104  ALA A C      1 
ATOM   1635  O O      . ALA A 1 108 ? -41.507  1.623   30.217  1    79.01  ? 104  ALA A O      1 
ATOM   1636  C CB     . ALA A 1 108 ? -39.815  -1.05   30.071  1    84.62  ? 104  ALA A CB     1 
ATOM   1637  H H      . ALA A 1 108 ? -40.692  0.805   32.179  0    156.79 ? 104  ALA A H      1 
ATOM   1638  H HA     . ALA A 1 108 ? -38.471  0.595   30.278  0    159.04 ? 104  ALA A HA     1 
ATOM   1639  H HB1    . ALA A 1 108 ? -39.581  -1.148  29.012  0    155.72 ? 104  ALA A HB1    1 
ATOM   1640  H HB2    . ALA A 1 108 ? -39.211  -1.744  30.653  0    158.89 ? 104  ALA A HB2    1 
ATOM   1641  H HB3    . ALA A 1 108 ? -40.874  -1.247  30.235  0    153.86 ? 104  ALA A HB3    1 
ATOM   1642  N N      . HIS A 1 109 ? -39.941  1.911   28.618  1    80.89  ? 105  HIS A N      1 
ATOM   1643  C CA     . HIS A 1 109 ? -40.757  2.876   27.865  1    77.77  ? 105  HIS A CA     1 
ATOM   1644  C C      . HIS A 1 109 ? -40.348  3.009   26.394  1    77.43  ? 105  HIS A C      1 
ATOM   1645  O O      . HIS A 1 109 ? -39.241  2.63    26.022  1    79.98  ? 105  HIS A O      1 
ATOM   1646  C CB     . HIS A 1 109 ? -40.749  4.254   28.565  1    77.99  ? 105  HIS A CB     1 
ATOM   1647  C CG     . HIS A 1 109 ? -39.499  5.048   28.335  1    80.57  ? 105  HIS A CG     1 
ATOM   1648  N ND1    . HIS A 1 109 ? -39.516  6.223   27.598  1    79.58  ? 105  HIS A ND1    1 
ATOM   1649  C CD2    . HIS A 1 109 ? -38.229  4.8     28.736  1    84.24  ? 105  HIS A CD2    1 
ATOM   1650  C CE1    . HIS A 1 109 ? -38.263  6.656   27.584  1    82.63  ? 105  HIS A CE1    1 
ATOM   1651  N NE2    . HIS A 1 109 ? -37.452  5.828   28.25   1    85.51  ? 105  HIS A NE2    1 
ATOM   1652  H H      . HIS A 1 109 ? -39.032  1.719   28.208  0    150.02 ? 105  HIS A H      1 
ATOM   1653  H HA     . HIS A 1 109 ? -41.788  2.529   27.848  0    138.88 ? 105  HIS A HA     1 
ATOM   1654  H HB2    . HIS A 1 109 ? -41.581  4.842   28.181  0    139.22 ? 105  HIS A HB2    1 
ATOM   1655  H HB3    . HIS A 1 109 ? -40.862  4.123   29.64   0    142.6  ? 105  HIS A HB3    1 
ATOM   1656  H HD2    . HIS A 1 109 ? -37.894  3.964   29.327  0    157.21 ? 105  HIS A HD2    1 
ATOM   1657  H HE1    . HIS A 1 109 ? -37.941  7.561   27.099  0    152.18 ? 105  HIS A HE1    1 
ATOM   1658  H HE2    . HIS A 1 109 ? -36.451  5.938   28.379  0    161.04 ? 105  HIS A HE2    1 
ATOM   1659  N N      . GLY A 1 110 ? -41.254  3.562   25.585  1    74.52  ? 106  GLY A N      1 
ATOM   1660  C CA     . GLY A 1 110 ? -41.041  3.796   24.159  1    74.02  ? 106  GLY A CA     1 
ATOM   1661  C C      . GLY A 1 110 ? -42.338  3.993   23.395  1    70.58  ? 106  GLY A C      1 
ATOM   1662  O O      . GLY A 1 110 ? -43.395  3.595   23.878  1    68.66  ? 106  GLY A O      1 
ATOM   1663  H H      . GLY A 1 110 ? -42.167  3.873   25.902  0    132.04 ? 106  GLY A H      1 
ATOM   1664  H HA2    . GLY A 1 110 ? -40.426  4.685   24.026  0    134.03 ? 106  GLY A HA2    1 
ATOM   1665  H HA3    . GLY A 1 110 ? -40.52   2.947   23.72   0    134.21 ? 106  GLY A HA3    1 
ATOM   1666  N N      . ASN A 1 111 ? -42.273  4.603   22.189  1    69.99  ? 107  ASN A N      1 
ATOM   1667  C CA     . ASN A 1 111 ? -43.451  4.841   21.335  1    67.07  ? 107  ASN A CA     1 
ATOM   1668  C C      . ASN A 1 111 ? -43.566  3.708   20.314  1    66.8   ? 107  ASN A C      1 
ATOM   1669  O O      . ASN A 1 111 ? -42.625  3.47    19.564  1    68.84  ? 107  ASN A O      1 
ATOM   1670  C CB     . ASN A 1 111 ? -43.342  6.19    20.623  1    66.9   ? 107  ASN A CB     1 
ATOM   1671  C CG     . ASN A 1 111 ? -44.604  6.602   19.908  1    64.12  ? 107  ASN A CG     1 
ATOM   1672  O OD1    . ASN A 1 111 ? -44.9    6.122   18.815  1    63.22  ? 107  ASN A OD1    1 
ATOM   1673  N ND2    . ASN A 1 111 ? -45.377  7.508   20.494  1    62.91  ? 107  ASN A ND2    1 
ATOM   1674  H H      . ASN A 1 111 ? -41.408  4.945   21.78   0    125.73 ? 107  ASN A H      1 
ATOM   1675  H HA     . ASN A 1 111 ? -44.355  4.864   21.941  0    115.97 ? 107  ASN A HA     1 
ATOM   1676  H HB2    . ASN A 1 111 ? -43.087  6.953   21.356  0    118.01 ? 107  ASN A HB2    1 
ATOM   1677  H HB3    . ASN A 1 111 ? -42.551  6.125   19.877  0    118.68 ? 107  ASN A HB3    1 
ATOM   1678  H HD21   . ASN A 1 111 ? -46.234  7.807   20.038  0    106.68 ? 107  ASN A HD21   1 
ATOM   1679  H HD22   . ASN A 1 111 ? -45.124  7.907   21.392  0    109.26 ? 107  ASN A HD22   1 
ATOM   1680  N N      . VAL A 1 112 ? -44.728  3.046   20.253  1    64.52  ? 108  VAL A N      1 
ATOM   1681  C CA     . VAL A 1 112 ? -44.939  1.878   19.39   1    64.33  ? 108  VAL A CA     1 
ATOM   1682  C C      . VAL A 1 112 ? -45.687  2.181   18.09   1    62.52  ? 108  VAL A C      1 
ATOM   1683  O O      . VAL A 1 112 ? -46.241  1.263   17.486  1    61.79  ? 108  VAL A O      1 
ATOM   1684  C CB     . VAL A 1 112 ? -45.635  0.746   20.187  1    63.68  ? 108  VAL A CB     1 
ATOM   1685  C CG1    . VAL A 1 112 ? -44.828  0.399   21.429  1    65.99  ? 108  VAL A CG1    1 
ATOM   1686  C CG2    . VAL A 1 112 ? -47.069  1.106   20.571  1    60.98  ? 108  VAL A CG2    1 
ATOM   1687  H H      . VAL A 1 112 ? -45.549  3.343   20.77   0    110.41 ? 108  VAL A H      1 
ATOM   1688  H HA     . VAL A 1 112 ? -43.972  1.473   19.097  0    113.6  ? 108  VAL A HA     1 
ATOM   1689  H HB     . VAL A 1 112 ? -45.673  -0.154  19.575  0    110.3  ? 108  VAL A HB     1 
ATOM   1690  H HG11   . VAL A 1 112 ? -45.278  -0.468  21.911  0    114.86 ? 108  VAL A HG11   1 
ATOM   1691  H HG12   . VAL A 1 112 ? -43.807  0.169   21.129  0    117.24 ? 108  VAL A HG12   1 
ATOM   1692  H HG13   . VAL A 1 112 ? -44.831  1.245   22.116  0    115.13 ? 108  VAL A HG13   1 
ATOM   1693  H HG21   . VAL A 1 112 ? -47.508  0.251   21.084  0    103.95 ? 108  VAL A HG21   1 
ATOM   1694  H HG22   . VAL A 1 112 ? -47.052  1.959   21.246  0    104.04 ? 108  VAL A HG22   1 
ATOM   1695  H HG23   . VAL A 1 112 ? -47.658  1.337   19.686  0    102.69 ? 108  VAL A HG23   1 
ATOM   1696  N N      . GLN A 1 113 ? -45.681  3.438   17.636  1    62.06  ? 109  GLN A N      1 
ATOM   1697  C CA     . GLN A 1 113 ? -46.378  3.812   16.409  1    60.58  ? 109  GLN A CA     1 
ATOM   1698  C C      . GLN A 1 113 ? -45.635  3.266   15.202  1    62.21  ? 109  GLN A C      1 
ATOM   1699  O O      . GLN A 1 113 ? -44.406  3.337   15.172  1    64.44  ? 109  GLN A O      1 
ATOM   1700  C CB     . GLN A 1 113 ? -46.46   5.338   16.303  1    59.97  ? 109  GLN A CB     1 
ATOM   1701  C CG     . GLN A 1 113 ? -47.376  5.832   15.201  1    58.78  ? 109  GLN A CG     1 
ATOM   1702  C CD     . GLN A 1 113 ? -47.776  7.284   15.364  1    58.21  ? 109  GLN A CD     1 
ATOM   1703  O OE1    . GLN A 1 113 ? -47.372  7.999   16.307  1    58.04  ? 109  GLN A OE1    1 
ATOM   1704  N NE2    . GLN A 1 113 ? -48.6    7.744   14.434  1    58.09  ? 109  GLN A NE2    1 
ATOM   1705  H H      . GLN A 1 113 ? -45.196  4.215   18.072  0    107.36 ? 109  GLN A H      1 
ATOM   1706  H HA     . GLN A 1 113 ? -47.389  3.408   16.422  0    101.7  ? 109  GLN A HA     1 
ATOM   1707  H HB2    . GLN A 1 113 ? -46.824  5.728   17.251  0    101.41 ? 109  GLN A HB2    1 
ATOM   1708  H HB3    . GLN A 1 113 ? -45.462  5.727   16.104  0    104.01 ? 109  GLN A HB3    1 
ATOM   1709  H HG2    . GLN A 1 113 ? -46.868  5.733   14.243  0    100.39 ? 109  GLN A HG2    1 
ATOM   1710  H HG3    . GLN A 1 113 ? -48.287  5.236   15.201  0    97.79  ? 109  GLN A HG3    1 
ATOM   1711  H HE21   . GLN A 1 113 ? -48.915  7.134   13.687  0    96.33  ? 109  GLN A HE21   1 
ATOM   1712  H HE22   . GLN A 1 113 ? -48.916  8.708   14.472  0    96.34  ? 109  GLN A HE22   1 
ATOM   1713  N N      . ASP A 1 114 ? -46.368  2.728   14.211  1    61.31  ? 110  ASP A N      1 
ATOM   1714  C CA     . ASP A 1 114 ? -45.751  2.215   12.99   1    62.9   ? 110  ASP A CA     1 
ATOM   1715  C C      . ASP A 1 114 ? -45.771  3.281   11.927  1    63.04  ? 110  ASP A C      1 
ATOM   1716  O O      . ASP A 1 114 ? -46.681  4.115   11.868  1    61.15  ? 110  ASP A O      1 
ATOM   1717  C CB     . ASP A 1 114 ? -46.446  0.951   12.477  1    62.06  ? 110  ASP A CB     1 
ATOM   1718  C CG     . ASP A 1 114 ? -46.203  -0.262  13.345  1    63.06  ? 110  ASP A CG     1 
ATOM   1719  O OD1    . ASP A 1 114 ? -45.016  -0.558  13.649  1    64.24  ? 110  ASP A OD1    1 
ATOM   1720  O OD2    . ASP A 1 114 ? -47.182  -0.929  13.701  1    62.85  ? 110  ASP A OD2    1 
ATOM   1721  H H      . ASP A 1 114 ? -47.379  2.643   14.228  0    103.21 ? 110  ASP A H      1 
ATOM   1722  H HA     . ASP A 1 114 ? -44.709  1.962   13.179  0    110.56 ? 110  ASP A HA     1 
ATOM   1723  H HB2    . ASP A 1 114 ? -47.521  1.126   12.447  0    104.91 ? 110  ASP A HB2    1 
ATOM   1724  H HB3    . ASP A 1 114 ? -46.091  0.723   11.473  0    108.1  ? 110  ASP A HB3    1 
ATOM   1725  N N      . ARG A 1 115 ? -44.756  3.23    11.077  1    65.4   ? 111  ARG A N      1 
ATOM   1726  C CA     . ARG A 1 115 ? -44.541  4.19    10.006  1    66     ? 111  ARG A CA     1 
ATOM   1727  C C      . ARG A 1 115 ? -45.76   4.246   9.071   1    64.32  ? 111  ARG A C      1 
ATOM   1728  O O      . ARG A 1 115 ? -46.256  5.33    8.779   1    63.33  ? 111  ARG A O      1 
ATOM   1729  C CB     . ARG A 1 115 ? -43.247  3.825   9.237   1    69.13  ? 111  ARG A CB     1 
ATOM   1730  C CG     . ARG A 1 115 ? -41.97   3.879   10.102  1    71.19  ? 111  ARG A CG     1 
ATOM   1731  C CD     . ARG A 1 115 ? -40.816  3.029   9.566   1    74.32  ? 111  ARG A CD     1 
ATOM   1732  N NE     . ARG A 1 115 ? -39.774  2.823   10.581  1    76.29  ? 111  ARG A NE     1 
ATOM   1733  C CZ     . ARG A 1 115 ? -38.681  2.072   10.417  1    79.15  ? 111  ARG A CZ     1 
ATOM   1734  N NH1    . ARG A 1 115 ? -38.454  1.456   9.26    1    80.35  ? 111  ARG A NH1    1 
ATOM   1735  N NH2    . ARG A 1 115 ? -37.792  1.951   11.402  1    81.04  ? 111  ARG A NH2    1 
ATOM   1736  H H      . ARG A 1 115 ? -44.077  2.476   11.096  0    115.43 ? 111  ARG A H      1 
ATOM   1737  H HA     . ARG A 1 115 ? -44.406  5.18    10.44   0    115.12 ? 111  ARG A HA     1 
ATOM   1738  H HB2    . ARG A 1 115 ? -43.348  2.814   8.846   0    122.65 ? 111  ARG A HB2    1 
ATOM   1739  H HB3    . ARG A 1 115 ? -43.117  4.527   8.414   0    122.92 ? 111  ARG A HB3    1 
ATOM   1740  H HG2    . ARG A 1 115 ? -41.625  4.911   10.147  0    127.32 ? 111  ARG A HG2    1 
ATOM   1741  H HG3    . ARG A 1 115 ? -42.193  3.527   11.108  0    125.95 ? 111  ARG A HG3    1 
ATOM   1742  H HD2    . ARG A 1 115 ? -41.19   2.053   9.261   0    133.37 ? 111  ARG A HD2    1 
ATOM   1743  H HD3    . ARG A 1 115 ? -40.366  3.542   8.717   0    135.04 ? 111  ARG A HD3    1 
ATOM   1744  H HE     . ARG A 1 115 ? -39.902  3.279   11.48   0    137.24 ? 111  ARG A HE     1 
ATOM   1745  H HH11   . ARG A 1 115 ? -39.102  1.53    8.482   0    145.97 ? 111  ARG A HH11   1 
ATOM   1746  H HH12   . ARG A 1 115 ? -37.615  0.896   9.145   0    149.55 ? 111  ARG A HH12   1 
ATOM   1747  H HH21   . ARG A 1 115 ? -37.946  2.418   12.29   0    147.69 ? 111  ARG A HH21   1 
ATOM   1748  H HH22   . ARG A 1 115 ? -36.957  1.387   11.275  0    150.94 ? 111  ARG A HH22   1 
ATOM   1749  N N      . ILE A 1 116 ? -46.284  3.066   8.691   1    64.18  ? 112  ILE A N      1 
ATOM   1750  C CA     . ILE A 1 116 ? -47.438  2.895   7.798   1    62.83  ? 112  ILE A CA     1 
ATOM   1751  C C      . ILE A 1 116 ? -48.414  1.916   8.428   1    61.02  ? 112  ILE A C      1 
ATOM   1752  O O      . ILE A 1 116 ? -48.021  0.815   8.808   1    61.97  ? 112  ILE A O      1 
ATOM   1753  C CB     . ILE A 1 116 ? -46.959  2.412   6.409   1    64.89  ? 112  ILE A CB     1 
ATOM   1754  C CG1    . ILE A 1 116 ? -46.306  3.627   5.684   1    66.58  ? 112  ILE A CG1    1 
ATOM   1755  C CG2    . ILE A 1 116 ? -48.086  1.723   5.6     1    63.77  ? 112  ILE A CG2    1 
ATOM   1756  C CD1    . ILE A 1 116 ? -45.679  3.419   4.594   1    68.75  ? 112  ILE A CD1    1 
ATOM   1757  H H      . ILE A 1 116 ? -45.9    2.172   8.98    0    111.51 ? 112  ILE A H      1 
ATOM   1758  H HA     . ILE A 1 116 ? -47.952  3.847   7.671   0    106.97 ? 112  ILE A HA     1 
ATOM   1759  H HB     . ILE A 1 116 ? -46.2    1.643   6.549   0    114.03 ? 112  ILE A HB     1 
ATOM   1760  H HG12   . ILE A 1 116 ? -47.039  4.411   5.493   0    114.92 ? 112  ILE A HG12   1 
ATOM   1761  H HG13   . ILE A 1 116 ? -45.572  4.021   6.386   0    117.04 ? 112  ILE A HG13   1 
ATOM   1762  H HG21   . ILE A 1 116 ? -47.768  1.589   4.568   0    111.95 ? 112  ILE A HG21   1 
ATOM   1763  H HG22   . ILE A 1 116 ? -48.296  0.741   6.026   0    109.43 ? 112  ILE A HG22   1 
ATOM   1764  H HG23   . ILE A 1 116 ? -48.977  2.347   5.64    0    108.94 ? 112  ILE A HG23   1 
ATOM   1765  H HD11   . ILE A 1 116 ? -45.064  4.294   4.381   0    122.48 ? 112  ILE A HD11   1 
ATOM   1766  H HD12   . ILE A 1 116 ? -45.068  2.526   4.699   0    122.45 ? 112  ILE A HD12   1 
ATOM   1767  H HD13   . ILE A 1 116 ? -46.398  3.273   3.789   0    120.57 ? 112  ILE A HD13   1 
ATOM   1768  N N      . GLY A 1 117 ? -49.685  2.311   8.472   1    58.73  ? 113  GLY A N      1 
ATOM   1769  C CA     . GLY A 1 117 ? -50.762  1.499   9.019   1    57.03  ? 113  GLY A CA     1 
ATOM   1770  C C      . GLY A 1 117 ? -52.102  2.209   8.982   1    55.02  ? 113  GLY A C      1 
ATOM   1771  O O      . GLY A 1 117 ? -52.148  3.441   8.933   1    54.87  ? 113  GLY A O      1 
ATOM   1772  H H      . GLY A 1 117 ? -50.015  3.205   8.124   0    98.78  ? 113  GLY A H      1 
ATOM   1773  H HA2    . GLY A 1 117 ? -50.845  0.575   8.448   0    95.99  ? 113  GLY A HA2    1 
ATOM   1774  H HA3    . GLY A 1 117 ? -50.53   1.244   10.052  0    95.19  ? 113  GLY A HA3    1 
ATOM   1775  N N      . ARG A 1 118 ? -53.204  1.437   8.993   1    53.77  ? 114  ARG A N      1 
ATOM   1776  C CA     . ARG A 1 118 ? -54.561  1.982   9.008   1    51.99  ? 114  ARG A CA     1 
ATOM   1777  C C      . ARG A 1 118 ? -55.105  1.773   10.404  1    50.45  ? 114  ARG A C      1 
ATOM   1778  O O      . ARG A 1 118 ? -55.254  0.614   10.779  1    50.49  ? 114  ARG A O      1 
ATOM   1779  C CB     . ARG A 1 118 ? -55.461  1.236   8.023   1    52.14  ? 114  ARG A CB     1 
ATOM   1780  C CG     . ARG A 1 118 ? -56.912  1.722   8.035   1    50.76  ? 114  ARG A CG     1 
ATOM   1781  C CD     . ARG A 1 118 ? -57.668  1.177   6.852   1    51.35  ? 114  ARG A CD     1 
ATOM   1782  N NE     . ARG A 1 118 ? -57.805  -0.28   6.95    1    51.37  ? 114  ARG A NE     1 
ATOM   1783  C CZ     . ARG A 1 118 ? -57.776  -1.153  5.938   1    52.44  ? 114  ARG A CZ     1 
ATOM   1784  N NH1    . ARG A 1 118 ? -57.605  -0.736  4.686   1    53.59  ? 114  ARG A NH1    1 
ATOM   1785  N NH2    . ARG A 1 118 ? -57.917  -2.45   6.172   1    52.57  ? 114  ARG A NH2    1 
ATOM   1786  H H      . ARG A 1 118 ? -53.178  0.423   8.993   0    88.6   ? 114  ARG A H      1 
ATOM   1787  H HA     . ARG A 1 118 ? -54.571  3.03    8.718   0    84.3   ? 114  ARG A HA     1 
ATOM   1788  H HB2    . ARG A 1 118 ? -55.063  1.38    7.02    0    85.73  ? 114  ARG A HB2    1 
ATOM   1789  H HB3    . ARG A 1 118 ? -55.46   0.173   8.259   0    84.61  ? 114  ARG A HB3    1 
ATOM   1790  H HG2    . ARG A 1 118 ? -57.415  1.383   8.94    0    80.19  ? 114  ARG A HG2    1 
ATOM   1791  H HG3    . ARG A 1 118 ? -56.927  2.809   7.98    0    81.15  ? 114  ARG A HG3    1 
ATOM   1792  H HD2    . ARG A 1 118 ? -58.665  1.614   6.833   0    81.63  ? 114  ARG A HD2    1 
ATOM   1793  H HD3    . ARG A 1 118 ? -57.109  1.471   5.967   0    83.78  ? 114  ARG A HD3    1 
ATOM   1794  H HE     . ARG A 1 118 ? -57.925  -0.656  7.886   0    82.03  ? 114  ARG A HE     1 
ATOM   1795  H HH11   . ARG A 1 118 ? -57.531  0.24    4.422   0    87.99  ? 114  ARG A HH11   1 
ATOM   1796  H HH12   . ARG A 1 118 ? -57.609  -1.419  3.937   0    89.1   ? 114  ARG A HH12   1 
ATOM   1797  H HH21   . ARG A 1 118 ? -58.035  -2.789  7.121   0    85.02  ? 114  ARG A HH21   1 
ATOM   1798  H HH22   . ARG A 1 118 ? -57.9    -3.114  5.405   0    86.92  ? 114  ARG A HH22   1 
ATOM   1799  N N      . PRO A 1 119 ? -55.435  2.823   11.191  1    49.31  ? 115  PRO A N      1 
ATOM   1800  C CA     . PRO A 1 119 ? -55.973  2.574   12.541  1    48.08  ? 115  PRO A CA     1 
ATOM   1801  C C      . PRO A 1 119 ? -57.28   1.791   12.495  1    47.04  ? 115  PRO A C      1 
ATOM   1802  O O      . PRO A 1 119 ? -58.115  2.044   11.63   1    46.58  ? 115  PRO A O      1 
ATOM   1803  C CB     . PRO A 1 119 ? -56.172  3.975   13.12   1    47.38  ? 115  PRO A CB     1 
ATOM   1804  C CG     . PRO A 1 119 ? -55.353  4.876   12.277  1    48.61  ? 115  PRO A CG     1 
ATOM   1805  C CD     . PRO A 1 119 ? -55.321  4.269   10.918  1    49.41  ? 115  PRO A CD     1 
ATOM   1806  H HA     . PRO A 1 119 ? -55.241  2.035   13.141  0    76.55  ? 115  PRO A HA     1 
ATOM   1807  H HB2    . PRO A 1 119 ? -57.225  4.249   13.061  0    73.43  ? 115  PRO A HB2    1 
ATOM   1808  H HB3    . PRO A 1 119 ? -55.827  3.997   14.152  0    74.38  ? 115  PRO A HB3    1 
ATOM   1809  H HG2    . PRO A 1 119 ? -55.815  5.862   12.243  0    76.61  ? 115  PRO A HG2    1 
ATOM   1810  H HG3    . PRO A 1 119 ? -54.349  4.94    12.691  0    77.95  ? 115  PRO A HG3    1 
ATOM   1811  H HD2    . PRO A 1 119 ? -56.164  4.616   10.322  0    78.32  ? 115  PRO A HD2    1 
ATOM   1812  H HD3    . PRO A 1 119 ? -54.368  4.507   10.449  0    80.11  ? 115  PRO A HD3    1 
ATOM   1813  N N      . SER A 1 120 ? -57.434  0.815   13.406  1    46.91  ? 116  SER A N      1 
ATOM   1814  C CA     . SER A 1 120 ? -58.592  -0.086  13.428  1    46.15  ? 116  SER A CA     1 
ATOM   1815  C C      . SER A 1 120 ? -59.88   0.564   13.88   1    44.77  ? 116  SER A C      1 
ATOM   1816  O O      . SER A 1 120 ? -59.863  1.498   14.685  1    44.35  ? 116  SER A O      1 
ATOM   1817  C CB     . SER A 1 120 ? -58.315  -1.295  14.31   1    46.58  ? 116  SER A CB     1 
ATOM   1818  O OG     . SER A 1 120 ? -57.339  -2.151  13.745  1    48.14  ? 116  SER A OG     1 
ATOM   1819  H H      . SER A 1 120 ? -56.769  0.628   14.149  0    73.72  ? 116  SER A H      1 
ATOM   1820  H HA     . SER A 1 120 ? -58.755  -0.443  12.411  0    72.07  ? 116  SER A HA     1 
ATOM   1821  H HB2    . SER A 1 120 ? -57.972  -0.96   15.288  0    72.25  ? 116  SER A HB2    1 
ATOM   1822  H HB3    . SER A 1 120 ? -59.239  -1.86   14.425  0    72.16  ? 116  SER A HB3    1 
ATOM   1823  H HG     . SER A 1 120 ? -56.775  -1.67   13.084  0    76.44  ? 116  SER A HG     1 
ATOM   1824  N N      . GLU A 1 121 ? -61.005  0.026   13.393  1    44.34  ? 117  GLU A N      1 
ATOM   1825  C CA     . GLU A 1 121 ? -62.308  0.572   13.718  1    43.29  ? 117  GLU A CA     1 
ATOM   1826  C C      . GLU A 1 121 ? -62.666  0.423   15.207  1    42.7   ? 117  GLU A C      1 
ATOM   1827  O O      . GLU A 1 121 ? -63.005  1.418   15.849  1    42.1   ? 117  GLU A O      1 
ATOM   1828  C CB     . GLU A 1 121 ? -63.38   -0.078  12.838  1    43.34  ? 117  GLU A CB     1 
ATOM   1829  C CG     . GLU A 1 121 ? -64.718  0.646   12.908  1    42.61  ? 117  GLU A CG     1 
ATOM   1830  C CD     . GLU A 1 121 ? -65.688  0.295   11.791  1    42.96  ? 117  GLU A CD     1 
ATOM   1831  O OE1    . GLU A 1 121 ? -66.02   -0.909  11.639  1    43.65  ? 117  GLU A OE1    1 
ATOM   1832  O OE2    . GLU A 1 121 ? -66.118  1.23    11.069  1    42.78  ? 117  GLU A OE2    1 
ATOM   1833  H H      . GLU A 1 121 ? -61.038  -0.784  12.782  0    68.15  ? 117  GLU A H      1 
ATOM   1834  H HA     . GLU A 1 121 ? -62.281  1.636   13.486  0    65.12  ? 117  GLU A HA     1 
ATOM   1835  H HB2    . GLU A 1 121 ? -63.048  -0.065  11.8    0    66.06  ? 117  GLU A HB2    1 
ATOM   1836  H HB3    . GLU A 1 121 ? -63.535  -1.105  13.166  0    65.58  ? 117  GLU A HB3    1 
ATOM   1837  H HG2    . GLU A 1 121 ? -65.198  0.406   13.856  0    63.3   ? 117  GLU A HG2    1 
ATOM   1838  H HG3    . GLU A 1 121 ? -64.541  1.719   12.849  0    63.65  ? 117  GLU A HG3    1 
ATOM   1839  N N      . THR A 1 122 ? -62.543  -0.797  15.769  1    43.08  ? 118  THR A N      1 
ATOM   1840  C CA     . THR A 1 122 ? -62.849  -1.047  17.187  1    42.81  ? 118  THR A CA     1 
ATOM   1841  C C      . THR A 1 122 ? -61.78   -0.474  18.173  1    42.96  ? 118  THR A C      1 
ATOM   1842  O O      . THR A 1 122 ? -61.856  -0.746  19.374  1    42.73  ? 118  THR A O      1 
ATOM   1843  C CB     . THR A 1 122 ? -63.102  -2.566  17.416  1    43.49  ? 118  THR A CB     1 
ATOM   1844  O OG1    . THR A 1 122 ? -62.054  -3.328  16.816  1    44.54  ? 118  THR A OG1    1 
ATOM   1845  C CG2    . THR A 1 122 ? -64.428  -3.033  16.836  1    43.33  ? 118  THR A CG2    1 
ATOM   1846  H H      . THR A 1 122 ? -62.235  -1.625  15.268  0    65.5   ? 118  THR A H      1 
ATOM   1847  H HA     . THR A 1 122 ? -63.773  -0.52   17.424  0    63.6   ? 118  THR A HA     1 
ATOM   1848  H HB     . THR A 1 122 ? -63.127  -2.78   18.483  0    65.79  ? 118  THR A HB     1 
ATOM   1849  H HG1    . THR A 1 122 ? -62.215  -4.296  16.965  0    68.52  ? 118  THR A HG1    1 
ATOM   1850  H HG21   . THR A 1 122 ? -64.622  -4.062  17.136  0    65.68  ? 118  THR A HG21   1 
ATOM   1851  H HG22   . THR A 1 122 ? -65.236  -2.402  17.203  0    64.5   ? 118  THR A HG22   1 
ATOM   1852  H HG23   . THR A 1 122 ? -64.402  -2.976  15.749  0    65.33  ? 118  THR A HG23   1 
ATOM   1853  N N      . GLY A 1 123 ? -60.836  0.331   17.671  1    43.56  ? 119  GLY A N      1 
ATOM   1854  C CA     . GLY A 1 123 ? -59.827  0.989   18.492  1    43.97  ? 119  GLY A CA     1 
ATOM   1855  C C      . GLY A 1 123 ? -58.653  0.118   18.889  1    45.28  ? 119  GLY A C      1 
ATOM   1856  O O      . GLY A 1 123 ? -58.514  -1.003  18.396  1    45.85  ? 119  GLY A O      1 
ATOM   1857  H H      . GLY A 1 123 ? -60.71   0.544   16.687  0    65.84  ? 119  GLY A H      1 
ATOM   1858  H HA2    . GLY A 1 123 ? -59.431  1.84    17.94   0    66.84  ? 119  GLY A HA2    1 
ATOM   1859  H HA3    . GLY A 1 123 ? -60.291  1.37    19.4    0    66.38  ? 119  GLY A HA3    1 
ATOM   1860  N N      . ILE A 1 124 ? -57.784  0.644   19.777  1    45.94  ? 120  ILE A N      1 
ATOM   1861  C CA     . ILE A 1 124 ? -56.611  -0.09   20.25   1    47.5   ? 120  ILE A CA     1 
ATOM   1862  C C      . ILE A 1 124 ? -57.079  -1.193  21.176  1    47.82  ? 120  ILE A C      1 
ATOM   1863  O O      . ILE A 1 124 ? -57.979  -0.969  21.986  1    47.19  ? 120  ILE A O      1 
ATOM   1864  C CB     . ILE A 1 124 ? -55.612  0.829   20.999  1    48.37  ? 120  ILE A CB     1 
ATOM   1865  C CG1    . ILE A 1 124 ? -55.035  1.908   20.073  1    48.44  ? 120  ILE A CG1    1 
ATOM   1866  C CG2    . ILE A 1 124 ? -54.482  0.002   21.61   1    50.22  ? 120  ILE A CG2    1 
ATOM   1867  C CD1    . ILE A 1 124 ? -54.517  3.146   20.784  1    48.88  ? 120  ILE A CD1    1 
ATOM   1868  H H      . ILE A 1 124 ? -57.881  1.569   20.182  0    70.75  ? 120  ILE A H      1 
ATOM   1869  H HA     . ILE A 1 124 ? -56.094  -0.533  19.4    0    75.11  ? 120  ILE A HA     1 
ATOM   1870  H HB     . ILE A 1 124 ? -56.156  1.311   21.811  0    75.79  ? 120  ILE A HB     1 
ATOM   1871  H HG12   . ILE A 1 124 ? -54.199  1.475   19.526  0    77.66  ? 120  ILE A HG12   1 
ATOM   1872  H HG13   . ILE A 1 124 ? -55.797  2.236   19.369  0    75.57  ? 120  ILE A HG13   1 
ATOM   1873  H HG21   . ILE A 1 124 ? -53.597  0.625   21.722  0    81.25  ? 120  ILE A HG21   1 
ATOM   1874  H HG22   . ILE A 1 124 ? -54.792  -0.356  22.59   0    80.48  ? 120  ILE A HG22   1 
ATOM   1875  H HG23   . ILE A 1 124 ? -54.259  -0.84   20.957  0    81.05  ? 120  ILE A HG23   1 
ATOM   1876  H HD11   . ILE A 1 124 ? -54.27   3.896   20.033  0    77.57  ? 120  ILE A HD11   1 
ATOM   1877  H HD12   . ILE A 1 124 ? -55.294  3.524   21.446  0    76.73  ? 120  ILE A HD12   1 
ATOM   1878  H HD13   . ILE A 1 124 ? -53.625  2.898   21.357  0    78.84  ? 120  ILE A HD13   1 
ATOM   1879  N N      . ILE A 1 125 ? -56.461  -2.372  21.073  1    48.99  ? 121  ILE A N      1 
ATOM   1880  C CA     . ILE A 1 125 ? -56.748  -3.499  21.955  1    49.66  ? 121  ILE A CA     1 
ATOM   1881  C C      . ILE A 1 125 ? -55.397  -3.967  22.462  1    51.72  ? 121  ILE A C      1 
ATOM   1882  O O      . ILE A 1 125 ? -54.487  -4.176  21.669  1    52.73  ? 121  ILE A O      1 
ATOM   1883  C CB     . ILE A 1 125 ? -57.552  -4.632  21.254  1    49.41  ? 121  ILE A CB     1 
ATOM   1884  C CG1    . ILE A 1 125 ? -58.878  -4.058  20.699  1    47.58  ? 121  ILE A CG1    1 
ATOM   1885  C CG2    . ILE A 1 125 ? -57.802  -5.817  22.226  1    50.47  ? 121  ILE A CG2    1 
ATOM   1886  C CD1    . ILE A 1 125 ? -59.774  -5.007  20.023  1    47.4   ? 121  ILE A CD1    1 
ATOM   1887  H H      . ILE A 1 125 ? -55.748  -2.581  20.382  0    78.47  ? 121  ILE A H      1 
ATOM   1888  H HA     . ILE A 1 125 ? -57.335  -3.168  22.81   0    78.75  ? 121  ILE A HA     1 
ATOM   1889  H HB     . ILE A 1 125 ? -56.961  -5.009  20.423  0    79.36  ? 121  ILE A HB     1 
ATOM   1890  H HG12   . ILE A 1 125 ? -59.436  -3.633  21.532  0    74.23  ? 121  ILE A HG12   1 
ATOM   1891  H HG13   . ILE A 1 125 ? -58.65   -3.272  19.98   0    74.13  ? 121  ILE A HG13   1 
ATOM   1892  H HG21   . ILE A 1 125 ? -58.333  -6.611  21.704  0    81.12  ? 121  ILE A HG21   1 
ATOM   1893  H HG22   . ILE A 1 125 ? -56.851  -6.212  22.58   0    82.55  ? 121  ILE A HG22   1 
ATOM   1894  H HG23   . ILE A 1 125 ? -58.395  -5.465  23.069  0    80.54  ? 121  ILE A HG23   1 
ATOM   1895  H HD11   . ILE A 1 125 ? -60.546  -4.448  19.497  0    73.18  ? 121  ILE A HD11   1 
ATOM   1896  H HD12   . ILE A 1 125 ? -59.194  -5.601  19.318  0    75.08  ? 121  ILE A HD12   1 
ATOM   1897  H HD13   . ILE A 1 125 ? -60.235  -5.651  20.771  0    74.73  ? 121  ILE A HD13   1 
ATOM   1898  N N      . GLY A 1 126 ? -55.258  -4.073  23.772  1    52.53  ? 122  GLY A N      1 
ATOM   1899  C CA     . GLY A 1 126 ? -54.018  -4.518  24.378  1    54.76  ? 122  GLY A CA     1 
ATOM   1900  C C      . GLY A 1 126 ? -54.303  -5.647  25.329  1    55.96  ? 122  GLY A C      1 
ATOM   1901  O O      . GLY A 1 126 ? -55.142  -5.501  26.223  1    55.41  ? 122  GLY A O      1 
ATOM   1902  H H      . GLY A 1 126 ? -55.983  -3.861  24.449  0    84.97  ? 122  GLY A H      1 
ATOM   1903  H HA2    . GLY A 1 126 ? -53.328  -4.874  23.616  0    91.36  ? 122  GLY A HA2    1 
ATOM   1904  H HA3    . GLY A 1 126 ? -53.551  -3.693  24.912  0    90.85  ? 122  GLY A HA3    1 
ATOM   1905  N N      . ILE A 1 127 ? -53.611  -6.783  25.126  1    57.79  ? 123  ILE A N      1 
ATOM   1906  C CA     . ILE A 1 127 ? -53.792  -8.007  25.913  1    59.37  ? 123  ILE A CA     1 
ATOM   1907  C C      . ILE A 1 127 ? -52.458  -8.624  26.28   1    62.25  ? 123  ILE A C      1 
ATOM   1908  O O      . ILE A 1 127 ? -51.532  -8.558  25.482  1    63.01  ? 123  ILE A O      1 
ATOM   1909  C CB     . ILE A 1 127 ? -54.662  -9.012  25.111  1    58.82  ? 123  ILE A CB     1 
ATOM   1910  C CG1    . ILE A 1 127 ? -54.069  -9.264  23.696  1    59.03  ? 123  ILE A CG1    1 
ATOM   1911  C CG2    . ILE A 1 127 ? -56.099  -8.476  25.017  1    56.42  ? 123  ILE A CG2    1 
ATOM   1912  C CD1    . ILE A 1 127 ? -54.671  -10.405 22.974  1    59.22  ? 123  ILE A CD1    1 
ATOM   1913  H H      . ILE A 1 127 ? -52.88   -6.876  24.428  0    97.83  ? 123  ILE A H      1 
ATOM   1914  H HA     . ILE A 1 127 ? -54.294  -7.776  26.852  0    100.43 ? 123  ILE A HA     1 
ATOM   1915  H HB     . ILE A 1 127 ? -54.683  -9.958  25.649  0    100.85 ? 123  ILE A HB     1 
ATOM   1916  H HG12   . ILE A 1 127 ? -54.238  -8.377  23.086  0    98.25  ? 123  ILE A HG12   1 
ATOM   1917  H HG13   . ILE A 1 127 ? -53      -9.458  23.764  0    101.54 ? 123  ILE A HG13   1 
ATOM   1918  H HG21   . ILE A 1 127 ? -56.752  -9.197  24.532  0    93.83  ? 123  ILE A HG21   1 
ATOM   1919  H HG22   . ILE A 1 127 ? -56.463  -8.278  26.023  0    94.14  ? 123  ILE A HG22   1 
ATOM   1920  H HG23   . ILE A 1 127 ? -56.093  -7.551  24.442  0    92.73  ? 123  ILE A HG23   1 
ATOM   1921  H HD11   . ILE A 1 127 ? -54.11   -10.573 22.056  0    100.7  ? 123  ILE A HD11   1 
ATOM   1922  H HD12   . ILE A 1 127 ? -54.626  -11.289 23.608  0    101.86 ? 123  ILE A HD12   1 
ATOM   1923  H HD13   . ILE A 1 127 ? -55.706  -10.168 22.736  0    98.61  ? 123  ILE A HD13   1 
ATOM   1924  N N      . ILE A 1 128 ? -52.354  -9.235  27.47   1    64.09  ? 124  ILE A N      1 
ATOM   1925  C CA     . ILE A 1 128 ? -51.109  -9.863  27.891  1    67.22  ? 124  ILE A CA     1 
ATOM   1926  C C      . ILE A 1 128 ? -51.329  -11.361 28.05   1    68.89  ? 124  ILE A C      1 
ATOM   1927  O O      . ILE A 1 128 ? -52.361  -11.816 28.543  1    68.14  ? 124  ILE A O      1 
ATOM   1928  C CB     . ILE A 1 128 ? -50.514  -9.224  29.168  1    68.56  ? 124  ILE A CB     1 
ATOM   1929  C CG1    . ILE A 1 128 ? -50.328  -7.709  28.962  1    66.83  ? 124  ILE A CG1    1 
ATOM   1930  C CG2    . ILE A 1 128 ? -49.165  -9.889  29.534  1    72.1   ? 124  ILE A CG2    1 
ATOM   1931  C CD1    . ILE A 1 128 ? -49.828  -6.948  30.18   1    68.12  ? 124  ILE A CD1    1 
ATOM   1932  H H      . ILE A 1 128 ? -53.102  -9.311  28.152  0    110.59 ? 124  ILE A H      1 
ATOM   1933  H HA     . ILE A 1 128 ? -50.352  -9.706  27.123  0    118.34 ? 124  ILE A HA     1 
ATOM   1934  H HB     . ILE A 1 128 ? -51.212  -9.383  29.989  0    120.78 ? 124  ILE A HB     1 
ATOM   1935  H HG12   . ILE A 1 128 ? -49.616  -7.556  28.153  0    117.4  ? 124  ILE A HG12   1 
ATOM   1936  H HG13   . ILE A 1 128 ? -51.285  -7.264  28.694  0    114.81 ? 124  ILE A HG13   1 
ATOM   1937  H HG21   . ILE A 1 128 ? -48.786  -9.456  30.458  0    129.81 ? 124  ILE A HG21   1 
ATOM   1938  H HG22   . ILE A 1 128 ? -49.297  -10.96  29.682  0    130.01 ? 124  ILE A HG22   1 
ATOM   1939  H HG23   . ILE A 1 128 ? -48.459  -9.711  28.725  0    128.89 ? 124  ILE A HG23   1 
ATOM   1940  H HD11   . ILE A 1 128 ? -49.993  -5.883  30.021  0    118.43 ? 124  ILE A HD11   1 
ATOM   1941  H HD12   . ILE A 1 128 ? -50.379  -7.283  31.058  0    120.2  ? 124  ILE A HD12   1 
ATOM   1942  H HD13   . ILE A 1 128 ? -48.764  -7.137  30.309  0    122.22 ? 124  ILE A HD13   1 
ATOM   1943  N N      . ASP A 1 129 ? -50.326  -12.106 27.604  1    71.36  ? 125  ASP A N      1 
ATOM   1944  C CA     . ASP A 1 129 ? -50.241  -13.568 27.646  1    73.52  ? 125  ASP A CA     1 
ATOM   1945  C C      . ASP A 1 129 ? -50.331  -14.032 29.112  1    75.5   ? 125  ASP A C      1 
ATOM   1946  O O      . ASP A 1 129 ? -49.652  -13.43  29.939  1    76.75  ? 125  ASP A O      1 
ATOM   1947  C CB     . ASP A 1 129 ? -48.884  -13.994 27.012  1    76.04  ? 125  ASP A CB     1 
ATOM   1948  C CG     . ASP A 1 129 ? -48.49   -15.427 27.171  1    79.32  ? 125  ASP A CG     1 
ATOM   1949  O OD1    . ASP A 1 129 ? -49.31   -16.302 26.868  1    79.06  ? 125  ASP A OD1    1 
ATOM   1950  O OD2    . ASP A 1 129 ? -47.356  -15.675 27.579  1    82.33  ? 125  ASP A OD2    1 
ATOM   1951  H H      . ASP A 1 129 ? -49.519  -11.653 27.185  0    127.53 ? 125  ASP A H      1 
ATOM   1952  H HA     . ASP A 1 129 ? -51.055  -13.984 27.054  0    130.37 ? 125  ASP A HA     1 
ATOM   1953  H HB2    . ASP A 1 129 ? -48.929  -13.789 25.944  0    136.06 ? 125  ASP A HB2    1 
ATOM   1954  H HB3    . ASP A 1 129 ? -48.089  -13.402 27.462  0    138.33 ? 125  ASP A HB3    1 
ATOM   1955  N N      . PRO A 1 130 ? -51.131  -15.064 29.484  1    76.06  ? 126  PRO A N      1 
ATOM   1956  C CA     . PRO A 1 130 ? -51.166  -15.491 30.901  1    78.27  ? 126  PRO A CA     1 
ATOM   1957  C C      . PRO A 1 130 ? -49.793  -15.826 31.518  1    81.99  ? 126  PRO A C      1 
ATOM   1958  O O      . PRO A 1 130 ? -49.558  -15.502 32.681  1    83.31  ? 126  PRO A O      1 
ATOM   1959  C CB     . PRO A 1 130 ? -52.103  -16.708 30.894  1    78.78  ? 126  PRO A CB     1 
ATOM   1960  C CG     . PRO A 1 130 ? -52.254  -17.106 29.472  1    77.57  ? 126  PRO A CG     1 
ATOM   1961  C CD     . PRO A 1 130 ? -52.038  -15.88  28.655  1    74.93  ? 126  PRO A CD     1 
ATOM   1962  H HA     . PRO A 1 130 ? -51.629  -14.71  31.503  0    140.74 ? 126  PRO A HA     1 
ATOM   1963  H HB2    . PRO A 1 130 ? -51.654  -17.515 31.472  0    146.13 ? 126  PRO A HB2    1 
ATOM   1964  H HB3    . PRO A 1 130 ? -53.067  -16.428 31.318  0    141.76 ? 126  PRO A HB3    1 
ATOM   1965  H HG2    . PRO A 1 130 ? -51.512  -17.864 29.226  0    143    ? 126  PRO A HG2    1 
ATOM   1966  H HG3    . PRO A 1 130 ? -53.258  -17.497 29.313  0    139.58 ? 126  PRO A HG3    1 
ATOM   1967  H HD2    . PRO A 1 130 ? -51.564  -16.144 27.711  0    135.27 ? 126  PRO A HD2    1 
ATOM   1968  H HD3    . PRO A 1 130 ? -52.983  -15.359 28.508  0    132.43 ? 126  PRO A HD3    1 
ATOM   1969  N N      . GLU A 1 131 ? -48.879  -16.444 30.747  1    83.88  ? 127  GLU A N      1 
ATOM   1970  C CA     . GLU A 1 131 ? -47.517  -16.747 31.221  1    87.68  ? 127  GLU A CA     1 
ATOM   1971  C C      . GLU A 1 131 ? -46.602  -15.489 31.264  1    87.46  ? 127  GLU A C      1 
ATOM   1972  O O      . GLU A 1 131 ? -45.452  -15.605 31.68   1    90.66  ? 127  GLU A O      1 
ATOM   1973  C CB     . GLU A 1 131 ? -46.855  -17.797 30.307  1    89.96  ? 127  GLU A CB     1 
ATOM   1974  C CG     . GLU A 1 131 ? -47.556  -19.143 30.263  1    91.26  ? 127  GLU A CG     1 
ATOM   1975  C CD     . GLU A 1 131 ? -47.326  -19.89  28.966  1    91.76  ? 127  GLU A CD     1 
ATOM   1976  O OE1    . GLU A 1 131 ? -46.311  -20.621 28.87   1    94.94  ? 127  GLU A OE1    1 
ATOM   1977  O OE2    . GLU A 1 131 ? -48.16   -19.739 28.042  1    89.16  ? 127  GLU A OE2    1 
ATOM   1978  H H      . GLU A 1 131 ? -49.051  -16.753 29.796  0    153.63 ? 127  GLU A H      1 
ATOM   1979  H HA     . GLU A 1 131 ? -47.568  -17.163 32.226  0    164.68 ? 127  GLU A HA     1 
ATOM   1980  H HB2    . GLU A 1 131 ? -46.819  -17.408 29.291  0    165.97 ? 127  GLU A HB2    1 
ATOM   1981  H HB3    . GLU A 1 131 ? -45.843  -17.982 30.664  0    170.64 ? 127  GLU A HB3    1 
ATOM   1982  H HG2    . GLU A 1 131 ? -47.176  -19.765 31.072  0    173.55 ? 127  GLU A HG2    1 
ATOM   1983  H HG3    . GLU A 1 131 ? -48.631  -19.007 30.378  0    168.36 ? 127  GLU A HG3    1 
ATOM   1984  N N      . CYS A 1 132 ? -47.101  -14.306 30.827  1    83.97  ? 128  CYS A N      1 
ATOM   1985  C CA     . CYS A 1 132 ? -46.369  -13.036 30.754  1    83.44  ? 128  CYS A CA     1 
ATOM   1986  C C      . CYS A 1 132 ? -45.115  -13.145 29.884  1    85.36  ? 128  CYS A C      1 
ATOM   1987  O O      . CYS A 1 132 ? -44.02   -12.754 30.294  1    87.6   ? 128  CYS A O      1 
ATOM   1988  C CB     . CYS A 1 132 ? -46.068  -12.469 32.139  1    84.89  ? 128  CYS A CB     1 
ATOM   1989  S SG     . CYS A 1 132 ? -47.527  -11.838 33.007  1    82.29  ? 128  CYS A SG     1 
ATOM   1990  H H      . CYS A 1 132 ? -48.055  -14.187 30.502  0    152.19 ? 128  CYS A H      1 
ATOM   1991  H HA     . CYS A 1 132 ? -47.021  -12.315 30.263  0    150.58 ? 128  CYS A HA     1 
ATOM   1992  H HB2    . CYS A 1 132 ? -45.618  -13.245 32.756  0    159.78 ? 128  CYS A HB2    1 
ATOM   1993  H HB3    . CYS A 1 132 ? -45.381  -11.63  32.041  0    156.88 ? 128  CYS A HB3    1 
ATOM   1994  H HG     . CYS A 1 132 ? -47.155  -11.375 34.206  0    152.73 ? 128  CYS A HG     1 
ATOM   1995  N N      . ARG A 1 133 ? -45.297  -13.69  28.672  1    84.64  ? 129  ARG A N      1 
ATOM   1996  C CA     . ARG A 1 133 ? -44.229  -13.836 27.683  1    86.29  ? 129  ARG A CA     1 
ATOM   1997  C C      . ARG A 1 133 ? -44.29   -12.72  26.63   1    83.52  ? 129  ARG A C      1 
ATOM   1998  O O      . ARG A 1 133 ? -43.281  -12.503 25.954  1    84.97  ? 129  ARG A O      1 
ATOM   1999  C CB     . ARG A 1 133 ? -44.305  -15.205 26.986  1    87.6   ? 129  ARG A CB     1 
ATOM   2000  C CG     . ARG A 1 133 ? -44.095  -16.388 27.926  1    90.88  ? 129  ARG A CG     1 
ATOM   2001  C CD     . ARG A 1 133 ? -44.316  -17.709 27.225  1    92.4   ? 129  ARG A CD     1 
ATOM   2002  N NE     . ARG A 1 133 ? -43.307  -17.951 26.191  1    94.57  ? 129  ARG A NE     1 
ATOM   2003  C CZ     . ARG A 1 133 ? -43.247  -19.041 25.429  1    96.23  ? 129  ARG A CZ     1 
ATOM   2004  N NH1    . ARG A 1 133 ? -44.148  -20.011 25.57   1    95.91  ? 129  ARG A NH1    1 
ATOM   2005  N NH2    . ARG A 1 133 ? -42.287  -19.172 24.52   1    98.4   ? 129  ARG A NH2    1 
ATOM   2006  H H      . ARG A 1 133 ? -46.191  -14.04  28.341  0    154.5  ? 129  ARG A H      1 
ATOM   2007  H HA     . ARG A 1 133 ? -43.258  -13.78  28.172  0    162.4  ? 129  ARG A HA     1 
ATOM   2008  H HB2    . ARG A 1 133 ? -45.289  -15.313 26.532  0    160.23 ? 129  ARG A HB2    1 
ATOM   2009  H HB3    . ARG A 1 133 ? -43.537  -15.246 26.215  0    163.85 ? 129  ARG A HB3    1 
ATOM   2010  H HG2    . ARG A 1 133 ? -43.073  -16.37  28.301  0    172.67 ? 129  ARG A HG2    1 
ATOM   2011  H HG3    . ARG A 1 133 ? -44.802  -16.327 28.752  0    169    ? 129  ARG A HG3    1 
ATOM   2012  H HD2    . ARG A 1 133 ? -44.255  -18.516 27.953  0    175.62 ? 129  ARG A HD2    1 
ATOM   2013  H HD3    . ARG A 1 133 ? -45.298  -17.705 26.755  0    170.62 ? 129  ARG A HD3    1 
ATOM   2014  H HE     . ARG A 1 133 ? -42.593  -17.242 26.06   0    177.88 ? 129  ARG A HE     1 
ATOM   2015  H HH11   . ARG A 1 133 ? -44.902  -19.948 26.247  0    179.53 ? 129  ARG A HH11   1 
ATOM   2016  H HH12   . ARG A 1 133 ? -44.097  -20.831 24.973  0    182.12 ? 129  ARG A HH12   1 
ATOM   2017  H HH21   . ARG A 1 133 ? -41.594  -18.44  24.399  0    185.85 ? 129  ARG A HH21   1 
ATOM   2018  H HH22   . ARG A 1 133 ? -42.248  -19.995 23.927  0    186.98 ? 129  ARG A HH22   1 
ATOM   2019  N N      . MET A 1 134 ? -45.458  -12.037 26.45   1    79.78  ? 130  MET A N      1 
ATOM   2020  C CA     . MET A 1 134 ? -45.565  -10.946 25.481  1    77.23  ? 130  MET A CA     1 
ATOM   2021  C C      . MET A 1 134 ? -46.783  -10.053 25.716  1    73.71  ? 130  MET A C      1 
ATOM   2022  O O      . MET A 1 134 ? -47.774  -10.505 26.283  1    72.9   ? 130  MET A O      1 
ATOM   2023  C CB     . MET A 1 134 ? -45.621  -11.515 24.055  1    76.87  ? 130  MET A CB     1 
ATOM   2024  C CG     . MET A 1 134 ? -46.957  -12.135 23.704  1    74.58  ? 130  MET A CG     1 
ATOM   2025  S SD     . MET A 1 134 ? -46.855  -13.375 22.416  1    75.77  ? 130  MET A SD     1 
ATOM   2026  C CE     . MET A 1 134 ? -46.386  -14.74  23.362  1    78.76  ? 130  MET A CE     1 
ATOM   2027  H H      . MET A 1 134 ? -46.329  -12.224 26.936  0    144.27 ? 130  MET A H      1 
ATOM   2028  H HA     . MET A 1 134 ? -44.676  -10.32  25.55   0    140.94 ? 130  MET A HA     1 
ATOM   2029  H HB2    . MET A 1 134 ? -45.438  -10.702 23.354  0    138.23 ? 130  MET A HB2    1 
ATOM   2030  H HB3    . MET A 1 134 ? -44.845  -12.27  23.95   0    141.82 ? 130  MET A HB3    1 
ATOM   2031  H HG2    . MET A 1 134 ? -47.377  -12.615 24.587  0    134.41 ? 130  MET A HG2    1 
ATOM   2032  H HG3    . MET A 1 134 ? -47.629  -11.356 23.346  0    131.6  ? 130  MET A HG3    1 
ATOM   2033  H HE1    . MET A 1 134 ? -46.139  -15.554 22.682  0    145.01 ? 130  MET A HE1    1 
ATOM   2034  H HE2    . MET A 1 134 ? -45.519  -14.486 23.969  0    145.64 ? 130  MET A HE2    1 
ATOM   2035  H HE3    . MET A 1 134 ? -47.216  -15.028 24.004  0    142.6  ? 130  MET A HE3    1 
ATOM   2036  N N      . ILE A 1 135 ? -46.729  -8.813  25.203  1    71.81  ? 131  ILE A N      1 
ATOM   2037  C CA     . ILE A 1 135 ? -47.859  -7.894  25.242  1    68.58  ? 131  ILE A CA     1 
ATOM   2038  C C      . ILE A 1 135 ? -48.334  -7.85   23.802  1    66.78  ? 131  ILE A C      1 
ATOM   2039  O O      . ILE A 1 135 ? -47.582  -7.431  22.925  1    67.37  ? 131  ILE A O      1 
ATOM   2040  C CB     . ILE A 1 135 ? -47.504  -6.458  25.709  1    68.09  ? 131  ILE A CB     1 
ATOM   2041  C CG1    . ILE A 1 135 ? -46.831  -6.439  27.086  1    70.39  ? 131  ILE A CG1    1 
ATOM   2042  C CG2    . ILE A 1 135 ? -48.768  -5.594  25.738  1    64.94  ? 131  ILE A CG2    1 
ATOM   2043  C CD1    . ILE A 1 135 ? -45.949  -5.2    27.332  1    71.18  ? 131  ILE A CD1    1 
ATOM   2044  H H      . ILE A 1 135 ? -45.913  -8.43   24.736  0    128.9  ? 131  ILE A H      1 
ATOM   2045  H HA     . ILE A 1 135 ? -48.651  -8.277  25.883  0    120.29 ? 131  ILE A HA     1 
ATOM   2046  H HB     . ILE A 1 135 ? -46.822  -6.04   24.971  0    120.15 ? 131  ILE A HB     1 
ATOM   2047  H HG12   . ILE A 1 135 ? -47.602  -6.443  27.855  0    124.05 ? 131  ILE A HG12   1 
ATOM   2048  H HG13   . ILE A 1 135 ? -46.199  -7.317  27.202  0    127.18 ? 131  ILE A HG13   1 
ATOM   2049  H HG21   . ILE A 1 135 ? -48.574  -4.661  26.265  0    112.6  ? 131  ILE A HG21   1 
ATOM   2050  H HG22   . ILE A 1 135 ? -49.077  -5.365  24.72   0    111.33 ? 131  ILE A HG22   1 
ATOM   2051  H HG23   . ILE A 1 135 ? -49.557  -6.142  26.252  0    112.4  ? 131  ILE A HG23   1 
ATOM   2052  H HD11   . ILE A 1 135 ? -45.706  -5.144  28.393  0    127.94 ? 131  ILE A HD11   1 
ATOM   2053  H HD12   . ILE A 1 135 ? -45.035  -5.306  26.749  0    127.98 ? 131  ILE A HD12   1 
ATOM   2054  H HD13   . ILE A 1 135 ? -46.47   -4.294  27.028  0    124.38 ? 131  ILE A HD13   1 
ATOM   2055  N N      . GLY A 1 136 ? -49.55   -8.304  23.566  1    64.89  ? 132  GLY A N      1 
ATOM   2056  C CA     . GLY A 1 136 ? -50.157  -8.283  22.247  1    63.2   ? 132  GLY A CA     1 
ATOM   2057  C C      . GLY A 1 136 ? -50.95   -7.01   22.055  1    60.48  ? 132  GLY A C      1 
ATOM   2058  O O      . GLY A 1 136 ? -51.845  -6.72   22.853  1    59.14  ? 132  GLY A O      1 
ATOM   2059  H H      . GLY A 1 136 ? -50.157  -8.71   24.271  0    112.63 ? 132  GLY A H      1 
ATOM   2060  H HA2    . GLY A 1 136 ? -49.404  -8.374  21.465  0    110.11 ? 132  GLY A HA2    1 
ATOM   2061  H HA3    . GLY A 1 136 ? -50.84   -9.126  22.155  0    108.84 ? 132  GLY A HA3    1 
ATOM   2062  N N      . LEU A 1 137 ? -50.606  -6.224  21.02   1    59.87  ? 133  LEU A N      1 
ATOM   2063  C CA     . LEU A 1 137 ? -51.303  -4.978  20.707  1    57.55  ? 133  LEU A CA     1 
ATOM   2064  C C      . LEU A 1 137 ? -51.868  -5.023  19.29   1    56.41  ? 133  LEU A C      1 
ATOM   2065  O O      . LEU A 1 137 ? -51.135  -5.327  18.352  1    57.63  ? 133  LEU A O      1 
ATOM   2066  C CB     . LEU A 1 137 ? -50.359  -3.773  20.784  1    58.05  ? 133  LEU A CB     1 
ATOM   2067  C CG     . LEU A 1 137 ? -49.712  -3.439  22.105  1    59.3   ? 133  LEU A CG     1 
ATOM   2068  C CD1    . LEU A 1 137 ? -48.826  -2.235  21.94   1    59.92  ? 133  LEU A CD1    1 
ATOM   2069  C CD2    . LEU A 1 137 ? -50.739  -3.2    23.18   1    57.92  ? 133  LEU A CD2    1 
ATOM   2070  H H      . LEU A 1 137 ? -49.844  -6.423  20.378  0    102.92 ? 133  LEU A H      1 
ATOM   2071  H HA     . LEU A 1 137 ? -52.129  -4.813  21.397  0    95.45  ? 133  LEU A HA     1 
ATOM   2072  H HB2    . LEU A 1 137 ? -49.545  -3.94   20.082  0    98.95  ? 133  LEU A HB2    1 
ATOM   2073  H HB3    . LEU A 1 137 ? -50.92   -2.893  20.472  0    96.1   ? 133  LEU A HB3    1 
ATOM   2074  H HG     . LEU A 1 137 ? -49.09   -4.276  22.416  0    102.38 ? 133  LEU A HG     1 
ATOM   2075  H HD11   . LEU A 1 137 ? -48.415  -1.949  22.907  0    102.84 ? 133  LEU A HD11   1 
ATOM   2076  H HD12   . LEU A 1 137 ? -48.014  -2.49   21.26   0    103.31 ? 133  LEU A HD12   1 
ATOM   2077  H HD13   . LEU A 1 137 ? -49.407  -1.414  21.521  0    100.27 ? 133  LEU A HD13   1 
ATOM   2078  H HD21   . LEU A 1 137 ? -50.265  -2.733  24.042  0    98.52  ? 133  LEU A HD21   1 
ATOM   2079  H HD22   . LEU A 1 137 ? -51.527  -2.558  22.789  0    95.73  ? 133  LEU A HD22   1 
ATOM   2080  H HD23   . LEU A 1 137 ? -51.15   -4.163  23.477  0    97.74  ? 133  LEU A HD23   1 
ATOM   2081  N N      . ARG A 1 138 ? -53.153  -4.668  19.133  1    54.27  ? 134  ARG A N      1 
ATOM   2082  C CA     . ARG A 1 138 ? -53.825  -4.59   17.843  1    53.15  ? 134  ARG A CA     1 
ATOM   2083  C C      . ARG A 1 138 ? -54.068  -3.12   17.614  1    51.71  ? 134  ARG A C      1 
ATOM   2084  O O      . ARG A 1 138 ? -55.065  -2.576  18.088  1    50.23  ? 134  ARG A O      1 
ATOM   2085  C CB     . ARG A 1 138 ? -55.155  -5.36   17.876  1    52.15  ? 134  ARG A CB     1 
ATOM   2086  C CG     . ARG A 1 138 ? -55.758  -5.633  16.504  1    51.73  ? 134  ARG A CG     1 
ATOM   2087  C CD     . ARG A 1 138 ? -56.287  -4.398  15.804  1    50.28  ? 134  ARG A CD     1 
ATOM   2088  N NE     . ARG A 1 138 ? -57.356  -3.748  16.577  1    48.62  ? 134  ARG A NE     1 
ATOM   2089  C CZ     . ARG A 1 138 ? -58.67   -3.832  16.345  1    47.45  ? 134  ARG A CZ     1 
ATOM   2090  N NH1    . ARG A 1 138 ? -59.133  -4.518  15.305  1    47.68  ? 134  ARG A NH1    1 
ATOM   2091  N NH2    . ARG A 1 138 ? -59.526  -3.185  17.121  1    46.23  ? 134  ARG A NH2    1 
ATOM   2092  H H      . ARG A 1 138 ? -53.769  -4.424  19.904  0    88.51  ? 134  ARG A H      1 
ATOM   2093  H HA     . ARG A 1 138 ? -53.201  -4.982  17.041  0    88.16  ? 134  ARG A HA     1 
ATOM   2094  H HB2    . ARG A 1 138 ? -54.979  -6.325  18.349  0    85.85  ? 134  ARG A HB2    1 
ATOM   2095  H HB3    . ARG A 1 138 ? -55.89   -4.807  18.457  0    83.5   ? 134  ARG A HB3    1 
ATOM   2096  H HG2    . ARG A 1 138 ? -54.993  -6.075  15.867  0    85.23  ? 134  ARG A HG2    1 
ATOM   2097  H HG3    . ARG A 1 138 ? -56.588  -6.328  16.625  0    83.52  ? 134  ARG A HG3    1 
ATOM   2098  H HD2    . ARG A 1 138 ? -55.478  -3.676  15.715  0    81.09  ? 134  ARG A HD2    1 
ATOM   2099  H HD3    . ARG A 1 138 ? -56.591  -4.658  14.793  0    80.72  ? 134  ARG A HD3    1 
ATOM   2100  H HE     . ARG A 1 138 ? -57.058  -3.206  17.38   0    76.88  ? 134  ARG A HE     1 
ATOM   2101  H HH11   . ARG A 1 138 ? -58.544  -5.03   14.658  0    76     ? 134  ARG A HH11   1 
ATOM   2102  H HH12   . ARG A 1 138 ? -60.135  -4.548  15.151  0    74.2   ? 134  ARG A HH12   1 
ATOM   2103  H HH21   . ARG A 1 138 ? -59.19   -2.646  17.912  0    71.66  ? 134  ARG A HH21   1 
ATOM   2104  H HH22   . ARG A 1 138 ? -60.523  -3.233  16.938  0    71.01  ? 134  ARG A HH22   1 
ATOM   2105  N N      . LEU A 1 139 ? -53.143  -2.464  16.921  1    52.44  ? 135  LEU A N      1 
ATOM   2106  C CA     . LEU A 1 139 ? -53.26   -1.035  16.647  1    51.53  ? 135  LEU A CA     1 
ATOM   2107  C C      . LEU A 1 139 ? -53.857  -0.826  15.248  1    50.85  ? 135  LEU A C      1 
ATOM   2108  O O      . LEU A 1 139 ? -54.855  -0.117  15.096  1    49.36  ? 135  LEU A O      1 
ATOM   2109  C CB     . LEU A 1 139 ? -51.88   -0.333  16.758  1    53.09  ? 135  LEU A CB     1 
ATOM   2110  C CG     . LEU A 1 139 ? -51.01   -0.684  17.955  1    54.47  ? 135  LEU A CG     1 
ATOM   2111  C CD1    . LEU A 1 139 ? -49.698  0.051   17.886  1    56.19  ? 135  LEU A CD1    1 
ATOM   2112  C CD2    . LEU A 1 139 ? -51.713  -0.377  19.248  1    53.39  ? 135  LEU A CD2    1 
ATOM   2113  H H      . LEU A 1 139 ? -52.301  -2.884  16.542  0    86.98  ? 135  LEU A H      1 
ATOM   2114  H HA     . LEU A 1 139 ? -53.921  -0.557  17.369  0    82.39  ? 135  LEU A HA     1 
ATOM   2115  H HB2    . LEU A 1 139 ? -51.303  -0.573  15.867  0    87.95  ? 135  LEU A HB2    1 
ATOM   2116  H HB3    . LEU A 1 139 ? -52.054  0.741   16.793  0    86.21  ? 135  LEU A HB3    1 
ATOM   2117  H HG     . LEU A 1 139 ? -50.79   -1.751  17.942  0    90.96  ? 135  LEU A HG     1 
ATOM   2118  H HD11   . LEU A 1 139 ? -49.085  -0.24   18.738  0    94.94  ? 135  LEU A HD11   1 
ATOM   2119  H HD12   . LEU A 1 139 ? -49.191  -0.212  16.959  0    94.75  ? 135  LEU A HD12   1 
ATOM   2120  H HD13   . LEU A 1 139 ? -49.888  1.124   17.913  0    92.98  ? 135  LEU A HD13   1 
ATOM   2121  H HD21   . LEU A 1 139 ? -51.026  -0.55   20.074  0    88.94  ? 135  LEU A HD21   1 
ATOM   2122  H HD22   . LEU A 1 139 ? -52.029  0.666   19.239  0    86.72  ? 135  LEU A HD22   1 
ATOM   2123  H HD23   . LEU A 1 139 ? -52.579  -1.029  19.353  0    86.82  ? 135  LEU A HD23   1 
ATOM   2124  N N      . TYR A 1 140 ? -53.255  -1.464  14.235  1    52.19  ? 136  TYR A N      1 
ATOM   2125  C CA     . TYR A 1 140 ? -53.664  -1.3    12.848  1    52.04  ? 136  TYR A CA     1 
ATOM   2126  C C      . TYR A 1 140 ? -54.344  -2.553  12.301  1    52.16  ? 136  TYR A C      1 
ATOM   2127  O O      . TYR A 1 140 ? -54.125  -3.663  12.807  1    52.9   ? 136  TYR A O      1 
ATOM   2128  C CB     . TYR A 1 140 ? -52.441  -0.913  11.997  1    53.78  ? 136  TYR A CB     1 
ATOM   2129  C CG     . TYR A 1 140 ? -51.665  0.264   12.56   1    54.12  ? 136  TYR A CG     1 
ATOM   2130  C CD1    . TYR A 1 140 ? -52.13   1.56    12.415  1    53.12  ? 136  TYR A CD1    1 
ATOM   2131  C CD2    . TYR A 1 140 ? -50.509  0.071   13.306  1    55.6   ? 136  TYR A CD2    1 
ATOM   2132  C CE1    . TYR A 1 140 ? -51.428  2.645   12.935  1    53.64  ? 136  TYR A CE1    1 
ATOM   2133  C CE2    . TYR A 1 140 ? -49.811  1.145   13.853  1    56.12  ? 136  TYR A CE2    1 
ATOM   2134  C CZ     . TYR A 1 140 ? -50.269  2.435   13.66   1    55.12  ? 136  TYR A CZ     1 
ATOM   2135  O OH     . TYR A 1 140 ? -49.582  3.515   14.173  1    55.8   ? 136  TYR A OH     1 
ATOM   2136  H H      . TYR A 1 140 ? -52.468  -2.096  14.351  0    86.28  ? 136  TYR A H      1 
ATOM   2137  H HA     . TYR A 1 140 ? -54.374  -0.479  12.762  0    83.35  ? 136  TYR A HA     1 
ATOM   2138  H HB2    . TYR A 1 140 ? -51.765  -1.764  11.938  0    89.81  ? 136  TYR A HB2    1 
ATOM   2139  H HB3    . TYR A 1 140 ? -52.78   -0.64   10.999  0    88.31  ? 136  TYR A HB3    1 
ATOM   2140  H HD1    . TYR A 1 140 ? -53.027  1.737   11.844  0    85.93  ? 136  TYR A HD1    1 
ATOM   2141  H HD2    . TYR A 1 140 ? -50.138  -0.928  13.46   0    93.34  ? 136  TYR A HD2    1 
ATOM   2142  H HE1    . TYR A 1 140 ? -51.795  3.647   12.786  0    87.32  ? 136  TYR A HE1    1 
ATOM   2143  H HE2    . TYR A 1 140 ? -48.901  0.971   14.405  0    94.81  ? 136  TYR A HE2    1 
ATOM   2144  H HH     . TYR A 1 140 ? -49.104  3.248   15.001  0    93.34  ? 136  TYR A HH     1 
ATOM   2145  N N      . ASP A 1 141 ? -55.217  -2.364  11.293  1    51.57  ? 137  ASP A N      1 
ATOM   2146  C CA     . ASP A 1 141 ? -55.93   -3.481  10.672  1    51.83  ? 137  ASP A CA     1 
ATOM   2147  C C      . ASP A 1 141 ? -54.911  -4.361  9.948   1    54.02  ? 137  ASP A C      1 
ATOM   2148  O O      . ASP A 1 141 ? -53.97   -3.834  9.352   1    55.14  ? 137  ASP A O      1 
ATOM   2149  C CB     . ASP A 1 141 ? -56.969  -2.986  9.633   1    51.06  ? 137  ASP A CB     1 
ATOM   2150  C CG     . ASP A 1 141 ? -58.292  -2.433  10.155  1    49.18  ? 137  ASP A CG     1 
ATOM   2151  O OD1    . ASP A 1 141 ? -58.754  -2.888  11.235  1    48.45  ? 137  ASP A OD1    1 
ATOM   2152  O OD2    . ASP A 1 141 ? -58.891  -1.577  9.459   1    48.64  ? 137  ASP A OD2    1 
ATOM   2153  H H      . ASP A 1 141 ? -55.444  -1.456  10.902  0    82.92  ? 137  ASP A H      1 
ATOM   2154  H HA     . ASP A 1 141 ? -56.432  -4.073  11.437  0    83.51  ? 137  ASP A HA     1 
ATOM   2155  H HB2    . ASP A 1 141 ? -56.509  -2.211  9.022   0    82.8   ? 137  ASP A HB2    1 
ATOM   2156  H HB3    . ASP A 1 141 ? -57.219  -3.834  8.995   0    83.1   ? 137  ASP A HB3    1 
ATOM   2157  N N      . GLY A 1 142 ? -55.101  -5.677  10.003  1    54.78  ? 138  GLY A N      1 
ATOM   2158  C CA     . GLY A 1 142 ? -54.224  -6.617  9.311   1    57.07  ? 138  GLY A CA     1 
ATOM   2159  C C      . GLY A 1 142 ? -52.823  -6.784  9.867   1    58.71  ? 138  GLY A C      1 
ATOM   2160  O O      . GLY A 1 142 ? -51.972  -7.381  9.193   1    60.88  ? 138  GLY A O      1 
ATOM   2161  H H      . GLY A 1 142 ? -55.861  -6.122  10.509  0    89.74  ? 138  GLY A H      1 
ATOM   2162  H HA2    . GLY A 1 142 ? -54.709  -7.591  9.286   0    95.9   ? 138  GLY A HA2    1 
ATOM   2163  H HA3    . GLY A 1 142 ? -54.093  -6.289  8.282   0    96.18  ? 138  GLY A HA3    1 
ATOM   2164  N N      . LEU A 1 143 ? -52.571  -6.266  11.093  1    57.92  ? 139  LEU A N      1 
ATOM   2165  C CA     . LEU A 1 143 ? -51.27   -6.354  11.76   1    59.59  ? 139  LEU A CA     1 
ATOM   2166  C C      . LEU A 1 143 ? -51.449  -6.519  13.262  1    58.95  ? 139  LEU A C      1 
ATOM   2167  O O      . LEU A 1 143 ? -52.224  -5.782  13.885  1    56.93  ? 139  LEU A O      1 
ATOM   2168  C CB     . LEU A 1 143 ? -50.436  -5.095  11.517  1    59.81  ? 139  LEU A CB     1 
ATOM   2169  C CG     . LEU A 1 143 ? -50.08   -4.791  10.08   1    60.9   ? 139  LEU A CG     1 
ATOM   2170  C CD1    . LEU A 1 143 ? -49.55   -3.388  9.956   1    60.72  ? 139  LEU A CD1    1 
ATOM   2171  C CD2    . LEU A 1 143 ? -49.064  -5.775  9.545   1    63.7   ? 139  LEU A CD2    1 
ATOM   2172  H H      . LEU A 1 143 ? -53.254  -5.775  11.66   0    95.75  ? 139  LEU A H      1 
ATOM   2173  H HA     . LEU A 1 143 ? -50.722  -7.219  11.392  0    102.84 ? 139  LEU A HA     1 
ATOM   2174  H HB2    . LEU A 1 143 ? -50.995  -4.244  11.901  0    99.89  ? 139  LEU A HB2    1 
ATOM   2175  H HB3    . LEU A 1 143 ? -49.504  -5.193  12.072  0    102.91 ? 139  LEU A HB3    1 
ATOM   2176  H HG     . LEU A 1 143 ? -50.976  -4.863  9.464   0    103.09 ? 139  LEU A HG     1 
ATOM   2177  H HD11   . LEU A 1 143 ? -49.27   -3.194  8.922   0    104.57 ? 139  LEU A HD11   1 
ATOM   2178  H HD12   . LEU A 1 143 ? -50.324  -2.686  10.261  0    101.74 ? 139  LEU A HD12   1 
ATOM   2179  H HD13   . LEU A 1 143 ? -48.68   -3.282  10.603  0    104.58 ? 139  LEU A HD13   1 
ATOM   2180  H HD21   . LEU A 1 143 ? -48.766  -5.463  8.545   0    111.04 ? 139  LEU A HD21   1 
ATOM   2181  H HD22   . LEU A 1 143 ? -48.196  -5.787  10.201  0    111.24 ? 139  LEU A HD22   1 
ATOM   2182  H HD23   . LEU A 1 143 ? -49.508  -6.768  9.491   0    110.4  ? 139  LEU A HD23   1 
ATOM   2183  N N      . PHE A 1 144 ? -50.68   -7.455  13.84   1    60.92  ? 140  PHE A N      1 
ATOM   2184  C CA     . PHE A 1 144 ? -50.686  -7.768  15.259  1    60.9   ? 140  PHE A CA     1 
ATOM   2185  C C      . PHE A 1 144 ? -49.279  -7.542  15.812  1    62.85  ? 140  PHE A C      1 
ATOM   2186  O O      . PHE A 1 144 ? -48.382  -8.327  15.521  1    65.3   ? 140  PHE A O      1 
ATOM   2187  C CB     . PHE A 1 144 ? -51.115  -9.224  15.454  1    61.8   ? 140  PHE A CB     1 
ATOM   2188  C CG     . PHE A 1 144 ? -51.276  -9.597  16.904  1    61.83  ? 140  PHE A CG     1 
ATOM   2189  C CD1    . PHE A 1 144 ? -52.387  -9.193  17.62   1    59.66  ? 140  PHE A CD1    1 
ATOM   2190  C CD2    . PHE A 1 144 ? -50.309  -10.331 17.556  1    64.26  ? 140  PHE A CD2    1 
ATOM   2191  C CE1    . PHE A 1 144 ? -52.534  -9.531  18.958  1    59.91  ? 140  PHE A CE1    1 
ATOM   2192  C CE2    . PHE A 1 144 ? -50.458  -10.663 18.894  1    64.52  ? 140  PHE A CE2    1 
ATOM   2193  C CZ     . PHE A 1 144 ? -51.575  -10.271 19.583  1    62.34  ? 140  PHE A CZ     1 
ATOM   2194  H H      . PHE A 1 144 ? -50.014  -8.026  13.33   0    105.72 ? 140  PHE A H      1 
ATOM   2195  H HA     . PHE A 1 144 ? -51.388  -7.136  15.8    0    102.06 ? 140  PHE A HA     1 
ATOM   2196  H HB2    . PHE A 1 144 ? -52.08   -9.368  14.969  0    104.67 ? 140  PHE A HB2    1 
ATOM   2197  H HB3    . PHE A 1 144 ? -50.382  -9.889  15.002  0    107.89 ? 140  PHE A HB3    1 
ATOM   2198  H HD1    . PHE A 1 144 ? -53.153  -8.617  17.128  0    99.49  ? 140  PHE A HD1    1 
ATOM   2199  H HD2    . PHE A 1 144 ? -49.432  -10.656 17.021  0    113.25 ? 140  PHE A HD2    1 
ATOM   2200  H HE1    . PHE A 1 144 ? -53.409  -9.215  19.5    0    100.31 ? 140  PHE A HE1    1 
ATOM   2201  H HE2    . PHE A 1 144 ? -49.698  -11.246 19.389  0    114.14 ? 140  PHE A HE2    1 
ATOM   2202  H HZ     . PHE A 1 144 ? -51.683  -10.526 20.625  0    107.63 ? 140  PHE A HZ     1 
ATOM   2203  N N      . LYS A 1 145 ? -49.076  -6.446  16.573  1    61.97  ? 141  LYS A N      1 
ATOM   2204  C CA     . LYS A 1 145 ? -47.776  -6.091  17.156  1    63.87  ? 141  LYS A CA     1 
ATOM   2205  C C      . LYS A 1 145 ? -47.508  -6.907  18.434  1    65.23  ? 141  LYS A C      1 
ATOM   2206  O O      . LYS A 1 145 ? -48.447  -7.2    19.18   1    63.92  ? 141  LYS A O      1 
ATOM   2207  C CB     . LYS A 1 145 ? -47.711  -4.574  17.401  1    62.57  ? 141  LYS A CB     1 
ATOM   2208  C CG     . LYS A 1 145 ? -46.389  -4.097  17.957  1    64.75  ? 141  LYS A CG     1 
ATOM   2209  C CD     . LYS A 1 145 ? -46.254  -2.589  17.886  1    63.99  ? 141  LYS A CD     1 
ATOM   2210  C CE     . LYS A 1 145 ? -45.849  -2.098  16.53   1    64.52  ? 141  LYS A CE     1 
ATOM   2211  N NZ     . LYS A 1 145 ? -44.634  -1.245  16.583  1    65.97  ? 141  LYS A NZ     1 
ATOM   2212  H H      . LYS A 1 145 ? -49.803  -5.774  16.798  0    104.44 ? 141  LYS A H      1 
ATOM   2213  H HA     . LYS A 1 145 ? -46.974  -6.321  16.459  0    112.21 ? 141  LYS A HA     1 
ATOM   2214  H HB2    . LYS A 1 145 ? -47.876  -4.066  16.452  0    107.05 ? 141  LYS A HB2    1 
ATOM   2215  H HB3    . LYS A 1 145 ? -48.492  -4.293  18.105  0    106.2  ? 141  LYS A HB3    1 
ATOM   2216  H HG2    . LYS A 1 145 ? -46.33   -4.372  19.01   0    112.95 ? 141  LYS A HG2    1 
ATOM   2217  H HG3    . LYS A 1 145 ? -45.571  -4.563  17.41   0    114.52 ? 141  LYS A HG3    1 
ATOM   2218  H HD2    . LYS A 1 145 ? -47.215  -2.138  18.133  0    108.8  ? 141  LYS A HD2    1 
ATOM   2219  H HD3    . LYS A 1 145 ? -45.5    -2.27   18.603  0    112.29 ? 141  LYS A HD3    1 
ATOM   2220  H HE2    . LYS A 1 145 ? -45.646  -2.95   15.884  0    113.12 ? 141  LYS A HE2    1 
ATOM   2221  H HE3    . LYS A 1 145 ? -46.66   -1.502  16.113  0    110.04 ? 141  LYS A HE3    1 
ATOM   2222  H HZ1    . LYS A 1 145 ? -44.41   -0.908  15.653  0    115.49 ? 141  LYS A HZ1    1 
ATOM   2223  H HZ2    . LYS A 1 145 ? -44.799  -0.448  17.19   0    114.56 ? 141  LYS A HZ2    1 
ATOM   2224  H HZ3    . LYS A 1 145 ? -43.849  -1.778  16.942  0    117.43 ? 141  LYS A HZ3    1 
ATOM   2225  N N      . VAL A 1 146 ? -46.229  -7.3    18.666  1    68.12  ? 142  VAL A N      1 
ATOM   2226  C CA     . VAL A 1 146 ? -45.848  -8.144  19.802  1    70.05  ? 142  VAL A CA     1 
ATOM   2227  C C      . VAL A 1 146 ? -44.619  -7.564  20.49   1    72.12  ? 142  VAL A C      1 
ATOM   2228  O O      . VAL A 1 146 ? -43.545  -7.56   19.895  1    74.06  ? 142  VAL A O      1 
ATOM   2229  C CB     . VAL A 1 146 ? -45.547  -9.603  19.356  1    72.31  ? 142  VAL A CB     1 
ATOM   2230  C CG1    . VAL A 1 146 ? -45.389  -10.533 20.552  1    74.12  ? 142  VAL A CG1    1 
ATOM   2231  C CG2    . VAL A 1 146 ? -46.637  -10.136 18.437  1    70.7   ? 142  VAL A CG2    1 
ATOM   2232  H H      . VAL A 1 146 ? -45.433  -7.008  18.108  0    121.15 ? 142  VAL A H      1 
ATOM   2233  H HA     . VAL A 1 146 ? -46.658  -8.172  20.53   0    122.84 ? 142  VAL A HA     1 
ATOM   2234  H HB     . VAL A 1 146 ? -44.611  -9.624  18.799  0    130.85 ? 142  VAL A HB     1 
ATOM   2235  H HG11   . VAL A 1 146 ? -45.08   -11.513 20.191  0    134.88 ? 142  VAL A HG11   1 
ATOM   2236  H HG12   . VAL A 1 146 ? -44.638  -10.148 21.24   0    134.91 ? 142  VAL A HG12   1 
ATOM   2237  H HG13   . VAL A 1 146 ? -46.352  -10.617 21.055  0    131.68 ? 142  VAL A HG13   1 
ATOM   2238  H HG21   . VAL A 1 146 ? -46.54   -11.219 18.366  0    127.04 ? 142  VAL A HG21   1 
ATOM   2239  H HG22   . VAL A 1 146 ? -47.608  -9.879  18.859  0    123.42 ? 142  VAL A HG22   1 
ATOM   2240  H HG23   . VAL A 1 146 ? -46.525  -9.688  17.451  0    124.71 ? 142  VAL A HG23   1 
ATOM   2241  N N      . ILE A 1 147 ? -44.762  -7.118  21.753  1    71.97  ? 143  ILE A N      1 
ATOM   2242  C CA     . ILE A 1 147 ? -43.637  -6.615  22.54   1    74.17  ? 143  ILE A CA     1 
ATOM   2243  C C      . ILE A 1 147 ? -43.206  -7.801  23.407  1    76.85  ? 143  ILE A C      1 
ATOM   2244  O O      . ILE A 1 147 ? -43.944  -8.136  24.34   1    76.13  ? 143  ILE A O      1 
ATOM   2245  C CB     . ILE A 1 147 ? -44.017  -5.421  23.462  1    72.53  ? 143  ILE A CB     1 
ATOM   2246  C CG1    . ILE A 1 147 ? -44.77   -4.327  22.698  1    69.56  ? 143  ILE A CG1    1 
ATOM   2247  C CG2    . ILE A 1 147 ? -42.767  -4.806  24.109  1    75.1   ? 143  ILE A CG2    1 
ATOM   2248  C CD1    . ILE A 1 147 ? -45.838  -3.605  23.488  1    67.22  ? 143  ILE A CD1    1 
ATOM   2249  H H      . ILE A 1 147 ? -45.644  -7.09   22.255  0    126.67 ? 143  ILE A H      1 
ATOM   2250  H HA     . ILE A 1 147 ? -42.833  -6.283  21.887  0    134.36 ? 143  ILE A HA     1 
ATOM   2251  H HB     . ILE A 1 147 ? -44.632  -5.81   24.272  0    129.14 ? 143  ILE A HB     1 
ATOM   2252  H HG12   . ILE A 1 147 ? -44.046  -3.567  22.408  0    123.95 ? 143  ILE A HG12   1 
ATOM   2253  H HG13   . ILE A 1 147 ? -45.242  -4.732  21.805  0    122.13 ? 143  ILE A HG13   1 
ATOM   2254  H HG21   . ILE A 1 147 ? -43.055  -3.879  24.602  0    134.28 ? 143  ILE A HG21   1 
ATOM   2255  H HG22   . ILE A 1 147 ? -42.357  -5.497  24.843  0    137.5  ? 143  ILE A HG22   1 
ATOM   2256  H HG23   . ILE A 1 147 ? -42.027  -4.6    23.337  0    136.36 ? 143  ILE A HG23   1 
ATOM   2257  H HD11   . ILE A 1 147 ? -46.09   -2.682  22.966  0    116.3  ? 143  ILE A HD11   1 
ATOM   2258  H HD12   . ILE A 1 147 ? -46.722  -4.235  23.549  0    116.91 ? 143  ILE A HD12   1 
ATOM   2259  H HD13   . ILE A 1 147 ? -45.462  -3.381  24.485  0    119.02 ? 143  ILE A HD13   1 
ATOM   2260  N N      . PRO A 1 148 ? -42.069  -8.48   23.135  1    80.14  ? 144  PRO A N      1 
ATOM   2261  C CA     . PRO A 1 148 ? -41.679  -9.604  24.001  1    82.96  ? 144  PRO A CA     1 
ATOM   2262  C C      . PRO A 1 148 ? -41.319  -9.12   25.403  1    84.23  ? 144  PRO A C      1 
ATOM   2263  O O      . PRO A 1 148 ? -40.506  -8.21   25.55   1    85.19  ? 144  PRO A O      1 
ATOM   2264  C CB     . PRO A 1 148 ? -40.468  -10.212 23.289  1    86.28  ? 144  PRO A CB     1 
ATOM   2265  C CG     . PRO A 1 148 ? -40.441  -9.59   21.947  1    84.76  ? 144  PRO A CG     1 
ATOM   2266  C CD     . PRO A 1 148 ? -41.072  -8.26   22.073  1    81.72  ? 144  PRO A CD     1 
ATOM   2267  H HA     . PRO A 1 148 ? -42.475  -10.346 24.043  0    151.6  ? 144  PRO A HA     1 
ATOM   2268  H HB2    . PRO A 1 148 ? -39.557  -9.977  23.837  0    162.22 ? 144  PRO A HB2    1 
ATOM   2269  H HB3    . PRO A 1 148 ? -40.599  -11.29  23.206  0    160.95 ? 144  PRO A HB3    1 
ATOM   2270  H HG2    . PRO A 1 148 ? -39.41   -9.495  21.607  0    158.91 ? 144  PRO A HG2    1 
ATOM   2271  H HG3    . PRO A 1 148 ? -41.013  -10.214 21.264  0    155.61 ? 144  PRO A HG3    1 
ATOM   2272  H HD2    . PRO A 1 148 ? -40.34   -7.512  22.376  0    150.94 ? 144  PRO A HD2    1 
ATOM   2273  H HD3    . PRO A 1 148 ? -41.546  -8.004  21.126  0    147.94 ? 144  PRO A HD3    1 
ATOM   2274  N N      . LEU A 1 149 ? -41.968  -9.678  26.423  1    84.28  ? 145  LEU A N      1 
ATOM   2275  C CA     . LEU A 1 149 ? -41.71   -9.297  27.802  1    85.65  ? 145  LEU A CA     1 
ATOM   2276  C C      . LEU A 1 149 ? -40.456  -10     28.249  1    90.19  ? 145  LEU A C      1 
ATOM   2277  O O      . LEU A 1 149 ? -40.519  -11.073 28.849  1    92.15  ? 145  LEU A O      1 
ATOM   2278  C CB     . LEU A 1 149 ? -42.891  -9.696  28.691  1    84.21  ? 145  LEU A CB     1 
ATOM   2279  C CG     . LEU A 1 149 ? -44.128  -8.827  28.549  1    80.1   ? 145  LEU A CG     1 
ATOM   2280  C CD1    . LEU A 1 149 ? -45.353  -9.53   29.102  1    78.97  ? 145  LEU A CD1    1 
ATOM   2281  C CD2    . LEU A 1 149 ? -43.917  -7.498  29.225  1    79.62  ? 145  LEU A CD2    1 
ATOM   2282  H H      . LEU A 1 149 ? -42.666  -10.407 26.319  0    154.68 ? 145  LEU A H      1 
ATOM   2283  H HA     . LEU A 1 149 ? -41.548  -8.223  27.881  0    157.53 ? 145  LEU A HA     1 
ATOM   2284  H HB2    . LEU A 1 149 ? -43.177  -10.723 28.467  0    155.77 ? 145  LEU A HB2    1 
ATOM   2285  H HB3    . LEU A 1 149 ? -42.569  -9.644  29.729  0    157.08 ? 145  LEU A HB3    1 
ATOM   2286  H HG     . LEU A 1 149 ? -44.322  -8.637  27.494  0    144.59 ? 145  LEU A HG     1 
ATOM   2287  H HD11   . LEU A 1 149 ? -46.226  -8.892  28.971  0    140.99 ? 145  LEU A HD11   1 
ATOM   2288  H HD12   . LEU A 1 149 ? -45.5    -10.464 28.562  0    144.04 ? 145  LEU A HD12   1 
ATOM   2289  H HD13   . LEU A 1 149 ? -45.195  -9.734  30.16   0    145.51 ? 145  LEU A HD13   1 
ATOM   2290  H HD21   . LEU A 1 149 ? -44.888  -7.036  29.389  0    142.67 ? 145  LEU A HD21   1 
ATOM   2291  H HD22   . LEU A 1 149 ? -43.42   -7.642  30.183  0    147.46 ? 145  LEU A HD22   1 
ATOM   2292  H HD23   . LEU A 1 149 ? -43.31   -6.864  28.581  0    145.45 ? 145  LEU A HD23   1 
ATOM   2293  N N      . ASP A 1 150 ? -39.309  -9.42   27.889  1    92.05  ? 146  ASP A N      1 
ATOM   2294  C CA     . ASP A 1 150 ? -37.996  -9.961  28.215  1    96.66  ? 146  ASP A CA     1 
ATOM   2295  C C      . ASP A 1 150 ? -37.294  -9.059  29.218  1    98.51  ? 146  ASP A C      1 
ATOM   2296  O O      . ASP A 1 150 ? -37.666  -7.895  29.409  1    96.17  ? 146  ASP A O      1 
ATOM   2297  C CB     . ASP A 1 150 ? -37.137  -10.116 26.942  1    98.01  ? 146  ASP A CB     1 
ATOM   2298  C CG     . ASP A 1 150 ? -37.598  -11.201 25.984  1    97.02  ? 146  ASP A CG     1 
ATOM   2299  O OD1    . ASP A 1 150 ? -38.51   -11.975 26.351  1    95.88  ? 146  ASP A OD1    1 
ATOM   2300  O OD2    . ASP A 1 150 ? -37.043  -11.281 24.87   1    97.59  ? 146  ASP A OD2    1 
ATOM   2301  H H      . ASP A 1 150 ? -39.264  -8.552  27.366  0    170.93 ? 146  ASP A H      1 
ATOM   2302  H HA     . ASP A 1 150 ? -38.088  -10.942 28.679  0    184.22 ? 146  ASP A HA     1 
ATOM   2303  H HB2    . ASP A 1 150 ? -37.147  -9.173  26.396  0    183.89 ? 146  ASP A HB2    1 
ATOM   2304  H HB3    . ASP A 1 150 ? -36.118  -10.355 27.243  0    189.12 ? 146  ASP A HB3    1 
ATOM   2305  N N      . ARG A 1 151 ? -36.287  -9.623  29.882  1    102.99 ? 147  ARG A N      1 
ATOM   2306  C CA     . ARG A 1 151 ? -35.494  -8.901  30.863  1    105.61 ? 147  ARG A CA     1 
ATOM   2307  C C      . ARG A 1 151 ? -34.731  -7.767  30.168  1    105.32 ? 147  ARG A C      1 
ATOM   2308  O O      . ARG A 1 151 ? -34.7    -6.649  30.681  1    104.47 ? 147  ARG A O      1 
ATOM   2309  C CB     . ARG A 1 151 ? -34.512  -9.87   31.542  1    110.86 ? 147  ARG A CB     1 
ATOM   2310  C CG     . ARG A 1 151 ? -33.665  -9.253  32.645  1    114.22 ? 147  ARG A CG     1 
ATOM   2311  C CD     . ARG A 1 151 ? -32.419  -10.073 32.888  1    119.67 ? 147  ARG A CD     1 
ATOM   2312  N NE     . ARG A 1 151 ? -32.709  -11.431 33.359  1    121.17 ? 147  ARG A NE     1 
ATOM   2313  C CZ     . ARG A 1 151 ? -33.07   -11.749 34.606  1    122.5  ? 147  ARG A CZ     1 
ATOM   2314  N NH1    . ARG A 1 151 ? -33.23   -10.8   35.525  1    122.4  ? 147  ARG A NH1    1 
ATOM   2315  N NH2    . ARG A 1 151 ? -33.293  -13.019 34.936  1    124.08 ? 147  ARG A NH2    1 
ATOM   2316  H H      . ARG A 1 151 ? -36.001  -10.587 29.741  0    198.41 ? 147  ARG A H      1 
ATOM   2317  H HA     . ARG A 1 151 ? -36.146  -8.474  31.624  0    200.57 ? 147  ARG A HA     1 
ATOM   2318  H HB2    . ARG A 1 151 ? -35.081  -10.688 31.981  0    213.71 ? 147  ARG A HB2    1 
ATOM   2319  H HB3    . ARG A 1 151 ? -33.842  -10.266 30.779  0    215.03 ? 147  ARG A HB3    1 
ATOM   2320  H HG2    . ARG A 1 151 ? -33.345  -8.247  32.38   0    220.24 ? 147  ARG A HG2    1 
ATOM   2321  H HG3    . ARG A 1 151 ? -34.244  -9.229  33.567  0    220.47 ? 147  ARG A HG3    1 
ATOM   2322  H HD2    . ARG A 1 151 ? -31.868  -10.168 31.953  0    233.49 ? 147  ARG A HD2    1 
ATOM   2323  H HD3    . ARG A 1 151 ? -31.791  -9.575  33.624  0    235.44 ? 147  ARG A HD3    1 
ATOM   2324  H HE     . ARG A 1 151 ? -32.598  -12.186 32.691  0    236.78 ? 147  ARG A HE     1 
ATOM   2325  H HH11   . ARG A 1 151 ? -33.068  -9.819  35.323  0    237.62 ? 147  ARG A HH11   1 
ATOM   2326  H HH12   . ARG A 1 151 ? -33.511  -11.061 36.464  0    239.83 ? 147  ARG A HH12   1 
ATOM   2327  H HH21   . ARG A 1 151 ? -33.194  -13.754 34.243  0    243.12 ? 147  ARG A HH21   1 
ATOM   2328  H HH22   . ARG A 1 151 ? -33.589  -13.263 35.876  0    243.8  ? 147  ARG A HH22   1 
ATOM   2329  N N      . ASP A 1 152 ? -34.152  -8.044  28.985  1    106.18 ? 148  ASP A N      1 
ATOM   2330  C CA     . ASP A 1 152 ? -33.355  -7.063  28.243  1    106.44 ? 148  ASP A CA     1 
ATOM   2331  C C      . ASP A 1 152 ? -34.192  -6.035  27.476  1    101.87 ? 148  ASP A C      1 
ATOM   2332  O O      . ASP A 1 152 ? -33.656  -4.99   27.102  1    101.93 ? 148  ASP A O      1 
ATOM   2333  C CB     . ASP A 1 152 ? -32.392  -7.784  27.278  1    109.54 ? 148  ASP A CB     1 
ATOM   2334  C CG     . ASP A 1 152 ? -31.462  -8.782  27.96   1    114.71 ? 148  ASP A CG     1 
ATOM   2335  O OD1    . ASP A 1 152 ? -30.224  -8.639  27.814  1    118.31 ? 148  ASP A OD1    1 
ATOM   2336  O OD2    . ASP A 1 152 ? -31.973  -9.703  28.641  1    115.35 ? 148  ASP A OD2    1 
ATOM   2337  H H      . ASP A 1 152 ? -34.221  -8.94   28.513  0    204.07 ? 148  ASP A H      1 
ATOM   2338  H HA     . ASP A 1 152 ? -32.734  -6.511  28.947  0    206.11 ? 148  ASP A HA     1 
ATOM   2339  H HB2    . ASP A 1 152 ? -32.978  -8.32   26.534  0    209.08 ? 148  ASP A HB2    1 
ATOM   2340  H HB3    . ASP A 1 152 ? -31.772  -7.036  26.786  0    211.32 ? 148  ASP A HB3    1 
ATOM   2341  N N      . ASN A 1 153 ? -35.481  -6.319  27.225  1    98.18  ? 149  ASN A N      1 
ATOM   2342  C CA     . ASN A 1 153 ? -36.334  -5.4    26.479  1    94.03  ? 149  ASN A CA     1 
ATOM   2343  C C      . ASN A 1 153 ? -36.838  -4.232  27.341  1    92.27  ? 149  ASN A C      1 
ATOM   2344  O O      . ASN A 1 153 ? -37.966  -4.243  27.844  1    89.66  ? 149  ASN A O      1 
ATOM   2345  C CB     . ASN A 1 153 ? -37.498  -6.148  25.832  1    91.06  ? 149  ASN A CB     1 
ATOM   2346  C CG     . ASN A 1 153 ? -38.225  -5.331  24.793  1    87.44  ? 149  ASN A CG     1 
ATOM   2347  O OD1    . ASN A 1 153 ? -37.766  -4.265  24.358  1    87.27  ? 149  ASN A OD1    1 
ATOM   2348  N ND2    . ASN A 1 153 ? -39.374  -5.822  24.351  1    84.68  ? 149  ASN A ND2    1 
ATOM   2349  H H      . ASN A 1 153 ? -35.956  -7.172  27.501  0    185.86 ? 149  ASN A H      1 
ATOM   2350  H HA     . ASN A 1 153 ? -35.739  -4.977  25.671  0    177.39 ? 149  ASN A HA     1 
ATOM   2351  H HB2    . ASN A 1 153 ? -37.105  -7.033  25.334  0    171.99 ? 149  ASN A HB2    1 
ATOM   2352  H HB3    . ASN A 1 153 ? -38.215  -6.452  26.593  0    169.3  ? 149  ASN A HB3    1 
ATOM   2353  H HD21   . ASN A 1 153 ? -39.907  -5.314  23.653  0    154    ? 149  ASN A HD21   1 
ATOM   2354  H HD22   . ASN A 1 153 ? -39.723  -6.706  24.708  0    156.59 ? 149  ASN A HD22   1 
ATOM   2355  N N      . LYS A 1 154 ? -35.977  -3.22   27.487  1    93.95  ? 150  LYS A N      1 
ATOM   2356  C CA     . LYS A 1 154 ? -36.264  -2.012  28.249  1    92.98  ? 150  LYS A CA     1 
ATOM   2357  C C      . LYS A 1 154 ? -36.86   -0.938  27.327  1    89.54  ? 150  LYS A C      1 
ATOM   2358  O O      . LYS A 1 154 ? -37.715  -0.18   27.765  1    87.14  ? 150  LYS A O      1 
ATOM   2359  C CB     . LYS A 1 154 ? -34.981  -1.508  28.93   1    97.03  ? 150  LYS A CB     1 
ATOM   2360  C CG     . LYS A 1 154 ? -34.356  -2.519  29.888  1    100.88 ? 150  LYS A CG     1 
ATOM   2361  C CD     . LYS A 1 154 ? -32.904  -2.824  29.518  1    105.29 ? 150  LYS A CD     1 
ATOM   2362  C CE     . LYS A 1 154 ? -32.215  -3.722  30.52   1    109.49 ? 150  LYS A CE     1 
ATOM   2363  N NZ     . LYS A 1 154 ? -30.753  -3.826  30.266  1    114.05 ? 150  LYS A NZ     1 
ATOM   2364  H H      . LYS A 1 154 ? -35.05   -3.216  27.075  0    178.84 ? 150  LYS A H      1 
ATOM   2365  H HA     . LYS A 1 154 ? -36.986  -2.225  29.036  0    173.47 ? 150  LYS A HA     1 
ATOM   2366  H HB2    . LYS A 1 154 ? -34.242  -1.275  28.164  0    184.49 ? 150  LYS A HB2    1 
ATOM   2367  H HB3    . LYS A 1 154 ? -35.214  -0.612  29.503  0    182.65 ? 150  LYS A HB3    1 
ATOM   2368  H HG2    . LYS A 1 154 ? -34.366  -2.103  30.895  0    192.37 ? 150  LYS A HG2    1 
ATOM   2369  H HG3    . LYS A 1 154 ? -34.918  -3.451  29.867  0    190.98 ? 150  LYS A HG3    1 
ATOM   2370  H HD2    . LYS A 1 154 ? -32.88   -3.321  28.549  0    201.08 ? 150  LYS A HD2    1 
ATOM   2371  H HD3    . LYS A 1 154 ? -32.347  -1.889  29.472  0    202.15 ? 150  LYS A HD3    1 
ATOM   2372  H HE2    . LYS A 1 154 ? -32.355  -3.313  31.519  0    210.97 ? 150  LYS A HE2    1 
ATOM   2373  H HE3    . LYS A 1 154 ? -32.644  -4.721  30.46   0    210.19 ? 150  LYS A HE3    1 
ATOM   2374  H HZ1    . LYS A 1 154 ? -30.319  -4.403  30.98   0    223.53 ? 150  LYS A HZ1    1 
ATOM   2375  H HZ2    . LYS A 1 154 ? -30.587  -4.246  29.357  0    220.55 ? 150  LYS A HZ2    1 
ATOM   2376  H HZ3    . LYS A 1 154 ? -30.33   -2.904  30.286  0    221.2  ? 150  LYS A HZ3    1 
ATOM   2377  N N      . GLU A 1 155 ? -36.42   -0.87   26.057  1    89.54  ? 151  GLU A N      1 
ATOM   2378  C CA     . GLU A 1 155 ? -36.951  0.096   25.094  1    86.66  ? 151  GLU A CA     1 
ATOM   2379  C C      . GLU A 1 155 ? -38.343  -0.298  24.543  1    82.89  ? 151  GLU A C      1 
ATOM   2380  O O      . GLU A 1 155 ? -38.972  0.526   23.873  1    80.38  ? 151  GLU A O      1 
ATOM   2381  C CB     . GLU A 1 155 ? -35.964  0.288   23.927  1    88.48  ? 151  GLU A CB     1 
ATOM   2382  C CG     . GLU A 1 155 ? -34.633  0.89    24.349  1    92.01  ? 151  GLU A CG     1 
ATOM   2383  C CD     . GLU A 1 155 ? -33.633  1.11    23.227  1    94.24  ? 151  GLU A CD     1 
ATOM   2384  O OE1    . GLU A 1 155 ? -32.426  1.25    23.526  1    97.78  ? 151  GLU A OE1    1 
ATOM   2385  O OE2    . GLU A 1 155 ? -34.054  1.145   22.049  1    92.66  ? 151  GLU A OE2    1 
ATOM   2386  H H      . GLU A 1 155 ? -35.693  -1.46   25.665  0    169.22 ? 151  GLU A H      1 
ATOM   2387  H HA     . GLU A 1 155 ? -37.052  1.065   25.582  0    160.21 ? 151  GLU A HA     1 
ATOM   2388  H HB2    . GLU A 1 155 ? -35.766  -0.676  23.46   0    165.68 ? 151  GLU A HB2    1 
ATOM   2389  H HB3    . GLU A 1 155 ? -36.413  0.964   23.202  0    162.63 ? 151  GLU A HB3    1 
ATOM   2390  H HG2    . GLU A 1 155 ? -34.822  1.861   24.805  0    171.73 ? 151  GLU A HG2    1 
ATOM   2391  H HG3    . GLU A 1 155 ? -34.167  0.233   25.082  0    174.85 ? 151  GLU A HG3    1 
ATOM   2392  N N      . LEU A 1 156 ? -38.832  -1.529  24.83   1    82.66  ? 152  LEU A N      1 
ATOM   2393  C CA     . LEU A 1 156 ? -40.13   -2.026  24.354  1    79.47  ? 152  LEU A CA     1 
ATOM   2394  C C      . LEU A 1 156 ? -40.172  -2.13   22.837  1    78.51  ? 152  LEU A C      1 
ATOM   2395  O O      . LEU A 1 156 ? -41.094  -1.632  22.188  1    75.62  ? 152  LEU A O      1 
ATOM   2396  C CB     . LEU A 1 156 ? -41.303  -1.198  24.894  1    76.41  ? 152  LEU A CB     1 
ATOM   2397  C CG     . LEU A 1 156 ? -41.37   -1.057  26.406  1    77.36  ? 152  LEU A CG     1 
ATOM   2398  C CD1    . LEU A 1 156 ? -42.544  -0.214  26.804  1    74.42  ? 152  LEU A CD1    1 
ATOM   2399  C CD2    . LEU A 1 156 ? -41.453  -2.416  27.093  1    78.83  ? 152  LEU A CD2    1 
ATOM   2400  H H      . LEU A 1 156 ? -38.349  -2.221  25.394  0    154.04 ? 152  LEU A H      1 
ATOM   2401  H HA     . LEU A 1 156 ? -40.248  -3.045  24.72   0    145.61 ? 152  LEU A HA     1 
ATOM   2402  H HB2    . LEU A 1 156 ? -41.244  -0.194  24.477  0    137.3  ? 152  LEU A HB2    1 
ATOM   2403  H HB3    . LEU A 1 156 ? -42.231  -1.671  24.58   0    136.06 ? 152  LEU A HB3    1 
ATOM   2404  H HG     . LEU A 1 156 ? -40.469  -0.559  26.761  0    142.24 ? 152  LEU A HG     1 
ATOM   2405  H HD11   . LEU A 1 156 ? -42.548  -0.1    27.886  0    134.54 ? 152  LEU A HD11   1 
ATOM   2406  H HD12   . LEU A 1 156 ? -42.458  0.761   26.327  0    132.88 ? 152  LEU A HD12   1 
ATOM   2407  H HD13   . LEU A 1 156 ? -43.459  -0.708  26.48   0    131.67 ? 152  LEU A HD13   1 
ATOM   2408  H HD21   . LEU A 1 156 ? -41.715  -2.266  28.139  0    143.56 ? 152  LEU A HD21   1 
ATOM   2409  H HD22   . LEU A 1 156 ? -42.212  -3.019  26.599  0    141.56 ? 152  LEU A HD22   1 
ATOM   2410  H HD23   . LEU A 1 156 ? -40.484  -2.909  27.032  0    145.96 ? 152  LEU A HD23   1 
ATOM   2411  N N      . LYS A 1 157 ? -39.144  -2.79   22.28   1    81.24  ? 153  LYS A N      1 
ATOM   2412  C CA     . LYS A 1 157 ? -39.024  -3.047  20.85   1    81.04  ? 153  LYS A CA     1 
ATOM   2413  C C      . LYS A 1 157 ? -40.054  -4.128  20.488  1    79.24  ? 153  LYS A C      1 
ATOM   2414  O O      . LYS A 1 157 ? -40.258  -5.07   21.257  1    79.87  ? 153  LYS A O      1 
ATOM   2415  C CB     . LYS A 1 157 ? -37.59   -3.498  20.503  1    84.95  ? 153  LYS A CB     1 
ATOM   2416  C CG     . LYS A 1 157 ? -36.521  -2.438  20.781  1    87.03  ? 153  LYS A CG     1 
ATOM   2417  C CD     . LYS A 1 157 ? -35.119  -2.967  20.496  1    91.25  ? 153  LYS A CD     1 
ATOM   2418  C CE     . LYS A 1 157 ? -34.045  -1.915  20.661  1    93.53  ? 153  LYS A CE     1 
ATOM   2419  N NZ     . LYS A 1 157 ? -32.676  -2.481  20.53   1    98.08  ? 153  LYS A NZ     1 
ATOM   2420  H H      . LYS A 1 157 ? -38.375  -3.177  22.816  0    151.39 ? 153  LYS A H      1 
ATOM   2421  H HA     . LYS A 1 157 ? -39.248  -2.137  20.295  0    146.89 ? 153  LYS A HA     1 
ATOM   2422  H HB2    . LYS A 1 157 ? -37.344  -4.384  21.085  0    158.74 ? 153  LYS A HB2    1 
ATOM   2423  H HB3    . LYS A 1 157 ? -37.55   -3.735  19.441  0    156.92 ? 153  LYS A HB3    1 
ATOM   2424  H HG2    . LYS A 1 157 ? -36.696  -1.575  20.139  0    160.21 ? 153  LYS A HG2    1 
ATOM   2425  H HG3    . LYS A 1 157 ? -36.565  -2.144  21.829  0    161.71 ? 153  LYS A HG3    1 
ATOM   2426  H HD2    . LYS A 1 157 ? -34.903  -3.783  21.183  0    172.52 ? 153  LYS A HD2    1 
ATOM   2427  H HD3    . LYS A 1 157 ? -35.079  -3.325  19.468  0    170.97 ? 153  LYS A HD3    1 
ATOM   2428  H HE2    . LYS A 1 157 ? -34.167  -1.155  19.892  0    174.83 ? 153  LYS A HE2    1 
ATOM   2429  H HE3    . LYS A 1 157 ? -34.135  -1.469  21.65   0    175.7  ? 153  LYS A HE3    1 
ATOM   2430  H HZ1    . LYS A 1 157 ? -31.984  -1.745  20.634  0    187.57 ? 153  LYS A HZ1    1 
ATOM   2431  H HZ2    . LYS A 1 157 ? -32.52   -3.182  21.247  0    187.27 ? 153  LYS A HZ2    1 
ATOM   2432  H HZ3    . LYS A 1 157 ? -32.562  -2.914  19.619  0    186.43 ? 153  LYS A HZ3    1 
ATOM   2433  N N      . ALA A 1 158 ? -40.726  -3.97   19.346  1    77.18  ? 154  ALA A N      1 
ATOM   2434  C CA     . ALA A 1 158 ? -41.788  -4.883  18.938  1    75.36  ? 154  ALA A CA     1 
ATOM   2435  C C      . ALA A 1 158 ? -41.745  -5.184  17.438  1    75.66  ? 154  ALA A C      1 
ATOM   2436  O O      . ALA A 1 158 ? -41.153  -4.427  16.671  1    76.75  ? 154  ALA A O      1 
ATOM   2437  C CB     . ALA A 1 158 ? -43.128  -4.265  19.303  1    71.81  ? 154  ALA A CB     1 
ATOM   2438  H H      . ALA A 1 158 ? -40.561  -3.218  18.684  0    139.65 ? 154  ALA A H      1 
ATOM   2439  H HA     . ALA A 1 158 ? -41.702  -5.834  19.461  0    137.02 ? 154  ALA A HA     1 
ATOM   2440  H HB1    . ALA A 1 158 ? -43.911  -5.011  19.173  0    126.94 ? 154  ALA A HB1    1 
ATOM   2441  H HB2    . ALA A 1 158 ? -43.089  -3.934  20.34   0    128.11 ? 154  ALA A HB2    1 
ATOM   2442  H HB3    . ALA A 1 158 ? -43.312  -3.415  18.648  0    126.97 ? 154  ALA A HB3    1 
ATOM   2443  N N      . PHE A 1 159 ? -42.373  -6.299  17.028  1    74.96  ? 155  PHE A N      1 
ATOM   2444  C CA     . PHE A 1 159 ? -42.468  -6.717  15.631  1    75.48  ? 155  PHE A CA     1 
ATOM   2445  C C      . PHE A 1 159 ? -43.909  -6.984  15.293  1    72.79  ? 155  PHE A C      1 
ATOM   2446  O O      . PHE A 1 159 ? -44.683  -7.438  16.143  1    72.57  ? 155  PHE A O      1 
ATOM   2447  C CB     . PHE A 1 159 ? -41.628  -7.973  15.359  1    79.04  ? 155  PHE A CB     1 
ATOM   2448  C CG     . PHE A 1 159 ? -41.953  -9.178  16.215  1    79.66  ? 155  PHE A CG     1 
ATOM   2449  C CD1    . PHE A 1 159 ? -42.757  -10.194 15.735  1    79.12  ? 155  PHE A CD1    1 
ATOM   2450  C CD2    . PHE A 1 159 ? -41.388  -9.331  17.464  1    81.03  ? 155  PHE A CD2    1 
ATOM   2451  C CE1    . PHE A 1 159 ? -43.028  -11.313 16.519  1    79.9   ? 155  PHE A CE1    1 
ATOM   2452  C CE2    . PHE A 1 159 ? -41.663  -10.445 18.238  1    81.85  ? 155  PHE A CE2    1 
ATOM   2453  C CZ     . PHE A 1 159 ? -42.46   -11.439 17.755  1    81.27  ? 155  PHE A CZ     1 
ATOM   2454  H H      . PHE A 1 159 ? -42.841  -6.933  17.668  0    134.75 ? 155  PHE A H      1 
ATOM   2455  H HA     . PHE A 1 159 ? -42.116  -5.932  14.963  0    136.4  ? 155  PHE A HA     1 
ATOM   2456  H HB2    . PHE A 1 159 ? -41.77   -8.265  14.32   0    144.22 ? 155  PHE A HB2    1 
ATOM   2457  H HB3    . PHE A 1 159 ? -40.58   -7.729  15.522  0    146.06 ? 155  PHE A HB3    1 
ATOM   2458  H HD1    . PHE A 1 159 ? -43.189  -10.102 14.752  0    143.15 ? 155  PHE A HD1    1 
ATOM   2459  H HD2    . PHE A 1 159 ? -40.739  -8.566  17.856  0    148.64 ? 155  PHE A HD2    1 
ATOM   2460  H HE1    . PHE A 1 159 ? -43.67   -12.093 16.153  0    145.41 ? 155  PHE A HE1    1 
ATOM   2461  H HE2    . PHE A 1 159 ? -41.199  -10.544 19.198  0    151.04 ? 155  PHE A HE2    1 
ATOM   2462  H HZ     . PHE A 1 159 ? -42.667  -12.302 18.366  0    149.34 ? 155  PHE A HZ     1 
ATOM   2463  N N      . ASN A 1 160 ? -44.262  -6.712  14.042  1    71     ? 156  ASN A N      1 
ATOM   2464  C CA     . ASN A 1 160 ? -45.611  -6.946  13.575  1    68.59  ? 156  ASN A CA     1 
ATOM   2465  C C      . ASN A 1 160 ? -45.673  -8.256  12.855  1    70.12  ? 156  ASN A C      1 
ATOM   2466  O O      . ASN A 1 160 ? -44.831  -8.517  11.993  1    72.54  ? 156  ASN A O      1 
ATOM   2467  C CB     . ASN A 1 160 ? -46.061  -5.852  12.624  1    66.85  ? 156  ASN A CB     1 
ATOM   2468  C CG     . ASN A 1 160 ? -46.446  -4.587  13.323  1    65.27  ? 156  ASN A CG     1 
ATOM   2469  O OD1    . ASN A 1 160 ? -47.529  -4.487  13.906  1    64.22  ? 156  ASN A OD1    1 
ATOM   2470  N ND2    . ASN A 1 160 ? -45.567  -3.605  13.306  1    65.27  ? 156  ASN A ND2    1 
ATOM   2471  H H      . ASN A 1 160 ? -43.635  -6.349  13.331  0    128    ? 156  ASN A H      1 
ATOM   2472  H HA     . ASN A 1 160 ? -46.31   -6.977  14.407  0    120.22 ? 156  ASN A HA     1 
ATOM   2473  H HB2    . ASN A 1 160 ? -45.276  -5.641  11.899  0    119.41 ? 156  ASN A HB2    1 
ATOM   2474  H HB3    . ASN A 1 160 ? -46.947  -6.208  12.102  0    116.73 ? 156  ASN A HB3    1 
ATOM   2475  H HD21   . ASN A 1 160 ? -45.791  -2.724  13.756  0    113.1  ? 156  ASN A HD21   1 
ATOM   2476  H HD22   . ASN A 1 160 ? -44.671  -3.716  12.841  0    116.13 ? 156  ASN A HD22   1 
ATOM   2477  N N      . ILE A 1 161 ? -46.66   -9.087  13.209  1    68.9   ? 157  ILE A N      1 
ATOM   2478  C CA     . ILE A 1 161 ? -46.921  -10.334 12.509  1    70.3   ? 157  ILE A CA     1 
ATOM   2479  C C      . ILE A 1 161 ? -48.084  -10.009 11.605  1    68.26  ? 157  ILE A C      1 
ATOM   2480  O O      . ILE A 1 161 ? -49.044  -9.358  12.038  1    65.65  ? 157  ILE A O      1 
ATOM   2481  C CB     . ILE A 1 161 ? -47.293  -11.516 13.427  1    71.04  ? 157  ILE A CB     1 
ATOM   2482  C CG1    . ILE A 1 161 ? -46.226  -11.735 14.509  1    72.72  ? 157  ILE A CG1    1 
ATOM   2483  C CG2    . ILE A 1 161 ? -47.511  -12.769 12.573  1    73.07  ? 157  ILE A CG2    1 
ATOM   2484  C CD1    . ILE A 1 161 ? -46.608  -12.713 15.579  1    73.65  ? 157  ILE A CD1    1 
ATOM   2485  H H      . ILE A 1 161 ? -47.302  -8.922  13.978  0    120.46 ? 157  ILE A H      1 
ATOM   2486  H HA     . ILE A 1 161 ? -46.06   -10.615 11.905  0    127.36 ? 157  ILE A HA     1 
ATOM   2487  H HB     . ILE A 1 161 ? -48.233  -11.274 13.921  0    124.43 ? 157  ILE A HB     1 
ATOM   2488  H HG12   . ILE A 1 161 ? -45.314  -12.097 14.035  0    132.88 ? 157  ILE A HG12   1 
ATOM   2489  H HG13   . ILE A 1 161 ? -46.025  -10.79  15.011  0    129.3  ? 157  ILE A HG13   1 
ATOM   2490  H HG21   . ILE A 1 161 ? -47.534  -13.654 13.207  0    131.68 ? 157  ILE A HG21   1 
ATOM   2491  H HG22   . ILE A 1 161 ? -48.47   -12.693 12.062  0    129.28 ? 157  ILE A HG22   1 
ATOM   2492  H HG23   . ILE A 1 161 ? -46.711  -12.851 11.84   0    132.83 ? 157  ILE A HG23   1 
ATOM   2493  H HD11   . ILE A 1 161 ? -46.008  -12.509 16.465  0    133.62 ? 157  ILE A HD11   1 
ATOM   2494  H HD12   . ILE A 1 161 ? -47.666  -12.602 15.809  0    130.37 ? 157  ILE A HD12   1 
ATOM   2495  H HD13   . ILE A 1 161 ? -46.402  -13.723 15.228  0    134.35 ? 157  ILE A HD13   1 
ATOM   2496  N N      . ARG A 1 162 ? -48.018  -10.458 10.352  1    69.65  ? 158  ARG A N      1 
ATOM   2497  C CA     . ARG A 1 162 ? -49.098  -10.212 9.407   1    68.08  ? 158  ARG A CA     1 
ATOM   2498  C C      . ARG A 1 162 ? -50.349  -10.948 9.868   1    66.79  ? 158  ARG A C      1 
ATOM   2499  O O      . ARG A 1 162 ? -50.249  -12.085 10.324  1    68.35  ? 158  ARG A O      1 
ATOM   2500  C CB     . ARG A 1 162 ? -48.712  -10.663 7.991   1    70.35  ? 158  ARG A CB     1 
ATOM   2501  C CG     . ARG A 1 162 ? -49.879  -10.582 7.025   1    69.39  ? 158  ARG A CG     1 
ATOM   2502  C CD     . ARG A 1 162 ? -49.54   -11.039 5.638   1    71.61  ? 158  ARG A CD     1 
ATOM   2503  N NE     . ARG A 1 162 ? -50.657  -10.732 4.739   1    70.56  ? 158  ARG A NE     1 
ATOM   2504  C CZ     . ARG A 1 162 ? -51.114  -11.478 3.723   1    71.63  ? 158  ARG A CZ     1 
ATOM   2505  N NH1    . ARG A 1 162 ? -50.541  -12.647 3.424   1    73.78  ? 158  ARG A NH1    1 
ATOM   2506  N NH2    . ARG A 1 162 ? -52.142  -11.055 2.993   1    70.78  ? 158  ARG A NH2    1 
ATOM   2507  H H      . ARG A 1 162 ? -47.229  -10.968 9.967   0    125.83 ? 158  ARG A H      1 
ATOM   2508  H HA     . ARG A 1 162 ? -49.309  -9.144  9.375   0    118.43 ? 158  ARG A HA     1 
ATOM   2509  H HB2    . ARG A 1 162 ? -47.928  -10.012 7.608   0    125.62 ? 158  ARG A HB2    1 
ATOM   2510  H HB3    . ARG A 1 162 ? -48.358  -11.692 8.032   0    126.98 ? 158  ARG A HB3    1 
ATOM   2511  H HG2    . ARG A 1 162 ? -50.671  -11.252 7.357   0    122.36 ? 158  ARG A HG2    1 
ATOM   2512  H HG3    . ARG A 1 162 ? -50.255  -9.56   6.997   0    120.65 ? 158  ARG A HG3    1 
ATOM   2513  H HD2    . ARG A 1 162 ? -48.672  -10.483 5.29    0    128.42 ? 158  ARG A HD2    1 
ATOM   2514  H HD3    . ARG A 1 162 ? -49.309  -12.101 5.677   0    129.49 ? 158  ARG A HD3    1 
ATOM   2515  H HE     . ARG A 1 162 ? -51.192  -9.899  4.961   0    123.17 ? 158  ARG A HE     1 
ATOM   2516  H HH11   . ARG A 1 162 ? -49.745  -13.029 3.92    0    133.7  ? 158  ARG A HH11   1 
ATOM   2517  H HH12   . ARG A 1 162 ? -50.892  -13.169 2.626   0    133.36 ? 158  ARG A HH12   1 
ATOM   2518  H HH21   . ARG A 1 162 ? -52.564  -10.151 3.183   0    123.44 ? 158  ARG A HH21   1 
ATOM   2519  H HH22   . ARG A 1 162 ? -52.469  -11.6   2.201   0    126.13 ? 158  ARG A HH22   1 
ATOM   2520  N N      . LEU A 1 163 ? -51.514  -10.305 9.734   1    64.26  ? 159  LEU A N      1 
ATOM   2521  C CA     . LEU A 1 163 ? -52.786  -10.9   10.112  1    63.01  ? 159  LEU A CA     1 
ATOM   2522  C C      . LEU A 1 163 ? -53.693  -10.915 8.881   1    62.75  ? 159  LEU A C      1 
ATOM   2523  O O      . LEU A 1 163 ? -53.928  -9.87   8.263   1    61.64  ? 159  LEU A O      1 
ATOM   2524  C CB     . LEU A 1 163 ? -53.412  -10.102 11.251  1    60.49  ? 159  LEU A CB     1 
ATOM   2525  C CG     . LEU A 1 163 ? -54.554  -10.764 11.998  1    59.86  ? 159  LEU A CG     1 
ATOM   2526  C CD1    . LEU A 1 163 ? -54.057  -11.812 12.948  1    61.86  ? 159  LEU A CD1    1 
ATOM   2527  C CD2    . LEU A 1 163 ? -55.335  -9.738  12.762  1    57.37  ? 159  LEU A CD2    1 
ATOM   2528  H H      . LEU A 1 163 ? -51.608  -9.368  9.354   0    110.51 ? 159  LEU A H      1 
ATOM   2529  H HA     . LEU A 1 163 ? -52.633  -11.927 10.437  0    110.01 ? 159  LEU A HA     1 
ATOM   2530  H HB2    . LEU A 1 163 ? -52.63   -9.874  11.974  0    103.47 ? 159  LEU A HB2    1 
ATOM   2531  H HB3    . LEU A 1 163 ? -53.797  -9.17   10.84   0    101.81 ? 159  LEU A HB3    1 
ATOM   2532  H HG     . LEU A 1 163 ? -55.235  -11.243 11.294  0    101.58 ? 159  LEU A HG     1 
ATOM   2533  H HD11   . LEU A 1 163 ? -54.893  -12.201 13.527  0    104.62 ? 159  LEU A HD11   1 
ATOM   2534  H HD12   . LEU A 1 163 ? -53.598  -12.629 12.392  0    107.28 ? 159  LEU A HD12   1 
ATOM   2535  H HD13   . LEU A 1 163 ? -53.324  -11.365 13.619  0    105.64 ? 159  LEU A HD13   1 
ATOM   2536  H HD21   . LEU A 1 163 ? -56.064  -10.244 13.393  0    95.53  ? 159  LEU A HD21   1 
ATOM   2537  H HD22   . LEU A 1 163 ? -54.649  -9.155  13.376  0    95.87  ? 159  LEU A HD22   1 
ATOM   2538  H HD23   . LEU A 1 163 ? -55.847  -9.086  12.056  0    94.94  ? 159  LEU A HD23   1 
ATOM   2539  N N      . GLU A 1 164 ? -54.165  -12.117 8.509   1    63.95  ? 160  GLU A N      1 
ATOM   2540  C CA     . GLU A 1 164 ? -54.998  -12.343 7.328   1    64.14  ? 160  GLU A CA     1 
ATOM   2541  C C      . GLU A 1 164 ? -56.345  -11.647 7.427   1    61.55  ? 160  GLU A C      1 
ATOM   2542  O O      . GLU A 1 164 ? -56.818  -11.1   6.437   1    61.21  ? 160  GLU A O      1 
ATOM   2543  C CB     . GLU A 1 164 ? -55.218  -13.856 7.12    1    66.03  ? 160  GLU A CB     1 
ATOM   2544  C CG     . GLU A 1 164 ? -53.972  -14.621 6.703   1    69.06  ? 160  GLU A CG     1 
ATOM   2545  C CD     . GLU A 1 164 ? -53.524  -14.399 5.274   1    70.52  ? 160  GLU A CD     1 
ATOM   2546  O OE1    . GLU A 1 164 ? -54.315  -13.835 4.48    1    69.78  ? 160  GLU A OE1    1 
ATOM   2547  O OE2    . GLU A 1 164 ? -52.379  -14.792 4.947   1    72.57  ? 160  GLU A OE2    1 
ATOM   2548  H H      . GLU A 1 164 ? -53.996  -12.964 9.041   0    111.63 ? 160  GLU A H      1 
ATOM   2549  H HA     . GLU A 1 164 ? -54.487  -11.951 6.451   0    111.9  ? 160  GLU A HA     1 
ATOM   2550  H HB2    . GLU A 1 164 ? -55.565  -14.291 8.056   0    114.74 ? 160  GLU A HB2    1 
ATOM   2551  H HB3    . GLU A 1 164 ? -55.988  -13.998 6.363   0    115.28 ? 160  GLU A HB3    1 
ATOM   2552  H HG2    . GLU A 1 164 ? -53.146  -14.34  7.353   0    122.1  ? 160  GLU A HG2    1 
ATOM   2553  H HG3    . GLU A 1 164 ? -54.171  -15.687 6.8     0    123.26 ? 160  GLU A HG3    1 
ATOM   2554  N N      . GLU A 1 165 ? -56.975  -11.709 8.609   1    60.03  ? 161  GLU A N      1 
ATOM   2555  C CA     . GLU A 1 165 ? -58.293  -11.14  8.871   1    57.76  ? 161  GLU A CA     1 
ATOM   2556  C C      . GLU A 1 165 ? -58.145  -9.655  9.134   1    56.08  ? 161  GLU A C      1 
ATOM   2557  O O      . GLU A 1 165 ? -57.549  -9.275  10.137  1    55.67  ? 161  GLU A O      1 
ATOM   2558  C CB     . GLU A 1 165 ? -58.936  -11.845 10.081  1    57.14  ? 161  GLU A CB     1 
ATOM   2559  C CG     . GLU A 1 165 ? -59.201  -13.339 9.883   1    58.86  ? 161  GLU A CG     1 
ATOM   2560  C CD     . GLU A 1 165 ? -58      -14.255 9.707   1    61.46  ? 161  GLU A CD     1 
ATOM   2561  O OE1    . GLU A 1 165 ? -56.962  -14.011 10.366  1    61.96  ? 161  GLU A OE1    1 
ATOM   2562  O OE2    . GLU A 1 165 ? -58.097  -15.217 8.908   1    63.18  ? 161  GLU A OE2    1 
ATOM   2563  H H      . GLU A 1 165 ? -56.586  -12.176 9.422   0    102.49 ? 161  GLU A H      1 
ATOM   2564  H HA     . GLU A 1 165 ? -58.94   -11.296 8.009   0    97.34  ? 161  GLU A HA     1 
ATOM   2565  H HB2    . GLU A 1 165 ? -58.288  -11.733 10.95   0    95.94  ? 161  GLU A HB2    1 
ATOM   2566  H HB3    . GLU A 1 165 ? -59.896  -11.371 10.284  0    94.25  ? 161  GLU A HB3    1 
ATOM   2567  H HG2    . GLU A 1 165 ? -59.747  -13.699 10.754  0    99.14  ? 161  GLU A HG2    1 
ATOM   2568  H HG3    . GLU A 1 165 ? -59.826  -13.457 8.998   0    99.74  ? 161  GLU A HG3    1 
ATOM   2569  N N      . LEU A 1 166 ? -58.636  -8.816  8.222   1    55.35  ? 162  LEU A N      1 
ATOM   2570  C CA     . LEU A 1 166 ? -58.489  -7.365  8.369   1    53.97  ? 162  LEU A CA     1 
ATOM   2571  C C      . LEU A 1 166 ? -59.37   -6.743  9.494   1    51.87  ? 162  LEU A C      1 
ATOM   2572  O O      . LEU A 1 166 ? -58.85   -6.108  10.413  1    51.17  ? 162  LEU A O      1 
ATOM   2573  C CB     . LEU A 1 166 ? -58.78   -6.667  7.032   1    54.27  ? 162  LEU A CB     1 
ATOM   2574  C CG     . LEU A 1 166 ? -57.715  -6.61   5.947   1    56.2   ? 162  LEU A CG     1 
ATOM   2575  C CD1    . LEU A 1 166 ? -56.564  -5.79   6.331   1    56.06  ? 162  LEU A CD1    1 
ATOM   2576  C CD2    . LEU A 1 166 ? -57.267  -7.962  5.51    1    58.21  ? 162  LEU A CD2    1 
ATOM   2577  H H      . LEU A 1 166 ? -59.105  -9.111  7.372   0    92.32  ? 162  LEU A H      1 
ATOM   2578  H HA     . LEU A 1 166 ? -57.453  -7.16   8.636   0    89.32  ? 162  LEU A HA     1 
ATOM   2579  H HB2    . LEU A 1 166 ? -59.649  -7.133  6.573   0    89.57  ? 162  LEU A HB2    1 
ATOM   2580  H HB3    . LEU A 1 166 ? -59.018  -5.633  7.267   0    88.15  ? 162  LEU A HB3    1 
ATOM   2581  H HG     . LEU A 1 166 ? -58.149  -6.092  5.093   0    93.77  ? 162  LEU A HG     1 
ATOM   2582  H HD11   . LEU A 1 166 ? -55.963  -5.646  5.434   0    94.76  ? 162  LEU A HD11   1 
ATOM   2583  H HD12   . LEU A 1 166 ? -56.888  -4.825  6.718   0    91.94  ? 162  LEU A HD12   1 
ATOM   2584  H HD13   . LEU A 1 166 ? -55.974  -6.317  7.077   0    93.41  ? 162  LEU A HD13   1 
ATOM   2585  H HD21   . LEU A 1 166 ? -56.591  -7.844  4.665   0    99.53  ? 162  LEU A HD21   1 
ATOM   2586  H HD22   . LEU A 1 166 ? -56.739  -8.425  6.342   0    98.13  ? 162  LEU A HD22   1 
ATOM   2587  H HD23   . LEU A 1 166 ? -58.121  -8.566  5.212   0    98.38  ? 162  LEU A HD23   1 
ATOM   2588  N N      . HIS A 1 167 ? -60.692  -6.91   9.401   1    51.09  ? 163  HIS A N      1 
ATOM   2589  C CA     . HIS A 1 167 ? -61.632  -6.351  10.358  1    49.36  ? 163  HIS A CA     1 
ATOM   2590  C C      . HIS A 1 167 ? -61.739  -7.26   11.591  1    49.29  ? 163  HIS A C      1 
ATOM   2591  O O      . HIS A 1 167 ? -62.484  -8.236  11.548  1    49.62  ? 163  HIS A O      1 
ATOM   2592  C CB     . HIS A 1 167 ? -63.006  -6.189  9.661   1    48.89  ? 163  HIS A CB     1 
ATOM   2593  C CG     . HIS A 1 167 ? -63.949  -5.222  10.314  1    47.27  ? 163  HIS A CG     1 
ATOM   2594  N ND1    . HIS A 1 167 ? -64.471  -5.454  11.576  1    46.47  ? 163  HIS A ND1    1 
ATOM   2595  C CD2    . HIS A 1 167 ? -64.497  -4.089  9.817   1    46.57  ? 163  HIS A CD2    1 
ATOM   2596  C CE1    . HIS A 1 167 ? -65.272  -4.429  11.829  1    45.32  ? 163  HIS A CE1    1 
ATOM   2597  N NE2    . HIS A 1 167 ? -65.323  -3.586  10.796  1    45.36  ? 163  HIS A NE2    1 
ATOM   2598  H H      . HIS A 1 167 ? -61.137  -7.429  8.651   0    83.12  ? 163  HIS A H      1 
ATOM   2599  H HA     . HIS A 1 167 ? -61.299  -5.363  10.672  0    77.86  ? 163  HIS A HA     1 
ATOM   2600  H HB2    . HIS A 1 167 ? -62.829  -5.81   8.655   0    78.15  ? 163  HIS A HB2    1 
ATOM   2601  H HB3    . HIS A 1 167 ? -63.51   -7.151  9.588   0    78.17  ? 163  HIS A HB3    1 
ATOM   2602  H HD2    . HIS A 1 167 ? -64.322  -3.665  8.841   0    73.13  ? 163  HIS A HD2    1 
ATOM   2603  H HE1    . HIS A 1 167 ? -65.807  -4.291  12.755  0    69.06  ? 163  HIS A HE1    1 
ATOM   2604  H HE2    . HIS A 1 167 ? -65.868  -2.732  10.745  0    69.34  ? 163  HIS A HE2    1 
ATOM   2605  N N      . VAL A 1 168 ? -60.991  -6.953  12.682  1    49.11  ? 164  VAL A N      1 
ATOM   2606  C CA     . VAL A 1 168 ? -61.056  -7.735  13.928  1    49.27  ? 164  VAL A CA     1 
ATOM   2607  C C      . VAL A 1 168 ? -61.947  -6.997  14.903  1    47.71  ? 164  VAL A C      1 
ATOM   2608  O O      . VAL A 1 168 ? -61.758  -5.802  15.111  1    46.8   ? 164  VAL A O      1 
ATOM   2609  C CB     . VAL A 1 168 ? -59.683  -8.001  14.566  1    50.4   ? 164  VAL A CB     1 
ATOM   2610  C CG1    . VAL A 1 168 ? -59.84   -8.762  15.877  1    50.64  ? 164  VAL A CG1    1 
ATOM   2611  C CG2    . VAL A 1 168 ? -58.777  -8.753  13.609  1    52.26  ? 164  VAL A CG2    1 
ATOM   2612  H H      . VAL A 1 168 ? -60.338  -6.177  12.721  0    77.85  ? 164  VAL A H      1 
ATOM   2613  H HA     . VAL A 1 168 ? -61.488  -8.712  13.725  0    79.07  ? 164  VAL A HA     1 
ATOM   2614  H HB     . VAL A 1 168 ? -59.208  -7.048  14.79   0    80.37  ? 164  VAL A HB     1 
ATOM   2615  H HG11   . VAL A 1 168 ? -58.893  -9.24   16.122  0    82.67  ? 164  VAL A HG11   1 
ATOM   2616  H HG12   . VAL A 1 168 ? -60.099  -8.065  16.673  0    80.39  ? 164  VAL A HG12   1 
ATOM   2617  H HG13   . VAL A 1 168 ? -60.619  -9.514  15.768  0    81.82  ? 164  VAL A HG13   1 
ATOM   2618  H HG21   . VAL A 1 168 ? -57.812  -8.9    14.091  0    85.88  ? 164  VAL A HG21   1 
ATOM   2619  H HG22   . VAL A 1 168 ? -59.227  -9.717  13.375  0    85.61  ? 164  VAL A HG22   1 
ATOM   2620  H HG23   . VAL A 1 168 ? -58.642  -8.173  12.697  0    84.87  ? 164  VAL A HG23   1 
ATOM   2621  N N      . ILE A 1 169 ? -62.89   -7.703  15.524  1    47.59  ? 165  ILE A N      1 
ATOM   2622  C CA     . ILE A 1 169 ? -63.831  -7.129  16.484  1    46.42  ? 165  ILE A CA     1 
ATOM   2623  C C      . ILE A 1 169 ? -63.204  -7.07   17.889  1    46.62  ? 165  ILE A C      1 
ATOM   2624  O O      . ILE A 1 169 ? -63.195  -6.005  18.511  1    45.75  ? 165  ILE A O      1 
