data_6TT0
# 
_entry.id   6TT0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6TT0         
WWPDB D_1292106018 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6TT0 
_pdbx_database_status.recvd_initial_deposition_date   2019-12-22 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'de la Mora, E.'    1 0000-0001-6945-7357 
'Mangiatordi, G.F.' 2 0000-0003-4042-2841 
'Belviso, B.D.'     3 0000-0003-2880-1064 
'Caliandro, R.'     4 0000-0002-0368-4925 
'Colletier, J.P.'   5 0000-0003-1819-4686 
'Catto, M.'         6 0000-0002-8411-304X 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Acs Med.Chem.Lett.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1948-5875 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            11 
_citation.language                  ? 
_citation.page_first                869 
_citation.page_last                 876 
_citation.title                     
'Chiral Separation, X-ray Structure, and Biological Evaluation of a Potent and Reversible Dual Binding Site AChE Inhibitor.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acsmedchemlett.9b00656 
_citation.pdbx_database_id_PubMed   32435398 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Catto, M.'         1  ? 
primary 'Pisani, L.'        2  ? 
primary 'de la Mora, E.'    3  ? 
primary 'Belviso, B.D.'     4  ? 
primary 'Mangiatordi, G.F.' 5  ? 
primary 'Pinto, A.'         6  ? 
primary 'Palma, A.'         7  ? 
primary 'Denora, N.'        8  ? 
primary 'Caliandro, R.'     9  ? 
primary 'Colletier, J.P.'   10 ? 
primary 'Silman, I.'        11 ? 
primary 'Nicolotti, O.'     12 ? 
primary 'Altomare, C.D.'    13 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6TT0 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     111.420 
_cell.length_a_esd                 ? 
_cell.length_b                     111.420 
_cell.length_b_esd                 ? 
_cell.length_c                     137.370 
_cell.length_c_esd                 ? 
_cell.volume                       1476892.240 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6TT0 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            
;P 31 2"
;
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase 65315.594 1  3.1.1.7 ? ? 'T. californica acetylcholinesterase' 
2 non-polymer syn 
'(1~{R},3~{S})-~{N}-(6,7-dimethoxy-2-oxidanylidene-chromen-3-yl)-3-[(phenylmethyl)amino]cyclohexane-1-carboxamide' 436.500   1  ? 
? ? ?                                     
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   2  ?       ? ? ?                                     
4 water       nat water 18.015    88 ?       ? ? ?                                     
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSGSEM
WNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHGSQE
APGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAEGRR
RAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQILLGV
NKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNVICP
LMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTGNPN
EPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATETIDEAERQWKTEFHRWSSYMMHWKNQF
DHYSRHESCAEL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSGSEM
WNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHGSQE
APGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAEGRR
RAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQILLGV
NKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNVICP
LMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTGNPN
EPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATETIDEAERQWKTEFHRWSSYMMHWKNQF
DHYSRHESCAEL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   GLU n 
1 3   LEU n 
1 4   LEU n 
1 5   VAL n 
1 6   ASN n 
1 7   THR n 
1 8   LYS n 
1 9   SER n 
1 10  GLY n 
1 11  LYS n 
1 12  VAL n 
1 13  MET n 
1 14  GLY n 
1 15  THR n 
1 16  ARG n 
1 17  VAL n 
1 18  PRO n 
1 19  VAL n 
1 20  LEU n 
1 21  SER n 
1 22  SER n 
1 23  HIS n 
1 24  ILE n 
1 25  SER n 
1 26  ALA n 
1 27  PHE n 
1 28  LEU n 
1 29  GLY n 
1 30  ILE n 
1 31  PRO n 
1 32  PHE n 
1 33  ALA n 
1 34  GLU n 
1 35  PRO n 
1 36  PRO n 
1 37  VAL n 
1 38  GLY n 
1 39  ASN n 
1 40  MET n 
1 41  ARG n 
1 42  PHE n 
1 43  ARG n 
1 44  ARG n 
1 45  PRO n 
1 46  GLU n 
1 47  PRO n 
1 48  LYS n 
1 49  LYS n 
1 50  PRO n 
1 51  TRP n 
1 52  SER n 
1 53  GLY n 
1 54  VAL n 
1 55  TRP n 
1 56  ASN n 
1 57  ALA n 
1 58  SER n 
1 59  THR n 
1 60  TYR n 
1 61  PRO n 
1 62  ASN n 
1 63  ASN n 
1 64  CYS n 
1 65  GLN n 
1 66  GLN n 
1 67  TYR n 
1 68  VAL n 
1 69  ASP n 
1 70  GLU n 
1 71  GLN n 
1 72  PHE n 
1 73  PRO n 
1 74  GLY n 
1 75  PHE n 
1 76  SER n 
1 77  GLY n 
1 78  SER n 
1 79  GLU n 
1 80  MET n 
1 81  TRP n 
1 82  ASN n 
1 83  PRO n 
1 84  ASN n 
1 85  ARG n 
1 86  GLU n 
1 87  MET n 
1 88  SER n 
1 89  GLU n 
1 90  ASP n 
1 91  CYS n 
1 92  LEU n 
1 93  TYR n 
1 94  LEU n 
1 95  ASN n 
1 96  ILE n 
1 97  TRP n 
1 98  VAL n 
1 99  PRO n 
1 100 SER n 
1 101 PRO n 
1 102 ARG n 
1 103 PRO n 
1 104 LYS n 
1 105 SER n 
1 106 THR n 
1 107 THR n 
1 108 VAL n 
1 109 MET n 
1 110 VAL n 
1 111 TRP n 
1 112 ILE n 
1 113 TYR n 
1 114 GLY n 
1 115 GLY n 
1 116 GLY n 
1 117 PHE n 
1 118 TYR n 
1 119 SER n 
1 120 GLY n 
1 121 SER n 
1 122 SER n 
1 123 THR n 
1 124 LEU n 
1 125 ASP n 
1 126 VAL n 
1 127 TYR n 
1 128 ASN n 
1 129 GLY n 
1 130 LYS n 
1 131 TYR n 
1 132 LEU n 
1 133 ALA n 
1 134 TYR n 
1 135 THR n 
1 136 GLU n 
1 137 GLU n 
1 138 VAL n 
1 139 VAL n 
1 140 LEU n 
1 141 VAL n 
1 142 SER n 
1 143 LEU n 
1 144 SER n 
1 145 TYR n 
1 146 ARG n 
1 147 VAL n 
1 148 GLY n 
1 149 ALA n 
1 150 PHE n 
1 151 GLY n 
1 152 PHE n 
1 153 LEU n 
1 154 ALA n 
1 155 LEU n 
1 156 HIS n 
1 157 GLY n 
1 158 SER n 
1 159 GLN n 
1 160 GLU n 
1 161 ALA n 
1 162 PRO n 
1 163 GLY n 
1 164 ASN n 
1 165 VAL n 
1 166 GLY n 
1 167 LEU n 
1 168 LEU n 
1 169 ASP n 
1 170 GLN n 
1 171 ARG n 
1 172 MET n 
1 173 ALA n 
1 174 LEU n 
1 175 GLN n 
1 176 TRP n 
1 177 VAL n 
1 178 HIS n 
1 179 ASP n 
1 180 ASN n 
1 181 ILE n 
1 182 GLN n 
1 183 PHE n 
1 184 PHE n 
1 185 GLY n 
1 186 GLY n 
1 187 ASP n 
1 188 PRO n 
1 189 LYS n 
1 190 THR n 
1 191 VAL n 
1 192 THR n 
1 193 ILE n 
1 194 PHE n 
1 195 GLY n 
1 196 GLU n 
1 197 SER n 
1 198 ALA n 
1 199 GLY n 
1 200 GLY n 
1 201 ALA n 
1 202 SER n 
1 203 VAL n 
1 204 GLY n 
1 205 MET n 
1 206 HIS n 
1 207 ILE n 
1 208 LEU n 
1 209 SER n 
1 210 PRO n 
1 211 GLY n 
1 212 SER n 
1 213 ARG n 
1 214 ASP n 