ATOM   2625  C CB     . ILE A 1 169 ? -65.153  -7.943  16.461  1    46.5   ? 165  ILE A CB     1 
ATOM   2626  C CG1    . ILE A 1 169 ? -65.754  -8.021  15.035  1    46.62  ? 165  ILE A CG1    1 
ATOM   2627  C CG2    . ILE A 1 169 ? -66.155  -7.378  17.455  1    45.52  ? 165  ILE A CG2    1 
ATOM   2628  C CD1    . ILE A 1 169 ? -65.992  -6.702  14.339  1    45.63  ? 165  ILE A CD1    1 
ATOM   2629  H H      . ILE A 1 169 ? -63.021  -8.7    15.391  0    75.58  ? 165  ILE A H      1 
ATOM   2630  H HA     . ILE A 1 169 ? -64.065  -6.107  16.19   0    71.2   ? 165  ILE A HA     1 
ATOM   2631  H HB     . ILE A 1 169 ? -64.92   -8.959  16.776  0    73.33  ? 165  ILE A HB     1 
ATOM   2632  H HG12   . ILE A 1 169 ? -65.087  -8.606  14.403  0    73.57  ? 165  ILE A HG12   1 
ATOM   2633  H HG13   . ILE A 1 169 ? -66.716  -8.528  15.096  0    72.77  ? 165  ILE A HG13   1 
ATOM   2634  H HG21   . ILE A 1 169 ? -67.142  -7.782  17.239  0    70.31  ? 165  ILE A HG21   1 
ATOM   2635  H HG22   . ILE A 1 169 ? -65.869  -7.666  18.465  0    70.42  ? 165  ILE A HG22   1 
ATOM   2636  H HG23   . ILE A 1 169 ? -66.167  -6.292  17.367  0    69.28  ? 165  ILE A HG23   1 
ATOM   2637  H HD11   . ILE A 1 169 ? -66.577  -6.875  13.438  0    70.76  ? 165  ILE A HD11   1 
ATOM   2638  H HD12   . ILE A 1 169 ? -66.533  -6.031  15.005  0    69.56  ? 165  ILE A HD12   1 
ATOM   2639  H HD13   . ILE A 1 169 ? -65.033  -6.259  14.07   0    70.47  ? 165  ILE A HD13   1 
ATOM   2640  N N      . ASP A 1 170 ? -62.687  -8.21   18.386  1    48     ? 166  ASP A N      1 
ATOM   2641  C CA     . ASP A 1 170 ? -62.026  -8.294  19.697  1    48.58  ? 166  ASP A CA     1 
ATOM   2642  C C      . ASP A 1 170 ? -61.114  -9.521  19.741  1    50.5   ? 166  ASP A C      1 
ATOM   2643  O O      . ASP A 1 170 ? -61.368  -10.495 19.046  1    51.36  ? 166  ASP A O      1 
ATOM   2644  C CB     . ASP A 1 170 ? -63.057  -8.333  20.857  1    48.16  ? 166  ASP A CB     1 
ATOM   2645  C CG     . ASP A 1 170 ? -62.487  -8.246  22.28   1    48.79  ? 166  ASP A CG     1 
ATOM   2646  O OD1    . ASP A 1 170 ? -61.331  -7.773  22.438  1    49.18  ? 166  ASP A OD1    1 
ATOM   2647  O OD2    . ASP A 1 170 ? -63.208  -8.632  23.239  1    49.06  ? 166  ASP A OD2    1 
ATOM   2648  H H      . ASP A 1 170 ? -62.724  -9.098  17.894  0    76.4   ? 166  ASP A H      1 
ATOM   2649  H HA     . ASP A 1 170 ? -61.398  -7.413  19.824  0    76.43  ? 166  ASP A HA     1 
ATOM   2650  H HB2    . ASP A 1 170 ? -63.744  -7.497  20.736  0    74.72  ? 166  ASP A HB2    1 
ATOM   2651  H HB3    . ASP A 1 170 ? -63.611  -9.268  20.79   0    76.53  ? 166  ASP A HB3    1 
ATOM   2652  N N      . VAL A 1 171 ? -60.057  -9.46   20.56   1    51.4   ? 167  VAL A N      1 
ATOM   2653  C CA     . VAL A 1 171 ? -59.082  -10.535 20.721  1    53.54  ? 167  VAL A CA     1 
ATOM   2654  C C      . VAL A 1 171 ? -58.64   -10.643 22.182  1    54.53  ? 167  VAL A C      1 
ATOM   2655  O O      . VAL A 1 171 ? -58.536  -9.626  22.873  1    53.72  ? 167  VAL A O      1 
ATOM   2656  C CB     . VAL A 1 171 ? -57.869  -10.308 19.79   1    54.27  ? 167  VAL A CB     1 
ATOM   2657  C CG1    . VAL A 1 171 ? -57.21   -8.952  20.045  1    53.45  ? 167  VAL A CG1    1 
ATOM   2658  C CG2    . VAL A 1 171 ? -56.855  -11.442 19.92   1    56.78  ? 167  VAL A CG2    1 
ATOM   2659  H H      . VAL A 1 171 ? -59.854  -8.656  21.144  0    82.53  ? 167  VAL A H      1 
ATOM   2660  H HA     . VAL A 1 171 ? -59.538  -11.486 20.451  0    88.46  ? 167  VAL A HA     1 
ATOM   2661  H HB     . VAL A 1 171 ? -58.223  -10.3   18.76   0    88.93  ? 167  VAL A HB     1 
ATOM   2662  H HG11   . VAL A 1 171 ? -56.364  -8.849  19.367  0    88.34  ? 167  VAL A HG11   1 
ATOM   2663  H HG12   . VAL A 1 171 ? -57.924  -8.152  19.852  0    85.99  ? 167  VAL A HG12   1 
ATOM   2664  H HG13   . VAL A 1 171 ? -56.856  -8.896  21.073  0    88.14  ? 167  VAL A HG13   1 
ATOM   2665  H HG21   . VAL A 1 171 ? -56.248  -11.472 19.015  0    95.53  ? 167  VAL A HG21   1 
ATOM   2666  H HG22   . VAL A 1 171 ? -56.209  -11.255 20.775  0    95.61  ? 167  VAL A HG22   1 
ATOM   2667  H HG23   . VAL A 1 171 ? -57.379  -12.387 20.052  0    95.6   ? 167  VAL A HG23   1 
ATOM   2668  N N      . LYS A 1 172 ? -58.374  -11.878 22.636  1    56.52  ? 168  LYS A N      1 
ATOM   2669  C CA     . LYS A 1 172 ? -57.896  -12.194 23.985  1    58.07  ? 168  LYS A CA     1 
ATOM   2670  C C      . LYS A 1 172 ? -56.843  -13.312 23.9    1    60.78  ? 168  LYS A C      1 
ATOM   2671  O O      . LYS A 1 172 ? -56.762  -14.009 22.889  1    61.42  ? 168  LYS A O      1 
ATOM   2672  C CB     . LYS A 1 172 ? -59.059  -12.661 24.886  1    57.98  ? 168  LYS A CB     1 
ATOM   2673  C CG     . LYS A 1 172 ? -60.151  -11.628 25.128  1    55.79  ? 168  LYS A CG     1 
ATOM   2674  C CD     . LYS A 1 172 ? -59.692  -10.448 25.963  1    55.42  ? 168  LYS A CD     1 
ATOM   2675  C CE     . LYS A 1 172 ? -60.833  -9.676  26.594  1    54.04  ? 168  LYS A CE     1 
ATOM   2676  N NZ     . LYS A 1 172 ? -61.734  -9.046  25.594  1    51.91  ? 168  LYS A NZ     1 
ATOM   2677  H H      . LYS A 1 172 ? -58.483  -12.712 22.068  0    95.17  ? 168  LYS A H      1 
ATOM   2678  H HA     . LYS A 1 172 ? -57.425  -11.334 24.453  0    97.47  ? 168  LYS A HA     1 
ATOM   2679  H HB2    . LYS A 1 172 ? -59.516  -13.533 24.421  0    97.98  ? 168  LYS A HB2    1 
ATOM   2680  H HB3    . LYS A 1 172 ? -58.653  -12.946 25.856  0    99.03  ? 168  LYS A HB3    1 
ATOM   2681  H HG2    . LYS A 1 172 ? -60.482  -11.236 24.168  0    91.36  ? 168  LYS A HG2    1 
ATOM   2682  H HG3    . LYS A 1 172 ? -60.982  -12.108 25.644  0    92.89  ? 168  LYS A HG3    1 
ATOM   2683  H HD2    . LYS A 1 172 ? -59.053  -10.811 26.767  0    93.56  ? 168  LYS A HD2    1 
ATOM   2684  H HD3    . LYS A 1 172 ? -59.131  -9.764  25.327  0    91.23  ? 168  LYS A HD3    1 
ATOM   2685  H HE2    . LYS A 1 172 ? -61.429  -10.355 27.204  0    89.59  ? 168  LYS A HE2    1 
ATOM   2686  H HE3    . LYS A 1 172 ? -60.419  -8.885  27.217  0    88.81  ? 168  LYS A HE3    1 
ATOM   2687  H HZ1    . LYS A 1 172 ? -62.33   -8.361  26.049  0    83.32  ? 168  LYS A HZ1    1 
ATOM   2688  H HZ2    . LYS A 1 172 ? -61.187  -8.589  24.871  0    83.73  ? 168  LYS A HZ2    1 
ATOM   2689  H HZ3    . LYS A 1 172 ? -62.323  -9.753  25.166  0    84.21  ? 168  LYS A HZ3    1 
ATOM   2690  N N      . PHE A 1 173 ? -56.044  -13.487 24.956  1    62.58  ? 169  PHE A N      1 
ATOM   2691  C CA     . PHE A 1 173 ? -55.088  -14.589 25.013  1    65.52  ? 169  PHE A CA     1 
ATOM   2692  C C      . PHE A 1 173 ? -55.784  -15.72  25.77   1    66.89  ? 169  PHE A C      1 
ATOM   2693  O O      . PHE A 1 173 ? -56.324  -15.475 26.848  1    66.51  ? 169  PHE A O      1 
ATOM   2694  C CB     . PHE A 1 173 ? -53.79   -14.193 25.743  1    67.22  ? 169  PHE A CB     1 
ATOM   2695  C CG     . PHE A 1 173 ? -52.676  -13.684 24.857  1    67.48  ? 169  PHE A CG     1 
ATOM   2696  C CD1    . PHE A 1 173 ? -51.868  -14.564 24.16   1    69.54  ? 169  PHE A CD1    1 
ATOM   2697  C CD2    . PHE A 1 173 ? -52.402  -12.333 24.768  1    66.01  ? 169  PHE A CD2    1 
ATOM   2698  C CE1    . PHE A 1 173 ? -50.831  -14.097 23.367  1    70.09  ? 169  PHE A CE1    1 
ATOM   2699  C CE2    . PHE A 1 173 ? -51.376  -11.868 23.959  1    66.51  ? 169  PHE A CE2    1 
ATOM   2700  C CZ     . PHE A 1 173 ? -50.596  -12.752 23.268  1    68.54  ? 169  PHE A CZ     1 
ATOM   2701  H H      . PHE A 1 173 ? -56.054  -12.889 25.776  0    107.4  ? 169  PHE A H      1 
ATOM   2702  H HA     . PHE A 1 173 ? -54.844  -14.949 24.013  0    114.5  ? 169  PHE A HA     1 
ATOM   2703  H HB2    . PHE A 1 173 ? -54.003  -13.426 26.485  0    117.01 ? 169  PHE A HB2    1 
ATOM   2704  H HB3    . PHE A 1 173 ? -53.409  -15.083 26.241  0    120.24 ? 169  PHE A HB3    1 
ATOM   2705  H HD1    . PHE A 1 173 ? -52.051  -15.624 24.23   0    124.56 ? 169  PHE A HD1    1 
ATOM   2706  H HD2    . PHE A 1 173 ? -53.017  -11.628 25.3    0    113.73 ? 169  PHE A HD2    1 
ATOM   2707  H HE1    . PHE A 1 173 ? -50.219  -14.792 22.817  0    126.19 ? 169  PHE A HE1    1 
ATOM   2708  H HE2    . PHE A 1 173 ? -51.184  -10.811 23.886  0    115.28 ? 169  PHE A HE2    1 
ATOM   2709  H HZ     . PHE A 1 173 ? -49.791  -12.392 22.648  0    121.49 ? 169  PHE A HZ     1 
ATOM   2710  N N      . LEU A 1 174 ? -55.784  -16.948 25.217  1    68.69  ? 170  LEU A N      1 
ATOM   2711  C CA     . LEU A 1 174 ? -56.442  -18.085 25.86   1    70.28  ? 170  LEU A CA     1 
ATOM   2712  C C      . LEU A 1 174 ? -55.609  -18.691 26.983  1    73.34  ? 170  LEU A C      1 
ATOM   2713  O O      . LEU A 1 174 ? -54.378  -18.67  26.94   1    74.98  ? 170  LEU A O      1 
ATOM   2714  C CB     . LEU A 1 174 ? -56.72   -19.188 24.835  1    71.21  ? 170  LEU A CB     1 
ATOM   2715  C CG     . LEU A 1 174 ? -57.698  -18.882 23.724  1    68.77  ? 170  LEU A CG     1 
ATOM   2716  C CD1    . LEU A 1 174 ? -57.782  -20.058 22.778  1    70.33  ? 170  LEU A CD1    1 
ATOM   2717  C CD2    . LEU A 1 174 ? -59.062  -18.577 24.282  1    66.84  ? 170  LEU A CD2    1 
ATOM   2718  H H      . LEU A 1 174 ? -55.332  -17.177 24.337  0    121.46 ? 170  LEU A H      1 
ATOM   2719  H HA     . LEU A 1 174 ? -57.385  -17.755 26.292  0    123.11 ? 170  LEU A HA     1 
ATOM   2720  H HB2    . LEU A 1 174 ? -55.776  -19.463 24.366  0    128.11 ? 170  LEU A HB2    1 
ATOM   2721  H HB3    . LEU A 1 174 ? -57.109  -20.05  25.375  0    128.06 ? 170  LEU A HB3    1 
ATOM   2722  H HG     . LEU A 1 174 ? -57.343  -18.013 23.172  0    119.92 ? 170  LEU A HG     1 
ATOM   2723  H HD11   . LEU A 1 174 ? -58.566  -19.917 22.036  0    123.26 ? 170  LEU A HD11   1 
ATOM   2724  H HD12   . LEU A 1 174 ? -56.821  -20.182 22.282  0    125.93 ? 170  LEU A HD12   1 
ATOM   2725  H HD13   . LEU A 1 174 ? -58.003  -20.951 23.362  0    126.5  ? 170  LEU A HD13   1 
ATOM   2726  H HD21   . LEU A 1 174 ? -59.795  -18.611 23.477  0    115.96 ? 170  LEU A HD21   1 
ATOM   2727  H HD22   . LEU A 1 174 ? -59.312  -19.311 25.047  0    118.55 ? 170  LEU A HD22   1 
ATOM   2728  H HD23   . LEU A 1 174 ? -59.055  -17.576 24.711  0    115.61 ? 170  LEU A HD23   1 
ATOM   2729  N N      . TYR A 1 175 ? -56.295  -19.286 27.959  1    74.37  ? 171  TYR A N      1 
ATOM   2730  C CA     . TYR A 1 175 ? -55.654  -19.968 29.079  1    77.59  ? 171  TYR A CA     1 
ATOM   2731  C C      . TYR A 1 175 ? -55.534  -21.467 28.78   1    80.44  ? 171  TYR A C      1 
ATOM   2732  O O      . TYR A 1 175 ? -56.313  -22.002 27.99   1    79.74  ? 171  TYR A O      1 
ATOM   2733  C CB     . TYR A 1 175 ? -56.492  -19.788 30.353  1    77.38  ? 171  TYR A CB     1 
ATOM   2734  C CG     . TYR A 1 175 ? -56.465  -18.388 30.926  1    75.27  ? 171  TYR A CG     1 
ATOM   2735  C CD1    . TYR A 1 175 ? -55.436  -17.984 31.762  1    76.83  ? 171  TYR A CD1    1 
ATOM   2736  C CD2    . TYR A 1 175 ? -57.517  -17.511 30.724  1    72.05  ? 171  TYR A CD2    1 
ATOM   2737  C CE1    . TYR A 1 175 ? -55.432  -16.724 32.346  1    75.17  ? 171  TYR A CE1    1 
ATOM   2738  C CE2    . TYR A 1 175 ? -57.521  -16.242 31.295  1    70.37  ? 171  TYR A CE2    1 
ATOM   2739  C CZ     . TYR A 1 175 ? -56.473  -15.852 32.108  1    71.92  ? 171  TYR A CZ     1 
ATOM   2740  O OH     . TYR A 1 175 ? -56.439  -14.606 32.692  1    70.5   ? 171  TYR A OH     1 
ATOM   2741  H H      . TYR A 1 175 ? -57.308  -19.322 27.99   0    132.4  ? 171  TYR A H      1 
ATOM   2742  H HA     . TYR A 1 175 ? -54.659  -19.568 29.265  0    141.54 ? 171  TYR A HA     1 
ATOM   2743  H HB2    . TYR A 1 175 ? -57.53   -20.051 30.145  0    139.21 ? 171  TYR A HB2    1 
ATOM   2744  H HB3    . TYR A 1 175 ? -56.098  -20.458 31.116  0    142.89 ? 171  TYR A HB3    1 
ATOM   2745  H HD1    . TYR A 1 175 ? -54.623  -18.659 31.962  0    141.8  ? 171  TYR A HD1    1 
ATOM   2746  H HD2    . TYR A 1 175 ? -58.337  -17.806 30.09   0    127.52 ? 171  TYR A HD2    1 
ATOM   2747  H HE1    . TYR A 1 175 ? -54.609  -16.424 32.97   0    136.97 ? 171  TYR A HE1    1 
ATOM   2748  H HE2    . TYR A 1 175 ? -58.341  -15.573 31.098  0    122.68 ? 171  TYR A HE2    1 
ATOM   2749  H HH     . TYR A 1 175 ? -57.219  -14.053 32.425  0    123.21 ? 171  TYR A HH     1 
ATOM   2750  N N      . GLY A 1 176 ? -54.593  -22.135 29.441  1    83.86  ? 172  GLY A N      1 
ATOM   2751  C CA     . GLY A 1 176 ? -54.408  -23.576 29.31   1    87.12  ? 172  GLY A CA     1 
ATOM   2752  C C      . GLY A 1 176 ? -53.963  -24.055 27.947  1    87.45  ? 172  GLY A C      1 
ATOM   2753  O O      . GLY A 1 176 ? -54.575  -24.958 27.372  1    87.91  ? 172  GLY A O      1 
ATOM   2754  H H      . GLY A 1 176 ? -53.935  -21.702 30.08   0    155.22 ? 172  GLY A H      1 
ATOM   2755  H HA2    . GLY A 1 176 ? -53.662  -23.901 30.034  0    164.28 ? 172  GLY A HA2    1 
ATOM   2756  H HA3    . GLY A 1 176 ? -55.347  -24.077 29.544  0    161.58 ? 172  GLY A HA3    1 
ATOM   2757  N N      . CYS A 1 177 ? -52.881  -23.469 27.435  1    87.42  ? 173  CYS A N      1 
ATOM   2758  C CA     . CYS A 1 177 ? -52.335  -23.824 26.13   1    87.95  ? 173  CYS A CA     1 
ATOM   2759  C C      . CYS A 1 177 ? -50.852  -24.053 26.246  1    91.14  ? 173  CYS A C      1 
ATOM   2760  O O      . CYS A 1 177 ? -50.164  -23.292 26.934  1    91.39  ? 173  CYS A O      1 
ATOM   2761  C CB     . CYS A 1 177 ? -52.632  -22.727 25.116  1    84.24  ? 173  CYS A CB     1 
ATOM   2762  S SG     . CYS A 1 177 ? -54.376  -22.265 25.025  1    80.5   ? 173  CYS A SG     1 
ATOM   2763  H H      . CYS A 1 177 ? -52.357  -22.741 27.911  0    161.95 ? 173  CYS A H      1 
ATOM   2764  H HA     . CYS A 1 177 ? -52.785  -24.744 25.758  0    164.51 ? 173  CYS A HA     1 
ATOM   2765  H HB2    . CYS A 1 177 ? -52.062  -21.838 25.383  0    154.47 ? 173  CYS A HB2    1 
ATOM   2766  H HB3    . CYS A 1 177 ? -52.329  -23.076 24.13   0    155.9  ? 173  CYS A HB3    1 
ATOM   2767  H HG     . CYS A 1 177 ? -54.889  -22.007 26.233  0    146.78 ? 173  CYS A HG     1 
ATOM   2768  N N      . GLN A 1 178 ? -50.37   -25.108 25.558  1    93.83  ? 174  GLN A N      1 
ATOM   2769  C CA     . GLN A 1 178 ? -48.954  -25.464 25.476  1    97.34  ? 174  GLN A CA     1 
ATOM   2770  C C      . GLN A 1 178 ? -48.134  -24.327 24.854  1    95.91  ? 174  GLN A C      1 
ATOM   2771  O O      . GLN A 1 178 ? -46.968  -24.159 25.212  1    98.19  ? 174  GLN A O      1 
ATOM   2772  C CB     . GLN A 1 178 ? -48.761  -26.762 24.662  1    100.31 ? 174  GLN A CB     1 
ATOM   2773  C CG     . GLN A 1 178 ? -49.357  -26.732 23.243  1    98.15  ? 174  GLN A CG     1 
ATOM   2774  C CD     . GLN A 1 178 ? -48.405  -27.269 22.199  1    101.07 ? 174  GLN A CD     1 
ATOM   2775  O OE1    . GLN A 1 178 ? -47.762  -28.322 22.389  1    105.13 ? 174  GLN A OE1    1 
ATOM   2776  N NE2    . GLN A 1 178 ? -48.304  -26.572 21.058  1    99.31  ? 174  GLN A NE2    1 
ATOM   2777  H H      . GLN A 1 178 ? -50.968  -25.762 25.063  0    176.35 ? 174  GLN A H      1 
ATOM   2778  H HA     . GLN A 1 178 ? -48.576  -25.64  26.482  0    186.08 ? 174  GLN A HA     1 
ATOM   2779  H HB2    . GLN A 1 178 ? -47.691  -26.948 24.578  0    193.22 ? 174  GLN A HB2    1 
ATOM   2780  H HB3    . GLN A 1 178 ? -49.234  -27.582 25.199  0    192.21 ? 174  GLN A HB3    1 
ATOM   2781  H HG2    . GLN A 1 178 ? -50.244  -27.364 23.228  0    185.6  ? 174  GLN A HG2    1 
ATOM   2782  H HG3    . GLN A 1 178 ? -49.636  -25.715 22.975  0    182.92 ? 174  GLN A HG3    1 
ATOM   2783  H HE21   . GLN A 1 178 ? -48.846  -25.727 20.91   0    185.28 ? 174  GLN A HE21   1 
ATOM   2784  H HE22   . GLN A 1 178 ? -47.676  -26.898 20.33   0    190.43 ? 174  GLN A HE22   1 
ATOM   2785  N N      . ALA A 1 179 ? -48.744  -23.556 23.929  1    92.38  ? 175  ALA A N      1 
ATOM   2786  C CA     . ALA A 1 179 ? -48.109  -22.422 23.278  1    90.74  ? 175  ALA A CA     1 
ATOM   2787  C C      . ALA A 1 179 ? -49.003  -21.176 23.438  1    86.41  ? 175  ALA A C      1 
ATOM   2788  O O      . ALA A 1 179 ? -50.23   -21.315 23.494  1    84.5   ? 175  ALA A O      1 
ATOM   2789  C CB     . ALA A 1 179 ? -47.9    -22.722 21.81   1    91.22  ? 175  ALA A CB     1 
ATOM   2790  H H      . ALA A 1 179 ? -49.699  -23.684 23.612  0    171.47 ? 175  ALA A H      1 
ATOM   2791  H HA     . ALA A 1 179 ? -47.132  -22.267 23.729  0    171.56 ? 175  ALA A HA     1 
ATOM   2792  H HB1    . ALA A 1 179 ? -47.427  -21.86  21.341  0    169.59 ? 175  ALA A HB1    1 
ATOM   2793  H HB2    . ALA A 1 179 ? -47.253  -23.594 21.718  0    173.93 ? 175  ALA A HB2    1 
ATOM   2794  H HB3    . ALA A 1 179 ? -48.864  -22.92  21.344  0    169.06 ? 175  ALA A HB3    1 
ATOM   2795  N N      . PRO A 1 180 ? -48.433  -19.953 23.511  1    84.99  ? 176  PRO A N      1 
ATOM   2796  C CA     . PRO A 1 180 ? -49.292  -18.764 23.673  1    81.09  ? 176  PRO A CA     1 
ATOM   2797  C C      . PRO A 1 180 ? -50.281  -18.574 22.519  1    78.39  ? 176  PRO A C      1 
ATOM   2798  O O      . PRO A 1 180 ? -49.867  -18.271 21.406  1    78.21  ? 176  PRO A O      1 
ATOM   2799  C CB     . PRO A 1 180 ? -48.287  -17.607 23.776  1    80.79  ? 176  PRO A CB     1 
ATOM   2800  C CG     . PRO A 1 180 ? -46.983  -18.237 24.083  1    84.71  ? 176  PRO A CG     1 
ATOM   2801  C CD     . PRO A 1 180 ? -47.003  -19.58  23.465  1    87.09  ? 176  PRO A CD     1 
ATOM   2802  H HA     . PRO A 1 180 ? -49.841  -18.83  24.611  0    148.17 ? 176  PRO A HA     1 
ATOM   2803  H HB2    . PRO A 1 180 ? -48.227  -17.057 22.838  0    146.35 ? 176  PRO A HB2    1 
ATOM   2804  H HB3    . PRO A 1 180 ? -48.586  -16.942 24.585  0    146.58 ? 176  PRO A HB3    1 
ATOM   2805  H HG2    . PRO A 1 180 ? -46.172  -17.641 23.668  0    156.69 ? 176  PRO A HG2    1 
ATOM   2806  H HG3    . PRO A 1 180 ? -46.877  -18.323 25.164  0    157.51 ? 176  PRO A HG3    1 
ATOM   2807  H HD2    . PRO A 1 180 ? -46.646  -19.536 22.438  0    161.86 ? 176  PRO A HD2    1 
ATOM   2808  H HD3    . PRO A 1 180 ? -46.382  -20.226 24.083  0    164.52 ? 176  PRO A HD3    1 
ATOM   2809  N N      . THR A 1 181 ? -51.585  -18.762 22.779  1    76.55  ? 177  THR A N      1 
ATOM   2810  C CA     . THR A 1 181 ? -52.607  -18.668 21.738  1    74.34  ? 177  THR A CA     1 
ATOM   2811  C C      . THR A 1 181 ? -53.511  -17.442 21.89   1    70.82  ? 177  THR A C      1 
ATOM   2812  O O      . THR A 1 181 ? -53.893  -17.104 23.007  1    70.14  ? 177  THR A O      1 
ATOM   2813  C CB     . THR A 1 181 ? -53.476  -19.934 21.784  1    75.51  ? 177  THR A CB     1 
ATOM   2814  O OG1    . THR A 1 181 ? -52.649  -21.096 21.626  1    79.05  ? 177  THR A OG1    1 
ATOM   2815  C CG2    . THR A 1 181 ? -54.581  -19.922 20.734  1    73.68  ? 177  THR A CG2    1 
ATOM   2816  H H      . THR A 1 181 ? -51.968  -18.978 23.694  0    138.47 ? 177  THR A H      1 
ATOM   2817  H HA     . THR A 1 181 ? -52.145  -18.625 20.754  0    133.77 ? 177  THR A HA     1 
ATOM   2818  H HB     . THR A 1 181 ? -53.958  -19.974 22.76   0    135.75 ? 177  THR A HB     1 
ATOM   2819  H HG1    . THR A 1 181 ? -52.251  -21.36  22.497  0    145.26 ? 177  THR A HG1    1 
ATOM   2820  H HG21   . THR A 1 181 ? -55.128  -20.863 20.758  0    132.82 ? 177  THR A HG21   1 
ATOM   2821  H HG22   . THR A 1 181 ? -55.292  -19.117 20.911  0    129.29 ? 177  THR A HG22   1 
ATOM   2822  H HG23   . THR A 1 181 ? -54.147  -19.797 19.744  0    131.87 ? 177  THR A HG23   1 
ATOM   2823  N N      . ILE A 1 182 ? -53.909  -16.827 20.755  1    68.8   ? 178  ILE A N      1 
ATOM   2824  C CA     . ILE A 1 182 ? -54.876  -15.723 20.724  1    65.63  ? 178  ILE A CA     1 
ATOM   2825  C C      . ILE A 1 182 ? -56.184  -16.255 20.136  1    64.62  ? 178  ILE A C      1 
ATOM   2826  O O      . ILE A 1 182 ? -56.183  -17.138 19.279  1    65.75  ? 178  ILE A O      1 
ATOM   2827  C CB     . ILE A 1 182 ? -54.395  -14.448 19.961  1    64.12  ? 178  ILE A CB     1 
ATOM   2828  C CG1    . ILE A 1 182 ? -53.957  -14.754 18.514  1    64.94  ? 178  ILE A CG1    1 
ATOM   2829  C CG2    . ILE A 1 182 ? -53.281  -13.746 20.726  1    64.91  ? 178  ILE A CG2    1 
ATOM   2830  C CD1    . ILE A 1 182 ? -53.883  -13.558 17.635  1    63.15  ? 178  ILE A CD1    1 
ATOM   2831  H H      . ILE A 1 182 ? -53.586  -17.101 19.832  0    121.97 ? 178  ILE A H      1 
ATOM   2832  H HA     . ILE A 1 182 ? -55.106  -15.419 21.744  0    113.82 ? 178  ILE A HA     1 
ATOM   2833  H HB     . ILE A 1 182 ? -55.243  -13.765 19.923  0    108.86 ? 178  ILE A HB     1 
ATOM   2834  H HG12   . ILE A 1 182 ? -52.964  -15.198 18.541  0    114.95 ? 178  ILE A HG12   1 
ATOM   2835  H HG13   . ILE A 1 182 ? -54.653  -15.451 18.048  0    113.03 ? 178  ILE A HG13   1 
ATOM   2836  H HG21   . ILE A 1 182 ? -53.063  -12.786 20.26   0    111.67 ? 178  ILE A HG21   1 
ATOM   2837  H HG22   . ILE A 1 182 ? -53.606  -13.585 21.753  0    112.34 ? 178  ILE A HG22   1 
ATOM   2838  H HG23   . ILE A 1 182 ? -52.393  -14.376 20.715  0    115.07 ? 178  ILE A HG23   1 
ATOM   2839  H HD11   . ILE A 1 182 ? -53.712  -13.885 16.61   0    109.71 ? 178  ILE A HD11   1 
ATOM   2840  H HD12   . ILE A 1 182 ? -54.823  -13.011 17.696  0    106.91 ? 178  ILE A HD12   1 
ATOM   2841  H HD13   . ILE A 1 182 ? -53.06   -12.919 17.952  0    109.07 ? 178  ILE A HD13   1 
ATOM   2842  N N      . CYS A 1 183 ? -57.292  -15.717 20.608  1    62.69  ? 179  CYS A N      1 
ATOM   2843  C CA     . CYS A 1 183 ? -58.616  -16.073 20.139  1    61.65  ? 179  CYS A CA     1 
ATOM   2844  C C      . CYS A 1 183 ? -59.297  -14.782 19.815  1    58.89  ? 179  CYS A C      1 
ATOM   2845  O O      . CYS A 1 183 ? -59.34   -13.89  20.666  1    57.75  ? 179  CYS A O      1 
ATOM   2846  C CB     . CYS A 1 183 ? -59.374  -16.832 21.213  1    62.39  ? 179  CYS A CB     1 
ATOM   2847  S SG     . CYS A 1 183 ? -61.081  -17.225 20.77   1    61.24  ? 179  CYS A SG     1 
ATOM   2848  H H      . CYS A 1 183 ? -57.311  -15.007 21.333  0    107.04 ? 179  CYS A H      1 
ATOM   2849  H HA     . CYS A 1 183 ? -58.572  -16.687 19.241  0    106.42 ? 179  CYS A HA     1 
ATOM   2850  H HB2    . CYS A 1 183 ? -58.85   -17.766 21.403  0    109.3  ? 179  CYS A HB2    1 
ATOM   2851  H HB3    . CYS A 1 183 ? -59.4    -16.229 22.119  0    106.45 ? 179  CYS A HB3    1 
ATOM   2852  H HG     . CYS A 1 183 ? -61.084  -18.23  19.886  0    106.57 ? 179  CYS A HG     1 
ATOM   2853  N N      . PHE A 1 184 ? -59.823  -14.658 18.599  1    58.01  ? 180  PHE A N      1 
ATOM   2854  C CA     . PHE A 1 184 ? -60.45   -13.42  18.18   1    55.66  ? 180  PHE A CA     1 
ATOM   2855  C C      . PHE A 1 184 ? -61.68   -13.616 17.33   1    54.95  ? 180  PHE A C      1 
ATOM   2856  O O      . PHE A 1 184 ? -61.806  -14.616 16.626  1    56.29  ? 180  PHE A O      1 
ATOM   2857  C CB     . PHE A 1 184 ? -59.428  -12.559 17.424  1    55.4   ? 180  PHE A CB     1 
ATOM   2858  C CG     . PHE A 1 184 ? -59.018  -13.111 16.082  1    56.61  ? 180  PHE A CG     1 
ATOM   2859  C CD1    . PHE A 1 184 ? -58.046  -14.086 15.984  1    58.97  ? 180  PHE A CD1    1 
ATOM   2860  C CD2    . PHE A 1 184 ? -59.569  -12.617 14.916  1    55.62  ? 180  PHE A CD2    1 
ATOM   2861  C CE1    . PHE A 1 184 ? -57.666  -14.591 14.749  1    60.32  ? 180  PHE A CE1    1 
ATOM   2862  C CE2    . PHE A 1 184 ? -59.173  -13.114 13.682  1    56.98  ? 180  PHE A CE2    1 
ATOM   2863  C CZ     . PHE A 1 184 ? -58.232  -14.105 13.608  1    59.31  ? 180  PHE A CZ     1 
ATOM   2864  H H      . PHE A 1 184 ? -59.828  -15.381 17.887  0    98.59  ? 180  PHE A H      1 
ATOM   2865  H HA     . PHE A 1 184 ? -60.771  -12.858 19.055  0    91.45  ? 180  PHE A HA     1 
ATOM   2866  H HB2    . PHE A 1 184 ? -59.849  -11.566 17.27   0    90.22  ? 180  PHE A HB2    1 
ATOM   2867  H HB3    . PHE A 1 184 ? -58.527  -12.486 18.03   0    92.6   ? 180  PHE A HB3    1 
ATOM   2868  H HD1    . PHE A 1 184 ? -57.6    -14.483 16.881  0    100.7  ? 180  PHE A HD1    1 
ATOM   2869  H HD2    . PHE A 1 184 ? -60.317  -11.844 14.967  0    90.76  ? 180  PHE A HD2    1 
ATOM   2870  H HE1    . PHE A 1 184 ? -56.917  -15.363 14.691  0    104.73 ? 180  PHE A HE1    1 
ATOM   2871  H HE2    . PHE A 1 184 ? -59.62   -12.733 12.78   0    94.84  ? 180  PHE A HE2    1 
ATOM   2872  H HZ     . PHE A 1 184 ? -57.928  -14.487 12.649  0    101.75 ? 180  PHE A HZ     1 
ATOM   2873  N N      . VAL A 1 185 ? -62.597  -12.645 17.415  1    53.01  ? 181  VAL A N      1 
ATOM   2874  C CA     . VAL A 1 185 ? -63.797  -12.596 16.6    1    52.29  ? 181  VAL A CA     1 
ATOM   2875  C C      . VAL A 1 185 ? -63.501  -11.562 15.532  1    51.23  ? 181  VAL A C      1 
ATOM   2876  O O      . VAL A 1 185 ? -63.022  -10.473 15.847  1    50.09  ? 181  VAL A O      1 
ATOM   2877  C CB     . VAL A 1 185 ? -65.06   -12.227 17.411  1    51.24  ? 181  VAL A CB     1 
ATOM   2878  C CG1    . VAL A 1 185 ? -66.227  -11.881 16.487  1    50.44  ? 181  VAL A CG1    1 
ATOM   2879  C CG2    . VAL A 1 185 ? -65.452  -13.362 18.346  1    52.6   ? 181  VAL A CG2    1 
ATOM   2880  H H      . VAL A 1 185 ? -62.525  -11.857 18.05   0    85.65  ? 181  VAL A H      1 
ATOM   2881  H HA     . VAL A 1 185 ? -63.977  -13.553 16.114  0    86.28  ? 181  VAL A HA     1 
ATOM   2882  H HB     . VAL A 1 185 ? -64.849  -11.349 18.021  0    81.71  ? 181  VAL A HB     1 
ATOM   2883  H HG11   . VAL A 1 185 ? -67.146  -12     17.058  0    80.59  ? 181  VAL A HG11   1 
ATOM   2884  H HG12   . VAL A 1 185 ? -66.14   -10.849 16.153  0    79.89  ? 181  VAL A HG12   1 
ATOM   2885  H HG13   . VAL A 1 185 ? -66.226  -12.56  15.635  0    81.95  ? 181  VAL A HG13   1 
ATOM   2886  H HG21   . VAL A 1 185 ? -66.213  -13.003 19.037  0    84.94  ? 181  VAL A HG21   1 
ATOM   2887  H HG22   . VAL A 1 185 ? -65.853  -14.181 17.751  0    86.63  ? 181  VAL A HG22   1 
ATOM   2888  H HG23   . VAL A 1 185 ? -64.571  -13.7   18.889  0    86.47  ? 181  VAL A HG23   1 
ATOM   2889  N N      . TYR A 1 186 ? -63.747  -11.911 14.273  1    51.83  ? 182  TYR A N      1 
ATOM   2890  C CA     . TYR A 1 186 ? -63.505  -11.016 13.157  1    51.28  ? 182  TYR A CA     1 
ATOM   2891  C C      . TYR A 1 186 ? -64.731  -10.957 12.24   1    51.08  ? 182  TYR A C      1 
ATOM   2892  O O      . TYR A 1 186 ? -65.673  -11.735 12.407  1    51.59  ? 182  TYR A O      1 
ATOM   2893  C CB     . TYR A 1 186 ? -62.235  -11.456 12.411  1    52.8   ? 182  TYR A CB     1 
ATOM   2894  C CG     . TYR A 1 186 ? -62.403  -12.698 11.566  1    54.65  ? 182  TYR A CG     1 
ATOM   2895  C CD1    . TYR A 1 186 ? -62.218  -13.964 12.108  1    56.16  ? 182  TYR A CD1    1 
ATOM   2896  C CD2    . TYR A 1 186 ? -62.692  -12.608 10.214  1    55.17  ? 182  TYR A CD2    1 
ATOM   2897  C CE1    . TYR A 1 186 ? -62.33   -15.107 11.326  1    58.1   ? 182  TYR A CE1    1 
ATOM   2898  C CE2    . TYR A 1 186 ? -62.833  -13.744 9.428   1    57.11  ? 182  TYR A CE2    1 
ATOM   2899  C CZ     . TYR A 1 186 ? -62.646  -14.992 9.986   1    58.57  ? 182  TYR A CZ     1 
ATOM   2900  O OH     . TYR A 1 186 ? -62.763  -16.094 9.182   1    60.69  ? 182  TYR A OH     1 
ATOM   2901  H H      . TYR A 1 186 ? -64.12   -12.811 13.988  0    85.16  ? 182  TYR A H      1 
ATOM   2902  H HA     . TYR A 1 186 ? -63.357  -9.999  13.514  0    81.68  ? 182  TYR A HA     1 
ATOM   2903  H HB2    . TYR A 1 186 ? -61.918  -10.649 11.752  0    85.8   ? 182  TYR A HB2    1 
ATOM   2904  H HB3    . TYR A 1 186 ? -61.457  -11.657 13.146  0    86.69  ? 182  TYR A HB3    1 
ATOM   2905  H HD1    . TYR A 1 186 ? -61.974  -14.06  13.152  0    93.46  ? 182  TYR A HD1    1 
ATOM   2906  H HD2    . TYR A 1 186 ? -62.838  -11.637 9.772   0    90.46  ? 182  TYR A HD2    1 
ATOM   2907  H HE1    . TYR A 1 186 ? -62.21   -16.076 11.772  0    99.17  ? 182  TYR A HE1    1 
ATOM   2908  H HE2    . TYR A 1 186 ? -63.065  -13.649 8.382   0    96.21  ? 182  TYR A HE2    1 
ATOM   2909  H HH     . TYR A 1 186 ? -62.449  -16.91  9.652   0    104.67 ? 182  TYR A HH     1 
ATOM   2910  N N      . GLN A 1 187 ? -64.736  -9.991  11.312  1    50.53  ? 183  GLN A N      1 
ATOM   2911  C CA     . GLN A 1 187 ? -65.828  -9.802  10.371  1    50.53  ? 183  GLN A CA     1 
ATOM   2912  C C      . GLN A 1 187 ? -65.292  -9.781  8.944   1    51.7   ? 183  GLN A C      1 
ATOM   2913  O O      . GLN A 1 187 ? -64.206  -9.266  8.677   1    51.8   ? 183  GLN A O      1 
ATOM   2914  C CB     . GLN A 1 187 ? -66.57   -8.496  10.674  1    48.88  ? 183  GLN A CB     1 
ATOM   2915  C CG     . GLN A 1 187 ? -67.903  -8.345  9.948   1    48.99  ? 183  GLN A CG     1 
ATOM   2916  C CD     . GLN A 1 187 ? -68.519  -7.002  10.243  1    47.58  ? 183  GLN A CD     1 
ATOM   2917  O OE1    . GLN A 1 187 ? -69.378  -6.868  11.128  1    46.83  ? 183  GLN A OE1    1 
ATOM   2918  N NE2    . GLN A 1 187 ? -68.081  -5.975  9.515   1    47.41  ? 183  GLN A NE2    1 
ATOM   2919  H H      . GLN A 1 187 ? -63.984  -9.321  11.192  0    80.86  ? 183  GLN A H      1 
ATOM   2920  H HA     . GLN A 1 187 ? -66.542  -10.62  10.46   0    81.78  ? 183  GLN A HA     1 
ATOM   2921  H HB2    . GLN A 1 187 ? -66.773  -8.452  11.743  0    76.81  ? 183  GLN A HB2    1 
ATOM   2922  H HB3    . GLN A 1 187 ? -65.938  -7.658  10.383  0    77.14  ? 183  GLN A HB3    1 
ATOM   2923  H HG2    . GLN A 1 187 ? -67.757  -8.425  8.872   0    78.71  ? 183  GLN A HG2    1 
ATOM   2924  H HG3    . GLN A 1 187 ? -68.589  -9.115  10.297  0    78.2   ? 183  GLN A HG3    1 
ATOM   2925  H HE21   . GLN A 1 187 ? -67.369  -6.117  8.806   0    75.06  ? 183  GLN A HE21   1 
ATOM   2926  H HE22   . GLN A 1 187 ? -68.463  -5.048  9.672   0    73.58  ? 183  GLN A HE22   1 
ATOM   2927  N N      . ASP A 1 188 ? -66.064  -10.376 8.04    1    52.8   ? 184  ASP A N      1 
ATOM   2928  C CA     . ASP A 1 188 ? -65.769  -10.451 6.612   1    54.25  ? 184  ASP A CA     1 
ATOM   2929  C C      . ASP A 1 188 ? -67.128  -10.462 5.84    1    54.73  ? 184  ASP A C      1 
ATOM   2930  O O      . ASP A 1 188 ? -68.175  -10.337 6.488   1    53.87  ? 184  ASP A O      1 
ATOM   2931  C CB     . ASP A 1 188 ? -64.857  -11.682 6.332   1    56.19  ? 184  ASP A CB     1 
ATOM   2932  C CG     . ASP A 1 188 ? -65.513  -13.051 6.417   1    57.62  ? 184  ASP A CG     1 
ATOM   2933  O OD1    . ASP A 1 188 ? -66.6    -13.151 7.018   1    56.89  ? 184  ASP A OD1    1 
ATOM   2934  O OD2    . ASP A 1 188 ? -64.92   -14.028 5.904   1    59.64  ? 184  ASP A OD2    1 
ATOM   2935  H H      . ASP A 1 188 ? -66.928  -10.853 8.279   0    86.27  ? 184  ASP A H      1 
ATOM   2936  H HA     . ASP A 1 188 ? -65.226  -9.558  6.304   0    88.92  ? 184  ASP A HA     1 
ATOM   2937  H HB2    . ASP A 1 188 ? -64.414  -11.583 5.342   0    94.7   ? 184  ASP A HB2    1 
ATOM   2938  H HB3    . ASP A 1 188 ? -64.058  -11.673 7.072   0    93.27  ? 184  ASP A HB3    1 
ATOM   2939  N N      . PRO A 1 189 ? -67.163  -10.547 4.493   1    56.24  ? 185  PRO A N      1 
ATOM   2940  C CA     . PRO A 1 189 ? -68.458  -10.524 3.797   1    56.92  ? 185  PRO A CA     1 
ATOM   2941  C C      . PRO A 1 189 ? -69.414  -11.633 4.23    1    57.61  ? 185  PRO A C      1 
ATOM   2942  O O      . PRO A 1 189 ? -70.622  -11.428 4.283   1    57.46  ? 185  PRO A O      1 
ATOM   2943  C CB     . PRO A 1 189 ? -68.069  -10.65  2.32    1    58.91  ? 185  PRO A CB     1 
ATOM   2944  C CG     . PRO A 1 189 ? -66.646  -10.246 2.254   1    58.7   ? 185  PRO A CG     1 
ATOM   2945  C CD     . PRO A 1 189 ? -66.049  -10.685 3.541   1    57.64  ? 185  PRO A CD     1 
ATOM   2946  H HA     . PRO A 1 189 ? -68.946  -9.563  3.952   0    94.08  ? 185  PRO A HA     1 
ATOM   2947  H HB2    . PRO A 1 189 ? -68.193  -11.682 1.996   0    101.18 ? 185  PRO A HB2    1 
ATOM   2948  H HB3    . PRO A 1 189 ? -68.687  -9.982  1.721   0    99.76  ? 185  PRO A HB3    1 
ATOM   2949  H HG2    . PRO A 1 189 ? -66.161  -10.745 1.416   0    100.99 ? 185  PRO A HG2    1 
ATOM   2950  H HG3    . PRO A 1 189 ? -66.576  -9.164  2.148   0    98.32  ? 185  PRO A HG3    1 
ATOM   2951  H HD2    . PRO A 1 189 ? -65.738  -11.726 3.465   0    98.27  ? 185  PRO A HD2    1 
ATOM   2952  H HD3    . PRO A 1 189 ? -65.222  -10.032 3.815   0    96.15  ? 185  PRO A HD3    1 
ATOM   2953  N N      . GLN A 1 190 ? -68.874  -12.799 4.567   1    58.52  ? 186  GLN A N      1 
ATOM   2954  C CA     . GLN A 1 190 ? -69.681  -13.94  4.982   1    59.48  ? 186  GLN A CA     1 
ATOM   2955  C C      . GLN A 1 190 ? -70.256  -13.825 6.41    1    57.85  ? 186  GLN A C      1 
ATOM   2956  O O      . GLN A 1 190 ? -70.966  -14.734 6.831   1    58.66  ? 186  GLN A O      1 
ATOM   2957  C CB     . GLN A 1 190 ? -68.86   -15.24  4.825   1    61.34  ? 186  GLN A CB     1 
ATOM   2958  C CG     . GLN A 1 190 ? -68.583  -15.633 3.363   1    63.64  ? 186  GLN A CG     1 
ATOM   2959  C CD     . GLN A 1 190 ? -67.681  -14.663 2.614   1    63.34  ? 186  GLN A CD     1 
ATOM   2960  O OE1    . GLN A 1 190 ? -66.69   -14.144 3.156   1    62.21  ? 186  GLN A OE1    1 
ATOM   2961  N NE2    . GLN A 1 190 ? -67.999  -14.398 1.345   1    64.57  ? 186  GLN A NE2    1 
ATOM   2962  H H      . GLN A 1 190 ? -67.879  -12.999 4.544   0    99.09  ? 186  GLN A H      1 
ATOM   2963  H HA     . GLN A 1 190 ? -70.532  -14.024 4.308   0    101.81 ? 186  GLN A HA     1 
ATOM   2964  H HB2    . GLN A 1 190 ? -67.904  -15.132 5.336   0    104.36 ? 186  GLN A HB2    1 
ATOM   2965  H HB3    . GLN A 1 190 ? -69.412  -16.065 5.271   0    105.6  ? 186  GLN A HB3    1 
ATOM   2966  H HG2    . GLN A 1 190 ? -68.098  -16.608 3.352   0    111.47 ? 186  GLN A HG2    1 
ATOM   2967  H HG3    . GLN A 1 190 ? -69.538  -15.693 2.843   0    110.79 ? 186  GLN A HG3    1 
ATOM   2968  H HE21   . GLN A 1 190 ? -68.806  -14.833 0.91    0    113.24 ? 186  GLN A HE21   1 
ATOM   2969  H HE22   . GLN A 1 190 ? -67.427  -13.755 0.808   0    112.17 ? 186  GLN A HE22   1 
ATOM   2970  N N      . GLY A 1 191 ? -69.977  -12.732 7.124   1    55.84  ? 187  GLY A N      1 
ATOM   2971  C CA     . GLY A 1 191 ? -70.471  -12.516 8.481   1    54.42  ? 187  GLY A CA     1 
ATOM   2972  C C      . GLY A 1 191 ? -69.361  -12.51  9.513   1    53.54  ? 187  GLY A C      1 
ATOM   2973  O O      . GLY A 1 191 ? -68.216  -12.208 9.17    1    53.49  ? 187  GLY A O      1 
ATOM   2974  H H      . GLY A 1 191 ? -69.398  -11.965 6.8     0    92.3   ? 187  GLY A H      1 
ATOM   2975  H HA2    . GLY A 1 191 ? -70.97   -11.549 8.524   0    88.68  ? 187  GLY A HA2    1 
ATOM   2976  H HA3    . GLY A 1 191 ? -71.194  -13.278 8.769   0    90.51  ? 187  GLY A HA3    1 
ATOM   2977  N N      . ARG A 1 192 ? -69.685  -12.834 10.787  1    53.06  ? 188  ARG A N      1 
ATOM   2978  C CA     . ARG A 1 192 ? -68.692  -12.865 11.866  1    52.49  ? 188  ARG A CA     1 
ATOM   2979  C C      . ARG A 1 192 ? -68.311  -14.287 12.209  1    54.17  ? 188  ARG A C      1 
ATOM   2980  O O      . ARG A 1 192 ? -69.139  -15.196 12.112  1    55.33  ? 188  ARG A O      1 
ATOM   2981  C CB     . ARG A 1 192 ? -69.183  -12.111 13.115  1    50.93  ? 188  ARG A CB     1 
ATOM   2982  C CG     . ARG A 1 192 ? -69.224  -10.61  12.899  1    49.37  ? 188  ARG A CG     1 
ATOM   2983  C CD     . ARG A 1 192 ? -69.362  -9.807  14.167  1    48.01  ? 188  ARG A CD     1 
ATOM   2984  N NE     . ARG A 1 192 ? -69.44   -8.381  13.847  1    46.79  ? 188  ARG A NE     1 
ATOM   2985  C CZ     . ARG A 1 192 ? -69.659  -7.412  14.731  1    45.65  ? 188  ARG A CZ     1 
ATOM   2986  N NH1    . ARG A 1 192 ? -69.824  -7.696  16.017  1    45.53  ? 188  ARG A NH1    1 
ATOM   2987  N NH2    . ARG A 1 192 ? -69.715  -6.147  14.334  1    44.82  ? 188  ARG A NH2    1 
ATOM   2988  H H      . ARG A 1 192 ? -70.623  -13.08  11.089  0    86.9   ? 188  ARG A H      1 
ATOM   2989  H HA     . ARG A 1 192 ? -67.777  -12.382 11.525  0    85.26  ? 188  ARG A HA     1 
ATOM   2990  H HB2    . ARG A 1 192 ? -70.19   -12.445 13.359  0    82.33  ? 188  ARG A HB2    1 
ATOM   2991  H HB3    . ARG A 1 192 ? -68.508  -12.317 13.944  0    82.05  ? 188  ARG A HB3    1 
ATOM   2992  H HG2    . ARG A 1 192 ? -68.302  -10.298 12.412  0    78.62  ? 188  ARG A HG2    1 
ATOM   2993  H HG3    . ARG A 1 192 ? -70.075  -10.374 12.263  0    78.71  ? 188  ARG A HG3    1 
ATOM   2994  H HD2    . ARG A 1 192 ? -70.278  -10.096 14.68   0    75.77  ? 188  ARG A HD2    1 
ATOM   2995  H HD3    . ARG A 1 192 ? -68.497  -9.982  14.804  0    75.65  ? 188  ARG A HD3    1 
ATOM   2996  H HE     . ARG A 1 192 ? -69.323  -8.121  12.873  0    73.14  ? 188  ARG A HE     1 
ATOM   2997  H HH11   . ARG A 1 192 ? -69.79   -8.652  16.359  0    70.96  ? 188  ARG A HH11   1 
ATOM   2998  H HH12   . ARG A 1 192 ? -69.993  -6.948  16.68   0    69.44  ? 188  ARG A HH12   1 
ATOM   2999  H HH21   . ARG A 1 192 ? -69.594  -5.911  13.355  0    68.8   ? 188  ARG A HH21   1 
ATOM   3000  H HH22   . ARG A 1 192 ? -69.884  -5.406  15.007  0    67.85  ? 188  ARG A HH22   1 
ATOM   3001  N N      . HIS A 1 193 ? -67.032  -14.481 12.578  1    54.57  ? 189  HIS A N      1 
ATOM   3002  C CA     . HIS A 1 193 ? -66.463  -15.793 12.896  1    56.45  ? 189  HIS A CA     1 
ATOM   3003  C C      . HIS A 1 193 ? -65.446  -15.682 14.033  1    56.26  ? 189  HIS A C      1 
ATOM   3004  O O      . HIS A 1 193 ? -64.866  -14.62  14.231  1    54.99  ? 189  HIS A O      1 
ATOM   3005  C CB     . HIS A 1 193 ? -65.745  -16.382 11.662  1    58.22  ? 189  HIS A CB     1 
ATOM   3006  C CG     . HIS A 1 193 ? -66.447  -16.143 10.362  1    58.35  ? 189  HIS A CG     1 
ATOM   3007  N ND1    . HIS A 1 193 ? -67.532  -16.906 9.981   1    59.72  ? 189  HIS A ND1    1 
ATOM   3008  C CD2    . HIS A 1 193 ? -66.219  -15.199 9.42    1    57.44  ? 189  HIS A CD2    1 
ATOM   3009  C CE1    . HIS A 1 193 ? -67.913  -16.425 8.807   1    59.67  ? 189  HIS A CE1    1 
ATOM   3010  N NE2    . HIS A 1 193 ? -67.149  -15.398 8.431   1    58.32  ? 189  HIS A NE2    1 
ATOM   3011  H H      . HIS A 1 193 ? -66.355  -13.731 12.672  0    89.28  ? 189  HIS A H      1 
ATOM   3012  H HA     . HIS A 1 193 ? -67.242  -16.489 13.205  0    94.92  ? 189  HIS A HA     1 
ATOM   3013  H HB2    . HIS A 1 193 ? -64.756  -15.932 11.588  0    97.9   ? 189  HIS A HB2    1 
ATOM   3014  H HB3    . HIS A 1 193 ? -65.651  -17.459 11.793  0    99.75  ? 189  HIS A HB3    1 
ATOM   3015  H HD2    . HIS A 1 193 ? -65.461  -14.436 9.443   0    95.54  ? 189  HIS A HD2    1 
ATOM   3016  H HE1    . HIS A 1 193 ? -68.732  -16.818 8.226   0    102.31 ? 189  HIS A HE1    1 
ATOM   3017  H HE2    . HIS A 1 193 ? -67.244  -14.862 7.574   0    98.29  ? 189  HIS A HE2    1 
ATOM   3018  N N      . VAL A 1 194 ? -65.2    -16.79  14.745  1    57.79  ? 190  VAL A N      1 
ATOM   3019  C CA     . VAL A 1 194 ? -64.208  -16.848 15.817  1    58.19  ? 190  VAL A CA     1 
ATOM   3020  C C      . VAL A 1 194 ? -63.097  -17.773 15.345  1    60.44  ? 190  VAL A C      1 
ATOM   3021  O O      . VAL A 1 194 ? -63.378  -18.852 14.848  1    62.18  ? 190  VAL A O      1 
ATOM   3022  C CB     . VAL A 1 194 ? -64.799  -17.277 17.184  1    58.43  ? 190  VAL A CB     1 
ATOM   3023  C CG1    . VAL A 1 194 ? -65.385  -18.688 17.144  1    60.51  ? 190  VAL A CG1    1 
ATOM   3024  C CG2    . VAL A 1 194 ? -63.755  -17.168 18.288  1    58.81  ? 190  VAL A CG2    1 
ATOM   3025  H H      . VAL A 1 194 ? -65.665  -17.674 14.565  0    98.44  ? 190  VAL A H      1 
ATOM   3026  H HA     . VAL A 1 194 ? -63.772  -15.859 15.954  0    96.74  ? 190  VAL A HA     1 
ATOM   3027  H HB     . VAL A 1 194 ? -65.608  -16.595 17.443  0    97.15  ? 190  VAL A HB     1 
ATOM   3028  H HG11   . VAL A 1 194 ? -65.862  -18.884 18.103  0    103.35 ? 190  VAL A HG11   1 
ATOM   3029  H HG12   . VAL A 1 194 ? -66.129  -18.757 16.352  0    103.05 ? 190  VAL A HG12   1 
ATOM   3030  H HG13   . VAL A 1 194 ? -64.593  -19.418 16.984  0    104.85 ? 190  VAL A HG13   1 
ATOM   3031  H HG21   . VAL A 1 194 ? -64.241  -17.357 19.244  0    99.56  ? 190  VAL A HG21   1 
ATOM   3032  H HG22   . VAL A 1 194 ? -62.974  -17.911 18.133  0    101.08 ? 190  VAL A HG22   1 
ATOM   3033  H HG23   . VAL A 1 194 ? -63.326  -16.167 18.28   0    98.04  ? 190  VAL A HG23   1 
ATOM   3034  N N      . LYS A 1 195 ? -61.845  -17.344 15.485  1    60.6   ? 191  LYS A N      1 
ATOM   3035  C CA     . LYS A 1 195 ? -60.665  -18.079 15.022  1    62.84  ? 191  LYS A CA     1 
ATOM   3036  C C      . LYS A 1 195 ? -59.558  -18.055 16.094  1    63.57  ? 191  LYS A C      1 
ATOM   3037  O O      . LYS A 1 195 ? -59.614  -17.233 17.012  1    62.03  ? 191  LYS A O      1 
ATOM   3038  C CB     . LYS A 1 195 ? -60.164  -17.402 13.733  1    62.5   ? 191  LYS A CB     1 
ATOM   3039  C CG     . LYS A 1 195 ? -59.175  -18.198 12.901  1    65.05  ? 191  LYS A CG     1 
ATOM   3040  C CD     . LYS A 1 195 ? -59.034  -17.597 11.498  1    64.84  ? 191  LYS A CD     1 
ATOM   3041  C CE     . LYS A 1 195 ? -58.146  -18.423 10.595  1    67.63  ? 191  LYS A CE     1 
ATOM   3042  N NZ     . LYS A 1 195 ? -58.165  -17.944 9.183   1    67.71  ? 191  LYS A NZ     1 
ATOM   3043  H H      . LYS A 1 195 ? -61.596  -16.468 15.934  0    102    ? 191  LYS A H      1 
ATOM   3044  H HA     . LYS A 1 195 ? -60.904  -19.119 14.802  0    109.9  ? 191  LYS A HA     1 
ATOM   3045  H HB2    . LYS A 1 195 ? -61.034  -17.211 13.108  0    106.66 ? 191  LYS A HB2    1 
ATOM   3046  H HB3    . LYS A 1 195 ? -59.69   -16.458 13.997  0    106.34 ? 191  LYS A HB3    1 
ATOM   3047  H HG2    . LYS A 1 195 ? -58.199  -18.177 13.383  0    113.91 ? 191  LYS A HG2    1 
ATOM   3048  H HG3    . LYS A 1 195 ? -59.527  -19.223 12.803  0    114.61 ? 191  LYS A HG3    1 
ATOM   3049  H HD2    . LYS A 1 195 ? -60.016  -17.54  11.031  0    111.93 ? 191  LYS A HD2    1 
ATOM   3050  H HD3    . LYS A 1 195 ? -58.602  -16.601 11.578  0    111.38 ? 191  LYS A HD3    1 
ATOM   3051  H HE2    . LYS A 1 195 ? -57.121  -18.367 10.957  0    119.6  ? 191  LYS A HE2    1 
ATOM   3052  H HE3    . LYS A 1 195 ? -58.49   -19.456 10.606  0    120.22 ? 191  LYS A HE3    1 
ATOM   3053  H HZ1    . LYS A 1 195 ? -57.45   -18.425 8.646   0    120.75 ? 191  LYS A HZ1    1 
ATOM   3054  H HZ2    . LYS A 1 195 ? -59.07   -18.136 8.765   0    118.86 ? 191  LYS A HZ2    1 
ATOM   3055  H HZ3    . LYS A 1 195 ? -57.991  -16.945 9.151   0    117.28 ? 191  LYS A HZ3    1 
ATOM   3056  N N      . THR A 1 196 ? -58.557  -18.955 15.984  1    66.16  ? 192  THR A N      1 
ATOM   3057  C CA     . THR A 1 196 ? -57.426  -18.998 16.917  1    67.39  ? 192  THR A CA     1 
ATOM   3058  C C      . THR A 1 196 ? -56.101  -19.166 16.163  1    69.3   ? 192  THR A C      1 
ATOM   3059  O O      . THR A 1 196 ? -56.071  -19.754 15.078  1    70.56  ? 192  THR A O      1 
ATOM   3060  C CB     . THR A 1 196 ? -57.586  -20.113 17.944  1    69.35  ? 192  THR A CB     1 
ATOM   3061  O OG1    . THR A 1 196 ? -57.666  -21.365 17.267  1    71.55  ? 192  THR A OG1    1 
ATOM   3062  C CG2    . THR A 1 196 ? -58.777  -19.922 18.847  1    67.79  ? 192  THR A CG2    1 
ATOM   3063  H H      . THR A 1 196 ? -58.508  -19.661 15.256  0    117.04 ? 192  THR A H      1 
ATOM   3064  H HA     . THR A 1 196 ? -57.362  -18.059 17.465  0    116.74 ? 192  THR A HA     1 
ATOM   3065  H HB     . THR A 1 196 ? -56.705  -20.091 18.583  0    123.61 ? 192  THR A HB     1 
ATOM   3066  H HG1    . THR A 1 196 ? -58.557  -21.488 16.844  0    126.83 ? 192  THR A HG1    1 
ATOM   3067  H HG21   . THR A 1 196 ? -58.855  -20.762 19.534  0    120.74 ? 192  THR A HG21   1 
ATOM   3068  H HG22   . THR A 1 196 ? -58.662  -19.006 19.425  0    117.64 ? 192  THR A HG22   1 
ATOM   3069  H HG23   . THR A 1 196 ? -59.692  -19.861 18.259  0    118.05 ? 192  THR A HG23   1 
ATOM   3070  N N      . TYR A 1 197 ? -55.007  -18.646 16.749  1    69.74  ? 193  TYR A N      1 
ATOM   3071  C CA     . TYR A 1 197 ? -53.655  -18.717 16.182  1    71.78  ? 193  TYR A CA     1 
ATOM   3072  C C      . TYR A 1 197 ? -52.645  -18.871 17.302  1    73.6   ? 193  TYR A C      1 
ATOM   3073  O O      . TYR A 1 197 ? -52.762  -18.175 18.31   1    72.28  ? 193  TYR A O      1 
ATOM   3074  C CB     . TYR A 1 197 ? -53.276  -17.394 15.487  1    70.12  ? 193  TYR A CB     1 
ATOM   3075  C CG     . TYR A 1 197 ? -53.907  -17.136 14.142  1    69.01  ? 193  TYR A CG     1 
ATOM   3076  C CD1    . TYR A 1 197 ? -53.831  -18.076 13.126  1    71.04  ? 193  TYR A CD1    1 
ATOM   3077  C CD2    . TYR A 1 197 ? -54.418  -15.884 13.826  1    66.28  ? 193  TYR A CD2    1 
ATOM   3078  C CE1    . TYR A 1 197 ? -54.374  -17.829 11.871  1    70.31  ? 193  TYR A CE1    1 
ATOM   3079  C CE2    . TYR A 1 197 ? -54.956  -15.619 12.573  1    65.55  ? 193  TYR A CE2    1 
ATOM   3080  C CZ     . TYR A 1 197 ? -54.931  -16.592 11.592  1    67.58  ? 193  TYR A CZ     1 
ATOM   3081  O OH     . TYR A 1 197 ? -55.431  -16.339 10.333  1    67.16  ? 193  TYR A OH     1 
ATOM   3082  H H      . TYR A 1 197 ? -55.032  -18.164 17.641  0    122.64 ? 193  TYR A H      1 
ATOM   3083  H HA     . TYR A 1 197 ? -53.554  -19.553 15.492  0    129.7  ? 193  TYR A HA     1 
ATOM   3084  H HB2    . TYR A 1 197 ? -53.556  -16.574 16.146  0    122.29 ? 193  TYR A HB2    1 
ATOM   3085  H HB3    . TYR A 1 197 ? -52.197  -17.382 15.342  0    125.76 ? 193  TYR A HB3    1 
ATOM   3086  H HD1    . TYR A 1 197 ? -53.414  -19.051 13.333  0    128.6  ? 193  TYR A HD1    1 
ATOM   3087  H HD2    . TYR A 1 197 ? -54.459  -15.119 14.581  0    114.38 ? 193  TYR A HD2    1 
ATOM   3088  H HE1    . TYR A 1 197 ? -54.339  -18.592 11.111  0    126.54 ? 193  TYR A HE1    1 
ATOM   3089  H HE2    . TYR A 1 197 ? -55.385  -14.65  12.376  0    112.37 ? 193  TYR A HE2    1 
ATOM   3090  H HH     . TYR A 1 197 ? -55.813  -15.424 10.285  0    115.97 ? 193  TYR A HH     1 
ATOM   3091  N N      . GLU A 1 198 ? -51.6    -19.679 17.097  1    76.76  ? 194  GLU A N      1 
ATOM   3092  C CA     . GLU A 1 198 ? -50.516  -19.778 18.075  1    78.9   ? 194  GLU A CA     1 
ATOM   3093  C C      . GLU A 1 198 ? -49.468  -18.708 17.715  1    78.77  ? 194  GLU A C      1 
ATOM   3094  O O      . GLU A 1 198 ? -49.226  -18.464 16.536  1    78.87  ? 194  GLU A O      1 
ATOM   3095  C CB     . GLU A 1 198 ? -49.922  -21.192 18.11   1    82.74  ? 194  GLU A CB     1 
ATOM   3096  C CG     . GLU A 1 198 ? -50.83   -22.187 18.81   1    83.4   ? 194  GLU A CG     1 
ATOM   3097  C CD     . GLU A 1 198 ? -50.247  -23.576 18.968  1    87.31  ? 194  GLU A CD     1 
ATOM   3098  O OE1    . GLU A 1 198 ? -50.58   -24.241 19.975  1    88.62  ? 194  GLU A OE1    1 
ATOM   3099  O OE2    . GLU A 1 198 ? -49.447  -23.996 18.1    1    89.27  ? 194  GLU A OE2    1 
ATOM   3100  H H      . GLU A 1 198 ? -51.476  -20.26  16.274  0    140.26 ? 194  GLU A H      1 
ATOM   3101  H HA     . GLU A 1 198 ? -50.881  -19.542 19.073  0    142.65 ? 194  GLU A HA     1 
ATOM   3102  H HB2    . GLU A 1 198 ? -49.767  -21.543 17.091  0    152.88 ? 194  GLU A HB2    1 
ATOM   3103  H HB3    . GLU A 1 198 ? -48.972  -21.167 18.641  0    153.91 ? 194  GLU A HB3    1 
ATOM   3104  H HG2    . GLU A 1 198 ? -51.055  -21.807 19.805  0    152.92 ? 194  GLU A HG2    1 
ATOM   3105  H HG3    . GLU A 1 198 ? -51.749  -22.276 18.233  0    151.8  ? 194  GLU A HG3    1 
ATOM   3106  N N      . VAL A 1 199 ? -48.892  -18.033 18.724  1    78.58  ? 195  VAL A N      1 
ATOM   3107  C CA     . VAL A 1 199 ? -47.941  -16.934 18.521  1    78.43  ? 195  VAL A CA     1 
ATOM   3108  C C      . VAL A 1 199 ? -46.512  -17.379 18.859  1    82.16  ? 195  VAL A C      1 
ATOM   3109  O O      . VAL A 1 199 ? -46.119  -17.361 20.028  1    83.38  ? 195  VAL A O      1 
ATOM   3110  C CB     . VAL A 1 199 ? -48.359  -15.693 19.353  1    75.73  ? 195  VAL A CB     1 
ATOM   3111  C CG1    . VAL A 1 199 ? -47.512  -14.479 18.986  1    75.26  ? 195  VAL A CG1    1 
ATOM   3112  C CG2    . VAL A 1 199 ? -49.844  -15.381 19.169  1    72.48  ? 195  VAL A CG2    1 
ATOM   3113  H H      . VAL A 1 199 ? -49.06   -18.236 19.705  0    142.98 ? 195  VAL A H      1 
ATOM   3114  H HA     . VAL A 1 199 ? -47.95   -16.641 17.472  0    141.84 ? 195  VAL A HA     1 
ATOM   3115  H HB     . VAL A 1 199 ? -48.205  -15.896 20.412  0    137.56 ? 195  VAL A HB     1 
ATOM   3116  H HG11   . VAL A 1 199 ? -47.892  -13.603 19.511  0    133.69 ? 195  VAL A HG11   1 
ATOM   3117  H HG12   . VAL A 1 199 ? -46.477  -14.647 19.278  0    138    ? 195  VAL A HG12   1 
ATOM   3118  H HG13   . VAL A 1 199 ? -47.571  -14.318 17.911  0    134.94 ? 195  VAL A HG13   1 
ATOM   3119  H HG21   . VAL A 1 199 ? -50.053  -14.372 19.521  0    127.61 ? 195  VAL A HG21   1 
ATOM   3120  H HG22   . VAL A 1 199 ? -50.094  -15.475 18.114  0    128.79 ? 195  VAL A HG22   1 
ATOM   3121  H HG23   . VAL A 1 199 ? -50.426  -16.094 19.752  0    129.77 ? 195  VAL A HG23   1 
ATOM   3122  N N      . SER A 1 200 ? -45.728  -17.757 17.833  1    84.15  ? 196  SER A N      1 
ATOM   3123  C CA     . SER A 1 200 ? -44.35   -18.211 18.03   1    88.01  ? 196  SER A CA     1 
ATOM   3124  C C      . SER A 1 200 ? -43.397  -17.021 18.105  1    87.97  ? 196  SER A C      1 
ATOM   3125  O O      . SER A 1 200 ? -43.182  -16.365 17.091  1    87.05  ? 196  SER A O      1 
ATOM   3126  C CB     . SER A 1 200 ? -43.926  -19.133 16.889  1    90.54  ? 196  SER A CB     1 
ATOM   3127  O OG     . SER A 1 200 ? -42.607  -19.612 17.087  1    94.6   ? 196  SER A OG     1 
ATOM   3128  H H      . SER A 1 200 ? -46.016  -17.754 16.859  0    154.4  ? 196  SER A H      1 
ATOM   3129  H HA     . SER A 1 200 ? -44.274  -18.78  18.955  0    165.07 ? 196  SER A HA     1 
ATOM   3130  H HB2    . SER A 1 200 ? -44.602  -19.986 16.86   0    169.28 ? 196  SER A HB2    1 
ATOM   3131  H HB3    . SER A 1 200 ? -43.973  -18.595 15.943  0    168.1  ? 196  SER A HB3    1 
ATOM   3132  H HG     . SER A 1 200 ? -42.402  -20.326 16.428  0    179.96 ? 196  SER A HG     1 
ATOM   3133  N N      . LEU A 1 201 ? -42.842  -16.727 19.298  1    89.06  ? 197  LEU A N      1 
ATOM   3134  C CA     . LEU A 1 201 ? -41.892  -15.619 19.474  1    89.48  ? 197  LEU A CA     1 
ATOM   3135  C C      . LEU A 1 201 ? -40.565  -15.936 18.793  1    93.14  ? 197  LEU A C      1 
ATOM   3136  O O      . LEU A 1 201 ? -39.963  -15.065 18.171  1    93.03  ? 197  LEU A O      1 
ATOM   3137  C CB     . LEU A 1 201 ? -41.639  -15.359 20.967  1    90.23  ? 197  LEU A CB     1 
ATOM   3138  C CG     . LEU A 1 201 ? -42.805  -14.842 21.792  1    86.95  ? 197  LEU A CG     1 
ATOM   3139  C CD1    . LEU A 1 201 ? -42.404  -14.707 23.255  1    88.49  ? 197  LEU A CD1    1 
ATOM   3140  C CD2    . LEU A 1 201 ? -43.307  -13.516 21.249  1    83.4   ? 197  LEU A CD2    1 
ATOM   3141  H H      . LEU A 1 201 ? -43.038  -17.231 20.156  0    166.67 ? 197  LEU A H      1 
ATOM   3142  H HA     . LEU A 1 201 ? -42.279  -14.708 19.019  0    164.25 ? 197  LEU A HA     1 
ATOM   3143  H HB2    . LEU A 1 201 ? -41.309  -16.29  21.426  0    171.04 ? 197  LEU A HB2    1 
ATOM   3144  H HB3    . LEU A 1 201 ? -40.841  -14.623 21.048  0    169.2  ? 197  LEU A HB3    1 
ATOM   3145  H HG     . LEU A 1 201 ? -43.619  -15.564 21.737  0    160.39 ? 197  LEU A HG     1 
ATOM   3146  H HD11   . LEU A 1 201 ? -43.214  -14.255 23.825  0    162.34 ? 197  LEU A HD11   1 
ATOM   3147  H HD12   . LEU A 1 201 ? -42.188  -15.699 23.649  0    167.11 ? 197  LEU A HD12   1 
ATOM   3148  H HD13   . LEU A 1 201 ? -41.512  -14.085 23.315  0    165.71 ? 197  LEU A HD13   1 
ATOM   3149  H HD21   . LEU A 1 201 ? -43.948  -13.04  21.989  0    151.58 ? 197  LEU A HD21   1 
ATOM   3150  H HD22   . LEU A 1 201 ? -42.457  -12.876 21.018  0    154.45 ? 197  LEU A HD22   1 
ATOM   3151  H HD23   . LEU A 1 201 ? -43.89   -13.708 20.348  0    152.13 ? 197  LEU A HD23   1 
ATOM   3152  N N      . ARG A 1 202 ? -40.105  -17.179 18.965  1    96.6   ? 198  ARG A N      1 
ATOM   3153  C CA     . ARG A 1 202 ? -38.882  -17.74  18.368  1    100.78 ? 198  ARG A CA     1 
ATOM   3154  C C      . ARG A 1 202 ? -38.877  -17.525 16.838  1    100.25 ? 198  ARG A C      1 
ATOM   3155  O O      . ARG A 1 202 ? -37.931  -16.951 16.299  1    101.72 ? 198  ARG A O      1 
ATOM   3156  C CB     . ARG A 1 202 ? -38.821  -19.246 18.747  1    103.75 ? 198  ARG A CB     1 
ATOM   3157  C CG     . ARG A 1 202 ? -37.801  -20.193 18.095  1    108.42 ? 198  ARG A CG     1 
ATOM   3158  C CD     . ARG A 1 202 ? -38.16   -21.687 18.309  1    110.46 ? 198  ARG A CD     1 
ATOM   3159  N NE     . ARG A 1 202 ? -38.877  -21.973 19.569  1    109.49 ? 198  ARG A NE     1 
ATOM   3160  C CZ     . ARG A 1 202 ? -40.206  -21.942 19.753  1    106.04 ? 198  ARG A CZ     1 
ATOM   3161  N NH1    . ARG A 1 202 ? -41.024  -21.643 18.743  1    103.11 ? 198  ARG A NH1    1 
ATOM   3162  N NH2    . ARG A 1 202 ? -40.725  -22.204 20.947  1    105.71 ? 198  ARG A NH2    1 
ATOM   3163  H H      . ARG A 1 202 ? -40.589  -17.808 19.6    0    182.48 ? 198  ARG A H      1 
ATOM   3164  H HA     . ARG A 1 202 ? -38.01   -17.243 18.791  0    193.23 ? 198  ARG A HA     1 
ATOM   3165  H HB2    . ARG A 1 202 ? -38.652  -19.3   19.821  0    199.13 ? 198  ARG A HB2    1 
ATOM   3166  H HB3    . ARG A 1 202 ? -39.803  -19.661 18.528  0    196.53 ? 198  ARG A HB3    1 
ATOM   3167  H HG2    . ARG A 1 202 ? -37.758  -20.021 17.021  0    208.29 ? 198  ARG A HG2    1 
ATOM   3168  H HG3    . ARG A 1 202 ? -36.823  -20.018 18.54   0    211.08 ? 198  ARG A HG3    1 
ATOM   3169  H HD2    . ARG A 1 202 ? -38.73   -22.057 17.459  0    212.23 ? 198  ARG A HD2    1 
ATOM   3170  H HD3    . ARG A 1 202 ? -37.224  -22.24  18.36   0    217.08 ? 198  ARG A HD3    1 
ATOM   3171  H HE     . ARG A 1 202 ? -38.301  -22.193 20.376  0    213.45 ? 198  ARG A HE     1 
ATOM   3172  H HH11   . ARG A 1 202 ? -40.697  -21.444 17.804  0    197.03 ? 198  ARG A HH11   1 
ATOM   3173  H HH12   . ARG A 1 202 ? -42.025  -21.637 18.908  0    194.44 ? 198  ARG A HH12   1 
ATOM   3174  H HH21   . ARG A 1 202 ? -40.119  -22.429 21.73   0    205.22 ? 198  ARG A HH21   1 
ATOM   3175  H HH22   . ARG A 1 202 ? -41.73   -22.187 21.085  0    200.27 ? 198  ARG A HH22   1 
ATOM   3176  N N      . GLU A 1 203 ? -39.966  -17.93  16.166  1    98.18  ? 199  GLU A N      1 
ATOM   3177  C CA     . GLU A 1 203 ? -40.123  -17.839 14.71   1    97.68  ? 199  GLU A CA     1 
ATOM   3178  C C      . GLU A 1 203 ? -40.679  -16.486 14.226  1    93.9   ? 199  GLU A C      1 
ATOM   3179  O O      . GLU A 1 203 ? -40.591  -16.198 13.035  1    93.88  ? 199  GLU A O      1 
ATOM   3180  C CB     . GLU A 1 203 ? -41.049  -18.978 14.24   1    97.43  ? 199  GLU A CB     1 
ATOM   3181  C CG     . GLU A 1 203 ? -40.794  -19.498 12.834  1    98.97  ? 199  GLU A CG     1 
ATOM   3182  C CD     . GLU A 1 203 ? -41.652  -20.688 12.435  1    99.18  ? 199  GLU A CD     1 
ATOM   3183  O OE1    . GLU A 1 203 ? -42.623  -21.002 13.163  1    97.21  ? 199  GLU A OE1    1 
ATOM   3184  O OE2    . GLU A 1 203 ? -41.357  -21.304 11.383  1    101.46 ? 199  GLU A OE2    1 
ATOM   3185  H H      . GLU A 1 203 ? -40.771  -18.337 16.63   0    184.69 ? 199  GLU A H      1 
ATOM   3186  H HA     . GLU A 1 203 ? -39.143  -17.974 14.254  0    187.75 ? 199  GLU A HA     1 
ATOM   3187  H HB2    . GLU A 1 203 ? -40.93   -19.826 14.913  0    186.4  ? 199  GLU A HB2    1 
ATOM   3188  H HB3    . GLU A 1 203 ? -42.077  -18.623 14.281  0    181.19 ? 199  GLU A HB3    1 
ATOM   3189  H HG2    . GLU A 1 203 ? -40.989  -18.697 12.123  0    186.05 ? 199  GLU A HG2    1 
ATOM   3190  H HG3    . GLU A 1 203 ? -39.752  -19.806 12.761  0    191.29 ? 199  GLU A HG3    1 
ATOM   3191  N N      . LYS A 1 204 ? -41.252  -15.674 15.132  1    90.94  ? 200  LYS A N      1 
ATOM   3192  C CA     . LYS A 1 204 ? -41.832  -14.362 14.835  1    87.37  ? 200  LYS A CA     1 
ATOM   3193  C C      . LYS A 1 204 ? -42.909  -14.459 13.751  1    85.02  ? 200  LYS A C      1 
ATOM   3194  O O      . LYS A 1 204 ? -42.823  -13.811 12.713  1    84.2   ? 200  LYS A O      1 
ATOM   3195  C CB     . LYS A 1 204 ? -40.749  -13.331 14.481  1    88.35  ? 200  LYS A CB     1 
ATOM   3196  C CG     . LYS A 1 204 ? -39.815  -12.982 15.639  1    90.16  ? 200  LYS A CG     1 
ATOM   3197  C CD     . LYS A 1 204 ? -38.824  -11.937 15.21   1    90.9   ? 200  LYS A CD     1 
ATOM   3198  C CE     . LYS A 1 204 ? -37.918  -11.517 16.346  1    92.48  ? 200  LYS A CE     1 
ATOM   3199  N NZ     . LYS A 1 204 ? -36.952  -12.586 16.744  1    96.75  ? 200  LYS A NZ     1 
ATOM   3200  H H      . LYS A 1 204 ? -41.367  -15.914 16.111  0    170.02 ? 200  LYS A H      1 
ATOM   3201  H HA     . LYS A 1 204 ? -42.326  -14.004 15.736  0    160.41 ? 200  LYS A HA     1 
ATOM   3202  H HB2    . LYS A 1 204 ? -40.142  -13.711 13.661  0    166.62 ? 200  LYS A HB2    1 
ATOM   3203  H HB3    . LYS A 1 204 ? -41.231  -12.402 14.181  0    161.86 ? 200  LYS A HB3    1 
ATOM   3204  H HG2    . LYS A 1 204 ? -40.394  -12.584 16.47   0    166.31 ? 200  LYS A HG2    1 
ATOM   3205  H HG3    . LYS A 1 204 ? -39.255  -13.861 15.956  0    171.18 ? 200  LYS A HG3    1 
ATOM   3206  H HD2    . LYS A 1 204 ? -38.199  -12.338 14.413  0    172.34 ? 200  LYS A HD2    1 
ATOM   3207  H HD3    . LYS A 1 204 ? -39.366  -11.061 14.855  0    167.31 ? 200  LYS A HD3    1 
ATOM   3208  H HE2    . LYS A 1 204 ? -37.344  -10.645 16.037  0    173.5  ? 200  LYS A HE2    1 
ATOM   3209  H HE3    . LYS A 1 204 ? -38.525  -11.272 17.217  0    171.4  ? 200  LYS A HE3    1 
ATOM   3210  H HZ1    . LYS A 1 204 ? -36.333  -12.23  17.465  0    183.88 ? 200  LYS A HZ1    1 
ATOM   3211  H HZ2    . LYS A 1 204 ? -37.445  -13.395 17.108  0    182.85 ? 200  LYS A HZ2    1 
ATOM   3212  H HZ3    . LYS A 1 204 ? -36.396  -12.868 15.943  0    184.78 ? 200  LYS A HZ3    1 
ATOM   3213  N N      . GLU A 1 205 ? -43.915  -15.295 14      1    84.21  ? 201  GLU A N      1 
ATOM   3214  C CA     . GLU A 1 205 ? -45.031  -15.503 13.077  1    82.18  ? 201  GLU A CA     1 
ATOM   3215  C C      . GLU A 1 205 ? -46.153  -16.318 13.749  1    81.07  ? 201  GLU A C      1 
ATOM   3216  O O      . GLU A 1 205 ? -45.918  -16.943 14.783  1    82.3   ? 201  GLU A O      1 
ATOM   3217  C CB     . GLU A 1 205 ? -44.552  -16.235 11.812  1    84.58  ? 201  GLU A CB     1 
ATOM   3218  C CG     . GLU A 1 205 ? -43.88   -17.565 12.117  1    88.23  ? 201  GLU A CG     1 
ATOM   3219  C CD     . GLU A 1 205 ? -43.791  -18.538 10.951  1    90.4   ? 201  GLU A CD     1 
ATOM   3220  O OE1    . GLU A 1 205 ? -42.948  -18.316 10.05   1    91.19  ? 201  GLU A OE1    1 
ATOM   3221  O OE2    . GLU A 1 205 ? -44.548  -19.539 10.952  1    91.52  ? 201  GLU A OE2    1 
ATOM   3222  H H      . GLU A 1 205 ? -43.976  -15.853 14.846  0    155.76 ? 201  GLU A H      1 
ATOM   3223  H HA     . GLU A 1 205 ? -45.434  -14.536 12.781  0    148.39 ? 201  GLU A HA     1 
ATOM   3224  H HB2    . GLU A 1 205 ? -45.412  -16.433 11.174  0    154.87 ? 201  GLU A HB2    1 
ATOM   3225  H HB3    . GLU A 1 205 ? -43.835  -15.61  11.283  0    156.98 ? 201  GLU A HB3    1 
ATOM   3226  H HG2    . GLU A 1 205 ? -42.866  -17.357 12.452  0    166.12 ? 201  GLU A HG2    1 
ATOM   3227  H HG3    . GLU A 1 205 ? -44.414  -18.084 12.912  0    163.75 ? 201  GLU A HG3    1 
ATOM   3228  N N      . PHE A 1 206 ? -47.352  -16.345 13.149  1    79.01  ? 202  PHE A N      1 
ATOM   3229  C CA     . PHE A 1 206 ? -48.449  -17.158 13.678  1    78.14  ? 202  PHE A CA     1 
ATOM   3230  C C      . PHE A 1 206 ? -48.327  -18.578 13.154  1    81.06  ? 202  PHE A C      1 
ATOM   3231  O O      . PHE A 1 206 ? -47.78   -18.805 12.076  1    82.93  ? 202  PHE A O      1 
ATOM   3232  C CB     . PHE A 1 206 ? -49.83   -16.621 13.259  1    74.9   ? 202  PHE A CB     1 
ATOM   3233  C CG     . PHE A 1 206 ? -50.239  -15.309 13.874  1    71.83  ? 202  PHE A CG     1 
ATOM   3234  C CD1    . PHE A 1 206 ? -50.334  -15.169 15.244  1    71.08  ? 202  PHE A CD1    1 
ATOM   3235  C CD2    . PHE A 1 206 ? -50.641  -14.253 13.082  1    69.77  ? 202  PHE A CD2    1 
ATOM   3236  C CE1    . PHE A 1 206 ? -50.714  -13.957 15.806  1    68.46  ? 202  PHE A CE1    1 
ATOM   3237  C CE2    . PHE A 1 206 ? -50.998  -13.041 13.646  1    67.19  ? 202  PHE A CE2    1 
ATOM   3238  C CZ     . PHE A 1 206 ? -51.056  -12.906 15.003  1    66.52  ? 202  PHE A CZ     1 
ATOM   3239  H H      . PHE A 1 206 ? -47.583  -15.822 12.311  0    142.76 ? 202  PHE A H      1 
ATOM   3240  H HA     . PHE A 1 206 ? -48.411  -17.179 14.766  0    141.73 ? 202  PHE A HA     1 
ATOM   3241  H HB2    . PHE A 1 206 ? -49.84   -16.506 12.176  0    134.84 ? 202  PHE A HB2    1 
ATOM   3242  H HB3    . PHE A 1 206 ? -50.578  -17.358 13.548  0    134.55 ? 202  PHE A HB3    1 
ATOM   3243  H HD1    . PHE A 1 206 ? -50.044  -15.985 15.884  0    128.12 ? 202  PHE A HD1    1 
ATOM   3244  H HD2    . PHE A 1 206 ? -50.585  -14.333 12.012  0    124.04 ? 202  PHE A HD2    1 
ATOM   3245  H HE1    . PHE A 1 206 ? -50.751  -13.843 16.876  0    120.37 ? 202  PHE A HE1    1 
ATOM   3246  H HE2    . PHE A 1 206 ? -51.276  -12.217 13.01   0    116.42 ? 202  PHE A HE2    1 
ATOM   3247  H HZ     . PHE A 1 206 ? -51.367  -11.971 15.438  0    114.53 ? 202  PHE A HZ     1 
ATOM   3248  N N      . ASN A 1 207 ? -48.871  -19.528 13.906  1    81.57  ? 203  ASN A N      1 
ATOM   3249  C CA     . ASN A 1 207 ? -48.937  -20.935 13.532  1    84.28  ? 203  ASN A CA     1 
ATOM   3250  C C      . ASN A 1 207 ? -50.415  -21.383 13.645  1    82.5   ? 203  ASN A C      1 
ATOM   3251  O O      . ASN A 1 207 ? -51.268  -20.616 14.108  1    79.44  ? 203  ASN A O      1 
ATOM   3252  C CB     . ASN A 1 207 ? -47.994  -21.773 14.416  1    87.56  ? 203  ASN A CB     1 
ATOM   3253  C CG     . ASN A 1 207 ? -46.52   -21.614 14.083  1    90.21  ? 203  ASN A CG     1 
ATOM   3254  O OD1    . ASN A 1 207 ? -46.131  -21.386 12.93   1    90.64  ? 203  ASN A OD1    1 
ATOM   3255  N ND2    . ASN A 1 207 ? -45.654  -21.762 15.08   1    92.37  ? 203  ASN A ND2    1 
ATOM   3256  H H      . ASN A 1 207 ? -49.291  -19.347 14.812  0    148.2  ? 203  ASN A H      1 
ATOM   3257  H HA     . ASN A 1 207 ? -48.648  -21.074 12.492  0    156.65 ? 203  ASN A HA     1 
ATOM   3258  H HB2    . ASN A 1 207 ? -48.138  -21.477 15.453  0    161.5  ? 203  ASN A HB2    1 
ATOM   3259  H HB3    . ASN A 1 207 ? -48.242  -22.827 14.297  0    164.45 ? 203  ASN A HB3    1 
ATOM   3260  H HD21   . ASN A 1 207 ? -44.66   -21.663 14.902  0    175.06 ? 203  ASN A HD21   1 
ATOM   3261  H HD22   . ASN A 1 207 ? -45.98   -21.983 16.016  0    172.86 ? 203  ASN A HD22   1 
ATOM   3262  N N      . LYS A 1 208 ? -50.736  -22.602 13.178  1    84.57  ? 204  LYS A N      1 
ATOM   3263  C CA     . LYS A 1 208 ? -52.112  -23.114 13.194  1    83.41  ? 204  LYS A CA     1 
ATOM   3264  C C      . LYS A 1 208 ? -52.715  -23.077 14.586  1    82.17  ? 204  LYS A C      1 
ATOM   3265  O O      . LYS A 1 208 ? -52.081  -23.517 15.544  1    84.09  ? 204  LYS A O      1 
ATOM   3266  C CB     . LYS A 1 208 ? -52.161  -24.545 12.638  1    86.6   ? 204  LYS A CB     1 
ATOM   3267  C CG     . LYS A 1 208 ? -53.564  -25.143 12.541  1    85.6   ? 204  LYS A CG     1 
ATOM   3268  C CD     . LYS A 1 208 ? -53.592  -26.437 11.675  1    88.66  ? 204  LYS A CD     1 
ATOM   3269  C CE     . LYS A 1 208 ? -54.279  -27.643 12.292  1    91.34  ? 204  LYS A CE     1 
ATOM   3270  N NZ     . LYS A 1 208 ? -54.42   -28.776 11.34   1    94.17  ? 204  LYS A NZ     1 
ATOM   3271  H H      . LYS A 1 208 ? -50.062  -23.253 12.788  0    158.86 ? 204  LYS A H      1 
ATOM   3272  H HA     . LYS A 1 208 ? -52.72   -22.487 12.545  0    151.39 ? 204  LYS A HA     1 
ATOM   3273  H HB2    . LYS A 1 208 ? -51.73   -24.537 11.638  0    161.5  ? 204  LYS A HB2    1 
ATOM   3274  H HB3    . LYS A 1 208 ? -51.594  -25.2   13.297  0    162.86 ? 204  LYS A HB3    1 
ATOM   3275  H HG2    . LYS A 1 208 ? -53.922  -25.402 13.535  0    158.35 ? 204  LYS A HG2    1 
ATOM   3276  H HG3    . LYS A 1 208 ? -54.212  -24.378 12.111  0    155.97 ? 204  LYS A HG3    1 
ATOM   3277  H HD2    . LYS A 1 208 ? -54.08   -26.193 10.736  0    164.26 ? 204  LYS A HD2    1 
ATOM   3278  H HD3    . LYS A 1 208 ? -52.587  -26.79  11.456  0    167.44 ? 204  LYS A HD3    1 
ATOM   3279  H HE2    . LYS A 1 208 ? -53.702  -27.987 13.148  0    173.01 ? 204  LYS A HE2    1 
ATOM   3280  H HE3    . LYS A 1 208 ? -55.274  -27.343 12.612  0    169.43 ? 204  LYS A HE3    1 
ATOM   3281  H HZ1    . LYS A 1 208 ? -54.717  -29.614 11.831  0    179.04 ? 204  LYS A HZ1    1 
ATOM   3282  H HZ2    . LYS A 1 208 ? -55.123  -28.53  10.651  0    175.68 ? 204  LYS A HZ2    1 
ATOM   3283  H HZ3    . LYS A 1 208 ? -53.545  -28.959 10.862  0    179.07 ? 204  LYS A HZ3    1 
ATOM   3284  N N      . GLY A 1 209 ? -53.911  -22.523 14.689  1    79.17  ? 205  GLY A N      1 
ATOM   3285  C CA     . GLY A 1 209 ? -54.585  -22.419 15.97   1    77.92  ? 205  GLY A CA     1 
ATOM   3286  C C      . GLY A 1 209 ? -54.957  -23.775 16.535  1    80.24  ? 205  GLY A C      1 
ATOM   3287  O O      . GLY A 1 209 ? -55.119  -24.737 15.784  1    82.26  ? 205  GLY A O      1 
ATOM   3288  H H      . GLY A 1 209 ? -54.441  -22.132 13.918  0    142.85 ? 205  GLY A H      1 
ATOM   3289  H HA2    . GLY A 1 209 ? -53.927  -21.9   16.665  0    141.15 ? 205  GLY A HA2    1 
ATOM   3290  H HA3    . GLY A 1 209 ? -55.496  -21.833 15.857  0    138.94 ? 205  GLY A HA3    1 
ATOM   3291  N N      . PRO A 1 210 ? -55.082  -23.892 17.866  1    80.23  ? 206  PRO A N      1 
ATOM   3292  C CA     . PRO A 1 210 ? -55.439  -25.186 18.457  1    82.72  ? 206  PRO A CA     1 
ATOM   3293  C C      . PRO A 1 210 ? -56.818  -25.688 18.053  1    82.1   ? 206  PRO A C      1 
ATOM   3294  O O      . PRO A 1 210 ? -56.965  -26.897 17.882  1    84.79  ? 206  PRO A O      1 
ATOM   3295  C CB     . PRO A 1 210 ? -55.356  -24.924 19.959  1    82.49  ? 206  PRO A CB     1 
ATOM   3296  C CG     . PRO A 1 210 ? -55.559  -23.48  20.099  1    79.01  ? 206  PRO A CG     1 
ATOM   3297  C CD     . PRO A 1 210 ? -54.907  -22.868 18.907  1    78.28  ? 206  PRO A CD     1 
ATOM   3298  H HA     . PRO A 1 210 ? -54.692  -25.933 18.19   0    154.84 ? 206  PRO A HA     1 
ATOM   3299  H HB2    . PRO A 1 210 ? -56.14   -25.478 20.473  0    151.82 ? 206  PRO A HB2    1 
ATOM   3300  H HB3    . PRO A 1 210 ? -54.372  -25.211 20.327  0    153.63 ? 206  PRO A HB3    1 
ATOM   3301  H HG2    . PRO A 1 210 ? -56.626  -23.26  20.11   0    141.98 ? 206  PRO A HG2    1 
ATOM   3302  H HG3    . PRO A 1 210 ? -55.083  -23.144 21.018  0    143.98 ? 206  PRO A HG3    1 
ATOM   3303  H HD2    . PRO A 1 210 ? -55.416  -21.949 18.625  0    139.67 ? 206  PRO A HD2    1 
ATOM   3304  H HD3    . PRO A 1 210 ? -53.85   -22.696 19.104  0    143.46 ? 206  PRO A HD3    1 
ATOM   3305  N N      . TRP A 1 211 ? -57.826  -24.8   17.9    1    78.85  ? 207  TRP A N      1 
ATOM   3306  C CA     . TRP A 1 211 ? -59.153  -25.243 17.466  1    78.41  ? 207  TRP A CA     1 
ATOM   3307  C C      . TRP A 1 211 ? -59.71   -24.475 16.285  1    76.2   ? 207  TRP A C      1 
ATOM   3308  O O      . TRP A 1 211 ? -59.456  -23.282 16.12   1    74.05  ? 207  TRP A O      1 
ATOM   3309  C CB     . TRP A 1 211 ? -60.191  -25.276 18.581  1    77.54  ? 207  TRP A CB     1 
ATOM   3310  C CG     . TRP A 1 211 ? -60.173  -24.164 19.567  1    75.21  ? 207  TRP A CG     1 
ATOM   3311  C CD1    . TRP A 1 211 ? -59.492  -24.134 20.748  1    76.07  ? 207  TRP A CD1    1 
ATOM   3312  C CD2    . TRP A 1 211 ? -61.084  -23.064 19.603  1    72.02  ? 207  TRP A CD2    1 
ATOM   3313  N NE1    . TRP A 1 211 ? -59.854  -23.023 21.473  1    73.52  ? 207  TRP A NE1    1 
ATOM   3314  C CE2    . TRP A 1 211 ? -60.809  -22.331 20.776  1    71     ? 207  TRP A CE2    1 
ATOM   3315  C CE3    . TRP A 1 211 ? -62.063  -22.589 18.723  1    70.14  ? 207  TRP A CE3    1 
ATOM   3316  C CZ2    . TRP A 1 211 ? -61.463  -21.136 21.079  1    68.14  ? 207  TRP A CZ2    1 
ATOM   3317  C CZ3    . TRP A 1 211 ? -62.718  -21.411 19.032  1    67.32  ? 207  TRP A CZ3    1 
ATOM   3318  C CH2    . TRP A 1 211 ? -62.418  -20.7   20.199  1    66.34  ? 207  TRP A CH2    1 
ATOM   3319  H H      . TRP A 1 211 ? -57.753  -23.8   18.062  0    141.41 ? 207  TRP A H      1 
ATOM   3320  H HA     . TRP A 1 211 ? -59.079  -26.279 17.137  0    144.94 ? 207  TRP A HA     1 
ATOM   3321  H HB2    . TRP A 1 211 ? -61.151  -25.192 18.077  0    139.3  ? 207  TRP A HB2    1 
ATOM   3322  H HB3    . TRP A 1 211 ? -60.112  -26.218 19.122  0    142.72 ? 207  TRP A HB3    1 
ATOM   3323  H HD1    . TRP A 1 211 ? -58.739  -24.844 21.043  0    139.68 ? 207  TRP A HD1    1 
ATOM   3324  H HE1    . TRP A 1 211 ? -59.41   -22.711 22.361  0    131.73 ? 207  TRP A HE1    1 
ATOM   3325  H HE3    . TRP A 1 211 ? -62.29   -23.12  17.815  0    125.06 ? 207  TRP A HE3    1 
ATOM   3326  H HZ2    . TRP A 1 211 ? -61.252  -20.598 21.988  0    119.18 ? 207  TRP A HZ2    1 
ATOM   3327  H HZ3    . TRP A 1 211 ? -63.47   -21.032 18.359  0    116.7  ? 207  TRP A HZ3    1 
ATOM   3328  H HH2    . TRP A 1 211 ? -62.957  -19.793 20.414  0    113.77 ? 207  TRP A HH2    1 
ATOM   3329  N N      . LYS A 1 212 ? -60.533  -25.188 15.499  1    77     ? 208  LYS A N      1 
ATOM   3330  C CA     . LYS A 1 212 ? -61.174  -24.734 14.265  1    75.74  ? 208  LYS A CA     1 
ATOM   3331  C C      . LYS A 1 212 ? -61.976  -23.447 14.404  1    72.29  ? 208  LYS A C      1 
ATOM   3332  O O      . LYS A 1 212 ? -62.57   -23.161 15.446  1    71     ? 208  LYS A O      1 
ATOM   3333  C CB     . LYS A 1 212 ? -62.102  -25.851 13.711  1    77.7   ? 208  LYS A CB     1 
ATOM   3334  C CG     . LYS A 1 212 ? -62.624  -25.612 12.287  1    77.5   ? 208  LYS A CG     1 
ATOM   3335  C CD     . LYS A 1 212 ? -63.428  -26.809 11.738  1    80.01  ? 208  LYS A CD     1 
ATOM   3336  C CE     . LYS A 1 212 ? -64.839  -26.935 12.288  1    79.17  ? 208  LYS A CE     1 
ATOM   3337  N NZ     . LYS A 1 212 ? -65.755  -25.877 11.773  1    76.48  ? 208  LYS A NZ     1 
ATOM   3338  H H      . LYS A 1 212 ? -60.784  -26.14  15.743  0    141.09 ? 208  LYS A H      1 
ATOM   3339  H HA     . LYS A 1 212 ? -60.394  -24.565 13.525  0    137.09 ? 208  LYS A HA     1 
ATOM   3340  H HB2    . LYS A 1 212 ? -61.554  -26.792 13.698  0    143.39 ? 208  LYS A HB2    1 
ATOM   3341  H HB3    . LYS A 1 212 ? -62.962  -25.933 14.374  0    140.01 ? 208  LYS A HB3    1 
ATOM   3342  H HG2    . LYS A 1 212 ? -63.274  -24.738 12.273  0    137.92 ? 208  LYS A HG2    1 
ATOM   3343  H HG3    . LYS A 1 212 ? -61.773  -25.451 11.627  0    140.96 ? 208  LYS A HG3    1 
ATOM   3344  H HD2    . LYS A 1 212 ? -63.503  -26.704 10.656  0    146.02 ? 208  LYS A HD2    1 
ATOM   3345  H HD3    . LYS A 1 212 ? -62.894  -27.727 11.978  0    148.15 ? 208  LYS A HD3    1 
ATOM   3346  H HE2    . LYS A 1 212 ? -65.24   -27.901 11.985  0    146.14 ? 208  LYS A HE2    1 
ATOM   3347  H HE3    . LYS A 1 212 ? -64.819  -26.87  13.374  0    143.4  ? 208  LYS A HE3    1 
ATOM   3348  H HZ1    . LYS A 1 212 ? -66.67   -25.985 12.197  0    137.54 ? 208  LYS A HZ1    1 
ATOM   3349  H HZ2    . LYS A 1 212 ? -65.395  -24.954 11.992  0    136.22 ? 208  LYS A HZ2    1 
ATOM   3350  H HZ3    . LYS A 1 212 ? -65.848  -25.968 10.766  0    139    ? 208  LYS A HZ3    1 
ATOM   3351  N N      . GLN A 1 213 ? -62.023  -22.705 13.306  1    71.05  ? 209  GLN A N      1 
ATOM   3352  C CA     . GLN A 1 213 ? -62.828  -21.508 13.214  1    68.1   ? 209  GLN A CA     1 
ATOM   3353  C C      . GLN A 1 213 ? -64.311  -21.935 13.222  1    67.89  ? 209  GLN A C      1 
ATOM   3354  O O      . GLN A 1 213 ? -64.648  -23.033 12.763  1    70     ? 209  GLN A O      1 
ATOM   3355  C CB     . GLN A 1 213 ? -62.493  -20.756 11.91   1    67.5   ? 209  GLN A CB     1 
ATOM   3356  C CG     . GLN A 1 213 ? -63.253  -19.441 11.687  1    64.66  ? 209  GLN A CG     1 
ATOM   3357  C CD     . GLN A 1 213 ? -63.465  -19.166 10.211  1    64.72  ? 209  GLN A CD     1 
ATOM   3358  O OE1    . GLN A 1 213 ? -62.606  -18.559 9.547   1    65.24  ? 209  GLN A OE1    1 
ATOM   3359  N NE2    . GLN A 1 213 ? -64.613  -19.6   9.66    1    64.39  ? 209  GLN A NE2    1 
ATOM   3360  H H      . GLN A 1 213 ? -61.516  -22.928 12.455  0    127.42 ? 209  GLN A H      1 
ATOM   3361  H HA     . GLN A 1 213 ? -62.64   -20.852 14.063  0    118.36 ? 209  GLN A HA     1 
ATOM   3362  H HB2    . GLN A 1 213 ? -61.429  -20.523 11.91   0    118.83 ? 209  GLN A HB2    1 
ATOM   3363  H HB3    . GLN A 1 213 ? -62.724  -21.409 11.069  0    119.85 ? 209  GLN A HB3    1 
ATOM   3364  H HG2    . GLN A 1 213 ? -64.226  -19.462 12.176  0    111.4  ? 209  GLN A HG2    1 
ATOM   3365  H HG3    . GLN A 1 213 ? -62.657  -18.625 12.092  0    110.97 ? 209  GLN A HG3    1 
ATOM   3366  H HE21   . GLN A 1 213 ? -65.298  -20.095 10.222  0    112.22 ? 209  GLN A HE21   1 
ATOM   3367  H HE22   . GLN A 1 213 ? -64.791  -19.434 8.675   0    112.48 ? 209  GLN A HE22   1 
ATOM   3368  N N      . GLU A 1 214 ? -65.189  -21.063 13.735  1    65.58  ? 210  GLU A N      1 
ATOM   3369  C CA     . GLU A 1 214 ? -66.626  -21.333 13.783  1    65.39  ? 210  GLU A CA     1 
ATOM   3370  C C      . GLU A 1 214 ? -67.396  -20.073 13.437  1    62.97  ? 210  GLU A C      1 
ATOM   3371  O O      . GLU A 1 214 ? -66.965  -18.988 13.813  1    61.11  ? 210  GLU A O      1 
ATOM   3372  C CB     . GLU A 1 214 ? -67.015  -21.833 15.181  1    65.73  ? 210  GLU A CB     1 
ATOM   3373  C CG     . GLU A 1 214 ? -66.773  -23.318 15.395  1    68.67  ? 210  GLU A CG     1 
ATOM   3374  C CD     . GLU A 1 214 ? -67.713  -24.245 14.633  1    70.6   ? 210  GLU A CD     1 
ATOM   3375  O OE1    . GLU A 1 214 ? -67.442  -25.471 14.583  1    73.28  ? 210  GLU A OE1    1 
ATOM   3376  O OE2    . GLU A 1 214 ? -68.698  -23.734 14.047  1    69.62  ? 210  GLU A OE2    1 
ATOM   3377  H H      . GLU A 1 214 ? -64.933  -20.161 14.125  0    112.68 ? 210  GLU A H      1 
ATOM   3378  H HA     . GLU A 1 214 ? -66.897  -22.077 13.035  0    115.46 ? 210  GLU A HA     1 
ATOM   3379  H HB2    . GLU A 1 214 ? -66.438  -21.282 15.921  0    113.56 ? 210  GLU A HB2    1 
ATOM   3380  H HB3    . GLU A 1 214 ? -68.076  -21.667 15.356  0    113.79 ? 210  GLU A HB3    1 
ATOM   3381  H HG2    . GLU A 1 214 ? -65.784  -23.605 15.047  0    121.96 ? 210  GLU A HG2    1 
ATOM   3382  H HG3    . GLU A 1 214 ? -66.874  -23.484 16.464  0    121.16 ? 210  GLU A HG3    1 
ATOM   3383  N N      . ASN A 1 215 ? -68.526  -20.198 12.71   1    63.16  ? 211  ASN A N      1 
ATOM   3384  C CA     . ASN A 1 215 ? -69.345  -19.036 12.328  1    61.19  ? 211  ASN A CA     1 
ATOM   3385  C C      . ASN A 1 215 ? -70.192  -18.601 13.523  1    59.82  ? 211  ASN A C      1 
ATOM   3386  O O      . ASN A 1 215 ? -70.975  -19.402 14.03   1    60.92  ? 211  ASN A O      1 
ATOM   3387  C CB     . ASN A 1 215 ? -70.23   -19.367 11.134  1    62.3   ? 211  ASN A CB     1 
ATOM   3388  C CG     . ASN A 1 215 ? -69.458  -19.88  9.944   1    63.97  ? 211  ASN A CG     1 
ATOM   3389  O OD1    . ASN A 1 215 ? -68.215  -19.855 9.905   1    64.18  ? 211  ASN A OD1    1 
ATOM   3390  N ND2    . ASN A 1 215 ? -70.178  -20.384 8.951   1    65.44  ? 211  ASN A ND2    1 
ATOM   3391  H H      . ASN A 1 215 ? -68.9    -21.088 12.397  0    110.58 ? 211  ASN A H      1 
ATOM   3392  H HA     . ASN A 1 215 ? -68.693  -18.215 12.034  0    103.51 ? 211  ASN A HA     1 
ATOM   3393  H HB2    . ASN A 1 215 ? -70.942  -20.138 11.427  0    108.18 ? 211  ASN A HB2    1 
ATOM   3394  H HB3    . ASN A 1 215 ? -70.761  -18.467 10.828  0    105.72 ? 211  ASN A HB3    1 
ATOM   3395  H HD21   . ASN A 1 215 ? -69.715  -20.751 8.126   0    115.35 ? 211  ASN A HD21   1 
ATOM   3396  H HD22   . ASN A 1 215 ? -71.19   -20.419 9.026   0    114.03 ? 211  ASN A HD22   1 
ATOM   3397  N N      . VAL A 1 216 ? -70.018  -17.343 13.981  1    57.64  ? 212  VAL A N      1 
ATOM   3398  C CA     . VAL A 1 216 ? -70.696  -16.798 15.168  1    56.4   ? 212  VAL A CA     1 
ATOM   3399  C C      . VAL A 1 216 ? -71.774  -15.749 14.799  1    55.05  ? 212  VAL A C      1 
ATOM   3400  O O      . VAL A 1 216 ? -71.916  -15.383 13.627  1    55     ? 212  VAL A O      1 
ATOM   3401  C CB     . VAL A 1 216 ? -69.67   -16.26  16.218  1    55.37  ? 212  VAL A CB     1 
ATOM   3402  C CG1    . VAL A 1 216 ? -68.705  -17.347 16.649  1    57.08  ? 212  VAL A CG1    1 
ATOM   3403  C CG2    . VAL A 1 216 ? -68.926  -15.025 15.718  1    53.86  ? 212  VAL A CG2    1 
ATOM   3404  H H      . VAL A 1 216 ? -69.426  -16.663 13.516  0    95.97  ? 212  VAL A H      1 
ATOM   3405  H HA     . VAL A 1 216 ? -71.232  -17.602 15.67   0    95.21  ? 212  VAL A HA     1 
ATOM   3406  H HB     . VAL A 1 216 ? -70.225  -15.958 17.105  0    91.17  ? 212  VAL A HB     1 
ATOM   3407  H HG11   . VAL A 1 216 ? -68.004  -16.939 17.375  0    95     ? 212  VAL A HG11   1 
ATOM   3408  H HG12   . VAL A 1 216 ? -69.271  -18.161 17.1    0    96.73  ? 212  VAL A HG12   1 
ATOM   3409  H HG13   . VAL A 1 216 ? -68.15   -17.709 15.785  0    96.45  ? 212  VAL A HG13   1 
ATOM   3410  H HG21   . VAL A 1 216 ? -68.172  -14.752 16.455  0    88.06  ? 212  VAL A HG21   1 
ATOM   3411  H HG22   . VAL A 1 216 ? -68.441  -15.244 14.768  0    89.18  ? 212  VAL A HG22   1 
ATOM   3412  H HG23   . VAL A 1 216 ? -69.623  -14.197 15.599  0    87.33  ? 212  VAL A HG23   1 
ATOM   3413  N N      . GLU A 1 217 ? -72.55   -15.301 15.815  1    54.26  ? 213  GLU A N      1 
ATOM   3414  C CA     . GLU A 1 217 ? -73.625  -14.332 15.674  1    53.23  ? 213  GLU A CA     1 
ATOM   3415  C C      . GLU A 1 217 ? -73.162  -13.062 14.968  1    51.72  ? 213  GLU A C      1 
ATOM   3416  O O      . GLU A 1 217 ? -72.016  -12.645 15.114  1    50.96  ? 213  GLU A O      1 
ATOM   3417  C CB     . GLU A 1 217 ? -74.185  -13.967 17.052  1    52.68  ? 213  GLU A CB     1 
ATOM   3418  C CG     . GLU A 1 217 ? -75.489  -13.2   16.992  1    52.27  ? 213  GLU A CG     1 
ATOM   3419  C CD     . GLU A 1 217 ? -75.698  -12.321 18.201  1    51.24  ? 213  GLU A CD     1 
ATOM   3420  O OE1    . GLU A 1 217 ? -75.312  -12.747 19.313  1    51.76  ? 213  GLU A OE1    1 
ATOM   3421  O OE2    . GLU A 1 217 ? -76.242  -11.204 18.04   1    50.09  ? 213  GLU A OE2    1 
ATOM   3422  H H      . GLU A 1 217 ? -72.419  -15.629 16.767  0    89.64  ? 213  GLU A H      1 
ATOM   3423  H HA     . GLU A 1 217 ? -74.423  -14.786 15.086  0    88.14  ? 213  GLU A HA     1 
ATOM   3424  H HB2    . GLU A 1 217 ? -74.377  -14.875 17.62   0    87.07  ? 213  GLU A HB2    1 
ATOM   3425  H HB3    . GLU A 1 217 ? -73.449  -13.351 17.566  0    84.86  ? 213  GLU A HB3    1 
ATOM   3426  H HG2    . GLU A 1 217 ? -75.523  -12.546 16.122  0    84.36  ? 213  GLU A HG2    1 
ATOM   3427  H HG3    . GLU A 1 217 ? -76.317  -13.906 16.951  0    86.18  ? 213  GLU A HG3    1 
ATOM   3428  N N      . ALA A 1 218 ? -74.076  -12.444 14.217  1    51.5   ? 214  ALA A N      1 
ATOM   3429  C CA     . ALA A 1 218 ? -73.815  -11.205 13.48   1    50.38  ? 214  ALA A CA     1 
ATOM   3430  C C      . ALA A 1 218 ? -73.292  -10.04  14.338  1    48.68  ? 214  ALA A C      1 
ATOM   3431  O O      . ALA A 1 218 ? -72.548  -9.208  13.825  1    47.88  ? 214  ALA A O      1 
ATOM   3432  C CB     . ALA A 1 218 ? -75.075  -10.767 12.752  1    50.79  ? 214  ALA A CB     1 
ATOM   3433  H H      . ALA A 1 218 ? -75.013  -12.809 14.074  0    84.13  ? 214  ALA A H      1 
ATOM   3434  H HA     . ALA A 1 218 ? -73.061  -11.412 12.723  0    81.19  ? 214  ALA A HA     1 
ATOM   3435  H HB1    . ALA A 1 218 ? -74.868  -9.848  12.207  0    81.03  ? 214  ALA A HB1    1 
ATOM   3436  H HB2    . ALA A 1 218 ? -75.371  -11.553 12.058  0    83.05  ? 214  ALA A HB2    1 
ATOM   3437  H HB3    . ALA A 1 218 ? -75.866  -10.601 13.482  0    81.58  ? 214  ALA A HB3    1 
ATOM   3438  N N      . GLU A 1 219 ? -73.696  -9.956  15.609  1    48.33  ? 215  GLU A N      1 
ATOM   3439  C CA     . GLU A 1 219 ? -73.253  -8.886  16.492  1    46.99  ? 215  GLU A CA     1 
ATOM   3440  C C      . GLU A 1 219 ? -72.413  -9.44   17.647  1    47.14  ? 215  GLU A C      1 
ATOM   3441  O O      . GLU A 1 219 ? -72.553  -9.002  18.792  1    46.66  ? 215  GLU A O      1 
ATOM   3442  C CB     . GLU A 1 219 ? -74.457  -8.125  17.044  1    46.67  ? 215  GLU A CB     1 
ATOM   3443  C CG     . GLU A 1 219 ? -75.371  -7.513  16.006  1    46.8   ? 215  GLU A CG     1 
ATOM   3444  C CD     . GLU A 1 219 ? -76.672  -7.062  16.653  1    46.96  ? 215  GLU A CD     1 
ATOM   3445  O OE1    . GLU A 1 219 ? -77.698  -7.77   16.475  1    48.16  ? 215  GLU A OE1    1 
ATOM   3446  O OE2    . GLU A 1 219 ? -76.652  -6.032  17.379  1    46.08  ? 215  GLU A OE2    1 
ATOM   3447  H H      . GLU A 1 219 ? -74.335  -10.607 16.055  0    77.07  ? 215  GLU A H      1 
ATOM   3448  H HA     . GLU A 1 219 ? -72.635  -8.166  15.957  0    72.68  ? 215  GLU A HA     1 
ATOM   3449  H HB2    . GLU A 1 219 ? -75.057  -8.806  17.645  0    73.41  ? 215  GLU A HB2    1 
ATOM   3450  H HB3    . GLU A 1 219 ? -74.102  -7.303  17.663  0    71.77  ? 215  GLU A HB3    1 
ATOM   3451  H HG2    . GLU A 1 219 ? -74.885  -6.644  15.564  0    72.17  ? 215  GLU A HG2    1 
ATOM   3452  H HG3    . GLU A 1 219 ? -75.619  -8.242  15.237  0    73.85  ? 215  GLU A HG3    1 
ATOM   3453  N N      . ALA A 1 220 ? -71.511  -10.38  17.349  1    48.01  ? 216  ALA A N      1 
ATOM   3454  C CA     . ALA A 1 220 ? -70.612  -10.933 18.359  1    48.46  ? 216  ALA A CA     1 
ATOM   3455  C C      . ALA A 1 220 ? -69.641  -9.827  18.772  1    47.3   ? 216  ALA A C      1 
ATOM   3456  O O      . ALA A 1 220 ? -68.747  -9.487  18.003  1    47.04  ? 216  ALA A O      1 
ATOM   3457  C CB     . ALA A 1 220 ? -69.85   -12.102 17.774  1    49.83  ? 216  ALA A CB     1 
ATOM   3458  H H      . ALA A 1 220 ? -71.38   -10.77  16.421  0    76.09  ? 216  ALA A H      1 
ATOM   3459  H HA     . ALA A 1 220 ? -71.178  -11.273 19.224  0    76.95  ? 216  ALA A HA     1 
ATOM   3460  H HB1    . ALA A 1 220 ? -69.058  -12.39  18.463  0    79.99  ? 216  ALA A HB1    1 
ATOM   3461  H HB2    . ALA A 1 220 ? -70.54   -12.933 17.634  0    80.53  ? 216  ALA A HB2    1 
ATOM   3462  H HB3    . ALA A 1 220 ? -69.424  -11.813 16.814  0    79.33  ? 216  ALA A HB3    1 
ATOM   3463  N N      . SER A 1 221 ? -69.862  -9.215  19.938  1    46.75  ? 217  SER A N      1 
ATOM   3464  C CA     . SER A 1 221 ? -69.075  -8.061  20.365  1    45.76  ? 217  SER A CA     1 
ATOM   3465  C C      . SER A 1 221 ? -67.843  -8.35   21.251  1    46.35  ? 217  SER A C      1 
ATOM   3466  O O      . SER A 1 221 ? -66.848  -7.635  21.107  1    45.9   ? 217  SER A O      1 
ATOM   3467  C CB     . SER A 1 221 ? -69.979  -7.049  21.071  1    44.95  ? 217  SER A CB     1 
ATOM   3468  O OG     . SER A 1 221 ? -70.768  -7.617  22.105  1    45.64  ? 217  SER A OG     1 
ATOM   3469  H H      . SER A 1 221 ? -70.578  -9.487  20.603  0    73.18  ? 217  SER A H      1 
ATOM   3470  H HA     . SER A 1 221 ? -68.714  -7.545  19.476  0    70.12  ? 217  SER A HA     1 
ATOM   3471  H HB2    . SER A 1 221 ? -69.353  -6.268  21.5    0    68.34  ? 217  SER A HB2    1 
ATOM   3472  H HB3    . SER A 1 221 ? -70.647  -6.612  20.331  0    68.46  ? 217  SER A HB3    1 
ATOM   3473  H HG     . SER A 1 221 ? -71.315  -6.913  22.541  0    70.04  ? 217  SER A HG     1 
ATOM   3474  N N      . MET A 1 222 ? -67.899  -9.331  22.18   1    47.54  ? 218  MET A N      1 
ATOM   3475  C CA     . MET A 1 222 ? -66.776  -9.557  23.099  1    48.36  ? 218  MET A CA     1 
ATOM   3476  C C      . MET A 1 222 ? -66.301  -10.982 23.226  1    50.11  ? 218  MET A C      1 
ATOM   3477  O O      . MET A 1 222 ? -67.1    -11.913 23.193  1    50.94  ? 218  MET A O      1 
ATOM   3478  C CB     . MET A 1 222 ? -67.148  -9.059  24.492  1    48.34  ? 218  MET A CB     1 
ATOM   3479  C CG     . MET A 1 222 ? -67.363  -7.572  24.549  1    46.89  ? 218  MET A CG     1 
ATOM   3480  S SD     . MET A 1 222 ? -68.307  -7.047  25.996  1    47.11  ? 218  MET A SD     1 
ATOM   3481  C CE     . MET A 1 222 ? -69.939  -7.54   25.54   1    47.2   ? 218  MET A CE     1 
ATOM   3482  H H      . MET A 1 222 ? -68.684  -9.962  22.308  0    75.09  ? 218  MET A H      1 
ATOM   3483  H HA     . MET A 1 222 ? -65.921  -8.971  22.765  0    75.92  ? 218  MET A HA     1 
ATOM   3484  H HB2    . MET A 1 222 ? -68.063  -9.55   24.818  0    76.75  ? 218  MET A HB2    1 
ATOM   3485  H HB3    . MET A 1 222 ? -66.336  -9.3    25.177  0    77.13  ? 218  MET A HB3    1 
ATOM   3486  H HG2    . MET A 1 222 ? -66.392  -7.078  24.583  0    72.89  ? 218  MET A HG2    1 
ATOM   3487  H HG3    . MET A 1 222 ? -67.908  -7.239  23.667  0    72.34  ? 218  MET A HG3    1 
ATOM   3488  H HE1    . MET A 1 222 ? -70.648  -6.95   26.12   0    73.71  ? 218  MET A HE1    1 
ATOM   3489  H HE2    . MET A 1 222 ? -70.091  -7.362  24.477  0    72.89  ? 218  MET A HE2    1 
ATOM   3490  H HE3    . MET A 1 222 ? -70.062  -8.597  25.771  0    74.73  ? 218  MET A HE3    1 
ATOM   3491  N N      . VAL A 1 223 ? -64.98   -11.136 23.443  1    50.91  ? 219  VAL A N      1 
ATOM   3492  C CA     . VAL A 1 223 ? -64.296  -12.417 23.659  1    52.91  ? 219  VAL A CA     1 
ATOM   3493  C C      . VAL A 1 223 ? -63.899  -12.47  25.135  1    53.99  ? 219  VAL A C      1 
ATOM   3494  O O      . VAL A 1 223 ? -63.405  -11.473 25.669  1    53.38  ? 219  VAL A O      1 
ATOM   3495  C CB     . VAL A 1 223 ? -63.037  -12.535 22.766  1    53.39  ? 219  VAL A CB     1 
ATOM   3496  C CG1    . VAL A 1 223 ? -62.256  -13.8   23.089  1    55.75  ? 219  VAL A CG1    1 
ATOM   3497  C CG2    . VAL A 1 223 ? -63.407  -12.502 21.297  1    52.62  ? 219  VAL A CG2    1 
ATOM   3498  H H      . VAL A 1 223 ? -64.332  -10.357 23.481  0    81.47  ? 219  VAL A H      1 
ATOM   3499  H HA     . VAL A 1 223 ? -64.958  -13.252 23.437  0    87.07  ? 219  VAL A HA     1 
ATOM   3500  H HB     . VAL A 1 223 ? -62.393  -11.678 22.955  0    86.95  ? 219  VAL A HB     1 
ATOM   3501  H HG11   . VAL A 1 223 ? -61.483  -13.941 22.333  0    93.18  ? 219  VAL A HG11   1 
ATOM   3502  H HG12   . VAL A 1 223 ? -61.787  -13.711 24.067  0    93.43  ? 219  VAL A HG12   1 
ATOM   3503  H HG13   . VAL A 1 223 ? -62.939  -14.648 23.081  0    93.44  ? 219  VAL A HG13   1 
ATOM   3504  H HG21   . VAL A 1 223 ? -62.504  -12.592 20.695  0    86.35  ? 219  VAL A HG21   1 
ATOM   3505  H HG22   . VAL A 1 223 ? -64.069  -13.342 21.103  0    86.54  ? 219  VAL A HG22   1 
ATOM   3506  H HG23   . VAL A 1 223 ? -63.913  -11.566 21.064  0    84.33  ? 219  VAL A HG23   1 
ATOM   3507  N N      . ILE A 1 224 ? -64.11   -13.615 25.793  1    55.78  ? 220  ILE A N      1 
ATOM   3508  C CA     . ILE A 1 224 ? -63.754  -13.77  27.198  1    57.22  ? 220  ILE A CA     1 
ATOM   3509  C C      . ILE A 1 224 ? -62.918  -15.012 27.297  1    59.66  ? 220  ILE A C      1 
ATOM   3510  O O      . ILE A 1 224 ? -63.453  -16.089 27.058  1    60.78  ? 220  ILE A O      1 
ATOM   3511  C CB     . ILE A 1 224 ? -65.01   -13.9   28.103  1    57.34  ? 220  ILE A CB     1 
ATOM   3512  C CG1    . ILE A 1 224 ? -65.802  -12.59  28.152  1    55.23  ? 220  ILE A CG1    1 
ATOM   3513  C CG2    . ILE A 1 224 ? -64.62   -14.325 29.516  1    59.44  ? 220  ILE A CG2    1 
ATOM   3514  C CD1    . ILE A 1 224 ? -67.233  -12.731 28.596  1    55.24  ? 220  ILE A CD1    1 
ATOM   3515  H H      . ILE A 1 224 ? -64.522  -14.447 25.384  0    93.4   ? 220  ILE A H      1 
ATOM   3516  H HA     . ILE A 1 224 ? -63.164  -12.927 27.556  0    95.44  ? 220  ILE A HA     1 
ATOM   3517  H HB     . ILE A 1 224 ? -65.638  -14.676 27.675  0    96.53  ? 220  ILE A HB     1 
ATOM   3518  H HG12   . ILE A 1 224 ? -65.311  -11.917 28.854  0    91.51  ? 220  ILE A HG12   1 
ATOM   3519  H HG13   . ILE A 1 224 ? -65.81   -12.136 27.163  0    90.17  ? 220  ILE A HG13   1 
ATOM   3520  H HG21   . ILE A 1 224 ? -65.462  -14.186 30.192  0    100.9  ? 220  ILE A HG21   1 
ATOM   3521  H HG22   . ILE A 1 224 ? -64.346  -15.379 29.52   0    102.49 ? 220  ILE A HG22   1 
ATOM   3522  H HG23   . ILE A 1 224 ? -63.779  -13.717 29.845  0    100.66 ? 220  ILE A HG23   1 
ATOM   3523  H HD11   . ILE A 1 224 ? -67.761  -11.812 28.343  0    89.97  ? 220  ILE A HD11   1 
ATOM   3524  H HD12   . ILE A 1 224 ? -67.688  -13.575 28.081  0    91.87  ? 220  ILE A HD12   1 
ATOM   3525  H HD13   . ILE A 1 224 ? -67.274  -12.88  29.674  0    92.68  ? 220  ILE A HD13   1 
ATOM   3526  N N      . ALA A 1 225 ? -61.635  -14.888 27.694  1    60.75  ? 221  ALA A N      1 
ATOM   3527  C CA     . ALA A 1 225 ? -60.765  -16.05  27.888  1    63.42  ? 221  ALA A CA     1 
ATOM   3528  C C      . ALA A 1 225 ? -61.131  -16.713 29.217  1    65.4   ? 221  ALA A C      1 
ATOM   3529  O O      . ALA A 1 225 ? -61.086  -16.051 30.256  1    65.44  ? 221  ALA A O      1 
ATOM   3530  C CB     . ALA A 1 225 ? -59.312  -15.616 27.907  1    64.09  ? 221  ALA A CB     1 
ATOM   3531  H H      . ALA A 1 225 ? -61.173  -14.003 27.879  0    102.91 ? 221  ALA A H      1 
ATOM   3532  H HA     . ALA A 1 225 ? -60.905  -16.76  27.074  0    109.93 ? 221  ALA A HA     1 
ATOM   3533  H HB1    . ALA A 1 225 ? -58.686  -16.497 28.032  0    113.3  ? 221  ALA A HB1    1 
ATOM   3534  H HB2    . ALA A 1 225 ? -59.077  -15.123 26.964  0    109.82 ? 221  ALA A HB2    1 
ATOM   3535  H HB3    . ALA A 1 225 ? -59.155  -14.927 28.735  0    110.95 ? 221  ALA A HB3    1 
ATOM   3536  N N      . VAL A 1 226 ? -61.508  -18.004 29.194  1    67.18  ? 222  VAL A N      1 
ATOM   3537  C CA     . VAL A 1 226 ? -61.92   -18.691 30.409  1    69.3   ? 222  VAL A CA     1 
ATOM   3538  C C      . VAL A 1 226 ? -60.723  -19.388 31.026  1    72.32  ? 222  VAL A C      1 
ATOM   3539  O O      . VAL A 1 226 ? -60.093  -20.185 30.336  1    73.68  ? 222  VAL A O      1 
ATOM   3540  C CB     . VAL A 1 226 ? -63.042  -19.715 30.149  1    69.94  ? 222  VAL A CB     1 
ATOM   3541  C CG1    . VAL A 1 226 ? -63.531  -20.33  31.457  1    72.2   ? 222  VAL A CG1    1 
ATOM   3542  C CG2    . VAL A 1 226 ? -64.195  -19.067 29.419  1    67.21  ? 222  VAL A CG2    1 
ATOM   3543  H H      . VAL A 1 226 ? -61.536  -18.585 28.362  0    117.98 ? 222  VAL A H      1 
ATOM   3544  H HA     . VAL A 1 226 ? -62.354  -17.954 31.081  0    121.56 ? 222  VAL A HA     1 
ATOM   3545  H HB     . VAL A 1 226 ? -62.655  -20.515 29.521  0    125.14 ? 222  VAL A HB     1 
ATOM   3546  H HG11   . VAL A 1 226 ? -64.41   -20.942 31.258  0    129.14 ? 222  VAL A HG11   1 
ATOM   3547  H HG12   . VAL A 1 226 ? -62.75   -20.953 31.888  0    131.27 ? 222  VAL A HG12   1 
ATOM   3548  H HG13   . VAL A 1 226 ? -63.786  -19.529 32.15   0    128.16 ? 222  VAL A HG13   1 
ATOM   3549  H HG21   . VAL A 1 226 ? -65.019  -19.776 29.346  0    118.71 ? 222  VAL A HG21   1 
ATOM   3550  H HG22   . VAL A 1 226 ? -64.504  -18.193 29.989  0    116.88 ? 222  VAL A HG22   1 
ATOM   3551  H HG23   . VAL A 1 226 ? -63.882  -18.77  28.419  0    116.69 ? 222  VAL A HG23   1 
ATOM   3552  N N      . PRO A 1 227 ? -60.426  -19.184 32.328  1    73.76  ? 223  PRO A N      1 
ATOM   3553  C CA     . PRO A 1 227 ? -59.304  -19.913 32.938  1    77.05  ? 223  PRO A CA     1 
ATOM   3554  C C      . PRO A 1 227 ? -59.585  -21.398 33.143  1    79.93  ? 223  PRO A C      1 
ATOM   3555  O O      . PRO A 1 227 ? -60.729  -21.86  33.095  1    79.55  ? 223  PRO A O      1 
ATOM   3556  C CB     . PRO A 1 227 ? -59.101  -19.226 34.301  1    77.77  ? 223  PRO A CB     1 
ATOM   3557  C CG     . PRO A 1 227 ? -60.029  -18.121 34.359  1    74.65  ? 223  PRO A CG     1 
ATOM   3558  C CD     . PRO A 1 227 ? -61.053  -18.263 33.294  1    72.69  ? 223  PRO A CD     1 
ATOM   3559  H HA     . PRO A 1 227 ? -58.398  -19.787 32.346  0    139.54 ? 223  PRO A HA     1 
ATOM   3560  H HB2    . PRO A 1 227 ? -59.32   -19.937 35.096  0    143.2  ? 223  PRO A HB2    1 
ATOM   3561  H HB3    . PRO A 1 227 ? -58.076  -18.865 34.382  0    142.07 ? 223  PRO A HB3    1 
ATOM   3562  H HG2    . PRO A 1 227 ? -60.508  -18.11  35.337  0    135.11 ? 223  PRO A HG2    1 
ATOM   3563  H HG3    . PRO A 1 227 ? -59.473  -17.196 34.21   0    133.21 ? 223  PRO A HG3    1 
ATOM   3564  H HD2    . PRO A 1 227 ? -61.975  -18.688 33.685  0    130.34 ? 223  PRO A HD2    1 
ATOM   3565  H HD3    . PRO A 1 227 ? -61.205  -17.275 32.86   0    127.47 ? 223  PRO A HD3    1 
ATOM   3566  N N      . GLU A 1 228 ? -58.507  -22.131 33.419  1    83.11  ? 224  GLU A N      1 
ATOM   3567  C CA     . GLU A 1 228 ? -58.546  -23.566 33.663  1    86.39  ? 224  GLU A CA     1 
ATOM   3568  C C      . GLU A 1 228 ? -59.501  -23.918 34.82   1    87.67  ? 224  GLU A C      1 
ATOM   3569  O O      . GLU A 1 228 ? -59.785  -23.063 35.665  1    86.69  ? 224  GLU A O      1 
ATOM   3570  C CB     . GLU A 1 228 ? -57.115  -24.07  33.948  1    89.75  ? 224  GLU A CB     1 
ATOM   3571  C CG     . GLU A 1 228 ? -56.231  -24.077 32.712  1    89.14  ? 224  GLU A CG     1 
ATOM   3572  C CD     . GLU A 1 228 ? -55.001  -24.965 32.799  1    92.86  ? 224  GLU A CD     1 
ATOM   3573  O OE1    . GLU A 1 228 ? -53.885  -24.45  32.561  1    92.99  ? 224  GLU A OE1    1 
ATOM   3574  O OE2    . GLU A 1 228 ? -55.15   -26.175 33.091  1    95.82  ? 224  GLU A OE2    1 
ATOM   3575  H H      . GLU A 1 228 ? -57.581  -21.719 33.476  0    153.24 ? 224  GLU A H      1 
ATOM   3576  H HA     . GLU A 1 228 ? -58.923  -24.049 32.763  0    159.48 ? 224  GLU A HA     1 
ATOM   3577  H HB2    . GLU A 1 228 ? -56.648  -23.405 34.673  0    167.64 ? 224  GLU A HB2    1 
ATOM   3578  H HB3    . GLU A 1 228 ? -57.14   -25.073 34.37   0    170.31 ? 224  GLU A HB3    1 
ATOM   3579  H HG2    . GLU A 1 228 ? -56.819  -24.427 31.864  0    165.4  ? 224  GLU A HG2    1 
ATOM   3580  H HG3    . GLU A 1 228 ? -55.888  -23.06  32.524  0    163.97 ? 224  GLU A HG3    1 
ATOM   3581  N N      . PRO A 1 229 ? -60.059  -25.148 34.857  1    89.81  ? 225  PRO A N      1 
ATOM   3582  C CA     . PRO A 1 229 ? -59.843  -26.295 33.953  1    91.5   ? 225  PRO A CA     1 
ATOM   3583  C C      . PRO A 1 229 ? -60.749  -26.326 32.725  1    89.02  ? 225  PRO A C      1 
ATOM   3584  O O      . PRO A 1 229 ? -60.805  -27.357 32.055  1    90.71  ? 225  PRO A O      1 
ATOM   3585  C CB     . PRO A 1 229 ? -60.105  -27.485 34.88   1    95.38  ? 225  PRO A CB     1 
ATOM   3586  C CG     . PRO A 1 229 ? -61.223  -26.997 35.742  1    94.17  ? 225  PRO A CG     1 
ATOM   3587  C CD     . PRO A 1 229 ? -60.979  -25.516 35.95   1    91.27  ? 225  PRO A CD     1 
ATOM   3588  H HA     . PRO A 1 229 ? -58.813  -26.361 33.609  0    172.34 ? 225  PRO A HA     1 
ATOM   3589  H HB2    . PRO A 1 229 ? -60.396  -28.372 34.319  0    181.03 ? 225  PRO A HB2    1 
ATOM   3590  H HB3    . PRO A 1 229 ? -59.218  -27.683 35.479  0    182.38 ? 225  PRO A HB3    1 
ATOM   3591  H HG2    . PRO A 1 229 ? -62.169  -27.158 35.229  0    175.99 ? 225  PRO A HG2    1 
ATOM   3592  H HG3    . PRO A 1 229 ? -61.204  -27.53  36.691  0    180.13 ? 225  PRO A HG3    1 
ATOM   3593  H HD2    . PRO A 1 229 ? -61.911  -24.961 35.86   0    168.58 ? 225  PRO A HD2    1 
ATOM   3594  H HD3    . PRO A 1 229 ? -60.506  -25.345 36.916  0    172.58 ? 225  PRO A HD3    1 
ATOM   3595  N N      . PHE A 1 230 ? -61.415  -25.209 32.393  1    85.33  ? 226  PHE A N      1 
ATOM   3596  C CA     . PHE A 1 230 ? -62.305  -25.187 31.24   1    83.19  ? 226  PHE A CA     1 
ATOM   3597  C C      . PHE A 1 230 ? -61.543  -24.817 29.985  1    81.65  ? 226  PHE A C      1 
ATOM   3598  O O      . PHE A 1 230 ? -61.638  -25.523 28.983  1    82.2   ? 226  PHE A O      1 
ATOM   3599  C CB     . PHE A 1 230 ? -63.461  -24.201 31.449  1    80.27  ? 226  PHE A CB     1 
ATOM   3600  C CG     . PHE A 1 230 ? -64.185  -24.341 32.76   1    81.49  ? 226  PHE A CG     1 
ATOM   3601  C CD1    . PHE A 1 230 ? -64.532  -25.591 33.248  1    84.9   ? 226  PHE A CD1    1 
ATOM   3602  C CD2    . PHE A 1 230 ? -64.576  -23.219 33.476  1    79.38  ? 226  PHE A CD2    1 
ATOM   3603  C CE1    . PHE A 1 230 ? -65.225  -25.717 34.441  1    86.18  ? 226  PHE A CE1    1 
ATOM   3604  C CE2    . PHE A 1 230 ? -65.276  -23.346 34.664  1    80.68  ? 226  PHE A CE2    1 
ATOM   3605  C CZ     . PHE A 1 230 ? -65.595  -24.594 35.137  1    84.08  ? 226  PHE A CZ     1 
ATOM   3606  H H      . PHE A 1 230 ? -61.337  -24.314 32.864  0    156.38 ? 226  PHE A H      1 
ATOM   3607  H HA     . PHE A 1 230 ? -62.755  -26.169 31.101  0    154.71 ? 226  PHE A HA     1 
ATOM   3608  H HB2    . PHE A 1 230 ? -63.063  -23.19  31.394  0    144.59 ? 226  PHE A HB2    1 
ATOM   3609  H HB3    . PHE A 1 230 ? -64.193  -24.354 30.657  0    145.58 ? 226  PHE A HB3    1 
ATOM   3610  H HD1    . PHE A 1 230 ? -64.253  -26.481 32.711  0    158.32 ? 226  PHE A HD1    1 
ATOM   3611  H HD2    . PHE A 1 230 ? -64.336  -22.234 33.106  0    142.52 ? 226  PHE A HD2    1 
ATOM   3612  H HE1    . PHE A 1 230 ? -65.469  -26.697 34.826  0    162.27 ? 226  PHE A HE1    1 
ATOM   3613  H HE2    . PHE A 1 230 ? -65.56   -22.466 35.215  0    146.45 ? 226  PHE A HE2    1 
ATOM   3614  H HZ     . PHE A 1 230 ? -66.122  -24.705 36.065  0    156.43 ? 226  PHE A HZ     1 
ATOM   3615  N N      . GLY A 1 231 ? -60.817  -23.707 30.031  1    79.86  ? 227  GLY A N      1 