1 215 LEU n 
1 216 PHE n 
1 217 ARG n 
1 218 ARG n 
1 219 ALA n 
1 220 ILE n 
1 221 LEU n 
1 222 GLN n 
1 223 SER n 
1 224 GLY n 
1 225 SER n 
1 226 PRO n 
1 227 ASN n 
1 228 CYS n 
1 229 PRO n 
1 230 TRP n 
1 231 ALA n 
1 232 SER n 
1 233 VAL n 
1 234 SER n 
1 235 VAL n 
1 236 ALA n 
1 237 GLU n 
1 238 GLY n 
1 239 ARG n 
1 240 ARG n 
1 241 ARG n 
1 242 ALA n 
1 243 VAL n 
1 244 GLU n 
1 245 LEU n 
1 246 GLY n 
1 247 ARG n 
1 248 ASN n 
1 249 LEU n 
1 250 ASN n 
1 251 CYS n 
1 252 ASN n 
1 253 LEU n 
1 254 ASN n 
1 255 SER n 
1 256 ASP n 
1 257 GLU n 
1 258 GLU n 
1 259 LEU n 
1 260 ILE n 
1 261 HIS n 
1 262 CYS n 
1 263 LEU n 
1 264 ARG n 
1 265 GLU n 
1 266 LYS n 
1 267 LYS n 
1 268 PRO n 
1 269 GLN n 
1 270 GLU n 
1 271 LEU n 
1 272 ILE n 
1 273 ASP n 
1 274 VAL n 
1 275 GLU n 
1 276 TRP n 
1 277 ASN n 
1 278 VAL n 
1 279 LEU n 
1 280 PRO n 
1 281 PHE n 
1 282 ASP n 
1 283 SER n 
1 284 ILE n 
1 285 PHE n 
1 286 ARG n 
1 287 PHE n 
1 288 SER n 
1 289 PHE n 
1 290 VAL n 
1 291 PRO n 
1 292 VAL n 
1 293 ILE n 
1 294 ASP n 
1 295 GLY n 
1 296 GLU n 
1 297 PHE n 
1 298 PHE n 
1 299 PRO n 
1 300 THR n 
1 301 SER n 
1 302 LEU n 
1 303 GLU n 
1 304 SER n 
1 305 MET n 
1 306 LEU n 
1 307 ASN n 
1 308 SER n 
1 309 GLY n 
1 310 ASN n 
1 311 PHE n 
1 312 LYS n 
1 313 LYS n 
1 314 THR n 
1 315 GLN n 
1 316 ILE n 
1 317 LEU n 
1 318 LEU n 
1 319 GLY n 
1 320 VAL n 
1 321 ASN n 
1 322 LYS n 
1 323 ASP n 
1 324 GLU n 
1 325 GLY n 
1 326 SER n 
1 327 PHE n 
1 328 PHE n 
1 329 LEU n 
1 330 LEU n 
1 331 TYR n 
1 332 GLY n 
1 333 ALA n 
1 334 PRO n 
1 335 GLY n 
1 336 PHE n 
1 337 SER n 
1 338 LYS n 
1 339 ASP n 
1 340 SER n 
1 341 GLU n 
1 342 SER n 
1 343 LYS n 
1 344 ILE n 
1 345 SER n 
1 346 ARG n 
1 347 GLU n 
1 348 ASP n 
1 349 PHE n 
1 350 MET n 
1 351 SER n 
1 352 GLY n 
1 353 VAL n 
1 354 LYS n 
1 355 LEU n 
1 356 SER n 
1 357 VAL n 
1 358 PRO n 
1 359 HIS n 
1 360 ALA n 
1 361 ASN n 
1 362 ASP n 
1 363 LEU n 
1 364 GLY n 
1 365 LEU n 
1 366 ASP n 
1 367 ALA n 
1 368 VAL n 
1 369 THR n 
1 370 LEU n 
1 371 GLN n 
1 372 TYR n 
1 373 THR n 
1 374 ASP n 
1 375 TRP n 
1 376 MET n 
1 377 ASP n 
1 378 ASP n 
1 379 ASN n 
1 380 ASN n 
1 381 GLY n 
1 382 ILE n 
1 383 LYS n 
1 384 ASN n 
1 385 ARG n 
1 386 ASP n 
1 387 GLY n 
1 388 LEU n 
1 389 ASP n 
1 390 ASP n 
1 391 ILE n 
1 392 VAL n 
1 393 GLY n 
1 394 ASP n 
1 395 HIS n 
1 396 ASN n 
1 397 VAL n 
1 398 ILE n 
1 399 CYS n 
1 400 PRO n 
1 401 LEU n 
1 402 MET n 
1 403 HIS n 
1 404 PHE n 
1 405 VAL n 
1 406 ASN n 
1 407 LYS n 
1 408 TYR n 
1 409 THR n 
1 410 LYS n 
1 411 PHE n 
1 412 GLY n 
1 413 ASN n 
1 414 GLY n 
1 415 THR n 
1 416 TYR n 
1 417 LEU n 
1 418 TYR n 
1 419 PHE n 
1 420 PHE n 
1 421 ASN n 
1 422 HIS n 
1 423 ARG n 
1 424 ALA n 
1 425 SER n 
1 426 ASN n 
1 427 LEU n 
1 428 VAL n 
1 429 TRP n 
1 430 PRO n 
1 431 GLU n 
1 432 TRP n 
1 433 MET n 
1 434 GLY n 
1 435 VAL n 
1 436 ILE n 
1 437 HIS n 
1 438 GLY n 
1 439 TYR n 
1 440 GLU n 
1 441 ILE n 
1 442 GLU n 
1 443 PHE n 
1 444 VAL n 
1 445 PHE n 
1 446 GLY n 
1 447 LEU n 
1 448 PRO n 
1 449 LEU n 
1 450 VAL n 
1 451 LYS n 
1 452 GLU n 
1 453 LEU n 
1 454 ASN n 
1 455 TYR n 
1 456 THR n 
1 457 ALA n 
1 458 GLU n 
1 459 GLU n 
1 460 GLU n 