ATOM   3616  C CA     . GLY A 1 231 ? -60.118  -23.196 28.863  1    78.28  ? 227  GLY A CA     1 
ATOM   3617  C C      . GLY A 1 231 ? -61.109  -22.622 27.872  1    75.18  ? 227  GLY A C      1 
ATOM   3618  O O      . GLY A 1 231 ? -62.226  -22.252 28.246  1    73.69  ? 227  GLY A O      1 
ATOM   3619  H H      . GLY A 1 231 ? -60.699  -23.132 30.859  0    145.23 ? 227  GLY A H      1 
ATOM   3620  H HA2    . GLY A 1 231 ? -59.428  -22.408 29.163  0    141.37 ? 227  GLY A HA2    1 
ATOM   3621  H HA3    . GLY A 1 231 ? -59.553  -23.991 28.38   0    143.95 ? 227  GLY A HA3    1 
ATOM   3622  N N      . GLY A 1 232 ? -60.719  -22.563 26.609  1    74.43  ? 228  GLY A N      1 
ATOM   3623  C CA     . GLY A 1 232 ? -61.588  -22.043 25.563  1    71.82  ? 228  GLY A CA     1 
ATOM   3624  C C      . GLY A 1 232 ? -61.995  -20.595 25.757  1    68.78  ? 228  GLY A C      1 
ATOM   3625  O O      . GLY A 1 232 ? -61.297  -19.838 26.437  1    68.36  ? 228  GLY A O      1 
ATOM   3626  H H      . GLY A 1 232 ? -59.808  -22.863 26.276  0    134.9  ? 228  GLY A H      1 
ATOM   3627  H HA2    . GLY A 1 232 ? -61.085  -22.132 24.601  0    127.94 ? 228  GLY A HA2    1 
ATOM   3628  H HA3    . GLY A 1 232 ? -62.498  -22.639 25.532  0    128.41 ? 228  GLY A HA3    1 
ATOM   3629  N N      . ALA A 1 233 ? -63.152  -20.211 25.19   1    66.86  ? 229  ALA A N      1 
ATOM   3630  C CA     . ALA A 1 233 ? -63.629  -18.837 25.257  1    64.13  ? 229  ALA A CA     1 
ATOM   3631  C C      . ALA A 1 233 ? -65.143  -18.721 25.188  1    62.93  ? 229  ALA A C      1 
ATOM   3632  O O      . ALA A 1 233 ? -65.799  -19.611 24.654  1    63.88  ? 229  ALA A O      1 
ATOM   3633  C CB     . ALA A 1 233 ? -63.015  -18.047 24.108  1    62.42  ? 229  ALA A CB     1 
ATOM   3634  H H      . ALA A 1 233 ? -63.773  -20.832 24.681  0    117.4  ? 229  ALA A H      1 
ATOM   3635  H HA     . ALA A 1 233 ? -63.312  -18.375 26.19   0    111.06 ? 229  ALA A HA     1 
ATOM   3636  H HB1    . ALA A 1 233 ? -63.393  -17.026 24.142  0    105.34 ? 229  ALA A HB1    1 
ATOM   3637  H HB2    . ALA A 1 233 ? -61.932  -18.044 24.22   0    108.16 ? 229  ALA A HB2    1 
ATOM   3638  H HB3    . ALA A 1 233 ? -63.291  -18.514 23.164  0    107.32 ? 229  ALA A HB3    1 
ATOM   3639  N N      . ILE A 1 234 ? -65.689  -17.594 25.71   1    61.04  ? 230  ILE A N      1 
ATOM   3640  C CA     . ILE A 1 234 ? -67.107  -17.261 25.617  1    59.79  ? 230  ILE A CA     1 
ATOM   3641  C C      . ILE A 1 234 ? -67.217  -16.033 24.728  1    57.31  ? 230  ILE A C      1 
ATOM   3642  O O      . ILE A 1 234 ? -66.454  -15.081 24.893  1    56.28  ? 230  ILE A O      1 
ATOM   3643  C CB     . ILE A 1 234 ? -67.75   -16.933 26.968  1    59.87  ? 230  ILE A CB     1 
ATOM   3644  C CG1    . ILE A 1 234 ? -67.428  -17.992 28.022  1    62.52  ? 230  ILE A CG1    1 
ATOM   3645  C CG2    . ILE A 1 234 ? -69.248  -16.764 26.817  1    59.03  ? 230  ILE A CG2    1 
ATOM   3646  C CD1    . ILE A 1 234 ? -67.444  -17.454 29.425  1    62.74  ? 230  ILE A CD1    1 
ATOM   3647  H H      . ILE A 1 234 ? -65.161  -16.897 26.227  0    103.64 ? 230  ILE A H      1 
ATOM   3648  H HA     . ILE A 1 234 ? -67.645  -18.083 25.146  0    102.3  ? 230  ILE A HA     1 
ATOM   3649  H HB     . ILE A 1 234 ? -67.378  -15.954 27.262  0    100.47 ? 230  ILE A HB     1 
ATOM   3650  H HG12   . ILE A 1 234 ? -68.177  -18.78  27.969  0    108.47 ? 230  ILE A HG12   1 
ATOM   3651  H HG13   . ILE A 1 234 ? -66.437  -18.413 27.858  0    108.51 ? 230  ILE A HG13   1 
ATOM   3652  H HG21   . ILE A 1 234 ? -69.716  -16.742 27.8    0    100.32 ? 230  ILE A HG21   1 
ATOM   3653  H HG22   . ILE A 1 234 ? -69.459  -15.826 26.305  0    98.11  ? 230  ILE A HG22   1 
ATOM   3654  H HG23   . ILE A 1 234 ? -69.648  -17.598 26.242  0    100.92 ? 230  ILE A HG23   1 
ATOM   3655  H HD11   . ILE A 1 234 ? -67.67   -18.267 30.114  0    109.88 ? 230  ILE A HD11   1 
ATOM   3656  H HD12   . ILE A 1 234 ? -66.464  -17.038 29.654  0    108.04 ? 230  ILE A HD12   1 
ATOM   3657  H HD13   . ILE A 1 234 ? -68.192  -16.667 29.512  0    106.52 ? 230  ILE A HD13   1 
ATOM   3658  N N      . ILE A 1 235 ? -68.2    -16.035 23.832  1    56.58  ? 231  ILE A N      1 
ATOM   3659  C CA     . ILE A 1 235 ? -68.452  -14.956 22.897  1    54.54  ? 231  ILE A CA     1 
ATOM   3660  C C      . ILE A 1 235 ? -69.841  -14.389 23.225  1    53.61  ? 231  ILE A C      1 
ATOM   3661  O O      . ILE A 1 235 ? -70.857  -15.085 23.115  1    54.45  ? 231  ILE A O      1 
ATOM   3662  C CB     . ILE A 1 235 ? -68.35   -15.487 21.442  1    54.8   ? 231  ILE A CB     1 
ATOM   3663  C CG1    . ILE A 1 235 ? -67.049  -16.303 21.193  1    56.33  ? 231  ILE A CG1    1 
ATOM   3664  C CG2    . ILE A 1 235 ? -68.487  -14.359 20.435  1    52.93  ? 231  ILE A CG2    1 
ATOM   3665  C CD1    . ILE A 1 235 ? -65.794  -15.585 21.349  1    55.85  ? 231  ILE A CD1    1 
ATOM   3666  H H      . ILE A 1 235 ? -68.868  -16.793 23.731  0    95.29  ? 231  ILE A H      1 
ATOM   3667  H HA     . ILE A 1 235 ? -67.717  -14.161 23.011  0    89.03  ? 231  ILE A HA     1 
ATOM   3668  H HB     . ILE A 1 235 ? -69.189  -16.163 21.284  0    91.23  ? 231  ILE A HB     1 
ATOM   3669  H HG12   . ILE A 1 235 ? -67.023  -17.161 21.864  0    95.4   ? 231  ILE A HG12   1 
ATOM   3670  H HG13   . ILE A 1 235 ? -67.075  -16.666 20.167  0    94.21  ? 231  ILE A HG13   1 
ATOM   3671  H HG21   . ILE A 1 235 ? -68.251  -14.741 19.443  0    86.82  ? 231  ILE A HG21   1 
ATOM   3672  H HG22   . ILE A 1 235 ? -69.509  -13.985 20.444  0    85.72  ? 231  ILE A HG22   1 
ATOM   3673  H HG23   . ILE A 1 235 ? -67.795  -13.561 20.7    0    85.55  ? 231  ILE A HG23   1 
ATOM   3674  H HD11   . ILE A 1 235 ? -64.972  -16.283 21.197  0    94.23  ? 231  ILE A HD11   1 
ATOM   3675  H HD12   . ILE A 1 235 ? -65.75   -14.803 20.593  0    91.5   ? 231  ILE A HD12   1 
ATOM   3676  H HD13   . ILE A 1 235 ? -65.729  -15.158 22.348  0    92.54  ? 231  ILE A HD13   1 
ATOM   3677  N N      . ILE A 1 236 ? -69.861  -13.136 23.689  1    52.13  ? 232  ILE A N      1 
ATOM   3678  C CA     . ILE A 1 236 ? -71.076  -12.407 24.025  1    51.28  ? 232  ILE A CA     1 
ATOM   3679  C C      . ILE A 1 236 ? -71.556  -11.698 22.761  1    49.9   ? 232  ILE A C      1 
ATOM   3680  O O      . ILE A 1 236 ? -70.758  -11.051 22.082  1    48.86  ? 232  ILE A O      1 
ATOM   3681  C CB     . ILE A 1 236 ? -70.783  -11.357 25.126  1    50.67  ? 232  ILE A CB     1 
ATOM   3682  C CG1    . ILE A 1 236 ? -70.099  -11.971 26.365  1    52.21  ? 232  ILE A CG1    1 
ATOM   3683  C CG2    . ILE A 1 236 ? -72.048  -10.599 25.512  1    50.12  ? 232  ILE A CG2    1 
ATOM   3684  C CD1    . ILE A 1 236 ? -70.873  -13.009 27.104  1    53.94  ? 232  ILE A CD1    1 
ATOM   3685  H H      . ILE A 1 236 ? -69.024  -12.586 23.85   0    84.11  ? 232  ILE A H      1 
ATOM   3686  H HA     . ILE A 1 236 ? -71.852  -13.084 24.38   0    83.81  ? 232  ILE A HA     1 
ATOM   3687  H HB     . ILE A 1 236 ? -70.094  -10.636 24.689  0    80.36  ? 232  ILE A HB     1 
ATOM   3688  H HG12   . ILE A 1 236 ? -69.152  -12.418 26.065  0    85.17  ? 232  ILE A HG12   1 
ATOM   3689  H HG13   . ILE A 1 236 ? -69.896  -11.167 27.07   0    84.31  ? 232  ILE A HG13   1 
ATOM   3690  H HG21   . ILE A 1 236 ? -71.873  -10.074 26.45   0    80.18  ? 232  ILE A HG21   1 
ATOM   3691  H HG22   . ILE A 1 236 ? -72.291  -9.873  24.737  0    79.15  ? 232  ILE A HG22   1 
ATOM   3692  H HG23   . ILE A 1 236 ? -72.866  -11.308 25.63   0    81.26  ? 232  ILE A HG23   1 
ATOM   3693  H HD11   . ILE A 1 236 ? -70.266  -13.362 27.937  0    89.7   ? 232  ILE A HD11   1 
ATOM   3694  H HD12   . ILE A 1 236 ? -71.794  -12.572 27.487  0    88.34  ? 232  ILE A HD12   1 
ATOM   3695  H HD13   . ILE A 1 236 ? -71.09   -13.843 26.438  0    89.19  ? 232  ILE A HD13   1 
ATOM   3696  N N      . GLY A 1 237 ? -72.85   -11.791 22.481  1    50.12  ? 233  GLY A N      1 
ATOM   3697  C CA     . GLY A 1 237 ? -73.459  -11.123 21.341  1    49.2   ? 233  GLY A CA     1 
ATOM   3698  C C      . GLY A 1 237 ? -74.584  -10.205 21.779  1    48.82  ? 233  GLY A C      1 
ATOM   3699  O O      . GLY A 1 237 ? -74.567  -9.665  22.888  1    48.89  ? 233  GLY A O      1 
ATOM   3700  H H      . GLY A 1 237 ? -73.517  -12.325 23.03   0    81.27  ? 233  GLY A H      1 
ATOM   3701  H HA2    . GLY A 1 237 ? -72.733  -10.525 20.794  0    77.37  ? 233  GLY A HA2    1 
ATOM   3702  H HA3    . GLY A 1 237 ? -73.867  -11.875 20.668  0    79.09  ? 233  GLY A HA3    1 
ATOM   3703  N N      . GLN A 1 238 ? -75.549  -10.002 20.903  1    48.61  ? 234  GLN A N      1 
ATOM   3704  C CA     . GLN A 1 238 ? -76.723  -9.189  21.184  1    48.53  ? 234  GLN A CA     1 
ATOM   3705  C C      . GLN A 1 238 ? -77.824  -10.091 21.726  1    50.12  ? 234  GLN A C      1 
ATOM   3706  O O      . GLN A 1 238 ? -78.492  -9.721  22.694  1    50.43  ? 234  GLN A O      1 
ATOM   3707  C CB     . GLN A 1 238 ? -77.195  -8.496  19.895  1    48.05  ? 234  GLN A CB     1 
ATOM   3708  C CG     . GLN A 1 238 ? -78.505  -7.703  20.01   1    48.33  ? 234  GLN A CG     1 
ATOM   3709  C CD     . GLN A 1 238 ? -78.387  -6.525  20.957  1    47.6   ? 234  GLN A CD     1 
ATOM   3710  O OE1    . GLN A 1 238 ? -77.744  -5.505  20.632  1    46.48  ? 234  GLN A OE1    1 
ATOM   3711  N NE2    . GLN A 1 238 ? -78.996  -6.636  22.15   1    48.43  ? 234  GLN A NE2    1 
ATOM   3712  H H      . GLN A 1 238 ? -75.548  -10.4   19.97   0    77.1   ? 234  GLN A H      1 
ATOM   3713  H HA     . GLN A 1 238 ? -76.495  -8.424  21.925  0    76.12  ? 234  GLN A HA     1 
ATOM   3714  H HB2    . GLN A 1 238 ? -76.421  -7.799  19.576  0    74.64  ? 234  GLN A HB2    1 
ATOM   3715  H HB3    . GLN A 1 238 ? -77.347  -9.249  19.121  0    76.36  ? 234  GLN A HB3    1 
ATOM   3716  H HG2    . GLN A 1 238 ? -78.734  -7.297  19.026  0    76.1   ? 234  GLN A HG2    1 
ATOM   3717  H HG3    . GLN A 1 238 ? -79.323  -8.348  20.327  0    77.45  ? 234  GLN A HG3    1 
ATOM   3718  H HE21   . GLN A 1 238 ? -79.498  -7.482  22.4    0    77.49  ? 234  GLN A HE21   1 
ATOM   3719  H HE22   . GLN A 1 238 ? -78.952  -5.869  22.812  0    76.12  ? 234  GLN A HE22   1 
ATOM   3720  N N      . GLU A 1 239 ? -78.022  -11.262 21.087  1    51.29  ? 235  GLU A N      1 
ATOM   3721  C CA     . GLU A 1 239 ? -79.059  -12.228 21.435  1    53.06  ? 235  GLU A CA     1 
ATOM   3722  C C      . GLU A 1 239 ? -78.532  -13.549 21.966  1    54.37  ? 235  GLU A C      1 
ATOM   3723  O O      . GLU A 1 239 ? -79.353  -14.385 22.336  1    56.02  ? 235  GLU A O      1 
ATOM   3724  C CB     . GLU A 1 239 ? -79.88   -12.545 20.184  1    53.91  ? 235  GLU A CB     1 
ATOM   3725  C CG     . GLU A 1 239 ? -80.308  -11.321 19.394  1    53     ? 235  GLU A CG     1 
ATOM   3726  C CD     . GLU A 1 239 ? -81.496  -11.581 18.484  1    54.35  ? 235  GLU A CD     1 
ATOM   3727  O OE1    . GLU A 1 239 ? -81.64   -12.736 18.011  1    55.79  ? 235  GLU A OE1    1 
ATOM   3728  O OE2    . GLU A 1 239 ? -82.289  -10.634 18.256  1    54.16  ? 235  GLU A OE2    1 
ATOM   3729  H H      . GLU A 1 239 ? -77.474  -11.567 20.29   0    82.69  ? 235  GLU A H      1 
ATOM   3730  H HA     . GLU A 1 239 ? -79.736  -11.814 22.18   0    86.88  ? 235  GLU A HA     1 
ATOM   3731  H HB2    . GLU A 1 239 ? -79.281  -13.169 19.521  0    88.79  ? 235  GLU A HB2    1 
ATOM   3732  H HB3    . GLU A 1 239 ? -80.778  -13.081 20.487  0    89.9   ? 235  GLU A HB3    1 
ATOM   3733  H HG2    . GLU A 1 239 ? -80.594  -10.53  20.086  0    86.03  ? 235  GLU A HG2    1 
ATOM   3734  H HG3    . GLU A 1 239 ? -79.471  -10.992 18.778  0    85.48  ? 235  GLU A HG3    1 
ATOM   3735  N N      . SER A 1 240 ? -77.204  -13.778 21.975  1    53.91  ? 236  SER A N      1 
ATOM   3736  C CA     . SER A 1 240 ? -76.671  -15.069 22.395  1    55.45  ? 236  SER A CA     1 
ATOM   3737  C C      . SER A 1 240 ? -75.275  -15.024 22.986  1    55     ? 236  SER A C      1 
ATOM   3738  O O      . SER A 1 240 ? -74.407  -14.307 22.492  1    53.56  ? 236  SER A O      1 
ATOM   3739  C CB     . SER A 1 240 ? -76.625  -16.008 21.196  1    56.56  ? 236  SER A CB     1 
ATOM   3740  O OG     . SER A 1 240 ? -75.627  -15.625 20.258  1    55.52  ? 236  SER A OG     1 
ATOM   3741  H H      . SER A 1 240 ? -76.484  -13.115 21.708  0    87.35  ? 236  SER A H      1 
ATOM   3742  H HA     . SER A 1 240 ? -77.331  -15.511 23.14   0    93.04  ? 236  SER A HA     1 
ATOM   3743  H HB2    . SER A 1 240 ? -76.406  -17.014 21.549  0    95.81  ? 236  SER A HB2    1 
ATOM   3744  H HB3    . SER A 1 240 ? -77.595  -16     20.7    0    94.75  ? 236  SER A HB3    1 
ATOM   3745  H HG     . SER A 1 240 ? -75.702  -14.661 20.033  0    90.78  ? 236  SER A HG     1 
ATOM   3746  N N      . ILE A 1 241 ? -75.042  -15.892 23.972  1    56.55  ? 237  ILE A N      1 
ATOM   3747  C CA     . ILE A 1 241 ? -73.75   -16.1   24.624  1    56.8   ? 237  ILE A CA     1 
ATOM   3748  C C      . ILE A 1 241 ? -73.349  -17.531 24.232  1    58.69  ? 237  ILE A C      1 
ATOM   3749  O O      . ILE A 1 241 ? -74.148  -18.448 24.431  1    60.39  ? 237  ILE A O      1 
ATOM   3750  C CB     . ILE A 1 241 ? -73.9    -15.955 26.155  1    57.42  ? 237  ILE A CB     1 
ATOM   3751  C CG1    . ILE A 1 241 ? -74.294  -14.521 26.545  1    55.81  ? 237  ILE A CG1    1 
ATOM   3752  C CG2    . ILE A 1 241 ? -72.625  -16.374 26.838  1    58.18  ? 237  ILE A CG2    1 
ATOM   3753  C CD1    . ILE A 1 241 ? -74.874  -14.378 27.962  1    56.73  ? 237  ILE A CD1    1 
ATOM   3754  H H      . ILE A 1 241 ? -75.761  -16.496 24.359  0    95.67  ? 237  ILE A H      1 
ATOM   3755  H HA     . ILE A 1 241 ? -72.999  -15.397 24.268  0    93.66  ? 237  ILE A HA     1 
ATOM   3756  H HB     . ILE A 1 241 ? -74.694  -16.622 26.485  0    97.7   ? 237  ILE A HB     1 
ATOM   3757  H HG12   . ILE A 1 241 ? -73.414  -13.884 26.483  0    91.73  ? 237  ILE A HG12   1 
ATOM   3758  H HG13   . ILE A 1 241 ? -75.056  -14.149 25.86   0    91.99  ? 237  ILE A HG13   1 
ATOM   3759  H HG21   . ILE A 1 241 ? -72.557  -15.936 27.832  0    98.39  ? 237  ILE A HG21   1 
ATOM   3760  H HG22   . ILE A 1 241 ? -72.62   -17.459 26.936  0    99.88  ? 237  ILE A HG22   1 
ATOM   3761  H HG23   . ILE A 1 241 ? -71.777  -16.058 26.232  0    97.23  ? 237  ILE A HG23   1 
ATOM   3762  H HD11   . ILE A 1 241 ? -75.36   -13.407 28.044  0    93.7   ? 237  ILE A HD11   1 
ATOM   3763  H HD12   . ILE A 1 241 ? -75.6    -15.172 28.133  0    96.16  ? 237  ILE A HD12   1 
ATOM   3764  H HD13   . ILE A 1 241 ? -74.071  -14.44  28.695  0    95.3   ? 237  ILE A HD13   1 
ATOM   3765  N N      . THR A 1 242 ? -72.162  -17.73  23.629  1    58.59  ? 238  THR A N      1 
ATOM   3766  C CA     . THR A 1 242 ? -71.74   -19.066 23.168  1    60.56  ? 238  THR A CA     1 
ATOM   3767  C C      . THR A 1 242 ? -70.343  -19.445 23.687  1    61.28  ? 238  THR A C      1 
ATOM   3768  O O      . THR A 1 242 ? -69.467  -18.594 23.729  1    59.83  ? 238  THR A O      1 
ATOM   3769  C CB     . THR A 1 242 ? -71.757  -19.11  21.626  1    60.22  ? 238  THR A CB     1 
ATOM   3770  O OG1    . THR A 1 242 ? -70.948  -18.047 21.13   1    58.38  ? 238  THR A OG1    1 
ATOM   3771  C CG2    . THR A 1 242 ? -73.142  -18.961 21.042  1    59.94  ? 238  THR A CG2    1 
ATOM   3772  H H      . THR A 1 242 ? -71.478  -17.002 23.45   0    97.71  ? 238  THR A H      1 
ATOM   3773  H HA     . THR A 1 242 ? -72.426  -19.831 23.528  0    104.75 ? 238  THR A HA     1 
ATOM   3774  H HB     . THR A 1 242 ? -71.345  -20.06  21.291  0    103.86 ? 238  THR A HB     1 
ATOM   3775  H HG1    . THR A 1 242 ? -70.896  -18.079 20.139  0    98.09  ? 238  THR A HG1    1 
ATOM   3776  H HG21   . THR A 1 242 ? -73.084  -18.955 19.955  0    101.56 ? 238  THR A HG21   1 
ATOM   3777  H HG22   . THR A 1 242 ? -73.775  -19.788 21.353  0    103.26 ? 238  THR A HG22   1 
ATOM   3778  H HG23   . THR A 1 242 ? -73.591  -18.027 21.374  0    100.31 ? 238  THR A HG23   1 
ATOM   3779  N N      . TYR A 1 243 ? -70.128  -20.724 24.042  1    63.69  ? 239  TYR A N      1 
ATOM   3780  C CA     . TYR A 1 243 ? -68.828  -21.201 24.519  1    64.95  ? 239  TYR A CA     1 
ATOM   3781  C C      . TYR A 1 243 ? -68.199  -22.08  23.462  1    66.44  ? 239  TYR A C      1 
ATOM   3782  O O      . TYR A 1 243 ? -68.853  -22.976 22.935  1    68.13  ? 239  TYR A O      1 
ATOM   3783  C CB     . TYR A 1 243 ? -68.971  -21.986 25.831  1    67.01  ? 239  TYR A CB     1 
ATOM   3784  C CG     . TYR A 1 243 ? -67.684  -22.613 26.324  1    69.2   ? 239  TYR A CG     1 
ATOM   3785  C CD1    . TYR A 1 243 ? -66.743  -21.854 27.012  1    68.94  ? 239  TYR A CD1    1 
ATOM   3786  C CD2    . TYR A 1 243 ? -67.432  -23.962 26.167  1    71.79  ? 239  TYR A CD2    1 
ATOM   3787  C CE1    . TYR A 1 243 ? -65.572  -22.424 27.493  1    71.23  ? 239  TYR A CE1    1 
ATOM   3788  C CE2    . TYR A 1 243 ? -66.264  -24.544 26.638  1    74.09  ? 239  TYR A CE2    1 
ATOM   3789  C CZ     . TYR A 1 243 ? -65.333  -23.769 27.3    1    73.83  ? 239  TYR A CZ     1 
ATOM   3790  O OH     . TYR A 1 243 ? -64.175  -24.348 27.755  1    76.35  ? 239  TYR A OH     1 
ATOM   3791  H H      . TYR A 1 243 ? -70.837  -21.451 24.009  0    111.61 ? 239  TYR A H      1 
ATOM   3792  H HA     . TYR A 1 243 ? -68.162  -20.363 24.718  0    111.95 ? 239  TYR A HA     1 
ATOM   3793  H HB2    . TYR A 1 243 ? -69.317  -21.308 26.605  0    116.88 ? 239  TYR A HB2    1 
ATOM   3794  H HB3    . TYR A 1 243 ? -69.692  -22.792 25.683  0    119.14 ? 239  TYR A HB3    1 
ATOM   3795  H HD1    . TYR A 1 243 ? -66.922  -20.804 27.166  0    119.79 ? 239  TYR A HD1    1 
ATOM   3796  H HD2    . TYR A 1 243 ? -68.15   -24.576 25.644  0    128.88 ? 239  TYR A HD2    1 
ATOM   3797  H HE1    . TYR A 1 243 ? -64.854  -21.806 28.006  0    126.37 ? 239  TYR A HE1    1 
ATOM   3798  H HE2    . TYR A 1 243 ? -66.079  -25.592 26.482  0    135.49 ? 239  TYR A HE2    1 
ATOM   3799  H HH     . TYR A 1 243 ? -63.573  -23.67  28.16   0    137.18 ? 239  TYR A HH     1 
ATOM   3800  N N      . HIS A 1 244 ? -66.918  -21.849 23.182  1    66.06  ? 240  HIS A N      1 
ATOM   3801  C CA     . HIS A 1 244 ? -66.182  -22.608 22.177  1    67.67  ? 240  HIS A CA     1 
ATOM   3802  C C      . HIS A 1 244 ? -64.909  -23.149 22.796  1    69.65  ? 240  HIS A C      1 
ATOM   3803  O O      . HIS A 1 244 ? -64.228  -22.411 23.503  1    68.67  ? 240  HIS A O      1 
ATOM   3804  C CB     . HIS A 1 244 ? -65.806  -21.679 21.018  1    65.87  ? 240  HIS A CB     1 
ATOM   3805  C CG     . HIS A 1 244 ? -66.975  -21.171 20.235  1    64.17  ? 240  HIS A CG     1 
ATOM   3806  N ND1    . HIS A 1 244 ? -67.064  -21.362 18.871  1    64.64  ? 240  HIS A ND1    1 
ATOM   3807  C CD2    . HIS A 1 244 ? -68.056  -20.459 20.648  1    62.26  ? 240  HIS A CD2    1 
ATOM   3808  C CE1    . HIS A 1 244 ? -68.208  -20.797 18.502  1    63.1   ? 240  HIS A CE1    1 
ATOM   3809  N NE2    . HIS A 1 244 ? -68.831  -20.232 19.535  1    61.63  ? 240  HIS A NE2    1 
ATOM   3810  H H      . HIS A 1 244 ? -66.349  -21.141 23.636  0    114.74 ? 240  HIS A H      1 
ATOM   3811  H HA     . HIS A 1 244 ? -66.761  -23.443 21.784  0    120.53 ? 240  HIS A HA     1 
ATOM   3812  H HB2    . HIS A 1 244 ? -65.277  -20.806 21.397  0    113.9  ? 240  HIS A HB2    1 
ATOM   3813  H HB3    . HIS A 1 244 ? -65.153  -22.234 20.346  0    116.32 ? 240  HIS A HB3    1 
ATOM   3814  H HD1    . HIS A 1 244 ? -66.382  -21.812 18.269  0    113.65 ? 240  HIS A HD1    1 
ATOM   3815  H HD2    . HIS A 1 244 ? -68.277  -20.132 21.651  0    106.31 ? 240  HIS A HD2    1 
ATOM   3816  H HE1    . HIS A 1 244 ? -68.595  -20.806 17.499  0    108.65 ? 240  HIS A HE1    1 
ATOM   3817  N N      . ASN A 1 245 ? -64.576  -24.412 22.537  1    72.54  ? 241  ASN A N      1 
ATOM   3818  C CA     . ASN A 1 245 ? -63.337  -25     23.048  1    75.01  ? 241  ASN A CA     1 
ATOM   3819  C C      . ASN A 1 245 ? -62.998  -26.235 22.224  1    77.51  ? 241  ASN A C      1 
ATOM   3820  O O      . ASN A 1 245 ? -62.873  -27.35  22.743  1    80.36  ? 241  ASN A O      1 
ATOM   3821  C CB     . ASN A 1 245 ? -63.473  -25.347 24.527  1    76.71  ? 241  ASN A CB     1 
ATOM   3822  C CG     . ASN A 1 245 ? -62.193  -25.818 25.166  1    79.53  ? 241  ASN A CG     1 
ATOM   3823  O OD1    . ASN A 1 245 ? -61.086  -25.558 24.676  1    80.42  ? 241  ASN A OD1    1 
ATOM   3824  N ND2    . ASN A 1 245 ? -62.316  -26.52  26.282  1    81.18  ? 241  ASN A ND2    1 
ATOM   3825  H H      . ASN A 1 245 ? -65.157  -25.049 22.001  0    130.74 ? 241  ASN A H      1 
ATOM   3826  H HA     . ASN A 1 245 ? -62.524  -24.283 22.928  0    134.09 ? 241  ASN A HA     1 
ATOM   3827  H HB2    . ASN A 1 245 ? -63.804  -24.466 25.074  0    136.81 ? 241  ASN A HB2    1 
ATOM   3828  H HB3    . ASN A 1 245 ? -64.216  -26.134 24.637  0    139.92 ? 241  ASN A HB3    1 
ATOM   3829  H HD21   . ASN A 1 245 ? -61.488  -26.863 26.757  0    150.6  ? 241  ASN A HD21   1 
ATOM   3830  H HD22   . ASN A 1 245 ? -63.234  -26.7   26.674  0    148.4  ? 241  ASN A HD22   1 
ATOM   3831  N N      . GLY A 1 246 ? -62.882  -26.021 20.925  1    76.69  ? 242  GLY A N      1 
ATOM   3832  C CA     . GLY A 1 246 ? -62.608  -27.104 19.999  1    79.15  ? 242  GLY A CA     1 
ATOM   3833  C C      . GLY A 1 246 ? -63.825  -27.962 19.802  1    80.04  ? 242  GLY A C      1 
ATOM   3834  O O      . GLY A 1 246 ? -64.838  -27.477 19.29   1    77.83  ? 242  GLY A O      1 
ATOM   3835  H H      . GLY A 1 246 ? -62.973  -25.112 20.482  0    136.66 ? 242  GLY A H      1 
ATOM   3836  H HA2    . GLY A 1 246 ? -62.377  -26.711 19.014  0    143.25 ? 242  GLY A HA2    1 
ATOM   3837  H HA3    . GLY A 1 246 ? -61.769  -27.704 20.349  0    146.5  ? 242  GLY A HA3    1 
ATOM   3838  N N      . ASP A 1 247 ? -63.732  -29.235 20.181  1    83.37  ? 243  ASP A N      1 
ATOM   3839  C CA     . ASP A 1 247 ? -64.858  -30.152 20.062  1    84.85  ? 243  ASP A CA     1 
ATOM   3840  C C      . ASP A 1 247 ? -66.114  -29.677 20.854  1    83.09  ? 243  ASP A C      1 
ATOM   3841  O O      . ASP A 1 247 ? -67.234  -29.818 20.354  1    82.2   ? 243  ASP A O      1 
ATOM   3842  C CB     . ASP A 1 247 ? -64.434  -31.573 20.477  1    88.94  ? 243  ASP A CB     1 
ATOM   3843  C CG     . ASP A 1 247 ? -63.937  -31.699 21.91   1    90.13  ? 243  ASP A CG     1 
ATOM   3844  O OD1    . ASP A 1 247 ? -63.888  -32.843 22.423  1    93.5   ? 243  ASP A OD1    1 
ATOM   3845  O OD2    . ASP A 1 247 ? -63.579  -30.651 22.515  1    87.88  ? 243  ASP A OD2    1 
ATOM   3846  H H      . ASP A 1 247 ? -62.873  -29.67  20.503  0    155.53 ? 243  ASP A H      1 
ATOM   3847  H HA     . ASP A 1 247 ? -65.139  -30.194 19.011  0    156.68 ? 243  ASP A HA     1 
ATOM   3848  H HB2    . ASP A 1 247 ? -65.281  -32.246 20.352  0    167.22 ? 243  ASP A HB2    1 
ATOM   3849  H HB3    . ASP A 1 247 ? -63.619  -31.887 19.826  0    167.3  ? 243  ASP A HB3    1 
ATOM   3850  N N      . LYS A 1 248 ? -65.93   -29.077 22.053  1    82.76  ? 244  LYS A N      1 
ATOM   3851  C CA     . LYS A 1 248 ? -67.058  -28.613 22.869  1    81.44  ? 244  LYS A CA     1 
ATOM   3852  C C      . LYS A 1 248 ? -67.673  -27.309 22.325  1    77.82  ? 244  LYS A C      1 
ATOM   3853  O O      . LYS A 1 248 ? -66.95   -26.401 21.894  1    75.93  ? 244  LYS A O      1 
ATOM   3854  C CB     . LYS A 1 248 ? -66.612  -28.446 24.337  1    81.99  ? 244  LYS A CB     1 
ATOM   3855  C CG     . LYS A 1 248 ? -67.758  -28.369 25.366  1    81.62  ? 244  LYS A CG     1 
ATOM   3856  C CD     . LYS A 1 248 ? -68.511  -29.69  25.532  1    83.9   ? 244  LYS A CD     1 
ATOM   3857  C CE     . LYS A 1 248 ? -69.407  -29.86  26.769  1    83.92  ? 244  LYS A CE     1 
ATOM   3858  N NZ     . LYS A 1 248 ? -68.7    -29.882 28.076  1    85.26  ? 244  LYS A NZ     1 
ATOM   3859  H H      . LYS A 1 248 ? -65.026  -28.904 22.48   0    152.4  ? 244  LYS A H      1 
ATOM   3860  H HA     . LYS A 1 248 ? -67.828  -29.381 22.837  0    150.65 ? 244  LYS A HA     1 
ATOM   3861  H HB2    . LYS A 1 248 ? -65.998  -29.305 24.604  0    153.13 ? 244  LYS A HB2    1 
ATOM   3862  H HB3    . LYS A 1 248 ? -66.024  -27.536 24.431  0    148.78 ? 244  LYS A HB3    1 
ATOM   3863  H HG2    . LYS A 1 248 ? -67.339  -28.07  26.324  0    150.26 ? 244  LYS A HG2    1 
ATOM   3864  H HG3    . LYS A 1 248 ? -68.491  -27.634 25.042  0    146.95 ? 244  LYS A HG3    1 
ATOM   3865  H HD2    . LYS A 1 248 ? -69.169  -29.809 24.674  0    153.78 ? 244  LYS A HD2    1 
ATOM   3866  H HD3    . LYS A 1 248 ? -67.781  -30.5   25.517  0    157.29 ? 244  LYS A HD3    1 
ATOM   3867  H HE2    . LYS A 1 248 ? -70.245  -29.157 26.81   0    152.43 ? 244  LYS A HE2    1 
ATOM   3868  H HE3    . LYS A 1 248 ? -69.799  -30.876 26.75   0    156.54 ? 244  LYS A HE3    1 
ATOM   3869  H HZ1    . LYS A 1 248 ? -69.223  -30.492 28.697  0    160.44 ? 244  LYS A HZ1    1 
ATOM   3870  H HZ2    . LYS A 1 248 ? -67.768  -30.267 27.948  0    159.48 ? 244  LYS A HZ2    1 
ATOM   3871  H HZ3    . LYS A 1 248 ? -68.652  -28.966 28.513  0    156.74 ? 244  LYS A HZ3    1 
ATOM   3872  N N      . TYR A 1 249 ? -69.018  -27.219 22.359  1    77.1   ? 245  TYR A N      1 
ATOM   3873  C CA     . TYR A 1 249 ? -69.745  -26.034 21.905  1    73.98  ? 245  TYR A CA     1 
ATOM   3874  C C      . TYR A 1 249 ? -71.111  -25.941 22.594  1    73.7   ? 245  TYR A C      1 
ATOM   3875  O O      . TYR A 1 249 ? -71.927  -26.85  22.475  1    75.6   ? 245  TYR A O      1 
ATOM   3876  C CB     . TYR A 1 249 ? -69.924  -26.059 20.383  1    73.62  ? 245  TYR A CB     1 
ATOM   3877  C CG     . TYR A 1 249 ? -70.919  -25.039 19.861  1    71.19  ? 245  TYR A CG     1 
ATOM   3878  C CD1    . TYR A 1 249 ? -70.588  -23.695 19.775  1    68.56  ? 245  TYR A CD1    1 
ATOM   3879  C CD2    . TYR A 1 249 ? -72.18   -25.43  19.43   1    71.76  ? 245  TYR A CD2    1 
ATOM   3880  C CE1    . TYR A 1 249 ? -71.477  -22.766 19.244  1    66.59  ? 245  TYR A CE1    1 
ATOM   3881  C CE2    . TYR A 1 249 ? -73.085  -24.504 18.922  1    69.83  ? 245  TYR A CE2    1 
ATOM   3882  C CZ     . TYR A 1 249 ? -72.73   -23.172 18.827  1    67.25  ? 245  TYR A CZ     1 
ATOM   3883  O OH     . TYR A 1 249 ? -73.605  -22.242 18.319  1    65.59  ? 245  TYR A OH     1 
ATOM   3884  H H      . TYR A 1 249 ? -69.63   -27.948 22.709  0    141.35 ? 245  TYR A H      1 
ATOM   3885  H HA     . TYR A 1 249 ? -69.168  -25.143 22.149  0    131.13 ? 245  TYR A HA     1 
ATOM   3886  H HB2    . TYR A 1 249 ? -68.962  -25.854 19.913  0    131.76 ? 245  TYR A HB2    1 
ATOM   3887  H HB3    . TYR A 1 249 ? -70.272  -27.049 20.092  0    134.19 ? 245  TYR A HB3    1 
ATOM   3888  H HD1    . TYR A 1 249 ? -69.611  -23.363 20.09   0    120.35 ? 245  TYR A HD1    1 
ATOM   3889  H HD2    . TYR A 1 249 ? -72.468  -26.467 19.491  0    130.36 ? 245  TYR A HD2    1 
ATOM   3890  H HE1    . TYR A 1 249 ? -71.188  -21.737 19.152  0    114.49 ? 245  TYR A HE1    1 
ATOM   3891  H HE2    . TYR A 1 249 ? -74.058  -24.837 18.599  0    124.66 ? 245  TYR A HE2    1 
ATOM   3892  H HH     . TYR A 1 249 ? -74.456  -22.673 18.042  0    115.36 ? 245  TYR A HH     1 
ATOM   3893  N N      . LEU A 1 250 ? -71.363  -24.816 23.268  1    71.57  ? 246  LEU A N      1 
ATOM   3894  C CA     . LEU A 1 250 ? -72.632  -24.537 23.927  1    71.22  ? 246  LEU A CA     1 
ATOM   3895  C C      . LEU A 1 250 ? -73.135  -23.196 23.441  1    68.31  ? 246  LEU A C      1 
ATOM   3896  O O      . LEU A 1 250 ? -72.349  -22.305 23.11   1    66.41  ? 246  LEU A O      1 
ATOM   3897  C CB     . LEU A 1 250 ? -72.477  -24.477 25.445  1    71.81  ? 246  LEU A CB     1 
ATOM   3898  C CG     . LEU A 1 250 ? -72.004  -25.742 26.127  1    74.9   ? 246  LEU A CG     1 
ATOM   3899  C CD1    . LEU A 1 250 ? -71.666  -25.469 27.577  1    75.32  ? 246  LEU A CD1    1 
ATOM   3900  C CD2    . LEU A 1 250 ? -73.037  -26.851 26.012  1    77.29  ? 246  LEU A CD2    1 
ATOM   3901  H H      . LEU A 1 250 ? -70.696  -24.058 23.376  0    125.98 ? 246  LEU A H      1 
ATOM   3902  H HA     . LEU A 1 250 ? -73.378  -25.288 23.672  0    128.26 ? 246  LEU A HA     1 
ATOM   3903  H HB2    . LEU A 1 250 ? -71.774  -23.684 25.688  0    126.63 ? 246  LEU A HB2    1 
ATOM   3904  H HB3    . LEU A 1 250 ? -73.444  -24.224 25.875  0    127.86 ? 246  LEU A HB3    1 
ATOM   3905  H HG     . LEU A 1 250 ? -71.093  -26.089 25.641  0    135.51 ? 246  LEU A HG     1 
ATOM   3906  H HD11   . LEU A 1 250 ? -71.345  -26.394 28.055  0    138.34 ? 246  LEU A HD11   1 
ATOM   3907  H HD12   . LEU A 1 250 ? -70.863  -24.734 27.615  0    134.42 ? 246  LEU A HD12   1 
ATOM   3908  H HD13   . LEU A 1 250 ? -72.55   -25.072 28.072  0    135.39 ? 246  LEU A HD13   1 
ATOM   3909  H HD21   . LEU A 1 250 ? -72.735  -27.685 26.646  0    142.55 ? 246  LEU A HD21   1 
ATOM   3910  H HD22   . LEU A 1 250 ? -74.006  -26.48  26.344  0    139.66 ? 246  LEU A HD22   1 
ATOM   3911  H HD23   . LEU A 1 250 ? -73.099  -27.179 24.975  0    140.36 ? 246  LEU A HD23   1 
ATOM   3912  N N      . ALA A 1 251 ? -74.455  -23.042 23.414  1    68.16  ? 247  ALA A N      1 
ATOM   3913  C CA     . ALA A 1 251 ? -75.073  -21.81  22.959  1    65.78  ? 247  ALA A CA     1 
ATOM   3914  C C      . ALA A 1 251 ? -76.392  -21.591 23.675  1    66.07  ? 247  ALA A C      1 
ATOM   3915  O O      . ALA A 1 251 ? -77.295  -22.422 23.58   1    68     ? 247  ALA A O      1 
ATOM   3916  C CB     . ALA A 1 251 ? -75.295  -21.874 21.456  1    65.46  ? 247  ALA A CB     1 
ATOM   3917  H H      . ALA A 1 251 ? -75.122  -23.751 23.699  0    121.69 ? 247  ALA A H      1 
ATOM   3918  H HA     . ALA A 1 251 ? -74.422  -20.968 23.183  0    113.16 ? 247  ALA A HA     1 
ATOM   3919  H HB1    . ALA A 1 251 ? -75.777  -20.957 21.126  0    112.57 ? 247  ALA A HB1    1 
ATOM   3920  H HB2    . ALA A 1 251 ? -74.333  -21.996 20.959  0    113.89 ? 247  ALA A HB2    1 
ATOM   3921  H HB3    . ALA A 1 251 ? -75.932  -22.728 21.228  0    115.91 ? 247  ALA A HB3    1 
ATOM   3922  N N      . ILE A 1 252 ? -76.497  -20.477 24.398  1    64.35  ? 248  ILE A N      1 
ATOM   3923  C CA     . ILE A 1 252 ? -77.717  -20.11  25.098  1    64.6   ? 248  ILE A CA     1 
ATOM   3924  C C      . ILE A 1 252 ? -78.199  -18.772 24.536  1    62.38  ? 248  ILE A C      1 
ATOM   3925  O O      . ILE A 1 252 ? -77.392  -17.871 24.299  1    60.44  ? 248  ILE A O      1 
ATOM   3926  C CB     . ILE A 1 252 ? -77.522  -20.079 26.638  1    65.35  ? 248  ILE A CB     1 
ATOM   3927  C CG1    . ILE A 1 252 ? -76.382  -19.123 27.06   1    63.58  ? 248  ILE A CG1    1 
ATOM   3928  C CG2    . ILE A 1 252 ? -77.261  -21.487 27.17   1    68.12  ? 248  ILE A CG2    1 
ATOM   3929  C CD1    . ILE A 1 252 ? -76.49   -18.605 28.453  1    63.78  ? 248  ILE A CD1    1 
ATOM   3930  H H      . ILE A 1 252 ? -75.754  -19.793 24.495  0    110.28 ? 248  ILE A H      1 
ATOM   3931  H HA     . ILE A 1 252 ? -78.499  -20.838 24.885  0    113.77 ? 248  ILE A HA     1 
ATOM   3932  H HB     . ILE A 1 252 ? -78.46   -19.734 27.071  0    114    ? 248  ILE A HB     1 
ATOM   3933  H HG12   . ILE A 1 252 ? -75.437  -19.661 26.989  0    110.45 ? 248  ILE A HG12   1 
ATOM   3934  H HG13   . ILE A 1 252 ? -76.353  -18.258 26.4    0    108.05 ? 248  ILE A HG13   1 
ATOM   3935  H HG21   . ILE A 1 252 ? -77.202  -21.453 28.257  0    120.56 ? 248  ILE A HG21   1 
ATOM   3936  H HG22   . ILE A 1 252 ? -78.08   -22.137 26.864  0    121.27 ? 248  ILE A HG22   1 
ATOM   3937  H HG23   . ILE A 1 252 ? -76.323  -21.854 26.757  0    119.93 ? 248  ILE A HG23   1 
ATOM   3938  H HD11   . ILE A 1 252 ? -75.656  -17.932 28.644  0    109.14 ? 248  ILE A HD11   1 
ATOM   3939  H HD12   . ILE A 1 252 ? -77.431  -18.067 28.555  0    109.84 ? 248  ILE A HD12   1 
ATOM   3940  H HD13   . ILE A 1 252 ? -76.46   -19.44  29.152  0    112.26 ? 248  ILE A HD13   1 
ATOM   3941  N N      . ALA A 1 253 ? -79.511  -18.651 24.304  1    62.89  ? 249  ALA A N      1 
ATOM   3942  C CA     . ALA A 1 253 ? -80.122  -17.436 23.776  1    61.27  ? 249  ALA A CA     1 
ATOM   3943  C C      . ALA A 1 253 ? -81.267  -17.039 24.708  1    61.92  ? 249  ALA A C      1 
ATOM   3944  O O      . ALA A 1 253 ? -82.44   -17.198 24.373  1    62.97  ? 249  ALA A O      1 
ATOM   3945  C CB     . ALA A 1 253 ? -80.637  -17.69  22.367  1    61.63  ? 249  ALA A CB     1 
ATOM   3946  H H      . ALA A 1 253 ? -80.19   -19.386 24.476  0    110.1  ? 249  ALA A H      1 
ATOM   3947  H HA     . ALA A 1 253 ? -79.409  -16.615 23.725  0    103.07 ? 249  ALA A HA     1 
ATOM   3948  H HB1    . ALA A 1 253 ? -81.171  -16.808 22.018  0    104.54 ? 249  ALA A HB1    1 
ATOM   3949  H HB2    . ALA A 1 253 ? -79.788  -17.889 21.715  0    105.06 ? 249  ALA A HB2    1 
ATOM   3950  H HB3    . ALA A 1 253 ? -81.302  -18.552 22.376  0    107.36 ? 249  ALA A HB3    1 
ATOM   3951  N N      . PRO A 1 254 ? -80.937  -16.576 25.924  1    61.61  ? 250  PRO A N      1 
ATOM   3952  C CA     . PRO A 1 254 ? -81.997  -16.216 26.874  1    62.5   ? 250  PRO A CA     1 
ATOM   3953  C C      . PRO A 1 254 ? -82.751  -14.968 26.423  1    61.17  ? 250  PRO A C      1 
ATOM   3954  O O      . PRO A 1 254 ? -82.085  -14.032 25.982  1    59.14  ? 250  PRO A O      1 
ATOM   3955  C CB     . PRO A 1 254 ? -81.247  -15.995 28.187  1    62.48  ? 250  PRO A CB     1 
ATOM   3956  C CG     . PRO A 1 254 ? -79.843  -15.76  27.82   1    60.82  ? 250  PRO A CG     1 
ATOM   3957  C CD     . PRO A 1 254 ? -79.592  -16.351 26.483  1    60.68  ? 250  PRO A CD     1 
ATOM   3958  H HA     . PRO A 1 254 ? -82.649  -17.075 27.014  0    109.36 ? 250  PRO A HA     1 
ATOM   3959  H HB2    . PRO A 1 254 ? -81.659  -15.128 28.7    0    106.95 ? 250  PRO A HB2    1 
ATOM   3960  H HB3    . PRO A 1 254 ? -81.335  -16.884 28.809  0    109.21 ? 250  PRO A HB3    1 
ATOM   3961  H HG2    . PRO A 1 254 ? -79.65   -14.689 27.795  0    102.21 ? 250  PRO A HG2    1 
ATOM   3962  H HG3    . PRO A 1 254 ? -79.201  -16.235 28.561  0    104.6  ? 250  PRO A HG3    1 
ATOM   3963  H HD2    . PRO A 1 254 ? -79.035  -15.652 25.861  0    101.75 ? 250  PRO A HD2    1 
ATOM   3964  H HD3    . PRO A 1 254 ? -79.061  -17.297 26.582  0    104.56 ? 250  PRO A HD3    1 
ATOM   3965  N N      . PRO A 1 255 ? -84.1    -14.901 26.481  1    62.46  ? 251  PRO A N      1 
ATOM   3966  C CA     . PRO A 1 255 ? -84.782  -13.686 26      1    61.47  ? 251  PRO A CA     1 
ATOM   3967  C C      . PRO A 1 255 ? -84.476  -12.39  26.758  1    60.04  ? 251  PRO A C      1 
ATOM   3968  O O      . PRO A 1 255 ? -84.611  -11.318 26.174  1    58.66  ? 251  PRO A O      1 
ATOM   3969  C CB     . PRO A 1 255 ? -86.267  -14.046 26.09   1    63.72  ? 251  PRO A CB     1 
ATOM   3970  C CG     . PRO A 1 255 ? -86.318  -15.505 26.237  1    65.65  ? 251  PRO A CG     1 
ATOM   3971  C CD     . PRO A 1 255 ? -85.075  -15.908 26.933  1    65.08  ? 251  PRO A CD     1 
ATOM   3972  H HA     . PRO A 1 255 ? -84.536  -13.528 24.95   0    104.32 ? 251  PRO A HA     1 
ATOM   3973  H HB2    . PRO A 1 255 ? -86.71   -13.558 26.957  0    110.63 ? 251  PRO A HB2    1 
ATOM   3974  H HB3    . PRO A 1 255 ? -86.772  -13.737 25.176  0    110.07 ? 251  PRO A HB3    1 
ATOM   3975  H HG2    . PRO A 1 255 ? -87.191  -15.777 26.827  0    116.24 ? 251  PRO A HG2    1 
ATOM   3976  H HG3    . PRO A 1 255 ? -86.369  -15.967 25.252  0    114.69 ? 251  PRO A HG3    1 
ATOM   3977  H HD2    . PRO A 1 255 ? -85.207  -15.861 28.012  0    113.96 ? 251  PRO A HD2    1 
ATOM   3978  H HD3    . PRO A 1 255 ? -84.821  -16.911 26.596  0    114.16 ? 251  PRO A HD3    1 
ATOM   3979  N N      . ILE A 1 256 ? -84.077  -12.469 28.036  1    60.55  ? 252  ILE A N      1 
ATOM   3980  C CA     . ILE A 1 256 ? -83.788  -11.27  28.822  1    59.57  ? 252  ILE A CA     1 
ATOM   3981  C C      . ILE A 1 256 ? -82.677  -10.419 28.211  1    57.17  ? 252  ILE A C      1 
ATOM   3982  O O      . ILE A 1 256 ? -82.792  -9.193  28.207  1    56.17  ? 252  ILE A O      1 
ATOM   3983  C CB     . ILE A 1 256 ? -83.461  -11.633 30.302  1    60.86  ? 252  ILE A CB     1 
ATOM   3984  C CG1    . ILE A 1 256 ? -83.478  -10.398 31.228  1    60.59  ? 252  ILE A CG1    1 
ATOM   3985  C CG2    . ILE A 1 256 ? -82.115  -12.325 30.422  1    60.45  ? 252  ILE A CG2    1 
ATOM   3986  C CD1    . ILE A 1 256 ? -84.822  -9.878  31.57   1    61.86  ? 252  ILE A CD1    1 
ATOM   3987  H H      . ILE A 1 256 ? -83.958  -13.336 28.55   0    104.43 ? 252  ILE A H      1 
ATOM   3988  H HA     . ILE A 1 256 ? -84.693  -10.664 28.825  0    101.42 ? 252  ILE A HA     1 
ATOM   3989  H HB     . ILE A 1 256 ? -84.223  -12.323 30.664  0    105.68 ? 252  ILE A HB     1 
ATOM   3990  H HG12   . ILE A 1 256 ? -83.008  -10.686 32.166  0    103.86 ? 252  ILE A HG12   1 
ATOM   3991  H HG13   . ILE A 1 256 ? -82.916  -9.58   30.779  0    101.42 ? 252  ILE A HG13   1 
ATOM   3992  H HG21   . ILE A 1 256 ? -82.079  -12.851 31.375  0    104.35 ? 252  ILE A HG21   1 
ATOM   3993  H HG22   . ILE A 1 256 ? -81.994  -13.031 29.603  0    103.21 ? 252  ILE A HG22   1 
ATOM   3994  H HG23   . ILE A 1 256 ? -81.322  -11.58  30.393  0    101.39 ? 252  ILE A HG23   1 
ATOM   3995  H HD11   . ILE A 1 256 ? -84.72   -9.125  32.35   0    106    ? 252  ILE A HD11   1 
ATOM   3996  H HD12   . ILE A 1 256 ? -85.275  -9.427  30.689  0    105.36 ? 252  ILE A HD12   1 
ATOM   3997  H HD13   . ILE A 1 256 ? -85.441  -10.7   31.928  0    107.84 ? 252  ILE A HD13   1 
ATOM   3998  N N      . ILE A 1 257 ? -81.604  -11.046 27.715  1    56.43  ? 253  ILE A N      1 
ATOM   3999  C CA     . ILE A 1 257 ? -80.451  -10.3   27.2    1    54.4   ? 253  ILE A CA     1 
ATOM   4000  C C      . ILE A 1 257 ? -80.724  -9.551  25.889  1    53.17  ? 253  ILE A C      1 
ATOM   4001  O O      . ILE A 1 257 ? -80.008  -8.592  25.58   1    51.59  ? 253  ILE A O      1 
ATOM   4002  C CB     . ILE A 1 257 ? -79.192  -11.205 27.074  1    54.3   ? 253  ILE A CB     1 
ATOM   4003  C CG1    . ILE A 1 257 ? -79.357  -12.291 25.985  1    54.87  ? 253  ILE A CG1    1 
ATOM   4004  C CG2    . ILE A 1 257 ? -78.837  -11.816 28.431  1    55.71  ? 253  ILE A CG2    1 
ATOM   4005  C CD1    . ILE A 1 257 ? -78.113  -13.088 25.709  1    54.63  ? 253  ILE A CD1    1 
ATOM   4006  H H      . ILE A 1 257 ? -81.512  -12.055 27.665  0    95.08  ? 253  ILE A H      1 
ATOM   4007  H HA     . ILE A 1 257 ? -80.216  -9.547  27.95   0    89.28  ? 253  ILE A HA     1 
ATOM   4008  H HB     . ILE A 1 257 ? -78.365  -10.567 26.765  0    88.07  ? 253  ILE A HB     1 
ATOM   4009  H HG12   . ILE A 1 257 ? -80.136  -12.987 26.293  0    92.29  ? 253  ILE A HG12   1 
ATOM   4010  H HG13   . ILE A 1 257 ? -79.638  -11.829 25.041  0    90.01  ? 253  ILE A HG13   1 
ATOM   4011  H HG21   . ILE A 1 257 ? -77.859  -12.291 28.387  0    92.41  ? 253  ILE A HG21   1 
ATOM   4012  H HG22   . ILE A 1 257 ? -78.841  -11.034 29.189  0    92.31  ? 253  ILE A HG22   1 
ATOM   4013  H HG23   . ILE A 1 257 ? -79.591  -12.559 28.685  0    94.04  ? 253  ILE A HG23   1 
ATOM   4014  H HD11   . ILE A 1 257 ? -78.277  -13.696 24.821  0    90.73  ? 253  ILE A HD11   1 
ATOM   4015  H HD12   . ILE A 1 257 ? -77.281  -12.405 25.542  0    88.9   ? 253  ILE A HD12   1 
ATOM   4016  H HD13   . ILE A 1 257 ? -77.9    -13.734 26.559  0    91.35  ? 253  ILE A HD13   1 
ATOM   4017  N N      . LYS A 1 258 ? -81.69   -10.036 25.092  1    54.09  ? 254  LYS A N      1 
ATOM   4018  C CA     . LYS A 1 258 ? -82.015  -9.44   23.797  1    53.37  ? 254  LYS A CA     1 
ATOM   4019  C C      . LYS A 1 258 ? -82.57   -8.015  23.91   1    52.69  ? 254  LYS A C      1 
ATOM   4020  O O      . LYS A 1 258 ? -82.388  -7.241  22.965  1    51.54  ? 254  LYS A O      1 
ATOM   4021  C CB     . LYS A 1 258 ? -83.026  -10.347 23.039  1    55.01  ? 254  LYS A CB     1 
ATOM   4022  C CG     . LYS A 1 258 ? -83.547  -9.814  21.678  1    54.74  ? 254  LYS A CG     1 
ATOM   4023  C CD     . LYS A 1 258 ? -84.605  -10.764 21.05   1    56.62  ? 254  LYS A CD     1 
ATOM   4024  C CE     . LYS A 1 258 ? -85.376  -10.188 19.866  1    56.93  ? 254  LYS A CE     1 
ATOM   4025  N NZ     . LYS A 1 258 ? -86.86   -10.213 20.067  1    58.62  ? 254  LYS A NZ     1 
ATOM   4026  H H      . LYS A 1 258 ? -82.255  -10.853 25.305  0    90.41  ? 254  LYS A H      1 
ATOM   4027  H HA     . LYS A 1 258 ? -81.105  -9.392  23.201  0    86.37  ? 254  LYS A HA     1 
ATOM   4028  H HB2    . LYS A 1 258 ? -82.551  -11.309 22.853  0    91.43  ? 254  LYS A HB2    1 
ATOM   4029  H HB3    . LYS A 1 258 ? -83.898  -10.491 23.676  0    92.21  ? 254  LYS A HB3    1 
ATOM   4030  H HG2    . LYS A 1 258 ? -84.032  -8.849  21.814  0    90.29  ? 254  LYS A HG2    1 
ATOM   4031  H HG3    . LYS A 1 258 ? -82.714  -9.723  20.983  0    89.32  ? 254  LYS A HG3    1 
ATOM   4032  H HD2    . LYS A 1 258 ? -84.096  -11.662 20.703  0    94.8   ? 254  LYS A HD2    1 
ATOM   4033  H HD3    . LYS A 1 258 ? -85.331  -11.032 21.817  0    95.9   ? 254  LYS A HD3    1 
ATOM   4034  H HE2    . LYS A 1 258 ? -85.071  -9.156  19.702  0    93.97  ? 254  LYS A HE2    1 
ATOM   4035  H HE3    . LYS A 1 258 ? -85.153  -10.785 18.983  0    95.8   ? 254  LYS A HE3    1 
ATOM   4036  H HZ1    . LYS A 1 258 ? -87.328  -9.868  19.235  0    99.45  ? 254  LYS A HZ1    1 
ATOM   4037  H HZ2    . LYS A 1 258 ? -87.172  -11.161 20.254  0    100.5  ? 254  LYS A HZ2    1 
ATOM   4038  H HZ3    . LYS A 1 258 ? -87.111  -9.622  20.853  0    98.83  ? 254  LYS A HZ3    1 
ATOM   4039  N N      . GLN A 1 259 ? -83.25   -7.661  25.033  1    53.59  ? 255  GLN A N      1 
ATOM   4040  C CA     . GLN A 1 259 ? -83.909  -6.359  25.117  1    53.35  ? 255  GLN A CA     1 
ATOM   4041  C C      . GLN A 1 259 ? -82.941  -5.165  25.333  1    51.7   ? 255  GLN A C      1 
ATOM   4042  O O      . GLN A 1 259 ? -83.336  -4.018  25.091  1    51.47  ? 255  GLN A O      1 
ATOM   4043  C CB     . GLN A 1 259 ? -85.059  -6.373  26.147  1    55.2   ? 255  GLN A CB     1 
ATOM   4044  C CG     . GLN A 1 259 ? -86.222  -5.365  25.825  1    55.67  ? 255  GLN A CG     1 
ATOM   4045  C CD     . GLN A 1 259 ? -86.897  -5.439  24.424  1    55.67  ? 255  GLN A CD     1 
ATOM   4046  O OE1    . GLN A 1 259 ? -87.732  -6.327  24.133  1    56.87  ? 255  GLN A OE1    1 
ATOM   4047  N NE2    . GLN A 1 259 ? -86.585  -4.474  23.533  1    54.54  ? 255  GLN A NE2    1 
ATOM   4048  H H      . GLN A 1 259 ? -83.349  -8.232  25.866  0    88.87  ? 255  GLN A H      1 
ATOM   4049  H HA     . GLN A 1 259 ? -84.347  -6.193  24.134  0    87.35  ? 255  GLN A HA     1 
ATOM   4050  H HB2    . GLN A 1 259 ? -85.495  -7.371  26.179  0    92.68  ? 255  GLN A HB2    1 
ATOM   4051  H HB3    . GLN A 1 259 ? -84.656  -6.115  27.125  0    91.43  ? 255  GLN A HB3    1 
ATOM   4052  H HG2    . GLN A 1 259 ? -87.01   -5.525  26.56   0    94.18  ? 255  GLN A HG2    1 
ATOM   4053  H HG3    . GLN A 1 259 ? -85.83   -4.357  25.95   0    91.68  ? 255  GLN A HG3    1 
ATOM   4054  H HE21   . GLN A 1 259 ? -85.932  -3.736  23.775  0    89.31  ? 255  GLN A HE21   1 
ATOM   4055  H HE22   . GLN A 1 259 ? -87.004  -4.489  22.608  0    90.55  ? 255  GLN A HE22   1 
ATOM   4056  N N      . SER A 1 260 ? -81.68   -5.419  25.699  1    50.74  ? 256  SER A N      1 
ATOM   4057  C CA     . SER A 1 260 ? -80.661  -4.372  25.73   1    49.34  ? 256  SER A CA     1 
ATOM   4058  C C      . SER A 1 260 ? -79.284  -4.972  25.469  1    48.42  ? 256  SER A C      1 
ATOM   4059  O O      . SER A 1 260 ? -79.029  -6.14   25.788  1    49.12  ? 256  SER A O      1 
ATOM   4060  C CB     . SER A 1 260 ? -80.671  -3.572  27.022  1    49.85  ? 256  SER A CB     1 
ATOM   4061  O OG     . SER A 1 260 ? -79.709  -2.534  26.914  1    48.67  ? 256  SER A OG     1 
ATOM   4062  H H      . SER A 1 260 ? -81.325  -6.328  25.98   0    82.03  ? 256  SER A H      1 
ATOM   4063  H HA     . SER A 1 260 ? -80.865  -3.683  24.911  0    77.96  ? 256  SER A HA     1 
ATOM   4064  H HB2    . SER A 1 260 ? -81.658  -3.136  27.171  0    80.37  ? 256  SER A HB2    1 
ATOM   4065  H HB3    . SER A 1 260 ? -80.412  -4.227  27.852  0    80.1   ? 256  SER A HB3    1 
ATOM   4066  H HG     . SER A 1 260 ? -79.843  -1.857  27.627  0    77.03  ? 256  SER A HG     1 
ATOM   4067  N N      . THR A 1 261 ? -78.403  -4.16   24.869  1    47.06  ? 257  THR A N      1 
ATOM   4068  C CA     . THR A 1 261 ? -77.07   -4.587  24.447  1    46.29  ? 257  THR A CA     1 
ATOM   4069  C C      . THR A 1 261 ? -76.099  -4.77   25.598  1    46.37  ? 257  THR A C      1 
ATOM   4070  O O      . THR A 1 261 ? -75.83   -3.806  26.309  1    46.05  ? 257  THR A O      1 
ATOM   4071  C CB     . THR A 1 261 ? -76.473  -3.566  23.46   1    45.05  ? 257  THR A CB     1 
ATOM   4072  O OG1    . THR A 1 261 ? -77.471  -3.103  22.548  1    45.2   ? 257  THR A OG1    1 
ATOM   4073  C CG2    . THR A 1 261 ? -75.294  -4.132  22.685  1    44.56  ? 257  THR A CG2    1 
ATOM   4074  H H      . THR A 1 261 ? -78.585  -3.182  24.671  0    73.05  ? 257  THR A H      1 
ATOM   4075  H HA     . THR A 1 261 ? -77.169  -5.548  23.943  0    72.27  ? 257  THR A HA     1 
ATOM   4076  H HB     . THR A 1 261 ? -76.108  -2.705  24.018  0    68.64  ? 257  THR A HB     1 
ATOM   4077  H HG1    . THR A 1 261 ? -77.784  -3.853  21.978  0    69.82  ? 257  THR A HG1    1 
ATOM   4078  H HG21   . THR A 1 261 ? -74.998  -3.437  21.901  0    67.27  ? 257  THR A HG21   1 
ATOM   4079  H HG22   . THR A 1 261 ? -74.44   -4.294  23.343  0    67.97  ? 257  THR A HG22   1 
ATOM   4080  H HG23   . THR A 1 261 ? -75.568  -5.082  22.227  0    68.54  ? 257  THR A HG23   1 
ATOM   4081  N N      . ILE A 1 262 ? -75.524  -5.985  25.752  1    46.98  ? 258  ILE A N      1 
ATOM   4082  C CA     . ILE A 1 262 ? -74.532  -6.229  26.792  1    47.38  ? 258  ILE A CA     1 
ATOM   4083  C C      . ILE A 1 262 ? -73.268  -5.537  26.331  1    46.24  ? 258  ILE A C      1 
ATOM   4084  O O      . ILE A 1 262 ? -72.814  -5.784  25.215  1    45.72  ? 258  ILE A O      1 
ATOM   4085  C CB     . ILE A 1 262 ? -74.333  -7.721  27.093  1    48.67  ? 258  ILE A CB     1 
ATOM   4086  C CG1    . ILE A 1 262 ? -75.643  -8.297  27.662  1    49.99  ? 258  ILE A CG1    1 
ATOM   4087  C CG2    . ILE A 1 262 ? -73.196  -7.896  28.106  1    49.29  ? 258  ILE A CG2    1 
ATOM   4088  C CD1    . ILE A 1 262 ? -75.8    -9.737  27.562  1    51.23  ? 258  ILE A CD1    1 
ATOM   4089  H H      . ILE A 1 262 ? -75.725  -6.801  25.182  0    73.71  ? 258  ILE A H      1 
ATOM   4090  H HA     . ILE A 1 262 ? -74.868  -5.767  27.717  0    74.62  ? 258  ILE A HA     1 
ATOM   4091  H HB     . ILE A 1 262 ? -74.075  -8.238  26.17   0    76.84  ? 258  ILE A HB     1 
ATOM   4092  H HG12   . ILE A 1 262 ? -75.696  -8.039  28.719  0    80.57  ? 258  ILE A HG12   1 
ATOM   4093  H HG13   . ILE A 1 262 ? -76.491  -7.852  27.145  0    79.59  ? 258  ILE A HG13   1 
ATOM   4094  H HG21   . ILE A 1 262 ? -73.106  -8.943  28.391  0    79.53  ? 258  ILE A HG21   1 
ATOM   4095  H HG22   . ILE A 1 262 ? -72.248  -7.573  27.681  0    77.68  ? 258  ILE A HG22   1 
ATOM   4096  H HG23   . ILE A 1 262 ? -73.423  -7.3    28.99   0    78.83  ? 258  ILE A HG23   1 
ATOM   4097  H HD11   . ILE A 1 262 ? -76.628  -10.04  28.202  0    83.9   ? 258  ILE A HD11   1 
ATOM   4098  H HD12   . ILE A 1 262 ? -76.019  -9.995  26.527  0    82.43  ? 258  ILE A HD12   1 
ATOM   4099  H HD13   . ILE A 1 262 ? -74.892  -10.246 27.879  0    83.12  ? 258  ILE A HD13   1 
ATOM   4100  N N      . VAL A 1 263 ? -72.724  -4.646  27.18   1    46.06  ? 259  VAL A N      1 
ATOM   4101  C CA     . VAL A 1 263 ? -71.58   -3.795  26.852  1    45.15  ? 259  VAL A CA     1 
ATOM   4102  C C      . VAL A 1 263 ? -70.278  -4.143  27.587  1    45.8   ? 259  VAL A C      1 
ATOM   4103  O O      . VAL A 1 263 ? -69.225  -3.751  27.088  1    45.27  ? 259  VAL A O      1 
ATOM   4104  C CB     . VAL A 1 263 ? -71.928  -2.299  27.051  1    44.51  ? 259  VAL A CB     1 
ATOM   4105  C CG1    . VAL A 1 263 ? -73.068  -1.885  26.141  1    43.91  ? 259  VAL A CG1    1 
ATOM   4106  C CG2    . VAL A 1 263 ? -72.264  -1.972  28.5    1    45.45  ? 259  VAL A CG2    1 
ATOM   4107  H H      . VAL A 1 263 ? -73.035  -4.543  28.14   0    71.98  ? 259  VAL A H      1 
ATOM   4108  H HA     . VAL A 1 263 ? -71.349  -3.915  25.794  0    68.75  ? 259  VAL A HA     1 
ATOM   4109  H HB     . VAL A 1 263 ? -71.056  -1.706  26.778  0    67.41  ? 259  VAL A HB     1 
ATOM   4110  H HG11   . VAL A 1 263 ? -73.229  -0.813  26.248  0    66.39  ? 259  VAL A HG11   1 
ATOM   4111  H HG12   . VAL A 1 263 ? -72.798  -2.114  25.111  0    66.12  ? 259  VAL A HG12   1 
ATOM   4112  H HG13   . VAL A 1 263 ? -73.974  -2.421  26.418  0    67.28  ? 259  VAL A HG13   1 
ATOM   4113  H HG21   . VAL A 1 263 ? -72.443  -0.901  28.577  0    69.63  ? 259  VAL A HG21   1 
ATOM   4114  H HG22   . VAL A 1 263 ? -73.167  -2.506  28.795  0    70.61  ? 259  VAL A HG22   1 
ATOM   4115  H HG23   . VAL A 1 263 ? -71.44   -2.249  29.157  0    70.55  ? 259  VAL A HG23   1 
ATOM   4116  N N      . CYS A 1 264 ? -70.316  -4.817  28.76   1    47.13  ? 260  CYS A N      1 
ATOM   4117  C CA     . CYS A 1 264 ? -69.076  -5.153  29.475  1    48.08  ? 260  CYS A CA     1 
ATOM   4118  C C      . CYS A 1 264 ? -69.214  -6.394  30.345  1    49.78  ? 260  CYS A C      1 
ATOM   4119  O O      . CYS A 1 264 ? -70.32   -6.772  30.732  1    50.31  ? 260  CYS A O      1 
ATOM   4120  C CB     . CYS A 1 264 ? -68.577  -3.963  30.281  1    48.15  ? 260  CYS A CB     1 
ATOM   4121  S SG     . CYS A 1 264 ? -69.685  -3.485  31.624  1    49.07  ? 260  CYS A SG     1 
ATOM   4122  H H      . CYS A 1 264 ? -71.16   -5.131  29.228  0    74.3   ? 260  CYS A H      1 
ATOM   4123  H HA     . CYS A 1 264 ? -68.304  -5.386  28.743  0    75.43  ? 260  CYS A HA     1 
ATOM   4124  H HB2    . CYS A 1 264 ? -67.616  -4.219  30.725  0    76.72  ? 260  CYS A HB2    1 
ATOM   4125  H HB3    . CYS A 1 264 ? -68.46   -3.109  29.616  0    74.82  ? 260  CYS A HB3    1 
ATOM   4126  H HG     . CYS A 1 264 ? -69.682  -2.149  31.717  0    77.16  ? 260  CYS A HG     1 
ATOM   4127  N N      . HIS A 1 265 ? -68.063  -7.019  30.646  1    50.85  ? 261  HIS A N      1 
ATOM   4128  C CA     . HIS A 1 265 ? -67.963  -8.26   31.407  1    52.77  ? 261  HIS A CA     1 
ATOM   4129  C C      . HIS A 1 265 ? -66.845  -8.185  32.457  1    54.22  ? 261  HIS A C      1 
ATOM   4130  O O      . HIS A 1 265 ? -66.023  -7.258  32.447  1    53.67  ? 261  HIS A O      1 
ATOM   4131  C CB     . HIS A 1 265 ? -67.675  -9.43   30.438  1    53.05  ? 261  HIS A CB     1 
ATOM   4132  C CG     . HIS A 1 265 ? -66.394  -9.273  29.666  1    52.58  ? 261  HIS A CG     1 
ATOM   4133  N ND1    . HIS A 1 265 ? -65.188  -9.739  30.16   1    53.96  ? 261  HIS A ND1    1 
ATOM   4134  C CD2    . HIS A 1 265 ? -66.173  -8.698  28.457  1    51.17  ? 261  HIS A CD2    1 
ATOM   4135  C CE1    . HIS A 1 265 ? -64.277  -9.428  29.245  1    53.28  ? 261  HIS A CE1    1 
ATOM   4136  N NE2    . HIS A 1 265 ? -64.826  -8.806  28.2    1    51.6   ? 261  HIS A NE2    1 
ATOM   4137  H H      . HIS A 1 265 ? -67.156  -6.652  30.377  0    81.55  ? 261  HIS A H      1 
ATOM   4138  H HA     . HIS A 1 265 ? -68.896  -8.466  31.93   0    86.61  ? 261  HIS A HA     1 
ATOM   4139  H HB2    . HIS A 1 265 ? -67.606  -10.351 31.014  0    88.27  ? 261  HIS A HB2    1 
ATOM   4140  H HB3    . HIS A 1 265 ? -68.49   -9.5    29.719  0    85.86  ? 261  HIS A HB3    1 
ATOM   4141  H HD2    . HIS A 1 265 ? -66.914  -8.25   27.817  0    81.33  ? 261  HIS A HD2    1 
ATOM   4142  H HE1    . HIS A 1 265 ? -63.225  -9.647  29.337  0    88.14  ? 261  HIS A HE1    1 
ATOM   4143  H HE2    . HIS A 1 265 ? -64.339  -8.478  27.372  0    82.77  ? 261  HIS A HE2    1 
ATOM   4144  N N      . ASN A 1 266 ? -66.824  -9.178  33.368  1    56.3   ? 262  ASN A N      1 
ATOM   4145  C CA     . ASN A 1 266 ? -65.787  -9.317  34.391  1    58.18  ? 262  ASN A CA     1 
ATOM   4146  C C      . ASN A 1 266 ? -65.848  -10.709 35.035  1    60.56  ? 262  ASN A C      1 
ATOM   4147  O O      . ASN A 1 266 ? -66.936  -11.272 35.166  1    60.98  ? 262  ASN A O      1 
ATOM   4148  C CB     . ASN A 1 266 ? -65.919  -8.239  35.475  1    58.48  ? 262  ASN A CB     1 
ATOM   4149  C CG     . ASN A 1 266 ? -64.74   -8.217  36.425  1    60.31  ? 262  ASN A CG     1 
ATOM   4150  O OD1    . ASN A 1 266 ? -64.886  -8.374  37.649  1    62.42  ? 262  ASN A OD1    1 
ATOM   4151  N ND2    . ASN A 1 266 ? -63.539  -8.026  35.884  1    59.78  ? 262  ASN A ND2    1 
ATOM   4152  H H      . ASN A 1 266 ? -67.54   -9.896  33.413  0    94.43  ? 262  ASN A H      1 
ATOM   4153  H HA     . ASN A 1 266 ? -64.817  -9.214  33.908  0    97.73  ? 262  ASN A HA     1 
ATOM   4154  H HB2    . ASN A 1 266 ? -65.996  -7.257  35.01   0    97.05  ? 262  ASN A HB2    1 
ATOM   4155  H HB3    . ASN A 1 266 ? -66.814  -8.443  36.063  0    99.42  ? 262  ASN A HB3    1 
ATOM   4156  H HD21   . ASN A 1 266 ? -62.717  -7.997  36.477  0    102.99 ? 262  ASN A HD21   1 
ATOM   4157  H HD22   . ASN A 1 266 ? -63.437  -7.878  34.885  0    100.09 ? 262  ASN A HD22   1 
ATOM   4158  N N      . ARG A 1 267 ? -64.694  -11.258 35.444  1    62.34  ? 263  ARG A N      1 
ATOM   4159  C CA     . ARG A 1 267 ? -64.648  -12.57  36.096  1    64.96  ? 263  ARG A CA     1 
ATOM   4160  C C      . ARG A 1 267 ? -64.806  -12.413 37.616  1    67.01  ? 263  ARG A C      1 
ATOM   4161  O O      . ARG A 1 267 ? -64.035  -11.68  38.237  1    67.62  ? 263  ARG A O      1 
ATOM   4162  C CB     . ARG A 1 267 ? -63.317  -13.279 35.79   1    66.3   ? 263  ARG A CB     1 
ATOM   4163  C CG     . ARG A 1 267 ? -63.248  -14.676 36.396  1    69.23  ? 263  ARG A CG     1 
ATOM   4164  C CD     . ARG A 1 267 ? -62.062  -15.502 35.951  1    70.74  ? 263  ARG A CD     1 
ATOM   4165  N NE     . ARG A 1 267 ? -60.8    -14.811 36.244  1    71.4   ? 263  ARG A NE     1 
ATOM   4166  C CZ     . ARG A 1 267 ? -59.885  -14.394 35.367  1    70.59  ? 263  ARG A CZ     1 
ATOM   4167  N NH1    . ARG A 1 267 ? -58.791  -13.771 35.788  1    71.51  ? 263  ARG A NH1    1 
ATOM   4168  N NH2    . ARG A 1 267 ? -60.047  -14.61  34.059  1    69.08  ? 263  ARG A NH2    1 
ATOM   4169  H H      . ARG A 1 267 ? -63.787  -10.812 35.351  0    107.04 ? 263  ARG A H      1 
ATOM   4170  H HA     . ARG A 1 267 ? -65.445  -13.206 35.715  0    112.76 ? 263  ARG A HA     1 
ATOM   4171  H HB2    . ARG A 1 267 ? -63.192  -13.364 34.711  0    114.6  ? 263  ARG A HB2    1 
ATOM   4172  H HB3    . ARG A 1 267 ? -62.503  -12.69  36.214  0    116.41 ? 263  ARG A HB3    1 
ATOM   4173  H HG2    . ARG A 1 267 ? -63.161  -14.578 37.478  0    124.02 ? 263  ARG A HG2    1 
ATOM   4174  H HG3    . ARG A 1 267 ? -64.158  -15.204 36.12   0    122.05 ? 263  ARG A HG3    1 
ATOM   4175  H HD2    . ARG A 1 267 ? -62.048  -16.405 36.56   0    128.13 ? 263  ARG A HD2    1 
ATOM   4176  H HD3    . ARG A 1 267 ? -62.199  -15.796 34.914  0    124.6  ? 263  ARG A HD3    1 
ATOM   4177  H HE     . ARG A 1 267 ? -60.619  -14.599 37.219  0    128.48 ? 263  ARG A HE     1 
ATOM   4178  H HH11   . ARG A 1 267 ? -58.657  -13.576 36.774  0    128.59 ? 263  ARG A HH11   1 
ATOM   4179  H HH12   . ARG A 1 267 ? -58.097  -13.463 35.114  0    126.66 ? 263  ARG A HH12   1 
ATOM   4180  H HH21   . ARG A 1 267 ? -60.832  -15.102 33.647  0    121.18 ? 263  ARG A HH21   1 
ATOM   4181  H HH22   . ARG A 1 267 ? -59.317  -14.295 33.427  0    121.27 ? 263  ARG A HH22   1 
ATOM   4182  N N      . VAL A 1 268 ? -65.78   -13.104 38.219  1    68.29  ? 264  VAL A N      1 
ATOM   4183  C CA     . VAL A 1 268 ? -65.971  -13.053 39.673  1    70.6   ? 264  VAL A CA     1 
ATOM   4184  C C      . VAL A 1 268 ? -64.977  -14.053 40.342  1    73.77  ? 264  VAL A C      1 
ATOM   4185  O O      . VAL A 1 268 ? -63.986  -13.629 40.941  1    74.99  ? 264  VAL A O      1 
ATOM   4186  C CB     . VAL A 1 268 ? -67.462  -13.305 40.077  1    70.99  ? 264  VAL A CB     1 
ATOM   4187  C CG1    . VAL A 1 268 ? -67.652  -13.252 41.591  1    73.71  ? 264  VAL A CG1    1 
ATOM   4188  C CG2    . VAL A 1 268 ? -68.387  -12.316 39.396  1    68.2   ? 264  VAL A CG2    1 
ATOM   4189  H H      . VAL A 1 268 ? -66.462  -13.674 37.73   0    119.78 ? 264  VAL A H      1 
ATOM   4190  H HA     . VAL A 1 268 ? -65.724  -12.057 40.037  0    124.9  ? 264  VAL A HA     1 
ATOM   4191  H HB     . VAL A 1 268 ? -67.744  -14.304 39.746  0    126.88 ? 264  VAL A HB     1 
ATOM   4192  H HG11   . VAL A 1 268 ? -68.718  -13.245 41.812  0    132.35 ? 264  VAL A HG11   1 
ATOM   4193  H HG12   . VAL A 1 268 ? -67.197  -14.131 42.045  0    134.47 ? 264  VAL A HG12   1 
ATOM   4194  H HG13   . VAL A 1 268 ? -67.186  -12.346 41.976  0    131.9  ? 264  VAL A HG13   1 
ATOM   4195  H HG21   . VAL A 1 268 ? -69.41   -12.515 39.71   0    120.64 ? 264  VAL A HG21   1 
ATOM   4196  H HG22   . VAL A 1 268 ? -68.103  -11.306 39.685  0    119.39 ? 264  VAL A HG22   1 
ATOM   4197  H HG23   . VAL A 1 268 ? -68.31   -12.429 38.315  0    118.44 ? 264  VAL A HG23   1 
ATOM   4198  N N      . ASP A 1 269 ? -65.191  -15.368 40.16   1    75.25  ? 265  ASP A N      1 
ATOM   4199  C CA     . ASP A 1 269 ? -64.367  -16.393 40.778  1    78.57  ? 265  ASP A CA     1 
ATOM   4200  C C      . ASP A 1 269 ? -63.119  -16.648 39.936  1    78.45  ? 265  ASP A C      1 
ATOM   4201  O O      . ASP A 1 269 ? -63.258  -16.777 38.723  1    76.33  ? 265  ASP A O      1 
ATOM   4202  C CB     . ASP A 1 269 ? -65.176  -17.691 40.905  1    80.45  ? 265  ASP A CB     1 
ATOM   4203  C CG     . ASP A 1 269 ? -66.464  -17.54  41.697  1    80.92  ? 265  ASP A CG     1 
ATOM   4204  O OD1    . ASP A 1 269 ? -66.434  -16.892 42.763  1    81.71  ? 265  ASP A OD1    1 
ATOM   4205  O OD2    . ASP A 1 269 ? -67.495  -18.086 41.259  1    80.72  ? 265  ASP A OD2    1 
ATOM   4206  H H      . ASP A 1 269 ? -65.918  -15.737 39.556  0    134.91 ? 265  ASP A H      1 
ATOM   4207  H HA     . ASP A 1 269 ? -64.106  -16.071 41.783  0    144.58 ? 265  ASP A HA     1 
ATOM   4208  H HB2    . ASP A 1 269 ? -65.432  -18.042 39.906  0    145.96 ? 265  ASP A HB2    1 
ATOM   4209  H HB3    . ASP A 1 269 ? -64.562  -18.437 41.406  0    149.97 ? 265  ASP A HB3    1 
ATOM   4210  N N      . PRO A 1 270 ? -61.913  -16.784 40.53   1    80.92  ? 266  PRO A N      1 
ATOM   4211  C CA     . PRO A 1 270 ? -60.722  -17.058 39.707  1    81.06  ? 266  PRO A CA     1 
ATOM   4212  C C      . PRO A 1 270 ? -60.836  -18.275 38.793  1    81.46  ? 266  PRO A C      1 
ATOM   4213  O O      . PRO A 1 270 ? -60.357  -18.203 37.664  1    80.07  ? 266  PRO A O      1 
ATOM   4214  C CB     . PRO A 1 270 ? -59.613  -17.271 40.735  1    84.53  ? 266  PRO A CB     1 
ATOM   4215  C CG     . PRO A 1 270 ? -60.082  -16.64  41.966  1    85.26  ? 266  PRO A CG     1 
ATOM   4216  C CD     . PRO A 1 270 ? -61.567  -16.672 41.959  1    83.9   ? 266  PRO A CD     1 
ATOM   4217  H HA     . PRO A 1 270 ? -60.482  -16.185 39.102  0    146.01 ? 266  PRO A HA     1 
ATOM   4218  H HB2    . PRO A 1 270 ? -59.456  -18.338 40.889  0    158.32 ? 266  PRO A HB2    1 
ATOM   4219  H HB3    . PRO A 1 270 ? -58.697  -16.796 40.388  0    155.49 ? 266  PRO A HB3    1 
ATOM   4220  H HG2    . PRO A 1 270 ? -59.697  -17.192 42.822  0    160.69 ? 266  PRO A HG2    1 
ATOM   4221  H HG3    . PRO A 1 270 ? -59.729  -15.61  41.995  0    156.24 ? 266  PRO A HG3    1 
ATOM   4222  H HD2    . PRO A 1 270 ? -61.932  -17.537 42.51   0    156.83 ? 266  PRO A HD2    1 
ATOM   4223  H HD3    . PRO A 1 270 ? -61.937  -15.738 42.38   0    153.54 ? 266  PRO A HD3    1 
ATOM   4224  N N      . ASN A 1 271 ? -61.462  -19.385 39.259  1    83.59  ? 267  ASN A N      1 
ATOM   4225  C CA     . ASN A 1 271 ? -61.633  -20.596 38.429  1    84.3   ? 267  ASN A CA     1 
ATOM   4226  C C      . ASN A 1 271 ? -62.537  -20.386 37.182  1    80.99  ? 267  ASN A C      1 
ATOM   4227  O O      . ASN A 1 271 ? -62.543  -21.234 36.287  1    81.18  ? 267  ASN A O      1 
ATOM   4228  C CB     . ASN A 1 271 ? -62.118  -21.798 39.267  1    87.64  ? 267  ASN A CB     1 
ATOM   4229  C CG     . ASN A 1 271 ? -63.521  -21.711 39.834  1    87.16  ? 267  ASN A CG     1 
ATOM   4230  O OD1    . ASN A 1 271 ? -64.252  -20.74  39.64   1    84.49  ? 267  ASN A OD1    1 
ATOM   4231  N ND2    . ASN A 1 271 ? -63.926  -22.741 40.561  1    90.02  ? 267  ASN A ND2    1 
ATOM   4232  H H      . ASN A 1 271 ? -61.834  -19.474 40.199  0    155.54 ? 267  ASN A H      1 
ATOM   4233  H HA     . ASN A 1 271 ? -60.65   -20.866 38.047  0    156.48 ? 267  ASN A HA     1 
ATOM   4234  H HB2    . ASN A 1 271 ? -62.069  -22.689 38.644  0    163.66 ? 267  ASN A HB2    1 
ATOM   4235  H HB3    . ASN A 1 271 ? -61.439  -21.918 40.11   0    165.39 ? 267  ASN A HB3    1 
ATOM   4236  H HD21   . ASN A 1 271 ? -64.856  -22.741 40.968  0    168.23 ? 267  ASN A HD21   1 
ATOM   4237  H HD22   . ASN A 1 271 ? -63.309  -23.534 40.706  0    170.7  ? 267  ASN A HD22   1 
ATOM   4238  N N      . GLY A 1 272 ? -63.263  -19.263 37.139  1    78.27  ? 268  GLY A N      1 
ATOM   4239  C CA     . GLY A 1 272 ? -64.117  -18.896 36.023  1    75.23  ? 268  GLY A CA     1 
ATOM   4240  C C      . GLY A 1 272 ? -65.506  -19.487 36.076  1    75.48  ? 268  GLY A C      1 
ATOM   4241  O O      . GLY A 1 272 ? -66.077  -19.762 35.021  1    74.29  ? 268  GLY A O      1 
ATOM   4242  H H      . GLY A 1 272 ? -63.297  -18.573 37.883  0    142.17 ? 268  GLY A H      1 
ATOM   4243  H HA2    . GLY A 1 272 ? -64.207  -17.811 35.986  0    133.5  ? 268  GLY A HA2    1 
ATOM   4244  H HA3    . GLY A 1 272 ? -63.665  -19.232 35.091  0    135.11 ? 268  GLY A HA3    1 
ATOM   4245  N N      . SER A 1 273 ? -66.075  -19.684 37.277  1    77.22  ? 269  SER A N      1 
ATOM   4246  C CA     . SER A 1 273 ? -67.419  -20.247 37.381  1    77.81  ? 269  SER A CA     1 
ATOM   4247  C C      . SER A 1 273 ? -68.466  -19.143 37.242  1    75.2   ? 269  SER A C      1 
ATOM   4248  O O      . SER A 1 273 ? -69.392  -19.298 36.459  1    74.17  ? 269  SER A O      1 
ATOM   4249  C CB     . SER A 1 273 ? -67.595  -21.038 38.673  1    81.33  ? 269  SER A CB     1 
ATOM   4250  O OG     . SER A 1 273 ? -67.138  -20.311 39.799  1    82     ? 269  SER A OG     1 
ATOM   4251  H H      . SER A 1 273 ? -65.648  -19.465 38.172  0    141.17 ? 269  SER A H      1 
ATOM   4252  H HA     . SER A 1 273 ? -67.564  -20.969 36.58   0    141.27 ? 269  SER A HA     1 
ATOM   4253  H HB2    . SER A 1 273 ? -68.651  -21.269 38.806  0    149.16 ? 269  SER A HB2    1 
ATOM   4254  H HB3    . SER A 1 273 ? -67.024  -21.962 38.602  0    150.94 ? 269  SER A HB3    1 
ATOM   4255  H HG     . SER A 1 273 ? -66.156  -20.419 39.902  0    151.37 ? 269  SER A HG     1 
ATOM   4256  N N      . ARG A 1 274 ? -68.309  -18.019 37.95   1    74.31  ? 270  ARG A N      1 
ATOM   4257  C CA     . ARG A 1 274 ? -69.263  -16.919 37.862  1    72.06  ? 270  ARG A CA     1 
ATOM   4258  C C      . ARG A 1 274 ? -68.627  -15.718 37.178  1    69.3   ? 270  ARG A C      1 
ATOM   4259  O O      . ARG A 1 274 ? -67.46   -15.425 37.425  1    69.62  ? 270  ARG A O      1 
ATOM   4260  C CB     . ARG A 1 274 ? -69.755  -16.53  39.26   1    73.62  ? 270  ARG A CB     1 
ATOM   4261  C CG     . ARG A 1 274 ? -70.586  -17.609 39.938  1    76.24  ? 270  ARG A CG     1 
ATOM   4262  C CD     . ARG A 1 274 ? -71.208  -17.116 41.23   1    77.63  ? 270  ARG A CD     1 
ATOM   4263  N NE     . ARG A 1 274 ? -70.2    -16.823 42.245  1    79.29  ? 270  ARG A NE     1 
ATOM   4264  C CZ     . ARG A 1 274 ? -70.434  -16.174 43.387  1    80.43  ? 270  ARG A CZ     1 
ATOM   4265  N NH1    . ARG A 1 274 ? -71.66   -15.735 43.673  1    80.08  ? 270  ARG A NH1    1 
ATOM   4266  N NH2    . ARG A 1 274 ? -69.447  -15.955 44.25   1    82.14  ? 270  ARG A NH2    1 
ATOM   4267  H H      . ARG A 1 274 ? -67.544  -17.839 38.591  0    134.55 ? 270  ARG A H      1 
ATOM   4268  H HA     . ARG A 1 274 ? -70.138  -17.214 37.286  0    127.92 ? 270  ARG A HA     1 
ATOM   4269  H HB2    . ARG A 1 274 ? -68.89   -16.331 39.89   0    133.11 ? 270  ARG A HB2    1 
ATOM   4270  H HB3    . ARG A 1 274 ? -70.367  -15.632 39.179  0    130.37 ? 270  ARG A HB3    1 
ATOM   4271  H HG2    . ARG A 1 274 ? -71.387  -17.916 39.269  0    137.03 ? 270  ARG A HG2    1 
ATOM   4272  H HG3    . ARG A 1 274 ? -69.945  -18.458 40.171  0    139.85 ? 270  ARG A HG3    1 
ATOM   4273  H HD2    . ARG A 1 274 ? -71.76   -16.201 41.024  0    139.07 ? 270  ARG A HD2    1 
ATOM   4274  H HD3    . ARG A 1 274 ? -71.875  -17.882 41.622  0    142.88 ? 270  ARG A HD3    1 
ATOM   4275  H HE     . ARG A 1 274 ? -69.252  -17.143 42.068  0    145.03 ? 270  ARG A HE     1 
ATOM   4276  H HH11   . ARG A 1 274 ? -72.444  -15.881 43.048  0    145.3  ? 270  ARG A HH11   1 
ATOM   4277  H HH12   . ARG A 1 274 ? -71.823  -15.247 44.55   0    147.44 ? 270  ARG A HH12   1 
ATOM   4278  H HH21   . ARG A 1 274 ? -68.508  -16.287 44.046  0    151.29 ? 270  ARG A HH21   1 
ATOM   4279  H HH22   . ARG A 1 274 ? -69.622  -15.466 45.121  0    151.9  ? 270  ARG A HH22   1 
ATOM   4280  N N      . TYR A 1 275 ? -69.404  -15.018 36.328  1    66.81  ? 271  TYR A N      1 
ATOM   4281  C CA     . TYR A 1 275 ? -68.967  -13.835 35.577  1    64.17  ? 271  TYR A CA     1 
ATOM   4282  C C      . TYR A 1 275 ? -70.074  -12.787 35.611  1    62.58  ? 271  TYR A C      1 
ATOM   4283  O O      . TYR A 1 275 ? -71.224  -13.123 35.373  1    62.58  ? 271  TYR A O      1 
ATOM   4284  C CB     . TYR A 1 275 ? -68.727  -14.203 34.106  1    62.83  ? 271  TYR A CB     1 
ATOM   4285  C CG     . TYR A 1 275 ? -67.367  -14.78  33.787  1    63.62  ? 271  TYR A CG     1 
ATOM   4286  C CD1    . TYR A 1 275 ? -67.09   -16.124 34.016  1    66.01  ? 271  TYR A CD1    1 
ATOM   4287  C CD2    . TYR A 1 275 ? -66.416  -14.034 33.119  1    62.06  ? 271  TYR A CD2    1 
ATOM   4288  C CE1    . TYR A 1 275 ? -65.863  -16.682 33.664  1    66.96  ? 271  TYR A CE1    1 
ATOM   4289  C CE2    . TYR A 1 275 ? -65.175  -14.567 32.797  1    62.99  ? 271  TYR A CE2    1 
ATOM   4290  C CZ     . TYR A 1 275 ? -64.907  -15.902 33.048  1    65.42  ? 271  TYR A CZ     1 
ATOM   4291  O OH     . TYR A 1 275 ? -63.695  -16.457 32.703  1    66.59  ? 271  TYR A OH     1 
ATOM   4292  H H      . TYR A 1 275 ? -70.374  -15.253 36.143  0    116.83 ? 271  TYR A H      1 
ATOM   4293  H HA     . TYR A 1 275 ? -68.056  -13.428 36.011  0    111.49 ? 271  TYR A HA     1 
ATOM   4294  H HB2    . TYR A 1 275 ? -69.474  -14.934 33.806  0    108.73 ? 271  TYR A HB2    1 
ATOM   4295  H HB3    . TYR A 1 275 ? -68.851  -13.301 33.506  0    106.14 ? 271  TYR A HB3    1 
ATOM   4296  H HD1    . TYR A 1 275 ? -67.816  -16.742 34.517  0    116.57 ? 271  TYR A HD1    1 
ATOM   4297  H HD2    . TYR A 1 275 ? -66.616  -12.997 32.907  0    104.83 ? 271  TYR A HD2    1 
ATOM   4298  H HE1    . TYR A 1 275 ? -65.656  -17.715 33.892  0    119.49 ? 271  TYR A HE1    1 
ATOM   4299  H HE2    . TYR A 1 275 ? -64.447  -13.954 32.301  0    107.64 ? 271  TYR A HE2    1 
ATOM   4300  H HH     . TYR A 1 275 ? -63.03   -15.748 32.502  0    115.72 ? 271  TYR A HH     1 
ATOM   4301  N N      . LEU A 1 276 ? -69.731  -11.517 35.83   1    61.38  ? 272  LEU A N      1 
ATOM   4302  C CA     . LEU A 1 276 ? -70.722  -10.445 35.813  1    60.03  ? 272  LEU A CA     1 
ATOM   4303  C C      . LEU A 1 276 ? -70.817  -9.844  34.418  1    57.48  ? 272  LEU A C      1 
ATOM   4304  O O      . LEU A 1 276 ? -69.813  -9.756  33.707  1    56.55  ? 272  LEU A O      1 
ATOM   4305  C CB     . LEU A 1 276 ? -70.36   -9.353  36.818  1    60.39  ? 272  LEU A CB     1 
ATOM   4306  C CG     . LEU A 1 276 ? -70.562  -9.702  38.283  1    63.02  ? 272  LEU A CG     1 
ATOM   4307  C CD1    . LEU A 1 276 ? -69.711  -8.831  39.165  1    63.76  ? 272  LEU A CD1    1 
ATOM   4308  C CD2    . LEU A 1 276 ? -72.005  -9.577  38.677  1    63.37  ? 272  LEU A CD2    1 
ATOM   4309  H H      . LEU A 1 276 ? -68.784  -11.206 36.016  0    105.04 ? 272  LEU A H      1 
ATOM   4310  H HA     . LEU A 1 276 ? -71.704  -10.842 36.069  0    102.71 ? 272  LEU A HA     1 
ATOM   4311  H HB2    . LEU A 1 276 ? -69.314  -9.081  36.683  0    102.49 ? 272  LEU A HB2    1 
ATOM   4312  H HB3    . LEU A 1 276 ? -70.983  -8.485  36.608  0    101.56 ? 272  LEU A HB3    1 
ATOM   4313  H HG     . LEU A 1 276 ? -70.255  -10.73  38.471  0    110.01 ? 272  LEU A HG     1 
ATOM   4314  H HD11   . LEU A 1 276 ? -69.918  -9.074  40.207  0    112.19 ? 272  LEU A HD11   1 
ATOM   4315  H HD12   . LEU A 1 276 ? -68.66   -9.018  38.943  0    110.23 ? 272  LEU A HD12   1 
ATOM   4316  H HD13   . LEU A 1 276 ? -69.957  -7.787  38.972  0    108.82 ? 272  LEU A HD13   1 
ATOM   4317  H HD21   . LEU A 1 276 ? -72.104  -9.867  39.722  0    111.48 ? 272  LEU A HD21   1 
ATOM   4318  H HD22   . LEU A 1 276 ? -72.324  -8.543  38.552  0    108.21 ? 272  LEU A HD22   1 
ATOM   4319  H HD23   . LEU A 1 276 ? -72.621  -10.232 38.064  0    109.11 ? 272  LEU A HD23   1 
ATOM   4320  N N      . LEU A 1 277 ? -72.048  -9.475  34.017  1    56.61  ? 273  LEU A N      1 
ATOM   4321  C CA     . LEU A 1 277 ? -72.351  -8.841  32.731  1    54.44  ? 273  LEU A CA     1 
ATOM   4322  C C      . LEU A 1 277 ? -73.174  -7.576  33      1    53.61  ? 273  LEU A C      1 
ATOM   4323  O O      . LEU A 1 277 ? -74.036  -7.571  33.879  1    54.83  ? 273  LEU A O      1 
ATOM   4324  C CB     . LEU A 1 277 ? -73.159  -9.783  31.81   1    54.58  ? 273  LEU A CB     1 
ATOM   4325  C CG     . LEU A 1 277 ? -72.494  -11.076 31.346  1    55.32  ? 273  LEU A CG     1 
ATOM   4326  C CD1    . LEU A 1 277 ? -73.414  -11.837 30.423  1    55.38  ? 273  LEU A CD1    1 
ATOM   4327  C CD2    . LEU A 1 277 ? -71.173  -10.808 30.645  1    54.2   ? 273  LEU A CD2    1 
ATOM   4328  H H      . LEU A 1 277 ? -72.88   -9.601  34.584  0    95.33  ? 273  LEU A H      1 
ATOM   4329  H HA     . LEU A 1 277 ? -71.434  -8.544  32.225  0    88.77  ? 273  LEU A HA     1 
ATOM   4330  H HB2    . LEU A 1 277 ? -74.07   -10.066 32.336  0    90.87  ? 273  LEU A HB2    1 
ATOM   4331  H HB3    . LEU A 1 277 ? -73.426  -9.225  30.914  0    88.42  ? 273  LEU A HB3    1 
ATOM   4332  H HG     . LEU A 1 277 ? -72.292  -11.703 32.213  0    93.14  ? 273  LEU A HG     1 
ATOM   4333  H HD11   . LEU A 1 277 ? -72.937  -12.771 30.131  0    92.51  ? 273  LEU A HD11   1 
ATOM   4334  H HD12   . LEU A 1 277 ? -74.347  -12.044 30.944  0    92.77  ? 273  LEU A HD12   1 
ATOM   4335  H HD13   . LEU A 1 277 ? -73.605  -11.227 29.542  0    90.33  ? 273  LEU A HD13   1 
ATOM   4336  H HD21   . LEU A 1 277 ? -70.823  -11.728 30.18   0    89.65  ? 273  LEU A HD21   1 
ATOM   4337  H HD22   . LEU A 1 277 ? -71.322  -10.042 29.885  0    87.54  ? 273  LEU A HD22   1 
ATOM   4338  H HD23   . LEU A 1 277 ? -70.44   -10.47  31.376  0    89.49  ? 273  LEU A HD23   1 
ATOM   4339  N N      . GLY A 1 278 ? -72.898  -6.52   32.249  1    51.81  ? 274  GLY A N      1 
ATOM   4340  C CA     . GLY A 1 278 ? -73.623  -5.265  32.373  1    51.07  ? 274  GLY A CA     1 
ATOM   4341  C C      . GLY A 1 278 ? -74.075  -4.802  31.008  1    49.6   ? 274  GLY A C      1 
ATOM   4342  O O      . GLY A 1 278 ? -73.298  -4.895  30.057  1    49.06  ? 274  GLY A O      1 
ATOM   4343  H H      . GLY A 1 278 ? -72.178  -6.497  31.535  0    83.23  ? 274  GLY A H      1 
ATOM   4344  H HA2    . GLY A 1 278 ? -74.496  -5.366  33.016  0    83.53  ? 274  GLY A HA2    1 
ATOM   4345  H HA3    . GLY A 1 278 ? -72.966  -4.507  32.797  0    82.32  ? 274  GLY A HA3    1 
ATOM   4346  N N      . ASP A 1 279 ? -75.334  -4.333  30.887  1    49.17  ? 275  ASP A N      1 
ATOM   4347  C CA     . ASP A 1 279 ? -75.862  -3.853  29.609  1    48.06  ? 275  ASP A CA     1 
ATOM   4348  C C      . ASP A 1 279 ? -76.227  -2.369  29.643  1    47.55  ? 275  ASP A C      1 
ATOM   4349  O O      . ASP A 1 279 ? -76.189  -1.739  30.703  1    48.18  ? 275  ASP A O      1 
ATOM   4350  C CB     . ASP A 1 279 ? -77.041  -4.736  29.124  1    48.84  ? 275  ASP A CB     1 
ATOM   4351  C CG     . ASP A 1 279 ? -78.328  -4.638  29.922  1    50.2   ? 275  ASP A CG     1 
ATOM   4352  O OD1    . ASP A 1 279 ? -78.34   -3.921  30.942  1    50.46  ? 275  ASP A OD1    1 
ATOM   4353  O OD2    . ASP A 1 279 ? -79.322  -5.3    29.531  1    51.17  ? 275  ASP A OD2    1 
ATOM   4354  H H      . ASP A 1 279 ? -76.001  -4.277  31.65   0    79.49  ? 275  ASP A H      1 
ATOM   4355  H HA     . ASP A 1 279 ? -75.079  -3.894  28.855  0    75.16  ? 275  ASP A HA     1 
ATOM   4356  H HB2    . ASP A 1 279 ? -77.275  -4.455  28.098  0    76.94  ? 275  ASP A HB2    1 
ATOM   4357  H HB3    . ASP A 1 279 ? -76.721  -5.777  29.147  0    78.23  ? 275  ASP A HB3    1 
ATOM   4358  N N      . MET A 1 280 ? -76.527  -1.799  28.468  1    46.72  ? 276  MET A N      1 
ATOM   4359  C CA     . MET A 1 280 ? -76.876  -0.392  28.346  1    46.35  ? 276  MET A CA     1 
ATOM   4360  C C      . MET A 1 280 ? -77.971  0.078   29.277  1    47.68  ? 276  MET A C      1 
ATOM   4361  O O      . MET A 1 280 ? -77.999  1.26    29.59   1    47.87  ? 276  MET A O      1 
ATOM   4362  C CB     . MET A 1 280 ? -77.291  -0.061  26.904  1    45.66  ? 276  MET A CB     1 
ATOM   4363  C CG     . MET A 1 280 ? -76.139  0.129   25.949  1    44.43  ? 276  MET A CG     1 
ATOM   4364  S SD     . MET A 1 280 ? -74.933  1.363   26.488  1    44.17  ? 276  MET A SD     1 
ATOM   4365  C CE     . MET A 1 280 ? -75.911  2.866   26.453  1    43.25  ? 276  MET A CE     1 
ATOM   4366  H H      . MET A 1 280 ? -76.514  -2.299  27.585  0    72.49  ? 276  MET A H      1 
ATOM   4367  H HA     . MET A 1 280 ? -75.988  0.175   28.622  0    71.64  ? 276  MET A HA     1 
ATOM   4368  H HB2    . MET A 1 280 ? -77.906  -0.872  26.517  0    70.94  ? 276  MET A HB2    1 
ATOM   4369  H HB3    . MET A 1 280 ? -77.882  0.853   26.912  0    70.74  ? 276  MET A HB3    1 
ATOM   4370  H HG2    . MET A 1 280 ? -75.614  -0.818  25.838  0    67.77  ? 276  MET A HG2    1 
ATOM   4371  H HG3    . MET A 1 280 ? -76.531  0.448   24.984  0    67.5   ? 276  MET A HG3    1 
ATOM   4372  H HE1    . MET A 1 280 ? -75.261  3.711   26.676  0    66.04  ? 276  MET A HE1    1 
ATOM   4373  H HE2    . MET A 1 280 ? -76.342  2.986   25.46   0    65.73  ? 276  MET A HE2    1 
ATOM   4374  H HE3    . MET A 1 280 ? -76.699  2.81    27.202  0    66.98  ? 276  MET A HE3    1 
ATOM   4375  N N      . GLU A 1 281 ? -78.874  -0.805  29.708  1    48.75  ? 277  GLU A N      1 
ATOM   4376  C CA     . GLU A 1 281 ? -79.938  -0.409  30.634  1    50.38  ? 277  GLU A CA     1 
ATOM   4377  C C      . GLU A 1 281 ? -79.508  -0.391  32.106  1    51.27  ? 277  GLU A C      1 
ATOM   4378  O O      . GLU A 1 281 ? -80.352  -0.231  32.981  1    52.56  ? 277  GLU A O      1 
ATOM   4379  C CB     . GLU A 1 281 ? -81.183  -1.318  30.434  1    51.39  ? 277  GLU A CB     1 
ATOM   4380  C CG     . GLU A 1 281 ? -82.113  -0.883  29.309  1    52.06  ? 277  GLU A CG     1 
ATOM   4381  C CD     . GLU A 1 281 ? -82.518  0.574   29.419  1    52.55  ? 277  GLU A CD     1 
ATOM   4382  O OE1    . GLU A 1 281 ? -83.364  0.867   30.291  1    54.25  ? 277  GLU A OE1    1 
ATOM   4383  O OE2    . GLU A 1 281 ? -81.952  1.426   28.692  1    51.43  ? 277  GLU A OE2    1 
ATOM   4384  H H      . GLU A 1 281 ? -78.894  -1.783  29.438  0    77.4   ? 277  GLU A H      1 
ATOM   4385  H HA     . GLU A 1 281 ? -80.207  0.622   30.416  0    80.77  ? 277  GLU A HA     1 
ATOM   4386  H HB2    . GLU A 1 281 ? -80.86   -2.332  30.205  0    82.98  ? 277  GLU A HB2    1 
ATOM   4387  H HB3    . GLU A 1 281 ? -81.783  -1.336  31.342  0    84.62  ? 277  GLU A HB3    1 
ATOM   4388  H HG2    . GLU A 1 281 ? -81.633  -1.021  28.342  0    83.13  ? 277  GLU A HG2    1 
ATOM   4389  H HG3    . GLU A 1 281 ? -83.021  -1.482  29.356  0    85.36  ? 277  GLU A HG3    1 
ATOM   4390  N N      . GLY A 1 282 ? -78.217  -0.537  32.378  1    50.88  ? 278  GLY A N      1 
ATOM   4391  C CA     . GLY A 1 282 ? -77.715  -0.593  33.734  1    51.95  ? 278  GLY A CA     1 
ATOM   4392  C C      . GLY A 1 282 ? -77.84   -1.979  34.331  1    53.49  ? 278  GLY A C      1 
ATOM   4393  O O      . GLY A 1 282 ? -77.032  -2.329  35.191  1    54.68  ? 278  GLY A O      1 
ATOM   4394  H H      . GLY A 1 282 ? -77.478  -0.603  31.686  0    80.85  ? 278  GLY A H      1 
ATOM   4395  H HA2    . GLY A 1 282 ? -76.661  -0.32   33.73   0    83.66  ? 278  GLY A HA2    1 
ATOM   4396  H HA3    . GLY A 1 282 ? -78.244  0.111   34.373  0    85.17  ? 278  GLY A HA3    1 
ATOM   4397  N N      . ARG A 1 283 ? -78.836  -2.804  33.874  1    53.63  ? 279  ARG A N      1 
ATOM   4398  C CA     . ARG A 1 283 ? -79.096  -4.173  34.353  1    55.26  ? 279  ARG A CA     1 
ATOM   4399  C C      . ARG A 1 283 ? -77.82   -4.977  34.462  1    55.02  ? 279  ARG A C      1 
ATOM   4400  O O      . ARG A 1 283 ? -76.997  -4.975  33.547  1    53.53  ? 279  ARG A O      1 
ATOM   4401  C CB     . ARG A 1 283 ? -80.073  -4.905  33.426  1    55.59  ? 279  ARG A CB     1 
ATOM   4402  C CG     . ARG A 1 283 ? -81.51   -4.39   33.537  1    56.72  ? 279  ARG A CG     1 
ATOM   4403  C CD     . ARG A 1 283 ? -82.52   -4.71   32.433  1    55.89  ? 279  ARG A CD     1 
ATOM   4404  N NE     . ARG A 1 283 ? -81.995  -5.352  31.223  1    54.95  ? 279  ARG A NE     1 
ATOM   4405  C CZ     . ARG A 1 283 ? -82.71   -6.092  30.378  1    55.48  ? 279  ARG A CZ     1 
ATOM   4406  N NH1    . ARG A 1 283 ? -84.016  -6.274  30.569  1    56.95  ? 279  ARG A NH1    1 
ATOM   4407  N NH2    . ARG A 1 283 ? -82.13   -6.647  29.32   1    54.76  ? 279  ARG A NH2    1 
ATOM   4408  H H      . ARG A 1 283 ? -79.507  -2.539  33.162  0    87.67  ? 279  ARG A H      1 
ATOM   4409  H HA     . ARG A 1 283 ? -79.55   -4.103  35.341  0    93.09  ? 279  ARG A HA     1 
ATOM   4410  H HB2    . ARG A 1 283 ? -79.698  -4.74   32.418  0    90.76  ? 279  ARG A HB2    1 
ATOM   4411  H HB3    . ARG A 1 283 ? -80.062  -5.968  33.662  0    93.2   ? 279  ARG A HB3    1 
ATOM   4412  H HG2    . ARG A 1 283 ? -81.938  -4.808  34.447  0    96.3   ? 279  ARG A HG2    1 
ATOM   4413  H HG3    . ARG A 1 283 ? -81.476  -3.306  33.636  0    94.38  ? 279  ARG A HG3    1 
ATOM   4414  H HD2    . ARG A 1 283 ? -83.246  -5.367  32.911  0    94.91  ? 279  ARG A HD2    1 
ATOM   4415  H HD3    . ARG A 1 283 ? -83.002  -3.782  32.128  0    92.75  ? 279  ARG A HD3    1 
ATOM   4416  H HE     . ARG A 1 283 ? -81.021  -5.23   30.973  0    89.76  ? 279  ARG A HE     1 
ATOM   4417  H HH11   . ARG A 1 283 ? -84.52   -5.871  31.351  0    96.44  ? 279  ARG A HH11   1 
ATOM   4418  H HH12   . ARG A 1 283 ? -84.55   -6.842  29.915  0    95.86  ? 279  ARG A HH12   1 
ATOM   4419  H HH21   . ARG A 1 283 ? -81.137  -6.5    29.15   0    88.98  ? 279  ARG A HH21   1 
ATOM   4420  H HH22   . ARG A 1 283 ? -82.683  -7.192  28.666  0    90.58  ? 279  ARG A HH22   1 
ATOM   4421  N N      . LEU A 1 284 ? -77.656  -5.637  35.598  1    56.71  ? 280  LEU A N      1 
ATOM   4422  C CA     . LEU A 1 284 ? -76.454  -6.384  35.94   1    57.23  ? 280  LEU A CA     1 
ATOM   4423  C C      . LEU A 1 284 ? -76.837  -7.839  36.085  1    58.9   ? 280  LEU A C      1 
ATOM   4424  O O      . LEU A 1 284 ? -77.677  -8.147  36.912  1    60.73  ? 280  LEU A O      1 
ATOM   4425  C CB     . LEU A 1 284 ? -75.892  -5.858  37.269  1    58.43  ? 280  LEU A CB     1 
ATOM   4426  C CG     . LEU A 1 284 ? -74.617  -6.526  37.775  1    59.34  ? 280  LEU A CG     1 
ATOM   4427  C CD1    . LEU A 1 284 ? -73.412  -6.027  37.025  1    57.58  ? 280  LEU A CD1    1 
ATOM   4428  C CD2    . LEU A 1 284 ? -74.43   -6.278  39.244  1    61.41  ? 280  LEU A CD2    1 
ATOM   4429  H H      . LEU A 1 284 ? -78.407  -5.758  36.272  0    96.35  ? 280  LEU A H      1 
ATOM   4430  H HA     . LEU A 1 284 ? -75.689  -6.283  35.172  0    94.53  ? 280  LEU A HA     1 
ATOM   4431  H HB2    . LEU A 1 284 ? -75.677  -4.797  37.146  0    97.63  ? 280  LEU A HB2    1 
ATOM   4432  H HB3    . LEU A 1 284 ? -76.655  -5.975  38.037  0    100.17 ? 280  LEU A HB3    1 
ATOM   4433  H HG     . LEU A 1 284 ? -74.667  -7.605  37.638  0    101.32 ? 280  LEU A HG     1 
ATOM   4434  H HD11   . LEU A 1 284 ? -72.521  -6.505  37.431  0    97.61  ? 280  LEU A HD11   1 
ATOM   4435  H HD12   . LEU A 1 284 ? -73.514  -6.28   35.971  0    95.46  ? 280  LEU A HD12   1 
ATOM   4436  H HD13   . LEU A 1 284 ? -73.335  -4.947  37.141  0    96.08  ? 280  LEU A HD13   1 
ATOM   4437  H HD21   . LEU A 1 284 ? -73.512  -6.765  39.573  0    105.93 ? 280  LEU A HD21   1 
ATOM   4438  H HD22   . LEU A 1 284 ? -74.359  -5.204  39.412  0    104.65 ? 280  LEU A HD22   1 
ATOM   4439  H HD23   . LEU A 1 284 ? -75.281  -6.684  39.789  0    106.64 ? 280  LEU A HD23   1 
ATOM   4440  N N      . PHE A 1 285 ? -76.232  -8.732  35.296  1    58.47  ? 281  PHE A N      1 
ATOM   4441  C CA     . PHE A 1 285 ? -76.517  -10.163 35.369  1    60.04  ? 281  PHE A CA     1 
ATOM   4442  C C      . PHE A 1 285 ? -75.278  -10.943 35.85   1    61.05  ? 281  PHE A C      1 
ATOM   4443  O O      . PHE A 1 285 ? -74.166  -10.413 35.93   1    60.28  ? 281  PHE A O      1 
ATOM   4444  C CB     . PHE A 1 285 ? -76.934  -10.706 33.986  1    58.95  ? 281  PHE A CB     1 
ATOM   4445  C CG     . PHE A 1 285 ? -77.881  -9.871  33.167  1    57.61  ? 281  PHE A CG     1 
ATOM   4446  C CD1    . PHE A 1 285 ? -79.236  -10.146 33.15   1    58.66  ? 281  PHE A CD1    1 
ATOM   4447  C CD2    . PHE A 1 285 ? -77.404  -8.911  32.3    1    55.5   ? 281  PHE A CD2    1 
ATOM   4448  C CE1    . PHE A 1 285 ? -80.101  -9.42   32.339  1    57.68  ? 281  PHE A CE1    1 
ATOM   4449  C CE2    . PHE A 1 285 ? -78.275  -8.177  31.499  1    54.52  ? 281  PHE A CE2    1 
ATOM   4450  C CZ     . PHE A 1 285 ? -79.616  -8.434  31.525  1    55.63  ? 281  PHE A CZ     1 
ATOM   4451  H H      . PHE A 1 285 ? -75.538  -8.497  34.592  0    97.12  ? 281  PHE A H      1 
ATOM   4452  H HA     . PHE A 1 285 ? -77.328  -10.365 36.066  0    103.48 ? 281  PHE A HA     1 
ATOM   4453  H HB2    . PHE A 1 285 ? -76.036  -10.853 33.389  0    98.69  ? 281  PHE A HB2    1 
ATOM   4454  H HB3    . PHE A 1 285 ? -77.418  -11.668 34.146  0    101.09 ? 281  PHE A HB3    1 
ATOM   4455  H HD1    . PHE A 1 285 ? -79.632  -10.912 33.793  0    100.78 ? 281  PHE A HD1    1 
ATOM   4456  H HD2    . PHE A 1 285 ? -76.349  -8.696  32.274  0    91.34  ? 281  PHE A HD2    1 
ATOM   4457  H HE1    . PHE A 1 285 ? -81.157  -9.611  32.375  0    97.9   ? 281  PHE A HE1    1 
ATOM   4458  H HE2    . PHE A 1 285 ? -77.888  -7.407  30.85   0    88.44  ? 281  PHE A HE2    1 
ATOM   4459  H HZ     . PHE A 1 285 ? -80.287  -7.864  30.904  0    91.8   ? 281  PHE A HZ     1 
ATOM   4460  N N      . MET A 1 286 ? -75.49   -12.22  36.14   1    62.94  ? 282  MET A N      1 
ATOM   4461  C CA     . MET A 1 286 ? -74.463  -13.162 36.527  1    64.4   ? 282  MET A CA     1 
ATOM   4462  C C      . MET A 1 286 ? -74.569  -14.318 35.537  1    64.55  ? 282  MET A C      1 
ATOM   4463  O O      . MET A 1 286 ? -75.646  -14.896 35.38   1    65.52  ? 282  MET A O      1 
ATOM   4464  C CB     . MET A 1 286 ? -74.722  -13.66  37.952  1    67.27  ? 282  MET A CB     1 
ATOM   4465  C CG     . MET A 1 286 ? -73.642  -14.568 38.484  1    69.27  ? 282  MET A CG     1 
ATOM   4466  S SD     . MET A 1 286 ? -72.162  -13.661 38.97   1    68.73  ? 282  MET A SD     1 
ATOM   4467  C CE     . MET A 1 286 ? -72.604  -13.208 40.637  1    70.72  ? 282  MET A CE     1 
ATOM   4468  H H      . MET A 1 286 ? -76.412  -12.645 36.106  0    109.19 ? 282  MET A H      1 
ATOM   4469  H HA     . MET A 1 286 ? -73.473  -12.711 36.478  0    110.78 ? 282  MET A HA     1 
ATOM   4470  H HB2    . MET A 1 286 ? -74.771  -12.793 38.608  0    117.82 ? 282  MET A HB2    1 
ATOM   4471  H HB3    . MET A 1 286 ? -75.666  -14.202 37.98   0    118.87 ? 282  MET A HB3    1 
ATOM   4472  H HG2    . MET A 1 286 ? -74.02   -15.086 39.364  0    124.42 ? 282  MET A HG2    1 
ATOM   4473  H HG3    . MET A 1 286 ? -73.346  -15.289 37.724  0    121.99 ? 282  MET A HG3    1 
ATOM   4474  H HE1    . MET A 1 286 ? -71.778  -12.658 41.085  0    125.72 ? 282  MET A HE1    1 
ATOM   4475  H HE2    . MET A 1 286 ? -73.494  -12.582 40.607  0    124.81 ? 282  MET A HE2    1 
ATOM   4476  H HE3    . MET A 1 286 ? -72.804  -14.113 41.209  0    127.91 ? 282  MET A HE3    1 
ATOM   4477  N N      . LEU A 1 287 ? -73.469  -14.621 34.845  1    63.73  ? 283  LEU A N      1 
ATOM   4478  C CA     . LEU A 1 287 ? -73.381  -15.716 33.894  1    64.07  ? 283  LEU A CA     1 
ATOM   4479  C C      . LEU A 1 287 ? -72.64   -16.816 34.621  1    66.66  ? 283  LEU A C      1 
ATOM   4480  O O      . LEU A 1 287 ? -71.456  -16.662 34.916  1    66.89  ? 283  LEU A O      1 
ATOM   4481  C CB     . LEU A 1 287 ? -72.627  -15.27  32.64   1    61.88  ? 283  LEU A CB     1 
ATOM   4482  C CG     . LEU A 1 287 ? -72.333  -16.332 31.593  1    62.3   ? 283  LEU A CG     1 
ATOM   4483  C CD1    . LEU A 1 287 ? -73.601  -16.9   30.997  1    62.6   ? 283  LEU A CD1    1 
ATOM   4484  C CD2    . LEU A 1 287 ? -71.511  -15.749 30.47   1    60.38  ? 283  LEU A CD2    1 
ATOM   4485  H H      . LEU A 1 287 ? -72.597  -14.109 34.931  0    109.51 ? 283  LEU A H      1 
ATOM   4486  H HA     . LEU A 1 287 ? -74.374  -16.058 33.612  0    111.21 ? 283  LEU A HA     1 
ATOM   4487  H HB2    . LEU A 1 287 ? -73.22   -14.498 32.151  0    104.53 ? 283  LEU A HB2    1 
ATOM   4488  H HB3    . LEU A 1 287 ? -71.671  -14.843 32.939  0    105.84 ? 283  LEU A HB3    1 
ATOM   4489  H HG     . LEU A 1 287 ? -71.762  -17.152 32.025  0    108.81 ? 283  LEU A HG     1 
ATOM   4490  H HD11   . LEU A 1 287 ? -73.324  -17.618 30.226  0    107.91 ? 283  LEU A HD11   1 
ATOM   4491  H HD12   . LEU A 1 287 ? -74.189  -17.403 31.762  0    109.36 ? 283  LEU A HD12   1 
ATOM   4492  H HD13   . LEU A 1 287 ? -74.163  -16.084 30.546  0    106.1  ? 283  LEU A HD13   1 
ATOM   4493  H HD21   . LEU A 1 287 ? -71.238  -16.546 29.779  0    103.35 ? 283  LEU A HD21   1 
ATOM   4494  H HD22   . LEU A 1 287 ? -72.103  -14.996 29.952  0    101.15 ? 283  LEU A HD22   1 
ATOM   4495  H HD23   . LEU A 1 287 ? -70.611  -15.294 30.878  0    102.73 ? 283  LEU A HD23   1 
ATOM   4496  N N      . LEU A 1 288 ? -73.367  -17.882 34.994  1    68.83  ? 284  LEU A N      1 
ATOM   4497  C CA     . LEU A 1 288 ? -72.84   -18.999 35.765  1    71.76  ? 284  LEU A CA     1 
ATOM   4498  C C      . LEU A 1 288 ? -72.53   -20.214 34.886  1    72.7   ? 284  LEU A C      1 
ATOM   4499  O O      . LEU A 1 288 ? -73.406  -20.686 34.167  1    72.67  ? 284  LEU A O      1 
ATOM   4500  C CB     . LEU A 1 288 ? -73.86   -19.382 36.851  1    74.04  ? 284  LEU A CB     1 
ATOM   4501  C CG     . LEU A 1 288 ? -74.23   -18.283 37.858  1    73.81  ? 284  LEU A CG     1 
ATOM   4502  C CD1    . LEU A 1 288 ? -75.487  -17.574 37.45   1    72.54  ? 284  LEU A CD1    1 
ATOM   4503  C CD2    . LEU A 1 288 ? -74.441  -18.858 39.222  1    77.01  ? 284  LEU A CD2    1 
ATOM   4504  H H      . LEU A 1 288 ? -74.343  -18.008 34.749  0    121.43 ? 284  LEU A H      1 
ATOM   4505  H HA     . LEU A 1 288 ? -71.929  -18.697 36.279  0    128.12 ? 284  LEU A HA     1 
ATOM   4506  H HB2    . LEU A 1 288 ? -74.78   -19.696 36.359  0    132.78 ? 284  LEU A HB2    1 
ATOM   4507  H HB3    . LEU A 1 288 ? -73.454  -20.22  37.416  0    135.21 ? 284  LEU A HB3    1 
ATOM   4508  H HG     . LEU A 1 288 ? -73.429  -17.551 37.954  0    131.24 ? 284  LEU A HG     1 
ATOM   4509  H HD11   . LEU A 1 288 ? -75.676  -16.759 38.148  0    129.39 ? 284  LEU A HD11   1 
ATOM   4510  H HD12   . LEU A 1 288 ? -75.369  -17.175 36.444  0    127.31 ? 284  LEU A HD12   1 
ATOM   4511  H HD13   . LEU A 1 288 ? -76.317  -18.279 37.477  0    130.94 ? 284  LEU A HD13   1 
ATOM   4512  H HD21   . LEU A 1 288 ? -74.77   -18.068 39.896  0    139.48 ? 284  LEU A HD21   1 
ATOM   4513  H HD22   . LEU A 1 288 ? -75.198  -19.638 39.165  0    140.96 ? 284  LEU A HD22   1 
ATOM   4514  H HD23   . LEU A 1 288 ? -73.501  -19.276 39.579  0    140.66 ? 284  LEU A HD23   1 
ATOM   4515  N N      . LEU A 1 289 ? -71.284  -20.723 34.965  1    73.88  ? 285  LEU A N      1 
ATOM   4516  C CA     . LEU A 1 289 ? -70.807  -21.895 34.227  1    75.19  ? 285  LEU A CA     1 
ATOM   4517  C C      . LEU A 1 289 ? -70.981  -23.169 35.09   1    78.85  ? 285  LEU A C      1 
ATOM   4518  O O      . LEU A 1 289 ? -70.221  -23.414 36.038  1    80.79  ? 285  LEU A O      1 
ATOM   4519  C CB     . LEU A 1 289 ? -69.335  -21.725 33.824  1    74.62  ? 285  LEU A CB     1 
ATOM   4520  C CG     . LEU A 1 289 ? -69.066  -20.788 32.668  1    71.48  ? 285  LEU A CG     1 
ATOM   4521  C CD1    . LEU A 1 289 ? -69.371  -19.372 33.033  1    69.18  ? 285  LEU A CD1    1 
ATOM   4522  C CD2    . LEU A 1 289 ? -67.641  -20.883 32.229  1    71.62  ? 285  LEU A CD2    1 
ATOM   4523  H H      . LEU A 1 289 ? -70.568  -20.326 35.565  0    132.79 ? 285  LEU A H      1 
ATOM   4524  H HA     . LEU A 1 289 ? -71.395  -22.02  33.319  0    134.4  ? 285  LEU A HA     1 
ATOM   4525  H HB2    . LEU A 1 289 ? -68.772  -21.353 34.677  0    134.66 ? 285  LEU A HB2    1 
ATOM   4526  H HB3    . LEU A 1 289 ? -68.952  -22.705 33.543  0    135.89 ? 285  LEU A HB3    1 
ATOM   4527  H HG     . LEU A 1 289 ? -69.7    -21.066 31.828  0    126.67 ? 285  LEU A HG     1 
ATOM   4528  H HD11   . LEU A 1 289 ? -69.134  -18.731 32.185  0    120.14 ? 285  LEU A HD11   1 
ATOM   4529  H HD12   . LEU A 1 289 ? -70.428  -19.278 33.276  0    122.17 ? 285  LEU A HD12   1 
ATOM   4530  H HD13   . LEU A 1 289 ? -68.764  -19.089 33.892  0    122.86 ? 285  LEU A HD13   1 
ATOM   4531  H HD21   . LEU A 1 289 ? -67.49   -20.23  31.37   0    125.45 ? 285  LEU A HD21   1 
ATOM   4532  H HD22   . LEU A 1 289 ? -66.997  -20.569 33.049  0    128.15 ? 285  LEU A HD22   1 
ATOM   4533  H HD23   . LEU A 1 289 ? -67.417  -21.912 31.952  0    129.38 ? 285  LEU A HD23   1 
ATOM   4534  N N      . GLU A 1 290 ? -72.003  -23.972 34.74   1    79.99  ? 286  GLU A N      1 
ATOM   4535  C CA     . GLU A 1 290 ? -72.376  -25.195 35.447  1    83.6   ? 286  GLU A CA     1 
ATOM   4536  C C      . GLU A 1 290 ? -71.393  -26.321 35.123  1    85.71  ? 286  GLU A C      1 
ATOM   4537  O O      . GLU A 1 290 ? -71.303  -26.747 33.976  1    84.71  ? 286  GLU A O      1 
ATOM   4538  C CB     . GLU A 1 290 ? -73.811  -25.615 35.054  1    84.21  ? 286  GLU A CB     1 
ATOM   4539  C CG     . GLU A 1 290 ? -74.882  -24.577 35.377  1    82.67  ? 286  GLU A CG     1 
ATOM   4540  C CD     . GLU A 1 290 ? -76.266  -24.884 34.831  1    83.04  ? 286  GLU A CD     1 
ATOM   4541  O OE1    . GLU A 1 290 ? -76.756  -26.012 35.071  1    85.98  ? 286  GLU A OE1    1 
ATOM   4542  O OE2    . GLU A 1 290 ? -76.867  -23.995 34.181  1    80.58  ? 286  GLU A OE2    1 
ATOM   4543  H H      . GLU A 1 290 ? -72.597  -23.795 33.937  0    144.43 ? 286  GLU A H      1 
ATOM   4544  H HA     . GLU A 1 290 ? -72.365  -25.002 36.519  0    154.93 ? 286  GLU A HA     1 
ATOM   4545  H HB2    . GLU A 1 290 ? -73.843  -25.798 33.981  0    154.04 ? 286  GLU A HB2    1 
ATOM   4546  H HB3    . GLU A 1 290 ? -74.064  -26.529 35.588  0    157.88 ? 286  GLU A HB3    1 
ATOM   4547  H HG2    . GLU A 1 290 ? -74.969  -24.504 36.46   0    153.11 ? 286  GLU A HG2    1 
ATOM   4548  H HG3    . GLU A 1 290 ? -74.584  -23.612 34.971  0    149.04 ? 286  GLU A HG3    1 
ATOM   4549  N N      . LYS A 1 291 ? -70.681  -26.814 36.136  1    88.87  ? 287  LYS A N      1 
ATOM   4550  C CA     . LYS A 1 291 ? -69.692  -27.881 35.987  1    91.43  ? 287  LYS A CA     1 
ATOM   4551  C C      . LYS A 1 291 ? -70.307  -29.285 35.976  1    94.56  ? 287  LYS A C      1 
ATOM   4552  O O      . LYS A 1 291 ? -71.461  -29.467 36.362  1    95.3   ? 287  LYS A O      1 
ATOM   4553  C CB     . LYS A 1 291 ? -68.694  -27.776 37.144  1    93.51  ? 287  LYS A CB     1 
ATOM   4554  C CG     . LYS A 1 291 ? -67.853  -26.514 37.083  1    90.99  ? 287  LYS A CG     1 
ATOM   4555  C CD     . LYS A 1 291 ? -66.872  -26.363 38.252  1    93.42  ? 287  LYS A CD     1 
ATOM   4556  C CE     . LYS A 1 291 ? -67.483  -26.048 39.599  1    95.06  ? 287  LYS A CE     1 
ATOM   4557  N NZ     . LYS A 1 291 ? -68.172  -24.725 39.626  1    91.99  ? 287  LYS A NZ     1 
ATOM   4558  H H      . LYS A 1 291 ? -70.768  -26.479 37.09   0    166.36 ? 287  LYS A H      1 
ATOM   4559  H HA     . LYS A 1 291 ? -69.144  -27.749 35.055  0    169.4  ? 287  LYS A HA     1 
ATOM   4560  H HB2    . LYS A 1 291 ? -69.251  -27.777 38.08   0    176.52 ? 287  LYS A HB2    1 
ATOM   4561  H HB3    . LYS A 1 291 ? -68.042  -28.644 37.124  0    177.81 ? 287  LYS A HB3    1 
ATOM   4562  H HG2    . LYS A 1 291 ? -67.272  -26.534 36.162  0    168.69 ? 287  LYS A HG2    1 
ATOM   4563  H HG3    . LYS A 1 291 ? -68.508  -25.645 37.079  0    167.44 ? 287  LYS A HG3    1 
ATOM   4564  H HD2    . LYS A 1 291 ? -66.301  -27.282 38.362  0    177.57 ? 287  LYS A HD2    1 
ATOM   4565  H HD3    . LYS A 1 291 ? -66.189  -25.544 38.03   0    173.15 ? 287  LYS A HD3    1 
ATOM   4566  H HE2    . LYS A 1 291 ? -68.197  -26.82  39.88   0    180.43 ? 287  LYS A HE2    1 
ATOM   4567  H HE3    . LYS A 1 291 ? -66.679  -26.013 40.332  0    180.48 ? 287  LYS A HE3    1 
ATOM   4568  H HZ1    . LYS A 1 291 ? -68.55   -24.565 40.555  0    173.21 ? 287  LYS A HZ1    1 
ATOM   4569  H HZ2    . LYS A 1 291 ? -67.517  -23.982 39.406  0    170.27 ? 287  LYS A HZ2    1 
ATOM   4570  H HZ3    . LYS A 1 291 ? -68.939  -24.705 38.961  0    170.09 ? 287  LYS A HZ3    1 
ATOM   4571  N N      . GLU A 1 292 ? -69.531  -30.276 35.516  1    96.54  ? 288  GLU A N      1 
ATOM   4572  C CA     . GLU A 1 292 ? -69.932  -31.687 35.527  1    100.07 ? 288  GLU A CA     1 
ATOM   4573  C C      . GLU A 1 292 ? -68.671  -32.545 35.675  1    103.11 ? 288  GLU A C      1 
ATOM   4574  O O      . GLU A 1 292 ? -67.972  -32.793 34.692  1    102.52 ? 288  GLU A O      1 
ATOM   4575  C CB     . GLU A 1 292 ? -70.746  -32.054 34.273  1    98.94  ? 288  GLU A CB     1 
ATOM   4576  C CG     . GLU A 1 292 ? -70.933  -33.544 34.016  1    102.78 ? 288  GLU A CG     1 
ATOM   4577  C CD     . GLU A 1 292 ? -71.698  -33.881 32.75   1    101.96 ? 288  GLU A CD     1 
ATOM   4578  O OE1    . GLU A 1 292 ? -72.415  -34.908 32.75   1    104.8  ? 288  GLU A OE1    1 
ATOM   4579  O OE2    . GLU A 1 292 ? -71.58   -33.126 31.757  1    98.68  ? 288  GLU A OE2    1 
ATOM   4580  H H      . GLU A 1 292 ? -68.607  -30.124 35.121  0    181.07 ? 288  GLU A H      1 
ATOM   4581  H HA     . GLU A 1 292 ? -70.56   -31.884 36.395  0    191.57 ? 288  GLU A HA     1 
ATOM   4582  H HB2    . GLU A 1 292 ? -71.747  -31.659 34.436  0    186.58 ? 288  GLU A HB2    1 
ATOM   4583  H HB3    . GLU A 1 292 ? -70.281  -31.597 33.401  0    185.63 ? 288  GLU A HB3    1 
ATOM   4584  H HG2    . GLU A 1 292 ? -69.962  -34.027 33.923  0    197.86 ? 288  GLU A HG2    1 
ATOM   4585  H HG3    . GLU A 1 292 ? -71.474  -33.976 34.858  0    198.28 ? 288  GLU A HG3    1 
ATOM   4586  N N      . GLU A 1 293 ? -68.375  -32.981 36.908  1    106.43 ? 289  GLU A N      1 
ATOM   4587  C CA     . GLU A 1 293 ? -67.182  -33.771 37.179  1    109.74 ? 289  GLU A CA     1 
ATOM   4588  C C      . GLU A 1 293 ? -67.257  -35.169 36.552  1    112.84 ? 289  GLU A C      1 
ATOM   4589  O O      . GLU A 1 293 ? -68.031  -36.017 36.994  1    115.58 ? 289  GLU A O      1 
ATOM   4590  C CB     . GLU A 1 293 ? -66.929  -33.858 38.688  1    112.61 ? 289  GLU A CB     1 
ATOM   4591  C CG     . GLU A 1 293 ? -65.591  -34.496 39.034  1    116.03 ? 289  GLU A CG     1 
ATOM   4592  C CD     . GLU A 1 293 ? -65.109  -34.301 40.463  1    116.18 ? 289  GLU A CD     1 
ATOM   4593  O OE1    . GLU A 1 293 ? -65.346  -33.208 41.035  1    116.56 ? 289  GLU A OE1    1 
ATOM   4594  O OE2    . GLU A 1 293 ? -64.435  -35.219 40.985  1    116.15 ? 289  GLU A OE2    1 
ATOM   4595  H H      . GLU A 1 293 ? -68.945  -32.808 37.73   0    204.5  ? 289  GLU A H      1 
ATOM   4596  H HA     . GLU A 1 293 ? -66.325  -33.26  36.746  0    209.87 ? 289  GLU A HA     1 
ATOM   4597  H HB2    . GLU A 1 293 ? -66.968  -32.854 39.108  0    215.17 ? 289  GLU A HB2    1 
ATOM   4598  H HB3    . GLU A 1 293 ? -67.706  -34.472 39.141  0    219.45 ? 289  GLU A HB3    1 
ATOM   4599  H HG2    . GLU A 1 293 ? -65.654  -35.564 38.825  0    228.66 ? 289  GLU A HG2    1 
ATOM   4600  H HG3    . GLU A 1 293 ? -64.824  -34.056 38.4    0    224.39 ? 289  GLU A HG3    1 
ATOM   4601  N N      . GLN A 1 294 ? -66.434  -35.4   35.517  1    112.68 ? 290  GLN A N      1 
ATOM   4602  C CA     . GLN A 1 294 ? -66.374  -36.678 34.814  1    115.69 ? 290  GLN A CA     1 
ATOM   4603  C C      . GLN A 1 294 ? -65.654  -37.729 35.664  1    120.62 ? 290  GLN A C      1 
ATOM   4604  O O      . GLN A 1 294 ? -64.909  -37.372 36.579  1    121.44 ? 290  GLN A O      1 
ATOM   4605  C CB     . GLN A 1 294 ? -65.625  -36.508 33.477  1    113.71 ? 290  GLN A CB     1 
ATOM   4606  C CG     . GLN A 1 294 ? -66.278  -35.542 32.493  1    109.15 ? 290  GLN A CG     1 
ATOM   4607  C CD     . GLN A 1 294 ? -67.578  -36.07  31.94   1    109.48 ? 290  GLN A CD     1 
ATOM   4608  O OE1    . GLN A 1 294 ? -68.291  -36.845 32.593  1    112.93 ? 290  GLN A OE1    1 
ATOM   4609  N NE2    . GLN A 1 294 ? -67.929  -35.658 30.726  1    106.11 ? 290  GLN A NE2    1 
ATOM   4610  H H      . GLN A 1 294 ? -65.784  -34.711 35.151  0    215.58 ? 290  GLN A H      1 
ATOM   4611  H HA     . GLN A 1 294 ? -67.382  -37.032 34.608  0    224.99 ? 290  GLN A HA     1 
ATOM   4612  H HB2    . GLN A 1 294 ? -64.622  -36.135 33.679  0    219.82 ? 290  GLN A HB2    1 
ATOM   4613  H HB3    . GLN A 1 294 ? -65.561  -37.479 32.99   0    222.6  ? 290  GLN A HB3    1 
ATOM   4614  H HG2    . GLN A 1 294 ? -66.489  -34.595 32.986  0    207.71 ? 290  GLN A HG2    1 
ATOM   4615  H HG3    . GLN A 1 294 ? -65.594  -35.375 31.662  0    209.08 ? 290  GLN A HG3    1 
ATOM   4616  H HE21   . GLN A 1 294 ? -67.332  -35.025 30.203  0    201    ? 290  GLN A HE21   1 
ATOM   4617  H HE22   . GLN A 1 294 ? -68.793  -35.988 30.307  0    203.39 ? 290  GLN A HE22   1 
ATOM   4618  N N      . MET A 1 295 ? -65.855  -39.018 35.367  1    124.12 ? 291  MET A N      1 
ATOM   4619  C CA     . MET A 1 295 ? -65.138  -40.08  36.091  1    129.37 ? 291  MET A CA     1 
ATOM   4620  C C      . MET A 1 295 ? -63.63   -40.071 35.808  1    130.34 ? 291  MET A C      1 
ATOM   4621  O O      . MET A 1 295 ? -62.843  -40.507 36.647  1    134.15 ? 291  MET A O      1 
ATOM   4622  C CB     . MET A 1 295 ? -65.752  -41.438 35.802  1    133.07 ? 291  MET A CB     1 
ATOM   4623  C CG     . MET A 1 295 ? -67.133  -41.555 36.359  1    133.43 ? 291  MET A CG     1 
ATOM   4624  S SD     . MET A 1 295 ? -67.872  -43.158 36.053  1    137.72 ? 291  MET A SD     1 
ATOM   4625  C CE     . MET A 1 295 ? -69.547  -42.692 36.133  1    136.64 ? 291  MET A CE     1 
ATOM   4626  H H      . MET A 1 295 ? -66.506  -39.332 34.655  0    242.85 ? 291  MET A H      1 
ATOM   4627  H HA     . MET A 1 295 ? -65.235  -39.885 37.159  0    255.67 ? 291  MET A HA     1 
ATOM   4628  H HB2    . MET A 1 295 ? -65.802  -41.622 34.73   0    261.83 ? 291  MET A HB2    1 
ATOM   4629  H HB3    . MET A 1 295 ? -65.131  -42.195 36.28   0    266.77 ? 291  MET A HB3    1 
ATOM   4630  H HG2    . MET A 1 295 ? -67.092  -41.414 37.438  0    264.46 ? 291  MET A HG2    1 
ATOM   4631  H HG3    . MET A 1 295 ? -67.772  -40.795 35.912  0    259.46 ? 291  MET A HG3    1 
ATOM   4632  H HE1    . MET A 1 295 ? -70.166  -43.561 35.921  0    271.19 ? 291  MET A HE1    1 
ATOM   4633  H HE2    . MET A 1 295 ? -69.759  -42.313 37.132  0    268.38 ? 291  MET A HE2    1 
ATOM   4634  H HE3    . MET A 1 295 ? -69.739  -41.918 35.392  0    264.92 ? 291  MET A HE3    1 
ATOM   4635  N N      . ASP A 1 296 ? -63.239  -39.557 34.632  1    127.1  ? 292  ASP A N      1 
ATOM   4636  C CA     . ASP A 1 296 ? -61.852  -39.289 34.226  1    127.41 ? 292  ASP A CA     1 
ATOM   4637  C C      . ASP A 1 296 ? -61.082  -38.514 35.328  1    127    ? 292  ASP A C      1 
ATOM   4638  O O      . ASP A 1 296 ? -59.925  -38.833 35.61   1    129.68 ? 292  ASP A O      1 
ATOM   4639  C CB     . ASP A 1 296 ? -61.878  -38.475 32.889  1    123.24 ? 292  ASP A CB     1 
ATOM   4640  C CG     . ASP A 1 296 ? -60.635  -37.714 32.458  1    122.82 ? 292  ASP A CG     1 
ATOM   4641  O OD1    . ASP A 1 296 ? -60.753  -36.853 31.552  1    118.72 ? 292  ASP A OD1    1 
ATOM   4642  O OD2    . ASP A 1 296 ? -59.55   -37.978 33.013  1    126.78 ? 292  ASP A OD2    1 
ATOM   4643  H H      . ASP A 1 296 ? -63.911  -39.374 33.893  0    247.39 ? 292  ASP A H      1 
ATOM   4644  H HA     . ASP A 1 296 ? -61.334  -40.229 34.049  0    253.58 ? 292  ASP A HA     1 
ATOM   4645  H HB2    . ASP A 1 296 ? -62.113  -39.172 32.086  0    241.47 ? 292  ASP A HB2    1 
ATOM   4646  H HB3    . ASP A 1 296 ? -62.669  -37.73  32.958  0    237.29 ? 292  ASP A HB3    1 
ATOM   4647  N N      . GLY A 1 297 ? -61.744  -37.523 35.924  1    123.88 ? 293  GLY A N      1 
ATOM   4648  C CA     . GLY A 1 297 ? -61.163  -36.618 36.909  1    122.91 ? 293  GLY A CA     1 
ATOM   4649  C C      . GLY A 1 297 ? -61.383  -35.18  36.47   1    117.46 ? 293  GLY A C      1 
ATOM   4650  O O      . GLY A 1 297 ? -61.616  -34.297 37.301  1    115.93 ? 293  GLY A O      1 
ATOM   4651  H H      . GLY A 1 297 ? -62.716  -37.296 35.736  0    240.35 ? 293  GLY A H      1 
ATOM   4652  H HA2    . GLY A 1 297 ? -61.645  -36.771 37.874  0    242.11 ? 293  GLY A HA2    1 
ATOM   4653  H HA3    . GLY A 1 297 ? -60.093  -36.784 37.026  0    242.21 ? 293  GLY A HA3    1 
ATOM   4654  N N      . THR A 1 298 ? -61.316  -34.938 35.141  1    114.7  ? 294  THR A N      1 
ATOM   4655  C CA     . THR A 1 298 ? -61.562  -33.625 34.533  1    109.64 ? 294  THR A CA     1 
ATOM   4656  C C      . THR A 1 298 ? -62.998  -33.164 34.792  1    107.57 ? 294  THR A C      1 
ATOM   4657  O O      . THR A 1 298 ? -63.888  -33.989 35.014  1    109.76 ? 294  THR A O      1 
ATOM   4658  C CB     . THR A 1 298 ? -61.328  -33.686 33.008  1    108.07 ? 294  THR A CB     1 
ATOM   4659  O OG1    . THR A 1 298 ? -62.067  -34.783 32.468  1    110.45 ? 294  THR A OG1    1 
ATOM   4660  C CG2    . THR A 1 298 ? -59.864  -33.828 32.641  1    108.99 ? 294  THR A CG2    1 
ATOM   4661  H H      . THR A 1 298 ? -61.064  -35.65  34.463  0    223.77 ? 294  THR A H      1 
ATOM   4662  H HA     . THR A 1 298 ? -60.888  -32.882 34.958  0    210.29 ? 294  THR A HA     1 
ATOM   4663  H HB     . THR A 1 298 ? -61.698  -32.764 32.562  0    204.07 ? 294  THR A HB     1 
ATOM   4664  H HG1    . THR A 1 298 ? -61.952  -34.811 31.481  0    211.91 ? 294  THR A HG1    1 
ATOM   4665  H HG21   . THR A 1 298 ? -59.761  -33.843 31.556  0    209.15 ? 294  THR A HG21   1 
ATOM   4666  H HG22   . THR A 1 298 ? -59.297  -32.99  33.04   0    209.1  ? 294  THR A HG22   1 
ATOM   4667  H HG23   . THR A 1 298 ? -59.467  -34.755 33.053  0    214.1  ? 294  THR A HG23   1 
ATOM   4668  N N      . VAL A 1 299 ? -63.225  -31.847 34.725  1    103.55 ? 295  VAL A N      1 
ATOM   4669  C CA     . VAL A 1 299 ? -64.547  -31.276 34.957  1    101.46 ? 295  VAL A CA     1 
ATOM   4670  C C      . VAL A 1 299 ? -65.003  -30.491 33.709  1    97.18  ? 295  VAL A C      1 
ATOM   4671  O O      . VAL A 1 299 ? -64.551  -29.37  33.455  1    94.25  ? 295  VAL A O      1 
ATOM   4672  C CB     . VAL A 1 299 ? -64.565  -30.459 36.284  1    101.51 ? 295  VAL A CB     1 
ATOM   4673  C CG1    . VAL A 1 299 ? -63.723  -29.196 36.201  1    98.53  ? 295  VAL A CG1    1 
ATOM   4674  C CG2    . VAL A 1 299 ? -65.982  -30.127 36.733  1    100.92 ? 295  VAL A CG2    1 
ATOM   4675  H H      . VAL A 1 299 ? -62.512  -31.16  34.504  0    195.92 ? 295  VAL A H      1 
ATOM   4676  H HA     . VAL A 1 299 ? -65.259  -32.089 35.083  0    194.68 ? 295  VAL A HA     1 
ATOM   4677  H HB     . VAL A 1 299 ? -64.129  -31.077 37.068  0    196.27 ? 295  VAL A HB     1 
ATOM   4678  H HG11   . VAL A 1 299 ? -63.622  -28.78  37.203  0    187.42 ? 295  VAL A HG11   1 
ATOM   4679  H HG12   . VAL A 1 299 ? -62.74   -29.442 35.804  0    187.73 ? 295  VAL A HG12   1 
ATOM   4680  H HG13   . VAL A 1 299 ? -64.224  -28.47  35.562  0    183.49 ? 295  VAL A HG13   1 
ATOM   4681  H HG21   . VAL A 1 299 ? -65.913  -29.343 37.484  0    190.32 ? 295  VAL A HG21   1 
ATOM   4682  H HG22   . VAL A 1 299 ? -66.56   -29.802 35.871  0    188.66 ? 295  VAL A HG22   1 
ATOM   4683  H HG23   . VAL A 1 299 ? -66.443  -31.008 37.176  0    193.94 ? 295  VAL A HG23   1 
ATOM   4684  N N      . THR A 1 300 ? -65.892  -31.121 32.915  1    97.13  ? 296  THR A N      1 
ATOM   4685  C CA     . THR A 1 300 ? -66.414  -30.552 31.676  1    93.63  ? 296  THR A CA     1 
ATOM   4686  C C      . THR A 1 300 ? -67.55   -29.552 31.931  1    90.69  ? 296  THR A C      1 
ATOM   4687  O O      . THR A 1 300 ? -68.306  -29.698 32.89   1    91.88  ? 296  THR A O      1 
ATOM   4688  C CB     . THR A 1 300 ? -66.875  -31.685 30.748  1    95.05  ? 296  THR A CB     1 
ATOM   4689  O OG1    . THR A 1 300 ? -67.898  -32.442 31.388  1    97.15  ? 296  THR A OG1    1 
ATOM   4690  C CG2    . THR A 1 300 ? -65.742  -32.593 30.333  1    97.87  ? 296  THR A CG2    1 
ATOM   4691  H H      . THR A 1 300 ? -66.283  -32.036 33.114  0    186.01 ? 296  THR A H      1 
ATOM   4692  H HA     . THR A 1 300 ? -65.611  -30.021 31.166  0    174.42 ? 296  THR A HA     1 
ATOM   4693  H HB     . THR A 1 300 ? -67.293  -31.241 29.847  0    176.85 ? 296  THR A HB     1 
ATOM   4694  H HG1    . THR A 1 300 ? -68.22   -33.156 30.778  0    185.43 ? 296  THR A HG1    1 
ATOM   4695  H HG21   . THR A 1 300 ? -66.106  -33.339 29.627  0    186.84 ? 296  THR A HG21   1 
ATOM   4696  H HG22   . THR A 1 300 ? -64.956  -32.005 29.862  0    183.93 ? 296  THR A HG22   1 
ATOM   4697  H HG23   . THR A 1 300 ? -65.321  -33.105 31.198  0    188.04 ? 296  THR A HG23   1 
ATOM   4698  N N      . LEU A 1 301 ? -67.671  -28.546 31.066  1    87.11  ? 297  LEU A N      1 
ATOM   4699  C CA     . LEU A 1 301 ? -68.704  -27.517 31.184  1    84.26  ? 297  LEU A CA     1 
ATOM   4700  C C      . LEU A 1 301 ? -70.053  -28.007 30.657  1    84.49  ? 297  LEU A C      1 
ATOM   4701  O O      . LEU A 1 301 ? -70.253  -28.085 29.448  1    83.47  ? 297  LEU A O      1 
ATOM   4702  C CB     . LEU A 1 301 ? -68.255  -26.256 30.437  1    80.75  ? 297  LEU A CB     1 
ATOM   4703  C CG     . LEU A 1 301 ? -69.236  -25.096 30.349  1    77.6   ? 297  LEU A CG     1 
ATOM   4704  C CD1    . LEU A 1 301 ? -69.792  -24.722 31.698  1    77.89  ? 297  LEU A CD1    1 
ATOM   4705  C CD2    . LEU A 1 301 ? -68.573  -23.909 29.711  1    74.7   ? 297  LEU A CD2    1 
ATOM   4706  H H      . LEU A 1 301 ? -67.062  -28.429 30.263  0    160.68 ? 297  LEU A H      1 
ATOM   4707  H HA     . LEU A 1 301 ? -68.821  -27.257 32.234  0    155.94 ? 297  LEU A HA     1 
ATOM   4708  H HB2    . LEU A 1 301 ? -67.356  -25.88  30.923  0    147.72 ? 297  LEU A HB2    1 
ATOM   4709  H HB3    . LEU A 1 301 ? -68.013  -26.528 29.411  0    147.36 ? 297  LEU A HB3    1 
ATOM   4710  H HG     . LEU A 1 301 ? -70.067  -25.385 29.708  0    140.47 ? 297  LEU A HG     1 
ATOM   4711  H HD11   . LEU A 1 301 ? -70.219  -23.722 31.652  0    139.2  ? 297  LEU A HD11   1 
ATOM   4712  H HD12   . LEU A 1 301 ? -70.565  -25.44  31.967  0    143.17 ? 297  LEU A HD12   1 
ATOM   4713  H HD13   . LEU A 1 301 ? -68.989  -24.762 32.431  0    142.65 ? 297  LEU A HD13   1 
ATOM   4714  H HD21   . LEU A 1 301 ? -69.299  -23.107 29.595  0    132.34 ? 297  LEU A HD21   1 
ATOM   4715  H HD22   . LEU A 1 301 ? -67.755  -23.582 30.35   0    134.73 ? 297  LEU A HD22   1 
ATOM   4716  H HD23   . LEU A 1 301 ? -68.185  -24.205 28.738  0    134.18 ? 297  LEU A HD23   1 
ATOM   4717  N N      . LYS A 1 302 ? -70.991  -28.286 31.568  1    85.98  ? 298  LYS A N      1 
ATOM   4718  C CA     . LYS A 1 302 ? -72.302  -28.829 31.226  1    86.72  ? 298  LYS A CA     1 
ATOM   4719  C C      . LYS A 1 302 ? -73.266  -27.847 30.565  1    83.57  ? 298  LYS A C      1 
ATOM   4720  O O      . LYS A 1 302 ? -73.97   -28.248 29.643  1    83.34  ? 298  LYS A O      1 
ATOM   4721  C CB     . LYS A 1 302 ? -72.968  -29.389 32.487  1    89.44  ? 298  LYS A CB     1 
ATOM   4722  C CG     . LYS A 1 302 ? -74.237  -30.168 32.203  1    90.97  ? 298  LYS A CG     1 
ATOM   4723  C CD     . LYS A 1 302 ? -74.324  -31.434 33.028  1    95.25  ? 298  LYS A CD     1 
ATOM   4724  C CE     . LYS A 1 302 ? -75.502  -32.296 32.636  1    97.09  ? 298  LYS A CE     1 
ATOM   4725  N NZ     . LYS A 1 302 ? -75.293  -32.986 31.334  1    97.48  ? 298  LYS A NZ     1 
ATOM   4726  H H      . LYS A 1 302 ? -70.873  -28.133 32.565  0    160.01 ? 298  LYS A H      1 
ATOM   4727  H HA     . LYS A 1 302 ? -72.144  -29.664 30.544  0    161.94 ? 298  LYS A HA     1 
ATOM   4728  H HB2    . LYS A 1 302 ? -72.25   -30.042 32.976  0    168.83 ? 298  LYS A HB2    1 
ATOM   4729  H HB3    . LYS A 1 302 ? -73.228  -28.566 33.151  0    165.19 ? 298  LYS A HB3    1 
ATOM   4730  H HG2    . LYS A 1 302 ? -75.098  -29.55  32.451  0    168.76 ? 298  LYS A HG2    1 
ATOM   4731  H HG3    . LYS A 1 302 ? -74.266  -30.448 31.15   0    169.46 ? 298  LYS A HG3    1 
ATOM   4732  H HD2    . LYS A 1 302 ? -73.422  -32.023 32.871  0    180.69 ? 298  LYS A HD2    1 
ATOM   4733  H HD3    . LYS A 1 302 ? -74.429  -31.172 34.08   0    180.02 ? 298  LYS A HD3    1 
ATOM   4734  H HE2    . LYS A 1 302 ? -75.656  -33.057 33.4    0    186.4  ? 298  LYS A HE2    1 
ATOM   4735  H HE3    . LYS A 1 302 ? -76.388  -31.67  32.542  0    181.8  ? 298  LYS A HE3    1 
ATOM   4736  H HZ1    . LYS A 1 302 ? -76.078  -33.598 31.137  0    185.74 ? 298  LYS A HZ1    1 
ATOM   4737  H HZ2    . LYS A 1 302 ? -75.212  -32.309 30.582  0    181.55 ? 298  LYS A HZ2    1 
ATOM   4738  H HZ3    . LYS A 1 302 ? -74.444  -33.542 31.373  0    185.65 ? 298  LYS A HZ3    1 
ATOM   4739  N N      . ASP A 1 303 ? -73.371  -26.606 31.077  1    81.47  ? 299  ASP A N      1 
ATOM   4740  C CA     . ASP A 1 303 ? -74.326  -25.614 30.557  1    78.73  ? 299  ASP A CA     1 
ATOM   4741  C C      . ASP A 1 303 ? -73.967  -24.189 31.032  1    76.16  ? 299  ASP A C      1 
ATOM   4742  O O      . ASP A 1 303 ? -73.173  -24.026 31.956  1    76.89  ? 299  ASP A O      1 
ATOM   4743  C CB     . ASP A 1 303 ? -75.758  -25.981 31.039  1    80.18  ? 299  ASP A CB     1 
ATOM   4744  C CG     . ASP A 1 303 ? -76.939  -25.419 30.248  1    78.57  ? 299  ASP A CG     1 
ATOM   4745  O OD1    . ASP A 1 303 ? -76.73   -24.509 29.424  1    75.81  ? 299  ASP A OD1    1 
ATOM   4746  O OD2    . ASP A 1 303 ? -78.075  -25.892 30.462  1    80.31  ? 299  ASP A OD2    1 
ATOM   4747  H H      . ASP A 1 303 ? -72.798  -26.263 31.841  0    148.87 ? 299  ASP A H      1 
ATOM   4748  H HA     . ASP A 1 303 ? -74.313  -25.63  29.469  0    141.85 ? 299  ASP A HA     1 
ATOM   4749  H HB2    . ASP A 1 303 ? -75.874  -27.063 31.025  0    148.55 ? 299  ASP A HB2    1 
ATOM   4750  H HB3    . ASP A 1 303 ? -75.866  -25.624 32.062  0    146.66 ? 299  ASP A HB3    1 
ATOM   4751  N N      . LEU A 1 304 ? -74.556  -23.165 30.376  1    73.39  ? 300  LEU A N      1 
ATOM   4752  C CA     . LEU A 1 304 ? -74.428  -21.75  30.714  1    70.9   ? 300  LEU A CA     1 
ATOM   4753  C C      . LEU A 1 304 ? -75.786  -21.244 31.182  1    70.71  ? 300  LEU A C      1 
ATOM   4754  O O      . LEU A 1 304 ? -76.82   -21.685 30.677  1    71.24  ? 300  LEU A O      1 
ATOM   4755  C CB     . LEU A 1 304 ? -73.993  -20.947 29.495  1    68.22  ? 300  LEU A CB     1 
ATOM   4756  C CG     . LEU A 1 304 ? -72.671  -21.347 28.886  1    68.35  ? 300  LEU A CG     1 
ATOM   4757  C CD1    . LEU A 1 304 ? -72.418  -20.583 27.62   1    65.93  ? 300  LEU A CD1    1 
ATOM   4758  C CD2    . LEU A 1 304 ? -71.536  -21.115 29.848  1    68.8   ? 300  LEU A CD2    1 
ATOM   4759  H H      . LEU A 1 304 ? -75.153  -23.303 29.566  0    130.89 ? 300  LEU A H      1 
ATOM   4760  H HA     . LEU A 1 304 ? -73.71   -21.603 31.519  0    126.39 ? 300  LEU A HA     1 
ATOM   4761  H HB2    . LEU A 1 304 ? -74.758  -21.065 28.729  0    119.57 ? 300  LEU A HB2    1 
ATOM   4762  H HB3    . LEU A 1 304 ? -73.927  -19.897 29.778  0    118.36 ? 300  LEU A HB3    1 
ATOM   4763  H HG     . LEU A 1 304 ? -72.688  -22.407 28.636  0    122.12 ? 300  LEU A HG     1 
ATOM   4764  H HD11   . LEU A 1 304 ? -71.545  -21.001 27.122  0    115.38 ? 300  LEU A HD11   1 
ATOM   4765  H HD12   . LEU A 1 304 ? -73.287  -20.664 26.97   0    114.85 ? 300  LEU A HD12   1 
ATOM   4766  H HD13   . LEU A 1 304 ? -72.235  -19.54  27.875  0    113.28 ? 300  LEU A HD13   1 
ATOM   4767  H HD21   . LEU A 1 304 ? -70.594  -21.19  29.306  0    121.11 ? 300  LEU A HD21   1 
ATOM   4768  H HD22   . LEU A 1 304 ? -71.633  -20.122 30.285  0    119.76 ? 300  LEU A HD22   1 
ATOM   4769  H HD23   . LEU A 1 304 ? -71.568  -21.871 30.631  0    123.41 ? 300  LEU A HD23   1 
ATOM   4770  N N      . ARG A 1 305 ? -75.786  -20.308 32.127  1    70.14  ? 301  ARG A N      1 
ATOM   4771  C CA     . ARG A 1 305 ? -77.017  -19.775 32.691  1    70.25  ? 301  ARG A CA     1 
ATOM   4772  C C      . ARG A 1 305 ? -76.874  -18.293 33.001  1    68.1   ? 301  ARG A C      1 
ATOM   4773  O O      . ARG A 1 305 ? -75.819  -17.868 33.456  1    67.89  ? 301  ARG A O      1 
ATOM   4774  C CB     . ARG A 1 305 ? -77.352  -20.541 33.977  1    73.27  ? 301  ARG A CB     1 
ATOM   4775  C CG     . ARG A 1 305 ? -78.637  -20.088 34.647  1    74.05  ? 301  ARG A CG     1 
ATOM   4776  C CD     . ARG A 1 305 ? -79.162  -21.104 35.647  1    77.49  ? 301  ARG A CD     1 
ATOM   4777  N NE     . ARG A 1 305 ? -78.77   -20.807 37.034  1    78.78  ? 301  ARG A NE     1 
ATOM   4778  C CZ     . ARG A 1 305 ? -77.708  -21.295 37.684  1    79.95  ? 301  ARG A CZ     1 
ATOM   4779  N NH1    . ARG A 1 305 ? -77.482  -20.954 38.95   1    81.33  ? 301  ARG A NH1    1 
ATOM   4780  N NH2    . ARG A 1 305 ? -76.862  -22.125 37.075  1    79.96  ? 301  ARG A NH2    1 
ATOM   4781  H H      . ARG A 1 305 ? -74.947  -19.876 32.504  0    123.72 ? 301  ARG A H      1 
ATOM   4782  H HA     . ARG A 1 305 ? -77.842  -19.896 31.992  0    124.21 ? 301  ARG A HA     1 
ATOM   4783  H HB2    . ARG A 1 305 ? -77.457  -21.595 33.728  0    132.74 ? 301  ARG A HB2    1 
ATOM   4784  H HB3    . ARG A 1 305 ? -76.541  -20.408 34.691  0    131.5  ? 301  ARG A HB3    1 
ATOM   4785  H HG2    . ARG A 1 305 ? -78.457  -19.159 35.186  0    131.67 ? 301  ARG A HG2    1 
ATOM   4786  H HG3    . ARG A 1 305 ? -79.401  -19.938 33.886  0    132.04 ? 301  ARG A HG3    1 
ATOM   4787  H HD2    . ARG A 1 305 ? -80.249  -21.041 35.623  0    140.79 ? 301  ARG A HD2    1 
ATOM   4788  H HD3    . ARG A 1 305 ? -78.877  -22.116 35.369  0    141.65 ? 301  ARG A HD3    1 
ATOM   4789  H HE     . ARG A 1 305 ? -79.387  -20.187 37.548  0    143.06 ? 301  ARG A HE     1 
ATOM   4790  H HH11   . ARG A 1 305 ? -78.116  -20.322 39.427  0    148.52 ? 301  ARG A HH11   1 
ATOM   4791  H HH12   . ARG A 1 305 ? -76.669  -21.313 39.44   0    149.59 ? 301  ARG A HH12   1 
ATOM   4792  H HH21   . ARG A 1 305 ? -76.964  -22.404 36.105  0    145    ? 301  ARG A HH21   1 
ATOM   4793  H HH22   . ARG A 1 305 ? -76.052  -22.464 37.585  0    146.89 ? 301  ARG A HH22   1 
ATOM   4794  N N      . VAL A 1 306 ? -77.941  -17.512 32.786  1    66.74  ? 302  VAL A N      1 
ATOM   4795  C CA     . VAL A 1 306 ? -77.938  -16.081 33.086  1    64.94  ? 302  VAL A CA     1 
ATOM   4796  C C      . VAL A 1 306 ? -78.974  -15.814 34.166  1    66.41  ? 302  VAL A C      1 
ATOM   4797  O O      . VAL A 1 306 ? -80.05   -16.405 34.158  1    67.87  ? 302  VAL A O      1 
ATOM   4798  C CB     . VAL A 1 306 ? -78.213  -15.219 31.839  1    62.54  ? 302  VAL A CB     1 
ATOM   4799  C CG1    . VAL A 1 306 ? -78.179  -13.738 32.188  1    60.96  ? 302  VAL A CG1    1 
ATOM   4800  C CG2    . VAL A 1 306 ? -77.21   -15.518 30.738  1    61.35  ? 302  VAL A CG2    1 
ATOM   4801  H H      . VAL A 1 306 ? -78.827  -17.841 32.417  0    117.26 ? 302  VAL A H      1 
ATOM   4802  H HA     . VAL A 1 306 ? -76.965  -15.783 33.475  0    112.46 ? 302  VAL A HA     1 
ATOM   4803  H HB     . VAL A 1 306 ? -79.208  -15.453 31.462  0    108.14 ? 302  VAL A HB     1 
ATOM   4804  H HG11   . VAL A 1 306 ? -78.137  -13.159 31.267  0    102.5  ? 302  VAL A HG11   1 
ATOM   4805  H HG12   . VAL A 1 306 ? -79.077  -13.466 32.741  0    104.99 ? 302  VAL A HG12   1 
ATOM   4806  H HG13   . VAL A 1 306 ? -77.292  -13.541 32.788  0    103.9  ? 302  VAL A HG13   1 
ATOM   4807  H HG21   . VAL A 1 306 ? -77.452  -14.914 29.865  0    103.43 ? 302  VAL A HG21   1 
ATOM   4808  H HG22   . VAL A 1 306 ? -76.221  -15.253 31.104  0    104.58 ? 302  VAL A HG22   1 
ATOM   4809  H HG23   . VAL A 1 306 ? -77.247  -16.574 30.474  0    106.22 ? 302  VAL A HG23   1 
ATOM   4810  N N      . GLU A 1 307 ? -78.647  -14.923 35.095  1    66.26  ? 303  GLU A N      1 
ATOM   4811  C CA     . GLU A 1 307 ? -79.525  -14.557 36.195  1    67.78  ? 303  GLU A CA     1 
ATOM   4812  C C      . GLU A 1 307 ? -79.414  -13.042 36.413  1    66.09  ? 303  GLU A C      1 
ATOM   4813  O O      . GLU A 1 307 ? -78.313  -12.544 36.634  1    65.04  ? 303  GLU A O      1 
ATOM   4814  C CB     . GLU A 1 307 ? -79.1    -15.301 37.474  1    70.38  ? 303  GLU A CB     1 
ATOM   4815  C CG     . GLU A 1 307 ? -79.432  -16.784 37.496  1    72.68  ? 303  GLU A CG     1 
ATOM   4816  C CD     . GLU A 1 307 ? -79.181  -17.44  38.843  1    75.64  ? 303  GLU A CD     1 
ATOM   4817  O OE1    . GLU A 1 307 ? -79.859  -18.447 39.153  1    78.1   ? 303  GLU A OE1    1 
ATOM   4818  O OE2    . GLU A 1 307 ? -78.309  -16.941 39.593  1    75.7   ? 303  GLU A OE2    1 
ATOM   4819  H H      . GLU A 1 307 ? -77.763  -14.425 35.115  0    114.71 ? 303  GLU A H      1 
ATOM   4820  H HA     . GLU A 1 307 ? -80.562  -14.806 35.975  0    119.82 ? 303  GLU A HA     1 
ATOM   4821  H HB2    . GLU A 1 307 ? -78.021  -15.203 37.583  0    124.24 ? 303  GLU A HB2    1 
ATOM   4822  H HB3    . GLU A 1 307 ? -79.596  -14.841 38.327  0    125.72 ? 303  GLU A HB3    1 
ATOM   4823  H HG2    . GLU A 1 307 ? -80.484  -16.916 37.249  0    130.4  ? 303  GLU A HG2    1 
ATOM   4824  H HG3    . GLU A 1 307 ? -78.811  -17.292 36.76   0    129.31 ? 303  GLU A HG3    1 
ATOM   4825  N N      . LEU A 1 308 ? -80.539  -12.308 36.346  1    66.02  ? 304  LEU A N      1 
ATOM   4826  C CA     . LEU A 1 308 ? -80.535  -10.862 36.548  1    64.73  ? 304  LEU A CA     1 
ATOM   4827  C C      . LEU A 1 308 ? -80.427  -10.542 38.036  1    66.42  ? 304  LEU A C      1 
ATOM   4828  O O      . LEU A 1 308 ? -81.298  -10.929 38.811  1    68.7   ? 304  LEU A O      1 
ATOM   4829  C CB     . LEU A 1 308 ? -81.821  -10.261 35.969  1    64.43  ? 304  LEU A CB     1 
ATOM   4830  C CG     . LEU A 1 308 ? -82.075  -8.785  36.211  1    63.62  ? 304  LEU A CG     1 
ATOM   4831  C CD1    . LEU A 1 308 ? -80.943  -7.924  35.692  1    61.18  ? 304  LEU A CD1    1 
ATOM   4832  C CD2    . LEU A 1 308 ? -83.353  -8.373  35.557  1    63.71  ? 304  LEU A CD2    1 
ATOM   4833  H H      . LEU A 1 308 ? -81.46   -12.688 36.15   0    116.05 ? 304  LEU A H      1 
ATOM   4834  H HA     . LEU A 1 308 ? -79.689  -10.426 36.02   0    110.49 ? 304  LEU A HA     1 
ATOM   4835  H HB2    . LEU A 1 308 ? -81.808  -10.412 34.891  0    110.38 ? 304  LEU A HB2    1 
ATOM   4836  H HB3    . LEU A 1 308 ? -82.67   -10.791 36.398  0    113.49 ? 304  LEU A HB3    1 
ATOM   4837  H HG     . LEU A 1 308 ? -82.184  -8.592  37.277  0    111.17 ? 304  LEU A HG     1 
ATOM   4838  H HD11   . LEU A 1 308 ? -81.217  -6.877  35.807  0    103.99 ? 304  LEU A HD11   1 
ATOM   4839  H HD12   . LEU A 1 308 ? -80.039  -8.128  36.264  0    104.62 ? 304  LEU A HD12   1 
ATOM   4840  H HD13   . LEU A 1 308 ? -80.777  -8.154  34.641  0    103.22 ? 304  LEU A HD13   1 
ATOM   4841  H HD21   . LEU A 1 308 ? -83.538  -7.319  35.763  0    109.65 ? 304  LEU A HD21   1 
ATOM   4842  H HD22   . LEU A 1 308 ? -83.269  -8.53   34.483  0    108.8  ? 304  LEU A HD22   1 
ATOM   4843  H HD23   . LEU A 1 308 ? -84.166  -8.975  35.961  0    111.94 ? 304  LEU A HD23   1 
ATOM   4844  N N      . LEU A 1 309 ? -79.374  -9.825  38.433  1    65.52  ? 305  LEU A N      1 
ATOM   4845  C CA     . LEU A 1 309 ? -79.16   -9.449  39.828  1    67.18  ? 305  LEU A CA     1 
ATOM   4846  C C      . LEU A 1 309 ? -79.985  -8.2    40.196  1    67     ? 305  LEU A C      1 
ATOM   4847  O O      . LEU A 1 309 ? -80.776  -8.249  41.135  1    69.16  ? 305  LEU A O      1 
ATOM   4848  C CB     . LEU A 1 309 ? -77.661  -9.203  40.086  1    66.58  ? 305  LEU A CB     1 
ATOM   4849  C CG     . LEU A 1 309 ? -76.705  -10.321 39.691  1    66.7   ? 305  LEU A CG     1 
ATOM   4850  C CD1    . LEU A 1 309 ? -75.289  -9.927  39.982  1    66.29  ? 305  LEU A CD1    1 
ATOM   4851  C CD2    . LEU A 1 309 ? -77.029  -11.592 40.426  1    69.52  ? 305  LEU A CD2    1 
ATOM   4852  H H      . LEU A 1 309 ? -78.653  -9.478  37.808  0    112.38 ? 305  LEU A H      1 
ATOM   4853  H HA     . LEU A 1 309 ? -79.478  -10.26  40.482  0    119.95 ? 305  LEU A HA     1 
ATOM   4854  H HB2    . LEU A 1 309 ? -77.361  -8.317  39.528  0    114.58 ? 305  LEU A HB2    1 
ATOM   4855  H HB3    . LEU A 1 309 ? -77.52   -9.019  41.15   0    118.08 ? 305  LEU A HB3    1 
ATOM   4856  H HG     . LEU A 1 309 ? -76.786  -10.51  38.621  0    115.26 ? 305  LEU A HG     1 
ATOM   4857  H HD11   . LEU A 1 309 ? -74.617  -10.702 39.616  0    115.97 ? 305  LEU A HD11   1 
ATOM   4858  H HD12   . LEU A 1 309 ? -75.072  -8.986  39.479  0    113.95 ? 305  LEU A HD12   1 
ATOM   4859  H HD13   . LEU A 1 309 ? -75.171  -9.811  41.058  0    117.53 ? 305  LEU A HD13   1 
ATOM   4860  H HD21   . LEU A 1 309 ? -76.2    -12.292 40.336  0    123.3  ? 305  LEU A HD21   1 
ATOM   4861  H HD22   . LEU A 1 309 ? -77.202  -11.355 41.474  0    124.58 ? 305  LEU A HD22   1 
ATOM   4862  H HD23   . LEU A 1 309 ? -77.925  -12.03  39.989  0    123.17 ? 305  LEU A HD23   1 
ATOM   4863  N N      . GLY A 1 310 ? -79.809  -7.11   39.445  1    64.64  ? 306  GLY A N      1 
ATOM   4864  C CA     . GLY A 1 310 ? -80.521  -5.857  39.676  1    64.6   ? 306  GLY A CA     1 
ATOM   4865  C C      . GLY A 1 310 ? -80.127  -4.781  38.682  1    62.13  ? 306  GLY A C      1 
ATOM   4866  O O      . GLY A 1 310 ? -79.698  -5.096  37.571  1    60.3   ? 306  GLY A O      1 
ATOM   4867  H H      . GLY A 1 310 ? -79.171  -7.069  38.656  0    110.81 ? 306  GLY A H      1 
ATOM   4868  H HA2    . GLY A 1 310 ? -81.594  -6.025  39.601  0    113.3  ? 306  GLY A HA2    1 
ATOM   4869  H HA3    . GLY A 1 310 ? -80.303  -5.499  40.681  0    113.8  ? 306  GLY A HA3    1 
ATOM   4870  N N      . GLU A 1 311 ? -80.265  -3.504  39.077  1    62.28  ? 307  GLU A N      1 
ATOM   4871  C CA     . GLU A 1 311 ? -79.907  -2.37   38.227  1    60.26  ? 307  GLU A CA     1 
ATOM   4872  C C      . GLU A 1 311 ? -78.8    -1.565  38.873  1    60.2   ? 307  GLU A C      1 
ATOM   4873  O O      . GLU A 1 311 ? -78.863  -1.315  40.065  1    62.1   ? 307  GLU A O      1 
ATOM   4874  C CB     . GLU A 1 311 ? -81.128  -1.46   38.001  1    60.63  ? 307  GLU A CB     1 
ATOM   4875  C CG     . GLU A 1 311 ? -80.852  -0.292  37.057  1    58.72  ? 307  GLU A CG     1 
ATOM   4876  C CD     . GLU A 1 311 ? -82.059  0.536   36.654  1    59.04  ? 307  GLU A CD     1 
ATOM   4877  O OE1    . GLU A 1 311 ? -82.526  0.395   35.497  1    57.99  ? 307  GLU A OE1    1 
ATOM   4878  O OE2    . GLU A 1 311 ? -82.524  1.345   37.49   1    60.53  ? 307  GLU A OE2    1 
ATOM   4879  H H      . GLU A 1 311 ? -80.624  -3.233  39.987  0    108.82 ? 307  GLU A H      1 
ATOM   4880  H HA     . GLU A 1 311 ? -79.561  -2.709  37.252  0    101.12 ? 307  GLU A HA     1 
ATOM   4881  H HB2    . GLU A 1 311 ? -81.931  -2.056  37.569  0    103.7  ? 307  GLU A HB2    1 
ATOM   4882  H HB3    . GLU A 1 311 ? -81.443  -1.047  38.957  0    105.02 ? 307  GLU A HB3    1 
ATOM   4883  H HG2    . GLU A 1 311 ? -80.153  0.399   37.525  0    99.13  ? 307  GLU A HG2    1 
ATOM   4884  H HG3    . GLU A 1 311 ? -80.408  -0.685  36.143  0    97.66  ? 307  GLU A HG3    1 
ATOM   4885  N N      . THR A 1 312 ? -77.808  -1.139  38.08   1    58.21  ? 308  THR A N      1 
ATOM   4886  C CA     . THR A 1 312 ? -76.689  -0.28   38.504  1    58.11  ? 308  THR A CA     1 
ATOM   4887  C C      . THR A 1 312 ? -76.55   0.912   37.493  1    56.3   ? 308  THR A C      1 
ATOM   4888  O O      . THR A 1 312 ? -77.41   1.054   36.624  1    55.53  ? 308  THR A O      1 
ATOM   4889  C CB     . THR A 1 312 ? -75.399  -1.117  38.584  1    57.92  ? 308  THR A CB     1 
ATOM   4890  O OG1    . THR A 1 312 ? -74.996  -1.468  37.268  1    56.01  ? 308  THR A OG1    1 
ATOM   4891  C CG2    . THR A 1 312 ? -75.551  -2.339  39.437  1    59.96  ? 308  THR A CG2    1 
ATOM   4892  H H      . THR A 1 312 ? -77.748  -1.379  37.096  0    96.72  ? 308  THR A H      1 
ATOM   4893  H HA     . THR A 1 312 ? -76.881  0.141   39.49   0    99.27  ? 308  THR A HA     1 
ATOM   4894  H HB     . THR A 1 312 ? -74.627  -0.494  39.03   0    97.46  ? 308  THR A HB     1 
ATOM   4895  H HG1    . THR A 1 312 ? -74.195  -2.053  37.296  0    93.14  ? 308  THR A HG1    1 
ATOM   4896  H HG21   . THR A 1 312 ? -74.585  -2.829  39.549  0    101.99 ? 308  THR A HG21   1 
ATOM   4897  H HG22   . THR A 1 312 ? -75.916  -2.056  40.423  0    103.54 ? 308  THR A HG22   1 
ATOM   4898  H HG23   . THR A 1 312 ? -76.248  -3.044  38.987  0    102    ? 308  THR A HG23   1 
ATOM   4899  N N      . SER A 1 313 ? -75.505  1.775   37.602  1    55.84  ? 309  SER A N      1 
ATOM   4900  C CA     . SER A 1 313 ? -75.288  2.822   36.603  1    54.23  ? 309  SER A CA     1 
ATOM   4901  C C      . SER A 1 313 ? -74.866  2.156   35.298  1    52.3   ? 309  SER A C      1 
ATOM   4902  O O      . SER A 1 313 ? -74.371  1.031   35.324  1    52.33  ? 309  SER A O      1 
ATOM   4903  C CB     . SER A 1 313 ? -74.208  3.791   37.055  1    54.65  ? 309  SER A CB     1 
ATOM   4904  O OG     . SER A 1 313 ? -74.682  4.544   38.153  1    56.68  ? 309  SER A OG     1 
ATOM   4905  H H      . SER A 1 313 ? -74.825  1.762   38.355  0    93.61  ? 309  SER A H      1 
ATOM   4906  H HA     . SER A 1 313 ? -76.211  3.373   36.424  0    89.16  ? 309  SER A HA     1 
ATOM   4907  H HB2    . SER A 1 313 ? -73.319  3.239   37.353  0    90     ? 309  SER A HB2    1 
ATOM   4908  H HB3    . SER A 1 313 ? -73.975  4.471   36.237  0    88.65  ? 309  SER A HB3    1 
ATOM   4909  H HG     . SER A 1 313 ? -73.972  5.151   38.49   0    94.53  ? 309  SER A HG     1 
ATOM   4910  N N      . ILE A 1 314 ? -75.074  2.826   34.153  1    50.89  ? 310  ILE A N      1 
ATOM   4911  C CA     . ILE A 1 314 ? -74.717  2.265   32.844  1    49.22  ? 310  ILE A CA     1 
ATOM   4912  C C      . ILE A 1 314 ? -73.195  2.083   32.794  1    49     ? 310  ILE A C      1 
ATOM   4913  O O      . ILE A 1 314 ? -72.461  3.043   32.548  1    49.23  ? 310  ILE A O      1 
ATOM   4914  C CB     . ILE A 1 314 ? -75.203  3.166   31.687  1    48.03  ? 310  ILE A CB     1 
ATOM   4915  C CG1    . ILE A 1 314 ? -76.736  3.341   31.7    1    48.62  ? 310  ILE A CG1    1 
ATOM   4916  C CG2    . ILE A 1 314 ? -74.704  2.587   30.353  1    46.57  ? 310  ILE A CG2    1 
ATOM   4917  C CD1    . ILE A 1 314 ? -77.226  4.377   30.711  1    47.68  ? 310  ILE A CD1    1 
ATOM   4918  H H      . ILE A 1 314 ? -75.455  3.766   34.115  0    81.83  ? 310  ILE A H      1 
ATOM   4919  H HA     . ILE A 1 314 ? -75.189  1.291   32.731  0    78.35  ? 310  ILE A HA     1 
ATOM   4920  H HB     . ILE A 1 314 ? -74.756  4.15    31.816  0    75.49  ? 310  ILE A HB     1 
ATOM   4921  H HG12   . ILE A 1 314 ? -77.198  2.39    31.438  0    77.07  ? 310  ILE A HG12   1 
ATOM   4922  H HG13   . ILE A 1 314 ? -77.069  3.652   32.689  0    78.22  ? 310  ILE A HG13   1 
ATOM   4923  H HG21   . ILE A 1 314 ? -75.281  2.968   29.513  0    71.88  ? 310  ILE A HG21   1 
ATOM   4924  H HG22   . ILE A 1 314 ? -73.663  2.875   30.208  0    71.9   ? 310  ILE A HG22   1 
ATOM   4925  H HG23   . ILE A 1 314 ? -74.782  1.501   30.388  0    72.64  ? 310  ILE A HG23   1 
ATOM   4926  H HD11   . ILE A 1 314 ? -78.194  4.757   31.027  0    76.22  ? 310  ILE A HD11   1 
ATOM   4927  H HD12   . ILE A 1 314 ? -76.509  5.194   30.658  0    74.9   ? 310  ILE A HD12   1 
ATOM   4928  H HD13   . ILE A 1 314 ? -77.342  3.918   29.73   0    74.44  ? 310  ILE A HD13   1 
ATOM   4929  N N      . ALA A 1 315 ? -72.727  0.862   33.065  1    48.77  ? 311  ALA A N      1 
ATOM   4930  C CA     . ALA A 1 315 ? -71.31   0.604   33.189  1    49.04  ? 311  ALA A CA     1 
ATOM   4931  C C      . ALA A 1 315 ? -70.53   0.716   31.916  1    47.63  ? 311  ALA A C      1 
ATOM   4932  O O      . ALA A 1 315 ? -71.014  0.355   30.846  1    46.92  ? 311  ALA A O      1 
ATOM   4933  C CB     . ALA A 1 315 ? -71.082  -0.77   33.778  1    50.49  ? 311  ALA A CB     1 
ATOM   4934  H H      . ALA A 1 315 ? -73.306  0.04    33.201  0    77.84  ? 311  ALA A H      1 
ATOM   4935  H HA     . ALA A 1 315 ? -70.913  1.322   33.906  0    78.44  ? 311  ALA A HA     1 
ATOM   4936  H HB1    . ALA A 1 315 ? -70.029  -0.865  34.041  0    81.38  ? 311  ALA A HB1    1 
ATOM   4937  H HB2    . ALA A 1 315 ? -71.704  -0.892  34.663  0    81.92  ? 311  ALA A HB2    1 
ATOM   4938  H HB3    . ALA A 1 315 ? -71.343  -1.52   33.033  0    80.3   ? 311  ALA A HB3    1 
ATOM   4939  N N      . GLU A 1 316 ? -69.329  1.29    32.036  1    47.48  ? 312  GLU A N      1 
ATOM   4940  C CA     . GLU A 1 316 ? -68.288  1.283   31.014  1    46.51  ? 312  GLU A CA     1 
ATOM   4941  C C      . GLU A 1 316 ? -67.454  0.019   31.294  1    47.37  ? 312  GLU A C      1 
ATOM   4942  O O      . GLU A 1 316 ? -67.117  -0.705  30.357  1    46.79  ? 312  GLU A O      1 
ATOM   4943  C CB     . GLU A 1 316 ? -67.41   2.546   31.116  1    46.42  ? 312  GLU A CB     1 
ATOM   4944  C CG     . GLU A 1 316 ? -66.32   2.691   30.064  1    45.78  ? 312  GLU A CG     1 
ATOM   4945  C CD     . GLU A 1 316 ? -66.738  2.679   28.61   1    44.44  ? 312  GLU A CD     1 
ATOM   4946  O OE1    . GLU A 1 316 ? -65.847  2.46    27.753  1    44.06  ? 312  GLU A OE1    1 
ATOM   4947  O OE2    . GLU A 1 316 ? -67.944  2.882   28.324  1    43.98  ? 312  GLU A OE2    1 
ATOM   4948  H H      . GLU A 1 316 ? -69.065  1.867   32.829  0    75.09  ? 312  GLU A H      1 
ATOM   4949  H HA     . GLU A 1 316 ? -68.725  1.219   30.018  0    71.33  ? 312  GLU A HA     1 
ATOM   4950  H HB2    . GLU A 1 316 ? -68.072  3.405   31.035  0    71.82  ? 312  GLU A HB2    1 
ATOM   4951  H HB3    . GLU A 1 316 ? -66.922  2.542   32.089  0    73.25  ? 312  GLU A HB3    1 
ATOM   4952  H HG2    . GLU A 1 316 ? -65.83   3.647   30.238  0    70.74  ? 312  GLU A HG2    1 
ATOM   4953  H HG3    . GLU A 1 316 ? -65.606  1.878   30.173  0    71.09  ? 312  GLU A HG3    1 
ATOM   4954  N N      . CYS A 1 317 ? -67.136  -0.246  32.59   1    48.94  ? 313  CYS A N      1 
ATOM   4955  C CA     . CYS A 1 317 ? -66.394  -1.419  33.012  1    50.16  ? 313  CYS A CA     1 
ATOM   4956  C C      . CYS A 1 317 ? -66.73   -1.785  34.455  1    51.99  ? 313  CYS A C      1 
ATOM   4957  O O      . CYS A 1 317 ? -66.775  -0.932  35.344  1    52.77  ? 313  CYS A O      1 
ATOM   4958  C CB     . CYS A 1 317 ? -64.896  -1.2    32.844  1    50.47  ? 313  CYS A CB     1 
ATOM   4959  S SG     . CYS A 1 317 ? -64.299  0.365   33.537  1    50.82  ? 313  CYS A SG     1 
ATOM   4960  H H      . CYS A 1 317 ? -67.365  0.369   33.365  0    78.24  ? 313  CYS A H      1 
ATOM   4961  H HA     . CYS A 1 317 ? -66.674  -2.255  32.372  0    79.91  ? 313  CYS A HA     1 
ATOM   4962  H HB2    . CYS A 1 317 ? -64.369  -2.013  33.342  0    82.38  ? 313  CYS A HB2    1 
ATOM   4963  H HB3    . CYS A 1 317 ? -64.656  -1.209  31.781  0    80.04  ? 313  CYS A HB3    1 
ATOM   4964  H HG     . CYS A 1 317 ? -64.977  0.634   34.66   0    82.72  ? 313  CYS A HG     1 
ATOM   4965  N N      . LEU A 1 318 ? -66.935  -3.08   34.664  1    52.89  ? 314  LEU A N      1 
ATOM   4966  C CA     . LEU A 1 318 ? -67.195  -3.668  35.959  1    54.95  ? 314  LEU A CA     1 
ATOM   4967  C C      . LEU A 1 318 ? -65.913  -4.272  36.438  1    56.6   ? 314  LEU A C      1 
ATOM   4968  O O      . LEU A 1 318 ? -65.092  -4.733  35.642  1    56.17  ? 314  LEU A O      1 
ATOM   4969  C CB     . LEU A 1 318 ? -68.217  -4.796  35.835  1    55.21  ? 314  LEU A CB     1 
ATOM   4970  C CG     . LEU A 1 318 ? -69.609  -4.398  35.41   1    54.04  ? 314  LEU A CG     1 
ATOM   4971  C CD1    . LEU A 1 318 ? -70.38   -5.595  34.942  1    54.35  ? 314  LEU A CD1    1 
ATOM   4972  C CD2    . LEU A 1 318 ? -70.345  -3.71   36.54   1    54.89  ? 314  LEU A CD2    1 
ATOM   4973  H H      . LEU A 1 318 ? -66.915  -3.776  33.925  0    85.81  ? 314  LEU A H      1 
ATOM   4974  H HA     . LEU A 1 318 ? -67.55   -2.928  36.674  0    91.31  ? 314  LEU A HA     1 
ATOM   4975  H HB2    . LEU A 1 318 ? -67.844  -5.521  35.113  0    91.22  ? 314  LEU A HB2    1 
ATOM   4976  H HB3    . LEU A 1 318 ? -68.301  -5.28   36.807  0    93.19  ? 314  LEU A HB3    1 
ATOM   4977  H HG     . LEU A 1 318 ? -69.556  -3.702  34.574  0    87.28  ? 314  LEU A HG     1 
ATOM   4978  H HD11   . LEU A 1 318 ? -71.37   -5.276  34.617  0    88.72  ? 314  LEU A HD11   1 
ATOM   4979  H HD12   . LEU A 1 318 ? -69.855  -6.066  34.112  0    88.82  ? 314  LEU A HD12   1 
ATOM   4980  H HD13   . LEU A 1 318 ? -70.472  -6.298  35.769  0    91.09  ? 314  LEU A HD13   1 
ATOM   4981  H HD21   . LEU A 1 318 ? -71.372  -3.528  36.229  0    90.08  ? 314  LEU A HD21   1 
ATOM   4982  H HD22   . LEU A 1 318 ? -70.334  -4.344  37.425  0    92.42  ? 314  LEU A HD22   1 
ATOM   4983  H HD23   . LEU A 1 318 ? -69.86   -2.759  36.755  0    90.37  ? 314  LEU A HD23   1 
ATOM   4984  N N      . THR A 1 319 ? -65.741  -4.299  37.747  1    58.72  ? 315  THR A N      1 
ATOM   4985  C CA     . THR A 1 319 ? -64.58   -4.94   38.365  1    60.88  ? 315  THR A CA     1 
ATOM   4986  C C      . THR A 1 319 ? -64.941  -5.284  39.812  1    63.36  ? 315  THR A C      1 
ATOM   4987  O O      . THR A 1 319 ? -65.055  -4.356  40.622  1    63.76  ? 315  THR A O      1 
ATOM   4988  C CB     . THR A 1 319 ? -63.312  -4.053  38.232  1    60.74  ? 315  THR A CB     1 
ATOM   4989  O OG1    . THR A 1 319 ? -62.166  -4.782  38.691  1    63.26  ? 315  THR A OG1    1 
ATOM   4990  C CG2    . THR A 1 319 ? -63.427  -2.747  38.982  1    60.44  ? 315  THR A CG2    1 
ATOM   4991  H H      . THR A 1 319 ? -66.383  -3.869  38.406  0    99.56  ? 315  THR A H      1 
ATOM   4992  H HA     . THR A 1 319 ? -64.376  -5.88   37.853  0    103.86 ? 315  THR A HA     1 
ATOM   4993  H HB     . THR A 1 319 ? -63.177  -3.8    37.181  0    101.78 ? 315  THR A HB     1 
ATOM   4994  H HG1    . THR A 1 319 ? -61.746  -5.301  37.955  0    108.4  ? 315  THR A HG1    1 
ATOM   4995  H HG21   . THR A 1 319 ? -62.625  -2.088  38.654  0    102.93 ? 315  THR A HG21   1 
ATOM   4996  H HG22   . THR A 1 319 ? -64.381  -2.266  38.773  0    102    ? 315  THR A HG22   1 
ATOM   4997  H HG23   . THR A 1 319 ? -63.333  -2.911  40.054  0    105.27 ? 315  THR A HG23   1 
ATOM   4998  N N      . TYR A 1 320 ? -65.214  -6.583  40.125  1    65.12  ? 316  TYR A N      1 
ATOM   4999  C CA     . TYR A 1 320 ? -65.537  -6.915  41.509  1    67.83  ? 316  TYR A CA     1 
ATOM   5000  C C      . TYR A 1 320 ? -64.242  -6.902  42.327  1    70.31  ? 316  TYR A C      1 
ATOM   5001  O O      . TYR A 1 320 ? -63.163  -7.165  41.792  1    70.89  ? 316  TYR A O      1 
ATOM   5002  C CB     . TYR A 1 320 ? -66.433  -8.173  41.7    1    68.68  ? 316  TYR A CB     1 
ATOM   5003  C CG     . TYR A 1 320 ? -65.78   -9.316  42.441  1    70.78  ? 316  TYR A CG     1 
ATOM   5004  C CD1    . TYR A 1 320 ? -66.18   -9.635  43.741  1    73.81  ? 316  TYR A CD1    1 
ATOM   5005  C CD2    . TYR A 1 320 ? -64.715  -10.005 41.902  1    70.01  ? 316  TYR A CD2    1 
ATOM   5006  C CE1    . TYR A 1 320 ? -65.538  -10.646 44.455  1    76.04  ? 316  TYR A CE1    1 
ATOM   5007  C CE2    . TYR A 1 320 ? -63.998  -10.932 42.646  1    72.22  ? 316  TYR A CE2    1 
ATOM   5008  C CZ     . TYR A 1 320 ? -64.429  -11.278 43.921  1    75.24  ? 316  TYR A CZ     1 
ATOM   5009  O OH     . TYR A 1 320 ? -63.764  -12.261 44.643  1    77.68  ? 316  TYR A OH     1 
ATOM   5010  H H      . TYR A 1 320 ? -65.218  -7.363  39.475  0    112.66 ? 316  TYR A H      1 
ATOM   5011  H HA     . TYR A 1 320 ? -66.115  -6.085  41.892  0    118.63 ? 316  TYR A HA     1 
ATOM   5012  H HB2    . TYR A 1 320 ? -67.26   -7.864  42.323  0    122.31 ? 316  TYR A HB2    1 
ATOM   5013  H HB3    . TYR A 1 320 ? -66.797  -8.534  40.735  0    119.47 ? 316  TYR A HB3    1 
ATOM   5014  H HD1    . TYR A 1 320 ? -67.01   -9.13   44.194  0    133.47 ? 316  TYR A HD1    1 
ATOM   5015  H HD2    . TYR A 1 320 ? -64.347  -9.709  40.93   0    122.61 ? 316  TYR A HD2    1 
ATOM   5016  H HE1    . TYR A 1 320 ? -65.849  -10.882 45.46   0    140.7  ? 316  TYR A HE1    1 
ATOM   5017  H HE2    . TYR A 1 320 ? -63.179  -11.454 42.177  0    129.79 ? 316  TYR A HE2    1 
ATOM   5018  H HH     . TYR A 1 320 ? -63.128  -12.744 44.052  0    141.79 ? 316  TYR A HH     1 
ATOM   5019  N N      . LEU A 1 321 ? -64.338  -6.483  43.591  1    71.92  ? 317  LEU A N      1 
ATOM   5020  C CA     . LEU A 1 321 ? -63.171  -6.388  44.455  1    74.65  ? 317  LEU A CA     1 
ATOM   5021  C C      . LEU A 1 321 ? -63.125  -7.664  45.309  1    77.52  ? 317  LEU A C      1 
ATOM   5022  O O      . LEU A 1 321 ? -62.283  -8.527  45.074  1    78.81  ? 317  LEU A O      1 
ATOM   5023  C CB     . LEU A 1 321 ? -63.224  -5.101  45.318  1    75.78  ? 317  LEU A CB     1 
ATOM   5024  C CG     . LEU A 1 321 ? -63.315  -3.759  44.617  1    73.28  ? 317  LEU A CG     1 
ATOM   5025  C CD1    . LEU A 1 321 ? -64.496  -3.68   43.746  1    70.93  ? 317  LEU A CD1    1 
ATOM   5026  C CD2    . LEU A 1 321 ? -63.446  -2.647  45.623  1    74.94  ? 317  LEU A CD2    1 
ATOM   5027  H H      . LEU A 1 321 ? -65.204  -6.203  44.042  0    128.51 ? 317  LEU A H      1 
ATOM   5028  H HA     . LEU A 1 321 ? -62.255  -6.34   43.869  0    133.58 ? 317  LEU A HA     1 
ATOM   5029  H HB2    . LEU A 1 321 ? -64.074  -5.151  45.996  0    137.46 ? 317  LEU A HB2    1 
ATOM   5030  H HB3    . LEU A 1 321 ? -62.303  -5.072  45.895  0    138.42 ? 317  LEU A HB3    1 
ATOM   5031  H HG     . LEU A 1 321 ? -62.419  -3.586  44.023  0    130.38 ? 317  LEU A HG     1 
ATOM   5032  H HD11   . LEU A 1 321 ? -64.526  -2.683  43.314  0    123.82 ? 317  LEU A HD11   1 
ATOM   5033  H HD12   . LEU A 1 321 ? -64.405  -4.413  42.945  0    123.98 ? 317  LEU A HD12   1 
ATOM   5034  H HD13   . LEU A 1 321 ? -65.396  -3.869  44.329  0    125.83 ? 317  LEU A HD13   1 
ATOM   5035  H HD21   . LEU A 1 321 ? -63.356  -1.691  45.111  0    132.84 ? 317  LEU A HD21   1 
ATOM   5036  H HD22   . LEU A 1 321 ? -64.423  -2.712  46.101  0    135.51 ? 317  LEU A HD22   1 
ATOM   5037  H HD23   . LEU A 1 321 ? -62.673  -2.749  46.383  0    136.6  ? 317  LEU A HD23   1 
ATOM   5038  N N      . ASP A 1 322 ? -64.055  -7.806  46.258  1    78.61  ? 318  ASP A N      1 
ATOM   5039  C CA     . ASP A 1 322 ? -64.147  -8.979  47.111  1    81.62  ? 318  ASP A CA     1 
ATOM   5040  C C      . ASP A 1 322 ? -65.42   -8.944  47.921  1    82.1   ? 318  ASP A C      1 
ATOM   5041  O O      . ASP A 1 322 ? -65.941  -7.871  48.231  1    80.29  ? 318  ASP A O      1 
ATOM   5042  C CB     . ASP A 1 322 ? -62.938  -9.147  48.04   1    85.34  ? 318  ASP A CB     1 
ATOM   5043  C CG     . ASP A 1 322 ? -62.802  -10.576 48.514  1    88.07  ? 318  ASP A CG     1 
ATOM   5044  O OD1    . ASP A 1 322 ? -62.895  -11.494 47.66   1    87.14  ? 318  ASP A OD1    1 
ATOM   5045  O OD2    . ASP A 1 322 ? -62.634  -10.783 49.741  1    91.3   ? 318  ASP A OD2    1 
ATOM   5046  H H      . ASP A 1 322 ? -64.773  -7.111  46.437  0    142.38 ? 318  ASP A H      1 
ATOM   5047  H HA     . ASP A 1 322 ? -64.221  -9.831  46.437  0    149.48 ? 318  ASP A HA     1 
ATOM   5048  H HB2    . ASP A 1 322 ? -62.018  -8.88   47.522  0    157.22 ? 318  ASP A HB2    1 
ATOM   5049  H HB3    . ASP A 1 322 ? -63.072  -8.515  48.916  0    159.29 ? 318  ASP A HB3    1 
ATOM   5050  N N      . ASN A 1 323 ? -65.948  -10.127 48.239  1    84.72  ? 319  ASN A N      1 
ATOM   5051  C CA     . ASN A 1 323 ? -67.232  -10.249 48.917  1    85.82  ? 319  ASN A CA     1 
ATOM   5052  C C      . ASN A 1 323 ? -68.302  -9.806  47.879  1    82.56  ? 319  ASN A C      1 
ATOM   5053  O O      . ASN A 1 323 ? -68.062  -9.932  46.662  1    80.4   ? 319  ASN A O      1 
ATOM   5054  C CB     . ASN A 1 323 ? -67.248  -9.428  50.231  1    88.14  ? 319  ASN A CB     1 
ATOM   5055  C CG     . ASN A 1 323 ? -66.111  -9.753  51.167  1    91.35  ? 319  ASN A CG     1 
ATOM   5056  O OD1    . ASN A 1 323 ? -65.321  -10.684 50.953  1    92.08  ? 319  ASN A OD1    1 
ATOM   5057  N ND2    . ASN A 1 323 ? -66.01   -8.996  52.245  1    93.54  ? 319  ASN A ND2    1 
ATOM   5058  H H      . ASN A 1 323 ? -65.51   -11.019 48.035  0    157.75 ? 319  ASN A H      1 
ATOM   5059  H HA     . ASN A 1 323 ? -67.412  -11.294 49.163  0    161.08 ? 319  ASN A HA     1 
ATOM   5060  H HB2    . ASN A 1 323 ? -67.215  -8.363  50.005  0    162.43 ? 319  ASN A HB2    1 
ATOM   5061  H HB3    . ASN A 1 323 ? -68.172  -9.656  50.761  0    165.67 ? 319  ASN A HB3    1 
ATOM   5062  H HD21   . ASN A 1 323 ? -65.267  -9.16   52.916  0    178.53 ? 319  ASN A HD21   1 
ATOM   5063  H HD22   . ASN A 1 323 ? -66.679  -8.248  52.401  0    175.52 ? 319  ASN A HD22   1 
ATOM   5064  N N      . GLY A 1 324 ? -69.448  -9.315  48.333  1    82.55  ? 320  GLY A N      1 
ATOM   5065  C CA     . GLY A 1 324 ? -70.464  -8.827  47.421  1    79.93  ? 320  GLY A CA     1 
ATOM   5066  C C      . GLY A 1 324 ? -70.087  -7.516  46.761  1    77.48  ? 320  GLY A C      1 
ATOM   5067  O O      . GLY A 1 324 ? -70.75   -7.129  45.802  1    75.59  ? 320  GLY A O      1 
ATOM   5068  H H      . GLY A 1 324 ? -69.725  -9.261  49.308  0    153.95 ? 320  GLY A H      1 
ATOM   5069  H HA2    . GLY A 1 324 ? -70.645  -9.563  46.64   0    144.62 ? 320  GLY A HA2    1 
ATOM   5070  H HA3    . GLY A 1 324 ? -71.397  -8.684  47.964  0    146.76 ? 320  GLY A HA3    1 
ATOM   5071  N N      . VAL A 1 325 ? -69.032  -6.822  47.228  1    77.69  ? 321  VAL A N      1 
ATOM   5072  C CA     . VAL A 1 325 ? -68.695  -5.501  46.705  1    75.61  ? 321  VAL A CA     1 
ATOM   5073  C C      . VAL A 1 325 ? -68.112  -5.489  45.281  1    72.63  ? 321  VAL A C      1 
ATOM   5074  O O      . VAL A 1 325 ? -67.076  -6.11   45.023  1    73.11  ? 321  VAL A O      1 
ATOM   5075  C CB     . VAL A 1 325 ? -67.768  -4.758  47.677  1    77.65  ? 321  VAL A CB     1 
ATOM   5076  C CG1    . VAL A 1 325 ? -67.415  -3.375  47.133  1    75.39  ? 321  VAL A CG1    1 
ATOM   5077  C CG2    . VAL A 1 325 ? -68.414  -4.651  49.061  1    80.3   ? 321  VAL A CG2    1 
ATOM   5078  H H      . VAL A 1 325 ? -68.383  -7.153  47.933  0    143.49 ? 321  VAL A H      1 
ATOM   5079  H HA     . VAL A 1 325 ? -69.621  -4.927  46.677  0    135.84 ? 321  VAL A HA     1 
ATOM   5080  H HB     . VAL A 1 325 ? -66.843  -5.323  47.783  0    142.01 ? 321  VAL A HB     1 
ATOM   5081  H HG11   . VAL A 1 325 ? -67.077  -2.748  47.956  0    137.84 ? 321  VAL A HG11   1 
ATOM   5082  H HG12   . VAL A 1 325 ? -66.61   -3.462  46.405  0    134.58 ? 321  VAL A HG12   1 
ATOM   5083  H HG13   . VAL A 1 325 ? -68.296  -2.933  46.669  0    134.75 ? 321  VAL A HG13   1 
ATOM   5084  H HG21   . VAL A 1 325 ? -67.753  -4.089  49.719  0    148.84 ? 321  VAL A HG21   1 
ATOM   5085  H HG22   . VAL A 1 325 ? -69.368  -4.135  48.968  0    146.42 ? 321  VAL A HG22   1 
ATOM   5086  H HG23   . VAL A 1 325 ? -68.568  -5.645  49.476  0    148.91 ? 321  VAL A HG23   1 
ATOM   5087  N N      . VAL A 1 326 ? -68.782  -4.7    44.381  1    69.89  ? 322  VAL A N      1 
ATOM   5088  C CA     . VAL A 1 326 ? -68.406  -4.483  42.98   1    67.02  ? 322  VAL A CA     1 
ATOM   5089  C C      . VAL A 1 326 ? -68.202  -3.012  42.715  1    65.32  ? 322  VAL A C      1 
ATOM   5090  O O      . VAL A 1 326 ? -68.995  -2.201  43.192  1    65.22  ? 322  VAL A O      1 
ATOM   5091  C CB     . VAL A 1 326 ? -69.438  -5.007  41.944  1    65.47  ? 322  VAL A CB     1 
ATOM   5092  C CG1    . VAL A 1 326 ? -68.861  -4.972  40.533  1    63.12  ? 322  VAL A CG1    1 
ATOM   5093  C CG2    . VAL A 1 326 ? -69.942  -6.397  42.273  1    67.56  ? 322  VAL A CG2    1 
ATOM   5094  H H      . VAL A 1 326 ? -69.622  -4.18   44.619  0    123.88 ? 322  VAL A H      1 
ATOM   5095  H HA     . VAL A 1 326 ? -67.445  -4.958  42.83   0    118.04 ? 322  VAL A HA     1 
ATOM   5096  H HB     . VAL A 1 326 ? -70.302  -4.347  41.946  0    113.23 ? 322  VAL A HB     1 
ATOM   5097  H HG11   . VAL A 1 326 ? -69.535  -5.514  39.871  0    107.69 ? 322  VAL A HG11   1 
ATOM   5098  H HG12   . VAL A 1 326 ? -68.777  -3.941  40.191  0    107.4  ? 322  VAL A HG12   1 
ATOM   5099  H HG13   . VAL A 1 326 ? -67.882  -5.447  40.531  0    109.44 ? 322  VAL A HG13   1 
ATOM   5100  H HG21   . VAL A 1 326 ? -70.948  -6.492  41.867  0    117.14 ? 322  VAL A HG21   1 
ATOM   5101  H HG22   . VAL A 1 326 ? -69.307  -7.131  41.783  0    118.4  ? 322  VAL A HG22   1 
ATOM   5102  H HG23   . VAL A 1 326 ? -69.966  -6.568  43.348  0    120.3  ? 322  VAL A HG23   1 
ATOM   5103  N N      . PHE A 1 327 ? -67.19   -2.663  41.898  1    64.22  ? 323  PHE A N      1 
ATOM   5104  C CA     . PHE A 1 327 ? -66.998  -1.275  41.503  1    62.71  ? 323  PHE A CA     1 
ATOM   5105  C C      . PHE A 1 327 ? -67.525  -1.131  40.069  1    59.92  ? 323  PHE A C      1 
ATOM   5106  O O      . PHE A 1 327 ? -66.983  -1.722  39.124  1    58.81  ? 323  PHE A O      1 
ATOM   5107  C CB     . PHE A 1 327 ? -65.549  -0.762  41.649  1    63.26  ? 323  PHE A CB     1 
ATOM   5108  C CG     . PHE A 1 327 ? -65.419  0.65    41.13   1    61.86  ? 323  PHE A CG     1 
ATOM   5109  C CD1    . PHE A 1 327 ? -65.924  1.718   41.853  1    62.9   ? 323  PHE A CD1    1 
ATOM   5110  C CD2    . PHE A 1 327 ? -64.909  0.898   39.865  1    59.71  ? 323  PHE A CD2    1 
ATOM   5111  C CE1    . PHE A 1 327 ? -65.926  2.999   41.322  1    61.81  ? 323  PHE A CE1    1 
ATOM   5112  C CE2    . PHE A 1 327 ? -64.878  2.188   39.352  1    58.63  ? 323  PHE A CE2    1 
ATOM   5113  C CZ     . PHE A 1 327 ? -65.405  3.227   40.075  1    59.69  ? 323  PHE A CZ     1 
ATOM   5114  H H      . PHE A 1 327 ? -66.507  -3.304  41.508  0    111.45 ? 323  PHE A H      1 
ATOM   5115  H HA     . PHE A 1 327 ? -67.591  -0.628  42.148  0    108.92 ? 323  PHE A HA     1 
ATOM   5116  H HB2    . PHE A 1 327 ? -65.311  -0.695  42.709  0    111.54 ? 323  PHE A HB2    1 
ATOM   5117  H HB3    . PHE A 1 327 ? -64.852  -1.412  41.122  0    109.11 ? 323  PHE A HB3    1 
ATOM   5118  H HD1    . PHE A 1 327 ? -66.372  1.542   42.817  0    110.11 ? 323  PHE A HD1    1 
ATOM   5119  H HD2    . PHE A 1 327 ? -64.535  0.081   39.273  0    100.87 ? 323  PHE A HD2    1 
ATOM   5120  H HE1    . PHE A 1 327 ? -66.3    3.823   41.906  0    106.56 ? 323  PHE A HE1    1 
ATOM   5121  H HE2    . PHE A 1 327 ? -64.468  2.368   38.372  0    97.35  ? 323  PHE A HE2    1 
ATOM   5122  H HZ     . PHE A 1 327 ? -65.35   4.232   39.691  0    100.21 ? 323  PHE A HZ     1 
ATOM   5123  N N      . VAL A 1 328 ? -68.626  -0.365  39.94   1    59.07  ? 324  VAL A N      1 
ATOM   5124  C CA     . VAL A 1 328 ? -69.289  -0.074  38.679  1    56.74  ? 324  VAL A CA     1 
ATOM   5125  C C      . VAL A 1 328 ? -68.67   1.224   38.157  1    55.56  ? 324  VAL A C      1 
ATOM   5126  O O      . VAL A 1 328 ? -69.002  2.306   38.646  1    55.92  ? 324  VAL A O      1 
ATOM   5127  C CB     . VAL A 1 328 ? -70.826  0.064   38.884  1    56.9   ? 324  VAL A CB     1 
ATOM   5128  C CG1    . VAL A 1 328 ? -71.536  0.231   37.55   1    54.77  ? 324  VAL A CG1    1 
ATOM   5129  C CG2    . VAL A 1 328 ? -71.397  -1.134  39.638  1    58.5   ? 324  VAL A CG2    1 
ATOM   5130  H H      . VAL A 1 328 ? -69.087  0.086   40.725  0    101.1  ? 324  VAL A H      1 
ATOM   5131  H HA     . VAL A 1 328 ? -69.109  -0.87   37.959  0    94.18  ? 324  VAL A HA     1 
ATOM   5132  H HB     . VAL A 1 328 ? -71.032  0.948   39.486  0    96.1   ? 324  VAL A HB     1 
ATOM   5133  H HG11   . VAL A 1 328 ? -72.611  0.263   37.725  0    91.12  ? 324  VAL A HG11   1 
ATOM   5134  H HG12   . VAL A 1 328 ? -71.216  1.153   37.068  0    89.65  ? 324  VAL A HG12   1 
ATOM   5135  H HG13   . VAL A 1 328 ? -71.282  -0.621  36.921  0    90.07  ? 324  VAL A HG13   1 
ATOM   5136  H HG21   . VAL A 1 328 ? -72.483  -1.078  39.636  0    99.1   ? 324  VAL A HG21   1 
ATOM   5137  H HG22   . VAL A 1 328 ? -71.071  -2.05   39.147  0    98.49  ? 324  VAL A HG22   1 
ATOM   5138  H HG23   . VAL A 1 328 ? -71.042  -1.117  40.667  0    100.73 ? 324  VAL A HG23   1 
ATOM   5139  N N      . GLY A 1 329 ? -67.735  1.101   37.222  1    54.44  ? 325  GLY A N      1 
ATOM   5140  C CA     . GLY A 1 329 ? -67.079  2.256   36.621  1    53.38  ? 325  GLY A CA     1 
ATOM   5141  C C      . GLY A 1 329 ? -67.907  2.756   35.462  1    51.47  ? 325  GLY A C      1 
ATOM   5142  O O      . GLY A 1 329 ? -67.902  2.128   34.403  1    50.26  ? 325  GLY A O      1 
ATOM   5143  H H      . GLY A 1 329 ? -67.408  0.215   36.852  0    89.75  ? 325  GLY A H      1 
ATOM   5144  H HA2    . GLY A 1 329 ? -66.944  3.055   37.349  0    88.43  ? 325  GLY A HA2    1 
ATOM   5145  H HA3    . GLY A 1 329 ? -66.101  1.963   36.245  0    87.3   ? 325  GLY A HA3    1 
ATOM   5146  N N      . SER A 1 330 ? -68.695  3.836   35.692  1    51.47  ? 326  SER A N      1 
ATOM   5147  C CA     . SER A 1 330 ? -69.624  4.394   34.699  1    49.99  ? 326  SER A CA     1 
ATOM   5148  C C      . SER A 1 330 ? -69.053  5.601   33.988  1    49.35  ? 326  SER A C      1 
ATOM   5149  O O      . SER A 1 330 ? -68.444  6.451   34.63   1    50.48  ? 326  SER A O      1 
ATOM   5150  C CB     . SER A 1 330 ? -70.935  4.793   35.372  1    50.67  ? 326  SER A CB     1 
ATOM   5151  O OG     . SER A 1 330 ? -71.851  5.336   34.435  1    49.55  ? 326  SER A OG     1 
ATOM   5152  H H      . SER A 1 330 ? -68.706  4.346   36.569  0    84.53  ? 326  SER A H      1 
ATOM   5153  H HA     . SER A 1 330 ? -69.858  3.634   33.955  0    79.24  ? 326  SER A HA     1 
ATOM   5154  H HB2    . SER A 1 330 ? -71.378  3.91    35.829  0    82.43  ? 326  SER A HB2    1 
ATOM   5155  H HB3    . SER A 1 330 ? -70.728  5.541   36.136  0    83.07  ? 326  SER A HB3    1 
ATOM   5156  H HG     . SER A 1 330 ? -71.827  4.823   33.585  0    78.57  ? 326  SER A HG     1 
ATOM   5157  N N      . ARG A 1 331 ? -69.272  5.691   32.677  1    50.31  ? 327  ARG A N      1 
ATOM   5158  C CA     . ARG A 1 331 ? -68.806  6.828   31.897  1    49.57  ? 327  ARG A CA     1 
ATOM   5159  C C      . ARG A 1 331 ? -69.936  7.819   31.619  1    46.4   ? 327  ARG A C      1 
ATOM   5160  O O      . ARG A 1 331 ? -69.662  9.008   31.44   1    45.44  ? 327  ARG A O      1 
ATOM   5161  C CB     . ARG A 1 331 ? -68.204  6.35    30.573  1    51.61  ? 327  ARG A CB     1 
ATOM   5162  C CG     . ARG A 1 331 ? -67.473  7.447   29.805  1    51.84  ? 327  ARG A CG     1 
ATOM   5163  C CD     . ARG A 1 331 ? -67.63   7.326   28.298  1    53.42  ? 327  ARG A CD     1 
ATOM   5164  N NE     . ARG A 1 331 ? -66.481  7.896   27.592  1    55.84  ? 327  ARG A NE     1 
ATOM   5165  C CZ     . ARG A 1 331 ? -65.3    7.292   27.436  1    60.18  ? 327  ARG A CZ     1 
ATOM   5166  N NH1    . ARG A 1 331 ? -65.085  6.083   27.958  1    62.43  ? 327  ARG A NH1    1 
ATOM   5167  N NH2    . ARG A 1 331 ? -64.317  7.902   26.779  1    62.74  ? 327  ARG A NH2    1 
ATOM   5168  H H      . ARG A 1 331 ? -69.762  4.995   32.124  0    80.79  ? 327  ARG A H      1 
ATOM   5169  H HA     . ARG A 1 331 ? -68.023  7.359   32.437  0    79.9   ? 327  ARG A HA     1 
ATOM   5170  H HB2    . ARG A 1 331 ? -67.462  5.583   30.788  0    86.37  ? 327  ARG A HB2    1 
ATOM   5171  H HB3    . ARG A 1 331 ? -68.996  5.947   29.944  0    83.14  ? 327  ARG A HB3    1 
ATOM   5172  H HG2    . ARG A 1 331 ? -67.835  8.431   30.099  0    82.23  ? 327  ARG A HG2    1 
ATOM   5173  H HG3    . ARG A 1 331 ? -66.413  7.37    30.039  0    86.93  ? 327  ARG A HG3    1 
ATOM   5174  H HD2    . ARG A 1 331 ? -67.754  6.284   28.006  0    89.06  ? 327  ARG A HD2    1 
ATOM   5175  H HD3    . ARG A 1 331 ? -68.51   7.894   27.999  0    85     ? 327  ARG A HD3    1 
ATOM   5176  H HE     . ARG A 1 331 ? -66.602  8.818   27.184  0    91.52  ? 327  ARG A HE     1 
ATOM   5177  H HH11   . ARG A 1 331 ? -65.799  5.581   28.474  0    105.64 ? 327  ARG A HH11   1 
ATOM   5178  H HH12   . ARG A 1 331 ? -64.18   5.643   27.832  0    110.96 ? 327  ARG A HH12   1 
ATOM   5179  H HH21   . ARG A 1 331 ? -64.464  8.823   26.379  0    106.54 ? 327  ARG A HH21   1 
ATOM   5180  H HH22   . ARG A 1 331 ? -63.418  7.446   26.662  0    111.84 ? 327  ARG A HH22   1 
ATOM   5181  N N      . LEU A 1 332 ? -71.189  7.345   31.549  1    45.4   ? 328  LEU A N      1 
ATOM   5182  C CA     . LEU A 1 332 ? -72.331  8.209   31.262  1    43.18  ? 328  LEU A CA     1 
ATOM   5183  C C      . LEU A 1 332 ? -72.867  8.882   32.531  1    41.89  ? 328  LEU A C      1 
ATOM   5184  O O      . LEU A 1 332 ? -73.12   10.09   32.528  1    40.7   ? 328  LEU A O      1 
ATOM   5185  C CB     . LEU A 1 332 ? -73.424  7.404   30.555  1    43.62  ? 328  LEU A CB     1 
ATOM   5186  C CG     . LEU A 1 332 ? -72.98   6.739   29.253  1    45.54  ? 328  LEU A CG     1 
ATOM   5187  C CD1    . LEU A 1 332 ? -74.031  5.809   28.736  1    46.7   ? 328  LEU A CD1    1 
ATOM   5188  C CD2    . LEU A 1 332 ? -72.635  7.76    28.206  1    45     ? 328  LEU A CD2    1 
ATOM   5189  H H      . LEU A 1 332 ? -71.449  6.372   31.671  0    70.62  ? 328  LEU A H      1 
ATOM   5190  H HA     . LEU A 1 332 ? -72.02   9.005   30.587  0    64.43  ? 328  LEU A HA     1 
ATOM   5191  H HB2    . LEU A 1 332 ? -73.761  6.615   31.226  0    66.24  ? 328  LEU A HB2    1 
ATOM   5192  H HB3    . LEU A 1 332 ? -74.257  8.068   30.328  0    64.46  ? 328  LEU A HB3    1 
ATOM   5193  H HG     . LEU A 1 332 ? -72.088  6.141   29.434  0    71.55  ? 328  LEU A HG     1 
ATOM   5194  H HD11   . LEU A 1 332 ? -73.674  5.332   27.825  0    74.61  ? 328  LEU A HD11   1 
ATOM   5195  H HD12   . LEU A 1 332 ? -74.231  5.052   29.493  0    73.22  ? 328  LEU A HD12   1 
ATOM   5196  H HD13   . LEU A 1 332 ? -74.937  6.377   28.528  0    71.49  ? 328  LEU A HD13   1 
ATOM   5197  H HD21   . LEU A 1 332 ? -72.573  7.275   27.233  0    70.63  ? 328  LEU A HD21   1 
ATOM   5198  H HD22   . LEU A 1 332 ? -73.407  8.529   28.187  0    67.2   ? 328  LEU A HD22   1 
ATOM   5199  H HD23   . LEU A 1 332 ? -71.672  8.208   28.444  0    69.08  ? 328  LEU A HD23   1 
ATOM   5200  N N      . GLY A 1 333 ? -72.978  8.115   33.609  1    42.63  ? 329  GLY A N      1 
ATOM   5201  C CA     . GLY A 1 333 ? -73.448  8.605   34.903  1    42.3   ? 329  GLY A CA     1 
ATOM   5202  C C      . GLY A 1 333 ? -72.47   8.396   36.037  1    43.98  ? 329  GLY A C      1 
ATOM   5203  O O      . GLY A 1 333 ? -71.33   7.987   35.815  1    45.09  ? 329  GLY A O      1 
ATOM   5204  H H      . GLY A 1 333 ? -72.763  7.124   33.618  0    64.97  ? 329  GLY A H      1 
ATOM   5205  H HA2    . GLY A 1 333 ? -73.714  9.66    34.867  0    62.4   ? 329  GLY A HA2    1 
ATOM   5206  H HA3    . GLY A 1 333 ? -74.335  8.039   35.182  0    63.37  ? 329  GLY A HA3    1 
ATOM   5207  N N      . ASP A 1 334 ? -72.936  8.649   37.268  1    44.83  ? 330  ASP A N      1 
ATOM   5208  C CA     . ASP A 1 334 ? -72.139  8.482   38.486  1    47.19  ? 330  ASP A CA     1 
ATOM   5209  C C      . ASP A 1 334 ? -71.602  7.043   38.651  1    48.63  ? 330  ASP A C      1 
ATOM   5210  O O      . ASP A 1 334 ? -72.35   6.093   38.447  1    48.21  ? 330  ASP A O      1 
ATOM   5211  C CB     . ASP A 1 334 ? -72.981  8.855   39.729  1    48.39  ? 330  ASP A CB     1 
ATOM   5212  C CG     . ASP A 1 334 ? -73.121  10.346  40.026  1    48.82  ? 330  ASP A CG     1 
ATOM   5213  O OD1    . ASP A 1 334 ? -72.626  11.161  39.224  1    47.52  ? 330  ASP A OD1    1 
ATOM   5214  O OD2    . ASP A 1 334 ? -73.712  10.693  41.078  1    50.97  ? 330  ASP A OD2    1 
ATOM   5215  H H      . ASP A 1 334 ? -73.879  8.979   37.441  0    68.13  ? 330  ASP A H      1 
ATOM   5216  H HA     . ASP A 1 334 ? -71.278  9.146   38.467  0    74.57  ? 330  ASP A HA     1 
ATOM   5217  H HB2    . ASP A 1 334 ? -73.981  8.435   39.629  0    75.66  ? 330  ASP A HB2    1 
ATOM   5218  H HB3    . ASP A 1 334 ? -72.49   8.405   40.589  0    78.47  ? 330  ASP A HB3    1 
ATOM   5219  N N      . SER A 1 335 ? -70.329  6.88    39.059  1    50.91  ? 331  SER A N      1 
ATOM   5220  C CA     . SER A 1 335 ? -69.777  5.547   39.318  1    52.95  ? 331  SER A CA     1 
ATOM   5221  C C      . SER A 1 335 ? -70.215  5.095   40.723  1    54.56  ? 331  SER A C      1 
ATOM   5222  O O      . SER A 1 335 ? -70.586  5.935   41.547  1    54.83  ? 331  SER A O      1 
ATOM   5223  C CB     . SER A 1 335 ? -68.262  5.557   39.182  1    55.66  ? 331  SER A CB     1 
ATOM   5224  O OG     . SER A 1 335 ? -67.918  5.923   37.856  1    54.79  ? 331  SER A OG     1 
ATOM   5225  H H      . SER A 1 335 ? -69.673  7.637   39.219  0    82.8   ? 331  SER A H      1 
ATOM   5226  H HA     . SER A 1 335 ? -70.166  4.831   38.595  0    85.63  ? 331  SER A HA     1 
ATOM   5227  H HB2    . SER A 1 335 ? -67.839  6.28    39.878  0    93.85  ? 331  SER A HB2    1 
ATOM   5228  H HB3    . SER A 1 335 ? -67.875  4.561   39.391  0    94.26  ? 331  SER A HB3    1 
ATOM   5229  H HG     . SER A 1 335 ? -67.019  6.344   37.842  0    92.01  ? 331  SER A HG     1 
ATOM   5230  N N      . GLN A 1 336 ? -70.213  3.775   40.989  1    56.07  ? 332  GLN A N      1 
ATOM   5231  C CA     . GLN A 1 336 ? -70.71   3.263   42.272  1    57.85  ? 332  GLN A CA     1 
ATOM   5232  C C      . GLN A 1 336 ? -69.896  2.117   42.858  1    61.04  ? 332  GLN A C      1 
ATOM   5233  O O      . GLN A 1 336 ? -69.147  1.462   42.149  1    61.78  ? 332  GLN A O      1 
ATOM   5234  C CB     . GLN A 1 336 ? -72.113  2.666   42.073  1    56.3   ? 332  GLN A CB     1 
ATOM   5235  C CG     . GLN A 1 336 ? -73.133  3.497   41.356  1    53.56  ? 332  GLN A CG     1 
ATOM   5236  C CD     . GLN A 1 336 ? -74.339  2.617   41.14   1    53.31  ? 332  GLN A CD     1 
ATOM   5237  O OE1    . GLN A 1 336 ? -74.327  1.726   40.277  1    53.03  ? 332  GLN A OE1    1 
ATOM   5238  N NE2    . GLN A 1 336 ? -75.393  2.807   41.93   1    54.14  ? 332  GLN A NE2    1 
ATOM   5239  H H      . GLN A 1 336 ? -69.872  3.058   40.355  0    93.66  ? 332  GLN A H      1 
ATOM   5240  H HA     . GLN A 1 336 ? -70.77   4.056   43.017  0    98.13  ? 332  GLN A HA     1 
ATOM   5241  H HB2    . GLN A 1 336 ? -71.998  1.74    41.511  0    93.89  ? 332  GLN A HB2    1 
ATOM   5242  H HB3    . GLN A 1 336 ? -72.528  2.439   43.053  0    95.37  ? 332  GLN A HB3    1 
ATOM   5243  H HG2    . GLN A 1 336 ? -73.406  4.365   41.954  0    88.03  ? 332  GLN A HG2    1 
ATOM   5244  H HG3    . GLN A 1 336 ? -72.761  3.801   40.379  0    86.34  ? 332  GLN A HG3    1 
ATOM   5245  H HE21   . GLN A 1 336 ? -75.377  3.523   42.648  0    89.64  ? 332  GLN A HE21   1 
ATOM   5246  H HE22   . GLN A 1 336 ? -76.222  2.235   41.805  0    89.11  ? 332  GLN A HE22   1 
ATOM   5247  N N      . LEU A 1 337 ? -70.136  1.827   44.152  1    63.37  ? 333  LEU A N      1 
ATOM   5248  C CA     . LEU A 1 337 ? -69.682  0.654   44.887  1    66.58  ? 333  LEU A CA     1 
ATOM   5249  C C      . LEU A 1 337 ? -71.01   0.031   45.287  1    65.91  ? 333  LEU A C      1 
ATOM   5250  O O      . LEU A 1 337 ? -71.817  0.685   45.943  1    65.82  ? 333  LEU A O      1 
ATOM   5251  C CB     . LEU A 1 337 ? -68.883  1.004   46.144  1    70.67  ? 333  LEU A CB     1 
ATOM   5252  C CG     . LEU A 1 337 ? -67.403  1.244   45.953  1    73.35  ? 333  LEU A CG     1 
ATOM   5253  C CD1    . LEU A 1 337 ? -66.787  1.767   47.223  1    78.04  ? 333  LEU A CD1    1 
ATOM   5254  C CD2    . LEU A 1 337 ? -66.697  -0.003  45.476  1    74.88  ? 333  LEU A CD2    1 
ATOM   5255  H H      . LEU A 1 337 ? -70.685  2.444   44.741  0    109.53 ? 333  LEU A H      1 
ATOM   5256  H HA     . LEU A 1 337 ? -69.136  -0.033  44.244  0    116.86 ? 333  LEU A HA     1 
ATOM   5257  H HB2    . LEU A 1 337 ? -69.307  1.91    46.573  0    125.34 ? 333  LEU A HB2    1 
ATOM   5258  H HB3    . LEU A 1 337 ? -68.995  0.189   46.858  0    127.68 ? 333  LEU A HB3    1 
ATOM   5259  H HG     . LEU A 1 337 ? -67.261  2       45.184  0    129.43 ? 333  LEU A HG     1 
ATOM   5260  H HD11   . LEU A 1 337 ? -65.731  1.975   47.055  0    143.74 ? 333  LEU A HD11   1 
ATOM   5261  H HD12   . LEU A 1 337 ? -67.299  2.683   47.516  0    140.84 ? 333  LEU A HD12   1 
ATOM   5262  H HD13   . LEU A 1 337 ? -66.897  1.016   48.003  0    143.79 ? 333  LEU A HD13   1 
ATOM   5263  H HD21   . LEU A 1 337 ? -65.632  0.091   45.683  0    137.83 ? 333  LEU A HD21   1 
ATOM   5264  H HD22   . LEU A 1 337 ? -67.1    -0.871  45.996  0    136.25 ? 333  LEU A HD22   1 
ATOM   5265  H HD23   . LEU A 1 337 ? -66.84   -0.11   44.402  0    132.34 ? 333  LEU A HD23   1 
ATOM   5266  N N      . VAL A 1 338 ? -71.28   -1.18   44.829  1    65.89  ? 334  VAL A N      1 
ATOM   5267  C CA     . VAL A 1 338 ? -72.557  -1.841  45.086  1    65.78  ? 334  VAL A CA     1 
ATOM   5268  C C      . VAL A 1 338 ? -72.321  -3.186  45.755  1    69.05  ? 334  VAL A C      1 
ATOM   5269  O O      . VAL A 1 338 ? -71.348  -3.866  45.446  1    70.6   ? 334  VAL A O      1 
ATOM   5270  C CB     . VAL A 1 338 ? -73.376  -1.974  43.782  1    63     ? 334  VAL A CB     1 
ATOM   5271  C CG1    . VAL A 1 338 ? -73.555  -0.613  43.117  1    60.03  ? 334  VAL A CG1    1 
ATOM   5272  C CG2    . VAL A 1 338 ? -72.725  -2.954  42.806  1    63.59  ? 334  VAL A CG2    1 
ATOM   5273  H H      . VAL A 1 338 ? -70.616  -1.757  44.322  0    115.59 ? 334  VAL A H      1 
ATOM   5274  H HA     . VAL A 1 338 ? -73.156  -1.244  45.772  0    114.92 ? 334  VAL A HA     1 
ATOM   5275  H HB     . VAL A 1 338 ? -74.365  -2.357  44.029  0    108.91 ? 334  VAL A HB     1 
ATOM   5276  H HG11   . VAL A 1 338 ? -74.315  -0.7    42.342  0    100.54 ? 334  VAL A HG11   1 
ATOM   5277  H HG12   . VAL A 1 338 ? -73.864  0.118   43.861  0    102.19 ? 334  VAL A HG12   1 
ATOM   5278  H HG13   . VAL A 1 338 ? -72.612  -0.31   42.663  0    101.8  ? 334  VAL A HG13   1 
ATOM   5279  H HG21   . VAL A 1 338 ? -73.223  -2.859  41.842  0    108.2  ? 334  VAL A HG21   1 
ATOM   5280  H HG22   . VAL A 1 338 ? -71.672  -2.7    42.696  0    110.28 ? 334  VAL A HG22   1 
ATOM   5281  H HG23   . VAL A 1 338 ? -72.839  -3.974  43.171  0    111.99 ? 334  VAL A HG23   1 
ATOM   5282  N N      . LYS A 1 339 ? -73.203  -3.562  46.678  1    70.56  ? 335  LYS A N      1 
ATOM   5283  C CA     . LYS A 1 339 ? -73.106  -4.822  47.402  1    73.91  ? 335  LYS A CA     1 
ATOM   5284  C C      . LYS A 1 339 ? -74.058  -5.831  46.778  1    73.47  ? 335  LYS A C      1 
ATOM   5285  O O      . LYS A 1 339 ? -75.256  -5.574  46.724  1    72.64  ? 335  LYS A O      1 
ATOM   5286  C CB     . LYS A 1 339 ? -73.477  -4.603  48.883  1    76.78  ? 335  LYS A CB     1 
ATOM   5287  C CG     . LYS A 1 339 ? -73.426  -5.853  49.783  1    80.8   ? 335  LYS A CG     1 
ATOM   5288  C CD     . LYS A 1 339 ? -72.01   -6.317  50.105  1    83.4   ? 335  LYS A CD     1 
ATOM   5289  C CE     . LYS A 1 339 ? -71.993  -7.386  51.176  1    87.81  ? 335  LYS A CE     1 
ATOM   5290  N NZ     . LYS A 1 339 ? -70.622  -7.623  51.702  1    91.14  ? 335  LYS A NZ     1 
ATOM   5291  H H      . LYS A 1 339 ? -74.014  -3.013  46.944  0    124.59 ? 335  LYS A H      1 
ATOM   5292  H HA     . LYS A 1 339 ? -72.091  -5.215  47.37   0    134.19 ? 335  LYS A HA     1 
ATOM   5293  H HB2    . LYS A 1 339 ? -72.793  -3.866  49.303  0    139.76 ? 335  LYS A HB2    1 
ATOM   5294  H HB3    . LYS A 1 339 ? -74.493  -4.214  48.931  0    138.04 ? 335  LYS A HB3    1 
ATOM   5295  H HG2    . LYS A 1 339 ? -73.912  -5.604  50.725  0    149.87 ? 335  LYS A HG2    1 
ATOM   5296  H HG3    . LYS A 1 339 ? -73.952  -6.683  49.315  0    147.53 ? 335  LYS A HG3    1 
ATOM   5297  H HD2    . LYS A 1 339 ? -71.563  -6.735  49.204  0    152.35 ? 335  LYS A HD2    1 
ATOM   5298  H HD3    . LYS A 1 339 ? -71.426  -5.467  50.458  0    154.32 ? 335  LYS A HD3    1 
ATOM   5299  H HE2    . LYS A 1 339 ? -72.624  -7.072  52.006  0    164.78 ? 335  LYS A HE2    1 
ATOM   5300  H HE3    . LYS A 1 339 ? -72.367  -8.32   50.758  0    163.11 ? 335  LYS A HE3    1 
ATOM   5301  H HZ1    . LYS A 1 339 ? -70.641  -8.374  52.385  0    173.92 ? 335  LYS A HZ1    1 
ATOM   5302  H HZ2    . LYS A 1 339 ? -69.998  -7.88   50.944  0    170.03 ? 335  LYS A HZ2    1 
ATOM   5303  H HZ3    . LYS A 1 339 ? -70.273  -6.782  52.151  0    171.8  ? 335  LYS A HZ3    1 
ATOM   5304  N N      . LEU A 1 340 ? -73.532  -6.968  46.301  1    74.74  ? 336  LEU A N      1 
ATOM   5305  C CA     . LEU A 1 340 ? -74.332  -8.063  45.78   1    75.48  ? 336  LEU A CA     1 
ATOM   5306  C C      . LEU A 1 340 ? -74.608  -8.959  46.955  1    79.12  ? 336  LEU A C      1 
ATOM   5307  O O      . LEU A 1 340 ? -73.673  -9.352  47.65   1    81.83  ? 336  LEU A O      1 
ATOM   5308  C CB     . LEU A 1 340 ? -73.588  -8.888  44.727  1    76.09  ? 336  LEU A CB     1 
ATOM   5309  C CG     . LEU A 1 340 ? -72.99   -8.154  43.554  1    73.47  ? 336  LEU A CG     1 
ATOM   5310  C CD1    . LEU A 1 340 ? -72.346  -9.142  42.6    1    75.41  ? 336  LEU A CD1    1 
ATOM   5311  C CD2    . LEU A 1 340 ? -74.026  -7.326  42.813  1    70.22  ? 336  LEU A CD2    1 
ATOM   5312  H H      . LEU A 1 340 ? -72.535  -7.155  46.258  0    135.6  ? 336  LEU A H      1 
ATOM   5313  H HA     . LEU A 1 340 ? -75.267  -7.703  45.353  0    134.4  ? 336  LEU A HA     1 
ATOM   5314  H HB2    . LEU A 1 340 ? -72.765  -9.409  45.213  0    140.04 ? 336  LEU A HB2    1 
ATOM   5315  H HB3    . LEU A 1 340 ? -74.286  -9.62   44.325  0    138.25 ? 336  LEU A HB3    1 
ATOM   5316  H HG     . LEU A 1 340 ? -72.219  -7.473  43.912  0    131.57 ? 336  LEU A HG     1 
ATOM   5317  H HD11   . LEU A 1 340 ? -72.106  -8.628  41.671  0    134.59 ? 336  LEU A HD11   1 
ATOM   5318  H HD12   . LEU A 1 340 ? -71.431  -9.524  43.052  0    138.52 ? 336  LEU A HD12   1 
ATOM   5319  H HD13   . LEU A 1 340 ? -73.033  -9.963  42.405  0    137.69 ? 336  LEU A HD13   1 
ATOM   5320  H HD21   . LEU A 1 340 ? -73.552  -6.837  41.963  0    123.1  ? 336  LEU A HD21   1 
ATOM   5321  H HD22   . LEU A 1 340 ? -74.814  -7.993  42.466  0    125.45 ? 336  LEU A HD22   1 
ATOM   5322  H HD23   . LEU A 1 340 ? -74.44   -6.568  43.477  0    123.67 ? 336  LEU A HD23   1 
ATOM   5323  N N      . ASN A 1 341 ? -75.873  -9.281  47.194  1    79.74  ? 337  ASN A N      1 
ATOM   5324  C CA     . ASN A 1 341 ? -76.242  -10.156 48.297  1    83.55  ? 337  ASN A CA     1 
ATOM   5325  C C      . ASN A 1 341 ? -76.788  -11.469 47.764  1    85.51  ? 337  ASN A C      1 
ATOM   5326  O O      . ASN A 1 341 ? -77.302  -11.533 46.637  1    84.06  ? 337  ASN A O      1 
ATOM   5327  C CB     . ASN A 1 341 ? -77.269  -9.482  49.196  1    84.18  ? 337  ASN A CB     1 
ATOM   5328  C CG     . ASN A 1 341 ? -76.739  -8.233  49.853  1    83.77  ? 337  ASN A CG     1 
ATOM   5329  O OD1    . ASN A 1 341 ? -77.261  -7.133  49.652  1    82.42  ? 337  ASN A OD1    1 
ATOM   5330  N ND2    . ASN A 1 341 ? -75.685  -8.371  50.65   1    85.57  ? 337  ASN A ND2    1 
ATOM   5331  H H      . ASN A 1 341 ? -76.666  -8.956  46.65   0    143.87 ? 337  ASN A H      1 
ATOM   5332  H HA     . ASN A 1 341 ? -75.372  -10.381 48.91   0    155.62 ? 337  ASN A HA     1 
ATOM   5333  H HB2    . ASN A 1 341 ? -78.139  -9.212  48.598  0    153.63 ? 337  ASN A HB2    1 
ATOM   5334  H HB3    . ASN A 1 341 ? -77.561  -10.179 49.981  0    158.18 ? 337  ASN A HB3    1 
ATOM   5335  H HD21   . ASN A 1 341 ? -75.297  -7.554  51.111  0    158.03 ? 337  ASN A HD21   1 
ATOM   5336  H HD22   . ASN A 1 341 ? -75.271  -9.285  50.804  0    160.01 ? 337  ASN A HD22   1 
ATOM   5337  N N      . VAL A 1 342 ? -76.618  -12.534 48.565  1    89.27  ? 338  VAL A N      1 
ATOM   5338  C CA     . VAL A 1 342 ? -77.137  -13.865 48.242  1    92.18  ? 338  VAL A CA     1 
ATOM   5339  C C      . VAL A 1 342 ? -78.691  -13.868 48.283  1    92.87  ? 338  VAL A C      1 
ATOM   5340  O O      . VAL A 1 342 ? -79.315  -14.62  47.527  1    93.92  ? 338  VAL A O      1 
ATOM   5341  C CB     . VAL A 1 342 ? -76.503  -14.979 49.128  1    96.34  ? 338  VAL A CB     1 
ATOM   5342  C CG1    . VAL A 1 342 ? -75.007  -15.117 48.844  1    97.04  ? 338  VAL A CG1    1 
ATOM   5343  C CG2    . VAL A 1 342 ? -76.747  -14.738 50.62   1    97.88  ? 338  VAL A CG2    1 
ATOM   5344  H H      . VAL A 1 342 ? -76.07   -12.493 49.417  0    167.84 ? 338  VAL A H      1 
ATOM   5345  H HA     . VAL A 1 342 ? -76.862  -14.091 47.211  0    171.79 ? 338  VAL A HA     1 
ATOM   5346  H HB     . VAL A 1 342 ? -76.967  -15.93  48.871  0    184.14 ? 338  VAL A HB     1 
ATOM   5347  H HG11   . VAL A 1 342 ? -74.601  -15.91  49.47   0    186.39 ? 338  VAL A HG11   1 
ATOM   5348  H HG12   . VAL A 1 342 ? -74.86   -15.359 47.792  0    182.54 ? 338  VAL A HG12   1 
ATOM   5349  H HG13   . VAL A 1 342 ? -74.51   -14.176 49.077  0    181.02 ? 338  VAL A HG13   1 
ATOM   5350  H HG21   . VAL A 1 342 ? -76.507  -15.655 51.158  0    189.24 ? 338  VAL A HG21   1 
ATOM   5351  H HG22   . VAL A 1 342 ? -76.092  -13.942 50.971  0    184.63 ? 338  VAL A HG22   1 
ATOM   5352  H HG23   . VAL A 1 342 ? -77.787  -14.468 50.797  0    185.9  ? 338  VAL A HG23   1 
ATOM   5353  N N      . ASP A 1 343 ? -79.315  -13.018 49.135  1    92.88  ? 339  ASP A N      1 
ATOM   5354  C CA     . ASP A 1 343 ? -80.776  -12.91  49.225  1    94.24  ? 339  ASP A CA     1 
ATOM   5355  C C      . ASP A 1 343 ? -81.29   -11.621 48.57   1    90.66  ? 339  ASP A C      1 
ATOM   5356  O O      . ASP A 1 343 ? -80.787  -10.536 48.866  1    88.48  ? 339  ASP A O      1 
ATOM   5357  C CB     . ASP A 1 343 ? -81.218  -12.951 50.691  1    97.9   ? 339  ASP A CB     1 
ATOM   5358  C CG     . ASP A 1 343 ? -81.005  -14.297 51.341  1    102.33 ? 339  ASP A CG     1 
ATOM   5359  O OD1    . ASP A 1 343 ? -81.221  -15.326 50.661  1    103.12 ? 339  ASP A OD1    1 
ATOM   5360  O OD2    . ASP A 1 343 ? -80.63   -14.326 52.534  1    105.41 ? 339  ASP A OD2    1 
ATOM   5361  H H      . ASP A 1 343 ? -78.834  -12.404 49.785  0    173.55 ? 339  ASP A H      1 
ATOM   5362  H HA     . ASP A 1 343 ? -81.246  -13.748 48.714  0    178.21 ? 339  ASP A HA     1 
ATOM   5363  H HB2    . ASP A 1 343 ? -80.651  -12.213 51.257  0    184.29 ? 339  ASP A HB2    1 
ATOM   5364  H HB3    . ASP A 1 343 ? -82.281  -12.72  50.747  0    185.6  ? 339  ASP A HB3    1 
ATOM   5365  N N      . SER A 1 344 ? -82.326  -11.738 47.719  1    90.65  ? 340  SER A N      1 
ATOM   5366  C CA     . SER A 1 344 ? -82.927  -10.605 47.012  1    87.61  ? 340  SER A CA     1 
ATOM   5367  C C      . SER A 1 344 ? -83.805  -9.825  47.981  1    89.17  ? 340  SER A C      1 
ATOM   5368  O O      . SER A 1 344 ? -84.481  -10.417 48.824  1    93.11  ? 340  SER A O      1 
ATOM   5369  C CB     . SER A 1 344 ? -83.792  -11.092 45.854  1    87.85  ? 340  SER A CB     1 
ATOM   5370  O OG     . SER A 1 344 ? -84.694  -12.107 46.268  1    92.38  ? 340  SER A OG     1 
ATOM   5371  H H      . SER A 1 344 ? -82.826  -12.608 47.565  0    171.77 ? 340  SER A H      1 
ATOM   5372  H HA     . SER A 1 344 ? -82.15   -9.958  46.605  0    159.43 ? 340  SER A HA     1 
ATOM   5373  H HB2    . SER A 1 344 ? -84.365  -10.254 45.461  0    162.19 ? 340  SER A HB2    1 
ATOM   5374  H HB3    . SER A 1 344 ? -83.146  -11.494 45.074  0    162.84 ? 340  SER A HB3    1 
ATOM   5375  H HG     . SER A 1 344 ? -85.28   -12.379 45.513  0    174.82 ? 340  SER A HG     1 
ATOM   5376  N N      . ASN A 1 345 ? -83.832  -8.507  47.844  1    86.69  ? 341  ASN A N      1 
ATOM   5377  C CA     . ASN A 1 345 ? -84.644  -7.645  48.715  1    88.64  ? 341  ASN A CA     1 
ATOM   5378  C C      . ASN A 1 345 ? -86.182  -7.77   48.401  1    91.54  ? 341  ASN A C      1 
ATOM   5379  O O      . ASN A 1 345 ? -86.584  -8.735  47.742  1    92.8   ? 341  ASN A O      1 
ATOM   5380  C CB     . ASN A 1 345 ? -84.105  -6.179  48.673  1    85.34  ? 341  ASN A CB     1 
ATOM   5381  C CG     . ASN A 1 345 ? -84.088  -5.482  47.327  1    81.53  ? 341  ASN A CG     1 
ATOM   5382  O OD1    . ASN A 1 345 ? -85.049  -5.536  46.558  1    82.33  ? 341  ASN A OD1    1 
ATOM   5383  N ND2    . ASN A 1 345 ? -82.99   -4.789  47.022  1    77.73  ? 341  ASN A ND2    1 
ATOM   5384  H H      . ASN A 1 345 ? -83.296  -8.015  47.138  0    157.14 ? 341  ASN A H      1 
ATOM   5385  H HA     . ASN A 1 345 ? -84.515  -7.979  49.744  0    167.48 ? 341  ASN A HA     1 
ATOM   5386  H HB2    . ASN A 1 345 ? -84.703  -5.563  49.343  0    159.91 ? 341  ASN A HB2    1 
ATOM   5387  H HB3    . ASN A 1 345 ? -83.083  -6.212  49.047  0    156.49 ? 341  ASN A HB3    1 
ATOM   5388  H HD21   . ASN A 1 345 ? -82.936  -4.295  46.138  0    138.31 ? 341  ASN A HD21   1 
ATOM   5389  H HD22   . ASN A 1 345 ? -82.216  -4.733  47.677  0    140.55 ? 341  ASN A HD22   1 
ATOM   5390  N N      . GLU A 1 346 ? -87.039  -6.859  48.926  1    93.5   ? 342  GLU A N      1 
ATOM   5391  C CA     . GLU A 1 346 ? -88.482  -6.907  48.662  1    97.19  ? 342  GLU A CA     1 
ATOM   5392  C C      . GLU A 1 346 ? -88.824  -6.597  47.19   1    94.74  ? 342  GLU A C      1 
ATOM   5393  O O      . GLU A 1 346 ? -89.854  -7.065  46.689  1    97.95  ? 342  GLU A O      1 
ATOM   5394  C CB     . GLU A 1 346 ? -89.232  -5.941  49.593  1    100.77 ? 342  GLU A CB     1 
ATOM   5395  C CG     . GLU A 1 346 ? -90.739  -6.153  49.617  1    106.44 ? 342  GLU A CG     1 
ATOM   5396  C CD     . GLU A 1 346 ? -91.205  -7.544  50.027  1    110.86 ? 342  GLU A CD     1 
ATOM   5397  O OE1    . GLU A 1 346 ? -90.464  -8.243  50.757  1    113.09 ? 342  GLU A OE1    1 
ATOM   5398  O OE2    . GLU A 1 346 ? -92.319  -7.936  49.614  1    112.44 ? 342  GLU A OE2    1 
ATOM   5399  H H      . GLU A 1 346 ? -86.767  -6.113  49.559  0    175.68 ? 342  GLU A H      1 
ATOM   5400  H HA     . GLU A 1 346 ? -88.822  -7.922  48.865  0    187.1  ? 342  GLU A HA     1 
ATOM   5401  H HB2    . GLU A 1 346 ? -88.867  -6.077  50.609  0    193.62 ? 342  GLU A HB2    1 
ATOM   5402  H HB3    . GLU A 1 346 ? -89.042  -4.921  49.26   0    189.17 ? 342  GLU A HB3    1 
ATOM   5403  H HG2    . GLU A 1 346 ? -91.153  -5.452  50.34   0    206.83 ? 342  GLU A HG2    1 
ATOM   5404  H HG3    . GLU A 1 346 ? -91.147  -5.936  48.631  0    202.96 ? 342  GLU A HG3    1 
ATOM   5405  N N      . GLN A 1 347 ? -87.956  -5.826  46.499  1    89.65  ? 343  GLN A N      1 
ATOM   5406  C CA     . GLN A 1 347 ? -88.129  -5.498  45.075  1    87.38  ? 343  GLN A CA     1 
ATOM   5407  C C      . GLN A 1 347 ? -87.62   -6.638  44.137  1    86.65  ? 343  GLN A C      1 
ATOM   5408  O O      . GLN A 1 347 ? -87.721  -6.492  42.917  1    85.44  ? 343  GLN A O      1 
ATOM   5409  C CB     . GLN A 1 347 ? -87.374  -4.188  44.71   1    82.51  ? 343  GLN A CB     1 
ATOM   5410  C CG     . GLN A 1 347 ? -87.446  -3.051  45.741  1    82.91  ? 343  GLN A CG     1 
ATOM   5411  C CD     . GLN A 1 347 ? -88.859  -2.708  46.137  1    87.99  ? 343  GLN A CD     1 
ATOM   5412  O OE1    . GLN A 1 347 ? -89.299  -2.975  47.266  1    92.25  ? 343  GLN A OE1    1 
ATOM   5413  N NE2    . GLN A 1 347 ? -89.607  -2.12   45.201  1    88.22  ? 343  GLN A NE2    1 
ATOM   5414  H H      . GLN A 1 347 ? -87.103  -5.446  46.895  0    165.12 ? 343  GLN A H      1 
ATOM   5415  H HA     . GLN A 1 347 ? -89.185  -5.338  44.865  0    165.28 ? 343  GLN A HA     1 
ATOM   5416  H HB2    . GLN A 1 347 ? -86.321  -4.427  44.574  0    148.8  ? 343  GLN A HB2    1 
ATOM   5417  H HB3    . GLN A 1 347 ? -87.777  -3.803  43.775  0    151.06 ? 343  GLN A HB3    1 
ATOM   5418  H HG2    . GLN A 1 347 ? -86.901  -3.329  46.641  0    152.66 ? 343  GLN A HG2    1 
ATOM   5419  H HG3    . GLN A 1 347 ? -87.004  -2.158  45.303  0    149.32 ? 343  GLN A HG3    1 
ATOM   5420  H HE21   . GLN A 1 347 ? -89.227  -1.942  44.275  0    160.8  ? 343  GLN A HE21   1 
ATOM   5421  H HE22   . GLN A 1 347 ? -90.567  -1.865  45.409  0    167.74 ? 343  GLN A HE22   1 
ATOM   5422  N N      . GLY A 1 348 ? -87.07   -7.727  44.701  1    87.85  ? 344  GLY A N      1 
ATOM   5423  C CA     . GLY A 1 348 ? -86.506  -8.839  43.945  1    87.88  ? 344  GLY A CA     1 
ATOM   5424  C C      . GLY A 1 348 ? -85.069  -8.627  43.504  1    83.42  ? 344  GLY A C      1 
ATOM   5425  O O      . GLY A 1 348 ? -84.5    -9.502  42.848  1    83.63  ? 344  GLY A O      1 
ATOM   5426  H H      . GLY A 1 348 ? -86.991  -7.879  45.701  0    164.24 ? 344  GLY A H      1 
ATOM   5427  H HA2    . GLY A 1 348 ? -86.532  -9.734  44.565  0    165.78 ? 344  GLY A HA2    1 
ATOM   5428  H HA3    . GLY A 1 348 ? -87.109  -9.021  43.057  0    164.33 ? 344  GLY A HA3    1 
ATOM   5429  N N      . SER A 1 349 ? -84.459  -7.474  43.872  1    80.06  ? 345  SER A N      1 
ATOM   5430  C CA     . SER A 1 349 ? -83.101  -7.101  43.482  1    76.24  ? 345  SER A CA     1 
ATOM   5431  C C      . SER A 1 349 ? -82.041  -7.579  44.482  1    76.74  ? 345  SER A C      1 
ATOM   5432  O O      . SER A 1 349 ? -82.168  -7.364  45.685  1    78.6   ? 345  SER A O      1 
ATOM   5433  C CB     . SER A 1 349 ? -83.013  -5.586  43.323  1    72.88  ? 345  SER A CB     1 
ATOM   5434  O OG     . SER A 1 349 ? -81.692  -5.144  43.064  1    69.86  ? 345  SER A OG     1 
ATOM   5435  H H      . SER A 1 349 ? -84.888  -6.766  44.459  0    146.23 ? 345  SER A H      1 
ATOM   5436  H HA     . SER A 1 349 ? -82.874  -7.527  42.506  0    137.17 ? 345  SER A HA     1 
ATOM   5437  H HB2    . SER A 1 349 ? -83.65   -5.288  42.491  0    129.63 ? 345  SER A HB2    1 
ATOM   5438  H HB3    . SER A 1 349 ? -83.364  -5.11   44.236  0    131.14 ? 345  SER A HB3    1 
ATOM   5439  H HG     . SER A 1 349 ? -81.666  -4.154  43.131  0    121.78 ? 345  SER A HG     1 
ATOM   5440  N N      . TYR A 1 350 ? -80.979  -8.194  43.968  1    75.66  ? 346  TYR A N      1 
ATOM   5441  C CA     . TYR A 1 350 ? -79.867  -8.653  44.786  1    76.51  ? 346  TYR A CA     1 
ATOM   5442  C C      . TYR A 1 350 ? -78.786  -7.555  44.929  1    73.71  ? 346  TYR A C      1 
ATOM   5443  O O      . TYR A 1 350 ? -77.838  -7.783  45.675  1    74.87  ? 346  TYR A O      1 
ATOM   5444  C CB     . TYR A 1 350 ? -79.252  -9.927  44.181  1    78.11  ? 346  TYR A CB     1 
ATOM   5445  C CG     . TYR A 1 350 ? -80.222  -11.081 44.064  1    81.69  ? 346  TYR A CG     1 
ATOM   5446  C CD1    . TYR A 1 350 ? -81.163  -11.122 43.045  1    82.2   ? 346  TYR A CD1    1 
ATOM   5447  C CD2    . TYR A 1 350 ? -80.141  -12.173 44.915  1    85.05  ? 346  TYR A CD2    1 
ATOM   5448  C CE1    . TYR A 1 350 ? -82.034  -12.194 42.91   1    86.21  ? 346  TYR A CE1    1 
ATOM   5449  C CE2    . TYR A 1 350 ? -81.009  -13.249 44.795  1    88.78  ? 346  TYR A CE2    1 
ATOM   5450  C CZ     . TYR A 1 350 ? -81.952  -13.26  43.784  1    89.45  ? 346  TYR A CZ     1 
ATOM   5451  O OH     . TYR A 1 350 ? -82.838  -14.302 43.652  1    93.85  ? 346  TYR A OH     1 
ATOM   5452  H H      . TYR A 1 350 ? -80.849  -8.376  42.978  0    135.74 ? 346  TYR A H      1 
ATOM   5453  H HA     . TYR A 1 350 ? -80.218  -8.906  45.786  0    140.46 ? 346  TYR A HA     1 
ATOM   5454  H HB2    . TYR A 1 350 ? -78.886  -9.701  43.18   0    140.09 ? 346  TYR A HB2    1 
ATOM   5455  H HB3    . TYR A 1 350 ? -78.422  -10.25  44.809  0    142.68 ? 346  TYR A HB3    1 
ATOM   5456  H HD1    . TYR A 1 350 ? -81.237  -10.293 42.356  0    148.2  ? 346  TYR A HD1    1 
ATOM   5457  H HD2    . TYR A 1 350 ? -79.411  -12.177 45.709  0    157.41 ? 346  TYR A HD2    1 
ATOM   5458  H HE1    . TYR A 1 350 ? -82.773  -12.196 42.126  0    160.34 ? 346  TYR A HE1    1 
ATOM   5459  H HE2    . TYR A 1 350 ? -80.938  -14.07  45.487  0    168.23 ? 346  TYR A HE2    1 
ATOM   5460  H HH     . TYR A 1 350 ? -82.637  -15.02  44.307  0    178.59 ? 346  TYR A HH     1 
ATOM   5461  N N      . VAL A 1 351 ? -78.912  -6.377  44.248  1    70.58  ? 347  VAL A N      1 
ATOM   5462  C CA     . VAL A 1 351 ? -77.92   -5.298  44.348  1    68.28  ? 347  VAL A CA     1 
ATOM   5463  C C      . VAL A 1 351 ? -78.399  -4.203  45.316  1    68.27  ? 347  VAL A C      1 
ATOM   5464  O O      . VAL A 1 351 ? -79.581  -3.858  45.333  1    68.66  ? 347  VAL A O      1 
ATOM   5465  C CB     . VAL A 1 351 ? -77.544  -4.705  42.966  1    65.3   ? 347  VAL A CB     1 
ATOM   5466  C CG1    . VAL A 1 351 ? -77.252  -5.806  41.96   1    66.31  ? 347  VAL A CG1    1 
ATOM   5467  C CG2    . VAL A 1 351 ? -78.633  -3.778  42.441  1    63.43  ? 347  VAL A CG2    1 
ATOM   5468  H H      . VAL A 1 351 ? -79.68   -6.142  43.628  0    124.49 ? 347  VAL A H      1 
ATOM   5469  H HA     . VAL A 1 351 ? -76.997  -5.708  44.754  0    121.14 ? 347  VAL A HA     1 
ATOM   5470  H HB     . VAL A 1 351 ? -76.638  -4.112  43.071  0    112.44 ? 347  VAL A HB     1 
ATOM   5471  H HG11   . VAL A 1 351 ? -76.733  -5.376  41.105  0    113.98 ? 347  VAL A HG11   1 
ATOM   5472  H HG12   . VAL A 1 351 ? -76.633  -6.564  42.437  0    117.49 ? 347  VAL A HG12   1 
ATOM   5473  H HG13   . VAL A 1 351 ? -78.194  -6.247  41.636  0    116.68 ? 347  VAL A HG13   1 
ATOM   5474  H HG21   . VAL A 1 351 ? -78.482  -3.635  41.372  0    107.96 ? 347  VAL A HG21   1 
ATOM   5475  H HG22   . VAL A 1 351 ? -79.604  -4.234  42.622  0    111.18 ? 347  VAL A HG22   1 
ATOM   5476  H HG23   . VAL A 1 351 ? -78.576  -2.812  42.94   0    108.71 ? 347  VAL A HG23   1 
ATOM   5477  N N      . VAL A 1 352 ? -77.468  -3.665  46.117  1    68.56  ? 348  VAL A N      1 
ATOM   5478  C CA     . VAL A 1 352 ? -77.723  -2.604  47.087  1    69.46  ? 348  VAL A CA     1 
ATOM   5479  C C      . VAL A 1 352 ? -76.639  -1.543  46.883  1    67.75  ? 348  VAL A C      1 
ATOM   5480  O O      . VAL A 1 352 ? -75.455  -1.849  46.991  1    68.51  ? 348  VAL A O      1 
ATOM   5481  C CB     . VAL A 1 352 ? -77.715  -3.147  48.53   1    73.6   ? 348  VAL A CB     1 
ATOM   5482  C CG1    . VAL A 1 352 ? -77.864  -2.012  49.536  1    75.43  ? 348  VAL A CG1    1 
ATOM   5483  C CG2    . VAL A 1 352 ? -78.809  -4.188  48.726  1    75.72  ? 348  VAL A CG2    1 
ATOM   5484  H H      . VAL A 1 352 ? -76.495  -3.948  46.104  0    120.96 ? 348  VAL A H      1 
ATOM   5485  H HA     . VAL A 1 352 ? -78.693  -2.143  46.906  0    122.35 ? 348  VAL A HA     1 
ATOM   5486  H HB     . VAL A 1 352 ? -76.755  -3.628  48.715  0    132.72 ? 348  VAL A HB     1 
ATOM   5487  H HG11   . VAL A 1 352 ? -78.147  -2.424  50.503  0    139.42 ? 348  VAL A HG11   1 
ATOM   5488  H HG12   . VAL A 1 352 ? -76.915  -1.486  49.64   0    135.45 ? 348  VAL A HG12   1 
ATOM   5489  H HG13   . VAL A 1 352 ? -78.631  -1.324  49.184  0    135.16 ? 348  VAL A HG13   1 
ATOM   5490  H HG21   . VAL A 1 352 ? -78.816  -4.513  49.765  0    139.77 ? 348  VAL A HG21   1 
ATOM   5491  H HG22   . VAL A 1 352 ? -79.77   -3.745  48.467  0    136.21 ? 348  VAL A HG22   1 
ATOM   5492  H HG23   . VAL A 1 352 ? -78.607  -5.044  48.085  0    135.98 ? 348  VAL A HG23   1 
ATOM   5493  N N      . ALA A 1 353 ? -77.038  -0.307  46.573  1    65.95  ? 349  ALA A N      1 
ATOM   5494  C CA     . ALA A 1 353 ? -76.09   0.765   46.315  1    64.56  ? 349  ALA A CA     1 
ATOM   5495  C C      . ALA A 1 353 ? -75.433  1.212   47.591  1    67.83  ? 349  ALA A C      1 
ATOM   5496  O O      . ALA A 1 353 ? -76.134  1.652   48.497  1    70.13  ? 349  ALA A O      1 
ATOM   5497  C CB     . ALA A 1 353 ? -76.808  1.935   45.674  1    62.25  ? 349  ALA A CB     1 
ATOM   5498  H H      . ALA A 1 353 ? -78.008  -0.019  46.493  0    114.97 ? 349  ALA A H      1 
ATOM   5499  H HA     . ALA A 1 353 ? -75.327  0.417   45.622  0    110.69 ? 349  ALA A HA     1 
ATOM   5500  H HB1    . ALA A 1 353 ? -76.089  2.732   45.49   0    106.05 ? 349  ALA A HB1    1 
ATOM   5501  H HB2    . ALA A 1 353 ? -77.245  1.609   44.732  0    104.97 ? 349  ALA A HB2    1 
ATOM   5502  H HB3    . ALA A 1 353 ? -77.59   2.292   46.342  0    108.6  ? 349  ALA A HB3    1 
ATOM   5503  N N      . MET A 1 354 ? -74.097  1.12    47.672  1    68.74  ? 350  MET A N      1 
ATOM   5504  C CA     . MET A 1 354 ? -73.359  1.53    48.871  1    72.62  ? 350  MET A CA     1 
ATOM   5505  C C      . MET A 1 354 ? -72.907  3       48.798  1    72.28  ? 350  MET A C      1 
ATOM   5506  O O      . MET A 1 354 ? -73.368  3.814   49.594  1    74.81  ? 350  MET A O      1 
ATOM   5507  C CB     . MET A 1 354 ? -72.124  0.634   49.101  1    74.81  ? 350  MET A CB     1 
ATOM   5508  C CG     . MET A 1 354 ? -72.436  -0.823  49.318  1    75.84  ? 350  MET A CG     1 
ATOM   5509  S SD     . MET A 1 354 ? -70.95   -1.834  49.104  1    77.73  ? 350  MET A SD     1 
ATOM   5510  C CE     . MET A 1 354 ? -69.957  -1.25   50.483  1    83.07  ? 350  MET A CE     1 
ATOM   5511  H H      . MET A 1 354 ? -73.496  0.763   46.937  0    119.75 ? 350  MET A H      1 
ATOM   5512  H HA     . MET A 1 354 ? -73.991  1.408   49.75   0    132.11 ? 350  MET A HA     1 
ATOM   5513  H HB2    . MET A 1 354 ? -71.477  0.718   48.229  0    132.49 ? 350  MET A HB2    1 
ATOM   5514  H HB3    . MET A 1 354 ? -71.602  1       49.983  0    137.72 ? 350  MET A HB3    1 
ATOM   5515  H HG2    . MET A 1 354 ? -72.801  -0.967  50.333  0    139.68 ? 350  MET A HG2    1 
ATOM   5516  H HG3    . MET A 1 354 ? -73.18   -1.161  48.599  0    134.22 ? 350  MET A HG3    1 
ATOM   5517  H HE1    . MET A 1 354 ? -69.082  -1.893  50.57   0    154.8  ? 350  MET A HE1    1 
ATOM   5518  H HE2    . MET A 1 354 ? -69.644  -0.224  50.294  0    151.98 ? 350  MET A HE2    1 
ATOM   5519  H HE3    . MET A 1 354 ? -70.55   -1.306  51.395  0    154.82 ? 350  MET A HE3    1 
ATOM   5520  N N      . GLU A 1 355 ? -72.005  3.332   47.863  1    69.81  ? 351  GLU A N      1 
ATOM   5521  C CA     . GLU A 1 355 ? -71.419  4.658   47.741  1    69.85  ? 351  GLU A CA     1 
ATOM   5522  C C      . GLU A 1 355 ? -71.475  5.121   46.303  1    65.38  ? 351  GLU A C      1 
ATOM   5523  O O      . GLU A 1 355 ? -71.257  4.323   45.395  1    63.17  ? 351  GLU A O      1 
ATOM   5524  C CB     . GLU A 1 355 ? -69.962  4.566   48.189  1    73.29  ? 351  GLU A CB     1 
ATOM   5525  C CG     . GLU A 1 355 ? -69.295  5.894   48.468  1    75.59  ? 351  GLU A CG     1 
ATOM   5526  C CD     . GLU A 1 355 ? -67.873  5.763   48.983  1    80.08  ? 351  GLU A CD     1 
ATOM   5527  O OE1    . GLU A 1 355 ? -67.141  6.776   48.924  1    82.16  ? 351  GLU A OE1    1 
ATOM   5528  O OE2    . GLU A 1 355 ? -67.487  4.663   49.449  1    81.98  ? 351  GLU A OE2    1 
ATOM   5529  H H      . GLU A 1 355 ? -71.659  2.682   47.164  0    121.98 ? 351  GLU A H      1 
ATOM   5530  H HA     . GLU A 1 355 ? -71.943  5.38    48.364  0    125.16 ? 351  GLU A HA     1 
ATOM   5531  H HB2    . GLU A 1 355 ? -69.925  3.966   49.097  0    134.23 ? 351  GLU A HB2    1 
ATOM   5532  H HB3    . GLU A 1 355 ? -69.389  4.081   47.401  0    129.63 ? 351  GLU A HB3    1 
ATOM   5533  H HG2    . GLU A 1 355 ? -69.263  6.48    47.55   0    133.38 ? 351  GLU A HG2    1 
ATOM   5534  H HG3    . GLU A 1 355 ? -69.874  6.424   49.223  0    138.18 ? 351  GLU A HG3    1 
ATOM   5535  N N      . THR A 1 356 ? -71.732  6.412   46.09   1    64.57  ? 352  THR A N      1 
ATOM   5536  C CA     . THR A 1 356 ? -71.812  6.971   44.745  1    60.69  ? 352  THR A CA     1 
ATOM   5537  C C      . THR A 1 356 ? -70.745  8.033   44.59   1    61.63  ? 352  THR A C      1 
ATOM   5538  O O      . THR A 1 356 ? -70.645  8.932   45.423  1    64.4   ? 352  THR A O      1 
ATOM   5539  C CB     . THR A 1 356 ? -73.212  7.538   44.508  1    59.03  ? 352  THR A CB     1 
ATOM   5540  O OG1    . THR A 1 356 ? -74.171  6.517   44.79   1    59.19  ? 352  THR A OG1    1 
ATOM   5541  C CG2    . THR A 1 356 ? -73.414  8.013   43.098  1    55.29  ? 352  THR A CG2    1 
ATOM   5542  H H      . THR A 1 356 ? -71.888  7.097   46.822  0    114.32 ? 352  THR A H      1 
ATOM   5543  H HA     . THR A 1 356 ? -71.646  6.197   43.997  0    101.71 ? 352  THR A HA     1 
ATOM   5544  H HB     . THR A 1 356 ? -73.374  8.382   45.177  0    101.86 ? 352  THR A HB     1 
ATOM   5545  H HG1    . THR A 1 356 ? -75.088  6.896   44.761  0    99.76  ? 352  THR A HG1    1 
ATOM   5546  H HG21   . THR A 1 356 ? -74.443  8.346   42.969  0    90.89  ? 352  THR A HG21   1 
ATOM   5547  H HG22   . THR A 1 356 ? -72.751  8.844   42.863  0    91.58  ? 352  THR A HG22   1 
ATOM   5548  H HG23   . THR A 1 356 ? -73.224  7.189   42.411  0    90.05  ? 352  THR A HG23   1 
ATOM   5549  N N      . PHE A 1 357 ? -69.937  7.915   43.534  1    59.95  ? 353  PHE A N      1 
ATOM   5550  C CA     . PHE A 1 357 ? -68.882  8.875   43.225  1    61.05  ? 353  PHE A CA     1 
ATOM   5551  C C      . PHE A 1 357 ? -69.383  9.727   42.066  1    57.55  ? 353  PHE A C      1 
ATOM   5552  O O      . PHE A 1 357 ? -69.846  9.185   41.062  1    54.54  ? 353  PHE A O      1 
ATOM   5553  C CB     . PHE A 1 357 ? -67.576  8.171   42.842  1    62.64  ? 353  PHE A CB     1 
ATOM   5554  C CG     . PHE A 1 357 ? -67.206  7.033   43.76   1    65.69  ? 353  PHE A CG     1 
ATOM   5555  C CD1    . PHE A 1 357 ? -66.56   7.27    44.958  1    70.15  ? 353  PHE A CD1    1 
ATOM   5556  C CD2    . PHE A 1 357 ? -67.568  5.738   43.459  1    64.43  ? 353  PHE A CD2    1 
ATOM   5557  C CE1    . PHE A 1 357 ? -66.224  6.218   45.799  1    73.21  ? 353  PHE A CE1    1 
ATOM   5558  C CE2    . PHE A 1 357 ? -67.245  4.695   44.307  1    67.38  ? 353  PHE A CE2    1 
ATOM   5559  C CZ     . PHE A 1 357 ? -66.581  4.939   45.476  1    71.63  ? 353  PHE A CZ     1 
ATOM   5560  H H      . PHE A 1 357 ? -69.985  7.158   42.86   0    100.27 ? 353  PHE A H      1 
ATOM   5561  H HA     . PHE A 1 357 ? -68.675  9.515   44.081  0    107.27 ? 353  PHE A HA     1 
ATOM   5562  H HB2    . PHE A 1 357 ? -67.673  7.771   41.834  0    105.45 ? 353  PHE A HB2    1 
ATOM   5563  H HB3    . PHE A 1 357 ? -66.766  8.899   42.874  0    109.9  ? 353  PHE A HB3    1 
ATOM   5564  H HD1    . PHE A 1 357 ? -66.278  8.275   45.221  0    126.08 ? 353  PHE A HD1    1 
ATOM   5565  H HD2    . PHE A 1 357 ? -68.084  5.531   42.537  0    108.83 ? 353  PHE A HD2    1 
ATOM   5566  H HE1    . PHE A 1 357 ? -65.709  6.411   46.724  0    135.22 ? 353  PHE A HE1    1 
ATOM   5567  H HE2    . PHE A 1 357 ? -67.52   3.696   44.029  0    117.46 ? 353  PHE A HE2    1 
ATOM   5568  H HZ     . PHE A 1 357 ? -66.327  4.123   46.136  0    130.21 ? 353  PHE A HZ     1 
ATOM   5569  N N      . THR A 1 358 ? -69.314  11.056  42.213  1    58.43  ? 354  THR A N      1 
ATOM   5570  C CA     . THR A 1 358 ? -69.835  11.967  41.205  1    55.53  ? 354  THR A CA     1 
ATOM   5571  C C      . THR A 1 358 ? -69.078  11.899  39.899  1    53.84  ? 354  THR A C      1 
ATOM   5572  O O      . THR A 1 358 ? -67.852  11.898  39.875  1    56.11  ? 354  THR A O      1 
ATOM   5573  C CB     . THR A 1 358 ? -69.859  13.393  41.732  1    57.69  ? 354  THR A CB     1 
ATOM   5574  O OG1    . THR A 1 358 ? -70.616  13.409  42.942  1    59.79  ? 354  THR A OG1    1 
ATOM   5575  C CG2    . THR A 1 358 ? -70.448  14.376  40.724  1    55.05  ? 354  THR A CG2    1 
ATOM   5576  H H      . THR A 1 358 ? -68.897  11.521  43.013  0    101.65 ? 354  THR A H      1 
ATOM   5577  H HA     . THR A 1 358 ? -70.871  11.685  41.025  0    90.17  ? 354  THR A HA     1 
ATOM   5578  H HB     . THR A 1 358 ? -68.839  13.704  41.949  0    99.44  ? 354  THR A HB     1 
ATOM   5579  H HG1    . THR A 1 358 ? -70.555  14.301  43.374  0    103.54 ? 354  THR A HG1    1 
ATOM   5580  H HG21   . THR A 1 358 ? -70.7    15.309  41.225  0    92.84  ? 354  THR A HG21   1 
ATOM   5581  H HG22   . THR A 1 358 ? -69.724  14.599  39.941  0    90.13  ? 354  THR A HG22   1 
ATOM   5582  H HG23   . THR A 1 358 ? -71.347  13.96   40.273  0    88.59  ? 354  THR A HG23   1 
ATOM   5583  N N      . ASN A 1 359 ? -69.832  11.839  38.809  1    50.46  ? 355  ASN A N      1 
ATOM   5584  C CA     . ASN A 1 359 ? -69.303  11.849  37.459  1    49.04  ? 355  ASN A CA     1 
ATOM   5585  C C      . ASN A 1 359 ? -70.109  12.864  36.691  1    46.63  ? 355  ASN A C      1 
ATOM   5586  O O      . ASN A 1 359 ? -71.267  12.603  36.346  1    44.59  ? 355  ASN A O      1 
ATOM   5587  C CB     . ASN A 1 359 ? -69.385  10.48   36.776  1    48.09  ? 355  ASN A CB     1 
ATOM   5588  C CG     . ASN A 1 359 ? -68.839  10.455  35.363  1    47.52  ? 355  ASN A CG     1 
ATOM   5589  O OD1    . ASN A 1 359 ? -68.186  11.392  34.887  1    48.04  ? 355  ASN A OD1    1 
ATOM   5590  N ND2    . ASN A 1 359 ? -69.138  9.402   34.63   1    46.96  ? 355  ASN A ND2    1 
ATOM   5591  H H      . ASN A 1 359 ? -70.845  11.783  38.823  0    79.59  ? 355  ASN A H      1 
ATOM   5592  H HA     . ASN A 1 359 ? -68.266  12.166  37.457  0    79.84  ? 355  ASN A HA     1 
ATOM   5593  H HB2    . ASN A 1 359 ? -68.838  9.747   37.367  0    77.76  ? 355  ASN A HB2    1 
ATOM   5594  H HB3    . ASN A 1 359 ? -70.431  10.192  36.688  0    74.16  ? 355  ASN A HB3    1 
ATOM   5595  H HD21   . ASN A 1 359 ? -68.798  9.334   33.675  0    73.6   ? 355  ASN A HD21   1 
ATOM   5596  H HD22   . ASN A 1 359 ? -69.706  8.656   35.019  0    73.07  ? 355  ASN A HD22   1 