1 461 ALA n 
1 462 LEU n 
1 463 SER n 
1 464 ARG n 
1 465 ARG n 
1 466 ILE n 
1 467 MET n 
1 468 HIS n 
1 469 TYR n 
1 470 TRP n 
1 471 ALA n 
1 472 THR n 
1 473 PHE n 
1 474 ALA n 
1 475 LYS n 
1 476 THR n 
1 477 GLY n 
1 478 ASN n 
1 479 PRO n 
1 480 ASN n 
1 481 GLU n 
1 482 PRO n 
1 483 HIS n 
1 484 SER n 
1 485 GLN n 
1 486 GLU n 
1 487 SER n 
1 488 LYS n 
1 489 TRP n 
1 490 PRO n 
1 491 LEU n 
1 492 PHE n 
1 493 THR n 
1 494 THR n 
1 495 LYS n 
1 496 GLU n 
1 497 GLN n 
1 498 LYS n 
1 499 PHE n 
1 500 ILE n 
1 501 ASP n 
1 502 LEU n 
1 503 ASN n 
1 504 THR n 
1 505 GLU n 
1 506 PRO n 
1 507 MET n 
1 508 LYS n 
1 509 VAL n 
1 510 HIS n 
1 511 GLN n 
1 512 ARG n 
1 513 LEU n 
1 514 ARG n 
1 515 VAL n 
1 516 GLN n 
1 517 MET n 
1 518 CYS n 
1 519 VAL n 
1 520 PHE n 
1 521 TRP n 
1 522 ASN n 
1 523 GLN n 
1 524 PHE n 
1 525 LEU n 
1 526 PRO n 
1 527 LYS n 
1 528 LEU n 
1 529 LEU n 
1 530 ASN n 
1 531 ALA n 
1 532 THR n 
1 533 GLU n 
1 534 THR n 
1 535 ILE n 
1 536 ASP n 
1 537 GLU n 
1 538 ALA n 
1 539 GLU n 
1 540 ARG n 
1 541 GLN n 
1 542 TRP n 
1 543 LYS n 
1 544 THR n 
1 545 GLU n 
1 546 PHE n 
1 547 HIS n 
1 548 ARG n 
1 549 TRP n 
1 550 SER n 
1 551 SER n 
1 552 TYR n 
1 553 MET n 
1 554 MET n 
1 555 HIS n 
1 556 TRP n 
1 557 LYS n 
1 558 ASN n 
1 559 GLN n 
1 560 PHE n 
1 561 ASP n 
1 562 HIS n 
1 563 TYR n 
1 564 SER n 
1 565 ARG n 
1 566 HIS n 
1 567 GLU n 
1 568 SER n 
1 569 CYS n 
1 570 ALA n 
1 571 GLU n 
1 572 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   572 
_entity_src_gen.gene_src_common_name               'Pacific electric ray' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ache 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Tetronarce californica' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7787 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'Pacific electric ray' 
_entity_src_gen.pdbx_host_org_scientific_name      'Tetronarce californica' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7787 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TETCF 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            P04058-2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSGSEM
WNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHGSQE
APGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAEGRR
RAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQILLGV
NKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNVICP
LMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTGNPN
EPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATETIDEAERQWKTEFHRWSSYMMHWKNQF
DHYSRHESCAEL
;
_struct_ref.pdbx_align_begin           25 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6TT0 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 572 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  25 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  596 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       4 
_struct_ref_seq.pdbx_auth_seq_align_end       575 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE ? 'C5 H11 N O2 S'  149.211 
N9T non-polymer                  . 
'(1~{R},3~{S})-~{N}-(6,7-dimethoxy-2-oxidanylidene-chromen-3-yl)-3-[(phenylmethyl)amino]cyclohexane-1-carboxamide' ? 