ATOM   5597  N N      . LEU A 1 360 ? -69.482  14.001  36.36   1    47.32  ? 356  LEU A N      1 
ATOM   5598  C CA     . LEU A 1 360 ? -70.138  15.014  35.539  1    45.39  ? 356  LEU A CA     1 
ATOM   5599  C C      . LEU A 1 360 ? -70.446  14.504  34.1    1    43.16  ? 356  LEU A C      1 
ATOM   5600  O O      . LEU A 1 360 ? -70.964  15.287  33.303  1    41.6   ? 356  LEU A O      1 
ATOM   5601  C CB     . LEU A 1 360 ? -69.298  16.306  35.5    1    47.13  ? 356  LEU A CB     1 
ATOM   5602  C CG     . LEU A 1 360 ? -68.968  16.938  36.863  1    50.37  ? 356  LEU A CG     1 
ATOM   5603  C CD1    . LEU A 1 360 ? -68.144  18.178  36.691  1    52.37  ? 356  LEU A CD1    1 
ATOM   5604  C CD2    . LEU A 1 360 ? -70.221  17.285  37.646  1    50.24  ? 356  LEU A CD2    1 
ATOM   5605  H H      . LEU A 1 360 ? -68.53   14.234  36.626  0    76.28  ? 356  LEU A H      1 
ATOM   5606  H HA     . LEU A 1 360 ? -71.098  15.257  35.992  0    69.33  ? 356  LEU A HA     1 
ATOM   5607  H HB2    . LEU A 1 360 ? -68.353  16.083  35.006  0    74.49  ? 356  LEU A HB2    1 
ATOM   5608  H HB3    . LEU A 1 360 ? -69.841  17.055  34.924  0    72.31  ? 356  LEU A HB3    1 
ATOM   5609  H HG     . LEU A 1 360 ? -68.387  16.232  37.455  0    82.55  ? 356  LEU A HG     1 
ATOM   5610  H HD11   . LEU A 1 360 ? -67.905  18.587  37.672  0    88.13  ? 356  LEU A HD11   1 
ATOM   5611  H HD12   . LEU A 1 360 ? -67.228  17.924  36.157  0    85.78  ? 356  LEU A HD12   1 
ATOM   5612  H HD13   . LEU A 1 360 ? -68.722  18.902  36.119  0    83.63  ? 356  LEU A HD13   1 
ATOM   5613  H HD21   . LEU A 1 360 ? -69.939  17.901  38.498  0    83.42  ? 356  LEU A HD21   1 
ATOM   5614  H HD22   . LEU A 1 360 ? -70.906  17.832  37      0    78.82  ? 356  LEU A HD22   1 
ATOM   5615  H HD23   . LEU A 1 360 ? -70.689  16.367  37.999  0    79.94  ? 356  LEU A HD23   1 
ATOM   5616  N N      . GLY A 1 361 ? -70.091  13.233  33.781  1    43.68  ? 357  GLY A N      1 
ATOM   5617  C CA     . GLY A 1 361 ? -70.374  12.515  32.543  1    42.71  ? 357  GLY A CA     1 
ATOM   5618  C C      . GLY A 1 361 ? -70.261  13.372  31.305  1    42.05  ? 357  GLY A C      1 
ATOM   5619  O O      . GLY A 1 361 ? -69.729  14.482  31.388  1    42.76  ? 357  GLY A O      1 
ATOM   5620  H H      . GLY A 1 361 ? -69.505  12.649  34.368  0    67.57  ? 357  GLY A H      1 
ATOM   5621  H HA2    . GLY A 1 361 ? -69.695  11.669  32.448  0    65.22  ? 357  GLY A HA2    1 
ATOM   5622  H HA3    . GLY A 1 361 ? -71.387  12.13   32.634  0    62.71  ? 357  GLY A HA3    1 
ATOM   5623  N N      . PRO A 1 362 ? -70.796  12.955  30.153  1    41.17  ? 358  PRO A N      1 
ATOM   5624  C CA     . PRO A 1 362 ? -70.746  13.835  28.972  1    40.91  ? 358  PRO A CA     1 
ATOM   5625  C C      . PRO A 1 362 ? -71.443  15.18   29.237  1    39.54  ? 358  PRO A C      1 
ATOM   5626  O O      . PRO A 1 362 ? -72.65   15.186  29.464  1    38.35  ? 358  PRO A O      1 
ATOM   5627  C CB     . PRO A 1 362 ? -71.463  13.019  27.899  1    40.92  ? 358  PRO A CB     1 
ATOM   5628  C CG     . PRO A 1 362 ? -72.279  12.038  28.66   1    40.3   ? 358  PRO A CG     1 
ATOM   5629  C CD     . PRO A 1 362 ? -71.465  11.687  29.846  1    40.94  ? 358  PRO A CD     1 
ATOM   5630  H HA     . PRO A 1 362 ? -69.714  14.005  28.675  0    61.42  ? 358  PRO A HA     1 
ATOM   5631  H HB2    . PRO A 1 362 ? -72.098  13.669  27.299  0    59.23  ? 358  PRO A HB2    1 
ATOM   5632  H HB3    . PRO A 1 362 ? -70.732  12.508  27.273  0    61.64  ? 358  PRO A HB3    1 
ATOM   5633  H HG2    . PRO A 1 362 ? -73.218  12.499  28.963  0    57.49  ? 358  PRO A HG2    1 
ATOM   5634  H HG3    . PRO A 1 362 ? -72.456  11.156  28.047  0    59.6   ? 358  PRO A HG3    1 
ATOM   5635  H HD2    . PRO A 1 362 ? -72.113  11.36   30.656  0    59.55  ? 358  PRO A HD2    1 
ATOM   5636  H HD3    . PRO A 1 362 ? -70.737  10.918  29.594  0    61.69  ? 358  PRO A HD3    1 
ATOM   5637  N N      . ILE A 1 363 ? -70.681  16.294  29.326  1    40.29  ? 359  ILE A N      1 
ATOM   5638  C CA     . ILE A 1 363 ? -71.265  17.622  29.553  1    39.64  ? 359  ILE A CA     1 
ATOM   5639  C C      . ILE A 1 363 ? -71.663  18.068  28.162  1    39.02  ? 359  ILE A C      1 
ATOM   5640  O O      . ILE A 1 363 ? -70.806  18.509  27.415  1    40.05  ? 359  ILE A O      1 
ATOM   5641  C CB     . ILE A 1 363 ? -70.265  18.611  30.222  1    41.42  ? 359  ILE A CB     1 
ATOM   5642  C CG1    . ILE A 1 363 ? -69.99   18.203  31.682  1    42.71  ? 359  ILE A CG1    1 
ATOM   5643  C CG2    . ILE A 1 363 ? -70.808  20.043  30.171  1    41.26  ? 359  ILE A CG2    1 
ATOM   5644  C CD1    . ILE A 1 363 ? -68.711  18.739  32.261  1    45.6   ? 359  ILE A CD1    1 
ATOM   5645  H H      . ILE A 1 363 ? -69.671  16.298  29.243  0    60.07  ? 359  ILE A H      1 
ATOM   5646  H HA     . ILE A 1 363 ? -72.15   17.559  30.184  0    56.52  ? 359  ILE A HA     1 
ATOM   5647  H HB     . ILE A 1 363 ? -69.329  18.579  29.666  0    62.3   ? 359  ILE A HB     1 
ATOM   5648  H HG12   . ILE A 1 363 ? -70.808  18.572  32.299  0    63.57  ? 359  ILE A HG12   1 
ATOM   5649  H HG13   . ILE A 1 363 ? -69.949  17.116  31.75   0    63.71  ? 359  ILE A HG13   1 
ATOM   5650  H HG21   . ILE A 1 363 ? -70.316  20.654  30.924  0    62.52  ? 359  ILE A HG21   1 
ATOM   5651  H HG22   . ILE A 1 363 ? -70.608  20.464  29.187  0    60.66  ? 359  ILE A HG22   1 
ATOM   5652  H HG23   . ILE A 1 363 ? -71.882  20.021  30.352  0    59.86  ? 359  ILE A HG23   1 
ATOM   5653  H HD11   . ILE A 1 363 ? -68.517  18.227  33.203  0    71.42  ? 359  ILE A HD11   1 
ATOM   5654  H HD12   . ILE A 1 363 ? -67.898  18.552  31.561  0    71.13  ? 359  ILE A HD12   1 
ATOM   5655  H HD13   . ILE A 1 363 ? -68.81   19.808  32.442  0    70.98  ? 359  ILE A HD13   1 
ATOM   5656  N N      . VAL A 1 364 ? -72.923  17.868  27.775  1    37.92  ? 360  VAL A N      1 
ATOM   5657  C CA     . VAL A 1 364 ? -73.37   18.174  26.413  1    37.89  ? 360  VAL A CA     1 
ATOM   5658  C C      . VAL A 1 364 ? -73.618  19.675  26.173  1    37.83  ? 360  VAL A C      1 
ATOM   5659  O O      . VAL A 1 364 ? -73.529  20.127  25.032  1    38.39  ? 360  VAL A O      1 
ATOM   5660  C CB     . VAL A 1 364 ? -74.592  17.321  26      1    37.69  ? 360  VAL A CB     1 
ATOM   5661  C CG1    . VAL A 1 364 ? -74.356  15.839  26.283  1    38.18  ? 360  VAL A CG1    1 
ATOM   5662  C CG2    . VAL A 1 364 ? -75.845  17.787  26.695  1    37.11  ? 360  VAL A CG2    1 
ATOM   5663  H H      . VAL A 1 364 ? -73.64   17.497  28.39   0    52.97  ? 360  VAL A H      1 
ATOM   5664  H HA     . VAL A 1 364 ? -72.577  17.88   25.727  0    54.33  ? 360  VAL A HA     1 
ATOM   5665  H HB     . VAL A 1 364 ? -74.747  17.431  24.928  0    53.54  ? 360  VAL A HB     1 
ATOM   5666  H HG11   . VAL A 1 364 ? -75.157  15.261  25.825  0    54.37  ? 360  VAL A HG11   1 
ATOM   5667  H HG12   . VAL A 1 364 ? -73.395  15.548  25.863  0    54.84  ? 360  VAL A HG12   1 
ATOM   5668  H HG13   . VAL A 1 364 ? -74.358  15.668  27.359  0    53.47  ? 360  VAL A HG13   1 
ATOM   5669  H HG21   . VAL A 1 364 ? -76.631  17.059  26.499  0    51.99  ? 360  VAL A HG21   1 
ATOM   5670  H HG22   . VAL A 1 364 ? -75.646  17.826  27.763  0    51.46  ? 360  VAL A HG22   1 
ATOM   5671  H HG23   . VAL A 1 364 ? -76.152  18.761  26.319  0    51.77  ? 360  VAL A HG23   1 
ATOM   5672  N N      . ASP A 1 365 ? -73.979  20.438  27.214  1    37.67  ? 361  ASP A N      1 
ATOM   5673  C CA     . ASP A 1 365 ? -74.2    21.899  27.116  1    38.24  ? 361  ASP A CA     1 
ATOM   5674  C C      . ASP A 1 365 ? -74.2    22.494  28.526  1    39.19  ? 361  ASP A C      1 
ATOM   5675  O O      . ASP A 1 365 ? -74.462  21.774  29.475  1    39.25  ? 361  ASP A O      1 
ATOM   5676  C CB     . ASP A 1 365 ? -75.536  22.23   26.41   1    38.14  ? 361  ASP A CB     1 
ATOM   5677  C CG     . ASP A 1 365 ? -75.633  23.642  25.836  1    38.95  ? 361  ASP A CG     1 
ATOM   5678  O OD1    . ASP A 1 365 ? -74.743  24.028  25.042  1    39.25  ? 361  ASP A OD1    1 
ATOM   5679  O OD2    . ASP A 1 365 ? -76.621  24.349  26.153  1    39.71  ? 361  ASP A OD2    1 
ATOM   5680  H H      . ASP A 1 365 ? -74.157  20.064  28.141  0    52.96  ? 361  ASP A H      1 
ATOM   5681  H HA     . ASP A 1 365 ? -73.383  22.35   26.555  0    54.82  ? 361  ASP A HA     1 
ATOM   5682  H HB2    . ASP A 1 365 ? -75.685  21.536  25.585  0    53.75  ? 361  ASP A HB2    1 
ATOM   5683  H HB3    . ASP A 1 365 ? -76.343  22.117  27.132  0    54.12  ? 361  ASP A HB3    1 
ATOM   5684  N N      . MET A 1 366 ? -73.936  23.788  28.673  1    40.45  ? 362  MET A N      1 
ATOM   5685  C CA     . MET A 1 366 ? -73.911  24.44   29.987  1    42.35  ? 362  MET A CA     1 
ATOM   5686  C C      . MET A 1 366 ? -74.157  25.942  29.871  1    44.02  ? 362  MET A C      1 
ATOM   5687  O O      . MET A 1 366 ? -74.106  26.492  28.772  1    43.62  ? 362  MET A O      1 
ATOM   5688  C CB     . MET A 1 366 ? -72.577  24.169  30.688  1    43.67  ? 362  MET A CB     1 
ATOM   5689  C CG     . MET A 1 366 ? -71.421  24.877  30.056  1    44.91  ? 362  MET A CG     1 
ATOM   5690  S SD     . MET A 1 366 ? -69.856  24.164  30.543  1    46.51  ? 362  MET A SD     1 
ATOM   5691  C CE     . MET A 1 366 ? -68.799  25.452  30.095  1    49.43  ? 362  MET A CE     1 
ATOM   5692  H H      . MET A 1 366 ? -73.797  24.426  27.897  0    59.23  ? 362  MET A H      1 
ATOM   5693  H HA     . MET A 1 366 ? -74.714  24.041  30.605  0    63.2   ? 362  MET A HA     1 
ATOM   5694  H HB2    . MET A 1 366 ? -72.654  24.534  31.71   0    67.82  ? 362  MET A HB2    1 
ATOM   5695  H HB3    . MET A 1 366 ? -72.378  23.098  30.679  0    65.04  ? 362  MET A HB3    1 
ATOM   5696  H HG2    . MET A 1 366 ? -71.497  24.819  28.972  0    67.54  ? 362  MET A HG2    1 
ATOM   5697  H HG3    . MET A 1 366 ? -71.413  25.917  30.377  0    70.5   ? 362  MET A HG3    1 
ATOM   5698  H HE1    . MET A 1 366 ? -67.774  25.168  30.33   0    80.45  ? 362  MET A HE1    1 
ATOM   5699  H HE2    . MET A 1 366 ? -68.894  25.63   29.025  0    77.62  ? 362  MET A HE2    1 
ATOM   5700  H HE3    . MET A 1 366 ? -69.069  26.353  30.643  0    80.25  ? 362  MET A HE3    1 
ATOM   5701  N N      . CYS A 1 367 ? -74.433  26.601  31.002  1    46.42  ? 363  CYS A N      1 
ATOM   5702  C CA     . CYS A 1 367 ? -74.622  28.051  31.062  1    48.92  ? 363  CYS A CA     1 
ATOM   5703  C C      . CYS A 1 367 ? -74.159  28.564  32.417  1    52.47  ? 363  CYS A C      1 
ATOM   5704  O O      . CYS A 1 367 ? -74.263  27.86   33.419  1    53.11  ? 363  CYS A O      1 
ATOM   5705  C CB     . CYS A 1 367 ? -76.069  28.456  30.78   1    49.19  ? 363  CYS A CB     1 
ATOM   5706  S SG     . CYS A 1 367 ? -77.255  27.811  31.974  1    51.07  ? 363  CYS A SG     1 
ATOM   5707  H H      . CYS A 1 367 ? -74.529  26.146  31.905  0    72.79  ? 363  CYS A H      1 
ATOM   5708  H HA     . CYS A 1 367 ? -74.002  28.527  30.304  0    77.51  ? 363  CYS A HA     1 
ATOM   5709  H HB2    . CYS A 1 367 ? -76.15   29.542  30.817  0    80.42  ? 363  CYS A HB2    1 
ATOM   5710  H HB3    . CYS A 1 367 ? -76.367  28.084  29.802  0    76.24  ? 363  CYS A HB3    1 
ATOM   5711  H HG     . CYS A 1 367 ? -78.286  28.654  32.112  0    85.61  ? 363  CYS A HG     1 
ATOM   5712  N N      . VAL A 1 368 ? -73.631  29.781  32.444  1    55.27  ? 364  VAL A N      1 
ATOM   5713  C CA     . VAL A 1 368 ? -73.178  30.397  33.681  1    59.73  ? 364  VAL A CA     1 
ATOM   5714  C C      . VAL A 1 368 ? -74.28   31.354  34.122  1    62.81  ? 364  VAL A C      1 
ATOM   5715  O O      . VAL A 1 368 ? -74.721  32.174  33.32   1    62.87  ? 364  VAL A O      1 
ATOM   5716  C CB     . VAL A 1 368 ? -71.839  31.122  33.469  1    61.88  ? 364  VAL A CB     1 
ATOM   5717  C CG1    . VAL A 1 368 ? -71.461  31.932  34.701  1    67.47  ? 364  VAL A CG1    1 
ATOM   5718  C CG2    . VAL A 1 368 ? -70.736  30.131  33.126  1    59.8   ? 364  VAL A CG2    1 
ATOM   5719  H H      . VAL A 1 368 ? -73.519  30.372  31.627  0    91.27  ? 364  VAL A H      1 
ATOM   5720  H HA     . VAL A 1 368 ? -73.021  29.647  34.453  0    101.62 ? 364  VAL A HA     1 
ATOM   5721  H HB     . VAL A 1 368 ? -71.946  31.813  32.635  0    105.71 ? 364  VAL A HB     1 
ATOM   5722  H HG11   . VAL A 1 368 ? -70.395  32.147  34.657  0    120.29 ? 364  VAL A HG11   1 
ATOM   5723  H HG12   . VAL A 1 368 ? -72.015  32.869  34.706  0    120.59 ? 364  VAL A HG12   1 
ATOM   5724  H HG13   . VAL A 1 368 ? -71.695  31.348  35.59   0    119.45 ? 364  VAL A HG13   1 
ATOM   5725  H HG21   . VAL A 1 368 ? -69.814  30.677  32.935  0    103.7  ? 364  VAL A HG21   1 
ATOM   5726  H HG22   . VAL A 1 368 ? -70.6    29.455  33.968  0    102.38 ? 364  VAL A HG22   1 
ATOM   5727  H HG23   . VAL A 1 368 ? -71.011  29.562  32.24   0    98.22  ? 364  VAL A HG23   1 
ATOM   5728  N N      . VAL A 1 369 ? -74.765  31.224  35.361  1    65.7   ? 365  VAL A N      1 
ATOM   5729  C CA     . VAL A 1 369 ? -75.834  32.076  35.89   1    69.71  ? 365  VAL A CA     1 
ATOM   5730  C C      . VAL A 1 369 ? -75.57   32.446  37.335  1    75.6   ? 365  VAL A C      1 
ATOM   5731  O O      . VAL A 1 369 ? -75.007  31.647  38.08   1    75.98  ? 365  VAL A O      1 
ATOM   5732  C CB     . VAL A 1 369 ? -77.203  31.373  35.813  1    68.1   ? 365  VAL A CB     1 
ATOM   5733  C CG1    . VAL A 1 369 ? -77.616  31.129  34.379  1    63.72  ? 365  VAL A CG1    1 
ATOM   5734  C CG2    . VAL A 1 369 ? -77.2    30.06   36.592  1    66.93  ? 365  VAL A CG2    1 
ATOM   5735  H H      . VAL A 1 369 ? -74.434  30.537  36.032  0    114.64 ? 365  VAL A H      1 
ATOM   5736  H HA     . VAL A 1 369 ? -75.9    33.001  35.32   0    124.14 ? 365  VAL A HA     1 
ATOM   5737  H HB     . VAL A 1 369 ? -77.952  32.021  36.265  0    123.25 ? 365  VAL A HB     1 
ATOM   5738  H HG11   . VAL A 1 369 ? -78.585  30.635  34.406  0    109.38 ? 365  VAL A HG11   1 
ATOM   5739  H HG12   . VAL A 1 369 ? -77.69   32.081  33.855  0    111.02 ? 365  VAL A HG12   1 
ATOM   5740  H HG13   . VAL A 1 369 ? -76.885  30.485  33.892  0    106.61 ? 365  VAL A HG13   1 
ATOM   5741  H HG21   . VAL A 1 369 ? -78.214  29.664  36.6    0    116.82 ? 365  VAL A HG21   1 
ATOM   5742  H HG22   . VAL A 1 369 ? -76.541  29.351  36.091  0    113.45 ? 365  VAL A HG22   1 
ATOM   5743  H HG23   . VAL A 1 369 ? -76.861  30.213  37.614  0    120.6  ? 365  VAL A HG23   1 
ATOM   5744  N N      . ASP A 1 370 ? -76.085  33.593  37.766  1    80.7   ? 366  ASP A N      1 
ATOM   5745  C CA     . ASP A 1 370 ? -75.959  34.018  39.15   1    87.74  ? 366  ASP A CA     1 
ATOM   5746  C C      . ASP A 1 370 ? -77.323  33.839  39.791  1    90.75  ? 366  ASP A C      1 
ATOM   5747  O O      . ASP A 1 370 ? -78.192  34.696  39.634  1    94.78  ? 366  ASP A O      1 
ATOM   5748  C CB     . ASP A 1 370 ? -75.501  35.489  39.207  1    92.48  ? 366  ASP A CB     1 
ATOM   5749  C CG     . ASP A 1 370 ? -74.257  35.73   40.013  1    98.78  ? 366  ASP A CG     1 
ATOM   5750  O OD1    . ASP A 1 370 ? -73.903  34.855  40.838  1    99.32  ? 366  ASP A OD1    1 
ATOM   5751  O OD2    . ASP A 1 370 ? -73.64   36.799  39.836  1    103.57 ? 366  ASP A OD2    1 
ATOM   5752  H H      . ASP A 1 370 ? -76.616  34.233  37.184  0    147.29 ? 366  ASP A H      1 
ATOM   5753  H HA     . ASP A 1 370 ? -75.269  33.356  39.67   0    162.7  ? 366  ASP A HA     1 
ATOM   5754  H HB2    . ASP A 1 370 ? -75.281  35.826  38.194  0    169.54 ? 366  ASP A HB2    1 
ATOM   5755  H HB3    . ASP A 1 370 ? -76.278  36.119  39.637  0    176.04 ? 366  ASP A HB3    1 
ATOM   5756  N N      . LEU A 1 371 ? -77.548  32.683  40.433  1    89.24  ? 367  LEU A N      1 
ATOM   5757  C CA     . LEU A 1 371 ? -78.838  32.398  41.053  1    92.26  ? 367  LEU A CA     1 
ATOM   5758  C C      . LEU A 1 371 ? -79.082  33.221  42.304  1    101.16 ? 367  LEU A C      1 
ATOM   5759  O O      . LEU A 1 371 ? -80.248  33.445  42.632  1    105.65 ? 367  LEU A O      1 
ATOM   5760  C CB     . LEU A 1 371 ? -78.961  30.91   41.388  1    88.73  ? 367  LEU A CB     1 
ATOM   5761  C CG     . LEU A 1 371 ? -78.958  29.96   40.193  1    80.92  ? 367  LEU A CG     1 
ATOM   5762  C CD1    . LEU A 1 371 ? -78.749  28.52   40.633  1    78.14  ? 367  LEU A CD1    1 
ATOM   5763  C CD2    . LEU A 1 371 ? -80.236  30.088  39.394  1    79.89  ? 367  LEU A CD2    1 
ATOM   5764  H H      . LEU A 1 371 ? -76.869  31.935  40.53   0    163.74 ? 367  LEU A H      1 
ATOM   5765  H HA     . LEU A 1 371 ? -79.631  32.65   40.351  0    171.44 ? 367  LEU A HA     1 
ATOM   5766  H HB2    . LEU A 1 371 ? -78.124  30.631  42.026  0    165.95 ? 367  LEU A HB2    1 
ATOM   5767  H HB3    . LEU A 1 371 ? -79.889  30.76   41.937  0    167.73 ? 367  LEU A HB3    1 
ATOM   5768  H HG     . LEU A 1 371 ? -78.132  30.223  39.535  0    145.23 ? 367  LEU A HG     1 
ATOM   5769  H HD11   . LEU A 1 371 ? -78.793  27.869  39.761  0    136.63 ? 367  LEU A HD11   1 
ATOM   5770  H HD12   . LEU A 1 371 ? -77.771  28.44   41.103  0    142.47 ? 367  LEU A HD12   1 
ATOM   5771  H HD13   . LEU A 1 371 ? -79.531  28.25   41.341  0    144.34 ? 367  LEU A HD13   1 
ATOM   5772  H HD21   . LEU A 1 371 ? -80.337  29.24   38.719  0    140.5  ? 367  LEU A HD21   1 
ATOM   5773  H HD22   . LEU A 1 371 ? -81.072  30.12   40.09   0    149.05 ? 367  LEU A HD22   1 
ATOM   5774  H HD23   . LEU A 1 371 ? -80.204  31.01   38.815  0    146.21 ? 367  LEU A HD23   1 
ATOM   5775  N N      . GLU A 1 372 ? -77.998  33.674  43.002  1    104.41 ? 368  GLU A N      1 
ATOM   5776  C CA     . GLU A 1 372 ? -78.069  34.466  44.247  1    113.84 ? 368  GLU A CA     1 
ATOM   5777  C C      . GLU A 1 372 ? -77.441  35.889  44.143  1    118.43 ? 368  GLU A C      1 
ATOM   5778  O O      . GLU A 1 372 ? -77.012  36.411  45.168  1    126.93 ? 368  GLU A O      1 
ATOM   5779  C CB     . GLU A 1 372 ? -77.393  33.678  45.401  1    116.38 ? 368  GLU A CB     1 
ATOM   5780  C CG     . GLU A 1 372 ? -78.08   32.366  45.778  1    113.71 ? 368  GLU A CG     1 
ATOM   5781  C CD     . GLU A 1 372 ? -77.72   31.11   44.999  1    104.62 ? 368  GLU A CD     1 
ATOM   5782  O OE1    . GLU A 1 372 ? -76.97   31.206  44      1    100.12 ? 368  GLU A OE1    1 
ATOM   5783  O OE2    . GLU A 1 372 ? -78.189  30.021  45.401  1    102.54 ? 368  GLU A OE2    1 
ATOM   5784  H H      . GLU A 1 372 ? -77.037  33.492  42.731  0    196.86 ? 368  GLU A H      1 
ATOM   5785  H HA     . GLU A 1 372 ? -79.111  34.604  44.531  0    223.32 ? 368  GLU A HA     1 
ATOM   5786  H HB2    . GLU A 1 372 ? -76.372  33.437  45.111  0    222.93 ? 368  GLU A HB2    1 
ATOM   5787  H HB3    . GLU A 1 372 ? -77.381  34.286  46.304  0    233.35 ? 368  GLU A HB3    1 
ATOM   5788  H HG2    . GLU A 1 372 ? -77.84   32.162  46.82   0    224.6  ? 368  GLU A HG2    1 
ATOM   5789  H HG3    . GLU A 1 372 ? -79.155  32.507  45.683  0    221.24 ? 368  GLU A HG3    1 
ATOM   5790  N N      . ARG A 1 373 ? -77.406  36.506  42.92   1    113.36 ? 369  ARG A N      1 
ATOM   5791  C CA     . ARG A 1 373 ? -76.888  37.871  42.6    1    116.92 ? 369  ARG A CA     1 
ATOM   5792  C C      . ARG A 1 373 ? -75.508  38.235  43.234  1    121.63 ? 369  ARG A C      1 
ATOM   5793  O O      . ARG A 1 373 ? -75.22   39.425  43.402  1    128.4  ? 369  ARG A O      1 
ATOM   5794  C CB     . ARG A 1 373 ? -77.928  38.979  42.959  1    123.76 ? 369  ARG A CB     1 
ATOM   5795  C CG     . ARG A 1 373 ? -79.399  38.685  42.567  1    121.46 ? 369  ARG A CG     1 
ATOM   5796  C CD     . ARG A 1 373 ? -79.694  38.685  41.062  1    114.72 ? 369  ARG A CD     1 
ATOM   5797  N NE     . ARG A 1 373 ? -81.039  38.159  40.746  1    113.96 ? 369  ARG A NE     1 
ATOM   5798  C CZ     . ARG A 1 373 ? -81.357  36.893  40.417  1    108.37 ? 369  ARG A CZ     1 
ATOM   5799  N NH1    . ARG A 1 373 ? -82.617  36.561  40.158  1    108.95 ? 369  ARG A NH1    1 
ATOM   5800  N NH2    . ARG A 1 373 ? -80.413  35.954  40.341  1    102.77 ? 369  ARG A NH2    1 
ATOM   5801  H H      . ARG A 1 373 ? -77.747  36.053  42.079  0    213.45 ? 369  ARG A H      1 
ATOM   5802  H HA     . ARG A 1 373 ? -76.748  37.917  41.521  0    222.46 ? 369  ARG A HA     1 
ATOM   5803  H HB2    . ARG A 1 373 ? -77.904  39.137  44.036  0    249.82 ? 369  ARG A HB2    1 
ATOM   5804  H HB3    . ARG A 1 373 ? -77.643  39.898  42.45   0    244.24 ? 369  ARG A HB3    1 
ATOM   5805  H HG2    . ARG A 1 373 ? -79.691  37.712  42.96   0    235.92 ? 369  ARG A HG2    1 
ATOM   5806  H HG3    . ARG A 1 373 ? -80.027  39.452  43.017  0    244.93 ? 369  ARG A HG3    1 
ATOM   5807  H HD2    . ARG A 1 373 ? -79.68   39.72   40.727  0    226.44 ? 369  ARG A HD2    1 
ATOM   5808  H HD3    . ARG A 1 373 ? -78.921  38.137  40.526  0    217.37 ? 369  ARG A HD3    1 
ATOM   5809  H HE     . ARG A 1 373 ? -81.8    38.831  40.78   0    225.8  ? 369  ARG A HE     1 
ATOM   5810  H HH11   . ARG A 1 373 ? -83.351  37.263  40.201  0    214.61 ? 369  ARG A HH11   1 
ATOM   5811  H HH12   . ARG A 1 373 ? -82.855  35.606  39.913  0    206.04 ? 369  ARG A HH12   1 
ATOM   5812  H HH21   . ARG A 1 373 ? -79.437  36.132  40.548  0    196.51 ? 369  ARG A HH21   1 
ATOM   5813  H HH22   . ARG A 1 373 ? -80.685  35.005  40.103  0    192.66 ? 369  ARG A HH22   1 
ATOM   5814  N N      . GLN A 1 374 ? -74.634  37.212  43.454  1    118.54 ? 370  GLN A N      1 
ATOM   5815  C CA     . GLN A 1 374 ? -73.324  37.269  44.146  1    123.24 ? 370  GLN A CA     1 
ATOM   5816  C C      . GLN A 1 374 ? -72.158  37.951  43.396  1    122.73 ? 370  GLN A C      1 
ATOM   5817  O O      . GLN A 1 374 ? -71.245  38.464  44.042  1    130.15 ? 370  GLN A O      1 
ATOM   5818  C CB     . GLN A 1 374 ? -72.807  35.841  44.484  1    119.36 ? 370  GLN A CB     1 
ATOM   5819  C CG     . GLN A 1 374 ? -73.781  34.746  44.936  1    116.88 ? 370  GLN A CG     1 
ATOM   5820  C CD     . GLN A 1 374 ? -73.564  33.444  44.141  1    108.54 ? 370  GLN A CD     1 
ATOM   5821  O OE1    . GLN A 1 374 ? -73.748  33.374  42.91   1    102.25 ? 370  GLN A OE1    1 
ATOM   5822  N NE2    . GLN A 1 374 ? -73.18   32.367  44.815  1    108.88 ? 370  GLN A NE2    1 
ATOM   5823  H H      . GLN A 1 374 ? -74.802  36.296  43.051  0    225.53 ? 370  GLN A H      1 
ATOM   5824  H HA     . GLN A 1 374 ? -73.437  37.816  45.079  0    249.18 ? 370  GLN A HA     1 
ATOM   5825  H HB2    . GLN A 1 374 ? -72.375  35.47   43.558  0    227.11 ? 370  GLN A HB2    1 
ATOM   5826  H HB3    . GLN A 1 374 ? -72.047  35.932  45.259  0    238.57 ? 370  GLN A HB3    1 
ATOM   5827  H HG2    . GLN A 1 374 ? -73.605  34.546  45.992  0    233.58 ? 370  GLN A HG2    1 
ATOM   5828  H HG3    . GLN A 1 374 ? -74.809  35.076  44.799  0    228.51 ? 370  GLN A HG3    1 
ATOM   5829  H HE21   . GLN A 1 374 ? -73.052  32.398  45.821  0    215.1  ? 370  GLN A HE21   1 
ATOM   5830  H HE22   . GLN A 1 374 ? -73.035  31.494  44.318  0    204.05 ? 370  GLN A HE22   1 
ATOM   5831  N N      . GLY A 1 375 ? -72.131  37.841  42.072  1    114.84 ? 371  GLY A N      1 
ATOM   5832  C CA     . GLY A 1 375 ? -71.019  38.315  41.252  1    113.65 ? 371  GLY A CA     1 
ATOM   5833  C C      . GLY A 1 375 ? -69.942  37.254  41.03   1    109.91 ? 371  GLY A C      1 
ATOM   5834  O O      . GLY A 1 375 ? -68.877  37.565  40.488  1    109.22 ? 371  GLY A O      1 
ATOM   5835  H H      . GLY A 1 375 ? -72.871  37.417  41.522  0    219    ? 371  GLY A H      1 
ATOM   5836  H HA2    . GLY A 1 375 ? -71.404  38.604  40.275  0    216.82 ? 371  GLY A HA2    1 
ATOM   5837  H HA3    . GLY A 1 375 ? -70.557  39.193  41.7    0    227.3  ? 371  GLY A HA3    1 
ATOM   5838  N N      . GLN A 1 376 ? -70.209  35.982  41.435  1    107.93 ? 372  GLN A N      1 
ATOM   5839  C CA     . GLN A 1 376 ? -69.293  34.85   41.282  1    104.71 ? 372  GLN A CA     1 
ATOM   5840  C C      . GLN A 1 376 ? -69.796  33.994  40.1    1    95.54  ? 372  GLN A C      1 
ATOM   5841  O O      . GLN A 1 376 ? -69.056  33.761  39.143  1    92.82  ? 372  GLN A O      1 
ATOM   5842  C CB     . GLN A 1 376 ? -69.219  34.002  42.587  1    107.84 ? 372  GLN A CB     1 
ATOM   5843  C CG     . GLN A 1 376 ? -69.249  34.795  43.905  1    117.7  ? 372  GLN A CG     1 
ATOM   5844  C CD     . GLN A 1 376 ? -68.965  33.938  45.11   1    121.15 ? 372  GLN A CD     1 
ATOM   5845  O OE1    . GLN A 1 376 ? -69.136  32.717  45.083  1    116.92 ? 372  GLN A OE1    1 
ATOM   5846  N NE2    . GLN A 1 376 ? -68.552  34.552  46.208  1    129.44 ? 372  GLN A NE2    1 
ATOM   5847  H H      . GLN A 1 376 ? -71.081  35.694  41.866  0    206.98 ? 372  GLN A H      1 
ATOM   5848  H HA     . GLN A 1 376 ? -68.286  35.195  41.053  0    202.37 ? 372  GLN A HA     1 
ATOM   5849  H HB2    . GLN A 1 376 ? -70.068  33.32   42.607  0    203.38 ? 372  GLN A HB2    1 
ATOM   5850  H HB3    . GLN A 1 376 ? -68.295  33.426  42.572  0    205.71 ? 372  GLN A HB3    1 
ATOM   5851  H HG2    . GLN A 1 376 ? -68.549  35.626  43.89   0    232.51 ? 372  GLN A HG2    1 
ATOM   5852  H HG3    . GLN A 1 376 ? -70.245  35.203  44.045  0    229.82 ? 372  GLN A HG3    1 
ATOM   5853  H HE21   . GLN A 1 376 ? -68.427  35.559  46.218  0    258.73 ? 372  GLN A HE21   1 
ATOM   5854  H HE22   . GLN A 1 376 ? -68.346  34.009  47.04   0    256.98 ? 372  GLN A HE22   1 
ATOM   5855  N N      . GLY A 1 377 ? -71.066  33.59   40.16   1    91.77  ? 373  GLY A N      1 
ATOM   5856  C CA     . GLY A 1 377 ? -71.69   32.767  39.135  1    84.08  ? 373  GLY A CA     1 
ATOM   5857  C C      . GLY A 1 377 ? -71.707  31.302  39.514  1    80.92  ? 373  GLY A C      1 
ATOM   5858  O O      . GLY A 1 377 ? -71.012  30.874  40.439  1    83.37  ? 373  GLY A O      1 
ATOM   5859  H H      . GLY A 1 377 ? -71.696  33.82   40.922  0    174.91 ? 373  GLY A H      1 
ATOM   5860  H HA2    . GLY A 1 377 ? -72.72   33.093  38.994  0    154.24 ? 373  GLY A HA2    1 
ATOM   5861  H HA3    . GLY A 1 377 ? -71.172  32.87   38.183  0    152.6  ? 373  GLY A HA3    1 
ATOM   5862  N N      . GLN A 1 378 ? -72.515  30.537  38.799  1    75.98  ? 374  GLN A N      1 
ATOM   5863  C CA     . GLN A 1 378 ? -72.685  29.102  38.978  1    72.6   ? 374  GLN A CA     1 
ATOM   5864  C C      . GLN A 1 378 ? -72.831  28.48   37.614  1    66.32  ? 374  GLN A C      1 
ATOM   5865  O O      . GLN A 1 378 ? -73.405  29.096  36.718  1    64.72  ? 374  GLN A O      1 
ATOM   5866  C CB     . GLN A 1 378 ? -73.936  28.799  39.791  1    74.41  ? 374  GLN A CB     1 
ATOM   5867  C CG     . GLN A 1 378 ? -73.817  29.224  41.228  1    81.49  ? 374  GLN A CG     1 
ATOM   5868  C CD     . GLN A 1 378 ? -75.153  29.221  41.909  1    83.95  ? 374  GLN A CD     1 
ATOM   5869  O OE1    . GLN A 1 378 ? -75.783  30.276  42.086  1    87.53  ? 374  GLN A OE1    1 
ATOM   5870  N NE2    . GLN A 1 378 ? -75.615  28.044  42.307  1    82.6   ? 374  GLN A NE2    1 
ATOM   5871  H H      . GLN A 1 378 ? -73.095  30.912  38.055  0    135.19 ? 374  GLN A H      1 
ATOM   5872  H HA     . GLN A 1 378 ? -71.821  28.664  39.475  0    130.8  ? 374  GLN A HA     1 
ATOM   5873  H HB2    . GLN A 1 378 ? -74.78   29.329  39.352  0    133    ? 374  GLN A HB2    1 
ATOM   5874  H HB3    . GLN A 1 378 ? -74.118  27.726  39.772  0    130.79 ? 374  GLN A HB3    1 
ATOM   5875  H HG2    . GLN A 1 378 ? -73.154  28.541  41.755  0    149.8  ? 374  GLN A HG2    1 
ATOM   5876  H HG3    . GLN A 1 378 ? -73.422  30.237  41.278  0    152.22 ? 374  GLN A HG3    1 
ATOM   5877  H HE21   . GLN A 1 378 ? -75.074  27.202  42.142  0    148.6  ? 374  GLN A HE21   1 
ATOM   5878  H HE22   . GLN A 1 378 ? -76.511  27.985  42.78   0    153.48 ? 374  GLN A HE22   1 
ATOM   5879  N N      . LEU A 1 379 ? -72.344  27.255  37.454  1    63.31  ? 375  LEU A N      1 
ATOM   5880  C CA     . LEU A 1 379 ? -72.423  26.565  36.182  1    58.12  ? 375  LEU A CA     1 
ATOM   5881  C C      . LEU A 1 379 ? -73.455  25.475  36.276  1    55.53  ? 375  LEU A C      1 
ATOM   5882  O O      . LEU A 1 379 ? -73.265  24.555  37.057  1    56.02  ? 375  LEU A O      1 
ATOM   5883  C CB     . LEU A 1 379 ? -71.055  25.967  35.857  1    57.4   ? 375  LEU A CB     1 
ATOM   5884  C CG     . LEU A 1 379 ? -70.868  25.452  34.444  1    53.54  ? 375  LEU A CG     1 
ATOM   5885  C CD1    . LEU A 1 379 ? -70.616  26.593  33.481  1    53.94  ? 375  LEU A CD1    1 
ATOM   5886  C CD2    . LEU A 1 379 ? -69.723  24.477  34.387  1    53.55  ? 375  LEU A CD2    1 
ATOM   5887  H H      . LEU A 1 379 ? -71.892  26.715  38.185  0    110.53 ? 375  LEU A H      1 
ATOM   5888  H HA     . LEU A 1 379 ? -72.706  27.252  35.387  0    96.86  ? 375  LEU A HA     1 
ATOM   5889  H HB2    . LEU A 1 379 ? -70.308  26.743  36.016  0    98.91  ? 375  LEU A HB2    1 
ATOM   5890  H HB3    . LEU A 1 379 ? -70.85   25.142  36.537  0    96.32  ? 375  LEU A HB3    1 
ATOM   5891  H HG     . LEU A 1 379 ? -71.758  24.922  34.105  0    84.92  ? 375  LEU A HG     1 
ATOM   5892  H HD11   . LEU A 1 379 ? -70.454  26.177  32.489  0    85.92  ? 375  LEU A HD11   1 
ATOM   5893  H HD12   . LEU A 1 379 ? -71.478  27.257  33.455  0    88.43  ? 375  LEU A HD12   1 
ATOM   5894  H HD13   . LEU A 1 379 ? -69.732  27.145  33.797  0    91.18  ? 375  LEU A HD13   1 
ATOM   5895  H HD21   . LEU A 1 379 ? -69.557  24.181  33.352  0    85.25  ? 375  LEU A HD21   1 
ATOM   5896  H HD22   . LEU A 1 379 ? -68.829  24.954  34.785  0    90.46  ? 375  LEU A HD22   1 
ATOM   5897  H HD23   . LEU A 1 379 ? -69.973  23.599  34.981  0    86.95  ? 375  LEU A HD23   1 
ATOM   5898  N N      . VAL A 1 380 ? -74.566  25.595  35.524  1    53.39  ? 376  VAL A N      1 
ATOM   5899  C CA     . VAL A 1 380 ? -75.616  24.567  35.455  1    51.34  ? 376  VAL A CA     1 
ATOM   5900  C C      . VAL A 1 380 ? -75.345  23.825  34.148  1    47.38  ? 376  VAL A C      1 
ATOM   5901  O O      . VAL A 1 380 ? -75.39   24.444  33.082  1    46.36  ? 376  VAL A O      1 
ATOM   5902  C CB     . VAL A 1 380 ? -77.059  25.131  35.489  1    52.91  ? 376  VAL A CB     1 
ATOM   5903  C CG1    . VAL A 1 380 ? -78.089  24.007  35.465  1    51.53  ? 376  VAL A CG1    1 
ATOM   5904  C CG2    . VAL A 1 380 ? -77.265  25.992  36.717  1    57.76  ? 376  VAL A CG2    1 
ATOM   5905  H H      . VAL A 1 380 ? -74.777  26.407  34.953  0    87.52  ? 376  VAL A H      1 
ATOM   5906  H HA     . VAL A 1 380 ? -75.522  23.868  36.284  0    83.66  ? 376  VAL A HA     1 
ATOM   5907  H HB     . VAL A 1 380 ? -77.219  25.755  34.611  0    85.59  ? 376  VAL A HB     1 
ATOM   5908  H HG11   . VAL A 1 380 ? -79.082  24.435  35.6    0    85.21  ? 376  VAL A HG11   1 
ATOM   5909  H HG12   . VAL A 1 380 ? -78.052  23.488  34.509  0    80.47  ? 376  VAL A HG12   1 
ATOM   5910  H HG13   . VAL A 1 380 ? -77.873  23.313  36.275  0    84.09  ? 376  VAL A HG13   1 
ATOM   5911  H HG21   . VAL A 1 380 ? -78.308  26.303  36.767  0    98.62  ? 376  VAL A HG21   1 
ATOM   5912  H HG22   . VAL A 1 380 ? -77.007  25.415  37.604  0    98.21  ? 376  VAL A HG22   1 
ATOM   5913  H HG23   . VAL A 1 380 ? -76.628  26.873  36.649  0    98.46  ? 376  VAL A HG23   1 
ATOM   5914  N N      . THR A 1 381 ? -75.006  22.522  34.23   1    45.71  ? 377  THR A N      1 
ATOM   5915  C CA     . THR A 1 381 ? -74.67   21.725  33.054  1    42.88  ? 377  THR A CA     1 
ATOM   5916  C C      . THR A 1 381 ? -75.768  20.727  32.716  1    41.24  ? 377  THR A C      1 
ATOM   5917  O O      . THR A 1 381 ? -76.584  20.388  33.57   1    42.06  ? 377  THR A O      1 
ATOM   5918  C CB     . THR A 1 381 ? -73.331  20.963  33.266  1    43.04  ? 377  THR A CB     1 
ATOM   5919  O OG1    . THR A 1 381 ? -73.506  19.94   34.257  1    43.36  ? 377  THR A OG1    1 
ATOM   5920  C CG2    . THR A 1 381 ? -72.193  21.868  33.659  1    45.57  ? 377  THR A CG2    1 
ATOM   5921  H H      . THR A 1 381 ? -74.959  21.996  35.097  0    71.44  ? 377  THR A H      1 
ATOM   5922  H HA     . THR A 1 381 ? -74.529  22.37   32.19   0    63.85  ? 377  THR A HA     1 
ATOM   5923  H HB     . THR A 1 381 ? -73.051  20.516  32.312  0    63.16  ? 377  THR A HB     1 
ATOM   5924  H HG1    . THR A 1 381 ? -73.653  19.045  33.852  0    64.16  ? 377  THR A HG1    1 
ATOM   5925  H HG21   . THR A 1 381 ? -71.267  21.297  33.7    0    70.56  ? 377  THR A HG21   1 
ATOM   5926  H HG22   . THR A 1 381 ? -72.077  22.672  32.935  0    69.97  ? 377  THR A HG22   1 
ATOM   5927  H HG23   . THR A 1 381 ? -72.377  22.301  34.641  0    72.18  ? 377  THR A HG23   1 
ATOM   5928  N N      . CYS A 1 382 ? -75.762  20.275  31.445  1    39.53  ? 378  CYS A N      1 
ATOM   5929  C CA     . CYS A 1 382 ? -76.562  19.2    30.888  1    38.45  ? 378  CYS A CA     1 
ATOM   5930  C C      . CYS A 1 382 ? -75.547  18.054  30.864  1    37.82  ? 378  CYS A C      1 
ATOM   5931  O O      . CYS A 1 382 ? -74.67   18.051  30.002  1    37.55  ? 378  CYS A O      1 
ATOM   5932  C CB     . CYS A 1 382 ? -77.056  19.539  29.484  1    37.97  ? 378  CYS A CB     1 
ATOM   5933  S SG     . CYS A 1 382 ? -78.554  20.547  29.439  1    39.43  ? 378  CYS A SG     1 
ATOM   5934  H H      . CYS A 1 382 ? -75.142  20.674  30.748  0    56.65  ? 378  CYS A H      1 
ATOM   5935  H HA     . CYS A 1 382 ? -77.406  18.951  31.529  0    55.26  ? 378  CYS A HA     1 
ATOM   5936  H HB2    . CYS A 1 382 ? -76.279  20.051  28.918  0    53.33  ? 378  CYS A HB2    1 
ATOM   5937  H HB3    . CYS A 1 382 ? -77.318  18.603  28.995  0    53.07  ? 378  CYS A HB3    1 
ATOM   5938  H HG     . CYS A 1 382 ? -78.927  20.724  28.166  0    56.59  ? 378  CYS A HG     1 
ATOM   5939  N N      . SER A 1 383 ? -75.599  17.155  31.871  1    38.14  ? 379  SER A N      1 
ATOM   5940  C CA     . SER A 1 383 ? -74.642  16.061  32.045  1    38.16  ? 379  SER A CA     1 
ATOM   5941  C C      . SER A 1 383 ? -75.304  14.671  32.049  1    37.93  ? 379  SER A C      1 
ATOM   5942  O O      . SER A 1 383 ? -76.424  14.513  32.544  1    38.28  ? 379  SER A O      1 
ATOM   5943  C CB     . SER A 1 383 ? -73.89   16.265  33.353  1    39.59  ? 379  SER A CB     1 
ATOM   5944  O OG     . SER A 1 383 ? -73.089  17.436  33.286  1    40.47  ? 379  SER A OG     1 
ATOM   5945  H H      . SER A 1 383 ? -76.315  17.166  32.591  0    54.57  ? 379  SER A H      1 
ATOM   5946  H HA     . SER A 1 383 ? -73.914  16.073  31.236  0    53.68  ? 379  SER A HA     1 
ATOM   5947  H HB2    . SER A 1 383 ? -74.619  16.394  34.152  0    57.78  ? 379  SER A HB2    1 
ATOM   5948  H HB3    . SER A 1 383 ? -73.284  15.382  33.551  0    57.36  ? 379  SER A HB3    1 
ATOM   5949  H HG     . SER A 1 383 ? -72.121  17.232  33.375  0    59.64  ? 379  SER A HG     1 
ATOM   5950  N N      . GLY A 1 384 ? -74.589  13.683  31.509  1    37.96  ? 380  GLY A N      1 
ATOM   5951  C CA     . GLY A 1 384 ? -75.059  12.309  31.42   1    38.24  ? 380  GLY A CA     1 
ATOM   5952  C C      . GLY A 1 384 ? -75.875  12.018  30.179  1    38.24  ? 380  GLY A C      1 
ATOM   5953  O O      . GLY A 1 384 ? -76.047  12.878  29.305  1    37.91  ? 380  GLY A O      1 
ATOM   5954  H H      . GLY A 1 384 ? -73.653  13.805  31.137  0    53.8   ? 380  GLY A H      1 
ATOM   5955  H HA2    . GLY A 1 384 ? -74.217  11.621  31.434  0    54.73  ? 380  GLY A HA2    1 
ATOM   5956  H HA3    . GLY A 1 384 ? -75.675  12.07   32.285  0    54.42  ? 380  GLY A HA3    1 
ATOM   5957  N N      . ALA A 1 385 ? -76.392  10.788  30.104  1    39.1   ? 381  ALA A N      1 
ATOM   5958  C CA     . ALA A 1 385 ? -77.235  10.359  28.997  1    40.08  ? 381  ALA A CA     1 
ATOM   5959  C C      . ALA A 1 385 ? -78.104  9.18    29.425  1    41.38  ? 381  ALA A C      1 
ATOM   5960  O O      . ALA A 1 385 ? -77.741  8.442   30.336  1    41.57  ? 381  ALA A O      1 
ATOM   5961  C CB     . ALA A 1 385 ? -76.37   9.965   27.815  1    41.11  ? 381  ALA A CB     1 
ATOM   5962  H H      . ALA A 1 385 ? -76.231  10.067  30.8    0    56.43  ? 381  ALA A H      1 
ATOM   5963  H HA     . ALA A 1 385 ? -77.89   11.17   28.684  0    57.95  ? 381  ALA A HA     1 
ATOM   5964  H HB1    . ALA A 1 385 ? -77.011  9.649   26.994  0    61.65  ? 381  ALA A HB1    1 
ATOM   5965  H HB2    . ALA A 1 385 ? -75.779  10.825  27.505  0    59.76  ? 381  ALA A HB2    1 
ATOM   5966  H HB3    . ALA A 1 385 ? -75.723  9.143   28.118  0    61.14  ? 381  ALA A HB3    1 
ATOM   5967  N N      . PHE A 1 386 ? -79.254  9.007   28.771  1    42.74  ? 382  PHE A N      1 
ATOM   5968  C CA     . PHE A 1 386 ? -80.16   7.893   29.055  1    44.74  ? 382  PHE A CA     1 
ATOM   5969  C C      . PHE A 1 386 ? -80.651  7.969   30.516  1    44.42  ? 382  PHE A C      1 
ATOM   5970  O O      . PHE A 1 386 ? -80.859  9.088   30.964  1    43.46  ? 382  PHE A O      1 
ATOM   5971  C CB     . PHE A 1 386 ? -79.487  6.556   28.663  1    46.29  ? 382  PHE A CB     1 
ATOM   5972  C CG     . PHE A 1 386 ? -78.835  6.595   27.294  1    47.24  ? 382  PHE A CG     1 
ATOM   5973  C CD1    . PHE A 1 386 ? -79.506  7.118   26.205  1    48.62  ? 382  PHE A CD1    1 
ATOM   5974  C CD2    . PHE A 1 386 ? -77.518  6.206   27.122  1    47.35  ? 382  PHE A CD2    1 
ATOM   5975  C CE1    . PHE A 1 386 ? -78.884  7.222   24.97   1    50.02  ? 382  PHE A CE1    1 
ATOM   5976  C CE2    . PHE A 1 386 ? -76.902  6.307   25.882  1    48.95  ? 382  PHE A CE2    1 
ATOM   5977  C CZ     . PHE A 1 386 ? -77.588  6.813   24.816  1    50.24  ? 382  PHE A CZ     1 
ATOM   5978  H H      . PHE A 1 386 ? -79.585  9.623   28.036  0    64.29  ? 382  PHE A H      1 
ATOM   5979  H HA     . PHE A 1 386 ? -81.038  8.007   28.424  0    69.93  ? 382  PHE A HA     1 
ATOM   5980  H HB2    . PHE A 1 386 ? -78.719  6.322   29.397  0    70.98  ? 382  PHE A HB2    1 
ATOM   5981  H HB3    . PHE A 1 386 ? -80.241  5.77    28.663  0    73.86  ? 382  PHE A HB3    1 
ATOM   5982  H HD1    . PHE A 1 386 ? -80.529  7.434   26.315  0    77.32  ? 382  PHE A HD1    1 
ATOM   5983  H HD2    . PHE A 1 386 ? -76.959  5.826   27.957  0    73.56  ? 382  PHE A HD2    1 
ATOM   5984  H HE1    . PHE A 1 386 ? -79.432  7.59    24.121  0    81.23  ? 382  PHE A HE1    1 
ATOM   5985  H HE2    . PHE A 1 386 ? -75.883  5.985   25.759  0    78.28  ? 382  PHE A HE2    1 
ATOM   5986  H HZ     . PHE A 1 386 ? -77.12   6.862   23.846  0    81.95  ? 382  PHE A HZ     1 
ATOM   5987  N N      . LYS A 1 387 ? -80.854  6.851   31.265  1    45.66  ? 383  LYS A N      1 
ATOM   5988  C CA     . LYS A 1 387 ? -81.305  6.96    32.665  1    45.96  ? 383  LYS A CA     1 
ATOM   5989  C C      . LYS A 1 387 ? -80.366  7.821   33.528  1    44.1   ? 383  LYS A C      1 
ATOM   5990  O O      . LYS A 1 387 ? -80.803  8.384   34.535  1    44.64  ? 383  LYS A O      1 
ATOM   5991  C CB     . LYS A 1 387 ? -81.523  5.577   33.297  1    47.88  ? 383  LYS A CB     1 
ATOM   5992  C CG     . LYS A 1 387 ? -80.267  4.779   33.58   1    47.22  ? 383  LYS A CG     1 
ATOM   5993  C CD     . LYS A 1 387 ? -80.626  3.363   34.013  1    49.57  ? 383  LYS A CD     1 
ATOM   5994  C CE     . LYS A 1 387 ? -79.554  2.656   34.801  1    49.48  ? 383  LYS A CE     1 
ATOM   5995  N NZ     . LYS A 1 387 ? -79.336  3.261   36.144  1    48.73  ? 383  LYS A NZ     1 
ATOM   5996  H H      . LYS A 1 387 ? -80.73   5.895   30.946  0    71.7   ? 383  LYS A H      1 
ATOM   5997  H HA     . LYS A 1 387 ? -82.273  7.458   32.661  0    72.04  ? 383  LYS A HA     1 
ATOM   5998  H HB2    . LYS A 1 387 ? -82.045  5.71    34.244  0    76.06  ? 383  LYS A HB2    1 
ATOM   5999  H HB3    . LYS A 1 387 ? -82.138  4.985   32.62   0    76.92  ? 383  LYS A HB3    1 
ATOM   6000  H HG2    . LYS A 1 387 ? -79.683  4.719   32.665  0    73.31  ? 383  LYS A HG2    1 
ATOM   6001  H HG3    . LYS A 1 387 ? -79.693  5.253   34.374  0    72.84  ? 383  LYS A HG3    1 
ATOM   6002  H HD2    . LYS A 1 387 ? -81.524  3.395   34.629  0    80.07  ? 383  LYS A HD2    1 
ATOM   6003  H HD3    . LYS A 1 387 ? -80.815  2.771   33.118  0    80.29  ? 383  LYS A HD3    1 
ATOM   6004  H HE2    . LYS A 1 387 ? -79.876  1.629   34.964  0    80.74  ? 383  LYS A HE2    1 
ATOM   6005  H HE3    . LYS A 1 387 ? -78.615  2.684   34.25   0    78.1   ? 383  LYS A HE3    1 
ATOM   6006  H HZ1    . LYS A 1 387 ? -78.731  2.66    36.695  0    77.83  ? 383  LYS A HZ1    1 
ATOM   6007  H HZ2    . LYS A 1 387 ? -78.901  4.174   36.052  0    75.72  ? 383  LYS A HZ2    1 
ATOM   6008  H HZ3    . LYS A 1 387 ? -80.225  3.364   36.625  0    78.09  ? 383  LYS A HZ3    1 
ATOM   6009  N N      . GLU A 1 388 ? -79.097  7.969   33.097  1    42.63  ? 384  GLU A N      1 
ATOM   6010  C CA     . GLU A 1 388 ? -78.102  8.796   33.773  1    41.55  ? 384  GLU A CA     1 
ATOM   6011  C C      . GLU A 1 388 ? -78.254  10.312  33.518  1    40.56  ? 384  GLU A C      1 
ATOM   6012  O O      . GLU A 1 388 ? -77.425  11.089  33.998  1    40.04  ? 384  GLU A O      1 
ATOM   6013  C CB     . GLU A 1 388 ? -76.692  8.345   33.347  1    41.3   ? 384  GLU A CB     1 
ATOM   6014  C CG     . GLU A 1 388 ? -76.404  6.88    33.632  1    42.68  ? 384  GLU A CG     1 
ATOM   6015  C CD     . GLU A 1 388 ? -76.729  6.39    35.034  1    43.66  ? 384  GLU A CD     1 
ATOM   6016  O OE1    . GLU A 1 388 ? -76.522  7.158   36.004  1    43.63  ? 384  GLU A OE1    1 
ATOM   6017  O OE2    . GLU A 1 388 ? -77.209  5.239   35.158  1    44.96  ? 384  GLU A OE2    1 
ATOM   6018  H H      . GLU A 1 388 ? -78.726  7.52    32.266  0    63.85  ? 384  GLU A H      1 
ATOM   6019  H HA     . GLU A 1 388 ? -78.195  8.658   34.849  0    62.08  ? 384  GLU A HA     1 
ATOM   6020  H HB2    . GLU A 1 388 ? -76.584  8.505   32.276  0    60.44  ? 384  GLU A HB2    1 
ATOM   6021  H HB3    . GLU A 1 388 ? -75.956  8.951   33.869  0    60.49  ? 384  GLU A HB3    1 
ATOM   6022  H HG2    . GLU A 1 388 ? -76.986  6.274   32.942  0    64.48  ? 384  GLU A HG2    1 
ATOM   6023  H HG3    . GLU A 1 388 ? -75.345  6.697   33.456  0    64.01  ? 384  GLU A HG3    1 
ATOM   6024  N N      . GLY A 1 389 ? -79.296  10.724  32.795  1    40.8   ? 385  GLY A N      1 
ATOM   6025  C CA     . GLY A 1 389 ? -79.525  12.126  32.483  1    40.25  ? 385  GLY A CA     1 
ATOM   6026  C C      . GLY A 1 389 ? -79.729  12.95   33.729  1    41.07  ? 385  GLY A C      1 
ATOM   6027  O O      . GLY A 1 389 ? -80.408  12.502  34.657  1    42.69  ? 385  GLY A O      1 
ATOM   6028  H H      . GLY A 1 389 ? -80.013  10.12   32.408  0    60.73  ? 385  GLY A H      1 
ATOM   6029  H HA2    . GLY A 1 389 ? -78.662  12.508  31.941  0    57.55  ? 385  GLY A HA2    1 
ATOM   6030  H HA3    . GLY A 1 389 ? -80.407  12.223  31.851  0    59.22  ? 385  GLY A HA3    1 
ATOM   6031  N N      . SER A 1 390 ? -79.075  14.122  33.785  1    35.05  ? 386  SER A N      1 
ATOM   6032  C CA     . SER A 1 390 ? -79.13   14.99   34.955  1    36.93  ? 386  SER A CA     1 
ATOM   6033  C C      . SER A 1 390 ? -78.623  16.394  34.655  1    36.9   ? 386  SER A C      1 
ATOM   6034  O O      . SER A 1 390 ? -77.987  16.618  33.626  1    35.86  ? 386  SER A O      1 
ATOM   6035  C CB     . SER A 1 390 ? -78.273  14.402  36.08   1    40.03  ? 386  SER A CB     1 
ATOM   6036  O OG     . SER A 1 390 ? -76.885  14.424  35.777  1    40.9   ? 386  SER A OG     1 
ATOM   6037  H H      . SER A 1 390 ? -78.503  14.496  33.035  0    46.46  ? 386  SER A H      1 
ATOM   6038  H HA     . SER A 1 390 ? -80.156  15.065  35.312  0    51.34  ? 386  SER A HA     1 
ATOM   6039  H HB2    . SER A 1 390 ? -78.437  14.993  36.98   0    60.07  ? 386  SER A HB2    1 
ATOM   6040  H HB3    . SER A 1 390 ? -78.573  13.373  36.272  0    58.48  ? 386  SER A HB3    1 
ATOM   6041  H HG     . SER A 1 390 ? -76.39   13.94   36.489  0    62.31  ? 386  SER A HG     1 
ATOM   6042  N N      . LEU A 1 391 ? -78.908  17.335  35.567  1    38.46  ? 387  LEU A N      1 
ATOM   6043  C CA     . LEU A 1 391 ? -78.337  18.67   35.546  1    39.29  ? 387  LEU A CA     1 
ATOM   6044  C C      . LEU A 1 391 ? -77.416  18.735  36.759  1    42.76  ? 387  LEU A C      1 
ATOM   6045  O O      . LEU A 1 391 ? -77.706  18.127  37.791  1    44.91  ? 387  LEU A O      1 
ATOM   6046  C CB     . LEU A 1 391 ? -79.372  19.796  35.602  1    39.91  ? 387  LEU A CB     1 
ATOM   6047  C CG     . LEU A 1 391 ? -80.489  19.743  34.595  1    35.6   ? 387  LEU A CG     1 
ATOM   6048  C CD1    . LEU A 1 391 ? -81.467  20.853  34.829  1    36.58  ? 387  LEU A CD1    1 
ATOM   6049  C CD2    . LEU A 1 391 ? -79.962  19.846  33.202  1    32.99  ? 387  LEU A CD2    1 
ATOM   6050  H H      . LEU A 1 391 ? -79.543  17.187  36.345  0    55.87  ? 387  LEU A H      1 
ATOM   6051  H HA     . LEU A 1 391 ? -77.729  18.817  34.654  0    55.15  ? 387  LEU A HA     1 
ATOM   6052  H HB2    . LEU A 1 391 ? -79.813  19.841  36.595  0    58.48  ? 387  LEU A HB2    1 
ATOM   6053  H HB3    . LEU A 1 391 ? -78.843  20.731  35.425  0    57.16  ? 387  LEU A HB3    1 
ATOM   6054  H HG     . LEU A 1 391 ? -81.019  18.798  34.7    0    48.22  ? 387  LEU A HG     1 
ATOM   6055  H HD11   . LEU A 1 391 ? -82.258  20.8    34.082  0    48.38  ? 387  LEU A HD11   1 
ATOM   6056  H HD12   . LEU A 1 391 ? -81.889  20.747  35.828  0    51.86  ? 387  LEU A HD12   1 
ATOM   6057  H HD13   . LEU A 1 391 ? -80.949  21.808  34.752  0    50.76  ? 387  LEU A HD13   1 
ATOM   6058  H HD21   . LEU A 1 391 ? -80.795  19.911  32.505  0    41.97  ? 387  LEU A HD21   1 
ATOM   6059  H HD22   . LEU A 1 391 ? -79.341  20.737  33.117  0    44.24  ? 387  LEU A HD22   1 
ATOM   6060  H HD23   . LEU A 1 391 ? -79.368  18.962  32.972  0    43.26  ? 387  LEU A HD23   1 
ATOM   6061  N N      . ARG A 1 392 ? -76.292  19.432  36.634  1    43.8   ? 388  ARG A N      1 
ATOM   6062  C CA     . ARG A 1 392 ? -75.344  19.559  37.733  1    47.73  ? 388  ARG A CA     1 
ATOM   6063  C C      . ARG A 1 392 ? -75.135  21.031  37.991  1    49.33  ? 388  ARG A C      1 
ATOM   6064  O O      . ARG A 1 392 ? -74.826  21.761  37.055  1    47.84  ? 388  ARG A O      1 
ATOM   6065  C CB     . ARG A 1 392 ? -74.006  18.897  37.379  1    48.47  ? 388  ARG A CB     1 
ATOM   6066  C CG     . ARG A 1 392 ? -74.13   17.476  36.872  1    46.78  ? 388  ARG A CG     1 
ATOM   6067  C CD     . ARG A 1 392 ? -74.244  16.505  38.009  1    49.51  ? 388  ARG A CD     1 
ATOM   6068  N NE     . ARG A 1 392 ? -74.462  15.159  37.498  1    47.87  ? 388  ARG A NE     1 
ATOM   6069  C CZ     . ARG A 1 392 ? -74.235  14.035  38.176  1    50.04  ? 388  ARG A CZ     1 
ATOM   6070  N NH1    . ARG A 1 392 ? -73.787  14.082  39.432  1    54.16  ? 388  ARG A NH1    1 
ATOM   6071  N NH2    . ARG A 1 392 ? -74.463  12.854  37.612  1    48.49  ? 388  ARG A NH2    1 
ATOM   6072  H H      . ARG A 1 392 ? -76.01   19.921  35.791  0    64.97  ? 388  ARG A H      1 
ATOM   6073  H HA     . ARG A 1 392 ? -75.719  19.098  38.645  0    76.9   ? 388  ARG A HA     1 
ATOM   6074  H HB2    . ARG A 1 392 ? -73.499  19.48   36.612  0    75.55  ? 388  ARG A HB2    1 
ATOM   6075  H HB3    . ARG A 1 392 ? -73.387  18.868  38.275  0    79.94  ? 388  ARG A HB3    1 
ATOM   6076  H HG2    . ARG A 1 392 ? -75.009  17.373  36.239  0    70.31  ? 388  ARG A HG2    1 
ATOM   6077  H HG3    . ARG A 1 392 ? -73.235  17.223  36.306  0    72.81  ? 388  ARG A HG3    1 
ATOM   6078  H HD2    . ARG A 1 392 ? -73.302  16.53   38.555  0    81.75  ? 388  ARG A HD2    1 
ATOM   6079  H HD3    . ARG A 1 392 ? -75.077  16.782  38.654  0    79.64  ? 388  ARG A HD3    1 
ATOM   6080  H HE     . ARG A 1 392 ? -74.778  15.08   36.537  0    72.49  ? 388  ARG A HE     1 
ATOM   6081  H HH11   . ARG A 1 392 ? -73.621  14.953  39.923  0    90.78  ? 388  ARG A HH11   1 
ATOM   6082  H HH12   . ARG A 1 392 ? -73.642  13.212  39.936  0    90.91  ? 388  ARG A HH12   1 
ATOM   6083  H HH21   . ARG A 1 392 ? -74.784  12.794  36.652  0    73.77  ? 388  ARG A HH21   1 
ATOM   6084  H HH22   . ARG A 1 392 ? -74.291  12      38.135  0    78.31  ? 388  ARG A HH22   1 
ATOM   6085  N N      . ILE A 1 393 ? -75.33   21.483  39.234  1    52.67  ? 389  ILE A N      1 
ATOM   6086  C CA     . ILE A 1 393 ? -75.104  22.872  39.589  1    55.06  ? 389  ILE A CA     1 
ATOM   6087  C C      . ILE A 1 393 ? -73.761  22.899  40.311  1    59.18  ? 389  ILE A C      1 
ATOM   6088  O O      . ILE A 1 393 ? -73.668  22.421  41.442  1    62.68  ? 389  ILE A O      1 
ATOM   6089  C CB     . ILE A 1 393 ? -76.271  23.42   40.435  1    57.6   ? 389  ILE A CB     1 
ATOM   6090  C CG1    . ILE A 1 393 ? -77.598  23.283  39.651  1    54.55  ? 389  ILE A CG1    1 
ATOM   6091  C CG2    . ILE A 1 393 ? -76.017  24.871  40.811  1    61.37  ? 389  ILE A CG2    1 
ATOM   6092  C CD1    . ILE A 1 393 ? -78.491  22.172  40.051  1    54.51  ? 389  ILE A CD1    1 
ATOM   6093  H H      . ILE A 1 393 ? -75.64   20.915  40.014  0    87.6   ? 389  ILE A H      1 
ATOM   6094  H HA     . ILE A 1 393 ? -75.029  23.498  38.7    0    88.98  ? 389  ILE A HA     1 
ATOM   6095  H HB     . ILE A 1 393 ? -76.305  22.855  41.365  0    97.89  ? 389  ILE A HB     1 
ATOM   6096  H HG12   . ILE A 1 393 ? -78.169  24.206  39.746  0    88.13  ? 389  ILE A HG12   1 
ATOM   6097  H HG13   . ILE A 1 393 ? -77.356  23.13   38.6    0    84.97  ? 389  ILE A HG13   1 
ATOM   6098  H HG21   . ILE A 1 393 ? -76.914  25.292  41.263  0    103.7  ? 389  ILE A HG21   1 
ATOM   6099  H HG22   . ILE A 1 393 ? -75.204  24.921  41.535  0    106.44 ? 389  ILE A HG22   1 
ATOM   6100  H HG23   . ILE A 1 393 ? -75.746  25.434  39.919  0    101.06 ? 389  ILE A HG23   1 
ATOM   6101  H HD11   . ILE A 1 393 ? -79.361  22.165  39.394  0    84.66  ? 389  ILE A HD11   1 
ATOM   6102  H HD12   . ILE A 1 393 ? -77.951  21.231  39.964  0    87.02  ? 389  ILE A HD12   1 
ATOM   6103  H HD13   . ILE A 1 393 ? -78.81   22.337  41.078  0    90.35  ? 389  ILE A HD13   1 
ATOM   6104  N N      . ILE A 1 394 ? -72.7    23.368  39.618  1    59.18  ? 390  ILE A N      1 
ATOM   6105  C CA     . ILE A 1 394 ? -71.352  23.464  40.178  1    63.45  ? 390  ILE A CA     1 
ATOM   6106  C C      . ILE A 1 394 ? -71.133  24.915  40.643  1    66.61  ? 390  ILE A C      1 
ATOM   6107  O O      . ILE A 1 394 ? -71.47   25.861  39.918  1    64.49  ? 390  ILE A O      1 
ATOM   6108  C CB     . ILE A 1 394 ? -70.268  23.025  39.153  1    61.9   ? 390  ILE A CB     1 
ATOM   6109  C CG1    . ILE A 1 394 ? -70.593  21.621  38.597  1    59.35  ? 390  ILE A CG1    1 
ATOM   6110  C CG2    . ILE A 1 394 ? -68.875  23.016  39.798  1    66.54  ? 390  ILE A CG2    1 
ATOM   6111  C CD1    . ILE A 1 394 ? -71.13   21.567  37.22   1    54.59  ? 390  ILE A CD1    1 
ATOM   6112  H H      . ILE A 1 394 ? -72.749  23.695  38.658  0    97.45  ? 390  ILE A H      1 
ATOM   6113  H HA     . ILE A 1 394 ? -71.26   22.806  41.041  0    111.99 ? 390  ILE A HA     1 
ATOM   6114  H HB     . ILE A 1 394 ? -70.243  23.772  38.361  0    104.21 ? 390  ILE A HB     1 
ATOM   6115  H HG12   . ILE A 1 394 ? -69.683  21.022  38.61   0    101.75 ? 390  ILE A HG12   1 
ATOM   6116  H HG13   . ILE A 1 394 ? -71.33   21.155  39.248  0    100.27 ? 390  ILE A HG13   1 
ATOM   6117  H HG21   . ILE A 1 394 ? -68.148  22.645  39.077  0    115.6  ? 390  ILE A HG21   1 
ATOM   6118  H HG22   . ILE A 1 394 ? -68.6    24.028  40.093  0    118.56 ? 390  ILE A HG22   1 
ATOM   6119  H HG23   . ILE A 1 394 ? -68.9    22.367  40.672  0    119    ? 390  ILE A HG23   1 
ATOM   6120  H HD11   . ILE A 1 394 ? -71.383  20.536  36.981  0    88.09  ? 390  ILE A HD11   1 
ATOM   6121  H HD12   . ILE A 1 394 ? -72.018  22.194  37.157  0    87.99  ? 390  ILE A HD12   1 
ATOM   6122  H HD13   . ILE A 1 394 ? -70.367  21.928  36.532  0    89.51  ? 390  ILE A HD13   1 
ATOM   6123  N N      . ARG A 1 395 ? -70.601  25.077  41.865  1    71.88  ? 391  ARG A N      1 
ATOM   6124  C CA     . ARG A 1 395 ? -70.288  26.376  42.458  1    75.9   ? 391  ARG A CA     1 
ATOM   6125  C C      . ARG A 1 395 ? -68.958  26.222  43.227  1    81.25  ? 391  ARG A C      1 
ATOM   6126  O O      . ARG A 1 395 ? -68.688  25.154  43.788  1    83.13  ? 391  ARG A O      1 
ATOM   6127  C CB     . ARG A 1 395 ? -71.443  26.849  43.37   1    77.93  ? 391  ARG A CB     1 
ATOM   6128  C CG     . ARG A 1 395 ? -71.554  26.071  44.66   1    82.44  ? 391  ARG A CG     1 
ATOM   6129  C CD     . ARG A 1 395 ? -72.617  26.567  45.618  1    84.09  ? 391  ARG A CD     1 
ATOM   6130  N NE     . ARG A 1 395 ? -72.418  26.041  46.975  1    90.11  ? 391  ARG A NE     1 
ATOM   6131  C CZ     . ARG A 1 395 ? -71.49   26.47   47.836  1    95.58  ? 391  ARG A CZ     1 
ATOM   6132  N NH1    . ARG A 1 395 ? -70.633  27.424  47.483  1    95.83  ? 391  ARG A NH1    1 
ATOM   6133  N NH2    . ARG A 1 395 ? -71.395  25.928  49.046  1    101.46 ? 391  ARG A NH2    1 
ATOM   6134  H H      . ARG A 1 395 ? -70.377  24.306  42.486  0    129.91 ? 391  ARG A H      1 
ATOM   6135  H HA     . ARG A 1 395 ? -70.141  27.122  41.679  0    134.7  ? 391  ARG A HA     1 
ATOM   6136  H HB2    . ARG A 1 395 ? -71.311  27.903  43.611  0    143.3  ? 391  ARG A HB2    1 
ATOM   6137  H HB3    . ARG A 1 395 ? -72.381  26.694  42.84   0    137.01 ? 391  ARG A HB3    1 
ATOM   6138  H HG2    . ARG A 1 395 ? -71.783  25.036  44.41   0    148.09 ? 391  ARG A HG2    1 
ATOM   6139  H HG3    . ARG A 1 395 ? -70.608  26.161  45.189  0    154.52 ? 391  ARG A HG3    1 
ATOM   6140  H HD2    . ARG A 1 395 ? -72.599  27.656  45.655  0    156.19 ? 391  ARG A HD2    1 
ATOM   6141  H HD3    . ARG A 1 395 ? -73.591  26.227  45.27   0    151.31 ? 391  ARG A HD3    1 
ATOM   6142  H HE     . ARG A 1 395 ? -73.053  25.313  47.285  0    167.3  ? 391  ARG A HE     1 
ATOM   6143  H HH11   . ARG A 1 395 ? -70.662  27.862  46.569  0    178.31 ? 391  ARG A HH11   1 
ATOM   6144  H HH12   . ARG A 1 395 ? -69.928  27.73   48.146  0    187.03 ? 391  ARG A HH12   1 
ATOM   6145  H HH21   . ARG A 1 395 ? -72.04   25.197  49.328  0    192.37 ? 391  ARG A HH21   1 
ATOM   6146  H HH22   . ARG A 1 395 ? -70.686  26.245  49.699  0    198.08 ? 391  ARG A HH22   1 
ATOM   6147  N N      . ASN A 1 396 ? -68.137  27.277  43.253  1    83.89  ? 392  ASN A N      1 
ATOM   6148  C CA     . ASN A 1 396 ? -66.84   27.215  43.938  1    89.57  ? 392  ASN A CA     1 
ATOM   6149  C C      . ASN A 1 396 ? -67.005  27.261  45.472  1    95.56  ? 392  ASN A C      1 
ATOM   6150  O O      . ASN A 1 396 ? -68.012  27.755  45.977  1    96.26  ? 392  ASN A O      1 
ATOM   6151  C CB     . ASN A 1 396 ? -65.9    28.351  43.448  1    91.17  ? 392  ASN A CB     1 
ATOM   6152  C CG     . ASN A 1 396 ? -64.71   27.913  42.607  1    90.98  ? 392  ASN A CG     1 
ATOM   6153  O OD1    . ASN A 1 396 ? -64.112  26.853  42.825  1    92.18  ? 392  ASN A OD1    1 
ATOM   6154  N ND2    . ASN A 1 396 ? -64.299  28.74   41.655  1    89.79  ? 392  ASN A ND2    1 
ATOM   6155  H H      . ASN A 1 396 ? -68.363  28.173  42.834  0    153.28 ? 392  ASN A H      1 
ATOM   6156  H HA     . ASN A 1 396 ? -66.396  26.247  43.716  0    166.12 ? 392  ASN A HA     1 
ATOM   6157  H HB2    . ASN A 1 396 ? -66.469  29.069  42.86   0    166.92 ? 392  ASN A HB2    1 
ATOM   6158  H HB3    . ASN A 1 396 ? -65.499  28.855  44.326  0    175.26 ? 392  ASN A HB3    1 
ATOM   6159  H HD21   . ASN A 1 396 ? -63.505  28.483  41.077  0    168.13 ? 392  ASN A HD21   1 
ATOM   6160  H HD22   . ASN A 1 396 ? -64.757  29.635  41.51   0    166.66 ? 392  ASN A HD22   1 
ATOM   6161  N N      . GLY A 1 397 ? -66.031  26.718  46.19   1    100.08 ? 393  GLY A N      1 
ATOM   6162  C CA     . GLY A 1 397 ? -66.063  26.692  47.648  1    106.68 ? 393  GLY A CA     1 
ATOM   6163  C C      . GLY A 1 397 ? -64.689  26.598  48.278  1    112.8  ? 393  GLY A C      1 
ATOM   6164  O O      . GLY A 1 397 ? -63.688  26.418  47.583  1    110.97 ? 393  GLY A O      1 
ATOM   6165  H H      . GLY A 1 397 ? -65.206  26.281  45.791  0    190.25 ? 393  GLY A H      1 
ATOM   6166  H HA2    . GLY A 1 397 ? -66.537  27.595  48.029  0    206.48 ? 393  GLY A HA2    1 
ATOM   6167  H HA3    . GLY A 1 397 ? -66.648  25.834  47.976  0    204.01 ? 393  GLY A HA3    1 
ATOM   6168  N N      . GLN A 1 408 ? -61.413  24.142  50.274  1    131.17 ? 708  GLN A N      1 
ATOM   6169  C CA     . GLN A 1 408 ? -61.31   24.557  48.876  1    124.43 ? 708  GLN A CA     1 
ATOM   6170  C C      . GLN A 1 408 ? -61.73   23.39   47.972  1    117.96 ? 708  GLN A C      1 
ATOM   6171  O O      . GLN A 1 408 ? -60.875  22.695  47.424  1    116.48 ? 708  GLN A O      1 
ATOM   6172  C CB     . GLN A 1 408 ? -59.876  24.995  48.547  1    128    ? 708  GLN A CB     1 
ATOM   6173  C CG     . GLN A 1 408 ? -59.46   26.301  49.214  1    134.49 ? 708  GLN A CG     1 
ATOM   6174  C CD     . GLN A 1 408 ? -57.976  26.579  49.104  1    138.17 ? 708  GLN A CD     1 
ATOM   6175  O OE1    . GLN A 1 408 ? -57.177  25.727  48.694  1    135.84 ? 708  GLN A OE1    1 
ATOM   6176  N NE2    . GLN A 1 408 ? -57.562  27.787  49.481  1    144.35 ? 708  GLN A NE2    1 
ATOM   6177  H HA     . GLN A 1 408 ? -61.971  25.404  48.7    0    242.31 ? 708  GLN A HA     1 
ATOM   6178  H HB2    . GLN A 1 408 ? -59.202  24.207  48.882  0    255.38 ? 708  GLN A HB2    1 
ATOM   6179  H HB3    . GLN A 1 408 ? -59.787  25.132  47.471  0    247.65 ? 708  GLN A HB3    1 
ATOM   6180  H HG2    . GLN A 1 408 ? -59.991  27.129  48.746  0    264.05 ? 708  GLN A HG2    1 
ATOM   6181  H HG3    . GLN A 1 408 ? -59.706  26.255  50.274  0    272.02 ? 708  GLN A HG3    1 
ATOM   6182  H HE21   . GLN A 1 408 ? -58.232  28.475  49.811  0    287.82 ? 708  GLN A HE21   1 
ATOM   6183  H HE22   . GLN A 1 408 ? -56.577  28.025  49.424  0    290.27 ? 708  GLN A HE22   1 
ATOM   6184  N N      . LYS A 1 409 ? -63.05   23.141  47.859  1    114.68 ? 709  LYS A N      1 
ATOM   6185  C CA     . LYS A 1 409 ? -63.614  22.032  47.063  1    108.74 ? 709  LYS A CA     1 
ATOM   6186  C C      . LYS A 1 409 ? -64.84   22.533  46.281  1    101.81 ? 709  LYS A C      1 
ATOM   6187  O O      . LYS A 1 409 ? -65.535  23.431  46.753  1    102.51 ? 709  LYS A O      1 
ATOM   6188  C CB     . LYS A 1 409 ? -64.005  20.841  47.989  1    111.78 ? 709  LYS A CB     1 
ATOM   6189  C CG     . LYS A 1 409 ? -62.937  20.489  49.06   1    119.65 ? 709  LYS A CG     1 
ATOM   6190  C CD     . LYS A 1 409 ? -63.284  19.301  49.979  1    122.14 ? 709  LYS A CD     1 
ATOM   6191  C CE     . LYS A 1 409 ? -63.365  17.957  49.289  1    116.92 ? 709  LYS A CE     1 
ATOM   6192  N NZ     . LYS A 1 409 ? -62.121  17.61   48.555  1    117.12 ? 709  LYS A NZ     1 
ATOM   6193  H H      . LYS A 1 409 ? -63.762  23.696  48.323  0    223.56 ? 709  LYS A H      1 
ATOM   6194  H HA     . LYS A 1 409 ? -62.886  21.67   46.339  0    207.62 ? 709  LYS A HA     1 
ATOM   6195  H HB2    . LYS A 1 409 ? -64.924  21.095  48.515  0    216.06 ? 709  LYS A HB2    1 
ATOM   6196  H HB3    . LYS A 1 409 ? -64.167  19.957  47.373  0    211.3  ? 709  LYS A HB3    1 
ATOM   6197  H HG2    . LYS A 1 409 ? -61.996  20.268  48.559  0    232.73 ? 709  LYS A HG2    1 
ATOM   6198  H HG3    . LYS A 1 409 ? -62.804  21.348  49.716  0    237.33 ? 709  LYS A HG3    1 
ATOM   6199  H HD2    . LYS A 1 409 ? -62.519  19.225  50.75   0    244.95 ? 709  LYS A HD2    1 
ATOM   6200  H HD3    . LYS A 1 409 ? -64.25   19.489  50.444  0    238.11 ? 709  LYS A HD3    1 
ATOM   6201  H HE2    . LYS A 1 409 ? -63.527  17.188  50.043  0    230.94 ? 709  LYS A HE2    1 
ATOM   6202  H HE3    . LYS A 1 409 ? -64.192  17.963  48.582  0    221.9  ? 709  LYS A HE3    1 
ATOM   6203  H HZ1    . LYS A 1 409 ? -62.153  16.638  48.265  0    225.61 ? 709  LYS A HZ1    1 
ATOM   6204  H HZ2    . LYS A 1 409 ? -62.029  18.19   47.727  0    224.37 ? 709  LYS A HZ2    1 
ATOM   6205  H HZ3    . LYS A 1 409 ? -61.312  17.753  49.151  0    233.32 ? 709  LYS A HZ3    1 
ATOM   6206  N N      . LEU A 1 410 ? -65.096  21.981  45.086  1    95.81  ? 710  LEU A N      1 
ATOM   6207  C CA     . LEU A 1 410 ? -66.258  22.404  44.29   1    89.33  ? 710  LEU A CA     1 
ATOM   6208  C C      . LEU A 1 410 ? -67.522  21.785  44.884  1    87.8   ? 710  LEU A C      1 
ATOM   6209  O O      . LEU A 1 410 ? -67.521  20.593  45.174  1    87.96  ? 710  LEU A O      1 
ATOM   6210  C CB     . LEU A 1 410 ? -66.141  21.954  42.815  1    84.22  ? 710  LEU A CB     1 
ATOM   6211  C CG     . LEU A 1 410 ? -65.154  22.703  41.925  1    84.24  ? 710  LEU A CG     1 
ATOM   6212  C CD1    . LEU A 1 410 ? -65.086  22.083  40.55   1    79.34  ? 710  LEU A CD1    1 
ATOM   6213  C CD2    . LEU A 1 410 ? -65.517  24.149  41.808  1    83.84  ? 710  LEU A CD2    1 
ATOM   6214  H H      . LEU A 1 410 ? -64.532  21.253  44.66   0    179.77 ? 710  LEU A H      1 
ATOM   6215  H HA     . LEU A 1 410 ? -66.352  23.488  44.321  0    166.91 ? 710  LEU A HA     1 
ATOM   6216  H HB2    . LEU A 1 410 ? -65.852  20.904  42.799  0    154.75 ? 710  LEU A HB2    1 
ATOM   6217  H HB3    . LEU A 1 410 ? -67.124  22.051  42.356  0    150.35 ? 710  LEU A HB3    1 
ATOM   6218  H HG     . LEU A 1 410 ? -64.162  22.642  42.371  0    159.24 ? 710  LEU A HG     1 
ATOM   6219  H HD11   . LEU A 1 410 ? -64.317  22.588  39.967  0    144.71 ? 710  LEU A HD11   1 
ATOM   6220  H HD12   . LEU A 1 410 ? -64.833  21.029  40.652  0    144.98 ? 710  LEU A HD12   1 
ATOM   6221  H HD13   . LEU A 1 410 ? -66.054  22.189  40.062  0    139.92 ? 710  LEU A HD13   1 
ATOM   6222  H HD21   . LEU A 1 410 ? -65.059  24.567  40.913  0    152.18 ? 710  LEU A HD21   1 
ATOM   6223  H HD22   . LEU A 1 410 ? -66.599  24.256  41.765  0    150.8  ? 710  LEU A HD22   1 
ATOM   6224  H HD23   . LEU A 1 410 ? -65.119  24.659  42.684  0    158.44 ? 710  LEU A HD23   1 
ATOM   6225  N N      . HIS A 1 411 ? -68.593  22.574  45.066  1    86.56  ? 711  HIS A N      1 
ATOM   6226  C CA     . HIS A 1 411 ? -69.87   22.044  45.555  1    85.28  ? 711  HIS A CA     1 
ATOM   6227  C C      . HIS A 1 411 ? -70.68   21.697  44.323  1    78.29  ? 711  HIS A C      1 
ATOM   6228  O O      . HIS A 1 411 ? -70.851  22.558  43.459  1    74.99  ? 711  HIS A O      1 
ATOM   6229  C CB     . HIS A 1 411 ? -70.645  23.077  46.367  1    88.34  ? 711  HIS A CB     1 
ATOM   6230  C CG     . HIS A 1 411 ? -70.262  23.16   47.8    1    95.61  ? 711  HIS A CG     1 
ATOM   6231  N ND1    . HIS A 1 411 ? -71.195  22.985  48.799  1    98.23  ? 711  HIS A ND1    1 
ATOM   6232  C CD2    . HIS A 1 411 ? -69.068  23.465  48.363  1    101.26 ? 711  HIS A CD2    1 
ATOM   6233  C CE1    . HIS A 1 411 ? -70.545  23.18   49.941  1    105.29 ? 711  HIS A CE1    1 
ATOM   6234  N NE2    . HIS A 1 411 ? -69.261  23.466  49.728  1    107.31 ? 711  HIS A NE2    1 
ATOM   6235  H H      . HIS A 1 411 ? -68.599  23.571  44.873  0    160.45 ? 711  HIS A H      1 
ATOM   6236  H HA     . HIS A 1 411 ? -69.727  21.157  46.17   0    159.99 ? 711  HIS A HA     1 
ATOM   6237  H HB2    . HIS A 1 411 ? -70.443  24.062  45.955  0    163.71 ? 711  HIS A HB2    1 
ATOM   6238  H HB3    . HIS A 1 411 ? -71.71   22.857  46.309  0    161.63 ? 711  HIS A HB3    1 
ATOM   6239  H HD2    . HIS A 1 411 ? -68.146  23.661  47.843  0    192.67 ? 711  HIS A HD2    1 
ATOM   6240  H HE1    . HIS A 1 411 ? -71      23.121  50.915  0    205.61 ? 711  HIS A HE1    1 
ATOM   6241  H HE2    . HIS A 1 411 ? -68.556  23.644  50.436  0    211.68 ? 711  HIS A HE2    1 
ATOM   6242  N N      . ILE A 1 412 ? -71.162  20.446  44.221  1    76.54  ? 712  ILE A N      1 
ATOM   6243  C CA     . ILE A 1 412 ? -71.954  20.023  43.073  1    70.35  ? 712  ILE A CA     1 
ATOM   6244  C C      . ILE A 1 412 ? -73.286  19.429  43.528  1    69.57  ? 712  ILE A C      1 
ATOM   6245  O O      . ILE A 1 412 ? -73.294  18.457  44.28   1    72.3   ? 712  ILE A O      1 
ATOM   6246  C CB     . ILE A 1 412 ? -71.161  18.992  42.243  1    68.5   ? 712  ILE A CB     1 
ATOM   6247  C CG1    . ILE A 1 412 ? -69.809  19.575  41.754  1    68.42  ? 712  ILE A CG1    1 
ATOM   6248  C CG2    . ILE A 1 412 ? -72.003  18.51   41.063  1    63.32  ? 712  ILE A CG2    1 
ATOM   6249  C CD1    . ILE A 1 412 ? -68.724  18.54   41.51   1    69.24  ? 712  ILE A CD1    1 
ATOM   6250  H H      . ILE A 1 412 ? -71.011  19.704  44.897  0    140.76 ? 712  ILE A H      1 
ATOM   6251  H HA     . ILE A 1 412 ? -72.158  20.877  42.429  0    122.31 ? 712  ILE A HA     1 
ATOM   6252  H HB     . ILE A 1 412 ? -70.966  18.138  42.889  0    122.93 ? 712  ILE A HB     1 
ATOM   6253  H HG12   . ILE A 1 412 ? -69.977  20.085  40.807  0    117.96 ? 712  ILE A HG12   1 
ATOM   6254  H HG13   . ILE A 1 412 ? -69.416  20.285  42.48   0    125    ? 712  ILE A HG13   1 
ATOM   6255  H HG21   . ILE A 1 412 ? -71.342  18.077  40.315  0    107.29 ? 712  ILE A HG21   1 
ATOM   6256  H HG22   . ILE A 1 412 ? -72.702  17.749  41.403  0    108.2  ? 712  ILE A HG22   1 
ATOM   6257  H HG23   . ILE A 1 412 ? -72.544  19.356  40.641  0    106.36 ? 712  ILE A HG23   1 
ATOM   6258  H HD11   . ILE A 1 412 ? -67.839  19.04   41.119  0    124.26 ? 712  ILE A HD11   1 
ATOM   6259  H HD12   . ILE A 1 412 ? -68.486  18.051  42.453  0    127.41 ? 712  ILE A HD12   1 
ATOM   6260  H HD13   . ILE A 1 412 ? -69.081  17.806  40.79   0    120.29 ? 712  ILE A HD13   1 
ATOM   6261  N N      . ARG A 1 413 ? -74.407  19.998  43.067  1    66.28  ? 713  ARG A N      1 
ATOM   6262  C CA     . ARG A 1 413 ? -75.738  19.49   43.38   1    65.27  ? 713  ARG A CA     1 
ATOM   6263  C C      . ARG A 1 413 ? -76.278  18.845  42.11   1    59.81  ? 713  ARG A C      1 
ATOM   6264  O O      . ARG A 1 413 ? -76.344  19.506  41.076  1    56.52  ? 713  ARG A O      1 
ATOM   6265  C CB     . ARG A 1 413 ? -76.672  20.627  43.818  1    66.08  ? 713  ARG A CB     1 
ATOM   6266  C CG     . ARG A 1 413 ? -78.047  20.137  44.268  1    66.86  ? 713  ARG A CG     1 
ATOM   6267  C CD     . ARG A 1 413 ? -79.118  21.217  44.215  1    66.74  ? 713  ARG A CD     1 
ATOM   6268  N NE     . ARG A 1 413 ? -80.449  20.649  44.437  1    65.75  ? 713  ARG A NE     1 
ATOM   6269  C CZ     . ARG A 1 413 ? -81.548  21.354  44.701  1    66.62  ? 713  ARG A CZ     1 
ATOM   6270  N NH1    . ARG A 1 413 ? -81.496  22.683  44.778  1    68.57  ? 713  ARG A NH1    1 
ATOM   6271  N NH2    . ARG A 1 413 ? -82.708  20.735  44.893  1    65.71  ? 713  ARG A NH2    1 
ATOM   6272  H H      . ARG A 1 413 ? -74.427  20.819  42.471  0    113.63 ? 713  ARG A H      1 
ATOM   6273  H HA     . ARG A 1 413 ? -75.707  18.751  44.18   0    116.21 ? 713  ARG A HA     1 
ATOM   6274  H HB2    . ARG A 1 413 ? -76.215  21.155  44.654  0    119.14 ? 713  ARG A HB2    1 
ATOM   6275  H HB3    . ARG A 1 413 ? -76.817  21.311  42.985  0    112.11 ? 713  ARG A HB3    1 
ATOM   6276  H HG2    . ARG A 1 413 ? -78.38   19.308  43.646  0    114    ? 713  ARG A HG2    1 
ATOM   6277  H HG3    . ARG A 1 413 ? -77.972  19.809  45.304  0    120.93 ? 713  ARG A HG3    1 
ATOM   6278  H HD2    . ARG A 1 413 ? -78.915  21.95   44.994  0    119.37 ? 713  ARG A HD2    1 
ATOM   6279  H HD3    . ARG A 1 413 ? -79.116  21.695  43.237  0    112.37 ? 713  ARG A HD3    1 
ATOM   6280  H HE     . ARG A 1 413 ? -80.537  19.64   44.391  0    112.77 ? 713  ARG A HE     1 
ATOM   6281  H HH11   . ARG A 1 413 ? -80.633  23.198  44.639  0    119.26 ? 713  ARG A HH11   1 
ATOM   6282  H HH12   . ARG A 1 413 ? -82.344  23.202  44.98   0    119.13 ? 713  ARG A HH12   1 
ATOM   6283  H HH21   . ARG A 1 413 ? -82.764  19.724  44.835  0    112.58 ? 713  ARG A HH21   1 
ATOM   6284  H HH22   . ARG A 1 413 ? -83.549  21.268  45.091  0    113.93 ? 713  ARG A HH22   1 
ATOM   6285  N N      . THR A 1 414 ? -76.689  17.575  42.191  1    59.24  ? 714  THR A N      1 
ATOM   6286  C CA     . THR A 1 414 ? -77.221  16.839  41.048  1    54.7   ? 714  THR A CA     1 
ATOM   6287  C C      . THR A 1 414 ? -78.755  16.876  41.036  1    52.98  ? 714  THR A C      1 
ATOM   6288  O O      . THR A 1 414 ? -79.383  16.836  42.094  1    55.73  ? 714  THR A O      1 
ATOM   6289  C CB     . THR A 1 414 ? -76.723  15.402  41.098  1    55.31  ? 714  THR A CB     1 
ATOM   6290  O OG1    . THR A 1 414 ? -75.288  15.402  41.157  1    57.24  ? 714  THR A OG1    1 
ATOM   6291  C CG2    . THR A 1 414 ? -77.205  14.588  39.917  1    51.15  ? 714  THR A CG2    1 
ATOM   6292  H H      . THR A 1 414 ? -76.684  17.031  43.048  0    103.11 ? 714  THR A H      1 
ATOM   6293  H HA     . THR A 1 414 ? -76.856  17.269  40.117  0    87.86  ? 714  THR A HA     1 
ATOM   6294  H HB     . THR A 1 414 ? -77.109  14.931  42.001  0    94.05  ? 714  THR A HB     1 
ATOM   6295  H HG1    . THR A 1 414 ? -74.959  14.525  41.489  0    97.7   ? 714  THR A HG1    1 
ATOM   6296  H HG21   . THR A 1 414 ? -76.607  13.682  39.831  0    83.04  ? 714  THR A HG21   1 
ATOM   6297  H HG22   . THR A 1 414 ? -78.248  14.304  40.046  0    81.51  ? 714  THR A HG22   1 
ATOM   6298  H HG23   . THR A 1 414 ? -77.105  15.169  39.001  0    80     ? 714  THR A HG23   1 
ATOM   6299  N N      . VAL A 1 415 ? -79.343  16.936  39.827  1    48.83  ? 715  VAL A N      1 
ATOM   6300  C CA     . VAL A 1 415 ? -80.789  16.941  39.595  1    47.02  ? 715  VAL A CA     1 
ATOM   6301  C C      . VAL A 1 415 ? -81.061  15.824  38.603  1    44.04  ? 715  VAL A C      1 
ATOM   6302  O O      . VAL A 1 415 ? -80.935  16.052  37.401  1    41.14  ? 715  VAL A O      1 
ATOM   6303  C CB     . VAL A 1 415 ? -81.28   18.291  39.036  1    45.87  ? 715  VAL A CB     1 
ATOM   6304  C CG1    . VAL A 1 415 ? -82.774  18.261  38.727  1    44.93  ? 715  VAL A CG1    1 
ATOM   6305  C CG2    . VAL A 1 415 ? -80.958  19.417  40.002  1    49.55  ? 715  VAL A CG2    1 
ATOM   6306  H H      . VAL A 1 415 ? -78.818  16.98   38.959  0    75.43  ? 715  VAL A H      1 
ATOM   6307  H HA     . VAL A 1 415 ? -81.332  16.761  40.52   0    75.85  ? 715  VAL A HA     1 
ATOM   6308  H HB     . VAL A 1 415 ? -80.75   18.491  38.108  0    68.37  ? 715  VAL A HB     1 
ATOM   6309  H HG11   . VAL A 1 415 ? -83.049  19.212  38.274  0    67     ? 715  VAL A HG11   1 
ATOM   6310  H HG12   . VAL A 1 415 ? -83.008  17.463  38.026  0    65.99  ? 715  VAL A HG12   1 
ATOM   6311  H HG13   . VAL A 1 415 ? -83.325  18.117  39.655  0    70.41  ? 715  VAL A HG13   1 
ATOM   6312  H HG21   . VAL A 1 415 ? -81.443  20.328  39.654  0    77.17  ? 715  VAL A HG21   1 
ATOM   6313  H HG22   . VAL A 1 415 ? -81.327  19.154  40.992  0    80.88  ? 715  VAL A HG22   1 
ATOM   6314  H HG23   . VAL A 1 415 ? -79.878  19.561  40.035  0    79.1   ? 715  VAL A HG23   1 
ATOM   6315  N N      . PRO A 1 416 ? -81.417  14.612  39.062  1    44.99  ? 716  PRO A N      1 
ATOM   6316  C CA     . PRO A 1 416 ? -81.663  13.525  38.109  1    42.51  ? 716  PRO A CA     1 
ATOM   6317  C C      . PRO A 1 416 ? -82.91   13.744  37.27   1    39.84  ? 716  PRO A C      1 
ATOM   6318  O O      . PRO A 1 416 ? -83.968  14.079  37.813  1    40.68  ? 716  PRO A O      1 
ATOM   6319  C CB     . PRO A 1 416 ? -81.813  12.282  38.992  1    44.93  ? 716  PRO A CB     1 
ATOM   6320  C CG     . PRO A 1 416 ? -81.459  12.691  40.355  1    48.84  ? 716  PRO A CG     1 
ATOM   6321  C CD     . PRO A 1 416 ? -81.603  14.162  40.451  1    48.78  ? 716  PRO A CD     1 
ATOM   6322  H HA     . PRO A 1 416 ? -80.796  13.391  37.463  0    62.55  ? 716  PRO A HA     1 
ATOM   6323  H HB2    . PRO A 1 416 ? -82.843  11.932  38.958  0    68.4   ? 716  PRO A HB2    1 
ATOM   6324  H HB3    . PRO A 1 416 ? -81.135  11.506  38.641  0    68.57  ? 716  PRO A HB3    1 
ATOM   6325  H HG2    . PRO A 1 416 ? -82.129  12.199  41.058  0    79.32  ? 716  PRO A HG2    1 
ATOM   6326  H HG3    . PRO A 1 416 ? -80.428  12.399  40.551  0    78.82  ? 716  PRO A HG3    1 
ATOM   6327  H HD2    . PRO A 1 416 ? -82.598  14.424  40.807  0    77.93  ? 716  PRO A HD2    1 
ATOM   6328  H HD3    . PRO A 1 416 ? -80.823  14.562  41.097  0    79.89  ? 716  PRO A HD3    1 
ATOM   6329  N N      . LEU A 1 417 ? -82.774  13.543  35.951  1    37.1   ? 717  LEU A N      1 
ATOM   6330  C CA     . LEU A 1 417 ? -83.847  13.664  34.973  1    34.84  ? 717  LEU A CA     1 
ATOM   6331  C C      . LEU A 1 417 ? -84.294  12.294  34.444  1    34.11  ? 717  LEU A C      1 
ATOM   6332  O O      . LEU A 1 417 ? -85.392  12.203  33.904  1    33.33  ? 717  LEU A O      1 
ATOM   6333  C CB     . LEU A 1 417 ? -83.354  14.486  33.789  1    30.11  ? 717  LEU A CB     1 
ATOM   6334  C CG     . LEU A 1 417 ? -82.877  15.883  34.076  1    30.99  ? 717  LEU A CG     1 
ATOM   6335  C CD1    . LEU A 1 417 ? -81.999  16.355  32.967  1    29.06  ? 717  LEU A CD1    1 
ATOM   6336  C CD2    . LEU A 1 417 ? -84.028  16.81   34.237  1    31.25  ? 717  LEU A CD2    1 
ATOM   6337  H H      . LEU A 1 417 ? -81.895  13.283  35.516  0    51.23  ? 717  LEU A H      1 
ATOM   6338  H HA     . LEU A 1 417 ? -84.71   14.161  35.412  0    47.28  ? 717  LEU A HA     1 
ATOM   6339  H HB2    . LEU A 1 417 ? -82.526  13.95   33.328  0    38.66  ? 717  LEU A HB2    1 
ATOM   6340  H HB3    . LEU A 1 417 ? -84.17   14.561  33.072  0    37.69  ? 717  LEU A HB3    1 
ATOM   6341  H HG     . LEU A 1 417 ? -82.296  15.911  34.997  0    42.39  ? 717  LEU A HG     1 
ATOM   6342  H HD11   . LEU A 1 417 ? -81.872  17.434  33.033  0    36.99  ? 717  LEU A HD11   1 
ATOM   6343  H HD12   . LEU A 1 417 ? -81.032  15.862  33.054  0    37.32  ? 717  LEU A HD12   1 
ATOM   6344  H HD13   . LEU A 1 417 ? -82.468  16.092  32.02   0    35.26  ? 717  LEU A HD13   1 
ATOM   6345  H HD21   . LEU A 1 417 ? -83.654  17.8    34.493  0    41.32  ? 717  LEU A HD21   1 
ATOM   6346  H HD22   . LEU A 1 417 ? -84.583  16.857  33.301  0    39.25  ? 717  LEU A HD22   1 
ATOM   6347  H HD23   . LEU A 1 417 ? -84.672  16.448  35.036  0    42.19  ? 717  LEU A HD23   1 
ATOM   6348  N N      . TYR A 1 418 ? -83.433  11.248  34.532  1    34.59  ? 718  TYR A N      1 
ATOM   6349  C CA     . TYR A 1 418 ? -83.725  9.898   34.034  1    34.23  ? 718  TYR A CA     1 
ATOM   6350  C C      . TYR A 1 418 ? -83.993  9.868   32.509  1    32.02  ? 718  TYR A C      1 
ATOM   6351  O O      . TYR A 1 418 ? -84.636  8.936   32.014  1    31.81  ? 718  TYR A O      1 
ATOM   6352  C CB     . TYR A 1 418 ? -84.851  9.249   34.845  1    35.68  ? 718  TYR A CB     1 
ATOM   6353  C CG     . TYR A 1 418 ? -84.597  9.322   36.335  1    38.44  ? 718  TYR A CG     1 
ATOM   6354  C CD1    . TYR A 1 418 ? -83.467  8.743   36.897  1    40.18  ? 718  TYR A CD1    1 
ATOM   6355  C CD2    . TYR A 1 418 ? -85.417  10.073  37.165  1    39.72  ? 718  TYR A CD2    1 
ATOM   6356  C CE1    . TYR A 1 418 ? -83.204  8.839   38.261  1    43.3   ? 718  TYR A CE1    1 
ATOM   6357  C CE2    . TYR A 1 418 ? -85.154  10.195  38.527  1    42.83  ? 718  TYR A CE2    1 
ATOM   6358  C CZ     . TYR A 1 418 ? -84.056  9.56    39.077  1    44.69  ? 718  TYR A CZ     1 
ATOM   6359  O OH     . TYR A 1 418 ? -83.776  9.672   40.423  1    48.34  ? 718  TYR A OH     1 
ATOM   6360  H H      . TYR A 1 418 ? -82.507  11.304  34.945  0    47.11  ? 718  TYR A H      1 
ATOM   6361  H HA     . TYR A 1 418 ? -82.836  9.29    34.193  0    46.2   ? 718  TYR A HA     1 
ATOM   6362  H HB2    . TYR A 1 418 ? -85.785  9.762   34.627  0    47.96  ? 718  TYR A HB2    1 
ATOM   6363  H HB3    . TYR A 1 418 ? -84.928  8.197   34.575  0    48.73  ? 718  TYR A HB3    1 
ATOM   6364  H HD1    . TYR A 1 418 ? -82.805  8.163   36.275  0    57.81  ? 718  TYR A HD1    1 
ATOM   6365  H HD2    . TYR A 1 418 ? -86.28   10.566  36.753  0    56.43  ? 718  TYR A HD2    1 
ATOM   6366  H HE1    . TYR A 1 418 ? -82.34   8.35    38.679  0    67.08  ? 718  TYR A HE1    1 
ATOM   6367  H HE2    . TYR A 1 418 ? -85.827  10.759  39.15   0    65.65  ? 718  TYR A HE2    1 
ATOM   6368  H HH     . TYR A 1 418 ? -84.478  10.194  40.892  0    77.39  ? 718  TYR A HH     1 
ATOM   6369  N N      . GLU A 1 419 ? -83.403  10.867  31.769  1    29.49  ? 719  GLU A N      1 
ATOM   6370  C CA     . GLU A 1 419 ? -83.432  11.02   30.303  1    24.99  ? 719  GLU A CA     1 
ATOM   6371  C C      . GLU A 1 419 ? -82.308  11.958  29.817  1    23.63  ? 719  GLU A C      1 
ATOM   6372  O O      . GLU A 1 419 ? -81.854  12.802  30.574  1    24.69  ? 719  GLU A O      1 
ATOM   6373  C CB     . GLU A 1 419 ? -84.793  11.49   29.8    1    23.2   ? 719  GLU A CB     1 
ATOM   6374  C CG     . GLU A 1 419 ? -85.242  12.827  30.33   1    23.81  ? 719  GLU A CG     1 
ATOM   6375  C CD     . GLU A 1 419 ? -86.585  13.27   29.793  1    23.8   ? 719  GLU A CD     1 
ATOM   6376  O OE1    . GLU A 1 419 ? -87.352  12.416  29.292  1    23.92  ? 719  GLU A OE1    1 
ATOM   6377  O OE2    . GLU A 1 419 ? -86.882  14.481  29.89   1    23.87  ? 719  GLU A OE2    1 
ATOM   6378  H H      . GLU A 1 419 ? -82.869  11.615  32.201  0    36.67  ? 719  GLU A H      1 
ATOM   6379  H HA     . GLU A 1 419 ? -83.245  10.043  29.859  0    29.42  ? 719  GLU A HA     1 
ATOM   6380  H HB2    . GLU A 1 419 ? -84.757  11.559  28.713  0    25.68  ? 719  GLU A HB2    1 
ATOM   6381  H HB3    . GLU A 1 419 ? -85.531  10.746  30.097  0    27.02  ? 719  GLU A HB3    1 
ATOM   6382  H HG2    . GLU A 1 419 ? -85.321  12.768  31.414  0    28.28  ? 719  GLU A HG2    1 
ATOM   6383  H HG3    . GLU A 1 419 ? -84.519  13.593  30.054  0    26.74  ? 719  GLU A HG3    1 
ATOM   6384  N N      . SER A 1 420 ? -81.866  11.799  28.564  1    22.69  ? 720  SER A N      1 
ATOM   6385  C CA     . SER A 1 420 ? -80.747  12.547  27.958  1    22.76  ? 720  SER A CA     1 
ATOM   6386  C C      . SER A 1 420 ? -80.972  14.081  27.781  1    22.87  ? 720  SER A C      1 
ATOM   6387  O O      . SER A 1 420 ? -81.755  14.472  26.913  1    22.66  ? 720  SER A O      1 
ATOM   6388  C CB     . SER A 1 420 ? -80.402  11.957  26.585  1    22.83  ? 720  SER A CB     1 
ATOM   6389  O OG     . SER A 1 420 ? -80.641  10.561  26.48   1    23.29  ? 720  SER A OG     1 
ATOM   6390  H H      . SER A 1 420 ? -82.28   11.133  27.919  0    25.22  ? 720  SER A H      1 
ATOM   6391  H HA     . SER A 1 420 ? -79.871  12.388  28.583  0    26.17  ? 720  SER A HA     1 
ATOM   6392  H HB2    . SER A 1 420 ? -81.003  12.44   25.816  0    24.64  ? 720  SER A HB2    1 
ATOM   6393  H HB3    . SER A 1 420 ? -79.347  12.143  26.386  0    25.49  ? 720  SER A HB3    1 
ATOM   6394  H HG     . SER A 1 420 ? -80.265  10.215  25.629  0    26.53  ? 720  SER A HG     1 
ATOM   6395  N N      . PRO A 1 421 ? -80.248  14.974  28.507  1    23.58  ? 721  PRO A N      1 
ATOM   6396  C CA     . PRO A 1 421 ? -80.395  16.425  28.252  1    23.91  ? 721  PRO A CA     1 
ATOM   6397  C C      . PRO A 1 421 ? -79.514  16.871  27.07   1    23.61  ? 721  PRO A C      1 
ATOM   6398  O O      . PRO A 1 421 ? -78.447  16.31   26.885  1    23.72  ? 721  PRO A O      1 
ATOM   6399  C CB     . PRO A 1 421 ? -79.991  17.053  29.585  1    25.51  ? 721  PRO A CB     1 
ATOM   6400  C CG     . PRO A 1 421 ? -79.087  16.05   30.245  1    25.97  ? 721  PRO A CG     1 
ATOM   6401  C CD     . PRO A 1 421 ? -79.246  14.715  29.56   1    24.68  ? 721  PRO A CD     1 
ATOM   6402  H HA     . PRO A 1 421 ? -81.431  16.695  28.054  0    25.79  ? 721  PRO A HA     1 
ATOM   6403  H HB2    . PRO A 1 421 ? -79.481  17.999  29.412  0    29.76  ? 721  PRO A HB2    1 
ATOM   6404  H HB3    . PRO A 1 421 ? -80.881  17.21   30.193  0    29.75  ? 721  PRO A HB3    1 
ATOM   6405  H HG2    . PRO A 1 421 ? -78.056  16.39   30.152  0    31.83  ? 721  PRO A HG2    1 
ATOM   6406  H HG3    . PRO A 1 421 ? -79.355  15.962  31.297  0    32.4   ? 721  PRO A HG3    1 
ATOM   6407  H HD2    . PRO A 1 421 ? -78.303  14.398  29.117  0    29.42  ? 721  PRO A HD2    1 
ATOM   6408  H HD3    . PRO A 1 421 ? -79.621  13.978  30.269  0    29.65  ? 721  PRO A HD3    1 
ATOM   6409  N N      . ARG A 1 422 ? -79.979  17.823  26.236  1    23.51  ? 722  ARG A N      1 
ATOM   6410  C CA     . ARG A 1 422 ? -79.286  18.259  25.002  1    23.64  ? 722  ARG A CA     1 
ATOM   6411  C C      . ARG A 1 422 ? -78.773  19.733  25.012  1    24.26  ? 722  ARG A C      1 
ATOM   6412  O O      . ARG A 1 422 ? -77.62   19.992  24.631  1    24.85  ? 722  ARG A O      1 
ATOM   6413  C CB     . ARG A 1 422 ? -80.224  18.042  23.761  1    23.57  ? 722  ARG A CB     1 
ATOM   6414  C CG     . ARG A 1 422 ? -80.762  16.63   23.55   1    23.55  ? 722  ARG A CG     1 
ATOM   6415  C CD     . ARG A 1 422 ? -79.588  15.675  23.394  1    24.05  ? 722  ARG A CD     1 
ATOM   6416  N NE     . ARG A 1 422 ? -79.953  14.294  23.094  1    24.46  ? 722  ARG A NE     1 
ATOM   6417  C CZ     . ARG A 1 422 ? -80.392  13.869  21.907  1    25.75  ? 722  ARG A CZ     1 
ATOM   6418  N NH1    . ARG A 1 422 ? -80.587  14.74   20.906  1    26.73  ? 722  ARG A NH1    1 
ATOM   6419  N NH2    . ARG A 1 422 ? -80.67   12.572  21.717  1    26.51  ? 722  ARG A NH2    1 
ATOM   6420  H H      . ARG A 1 422 ? -80.852  18.316  26.391  0    25.35  ? 722  ARG A H      1 
ATOM   6421  H HA     . ARG A 1 422 ? -78.395  17.649  24.862  0    26.08  ? 722  ARG A HA     1 
ATOM   6422  H HB2    . ARG A 1 422 ? -81.086  18.698  23.871  0    25.34  ? 722  ARG A HB2    1 
ATOM   6423  H HB3    . ARG A 1 422 ? -79.675  18.318  22.862  0    25.73  ? 722  ARG A HB3    1 
ATOM   6424  H HG2    . ARG A 1 422 ? -81.343  16.323  24.419  0    25.09  ? 722  ARG A HG2    1 
ATOM   6425  H HG3    . ARG A 1 422 ? -81.377  16.598  22.652  0    25.6   ? 722  ARG A HG3    1 
ATOM   6426  H HD2    . ARG A 1 422 ? -78.92   16.04   22.615  0    26.81  ? 722  ARG A HD2    1 
ATOM   6427  H HD3    . ARG A 1 422 ? -79.057  15.595  24.341  0    26.42  ? 722  ARG A HD3    1 
ATOM   6428  H HE     . ARG A 1 422 ? -79.813  13.605  23.829  0    26.99  ? 722  ARG A HE     1 
ATOM   6429  H HH11   . ARG A 1 422 ? -80.362  15.722  20.996  0    30.4   ? 722  ARG A HH11   1 
ATOM   6430  H HH12   . ARG A 1 422 ? -80.913  14.396  20.009  0    31.44  ? 722  ARG A HH12   1 
ATOM   6431  H HH21   . ARG A 1 422 ? -80.545  11.906  22.473  0    30.33  ? 722  ARG A HH21   1 
ATOM   6432  H HH22   . ARG A 1 422 ? -81.022  12.25   20.82   0    31.19  ? 722  ARG A HH22   1 
ATOM   6433  N N      . LYS A 1 423 ? -79.655  20.692  25.364  1    24.38  ? 723  LYS A N      1 
ATOM   6434  C CA     . LYS A 1 423 ? -79.316  22.115  25.442  1    25.2   ? 723  LYS A CA     1 
ATOM   6435  C C      . LYS A 1 423 ? -80.006  22.737  26.651  1    26.04  ? 723  LYS A C      1 
ATOM   6436  O O      . LYS A 1 423 ? -81.128  22.361  26.99   1    25.77  ? 723  LYS A O      1 
ATOM   6437  C CB     . LYS A 1 423 ? -79.765  22.875  24.191  1    25.05  ? 723  LYS A CB     1 
ATOM   6438  C CG     . LYS A 1 423 ? -79.099  22.444  22.899  1    25.21  ? 723  LYS A CG     1 
ATOM   6439  C CD     . LYS A 1 423 ? -77.659  22.868  22.886  1    26.15  ? 723  LYS A CD     1 
ATOM   6440  C CE     . LYS A 1 423 ? -76.999  22.686  21.553  1    27.02  ? 723  LYS A CE     1 
ATOM   6441  N NZ     . LYS A 1 423 ? -75.554  23.055  21.633  1    28.09  ? 723  LYS A NZ     1 
ATOM   6442  H H      . LYS A 1 423 ? -80.622  20.499  25.604  0    26.4   ? 723  LYS A H      1 
ATOM   6443  H HA     . LYS A 1 423 ? -78.244  22.241  25.582  0    29.15  ? 723  LYS A HA     1 
ATOM   6444  H HB2    . LYS A 1 423 ? -80.841  22.738  24.111  0    27.68  ? 723  LYS A HB2    1 
ATOM   6445  H HB3    . LYS A 1 423 ? -79.554  23.933  24.339  0    28.79  ? 723  LYS A HB3    1 
ATOM   6446  H HG2    . LYS A 1 423 ? -79.139  21.36   22.806  0    28.49  ? 723  LYS A HG2    1 
ATOM   6447  H HG3    . LYS A 1 423 ? -79.605  22.914  22.057  0    29.08  ? 723  LYS A HG3    1 
ATOM   6448  H HD2    . LYS A 1 423 ? -77.588  23.923  23.147  0    31.53  ? 723  LYS A HD2    1 
ATOM   6449  H HD3    . LYS A 1 423 ? -77.097  22.268  23.598  0    31.15  ? 723  LYS A HD3    1 
ATOM   6450  H HE2    . LYS A 1 423 ? -77.074  21.643  21.25   0    32.82  ? 723  LYS A HE2    1 
ATOM   6451  H HE3    . LYS A 1 423 ? -77.479  23.332  20.819  0    33.43  ? 723  LYS A HE3    1 
ATOM   6452  H HZ1    . LYS A 1 423 ? -75.118  22.952  20.722  0    36.61  ? 723  LYS A HZ1    1 
ATOM   6453  H HZ2    . LYS A 1 423 ? -75.458  24.019  21.937  0    36.16  ? 723  LYS A HZ2    1 
ATOM   6454  H HZ3    . LYS A 1 423 ? -75.078  22.452  22.296  0    35.67  ? 723  LYS A HZ3    1 
ATOM   6455  N N      . ILE A 1 424 ? -79.324  23.694  27.296  1    27.55  ? 724  ILE A N      1 
ATOM   6456  C CA     . ILE A 1 424 ? -79.851  24.429  28.446  1    29.28  ? 724  ILE A CA     1 
ATOM   6457  C C      . ILE A 1 424 ? -79.722  25.918  28.17   1    30.51  ? 724  ILE A C      1 
ATOM   6458  O O      . ILE A 1 424 ? -78.863  26.377  27.401  1    30.58  ? 724  ILE A O      1 
ATOM   6459  C CB     . ILE A 1 424 ? -79.172  24.055  29.805  1    31.27  ? 724  ILE A CB     1 
ATOM   6460  C CG1    . ILE A 1 424 ? -79.813  24.83   30.974  1    33.66  ? 724  ILE A CG1    1 
ATOM   6461  C CG2    . ILE A 1 424 ? -77.67   24.304  29.768  1    32.01  ? 724  ILE A CG2    1 
ATOM   6462  C CD1    . ILE A 1 424 ? -79.476  24.35   32.27   1    35.49  ? 724  ILE A CD1    1 
ATOM   6463  H H      . ILE A 1 424 ? -78.395  24      27.026  0    33.28  ? 724  ILE A H      1 
ATOM   6464  H HA     . ILE A 1 424 ? -80.913  24.214  28.553  0    35.07  ? 724  ILE A HA     1 
ATOM   6465  H HB     . ILE A 1 424 ? -79.331  22.99   29.971  0    38.82  ? 724  ILE A HB     1 
ATOM   6466  H HG12   . ILE A 1 424 ? -79.493  25.87   30.935  0    44.72  ? 724  ILE A HG12   1 
ATOM   6467  H HG13   . ILE A 1 424 ? -80.896  24.777  30.874  0    43.01  ? 724  ILE A HG13   1 
ATOM   6468  H HG21   . ILE A 1 424 ? -77.211  23.823  30.63   0    42.64  ? 724  ILE A HG21   1 
ATOM   6469  H HG22   . ILE A 1 424 ? -77.249  23.885  28.856  0    40.74  ? 724  ILE A HG22   1 
ATOM   6470  H HG23   . ILE A 1 424 ? -77.475  25.375  29.808  0    42.45  ? 724  ILE A HG23   1 
ATOM   6471  H HD11   . ILE A 1 424 ? -80.106  24.852  33.004  0    48.66  ? 724  ILE A HD11   1 
ATOM   6472  H HD12   . ILE A 1 424 ? -79.646  23.275  32.306  0    46.72  ? 724  ILE A HD12   1 
ATOM   6473  H HD13   . ILE A 1 424 ? -78.43   24.571  32.476  0    48.76  ? 724  ILE A HD13   1 
ATOM   6474  N N      . CYS A 1 425 ? -80.609  26.666  28.794  1    31.75  ? 725  CYS A N      1 
ATOM   6475  C CA     . CYS A 1 425 ? -80.575  28.106  28.747  1    33.17  ? 725  CYS A CA     1 
ATOM   6476  C C      . CYS A 1 425 ? -81.414  28.673  29.899  1    35.32  ? 725  CYS A C      1 
ATOM   6477  O O      . CYS A 1 425 ? -82.361  28.05   30.375  1    35.26  ? 725  CYS A O      1 
ATOM   6478  C CB     . CYS A 1 425 ? -81.003  28.646  27.387  1    31.81  ? 725  CYS A CB     1 
ATOM   6479  S SG     . CYS A 1 425 ? -82.783  28.907  27.225  1    31.39  ? 725  CYS A SG     1 
ATOM   6480  H H      . CYS A 1 425 ? -81.375  26.284  29.34   0    39.87  ? 725  CYS A H      1 
ATOM   6481  H HA     . CYS A 1 425 ? -79.547  28.428  28.912  0    43.98  ? 725  CYS A HA     1 
ATOM   6482  H HB2    . CYS A 1 425 ? -80.519  29.61   27.235  0    41.8   ? 725  CYS A HB2    1 
ATOM   6483  H HB3    . CYS A 1 425 ? -80.697  27.96   26.598  0    39.81  ? 725  CYS A HB3    1 
ATOM   6484  H HG     . CYS A 1 425 ? -83.055  29.374  26      0    39.9   ? 725  CYS A HG     1 
ATOM   6485  N N      . TYR A 1 426 ? -81.049  29.852  30.324  1    37.46  ? 726  TYR A N      1 
ATOM   6486  C CA     . TYR A 1 426 ? -81.656  30.496  31.469  1    40.23  ? 726  TYR A CA     1 
ATOM   6487  C C      . TYR A 1 426 ? -82.556  31.658  31.059  1    40.67  ? 726  TYR A C      1 
ATOM   6488  O O      . TYR A 1 426 ? -82.181  32.441  30.184  1    40.37  ? 726  TYR A O      1 
ATOM   6489  C CB     . TYR A 1 426 ? -80.527  30.96   32.396  1    44.05  ? 726  TYR A CB     1 
ATOM   6490  C CG     . TYR A 1 426 ? -81.007  31.718  33.612  1    48.37  ? 726  TYR A CG     1 
ATOM   6491  C CD1    . TYR A 1 426 ? -81.739  31.087  34.604  1    49.4   ? 726  TYR A CD1    1 
ATOM   6492  C CD2    . TYR A 1 426 ? -80.719  33.059  33.773  1    50.86  ? 726  TYR A CD2    1 
ATOM   6493  C CE1    . TYR A 1 426 ? -82.181  31.776  35.719  1    52.72  ? 726  TYR A CE1    1 
ATOM   6494  C CE2    . TYR A 1 426 ? -81.146  33.756  34.885  1    54.09  ? 726  TYR A CE2    1 
ATOM   6495  C CZ     . TYR A 1 426 ? -81.895  33.118  35.849  1    55.06  ? 726  TYR A CZ     1 
ATOM   6496  O OH     . TYR A 1 426 ? -82.317  33.826  36.952  1    58.62  ? 726  TYR A OH     1 
ATOM   6497  H H      . TYR A 1 426 ? -80.299  30.38   29.89   0    51.8   ? 726  TYR A H      1 
ATOM   6498  H HA     . TYR A 1 426 ? -82.254  29.786  32.04   0    56.52  ? 726  TYR A HA     1 
ATOM   6499  H HB2    . TYR A 1 426 ? -79.998  30.069  32.732  0    63.5   ? 726  TYR A HB2    1 
ATOM   6500  H HB3    . TYR A 1 426 ? -79.843  31.602  31.841  0    64.03  ? 726  TYR A HB3    1 
ATOM   6501  H HD1    . TYR A 1 426 ? -81.976  30.044  34.498  0    72.02  ? 726  TYR A HD1    1 
ATOM   6502  H HD2    . TYR A 1 426 ? -80.132  33.569  33.028  0    76.75  ? 726  TYR A HD2    1 
ATOM   6503  H HE1    . TYR A 1 426 ? -82.765  31.27   36.468  0    81.55  ? 726  TYR A HE1    1 
ATOM   6504  H HE2    . TYR A 1 426 ? -80.903  34.798  34.988  0    85.9   ? 726  TYR A HE2    1 
ATOM   6505  H HH     . TYR A 1 426 ? -82.611  33.21   37.673  0    94.37  ? 726  TYR A HH     1 
ATOM   6506  N N      . GLN A 1 427 ? -83.75   31.756  31.685  1    42.01  ? 727  GLN A N      1 
ATOM   6507  C CA     . GLN A 1 427 ? -84.717  32.829  31.462  1    43.43  ? 727  GLN A CA     1 
ATOM   6508  C C      . GLN A 1 427 ? -84.957  33.489  32.813  1    48.29  ? 727  GLN A C      1 
ATOM   6509  O O      . GLN A 1 427 ? -85.672  32.922  33.641  1    49.26  ? 727  GLN A O      1 
ATOM   6510  C CB     . GLN A 1 427 ? -86.021  32.252  30.894  1    41.08  ? 727  GLN A CB     1 
ATOM   6511  C CG     . GLN A 1 427 ? -87.053  33.293  30.525  1    42.24  ? 727  GLN A CG     1 
ATOM   6512  C CD     . GLN A 1 427 ? -88.084  32.746  29.574  1    40.29  ? 727  GLN A CD     1 
ATOM   6513  O OE1    . GLN A 1 427 ? -89.175  32.337  29.968  1    41.18  ? 727  GLN A OE1    1 
ATOM   6514  N NE2    . GLN A 1 427 ? -87.769  32.739  28.293  1    38.21  ? 727  GLN A NE2    1 
ATOM   6515  H H      . GLN A 1 427 ? -84.077  31.086  32.374  0    60.38  ? 727  GLN A H      1 
ATOM   6516  H HA     . GLN A 1 427 ? -84.328  33.582  30.778  0    63.17  ? 727  GLN A HA     1 
ATOM   6517  H HB2    . GLN A 1 427 ? -85.782  31.698  29.988  0    57     ? 727  GLN A HB2    1 
ATOM   6518  H HB3    . GLN A 1 427 ? -86.472  31.576  31.619  0    59.15  ? 727  GLN A HB3    1 
ATOM   6519  H HG2    . GLN A 1 427 ? -87.566  33.626  31.426  0    63.26  ? 727  GLN A HG2    1 
ATOM   6520  H HG3    . GLN A 1 427 ? -86.554  34.135  30.047  0    61.6   ? 727  GLN A HG3    1 
ATOM   6521  H HE21   . GLN A 1 427 ? -86.868  33.088  27.982  0    53.96  ? 727  GLN A HE21   1 
ATOM   6522  H HE22   . GLN A 1 427 ? -88.433  32.379  27.614  0    53.64  ? 727  GLN A HE22   1 
ATOM   6523  N N      . GLU A 1 428 ? -84.289  34.633  33.075  1    50.68  ? 728  GLU A N      1 
ATOM   6524  C CA     . GLU A 1 428 ? -84.425  35.334  34.348  1    54.32  ? 728  GLU A CA     1 
ATOM   6525  C C      . GLU A 1 428 ? -85.813  35.894  34.572  1    55.49  ? 728  GLU A C      1 
ATOM   6526  O O      . GLU A 1 428 ? -86.298  35.888  35.701  1    58.23  ? 728  GLU A O      1 
ATOM   6527  C CB     . GLU A 1 428 ? -83.422  36.479  34.44   1    56.43  ? 728  GLU A CB     1 
ATOM   6528  C CG     . GLU A 1 428 ? -83.411  37.128  35.812  1    60.76  ? 728  GLU A CG     1 
ATOM   6529  C CD     . GLU A 1 428 ? -82.06   37.678  36.211  1    63.06  ? 728  GLU A CD     1 
ATOM   6530  O OE1    . GLU A 1 428 ? -81.8    38.874  35.936  1    63.56  ? 728  GLU A OE1    1 
ATOM   6531  O OE2    . GLU A 1 428 ? -81.264  36.91   36.803  1    64.63  ? 728  GLU A OE2    1 
ATOM   6532  H H      . GLU A 1 428 ? -83.636  35.079  32.438  0    76.52  ? 728  GLU A H      1 
ATOM   6533  H HA     . GLU A 1 428 ? -84.213  34.627  35.149  0    85.25  ? 728  GLU A HA     1 
ATOM   6534  H HB2    . GLU A 1 428 ? -82.422  36.106  34.23   0    88.5   ? 728  GLU A HB2    1 
ATOM   6535  H HB3    . GLU A 1 428 ? -83.691  37.243  33.712  0    89.29  ? 728  GLU A HB3    1 
ATOM   6536  H HG2    . GLU A 1 428 ? -84.12   37.955  35.823  0    100.11 ? 728  GLU A HG2    1 
ATOM   6537  H HG3    . GLU A 1 428 ? -83.697  36.391  36.561  0    99.09  ? 728  GLU A HG3    1 
ATOM   6538  N N      . VAL A 1 429 ? -86.46   36.359  33.507  1    53.7   ? 729  VAL A N      1 
ATOM   6539  C CA     . VAL A 1 429 ? -87.806  36.93   33.574  1    54.73  ? 729  VAL A CA     1 
ATOM   6540  C C      . VAL A 1 429 ? -88.811  35.961  34.22   1    54.59  ? 729  VAL A C      1 
ATOM   6541  O O      . VAL A 1 429 ? -89.714  36.392  34.931  1    56.95  ? 729  VAL A O      1 
ATOM   6542  C CB     . VAL A 1 429 ? -88.266  37.374  32.157  1    52.74  ? 729  VAL A CB     1 
ATOM   6543  C CG1    . VAL A 1 429 ? -89.732  37.802  32.154  1    53.73  ? 729  VAL A CG1    1 
ATOM   6544  C CG2    . VAL A 1 429 ? -87.383  38.498  31.623  1    53.48  ? 729  VAL A CG2    1 
ATOM   6545  H H      . VAL A 1 429 ? -86.078  36.321  32.568  0    82.43  ? 729  VAL A H      1 
ATOM   6546  H HA     . VAL A 1 429 ? -87.772  37.82   34.201  0    89.62  ? 729  VAL A HA     1 
ATOM   6547  H HB     . VAL A 1 429 ? -88.176  36.528  31.477  0    80.68  ? 729  VAL A HB     1 
ATOM   6548  H HG11   . VAL A 1 429 ? -89.933  38.402  31.268  0    85.63  ? 729  VAL A HG11   1 
ATOM   6549  H HG12   . VAL A 1 429 ? -90.37   36.919  32.133  0    84.96  ? 729  VAL A HG12   1 
ATOM   6550  H HG13   . VAL A 1 429 ? -89.938  38.387  33.05   0    88.57  ? 729  VAL A HG13   1 
ATOM   6551  H HG21   . VAL A 1 429 ? -87.776  38.84   30.667  0    84.45  ? 729  VAL A HG21   1 
ATOM   6552  H HG22   . VAL A 1 429 ? -87.389  39.32   32.338  0    87.58  ? 729  VAL A HG22   1 
ATOM   6553  H HG23   . VAL A 1 429 ? -86.366  38.135  31.482  0    83.81  ? 729  VAL A HG23   1 
ATOM   6554  N N      . SER A 1 430 ? -88.617  34.659  34.003  1    52.13  ? 730  SER A N      1 
ATOM   6555  C CA     . SER A 1 430 ? -89.475  33.61   34.523  1    51.79  ? 730  SER A CA     1 
ATOM   6556  C C      . SER A 1 430 ? -88.847  32.818  35.665  1    53.08  ? 730  SER A C      1 
ATOM   6557  O O      . SER A 1 430 ? -89.442  31.83   36.071  1    52.8   ? 730  SER A O      1 
ATOM   6558  C CB     . SER A 1 430 ? -89.821  32.638  33.406  1    48.34  ? 730  SER A CB     1 
ATOM   6559  O OG     . SER A 1 430 ? -90.284  33.319  32.255  1    47.48  ? 730  SER A OG     1 
ATOM   6560  H H      . SER A 1 430 ? -87.848  34.281  33.46   0    79.09  ? 730  SER A H      1 
ATOM   6561  H HA     . SER A 1 430 ? -90.409  34.032  34.889  0    82.21  ? 730  SER A HA     1 
ATOM   6562  H HB2    . SER A 1 430 ? -88.932  32.067  33.143  0    71.31  ? 730  SER A HB2    1 
ATOM   6563  H HB3    . SER A 1 430 ? -90.609  31.968  33.748  0    73.1   ? 730  SER A HB3    1 
ATOM   6564  H HG     . SER A 1 430 ? -90.31   32.705  31.475  0    69.74  ? 730  SER A HG     1 
ATOM   6565  N N      . GLN A 1 431 ? -87.659  33.197  36.182  1    54.71  ? 731  GLN A N      1 
ATOM   6566  C CA     . GLN A 1 431 ? -87.005  32.487  37.293  1    56.47  ? 731  GLN A CA     1 
ATOM   6567  C C      . GLN A 1 431 ? -86.909  30.981  37.034  1    53.86  ? 731  GLN A C      1 
ATOM   6568  O O      . GLN A 1 431 ? -87.322  30.17   37.871  1    54.92  ? 731  GLN A O      1 
ATOM   6569  C CB     . GLN A 1 431 ? -87.743  32.76   38.625  1    60.3   ? 731  GLN A CB     1 
ATOM   6570  C CG     . GLN A 1 431 ? -87.73   34.213  39.07   1    63.65  ? 731  GLN A CG     1 
ATOM   6571  C CD     . GLN A 1 431 ? -86.362  34.628  39.564  1    65.82  ? 731  GLN A CD     1 
ATOM   6572  O OE1    . GLN A 1 431 ? -86.079  34.609  40.772  1    69.31  ? 731  GLN A OE1    1 
ATOM   6573  N NE2    . GLN A 1 431 ? -85.466  34.995  38.643  1    64.02  ? 731  GLN A NE2    1 
ATOM   6574  H H      . GLN A 1 431 ? -87.115  33.992  35.86   0    86.04  ? 731  GLN A H      1 
ATOM   6575  H HA     . GLN A 1 431 ? -85.984  32.857  37.384  0    89.93  ? 731  GLN A HA     1 
ATOM   6576  H HB2    . GLN A 1 431 ? -88.782  32.448  38.525  0    97.6   ? 731  GLN A HB2    1 
ATOM   6577  H HB3    . GLN A 1 431 ? -87.258  32.19   39.416  0    99.25  ? 731  GLN A HB3    1 
ATOM   6578  H HG2    . GLN A 1 431 ? -88.007  34.861  38.24   0    104.12 ? 731  GLN A HG2    1 
ATOM   6579  H HG3    . GLN A 1 431 ? -88.436  34.339  39.889  0    108.07 ? 731  GLN A HG3    1 
ATOM   6580  H HE21   . GLN A 1 431 ? -85.714  34.988  37.659  0    103.22 ? 731  GLN A HE21   1 
ATOM   6581  H HE22   . GLN A 1 431 ? -84.535  35.283  38.928  0    107.2  ? 731  GLN A HE22   1 
ATOM   6582  N N      . CYS A 1 432 ? -86.427  30.615  35.848  1    50.69  ? 732  CYS A N      1 
ATOM   6583  C CA     . CYS A 1 432 ? -86.337  29.211  35.483  1    47.68  ? 732  CYS A CA     1 
ATOM   6584  C C      . CYS A 1 432 ? -85.462  28.991  34.258  1    43.59  ? 732  CYS A C      1 
ATOM   6585  O O      . CYS A 1 432 ? -85.136  29.931  33.527  1    43.51  ? 732  CYS A O      1 
ATOM   6586  C CB     . CYS A 1 432 ? -87.737  28.632  35.274  1    46     ? 732  CYS A CB     1 