'C25 H28 N2 O5'  436.500 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose 
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6TT0 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.10 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         70.0 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;32% PEG 200 
100 mM MES pH 5.5
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-08-28 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.074 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.074 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            67.6781327552 
_reflns.entry_id                         6TT0 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.8 
_reflns.d_resolution_low                 39.48 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       24409 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       1.5 
_reflns.percent_possible_obs             98.1 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  1.8 
_reflns.pdbx_Rmerge_I_obs                0.04067 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.05751 
_reflns.pdbx_Rpim_I_all                  0.04067 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.998 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.8 
_reflns_shell.d_res_low                   2.9 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.57 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           4385 
_reflns_shell.percent_possible_all        98.81 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.3768 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             1.8 
_reflns_shell.pdbx_Rsym_value             0.5328 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.872 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               69.9462107358 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6TT0 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.80003021833 
_refine.ls_d_res_low                             39.4797998252 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     24321 
_refine.ls_number_reflns_R_free                  1189 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.1160238825 
_refine.ls_percent_reflns_R_free                 4.88877924427 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.190702741239 
_refine.ls_R_factor_R_free                       0.235273529519 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.188337050801 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34889918222 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2vt7 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 27.3771183945 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.395506018796 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.80003021833 
_refine_hist.d_res_low                        39.4797998252 
_refine_hist.number_atoms_solvent             88 
_refine_hist.number_atoms_total               4392 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        4244 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         60 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0313726064679  ? 4435 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.36277781983    ? 6027 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0701859922473  ? 632  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.00704724221652 ? 781  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 18.6489304747    ? 1614 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.80003021833 2.9274        . . 152 2870 98.7259065665 . . . 0.356367648559 . 0.320846141352 . . . . . . . . . 
. . 
'X-RAY DIFFRACTION' 2.9274        3.0817        . . 145 2857 98.9452867502 . . . 0.327178965308 . 0.281362307487 . . . . . . . . . 
. . 
'X-RAY DIFFRACTION' 3.0817        3.2747        . . 145 2891 98.6034426762 . . . 0.319978388111 . 0.240659008296 . . . . . . . . . 
. . 