ATOM   6587  S SG     . CYS A 1 432 ? -88.539  29.173  33.743  1    42.51  ? 732  CYS A SG     1 
ATOM   6588  H H      . CYS A 1 432 ? -86.092  31.254  35.135  0    75.78  ? 732  CYS A H      1 
ATOM   6589  H HA     . CYS A 1 432 ? -85.878  28.658  36.302  0    71.57  ? 732  CYS A HA     1 
ATOM   6590  H HB2    . CYS A 1 432 ? -87.65   27.547  35.225  0    66.34  ? 732  CYS A HB2    1 
ATOM   6591  H HB3    . CYS A 1 432 ? -88.387  28.901  36.104  0    69.83  ? 732  CYS A HB3    1 
ATOM   6592  H HG     . CYS A 1 432 ? -89.756  28.622  33.663  0    61.41  ? 732  CYS A HG     1 
ATOM   6593  N N      . PHE A 1 433 ? -85.121  27.721  34.029  1    41.27  ? 733  PHE A N      1 
ATOM   6594  C CA     . PHE A 1 433 ? -84.342  27.285  32.892  1    38.55  ? 733  PHE A CA     1 
ATOM   6595  C C      . PHE A 1 433 ? -85.24   26.558  31.873  1    35.65  ? 733  PHE A C      1 
ATOM   6596  O O      . PHE A 1 433 ? -86.278  25.994  32.225  1    35.5   ? 733  PHE A O      1 
ATOM   6597  C CB     . PHE A 1 433 ? -83.254  26.302  33.357  1    38.79  ? 733  PHE A CB     1 
ATOM   6598  C CG     . PHE A 1 433 ? -82.266  26.839  34.357  1    41.86  ? 733  PHE A CG     1 
ATOM   6599  C CD1    . PHE A 1 433 ? -81.128  27.503  33.94   1    41.76  ? 733  PHE A CD1    1 
ATOM   6600  C CD2    . PHE A 1 433 ? -82.416  26.583  35.706  1    45.45  ? 733  PHE A CD2    1 
ATOM   6601  C CE1    . PHE A 1 433 ? -80.186  27.943  34.859  1    45.4   ? 733  PHE A CE1    1 
ATOM   6602  C CE2    . PHE A 1 433 ? -81.492  27.059  36.624  1    49.23  ? 733  PHE A CE2    1 
ATOM   6603  C CZ     . PHE A 1 433 ? -80.392  27.748  36.196  1    49.02  ? 733  PHE A CZ     1 
ATOM   6604  H H      . PHE A 1 433 ? -85.388  26.957  34.641  0    58.72  ? 733  PHE A H      1 
ATOM   6605  H HA     . PHE A 1 433 ? -83.855  28.128  32.403  0    52.97  ? 733  PHE A HA     1 
ATOM   6606  H HB2    . PHE A 1 433 ? -83.742  25.44   33.809  0    53.26  ? 733  PHE A HB2    1 
ATOM   6607  H HB3    . PHE A 1 433 ? -82.689  25.978  32.484  0    51.66  ? 733  PHE A HB3    1 
ATOM   6608  H HD1    . PHE A 1 433 ? -80.97   27.679  32.889  0    57.81  ? 733  PHE A HD1    1 
ATOM   6609  H HD2    . PHE A 1 433 ? -83.293  26.064  36.055  0    66.4   ? 733  PHE A HD2    1 
ATOM   6610  H HE1    . PHE A 1 433 ? -79.323  28.493  34.523  0    66.9   ? 733  PHE A HE1    1 
ATOM   6611  H HE2    . PHE A 1 433 ? -81.64   26.882  37.676  0    76.09  ? 733  PHE A HE2    1 
ATOM   6612  H HZ     . PHE A 1 433 ? -79.664  28.091  36.91   0    76.07  ? 733  PHE A HZ     1 
ATOM   6613  N N      . GLY A 1 434 ? -84.797  26.565  30.628  1    33.66  ? 734  GLY A N      1 
ATOM   6614  C CA     . GLY A 1 434 ? -85.392  25.813  29.541  1    30.88  ? 734  GLY A CA     1 
ATOM   6615  C C      . GLY A 1 434 ? -84.367  24.763  29.176  1    29.41  ? 734  GLY A C      1 
ATOM   6616  O O      . GLY A 1 434 ? -83.203  25.111  28.988  1    29.72  ? 734  GLY A O      1 
ATOM   6617  H H      . GLY A 1 434 ? -83.99   27.102  30.328  0    43.51  ? 734  GLY A H      1 
ATOM   6618  H HA2    . GLY A 1 434 ? -86.329  25.339  29.829  0    38.29  ? 734  GLY A HA2    1 
ATOM   6619  H HA3    . GLY A 1 434 ? -85.563  26.461  28.683  0    38.04  ? 734  GLY A HA3    1 
ATOM   6620  N N      . VAL A 1 435 ? -84.751  23.48   29.126  1    28.15  ? 735  VAL A N      1 
ATOM   6621  C CA     . VAL A 1 435 ? -83.825  22.381  28.818  1    27.03  ? 735  VAL A CA     1 
ATOM   6622  C C      . VAL A 1 435 ? -84.441  21.457  27.767  1    25.36  ? 735  VAL A C      1 
ATOM   6623  O O      . VAL A 1 435 ? -85.503  20.899  28.014  1    25.26  ? 735  VAL A O      1 
ATOM   6624  C CB     . VAL A 1 435 ? -83.448  21.573  30.089  1    28.2   ? 735  VAL A CB     1 
ATOM   6625  C CG1    . VAL A 1 435 ? -82.67   20.31   29.743  1    26.96  ? 735  VAL A CG1    1 
ATOM   6626  C CG2    . VAL A 1 435 ? -82.649  22.416  31.062  1    30.66  ? 735  VAL A CG2    1 
ATOM   6627  H H      . VAL A 1 435 ? -85.707  23.171  29.264  0    32.95  ? 735  VAL A H      1 
ATOM   6628  H HA     . VAL A 1 435 ? -82.898  22.77   28.402  0    30.85  ? 735  VAL A HA     1 
ATOM   6629  H HB     . VAL A 1 435 ? -84.366  21.273  30.592  0    33.33  ? 735  VAL A HB     1 
ATOM   6630  H HG11   . VAL A 1 435 ? -82.164  19.962  30.642  0    31.86  ? 735  VAL A HG11   1 
ATOM   6631  H HG12   . VAL A 1 435 ? -83.363  19.537  29.412  0    30.19  ? 735  VAL A HG12   1 
ATOM   6632  H HG13   . VAL A 1 435 ? -81.949  20.536  28.961  0    30.63  ? 735  VAL A HG13   1 
ATOM   6633  H HG21   . VAL A 1 435 ? -82.576  21.886  32.011  0    38.58  ? 735  VAL A HG21   1 
ATOM   6634  H HG22   . VAL A 1 435 ? -81.653  22.554  30.645  0    37.51  ? 735  VAL A HG22   1 
ATOM   6635  H HG23   . VAL A 1 435 ? -83.134  23.379  31.209  0    38.25  ? 735  VAL A HG23   1 
ATOM   6636  N N      . LEU A 1 436 ? -83.752  21.249  26.627  1    24.5   ? 736  LEU A N      1 
ATOM   6637  C CA     . LEU A 1 436 ? -84.185  20.297  25.601  1    23.74  ? 736  LEU A CA     1 
ATOM   6638  C C      . LEU A 1 436 ? -83.732  18.892  26.059  1    23.39  ? 736  LEU A C      1 
ATOM   6639  O O      . LEU A 1 436 ? -82.63   18.759  26.583  1    23.51  ? 736  LEU A O      1 
ATOM   6640  C CB     . LEU A 1 436 ? -83.551  20.643  24.243  1    23.77  ? 736  LEU A CB     1 
ATOM   6641  C CG     . LEU A 1 436 ? -83.911  21.993  23.625  1    24.22  ? 736  LEU A CG     1 
ATOM   6642  C CD1    . LEU A 1 436 ? -83.237  22.167  22.275  1    24.68  ? 736  LEU A CD1    1 
ATOM   6643  C CD2    . LEU A 1 436 ? -85.411  22.15   23.467  1    24.45  ? 736  LEU A CD2    1 
ATOM   6644  H H      . LEU A 1 436 ? -82.89   21.728  26.388  0    26.83  ? 736  LEU A H      1 
ATOM   6645  H HA     . LEU A 1 436 ? -85.27   20.291  25.509  0    25.67  ? 736  LEU A HA     1 
ATOM   6646  H HB2    . LEU A 1 436 ? -82.468  20.618  24.356  0    25.69  ? 736  LEU A HB2    1 
ATOM   6647  H HB3    . LEU A 1 436 ? -83.852  19.875  23.532  0    25.67  ? 736  LEU A HB3    1 
ATOM   6648  H HG     . LEU A 1 436 ? -83.549  22.783  24.279  0    26.49  ? 736  LEU A HG     1 
ATOM   6649  H HD11   . LEU A 1 436 ? -83.666  23.019  21.752  0    27.89  ? 736  LEU A HD11   1 
ATOM   6650  H HD12   . LEU A 1 436 ? -82.17   22.33   22.41   0    27.32  ? 736  LEU A HD12   1 
ATOM   6651  H HD13   . LEU A 1 436 ? -83.38   21.261  21.688  0    27.27  ? 736  LEU A HD13   1 
ATOM   6652  H HD21   . LEU A 1 436 ? -85.63   23.043  22.881  0    27.33  ? 736  LEU A HD21   1 
ATOM   6653  H HD22   . LEU A 1 436 ? -85.808  21.268  22.968  0    26.66  ? 736  LEU A HD22   1 
ATOM   6654  H HD23   . LEU A 1 436 ? -85.861  22.241  24.453  0    26.65  ? 736  LEU A HD23   1 
ATOM   6655  N N      . SER A 1 437 ? -84.587  17.866  25.921  1    23.18  ? 737  SER A N      1 
ATOM   6656  C CA     . SER A 1 437 ? -84.247  16.52   26.382  1    22.94  ? 737  SER A CA     1 
ATOM   6657  C C      . SER A 1 437 ? -84.88   15.447  25.517  1    22.98  ? 737  SER A C      1 
ATOM   6658  O O      . SER A 1 437 ? -86      15.616  25.029  1    23.4   ? 737  SER A O      1 
ATOM   6659  C CB     . SER A 1 437 ? -84.699  16.322  27.824  1    23.28  ? 737  SER A CB     1 
ATOM   6660  O OG     . SER A 1 437 ? -86.114  16.236  27.91   1    23.5   ? 737  SER A OG     1 
ATOM   6661  H H      . SER A 1 437 ? -85.507  17.937  25.499  0    24.88  ? 737  SER A H      1 
ATOM   6662  H HA     . SER A 1 437 ? -83.168  16.377  26.346  0    24.42  ? 737  SER A HA     1 
ATOM   6663  H HB2    . SER A 1 437 ? -84.252  15.405  28.205  0    24.87  ? 737  SER A HB2    1 
ATOM   6664  H HB3    . SER A 1 437 ? -84.363  17.171  28.418  0    25.29  ? 737  SER A HB3    1 
ATOM   6665  H HG     . SER A 1 437 ? -86.386  15.638  28.655  0    25.28  ? 737  SER A HG     1 
ATOM   6666  N N      . SER A 1 438 ? -84.212  14.296  25.444  1    22.91  ? 738  SER A N      1 
ATOM   6667  C CA     . SER A 1 438 ? -84.623  13.169  24.629  1    23.56  ? 738  SER A CA     1 
ATOM   6668  C C      . SER A 1 438 ? -84.794  11.923  25.481  1    23.41  ? 738  SER A C      1 
ATOM   6669  O O      . SER A 1 438 ? -83.869  11.557  26.198  1    23.03  ? 738  SER A O      1 
ATOM   6670  C CB     . SER A 1 438 ? -83.55   12.923  23.574  1    24.22  ? 738  SER A CB     1 
ATOM   6671  O OG     . SER A 1 438 ? -83.396  11.565  23.19   1    25.46  ? 738  SER A OG     1 
ATOM   6672  H H      . SER A 1 438 ? -83.381  14.102  25.993  0    24.3   ? 738  SER A H      1 
ATOM   6673  H HA     . SER A 1 438 ? -85.561  13.375  24.117  0    25.64  ? 738  SER A HA     1 
ATOM   6674  H HB2    . SER A 1 438 ? -83.798  13.513  22.694  0    26.55  ? 738  SER A HB2    1 
ATOM   6675  H HB3    . SER A 1 438 ? -82.595  13.262  23.973  0    26     ? 738  SER A HB3    1 
ATOM   6676  H HG     . SER A 1 438 ? -82.967  11.516  22.295  0    28.76  ? 738  SER A HG     1 
ATOM   6677  N N      . ARG A 1 439 ? -85.915  11.214  25.319  1    23.99  ? 739  ARG A N      1 
ATOM   6678  C CA     . ARG A 1 439 ? -86.14   9.952   26.009  1    24.13  ? 739  ARG A CA     1 
ATOM   6679  C C      . ARG A 1 439 ? -86.419  8.862   24.995  1    25.63  ? 739  ARG A C      1 
ATOM   6680  O O      . ARG A 1 439 ? -87.08   9.126   23.999  1    26.82  ? 739  ARG A O      1 
ATOM   6681  C CB     . ARG A 1 439 ? -87.297  10.069  27.001  1    24.05  ? 739  ARG A CB     1 
ATOM   6682  C CG     . ARG A 1 439 ? -88.655  10.305  26.383  1    25     ? 739  ARG A CG     1 
ATOM   6683  C CD     . ARG A 1 439 ? -89.753  10.01   27.371  1    25.69  ? 739  ARG A CD     1 
ATOM   6684  N NE     . ARG A 1 439 ? -91.05   9.954   26.713  1    27.18  ? 739  ARG A NE     1 
ATOM   6685  C CZ     . ARG A 1 439 ? -91.83   10.999  26.453  1    27.47  ? 739  ARG A CZ     1 
ATOM   6686  N NH1    . ARG A 1 439 ? -91.449  12.226  26.795  1    26.21  ? 739  ARG A NH1    1 
ATOM   6687  N NH2    . ARG A 1 439 ? -92.998  10.828  25.851  1    29.54  ? 739  ARG A NH2    1 
ATOM   6688  H H      . ARG A 1 439 ? -86.681  11.486  24.712  0    26.31  ? 739  ARG A H      1 
ATOM   6689  H HA     . ARG A 1 439 ? -85.258  9.657   26.575  0    26.99  ? 739  ARG A HA     1 
ATOM   6690  H HB2    . ARG A 1 439 ? -87.342  9.143   27.575  0    27.89  ? 739  ARG A HB2    1 
ATOM   6691  H HB3    . ARG A 1 439 ? -87.092  10.901  27.673  0    26.91  ? 739  ARG A HB3    1 
ATOM   6692  H HG2    . ARG A 1 439 ? -88.736  11.343  26.063  0    28.33  ? 739  ARG A HG2    1 
ATOM   6693  H HG3    . ARG A 1 439 ? -88.809  9.629   25.543  0    29.28  ? 739  ARG A HG3    1 
ATOM   6694  H HD2    . ARG A 1 439 ? -89.588  9.021   27.795  0    31.08  ? 739  ARG A HD2    1 
ATOM   6695  H HD3    . ARG A 1 439 ? -89.757  10.741  28.178  0    30.4   ? 739  ARG A HD3    1 
ATOM   6696  H HE     . ARG A 1 439 ? -91.384  9.035   26.433  0    34.03  ? 739  ARG A HE     1 
ATOM   6697  H HH11   . ARG A 1 439 ? -90.567  12.429  27.25   0    30.69  ? 739  ARG A HH11   1 
ATOM   6698  H HH12   . ARG A 1 439 ? -92.07   13.004  26.593  0    31.72  ? 739  ARG A HH12   1 
ATOM   6699  H HH21   . ARG A 1 439 ? -93.301  9.896   25.583  0    38.38  ? 739  ARG A HH21   1 
ATOM   6700  H HH22   . ARG A 1 439 ? -93.598  11.621  25.653  0    37.88  ? 739  ARG A HH22   1 
ATOM   6701  N N      . ILE A 1 440 ? -85.969  7.63    25.26   1    26.05  ? 740  ILE A N      1 
ATOM   6702  C CA     . ILE A 1 440 ? -86.219  6.515   24.345  1    27.97  ? 740  ILE A CA     1 
ATOM   6703  C C      . ILE A 1 440 ? -87.515  5.783   24.69   1    29.49  ? 740  ILE A C      1 
ATOM   6704  O O      . ILE A 1 440 ? -87.711  5.341   25.817  1    29.77  ? 740  ILE A O      1 
ATOM   6705  C CB     . ILE A 1 440 ? -85.063  5.485   24.344  1    28.75  ? 740  ILE A CB     1 
ATOM   6706  C CG1    . ILE A 1 440 ? -83.695  6.156   24.168  1    27.81  ? 740  ILE A CG1    1 
ATOM   6707  C CG2    . ILE A 1 440 ? -85.287  4.418   23.278  1    31.48  ? 740  ILE A CG2    1 
ATOM   6708  C CD1    . ILE A 1 440 ? -83.532  7.038   22.927  1    28.92  ? 740  ILE A CD1    1 
ATOM   6709  H H      . ILE A 1 440 ? -85.449  7.371   26.093  0    30.83  ? 740  ILE A H      1 
ATOM   6710  H HA     . ILE A 1 440 ? -86.289  6.915   23.334  0    34.52  ? 740  ILE A HA     1 
ATOM   6711  H HB     . ILE A 1 440 ? -85.064  4.986   25.312  0    36.14  ? 740  ILE A HB     1 
ATOM   6712  H HG12   . ILE A 1 440 ? -83.499  6.783   25.035  0    33.42  ? 740  ILE A HG12   1 
ATOM   6713  H HG13   . ILE A 1 440 ? -82.933  5.38    24.115  0    35.02  ? 740  ILE A HG13   1 
ATOM   6714  H HG21   . ILE A 1 440 ? -84.354  3.881   23.11   0    41.4   ? 740  ILE A HG21   1 
ATOM   6715  H HG22   . ILE A 1 440 ? -86.038  3.709   23.625  0    41.52  ? 740  ILE A HG22   1 
ATOM   6716  H HG23   . ILE A 1 440 ? -85.614  4.894   22.354  0    41.06  ? 740  ILE A HG23   1 
ATOM   6717  H HD11   . ILE A 1 440 ? -82.494  7.363   22.864  0    35.34  ? 740  ILE A HD11   1 
ATOM   6718  H HD12   . ILE A 1 440 ? -83.784  6.459   22.04   0    36.76  ? 740  ILE A HD12   1 
ATOM   6719  H HD13   . ILE A 1 440 ? -84.182  7.908   23.006  0    34.97  ? 740  ILE A HD13   1 
ATOM   6720  N N      . GLU A 1 441 ? -88.385  5.647   23.722  1    31.31  ? 741  GLU A N      1 
ATOM   6721  C CA     . GLU A 1 441 ? -89.584  4.839   23.827  1    33.58  ? 741  GLU A CA     1 
ATOM   6722  C C      . GLU A 1 441 ? -89.397  3.759   22.742  1    36.61  ? 741  GLU A C      1 
ATOM   6723  O O      . GLU A 1 441 ? -88.752  4.013   21.718  1    37.39  ? 741  GLU A O      1 
ATOM   6724  C CB     . GLU A 1 441 ? -90.866  5.654   23.572  1    34.23  ? 741  GLU A CB     1 
ATOM   6725  C CG     . GLU A 1 441 ? -91.204  6.661   24.66   1    32     ? 741  GLU A CG     1 
ATOM   6726  C CD     . GLU A 1 441 ? -92.676  7.02    24.813  1    33.55  ? 741  GLU A CD     1 
ATOM   6727  O OE1    . GLU A 1 441 ? -93.508  6.527   24.021  1    36.06  ? 741  GLU A OE1    1 
ATOM   6728  O OE2    . GLU A 1 441 ? -93.005  7.791   25.743  1    32.59  ? 741  GLU A OE2    1 
ATOM   6729  H H      . GLU A 1 441 ? -88.297  6.092   22.814  0    40.26  ? 741  GLU A H      1 
ATOM   6730  H HA     . GLU A 1 441 ? -89.665  4.353   24.797  0    44.46  ? 741  GLU A HA     1 
ATOM   6731  H HB2    . GLU A 1 441 ? -90.765  6.192   22.63   0    45.63  ? 741  GLU A HB2    1 
ATOM   6732  H HB3    . GLU A 1 441 ? -91.686  4.941   23.511  0    46.95  ? 741  GLU A HB3    1 
ATOM   6733  H HG2    . GLU A 1 441 ? -90.87   6.26    25.616  0    41.34  ? 741  GLU A HG2    1 
ATOM   6734  H HG3    . GLU A 1 441 ? -90.666  7.584   24.45   0    40.62  ? 741  GLU A HG3    1 
ATOM   6735  N N      . VAL A 1 442 ? -89.896  2.552   22.982  1    37.72  ? 742  VAL A N      1 
ATOM   6736  C CA     . VAL A 1 442 ? -89.791  1.467   21.999  1    40.08  ? 742  VAL A CA     1 
ATOM   6737  C C      . VAL A 1 442 ? -91.165  1.17    21.412  1    42.03  ? 742  VAL A C      1 
ATOM   6738  O O      . VAL A 1 442 ? -92.184  1.487   22.02   1    41.24  ? 742  VAL A O      1 
ATOM   6739  C CB     . VAL A 1 442 ? -89.131  0.215   22.586  1    40.15  ? 742  VAL A CB     1 
ATOM   6740  C CG1    . VAL A 1 442 ? -87.851  0.565   23.306  1    38.56  ? 742  VAL A CG1    1 
ATOM   6741  C CG2    . VAL A 1 442 ? -90.065  -0.506  23.506  1    40.85  ? 742  VAL A CG2    1 
ATOM   6742  H H      . VAL A 1 442 ? -90.352  2.295   23.851  0    52.39  ? 742  VAL A H      1 
ATOM   6743  H HA     . VAL A 1 442 ? -89.164  1.78    21.165  0    57.46  ? 742  VAL A HA     1 
ATOM   6744  H HB     . VAL A 1 442 ? -88.882  -0.468  21.775  0    59.86  ? 742  VAL A HB     1 
ATOM   6745  H HG11   . VAL A 1 442 ? -87.384  -0.346  23.68   0    55.51  ? 742  VAL A HG11   1 
ATOM   6746  H HG12   . VAL A 1 442 ? -87.216  1.046   22.569  0    54.72  ? 742  VAL A HG12   1 
ATOM   6747  H HG13   . VAL A 1 442 ? -88.052  1.246   24.132  0    53.28  ? 742  VAL A HG13   1 
ATOM   6748  H HG21   . VAL A 1 442 ? -89.478  -1.004  24.276  0    60.26  ? 742  VAL A HG21   1 
ATOM   6749  H HG22   . VAL A 1 442 ? -90.752  0.2     23.969  0    59.07  ? 742  VAL A HG22   1 
ATOM   6750  H HG23   . VAL A 1 442 ? -90.604  -1.249  22.92   0    61.89  ? 742  VAL A HG23   1 
ATOM   6751  N N      . GLN A 1 443 ? -91.193  0.559   20.239  1    44.82  ? 743  GLN A N      1 
ATOM   6752  C CA     . GLN A 1 443 ? -92.437  0.3     19.536  1    47.14  ? 743  GLN A CA     1 
ATOM   6753  C C      . GLN A 1 443 ? -93.157  -0.864  20.202  1    48.03  ? 743  GLN A C      1 
ATOM   6754  O O      . GLN A 1 443 ? -92.578  -1.937  20.289  1    49.1   ? 743  GLN A O      1 
ATOM   6755  C CB     . GLN A 1 443 ? -92.128  0.019   18.058  1    50.37  ? 743  GLN A CB     1 
ATOM   6756  C CG     . GLN A 1 443 ? -93.017  0.725   17.051  1    52.2   ? 743  GLN A CG     1 
ATOM   6757  C CD     . GLN A 1 443 ? -92.503  2.102   16.724  1    51.36  ? 743  GLN A CD     1 
ATOM   6758  O OE1    . GLN A 1 443 ? -91.322  2.296   16.425  1    50.85  ? 743  GLN A OE1    1 
ATOM   6759  N NE2    . GLN A 1 443 ? -93.377  3.093   16.739  1    51.51  ? 743  GLN A NE2    1 
ATOM   6760  H H      . GLN A 1 443 ? -90.362  0.199   19.783  0    68.04  ? 743  GLN A H      1 
ATOM   6761  H HA     . GLN A 1 443 ? -93.074  1.178   19.63   0    72.14  ? 743  GLN A HA     1 
ATOM   6762  H HB2    . GLN A 1 443 ? -91.098  0.294   17.838  0    78.52  ? 743  GLN A HB2    1 
ATOM   6763  H HB3    . GLN A 1 443 ? -92.241  -1.046  17.891  0    81.4   ? 743  GLN A HB3    1 
ATOM   6764  H HG2    . GLN A 1 443 ? -93.039  0.143   16.131  0    86.27  ? 743  GLN A HG2    1 
ATOM   6765  H HG3    . GLN A 1 443 ? -94.02   0.803   17.468  0    83.49  ? 743  GLN A HG3    1 
ATOM   6766  H HE21   . GLN A 1 443 ? -94.353  2.928   16.964  0    82.06  ? 743  GLN A HE21   1 
ATOM   6767  H HE22   . GLN A 1 443 ? -93.064  4.034   16.524  0    80     ? 743  GLN A HE22   1 
ATOM   6768  N N      . ASP A 1 444 ? -94.401  -0.636  20.704  1    48.3   ? 744  ASP A N      1 
ATOM   6769  C CA     . ASP A 1 444 ? -95.204  -1.644  21.429  1    50.13  ? 744  ASP A CA     1 
ATOM   6770  C C      . ASP A 1 444 ? -96.32   -2.271  20.577  1    53.9   ? 744  ASP A C      1 
ATOM   6771  O O      . ASP A 1 444 ? -96.599  -1.787  19.487  1    55.15  ? 744  ASP A O      1 
ATOM   6772  C CB     . ASP A 1 444 ? -95.776  -1.042  22.73   1    49     ? 744  ASP A CB     1 
ATOM   6773  C CG     . ASP A 1 444 ? -96.756  0.093   22.546  1    49.14  ? 744  ASP A CG     1 
ATOM   6774  O OD1    . ASP A 1 444 ? -97.608  -0.007  21.654  1    51.46  ? 744  ASP A OD1    1 
ATOM   6775  O OD2    . ASP A 1 444 ? -96.669  1.08    23.3    1    47.24  ? 744  ASP A OD2    1 
ATOM   6776  H H      . ASP A 1 444 ? -94.884  0.25    20.588  0    76.12  ? 744  ASP A H      1 
ATOM   6777  H HA     . ASP A 1 444 ? -94.553  -2.461  21.736  0    80.35  ? 744  ASP A HA     1 
ATOM   6778  H HB2    . ASP A 1 444 ? -96.285  -1.83   23.283  0    79.07  ? 744  ASP A HB2    1 
ATOM   6779  H HB3    . ASP A 1 444 ? -94.942  -0.661  23.316  0    75.37  ? 744  ASP A HB3    1 
ATOM   6780  N N      . THR A 1 445 ? -96.973  -3.33   21.082  1    56.09  ? 745  THR A N      1 
ATOM   6781  C CA     . THR A 1 445 ? -98.015  -4.026  20.327  1    60.13  ? 745  THR A CA     1 
ATOM   6782  C C      . THR A 1 445 ? -99.224  -3.17   20.026  1    61.6   ? 745  THR A C      1 
ATOM   6783  O O      . THR A 1 445 ? -99.959  -3.507  19.108  1    65.27  ? 745  THR A O      1 
ATOM   6784  C CB     . THR A 1 445 ? -98.457  -5.294  21.04   1    62.16  ? 745  THR A CB     1 
ATOM   6785  O OG1    . THR A 1 445 ? -98.943  -4.959  22.33   1    61.1   ? 745  THR A OG1    1 
ATOM   6786  C CG2    . THR A 1 445 ? -97.356  -6.291  21.175  1    61.54  ? 745  THR A CG2    1 
ATOM   6787  H H      . THR A 1 445 ? -96.808  -3.708  22.009  0    92.62  ? 745  THR A H      1 
ATOM   6788  H HA     . THR A 1 445 ? -97.594  -4.319  19.366  0    103.58 ? 745  THR A HA     1 
ATOM   6789  H HB     . THR A 1 445 ? -99.247  -5.752  20.448  0    109.89 ? 745  THR A HB     1 
ATOM   6790  H HG1    . THR A 1 445 ? -99.915  -4.759  22.31   0    105.68 ? 745  THR A HG1    1 
ATOM   6791  H HG21   . THR A 1 445 ? -97.71   -7.163  21.722  0    107.26 ? 745  THR A HG21   1 
ATOM   6792  H HG22   . THR A 1 445 ? -97.003  -6.596  20.191  0    107.1  ? 745  THR A HG22   1 
ATOM   6793  H HG23   . THR A 1 445 ? -96.52   -5.859  21.723  0    102.82 ? 745  THR A HG23   1 
ATOM   6794  N N      . SER A 1 446 ? -99.443  -2.081  20.764  1    59.27  ? 746  SER A N      1 
ATOM   6795  C CA     . SER A 1 446 ? -100.579 -1.201  20.503  1    60.84  ? 746  SER A CA     1 
ATOM   6796  C C      . SER A 1 446 ? -100.455 -0.405  19.208  1    60.88  ? 746  SER A C      1 
ATOM   6797  O O      . SER A 1 446 ? -101.419 0.239   18.819  1    62.41  ? 746  SER A O      1 
ATOM   6798  C CB     . SER A 1 446 ? -100.754 -0.214  21.654  1    58.71  ? 746  SER A CB     1 
ATOM   6799  O OG     . SER A 1 446 ? -100.073 1.02    21.473  1    55.09  ? 746  SER A OG     1 
ATOM   6800  H H      . SER A 1 446 ? -98.853  -1.778  21.531  0    97.52  ? 746  SER A H      1 
ATOM   6801  H HA     . SER A 1 446 ? -101.489 -1.796  20.442  0    106.48 ? 746  SER A HA     1 
ATOM   6802  H HB2    . SER A 1 446 ? -101.816 -0.008  21.782  0    100.28 ? 746  SER A HB2    1 
ATOM   6803  H HB3    . SER A 1 446 ? -100.345 -0.652  22.561  0    97.15  ? 746  SER A HB3    1 
ATOM   6804  H HG     . SER A 1 446 ? -99.092  0.859   21.456  0    89.31  ? 746  SER A HG     1 
ATOM   6805  N N      . GLY A 1 447 ? -99.269  -0.358  18.621  1    59.37  ? 747  GLY A N      1 
ATOM   6806  C CA     . GLY A 1 447 ? -98.999  0.459   17.451  1    59.47  ? 747  GLY A CA     1 
ATOM   6807  C C      . GLY A 1 447 ? -98.118  1.621   17.85   1    55.46  ? 747  GLY A C      1 
ATOM   6808  O O      . GLY A 1 447 ? -97.102  1.88    17.206  1    54.51  ? 747  GLY A O      1 
ATOM   6809  H H      . GLY A 1 447 ? -98.449  -0.873  18.922  0    99.56  ? 747  GLY A H      1 
ATOM   6810  H HA2    . GLY A 1 447 ? -98.472  -0.134  16.706  0    102.53 ? 747  GLY A HA2    1 
ATOM   6811  H HA3    . GLY A 1 447 ? -99.911  0.846   16.999  0    103.74 ? 747  GLY A HA3    1 
ATOM   6812  N N      . GLY A 1 448 ? -98.467  2.275   18.956  1    53.35  ? 748  GLY A N      1 
ATOM   6813  C CA     . GLY A 1 448 ? -97.697  3.387   19.49   1    49.81  ? 748  GLY A CA     1 
ATOM   6814  C C      . GLY A 1 448 ? -96.365  2.983   20.092  1    47.16  ? 748  GLY A C      1 
ATOM   6815  O O      . GLY A 1 448 ? -95.752  2.006   19.667  1    48.05  ? 748  GLY A O      1 
ATOM   6816  H H      . GLY A 1 448 ? -99.294  2.068   19.506  0    88.68  ? 748  GLY A H      1 
ATOM   6817  H HA2    . GLY A 1 448 ? -97.51   4.11    18.697  0    80.11  ? 748  GLY A HA2    1 
ATOM   6818  H HA3    . GLY A 1 448 ? -98.287  3.878   20.263  0    79.38  ? 748  GLY A HA3    1 
ATOM   6819  N N      . THR A 1 449 ? -95.887  3.762   21.059  1    44.25  ? 749  THR A N      1 
ATOM   6820  C CA     . THR A 1 449 ? -94.61   3.512   21.725  1    41.93  ? 749  THR A CA     1 
ATOM   6821  C C      . THR A 1 449 ? -94.784  3.66    23.239  1    40.84  ? 749  THR A C      1 
ATOM   6822  O O      . THR A 1 449 ? -95.709  4.343   23.712  1    41.22  ? 749  THR A O      1 
ATOM   6823  C CB     . THR A 1 449 ? -93.508  4.428   21.173  1    40.49  ? 749  THR A CB     1 
ATOM   6824  O OG1    . THR A 1 449 ? -93.756  5.77    21.576  1    38.65  ? 749  THR A OG1    1 
ATOM   6825  C CG2    . THR A 1 449 ? -93.409  4.392   19.672  1    42.67  ? 749  THR A CG2    1 
ATOM   6826  H H      . THR A 1 449 ? -96.362  4.589   21.408  0    67.19  ? 749  THR A H      1 
ATOM   6827  H HA     . THR A 1 449 ? -94.287  2.487   21.552  0    63.44  ? 749  THR A HA     1 
ATOM   6828  H HB     . THR A 1 449 ? -92.549  4.09    21.562  0    57.84  ? 749  THR A HB     1 
ATOM   6829  H HG1    . THR A 1 449 ? -93.312  5.972   22.441  0    53.81  ? 749  THR A HG1    1 
ATOM   6830  H HG21   . THR A 1 449 ? -92.771  5.206   19.336  0    62.4   ? 749  THR A HG21   1 
ATOM   6831  H HG22   . THR A 1 449 ? -92.972  3.452   19.341  0    64.51  ? 749  THR A HG22   1 
ATOM   6832  H HG23   . THR A 1 449 ? -94.385  4.514   19.204  0    65.38  ? 749  THR A HG23   1 
ATOM   6833  N N      . THR A 1 450 ? -93.872  3.051   23.996  1    40.04  ? 750  THR A N      1 
ATOM   6834  C CA     . THR A 1 450 ? -93.97   3.026   25.454  1    39.59  ? 750  THR A CA     1 
ATOM   6835  C C      . THR A 1 450 ? -92.583  3.236   26.069  1    37.52  ? 750  THR A C      1 
ATOM   6836  O O      . THR A 1 450 ? -91.592  2.725   25.55   1    37.17  ? 750  THR A O      1 
ATOM   6837  C CB     . THR A 1 450 ? -94.652  1.71    25.85   1    41.61  ? 750  THR A CB     1 
ATOM   6838  O OG1    . THR A 1 450 ? -94.987  1.699   27.227  1    41.91  ? 750  THR A OG1    1 
ATOM   6839  C CG2    . THR A 1 450 ? -93.812  0.572   25.558  1    41.56  ? 750  THR A CG2    1 
ATOM   6840  H H      . THR A 1 450 ? -93.044  2.595   23.626  0    57.87  ? 750  THR A H      1 
ATOM   6841  H HA     . THR A 1 450 ? -94.603  3.842   25.799  0    56.72  ? 750  THR A HA     1 
ATOM   6842  H HB     . THR A 1 450 ? -95.581  1.579   25.295  0    63.13  ? 750  THR A HB     1 
ATOM   6843  H HG1    . THR A 1 450 ? -95.532  0.894   27.43   0    63.69  ? 750  THR A HG1    1 
ATOM   6844  H HG21   . THR A 1 450 ? -94.403  -0.34   25.534  0    63.81  ? 750  THR A HG21   1 
ATOM   6845  H HG22   . THR A 1 450 ? -93.332  0.698   24.59   0    61.48  ? 750  THR A HG22   1 
ATOM   6846  H HG23   . THR A 1 450 ? -93.038  0.478   26.318  0    60.98  ? 750  THR A HG23   1 
ATOM   6847  N N      . ALA A 1 451 ? -92.514  4.03    27.154  1    36.63  ? 751  ALA A N      1 
ATOM   6848  C CA     . ALA A 1 451 ? -91.257  4.364   27.819  1    35.15  ? 751  ALA A CA     1 
ATOM   6849  C C      . ALA A 1 451 ? -90.858  3.288   28.793  1    36.1   ? 751  ALA A C      1 
ATOM   6850  O O      . ALA A 1 451 ? -91.704  2.791   29.534  1    37.71  ? 751  ALA A O      1 
ATOM   6851  C CB     . ALA A 1 451 ? -91.392  5.677   28.559  1    34.54  ? 751  ALA A CB     1 
ATOM   6852  H H      . ALA A 1 451 ? -93.321  4.459   27.596  0    51.02  ? 751  ALA A H      1 
ATOM   6853  H HA     . ALA A 1 451 ? -90.466  4.485   27.079  0    46.45  ? 751  ALA A HA     1 
ATOM   6854  H HB1    . ALA A 1 451 ? -90.429  5.94    28.995  0    45.02  ? 751  ALA A HB1    1 
ATOM   6855  H HB2    . ALA A 1 451 ? -91.705  6.454   27.864  0    45.22  ? 751  ALA A HB2    1 
ATOM   6856  H HB3    . ALA A 1 451 ? -92.133  5.56    29.349  0    46.91  ? 751  ALA A HB3    1 
ATOM   6857  N N      . LEU A 1 452 ? -89.552  3.029   28.879  1    35.48  ? 752  LEU A N      1 
ATOM   6858  C CA     . LEU A 1 452 ? -88.967  1.984   29.732  1    36.69  ? 752  LEU A CA     1 
ATOM   6859  C C      . LEU A 1 452 ? -89.131  2.305   31.215  1    37.51  ? 752  LEU A C      1 
ATOM   6860  O O      . LEU A 1 452 ? -89.305  1.396   32.028  1    39.36  ? 752  LEU A O      1 
ATOM   6861  C CB     . LEU A 1 452 ? -87.474  1.837   29.439  1    36.01  ? 752  LEU A CB     1 
ATOM   6862  C CG     . LEU A 1 452 ? -87.054  1.693   27.981  1    35.38  ? 752  LEU A CG     1 
ATOM   6863  C CD1    . LEU A 1 452 ? -85.548  1.748   27.864  1    34.95  ? 752  LEU A CD1    1 
ATOM   6864  C CD2    . LEU A 1 452 ? -87.628  0.43    27.37   1    36.99  ? 752  LEU A CD2    1 
ATOM   6865  H H      . LEU A 1 452 ? -88.859  3.62    28.431  0    46.96  ? 752  LEU A H      1 
ATOM   6866  H HA     . LEU A 1 452 ? -89.456  1.033   29.532  0    52.07  ? 752  LEU A HA     1 
ATOM   6867  H HB2    . LEU A 1 452 ? -86.967  2.717   29.83   0    48.42  ? 752  LEU A HB2    1 
ATOM   6868  H HB3    . LEU A 1 452 ? -87.117  0.952   29.963  0    50.56  ? 752  LEU A HB3    1 
ATOM   6869  H HG     . LEU A 1 452 ? -87.416  2.532   27.388  0    47.06  ? 752  LEU A HG     1 
ATOM   6870  H HD11   . LEU A 1 452 ? -85.263  1.631   26.819  0    46.9   ? 752  LEU A HD11   1 
ATOM   6871  H HD12   . LEU A 1 452 ? -85.194  2.708   28.236  0    46.03  ? 752  LEU A HD12   1 
ATOM   6872  H HD13   . LEU A 1 452 ? -85.119  0.939   28.455  0    48.15  ? 752  LEU A HD13   1 
ATOM   6873  H HD21   . LEU A 1 452 ? -87.207  0.303   26.373  0    51.56  ? 752  LEU A HD21   1 
ATOM   6874  H HD22   . LEU A 1 452 ? -87.368  -0.422  27.995  0    52.71  ? 752  LEU A HD22   1 
ATOM   6875  H HD23   . LEU A 1 452 ? -88.711  0.523   27.301  0    51.95  ? 752  LEU A HD23   1 
ATOM   6876  N N      . ARG A 1 453 ? -88.998  3.596   31.563  1    36.48  ? 753  ARG A N      1 
ATOM   6877  C CA     . ARG A 1 453 ? -89.122  4.116   32.922  1    37.56  ? 753  ARG A CA     1 
ATOM   6878  C C      . ARG A 1 453 ? -89.697  5.531   32.873  1    36.58  ? 753  ARG A C      1 
ATOM   6879  O O      . ARG A 1 453 ? -89.566  6.195   31.841  1    34.83  ? 753  ARG A O      1 
ATOM   6880  C CB     . ARG A 1 453 ? -87.739  4.155   33.601  1    37.93  ? 753  ARG A CB     1 
ATOM   6881  C CG     . ARG A 1 453 ? -86.775  5.21    33.03   1    36.01  ? 753  ARG A CG     1 
ATOM   6882  C CD     . ARG A 1 453 ? -85.379  5.11    33.614  1    36.82  ? 753  ARG A CD     1 
ATOM   6883  N NE     . ARG A 1 453 ? -84.778  3.78    33.493  1    37.66  ? 753  ARG A NE     1 
ATOM   6884  C CZ     . ARG A 1 453 ? -84.288  3.261   32.367  1    36.62  ? 753  ARG A CZ     1 
ATOM   6885  N NH1    . ARG A 1 453 ? -84.347  3.949   31.223  1    34.7   ? 753  ARG A NH1    1 
ATOM   6886  N NH2    . ARG A 1 453 ? -83.759  2.041   32.369  1    37.83  ? 753  ARG A NH2    1 
ATOM   6887  H H      . ARG A 1 453 ? -88.765  4.329   30.899  0    48.92  ? 753  ARG A H      1 
ATOM   6888  H HA     . ARG A 1 453 ? -89.786  3.462   33.481  0    54.33  ? 753  ARG A HA     1 
ATOM   6889  H HB2    . ARG A 1 453 ? -87.876  4.366   34.66   0    54.87  ? 753  ARG A HB2    1 
ATOM   6890  H HB3    . ARG A 1 453 ? -87.282  3.175   33.474  0    54.19  ? 753  ARG A HB3    1 
ATOM   6891  H HG2    . ARG A 1 453 ? -86.714  5.089   31.95   0    48.12  ? 753  ARG A HG2    1 
ATOM   6892  H HG3    . ARG A 1 453 ? -87.133  6.21    33.271  0    48.8   ? 753  ARG A HG3    1 
ATOM   6893  H HD2    . ARG A 1 453 ? -84.725  5.825   33.116  0    49.85  ? 753  ARG A HD2    1 
ATOM   6894  H HD3    . ARG A 1 453 ? -85.433  5.34    34.676  0    52.58  ? 753  ARG A HD3    1 
ATOM   6895  H HE     . ARG A 1 453 ? -84.714  3.221   34.339  0    54.76  ? 753  ARG A HE     1 
ATOM   6896  H HH11   . ARG A 1 453 ? -84.729  4.887   31.178  0    45.62  ? 753  ARG A HH11   1 
ATOM   6897  H HH12   . ARG A 1 453 ? -83.968  3.542   30.373  0    46.1   ? 753  ARG A HH12   1 
ATOM   6898  H HH21   . ARG A 1 453 ? -83.717  1.497   33.226  0    55.13  ? 753  ARG A HH21   1 
ATOM   6899  H HH22   . ARG A 1 453 ? -83.392  1.643   31.512  0    52.96  ? 753  ARG A HH22   1 
ATOM   6900  N N      . PRO A 1 454 ? -90.258  6.06    33.973  1    37.98  ? 754  PRO A N      1 
ATOM   6901  C CA     . PRO A 1 454 ? -90.743  7.449   33.941  1    37.3   ? 754  PRO A CA     1 
ATOM   6902  C C      . PRO A 1 454 ? -89.586  8.415   34.145  1    36.18  ? 754  PRO A C      1 
ATOM   6903  O O      . PRO A 1 454 ? -88.669  8.114   34.913  1    36.74  ? 754  PRO A O      1 
ATOM   6904  C CB     . PRO A 1 454 ? -91.743  7.509   35.085  1    39.77  ? 754  PRO A CB     1 
ATOM   6905  C CG     . PRO A 1 454 ? -91.467  6.32    35.927  1    41.76  ? 754  PRO A CG     1 
ATOM   6906  C CD     . PRO A 1 454 ? -90.423  5.467   35.307  1    40.59  ? 754  PRO A CD     1 
ATOM   6907  H HA     . PRO A 1 454 ? -91.264  7.681   33.012  0    51.17  ? 754  PRO A HA     1 
ATOM   6908  H HB2    . PRO A 1 454 ? -91.58   8.419   35.659  0    57.95  ? 754  PRO A HB2    1 
ATOM   6909  H HB3    . PRO A 1 454 ? -92.754  7.495   34.685  0    57.81  ? 754  PRO A HB3    1 
ATOM   6910  H HG2    . PRO A 1 454 ? -91.136  6.656   36.908  0    63.57  ? 754  PRO A HG2    1 
ATOM   6911  H HG3    . PRO A 1 454 ? -92.392  5.752   36.018  0    63.07  ? 754  PRO A HG3    1 
ATOM   6912  H HD2    . PRO A 1 454 ? -89.497  5.522   35.879  0    59.8   ? 754  PRO A HD2    1 
ATOM   6913  H HD3    . PRO A 1 454 ? -90.792  4.445   35.249  0    60.33  ? 754  PRO A HD3    1 
ATOM   6914  N N      . SER A 1 455 ? -89.617  9.556   33.439  1    34.84  ? 755  SER A N      1 
ATOM   6915  C CA     . SER A 1 455 ? -88.552  10.546  33.473  1    33.85  ? 755  SER A CA     1 
ATOM   6916  C C      . SER A 1 455 ? -89.084  11.986  33.58   1    33.66  ? 755  SER A C      1 
ATOM   6917  O O      . SER A 1 455 ? -90.291  12.192  33.638  1    34.22  ? 755  SER A O      1 
ATOM   6918  C CB     . SER A 1 455 ? -87.694  10.377  32.226  1    32.01  ? 755  SER A CB     1 
ATOM   6919  O OG     . SER A 1 455 ? -88.507  10.561  31.081  1    29.54  ? 755  SER A OG     1 
ATOM   6920  H H      . SER A 1 455 ? -90.381  9.818   32.823  0    46.45  ? 755  SER A H      1 
ATOM   6921  H HA     . SER A 1 455 ? -87.934  10.386  34.354  0    45.68  ? 755  SER A HA     1 
ATOM   6922  H HB2    . SER A 1 455 ? -86.886  11.107  32.234  0    39.89  ? 755  SER A HB2    1 
ATOM   6923  H HB3    . SER A 1 455 ? -87.282  9.37    32.213  0    40.88  ? 755  SER A HB3    1 
ATOM   6924  H HG     . SER A 1 455 ? -88.47   11.503  30.769  0    35.75  ? 755  SER A HG     1 
ATOM   6925  N N      . ALA A 1 456 ? -88.17   12.98   33.642  1    32.51  ? 756  ALA A N      1 
ATOM   6926  C CA     . ALA A 1 456 ? -88.48   14.403  33.764  1    31.09  ? 756  ALA A CA     1 
ATOM   6927  C C      . ALA A 1 456 ? -89.644  14.867  32.88   1    29.51  ? 756  ALA A C      1 
ATOM   6928  O O      . ALA A 1 456 ? -90.542  15.539  33.371  1    31.39  ? 756  ALA A O      1 
ATOM   6929  C CB     . ALA A 1 456 ? -87.237  15.225  33.453  1    29.4   ? 756  ALA A CB     1 
ATOM   6930  H H      . ALA A 1 456 ? -87.171  12.798  33.621  0    41.9   ? 756  ALA A H      1 
ATOM   6931  H HA     . ALA A 1 456 ? -88.745  14.6    34.801  0    42.27  ? 756  ALA A HA     1 
ATOM   6932  H HB1    . ALA A 1 456 ? -87.504  16.28   33.42   0    37.71  ? 756  ALA A HB1    1 
ATOM   6933  H HB2    . ALA A 1 456 ? -86.499  15.054  34.234  0    38.67  ? 756  ALA A HB2    1 
ATOM   6934  H HB3    . ALA A 1 456 ? -86.837  14.911  32.49   0    36.15  ? 756  ALA A HB3    1 
ATOM   6935  N N      . SER A 1 457 ? -89.662  14.458  31.603  1    27.13  ? 757  SER A N      1 
ATOM   6936  C CA     . SER A 1 457 ? -90.707  14.838  30.66   1    26.76  ? 757  SER A CA     1 
ATOM   6937  C C      . SER A 1 457 ? -92.059  14.184  30.956  1    29.39  ? 757  SER A C      1 
ATOM   6938  O O      . SER A 1 457 ? -93.084  14.848  30.804  1    30.7   ? 757  SER A O      1 
ATOM   6939  C CB     . SER A 1 457 ? -90.278  14.508  29.236  1    25.21  ? 757  SER A CB     1 
ATOM   6940  O OG     . SER A 1 457 ? -90.112  13.111  29.053  1    24.94  ? 757  SER A OG     1 
ATOM   6941  H H      . SER A 1 457 ? -88.961  13.849  31.193  0    32.81  ? 757  SER A H      1 
ATOM   6942  H HA     . SER A 1 457 ? -90.843  15.919  30.718  0    32.82  ? 757  SER A HA     1 
ATOM   6943  H HB2    . SER A 1 457 ? -91.039  14.865  28.544  0    29.75  ? 757  SER A HB2    1 
ATOM   6944  H HB3    . SER A 1 457 ? -89.329  15.001  29.034  0    28.79  ? 757  SER A HB3    1 
ATOM   6945  H HG     . SER A 1 457 ? -89.242  12.822  29.433  0    28.98  ? 757  SER A HG     1 
ATOM   6946  N N      . THR A 1 458 ? -92.082  12.905  31.369  1    32.03  ? 758  THR A N      1 
ATOM   6947  C CA     . THR A 1 458 ? -93.359  12.238  31.673  1    34.44  ? 758  THR A CA     1 
ATOM   6948  C C      . THR A 1 458 ? -93.918  12.692  33.037  1    36.49  ? 758  THR A C      1 
ATOM   6949  O O      . THR A 1 458 ? -95.13   12.715  33.233  1    38.21  ? 758  THR A O      1 
ATOM   6950  C CB     . THR A 1 458 ? -93.196  10.723  31.65   1    34.66  ? 758  THR A CB     1 
ATOM   6951  O OG1    . THR A 1 458 ? -92.498  10.307  32.835  1    35.25  ? 758  THR A OG1    1 
ATOM   6952  C CG2    . THR A 1 458 ? -92.493  10.224  30.389  1    33.12  ? 758  THR A CG2    1 
ATOM   6953  H H      . THR A 1 458 ? -91.251  12.343  31.532  0    40.81  ? 758  THR A H      1 
ATOM   6954  H HA     . THR A 1 458 ? -94.094  12.492  30.911  0    45.74  ? 758  THR A HA     1 
ATOM   6955  H HB     . THR A 1 458 ? -94.184  10.272  31.646  0    47.57  ? 758  THR A HB     1 
ATOM   6956  H HG1    . THR A 1 458 ? -92.732  9.373   33.065  0    48.88  ? 758  THR A HG1    1 
ATOM   6957  H HG21   . THR A 1 458 ? -92.539  9.137   30.348  0    43.46  ? 758  THR A HG21   1 
ATOM   6958  H HG22   . THR A 1 458 ? -92.988  10.632  29.51   0    42.85  ? 758  THR A HG22   1 
ATOM   6959  H HG23   . THR A 1 458 ? -91.446  10.522  30.381  0    41.79  ? 758  THR A HG23   1 
ATOM   6960  N N      . GLN A 1 459 ? -93.02   13.008  33.979  1    36.75  ? 759  GLN A N      1 
ATOM   6961  C CA     . GLN A 1 459 ? -93.352  13.42   35.335  1    39.2   ? 759  GLN A CA     1 
ATOM   6962  C C      . GLN A 1 459 ? -93.383  14.956  35.51   1    39.49  ? 759  GLN A C      1 
ATOM   6963  O O      . GLN A 1 459 ? -93.012  15.47   36.578  1    41.17  ? 759  GLN A O      1 
ATOM   6964  C CB     . GLN A 1 459 ? -92.327  12.802  36.288  1    40.13  ? 759  GLN A CB     1 
ATOM   6965  C CG     . GLN A 1 459 ? -92.181  11.284  36.131  1    40.18  ? 759  GLN A CG     1 
ATOM   6966  C CD     . GLN A 1 459 ? -91.476  10.685  37.329  1    41.92  ? 759  GLN A CD     1 
ATOM   6967  O OE1    . GLN A 1 459 ? -92.039  9.855   38.059  1    44.11  ? 759  GLN A OE1    1 
ATOM   6968  N NE2    . GLN A 1 459 ? -90.236  11.101  37.583  1    41.32  ? 759  GLN A NE2    1 
ATOM   6969  H H      . GLN A 1 459 ? -92.017  12.961  33.837  0    49.72  ? 759  GLN A H      1 
ATOM   6970  H HA     . GLN A 1 459 ? -94.333  13.038  35.617  0    57.67  ? 759  GLN A HA     1 
ATOM   6971  H HB2    . GLN A 1 459 ? -91.355  13.255  36.095  0    57.07  ? 759  GLN A HB2    1 
ATOM   6972  H HB3    . GLN A 1 459 ? -92.62   12.99   37.319  0    60.51  ? 759  GLN A HB3    1 
ATOM   6973  H HG2    . GLN A 1 459 ? -93.166  10.828  36.045  0    59.27  ? 759  GLN A HG2    1 
ATOM   6974  H HG3    . GLN A 1 459 ? -91.59   11.065  35.242  0    56.26  ? 759  GLN A HG3    1 
ATOM   6975  H HE21   . GLN A 1 459 ? -89.788  11.798  36.997  0    59.25  ? 759  GLN A HE21   1 
ATOM   6976  H HE22   . GLN A 1 459 ? -89.743  10.719  38.383  0    62.52  ? 759  GLN A HE22   1 
ATOM   6977  N N      . ALA A 1 460 ? -93.857  15.684  34.483  1    38.27  ? 760  ALA A N      1 
ATOM   6978  C CA     . ALA A 1 460 ? -93.979  17.137  34.573  1    38.74  ? 760  ALA A CA     1 
ATOM   6979  C C      . ALA A 1 460 ? -95.301  17.488  35.229  1    41.45  ? 760  ALA A C      1 
ATOM   6980  O O      . ALA A 1 460 ? -96.296  16.77   35.058  1    42.45  ? 760  ALA A O      1 
ATOM   6981  C CB     . ALA A 1 460 ? -93.916  17.756  33.192  1    36.75  ? 760  ALA A CB     1 
ATOM   6982  H H      . ALA A 1 460 ? -94.167  15.306  33.594  0    52.99  ? 760  ALA A H      1 
ATOM   6983  H HA     . ALA A 1 460 ? -93.167  17.556  35.165  0    55.36  ? 760  ALA A HA     1 
ATOM   6984  H HB1    . ALA A 1 460 ? -93.954  18.84   33.285  0    51.1   ? 760  ALA A HB1    1 
ATOM   6985  H HB2    . ALA A 1 460 ? -92.983  17.457  32.718  0    49.04  ? 760  ALA A HB2    1 
ATOM   6986  H HB3    . ALA A 1 460 ? -94.764  17.403  32.606  0    50.78  ? 760  ALA A HB3    1 
ATOM   6987  N N      . LEU A 1 461 ? -95.321  18.608  35.946  1    42.94  ? 761  LEU A N      1 
ATOM   6988  C CA     . LEU A 1 461 ? -96.517  19.077  36.635  1    45.98  ? 761  LEU A CA     1 
ATOM   6989  C C      . LEU A 1 461 ? -97.635  19.366  35.619  1    45.76  ? 761  LEU A C      1 
ATOM   6990  O O      . LEU A 1 461 ? -98.723  18.795  35.725  1    47.38  ? 761  LEU A O      1 
ATOM   6991  C CB     . LEU A 1 461 ? -96.177  20.306  37.498  1    47.76  ? 761  LEU A CB     1 
ATOM   6992  C CG     . LEU A 1 461 ? -95.183  20.012  38.63   1    49.06  ? 761  LEU A CG     1 
ATOM   6993  C CD1    . LEU A 1 461 ? -94.722  21.254  39.318  1    51.17  ? 761  LEU A CD1    1 
ATOM   6994  C CD2    . LEU A 1 461 ? -95.796  19.108  39.684  1    51.8   ? 761  LEU A CD2    1 
ATOM   6995  H H      . LEU A 1 461 ? -94.517  19.218  36.043  0    63.9   ? 761  LEU A H      1 
ATOM   6996  H HA     . LEU A 1 461 ? -96.867  18.276  37.285  0    72.58  ? 761  LEU A HA     1 
ATOM   6997  H HB2    . LEU A 1 461 ? -95.743  21.069  36.854  0    73.55  ? 761  LEU A HB2    1 
ATOM   6998  H HB3    . LEU A 1 461 ? -97.093  20.688  37.946  0    77.46  ? 761  LEU A HB3    1 
ATOM   6999  H HG     . LEU A 1 461 ? -94.308  19.507  38.226  0    75.85  ? 761  LEU A HG     1 
ATOM   7000  H HD11   . LEU A 1 461 ? -93.72   21.084  39.709  0    82.23  ? 761  LEU A HD11   1 
ATOM   7001  H HD12   . LEU A 1 461 ? -94.726  22.091  38.624  0    80.91  ? 761  LEU A HD12   1 
ATOM   7002  H HD13   . LEU A 1 461 ? -95.397  21.449  40.15   0    85.29  ? 761  LEU A HD13   1 
ATOM   7003  H HD21   . LEU A 1 461 ? -95.175  19.14   40.578  0    85.94  ? 761  LEU A HD21   1 
ATOM   7004  H HD22   . LEU A 1 461 ? -96.799  19.46   39.921  0    86.3   ? 761  LEU A HD22   1 
ATOM   7005  H HD23   . LEU A 1 461 ? -95.833  18.084  39.313  0    83.06  ? 761  LEU A HD23   1 
ATOM   7006  N N      . SER A 1 462 ? -97.333  20.168  34.593  1    43.82  ? 762  SER A N      1 
ATOM   7007  C CA     . SER A 1 462 ? -98.241  20.454  33.474  1    43.65  ? 762  SER A CA     1 
ATOM   7008  C C      . SER A 1 462 ? -97.525  20.003  32.19   1    40.81  ? 762  SER A C      1 
ATOM   7009  O O      . SER A 1 462 ? -96.297  20.1    32.122  1    38.98  ? 762  SER A O      1 
ATOM   7010  C CB     . SER A 1 462 ? -98.613  21.937  33.418  1    44.75  ? 762  SER A CB     1 
ATOM   7011  O OG     . SER A 1 462 ? -97.525  22.826  33.194  1    42.77  ? 762  SER A OG     1 
ATOM   7012  H H      . SER A 1 462 ? -96.445  20.654  34.514  0    65.01  ? 762  SER A H      1 
ATOM   7013  H HA     . SER A 1 462 ? -99.166  19.886  33.563  0    67.26  ? 762  SER A HA     1 
ATOM   7014  H HB2    . SER A 1 462 ? -99.33   22.074  32.612  0    68.68  ? 762  SER A HB2    1 
ATOM   7015  H HB3    . SER A 1 462 ? -99.093  22.206  34.359  0    70.66  ? 762  SER A HB3    1 
ATOM   7016  H HG     . SER A 1 462 ? -96.648  22.36   33.198  0    62.43  ? 762  SER A HG     1 
ATOM   7017  N N      . SER A 1 463 ? -98.257  19.456  31.208  1    40.84  ? 763  SER A N      1 
ATOM   7018  C CA     . SER A 1 463 ? -97.61   18.995  29.97   1    38.7   ? 763  SER A CA     1 
ATOM   7019  C C      . SER A 1 463 ? -98.436  19.284  28.74   1    39.4   ? 763  SER A C      1 
ATOM   7020  O O      . SER A 1 463 ? -99.649  19.477  28.832  1    41.67  ? 763  SER A O      1 
ATOM   7021  C CB     . SER A 1 463 ? -97.233  17.515  30.039  1    38.2   ? 763  SER A CB     1 
ATOM   7022  O OG     . SER A 1 463 ? -97.524  16.875  31.271  1    40.45  ? 763  SER A OG     1 
ATOM   7023  H H      . SER A 1 463 ? -99.264  19.329  31.232  0    61.35  ? 763  SER A H      1 
ATOM   7024  H HA     . SER A 1 463 ? -96.68   19.545  29.826  0    53.5   ? 763  SER A HA     1 
ATOM   7025  H HB2    . SER A 1 463 ? -97.739  16.987  29.228  0    52.98  ? 763  SER A HB2    1 
ATOM   7026  H HB3    . SER A 1 463 ? -96.157  17.456  29.883  0    52.67  ? 763  SER A HB3    1 
ATOM   7027  H HG     . SER A 1 463 ? -97.611  15.894  31.127  0    58.07  ? 763  SER A HG     1 
ATOM   7028  N N      . SER A 1 464 ? -97.765  19.337  27.589  1    37.92  ? 764  SER A N      1 
ATOM   7029  C CA     . SER A 1 464 ? -98.385  19.629  26.308  1    39.02  ? 764  SER A CA     1 
ATOM   7030  C C      . SER A 1 464 ? -97.716  18.817  25.176  1    37.86  ? 764  SER A C      1 
ATOM   7031  O O      . SER A 1 464 ? -96.632  18.266  25.365  1    35.9   ? 764  SER A O      1 
ATOM   7032  C CB     . SER A 1 464 ? -98.281  21.126  26.033  1    39.49  ? 764  SER A CB     1 
ATOM   7033  O OG     . SER A 1 464 ? -96.937  21.574  26.131  1    37.43  ? 764  SER A OG     1 
ATOM   7034  H H      . SER A 1 464 ? -96.766  19.174  27.518  0    51.68  ? 764  SER A H      1 
ATOM   7035  H HA     . SER A 1 464 ? -99.441  19.365  26.334  0    57.55  ? 764  SER A HA     1 
ATOM   7036  H HB2    . SER A 1 464 ? -98.648  21.323  25.027  0    57.44  ? 764  SER A HB2    1 
ATOM   7037  H HB3    . SER A 1 464 ? -98.901  21.654  26.755  0    58.04  ? 764  SER A HB3    1 
ATOM   7038  H HG     . SER A 1 464 ? -96.787  22.226  26.864  0    52.19  ? 764  SER A HG     1 
ATOM   7039  N N      . VAL A 1 465 ? -98.377  18.725  24.016  1    39.51  ? 765  VAL A N      1 
ATOM   7040  C CA     . VAL A 1 465 ? -97.852  18.032  22.833  1    39.24  ? 765  VAL A CA     1 
ATOM   7041  C C      . VAL A 1 465 ? -98.068  18.969  21.649  1    40.8   ? 765  VAL A C      1 
ATOM   7042  O O      . VAL A 1 465 ? -99.16   19.532  21.524  1    43.19  ? 765  VAL A O      1 
ATOM   7043  C CB     . VAL A 1 465 ? -98.532  16.663  22.577  1    40.62  ? 765  VAL A CB     1 
ATOM   7044  C CG1    . VAL A 1 465 ? -98.247  15.674  23.7    1    39.23  ? 765  VAL A CG1    1 
ATOM   7045  C CG2    . VAL A 1 465 ? -100.038 16.817  22.35   1    43.67  ? 765  VAL A CG2    1 
ATOM   7046  H H      . VAL A 1 465 ? -99.291  19.139  23.861  0    58.68  ? 765  VAL A H      1 
ATOM   7047  H HA     . VAL A 1 465 ? -96.782  17.859  22.931  0    54.33  ? 765  VAL A HA     1 
ATOM   7048  H HB     . VAL A 1 465 ? -98.116  16.245  21.661  0    59.43  ? 765  VAL A HB     1 
ATOM   7049  H HG11   . VAL A 1 465 ? -98.956  14.851  23.633  0    57.85  ? 765  VAL A HG11   1 
ATOM   7050  H HG12   . VAL A 1 465 ? -97.242  15.273  23.584  0    54.69  ? 765  VAL A HG12   1 
ATOM   7051  H HG13   . VAL A 1 465 ? -98.349  16.171  24.663  0    56.35  ? 765  VAL A HG13   1 
ATOM   7052  H HG21   . VAL A 1 465 ? -100.492 15.831  22.268  0    67.27  ? 765  VAL A HG21   1 
ATOM   7053  H HG22   . VAL A 1 465 ? -100.478 17.353  23.19   0    66.36  ? 765  VAL A HG22   1 
ATOM   7054  H HG23   . VAL A 1 465 ? -100.22  17.359  21.423  0    67.37  ? 765  VAL A HG23   1 
ATOM   7055  N N      . SER A 1 466 ? -97.057  19.141  20.78   1    39.85  ? 766  SER A N      1 
ATOM   7056  C CA     . SER A 1 466 ? -97.194  20.073  19.661  1    41.63  ? 766  SER A CA     1 
ATOM   7057  C C      . SER A 1 466 ? -98.284  19.634  18.699  1    44.94  ? 766  SER A C      1 
ATOM   7058  O O      . SER A 1 466 ? -98.255  18.511  18.219  1    45.41  ? 766  SER A O      1 
ATOM   7059  C CB     . SER A 1 466 ? -95.87   20.262  18.921  1    40.46  ? 766  SER A CB     1 
ATOM   7060  O OG     . SER A 1 466 ? -95.058  21.323  19.41   1    38.67  ? 766  SER A OG     1 
ATOM   7061  H H      . SER A 1 466 ? -96.166  18.658  20.832  0    56.02  ? 766  SER A H      1 
ATOM   7062  H HA     . SER A 1 466 ? -97.505  21.03   20.081  0    61.74  ? 766  SER A HA     1 
ATOM   7063  H HB2    . SER A 1 466 ? -95.294  19.339  18.957  0    57.93  ? 766  SER A HB2    1 
ATOM   7064  H HB3    . SER A 1 466 ? -96.106  20.483  17.88   0    60.97  ? 766  SER A HB3    1 
ATOM   7065  H HG     . SER A 1 466 ? -94.767  21.121  20.337  0    53.29  ? 766  SER A HG     1 
ATOM   7066  N N      . SER A 1 467 ? -99.263  20.515  18.449  1    47.46  ? 767  SER A N      1 
ATOM   7067  C CA     . SER A 1 467 ? -100.388 20.246  17.554  1    51.38  ? 767  SER A CA     1 
ATOM   7068  C C      . SER A 1 467 ? -100.17  20.892  16.17   1    53.59  ? 767  SER A C      1 
ATOM   7069  O O      . SER A 1 467 ? -101.148 21.333  15.548  1    57.51  ? 767  SER A O      1 
ATOM   7070  C CB     . SER A 1 467 ? -101.684 20.78   18.171  1    53.37  ? 767  SER A CB     1 
ATOM   7071  O OG     . SER A 1 467 ? -102.84  20.357  17.454  1    57.47  ? 767  SER A OG     1 
ATOM   7072  H H      . SER A 1 467 ? -99.303  21.445  18.855  0    74.03  ? 767  SER A H      1 
ATOM   7073  H HA     . SER A 1 467 ? -100.522 19.175  17.408  0    83.23  ? 767  SER A HA     1 
ATOM   7074  H HB2    . SER A 1 467 ? -101.771 20.423  19.195  0    85.73  ? 767  SER A HB2    1 
ATOM   7075  H HB3    . SER A 1 467 ? -101.637 21.869  18.18   0    87.74  ? 767  SER A HB3    1 
ATOM   7076  H HG     . SER A 1 467 ? -103.042 21.008  16.732  0    98.08  ? 767  SER A HG     1 
ATOM   7077  N N      . SER A 1 468 ? -98.906  20.955  15.684  1    51.59  ? 768  SER A N      1 
ATOM   7078  C CA     . SER A 1 468 ? -98.656  21.554  14.377  1    53.86  ? 768  SER A CA     1 
ATOM   7079  C C      . SER A 1 468 ? -99.127  20.641  13.242  1    57.5   ? 768  SER A C      1 
ATOM   7080  O O      . SER A 1 468 ? -99.028  19.408  13.314  1    56.78  ? 768  SER A O      1 
ATOM   7081  C CB     . SER A 1 468 ? -97.184  21.875  14.18   1    51.28  ? 768  SER A CB     1 
ATOM   7082  O OG     . SER A 1 468 ? -96.98   22.457  12.902  1    53.94  ? 768  SER A OG     1 
ATOM   7083  H H      . SER A 1 468 ? -98.074  20.599  16.144  0    80.92  ? 768  SER A H      1 
ATOM   7084  H HA     . SER A 1 468 ? -99.197  22.497  14.315  0    90.61  ? 768  SER A HA     1 
ATOM   7085  H HB2    . SER A 1 468 ? -96.863  22.574  14.951  0    81.94  ? 768  SER A HB2    1 
ATOM   7086  H HB3    . SER A 1 468 ? -96.604  20.957  14.239  0    81.66  ? 768  SER A HB3    1 
ATOM   7087  H HG     . SER A 1 468 ? -96.009  22.596  12.744  0    88.35  ? 768  SER A HG     1 
ATOM   7088  N N      . LYS A 1 469 ? -99.623  21.282  12.183  1    61.63  ? 769  LYS A N      1 
ATOM   7089  C CA     . LYS A 1 469 ? -100.074 20.653  10.953  1    66.22  ? 769  LYS A CA     1 
ATOM   7090  C C      . LYS A 1 469 ? -99.223  21.23   9.798   1    68.32  ? 769  LYS A C      1 
ATOM   7091  O O      . LYS A 1 469 ? -99.75   21.44   8.701   1    73.3   ? 769  LYS A O      1 
ATOM   7092  C CB     . LYS A 1 469 ? -101.567 20.957  10.757  1    70.41  ? 769  LYS A CB     1 
ATOM   7093  C CG     . LYS A 1 469 ? -102.459 20.354  11.852  1    69.86  ? 769  LYS A CG     1 
ATOM   7094  C CD     . LYS A 1 469 ? -103.948 20.583  11.545  1    75.28  ? 769  LYS A CD     1 
ATOM   7095  C CE     . LYS A 1 469 ? -104.888 19.7    12.34   1    75.21  ? 769  LYS A CE     1 
ATOM   7096  N NZ     . LYS A 1 469 ? -106.317 19.869  11.915  1    81.16  ? 769  LYS A NZ     1 
ATOM   7097  H H      . LYS A 1 469 ? -99.663  22.294  12.114  0    106.66 ? 769  LYS A H      1 
ATOM   7098  H HA     . LYS A 1 469 ? -99.951  19.571  10.965  0    115.94 ? 769  LYS A HA     1 
ATOM   7099  H HB2    . LYS A 1 469 ? -101.703 22.038  10.768  0    125.73 ? 769  LYS A HB2    1 
ATOM   7100  H HB3    . LYS A 1 469 ? -101.895 20.544  9.803   0    129.41 ? 769  LYS A HB3    1 
ATOM   7101  H HG2    . LYS A 1 469 ? -102.282 19.281  11.905  0    123.28 ? 769  LYS A HG2    1 
ATOM   7102  H HG3    . LYS A 1 469 ? -102.23  20.812  12.814  0    120.31 ? 769  LYS A HG3    1 
ATOM   7103  H HD2    . LYS A 1 469 ? -104.195 21.617  11.782  0    135    ? 769  LYS A HD2    1 
ATOM   7104  H HD3    . LYS A 1 469 ? -104.129 20.388  10.488  0    138.84 ? 769  LYS A HD3    1 
ATOM   7105  H HE2    . LYS A 1 469 ? -104.615 18.657  12.185  0    134.95 ? 769  LYS A HE2    1 
ATOM   7106  H HE3    . LYS A 1 469 ? -104.806 19.954  13.397  0    131.68 ? 769  LYS A HE3    1 
ATOM   7107  H HZ1    . LYS A 1 469 ? -106.916 19.273  12.476  0    147.59 ? 769  LYS A HZ1    1 
ATOM   7108  H HZ2    . LYS A 1 469 ? -106.604 20.834  12.045  0    147.69 ? 769  LYS A HZ2    1 
ATOM   7109  H HZ3    . LYS A 1 469 ? -106.424 19.62   10.937  0    150.95 ? 769  LYS A HZ3    1 
ATOM   7110  N N      . LEU A 1 470 ? -97.903  21.492  10.042  1    65.11  ? 770  LEU A N      1 
ATOM   7111  C CA     . LEU A 1 470 ? -97.014  22.028  9.011   1    67.32  ? 770  LEU A CA     1 
ATOM   7112  C C      . LEU A 1 470 ? -96.594  20.927  8.045   1    69.63  ? 770  LEU A C      1 
ATOM   7113  O O      . LEU A 1 470 ? -96.519  21.17   6.83    1    74.5   ? 770  LEU A O      1 
ATOM   7114  C CB     . LEU A 1 470 ? -95.735  22.657  9.608   1    63.19  ? 770  LEU A CB     1 
ATOM   7115  C CG     . LEU A 1 470 ? -95.733  24.138  9.949   1    62.11  ? 770  LEU A CG     1 
ATOM   7116  C CD1    . LEU A 1 470 ? -94.356  24.56   10.39   1    59.24  ? 770  LEU A CD1    1 
ATOM   7117  C CD2    . LEU A 1 470 ? -96.185  25.008  8.765   1    67.09  ? 770  LEU A CD2    1 
ATOM   7118  H H      . LEU A 1 470 ? -97.442  21.321  10.93   0    109.6  ? 770  LEU A H      1 
ATOM   7119  H HA     . LEU A 1 470 ? -97.56   22.763  8.423   0    120.9  ? 770  LEU A HA     1 
ATOM   7120  H HB2    . LEU A 1 470 ? -95.455  22.118  10.511  0    105.25 ? 770  LEU A HB2    1 
ATOM   7121  H HB3    . LEU A 1 470 ? -94.954  22.511  8.865   0    109.97 ? 770  LEU A HB3    1 
ATOM   7122  H HG     . LEU A 1 470 ? -96.425  24.32   10.769  0    104.26 ? 770  LEU A HG     1 
ATOM   7123  H HD11   . LEU A 1 470 ? -94.306  25.646  10.463  0    99.04  ? 770  LEU A HD11   1 
ATOM   7124  H HD12   . LEU A 1 470 ? -94.165  24.12   11.367  0    95.63  ? 770  LEU A HD12   1 
ATOM   7125  H HD13   . LEU A 1 470 ? -93.621  24.202  9.671   0    100.02 ? 770  LEU A HD13   1 
ATOM   7126  H HD21   . LEU A 1 470 ? -95.874  26.039  8.93    0    115.5  ? 770  LEU A HD21   1 
ATOM   7127  H HD22   . LEU A 1 470 ? -95.735  24.632  7.847   0    119.05 ? 770  LEU A HD22   1 
ATOM   7128  H HD23   . LEU A 1 470 ? -97.271  24.992  8.687   0    118.45 ? 770  LEU A HD23   1 
ATOM   7129  N N      . PHE A 1 471 ? -96.3    19.728  8.574   1    66.61  ? 771  PHE A N      1 
ATOM   7130  C CA     . PHE A 1 471 ? -95.845  18.619  7.74    1    68.62  ? 771  PHE A CA     1 
ATOM   7131  C C      . PHE A 1 471 ? -97.016  17.781  7.169   1    73.37  ? 771  PHE A C      1 
ATOM   7132  O O      . PHE A 1 471 ? -96.794  17.042  6.204   1    77.48  ? 771  PHE A O      1 
ATOM   7133  C CB     . PHE A 1 471 ? -94.808  17.799  8.506   1    64.05  ? 771  PHE A CB     1 
ATOM   7134  C CG     . PHE A 1 471 ? -93.701  18.707  9.035   1    60.23  ? 771  PHE A CG     1 
ATOM   7135  C CD1    . PHE A 1 471 ? -93.06   19.611  8.196   1    61.85  ? 771  PHE A CD1    1 
ATOM   7136  C CD2    . PHE A 1 471 ? -93.446  18.798  10.39   1    55.51  ? 771  PHE A CD2    1 
ATOM   7137  C CE1    . PHE A 1 471 ? -92.115  20.506  8.69    1    58.71  ? 771  PHE A CE1    1 
ATOM   7138  C CE2    . PHE A 1 471 ? -92.482  19.681  10.878  1    52.53  ? 771  PHE A CE2    1 
ATOM   7139  C CZ     . PHE A 1 471 ? -91.834  20.538  10.025  1    54.08  ? 771  PHE A CZ     1 
ATOM   7140  H H      . PHE A 1 471 ? -96.372  19.493  9.558   0    113.34 ? 771  PHE A H      1 
ATOM   7141  H HA     . PHE A 1 471 ? -95.33   19.018  6.868   0    123.45 ? 771  PHE A HA     1 
ATOM   7142  H HB2    . PHE A 1 471 ? -95.294  17.295  9.339   0    109.33 ? 771  PHE A HB2    1 
ATOM   7143  H HB3    . PHE A 1 471 ? -94.356  17.071  7.833   0    112.83 ? 771  PHE A HB3    1 
ATOM   7144  H HD1    . PHE A 1 471 ? -93.268  19.603  7.14    0    110.52 ? 771  PHE A HD1    1 
ATOM   7145  H HD2    . PHE A 1 471 ? -93.947  18.124  11.065  0    91.24  ? 771  PHE A HD2    1 
ATOM   7146  H HE1    . PHE A 1 471 ? -91.598  21.167  8.015   0    101.16 ? 771  PHE A HE1    1 
ATOM   7147  H HE2    . PHE A 1 471 ? -92.255  19.697  11.93   0    82.57  ? 771  PHE A HE2    1 
ATOM   7148  H HZ     . PHE A 1 471 ? -91.087  21.216  10.404  0    87.32  ? 771  PHE A HZ     1 
ATOM   7149  N N      . SER A 1 472 ? -98.274  18.006  7.682   1    73.09  ? 772  SER A N      1 
ATOM   7150  C CA     . SER A 1 472 ? -99.574  17.459  7.222   1    77.78  ? 772  SER A CA     1 
ATOM   7151  C C      . SER A 1 472 ? -99.512  15.929  6.973   1    79.11  ? 772  SER A C      1 
ATOM   7152  O O      . SER A 1 472 ? -98.898  15.251  7.814   1    75.03  ? 772  SER A O      1 
ATOM   7153  C CB     . SER A 1 472 ? -100.106 18.262  6.021   1    83.54  ? 772  SER A CB     1 
ATOM   7154  O OG     . SER A 1 472 ? -100.301 19.636  6.323   1    83.43  ? 772  SER A OG     1 
ATOM   7155  H H      . SER A 1 472 ? -98.43   18.606  8.485   0    127.87 ? 772  SER A H      1 
ATOM   7156  H HA     . SER A 1 472 ? -100.29  17.588  8.032   0    139.66 ? 772  SER A HA     1 
ATOM   7157  H HB2    . SER A 1 472 ? -99.414  18.142  5.188   0    155.71 ? 772  SER A HB2    1 
ATOM   7158  H HB3    . SER A 1 472 ? -101.089 17.886  5.746   0    157.24 ? 772  SER A HB3    1 
ATOM   7159  H HG     . SER A 1 472 ? -100.311 19.787  7.306   0    148.6  ? 772  SER A HG     1 
ATOM   7160  N N      . SER A 1 473 ? -100.183 15.369  5.908   1    85.04  ? 773  SER A N      1 
ATOM   7161  C CA     . SER A 1 473 ? -100.159 13.935  5.63    1    87.56  ? 773  SER A CA     1 
ATOM   7162  C C      . SER A 1 473 ? -98.701  13.45   5.454   1    85.48  ? 773  SER A C      1 
ATOM   7163  O O      . SER A 1 473 ? -98.342  12.394  6.003   1    84.1   ? 773  SER A O      1 
ATOM   7164  C CB     . SER A 1 473 ? -101.017 13.596  4.4     1    95     ? 773  SER A CB     1 
ATOM   7165  O OG     . SER A 1 473 ? -100.701 14.384  3.261   1    98.04  ? 773  SER A OG     1 
ATOM   7166  H H      . SER A 1 473 ? -100.762 15.873  5.245   0    161.17 ? 773  SER A H      1 
ATOM   7167  H HA     . SER A 1 473 ? -100.585 13.402  6.48    0    159.91 ? 773  SER A HA     1 
ATOM   7168  H HB2    . SER A 1 473 ? -100.879 12.542  4.163   0    179.92 ? 773  SER A HB2    1 
ATOM   7169  H HB3    . SER A 1 473 ? -102.063 13.759  4.655   0    180.1  ? 773  SER A HB3    1 
ATOM   7170  H HG     . SER A 1 473 ? -101.443 14.329  2.605   0    191.05 ? 773  SER A HG     1 
ATOM   7171  N N      . SER A 1 474 ? -97.858  14.231  4.719   1    85.72  ? 774  SER A N      1 
ATOM   7172  C CA     . SER A 1 474 ? -96.45   13.891  4.437   1    84.4   ? 774  SER A CA     1 
ATOM   7173  C C      . SER A 1 474 ? -96.302  12.692  3.433   1    90.31  ? 774  SER A C      1 
ATOM   7174  O O      . SER A 1 474 ? -95.221  12.584  2.843   1    93.44  ? 774  SER A O      1 
ATOM   7175  C CB     . SER A 1 474 ? -95.637  13.674  5.731   1    78.44  ? 774  SER A CB     1 
ATOM   7176  O OG     . SER A 1 474 ? -95.576  12.345  6.234   1    78.31  ? 774  SER A OG     1 
ATOM   7177  H H      . SER A 1 474 ? -98.134  15.114  4.302   0    159.85 ? 774  SER A H      1 
ATOM   7178  H HA     . SER A 1 474 ? -96.003  14.756  3.949   0    155.57 ? 774  SER A HA     1 
ATOM   7179  H HB2    . SER A 1 474 ? -94.618  14.009  5.546   0    140.24 ? 774  SER A HB2    1 
ATOM   7180  H HB3    . SER A 1 474 ? -96.079  14.293  6.511   0    138.52 ? 774  SER A HB3    1 
ATOM   7181  H HG     . SER A 1 474 ? -96.484  11.944  6.261   0    142.49 ? 774  SER A HG     1 
ATOM   7182  N N      . THR A 1 475 ? -97.4    11.852  3.182   1    92.17  ? 775  THR A N      1 
ATOM   7183  C CA     . THR A 1 475 ? -97.447  10.62   2.345   1    98.24  ? 775  THR A CA     1 
ATOM   7184  C C      . THR A 1 475 ? -96.059  9.882   2.38    1    97.63  ? 775  THR A C      1 
ATOM   7185  O O      . THR A 1 475 ? -95.595  9.362   1.356   1    102.79 ? 775  THR A O      1 
ATOM   7186  C CB     . THR A 1 475 ? -97.998  10.914  0.909   1    105.26 ? 775  THR A CB     1 
ATOM   7187  O OG1    . THR A 1 475 ? -99.246  11.603  1.035   1    106.28 ? 775  THR A OG1    1 
ATOM   7188  C CG2    . THR A 1 475 ? -98.249  9.65    0.085   1    112.03 ? 775  THR A CG2    1 
ATOM   7189  H H      . THR A 1 475 ? -98.321  12.024  3.571   0    171.52 ? 775  THR A H      1 
ATOM   7190  H HA     . THR A 1 475 ? -98.182  9.965   2.81    0    185.13 ? 775  THR A HA     1 
ATOM   7191  H HB     . THR A 1 475 ? -97.288  11.543  0.373   0    201.89 ? 775  THR A HB     1 
ATOM   7192  H HG1    . THR A 1 475 ? -99.566  11.916  0.149   0    208.85 ? 775  THR A HG1    1 
ATOM   7193  H HG21   . THR A 1 475 ? -98.742  9.918   -0.849  0    221.47 ? 775  THR A HG21   1 
ATOM   7194  H HG22   . THR A 1 475 ? -97.303  9.161   -0.143  0    215.64 ? 775  THR A HG22   1 
ATOM   7195  H HG23   . THR A 1 475 ? -98.888  8.96    0.634   0    215.28 ? 775  THR A HG23   1 
ATOM   7196  N N      . ALA A 1 476 ? -95.406  9.857   3.584   1    91.74  ? 776  ALA A N      1 
ATOM   7197  C CA     . ALA A 1 476 ? -94.059  9.318   3.804   1    90.58  ? 776  ALA A CA     1 
ATOM   7198  C C      . ALA A 1 476 ? -94.08   7.849   4.288   1    90.01  ? 776  ALA A C      1 
ATOM   7199  O O      . ALA A 1 476 ? -94.486  7.64    5.437   1    86.93  ? 776  ALA A O      1 
ATOM   7200  C CB     . ALA A 1 476 ? -93.324  10.185  4.829   1    84.7   ? 776  ALA A CB     1 
ATOM   7201  H H      . ALA A 1 476 ? -95.822  10.195  4.446   0    165.32 ? 776  ALA A H      1 
ATOM   7202  H HA     . ALA A 1 476 ? -93.496  9.398   2.876   0    168.67 ? 776  ALA A HA     1 
ATOM   7203  H HB1    . ALA A 1 476 ? -92.32   9.793   4.984   0    150.28 ? 776  ALA A HB1    1 
ATOM   7204  H HB2    . ALA A 1 476 ? -93.265  11.205  4.45    0    152.64 ? 776  ALA A HB2    1 
ATOM   7205  H HB3    . ALA A 1 476 ? -93.87   10.178  5.771   0    148.45 ? 776  ALA A HB3    1 
ATOM   7206  N N      . PRO A 1 477 ? -93.643  6.827   3.469   1    92.94  ? 777  PRO A N      1 
ATOM   7207  C CA     . PRO A 1 477 ? -93.645  5.43    3.967   1    92.6   ? 777  PRO A CA     1 
ATOM   7208  C C      . PRO A 1 477 ? -92.633  5.222   5.105   1    86.28  ? 777  PRO A C      1 
ATOM   7209  O O      . PRO A 1 477 ? -91.436  5.021   4.882   1    85.67  ? 777  PRO A O      1 
ATOM   7210  C CB     . PRO A 1 477 ? -93.319  4.592   2.714   1    98.27  ? 777  PRO A CB     1 
ATOM   7211  C CG     . PRO A 1 477 ? -92.58   5.506   1.821   1    98.47  ? 777  PRO A CG     1 
ATOM   7212  C CD     . PRO A 1 477 ? -93.132  6.892   2.078   1    96.87  ? 777  PRO A CD     1 
ATOM   7213  H HA     . PRO A 1 477 ? -94.643  5.165   4.311   0    170.03 ? 777  PRO A HA     1 
ATOM   7214  H HB2    . PRO A 1 477 ? -92.703  3.735   2.98    0    180.42 ? 777  PRO A HB2    1 
ATOM   7215  H HB3    . PRO A 1 477 ? -94.245  4.266   2.241   0    186.38 ? 777  PRO A HB3    1 
ATOM   7216  H HG2    . PRO A 1 477 ? -91.52   5.47    2.07    0    179.97 ? 777  PRO A HG2    1 
ATOM   7217  H HG3    . PRO A 1 477 ? -92.735  5.214   0.783   0    188.79 ? 777  PRO A HG3    1 
ATOM   7218  H HD2    . PRO A 1 477 ? -92.326  7.62    1.995   0    177.4  ? 777  PRO A HD2    1 
ATOM   7219  H HD3    . PRO A 1 477 ? -93.94   7.115   1.383   0    184.54 ? 777  PRO A HD3    1 
ATOM   7220  N N      . HIS A 1 478 ? -93.142  5.295   6.337   1    82.16  ? 778  HIS A N      1 
ATOM   7221  C CA     . HIS A 1 478 ? -92.365  5.208   7.57    1    76.35  ? 778  HIS A CA     1 
ATOM   7222  C C      . HIS A 1 478 ? -92.742  3.941   8.371   1    75.32  ? 778  HIS A C      1 
ATOM   7223  O O      . HIS A 1 478 ? -92.556  3.938   9.589   1    70.71  ? 778  HIS A O      1 
ATOM   7224  C CB     . HIS A 1 478 ? -92.662  6.474   8.421   1    72.05  ? 778  HIS A CB     1 
ATOM   7225  C CG     . HIS A 1 478 ? -94.061  6.487   8.985   1    71.15  ? 778  HIS A CG     1 
ATOM   7226  N ND1    . HIS A 1 478 ? -95.179  6.325   8.157   1    74.61  ? 778  HIS A ND1    1 
ATOM   7227  C CD2    . HIS A 1 478 ? -94.478  6.529   10.277  1    67.57  ? 778  HIS A CD2    1 
ATOM   7228  C CE1    . HIS A 1 478 ? -96.232  6.322   8.965   1    73.05  ? 778  HIS A CE1    1 
ATOM   7229  N NE2    . HIS A 1 478 ? -95.861  6.442   10.252  1    68.74  ? 778  HIS A NE2    1 
ATOM   7230  H H      . HIS A 1 478 ? -94.137  5.399   6.506   0    147.24 ? 778  HIS A H      1 
ATOM   7231  H HA     . HIS A 1 478 ? -91.296  5.178   7.365   0    132.65 ? 778  HIS A HA     1 
ATOM   7232  H HB2    . HIS A 1 478 ? -91.962  6.52    9.255   0    120.26 ? 778  HIS A HB2    1 
ATOM   7233  H HB3    . HIS A 1 478 ? -92.547  7.357   7.794   0    125.35 ? 778  HIS A HB3    1 
ATOM   7234  H HD2    . HIS A 1 478 ? -93.857  6.605   11.154  0    111.78 ? 778  HIS A HD2    1 
ATOM   7235  H HE1    . HIS A 1 478 ? -97.253  6.244   8.632   0    132.24 ? 778  HIS A HE1    1 
ATOM   7236  H HE2    . HIS A 1 478 ? -96.481  6.463   11.055  0    117.77 ? 778  HIS A HE2    1 
ATOM   7237  N N      . GLU A 1 479 ? -93.253  2.868   7.719   1    79.7   ? 779  GLU A N      1 
ATOM   7238  C CA     . GLU A 1 479 ? -93.683  1.674   8.449   1    79.05  ? 779  GLU A CA     1 
ATOM   7239  C C      . GLU A 1 479 ? -92.602  1.114   9.393   1    74.74  ? 779  GLU A C      1 
ATOM   7240  O O      . GLU A 1 479 ? -91.461  0.907   8.982   1    75.28  ? 779  GLU A O      1 
ATOM   7241  C CB     . GLU A 1 479 ? -94.217  0.59    7.491   1    84.91  ? 779  GLU A CB     1 
ATOM   7242  C CG     . GLU A 1 479 ? -95.038  -0.501  8.172   1    85.49  ? 779  GLU A CG     1 
ATOM   7243  C CD     . GLU A 1 479 ? -96.271  -0.074  8.955   1    84.23  ? 779  GLU A CD     1 
ATOM   7244  O OE1    . GLU A 1 479 ? -97.25   -0.857  8.962   1    85.55  ? 779  GLU A OE1    1 
ATOM   7245  O OE2    . GLU A 1 479 ? -96.264  1.022   9.568   1    82.11  ? 779  GLU A OE2    1 
ATOM   7246  H H      . GLU A 1 479 ? -93.352  2.789   6.713   0    145.29 ? 779  GLU A H      1 
ATOM   7247  H HA     . GLU A 1 479 ? -94.511  1.999   9.077   0    138.53 ? 779  GLU A HA     1 
ATOM   7248  H HB2    . GLU A 1 479 ? -94.859  1.062   6.748   0    156.47 ? 779  GLU A HB2    1 
ATOM   7249  H HB3    . GLU A 1 479 ? -93.373  0.11    6.998   0    154.56 ? 779  GLU A HB3    1 
ATOM   7250  H HG2    . GLU A 1 479 ? -95.384  -1.185  7.399   0    159.17 ? 779  GLU A HG2    1 
ATOM   7251  H HG3    . GLU A 1 479 ? -94.398  -1.041  8.867   0    151.71 ? 779  GLU A HG3    1 
ATOM   7252  N N      . THR A 1 480 ? -92.987  0.917   10.671  1    71     ? 780  THR A N      1 
ATOM   7253  C CA     . THR A 1 480 ? -92.127  0.495   11.783  1    67.04  ? 780  THR A CA     1 
ATOM   7254  C C      . THR A 1 480 ? -92.523  -0.852  12.393  1    67.14  ? 780  THR A C      1 
ATOM   7255  O O      . THR A 1 480 ? -93.703  -1.096  12.665  1    67.18  ? 780  THR A O      1 
ATOM   7256  C CB     . THR A 1 480 ? -92.204  1.542   12.904  1    62.22  ? 780  THR A CB     1 
ATOM   7257  O OG1    . THR A 1 480 ? -93.583  1.817   13.183  1    61.92  ? 780  THR A OG1    1 
ATOM   7258  C CG2    . THR A 1 480 ? -91.48   2.833   12.554  1    61.8   ? 780  THR A CG2    1 
ATOM   7259  H H      . THR A 1 480 ? -93.956  1.018   10.959  0    122.72 ? 780  THR A H      1 
ATOM   7260  H HA     . THR A 1 480 ? -91.089  0.423   11.46   0    114.67 ? 780  THR A HA     1 
ATOM   7261  H HB     . THR A 1 480 ? -91.734  1.135   13.797  0    101.31 ? 780  THR A HB     1 
ATOM   7262  H HG1    . THR A 1 480 ? -93.948  1.171   13.843  0    104.04 ? 780  THR A HG1    1 
ATOM   7263  H HG21   . THR A 1 480 ? -91.534  3.527   13.393  0    98.59  ? 780  THR A HG21   1 
ATOM   7264  H HG22   . THR A 1 480 ? -90.434  2.624   12.332  0    102.04 ? 780  THR A HG22   1 
ATOM   7265  H HG23   . THR A 1 480 ? -91.942  3.289   11.68   0    104.28 ? 780  THR A HG23   1 
ATOM   7266  N N      . SER A 1 481 ? -91.507  -1.691  12.668  1    67.24  ? 781  SER A N      1 
ATOM   7267  C CA     . SER A 1 481 ? -91.652  -2.999  13.303  1    67.45  ? 781  SER A CA     1 
ATOM   7268  C C      . SER A 1 481 ? -91.608  -2.861  14.848  1    62.77  ? 781  SER A C      1 
ATOM   7269  O O      . SER A 1 481 ? -91.211  -1.821  15.374  1    59.45  ? 781  SER A O      1 
ATOM   7270  C CB     . SER A 1 481 ? -90.533  -3.925  12.832  1    69.39  ? 781  SER A CB     1 
ATOM   7271  O OG     . SER A 1 481 ? -90.456  -3.975  11.417  1    73.75  ? 781  SER A OG     1 
ATOM   7272  H H      . SER A 1 481 ? -90.536  -1.484  12.454  0    113.91 ? 781  SER A H      1 
ATOM   7273  H HA     . SER A 1 481 ? -92.601  -3.45   13.019  0    118.08 ? 781  SER A HA     1 
ATOM   7274  H HB2    . SER A 1 481 ? -89.586  -3.557  13.222  0    116.85 ? 781  SER A HB2    1 
ATOM   7275  H HB3    . SER A 1 481 ? -90.727  -4.927  13.21   0    120.35 ? 781  SER A HB3    1 
ATOM   7276  H HG     . SER A 1 481 ? -89.708  -4.566  11.14   0    130.31 ? 781  SER A HG     1 
ATOM   7277  N N      . PHE A 1 482 ? -92.003  -3.918  15.57   1    62.85  ? 782  PHE A N      1 
ATOM   7278  C CA     . PHE A 1 482 ? -92.019  -3.91   17.032  1    59     ? 782  PHE A CA     1 
ATOM   7279  C C      . PHE A 1 482 ? -90.625  -3.913  17.613  1    56.59  ? 782  PHE A C      1 
ATOM   7280  O O      . PHE A 1 482 ? -89.685  -4.364  16.968  1    58.43  ? 782  PHE A O      1 
ATOM   7281  C CB     . PHE A 1 482 ? -92.808  -5.102  17.571  1    60.32  ? 782  PHE A CB     1 
ATOM   7282  C CG     . PHE A 1 482 ? -94.243  -5.113  17.115  1    62.97  ? 782  PHE A CG     1 
ATOM   7283  C CD1    . PHE A 1 482 ? -95.08   -4.055  17.395  1    61.21  ? 782  PHE A CD1    1 
ATOM   7284  C CD2    . PHE A 1 482 ? -94.739  -6.156  16.364  1    67.58  ? 782  PHE A CD2    1 
ATOM   7285  C CE1    . PHE A 1 482 ? -96.383  -4.052  16.956  1    63.92  ? 782  PHE A CE1    1 
ATOM   7286  C CE2    . PHE A 1 482 ? -96.049  -6.155  15.943  1    70.39  ? 782  PHE A CE2    1 
ATOM   7287  C CZ     . PHE A 1 482 ? -96.865  -5.106  16.252  1    68.51  ? 782  PHE A CZ     1 
ATOM   7288  H H      . PHE A 1 482 ? -92.292  -4.799  15.158  0    109.05 ? 782  PHE A H      1 
ATOM   7289  H HA     . PHE A 1 482 ? -92.55   -3.026  17.369  0    96.69  ? 782  PHE A HA     1 
ATOM   7290  H HB2    . PHE A 1 482 ? -92.327  -6.018  17.233  0    103.71 ? 782  PHE A HB2    1 
ATOM   7291  H HB3    . PHE A 1 482 ? -92.806  -5.062  18.659  0    99.71  ? 782  PHE A HB3    1 
ATOM   7292  H HD1    . PHE A 1 482 ? -94.71   -3.217  17.958  0    101.25 ? 782  PHE A HD1    1 
ATOM   7293  H HD2    . PHE A 1 482 ? -94.118  -7.001  16.128  0    119.23 ? 782  PHE A HD2    1 
ATOM   7294  H HE1    . PHE A 1 482 ? -97.03   -3.232  17.192  0    109.71 ? 782  PHE A HE1    1 
ATOM   7295  H HE2    . PHE A 1 482 ? -96.43   -6.993  15.377  0    128.05 ? 782  PHE A HE2    1 
ATOM   7296  H HZ     . PHE A 1 482 ? -97.883  -5.105  15.907  0    123.16 ? 782  PHE A HZ     1 
ATOM   7297  N N      . GLY A 1 483 ? -90.491  -3.406  18.822  1    52.87  ? 783  GLY A N      1 
ATOM   7298  C CA     . GLY A 1 483 ? -89.207  -3.374  19.505  1    50.61  ? 783  GLY A CA     1 
ATOM   7299  C C      . GLY A 1 483 ? -88.235  -2.297  19.055  1    49.57  ? 783  GLY A C      1 
ATOM   7300  O O      . GLY A 1 483 ? -87.227  -2.088  19.728  1    47.92  ? 783  GLY A O      1 
ATOM   7301  H H      . GLY A 1 483 ? -91.252  -3.008  19.362  0    84.35  ? 783  GLY A H      1 
ATOM   7302  H HA2    . GLY A 1 483 ? -89.39   -3.224  20.567  0    78.75  ? 783  GLY A HA2    1 
ATOM   7303  H HA3    . GLY A 1 483 ? -88.712  -4.339  19.395  0    81.88  ? 783  GLY A HA3    1 
ATOM   7304  N N      . GLU A 1 484 ? -88.494  -1.613  17.927  1    50.72  ? 784  GLU A N      1 
ATOM   7305  C CA     . GLU A 1 484 ? -87.595  -0.561  17.447  1    50.08  ? 784  GLU A CA     1 
ATOM   7306  C C      . GLU A 1 484 ? -87.593  0.612   18.401  1    46.59  ? 784  GLU A C      1 
ATOM   7307  O O      . GLU A 1 484 ? -88.653  0.996   18.881  1    45.98  ? 784  GLU A O      1 
ATOM   7308  C CB     . GLU A 1 484 ? -88.027  -0.052  16.059  1    53.01  ? 784  GLU A CB     1 
ATOM   7309  C CG     . GLU A 1 484 ? -87.69   -1.009  14.928  1    56.76  ? 784  GLU A CG     1 
ATOM   7310  C CD     . GLU A 1 484 ? -88.214  -0.606  13.561  1    60.02  ? 784  GLU A CD     1 
ATOM   7311  O OE1    . GLU A 1 484 ? -88.189  -1.458  12.641  1    63.99  ? 784  GLU A OE1    1 
ATOM   7312  O OE2    . GLU A 1 484 ? -88.676  0.551   13.416  1    58.88  ? 784  GLU A OE2    1 
ATOM   7313  H H      . GLU A 1 484 ? -89.3    -1.766  17.33   0    81.42  ? 784  GLU A H      1 
ATOM   7314  H HA     . GLU A 1 484 ? -86.583  -0.957  17.379  0    77.65  ? 784  GLU A HA     1 
ATOM   7315  H HB2    . GLU A 1 484 ? -89.103  0.122   16.053  0    84.01  ? 784  GLU A HB2    1 
ATOM   7316  H HB3    . GLU A 1 484 ? -87.516  0.89    15.861  0    82.04  ? 784  GLU A HB3    1 
ATOM   7317  H HG2    . GLU A 1 484 ? -86.606  -1.078  14.848  0    91.01  ? 784  GLU A HG2    1 
ATOM   7318  H HG3    . GLU A 1 484 ? -88.103  -1.989  15.167  0    92.71  ? 784  GLU A HG3    1 
ATOM   7319  N N      . GLU A 1 485 ? -86.425  1.185   18.68   1    44.69  ? 785  GLU A N      1 
ATOM   7320  C CA     . GLU A 1 485 ? -86.336  2.356   19.549  1    41.8   ? 785  GLU A CA     1 
ATOM   7321  C C      . GLU A 1 485 ? -86.645  3.621   18.751  1    42.2   ? 785  GLU A C      1 
ATOM   7322  O O      . GLU A 1 485 ? -86.372  3.658   17.554  1    44.4   ? 785  GLU A O      1 
ATOM   7323  C CB     . GLU A 1 485 ? -84.911  2.511   20.094  1    40.14  ? 785  GLU A CB     1 
ATOM   7324  C CG     . GLU A 1 485 ? -84.491  1.494   21.139  1    39.29  ? 785  GLU A CG     1 
ATOM   7325  C CD     . GLU A 1 485 ? -83.19   1.806   21.857  1    37.79  ? 785  GLU A CD     1 
ATOM   7326  O OE1    . GLU A 1 485 ? -82.455  2.72    21.406  1    37.57  ? 785  GLU A OE1    1 
ATOM   7327  O OE2    . GLU A 1 485 ? -82.923  1.153   22.895  1    37.33  ? 785  GLU A OE2    1 
ATOM   7328  H H      . GLU A 1 485 ? -85.53   0.864   18.324  0    66.55  ? 785  GLU A H      1 
ATOM   7329  H HA     . GLU A 1 485 ? -87.021  2.27    20.392  0    58.8   ? 785  GLU A HA     1 
ATOM   7330  H HB2    . GLU A 1 485 ? -84.199  2.44    19.273  0    57.4   ? 785  GLU A HB2    1 
ATOM   7331  H HB3    . GLU A 1 485 ? -84.836  3.499   20.546  0    54.58  ? 785  GLU A HB3    1 
ATOM   7332  H HG2    . GLU A 1 485 ? -85.24   1.489   21.925  0    54.45  ? 785  GLU A HG2    1 
ATOM   7333  H HG3    . GLU A 1 485 ? -84.412  0.507   20.686  0    57.04  ? 785  GLU A HG3    1 
ATOM   7334  N N      . VAL A 1 486 ? -87.169  4.664   19.408  1    39.6   ? 786  VAL A N      1 
ATOM   7335  C CA     . VAL A 1 486 ? -87.388  5.994   18.811  1    39.16  ? 786  VAL A CA     1 
ATOM   7336  C C      . VAL A 1 486 ? -87.126  7.023   19.888  1    35.24  ? 786  VAL A C      1 
ATOM   7337  O O      . VAL A 1 486 ? -87.48   6.778   21.037  1    33.36  ? 786  VAL A O      1 
ATOM   7338  C CB     . VAL A 1 486 ? -88.79   6.253   18.19   1    41.93  ? 786  VAL A CB     1 
ATOM   7339  C CG1    . VAL A 1 486 ? -89.049  5.376   16.969  1    45.49  ? 786  VAL A CG1    1 
ATOM   7340  C CG2    . VAL A 1 486 ? -89.901  6.098   19.211  1    40.89  ? 786  VAL A CG2    1 
ATOM   7341  H H      . VAL A 1 486 ? -87.476  4.606   20.374  0    53.79  ? 786  VAL A H      1 
ATOM   7342  H HA     . VAL A 1 486 ? -86.654  6.156   18.024  0    54.58  ? 786  VAL A HA     1 
ATOM   7343  H HB     . VAL A 1 486 ? -88.818  7.286   17.844  0    58.57  ? 786  VAL A HB     1 
ATOM   7344  H HG11   . VAL A 1 486 ? -90.026  5.618   16.554  0    67.75  ? 786  VAL A HG11   1 
ATOM   7345  H HG12   . VAL A 1 486 ? -88.279  5.574   16.225  0    67     ? 786  VAL A HG12   1 
ATOM   7346  H HG13   . VAL A 1 486 ? -89.013  4.331   17.272  0    66.78  ? 786  VAL A HG13   1 
ATOM   7347  H HG21   . VAL A 1 486 ? -90.844  6.229   18.685  0    58.58  ? 786  VAL A HG21   1 
ATOM   7348  H HG22   . VAL A 1 486 ? -89.848  5.106   19.657  0    57.45  ? 786  VAL A HG22   1 
ATOM   7349  H HG23   . VAL A 1 486 ? -89.815  6.86    19.984  0    55.24  ? 786  VAL A HG23   1 
ATOM   7350  N N      . GLU A 1 487 ? -86.526  8.17    19.545  1    34.78  ? 787  GLU A N      1 
ATOM   7351  C CA     . GLU A 1 487 ? -86.328  9.234   20.528  1    32.03  ? 787  GLU A CA     1 
ATOM   7352  C C      . GLU A 1 487 ? -87.576  10.112  20.569  1    31.79  ? 787  GLU A C      1 
ATOM   7353  O O      . GLU A 1 487 ? -88.245  10.289  19.555  1    33.77  ? 787  GLU A O      1 
ATOM   7354  C CB     . GLU A 1 487 ? -85.135  10.116  20.172  1    31.59  ? 787  GLU A CB     1 
ATOM   7355  C CG     . GLU A 1 487 ? -83.831  9.378   20.021  1    31.62  ? 787  GLU A CG     1 
ATOM   7356  C CD     . GLU A 1 487 ? -82.623  10.296  20.148  1    30.44  ? 787  GLU A CD     1 
ATOM   7357  O OE1    . GLU A 1 487 ? -82.756  11.516  19.897  1    30.38  ? 787  GLU A OE1    1 
ATOM   7358  O OE2    . GLU A 1 487 ? -81.542  9.799   20.534  1    29.77  ? 787  GLU A OE2    1 
ATOM   7359  H H      . GLU A 1 487 ? -86.164  8.384   18.621  0    46.36  ? 787  GLU A H      1 
ATOM   7360  H HA     . GLU A 1 487 ? -86.156  8.819   21.52   0    39.21  ? 787  GLU A HA     1 
ATOM   7361  H HB2    . GLU A 1 487 ? -85.34   10.626  19.233  0    40.17  ? 787  GLU A HB2    1 
ATOM   7362  H HB3    . GLU A 1 487 ? -84.985  10.844  20.968  0    37.83  ? 787  GLU A HB3    1 
ATOM   7363  H HG2    . GLU A 1 487 ? -83.772  8.618   20.8    0    38.75  ? 787  GLU A HG2    1 
ATOM   7364  H HG3    . GLU A 1 487 ? -83.799  8.912   19.038  0    40.79  ? 787  GLU A HG3    1 
ATOM   7365  N N      . VAL A 1 488 ? -87.866  10.682  21.73   1    29.52  ? 788  VAL A N      1 
ATOM   7366  C CA     . VAL A 1 488 ? -88.988  11.583  21.908  1    29.33  ? 788  VAL A CA     1 
ATOM   7367  C C      . VAL A 1 488 ? -88.417  12.851  22.526  1    27.33  ? 788  VAL A C      1 
ATOM   7368  O O      . VAL A 1 488 ? -87.945  12.831  23.673  1    25.8   ? 788  VAL A O      1 
ATOM   7369  C CB     . VAL A 1 488 ? -90.071  10.97   22.797  1    29.36  ? 788  VAL A CB     1 
ATOM   7370  C CG1    . VAL A 1 488 ? -91.25   11.921  22.945  1    29.38  ? 788  VAL A CG1    1 
ATOM   7371  C CG2    . VAL A 1 488 ? -90.515  9.639   22.235  1    31.24  ? 788  VAL A CG2    1 
ATOM   7372  H H      . VAL A 1 488 ? -87.328  10.545  22.58   0    34.85  ? 788  VAL A H      1 
ATOM   7373  H HA     . VAL A 1 488 ? -89.439  11.835  20.95   0    36.54  ? 788  VAL A HA     1 
ATOM   7374  H HB     . VAL A 1 488 ? -89.666  10.803  23.793  0    35.08  ? 788  VAL A HB     1 
ATOM   7375  H HG11   . VAL A 1 488 ? -92.075  11.397  23.424  0    37.07  ? 788  VAL A HG11   1 
ATOM   7376  H HG12   . VAL A 1 488 ? -90.968  12.769  23.568  0    35.45  ? 788  VAL A HG12   1 
ATOM   7377  H HG13   . VAL A 1 488 ? -91.552  12.266  21.958  0    37.39  ? 788  VAL A HG13   1 
ATOM   7378  H HG21   . VAL A 1 488 ? -91.373  9.284   22.802  0    40.25  ? 788  VAL A HG21   1 
ATOM   7379  H HG22   . VAL A 1 488 ? -90.78   9.772   21.186  0    40.84  ? 788  VAL A HG22   1 
ATOM   7380  H HG23   . VAL A 1 488 ? -89.7    8.922   22.32   0    39.46  ? 788  VAL A HG23   1 
ATOM   7381  N N      . HIS A 1 489 ? -88.426  13.954  21.757  1    27.79  ? 789  HIS A N      1 
ATOM   7382  C CA     . HIS A 1 489 ? -87.855  15.223  22.204  1    26.34  ? 789  HIS A CA     1 
ATOM   7383  C C      . HIS A 1 489 ? -88.886  16.114  22.907  1    25.89  ? 789  HIS A C      1 
ATOM   7384  O O      . HIS A 1 489 ? -90.064  16.154  22.531  1    27.08  ? 789  HIS A O      1 
ATOM   7385  C CB     . HIS A 1 489 ? -87.15   15.929  21.03   1    27.27  ? 789  HIS A CB     1 
ATOM   7386  C CG     . HIS A 1 489 ? -85.909  15.199  20.619  1    27.82  ? 789  HIS A CG     1 
ATOM   7387  N ND1    . HIS A 1 489 ? -84.66   15.611  21.04   1    26.57  ? 789  HIS A ND1    1 
ATOM   7388  C CD2    . HIS A 1 489 ? -85.78   14.041  19.936  1    29.88  ? 789  HIS A CD2    1 
ATOM   7389  C CE1    . HIS A 1 489 ? -83.811  14.732  20.544  1    27.6   ? 789  HIS A CE1    1 
ATOM   7390  N NE2    . HIS A 1 489 ? -84.444  13.756  19.895  1    29.71  ? 789  HIS A NE2    1 
ATOM   7391  H H      . HIS A 1 489 ? -88.828  13.999  20.826  0    33.48  ? 789  HIS A H      1 
ATOM   7392  H HA     . HIS A 1 489 ? -87.067  15.011  22.925  0    28.9   ? 789  HIS A HA     1 
ATOM   7393  H HB2    . HIS A 1 489 ? -87.821  15.979  20.174  0    32.4   ? 789  HIS A HB2    1 
ATOM   7394  H HB3    . HIS A 1 489 ? -86.864  16.933  21.339  0    30.69  ? 789  HIS A HB3    1 
ATOM   7395  H HD2    . HIS A 1 489 ? -86.575  13.457  19.504  0    36.67  ? 789  HIS A HD2    1 
ATOM   7396  H HE1    . HIS A 1 489 ? -82.743  14.793  20.66   0    31.53  ? 789  HIS A HE1    1 
ATOM   7397  H HE2    . HIS A 1 489 ? -84.013  12.952  19.45   0    36.18  ? 789  HIS A HE2    1 
ATOM   7398  N N      . ASN A 1 490 ? -88.431  16.768  23.987  1    24.71  ? 790  ASN A N      1 
ATOM   7399  C CA     . ASN A 1 490 ? -89.253  17.632  24.812  1    24.7   ? 790  ASN A CA     1 
ATOM   7400  C C      . ASN A 1 490 ? -88.49   18.891  25.199  1    24.34  ? 790  ASN A C      1 
ATOM   7401  O O      . ASN A 1 490 ? -87.263  18.906  25.195  1    23.92  ? 790  ASN A O      1 
ATOM   7402  C CB     . ASN A 1 490 ? -89.653  16.903  26.098  1    24.59  ? 790  ASN A CB     1 
ATOM   7403  C CG     . ASN A 1 490 ? -90.061  15.477  25.919  1    24.94  ? 790  ASN A CG     1 
ATOM   7404  O OD1    . ASN A 1 490 ? -91.248  15.186  25.83   1    25.93  ? 790  ASN A OD1    1 
ATOM   7405  N ND2    . ASN A 1 490 ? -89.09   14.564  25.875  1    24.45  ? 790  ASN A ND2    1 
ATOM   7406  H H      . ASN A 1 490 ? -87.471  16.722  24.314  0    26.61  ? 790  ASN A H      1 
ATOM   7407  H HA     . ASN A 1 490 ? -90.158  17.931  24.285  0    28.05  ? 790  ASN A HA     1 
ATOM   7408  H HB2    . ASN A 1 490 ? -88.815  16.929  26.792  0    26.85  ? 790  ASN A HB2    1 
ATOM   7409  H HB3    . ASN A 1 490 ? -90.502  17.427  26.536  0    27.97  ? 790  ASN A HB3    1 
ATOM   7410  H HD21   . ASN A 1 490 ? -89.325  13.584  25.755  0    27.33  ? 790  ASN A HD21   1 
ATOM   7411  H HD22   . ASN A 1 490 ? -88.119  14.845  25.961  0    26.38  ? 790  ASN A HD22   1 
ATOM   7412  N N      . LEU A 1 491 ? -89.225  19.937  25.557  1    24.85  ? 791  LEU A N      1 
ATOM   7413  C CA     . LEU A 1 491 ? -88.659  21.152  26.101  1    25.05  ? 791  LEU A CA     1 
ATOM   7414  C C      . LEU A 1 491 ? -89.158  21.184  27.54   1    25.9   ? 791  LEU A C      1 
ATOM   7415  O O      . LEU A 1 491 ? -90.364  21.285  27.761  1    26.66  ? 791  LEU A O      1 
ATOM   7416  C CB     . LEU A 1 491 ? -89.144  22.387  25.348  1    25.57  ? 791  LEU A CB     1 
ATOM   7417  C CG     . LEU A 1 491 ? -88.854  23.742  26.016  1    26.28  ? 791  LEU A CG     1 
ATOM   7418  C CD1    . LEU A 1 491 ? -87.376  24.02   26.09   1    26.01  ? 791  LEU A CD1    1 
ATOM   7419  C CD2    . LEU A 1 491 ? -89.529  24.845  25.267  1    26.92  ? 791  LEU A CD2    1 
ATOM   7420  H H      . LEU A 1 491 ? -90.237  19.964  25.484  0    28.41  ? 791  LEU A H      1 
ATOM   7421  H HA     . LEU A 1 491 ? -87.571  21.127  26.081  0    27.44  ? 791  LEU A HA     1 
ATOM   7422  H HB2    . LEU A 1 491 ? -88.669  22.4    24.369  0    29.24  ? 791  LEU A HB2    1 
ATOM   7423  H HB3    . LEU A 1 491 ? -90.224  22.313  25.224  0    30.14  ? 791  LEU A HB3    1 
ATOM   7424  H HG     . LEU A 1 491 ? -89.253  23.765  27.029  0    31.32  ? 791  LEU A HG     1 
ATOM   7425  H HD11   . LEU A 1 491 ? -87.227  24.979  26.583  0    30.59  ? 791  LEU A HD11   1 
ATOM   7426  H HD12   . LEU A 1 491 ? -86.863  23.239  26.648  0    29.43  ? 791  LEU A HD12   1 
ATOM   7427  H HD13   . LEU A 1 491 ? -87.01   24.076  25.067  0    29.7   ? 791  LEU A HD13   1 
ATOM   7428  H HD21   . LEU A 1 491 ? -89.31   25.794  25.756  0    33.21  ? 791  LEU A HD21   1 
ATOM   7429  H HD22   . LEU A 1 491 ? -89.158  24.861  24.244  0    32.55  ? 791  LEU A HD22   1 
ATOM   7430  H HD23   . LEU A 1 491 ? -90.604  24.668  25.268  0    33.41  ? 791  LEU A HD23   1 
ATOM   7431  N N      . LEU A 1 492 ? -88.247  21.078  28.505  1    26.29  ? 792  LEU A N      1 
ATOM   7432  C CA     . LEU A 1 492 ? -88.56   21.089  29.926  1    27.9   ? 792  LEU A CA     1 
ATOM   7433  C C      . LEU A 1 492 ? -88.384  22.511  30.472  1    29.7   ? 792  LEU A C      1 
ATOM   7434  O O      . LEU A 1 492 ? -87.434  23.188  30.085  1    29.58  ? 792  LEU A O      1 
ATOM   7435  C CB     . LEU A 1 492 ? -87.591  20.162  30.666  1    27.99  ? 792  LEU A CB     1 
ATOM   7436  C CG     . LEU A 1 492 ? -87.484  18.738  30.162  1    26.48  ? 792  LEU A CG     1 
ATOM   7437  C CD1    . LEU A 1 492 ? -86.42   17.992  30.896  1    26.81  ? 792  LEU A CD1    1 
ATOM   7438  C CD2    . LEU A 1 492 ? -88.788  18.02   30.306  1    26.65  ? 792  LEU A CD2    1 
ATOM   7439  H H      . LEU A 1 492 ? -87.251  20.983  28.329  0    29.56  ? 792  LEU A H      1 
ATOM   7440  H HA     . LEU A 1 492 ? -89.58   20.753  30.109  0    33.77  ? 792  LEU A HA     1 
ATOM   7441  H HB2    . LEU A 1 492 ? -86.596  20.6    30.604  0    33.04  ? 792  LEU A HB2    1 
ATOM   7442  H HB3    . LEU A 1 492 ? -87.896  20.114  31.71   0    34.5   ? 792  LEU A HB3    1 
ATOM   7443  H HG     . LEU A 1 492 ? -87.215  18.74   29.107  0    29.61  ? 792  LEU A HG     1 
ATOM   7444  H HD11   . LEU A 1 492 ? -86.344  16.985  30.488  0    30.71  ? 792  LEU A HD11   1 
ATOM   7445  H HD12   . LEU A 1 492 ? -85.472  18.512  30.774  0    31.02  ? 792  LEU A HD12   1 
ATOM   7446  H HD13   . LEU A 1 492 ? -86.686  17.946  31.951  0    32.48  ? 792  LEU A HD13   1 
ATOM   7447  H HD21   . LEU A 1 492 ? -88.644  16.969  30.062  0    30.95  ? 792  LEU A HD21   1 
ATOM   7448  H HD22   . LEU A 1 492 ? -89.139  18.119  31.331  0    32.53  ? 792  LEU A HD22   1 
ATOM   7449  H HD23   . LEU A 1 492 ? -89.514  18.455  29.621  0    31.25  ? 792  LEU A HD23   1 
ATOM   7450  N N      . ILE A 1 493 ? -89.285  22.958  31.375  1    31.59  ? 793  ILE A N      1 
ATOM   7451  C CA     . ILE A 1 493 ? -89.222  24.261  32.047  1    33.69  ? 793  ILE A CA     1 
ATOM   7452  C C      . ILE A 1 493 ? -88.99   23.916  33.512  1    35.89  ? 793  ILE A C      1 
ATOM   7453  O O      . ILE A 1 493 ? -89.875  23.351  34.139  1    37.04  ? 793  ILE A O      1 
ATOM   7454  C CB     . ILE A 1 493 ? -90.527  25.05   31.808  1    34.16  ? 793  ILE A CB     1 
ATOM   7455  C CG1    . ILE A 1 493 ? -90.826  25.179  30.308  1    32.16  ? 793  ILE A CG1    1 
ATOM   7456  C CG2    . ILE A 1 493 ? -90.467  26.414  32.462  1    37.16  ? 793  ILE A CG2    1 
ATOM   7457  C CD1    . ILE A 1 493 ? -89.721  25.776  29.477  1    31.34  ? 793  ILE A CD1    1 
ATOM   7458  H H      . ILE A 1 493 ? -90.093  22.415  31.665  0    40.88  ? 793  ILE A H      1 
ATOM   7459  H HA     . ILE A 1 493 ? -88.38   24.853  31.692  0    44.13  ? 793  ILE A HA     1 
ATOM   7460  H HB     . ILE A 1 493 ? -91.349  24.496  32.261  0    46.93  ? 793  ILE A HB     1 
ATOM   7461  H HG12   . ILE A 1 493 ? -91.046  24.193  29.902  0    41.6   ? 793  ILE A HG12   1 
ATOM   7462  H HG13   . ILE A 1 493 ? -91.702  25.813  30.181  0    43.57  ? 793  ILE A HG13   1 
ATOM   7463  H HG21   . ILE A 1 493 ? -91.29   27.026  32.095  0    52.54  ? 793  ILE A HG21   1 
ATOM   7464  H HG22   . ILE A 1 493 ? -90.564  26.295  33.539  0    53.25  ? 793  ILE A HG22   1 
ATOM   7465  H HG23   . ILE A 1 493 ? -89.515  26.887  32.228  0    51.23  ? 793  ILE A HG23   1 
ATOM   7466  H HD11   . ILE A 1 493 ? -90.088  25.962  28.469  0    40.06  ? 793  ILE A HD11   1 
ATOM   7467  H HD12   . ILE A 1 493 ? -89.39   26.715  29.917  0    41.32  ? 793  ILE A HD12   1 
ATOM   7468  H HD13   . ILE A 1 493 ? -88.889  25.076  29.425  0    39.33  ? 793  ILE A HD13   1 
ATOM   7469  N N      . ILE A 1 494 ? -87.772  24.169  34.024  1    37.07  ? 794  ILE A N      1 
ATOM   7470  C CA     . ILE A 1 494 ? -87.336  23.776  35.368  1    39.58  ? 794  ILE A CA     1 
ATOM   7471  C C      . ILE A 1 494 ? -87.095  24.99   36.244  1    43.66  ? 794  ILE A C      1 
ATOM   7472  O O      . ILE A 1 494 ? -86.292  25.828  35.847  1    43.26  ? 794  ILE A O      1 
ATOM   7473  C CB     . ILE A 1 494 ? -86.033  22.95   35.205  1    38.5   ? 794  ILE A CB     1 
ATOM   7474  C CG1    . ILE A 1 494 ? -86.331  21.638  34.474  1    35.54  ? 794  ILE A CG1    1 
ATOM   7475  C CG2    . ILE A 1 494 ? -85.414  22.658  36.54   1    41.88  ? 794  ILE A CG2    1 
ATOM   7476  C CD1    . ILE A 1 494 ? -85.161  21.005  33.826  1    33.93  ? 794  ILE A CD1    1 
ATOM   7477  H H      . ILE A 1 494 ? -87.047  24.667  33.518  0    50     ? 794  ILE A H      1 
ATOM   7478  H HA     . ILE A 1 494 ? -88.079  23.139  35.845  0    56.55  ? 794  ILE A HA     1 
ATOM   7479  H HB     . ILE A 1 494 ? -85.307  23.535  34.64   0    52.75  ? 794  ILE A HB     1 
ATOM   7480  H HG12   . ILE A 1 494 ? -86.722  20.927  35.2    0    48.77  ? 794  ILE A HG12   1 
ATOM   7481  H HG13   . ILE A 1 494 ? -87.075  21.803  33.696  0    46.71  ? 794  ILE A HG13   1 
ATOM   7482  H HG21   . ILE A 1 494 ? -84.675  21.864  36.449  0    59.43  ? 794  ILE A HG21   1 
ATOM   7483  H HG22   . ILE A 1 494 ? -84.921  23.551  36.922  0    61.57  ? 794  ILE A HG22   1 
ATOM   7484  H HG23   . ILE A 1 494 ? -86.215  22.342  37.206  0    61.41  ? 794  ILE A HG23   1 
ATOM   7485  H HD11   . ILE A 1 494 ? -85.522  20.234  33.147  0    42.99  ? 794  ILE A HD11   1 
ATOM   7486  H HD12   . ILE A 1 494 ? -84.605  21.757  33.268  0    43.73  ? 794  ILE A HD12   1 
ATOM   7487  H HD13   . ILE A 1 494 ? -84.523  20.546  34.58   0    45.45  ? 794  ILE A HD13   1 
ATOM   7488  N N      . ASP A 1 495 ? -87.715  25.052  37.457  1    47.65  ? 795  ASP A N      1 
ATOM   7489  C CA     . ASP A 1 495 ? -87.547  26.174  38.397  1    51.1   ? 795  ASP A CA     1 
ATOM   7490  C C      . ASP A 1 495 ? -86.073  26.392  38.79   1    52.46  ? 795  ASP A C      1 
ATOM   7491  O O      . ASP A 1 495 ? -85.379  25.418  39.054  1    51.81  ? 795  ASP A O      1 
ATOM   7492  C CB     . ASP A 1 495 ? -88.374  25.956  39.667  1    54.01  ? 795  ASP A CB     1 
ATOM   7493  C CG     . ASP A 1 495 ? -88.259  27.134  40.617  1    58.04  ? 795  ASP A CG     1 
ATOM   7494  O OD1    . ASP A 1 495 ? -88.88   28.193  40.337  1    58.49  ? 795  ASP A OD1    1 
ATOM   7495  O OD2    . ASP A 1 495 ? -87.495  27.027  41.599  1    60.96  ? 795  ASP A OD2    1 
ATOM   7496  H H      . ASP A 1 495 ? -88.344  24.336  37.806  0    71.58  ? 795  ASP A H      1 
ATOM   7497  H HA     . ASP A 1 495 ? -87.906  27.083  37.918  0    78.22  ? 795  ASP A HA     1 
ATOM   7498  H HB2    . ASP A 1 495 ? -89.423  25.823  39.412  0    84.81  ? 795  ASP A HB2    1 
ATOM   7499  H HB3    . ASP A 1 495 ? -88.002  25.072  40.183  0    86.1   ? 795  ASP A HB3    1 
ATOM   7500  N N      . GLN A 1 496 ? -85.606  27.664  38.86   1    54.52  ? 796  GLN A N      1 
ATOM   7501  C CA     . GLN A 1 496 ? -84.195  27.967  39.153  1    55.92  ? 796  GLN A CA     1 
ATOM   7502  C C      . GLN A 1 496 ? -83.743  27.743  40.603  1    59.72  ? 796  GLN A C      1 
ATOM   7503  O O      . GLN A 1 496 ? -82.552  27.868  40.863  1    60.64  ? 796  GLN A O      1 
ATOM   7504  C CB     . GLN A 1 496 ? -83.853  29.395  38.71   1    56.85  ? 796  GLN A CB     1 
ATOM   7505  C CG     . GLN A 1 496 ? -84.432  30.508  39.574  1    60.88  ? 796  GLN A CG     1 
ATOM   7506  C CD     . GLN A 1 496 ? -83.707  31.815  39.38   1    62.28  ? 796  GLN A CD     1 
ATOM   7507  O OE1    . GLN A 1 496 ? -83.948  32.531  38.411  1    60.47  ? 796  GLN A OE1    1 
ATOM   7508  N NE2    . GLN A 1 496 ? -82.807  32.177  40.291  1    65.78  ? 796  GLN A NE2    1 
ATOM   7509  H H      . GLN A 1 496 ? -86.177  28.482  38.67   0    85.68  ? 796  GLN A H      1 
ATOM   7510  H HA     . GLN A 1 496 ? -83.583  27.305  38.541  0    85.84  ? 796  GLN A HA     1 
ATOM   7511  H HB2    . GLN A 1 496 ? -82.771  29.5    38.697  0    90.05  ? 796  GLN A HB2    1 
ATOM   7512  H HB3    . GLN A 1 496 ? -84.246  29.541  37.704  0    87.08  ? 796  GLN A HB3    1 
ATOM   7513  H HG2    . GLN A 1 496 ? -85.459  30.674  39.254  0    97.4   ? 796  GLN A HG2    1 
ATOM   7514  H HG3    . GLN A 1 496 ? -84.423  30.253  40.631  0    101.05 ? 796  GLN A HG3    1 
ATOM   7515  H HE21   . GLN A 1 496 ? -82.61   31.575  41.084  0    110.92 ? 796  GLN A HE21   1 
ATOM   7516  H HE22   . GLN A 1 496 ? -82.305  33.052  40.179  0    110.2  ? 796  GLN A HE22   1 
ATOM   7517  N N      . HIS A 1 497 ? -84.653  27.428  41.535  1    62.25  ? 797  HIS A N      1 
ATOM   7518  C CA     . HIS A 1 497 ? -84.323  27.208  42.943  1    66.57  ? 797  HIS A CA     1 
ATOM   7519  C C      . HIS A 1 497 ? -84.612  25.76   43.38   1    65.92  ? 797  HIS A C      1 
ATOM   7520  O O      . HIS A 1 497 ? -83.728  25.111  43.938  1    67.24  ? 797  HIS A O      1 
ATOM   7521  C CB     . HIS A 1 497 ? -85.088  28.208  43.819  1    70.8   ? 797  HIS A CB     1 
ATOM   7522  C CG     . HIS A 1 497 ? -84.795  29.629  43.441  1    71.69  ? 797  HIS A CG     1 
ATOM   7523  N ND1    . HIS A 1 497 ? -85.79   30.553  43.191  1    71.46  ? 797  HIS A ND1    1 
ATOM   7524  C CD2    . HIS A 1 497 ? -83.592  30.244  43.312  1    73.02  ? 797  HIS A CD2    1 
ATOM   7525  C CE1    . HIS A 1 497 ? -85.163  31.702  42.943  1    72.64  ? 797  HIS A CE1    1 
ATOM   7526  N NE2    . HIS A 1 497 ? -83.843  31.557  42.994  1    73.57  ? 797  HIS A NE2    1 
ATOM   7527  H H      . HIS A 1 497 ? -85.643  27.308  41.349  0    101.57 ? 797  HIS A H      1 
ATOM   7528  H HA     . HIS A 1 497 ? -83.264  27.408  43.101  0    113.2  ? 797  HIS A HA     1 
ATOM   7529  H HB2    . HIS A 1 497 ? -86.15   27.965  43.78   0    120.88 ? 797  HIS A HB2    1 
ATOM   7530  H HB3    . HIS A 1 497 ? -84.745  28.119  44.849  0    125.23 ? 797  HIS A HB3    1 
ATOM   7531  H HD2    . HIS A 1 497 ? -82.625  29.786  43.431  0    125.83 ? 797  HIS A HD2    1 
ATOM   7532  H HE1    . HIS A 1 497 ? -85.628  32.651  42.778  0    125.76 ? 797  HIS A HE1    1 
ATOM   7533  H HE2    . HIS A 1 497 ? -83.153  32.287  42.847  0    127.44 ? 797  HIS A HE2    1 
ATOM   7534  N N      . THR A 1 498 ? -85.832  25.251  43.117  1    64.05  ? 798  THR A N      1 
ATOM   7535  C CA     . THR A 1 498 ? -86.222  23.876  43.469  1    63.43  ? 798  THR A CA     1 
ATOM   7536  C C      . THR A 1 498 ? -85.855  22.85   42.411  1    58.87  ? 798  THR A C      1 
ATOM   7537  O O      . THR A 1 498 ? -85.856  21.663  42.708  1    58.55  ? 798  THR A O      1 
ATOM   7538  C CB     . THR A 1 498 ? -87.735  23.772  43.707  1    63.91  ? 798  THR A CB     1 
ATOM   7539  O OG1    . THR A 1 498 ? -88.445  23.878  42.473  1    60.02  ? 798  THR A OG1    1 
ATOM   7540  C CG2    . THR A 1 498 ? -88.232  24.807  44.675  1    68.68  ? 798  THR A CG2    1 
ATOM   7541  H H      . THR A 1 498 ? -86.562  25.77   42.641  0    106.22 ? 798  THR A H      1 
ATOM   7542  H HA     . THR A 1 498 ? -85.728  23.589  44.396  0    110.15 ? 798  THR A HA     1 
ATOM   7543  H HB     . THR A 1 498 ? -87.936  22.798  44.149  0    109.22 ? 798  THR A HB     1 
ATOM   7544  H HG1    . THR A 1 498 ? -89.422  23.824  42.632  0    100.54 ? 798  THR A HG1    1 
ATOM   7545  H HG21   . THR A 1 498 ? -89.269  24.609  44.939  0    119.81 ? 798  THR A HG21   1 
ATOM   7546  H HG22   . THR A 1 498 ? -87.629  24.789  45.582  0    122.22 ? 798  THR A HG22   1 
ATOM   7547  H HG23   . THR A 1 498 ? -88.169  25.802  44.236  0    118.27 ? 798  THR A HG23   1 
ATOM   7548  N N      . PHE A 1 499 ? -85.639  23.287  41.17   1    55.63  ? 799  PHE A N      1 
ATOM   7549  C CA     . PHE A 1 499 ? -85.348  22.425  40.037  1    51.59  ? 799  PHE A CA     1 
ATOM   7550  C C      . PHE A 1 499 ? -86.461  21.42   39.76   1    49.69  ? 799  PHE A C      1 
ATOM   7551  O O      . PHE A 1 499 ? -86.21   20.316  39.268  1    47.38  ? 799  PHE A O      1 
ATOM   7552  C CB     . PHE A 1 499 ? -83.975  21.763  40.173  1    51.48  ? 799  PHE A CB     1 
ATOM   7553  C CG     . PHE A 1 499 ? -82.875  22.782  40.125  1    53.2   ? 799  PHE A CG     1 
ATOM   7554  C CD1    . PHE A 1 499 ? -82.412  23.26   38.915  1    51.37  ? 799  PHE A CD1    1 
ATOM   7555  C CD2    . PHE A 1 499 ? -82.404  23.366  41.283  1    56.98  ? 799  PHE A CD2    1 
ATOM   7556  C CE1    . PHE A 1 499 ? -81.433  24.237  38.866  1    53.02  ? 799  PHE A CE1    1 
ATOM   7557  C CE2    . PHE A 1 499 ? -81.437  24.357  41.234  1    58.83  ? 799  PHE A CE2    1 
ATOM   7558  C CZ     . PHE A 1 499 ? -80.963  24.794  40.026  1    56.69  ? 799  PHE A CZ     1 
ATOM   7559  H H      . PHE A 1 499 ? -85.666  24.263  40.897  0    89.22  ? 799  PHE A H      1 
ATOM   7560  H HA     . PHE A 1 499 ? -85.323  23.069  39.161  0    78.52  ? 799  PHE A HA     1 
ATOM   7561  H HB2    . PHE A 1 499 ? -83.908  21.21   41.109  0    83     ? 799  PHE A HB2    1 
ATOM   7562  H HB3    . PHE A 1 499 ? -83.816  21.094  39.33   0    77.82  ? 799  PHE A HB3    1 
ATOM   7563  H HD1    . PHE A 1 499 ? -82.782  22.835  37.996  0    76.01  ? 799  PHE A HD1    1 
ATOM   7564  H HD2    . PHE A 1 499 ? -82.779  23.034  42.236  0    95.16  ? 799  PHE A HD2    1 
ATOM   7565  H HE1    . PHE A 1 499 ? -81.065  24.582  37.913  0    80.29  ? 799  PHE A HE1    1 
ATOM   7566  H HE2    . PHE A 1 499 ? -81.051  24.781  42.144  0    99.89  ? 799  PHE A HE2    1 
ATOM   7567  H HZ     . PHE A 1 499 ? -80.2    25.553  39.988  0    92     ? 799  PHE A HZ     1 
ATOM   7568  N N      . GLU A 1 500 ? -87.701  21.853  39.992  1    50.73  ? 800  GLU A N      1 
ATOM   7569  C CA     . GLU A 1 500 ? -88.871  21.034  39.78   1    49.17  ? 800  GLU A CA     1 
ATOM   7570  C C      . GLU A 1 500 ? -89.307  21.212  38.348  1    45.76  ? 800  GLU A C      1 
ATOM   7571  O O      . GLU A 1 500 ? -89.271  22.33   37.831  1    45.61  ? 800  GLU A O      1 
ATOM   7572  C CB     . GLU A 1 500 ? -89.966  21.504  40.734  1    51.94  ? 800  GLU A CB     1 
ATOM   7573  C CG     . GLU A 1 500 ? -91.097  20.525  40.961  1    51.15  ? 800  GLU A CG     1 
ATOM   7574  C CD     . GLU A 1 500 ? -92.156  21.029  41.933  1    54.95  ? 800  GLU A CD     1 
ATOM   7575  O OE1    . GLU A 1 500 ? -92.082  22.209  42.357  1    56.73  ? 800  GLU A OE1    1 
ATOM   7576  O OE2    . GLU A 1 500 ? -93.061  20.233  42.278  1    56.39  ? 800  GLU A OE2    1 
ATOM   7577  H H      . GLU A 1 500 ? -87.931  22.79   40.307  0    80.88  ? 800  GLU A H      1 