'X-RAY DIFFRACTION' 3.2747        3.5274        . . 138 2867 98.4277759581 . . . 0.255646670453 . 0.216373671688 . . . . . . . . . 
. . 
'X-RAY DIFFRACTION' 3.5274        3.8821        . . 132 2903 98.7955729167 . . . 0.215310087741 . 0.173719937024 . . . . . . . . . 
. . 
'X-RAY DIFFRACTION' 3.8821        4.4432        . . 142 2912 98.3891752577 . . . 0.234194357839 . 0.163088895232 . . . . . . . . . 
. . 
'X-RAY DIFFRACTION' 4.4432        5.5954        . . 163 2890 97.8212111503 . . . 0.202471212783 . 0.153402008535 . . . . . . . . . 
. . 
'X-RAY DIFFRACTION' 5.5954        39.4797998252 . . 172 2942 95.4044117647 . . . 0.213384360563 . 0.177144198297 . . . . . . . . . 
. . 
# 
_struct.entry_id                     6TT0 
_struct.title                        
'Crystal structure of a potent and reversible dual binding site Acetylcholinesterase chiral inhibitor' 
_struct.pdbx_descriptor              'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6TT0 
_struct_keywords.text            
;dual binding site inhibitor, chiral separation, acetylcholinesterase, Alzheimer's disease, HYDROLASE
;
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 VAL A 37  ? ARG A 41  ? VAL A 40  ARG A 44  5 ? 5  
HELX_P HELX_P2  AA2 PHE A 75  ? MET A 80  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P3  AA3 LEU A 124 ? TYR A 127 ? LEU A 127 TYR A 130 5 ? 4  
HELX_P HELX_P4  AA4 ASN A 128 ? GLU A 137 ? ASN A 131 GLU A 140 1 ? 10 
HELX_P HELX_P5  AA5 GLY A 148 ? LEU A 153 ? GLY A 151 LEU A 156 1 ? 6  
HELX_P HELX_P6  AA6 ASN A 164 ? ILE A 181 ? ASN A 167 ILE A 184 1 ? 18 
HELX_P HELX_P7  AA7 GLN A 182 ? PHE A 184 ? GLN A 185 PHE A 187 5 ? 3  
HELX_P HELX_P8  AA8 SER A 197 ? SER A 209 ? SER A 200 SER A 212 1 ? 13 
HELX_P HELX_P9  AA9 SER A 209 ? ASP A 214 ? SER A 212 ASP A 217 1 ? 6  
HELX_P HELX_P10 AB1 SER A 234 ? LEU A 249 ? SER A 237 LEU A 252 1 ? 16 
HELX_P HELX_P11 AB2 SER A 255 ? LYS A 266 ? SER A 258 LYS A 269 1 ? 12 
HELX_P HELX_P12 AB3 LYS A 267 ? GLU A 275 ? LYS A 270 GLU A 278 1 ? 9  
HELX_P HELX_P13 AB4 TRP A 276 ? LEU A 279 ? TRP A 279 LEU A 282 5 ? 4  
HELX_P HELX_P14 AB5 SER A 301 ? SER A 308 ? SER A 304 SER A 311 1 ? 8  
HELX_P HELX_P15 AB6 GLY A 325 ? ALA A 333 ? GLY A 328 ALA A 336 1 ? 9  
HELX_P HELX_P16 AB7 SER A 345 ? VAL A 357 ? SER A 348 VAL A 360 1 ? 13 
HELX_P HELX_P17 AB8 ASN A 361 ? THR A 373 ? ASN A 364 THR A 376 1 ? 13 
HELX_P HELX_P18 AB9 ASN A 380 ? VAL A 397 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P19 AC1 VAL A 397 ? LYS A 410 ? VAL A 400 LYS A 413 1 ? 14 
HELX_P HELX_P20 AC2 PRO A 430 ? GLY A 434 ? PRO A 433 GLY A 437 5 ? 5  
HELX_P HELX_P21 AC3 GLU A 440 ? PHE A 445 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P22 AC4 GLY A 446 ? VAL A 450 ? GLY A 449 VAL A 453 5 ? 5  
HELX_P HELX_P23 AC5 THR A 456 ? GLY A 477 ? THR A 459 GLY A 480 1 ? 22 
HELX_P HELX_P24 AC6 ARG A 514 ? GLN A 523 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P25 AC7 GLN A 523 ? ALA A 531 ? GLN A 526 ALA A 534 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 251 SG  ? ? ? 1_555 A CYS 262 SG ? ? A CYS 254 A CYS 265 1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf2 disulf ?   ? A CYS 399 SG  ? ? ? 1_555 A CYS 518 SG ? ? A CYS 402 A CYS 521 1_555 ? ? ? ? ? ? ? 2.047 ? ?               
covale1 covale one ? A ASN 56  ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 59  A NAG 602 1_555 ? ? ? ? ? ? ? 1.467 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           100 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    101 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       2.75 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 4   ? THR A 7   ? LEU A 7   THR A 10  
AA1 2  GLY A 10  ? MET A 13  ? GLY A 13  MET A 16  
AA1 3  VAL A 54  ? ASN A 56  ? VAL A 57  ASN A 59  
AA2 1  THR A 15  ? VAL A 19  ? THR A 18  VAL A 22  
AA2 2  SER A 22  ? PRO A 31  ? SER A 25  PRO A 34  
AA2 3  TYR A 93  ? VAL A 98  ? TYR A 96  VAL A 101 