ATOM   7578  H HA     . GLU A 1 500 ? -88.647  19.985  39.972  0    76.78  ? 800  GLU A HA     1 
ATOM   7579  H HB2    . GLU A 1 500 ? -89.51   21.683  41.706  0    86.46  ? 800  GLU A HB2    1 
ATOM   7580  H HB3    . GLU A 1 500 ? -90.392  22.427  40.344  0    83.37  ? 800  GLU A HB3    1 
ATOM   7581  H HG2    . GLU A 1 500 ? -91.564  20.316  40.002  0    80.38  ? 800  GLU A HG2    1 
ATOM   7582  H HG3    . GLU A 1 500 ? -90.677  19.604  41.364  0    82.88  ? 800  GLU A HG3    1 
ATOM   7583  N N      . VAL A 1 501 ? -89.716  20.123  37.705  1    43.33  ? 801  VAL A N      1 
ATOM   7584  C CA     . VAL A 1 501 ? -90.156  20.177  36.322  1    40.64  ? 801  VAL A CA     1 
ATOM   7585  C C      . VAL A 1 501 ? -91.552  20.777  36.275  1    41.25  ? 801  VAL A C      1 
ATOM   7586  O O      . VAL A 1 501 ? -92.547  20.084  36.517  1    41.44  ? 801  VAL A O      1 
ATOM   7587  C CB     . VAL A 1 501 ? -90.13   18.795  35.686  1    37.73  ? 801  VAL A CB     1 
ATOM   7588  C CG1    . VAL A 1 501 ? -90.569  18.878  34.23   1    34.12  ? 801  VAL A CG1    1 
ATOM   7589  C CG2    . VAL A 1 501 ? -88.743  18.189  35.803  1    37.07  ? 801  VAL A CG2    1 
ATOM   7590  H H      . VAL A 1 501 ? -89.783  19.202  38.127  0    64.94  ? 801  VAL A H      1 
ATOM   7591  H HA     . VAL A 1 501 ? -89.477  20.811  35.753  0    57.05  ? 801  VAL A HA     1 
ATOM   7592  H HB     . VAL A 1 501 ? -90.821  18.138  36.212  0    54.13  ? 801  VAL A HB     1 
ATOM   7593  H HG11   . VAL A 1 501 ? -90.343  17.933  33.738  0    45.16  ? 801  VAL A HG11   1 
ATOM   7594  H HG12   . VAL A 1 501 ? -91.641  19.056  34.173  0    46.88  ? 801  VAL A HG12   1 
ATOM   7595  H HG13   . VAL A 1 501 ? -90.027  19.686  33.741  0    45.35  ? 801  VAL A HG13   1 
ATOM   7596  H HG21   . VAL A 1 501 ? -88.694  17.28   35.206  0    50.41  ? 801  VAL A HG21   1 
ATOM   7597  H HG22   . VAL A 1 501 ? -88.008  18.91   35.447  0    50.8   ? 801  VAL A HG22   1 
ATOM   7598  H HG23   . VAL A 1 501 ? -88.545  17.941  36.845  0    53.7   ? 801  VAL A HG23   1 
ATOM   7599  N N      . LEU A 1 502 ? -91.624  22.066  35.938  1    42.17  ? 802  LEU A N      1 
ATOM   7600  C CA     . LEU A 1 502 ? -92.868  22.824  35.937  1    43.07  ? 802  LEU A CA     1 
ATOM   7601  C C      . LEU A 1 502 ? -93.732  22.469  34.752  1    40.8   ? 802  LEU A C      1 
ATOM   7602  O O      . LEU A 1 502 ? -94.943  22.306  34.896  1    42.09  ? 802  LEU A O      1 
ATOM   7603  C CB     . LEU A 1 502 ? -92.558  24.326  35.936  1    44.6   ? 802  LEU A CB     1 
ATOM   7604  C CG     . LEU A 1 502 ? -91.628  24.825  37.033  1    47.34  ? 802  LEU A CG     1 
ATOM   7605  C CD1    . LEU A 1 502 ? -91.177  26.228  36.746  1    48.57  ? 802  LEU A CD1    1 
ATOM   7606  C CD2    . LEU A 1 502 ? -92.284  24.726  38.37   1    50.23  ? 802  LEU A CD2    1 
ATOM   7607  H H      . LEU A 1 502 ? -90.831  22.614  35.616  0    60.48  ? 802  LEU A H      1 
ATOM   7608  H HA     . LEU A 1 502 ? -93.428  22.592  36.839  0    66.02  ? 802  LEU A HA     1 
ATOM   7609  H HB2    . LEU A 1 502 ? -92.091  24.574  34.984  0    64.36  ? 802  LEU A HB2    1 
ATOM   7610  H HB3    . LEU A 1 502 ? -93.502  24.862  36.022  0    67.82  ? 802  LEU A HB3    1 
ATOM   7611  H HG     . LEU A 1 502 ? -90.734  24.205  37.065  0    70.71  ? 802  LEU A HG     1 
ATOM   7612  H HD11   . LEU A 1 502 ? -90.563  26.583  37.571  0    75.31  ? 802  LEU A HD11   1 
ATOM   7613  H HD12   . LEU A 1 502 ? -90.586  26.225  35.832  0    71.23  ? 802  LEU A HD12   1 
ATOM   7614  H HD13   . LEU A 1 502 ? -92.053  26.864  36.624  0    74.7   ? 802  LEU A HD13   1 
ATOM   7615  H HD21   . LEU A 1 502 ? -91.631  25.188  39.109  0    80.57  ? 802  LEU A HD21   1 
ATOM   7616  H HD22   . LEU A 1 502 ? -93.24   25.247  38.335  0    79.9   ? 802  LEU A HD22   1 
ATOM   7617  H HD23   . LEU A 1 502 ? -92.436  23.678  38.624  0    78.65  ? 802  LEU A HD23   1 
ATOM   7618  N N      . HIS A 1 503 ? -93.113  22.357  33.585  1    38.04  ? 803  HIS A N      1 
ATOM   7619  C CA     . HIS A 1 503 ? -93.824  22.022  32.375  1    36.09  ? 803  HIS A CA     1 
ATOM   7620  C C      . HIS A 1 503 ? -92.924  21.234  31.465  1    32.56  ? 803  HIS A C      1 
ATOM   7621  O O      . HIS A 1 503 ? -91.701  21.357  31.525  1    31.24  ? 803  HIS A O      1 
ATOM   7622  C CB     . HIS A 1 503 ? -94.292  23.301  31.673  1    36.61  ? 803  HIS A CB     1 
ATOM   7623  C CG     . HIS A 1 503 ? -95.297  23.08   30.584  1    37.21  ? 803  HIS A CG     1 
ATOM   7624  N ND1    . HIS A 1 503 ? -96.64   23.347  30.78   1    39.38  ? 803  HIS A ND1    1 
ATOM   7625  C CD2    . HIS A 1 503 ? -95.118  22.667  29.305  1    34.7   ? 803  HIS A CD2    1 
ATOM   7626  C CE1    . HIS A 1 503 ? -97.24   23.066  29.632  1    39.13  ? 803  HIS A CE1    1 
ATOM   7627  N NE2    . HIS A 1 503 ? -96.361  22.653  28.713  1    37     ? 803  HIS A NE2    1 
ATOM   7628  H H      . HIS A 1 503 ? -92.12   22.514  33.443  0    52.55  ? 803  HIS A H      1 
ATOM   7629  H HA     . HIS A 1 503 ? -94.696  21.41   32.602  0    51.11  ? 803  HIS A HA     1 
ATOM   7630  H HB2    . HIS A 1 503 ? -94.75   23.954  32.414  0    52.96  ? 803  HIS A HB2    1 
ATOM   7631  H HB3    . HIS A 1 503 ? -93.426  23.793  31.233  0    49.99  ? 803  HIS A HB3    1 
ATOM   7632  H HD1    . HIS A 1 503 ? -97.078  23.691  31.628  0    58.28  ? 803  HIS A HD1    1 
ATOM   7633  H HD2    . HIS A 1 503 ? -94.185  22.388  28.845  0    45.77  ? 803  HIS A HD2    1 
ATOM   7634  H HE1    . HIS A 1 503 ? -98.298  23.165  29.459  0    57.76  ? 803  HIS A HE1    1 
ATOM   7635  N N      . ALA A 1 504 ? -93.524  20.4    30.642  1    31.63  ? 804  ALA A N      1 
ATOM   7636  C CA     . ALA A 1 504 ? -92.804  19.662  29.636  1    29.05  ? 804  ALA A CA     1 
ATOM   7637  C C      . ALA A 1 504 ? -93.627  19.728  28.375  1    29.19  ? 804  ALA A C      1 
ATOM   7638  O O      . ALA A 1 504 ? -94.814  19.428  28.413  1    31.84  ? 804  ALA A O      1 
ATOM   7639  C CB     . ALA A 1 504 ? -92.605  18.224  30.069  1    28.81  ? 804  ALA A CB     1 
ATOM   7640  H H      . ALA A 1 504 ? -94.52   20.207  30.654  0    42.96  ? 804  ALA A H      1 
ATOM   7641  H HA     . ALA A 1 504 ? -91.829  20.105  29.439  0    36.05  ? 804  ALA A HA     1 
ATOM   7642  H HB1    . ALA A 1 504 ? -92.295  17.636  29.207  0    35.51  ? 804  ALA A HB1    1 
ATOM   7643  H HB2    . ALA A 1 504 ? -91.828  18.193  30.832  0    36.47  ? 804  ALA A HB2    1 
ATOM   7644  H HB3    . ALA A 1 504 ? -93.538  17.835  30.474  0    37.7   ? 804  ALA A HB3    1 
ATOM   7645  N N      . HIS A 1 505 ? -93.03   20.194  27.277  1    27.93  ? 805  HIS A N      1 
ATOM   7646  C CA     . HIS A 1 505 ? -93.702  20.234  25.989  1    28.76  ? 805  HIS A CA     1 
ATOM   7647  C C      . HIS A 1 505 ? -93.074  19.21   25.083  1    27.68  ? 805  HIS A C      1 
ATOM   7648  O O      . HIS A 1 505 ? -91.906  19.345  24.757  1    26.53  ? 805  HIS A O      1 
ATOM   7649  C CB     . HIS A 1 505 ? -93.595  21.618  25.352  1    29.22  ? 805  HIS A CB     1 
ATOM   7650  C CG     . HIS A 1 505 ? -94.21   21.698  23.987  1    31.39  ? 805  HIS A CG     1 
ATOM   7651  N ND1    . HIS A 1 505 ? -95.577  21.709  23.829  1    35.54  ? 805  HIS A ND1    1 
ATOM   7652  C CD2    . HIS A 1 505 ? -93.639  21.713  22.762  1    30.48  ? 805  HIS A CD2    1 
ATOM   7653  C CE1    . HIS A 1 505 ? -95.797  21.766  22.527  1    36.47  ? 805  HIS A CE1    1 
ATOM   7654  N NE2    . HIS A 1 505 ? -94.665  21.831  21.85   1    35.16  ? 805  HIS A NE2    1 
ATOM   7655  H H      . HIS A 1 505 ? -92.097  20.591  27.255  0    34.07  ? 805  HIS A H      1 
ATOM   7656  H HA     . HIS A 1 505 ? -94.761  20.003  26.09   0    37.88  ? 805  HIS A HA     1 
ATOM   7657  H HB2    . HIS A 1 505 ? -94.133  22.323  25.986  0    38.6   ? 805  HIS A HB2    1 
ATOM   7658  H HB3    . HIS A 1 505 ? -92.547  21.904  25.288  0    36.55  ? 805  HIS A HB3    1 
ATOM   7659  H HD1    . HIS A 1 505 ? -96.279  21.684  24.561  0    49.1   ? 805  HIS A HD1    1 
ATOM   7660  H HD2    . HIS A 1 505 ? -92.595  21.589  22.542  0    38.71  ? 805  HIS A HD2    1 
ATOM   7661  H HE1    . HIS A 1 505 ? -96.771  21.731  22.065  0    52.23  ? 805  HIS A HE1    1 
ATOM   7662  N N      . GLN A 1 506 ? -93.834  18.204  24.662  1    28.98  ? 806  GLN A N      1 
ATOM   7663  C CA     . GLN A 1 506 ? -93.347  17.187  23.749  1    28.85  ? 806  GLN A CA     1 
ATOM   7664  C C      . GLN A 1 506 ? -93.464  17.663  22.305  1    30.38  ? 806  GLN A C      1 
ATOM   7665  O O      . GLN A 1 506 ? -94.496  18.213  21.916  1    33.37  ? 806  GLN A O      1 
ATOM   7666  C CB     . GLN A 1 506 ? -94.177  15.926  23.906  1    30.47  ? 806  GLN A CB     1 
ATOM   7667  C CG     . GLN A 1 506 ? -93.706  14.779  23.031  1    30.68  ? 806  GLN A CG     1 
ATOM   7668  C CD     . GLN A 1 506 ? -94.381  13.508  23.44   1    32     ? 806  GLN A CD     1 
ATOM   7669  O OE1    . GLN A 1 506 ? -94.297  13.072  24.599  1    31.01  ? 806  GLN A OE1    1 
ATOM   7670  N NE2    . GLN A 1 506 ? -95.066  12.872  22.501  1    35.46  ? 806  GLN A NE2    1 
ATOM   7671  H H      . GLN A 1 506 ? -94.802  18.068  24.933  0    38.02  ? 806  GLN A H      1 
ATOM   7672  H HA     . GLN A 1 506 ? -92.312  16.94   23.977  0    35.16  ? 806  GLN A HA     1 
ATOM   7673  H HB2    . GLN A 1 506 ? -94.156  15.616  24.95   0    39.13  ? 806  GLN A HB2    1 
ATOM   7674  H HB3    . GLN A 1 506 ? -95.194  16.171  23.606  0    40.97  ? 806  GLN A HB3    1 
ATOM   7675  H HG2    . GLN A 1 506 ? -93.944  14.987  21.99   0    40.75  ? 806  GLN A HG2    1 
ATOM   7676  H HG3    . GLN A 1 506 ? -92.632  14.653  23.159  0    38.33  ? 806  GLN A HG3    1 
ATOM   7677  H HE21   . GLN A 1 506 ? -95.129  13.231  21.554  0    48.99  ? 806  GLN A HE21   1 
ATOM   7678  H HE22   . GLN A 1 506 ? -95.539  12.004  22.734  0    48.79  ? 806  GLN A HE22   1 
ATOM   7679  N N      . PHE A 1 507 ? -92.437  17.376  21.501  1    29.87  ? 807  PHE A N      1 
ATOM   7680  C CA     . PHE A 1 507 ? -92.389  17.757  20.097  1    31.99  ? 807  PHE A CA     1 
ATOM   7681  C C      . PHE A 1 507 ? -93.021  16.698  19.199  1    35.18  ? 807  PHE A C      1 
ATOM   7682  O O      . PHE A 1 507 ? -93.382  15.611  19.665  1    35.37  ? 807  PHE A O      1 
ATOM   7683  C CB     . PHE A 1 507 ? -90.931  18.042  19.685  1    30.67  ? 807  PHE A CB     1 
ATOM   7684  C CG     . PHE A 1 507 ? -90.433  19.362  20.202  1    29.03  ? 807  PHE A CG     1 
ATOM   7685  C CD1    . PHE A 1 507 ? -90.828  20.549  19.607  1    30.59  ? 807  PHE A CD1    1 
ATOM   7686  C CD2    . PHE A 1 507 ? -89.653  19.427  21.342  1    27.28  ? 807  PHE A CD2    1 
ATOM   7687  C CE1    . PHE A 1 507 ? -90.417  21.772  20.117  1    29.4   ? 807  PHE A CE1    1 
ATOM   7688  C CE2    . PHE A 1 507 ? -89.235  20.652  21.849  1    26.45  ? 807  PHE A CE2    1 
ATOM   7689  C CZ     . PHE A 1 507 ? -89.61   21.816  21.226  1    27.06  ? 807  PHE A CZ     1 
ATOM   7690  H H      . PHE A 1 507 ? -91.618  16.859  21.805  0    37.01  ? 807  PHE A H      1 
ATOM   7691  H HA     . PHE A 1 507 ? -92.973  18.664  19.947  0    42.97  ? 807  PHE A HA     1 
ATOM   7692  H HB2    . PHE A 1 507 ? -90.278  17.256  20.062  0    38.38  ? 807  PHE A HB2    1 
ATOM   7693  H HB3    . PHE A 1 507 ? -90.866  18.081  18.599  0    40.81  ? 807  PHE A HB3    1 
ATOM   7694  H HD1    . PHE A 1 507 ? -91.461  20.523  18.739  0    41.42  ? 807  PHE A HD1    1 
ATOM   7695  H HD2    . PHE A 1 507 ? -89.351  18.521  21.843  0    31.92  ? 807  PHE A HD2    1 
ATOM   7696  H HE1    . PHE A 1 507 ? -90.707  22.689  19.624  0    38.8   ? 807  PHE A HE1    1 
ATOM   7697  H HE2    . PHE A 1 507 ? -88.605  20.685  22.726  0    30.24  ? 807  PHE A HE2    1 
ATOM   7698  H HZ     . PHE A 1 507 ? -89.284  22.761  21.617  0    32.91  ? 807  PHE A HZ     1 
ATOM   7699  N N      . LEU A 1 508 ? -93.199  17.055  17.911  1    38.33  ? 808  LEU A N      1 
ATOM   7700  C CA     . LEU A 1 508 ? -93.78   16.207  16.871  1    40.81  ? 808  LEU A CA     1 
ATOM   7701  C C      . LEU A 1 508 ? -93.075  14.852  16.752  1    41.5   ? 808  LEU A C      1 
ATOM   7702  O O      . LEU A 1 508 ? -91.918  14.698  17.151  1    39.64  ? 808  LEU A O      1 
ATOM   7703  C CB     . LEU A 1 508 ? -93.738  16.943  15.507  1    42.98  ? 808  LEU A CB     1 
ATOM   7704  C CG     . LEU A 1 508 ? -94.929  17.834  15.095  1    45.82  ? 808  LEU A CG     1 
ATOM   7705  C CD1    . LEU A 1 508 ? -95.392  18.709  16.193  1    44.78  ? 808  LEU A CD1    1 
ATOM   7706  C CD2    . LEU A 1 508 ? -94.566  18.707  13.93   1    48.28  ? 808  LEU A CD2    1 
ATOM   7707  H H      . LEU A 1 508 ? -92.947  17.979  17.576  0    53.99  ? 808  LEU A H      1 
ATOM   7708  H HA     . LEU A 1 508 ? -94.818  16.002  17.126  0    60.39  ? 808  LEU A HA     1 
ATOM   7709  H HB2    . LEU A 1 508 ? -92.843  17.561  15.458  0    63.49  ? 808  LEU A HB2    1 
ATOM   7710  H HB3    . LEU A 1 508 ? -93.662  16.175  14.738  0    66.09  ? 808  LEU A HB3    1 
ATOM   7711  H HG     . LEU A 1 508 ? -95.762  17.198  14.797  0    72.64  ? 808  LEU A HG     1 
ATOM   7712  H HD11   . LEU A 1 508 ? -96.191  19.349  15.823  0    70.54  ? 808  LEU A HD11   1 
ATOM   7713  H HD12   . LEU A 1 508 ? -95.78   18.104  17.011  0    67.09  ? 808  LEU A HD12   1 
ATOM   7714  H HD13   . LEU A 1 508 ? -94.559  19.316  16.544  0    66.5   ? 808  LEU A HD13   1 
ATOM   7715  H HD21   . LEU A 1 508 ? -95.479  19.088  13.476  0    78.73  ? 808  LEU A HD21   1 
ATOM   7716  H HD22   . LEU A 1 508 ? -93.945  19.532  14.275  0    74.66  ? 808  LEU A HD22   1 
ATOM   7717  H HD23   . LEU A 1 508 ? -94.018  18.102  13.21   0    77.26  ? 808  LEU A HD23   1 
ATOM   7718  N N      . GLN A 1 509 ? -93.796  13.858  16.215  1    43.54  ? 809  GLN A N      1 
ATOM   7719  C CA     . GLN A 1 509 ? -93.25   12.524  16.058  1    44.46  ? 809  GLN A CA     1 
ATOM   7720  C C      . GLN A 1 509 ? -92.148  12.562  15.018  1    46.02  ? 809  GLN A C      1 
ATOM   7721  O O      . GLN A 1 509 ? -92.362  13.059  13.913  1    48.28  ? 809  GLN A O      1 
ATOM   7722  C CB     . GLN A 1 509 ? -94.344  11.539  15.651  1    46.8   ? 809  GLN A CB     1 
ATOM   7723  C CG     . GLN A 1 509 ? -93.917  10.078  15.796  1    47.24  ? 809  GLN A CG     1 
ATOM   7724  C CD     . GLN A 1 509 ? -94.954  9.124   15.249  1    50.07  ? 809  GLN A CD     1 
ATOM   7725  O OE1    . GLN A 1 509 ? -96.154  9.44    15.202  1    50.79  ? 809  GLN A OE1    1 
ATOM   7726  N NE2    . GLN A 1 509 ? -94.517  7.933   14.808  1    52.01  ? 809  GLN A NE2    1 
ATOM   7727  H H      . GLN A 1 509 ? -94.751  13.959  15.886  0    66.65  ? 809  GLN A H      1 
ATOM   7728  H HA     . GLN A 1 509 ? -92.833  12.205  17.012  0    63.58  ? 809  GLN A HA     1 
ATOM   7729  H HB2    . GLN A 1 509 ? -95.211  11.691  16.291  0    71.44  ? 809  GLN A HB2    1 
ATOM   7730  H HB3    . GLN A 1 509 ? -94.615  11.708  14.611  0    74.15  ? 809  GLN A HB3    1 
ATOM   7731  H HG2    . GLN A 1 509 ? -92.989  9.909   15.252  0    72.1   ? 809  GLN A HG2    1 
ATOM   7732  H HG3    . GLN A 1 509 ? -93.767  9.855   16.851  0    69.77  ? 809  GLN A HG3    1 
ATOM   7733  H HE21   . GLN A 1 509 ? -93.529  7.7     14.832  0    81.31  ? 809  GLN A HE21   1 
ATOM   7734  H HE22   . GLN A 1 509 ? -95.182  7.263   14.434  0    84.94  ? 809  GLN A HE22   1 
ATOM   7735  N N      . ASN A 1 510 ? -90.968  12.036  15.387  1    45.03  ? 810  ASN A N      1 
ATOM   7736  C CA     . ASN A 1 510 ? -89.753  12.039  14.572  1    46.2   ? 810  ASN A CA     1 
ATOM   7737  C C      . ASN A 1 510 ? -89.16   13.445  14.439  1    45.14  ? 810  ASN A C      1 
ATOM   7738  O O      . ASN A 1 510 ? -88.485  13.722  13.444  1    46.88  ? 810  ASN A O      1 
ATOM   7739  C CB     . ASN A 1 510 ? -89.964  11.38   13.204  1    50.07  ? 810  ASN A CB     1 
ATOM   7740  C CG     . ASN A 1 510 ? -90.188  9.899   13.306  1    51.09  ? 810  ASN A CG     1 
ATOM   7741  O OD1    . ASN A 1 510 ? -91.281  9.395   13.047  1    52.76  ? 810  ASN A OD1    1 
ATOM   7742  N ND2    . ASN A 1 510 ? -89.153  9.161   13.682  1    50.24  ? 810  ASN A ND2    1 
ATOM   7743  H H      . ASN A 1 510 ? -90.821  11.575  16.278  0    63.63  ? 810  ASN A H      1 
ATOM   7744  H HA     . ASN A 1 510 ? -89.007  11.447  15.1    0    65.97  ? 810  ASN A HA     1 
ATOM   7745  H HB2    . ASN A 1 510 ? -90.818  11.824  12.694  0    77.76  ? 810  ASN A HB2    1 
ATOM   7746  H HB3    . ASN A 1 510 ? -89.076  11.508  12.589  0    76.61  ? 810  ASN A HB3    1 
ATOM   7747  H HD21   . ASN A 1 510 ? -89.249  8.153   13.77   0    76.9   ? 810  ASN A HD21   1 
ATOM   7748  H HD22   . ASN A 1 510 ? -88.262  9.605   13.878  0    74.64  ? 810  ASN A HD22   1 
ATOM   7749  N N      . GLU A 1 511 ? -89.375  14.318  15.468  1    41.69  ? 811  GLU A N      1 
ATOM   7750  C CA     . GLU A 1 511 ? -88.842  15.677  15.505  1    39.93  ? 811  GLU A CA     1 
ATOM   7751  C C      . GLU A 1 511 ? -87.804  15.746  16.611  1    35.76  ? 811  GLU A C      1 
ATOM   7752  O O      . GLU A 1 511 ? -88.091  15.363  17.747  1    33.97  ? 811  GLU A O      1 
ATOM   7753  C CB     . GLU A 1 511 ? -89.95   16.701  15.757  1    39.7   ? 811  GLU A CB     1 
ATOM   7754  C CG     . GLU A 1 511 ? -89.461  18.136  15.686  1    38.89  ? 811  GLU A CG     1 
ATOM   7755  C CD     . GLU A 1 511 ? -90.554  19.184  15.719  1    39.51  ? 811  GLU A CD     1 
ATOM   7756  O OE1    . GLU A 1 511 ? -91.412  19.115  16.625  1    39.15  ? 811  GLU A OE1    1 
ATOM   7757  O OE2    . GLU A 1 511 ? -90.543  20.09   14.855  1    40.36  ? 811  GLU A OE2    1 
ATOM   7758  H H      . GLU A 1 511 ? -89.909  14.097  16.303  0    57.92  ? 811  GLU A H      1 
ATOM   7759  H HA     . GLU A 1 511 ? -88.371  15.925  14.555  0    57.39  ? 811  GLU A HA     1 
ATOM   7760  H HB2    . GLU A 1 511 ? -90.727  16.573  15.005  0    57.96  ? 811  GLU A HB2    1 
ATOM   7761  H HB3    . GLU A 1 511 ? -90.364  16.536  16.751  0    54.16  ? 811  GLU A HB3    1 
ATOM   7762  H HG2    . GLU A 1 511 ? -88.832  18.323  16.555  0    52.23  ? 811  GLU A HG2    1 
ATOM   7763  H HG3    . GLU A 1 511 ? -88.887  18.272  14.771  0    55.78  ? 811  GLU A HG3    1 
ATOM   7764  N N      . TYR A 1 512 ? -86.599  16.239  16.271  1    35.67  ? 812  TYR A N      1 
ATOM   7765  C CA     . TYR A 1 512 ? -85.476  16.371  17.2    1    33.49  ? 812  TYR A CA     1 
ATOM   7766  C C      . TYR A 1 512 ? -85.206  17.831  17.511  1    32.02  ? 812  TYR A C      1 
ATOM   7767  O O      . TYR A 1 512 ? -84.896  18.59   16.59   1    33.06  ? 812  TYR A O      1 
ATOM   7768  C CB     . TYR A 1 512 ? -84.189  15.85   16.572  1    34.74  ? 812  TYR A CB     1 
ATOM   7769  C CG     . TYR A 1 512 ? -83.971  14.362  16.645  1    35.5   ? 812  TYR A CG     1 
ATOM   7770  C CD1    . TYR A 1 512 ? -84.965  13.466  16.246  1    37.19  ? 812  TYR A CD1    1 
ATOM   7771  C CD2    . TYR A 1 512 ? -82.725  13.844  16.956  1    34.96  ? 812  TYR A CD2    1 
ATOM   7772  C CE1    . TYR A 1 512 ? -84.729  12.084  16.2    1    38.19  ? 812  TYR A CE1    1 
ATOM   7773  C CE2    . TYR A 1 512 ? -82.469  12.47   16.898  1    35.91  ? 812  TYR A CE2    1 
ATOM   7774  C CZ     . TYR A 1 512 ? -83.487  11.583  16.559  1    37.45  ? 812  TYR A CZ     1 
ATOM   7775  O OH     . TYR A 1 512 ? -83.259  10.212  16.534  1    38.53  ? 812  TYR A OH     1 
ATOM   7776  H H      . TYR A 1 512 ? -86.384  16.599  15.345  0    49.24  ? 812  TYR A H      1 
ATOM   7777  H HA     . TYR A 1 512 ? -85.662  15.836  18.129  0    41.7   ? 812  TYR A HA     1 
ATOM   7778  H HB2    . TYR A 1 512 ? -84.097  16.161  15.533  0    47.26  ? 812  TYR A HB2    1 
ATOM   7779  H HB3    . TYR A 1 512 ? -83.372  16.305  17.129  0    44.36  ? 812  TYR A HB3    1 
ATOM   7780  H HD1    . TYR A 1 512 ? -85.94   13.831  15.961  0    50.09  ? 812  TYR A HD1    1 
ATOM   7781  H HD2    . TYR A 1 512 ? -81.935  14.524  17.216  0    45.28  ? 812  TYR A HD2    1 
ATOM   7782  H HE1    . TYR A 1 512 ? -85.528  11.405  15.935  0    52.38  ? 812  TYR A HE1    1 
ATOM   7783  H HE2    . TYR A 1 512 ? -81.504  12.106  17.198  0    47.56  ? 812  TYR A HE2    1 
ATOM   7784  H HH     . TYR A 1 512 ? -82.332  10.007  16.82   0    52.04  ? 812  TYR A HH     1 
ATOM   7785  N N      . ALA A 1 513 ? -85.222  18.215  18.796  1    29.39  ? 813  ALA A N      1 
ATOM   7786  C CA     . ALA A 1 513 ? -84.89   19.578  19.196  1    28.23  ? 813  ALA A CA     1 
ATOM   7787  C C      . ALA A 1 513 ? -83.361  19.715  19.245  1    27.74  ? 813  ALA A C      1 
ATOM   7788  O O      . ALA A 1 513 ? -82.699  18.964  19.98   1    26.75  ? 813  ALA A O      1 
ATOM   7789  C CB     . ALA A 1 513 ? -85.496  19.882  20.545  1    26.5   ? 813  ALA A CB     1 
ATOM   7790  H H      . ALA A 1 513 ? -85.462  17.606  19.572  0    34.62  ? 813  ALA A H      1 
ATOM   7791  H HA     . ALA A 1 513 ? -85.273  20.296  18.474  0    34.82  ? 813  ALA A HA     1 
ATOM   7792  H HB1    . ALA A 1 513 ? -85.449  20.958  20.704  0    30.43  ? 813  ALA A HB1    1 
ATOM   7793  H HB2    . ALA A 1 513 ? -86.533  19.554  20.548  0    30.73  ? 813  ALA A HB2    1 
ATOM   7794  H HB3    . ALA A 1 513 ? -84.937  19.364  21.324  0    29.49  ? 813  ALA A HB3    1 
ATOM   7795  N N      . LEU A 1 514 ? -82.804  20.65   18.431  1    28.74  ? 814  LEU A N      1 
ATOM   7796  C CA     . LEU A 1 514 ? -81.362  20.856  18.277  1    28.81  ? 814  LEU A CA     1 
ATOM   7797  C C      . LEU A 1 514 ? -80.822  22.152  18.871  1    27.79  ? 814  LEU A C      1 
ATOM   7798  O O      . LEU A 1 514 ? -79.662  22.173  19.29   1    27.47  ? 814  LEU A O      1 
ATOM   7799  C CB     . LEU A 1 514 ? -80.993  20.833  16.789  1    31.04  ? 814  LEU A CB     1 
ATOM   7800  C CG     . LEU A 1 514 ? -81.602  19.747  15.92   1    33.24  ? 814  LEU A CG     1 
ATOM   7801  C CD1    . LEU A 1 514 ? -81.076  19.851  14.531  1    37.2   ? 814  LEU A CD1    1 
ATOM   7802  C CD2    . LEU A 1 514 ? -81.33   18.367  16.481  1    32.5   ? 814  LEU A CD2    1 
ATOM   7803  H H      . LEU A 1 514 ? -83.349  21.289  17.86   0    36.18  ? 814  LEU A H      1 
ATOM   7804  H HA     . LEU A 1 514 ? -80.82   20.04   18.753  0    34.96  ? 814  LEU A HA     1 
ATOM   7805  H HB2    . LEU A 1 514 ? -81.29   21.786  16.356  0    41.33  ? 814  LEU A HB2    1 
ATOM   7806  H HB3    . LEU A 1 514 ? -79.912  20.728  16.719  0    40.77  ? 814  LEU A HB3    1 
ATOM   7807  H HG     . LEU A 1 514 ? -82.681  19.884  15.876  0    44.35  ? 814  LEU A HG     1 
ATOM   7808  H HD11   . LEU A 1 514 ? -81.442  19.005  13.953  0    52.89  ? 814  LEU A HD11   1 
ATOM   7809  H HD12   . LEU A 1 514 ? -81.421  20.789  14.098  0    52.67  ? 814  LEU A HD12   1 
ATOM   7810  H HD13   . LEU A 1 514 ? -79.987  19.831  14.555  0    51.9   ? 814  LEU A HD13   1 
ATOM   7811  H HD21   . LEU A 1 514 ? -81.677  17.613  15.777  0    43.61  ? 814  LEU A HD21   1 
ATOM   7812  H HD22   . LEU A 1 514 ? -80.26   18.256  16.651  0    42.44  ? 814  LEU A HD22   1 
ATOM   7813  H HD23   . LEU A 1 514 ? -81.865  18.252  17.424  0    40.85  ? 814  LEU A HD23   1 
ATOM   7814  N N      . SER A 1 515 ? -81.605  23.238  18.853  1    27.6   ? 815  SER A N      1 
ATOM   7815  C CA     . SER A 1 515 ? -81.134  24.523  19.36   1    27.09  ? 815  SER A CA     1 
ATOM   7816  C C      . SER A 1 515 ? -82.186  25.216  20.215  1    26.63  ? 815  SER A C      1 
ATOM   7817  O O      . SER A 1 515 ? -83.376  25.031  19.988  1    26.64  ? 815  SER A O      1 
ATOM   7818  C CB     . SER A 1 515 ? -80.716  25.406  18.195  1    29.44  ? 815  SER A CB     1 
ATOM   7819  O OG     . SER A 1 515 ? -81.763  25.505  17.246  1    31.21  ? 815  SER A OG     1 
ATOM   7820  H H      . SER A 1 515 ? -82.553  23.266  18.491  0    34.5   ? 815  SER A H      1 
ATOM   7821  H HA     . SER A 1 515 ? -80.257  24.386  19.99   0    33.16  ? 815  SER A HA     1 
ATOM   7822  H HB2    . SER A 1 515 ? -80.462  26.399  18.564  0    38.49  ? 815  SER A HB2    1 
ATOM   7823  H HB3    . SER A 1 515 ? -79.853  24.942  17.721  0    38.85  ? 815  SER A HB3    1 
ATOM   7824  H HG     . SER A 1 515 ? -81.731  24.748  16.604  0    42.28  ? 815  SER A HG     1 
ATOM   7825  N N      . LEU A 1 516 ? -81.744  26.003  21.213  1    26.5   ? 816  LEU A N      1 
ATOM   7826  C CA     . LEU A 1 516 ? -82.638  26.699  22.148  1    26.49  ? 816  LEU A CA     1 
ATOM   7827  C C      . LEU A 1 516 ? -82.045  28.05   22.614  1    27.46  ? 816  LEU A C      1 
ATOM   7828  O O      . LEU A 1 516 ? -80.878  28.097  23.011  1    27.92  ? 816  LEU A O      1 
ATOM   7829  C CB     . LEU A 1 516 ? -82.878  25.781  23.358  1    25.89  ? 816  LEU A CB     1 
ATOM   7830  C CG     . LEU A 1 516 ? -83.568  26.376  24.577  1    26.54  ? 816  LEU A CG     1 
ATOM   7831  C CD1    . LEU A 1 516 ? -85.03   26.57   24.328  1    26.5   ? 816  LEU A CD1    1 
ATOM   7832  C CD2    . LEU A 1 516 ? -83.382  25.502  25.77   1    26.59  ? 816  LEU A CD2    1 
ATOM   7833  H H      . LEU A 1 516 ? -80.762  26.183  21.396  0    32.43  ? 816  LEU A H      1 
ATOM   7834  H HA     . LEU A 1 516 ? -83.596  26.897  21.67   0    32.34  ? 816  LEU A HA     1 
ATOM   7835  H HB2    . LEU A 1 516 ? -83.5    24.952  23.024  0    29.67  ? 816  LEU A HB2    1 
ATOM   7836  H HB3    . LEU A 1 516 ? -81.909  25.396  23.673  0    30.02  ? 816  LEU A HB3    1 
ATOM   7837  H HG     . LEU A 1 516 ? -83.146  27.346  24.834  0    31.95  ? 816  LEU A HG     1 
ATOM   7838  H HD11   . LEU A 1 516 ? -85.456  27.156  25.142  0    31.85  ? 816  LEU A HD11   1 
ATOM   7839  H HD12   . LEU A 1 516 ? -85.18   27.085  23.379  0    31.95  ? 816  LEU A HD12   1 
ATOM   7840  H HD13   . LEU A 1 516 ? -85.504  25.591  24.3    0    30.71  ? 816  LEU A HD13   1 
ATOM   7841  H HD21   . LEU A 1 516 ? -83.746  26.027  26.652  0    31.33  ? 816  LEU A HD21   1 
ATOM   7842  H HD22   . LEU A 1 516 ? -83.952  24.582  25.646  0    30.06  ? 816  LEU A HD22   1 
ATOM   7843  H HD23   . LEU A 1 516 ? -82.325  25.269  25.898  0    30.77  ? 816  LEU A HD23   1 
ATOM   7844  N N      . VAL A 1 517 ? -82.875  29.125  22.615  1    28.03  ? 817  VAL A N      1 
ATOM   7845  C CA     . VAL A 1 517 ? -82.504  30.47   23.068  1    29.73  ? 817  VAL A CA     1 
ATOM   7846  C C      . VAL A 1 517 ? -83.649  31.102  23.855  1    30.54  ? 817  VAL A C      1 
ATOM   7847  O O      . VAL A 1 517 ? -84.811  30.803  23.599  1    30.2   ? 817  VAL A O      1 
ATOM   7848  C CB     . VAL A 1 517 ? -82.106  31.406  21.904  1    31.4   ? 817  VAL A CB     1 
ATOM   7849  C CG1    . VAL A 1 517 ? -80.837  30.929  21.234  1    31.49  ? 817  VAL A CG1    1 
ATOM   7850  C CG2    . VAL A 1 517 ? -83.22   31.548  20.884  1    32.24  ? 817  VAL A CG2    1 
ATOM   7851  H H      . VAL A 1 517 ? -83.838  29.081  22.299  0    35.75  ? 817  VAL A H      1 
ATOM   7852  H HA     . VAL A 1 517 ? -81.653  30.403  23.745  0    38.9   ? 817  VAL A HA     1 
ATOM   7853  H HB     . VAL A 1 517 ? -81.907  32.394  22.315  0    43.43  ? 817  VAL A HB     1 
ATOM   7854  H HG11   . VAL A 1 517 ? -80.56   31.631  20.449  0    43.93  ? 817  VAL A HG11   1 
ATOM   7855  H HG12   . VAL A 1 517 ? -80.043  30.876  21.979  0    42.5   ? 817  VAL A HG12   1 
ATOM   7856  H HG13   . VAL A 1 517 ? -81.007  29.944  20.804  0    41.77  ? 817  VAL A HG13   1 
ATOM   7857  H HG21   . VAL A 1 517 ? -82.851  32.137  20.046  0    45.35  ? 817  VAL A HG21   1 
ATOM   7858  H HG22   . VAL A 1 517 ? -83.492  30.554  20.537  0    43.25  ? 817  VAL A HG22   1 
ATOM   7859  H HG23   . VAL A 1 517 ? -84.077  32.049  21.331  0    44.47  ? 817  VAL A HG23   1 
ATOM   7860  N N      . SER A 1 518 ? -83.32   31.991  24.797  1    32.2   ? 818  SER A N      1 
ATOM   7861  C CA     . SER A 1 518 ? -84.316  32.73   25.567  1    33.83  ? 818  SER A CA     1 
ATOM   7862  C C      . SER A 1 518 ? -83.999  34.177  25.354  1    36.43  ? 818  SER A C      1 
ATOM   7863  O O      . SER A 1 518 ? -82.877  34.587  25.636  1    37.65  ? 818  SER A O      1 
ATOM   7864  C CB     . SER A 1 518 ? -84.24   32.411  27.052  1    34.47  ? 818  SER A CB     1 
ATOM   7865  O OG     . SER A 1 518 ? -85.11   33.274  27.766  1    36.56  ? 818  SER A OG     1 
ATOM   7866  H H      . SER A 1 518 ? -82.364  32.224  25.046  0    43.86  ? 818  SER A H      1 
ATOM   7867  H HA     . SER A 1 518 ? -85.329  32.53   25.219  0    46.31  ? 818  SER A HA     1 
ATOM   7868  H HB2    . SER A 1 518 ? -84.547  31.38   27.219  0    46.27  ? 818  SER A HB2    1 
ATOM   7869  H HB3    . SER A 1 518 ? -83.219  32.56   27.4    0    47.83  ? 818  SER A HB3    1 
ATOM   7870  H HG     . SER A 1 518 ? -84.807  33.352  28.708  0    52.56  ? 818  SER A HG     1 
ATOM   7871  N N      . CYS A 1 519 ? -84.964  34.957  24.862  1    37.67  ? 819  CYS A N      1 
ATOM   7872  C CA     . CYS A 1 519 ? -84.715  36.367  24.577  1    40.49  ? 819  CYS A CA     1 
ATOM   7873  C C      . CYS A 1 519 ? -85.982  37.126  24.16   1    42.42  ? 819  CYS A C      1 
ATOM   7874  O O      . CYS A 1 519 ? -87.007  36.521  23.845  1    41.89  ? 819  CYS A O      1 
ATOM   7875  C CB     . CYS A 1 519 ? -83.672  36.47   23.47   1    41.01  ? 819  CYS A CB     1 
ATOM   7876  S SG     . CYS A 1 519 ? -84.212  35.736  21.904  1    40.53  ? 819  CYS A SG     1 
ATOM   7877  H H      . CYS A 1 519 ? -85.912  34.66   24.654  0    53.84  ? 819  CYS A H      1 
ATOM   7878  H HA     . CYS A 1 519 ? -84.315  36.848  25.469  0    60.4   ? 819  CYS A HA     1 
ATOM   7879  H HB2    . CYS A 1 519 ? -83.51   37.532  23.299  0    61.92  ? 819  CYS A HB2    1 
ATOM   7880  H HB3    . CYS A 1 519 ? -82.736  36.003  23.771  0    59.44  ? 819  CYS A HB3    1 
ATOM   7881  H HG     . CYS A 1 519 ? -83.242  35.881  20.995  0    59.75  ? 819  CYS A HG     1 
ATOM   7882  N N      . LYS A 1 520 ? -85.867  38.468  24.114  1    36.97  ? 820  LYS A N      1 
ATOM   7883  C CA     . LYS A 1 520 ? -86.869  39.355  23.56   1    38.49  ? 820  LYS A CA     1 
ATOM   7884  C C      . LYS A 1 520 ? -86.361  39.644  22.142  1    36.93  ? 820  LYS A C      1 
ATOM   7885  O O      . LYS A 1 520 ? -85.142  39.659  21.902  1    36.89  ? 820  LYS A O      1 
ATOM   7886  C CB     . LYS A 1 520 ? -86.95   40.663  24.343  1    44.28  ? 820  LYS A CB     1 
ATOM   7887  C CG     . LYS A 1 520 ? -87.098  40.51   25.84   1    46.77  ? 820  LYS A CG     1 
ATOM   7888  C CD     . LYS A 1 520 ? -87.032  41.873  26.514  1    52.23  ? 820  LYS A CD     1 
ATOM   7889  C CE     . LYS A 1 520 ? -87.344  41.813  27.987  1    55.22  ? 820  LYS A CE     1 
ATOM   7890  N NZ     . LYS A 1 520 ? -87.501  43.168  28.58   1    60.1   ? 820  LYS A NZ     1 
ATOM   7891  H H      . LYS A 1 520 ? -85.056  38.962  24.473  0    46.83  ? 820  LYS A H      1 
ATOM   7892  H HA     . LYS A 1 520 ? -87.853  38.89   23.52   0    49.34  ? 820  LYS A HA     1 
ATOM   7893  H HB2    . LYS A 1 520 ? -86.043  41.236  24.156  0    60.66  ? 820  LYS A HB2    1 
ATOM   7894  H HB3    . LYS A 1 520 ? -87.813  41.223  23.985  0    61.67  ? 820  LYS A HB3    1 
ATOM   7895  H HG2    . LYS A 1 520 ? -88.068  40.068  26.063  0    64.95  ? 820  LYS A HG2    1 
ATOM   7896  H HG3    . LYS A 1 520 ? -86.296  39.894  26.243  0    63.7   ? 820  LYS A HG3    1 
ATOM   7897  H HD2    . LYS A 1 520 ? -86.027  42.278  26.401  0    75.98  ? 820  LYS A HD2    1 
ATOM   7898  H HD3    . LYS A 1 520 ? -87.754  42.541  26.045  0    77.04  ? 820  LYS A HD3    1 
ATOM   7899  H HE2    . LYS A 1 520 ? -88.276  41.268  28.132  0    81.53  ? 820  LYS A HE2    1 
ATOM   7900  H HE3    . LYS A 1 520 ? -86.529  41.308  28.504  0    81.2   ? 820  LYS A HE3    1 
ATOM   7901  H HZ1    . LYS A 1 520 ? -87.721  43.092  29.567  0    94.45  ? 820  LYS A HZ1    1 
ATOM   7902  H HZ2    . LYS A 1 520 ? -86.64   43.695  28.473  0    93.21  ? 820  LYS A HZ2    1 
ATOM   7903  H HZ3    . LYS A 1 520 ? -88.252  43.665  28.112  0    93.38  ? 820  LYS A HZ3    1 
ATOM   7904  N N      . LEU A 1 521 ? -87.28   39.869  21.203  1    36.14  ? 821  LEU A N      1 
ATOM   7905  C CA     . LEU A 1 521 ? -86.919  40.188  19.815  1    35.3   ? 821  LEU A CA     1 
ATOM   7906  C C      . LEU A 1 521 ? -87.692  41.405  19.346  1    38.79  ? 821  LEU A C      1 
ATOM   7907  O O      . LEU A 1 521 ? -88.8    41.653  19.824  1    39.55  ? 821  LEU A O      1 
ATOM   7908  C CB     . LEU A 1 521 ? -87.22   39.018  18.883  1    30.97  ? 821  LEU A CB     1 
ATOM   7909  C CG     . LEU A 1 521 ? -86.512  37.723  19.171  1    27.95  ? 821  LEU A CG     1 
ATOM   7910  C CD1    . LEU A 1 521 ? -87.043  36.643  18.286  1    24.89  ? 821  LEU A CD1    1 
ATOM   7911  C CD2    . LEU A 1 521 ? -85.019  37.871  19.009  1    28.25  ? 821  LEU A CD2    1 
ATOM   7912  H H      . LEU A 1 521 ? -88.281  39.834  21.367  0    46.85  ? 821  LEU A H      1 
ATOM   7913  H HA     . LEU A 1 521 ? -85.861  40.435  19.738  0    44.53  ? 821  LEU A HA     1 
ATOM   7914  H HB2    . LEU A 1 521 ? -88.289  38.817  18.934  0    37.53  ? 821  LEU A HB2    1 
ATOM   7915  H HB3    . LEU A 1 521 ? -86.957  39.315  17.869  0    37.22  ? 821  LEU A HB3    1 
ATOM   7916  H HG     . LEU A 1 521 ? -86.706  37.434  20.203  0    32.13  ? 821  LEU A HG     1 
ATOM   7917  H HD11   . LEU A 1 521 ? -86.499  35.721  18.485  0    26.6   ? 821  LEU A HD11   1 
ATOM   7918  H HD12   . LEU A 1 521 ? -88.1    36.497  18.504  0    27.51  ? 821  LEU A HD12   1 
ATOM   7919  H HD13   . LEU A 1 521 ? -86.913  36.94   17.247  0    27.44  ? 821  LEU A HD13   1 
ATOM   7920  H HD21   . LEU A 1 521 ? -84.557  36.886  19.038  0    31.17  ? 821  LEU A HD21   1 
ATOM   7921  H HD22   . LEU A 1 521 ? -84.808  38.354  18.056  0    32.46  ? 821  LEU A HD22   1 
ATOM   7922  H HD23   . LEU A 1 521 ? -84.627  38.475  19.826  0    33.9   ? 821  LEU A HD23   1 
ATOM   7923  N N      . GLY A 1 522 ? -87.09   42.171  18.434  1    40.19  ? 822  GLY A N      1 
ATOM   7924  C CA     . GLY A 1 522 ? -87.678  43.387  17.89   1    43.09  ? 822  GLY A CA     1 
ATOM   7925  C C      . GLY A 1 522 ? -88.149  44.351  18.962  1    47.2   ? 822  GLY A C      1 
ATOM   7926  O O      . GLY A 1 522 ? -87.501  44.484  20.002  1    49.16  ? 822  GLY A O      1 
ATOM   7927  H H      . GLY A 1 522 ? -86.178  41.967  18.039  0    53.72  ? 822  GLY A H      1 
ATOM   7928  H HA2    . GLY A 1 522 ? -86.941  43.898  17.272  0    62.48  ? 822  GLY A HA2    1 
ATOM   7929  H HA3    . GLY A 1 522 ? -88.525  43.121  17.259  0    61.62  ? 822  GLY A HA3    1 
ATOM   7930  N N      . LYS A 1 523 ? -89.309  44.969  18.747  1    48.09  ? 823  LYS A N      1 
ATOM   7931  C CA     . LYS A 1 523 ? -89.904  45.843  19.742  1    51.63  ? 823  LYS A CA     1 
ATOM   7932  C C      . LYS A 1 523 ? -90.965  45.077  20.562  1    50.39  ? 823  LYS A C      1 
ATOM   7933  O O      . LYS A 1 523 ? -91.899  45.686  21.068  1    53.23  ? 823  LYS A O      1 
ATOM   7934  C CB     . LYS A 1 523 ? -90.476  47.085  19.058  1    54.99  ? 823  LYS A CB     1 
ATOM   7935  C CG     . LYS A 1 523 ? -89.395  47.889  18.336  1    56.99  ? 823  LYS A CG     1 
ATOM   7936  C CD     . LYS A 1 523 ? -89.903  49.249  17.881  1    61.37  ? 823  LYS A CD     1 
ATOM   7937  C CE     . LYS A 1 523 ? -88.805  50.149  17.362  1    64.33  ? 823  LYS A CE     1 
ATOM   7938  N NZ     . LYS A 1 523 ? -89.311  51.516  17.036  1    69.2   ? 823  LYS A NZ     1 
ATOM   7939  H H      . LYS A 1 523 ? -89.854  44.885  17.895  0    73.75  ? 823  LYS A H      1 
ATOM   7940  H HA     . LYS A 1 523 ? -89.143  46.196  20.437  0    81.95  ? 823  LYS A HA     1 
ATOM   7941  H HB2    . LYS A 1 523 ? -91.222  46.782  18.324  0    89.3   ? 823  LYS A HB2    1 
ATOM   7942  H HB3    . LYS A 1 523 ? -90.927  47.735  19.805  0    92.41  ? 823  LYS A HB3    1 
ATOM   7943  H HG2    . LYS A 1 523 ? -88.557  48.048  19.013  0    93.54  ? 823  LYS A HG2    1 
ATOM   7944  H HG3    . LYS A 1 523 ? -89.066  47.344  17.453  0    91.15  ? 823  LYS A HG3    1 
ATOM   7945  H HD2    . LYS A 1 523 ? -90.629  49.107  17.081  0    103.75 ? 823  LYS A HD2    1 
ATOM   7946  H HD3    . LYS A 1 523 ? -90.374  49.755  18.722  0    106.16 ? 823  LYS A HD3    1 
ATOM   7947  H HE2    . LYS A 1 523 ? -88.033  50.248  18.124  0    109.67 ? 823  LYS A HE2    1 
ATOM   7948  H HE3    . LYS A 1 523 ? -88.385  49.718  16.455  0    107.64 ? 823  LYS A HE3    1 
ATOM   7949  H HZ1    . LYS A 1 523 ? -88.549  52.102  16.709  0    122.89 ? 823  LYS A HZ1    1 
ATOM   7950  H HZ2    . LYS A 1 523 ? -90.018  51.46   16.31   0    121.33 ? 823  LYS A HZ2    1 
ATOM   7951  H HZ3    . LYS A 1 523 ? -89.722  51.939  17.862  0    123.19 ? 823  LYS A HZ3    1 
ATOM   7952  N N      . ASP A 1 524 ? -90.794  43.746  20.726  1    46.71  ? 824  ASP A N      1 
ATOM   7953  C CA     . ASP A 1 524 ? -91.699  42.904  21.499  1    45.76  ? 824  ASP A CA     1 
ATOM   7954  C C      . ASP A 1 524 ? -91.142  42.853  22.904  1    47.05  ? 824  ASP A C      1 
ATOM   7955  O O      . ASP A 1 524 ? -89.991  42.447  23.085  1    46.62  ? 824  ASP A O      1 
ATOM   7956  C CB     . ASP A 1 524 ? -91.743  41.482  20.919  1    41.67  ? 824  ASP A CB     1 
ATOM   7957  C CG     . ASP A 1 524 ? -92.779  40.58   21.551  1    41.4   ? 824  ASP A CG     1 
ATOM   7958  O OD1    . ASP A 1 524 ? -92.838  40.521  22.789  1    42.15  ? 824  ASP A OD1    1 
ATOM   7959  O OD2    . ASP A 1 524 ? -93.531  39.927  20.803  1    41.32  ? 824  ASP A OD2    1 
ATOM   7960  H H      . ASP A 1 524 ? -90.017  43.217  20.343  0    68.53  ? 824  ASP A H      1 
ATOM   7961  H HA     . ASP A 1 524 ? -92.708  43.31   21.478  0    71.82  ? 824  ASP A HA     1 
ATOM   7962  H HB2    . ASP A 1 524 ? -91.976  41.558  19.858  0    60.82  ? 824  ASP A HB2    1 
ATOM   7963  H HB3    . ASP A 1 524 ? -90.773  41.005  21.046  0    58.58  ? 824  ASP A HB3    1 
ATOM   7964  N N      . PRO A 1 525 ? -91.935  43.208  23.918  1    49.76  ? 825  PRO A N      1 
ATOM   7965  C CA     . PRO A 1 525 ? -91.413  43.204  25.293  1    51.54  ? 825  PRO A CA     1 
ATOM   7966  C C      . PRO A 1 525 ? -91.379  41.855  26.013  1    49.03  ? 825  PRO A C      1 
ATOM   7967  O O      . PRO A 1 525 ? -90.748  41.77   27.064  1    50.93  ? 825  PRO A O      1 
ATOM   7968  C CB     . PRO A 1 525 ? -92.351  44.167  25.994  1    55.9   ? 825  PRO A CB     1 
ATOM   7969  C CG     . PRO A 1 525 ? -93.639  43.981  25.3    1    55.1   ? 825  PRO A CG     1 
ATOM   7970  C CD     . PRO A 1 525 ? -93.315  43.716  23.868  1    51.95  ? 825  PRO A CD     1 
ATOM   7971  H HA     . PRO A 1 525 ? -90.414  43.637  25.34   0    80.54  ? 825  PRO A HA     1 
ATOM   7972  H HB2    . PRO A 1 525 ? -92.428  43.901  27.043  0    91.67  ? 825  PRO A HB2    1 
ATOM   7973  H HB3    . PRO A 1 525 ? -91.988  45.188  25.884  0    92.76  ? 825  PRO A HB3    1 
ATOM   7974  H HG2    . PRO A 1 525 ? -94.167  43.136  25.739  0    89.44  ? 825  PRO A HG2    1 
ATOM   7975  H HG3    . PRO A 1 525 ? -94.232  44.89   25.395  0    93.63  ? 825  PRO A HG3    1 
ATOM   7976  H HD2    . PRO A 1 525 ? -93.984  42.958  23.465  0    82.12  ? 825  PRO A HD2    1 
ATOM   7977  H HD3    . PRO A 1 525 ? -93.361  44.64   23.295  0    85.24  ? 825  PRO A HD3    1 
ATOM   7978  N N      . ASN A 1 526 ? -92.045  40.811  25.482  1    45.95  ? 826  ASN A N      1 
ATOM   7979  C CA     . ASN A 1 526 ? -92.063  39.489  26.123  1    43.84  ? 826  ASN A CA     1 
ATOM   7980  C C      . ASN A 1 526 ? -90.744  38.754  25.902  1    41.16  ? 826  ASN A C      1 
ATOM   7981  O O      . ASN A 1 526 ? -90.132  38.893  24.834  1    39.49  ? 826  ASN A O      1 
ATOM   7982  C CB     . ASN A 1 526 ? -93.184  38.624  25.549  1    42.28  ? 826  ASN A CB     1 
ATOM   7983  C CG     . ASN A 1 526 ? -94.574  39.186  25.709  1    46.06  ? 826  ASN A CG     1 
ATOM   7984  O OD1    . ASN A 1 526 ? -94.962  39.634  26.787  1    49.14  ? 826  ASN A OD1    1 
ATOM   7985  N ND2    . ASN A 1 526 ? -95.374  39.14   24.651  1    46.34  ? 826  ASN A ND2    1 
ATOM   7986  H H      . ASN A 1 526 ? -92.565  40.842  24.612  0    69.19  ? 826  ASN A H      1 
ATOM   7987  H HA     . ASN A 1 526 ? -92.233  39.602  27.193  0    67.31  ? 826  ASN A HA     1 
ATOM   7988  H HB2    . ASN A 1 526 ? -92.986  38.482  24.487  0    61.02  ? 826  ASN A HB2    1 
ATOM   7989  H HB3    . ASN A 1 526 ? -93.164  37.659  26.052  0    61.89  ? 826  ASN A HB3    1 
ATOM   7990  H HD21   . ASN A 1 526 ? -96.318  39.506  24.722  0    74.59  ? 826  ASN A HD21   1 
ATOM   7991  H HD22   . ASN A 1 526 ? -95.06   38.738  23.774  0    69.59  ? 826  ASN A HD22   1 
ATOM   7992  N N      . THR A 1 527 ? -90.334  37.934  26.888  1    41.33  ? 827  THR A N      1 
ATOM   7993  C CA     . THR A 1 527 ? -89.118  37.122  26.792  1    39.54  ? 827  THR A CA     1 
ATOM   7994  C C      . THR A 1 527 ? -89.552  35.697  26.38   1    35.53  ? 827  THR A C      1 
ATOM   7995  O O      . THR A 1 527 ? -90.194  34.985  27.159  1    35.56  ? 827  THR A O      1 
ATOM   7996  C CB     . THR A 1 527 ? -88.337  37.176  28.116  1    42.67  ? 827  THR A CB     1 
ATOM   7997  O OG1    . THR A 1 527 ? -88.151  38.54   28.481  1    46.99  ? 827  THR A OG1    1 
ATOM   7998  C CG2    . THR A 1 527 ? -86.98   36.495  28.029  1    40.95  ? 827  THR A CG2    1 
ATOM   7999  H H      . THR A 1 527 ? -90.827  37.812  27.767  0    60.19  ? 827  THR A H      1 
ATOM   8000  H HA     . THR A 1 527 ? -88.457  37.516  26.021  0    51.93  ? 827  THR A HA     1 
ATOM   8001  H HB     . THR A 1 527 ? -88.914  36.673  28.892  0    59.64  ? 827  THR A HB     1 
ATOM   8002  H HG1    . THR A 1 527 ? -87.522  38.981  27.851  0    66.2   ? 827  THR A HG1    1 
ATOM   8003  H HG21   . THR A 1 527 ? -86.442  36.613  28.969  0    55.55  ? 827  THR A HG21   1 
ATOM   8004  H HG22   . THR A 1 527 ? -87.1    35.431  27.828  0    52.14  ? 827  THR A HG22   1 
ATOM   8005  H HG23   . THR A 1 527 ? -86.391  36.939  27.228  0    52.84  ? 827  THR A HG23   1 
ATOM   8006  N N      . TYR A 1 528 ? -89.255  35.308  25.139  1    31.83  ? 828  TYR A N      1 
ATOM   8007  C CA     . TYR A 1 528 ? -89.654  34.011  24.605  1    28.54  ? 828  TYR A CA     1 
ATOM   8008  C C      . TYR A 1 528 ? -88.568  32.959  24.74   1    26.67  ? 828  TYR A C      1 
ATOM   8009  O O      . TYR A 1 528 ? -87.408  33.289  24.965  1    27.37  ? 828  TYR A O      1 
ATOM   8010  C CB     . TYR A 1 528 ? -89.992  34.171  23.123  1    26.6   ? 828  TYR A CB     1 
ATOM   8011  C CG     . TYR A 1 528 ? -91.132  35.125  22.869  1    28.58  ? 828  TYR A CG     1 
ATOM   8012  C CD1    . TYR A 1 528 ? -92.395  34.877  23.377  1    31.69  ? 828  TYR A CD1    1 
ATOM   8013  C CD2    . TYR A 1 528 ? -90.973  36.228  22.046  1    29.34  ? 828  TYR A CD2    1 
ATOM   8014  C CE1    . TYR A 1 528 ? -93.455  35.745  23.137  1    35.69  ? 828  TYR A CE1    1 
ATOM   8015  C CE2    . TYR A 1 528 ? -92.032  37.089  21.771  1    31.29  ? 828  TYR A CE2    1 
ATOM   8016  C CZ     . TYR A 1 528 ? -93.28   36.837  22.309  1    35.93  ? 828  TYR A CZ     1 
ATOM   8017  O OH     . TYR A 1 528 ? -94.35   37.674  22.07   1    38.87  ? 828  TYR A OH     1 
ATOM   8018  H H      . TYR A 1 528 ? -88.733  35.871  24.476  0    38.38  ? 828  TYR A H      1 
ATOM   8019  H HA     . TYR A 1 528 ? -90.544  33.644  25.114  0    35.03  ? 828  TYR A HA     1 
ATOM   8020  H HB2    . TYR A 1 528 ? -89.113  34.53   22.589  0    29.57  ? 828  TYR A HB2    1 
ATOM   8021  H HB3    . TYR A 1 528 ? -90.286  33.199  22.731  0    29.46  ? 828  TYR A HB3    1 
ATOM   8022  H HD1    . TYR A 1 528 ? -92.54   34.027  24.018  0    41.14  ? 828  TYR A HD1    1 
ATOM   8023  H HD2    . TYR A 1 528 ? -90.008  36.429  21.604  0    35     ? 828  TYR A HD2    1 
ATOM   8024  H HE1    . TYR A 1 528 ? -94.424  35.542  23.561  0    50.5   ? 828  TYR A HE1    1 
ATOM   8025  H HE2    . TYR A 1 528 ? -91.867  37.944  21.136  0    41.91  ? 828  TYR A HE2    1 
ATOM   8026  H HH     . TYR A 1 528 ? -94.102  38.389  21.427  0    55.79  ? 828  TYR A HH     1 
ATOM   8027  N N      . PHE A 1 529 ? -88.957  31.684  24.594  1    24.85  ? 829  PHE A N      1 
ATOM   8028  C CA     . PHE A 1 529 ? -88.072  30.521  24.564  1    23.36  ? 829  PHE A CA     1 
ATOM   8029  C C      . PHE A 1 529 ? -88.251  30.013  23.145  1    21.33  ? 829  PHE A C      1 
ATOM   8030  O O      . PHE A 1 529 ? -89.353  29.58   22.82   1    21.25  ? 829  PHE A O      1 
ATOM   8031  C CB     . PHE A 1 529 ? -88.547  29.424  25.532  1    23.98  ? 829  PHE A CB     1 
ATOM   8032  C CG     . PHE A 1 529 ? -88      29.433  26.946  1    26.25  ? 829  PHE A CG     1 
ATOM   8033  C CD1    . PHE A 1 529 ? -86.636  29.362  27.177  1    26.48  ? 829  PHE A CD1    1 
ATOM   8034  C CD2    . PHE A 1 529 ? -88.852  29.306  28.037  1    28.69  ? 829  PHE A CD2    1 
ATOM   8035  C CE1    . PHE A 1 529 ? -86.131  29.257  28.478  1    29.21  ? 829  PHE A CE1    1 
ATOM   8036  C CE2    . PHE A 1 529 ? -88.346  29.182  29.332  1    31.47  ? 829  PHE A CE2    1 
ATOM   8037  C CZ     . PHE A 1 529 ? -86.991  29.15   29.544  1    31.77  ? 829  PHE A CZ     1 
ATOM   8038  H H      . PHE A 1 529 ? -89.933  31.43   24.48   0    27.39  ? 829  PHE A H      1 
ATOM   8039  H HA     . PHE A 1 529 ? -87.031  30.776  24.754  0    25.5   ? 829  PHE A HA     1 
ATOM   8040  H HB2    . PHE A 1 529 ? -89.632  29.467  25.602  0    26.48  ? 829  PHE A HB2    1 
ATOM   8041  H HB3    . PHE A 1 529 ? -88.263  28.467  25.099  0    25.41  ? 829  PHE A HB3    1 
ATOM   8042  H HD1    . PHE A 1 529 ? -85.954  29.405  26.341  0    28.83  ? 829  PHE A HD1    1 
ATOM   8043  H HD2    . PHE A 1 529 ? -89.918  29.306  27.883  0    36.02  ? 829  PHE A HD2    1 
ATOM   8044  H HE1    . PHE A 1 529 ? -85.061  29.24   28.643  0    33.85  ? 829  PHE A HE1    1 
ATOM   8045  H HE2    . PHE A 1 529 ? -89.021  29.133  30.17   0    42.54  ? 829  PHE A HE2    1 
ATOM   8046  H HZ     . PHE A 1 529 ? -86.589  29.102  30.545  0    41.11  ? 829  PHE A HZ     1 
ATOM   8047  N N      . ILE A 1 530 ? -87.216  30.095  22.296  1    20.29  ? 830  ILE A N      1 
ATOM   8048  C CA     . ILE A 1 530 ? -87.294  29.678  20.889  1    19.07  ? 830  ILE A CA     1 
ATOM   8049  C C      . ILE A 1 530 ? -86.5    28.381  20.682  1    18.49  ? 830  ILE A C      1 
ATOM   8050  O O      . ILE A 1 530 ? -85.358  28.294  21.121  1    18.48  ? 830  ILE A O      1 
ATOM   8051  C CB     . ILE A 1 530 ? -86.772  30.801  19.963  1    18.88  ? 830  ILE A CB     1 
ATOM   8052  C CG1    . ILE A 1 530 ? -87.45   32.135  20.287  1    20.22  ? 830  ILE A CG1    1 
ATOM   8053  C CG2    . ILE A 1 530 ? -86.974  30.441  18.491  1    18.2   ? 830  ILE A CG2    1 
ATOM   8054  C CD1    . ILE A 1 530 ? -86.802  33.292  19.716  1    20.84  ? 830  ILE A CD1    1 
ATOM   8055  H H      . ILE A 1 530 ? -86.298  30.445  22.552  0    21.18  ? 830  ILE A H      1 
ATOM   8056  H HA     . ILE A 1 530 ? -88.33   29.49   20.612  0    19.35  ? 830  ILE A HA     1 
ATOM   8057  H HB     . ILE A 1 530 ? -85.703  30.896  20.136  0    19.11  ? 830  ILE A HB     1 
ATOM   8058  H HG12   . ILE A 1 530 ? -88.461  32.095  19.89   0    20.85  ? 830  ILE A HG12   1 
ATOM   8059  H HG13   . ILE A 1 530 ? -87.48   32.296  21.363  0    21.45  ? 830  ILE A HG13   1 
ATOM   8060  H HG21   . ILE A 1 530 ? -86.57   31.232  17.862  0    18.31  ? 830  ILE A HG21   1 
ATOM   8061  H HG22   . ILE A 1 530 ? -86.46   29.511  18.254  0    18.12  ? 830  ILE A HG22   1 
ATOM   8062  H HG23   . ILE A 1 530 ? -88.04   30.329  18.302  0    18.35  ? 830  ILE A HG23   1 
ATOM   8063  H HD11   . ILE A 1 530 ? -87.174  34.181  20.223  0    22.69  ? 830  ILE A HD11   1 
ATOM   8064  H HD12   . ILE A 1 530 ? -85.724  33.212  19.852  0    21.8   ? 830  ILE A HD12   1 
ATOM   8065  H HD13   . ILE A 1 530 ? -87.045  33.354  18.657  0    21.42  ? 830  ILE A HD13   1 
ATOM   8066  N N      . VAL A 1 531 ? -87.104  27.389  20.003  1    18.61  ? 831  VAL A N      1 
ATOM   8067  C CA     . VAL A 1 531 ? -86.486  26.09   19.739  1    18.82  ? 831  VAL A CA     1 
ATOM   8068  C C      . VAL A 1 531 ? -86.352  25.882  18.222  1    19     ? 831  VAL A C      1 
ATOM   8069  O O      . VAL A 1 531 ? -87.218  26.307  17.455  1    19.51  ? 831  VAL A O      1 
ATOM   8070  C CB     . VAL A 1 531 ? -87.306  24.934  20.383  1    20.12  ? 831  VAL A CB     1 
ATOM   8071  C CG1    . VAL A 1 531 ? -86.594  23.592  20.223  1    20.99  ? 831  VAL A CG1    1 
ATOM   8072  C CG2    . VAL A 1 531 ? -87.579  25.213  21.852  1    20.3   ? 831  VAL A CG2    1 
ATOM   8073  H H      . VAL A 1 531 ? -88.039  27.462  19.616  0    18.82  ? 831  VAL A H      1 
ATOM   8074  H HA     . VAL A 1 531 ? -85.489  26.055  20.173  0    18.97  ? 831  VAL A HA     1 
ATOM   8075  H HB     . VAL A 1 531 ? -88.267  24.862  19.876  0    21.18  ? 831  VAL A HB     1 
ATOM   8076  H HG11   . VAL A 1 531 ? -87.101  22.84   20.825  0    22.69  ? 831  VAL A HG11   1 
ATOM   8077  H HG12   . VAL A 1 531 ? -86.619  23.289  19.178  0    22.31  ? 831  VAL A HG12   1 
ATOM   8078  H HG13   . VAL A 1 531 ? -85.562  23.695  20.556  0    21.59  ? 831  VAL A HG13   1 
ATOM   8079  H HG21   . VAL A 1 531 ? -87.964  24.313  22.329  0    21.58  ? 831  VAL A HG21   1 
ATOM   8080  H HG22   . VAL A 1 531 ? -86.641  25.511  22.318  0    20.76  ? 831  VAL A HG22   1 
ATOM   8081  H HG23   . VAL A 1 531 ? -88.31   26.014  21.936  0    20.94  ? 831  VAL A HG23   1 
ATOM   8082  N N      . GLY A 1 532 ? -85.267  25.219  17.825  1    18.81  ? 832  GLY A N      1 
ATOM   8083  C CA     . GLY A 1 532 ? -84.964  24.88   16.443  1    19.59  ? 832  GLY A CA     1 
ATOM   8084  C C      . GLY A 1 532 ? -84.984  23.375  16.337  1    21.55  ? 832  GLY A C      1 
ATOM   8085  O O      . GLY A 1 532 ? -84.361  22.7    17.159  1    21.57  ? 832  GLY A O      1 
ATOM   8086  H H      . GLY A 1 532 ? -84.551  24.888  18.464  0    19.32  ? 832  GLY A H      1 
ATOM   8087  H HA2    . GLY A 1 532 ? -85.679  25.317  15.748  0    20.48  ? 832  GLY A HA2    1 
ATOM   8088  H HA3    . GLY A 1 532 ? -83.966  25.245  16.203  0    20.04  ? 832  GLY A HA3    1 
ATOM   8089  N N      . THR A 1 533 ? -85.722  22.835  15.367  1    23.68  ? 833  THR A N      1 
ATOM   8090  C CA     . THR A 1 533 ? -85.875  21.39   15.243  1    26.5   ? 833  THR A CA     1 
ATOM   8091  C C      . THR A 1 533 ? -85.518  20.868  13.826  1    28.84  ? 833  THR A C      1 
ATOM   8092  O O      . THR A 1 533 ? -85.244  21.651  12.92   1    28.17  ? 833  THR A O      1 
ATOM   8093  C CB     . THR A 1 533 ? -87.321  20.994  15.676  1    28.54  ? 833  THR A CB     1 
ATOM   8094  O OG1    . THR A 1 533 ? -88.237  21.371  14.649  1    30.27  ? 833  THR A OG1    1 
ATOM   8095  C CG2    . THR A 1 533 ? -87.762  21.611  17.002  1    26.62  ? 833  THR A CG2    1 
ATOM   8096  H H      . THR A 1 533 ? -86.223  23.362  14.658  0    25.95  ? 833  THR A H      1 
ATOM   8097  H HA     . THR A 1 533 ? -85.199  20.881  15.927  0    29.64  ? 833  THR A HA     1 
ATOM   8098  H HB     . THR A 1 533 ? -87.351  19.912  15.789  0    34.01  ? 833  THR A HB     1 
ATOM   8099  H HG1    . THR A 1 533 ? -89.159  21.107  14.905  0    36.12  ? 833  THR A HG1    1 
ATOM   8100  H HG21   . THR A 1 533 ? -88.685  21.141  17.336  0    30.97  ? 833  THR A HG21   1 
ATOM   8101  H HG22   . THR A 1 533 ? -87.003  21.486  17.77   0    29.38  ? 833  THR A HG22   1 
ATOM   8102  H HG23   . THR A 1 533 ? -87.948  22.676  16.87   0    28.87  ? 833  THR A HG23   1 
ATOM   8103  N N      . ALA A 1 534 ? -85.519  19.529  13.664  1    32.09  ? 834  ALA A N      1 
ATOM   8104  C CA     . ALA A 1 534 ? -85.262  18.827  12.418  1    35.49  ? 834  ALA A CA     1 
ATOM   8105  C C      . ALA A 1 534 ? -86.165  17.599  12.322  1    40.36  ? 834  ALA A C      1 
ATOM   8106  O O      . ALA A 1 534 ? -86.36   16.928  13.328  1    40.92  ? 834  ALA A O      1 
ATOM   8107  C CB     . ALA A 1 534 ? -83.827  18.375  12.399  1    34.98  ? 834  ALA A CB     1 
ATOM   8108  H H      . ALA A 1 534 ? -85.71   18.89   14.429  0    38.2   ? 834  ALA A H      1 
ATOM   8109  H HA     . ALA A 1 534 ? -85.447  19.472  11.561  0    42.65  ? 834  ALA A HA     1 
ATOM   8110  H HB1    . ALA A 1 534 ? -83.628  17.867  11.458  0    43.62  ? 834  ALA A HB1    1 
ATOM   8111  H HB2    . ALA A 1 534 ? -83.19   19.252  12.495  0    40.23  ? 834  ALA A HB2    1 
ATOM   8112  H HB3    . ALA A 1 534 ? -83.658  17.698  13.235  0    42.07  ? 834  ALA A HB3    1 
ATOM   8113  N N      . MET A 1 535 ? -86.699  17.291  11.127  1    44.52  ? 835  MET A N      1 
ATOM   8114  C CA     . MET A 1 535 ? -87.493  16.085  10.935  1    50.45  ? 835  MET A CA     1 
ATOM   8115  C C      . MET A 1 535 ? -86.548  14.998  10.485  1    53.7   ? 835  MET A C      1 
ATOM   8116  O O      . MET A 1 535 ? -86.081  14.98   9.341   1    55.81  ? 835  MET A O      1 
ATOM   8117  C CB     . MET A 1 535 ? -88.613  16.286  9.933   1    54.36  ? 835  MET A CB     1 
ATOM   8118  C CG     . MET A 1 535 ? -89.636  17.298  10.387  1    52.02  ? 835  MET A CG     1 
ATOM   8119  S SD     . MET A 1 535 ? -90.339  17.013  12.035  1    51.28  ? 835  MET A SD     1 
ATOM   8120  C CE     . MET A 1 535 ? -91.267  15.559  11.754  1    57.76  ? 835  MET A CE     1 
ATOM   8121  H H      . MET A 1 535 ? -86.595  17.852  10.288  0    56.64  ? 835  MET A H      1 
ATOM   8122  H HA     . MET A 1 535 ? -87.956  15.801  11.879  0    67.97  ? 835  MET A HA     1 
ATOM   8123  H HB2    . MET A 1 535 ? -88.183  16.615  8.989   0    75.34  ? 835  MET A HB2    1 
ATOM   8124  H HB3    . MET A 1 535 ? -89.128  15.337  9.792   0    78.64  ? 835  MET A HB3    1 
ATOM   8125  H HG2    . MET A 1 535 ? -89.164  18.279  10.402  0    68.97  ? 835  MET A HG2    1 
ATOM   8126  H HG3    . MET A 1 535 ? -90.46   17.302  9.676   0    74.45  ? 835  MET A HG3    1 
ATOM   8127  H HE1    . MET A 1 535 ? -91.851  15.336  12.645  0    84.9   ? 835  MET A HE1    1 
ATOM   8128  H HE2    . MET A 1 535 ? -91.93   15.722  10.906  0    86.34  ? 835  MET A HE2    1 
ATOM   8129  H HE3    . MET A 1 535 ? -90.584  14.738  11.541  0    84.72  ? 835  MET A HE3    1 
ATOM   8130  N N      . VAL A 1 536 ? -86.254  14.101  11.426  1    54.43  ? 836  VAL A N      1 
ATOM   8131  C CA     . VAL A 1 536 ? -85.275  13.047  11.314  1    57.23  ? 836  VAL A CA     1 
ATOM   8132  C C      . VAL A 1 536 ? -85.928  11.736  10.994  1    63.74  ? 836  VAL A C      1 
ATOM   8133  O O      . VAL A 1 536 ? -86.542  11.111  11.853  1    64.71  ? 836  VAL A O      1 
ATOM   8134  C CB     . VAL A 1 536 ? -84.482  12.959  12.639  1    53.37  ? 836  VAL A CB     1 
ATOM   8135  C CG1    . VAL A 1 536 ? -83.407  11.887  12.565  1    56.52  ? 836  VAL A CG1    1 
ATOM   8136  C CG2    . VAL A 1 536 ? -83.871  14.312  13.007  1    46.95  ? 836  VAL A CG2    1 
ATOM   8137  H H      . VAL A 1 536 ? -86.714  14.079  12.331  0    74.68  ? 836  VAL A H      1 
ATOM   8138  H HA     . VAL A 1 536 ? -84.556  13.293  10.535  0    78.9   ? 836  VAL A HA     1 
ATOM   8139  H HB     . VAL A 1 536 ? -85.162  12.684  13.444  0    73.25  ? 836  VAL A HB     1 
ATOM   8140  H HG11   . VAL A 1 536 ? -82.744  11.986  13.424  0    76.13  ? 836  VAL A HG11   1 
ATOM   8141  H HG12   . VAL A 1 536 ? -83.867  10.9    12.587  0    81.09  ? 836  VAL A HG12   1 
ATOM   8142  H HG13   . VAL A 1 536 ? -82.843  12.016  11.643  0    77.27  ? 836  VAL A HG13   1 
ATOM   8143  H HG21   . VAL A 1 536 ? -83.251  14.197  13.894  0    59.15  ? 836  VAL A HG21   1 
ATOM   8144  H HG22   . VAL A 1 536 ? -83.275  14.674  12.17   0    59.7   ? 836  VAL A HG22   1 
ATOM   8145  H HG23   . VAL A 1 536 ? -84.667  15.022  13.226  0    59.5   ? 836  VAL A HG23   1 
ATOM   8146  N N      . TYR A 1 537 ? -85.793  11.323  9.759   1    67.58  ? 837  TYR A N      1 
ATOM   8147  C CA     . TYR A 1 537 ? -86.273  10.033  9.313   1    72.96  ? 837  TYR A CA     1 
ATOM   8148  C C      . TYR A 1 537 ? -85.027  9.184   9.007   1    74.88  ? 837  TYR A C      1 
ATOM   8149  O O      . TYR A 1 537 ? -84.014  9.744   8.564   1    73.31  ? 837  TYR A O      1 
ATOM   8150  C CB     . TYR A 1 537 ? -87.165  10.186  8.071   1    76.23  ? 837  TYR A CB     1 
ATOM   8151  C CG     . TYR A 1 537 ? -88.339  11.103  8.324   1    74.15  ? 837  TYR A CG     1 
ATOM   8152  C CD1    . TYR A 1 537 ? -89.245  10.843  9.34    1    73.67  ? 837  TYR A CD1    1 
ATOM   8153  C CD2    . TYR A 1 537 ? -88.49   12.286  7.609   1    72.61  ? 837  TYR A CD2    1 
ATOM   8154  C CE1    . TYR A 1 537 ? -90.287  11.719  9.628   1    71.75  ? 837  TYR A CE1    1 
ATOM   8155  C CE2    . TYR A 1 537 ? -89.536  13.168  7.879   1    70.69  ? 837  TYR A CE2    1 
ATOM   8156  C CZ     . TYR A 1 537 ? -90.436  12.88   8.89    1    70.21  ? 837  TYR A CZ     1 
ATOM   8157  O OH     . TYR A 1 537 ? -91.486  13.734  9.159   1    68.5   ? 837  TYR A OH     1 
ATOM   8158  H H      . TYR A 1 537 ? -85.362  11.873  9.023   0    98.54  ? 837  TYR A H      1 
ATOM   8159  H HA     . TYR A 1 537 ? -86.872  9.565   10.089  0    112.64 ? 837  TYR A HA     1 
ATOM   8160  H HB2    . TYR A 1 537 ? -86.572  10.595  7.257   0    117.95 ? 837  TYR A HB2    1 
ATOM   8161  H HB3    . TYR A 1 537 ? -87.557  9.208   7.791   0    122.98 ? 837  TYR A HB3    1 
ATOM   8162  H HD1    . TYR A 1 537 ? -89.13   9.946   9.929   0    116.43 ? 837  TYR A HD1    1 
ATOM   8163  H HD2    . TYR A 1 537 ? -87.791  12.53   6.831   0    111.21 ? 837  TYR A HD2    1 
ATOM   8164  H HE1    . TYR A 1 537 ? -90.982  11.485  10.413  0    112.64 ? 837  TYR A HE1    1 
ATOM   8165  H HE2    . TYR A 1 537 ? -89.633  14.076  7.299   0    107.44 ? 837  TYR A HE2    1 
ATOM   8166  H HH     . TYR A 1 537 ? -91.516  14.489  8.513   0    105.13 ? 837  TYR A HH     1 
ATOM   8167  N N      . PRO A 1 538 ? -85.038  7.85    9.255   1    78.37  ? 838  PRO A N      1 
ATOM   8168  C CA     . PRO A 1 538 ? -83.848  7.041   8.908   1    80.45  ? 838  PRO A CA     1 
ATOM   8169  C C      . PRO A 1 538 ? -83.475  7.108   7.417   1    83.48  ? 838  PRO A C      1 
ATOM   8170  O O      . PRO A 1 538 ? -82.287  7.103   7.083   1    83.28  ? 838  PRO A O      1 
ATOM   8171  C CB     . PRO A 1 538 ? -84.254  5.608   9.29    1    84.71  ? 838  PRO A CB     1 
ATOM   8172  C CG     . PRO A 1 538 ? -85.451  5.733   10.152  1    83.52  ? 838  PRO A CG     1 
ATOM   8173  C CD     . PRO A 1 538 ? -86.13   7.009   9.794   1    80.94  ? 838  PRO A CD     1 
ATOM   8174  H HA     . PRO A 1 538 ? -82.995  7.351   9.509   0    123.99 ? 838  PRO A HA     1 
ATOM   8175  H HB2    . PRO A 1 538 ? -84.492  5.046   8.389   0    141.63 ? 838  PRO A HB2    1 
ATOM   8176  H HB3    . PRO A 1 538 ? -83.437  5.134   9.832   0    137.03 ? 838  PRO A HB3    1 
ATOM   8177  H HG2    . PRO A 1 538 ? -86.118  4.889   9.984   0    140.15 ? 838  PRO A HG2    1 
ATOM   8178  H HG3    . PRO A 1 538 ? -85.134  5.762   11.194  0    133.19 ? 838  PRO A HG3    1 
ATOM   8179  H HD2    . PRO A 1 538 ? -86.899  6.839   9.042   0    132.97 ? 838  PRO A HD2    1 
ATOM   8180  H HD3    . PRO A 1 538 ? -86.548  7.434   10.705  0    127.12 ? 838  PRO A HD3    1 
ATOM   8181  N N      . GLU A 1 539 ? -84.5    7.189   6.532   1    86.47  ? 839  GLU A N      1 
ATOM   8182  C CA     . GLU A 1 539 ? -84.348  7.249   5.072   1    89.85  ? 839  GLU A CA     1 
ATOM   8183  C C      . GLU A 1 539 ? -83.527  8.47    4.616   1    85.84  ? 839  GLU A C      1 
ATOM   8184  O O      . GLU A 1 539 ? -82.668  8.347   3.745   1    87.57  ? 839  GLU A O      1 
ATOM   8185  C CB     . GLU A 1 539 ? -85.734  7.267   4.384   1    93.2   ? 839  GLU A CB     1 
ATOM   8186  C CG     . GLU A 1 539 ? -86.642  6.089   4.732   1    98.12  ? 839  GLU A CG     1 
ATOM   8187  C CD     . GLU A 1 539 ? -87.588  6.272   5.908   1    95.76  ? 839  GLU A CD     1 
ATOM   8188  O OE1    . GLU A 1 539 ? -87.387  7.218   6.703   1    89.93  ? 839  GLU A OE1    1 
ATOM   8189  O OE2    . GLU A 1 539 ? -88.531  5.456   6.037   1    100.17 ? 839  GLU A OE2    1 
ATOM   8190  H H      . GLU A 1 539 ? -85.471  7.229   6.821   0    140.39 ? 839  GLU A H      1 
ATOM   8191  H HA     . GLU A 1 539 ? -83.825  6.353   4.738   0    150.22 ? 839  GLU A HA     1 
ATOM   8192  H HB2    . GLU A 1 539 ? -86.247  8.191   4.643   0    151.35 ? 839  GLU A HB2    1 
ATOM   8193  H HB3    . GLU A 1 539 ? -85.576  7.237   3.307   0    157.04 ? 839  GLU A HB3    1 
ATOM   8194  H HG2    . GLU A 1 539 ? -87.254  5.863   3.86    0    169.85 ? 839  GLU A HG2    1 
ATOM   8195  H HG3    . GLU A 1 539 ? -86.014  5.228   4.955   0    167.55 ? 839  GLU A HG3    1 
ATOM   8196  N N      . GLU A 1 540 ? -83.798  9.641   5.199   1    80.83  ? 840  GLU A N      1 
ATOM   8197  C CA     . GLU A 1 540 ? -83.087  10.878  4.871   1    76.99  ? 840  GLU A CA     1 
ATOM   8198  C C      . GLU A 1 540 ? -81.609  10.818  5.279   1    74.86  ? 840  GLU A C      1 
ATOM   8199  O O      . GLU A 1 540 ? -81.28   10.469  6.417   1    73.12  ? 840  GLU A O      1 
ATOM   8200  C CB     . GLU A 1 540 ? -83.734  12.083  5.589   1    72.39  ? 840  GLU A CB     1 
ATOM   8201  C CG     . GLU A 1 540 ? -85.131  12.441  5.109   1    73.78  ? 840  GLU A CG     1 
ATOM   8202  C CD     . GLU A 1 540 ? -85.712  13.679  5.772   1    69.14  ? 840  GLU A CD     1 
ATOM   8203  O OE1    . GLU A 1 540 ? -85.346  13.971  6.937   1    65.05  ? 840  GLU A OE1    1 
ATOM   8204  O OE2    . GLU A 1 540 ? -86.537  14.362  5.12    1    69.52  ? 840  GLU A OE2    1 
ATOM   8205  H H      . GLU A 1 540 ? -84.518  9.764   5.904   0    125.7  ? 840  GLU A H      1 
ATOM   8206  H HA     . GLU A 1 540 ? -83.155  11.049  3.798   0    120.62 ? 840  GLU A HA     1 
ATOM   8207  H HB2    . GLU A 1 540 ? -83.791  11.858  6.653   0    106.94 ? 840  GLU A HB2    1 
ATOM   8208  H HB3    . GLU A 1 540 ? -83.103  12.957  5.434   0    105.64 ? 840  GLU A HB3    1 
ATOM   8209  H HG2    . GLU A 1 540 ? -85.093  12.625  4.036   0    114    ? 840  GLU A HG2    1 
ATOM   8210  H HG3    . GLU A 1 540 ? -85.798  11.604  5.309   0    114.96 ? 840  GLU A HG3    1 
ATOM   8211  N N      . ALA A 1 541 ? -80.725  11.188  4.357   1    75.14  ? 841  ALA A N      1 
ATOM   8212  C CA     . ALA A 1 541 ? -79.296  11.27   4.639   1    73.16  ? 841  ALA A CA     1 
ATOM   8213  C C      . ALA A 1 541 ? -79.019  12.544  5.485   1    67.14  ? 841  ALA A C      1 
ATOM   8214  O O      . ALA A 1 541 ? -78.235  12.522  6.436   1    64.29  ? 841  ALA A O      1 
ATOM   8215  C CB     . ALA A 1 541 ? -78.525  11.315  3.327   1    75.51  ? 841  ALA A CB     1 
ATOM   8216  H H      . ALA A 1 541 ? -80.962  11.436  3.401   0    116.13 ? 841  ALA A H      1 
ATOM   8217  H HA     . ALA A 1 541 ? -78.971  10.394  5.199   0    111.03 ? 841  ALA A HA     1 
ATOM   8218  H HB1    . ALA A 1 541 ? -77.458  11.328  3.544   0    114.65 ? 841  ALA A HB1    1 
ATOM   8219  H HB2    . ALA A 1 541 ? -78.776  10.432  2.74    0    119.85 ? 841  ALA A HB2    1 
ATOM   8220  H HB3    . ALA A 1 541 ? -78.804  12.216  2.782   0    114.87 ? 841  ALA A HB3    1 
ATOM   8221  N N      . GLU A 1 542 ? -79.677  13.645  5.117   1    64.95  ? 842  GLU A N      1 
ATOM   8222  C CA     . GLU A 1 542 ? -79.626  14.898  5.838   1    58.46  ? 842  GLU A CA     1 
ATOM   8223  C C      . GLU A 1 542 ? -81.09   15.421  5.932   1    57.61  ? 842  GLU A C      1 
ATOM   8224  O O      . GLU A 1 542 ? -81.858  15.156  5.001   1    62.32  ? 842  GLU A O      1 
ATOM   8225  C CB     . GLU A 1 542 ? -78.679  15.882  5.135   1    56.82  ? 842  GLU A CB     1 
ATOM   8226  C CG     . GLU A 1 542 ? -78.335  17.081  6.013   1    50.06  ? 842  GLU A CG     1 
ATOM   8227  C CD     . GLU A 1 542 ? -77.094  17.881  5.666   1    48.56  ? 842  GLU A CD     1 
ATOM   8228  O OE1    . GLU A 1 542 ? -76.933  18.999  6.219   1    44.21  ? 842  GLU A OE1    1 
ATOM   8229  O OE2    . GLU A 1 542 ? -76.277  17.384  4.853   1    52.17  ? 842  GLU A OE2    1 
ATOM   8230  H H      . GLU A 1 542 ? -80.255  13.706  4.284   0    95.28  ? 842  GLU A H      1 
ATOM   8231  H HA     . GLU A 1 542 ? -79.245  14.684  6.833   0    78.99  ? 842  GLU A HA     1 
ATOM   8232  H HB2    . GLU A 1 542 ? -77.765  15.346  4.884   0    79.6   ? 842  GLU A HB2    1 
ATOM   8233  H HB3    . GLU A 1 542 ? -79.152  16.25   4.226   0    79.7   ? 842  GLU A HB3    1 
ATOM   8234  H HG2    . GLU A 1 542 ? -79.174  17.773  5.982   0    64.86  ? 842  GLU A HG2    1 
ATOM   8235  H HG3    . GLU A 1 542 ? -78.199  16.729  7.034   0    64.26  ? 842  GLU A HG3    1 
ATOM   8236  N N      . PRO A 1 543 ? -81.55   16.085  7.03    1    52.27  ? 843  PRO A N      1 
ATOM   8237  C CA     . PRO A 1 543 ? -82.971  16.452  7.114   1    52.24  ? 843  PRO A CA     1 
ATOM   8238  C C      . PRO A 1 543 ? -83.391  17.503  6.121   1    52.42  ? 843  PRO A C      1 
ATOM   8239  O O      . PRO A 1 543 ? -82.632  18.422  5.861   1    49.81  ? 843  PRO A O      1 
ATOM   8240  C CB     . PRO A 1 543 ? -83.118  16.957  8.549   1    46.76  ? 843  PRO A CB     1 
ATOM   8241  C CG     . PRO A 1 543 ? -81.959  16.378  9.269   1    45.44  ? 843  PRO A CG     1 
ATOM   8242  C CD     . PRO A 1 543 ? -80.865  16.472  8.276   1    46.88  ? 843  PRO A CD     1 
ATOM   8243  H HA     . PRO A 1 543 ? -83.591  15.564  6.995   0    72.42  ? 843  PRO A HA     1 
ATOM   8244  H HB2    . PRO A 1 543 ? -83.083  18.045  8.569   0    57.69  ? 843  PRO A HB2    1 
ATOM   8245  H HB3    . PRO A 1 543 ? -84.053  16.593  8.974   0    60.63  ? 843  PRO A HB3    1 
ATOM   8246  H HG2    . PRO A 1 543 ? -81.742  16.928  10.182  0    54.52  ? 843  PRO A HG2    1 
ATOM   8247  H HG3    . PRO A 1 543 ? -82.166  15.335  9.508   0    59.04  ? 843  PRO A HG3    1 
ATOM   8248  H HD2    . PRO A 1 543 ? -80.503  17.496  8.21    0    57.62  ? 843  PRO A HD2    1 
ATOM   8249  H HD3    . PRO A 1 543 ? -80.077  15.781  8.567   0    59.87  ? 843  PRO A HD3    1 
ATOM   8250  N N      . LYS A 1 544 ? -84.595  17.364  5.576   1    56.18  ? 844  LYS A N      1 
ATOM   8251  C CA     . LYS A 1 544 ? -85.12   18.295  4.591   1    57.26  ? 844  LYS A CA     1 
ATOM   8252  C C      . LYS A 1 544 ? -86.262  19.166  5.128   1    54.8   ? 844  LYS A C      1 
ATOM   8253  O O      . LYS A 1 544 ? -86.792  19.972  4.37    1    55.47  ? 844  LYS A O      1 
ATOM   8254  C CB     . LYS A 1 544 ? -85.556  17.526  3.341   1    63.57  ? 844  LYS A CB     1 
ATOM   8255  C CG     . LYS A 1 544 ? -84.44   16.668  2.777   1    66.31  ? 844  LYS A CG     1 
ATOM   8256  C CD     . LYS A 1 544 ? -84.733  16.142  1.381   1    71.7   ? 844  LYS A CD     1 
ATOM   8257  C CE     . LYS A 1 544 ? -85.762  15.04   1.351   1    75.9   ? 844  LYS A CE     1 
ATOM   8258  N NZ     . LYS A 1 544 ? -85.963  14.511  -0.03   1    81.59  ? 844  LYS A NZ     1 
ATOM   8259  H H      . LYS A 1 544 ? -85.239  16.612  5.801   0    79.5   ? 844  LYS A H      1 
ATOM   8260  H HA     . LYS A 1 544 ? -84.336  18.979  4.269   0    78.89  ? 844  LYS A HA     1 
ATOM   8261  H HB2    . LYS A 1 544 ? -86.391  16.875  3.594   0    94.74  ? 844  LYS A HB2    1 
ATOM   8262  H HB3    . LYS A 1 544 ? -85.852  18.239  2.573   0    94.04  ? 844  LYS A HB3    1 
ATOM   8263  H HG2    . LYS A 1 544 ? -83.529  17.264  2.727   0    95.97  ? 844  LYS A HG2    1 
ATOM   8264  H HG3    . LYS A 1 544 ? -84.284  15.808  3.427   0    97.81  ? 844  LYS A HG3    1 
ATOM   8265  H HD2    . LYS A 1 544 ? -85.097  16.958  0.758   0    110.63 ? 844  LYS A HD2    1 
ATOM   8266  H HD3    . LYS A 1 544 ? -83.81   15.743  0.961   0    110.98 ? 844  LYS A HD3    1 
ATOM   8267  H HE2    . LYS A 1 544 ? -85.428  14.219  1.984   0    118.49 ? 844  LYS A HE2    1 
ATOM   8268  H HE3    . LYS A 1 544 ? -86.714  15.43   1.709   0    118.2  ? 844  LYS A HE3    1 
ATOM   8269  H HZ1    . LYS A 1 544 ? -86.676  13.789  -0.025  0    134.47 ? 844  LYS A HZ1    1 
ATOM   8270  H HZ2    . LYS A 1 544 ? -86.259  15.261  -0.647  0    132.29 ? 844  LYS A HZ2    1 
ATOM   8271  H HZ3    . LYS A 1 544 ? -85.096  14.118  -0.382  0    132.56 ? 844  LYS A HZ3    1 
ATOM   8272  N N      . GLN A 1 545 ? -86.63   19.046  6.418   1    51.52  ? 845  GLN A N      1 
ATOM   8273  C CA     . GLN A 1 545 ? -87.672  19.873  7.024   1    49.3   ? 845  GLN A CA     1 
ATOM   8274  C C      . GLN A 1 545 ? -87.281  20.195  8.467   1    43.64  ? 845  GLN A C      1 
ATOM   8275  O O      . GLN A 1 545 ? -86.528  19.463  9.099   1    42.86  ? 845  GLN A O      1 
ATOM   8276  C CB     . GLN A 1 545 ? -89.036  19.16   7.049   1    53.96  ? 845  GLN A CB     1 
ATOM   8277  C CG     . GLN A 1 545 ? -89.488  18.499  5.765   1    59.73  ? 845  GLN A CG     1 
ATOM   8278  C CD     . GLN A 1 545 ? -90.513  17.413  6.043   1    63.4   ? 845  GLN A CD     1 
ATOM   8279  O OE1    . GLN A 1 545 ? -90.187  16.325  6.55    1    65.49  ? 845  GLN A OE1    1 
ATOM   8280  N NE2    . GLN A 1 545 ? -91.772  17.668  5.711   1    64.28  ? 845  GLN A NE2    1 
ATOM   8281  H H      . GLN A 1 545 ? -86.23   18.387  7.079   0    69.04  ? 845  GLN A H      1 
ATOM   8282  H HA     . GLN A 1 545 ? -87.775  20.815  6.489   0    66.35  ? 845  GLN A HA     1 
ATOM   8283  H HB2    . GLN A 1 545 ? -89.014  18.392  7.821   0    75.35  ? 845  GLN A HB2    1 
ATOM   8284  H HB3    . GLN A 1 545 ? -89.79   19.901  7.308   0    75.17  ? 845  GLN A HB3    1 
ATOM   8285  H HG2    . GLN A 1 545 ? -89.92   19.252  5.108   0    88     ? 845  GLN A HG2    1 
ATOM   8286  H HG3    . GLN A 1 545 ? -88.644  18.018  5.274   0    87.57  ? 845  GLN A HG3    1 
ATOM   8287  H HE21   . GLN A 1 545 ? -92.032  18.557  5.297   0    98.2   ? 845  GLN A HE21   1 
ATOM   8288  H HE22   . GLN A 1 545 ? -92.484  16.966  5.886   0    101.56 ? 845  GLN A HE22   1 
ATOM   8289  N N      . GLY A 1 546 ? -87.834  21.268  8.991   1    40.38  ? 846  GLY A N      1 
ATOM   8290  C CA     . GLY A 1 546 ? -87.607  21.677  10.369  1    35.85  ? 846  GLY A CA     1 
ATOM   8291  C C      . GLY A 1 546 ? -88.538  22.8    10.778  1    33.82  ? 846  GLY A C      1 
ATOM   8292  O O      . GLY A 1 546 ? -89.343  23.262  9.965   1    35.49  ? 846  GLY A O      1 
ATOM   8293  H H      . GLY A 1 546 ? -88.46   21.884  8.485   0    51.55  ? 846  GLY A H      1 
ATOM   8294  H HA2    . GLY A 1 546 ? -87.782  20.833  11.035  0    43.63  ? 846  GLY A HA2    1 
ATOM   8295  H HA3    . GLY A 1 546 ? -86.576  22.006  10.485  0    41.63  ? 846  GLY A HA3    1 
ATOM   8296  N N      . ARG A 1 547 ? -88.471  23.213  12.056  1    30.72  ? 847  ARG A N      1 
ATOM   8297  C CA     . ARG A 1 547 ? -89.291  24.302  12.603  1    28.93  ? 847  ARG A CA     1 
ATOM   8298  C C      . ARG A 1 547 ? -88.455  25.206  13.482  1    25.06  ? 847  ARG A C      1 
ATOM   8299  O O      . ARG A 1 547 ? -87.516  24.744  14.131  1    23.94  ? 847  ARG A O      1 
ATOM   8300  C CB     . ARG A 1 547 ? -90.423  23.775  13.513  1    30.31  ? 847  ARG A CB     1 
ATOM   8301  C CG     . ARG A 1 547 ? -91.525  22.999  12.83   1    35.14  ? 847  ARG A CG     1 
ATOM   8302  C CD     . ARG A 1 547 ? -92.812  22.996  13.641  1    36.69  ? 847  ARG A CD     1 
ATOM   8303  N NE     . ARG A 1 547 ? -92.665  22.352  14.949  1    35.51  ? 847  ARG A NE     1 
ATOM   8304  C CZ     . ARG A 1 547 ? -93.571  22.391  15.93   1    36.11  ? 847  ARG A CZ     1 
ATOM   8305  N NH1    . ARG A 1 547 ? -94.7    23.073  15.78   1    37.57  ? 847  ARG A NH1    1 
ATOM   8306  N NH2    . ARG A 1 547 ? -93.334  21.784  17.083  1    35.47  ? 847  ARG A NH2    1 
ATOM   8307  H H      . ARG A 1 547 ? -87.851  22.797  12.744  0    35.05  ? 847  ARG A H      1 
ATOM   8308  H HA     . ARG A 1 547 ? -89.728  24.903  11.808  0    33.62  ? 847  ARG A HA     1 
ATOM   8309  H HB2    . ARG A 1 547 ? -89.983  23.122  14.266  0    34.65  ? 847  ARG A HB2    1 
ATOM   8310  H HB3    . ARG A 1 547 ? -90.884  24.63   14.005  0    34.26  ? 847  ARG A HB3    1 
ATOM   8311  H HG2    . ARG A 1 547 ? -91.732  23.447  11.859  0    44.64  ? 847  ARG A HG2    1 
ATOM   8312  H HG3    . ARG A 1 547 ? -91.204  21.966  12.706  0    43.99  ? 847  ARG A HG3    1 
ATOM   8313  H HD2    . ARG A 1 547 ? -93.132  24.025  13.798  0    47.14  ? 847  ARG A HD2    1 
ATOM   8314  H HD3    . ARG A 1 547 ? -93.575  22.453  13.087  0    50.3   ? 847  ARG A HD3    1 
ATOM   8315  H HE     . ARG A 1 547 ? -91.813  21.824  15.111  0    44.13  ? 847  ARG A HE     1 
ATOM   8316  H HH11   . ARG A 1 547 ? -94.922  23.555  14.915  0    51.87  ? 847  ARG A HH11   1 
ATOM   8317  H HH12   . ARG A 1 547 ? -95.378  23.095  16.535  0    52.57  ? 847  ARG A HH12   1 
ATOM   8318  H HH21   . ARG A 1 547 ? -92.475  21.26   17.215  0    45.21  ? 847  ARG A HH21   1 
ATOM   8319  H HH22   . ARG A 1 547 ? -94.021  21.814  17.829  0    47.84  ? 847  ARG A HH22   1 
ATOM   8320  N N      . ILE A 1 548 ? -88.823  26.494  13.539  1    23.65  ? 848  ILE A N      1 
ATOM   8321  C CA     . ILE A 1 548 ? -88.296  27.44   14.51   1    21.09  ? 848  ILE A CA     1 
ATOM   8322  C C      . ILE A 1 548 ? -89.579  27.808  15.232  1    21.43  ? 848  ILE A C      1 
ATOM   8323  O O      . ILE A 1 548 ? -90.457  28.425  14.617  1    22.31  ? 848  ILE A O      1 
ATOM   8324  C CB     . ILE A 1 548 ? -87.594  28.652  13.891  1    20.03  ? 848  ILE A CB     1 
ATOM   8325  C CG1    . ILE A 1 548 ? -86.368  28.187  13.114  1    20.12  ? 848  ILE A CG1    1 
ATOM   8326  C CG2    . ILE A 1 548 ? -87.194  29.64   14.977  1    18.29  ? 848  ILE A CG2    1 
ATOM   8327  C CD1    . ILE A 1 548 ? -85.791  29.203  12.236  1    19.68  ? 848  ILE A CD1    1 
ATOM   8328  H H      . ILE A 1 548 ? -89.511  26.912  12.919  0    26.24  ? 848  ILE A H      1 
ATOM   8329  H HA     . ILE A 1 548 ? -87.618  26.957  15.212  0    21.66  ? 848  ILE A HA     1 
ATOM   8330  H HB     . ILE A 1 548 ? -88.284  29.143  13.209  0    21.07  ? 848  ILE A HB     1 
ATOM   8331  H HG12   . ILE A 1 548 ? -85.599  27.891  13.826  0    20.47  ? 848  ILE A HG12   1 
ATOM   8332  H HG13   . ILE A 1 548 ? -86.631  27.336  12.487  0    21.65  ? 848  ILE A HG13   1 
ATOM   8333  H HG21   . ILE A 1 548 ? -86.706  30.503  14.526  0    18.67  ? 848  ILE A HG21   1 
ATOM   8334  H HG22   . ILE A 1 548 ? -88.073  29.984  15.519  0    18.77  ? 848  ILE A HG22   1 
ATOM   8335  H HG23   . ILE A 1 548 ? -86.508  29.149  15.666  0    18.49  ? 848  ILE A HG23   1 
ATOM   8336  H HD11   . ILE A 1 548 ? -85.11   28.714  11.541  0    20.79  ? 848  ILE A HD11   1 
ATOM   8337  H HD12   . ILE A 1 548 ? -86.587  29.703  11.686  0    20.91  ? 848  ILE A HD12   1 
ATOM   8338  H HD13   . ILE A 1 548 ? -85.239  29.927  12.834  0    19.98  ? 848  ILE A HD13   1 
ATOM   8339  N N      . VAL A 1 549 ? -89.753  27.302  16.471  1    21.29  ? 849  VAL A N      1 
ATOM   8340  C CA     . VAL A 1 549 ? -90.972  27.52   17.25   1    22.01  ? 849  VAL A CA     1 
ATOM   8341  C C      . VAL A 1 549 ? -90.674  28.528  18.35   1    20.68  ? 849  VAL A C      1 
ATOM   8342  O O      . VAL A 1 549 ? -89.674  28.378  19.043  1    19.83  ? 849  VAL A O      1 
ATOM   8343  C CB     . VAL A 1 549 ? -91.514  26.199  17.849  1    23.76  ? 849  VAL A CB     1 
ATOM   8344  C CG1    . VAL A 1 549 ? -92.896  26.408  18.452  1    26.23  ? 849  VAL A CG1    1 
ATOM   8345  C CG2    . VAL A 1 549 ? -91.557  25.093  16.804  1    26.06  ? 849  VAL A CG2    1 
ATOM   8346  H H      . VAL A 1 549 ? -89.067  26.733  16.958  0    22.11  ? 849  VAL A H      1 
ATOM   8347  H HA     . VAL A 1 549 ? -91.739  27.941  16.601  0    23.79  ? 849  VAL A HA     1 
ATOM   8348  H HB     . VAL A 1 549 ? -90.846  25.871  18.645  0    25.32  ? 849  VAL A HB     1 
ATOM   8349  H HG11   . VAL A 1 549 ? -93.302  25.444  18.755  0    31.84  ? 849  VAL A HG11   1 
ATOM   8350  H HG12   . VAL A 1 549 ? -92.82   27.053  19.326  0    30.19  ? 849  VAL A HG12   1 
ATOM   8351  H HG13   . VAL A 1 549 ? -93.544  26.867  17.708  0    31.74  ? 849  VAL A HG13   1 
ATOM   8352  H HG21   . VAL A 1 549 ? -92.088  24.234  17.211  0    30.09  ? 849  VAL A HG21   1 
ATOM   8353  H HG22   . VAL A 1 549 ? -92.066  25.467  15.917  0    29.7   ? 849  VAL A HG22   1 
ATOM   8354  H HG23   . VAL A 1 549 ? -90.541  24.794  16.551  0    28.58  ? 849  VAL A HG23   1 
ATOM   8355  N N      . VAL A 1 550 ? -91.541  29.544  18.512  1    21.3   ? 850  VAL A N      1 
ATOM   8356  C CA     . VAL A 1 550 ? -91.408  30.592  19.523  1    21.29  ? 850  VAL A CA     1 
ATOM   8357  C C      . VAL A 1 550 ? -92.452  30.319  20.593  1    25.42  ? 850  VAL A C      1 
ATOM   8358  O O      . VAL A 1 550 ? -93.629  30.315  20.277  1    30.5   ? 850  VAL A O      1 
ATOM   8359  C CB     . VAL A 1 550 ? -91.634  31.981  18.889  1    21.93  ? 850  VAL A CB     1 
ATOM   8360  C CG1    . VAL A 1 550 ? -91.441  33.089  19.915  1    22.97  ? 850  VAL A CG1    1 
ATOM   8361  C CG2    . VAL A 1 550 ? -90.724  32.189  17.684  1    20.59  ? 850  VAL A CG2    1 
ATOM   8362  H H      . VAL A 1 550 ? -92.373  29.666  17.943  0    22.93  ? 850  VAL A H      1 
ATOM   8363  H HA     . VAL A 1 550 ? -90.417  30.579  19.974  0    21.82  ? 850  VAL A HA     1 
ATOM   8364  H HB     . VAL A 1 550 ? -92.66   32.043  18.529  0    25.04  ? 850  VAL A HB     1 
ATOM   8365  H HG11   . VAL A 1 550 ? -91.447  34.052  19.406  0    25.9   ? 850  VAL A HG11   1 
ATOM   8366  H HG12   . VAL A 1 550 ? -92.245  33.072  20.648  0    26.81  ? 850  VAL A HG12   1 
ATOM   8367  H HG13   . VAL A 1 550 ? -90.491  32.952  20.426  0    24.32  ? 850  VAL A HG13   1 
ATOM   8368  H HG21   . VAL A 1 550 ? -90.789  33.227  17.358  0    21.68  ? 850  VAL A HG21   1 
ATOM   8369  H HG22   . VAL A 1 550 ? -89.697  31.95   17.956  0    21     ? 850  VAL A HG22   1 
ATOM   8370  H HG23   . VAL A 1 550 ? -91.048  31.54   16.872  0    21.29  ? 850  VAL A HG23   1 
ATOM   8371  N N      . PHE A 1 551 ? -92.039  30.058  21.833  1    24.23  ? 851  PHE A N      1 
ATOM   8372  C CA     . PHE A 1 551 ? -92.963  29.805  22.933  1    30.65  ? 851  PHE A CA     1 
ATOM   8373  C C      . PHE A 1 551 ? -92.86   30.9    23.976  1    31.68  ? 851  PHE A C      1 
ATOM   8374  O O      . PHE A 1 551 ? -91.817  31.55   24.084  1    27.79  ? 851  PHE A O      1 
ATOM   8375  C CB     . PHE A 1 551 ? -92.609  28.504  23.647  1    30.41  ? 851  PHE A CB     1 
ATOM   8376  C CG     . PHE A 1 551 ? -92.605  27.246  22.834  1    29.91  ? 851  PHE A CG     1 
ATOM   8377  C CD1    . PHE A 1 551 ? -93.767  26.528  22.647  1    32.43  ? 851  PHE A CD1    1 
ATOM   8378  C CD2    . PHE A 1 551 ? -91.416  26.687  22.403  1    23.67  ? 851  PHE A CD2    1 
ATOM   8379  C CE1    . PHE A 1 551 ? -93.751  25.327  21.962  1    32.56  ? 851  PHE A CE1    1 
ATOM   8380  C CE2    . PHE A 1 551 ? -91.403  25.492  21.708  1    23.96  ? 851  PHE A CE2    1 
ATOM   8381  C CZ     . PHE A 1 551 ? -92.566  24.807  21.51   1    28.87  ? 851  PHE A CZ     1 
ATOM   8382  H H      . PHE A 1 551 ? -91.063  30.007  22.108  0    25.53  ? 851  PHE A H      1 
ATOM   8383  H HA     . PHE A 1 551 ? -93.996  29.742  22.595  0    39.05  ? 851  PHE A HA     1 
ATOM   8384  H HB2    . PHE A 1 551 ? -91.625  28.609  24.104  0    35.52  ? 851  PHE A HB2    1 
ATOM   8385  H HB3    . PHE A 1 551 ? -93.358  28.367  24.425  0    39.12  ? 851  PHE A HB3    1 
ATOM   8386  H HD1    . PHE A 1 551 ? -94.702  26.913  23.02   0    43.41  ? 851  PHE A HD1    1 
ATOM   8387  H HD2    . PHE A 1 551 ? -90.493  27.215  22.562  0    24.46  ? 851  PHE A HD2    1 
ATOM   8388  H HE1    . PHE A 1 551 ? -94.676  24.787  21.807  0    43.8   ? 851  PHE A HE1    1 
ATOM   8389  H HE2    . PHE A 1 551 ? -90.474  25.089  21.343  0    25.4   ? 851  PHE A HE2    1 
ATOM   8390  H HZ     . PHE A 1 551 ? -92.559  23.877  20.964  0    34.96  ? 851  PHE A HZ     1 
ATOM   8391  N N      . GLN A 1 552 ? -93.901  31.052  24.814  1    34.68  ? 852  GLN A N      1 
ATOM   8392  C CA     . GLN A 1 552 ? -93.849  31.989  25.929  1    36.4   ? 852  GLN A CA     1 
ATOM   8393  C C      . GLN A 1 552 ? -94.302  31.282  27.179  1    38.79  ? 852  GLN A C      1 
ATOM   8394  O O      . GLN A 1 552 ? -95.395  30.721  27.199  1    40.94  ? 852  GLN A O      1 
ATOM   8395  C CB     . GLN A 1 552 ? -94.73   33.221  25.709  1    38.7   ? 852  GLN A CB     1 
ATOM   8396  C CG     . GLN A 1 552 ? -94.454  34.298  26.759  1    40.51  ? 852  GLN A CG     1 
ATOM   8397  C CD     . GLN A 1 552 ? -95.393  35.461  26.711  1    43.56  ? 852  GLN A CD     1 
ATOM   8398  O OE1    . GLN A 1 552 ? -96.348  35.51   25.929  1    44.63  ? 852  GLN A OE1    1 
ATOM   8399  N NE2    . GLN A 1 552 ? -95.132  36.425  27.569  1    45.49  ? 852  GLN A NE2    1 
ATOM   8400  H H      . GLN A 1 552 ? -94.776  30.545  24.739  0    47.72  ? 852  GLN A H      1 
ATOM   8401  H HA     . GLN A 1 552 ? -92.821  32.316  26.081  0    48.41  ? 852  GLN A HA     1 
ATOM   8402  H HB2    . GLN A 1 552 ? -94.531  33.64   24.723  0    53.68  ? 852  GLN A HB2    1 
ATOM   8403  H HB3    . GLN A 1 552 ? -95.777  32.93   25.781  0    57.14  ? 852  GLN A HB3    1 
ATOM   8404  H HG2    . GLN A 1 552 ? -94.531  33.878  27.761  0    60.41  ? 852  GLN A HG2    1 
ATOM   8405  H HG3    . GLN A 1 552 ? -93.447  34.684  26.605  0    57.26  ? 852  GLN A HG3    1 
ATOM   8406  H HE21   . GLN A 1 552 ? -94.342  36.342  28.2    0    69.52  ? 852  GLN A HE21   1 
ATOM   8407  H HE22   . GLN A 1 552 ? -95.722  37.251  27.601  0    72.46  ? 852  GLN A HE22   1 
ATOM   8408  N N      . TYR A 1 553 ? -93.479  31.325  28.223  1    38.91  ? 853  TYR A N      1 
ATOM   8409  C CA     . TYR A 1 553 ? -93.822  30.699  29.477  1    41.65  ? 853  TYR A CA     1 
ATOM   8410  C C      . TYR A 1 553 ? -94.479  31.737  30.398  1    45.27  ? 853  TYR A C      1 
ATOM   8411  O O      . TYR A 1 553 ? -93.832  32.715  30.737  1    45.35  ? 853  TYR A O      1 
ATOM   8412  C CB     . TYR A 1 553 ? -92.558  30.108  30.126  1    40.42  ? 853  TYR A CB     1 
ATOM   8413  C CG     . TYR A 1 553 ? -92.901  29.295  31.348  1    43.61  ? 853  TYR A CG     1 
ATOM   8414  C CD1    . TYR A 1 553 ? -93.591  28.1    31.239  1    44.77  ? 853  TYR A CD1    1 
ATOM   8415  C CD2    . TYR A 1 553 ? -92.68   29.799  32.617  1    46.25  ? 853  TYR A CD2    1 
ATOM   8416  C CE1    . TYR A 1 553 ? -94.02   27.408  32.359  1    48.31  ? 853  TYR A CE1    1 
ATOM   8417  C CE2    . TYR A 1 553 ? -93.079  29.104  33.745  1    49.78  ? 853  TYR A CE2    1 
ATOM   8418  C CZ     . TYR A 1 553 ? -93.753  27.909  33.614  1    50.79  ? 853  TYR A CZ     1 
ATOM   8419  O OH     . TYR A 1 553 ? -94.149  27.213  34.732  1    54.75  ? 853  TYR A OH     1 
ATOM   8420  H H      . TYR A 1 553 ? -92.572  31.781  28.233  0    54.35  ? 853  TYR A H      1 
ATOM   8421  H HA     . TYR A 1 553 ? -94.53   29.89   29.308  0    62.58  ? 853  TYR A HA     1 
ATOM   8422  H HB2    . TYR A 1 553 ? -92.038  29.461  29.421  0    56.5   ? 853  TYR A HB2    1 
ATOM   8423  H HB3    . TYR A 1 553 ? -91.893  30.915  30.428  0    58.81  ? 853  TYR A HB3    1 
ATOM   8424  H HD1    . TYR A 1 553 ? -93.827  27.714  30.261  0    66.93  ? 853  TYR A HD1    1 
ATOM   8425  H HD2    . TYR A 1 553 ? -92.164  30.736  32.734  0    71.49  ? 853  TYR A HD2    1 
ATOM   8426  H HE1    . TYR A 1 553 ? -94.534  26.469  32.251  0    77.33  ? 853  TYR A HE1    1 
ATOM   8427  H HE2    . TYR A 1 553 ? -92.86   29.509  34.719  0    81.83  ? 853  TYR A HE2    1 
ATOM   8428  H HH     . TYR A 1 553 ? -93.887  27.692  35.561  0    92.24  ? 853  TYR A HH     1 
ATOM   8429  N N      . SER A 1 554 ? -95.756  31.578  30.757  1    48.75  ? 854  SER A N      1 
ATOM   8430  C CA     . SER A 1 554 ? -96.434  32.512  31.668  1    52.86  ? 854  SER A CA     1 
ATOM   8431  C C      . SER A 1 554 ? -97.583  31.794  32.344  1    56.93  ? 854  SER A C      1 
ATOM   8432  O O      . SER A 1 554 ? -98.289  31.021  31.695  1    56.83  ? 854  SER A O      1 
ATOM   8433  C CB     . SER A 1 554 ? -96.954  33.741  30.922  1    53.11  ? 854  SER A CB     1 
ATOM   8434  O OG     . SER A 1 554 ? -97.622  33.363  29.727  1    51.27  ? 854  SER A OG     1 
ATOM   8435  H H      . SER A 1 554 ? -96.358  30.834  30.419  0    77.51  ? 854  SER A H      1 
ATOM   8436  H HA     . SER A 1 554 ? -95.741  32.849  32.437  0    86.79  ? 854  SER A HA     1 
ATOM   8437  H HB2    . SER A 1 554 ? -97.671  34.269  31.55   0    90.42  ? 854  SER A HB2    1 
ATOM   8438  H HB3    . SER A 1 554 ? -96.122  34.397  30.67   0    84.88  ? 854  SER A HB3    1 
ATOM   8439  H HG     . SER A 1 554 ? -98.194  34.111  29.413  0    84.09  ? 854  SER A HG     1 
ATOM   8440  N N      . ASP A 1 555 ? -97.767  32.029  33.644  1    60.96  ? 855  ASP A N      1 
ATOM   8441  C CA     . ASP A 1 555 ? -98.824  31.383  34.423  1    65.6   ? 855  ASP A CA     1 
ATOM   8442  C C      . ASP A 1 555 ? -98.704  29.859  34.376  1    64.73  ? 855  ASP A C      1 
ATOM   8443  O O      . ASP A 1 555 ? -99.677  29.159  34.092  1    66.49  ? 855  ASP A O      1 
ATOM   8444  C CB     . ASP A 1 555 ? -100.219 31.841  33.962  1    68.59  ? 855  ASP A CB     1 
ATOM   8445  C CG     . ASP A 1 555 ? -100.388 33.334  33.987  1    70.01  ? 855  ASP A CG     1 
ATOM   8446  O OD1    . ASP A 1 555 ? -100.3   33.922  35.09   1    72.68  ? 855  ASP A OD1    1 
ATOM   8447  O OD2    . ASP A 1 555 ? -100.608 33.919  32.905  1    68.88  ? 855  ASP A OD2    1 
ATOM   8448  H H      . ASP A 1 555 ? -97.203  32.668  34.196  0    104.37 ? 855  ASP A H      1 
ATOM   8449  H HA     . ASP A 1 555 ? -98.711  31.687  35.463  0    116.86 ? 855  ASP A HA     1 
ATOM   8450  H HB2    . ASP A 1 555 ? -100.392 31.507  32.94   0    118.29 ? 855  ASP A HB2    1 
ATOM   8451  H HB3    . ASP A 1 555 ? -100.967 31.417  34.629  0    124.44 ? 855  ASP A HB3    1 
ATOM   8452  N N      . GLY A 1 556 ? -97.497  29.369  34.622  1    62.29  ? 856  GLY A N      1 
ATOM   8453  C CA     . GLY A 1 556 ? -97.221  27.942  34.663  1    61.71  ? 856  GLY A CA     1 
ATOM   8454  C C      . GLY A 1 556 ? -97.444  27.127  33.4    1    58.98  ? 856  GLY A C      1 
ATOM   8455  O O      . GLY A 1 556 ? -97.377  25.897  33.482  1    59.66  ? 856  GLY A O      1 
ATOM   8456  H H      . GLY A 1 556 ? -96.677  29.935  34.812  0    105.32 ? 856  GLY A H      1 
ATOM   8457  H HA2    . GLY A 1 556 ? -96.179  27.807  34.947  0    103.79 ? 856  GLY A HA2    1 
ATOM   8458  H HA3    . GLY A 1 556 ? -97.833  27.505  35.452  0    109.47 ? 856  GLY A HA3    1 
ATOM   8459  N N      . LYS A 1 557 ? -97.7    27.77   32.227  1    56.31  ? 857  LYS A N      1 
ATOM   8460  C CA     . LYS A 1 557 ? -97.939  27.044  30.966  1    54.22  ? 857  LYS A CA     1 
ATOM   8461  C C      . LYS A 1 557 ? -97.281  27.702  29.737  1    49.72  ? 857  LYS A C      1 
ATOM   8462  O O      . LYS A 1 557 ? -97.291  28.931  29.611  1    49.14  ? 857  LYS A O      1 
ATOM   8463  C CB     . LYS A 1 557 ? -99.451  26.868  30.712  1    58.02  ? 857  LYS A CB     1 
ATOM   8464  C CG     . LYS A 1 557 ? -100.111 25.855  31.65   1    62.56  ? 857  LYS A CG     1 
ATOM   8465  C CD     . LYS A 1 557 ? -101.471 25.347  31.19   1    66.11  ? 857  LYS A CD     1 
ATOM   8466  C CE     . LYS A 1 557 ? -101.753 23.961  31.75   1    69.49  ? 857  LYS A CE     1 
ATOM   8467  N NZ     . LYS A 1 557 ? -101.062 22.882  30.986  1    66.8   ? 857  LYS A NZ     1 
ATOM   8468  H H      . LYS A 1 557 ? -97.75   28.778  32.121  0    93.53  ? 857  LYS A H      1 
ATOM   8469  H HA     . LYS A 1 557 ? -97.5    26.052  31.054  0    88.78  ? 857  LYS A HA     1 
ATOM   8470  H HB2    . LYS A 1 557 ? -99.941  27.829  30.858  0    99.17  ? 857  LYS A HB2    1 
ATOM   8471  H HB3    . LYS A 1 557 ? -99.592  26.529  29.687  0    96.22  ? 857  LYS A HB3    1 
ATOM   8472  H HG2    . LYS A 1 557 ? -99.454  24.992  31.746  0    106.55 ? 857  LYS A HG2    1 
ATOM   8473  H HG3    . LYS A 1 557 ? -100.249 26.323  32.623  0    110.13 ? 857  LYS A HG3    1 
ATOM   8474  H HD2    . LYS A 1 557 ? -102.246 26.023  31.546  0    118.39 ? 857  LYS A HD2    1 
ATOM   8475  H HD3    . LYS A 1 557 ? -101.493 25.29   30.103  0    113.49 ? 857  LYS A HD3    1 
ATOM   8476  H HE2    . LYS A 1 557 ? -101.41  23.911  32.783  0    124.57 ? 857  LYS A HE2    1 
ATOM   8477  H HE3    . LYS A 1 557 ? -102.824 23.773  31.701  0    127.01 ? 857  LYS A HE3    1 
ATOM   8478  H HZ1    . LYS A 1 557 ? -101.155 21.994  31.471  0    119.98 ? 857  LYS A HZ1    1 
ATOM   8479  H HZ2    . LYS A 1 557 ? -101.484 22.8    30.067  0    116.6  ? 857  LYS A HZ2    1 
ATOM   8480  H HZ3    . LYS A 1 557 ? -100.079 23.107  30.88   0    113.82 ? 857  LYS A HZ3    1 
ATOM   8481  N N      . LEU A 1 558 ? -96.741  26.864  28.805  1    47.06  ? 858  LEU A N      1 
ATOM   8482  C CA     . LEU A 1 558 ? -96.085  27.329  27.574  1    43.22  ? 858  LEU A CA     1 
ATOM   8483  C C      . LEU A 1 558 ? -97.069  27.507  26.453  1    44.19  ? 858  LEU A C      1 
ATOM   8484  O O      . LEU A 1 558 ? -97.602  26.514  25.971  1    45.57  ? 858  LEU A O      1 
ATOM   8485  C CB     . LEU A 1 558 ? -95.061  26.312  27.052  1    40.34  ? 858  LEU A CB     1 
ATOM   8486  C CG     . LEU A 1 558 ? -93.726  26.203  27.728  1    38.49  ? 858  LEU A CG     1 
ATOM   8487  C CD1    . LEU A 1 558 ? -92.953  25.051  27.152  1    36.5   ? 858  LEU A CD1    1 
ATOM   8488  C CD2    . LEU A 1 558 ? -92.916  27.44   27.55   1    36.23  ? 858  LEU A CD2    1 
ATOM   8489  H H      . LEU A 1 558 ? -96.763  25.853  28.886  0    74.34  ? 858  LEU A H      1 
ATOM   8490  H HA     . LEU A 1 558 ? -95.612  28.293  27.751  0    63.95  ? 858  LEU A HA     1 
ATOM   8491  H HB2    . LEU A 1 558 ? -95.514  25.323  27.088  0    60.44  ? 858  LEU A HB2    1 
ATOM   8492  H HB3    . LEU A 1 558 ? -94.86   26.561  26.011  0    56.71  ? 858  LEU A HB3    1 
ATOM   8493  H HG     . LEU A 1 558 ? -93.868  26.029  28.793  0    56.84  ? 858  LEU A HG     1 
ATOM   8494  H HD11   . LEU A 1 558 ? -91.997  24.963  27.665  0    49.24  ? 858  LEU A HD11   1 
ATOM   8495  H HD12   . LEU A 1 558 ? -93.525  24.136  27.299  0    52.38  ? 858  LEU A HD12   1 
ATOM   8496  H HD13   . LEU A 1 558 ? -92.793  25.226  26.089  0    48.41  ? 858  LEU A HD13   1 
ATOM   8497  H HD21   . LEU A 1 558 ? -91.944  27.29   28.018  0    48.59  ? 858  LEU A HD21   1 
ATOM   8498  H HD22   . LEU A 1 558 ? -92.777  27.623  26.487  0    47.68  ? 858  LEU A HD22   1 
ATOM   8499  H HD23   . LEU A 1 558 ? -93.407  28.289  28.02   0    51.27  ? 858  LEU A HD23   1 
ATOM   8500  N N      . GLN A 1 559 ? -97.234  28.729  25.953  1    43.7   ? 859  GLN A N      1 
ATOM   8501  C CA     . GLN A 1 559 ? -98.113  28.981  24.814  1    44.79  ? 859  GLN A CA     1 
ATOM   8502  C C      . GLN A 1 559 ? -97.253  29.082  23.533  1    41.18  ? 859  GLN A C      1 
ATOM   8503  O O      . GLN A 1 559 ? -96.182  29.685  23.579  1    38.63  ? 859  GLN A O      1 
ATOM   8504  C CB     . GLN A 1 559 ? -98.918  30.284  25.069  1    47.61  ? 859  GLN A CB     1 
ATOM   8505  C CG     . GLN A 1 559 ? -100.092 30.546  24.098  1    49.85  ? 859  GLN A CG     1 
ATOM   8506  C CD     . GLN A 1 559 ? -101.168 29.451  24.057  1    53.06  ? 859  GLN A CD     1 
ATOM   8507  O OE1    . GLN A 1 559 ? -101.174 28.584  23.149  1    52.33  ? 859  GLN A OE1    1 
ATOM   8508  N NE2    . GLN A 1 559 ? -102.117 29.465  25.024  1    57.23  ? 859  GLN A NE2    1 
ATOM   8509  H H      . GLN A 1 559 ? -96.79   29.569  26.311  0    65.48  ? 859  GLN A H      1 
ATOM   8510  H HA     . GLN A 1 559 ? -98.819  28.161  24.689  0    70.24  ? 859  GLN A HA     1 
ATOM   8511  H HB2    . GLN A 1 559 ? -99.335  30.239  26.074  0    76.81  ? 859  GLN A HB2    1 
ATOM   8512  H HB3    . GLN A 1 559 ? -98.238  31.131  24.995  0    72.61  ? 859  GLN A HB3    1 
ATOM   8513  H HG2    . GLN A 1 559 ? -100.582 31.473  24.39   0    81.41  ? 859  GLN A HG2    1 
ATOM   8514  H HG3    . GLN A 1 559 ? -99.692  30.651  23.09   0    77.3   ? 859  GLN A HG3    1 
ATOM   8515  H HE21   . GLN A 1 559 ? -102.101 30.182  25.742  0    96.44  ? 859  GLN A HE21   1 
ATOM   8516  H HE22   . GLN A 1 559 ? -102.845 28.757  25.029  0    98.18  ? 859  GLN A HE22   1 
ATOM   8517  N N      . THR A 1 560 ? -97.688  28.477  22.411  1    41.38  ? 860  THR A N      1 
ATOM   8518  C CA     . THR A 1 560 ? -96.956  28.587  21.153  1    38.63  ? 860  THR A CA     1 
ATOM   8519  C C      . THR A 1 560 ? -97.34   29.919  20.51   1    39.17  ? 860  THR A C      1 
ATOM   8520  O O      . THR A 1 560 ? -98.5    30.12   20.154  1    42.08  ? 860  THR A O      1 
ATOM   8521  C CB     . THR A 1 560 ? -97.268  27.417  20.264  1    39.44  ? 860  THR A CB     1 
ATOM   8522  O OG1    . THR A 1 560 ? -97.007  26.219  21      1    39.71  ? 860  THR A OG1    1 
ATOM   8523  C CG2    . THR A 1 560 ? -96.449  27.44   18.978  1    36.93  ? 860  THR A CG2    1 
ATOM   8524  H H      . THR A 1 560 ? -98.538  27.929  22.339  0    63.28  ? 860  THR A H      1 
ATOM   8525  H HA     . THR A 1 560 ? -95.883  28.576  21.342  0    52.26  ? 860  THR A HA     1 
ATOM   8526  H HB     . THR A 1 560 ? -98.322  27.443  19.99   0    59.54  ? 860  THR A HB     1 
ATOM   8527  H HG1    . THR A 1 560 ? -96.026  26.097  21.104  0    55     ? 860  THR A HG1    1 
ATOM   8528  H HG21   . THR A 1 560 ? -96.586  26.503  18.441  0    52.17  ? 860  THR A HG21   1 
ATOM   8529  H HG22   . THR A 1 560 ? -96.767  28.256  18.33   0    51.52  ? 860  THR A HG22   1 
ATOM   8530  H HG23   . THR A 1 560 ? -95.392  27.56   19.208  0    48.6   ? 860  THR A HG23   1 
ATOM   8531  N N      . VAL A 1 561 ? -96.358  30.819  20.373  1    36.83  ? 861  VAL A N      1 
ATOM   8532  C CA     . VAL A 1 561 ? -96.511  32.183  19.864  1    37.49  ? 861  VAL A CA     1 
ATOM   8533  C C      . VAL A 1 561 ? -96.476  32.25   18.34   1    37.06  ? 861  VAL A C      1 
ATOM   8534  O O      . VAL A 1 561 ? -97.262  32.978  17.729  1    39.4   ? 861  VAL A O      1 
ATOM   8535  C CB     . VAL A 1 561 ? -95.411  33.074  20.47   1    35.76  ? 861  VAL A CB     1 
ATOM   8536  C CG1    . VAL A 1 561 ? -95.508  34.501  19.943  1    37.01  ? 861  VAL A CG1    1 
ATOM   8537  C CG2    . VAL A 1 561 ? -95.468  33.039  21.992  1    36.79  ? 861  VAL A CG2    1 
ATOM   8538  H H      . VAL A 1 561 ? -95.391  30.608  20.594  0    48.75  ? 861  VAL A H      1 
ATOM   8539  H HA     . VAL A 1 561 ? -97.472  32.578  20.19   0    55.16  ? 861  VAL A HA     1 
ATOM   8540  H HB     . VAL A 1 561 ? -94.447  32.677  20.157  0    46.03  ? 861  VAL A HB     1 
ATOM   8541  H HG11   . VAL A 1 561 ? -94.941  35.165  20.594  0    50.56  ? 861  VAL A HG11   1 
ATOM   8542  H HG12   . VAL A 1 561 ? -95.088  34.548  18.94   0    50.24  ? 861  VAL A HG12   1 
ATOM   8543  H HG13   . VAL A 1 561 ? -96.554  34.803  19.922  0    53.86  ? 861  VAL A HG13   1 
ATOM   8544  H HG21   . VAL A 1 561 ? -94.753  33.754  22.395  0    49.94  ? 861  VAL A HG21   1 
ATOM   8545  H HG22   . VAL A 1 561 ? -96.475  33.299  22.316  0    53.43  ? 861  VAL A HG22   1 
ATOM   8546  H HG23   . VAL A 1 561 ? -95.209  32.042  22.346  0    49.8   ? 861  VAL A HG23   1 
ATOM   8547  N N      . ALA A 1 562 ? -95.52   31.559  17.727  1    34.45  ? 862  ALA A N      1 
ATOM   8548  C CA     . ALA A 1 562 ? -95.384  31.52   16.272  1    34.51  ? 862  ALA A CA     1 
ATOM   8549  C C      . ALA A 1 562 ? -94.492  30.349  15.869  1    32.48  ? 862  ALA A C      1 
ATOM   8550  O O      . ALA A 1 562 ? -93.707  29.856  16.679  1    30.3   ? 862  ALA A O      1 
ATOM   8551  C CB     . ALA A 1 562 ? -94.794  32.831  15.76   1    33.96  ? 862  ALA A CB     1 
ATOM   8552  H H      . ALA A 1 562 ? -94.81   31.03   18.225  0    44.08  ? 862  ALA A H      1 
ATOM   8553  H HA     . ALA A 1 562 ? -96.362  31.378  15.815  0    48.5   ? 862  ALA A HA     1 
ATOM   8554  H HB1    . ALA A 1 562 ? -94.66   32.765  14.681  0    45.09  ? 862  ALA A HB1    1 
ATOM   8555  H HB2    . ALA A 1 562 ? -95.474  33.648  15.999  0    46.69  ? 862  ALA A HB2    1 
ATOM   8556  H HB3    . ALA A 1 562 ? -93.832  33.001  16.244  0    42.62  ? 862  ALA A HB3    1 
ATOM   8557  N N      . GLU A 1 563 ? -94.65   29.862  14.651  1    33.59  ? 863  GLU A N      1 
ATOM   8558  C CA     . GLU A 1 563 ? -93.774  28.814  14.129  1    32.09  ? 863  GLU A CA     1 
ATOM   8559  C C      . GLU A 1 563 ? -93.459  29.155  12.691  1    32.51  ? 863  GLU A C      1 
ATOM   8560  O O      . GLU A 1 563 ? -94.327  29.65   11.959  1    35.05  ? 863  GLU A O      1 
ATOM   8561  C CB     . GLU A 1 563 ? -94.345  27.399  14.286  1    33.6   ? 863  GLU A CB     1 
ATOM   8562  C CG     . GLU A 1 563 ? -95.693  27.159  13.625  1    37.54  ? 863  GLU A CG     1 
ATOM   8563  C CD     . GLU A 1 563 ? -96.181  25.724  13.742  1    39.51  ? 863  GLU A CD     1 
ATOM   8564  O OE1    . GLU A 1 563 ? -95.473  24.831  13.228  1    39.14  ? 863  GLU A OE1    1 
ATOM   8565  O OE2    . GLU A 1 563 ? -97.258  25.486  14.344  1    41.84  ? 863  GLU A OE2    1 
ATOM   8566  H H      . GLU A 1 563 ? -95.37   30.161  14.002  0    45.94  ? 863  GLU A H      1 
ATOM   8567  H HA     . GLU A 1 563 ? -92.833  28.832  14.678  0    38.03  ? 863  GLU A HA     1 