AA2 4  VAL A 139 ? LEU A 143 ? VAL A 142 LEU A 146 
AA2 5  THR A 106 ? ILE A 112 ? THR A 109 ILE A 115 
AA2 6  GLY A 186 ? GLU A 196 ? GLY A 189 GLU A 199 
AA2 7  ARG A 218 ? GLN A 222 ? ARG A 221 GLN A 225 
AA2 8  ILE A 316 ? ASN A 321 ? ILE A 319 ASN A 324 
AA2 9  THR A 415 ? PHE A 420 ? THR A 418 PHE A 423 
AA2 10 LYS A 498 ? LEU A 502 ? LYS A 501 LEU A 505 
AA2 11 VAL A 509 ? GLN A 511 ? VAL A 512 GLN A 514 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 5   ? N VAL A 8   O VAL A 12  ? O VAL A 15  
AA1 2  3  N MET A 13  ? N MET A 16  O TRP A 55  ? O TRP A 58  
AA2 1  2  N VAL A 17  ? N VAL A 20  O ILE A 24  ? O ILE A 27  
AA2 2  3  N PHE A 27  ? N PHE A 30  O ILE A 96  ? O ILE A 99  
AA2 3  4  N TRP A 97  ? N TRP A 100 O LEU A 140 ? O LEU A 143 
AA2 4  5  O VAL A 141 ? O VAL A 144 N TRP A 111 ? N TRP A 114 
AA2 5  6  N VAL A 110 ? N VAL A 113 O PHE A 194 ? O PHE A 197 
AA2 6  7  N GLY A 195 ? N GLY A 198 O GLN A 222 ? O GLN A 225 
AA2 7  8  N ALA A 219 ? N ALA A 222 O LEU A 317 ? O LEU A 320 
AA2 8  9  N LEU A 318 ? N LEU A 321 O TYR A 416 ? O TYR A 419 
AA2 9  10 N PHE A 419 ? N PHE A 422 O LEU A 502 ? O LEU A 505 
AA2 10 11 N PHE A 499 ? N PHE A 502 O HIS A 510 ? O HIS A 513 
# 
_atom_sites.entry_id                    6TT0 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.008975 
_atom_sites.fract_transf_matrix[1][2]   0.005182 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010363 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007280 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C ? ? 3.54356 2.42580 25.62398 1.50364  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N ? ? 4.01032 2.96436 19.97189 1.75589  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O ? ? 7.96527 ?       9.05267  ?        0.0 
;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S ? ? 9.55732 6.39887 1.23737  29.19336 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 1   ? 26.24700  64.35400 263.68400 1.000 91.45234  ? 4   SER A N   1 
ATOM   2    C CA  . SER A 1 1   ? 26.46200  63.34800 264.70300 1.000 89.83493  ? 4   SER A CA  1 
ATOM   3    C C   . SER A 1 1   ? 25.14500  62.77500 265.15200 1.000 88.49761  ? 4   SER A C   1 
ATOM   4    O O   . SER A 1 1   ? 24.11000  63.36000 264.95900 1.000 87.29109  ? 4   SER A O   1 
ATOM   5    C CB  . SER A 1 1   ? 27.19700  63.93800 265.88800 1.000 89.76616  ? 4   SER A CB  1 
ATOM   6    O OG  . SER A 1 1   ? 27.52100  62.92700 266.80900 1.000 94.97023  ? 4   SER A OG  1 
ATOM   7    N N   . GLU A 1 2   ? 25.19300  61.61800 265.79100 1.000 86.39908  ? 5   GLU A N   1 
ATOM   8    C CA  . GLU A 1 2   ? 24.00400  60.94500 266.26700 1.000 83.35660  ? 5   GLU A CA  1 
ATOM   9    C C   . GLU A 1 2   ? 23.29600  61.80900 267.24400 1.000 84.08359  ? 5   GLU A C   1 
ATOM   10   O O   . GLU A 1 2   ? 22.11200  61.87200 267.24900 1.000 84.23723  ? 5   GLU A O   1 
ATOM   11   C CB  . GLU A 1 2   ? 24.39400  59.70000 267.05600 1.000 80.10371  ? 5   GLU A CB  1 
ATOM   12   C CG  . GLU A 1 2   ? 24.35100  58.37600 266.33300 1.000 85.12061  ? 5   GLU A CG  1 
ATOM   13   C CD  . GLU A 1 2   ? 23.47100  57.35700 267.01300 1.000 89.90332  ? 5   GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 2   ? 23.85200  56.18800 267.14100 1.000 92.26794  ? 5   GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 2   ? 22.37000  57.71900 267.41200 1.000 90.03699  ? 5   GLU A OE2 1 
ATOM   16   N N   . LEU A 1 3   ? 24.03700  62.45900 268.10100 1.000 79.97178  ? 6   LEU A N   1 
ATOM   17   C CA  . LEU A 1 3   ? 23.44500  63.25600 269.13300 1.000 77.04990  ? 6   LEU A CA  1 
ATOM   18   C C   . LEU A 1 3   ? 23.17200  64.65900 268.74200 1.000 79.50920  ? 6   LEU A C   1 
ATOM   19   O O   . LEU A 1 3   ? 23.08500  65.52400 269.56400 1.000 79.81715  ? 6   LEU A O   1 
ATOM   20   C CB  . LEU A 1 3   ? 24.35500  63.27200 270.32000 1.000 82.59936  ? 6   LEU A CB  1 