ATOM   8568  H HB2    . GLU A 1 563 ? -93.637  26.698  13.847  0    42.79  ? 863  GLU A HB2    1 
ATOM   8569  H HB3    . GLU A 1 563 ? -94.46   27.185  15.347  0    43.42  ? 863  GLU A HB3    1 
ATOM   8570  H HG2    . GLU A 1 563 ? -96.433  27.808  14.09   0    53.66  ? 863  GLU A HG2    1 
ATOM   8571  H HG3    . GLU A 1 563 ? -95.623  27.386  12.562  0    53.17  ? 863  GLU A HG3    1 
ATOM   8572  N N      . LYS A 1 564 ? -92.196  28.959  12.314  1    27.42  ? 864  LYS A N      1 
ATOM   8573  C CA     . LYS A 1 564 ? -91.68   29.276  10.987  1    28.19  ? 864  LYS A CA     1 
ATOM   8574  C C      . LYS A 1 564 ? -91.11   27.989  10.424  1    29.75  ? 864  LYS A C      1 
ATOM   8575  O O      . LYS A 1 564 ? -90.257  27.389  11.076  1    27.97  ? 864  LYS A O      1 
ATOM   8576  C CB     . LYS A 1 564 ? -90.581  30.367  11.102  1    25.21  ? 864  LYS A CB     1 
ATOM   8577  C CG     . LYS A 1 564 ? -90.042  30.927  9.781   1    26.4   ? 864  LYS A CG     1 
ATOM   8578  C CD     . LYS A 1 564 ? -91.066  31.79   9.072   1    33.06  ? 864  LYS A CD     1 
ATOM   8579  C CE     . LYS A 1 564 ? -90.523  32.488  7.854   1    34.9   ? 864  LYS A CE     1 
ATOM   8580  N NZ     . LYS A 1 564 ? -91.579  33.297  7.169   1    38.6   ? 864  LYS A NZ     1 
ATOM   8581  H H      . LYS A 1 564 ? -91.498  28.546  12.922  0    31.13  ? 864  LYS A H      1 
ATOM   8582  H HA     . LYS A 1 564 ? -92.473  29.629  10.332  0    36.92  ? 864  LYS A HA     1 
ATOM   8583  H HB2    . LYS A 1 564 ? -90.988  31.201  11.672  0    29.34  ? 864  LYS A HB2    1 
ATOM   8584  H HB3    . LYS A 1 564 ? -89.735  29.945  11.64   0    26.89  ? 864  LYS A HB3    1 
ATOM   8585  H HG2    . LYS A 1 564 ? -89.174  31.549  9.994   0    30.12  ? 864  LYS A HG2    1 
ATOM   8586  H HG3    . LYS A 1 564 ? -89.763  30.109  9.119   0    31.76  ? 864  LYS A HG3    1 
ATOM   8587  H HD2    . LYS A 1 564 ? -91.888  31.161  8.733   0    44.39  ? 864  LYS A HD2    1 
ATOM   8588  H HD3    . LYS A 1 564 ? -91.438  32.548  9.761   0    42.65  ? 864  LYS A HD3    1 
ATOM   8589  H HE2    . LYS A 1 564 ? -89.721  33.159  8.16    0    44.91  ? 864  LYS A HE2    1 
ATOM   8590  H HE3    . LYS A 1 564 ? -90.145  31.751  7.148   0    46.38  ? 864  LYS A HE3    1 
ATOM   8591  H HZ1    . LYS A 1 564 ? -91.24   33.615  6.267   0    55.66  ? 864  LYS A HZ1    1 
ATOM   8592  H HZ2    . LYS A 1 564 ? -92.412  32.736  7.026   0    55.75  ? 864  LYS A HZ2    1 
ATOM   8593  H HZ3    . LYS A 1 564 ? -91.818  34.104  7.736   0    54.39  ? 864  LYS A HZ3    1 
ATOM   8594  N N      . GLU A 1 565 ? -91.601  27.527  9.259   1    33.66  ? 865  GLU A N      1 
ATOM   8595  C CA     . GLU A 1 565 ? -91.072  26.307  8.658   1    36.43  ? 865  GLU A CA     1 
ATOM   8596  C C      . GLU A 1 565 ? -89.728  26.599  7.988   1    35.08  ? 865  GLU A C      1 
ATOM   8597  O O      . GLU A 1 565 ? -89.524  27.699  7.475   1    34.4   ? 865  GLU A O      1 
ATOM   8598  C CB     . GLU A 1 565 ? -92.048  25.733  7.617   1    41.07  ? 865  GLU A CB     1 
ATOM   8599  C CG     . GLU A 1 565 ? -91.695  24.309  7.186   1    44.73  ? 865  GLU A CG     1 
ATOM   8600  C CD     . GLU A 1 565 ? -92.548  23.677  6.095   1    49.51  ? 865  GLU A CD     1 
ATOM   8601  O OE1    . GLU A 1 565 ? -92.133  22.622  5.56    1    52.8   ? 865  GLU A OE1    1 
ATOM   8602  O OE2    . GLU A 1 565 ? -93.626  24.231  5.775   1    49.95  ? 865  GLU A OE2    1 
ATOM   8603  H H      . GLU A 1 565 ? -92.349  27.963  8.728   0    45.77  ? 865  GLU A H      1 
ATOM   8604  H HA     . GLU A 1 565 ? -90.922  25.56   9.436   0    46.26  ? 865  GLU A HA     1 
ATOM   8605  H HB2    . GLU A 1 565 ? -93.056  25.728  8.03    0    58.47  ? 865  GLU A HB2    1 
ATOM   8606  H HB3    . GLU A 1 565 ? -92.02   26.362  6.729   0    58.32  ? 865  GLU A HB3    1 
ATOM   8607  H HG2    . GLU A 1 565 ? -90.671  24.293  6.819   0    61.41  ? 865  GLU A HG2    1 
ATOM   8608  H HG3    . GLU A 1 565 ? -91.771  23.665  8.06    0    61.86  ? 865  GLU A HG3    1 
ATOM   8609  N N      . VAL A 1 566 ? -88.825  25.603  7.972   1    35.35  ? 866  VAL A N      1 
ATOM   8610  C CA     . VAL A 1 566 ? -87.512  25.691  7.317   1    34.87  ? 866  VAL A CA     1 
ATOM   8611  C C      . VAL A 1 566 ? -87.228  24.396  6.522   1    39.06  ? 866  VAL A C      1 
ATOM   8612  O O      . VAL A 1 566 ? -87.823  23.352  6.805   1    41.45  ? 866  VAL A O      1 
ATOM   8613  C CB     . VAL A 1 566 ? -86.37   26.021  8.307   1    30.37  ? 866  VAL A CB     1 
ATOM   8614  C CG1    . VAL A 1 566 ? -86.517  27.426  8.869   1    27.39  ? 866  VAL A CG1    1 
ATOM   8615  C CG2    . VAL A 1 566 ? -86.297  25.01   9.434   1    29.37  ? 866  VAL A CG2    1 
ATOM   8616  H H      . VAL A 1 566 ? -88.982  24.701  8.411   0    43.92  ? 866  VAL A H      1 
ATOM   8617  H HA     . VAL A 1 566 ? -87.542  26.49   6.577   0    43.69  ? 866  VAL A HA     1 
ATOM   8618  H HB     . VAL A 1 566 ? -85.427  25.982  7.767   0    35.3   ? 866  VAL A HB     1 
ATOM   8619  H HG11   . VAL A 1 566 ? -85.681  27.633  9.535   0    29.57  ? 866  VAL A HG11   1 
ATOM   8620  H HG12   . VAL A 1 566 ? -86.516  28.138  8.045   0    31.35  ? 866  VAL A HG12   1 
ATOM   8621  H HG13   . VAL A 1 566 ? -87.454  27.493  9.419   0    30.81  ? 866  VAL A HG13   1 
ATOM   8622  H HG21   . VAL A 1 566 ? -85.513  25.324  10.121  0    32.31  ? 866  VAL A HG21   1 
ATOM   8623  H HG22   . VAL A 1 566 ? -87.247  24.982  9.966   0    33.78  ? 866  VAL A HG22   1 
ATOM   8624  H HG23   . VAL A 1 566 ? -86.059  24.025  9.035   0    35.16  ? 866  VAL A HG23   1 
ATOM   8625  N N      . LYS A 1 567 ? -86.352  24.469  5.501   1    40.57  ? 867  LYS A N      1 
ATOM   8626  C CA     . LYS A 1 567 ? -86.016  23.302  4.661   1    45.22  ? 867  LYS A CA     1 
ATOM   8627  C C      . LYS A 1 567 ? -84.66   22.672  5.079   1    43.28  ? 867  LYS A C      1 
ATOM   8628  O O      . LYS A 1 567 ? -83.74   22.55   4.269   1    44.86  ? 867  LYS A O      1 
ATOM   8629  C CB     . LYS A 1 567 ? -85.988  23.69   3.168   1    48.81  ? 867  LYS A CB     1 
ATOM   8630  C CG     . LYS A 1 567 ? -87.337  24.093  2.571   1    51.55  ? 867  LYS A CG     1 
ATOM   8631  C CD     . LYS A 1 567 ? -87.166  25.154  1.47    1    51.97  ? 867  LYS A CD     1 
ATOM   8632  C CE     . LYS A 1 567 ? -88.273  25.151  0.448   1    55.74  ? 867  LYS A CE     1 
ATOM   8633  N NZ     . LYS A 1 567 ? -88.042  26.161  -0.617  1    56.32  ? 867  LYS A NZ     1 
ATOM   8634  H H      . LYS A 1 567 ? -85.865  25.317  5.233   0    51.79  ? 867  LYS A H      1 
ATOM   8635  H HA     . LYS A 1 567 ? -86.777  22.532  4.766   0    61.8   ? 867  LYS A HA     1 
ATOM   8636  H HB2    . LYS A 1 567 ? -85.303  24.527  3.043   0    66.77  ? 867  LYS A HB2    1 
ATOM   8637  H HB3    . LYS A 1 567 ? -85.637  22.837  2.588   0    69.68  ? 867  LYS A HB3    1 
ATOM   8638  H HG2    . LYS A 1 567 ? -87.805  23.216  2.126   0    77.09  ? 867  LYS A HG2    1 
ATOM   8639  H HG3    . LYS A 1 567 ? -87.977  24.507  3.348   0    73.03  ? 867  LYS A HG3    1 
ATOM   8640  H HD2    . LYS A 1 567 ? -87.142  26.14   1.931   0    75.17  ? 867  LYS A HD2    1 
ATOM   8641  H HD3    . LYS A 1 567 ? -86.232  24.97   0.94    0    77.51  ? 867  LYS A HD3    1 
ATOM   8642  H HE2    . LYS A 1 567 ? -88.322  24.17   -0.022  0    88.61  ? 867  LYS A HE2    1 
ATOM   8643  H HE3    . LYS A 1 567 ? -89.218  25.381  0.939   0    86.16  ? 867  LYS A HE3    1 
ATOM   8644  H HZ1    . LYS A 1 567 ? -88.782  26.108  -1.309  0    93     ? 867  LYS A HZ1    1 
ATOM   8645  H HZ2    . LYS A 1 567 ? -88.036  27.092  -0.214  0    87.75  ? 867  LYS A HZ2    1 
ATOM   8646  H HZ3    . LYS A 1 567 ? -87.15   25.991  -1.071  0    89.87  ? 867  LYS A HZ3    1 
ATOM   8647  N N      . GLY A 1 568 ? -84.569  22.265  6.338   1    40.42  ? 868  GLY A N      1 
ATOM   8648  C CA     . GLY A 1 568 ? -83.374  21.645  6.893   1    38.89  ? 868  GLY A CA     1 
ATOM   8649  C C      . GLY A 1 568 ? -83.39   21.653  8.404   1    35.09  ? 868  GLY A C      1 
ATOM   8650  O O      . GLY A 1 568 ? -84.378  22.049  9.022   1    33.87  ? 868  GLY A O      1 
ATOM   8651  H H      . GLY A 1 568 ? -85.322  22.358  7.011   0    49.57  ? 868  GLY A H      1 
ATOM   8652  H HA2    . GLY A 1 568 ? -83.306  20.614  6.55    0    49.28  ? 868  GLY A HA2    1 
ATOM   8653  H HA3    . GLY A 1 568 ? -82.489  22.183  6.559   0    46.63  ? 868  GLY A HA3    1 
ATOM   8654  N N      . ALA A 1 569 ? -82.299  21.214  9.013   1    33.7   ? 869  ALA A N      1 
ATOM   8655  C CA     . ALA A 1 569 ? -82.172  21.169  10.467  1    30.81  ? 869  ALA A CA     1 
ATOM   8656  C C      . ALA A 1 569 ? -81.707  22.497  11.002  1    27.08  ? 869  ALA A C      1 
ATOM   8657  O O      . ALA A 1 569 ? -80.842  23.1    10.396  1    26.7   ? 869  ALA A O      1 
ATOM   8658  C CB     . ALA A 1 569 ? -81.164  20.113  10.851  1    31.88  ? 869  ALA A CB     1 
ATOM   8659  H H      . ALA A 1 569 ? -81.478  20.878  8.52    0    40.63  ? 869  ALA A H      1 
ATOM   8660  H HA     . ALA A 1 569 ? -83.131  20.92   10.917  0    36.1   ? 869  ALA A HA     1 
ATOM   8661  H HB1    . ALA A 1 569 ? -81.072  20.078  11.934  0    36.34  ? 869  ALA A HB1    1 
ATOM   8662  H HB2    . ALA A 1 569 ? -81.517  19.156  10.472  0    39.22  ? 869  ALA A HB2    1 
ATOM   8663  H HB3    . ALA A 1 569 ? -80.2    20.357  10.408  0    37.34  ? 869  ALA A HB3    1 
ATOM   8664  N N      . VAL A 1 570 ? -82.244  22.953  12.129  1    24.89  ? 870  VAL A N      1 
ATOM   8665  C CA     . VAL A 1 570 ? -81.827  24.211  12.766  1    22.14  ? 870  VAL A CA     1 
ATOM   8666  C C      . VAL A 1 570 ? -80.776  23.894  13.844  1    21.2   ? 870  VAL A C      1 
ATOM   8667  O O      . VAL A 1 570 ? -81.086  23.844  15.038  1    20.3   ? 870  VAL A O      1 
ATOM   8668  C CB     . VAL A 1 570 ? -83.037  24.961  13.358  1    21.05  ? 870  VAL A CB     1 
ATOM   8669  C CG1    . VAL A 1 570 ? -82.607  26.309  13.944  1    18.69  ? 870  VAL A CG1    1 
ATOM   8670  C CG2    . VAL A 1 570 ? -84.109  25.158  12.304  1    22.58  ? 870  VAL A CG2    1 
ATOM   8671  H H      . VAL A 1 570 ? -83.011  22.499  12.613  0    27.78  ? 870  VAL A H      1 
ATOM   8672  H HA     . VAL A 1 570 ? -81.365  24.871  12.033  0    23.51  ? 870  VAL A HA     1 
ATOM   8673  H HB     . VAL A 1 570 ? -83.471  24.353  14.149  0    22.2   ? 870  VAL A HB     1 
ATOM   8674  H HG11   . VAL A 1 570 ? -83.493  26.899  14.171  0    19.26  ? 870  VAL A HG11   1 
ATOM   8675  H HG12   . VAL A 1 570 ? -82.045  26.147  14.863  0    19.2   ? 870  VAL A HG12   1 
ATOM   8676  H HG13   . VAL A 1 570 ? -81.987  26.832  13.218  0    19.51  ? 870  VAL A HG13   1 
ATOM   8677  H HG21   . VAL A 1 570 ? -84.901  25.785  12.707  0    23.75  ? 870  VAL A HG21   1 
ATOM   8678  H HG22   . VAL A 1 570 ? -83.651  25.642  11.442  0    24.3   ? 870  VAL A HG22   1 
ATOM   8679  H HG23   . VAL A 1 570 ? -84.522  24.193  12.015  0    25.33  ? 870  VAL A HG23   1 
ATOM   8680  N N      . TYR A 1 571 ? -79.53   23.685  13.409  1    21.63  ? 871  TYR A N      1 
ATOM   8681  C CA     . TYR A 1 571 ? -78.426  23.271  14.275  1    21.41  ? 871  TYR A CA     1 
ATOM   8682  C C      . TYR A 1 571 ? -78.085  24.242  15.416  1    19.51  ? 871  TYR A C      1 
ATOM   8683  O O      . TYR A 1 571 ? -77.712  23.779  16.498  1    19.54  ? 871  TYR A O      1 
ATOM   8684  C CB     . TYR A 1 571 ? -77.166  22.982  13.43   1    22.63  ? 871  TYR A CB     1 
ATOM   8685  C CG     . TYR A 1 571 ? -77.302  21.796  12.498  1    25.18  ? 871  TYR A CG     1 
ATOM   8686  C CD1    . TYR A 1 571 ? -77.6    20.534  12.994  1    26.65  ? 871  TYR A CD1    1 
ATOM   8687  C CD2    . TYR A 1 571 ? -77.088  21.92   11.133  1    26.76  ? 871  TYR A CD2    1 
ATOM   8688  C CE1    . TYR A 1 571 ? -77.715  19.434  12.146  1    29.86  ? 871  TYR A CE1    1 
ATOM   8689  C CE2    . TYR A 1 571 ? -77.206  20.83   10.274  1    30.02  ? 871  TYR A CE2    1 
ATOM   8690  C CZ     . TYR A 1 571 ? -77.494  19.578  10.786  1    31.68  ? 871  TYR A CZ     1 
ATOM   8691  O OH     . TYR A 1 571 ? -77.596  18.481  9.941   1    35.71  ? 871  TYR A OH     1 
ATOM   8692  H H      . TYR A 1 571 ? -79.26   23.812  12.438  0    23.32  ? 871  TYR A H      1 
ATOM   8693  H HA     . TYR A 1 571 ? -78.72   22.335  14.749  0    23.12  ? 871  TYR A HA     1 
ATOM   8694  H HB2    . TYR A 1 571 ? -76.939  23.86   12.822  0    24.12  ? 871  TYR A HB2    1 
ATOM   8695  H HB3    . TYR A 1 571 ? -76.335  22.779  14.102  0    24.3   ? 871  TYR A HB3    1 
ATOM   8696  H HD1    . TYR A 1 571 ? -77.776  20.411  14.049  0    29.5   ? 871  TYR A HD1    1 
ATOM   8697  H HD2    . TYR A 1 571 ? -76.83   22.882  10.718  0    29.65  ? 871  TYR A HD2    1 
ATOM   8698  H HE1    . TYR A 1 571 ? -77.955  18.467  12.559  0    35.47  ? 871  TYR A HE1    1 
ATOM   8699  H HE2    . TYR A 1 571 ? -76.979  20.928  9.235   0    35.73  ? 871  TYR A HE2    1 
ATOM   8700  H HH     . TYR A 1 571 ? -77.31   18.708  9.018   0    43.58  ? 871  TYR A HH     1 
ATOM   8701  N N      . SER A 1 572 ? -78.196  25.57   15.183  1    18.54  ? 872  SER A N      1 
ATOM   8702  C CA     . SER A 1 572 ? -77.819  26.581  16.183  1    17.93  ? 872  SER A CA     1 
ATOM   8703  C C      . SER A 1 572 ? -78.587  27.9    15.978  1    17.29  ? 872  SER A C      1 
ATOM   8704  O O      . SER A 1 572 ? -78.916  28.261  14.842  1    17.32  ? 872  SER A O      1 
ATOM   8705  C CB     . SER A 1 572 ? -76.312  26.847  16.1    1    19     ? 872  SER A CB     1 
ATOM   8706  O OG     . SER A 1 572 ? -75.771  27.432  17.275  1    19.66  ? 872  SER A OG     1 
ATOM   8707  H H      . SER A 1 572 ? -78.544  25.969  14.318  0    19.39  ? 872  SER A H      1 
ATOM   8708  H HA     . SER A 1 572 ? -78.047  26.217  17.183  0    18.7   ? 872  SER A HA     1 
ATOM   8709  H HB2    . SER A 1 572 ? -75.802  25.901  15.919  0    20.07  ? 872  SER A HB2    1 
ATOM   8710  H HB3    . SER A 1 572 ? -76.127  27.516  15.261  0    19.79  ? 872  SER A HB3    1 
ATOM   8711  H HG     . SER A 1 572 ? -74.801  27.23   17.348  0    20.89  ? 872  SER A HG     1 
ATOM   8712  N N      . MET A 1 573 ? -78.86   28.615  17.089  1    17.39  ? 873  MET A N      1 
ATOM   8713  C CA     . MET A 1 573 ? -79.535  29.923  17.094  1    17.54  ? 873  MET A CA     1 
ATOM   8714  C C      . MET A 1 573 ? -78.906  30.831  18.146  1    19.33  ? 873  MET A C      1 
ATOM   8715  O O      . MET A 1 573 ? -78.45   30.327  19.173  1    19.99  ? 873  MET A O      1 
ATOM   8716  C CB     . MET A 1 573 ? -81.011  29.769  17.431  1    16.73  ? 873  MET A CB     1 
ATOM   8717  C CG     . MET A 1 573 ? -81.774  28.97   16.421  1    15.92  ? 873  MET A CG     1 
ATOM   8718  S SD     . MET A 1 573 ? -83.559  29.054  16.692  1    16.01  ? 873  MET A SD     1 
ATOM   8719  C CE     . MET A 1 573 ? -83.669  28.203  18.249  1    16.36  ? 873  MET A CE     1 
ATOM   8720  H H      . MET A 1 573 ? -78.616  28.306  18.024  0    18.19  ? 873  MET A H      1 
ATOM   8721  H HA     . MET A 1 573 ? -79.448  30.404  16.122  0    18.19  ? 873  MET A HA     1 
ATOM   8722  H HB2    . MET A 1 573 ? -81.078  29.264  18.394  0    17.34  ? 873  MET A HB2    1 
ATOM   8723  H HB3    . MET A 1 573 ? -81.467  30.756  17.496  0    17.47  ? 873  MET A HB3    1 
ATOM   8724  H HG2    . MET A 1 573 ? -81.559  29.357  15.427  0    16.53  ? 873  MET A HG2    1 
ATOM   8725  H HG3    . MET A 1 573 ? -81.468  27.927  16.491  0    16.52  ? 873  MET A HG3    1 
ATOM   8726  H HE1    . MET A 1 573 ? -84.713  27.983  18.461  0    16.76  ? 873  MET A HE1    1 
ATOM   8727  H HE2    . MET A 1 573 ? -83.102  27.275  18.185  0    16.83  ? 873  MET A HE2    1 
ATOM   8728  H HE3    . MET A 1 573 ? -83.255  28.831  19.037  0    16.86  ? 873  MET A HE3    1 
ATOM   8729  N N      . VAL A 1 574 ? -78.91   32.162  17.905  1    20.45  ? 874  VAL A N      1 
ATOM   8730  C CA     . VAL A 1 574 ? -78.361  33.18   18.822  1    22.77  ? 874  VAL A CA     1 
ATOM   8731  C C      . VAL A 1 574 ? -79.166  34.488  18.698  1    23.97  ? 874  VAL A C      1 
ATOM   8732  O O      . VAL A 1 574 ? -79.639  34.816  17.602  1    23.26  ? 874  VAL A O      1 
ATOM   8733  C CB     . VAL A 1 574 ? -76.853  33.477  18.572  1    24.4   ? 874  VAL A CB     1 
ATOM   8734  C CG1    . VAL A 1 574 ? -75.96   32.334  19.04   1    24.23  ? 874  VAL A CG1    1 
ATOM   8735  C CG2    . VAL A 1 574 ? -76.587  33.798  17.112  1    24.01  ? 874  VAL A CG2    1 
ATOM   8736  H H      . VAL A 1 574 ? -79.301  32.57   17.062  0    21.29  ? 874  VAL A H      1 
ATOM   8737  H HA     . VAL A 1 574 ? -78.474  32.837  19.85   0    24.84  ? 874  VAL A HA     1 
ATOM   8738  H HB     . VAL A 1 574 ? -76.579  34.358  19.15   0    28.36  ? 874  VAL A HB     1 
ATOM   8739  H HG11   . VAL A 1 574 ? -74.914  32.622  18.935  0    27.6   ? 874  VAL A HG11   1 
ATOM   8740  H HG12   . VAL A 1 574 ? -76.18   32.122  20.085  0    27.09  ? 874  VAL A HG12   1 
ATOM   8741  H HG13   . VAL A 1 574 ? -76.163  31.454  18.431  0    25.62  ? 874  VAL A HG13   1 
ATOM   8742  H HG21   . VAL A 1 574 ? -75.544  33.579  16.893  0    26.85  ? 874  VAL A HG21   1 
ATOM   8743  H HG22   . VAL A 1 574 ? -77.21   33.171  16.478  0    25.28  ? 874  VAL A HG22   1 
ATOM   8744  H HG23   . VAL A 1 574 ? -76.796  34.853  16.938  0    27.16  ? 874  VAL A HG23   1 
ATOM   8745  N N      . GLU A 1 575 ? -79.318  35.242  19.818  1    26.35  ? 875  GLU A N      1 
ATOM   8746  C CA     . GLU A 1 575 ? -80.005  36.537  19.774  1    28.44  ? 875  GLU A CA     1 
ATOM   8747  C C      . GLU A 1 575 ? -78.997  37.492  19.172  1    30.85  ? 875  GLU A C      1 
ATOM   8748  O O      . GLU A 1 575 ? -77.924  37.689  19.754  1    32.89  ? 875  GLU A O      1 
ATOM   8749  C CB     . GLU A 1 575 ? -80.411  37.034  21.174  1    31.12  ? 875  GLU A CB     1 
ATOM   8750  C CG     . GLU A 1 575 ? -81.186  38.352  21.167  1    33.75  ? 875  GLU A CG     1 
ATOM   8751  C CD     . GLU A 1 575 ? -80.446  39.682  21.266  1    38.34  ? 875  GLU A CD     1 
ATOM   8752  O OE1    . GLU A 1 575 ? -79.197  39.705  21.405  1    40.22  ? 875  GLU A OE1    1 
ATOM   8753  O OE2    . GLU A 1 575 ? -81.142  40.722  21.193  1    40.6   ? 875  GLU A OE2    1 
ATOM   8754  H H      . GLU A 1 575 ? -78.978  34.984  20.739  0    30.29  ? 875  GLU A H      1 
ATOM   8755  H HA     . GLU A 1 575 ? -80.895  36.482  19.151  0    31.85  ? 875  GLU A HA     1 
ATOM   8756  H HB2    . GLU A 1 575 ? -81.057  36.284  21.627  0    35.58  ? 875  GLU A HB2    1 
ATOM   8757  H HB3    . GLU A 1 575 ? -79.52   37.152  21.79   0    37.81  ? 875  GLU A HB3    1 
ATOM   8758  H HG2    . GLU A 1 575 ? -81.78   38.385  20.256  0    39.25  ? 875  GLU A HG2    1 
ATOM   8759  H HG3    . GLU A 1 575 ? -81.855  38.337  22.024  0    40.72  ? 875  GLU A HG3    1 
ATOM   8760  N N      . PHE A 1 576 ? -79.313  38.074  18.021  1    31.09  ? 876  PHE A N      1 
ATOM   8761  C CA     . PHE A 1 576 ? -78.396  38.978  17.346  1    33.78  ? 876  PHE A CA     1 
ATOM   8762  C C      . PHE A 1 576 ? -78.988  40.364  17.222  1    37.17  ? 876  PHE A C      1 
ATOM   8763  O O      . PHE A 1 576 ? -79.751  40.619  16.296  1    36.33  ? 876  PHE A O      1 
ATOM   8764  C CB     . PHE A 1 576 ? -78.053  38.41   15.965  1    31.36  ? 876  PHE A CB     1 
ATOM   8765  C CG     . PHE A 1 576 ? -77.012  39.205  15.218  1    34.17  ? 876  PHE A CG     1 
ATOM   8766  C CD1    . PHE A 1 576 ? -75.685  39.171  15.603  1    36.12  ? 876  PHE A CD1    1 
ATOM   8767  C CD2    . PHE A 1 576 ? -77.349  39.925  14.091  1    35.15  ? 876  PHE A CD2    1 
ATOM   8768  C CE1    . PHE A 1 576 ? -74.721  39.831  14.864  1    39.03  ? 876  PHE A CE1    1 
ATOM   8769  C CE2    . PHE A 1 576 ? -76.389  40.637  13.396  1    38.27  ? 876  PHE A CE2    1 
ATOM   8770  C CZ     . PHE A 1 576 ? -75.084  40.588  13.785  1    40.2   ? 876  PHE A CZ     1 
ATOM   8771  H H      . PHE A 1 576 ? -80.192  37.942  17.531  0    35.64  ? 876  PHE A H      1 
ATOM   8772  H HA     . PHE A 1 576 ? -77.459  39.068  17.893  0    41.48  ? 876  PHE A HA     1 
ATOM   8773  H HB2    . PHE A 1 576 ? -77.649  37.408  16.103  0    35.71  ? 876  PHE A HB2    1 
ATOM   8774  H HB3    . PHE A 1 576 ? -78.954  38.353  15.356  0    35.97  ? 876  PHE A HB3    1 
ATOM   8775  H HD1    . PHE A 1 576 ? -75.394  38.592  16.463  0    43.41  ? 876  PHE A HD1    1 
ATOM   8776  H HD2    . PHE A 1 576 ? -78.376  39.979  13.777  0    43.38  ? 876  PHE A HD2    1 
ATOM   8777  H HE1    . PHE A 1 576 ? -73.693  39.818  15.19   0    51.53  ? 876  PHE A HE1    1 
ATOM   8778  H HE2    . PHE A 1 576 ? -76.669  41.2    12.521  0    51.99  ? 876  PHE A HE2    1 
ATOM   8779  H HZ     . PHE A 1 576 ? -74.339  41.113  13.213  0    56.09  ? 876  PHE A HZ     1 
ATOM   8780  N N      . ASN A 1 577 ? -78.681  41.26   18.172  1    41.56  ? 877  ASN A N      1 
ATOM   8781  C CA     . ASN A 1 577 ? -79.153  42.644  18.113  1    46.04  ? 877  ASN A CA     1 
ATOM   8782  C C      . ASN A 1 577 ? -80.674  42.754  17.879  1    44.61  ? 877  ASN A C      1 
ATOM   8783  O O      . ASN A 1 577 ? -81.116  43.405  16.937  1    45.82  ? 877  ASN A O      1 
ATOM   8784  C CB     . ASN A 1 577 ? -78.376  43.402  17.017  1    48.75  ? 877  ASN A CB     1 
ATOM   8785  C CG     . ASN A 1 577 ? -76.87   43.238  17.097  1    50.31  ? 877  ASN A CG     1 
ATOM   8786  O OD1    . ASN A 1 577 ? -76.322  42.688  18.069  1    51.09  ? 877  ASN A OD1    1 
ATOM   8787  N ND2    . ASN A 1 577 ? -76.177  43.693  16.06   1    50.66  ? 877  ASN A ND2    1 
ATOM   8788  H H      . ASN A 1 577 ? -78.108  41.059  18.985  0    53.67  ? 877  ASN A H      1 
ATOM   8789  H HA     . ASN A 1 577 ? -78.931  43.129  19.063  0    64.08  ? 877  ASN A HA     1 
ATOM   8790  H HB2    . ASN A 1 577 ? -78.69   43.034  16.041  0    66.7   ? 877  ASN A HB2    1 
ATOM   8791  H HB3    . ASN A 1 577 ? -78.601  44.464  17.098  0    70.97  ? 877  ASN A HB3    1 
ATOM   8792  H HD21   . ASN A 1 577 ? -75.165  43.612  16.05   0    73.43  ? 877  ASN A HD21   1 
ATOM   8793  H HD22   . ASN A 1 577 ? -76.661  44.114  15.273  0    73.16  ? 877  ASN A HD22   1 
ATOM   8794  N N      . GLY A 1 578 ? -81.44   42.042  18.689  1    42.33  ? 878  GLY A N      1 
ATOM   8795  C CA     . GLY A 1 578 ? -82.897  42.027  18.595  1    41.15  ? 878  GLY A CA     1 
ATOM   8796  C C      . GLY A 1 578 ? -83.477  41.148  17.5    1    36.99  ? 878  GLY A C      1 
ATOM   8797  O O      . GLY A 1 578 ? -84.695  40.994  17.414  1    36.81  ? 878  GLY A O      1 
ATOM   8798  H H      . GLY A 1 578 ? -81.08   41.452  19.433  0    54.57  ? 878  GLY A H      1 
ATOM   8799  H HA2    . GLY A 1 578 ? -83.299  41.67   19.542  0    53.39  ? 878  GLY A HA2    1 
ATOM   8800  H HA3    . GLY A 1 578 ? -83.261  43.041  18.442  0    56.74  ? 878  GLY A HA3    1 
ATOM   8801  N N      . LYS A 1 579 ? -82.627  40.58   16.649  1    34.2   ? 879  LYS A N      1 
ATOM   8802  C CA     . LYS A 1 579 ? -83.038  39.696  15.565  1    30.86  ? 879  LYS A CA     1 
ATOM   8803  C C      . LYS A 1 579 ? -82.652  38.247  15.926  1    27.37  ? 879  LYS A C      1 
ATOM   8804  O O      . LYS A 1 579 ? -81.904  38.026  16.881  1    27.72  ? 879  LYS A O      1 
ATOM   8805  C CB     . LYS A 1 579 ? -82.364  40.148  14.262  1    32.11  ? 879  LYS A CB     1 
ATOM   8806  C CG     . LYS A 1 579 ? -82.822  41.516  13.793  1    36.21  ? 879  LYS A CG     1 
ATOM   8807  C CD     . LYS A 1 579 ? -81.953  42.067  12.678  1    38.13  ? 879  LYS A CD     1 
ATOM   8808  C CE     . LYS A 1 579 ? -82.327  43.489  12.349  1    42.04  ? 879  LYS A CE     1 
ATOM   8809  N NZ     . LYS A 1 579 ? -81.503  44.057  11.257  1    43.68  ? 879  LYS A NZ     1 
ATOM   8810  H H      . LYS A 1 579 ? -81.62   40.703  16.678  0    41.56  ? 879  LYS A H      1 
ATOM   8811  H HA     . LYS A 1 579 ? -84.115  39.73   15.412  0    36.53  ? 879  LYS A HA     1 
ATOM   8812  H HB2    . LYS A 1 579 ? -81.29   40.198  14.432  0    39.2   ? 879  LYS A HB2    1 
ATOM   8813  H HB3    . LYS A 1 579 ? -82.586  39.425  13.479  0    38.06  ? 879  LYS A HB3    1 
ATOM   8814  H HG2    . LYS A 1 579 ? -83.843  41.433  13.425  0    47.69  ? 879  LYS A HG2    1 
ATOM   8815  H HG3    . LYS A 1 579 ? -82.78   42.223  14.62   0    48.79  ? 879  LYS A HG3    1 
ATOM   8816  H HD2    . LYS A 1 579 ? -80.909  42.053  12.987  0    51.66  ? 879  LYS A HD2    1 
ATOM   8817  H HD3    . LYS A 1 579 ? -82.09   41.462  11.783  0    51.08  ? 879  LYS A HD3    1 
ATOM   8818  H HE2    . LYS A 1 579 ? -83.371  43.526  12.04   0    61     ? 879  LYS A HE2    1 
ATOM   8819  H HE3    . LYS A 1 579 ? -82.182  44.107  13.234  0    61.62  ? 879  LYS A HE3    1 
ATOM   8820  H HZ1    . LYS A 1 579 ? -81.796  45.009  11.063  0    68.04  ? 879  LYS A HZ1    1 
ATOM   8821  H HZ2    . LYS A 1 579 ? -80.525  44.063  11.531  0    65.12  ? 879  LYS A HZ2    1 
ATOM   8822  H HZ3    . LYS A 1 579 ? -81.608  43.498  10.418  0    64.35  ? 879  LYS A HZ3    1 
ATOM   8823  N N      . LEU A 1 580 ? -83.183  37.259  15.193  1    24.7   ? 880  LEU A N      1 
ATOM   8824  C CA     . LEU A 1 580 ? -82.886  35.852  15.461  1    22.23  ? 880  LEU A CA     1 
ATOM   8825  C C      . LEU A 1 580 ? -81.995  35.31   14.372  1    21.42  ? 880  LEU A C      1 
ATOM   8826  O O      . LEU A 1 580 ? -82.439  35.194  13.238  1    21.16  ? 880  LEU A O      1 
ATOM   8827  C CB     . LEU A 1 580 ? -84.187  35.041  15.533  1    20.76  ? 880  LEU A CB     1 
ATOM   8828  C CG     . LEU A 1 580 ? -84.06   33.532  15.712  1    18.81  ? 880  LEU A CG     1 
ATOM   8829  C CD1    . LEU A 1 580 ? -83.258  33.174  16.965  1    19.12  ? 880  LEU A CD1    1 
ATOM   8830  C CD2    . LEU A 1 580 ? -85.426  32.89   15.766  1    18.23  ? 880  LEU A CD2    1 
ATOM   8831  H H      . LEU A 1 580 ? -83.815  37.402  14.411  0    27.28  ? 880  LEU A H      1 
ATOM   8832  H HA     . LEU A 1 580 ? -82.378  35.744  16.417  0    24.08  ? 880  LEU A HA     1 
ATOM   8833  H HB2    . LEU A 1 580 ? -84.763  35.41   16.379  0    22.19  ? 880  LEU A HB2    1 
ATOM   8834  H HB3    . LEU A 1 580 ? -84.754  35.212  14.62   0    21.81  ? 880  LEU A HB3    1 
ATOM   8835  H HG     . LEU A 1 580 ? -83.544  33.097  14.856  0    19.31  ? 880  LEU A HG     1 
ATOM   8836  H HD11   . LEU A 1 580 ? -83.334  32.102  17.14   0    19.31  ? 880  LEU A HD11   1 
ATOM   8837  H HD12   . LEU A 1 580 ? -82.215  33.445  16.811  0    20.01  ? 880  LEU A HD12   1 
ATOM   8838  H HD13   . LEU A 1 580 ? -83.668  33.72   17.812  0    20.21  ? 880  LEU A HD13   1 
ATOM   8839  H HD21   . LEU A 1 580 ? -85.314  31.818  15.928  0    18.42  ? 880  LEU A HD21   1 
ATOM   8840  H HD22   . LEU A 1 580 ? -85.992  33.334  16.583  0    18.96  ? 880  LEU A HD22   1 
ATOM   8841  H HD23   . LEU A 1 580 ? -85.935  33.067  14.819  0    18.86  ? 880  LEU A HD23   1 
ATOM   8842  N N      . LEU A 1 581 ? -80.743  34.983  14.71   1    21.47  ? 881  LEU A N      1 
ATOM   8843  C CA     . LEU A 1 581 ? -79.796  34.416  13.759  1    21.08  ? 881  LEU A CA     1 
ATOM   8844  C C      . LEU A 1 581 ? -79.813  32.89   13.943  1    19.24  ? 881  LEU A C      1 
ATOM   8845  O O      . LEU A 1 581 ? -79.555  32.421  15.047  1    18.98  ? 881  LEU A O      1 
ATOM   8846  C CB     . LEU A 1 581 ? -78.393  34.985  14.017  1    22.76  ? 881  LEU A CB     1 
ATOM   8847  C CG     . LEU A 1 581 ? -77.299  34.559  13.043  1    22.92  ? 881  LEU A CG     1 
ATOM   8848  C CD1    . LEU A 1 581 ? -77.338  35.394  11.795  1    24.27  ? 881  LEU A CD1    1 
ATOM   8849  C CD2    . LEU A 1 581 ? -75.958  34.67   13.678  1    24.35  ? 881  LEU A CD2    1 
ATOM   8850  H H      . LEU A 1 581 ? -80.351  35.102  15.638  0    23.22  ? 881  LEU A H      1 
ATOM   8851  H HA     . LEU A 1 581 ? -80.07   34.655  12.734  0    22.42  ? 881  LEU A HA     1 
ATOM   8852  H HB2    . LEU A 1 581 ? -78.457  36.07   13.971  0    25.72  ? 881  LEU A HB2    1 
ATOM   8853  H HB3    . LEU A 1 581 ? -78.085  34.69   15.018  0    24.64  ? 881  LEU A HB3    1 
ATOM   8854  H HG     . LEU A 1 581 ? -77.423  33.517  12.747  0    24.02  ? 881  LEU A HG     1 
ATOM   8855  H HD11   . LEU A 1 581 ? -76.576  35.034  11.105  0    26.89  ? 881  LEU A HD11   1 
ATOM   8856  H HD12   . LEU A 1 581 ? -78.322  35.309  11.337  0    26.28  ? 881  LEU A HD12   1 
ATOM   8857  H HD13   . LEU A 1 581 ? -77.137  36.432  12.056  0    27.97  ? 881  LEU A HD13   1 
ATOM   8858  H HD21   . LEU A 1 581 ? -75.209  34.374  12.946  0    27.01  ? 881  LEU A HD21   1 
ATOM   8859  H HD22   . LEU A 1 581 ? -75.796  35.701  13.985  0    28.16  ? 881  LEU A HD22   1 
ATOM   8860  H HD23   . LEU A 1 581 ? -75.911  34.007  14.54   0    26.48  ? 881  LEU A HD23   1 
ATOM   8861  N N      . ALA A 1 582 ? -80.184  32.127  12.89   1    18.58  ? 882  ALA A N      1 
ATOM   8862  C CA     . ALA A 1 582 ? -80.269  30.661  12.937  1    17.79  ? 882  ALA A CA     1 
ATOM   8863  C C      . ALA A 1 582 ? -79.577  30.048  11.751  1    18.8   ? 882  ALA A C      1 
ATOM   8864  O O      . ALA A 1 582 ? -79.56   30.659  10.686  1    19.84  ? 882  ALA A O      1 
ATOM   8865  C CB     . ALA A 1 582 ? -81.718  30.224  12.931  1    17.31  ? 882  ALA A CB     1 
ATOM   8866  H H      . ALA A 1 582 ? -80.434  32.504  11.982  0    19.61  ? 882  ALA A H      1 
ATOM   8867  H HA     . ALA A 1 582 ? -79.797  30.272  13.837  0    18.32  ? 882  ALA A HA     1 
ATOM   8868  H HB1    . ALA A 1 582 ? -81.766  29.151  13.109  0    17.97  ? 882  ALA A HB1    1 
ATOM   8869  H HB2    . ALA A 1 582 ? -82.257  30.762  13.709  0    17.83  ? 882  ALA A HB2    1 
ATOM   8870  H HB3    . ALA A 1 582 ? -82.149  30.455  11.958  0    18.24  ? 882  ALA A HB3    1 
ATOM   8871  N N      . SER A 1 583 ? -79.067  28.81   11.914  1    19.04  ? 883  SER A N      1 
ATOM   8872  C CA     . SER A 1 583 ? -78.353  28.089  10.86   1    20.59  ? 883  SER A CA     1 
ATOM   8873  C C      . SER A 1 583 ? -79.105  26.851  10.404  1    21.75  ? 883  SER A C      1 
ATOM   8874  O O      . SER A 1 583 ? -79.172  25.883  11.154  1    21.63  ? 883  SER A O      1 
ATOM   8875  C CB     . SER A 1 583 ? -76.975  27.667  11.347  1    20.77  ? 883  SER A CB     1 
ATOM   8876  O OG     . SER A 1 583 ? -77.095  26.926  12.549  1    20.13  ? 883  SER A OG     1 
ATOM   8877  H H      . SER A 1 583 ? -79.14   28.28   12.777  0    19.51  ? 883  SER A H      1 
ATOM   8878  H HA     . SER A 1 583 ? -78.201  28.733  9.996   0    21.78  ? 883  SER A HA     1 
ATOM   8879  H HB2    . SER A 1 583 ? -76.505  27.054  10.579  0    22.38  ? 883  SER A HB2    1 
ATOM   8880  H HB3    . SER A 1 583 ? -76.366  28.551  11.527  0    21.65  ? 883  SER A HB3    1 
ATOM   8881  H HG     . SER A 1 583 ? -77.136  25.951  12.365  0    21.15  ? 883  SER A HG     1 
ATOM   8882  N N      . ILE A 1 584 ? -79.598  26.857  9.146   1    23.47  ? 884  ILE A N      1 
ATOM   8883  C CA     . ILE A 1 584 ? -80.346  25.754  8.548   1    25.76  ? 884  ILE A CA     1 
ATOM   8884  C C      . ILE A 1 584 ? -79.473  24.976  7.562   1    28.56  ? 884  ILE A C      1 
ATOM   8885  O O      . ILE A 1 584 ? -79.355  25.369  6.405   1    30.4   ? 884  ILE A O      1 
ATOM   8886  C CB     . ILE A 1 584 ? -81.633  26.279  7.866   1    26.8   ? 884  ILE A CB     1 
ATOM   8887  C CG1    . ILE A 1 584 ? -82.459  27.142  8.844   1    24.28  ? 884  ILE A CG1    1 
ATOM   8888  C CG2    . ILE A 1 584 ? -82.493  25.128  7.362   1    29.87  ? 884  ILE A CG2    1 
ATOM   8889  C CD1    . ILE A 1 584 ? -82.26   28.649  8.741   1    23.16  ? 884  ILE A CD1    1 
ATOM   8890  H H      . ILE A 1 584 ? -79.489  27.637  8.506   0    25.59  ? 884  ILE A H      1 
ATOM   8891  H HA     . ILE A 1 584 ? -80.664  25.067  9.331   0    28.52  ? 884  ILE A HA     1 
ATOM   8892  H HB     . ILE A 1 584 ? -81.35   26.874  6.999   0    30.7   ? 884  ILE A HB     1 
ATOM   8893  H HG12   . ILE A 1 584 ? -83.517  26.949  8.675   0    27.22  ? 884  ILE A HG12   1 
ATOM   8894  H HG13   . ILE A 1 584 ? -82.203  26.851  9.862   0    25.81  ? 884  ILE A HG13   1 
ATOM   8895  H HG21   . ILE A 1 584 ? -83.349  25.537  6.828   0    35.3   ? 884  ILE A HG21   1 
ATOM   8896  H HG22   . ILE A 1 584 ? -81.926  24.492  6.683   0    35.87  ? 884  ILE A HG22   1 
ATOM   8897  H HG23   . ILE A 1 584 ? -82.835  24.546  8.216   0    34.15  ? 884  ILE A HG23   1 
ATOM   8898  H HD11   . ILE A 1 584 ? -82.88   29.14   9.489   0    24.26  ? 884  ILE A HD11   1 
ATOM   8899  H HD12   . ILE A 1 584 ? -81.211  28.883  8.916   0    24.59  ? 884  ILE A HD12   1 
ATOM   8900  H HD13   . ILE A 1 584 ? -82.552  28.976  7.744   0    25.86  ? 884  ILE A HD13   1 
ATOM   8901  N N      . ASN A 1 585 ? -78.92   23.837  8.005   1    29.28  ? 885  ASN A N      1 
ATOM   8902  C CA     . ASN A 1 585 ? -78.071  22.966  7.194   1    32.36  ? 885  ASN A CA     1 
ATOM   8903  C C      . ASN A 1 585 ? -76.824  23.735  6.7     1    31.87  ? 885  ASN A C      1 
ATOM   8904  O O      . ASN A 1 585 ? -75.965  24.039  7.524   1    29.46  ? 885  ASN A O      1 
ATOM   8905  C CB     . ASN A 1 585 ? -78.882  22.262  6.065   1    36.69  ? 885  ASN A CB     1 
ATOM   8906  C CG     . ASN A 1 585 ? -79.636  21.032  6.476   1    38.53  ? 885  ASN A CG     1 
ATOM   8907  O OD1    . ASN A 1 585 ? -79.688  20.652  7.645   1    36.18  ? 885  ASN A OD1    1 
ATOM   8908  N ND2    . ASN A 1 585 ? -80.228  20.363  5.504   1    43.39  ? 885  ASN A ND2    1 
ATOM   8909  H H      . ASN A 1 585 ? -79.044  23.486  8.949   0    33     ? 885  ASN A H      1 
ATOM   8910  H HA     . ASN A 1 585 ? -77.683  22.186  7.841   0    38.11  ? 885  ASN A HA     1 
ATOM   8911  H HB2    . ASN A 1 585 ? -79.599  22.961  5.638   0    44.18  ? 885  ASN A HB2    1 
ATOM   8912  H HB3    . ASN A 1 585 ? -78.188  21.941  5.289   0    45.65  ? 885  ASN A HB3    1 
ATOM   8913  H HD21   . ASN A 1 585 ? -80.752  19.52   5.713   0    55.37  ? 885  ASN A HD21   1 
ATOM   8914  H HD22   . ASN A 1 585 ? -80.145  20.684  4.544   0    56.36  ? 885  ASN A HD22   1 
ATOM   8915  N N      . SER A 1 586 ? -76.738  24.085  5.4     1    34.64  ? 886  SER A N      1 
ATOM   8916  C CA     . SER A 1 586 ? -75.626  24.812  4.819   1    34.93  ? 886  SER A CA     1 
ATOM   8917  C C      . SER A 1 586 ? -75.817  26.339  4.899   1    33.05  ? 886  SER A C      1 
ATOM   8918  O O      . SER A 1 586 ? -74.885  27.061  4.561   1    33.69  ? 886  SER A O      1 
ATOM   8919  C CB     . SER A 1 586 ? -75.48   24.406  3.356   1    39.76  ? 886  SER A CB     1 
ATOM   8920  O OG     . SER A 1 586 ? -76.638  24.772  2.625   1    42.15  ? 886  SER A OG     1 
ATOM   8921  H H      . SER A 1 586 ? -77.454  23.891  4.707   0    42.58  ? 886  SER A H      1 
ATOM   8922  H HA     . SER A 1 586 ? -74.701  24.554  5.332   0    41.26  ? 886  SER A HA     1 
ATOM   8923  H HB2    . SER A 1 586 ? -74.613  24.91   2.932   0    52.65  ? 886  SER A HB2    1 
ATOM   8924  H HB3    . SER A 1 586 ? -75.349  23.327  3.3     0    52.02  ? 886  SER A HB3    1 
ATOM   8925  H HG     . SER A 1 586 ? -76.529  24.515  1.672   0    58.74  ? 886  SER A HG     1 
ATOM   8926  N N      . THR A 1 587 ? -77      26.838  5.333   1    31.18  ? 887  THR A N      1 
ATOM   8927  C CA     . THR A 1 587 ? -77.311  28.269  5.351   1    29.98  ? 887  THR A CA     1 
ATOM   8928  C C      . THR A 1 587 ? -77.216  28.895  6.733   1    26.5   ? 887  THR A C      1 
ATOM   8929  O O      . THR A 1 587 ? -77.401  28.206  7.727   1    25.11  ? 887  THR A O      1 
ATOM   8930  C CB     . THR A 1 587 ? -78.73   28.471  4.814   1    31.47  ? 887  THR A CB     1 
ATOM   8931  O OG1    . THR A 1 587 ? -78.88   27.762  3.582   1    35.88  ? 887  THR A OG1    1 
ATOM   8932  C CG2    . THR A 1 587 ? -79.073  29.925  4.607   1    30.15  ? 887  THR A CG2    1 
ATOM   8933  H H      . THR A 1 587 ? -77.769  26.278  5.686   0    36.1   ? 887  THR A H      1 
ATOM   8934  H HA     . THR A 1 587 ? -76.628  28.801  4.69    0    36.32  ? 887  THR A HA     1 
ATOM   8935  H HB     . THR A 1 587 ? -79.437  28.066  5.536   0    35.99  ? 887  THR A HB     1 
ATOM   8936  H HG1    . THR A 1 587 ? -79.839  27.712  3.33    0    46.64  ? 887  THR A HG1    1 
ATOM   8937  H HG21   . THR A 1 587 ? -79.929  30.012  3.94    0    37.96  ? 887  THR A HG21   1 
ATOM   8938  H HG22   . THR A 1 587 ? -79.332  30.392  5.556   0    34.41  ? 887  THR A HG22   1 
ATOM   8939  H HG23   . THR A 1 587 ? -78.228  30.454  4.168   0    37.63  ? 887  THR A HG23   1 
ATOM   8940  N N      . VAL A 1 588 ? -76.922  30.212  6.777   1    25.88  ? 888  VAL A N      1 
ATOM   8941  C CA     . VAL A 1 588 ? -76.877  31.046  7.98    1    23.82  ? 888  VAL A CA     1 
ATOM   8942  C C      . VAL A 1 588 ? -77.84   32.182  7.67    1    23.92  ? 888  VAL A C      1 
ATOM   8943  O O      . VAL A 1 588 ? -77.58   32.981  6.775   1    25.62  ? 888  VAL A O      1 
ATOM   8944  C CB     . VAL A 1 588 ? -75.466  31.558  8.286   1    24.25  ? 888  VAL A CB     1 
ATOM   8945  C CG1    . VAL A 1 588 ? -75.516  32.67   9.321   1    23.76  ? 888  VAL A CG1    1 
ATOM   8946  C CG2    . VAL A 1 588 ? -74.559  30.421  8.738   1    24.1   ? 888  VAL A CG2    1 
ATOM   8947  H H      . VAL A 1 588 ? -76.704  30.749  5.944   0    29.65  ? 888  VAL A H      1 
ATOM   8948  H HA     . VAL A 1 588 ? -77.242  30.499  8.847   0    25.23  ? 888  VAL A HA     1 
ATOM   8949  H HB     . VAL A 1 588 ? -75.032  31.96   7.374   0    27.41  ? 888  VAL A HB     1 
ATOM   8950  H HG11   . VAL A 1 588 ? -74.539  32.76   9.792   0    26.4   ? 888  VAL A HG11   1 
ATOM   8951  H HG12   . VAL A 1 588 ? -75.761  33.612  8.832   0    26.34  ? 888  VAL A HG12   1 
ATOM   8952  H HG13   . VAL A 1 588 ? -76.267  32.431  10.072  0    25.18  ? 888  VAL A HG13   1 
ATOM   8953  H HG21   . VAL A 1 588 ? -73.563  30.819  8.926   0    26.75  ? 888  VAL A HG21   1 
ATOM   8954  H HG22   . VAL A 1 588 ? -74.966  29.985  9.649   0    25.65  ? 888  VAL A HG22   1 
ATOM   8955  H HG23   . VAL A 1 588 ? -74.515  29.668  7.952   0    26.88  ? 888  VAL A HG23   1 
ATOM   8956  N N      . ARG A 1 589 ? -78.991  32.187  8.347   1    22.53  ? 889  ARG A N      1 
ATOM   8957  C CA     . ARG A 1 589 ? -80.095  33.109  8.101   1    22.87  ? 889  ARG A CA     1 
ATOM   8958  C C      . ARG A 1 589 ? -80.293  34.059  9.257   1    22.11  ? 889  ARG A C      1 
ATOM   8959  O O      . ARG A 1 589 ? -80.096  33.668  10.408  1    21     ? 889  ARG A O      1 
ATOM   8960  C CB     . ARG A 1 589 ? -81.383  32.282  7.936   1    23.05  ? 889  ARG A CB     1 
ATOM   8961  C CG     . ARG A 1 589 ? -82.501  32.984  7.196   1    24.21  ? 889  ARG A CG     1 
ATOM   8962  C CD     . ARG A 1 589 ? -83.569  32      6.751   1    25.6   ? 889  ARG A CD     1 
ATOM   8963  N NE     . ARG A 1 589 ? -83.163  31.154  5.628   1    28.22  ? 889  ARG A NE     1 
ATOM   8964  C CZ     . ARG A 1 589 ? -83.883  30.145  5.139   0.89 30.8   ? 889  ARG A CZ     1 
ATOM   8965  N NH1    . ARG A 1 589 ? -85.052  29.824  5.686   1    30.78  ? 889  ARG A NH1    1 
ATOM   8966  N NH2    . ARG A 1 589 ? -83.432  29.439  4.101   1    33.99  ? 889  ARG A NH2    1 
ATOM   8967  H H      . ARG A 1 589 ? -79.201  31.54   9.101   0    23.56  ? 889  ARG A H      1 
ATOM   8968  H HA     . ARG A 1 589 ? -79.914  33.687  7.196   0    25.38  ? 889  ARG A HA     1 
ATOM   8969  H HB2    . ARG A 1 589 ? -81.139  31.372  7.391   0    25.32  ? 889  ARG A HB2    1 
ATOM   8970  H HB3    . ARG A 1 589 ? -81.757  32.025  8.925   0    24.05  ? 889  ARG A HB3    1 
ATOM   8971  H HG2    . ARG A 1 589 ? -82.965  33.713  7.859   0    26.38  ? 889  ARG A HG2    1 
ATOM   8972  H HG3    . ARG A 1 589 ? -82.101  33.475  6.31    0    28.75  ? 889  ARG A HG3    1 
ATOM   8973  H HD2    . ARG A 1 589 ? -83.815  31.35   7.589   0    27.61  ? 889  ARG A HD2    1 
ATOM   8974  H HD3    . ARG A 1 589 ? -84.453  32.557  6.443   0    30.63  ? 889  ARG A HD3    1 
ATOM   8975  H HE     . ARG A 1 589 ? -82.272  31.364  5.185   0    34.05  ? 889  ARG A HE     1 
ATOM   8976  H HH11   . ARG A 1 589 ? -85.437  30.346  6.466   0    36.7   ? 889  ARG A HH11   1 
ATOM   8977  H HH12   . ARG A 1 589 ? -85.593  29.057  5.298   0    39.04  ? 889  ARG A HH12   1 
ATOM   8978  H HH21   . ARG A 1 589 ? -82.534  29.662  3.681   0    43.89  ? 889  ARG A HH21   1 
ATOM   8979  H HH22   . ARG A 1 589 ? -83.976  28.665  3.734   0    44.78  ? 889  ARG A HH22   1 
ATOM   8980  N N      . LEU A 1 590 ? -80.761  35.275  8.96    1    23.39  ? 890  LEU A N      1 
ATOM   8981  C CA     . LEU A 1 590 ? -81.07   36.273  9.972   1    23.99  ? 890  LEU A CA     1 
ATOM   8982  C C      . LEU A 1 590 ? -82.532  36.656  9.817   1    24.49  ? 890  LEU A C      1 
ATOM   8983  O O      . LEU A 1 590 ? -82.908  37.231  8.798   1    28.19  ? 890  LEU A O      1 
ATOM   8984  C CB     . LEU A 1 590 ? -80.175  37.499  9.804   1    26.65  ? 890  LEU A CB     1 
ATOM   8985  C CG     . LEU A 1 590 ? -80.38   38.643  10.769  1    28.78  ? 890  LEU A CG     1 
ATOM   8986  C CD1    . LEU A 1 590 ? -80.063  38.223  12.181  1    27.8   ? 890  LEU A CD1    1 
ATOM   8987  C CD2    . LEU A 1 590 ? -79.51   39.802  10.382  1    32.71  ? 890  LEU A CD2    1 
ATOM   8988  H H      . LEU A 1 590 ? -80.978  35.581  8.018   0    26.95  ? 890  LEU A H      1 
ATOM   8989  H HA     . LEU A 1 590 ? -80.922  35.859  10.967  0    25.72  ? 890  LEU A HA     1 
ATOM   8990  H HB2    . LEU A 1 590 ? -79.145  37.183  9.954   0    30.68  ? 890  LEU A HB2    1 
ATOM   8991  H HB3    . LEU A 1 590 ? -80.297  37.889  8.795   0    33.34  ? 890  LEU A HB3    1 
ATOM   8992  H HG     . LEU A 1 590 ? -81.414  38.984  10.739  0    35.38  ? 890  LEU A HG     1 
ATOM   8993  H HD11   . LEU A 1 590 ? -80.069  39.111  12.81   0    33.17  ? 890  LEU A HD11   1 
ATOM   8994  H HD12   . LEU A 1 590 ? -80.822  37.53   12.539  0    30.53  ? 890  LEU A HD12   1 
ATOM   8995  H HD13   . LEU A 1 590 ? -79.079  37.755  12.21   0    31.77  ? 890  LEU A HD13   1 
ATOM   8996  H HD21   . LEU A 1 590 ? -79.681  40.625  11.073  0    43.65  ? 890  LEU A HD21   1 
ATOM   8997  H HD22   . LEU A 1 590 ? -78.468  39.49   10.424  0    42.38  ? 890  LEU A HD22   1 
ATOM   8998  H HD23   . LEU A 1 590 ? -79.765  40.114  9.37    0    44.46  ? 890  LEU A HD23   1 
ATOM   8999  N N      . TYR A 1 591 ? -83.361  36.314  10.811  1    23.33  ? 891  TYR A N      1 
ATOM   9000  C CA     . TYR A 1 591 ? -84.793  36.614  10.807  1    24.03  ? 891  TYR A CA     1 
ATOM   9001  C C      . TYR A 1 591 ? -85.084  37.834  11.654  1    25.87  ? 891  TYR A C      1 
ATOM   9002  O O      . TYR A 1 591 ? -84.404  38.074  12.649  1    25.94  ? 891  TYR A O      1 
ATOM   9003  C CB     . TYR A 1 591 ? -85.593  35.45   11.394  1    21.96  ? 891  TYR A CB     1 
ATOM   9004  C CG     . TYR A 1 591 ? -85.621  34.182  10.572  1    21.07  ? 891  TYR A CG     1 
ATOM   9005  C CD1    . TYR A 1 591 ? -86.667  33.924  9.695   1    22.74  ? 891  TYR A CD1    1 
ATOM   9006  C CD2    . TYR A 1 591 ? -84.711  33.156  10.808  1    19.96  ? 891  TYR A CD2    1 
ATOM   9007  C CE1    . TYR A 1 591 ? -86.777  32.697  9.032   1    23.08  ? 891  TYR A CE1    1 
ATOM   9008  C CE2    . TYR A 1 591 ? -84.793  31.938  10.13   1    20.55  ? 891  TYR A CE2    1 
ATOM   9009  C CZ     . TYR A 1 591 ? -85.842  31.702  9.256   1    22.34  ? 891  TYR A CZ     1 
ATOM   9010  O OH     . TYR A 1 591 ? -85.941  30.523  8.545   1    24.06  ? 891  TYR A OH     1 
ATOM   9011  H H      . TYR A 1 591 ? -83.065  35.827  11.65   0    24.74  ? 891  TYR A H      1 
ATOM   9012  H HA     . TYR A 1 591 ? -85.152  36.803  9.798   0    28.57  ? 891  TYR A HA     1 
ATOM   9013  H HB2    . TYR A 1 591 ? -85.171  35.192  12.364  0    22.96  ? 891  TYR A HB2    1 
ATOM   9014  H HB3    . TYR A 1 591 ? -86.624  35.777  11.518  0    23.79  ? 891  TYR A HB3    1 
ATOM   9015  H HD1    . TYR A 1 591 ? -87.425  34.675  9.54    0    26.62  ? 891  TYR A HD1    1 
ATOM   9016  H HD2    . TYR A 1 591 ? -83.908  33.316  11.506  0    20.82  ? 891  TYR A HD2    1 
ATOM   9017  H HE1    . TYR A 1 591 ? -87.574  32.534  8.327   0    27.16  ? 891  TYR A HE1    1 
ATOM   9018  H HE2    . TYR A 1 591 ? -84.05   31.179  10.307  0    21.42  ? 891  TYR A HE2    1 
ATOM   9019  H HH     . TYR A 1 591 ? -85.228  29.889  8.817   0    25.92  ? 891  TYR A HH     1 
ATOM   9020  N N      . GLU A 1 592 ? -86.139  38.556  11.296  1    28.76  ? 892  GLU A N      1 
ATOM   9021  C CA     . GLU A 1 592 ? -86.624  39.723  12.026  1    31.12  ? 892  GLU A CA     1 
ATOM   9022  C C      . GLU A 1 592 ? -87.972  39.347  12.68   1    31.4   ? 892  GLU A C      1 
ATOM   9023  O O      . GLU A 1 592 ? -88.719  38.56   12.107  1    33.17  ? 892  GLU A O      1 
ATOM   9024  C CB     . GLU A 1 592 ? -86.824  40.907  11.055  1    37.07  ? 892  GLU A CB     1 
ATOM   9025  C CG     . GLU A 1 592 ? -85.571  41.707  10.734  1    38.45  ? 892  GLU A CG     1 
ATOM   9026  C CD     . GLU A 1 592 ? -85.807  42.882  9.801   1    42.61  ? 892  GLU A CD     1 
ATOM   9027  O OE1    . GLU A 1 592 ? -86.322  42.644  8.684   1    44.04  ? 892  GLU A OE1    1 
ATOM   9028  O OE2    . GLU A 1 592 ? -85.481  44.033  10.18   1    44.9   ? 892  GLU A OE2    1 
ATOM   9029  H H      . GLU A 1 592 ? -86.71   38.339  10.486  0    37.05  ? 892  GLU A H      1 
ATOM   9030  H HA     . GLU A 1 592 ? -85.931  40.025  12.811  0    40.02  ? 892  GLU A HA     1 
ATOM   9031  H HB2    . GLU A 1 592 ? -87.232  40.534  10.116  0    52.08  ? 892  GLU A HB2    1 
ATOM   9032  H HB3    . GLU A 1 592 ? -87.536  41.597  11.503  0    52.99  ? 892  GLU A HB3    1 
ATOM   9033  H HG2    . GLU A 1 592 ? -85.176  42.11   11.664  0    54.02  ? 892  GLU A HG2    1 
ATOM   9034  H HG3    . GLU A 1 592 ? -84.84   41.045  10.273  0    52.94  ? 892  GLU A HG3    1 
ATOM   9035  N N      . TRP A 1 593 ? -88.289  39.898  13.864  1    31.02  ? 893  TRP A N      1 
ATOM   9036  C CA     . TRP A 1 593 ? -89.564  39.618  14.528  1    32.35  ? 893  TRP A CA     1 
ATOM   9037  C C      . TRP A 1 593 ? -90.508  40.788  14.228  1    37.61  ? 893  TRP A C      1 
ATOM   9038  O O      . TRP A 1 593 ? -90.317  41.88   14.763  1    39.43  ? 893  TRP A O      1 
ATOM   9039  C CB     . TRP A 1 593 ? -89.342  39.434  16.031  1    30.81  ? 893  TRP A CB     1 
ATOM   9040  C CG     . TRP A 1 593 ? -90.56   39.057  16.825  1    30.75  ? 893  TRP A CG     1 
ATOM   9041  C CD1    . TRP A 1 593 ? -91.134  39.782  17.827  1    33.92  ? 893  TRP A CD1    1 
ATOM   9042  C CD2    . TRP A 1 593 ? -91.258  37.803  16.79   1    30.54  ? 893  TRP A CD2    1 
ATOM   9043  N NE1    . TRP A 1 593 ? -92.158  39.066  18.404  1    35.86  ? 893  TRP A NE1    1 
ATOM   9044  C CE2    . TRP A 1 593 ? -92.268  37.855  17.772  1    34.1   ? 893  TRP A CE2    1 
ATOM   9045  C CE3    . TRP A 1 593 ? -91.152  36.657  16      1    28.86  ? 893  TRP A CE3    1 
ATOM   9046  C CZ2    . TRP A 1 593 ? -93.127  36.784  18.02   1    34.09  ? 893  TRP A CZ2    1 
ATOM   9047  C CZ3    . TRP A 1 593 ? -92.031  35.615  16.223  1    30.81  ? 893  TRP A CZ3    1 
ATOM   9048  C CH2    . TRP A 1 593 ? -93.002  35.685  17.224  1    32.63  ? 893  TRP A CH2    1 
ATOM   9049  H H      . TRP A 1 593 ? -87.686  40.531  14.38   0    41.28  ? 893  TRP A H      1 
ATOM   9050  H HA     . TRP A 1 593 ? -90.009  38.696  14.156  0    42     ? 893  TRP A HA     1 
ATOM   9051  H HB2    . TRP A 1 593 ? -88.611  38.64   16.172  0    37.62  ? 893  TRP A HB2    1 
ATOM   9052  H HB3    . TRP A 1 593 ? -88.951  40.363  16.446  0    41.27  ? 893  TRP A HB3    1 
ATOM   9053  H HD1    . TRP A 1 593 ? -90.818  40.764  18.134  0    47.75  ? 893  TRP A HD1    1 
ATOM   9054  H HE1    . TRP A 1 593 ? -92.769  39.399  19.177  0    50.54  ? 893  TRP A HE1    1 
ATOM   9055  H HE3    . TRP A 1 593 ? -90.383  36.578  15.251  0    34.77  ? 893  TRP A HE3    1 
ATOM   9056  H HZ2    . TRP A 1 593 ? -93.911  36.854  18.756  0    46.53  ? 893  TRP A HZ2    1 
ATOM   9057  H HZ3    . TRP A 1 593 ? -91.944  34.717  15.635  0    37.27  ? 893  TRP A HZ3    1 
ATOM   9058  H HH2    . TRP A 1 593 ? -93.677  34.858  17.354  0    42.2   ? 893  TRP A HH2    1 
ATOM   9059  N N      . THR A 1 594 ? -91.501  40.568  13.342  1    39.15  ? 894  THR A N      1 
ATOM   9060  C CA     . THR A 1 594 ? -92.422  41.625  12.916  1    43.07  ? 894  THR A CA     1 
ATOM   9061  C C      . THR A 1 594 ? -93.397  42.04   14.009  1    44.77  ? 894  THR A C      1 
ATOM   9062  O O      . THR A 1 594 ? -93.628  41.299  14.96   1    43.01  ? 894  THR A O      1 
ATOM   9063  C CB     . THR A 1 594 ? -93.22   41.203  11.65   1    44.68  ? 894  THR A CB     1 
ATOM   9064  O OG1    . THR A 1 594 ? -94.18   40.201  11.985  1    43.92  ? 894  THR A OG1    1 
ATOM   9065  C CG2    . THR A 1 594 ? -92.332  40.745  10.51   1    43.78  ? 894  THR A CG2    1 
ATOM   9066  H H      . THR A 1 594 ? -91.701  39.661  12.933  0    55.15  ? 894  THR A H      1 
ATOM   9067  H HA     . THR A 1 594 ? -91.837  42.504  12.649  0    66.19  ? 894  THR A HA     1 
ATOM   9068  H HB     . THR A 1 594 ? -93.762  42.077  11.289  0    71.66  ? 894  THR A HB     1 
ATOM   9069  H HG1    . THR A 1 594 ? -93.72   39.344  12.185  0    64.31  ? 894  THR A HG1    1 
ATOM   9070  H HG21   . THR A 1 594 ? -92.938  40.548  9.626   0    68.05  ? 894  THR A HG21   1 
ATOM   9071  H HG22   . THR A 1 594 ? -91.604  41.519  10.271  0    67.3   ? 894  THR A HG22   1 
ATOM   9072  H HG23   . THR A 1 594 ? -91.804  39.832  10.78   0    63.39  ? 894  THR A HG23   1 
ATOM   9073  N N      . THR A 1 595 ? -93.997  43.222  13.851  1    48.67  ? 895  THR A N      1 
ATOM   9074  C CA     . THR A 1 595 ? -95.041  43.678  14.754  1    51.24  ? 895  THR A CA     1 
ATOM   9075  C C      . THR A 1 595 ? -96.259  42.713  14.732  1    51.59  ? 895  THR A C      1 
ATOM   9076  O O      . THR A 1 595 ? -97.101  42.815  15.619  1    53.37  ? 895  THR A O      1 
ATOM   9077  C CB     . THR A 1 595 ? -95.458  45.114  14.386  1    55.82  ? 895  THR A CB     1 
ATOM   9078  O OG1    . THR A 1 595 ? -95.721  45.183  12.983  1    57.55  ? 895  THR A OG1    1 
ATOM   9079  C CG2    . THR A 1 595 ? -94.392  46.135  14.737  1    56.29  ? 895  THR A CG2    1 
ATOM   9080  H H      . THR A 1 595 ? -93.773  43.866  13.1    0    78.9   ? 895  THR A H      1 
ATOM   9081  H HA     . THR A 1 595 ? -94.654  43.677  15.772  0    81.67  ? 895  THR A HA     1 
ATOM   9082  H HB     . THR A 1 595 ? -96.364  45.368  14.934  0    95.26  ? 895  THR A HB     1 
ATOM   9083  H HG1    . THR A 1 595 ? -96.639  44.855  12.795  0    97.72  ? 895  THR A HG1    1 
ATOM   9084  H HG21   . THR A 1 595 ? -94.726  47.133  14.457  0    97.79  ? 895  THR A HG21   1 
ATOM   9085  H HG22   . THR A 1 595 ? -94.199  46.116  15.808  0    93.29  ? 895  THR A HG22   1 
ATOM   9086  H HG23   . THR A 1 595 ? -93.468  45.908  14.208  0    92.17  ? 895  THR A HG23   1 
ATOM   9087  N N      . GLU A 1 596 ? -96.341  41.767  13.752  1    50.36  ? 896  GLU A N      1 
ATOM   9088  C CA     . GLU A 1 596 ? -97.427  40.776  13.663  1    51.07  ? 896  GLU A CA     1 
ATOM   9089  C C      . GLU A 1 596 ? -97.089  39.491  14.438  1    47.44  ? 896  GLU A C      1 
ATOM   9090  O O      . GLU A 1 596 ? -97.739  38.467  14.205  1    47.67  ? 896  GLU A O      1 
ATOM   9091  C CB     . GLU A 1 596 ? -97.682  40.371  12.194  1    52.48  ? 896  GLU A CB     1 
ATOM   9092  C CG     . GLU A 1 596 ? -97.545  41.48   11.164  1    55.41  ? 896  GLU A CG     1 
ATOM   9093  C CD     . GLU A 1 596 ? -98.255  42.781  11.505  1    59.11  ? 896  GLU A CD     1 
ATOM   9094  O OE1    . GLU A 1 596 ? -97.717  43.857  11.15   1    60.14  ? 896  GLU A OE1    1 
ATOM   9095  O OE2    . GLU A 1 596 ? -99.338  42.73   12.135  1    61.33  ? 896  GLU A OE2    1 
ATOM   9096  H H      . GLU A 1 596 ? -95.647  41.645  13.023  0    79.74  ? 896  GLU A H      1 
ATOM   9097  H HA     . GLU A 1 596 ? -98.352  41.19   14.062  0    85.11  ? 896  GLU A HA     1 
ATOM   9098  H HB2    . GLU A 1 596 ? -96.974  39.59   11.922  0    82.75  ? 896  GLU A HB2    1 
ATOM   9099  H HB3    . GLU A 1 596 ? -98.696  39.98   12.116  0    87.5   ? 896  GLU A HB3    1 
ATOM   9100  H HG2    . GLU A 1 596 ? -96.488  41.703  11.03   0    89.96  ? 896  GLU A HG2    1 
ATOM   9101  H HG3    . GLU A 1 596 ? -97.958  41.122  10.223  0    93.53  ? 896  GLU A HG3    1 
ATOM   9102  N N      . LYS A 1 597 ? -96.067  39.525  15.333  1    44.63  ? 897  LYS A N      1 
ATOM   9103  C CA     . LYS A 1 597 ? -95.571  38.378  16.085  1    41.32  ? 897  LYS A CA     1 
ATOM   9104  C C      . LYS A 1 597 ? -95.289  37.193  15.161  1    39.34  ? 897  LYS A C      1 
ATOM   9105  O O      . LYS A 1 597 ? -95.84   36.114  15.364  1    38.37  ? 897  LYS A O      1 
ATOM   9106  C CB     . LYS A 1 597 ? -96.504  37.999  17.253  1    42.63  ? 897  LYS A CB     1 
ATOM   9107  C CG     . LYS A 1 597 ? -96.445  38.963  18.442  1    44.1   ? 897  LYS A CG     1 
ATOM   9108  C CD     . LYS A 1 597 ? -97.336  38.497  19.59   1    46.11  ? 897  LYS A CD     1 
ATOM   9109  C CE     . LYS A 1 597 ? -97.284  39.402  20.794  1    48.03  ? 897  LYS A CE     1 
ATOM   9110  N NZ     . LYS A 1 597 ? -98.198  38.941  21.869  1    50.59  ? 897  LYS A NZ     1 
ATOM   9111  H H      . LYS A 1 597 ? -95.563  40.371  15.576  0    68.48  ? 897  LYS A H      1 
ATOM   9112  H HA     . LYS A 1 597 ? -94.609  38.662  16.511  0    59.32  ? 897  LYS A HA     1 
ATOM   9113  H HB2    . LYS A 1 597 ? -97.533  37.976  16.896  0    66.34  ? 897  LYS A HB2    1 
ATOM   9114  H HB3    . LYS A 1 597 ? -96.225  37.02   17.641  0    61.87  ? 897  LYS A HB3    1 
ATOM   9115  H HG2    . LYS A 1 597 ? -95.421  39.019  18.808  0    64.94  ? 897  LYS A HG2    1 
ATOM   9116  H HG3    . LYS A 1 597 ? -96.784  39.949  18.125  0    69.42  ? 897  LYS A HG3    1 
ATOM   9117  H HD2    . LYS A 1 597 ? -98.367  38.465  19.24   0    73.49  ? 897  LYS A HD2    1 
ATOM   9118  H HD3    . LYS A 1 597 ? -97.02   37.502  19.9    0    68.99  ? 897  LYS A HD3    1 
ATOM   9119  H HE2    . LYS A 1 597 ? -96.269  39.412  21.189  0    73.01  ? 897  LYS A HE2    1 
ATOM   9120  H HE3    . LYS A 1 597 ? -97.585  40.407  20.503  0    77.5   ? 897  LYS A HE3    1 
ATOM   9121  H HZ1    . LYS A 1 597 ? -98.151  39.571  22.663  0    81.61  ? 897  LYS A HZ1    1 
ATOM   9122  H HZ2    . LYS A 1 597 ? -99.153  38.914  21.525  0    82.32  ? 897  LYS A HZ2    1 
ATOM   9123  H HZ3    . LYS A 1 597 ? -97.932  38.008  22.172  0    78.19  ? 897  LYS A HZ3    1 
ATOM   9124  N N      . GLU A 1 598 ? -94.462  37.436  14.115  1    39.35  ? 898  GLU A N      1 
ATOM   9125  C CA     . GLU A 1 598 ? -94.058  36.446  13.111  1    37.97  ? 898  GLU A CA     1 
ATOM   9126  C C      . GLU A 1 598 ? -92.62   36.705  12.657  1    35.95  ? 898  GLU A C      1 
ATOM   9127  O O      . GLU A 1 598 ? -92.246  37.858  12.478  1    37.4   ? 898  GLU A O      1 
ATOM   9128  C CB     . GLU A 1 598 ? -94.987  36.506  11.875  1    41.2   ? 898  GLU A CB     1 
ATOM   9129  C CG     . GLU A 1 598 ? -96.363  35.885  12.079  1    43.41  ? 898  GLU A CG     1 
ATOM   9130  C CD     . GLU A 1 598 ? -96.368  34.414  12.488  1    41.65  ? 898  GLU A CD     1 
ATOM   9131  O OE1    . GLU A 1 598 ? -95.403  33.677  12.15   1    38.78  ? 898  GLU A OE1    1 
ATOM   9132  O OE2    . GLU A 1 598 ? -97.337  34.007  13.175  1    43.53  ? 898  GLU A OE2    1 
ATOM   9133  H H      . GLU A 1 598 ? -94.052  38.348  13.94   0    56.54  ? 898  GLU A H      1 
ATOM   9134  H HA     . GLU A 1 598 ? -94.094  35.447  13.543  0    51.63  ? 898  GLU A HA     1 
ATOM   9135  H HB2    . GLU A 1 598 ? -95.135  37.55   11.6    0    62.02  ? 898  GLU A HB2    1 
ATOM   9136  H HB3    . GLU A 1 598 ? -94.504  35.976  11.054  0    59.49  ? 898  GLU A HB3    1 
ATOM   9137  H HG2    . GLU A 1 598 ? -96.88   36.445  12.857  0    66.02  ? 898  GLU A HG2    1 
ATOM   9138  H HG3    . GLU A 1 598 ? -96.919  35.969  11.146  0    67.75  ? 898  GLU A HG3    1 
ATOM   9139  N N      . LEU A 1 599 ? -91.807  35.659  12.471  1    33.2   ? 899  LEU A N      1 
ATOM   9140  C CA     . LEU A 1 599 ? -90.434  35.827  11.987  1    31.52  ? 899  LEU A CA     1 
ATOM   9141  C C      . LEU A 1 599 ? -90.461  36.028  10.486  1    33.39  ? 899  LEU A C      1 
ATOM   9142  O O      . LEU A 1 599 ? -91.17   35.298  9.788   1    34.46  ? 899  LEU A O      1 
ATOM   9143  C CB     . LEU A 1 599 ? -89.589  34.58   12.267  1    25.83  ? 899  LEU A CB     1 
ATOM   9144  C CG     . LEU A 1 599 ? -89.178  34.339  13.69   1    21.75  ? 899  LEU A CG     1 
ATOM   9145  C CD1    . LEU A 1 599 ? -88.85   32.879  13.898  1    20.31  ? 899  LEU A CD1    1 
ATOM   9146  C CD2    . LEU A 1 599 ? -87.992  35.177  14.043  1    21.35  ? 899  LEU A CD2    1 
ATOM   9147  H H      . LEU A 1 599 ? -92.071  34.695  12.648  0    41.96  ? 899  LEU A H      1 
ATOM   9148  H HA     . LEU A 1 599 ? -89.972  36.693  12.456  0    39.17  ? 899  LEU A HA     1 
ATOM   9149  H HB2    . LEU A 1 599 ? -90.14   33.702  11.932  0    29.74  ? 899  LEU A HB2    1 
ATOM   9150  H HB3    . LEU A 1 599 ? -88.673  34.662  11.684  0    28.85  ? 899  LEU A HB3    1 
ATOM   9151  H HG     . LEU A 1 599 ? -89.99   34.593  14.37   0    23.71  ? 899  LEU A HG     1 
ATOM   9152  H HD11   . LEU A 1 599 ? -88.445  32.75   14.901  0    20.61  ? 899  LEU A HD11   1 
ATOM   9153  H HD12   . LEU A 1 599 ? -89.76   32.291  13.789  0    21.08  ? 899  LEU A HD12   1 
ATOM   9154  H HD13   . LEU A 1 599 ? -88.115  32.57   13.156  0    20.83  ? 899  LEU A HD13   1 
ATOM   9155  H HD21   . LEU A 1 599 ? -87.842  35.133  15.121  0    22.4   ? 899  LEU A HD21   1 
ATOM   9156  H HD22   . LEU A 1 599 ? -87.121  34.758  13.543  0    22.06  ? 899  LEU A HD22   1 
ATOM   9157  H HD23   . LEU A 1 599 ? -88.14   36.209  13.73   0    23.31  ? 899  LEU A HD23   1 
ATOM   9158  N N      . ARG A 1 600 ? -89.68   36.983  9.97    1    34.23  ? 900  ARG A N      1 
ATOM   9159  C CA     . ARG A 1 600 ? -89.565  37.172  8.534   1    36.46  ? 900  ARG A CA     1 
ATOM   9160  C C      . ARG A 1 600 ? -88.101  37.372  8.201   1    35.53  ? 900  ARG A C      1 
ATOM   9161  O O      . ARG A 1 600 ? -87.457  38.263  8.757   1    35.41  ? 900  ARG A O      1 
ATOM   9162  C CB     . ARG A 1 600 ? -90.435  38.329  7.996   1    40.35  ? 900  ARG A CB     1 
ATOM   9163  C CG     . ARG A 1 600 ? -90.8    38.173  6.479   1    43.29  ? 900  ARG A CG     1 
ATOM   9164  C CD     . ARG A 1 600 ? -91.821  37.027  6.146   1    43.75  ? 900  ARG A CD     1 
ATOM   9165  N NE     . ARG A 1 600 ? -91.713  36.422  4.789   1    45.7   ? 900  ARG A NE     1 
ATOM   9166  C CZ     . ARG A 1 600 ? -90.938  35.381  4.434   1    44.07  ? 900  ARG A CZ     1 
ATOM   9167  N NH1    . ARG A 1 600 ? -90.965  34.918  3.185   1    46.7   ? 900  ARG A NH1    1 
ATOM   9168  N NH2    . ARG A 1 600 ? -90.122  34.807  5.321   1    40.26  ? 900  ARG A NH2    1 
ATOM   9169  H H      . ARG A 1 600 ? -89.122  37.632  10.516  0    44.73  ? 900  ARG A H      1 
ATOM   9170  H HA     . ARG A 1 600 ? -89.887  36.248  8.057   0    50.07  ? 900  ARG A HA     1 
ATOM   9171  H HB2    . ARG A 1 600 ? -91.367  38.362  8.559   0    59.21  ? 900  ARG A HB2    1 
ATOM   9172  H HB3    . ARG A 1 600 ? -89.896  39.267  8.116   0    59.21  ? 900  ARG A HB3    1 
ATOM   9173  H HG2    . ARG A 1 600 ? -91.236  39.109  6.134   0    68     ? 900  ARG A HG2    1 
ATOM   9174  H HG3    . ARG A 1 600 ? -89.886  37.97   5.922   0    64.44  ? 900  ARG A HG3    1 
ATOM   9175  H HD2    . ARG A 1 600 ? -91.789  36.23   6.886   0    64.16  ? 900  ARG A HD2    1 
ATOM   9176  H HD3    . ARG A 1 600 ? -92.812  37.476  6.184   0    69     ? 900  ARG A HD3    1 
ATOM   9177  H HE     . ARG A 1 600 ? -92.329  36.804  4.077   0    74.09  ? 900  ARG A HE     1 
ATOM   9178  H HH11   . ARG A 1 600 ? -91.581  35.338  2.496   0    76.22  ? 900  ARG A HH11   1 
ATOM   9179  H HH12   . ARG A 1 600 ? -90.368  34.143  2.914   0    71.91  ? 900  ARG A HH12   1 
ATOM   9180  H HH21   . ARG A 1 600 ? -90.047  35.147  6.273   0    56.98  ? 900  ARG A HH21   1 
ATOM   9181  H HH22   . ARG A 1 600 ? -89.527  34.037  5.031   0    57.73  ? 900  ARG A HH22   1 
ATOM   9182  N N      . THR A 1 601 ? -87.582  36.523  7.294   1    35.37  ? 901  THR A N      1 
ATOM   9183  C CA     . THR A 1 601 ? -86.191  36.532  6.857   1    34.84  ? 901  THR A CA     1 
ATOM   9184  C C      . THR A 1 601 ? -85.746  37.92   6.38    1    37.51  ? 901  THR A C      1 
ATOM   9185  O O      . THR A 1 601 ? -86.527  38.656  5.772   1    40.76  ? 901  THR A O      1 
ATOM   9186  C CB     . THR A 1 601 ? -85.979  35.528  5.717   1    35.53  ? 901  THR A CB     1 
ATOM   9187  O OG1    . THR A 1 601 ? -86.602  34.282  6.033   1    34.25  ? 901  THR A OG1    1 
ATOM   9188  C CG2    . THR A 1 601 ? -84.513  35.316  5.401   1    34.55  ? 901  THR A CG2    1 
ATOM   9189  H H      . THR A 1 601 ? -88.147  35.816  6.832   0    48.74  ? 901  THR A H      1 
ATOM   9190  H HA     . THR A 1 601 ? -85.562  36.218  7.687   0    44.2   ? 901  THR A HA     1 
ATOM   9191  H HB     . THR A 1 601 ? -86.45   35.931  4.821   0    51.15  ? 901  THR A HB     1 
ATOM   9192  H HG1    . THR A 1 601 ? -86.341  33.994  6.947   0    43.09  ? 901  THR A HG1    1 
ATOM   9193  H HG21   . THR A 1 601 ? -84.401  34.444  4.759   0    46.68  ? 901  THR A HG21   1 
ATOM   9194  H HG22   . THR A 1 601 ? -84.108  36.183  4.879   0    48.3   ? 901  THR A HG22   1 
ATOM   9195  H HG23   . THR A 1 601 ? -83.949  35.159  6.319   0    43.9   ? 901  THR A HG23   1 
ATOM   9196  N N      . GLU A 1 602 ? -84.499  38.272  6.68    1    36.54  ? 902  GLU A N      1 
ATOM   9197  C CA     . GLU A 1 602 ? -83.88   39.519  6.241   1    39.33  ? 902  GLU A CA     1 
ATOM   9198  C C      . GLU A 1 602 ? -82.775  39.206  5.214   1    40.15  ? 902  GLU A C      1 
ATOM   9199  O O      . GLU A 1 602 ? -82.727  39.841  4.158   1    43.66  ? 902  GLU A O      1 
ATOM   9200  C CB     . GLU A 1 602 ? -83.296  40.306  7.432   1    38.62  ? 902  GLU A CB     1 
ATOM   9201  C CG     . GLU A 1 602 ? -82.454  41.504  7.001   1    41.94  ? 902  GLU A CG     1 
ATOM   9202  C CD     . GLU A 1 602 ? -82.028  42.448  8.105   1    42.48  ? 902  GLU A CD     1 
ATOM   9203  O OE1    . GLU A 1 602 ? -81.735  43.624  7.792   1    46.02  ? 902  GLU A OE1    1 
ATOM   9204  O OE2    . GLU A 1 602 ? -81.976  42.017  9.28    1    39.87  ? 902  GLU A OE2    1 
ATOM   9205  H H      . GLU A 1 602 ? -83.893  37.708  7.266   0    48.04  ? 902  GLU A H      1 
ATOM   9206  H HA     . GLU A 1 602 ? -84.611  40.16   5.752   0    59.14  ? 902  GLU A HA     1 
ATOM   9207  H HB2    . GLU A 1 602 ? -84.117  40.676  8.044   0    54.9   ? 902  GLU A HB2    1 
ATOM   9208  H HB3    . GLU A 1 602 ? -82.662  39.644  8.018   0    52.43  ? 902  GLU A HB3    1 
ATOM   9209  H HG2    . GLU A 1 602 ? -81.53   41.154  6.545   0    62.14  ? 902  GLU A HG2    1 
ATOM   9210  H HG3    . GLU A 1 602 ? -83.022  42.084  6.276   0    64.95  ? 902  GLU A HG3    1 
ATOM   9211  N N      . CYS A 1 603 ? -81.859  38.271  5.549   1    37.4   ? 903  CYS A N      1 
ATOM   9212  C CA     . CYS A 1 603 ? -80.733  37.926  4.678   1    38.65  ? 903  CYS A CA     1 
ATOM   9213  C C      . CYS A 1 603 ? -80.19   36.503  4.956   1    35.85  ? 903  CYS A C      1 
ATOM   9214  O O      . CYS A 1 603 ? -80.476  35.911  6.007   1    32.79  ? 903  CYS A O      1 
ATOM   9215  C CB     . CYS A 1 603 ? -79.634  38.975  4.818   1    40.69  ? 903  CYS A CB     1 
ATOM   9216  S SG     . CYS A 1 603 ? -79.095  39.256  6.529   1    38.18  ? 903  CYS A SG     1 
ATOM   9217  H H      . CYS A 1 603 ? -81.874  37.745  6.416   0    50.12  ? 903  CYS A H      1 
ATOM   9218  H HA     . CYS A 1 603 ? -81.067  37.939  3.641   0    57.83  ? 903  CYS A HA     1 
ATOM   9219  H HB2    . CYS A 1 603 ? -78.772  38.645  4.24    0    60.68  ? 903  CYS A HB2    1 
ATOM   9220  H HB3    . CYS A 1 603 ? -80.009  39.918  4.423   0    62.38  ? 903  CYS A HB3    1 
ATOM   9221  H HG     . CYS A 1 603 ? -78.599  38.116  7.023   0    51.29  ? 903  CYS A HG     1 
ATOM   9222  N N      . ASN A 1 604 ? -79.411  35.962  3.987   1    37.38  ? 904  ASN A N      1 
ATOM   9223  C CA     . ASN A 1 604 ? -78.819  34.627  4.07    1    35.6   ? 904  ASN A CA     1 
ATOM   9224  C C      . ASN A 1 604 ? -77.354  34.625  3.648   1    37.01  ? 904  ASN A C      1 
ATOM   9225  O O      . ASN A 1 604 ? -76.908  35.508  2.908   1    40.15  ? 904  ASN A O      1 
ATOM   9226  C CB     . ASN A 1 604 ? -79.537  33.691  3.12    1    36.83  ? 904  ASN A CB     1 
ATOM   9227  C CG     . ASN A 1 604 ? -80.997  33.498  3.358   1    36     ? 904  ASN A CG     1 
ATOM   9228  O OD1    . ASN A 1 604 ? -81.399  32.628  4.114   1    30.94  ? 904  ASN A OD1    1 
ATOM   9229  N ND2    . ASN A 1 604 ? -81.834  34.252  2.669   1    38.58  ? 904  ASN A ND2    1 
ATOM   9230  H H      . ASN A 1 604 ? -79.18   36.446  3.125   0    55.27  ? 904  ASN A H      1 
ATOM   9231  H HA     . ASN A 1 604 ? -78.893  34.226  5.079   0    45.68  ? 904  ASN A HA     1 
ATOM   9232  H HB2    . ASN A 1 604 ? -79.41   34.064  2.104   0    54.12  ? 904  ASN A HB2    1 
ATOM   9233  H HB3    . ASN A 1 604 ? -79.073  32.709  3.2     0    50.05  ? 904  ASN A HB3    1 
ATOM   9234  H HD21   . ASN A 1 604 ? -82.834  34.148  2.81    0    54.79  ? 904  ASN A HD21   1 
ATOM   9235  H HD22   . ASN A 1 604 ? -81.492  34.947  2.014   0    57.35  ? 904  ASN A HD22   1 
ATOM   9236  N N      . HIS A 1 605 ? -76.622  33.598  4.102   1    35.11  ? 905  HIS A N      1 
ATOM   9237  C CA     . HIS A 1 605 ? -75.248  33.316  3.702   1    36.5   ? 905  HIS A CA     1 
ATOM   9238  C C      . HIS A 1 605 ? -75.21   31.81   3.45    1    34.63  ? 905  HIS A C      1 
ATOM   9239  O O      . HIS A 1 605 ? -75.389  31.047  4.395   1    30.65  ? 905  HIS A O      1 
ATOM   9240  C CB     . HIS A 1 605 ? -74.233  33.719  4.78    1    35.17  ? 905  HIS A CB     1 
ATOM   9241  C CG     . HIS A 1 605 ? -72.861  33.154  4.533   1    36.35  ? 905  HIS A CG     1 
ATOM   9242  N ND1    . HIS A 1 605 ? -72.439  31.978  5.141   1    32.64  ? 905  HIS A ND1    1 
ATOM   9243  C CD2    . HIS A 1 605 ? -71.89   33.582  3.688   1    39.84  ? 905  HIS A CD2    1 
ATOM   9244  C CE1    . HIS A 1 605 ? -71.215  31.76   4.681   1    36.45  ? 905  HIS A CE1    1 
ATOM   9245  N NE2    . HIS A 1 605 ? -70.839  32.707  3.816   1    39.84  ? 905  HIS A NE2    1 
ATOM   9246  H H      . HIS A 1 605 ? -76.975  32.934  4.784   0    44.94  ? 905  HIS A H      1 
ATOM   9247  H HA     . HIS A 1 605 ? -74.998  33.836  2.779   0    53.45  ? 905  HIS A HA     1 
ATOM   9248  H HB2    . HIS A 1 605 ? -74.146  34.805  4.784   0    49.17  ? 905  HIS A HB2    1 
ATOM   9249  H HB3    . HIS A 1 605 ? -74.58   33.385  5.754   0    44.92  ? 905  HIS A HB3    1 
ATOM   9250  H HD2    . HIS A 1 605 ? -71.933  34.447  3.047   0    60.44  ? 905  HIS A HD2    1 
ATOM   9251  H HE1    . HIS A 1 605 ? -70.6    30.923  4.966   0    49.57  ? 905  HIS A HE1    1 
ATOM   9252  H HE2    . HIS A 1 605 ? -69.942  32.774  3.346   0    60.1   ? 905  HIS A HE2    1 
ATOM   9253  N N      . TYR A 1 606 ? -74.991  31.384  2.198   1    38.67  ? 906  TYR A N      1 
ATOM   9254  C CA     . TYR A 1 606 ? -75.037  29.966  1.855   1    39.41  ? 906  TYR A CA     1 
ATOM   9255  C C      . TYR A 1 606 ? -73.693  29.274  1.664   1    40.41  ? 906  TYR A C      1 
ATOM   9256  O O      . TYR A 1 606 ? -73.698  28.08   1.366   1    41.51  ? 906  TYR A O      1 
ATOM   9257  C CB     . TYR A 1 606 ? -75.848  29.772  0.584   1    42.54  ? 906  TYR A CB     1 
ATOM   9258  C CG     . TYR A 1 606 ? -77.163  30.515  0.558   1    42.17  ? 906  TYR A CG     1 
ATOM   9259  C CD1    . TYR A 1 606 ? -78.303  29.968  1.12    1    41.26  ? 906  TYR A CD1    1 
ATOM   9260  C CD2    . TYR A 1 606 ? -77.288  31.716  -0.12   1    44.47  ? 906  TYR A CD2    1 
ATOM   9261  C CE1    . TYR A 1 606 ? -79.527  30.623  1.055   1    41.18  ? 906  TYR A CE1    1 
ATOM   9262  C CE2    . TYR A 1 606 ? -78.509  32.369  -0.215  1    44.97  ? 906  TYR A CE2    1 
ATOM   9263  C CZ     . TYR A 1 606 ? -79.635  31.809  0.356   1    42.86  ? 906  TYR A CZ     1 
ATOM   9264  O OH     . TYR A 1 606 ? -80.84   32.473  0.301   1    43.64  ? 906  TYR A OH     1 
ATOM   9265  H H      . TYR A 1 606 ? -74.774  31.986  1.41    0    57.88  ? 906  TYR A H      1 
ATOM   9266  H HA     . TYR A 1 606 ? -75.569  29.417  2.63    0    53.36  ? 906  TYR A HA     1 
ATOM   9267  H HB2    . TYR A 1 606 ? -75.256  30.112  -0.265  0    65.84  ? 906  TYR A HB2    1 
ATOM   9268  H HB3    . TYR A 1 606 ? -76.077  28.714  0.466   0    62.77  ? 906  TYR A HB3    1 
ATOM   9269  H HD1    . TYR A 1 606 ? -78.237  29.021  1.631   0    57.55  ? 906  TYR A HD1    1 
ATOM   9270  H HD2    . TYR A 1 606 ? -76.424  32.151  -0.596  0    69.83  ? 906  TYR A HD2    1 
ATOM   9271  H HE1    . TYR A 1 606 ? -80.4    30.177  1.501   0    58.33  ? 906  TYR A HE1    1 
ATOM   9272  H HE2    . TYR A 1 606 ? -78.566  33.313  -0.733  0    71.29  ? 906  TYR A HE2    1 
ATOM   9273  H HH     . TYR A 1 606 ? -80.777  33.284  -0.269  0    68.22  ? 906  TYR A HH     1 
ATOM   9274  N N      . ASN A 1 607 ? -72.553  29.976  1.812   1    40.89  ? 907  ASN A N      1 
ATOM   9275  C CA     . ASN A 1 607 ? -71.247  29.34   1.612   1    42.4   ? 907  ASN A CA     1 
ATOM   9276  C C      . ASN A 1 607 ? -70.78   28.516  2.827   1    39.61  ? 907  ASN A C      1 
ATOM   9277  O O      . ASN A 1 607 ? -69.87   28.923  3.555   1    39.17  ? 907  ASN A O      1 
ATOM   9278  C CB     . ASN A 1 607 ? -70.19   30.375  1.233   1    45.51  ? 907  ASN A CB     1 
ATOM   9279  C CG     . ASN A 1 607 ? -68.892  29.738  0.801   1    48.18  ? 907  ASN A CG     1 
ATOM   9280  O OD1    . ASN A 1 607 ? -68.887  28.702  0.116   1    49.5   ? 907  ASN A OD1    1 
ATOM   9281  N ND2    . ASN A 1 607 ? -67.761  30.321  1.205   1    49.5   ? 907  ASN A ND2    1 
ATOM   9282  H H      . ASN A 1 607 ? -72.491  30.957  2.064   0    59.86  ? 907  ASN A H      1 
ATOM   9283  H HA     . ASN A 1 607 ? -71.331  28.651  0.773   0    65.19  ? 907  ASN A HA     1 
ATOM   9284  H HB2    . ASN A 1 607 ? -70.556  30.977  0.405   0    72.22  ? 907  ASN A HB2    1 
ATOM   9285  H HB3    . ASN A 1 607 ? -70.002  31.018  2.091   0    68.44  ? 907  ASN A HB3    1 
ATOM   9286  H HD21   . ASN A 1 607 ? -66.868  29.918  0.94    0    80.84  ? 907  ASN A HD21   1 
ATOM   9287  H HD22   . ASN A 1 607 ? -67.787  31.155  1.782   0    77.75  ? 907  ASN A HD22   1 
ATOM   9288  N N      . ASN A 1 608 ? -71.391  27.344  3.023   1    38.73  ? 908  ASN A N      1 
ATOM   9289  C CA     . ASN A 1 608 ? -71.046  26.429  4.113   1    37.32  ? 908  ASN A CA     1 
ATOM   9290  C C      . ASN A 1 608 ? -71.284  24.975  3.708   1    40.08  ? 908  ASN A C      1 
ATOM   9291  O O      . ASN A 1 608 ? -72.163  24.696  2.894   1    42.01  ? 908  ASN A O      1 
ATOM   9292  C CB     . ASN A 1 608 ? -71.904  26.723  5.34    1    33.78  ? 908  ASN A CB     1 
ATOM   9293  C CG     . ASN A 1 608 ? -71.655  28.067  5.928   1    31.62  ? 908  ASN A CG     1 
ATOM   9294  O OD1    . ASN A 1 608 ? -70.529  28.362  6.326   1    31.53  ? 908  ASN A OD1    1 
ATOM   9295  N ND2    . ASN A 1 608 ? -72.675  28.915  5.973   1    30.43  ? 908  ASN A ND2    1 
ATOM   9296  H H      . ASN A 1 608 ? -72.143  27      2.437   0    54.77  ? 908  ASN A H      1 
ATOM   9297  H HA     . ASN A 1 608 ? -69.997  26.538  4.384   0    50.96  ? 908  ASN A HA     1 
ATOM   9298  H HB2    . ASN A 1 608 ? -72.952  26.643  5.056   0    41.84  ? 908  ASN A HB2    1 
ATOM   9299  H HB3    . ASN A 1 608 ? -71.679  25.985  6.109   0    41.07  ? 908  ASN A HB3    1 
ATOM   9300  H HD21   . ASN A 1 608 ? -72.538  29.84   6.367   0    36.83  ? 908  ASN A HD21   1 
ATOM   9301  H HD22   . ASN A 1 608 ? -73.589  28.651  5.62    0    36.86  ? 908  ASN A HD22   1 
ATOM   9302  N N      . ILE A 1 609 ? -70.517  24.047  4.284   1    40.61  ? 909  ILE A N      1 
ATOM   9303  C CA     . ILE A 1 609 ? -70.753  22.626  4.073   1    43.35  ? 909  ILE A CA     1 
ATOM   9304  C C      . ILE A 1 609 ? -71.932  22.288  5.002   1    40.62  ? 909  ILE A C      1 
ATOM   9305  O O      . ILE A 1 609 ? -72.954  21.762  4.55    1    42.32  ? 909  ILE A O      1 
ATOM   9306  C CB     . ILE A 1 609 ? -69.49   21.783  4.375   1    44.72  ? 909  ILE A CB     1 
ATOM   9307  C CG1    . ILE A 1 609 ? -68.31   22.175  3.459   1    46.15  ? 909  ILE A CG1    1 
ATOM   9308  C CG2    . ILE A 1 609 ? -69.795  20.294  4.274   1    47.63  ? 909  ILE A CG2    1 
ATOM   9309  C CD1    . ILE A 1 609 ? -68.463  21.904  1.946   1    49.47  ? 909  ILE A CD1    1 
ATOM   9310  H H      . ILE A 1 609 ? -69.734  24.247  4.898   0    54.06  ? 909  ILE A H      1 
ATOM   9311  H HA     . ILE A 1 609 ? -71.06   22.427  3.047   0    61     ? 909  ILE A HA     1 
ATOM   9312  H HB     . ILE A 1 609 ? -69.197  21.987  5.404   0    59.76  ? 909  ILE A HB     1 
ATOM   9313  H HG12   . ILE A 1 609 ? -68.103  23.237  3.585   0    66.53  ? 909  ILE A HG12   1 
ATOM   9314  H HG13   . ILE A 1 609 ? -67.442  21.601  3.778   0    67.87  ? 909  ILE A HG13   1 
ATOM   9315  H HG21   . ILE A 1 609 ? -68.859  19.746  4.18    0    67.99  ? 909  ILE A HG21   1 
ATOM   9316  H HG22   . ILE A 1 609 ? -70.311  19.971  5.177   0    64.01  ? 909  ILE A HG22   1 
ATOM   9317  H HG23   . ILE A 1 609 ? -70.422  20.117  3.401   0    68.07  ? 909  ILE A HG23   1 
ATOM   9318  H HD11   . ILE A 1 609 ? -67.536  22.185  1.449   0    77.36  ? 909  ILE A HD11   1 
ATOM   9319  H HD12   . ILE A 1 609 ? -68.665  20.848  1.78    0    75.7   ? 909  ILE A HD12   1 
ATOM   9320  H HD13   . ILE A 1 609 ? -69.283  22.508  1.558   0    74.37  ? 909  ILE A HD13   1 
ATOM   9321  N N      . MET A 1 610 ? -71.811  22.644  6.291   1    36.77  ? 910  MET A N      1 
ATOM   9322  C CA     . MET A 1 610 ? -72.881  22.434  7.25    1    34.18  ? 910  MET A CA     1 
ATOM   9323  C C      . MET A 1 610 ? -72.596  23.296  8.494   1    30.61  ? 910  MET A C      1 
ATOM   9324  O O      . MET A 1 610 ? -71.777  22.92   9.33    1    30.38  ? 910  MET A O      1 
ATOM   9325  C CB     . MET A 1 610 ? -72.976  20.946  7.576   1    35.88  ? 910  MET A CB     1 
ATOM   9326  C CG     . MET A 1 610 ? -74.231  20.557  8.281   1    34.53  ? 910  MET A CG     1 
ATOM   9327  S SD     . MET A 1 610 ? -74.047  18.998  9.171   1    36.45  ? 910  MET A SD     1 
ATOM   9328  C CE     . MET A 1 610 ? -74.2    17.812  7.872   1    42.1   ? 910  MET A CE     1 
ATOM   9329  H H      . MET A 1 610 ? -70.963  23.046  6.677   0    44.94  ? 910  MET A H      1 
ATOM   9330  H HA     . MET A 1 610 ? -73.821  22.752  6.802   0    40.58  ? 910  MET A HA     1 
ATOM   9331  H HB2    . MET A 1 610 ? -72.961  20.373  6.65    0    44.94  ? 910  MET A HB2    1 
ATOM   9332  H HB3    . MET A 1 610 ? -72.117  20.66   8.18    0    42.86  ? 910  MET A HB3    1 
ATOM   9333  H HG2    . MET A 1 610 ? -74.496  21.317  9.014   0    39.43  ? 910  MET A HG2    1 
ATOM   9334  H HG3    . MET A 1 610 ? -75.034  20.439  7.556   0    41.89  ? 910  MET A HG3    1 
ATOM   9335  H HE1    . MET A 1 610 ? -74.325  16.828  8.323   0    52.93  ? 910  MET A HE1    1 
ATOM   9336  H HE2    . MET A 1 610 ? -75.069  18.068  7.269   0    52.16  ? 910  MET A HE2    1 
ATOM   9337  H HE3    . MET A 1 610 ? -73.301  17.835  7.257   0    53.2   ? 910  MET A HE3    1 
ATOM   9338  N N      . ALA A 1 611 ? -73.229  24.493  8.558   1    28.53  ? 911  ALA A N      1 
ATOM   9339  C CA     . ALA A 1 611 ? -73.073  25.49   9.633   1    26.08  ? 911  ALA A CA     1 
ATOM   9340  C C      . ALA A 1 611 ? -73.643  24.988  10.955  1    24.55  ? 911  ALA A C      1 
ATOM   9341  O O      . ALA A 1 611 ? -74.838  25.137  11.198  1    23.43  ? 911  ALA A O      1 
ATOM   9342  C CB     . ALA A 1 611 ? -73.766  26.79   9.234   1    25.14  ? 911  ALA A CB     1 
ATOM   9343  H H      . ALA A 1 611 ? -73.872  24.801  7.836   0    32.87  ? 911  ALA A H      1 
ATOM   9344  H HA     . ALA A 1 611 ? -72.015  25.706  9.772   0    29.47  ? 911  ALA A HA     1 
ATOM   9345  H HB1    . ALA A 1 611 ? -73.759  27.468  10.086  0    27.11  ? 911  ALA A HB1    1 
ATOM   9346  H HB2    . ALA A 1 611 ? -73.218  27.235  8.404   0    28.53  ? 911  ALA A HB2    1 
ATOM   9347  H HB3    . ALA A 1 611 ? -74.79   26.581  8.931   0    27.75  ? 911  ALA A HB3    1 
ATOM   9348  N N      . LEU A 1 612 ? -72.791  24.42   11.816  1    24.83  ? 912  LEU A N      1 
ATOM   9349  C CA     . LEU A 1 612 ? -73.226  23.815  13.07   1    23.98  ? 912  LEU A CA     1 
ATOM   9350  C C      . LEU A 1 612 ? -73.195  24.7    14.301  1    22.61  ? 912  LEU A C      1 
ATOM   9351  O O      . LEU A 1 612 ? -74.014  24.502  15.198  1    21.75  ? 912  LEU A O      1 
ATOM   9352  C CB     . LEU A 1 612 ? -72.344  22.599  13.357  1    25.57  ? 912  LEU A CB     1 
ATOM   9353  C CG     . LEU A 1 612 ? -72.367  21.493  12.331  1    27.85  ? 912  LEU A CG     1 
ATOM   9354  C CD1    . LEU A 1 612 ? -71.32   20.486  12.631  1    29.76  ? 912  LEU A CD1    1 
ATOM   9355  C CD2    . LEU A 1 612 ? -73.709  20.822  12.297  1    28.02  ? 912  LEU A CD2    1 
ATOM   9356  H H      . LEU A 1 612 ? -71.788  24.368  11.666  0    27.99  ? 912  LEU A H      1 
ATOM   9357  H HA     . LEU A 1 612 ? -74.251  23.465  12.959  0    26.05  ? 912  LEU A HA     1 
ATOM   9358  H HB2    . LEU A 1 612 ? -71.314  22.941  13.444  0    28.72  ? 912  LEU A HB2    1 
ATOM   9359  H HB3    . LEU A 1 612 ? -72.654  22.173  14.31   0    28.19  ? 912  LEU A HB3    1 
ATOM   9360  H HG     . LEU A 1 612 ? -72.166  21.897  11.34   0    32.07  ? 912  LEU A HG     1 
ATOM   9361  H HD11   . LEU A 1 612 ? -71.35   19.696  11.882  0    35.61  ? 912  LEU A HD11   1 
ATOM   9362  H HD12   . LEU A 1 612 ? -70.348  20.975  12.624  0    34.44  ? 912  LEU A HD12   1 
ATOM   9363  H HD13   . LEU A 1 612 ? -71.508  20.066  13.619  0    34.1   ? 912  LEU A HD13   1 
ATOM   9364  H HD21   . LEU A 1 612 ? -73.634  19.903  11.716  0    33.3   ? 912  LEU A HD21   1 
ATOM   9365  H HD22   . LEU A 1 612 ? -74.03   20.591  13.311  0    31.51  ? 912  LEU A HD22   1 
ATOM   9366  H HD23   . LEU A 1 612 ? -74.429  21.481  11.815  0    31.45  ? 912  LEU A HD23   1 
ATOM   9367  N N      . TYR A 1 613 ? -72.209  25.598  14.407  1    23.05  ? 913  TYR A N      1 
ATOM   9368  C CA     . TYR A 1 613 ? -72.018  26.407  15.617  1    22.92  ? 913  TYR A CA     1 
ATOM   9369  C C      . TYR A 1 613 ? -72.04   27.898  15.33   1    23     ? 913  TYR A C      1 
ATOM   9370  O O      . TYR A 1 613 ? -71.434  28.334  14.366  1    23.69  ? 913  TYR A O      1 
ATOM   9371  C CB     . TYR A 1 613 ? -70.68   26.029  16.285  1    24.54  ? 913  TYR A CB     1 
ATOM   9372  C CG     . TYR A 1 613 ? -70.43   24.534  16.353  1    25.04  ? 913  TYR A CG     1 
ATOM   9373  C CD1    . TYR A 1 613 ? -71.128  23.739  17.254  1    24.56  ? 913  TYR A CD1    1 
ATOM   9374  C CD2    . TYR A 1 613 ? -69.587  23.905  15.454  1    26.36  ? 913  TYR A CD2    1 
ATOM   9375  C CE1    . TYR A 1 613 ? -70.956  22.361  17.281  1    25.45  ? 913  TYR A CE1    1 
ATOM   9376  C CE2    . TYR A 1 613 ? -69.379  22.53   15.497  1    27.39  ? 913  TYR A CE2    1 
ATOM   9377  C CZ     . TYR A 1 613 ? -70.067  21.76   16.415  1    26.95  ? 913  TYR A CZ     1 
ATOM   9378  O OH     . TYR A 1 613 ? -69.898  20.398  16.477  1    28.43  ? 913  TYR A OH     1 
ATOM   9379  H H      . TYR A 1 613 ? -71.523  25.788  13.684  0    25.42  ? 913  TYR A H      1 
ATOM   9380  H HA     . TYR A 1 613 ? -72.805  26.2    16.34   0    24.34  ? 913  TYR A HA     1 
ATOM   9381  H HB2    . TYR A 1 613 ? -69.864  26.492  15.731  0    27.64  ? 913  TYR A HB2    1 
ATOM   9382  H HB3    . TYR A 1 613 ? -70.688  26.405  17.305  0    27.23  ? 913  TYR A HB3    1 
ATOM   9383  H HD1    . TYR A 1 613 ? -71.819  24.198  17.939  0    26.61  ? 913  TYR A HD1    1 
ATOM   9384  H HD2    . TYR A 1 613 ? -69.045  24.497  14.735  0    29.93  ? 913  TYR A HD2    1 
ATOM   9385  H HE1    . TYR A 1 613 ? -71.481  21.768  18.012  0    28.27  ? 913  TYR A HE1    1 
ATOM   9386  H HE2    . TYR A 1 613 ? -68.707  22.064  14.8    0    31.87  ? 913  TYR A HE2    1 
ATOM   9387  H HH     . TYR A 1 613 ? -69.061  20.121  16.02   0    33.31  ? 913  TYR A HH     1 
ATOM   9388  N N      . LEU A 1 614 ? -72.715  28.685  16.174  1    22.76  ? 914  LEU A N      1 
ATOM   9389  C CA     . LEU A 1 614 ? -72.798  30.131  15.988  1    23.45  ? 914  LEU A CA     1 
ATOM   9390  C C      . LEU A 1 614 ? -72.485  30.854  17.287  1    25.2   ? 914  LEU A C      1 
ATOM   9391  O O      . LEU A 1 614 ? -72.999  30.48   18.34   1    24.88  ? 914  LEU A O      1 
ATOM   9392  C CB     . LEU A 1 614 ? -74.215  30.543  15.548  1    21.98  ? 914  LEU A CB     1 
ATOM   9393  C CG     . LEU A 1 614 ? -74.673  30.158  14.153  1    21.1   ? 914  LEU A CG     1 
ATOM   9394  C CD1    . LEU A 1 614 ? -76.141  30.47   13.992  1    20.09  ? 914  LEU A CD1    1 
ATOM   9395  C CD2    . LEU A 1 614 ? -73.849  30.857  13.09   1    22.36  ? 914  LEU A CD2    1 
ATOM   9396  H H      . LEU A 1 614 ? -73.211  28.359  16.997  0    24.38  ? 914  LEU A H      1 
ATOM   9397  H HA     . LEU A 1 614 ? -72.083  30.463  15.237  0    26.11  ? 914  LEU A HA     1 
ATOM   9398  H HB2    . LEU A 1 614 ? -74.922  30.097  16.245  0    23.06  ? 914  LEU A HB2    1 
ATOM   9399  H HB3    . LEU A 1 614 ? -74.285  31.627  15.619  0    24.04  ? 914  LEU A HB3    1 
ATOM   9400  H HG     . LEU A 1 614 ? -74.542  29.084  14.025  0    22.02  ? 914  LEU A HG     1 
ATOM   9401  H HD11   . LEU A 1 614 ? -76.437  30.343  12.953  0    20.8   ? 914  LEU A HD11   1 
ATOM   9402  H HD12   . LEU A 1 614 ? -76.715  29.795  14.626  0    20.49  ? 914  LEU A HD12   1 
ATOM   9403  H HD13   . LEU A 1 614 ? -76.315  31.5    14.3    0    21.15  ? 914  LEU A HD13   1 
ATOM   9404  H HD21   . LEU A 1 614 ? -74.327  30.723  12.121  0    23.77  ? 914  LEU A HD21   1 
ATOM   9405  H HD22   . LEU A 1 614 ? -73.779  31.917  13.329  0    24.53  ? 914  LEU A HD22   1 
ATOM   9406  H HD23   . LEU A 1 614 ? -72.855  30.414  13.061  0    24.44  ? 914  LEU A HD23   1 
ATOM   9407  N N      . LYS A 1 615 ? -71.679  31.918  17.194  1    27.6   ? 915  LYS A N      1 
ATOM   9408  C CA     . LYS A 1 615 ? -71.326  32.81   18.307  1    30.53  ? 915  LYS A CA     1 
ATOM   9409  C C      . LYS A 1 615 ? -71.227  34.249  17.721  1    32.67  ? 915  LYS A C      1 
ATOM   9410  O O      . LYS A 1 615 ? -70.717  34.399  16.611  1    32.62  ? 915  LYS A O      1 
ATOM   9411  C CB     . LYS A 1 615 ? -69.988  32.385  18.953  1    32.98  ? 915  LYS A CB     1 
ATOM   9412  C CG     . LYS A 1 615 ? -70.043  31.036  19.661  1    31.68  ? 915  LYS A CG     1 
ATOM   9413  C CD     . LYS A 1 615 ? -70.579  31.15   21.082  1    32.3   ? 915  LYS A CD     1 
ATOM   9414  C CE     . LYS A 1 615 ? -70.801  29.8    21.741  1    31.03  ? 915  LYS A CE     1 
ATOM   9415  N NZ     . LYS A 1 615 ? -69.586  29.259  22.407  1    33.81  ? 915  LYS A NZ     1 
ATOM   9416  H H      . LYS A 1 615 ? -71.226  32.193  16.327  0    31.78  ? 915  LYS A H      1 
ATOM   9417  H HA     . LYS A 1 615 ? -72.105  32.803  19.068  0    35.41  ? 915  LYS A HA     1 
ATOM   9418  H HB2    . LYS A 1 615 ? -69.227  32.324  18.176  0    39.45  ? 915  LYS A HB2    1 
ATOM   9419  H HB3    . LYS A 1 615 ? -69.703  33.136  19.689  0    40.83  ? 915  LYS A HB3    1 
ATOM   9420  H HG2    . LYS A 1 615 ? -70.703  30.373  19.105  0    35.68  ? 915  LYS A HG2    1 
ATOM   9421  H HG3    . LYS A 1 615 ? -69.044  30.605  19.703  0    38.06  ? 915  LYS A HG3    1 
ATOM   9422  H HD2    . LYS A 1 615 ? -69.866  31.707  21.686  0    40.04  ? 915  LYS A HD2    1 
ATOM   9423  H HD3    . LYS A 1 615 ? -71.537  31.668  21.051  0    37.52  ? 915  LYS A HD3    1 
ATOM   9424  H HE2    . LYS A 1 615 ? -71.578  29.905  22.498  0    36.2   ? 915  LYS A HE2    1 
ATOM   9425  H HE3    . LYS A 1 615 ? -71.12   29.08   20.988  0    35.01  ? 915  LYS A HE3    1 
ATOM   9426  H HZ1    . LYS A 1 615 ? -69.794  28.364  22.84   0    39.9   ? 915  LYS A HZ1    1 
ATOM   9427  H HZ2    . LYS A 1 615 ? -68.845  29.13   21.725  0    40.23  ? 915  LYS A HZ2    1 
ATOM   9428  H HZ3    . LYS A 1 615 ? -69.263  29.9    23.125  0    41.85  ? 915  LYS A HZ3    1 
ATOM   9429  N N      . THR A 1 616 ? -71.755  35.288  18.417  1    34.92  ? 916  THR A N      1 
ATOM   9430  C CA     . THR A 1 616 ? -71.709  36.661  17.892  1    37.69  ? 916  THR A CA     1 
ATOM   9431  C C      . THR A 1 616 ? -71.113  37.639  18.878  1    42.94  ? 916  THR A C      1 
ATOM   9432  O O      . THR A 1 616 ? -71.221  37.452  20.088  1    44.1   ? 916  THR A O      1 
ATOM   9433  C CB     . THR A 1 616 ? -73.101  37.138  17.475  1    35.92  ? 916  THR A CB     1 
ATOM   9434  O OG1    . THR A 1 616 ? -73.923  37.272  18.632  1    36.15  ? 916  THR A OG1    1 
ATOM   9435  C CG2    . THR A 1 616 ? -73.748  36.195  16.509  1    31.67  ? 916  THR A CG2    1 
ATOM   9436  H H      . THR A 1 616 ? -72.204  35.202  19.323  0    42.16  ? 916  THR A H      1 
ATOM   9437  H HA     . THR A 1 616 ? -71.087  36.694  16.998  0    46.55  ? 916  THR A HA     1 
ATOM   9438  H HB     . THR A 1 616 ? -73.012  38.109  16.99   0    44.89  ? 916  THR A HB     1 
ATOM   9439  H HG1    . THR A 1 616 ? -74.844  37.543  18.377  0    43.19  ? 916  THR A HG1    1 
ATOM   9440  H HG21   . THR A 1 616 ? -74.577  36.671  15.989  0    37.02  ? 916  THR A HG21   1 
ATOM   9441  H HG22   . THR A 1 616 ? -73.013  35.848  15.782  0    37.35  ? 916  THR A HG22   1 
ATOM   9442  H HG23   . THR A 1 616 ? -74.121  35.333  17.058  0    36.19  ? 916  THR A HG23   1 
ATOM   9443  N N      . LYS A 1 617 ? -70.475  38.68   18.347  1    46.74  ? 917  LYS A N      1 
ATOM   9444  C CA     . LYS A 1 617 ? -69.9    39.767  19.13   1    53.02  ? 917  LYS A CA     1 
ATOM   9445  C C      . LYS A 1 617 ? -70.162  41.034  18.345  1    55.26  ? 917  LYS A C      1 
ATOM   9446  O O      . LYS A 1 617 ? -69.453  41.315  17.38   1    55.94  ? 917  LYS A O      1 
ATOM   9447  C CB     . LYS A 1 617 ? -68.387  39.577  19.369  1    55.83  ? 917  LYS A CB     1 
ATOM   9448  C CG     . LYS A 1 617 ? -67.781  40.684  20.233  1    61.64  ? 917  LYS A CG     1 
ATOM   9449  C CD     . LYS A 1 617 ? -66.36   40.395  20.702  1    63.82  ? 917  LYS A CD     1 
ATOM   9450  C CE     . LYS A 1 617 ? -65.994  41.194  21.939  1    69.02  ? 917  LYS A CE     1 
ATOM   9451  N NZ     . LYS A 1 617 ? -66.117  42.674  21.744  1    72.76  ? 917  LYS A NZ     1 
ATOM   9452  H H      . LYS A 1 617 ? -70.322  38.783  17.348  0    63.17  ? 917  LYS A H      1 
ATOM   9453  H HA     . LYS A 1 617 ? -70.392  39.846  20.098  0    74.32  ? 917  LYS A HA     1 
ATOM   9454  H HB2    . LYS A 1 617 ? -68.239  38.629  19.885  0    78.68  ? 917  LYS A HB2    1 
ATOM   9455  H HB3    . LYS A 1 617 ? -67.858  39.562  18.418  0    81.3   ? 917  LYS A HB3    1 
ATOM   9456  H HG2    . LYS A 1 617 ? -67.758  41.616  19.669  0    94.52  ? 917  LYS A HG2    1 
ATOM   9457  H HG3    . LYS A 1 617 ? -68.405  40.811  21.116  0    91.65  ? 917  LYS A HG3    1 
ATOM   9458  H HD2    . LYS A 1 617 ? -66.258  39.338  20.942  0    95.31  ? 917  LYS A HD2    1 
ATOM   9459  H HD3    . LYS A 1 617 ? -65.663  40.666  19.911  0    99.55  ? 917  LYS A HD3    1 
ATOM   9460  H HE2    . LYS A 1 617 ? -66.657  40.908  22.754  0    106.68 ? 917  LYS A HE2    1 
ATOM   9461  H HE3    . LYS A 1 617 ? -64.961  40.977  22.208  0    110.57 ? 917  LYS A HE3    1 
ATOM   9462  H HZ1    . LYS A 1 617 ? -65.665  43.158  22.513  0    120.26 ? 917  LYS A HZ1    1 
ATOM   9463  H HZ2    . LYS A 1 617 ? -65.672  42.945  20.873  0    117.9  ? 917  LYS A HZ2    1 
ATOM   9464  H HZ3    . LYS A 1 617 ? -67.094  42.948  21.716  0    115.12 ? 917  LYS A HZ3    1 
ATOM   9465  N N      . GLY A 1 618 ? -71.206  41.757  18.729  1    56.35  ? 918  GLY A N      1 
ATOM   9466  C CA     . GLY A 1 618 ? -71.589  42.975  18.034  1    58.67  ? 918  GLY A CA     1 
ATOM   9467  C C      . GLY A 1 618 ? -72.198  42.599  16.707  1    54.54  ? 918  GLY A C      1 
ATOM   9468  O O      . GLY A 1 618 ? -73.03   41.699  16.671  1    50.51  ? 918  GLY A O      1 
ATOM   9469  H H      . GLY A 1 618 ? -71.809  41.531  19.513  0    80.1   ? 918  GLY A H      1 
ATOM   9470  H HA2    . GLY A 1 618 ? -72.327  43.52   18.62   0    87.46  ? 918  GLY A HA2    1 
ATOM   9471  H HA3    . GLY A 1 618 ? -70.717  43.609  17.88   0    90.25  ? 918  GLY A HA3    1 
ATOM   9472  N N      . ASP A 1 619 ? -71.762  43.231  15.612  1    55.67  ? 919  ASP A N      1 
ATOM   9473  C CA     . ASP A 1 619 ? -72.251  42.886  14.277  1    52.32  ? 919  ASP A CA     1 
ATOM   9474  C C      . ASP A 1 619 ? -71.454  41.727  13.627  1    49.21  ? 919  ASP A C      1 
ATOM   9475  O O      . ASP A 1 619 ? -71.761  41.353  12.499  1    46.43  ? 919  ASP A O      1 
ATOM   9476  C CB     . ASP A 1 619 ? -72.272  44.131  13.366  1    54.59  ? 919  ASP A CB     1 
ATOM   9477  C CG     . ASP A 1 619 ? -73.367  45.141  13.698  1    56.54  ? 919  ASP A CG     1 
ATOM   9478  O OD1    . ASP A 1 619 ? -74.059  44.96   14.732  1    57.12  ? 919  ASP A OD1    1 
ATOM   9479  O OD2    . ASP A 1 619 ? -73.534  46.109  12.926  1    57.72  ? 919  ASP A OD2    1 
ATOM   9480  H H      . ASP A 1 619 ? -71.078  43.982  15.624  0    86.83  ? 919  ASP A H      1 
ATOM   9481  H HA     . ASP A 1 619 ? -73.284  42.554  14.361  0    75.4   ? 919  ASP A HA     1 
ATOM   9482  H HB2    . ASP A 1 619 ? -71.318  44.65   13.442  0    88.07  ? 919  ASP A HB2    1 
ATOM   9483  H HB3    . ASP A 1 619 ? -72.434  43.82   12.335  0    84.37  ? 919  ASP A HB3    1 
ATOM   9484  N N      . PHE A 1 620 ? -70.471  41.134  14.342  1    49.79  ? 920  PHE A N      1 
ATOM   9485  C CA     . PHE A 1 620 ? -69.682  40.008  13.845  1    47.15  ? 920  PHE A CA     1 
ATOM   9486  C C      . PHE A 1 620 ? -70.302  38.69   14.255  1    42.98  ? 920  PHE A C      1 
ATOM   9487  O O      . PHE A 1 620 ? -70.893  38.59   15.332  1    42.21  ? 920  PHE A O      1 
ATOM   9488  C CB     . PHE A 1 620 ? -68.251  40.067  14.382  1    49.59  ? 920  PHE A CB     1 
ATOM   9489  C CG     . PHE A 1 620 ? -67.482  41.214  13.793  1    52.67  ? 920  PHE A CG     1 
ATOM   9490  C CD1    . PHE A 1 620 ? -66.95   41.127  12.523  1    52.12  ? 920  PHE A CD1    1 
ATOM   9491  C CD2    . PHE A 1 620 ? -67.396  42.424  14.457  1    57.13  ? 920  PHE A CD2    1 
ATOM   9492  C CE1    . PHE A 1 620 ? -66.279  42.203  11.959  1    56.39  ? 920  PHE A CE1    1 
ATOM   9493  C CE2    . PHE A 1 620 ? -66.738  43.507  13.885  1    60.98  ? 920  PHE A CE2    1 
ATOM   9494  C CZ     . PHE A 1 620 ? -66.183  43.39   12.641  1    60.54  ? 920  PHE A CZ     1 
ATOM   9495  H H      . PHE A 1 620 ? -70.196  41.408  15.28   0    74.16  ? 920  PHE A H      1 
ATOM   9496  H HA     . PHE A 1 620 ? -69.639  40.033  12.757  0    69.2   ? 920  PHE A HA     1 
ATOM   9497  H HB2    . PHE A 1 620 ? -68.267  40.176  15.465  0    74.1   ? 920  PHE A HB2    1 
ATOM   9498  H HB3    . PHE A 1 620 ? -67.737  39.145  14.114  0    73     ? 920  PHE A HB3    1 
ATOM   9499  H HD1    . PHE A 1 620 ? -67.028  40.201  11.979  0    81.6   ? 920  PHE A HD1    1 
ATOM   9500  H HD2    . PHE A 1 620 ? -67.821  42.522  15.441  0    90.87  ? 920  PHE A HD2    1 
ATOM   9501  H HE1    . PHE A 1 620 ? -65.843  42.111  10.979  0    95.84  ? 920  PHE A HE1    1 
ATOM   9502  H HE2    . PHE A 1 620 ? -66.634  44.425  14.438  0    104.73 ? 920  PHE A HE2    1 
ATOM   9503  H HZ     . PHE A 1 620 ? -65.65   44.219  12.207  0    107.1  ? 920  PHE A HZ     1 
ATOM   9504  N N      . ILE A 1 621 ? -70.141  37.668  13.405  1    39.73  ? 921  ILE A N      1 
ATOM   9505  C CA     . ILE A 1 621 ? -70.674  36.33   13.63   1    35.25  ? 921  ILE A CA     1 
ATOM   9506  C C      . ILE A 1 621 ? -69.578  35.334  13.312  1    34.88  ? 921  ILE A C      1 
ATOM   9507  O O      . ILE A 1 621 ? -69.023  35.374  12.224  1    35.64  ? 921  ILE A O      1 
ATOM   9508  C CB     . ILE A 1 621 ? -71.868  36.078  12.695  1    32.2   ? 921  ILE A CB     1 
ATOM   9509  C CG1    . ILE A 1 621 ? -72.991  37.119  12.887  1    32.88  ? 921  ILE A CG1    1 
ATOM   9510  C CG2    . ILE A 1 621 ? -72.388  34.659  12.862  1    28.67  ? 921  ILE A CG2    1 
ATOM   9511  C CD1    . ILE A 1 621 ? -73.958  37.18   11.765  1    31.4   ? 921  ILE A CD1    1 
ATOM   9512  H H      . ILE A 1 621 ? -69.634  37.744  12.528  0    55.05  ? 921  ILE A H      1 
ATOM   9513  H HA     . ILE A 1 621 ? -70.999  36.2    14.661  0    43.19  ? 921  ILE A HA     1 
ATOM   9514  H HB     . ILE A 1 621 ? -71.492  36.188  11.682  0    40.45  ? 921  ILE A HB     1 
ATOM   9515  H HG12   . ILE A 1 621 ? -73.556  36.87   13.784  0    38.39  ? 921  ILE A HG12   1 
ATOM   9516  H HG13   . ILE A 1 621 ? -72.566  38.115  12.991  0    42.57  ? 921  ILE A HG13   1 
ATOM   9517  H HG21   . ILE A 1 621 ? -73.087  34.455  12.053  0    32.16  ? 921  ILE A HG21   1 
ATOM   9518  H HG22   . ILE A 1 621 ? -71.581  33.93   12.813  0    32.98  ? 921  ILE A HG22   1 
ATOM   9519  H HG23   . ILE A 1 621 ? -72.899  34.581  13.82   0    32.73  ? 921  ILE A HG23   1 
ATOM   9520  H HD11   . ILE A 1 621 ? -74.64   38.011  11.932  0    38.97  ? 921  ILE A HD11   1 
ATOM   9521  H HD12   . ILE A 1 621 ? -73.413  37.324  10.833  0    40.11  ? 921  ILE A HD12   1 
ATOM   9522  H HD13   . ILE A 1 621 ? -74.521  36.248  11.725  0    36.04  ? 921  ILE A HD13   1 
ATOM   9523  N N      . LEU A 1 622 ? -69.316  34.403  14.215  1    33.9   ? 922  LEU A N      1 
ATOM   9524  C CA     . LEU A 1 622 ? -68.318  33.359  14.022  1    33.75  ? 922  LEU A CA     1 
ATOM   9525  C C      . LEU A 1 622 ? -69.083  32.087  13.753  1    30.25  ? 922  LEU A C      1 
ATOM   9526  O O      . LEU A 1 622 ? -69.855  31.647  14.604  1    28.73  ? 922  LEU A O      1 
ATOM   9527  C CB     . LEU A 1 622 ? -67.473  33.214  15.281  1    35.94  ? 922  LEU A CB     1 
ATOM   9528  C CG     . LEU A 1 622 ? -66.388  32.166  15.255  1    36.22  ? 922  LEU A CG     1 
ATOM   9529  C CD1    . LEU A 1 622 ? -65.297  32.521  14.257  1    38.65  ? 922  LEU A CD1    1 
ATOM   9530  C CD2    . LEU A 1 622 ? -65.803  32.005  16.631  1    38.46  ? 922  LEU A CD2    1 
ATOM   9531  H H      . LEU A 1 622 ? -69.788  34.336  15.111  0    40.17  ? 922  LEU A H      1 
ATOM   9532  H HA     . LEU A 1 622 ? -67.67   33.593  13.179  0    43.62  ? 922  LEU A HA     1 
ATOM   9533  H HB2    . LEU A 1 622 ? -66.99   34.171  15.47   0    47.7   ? 922  LEU A HB2    1 
ATOM   9534  H HB3    . LEU A 1 622 ? -68.134  32.981  16.114  0    43.5   ? 922  LEU A HB3    1 
ATOM   9535  H HG     . LEU A 1 622 ? -66.804  31.201  14.969  0    44.2   ? 922  LEU A HG     1 
ATOM   9536  H HD11   . LEU A 1 622 ? -64.462  31.835  14.392  0    53.13  ? 922  LEU A HD11   1 
ATOM   9537  H HD12   . LEU A 1 622 ? -65.686  32.417  13.245  0    51.71  ? 922  LEU A HD12   1 
ATOM   9538  H HD13   . LEU A 1 622 ? -64.967  33.544  14.43   0    54.57  ? 922  LEU A HD13   1 
ATOM   9539  H HD21   . LEU A 1 622 ? -65.031  31.238  16.603  0    50.6   ? 922  LEU A HD21   1 
ATOM   9540  H HD22   . LEU A 1 622 ? -65.372  32.955  16.946  0    52.17  ? 922  LEU A HD22   1 
ATOM   9541  H HD23   . LEU A 1 622 ? -66.59   31.708  17.322  0    47.79  ? 922  LEU A HD23   1 
ATOM   9542  N N      . VAL A 1 623 ? -68.885  31.504  12.575  1    29.6   ? 923  VAL A N      1 
ATOM   9543  C CA     . VAL A 1 623 ? -69.614  30.313  12.159  1    27.43  ? 923  VAL A CA     1 
ATOM   9544  C C      . VAL A 1 623 ? -68.674  29.102  12.177  1    28.13  ? 923  VAL A C      1 
ATOM   9545  O O      . VAL A 1 623 ? -67.664  29.108  11.483  1    29.9   ? 923  VAL A O      1 
ATOM   9546  C CB     . VAL A 1 623 ? -70.231  30.505  10.747  1    27.14  ? 923  VAL A CB     1 
ATOM   9547  C CG1    . VAL A 1 623 ? -71.177  29.357  10.399  1    25.79  ? 923  VAL A CG1    1 
ATOM   9548  C CG2    . VAL A 1 623 ? -70.944  31.851  10.615  1    27.11  ? 923  VAL A CG2    1 
ATOM   9549  H H      . VAL A 1 623 ? -68.207  31.816  11.886  0    36.14  ? 923  VAL A H      1 
ATOM   9550  H HA     . VAL A 1 623 ? -70.433  30.129  12.852  0    30.38  ? 923  VAL A HA     1 
ATOM   9551  H HB     . VAL A 1 623 ? -69.428  30.491  10.012  0    31.71  ? 923  VAL A HB     1 
ATOM   9552  H HG11   . VAL A 1 623 ? -71.67   29.579  9.454   0    28.89  ? 923  VAL A HG11   1 
ATOM   9553  H HG12   . VAL A 1 623 ? -70.609  28.434  10.293  0    29.11  ? 923  VAL A HG12   1 
ATOM   9554  H HG13   . VAL A 1 623 ? -71.915  29.252  11.192  0    28.01  ? 923  VAL A HG13   1 
ATOM   9555  H HG21   . VAL A 1 623 ? -71.437  31.895  9.645   0    30.65  ? 923  VAL A HG21   1 
ATOM   9556  H HG22   . VAL A 1 623 ? -71.681  31.939  11.412  0    30.05  ? 923  VAL A HG22   1 
ATOM   9557  H HG23   . VAL A 1 623 ? -70.219  32.659  10.685  0    31.81  ? 923  VAL A HG23   1 
ATOM   9558  N N      . GLY A 1 624 ? -69.012  28.089  12.972  1    27.07  ? 924  GLY A N