ATOM   21   C CG  . LEU A 1 3   ? 24.88600  61.92700 270.69300 1.000 85.06292  ? 6   LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 3   ? 25.68700  62.14200 271.94100 1.000 78.37779  ? 6   LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 3   ? 23.73800  60.99100 270.96700 1.000 78.11977  ? 6   LEU A CD2 1 
ATOM   24   N N   . LEU A 1 4   ? 23.03700  64.90300 267.47000 1.000 79.55069  ? 7   LEU A N   1 
ATOM   25   C CA  . LEU A 1 4   ? 22.74700  66.25700 267.02300 1.000 76.04094  ? 7   LEU A CA  1 
ATOM   26   C C   . LEU A 1 4   ? 21.58100  66.19500 266.05100 1.000 74.03090  ? 7   LEU A C   1 
ATOM   27   O O   . LEU A 1 4   ? 21.60800  65.39800 265.11400 1.000 77.82248  ? 7   LEU A O   1 
ATOM   28   C CB  . LEU A 1 4   ? 23.97900  66.87700 266.37700 1.000 76.98479  ? 7   LEU A CB  1 
ATOM   29   C CG  . LEU A 1 4   ? 23.83100  68.30600 265.87600 1.000 82.69256  ? 7   LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 4   ? 23.19000  69.17900 266.94000 1.000 81.44034  ? 7   LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 4   ? 25.20000  68.84400 265.47800 1.000 81.88422  ? 7   LEU A CD2 1 
ATOM   32   N N   . VAL A 1 5   ? 20.54000  66.98900 266.29400 1.000 72.45894  ? 8   VAL A N   1 
ATOM   33   C CA  . VAL A 1 5   ? 19.29900  66.87800 265.53300 1.000 74.03642  ? 8   VAL A CA  1 
ATOM   34   C C   . VAL A 1 5   ? 18.78700  68.26500 265.17100 1.000 75.44279  ? 8   VAL A C   1 
ATOM   35   O O   . VAL A 1 5   ? 18.64300  69.13900 266.03800 1.000 71.43177  ? 8   VAL A O   1 
ATOM   36   C CB  . VAL A 1 5   ? 18.20800  66.09200 266.28500 1.000 74.45213  ? 8   VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 5   ? 16.89700  66.10900 265.48300 1.000 70.47195  ? 8   VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 5   ? 18.65200  64.67000 266.52600 1.000 72.23611  ? 8   VAL A CG2 1 
ATOM   39   N N   . ASN A 1 6   ? 18.46800  68.43900 263.89600 1.000 73.98927  ? 9   ASN A N   1 
ATOM   40   C CA  . ASN A 1 6   ? 18.05000  69.71600 263.34800 1.000 73.75253  ? 9   ASN A CA  1 
ATOM   41   C C   . ASN A 1 6   ? 16.52800  69.75700 263.35600 1.000 71.90737  ? 9   ASN A C   1 
ATOM   42   O O   . ASN A 1 6   ? 15.88400  69.25600 262.43500 1.000 81.09571  ? 9   ASN A O   1 
ATOM   43   C CB  . ASN A 1 6   ? 18.62000  69.87200 261.94600 1.000 81.85817  ? 9   ASN A CB  1 
ATOM   44   C CG  . ASN A 1 6   ? 19.32300  71.17900 261.76400 1.000 88.44672  ? 9   ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 6   ? 18.88400  72.20400 262.30300 1.000 84.24472  ? 9   ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 6   ? 20.43300  71.16300 261.00900 1.000 87.79668  ? 9   ASN A ND2 1 
ATOM   47   N N   . THR A 1 7   ? 15.95100  70.33600 264.39700 1.000 67.29932  ? 10  THR A N   1 
ATOM   48   C CA  . THR A 1 7   ? 14.50400  70.43600 264.47800 1.000 68.96237  ? 10  THR A CA  1 
ATOM   49   C C   . THR A 1 7   ? 14.04900  71.76100 263.90000 1.000 66.30262  ? 10  THR A C   1 
ATOM   50   O O   . THR A 1 7   ? 14.84400  72.67600 263.66900 1.000 66.60632  ? 10  THR A O   1 
ATOM   51   C CB  . THR A 1 7   ? 13.98700  70.31900 265.92500 1.000 72.96808  ? 10  THR A CB  1 
ATOM   52   O OG1 . THR A 1 7   ? 14.07100  71.59700 266.58500 1.000 64.43316  ? 10  THR A OG1 1 
ATOM   53   C CG2 . THR A 1 7   ? 14.75200  69.24000 266.72600 1.000 67.85687  ? 10  THR A CG2 1 
ATOM   54   N N   . LYS A 1 8   ? 12.73400  71.86100 263.69300 1.000 68.02026  ? 11  LYS A N   1 
ATOM   55   C CA  . LYS A 1 8   ? 12.13000  73.06900 263.15500 1.000 64.96778  ? 11  LYS A CA  1 
ATOM   56   C C   . LYS A 1 8   ? 12.21700  74.23900 264.12000 1.000 70.17024  ? 11  LYS A C   1 
ATOM   57   O O   . LYS A 1 8   ? 11.99600  75.37800 263.69900 1.000 71.13449  ? 11  LYS A O   1 
ATOM   58   C CB  . LYS A 1 8   ? 10.66600  72.81500 262.78900 1.000 64.76580  ? 11  LYS A CB  1 
ATOM   59   C CG  . LYS A 1 8   ? 10.40000  71.63600 261.83600 1.000 67.13629  ? 11  LYS A CG  1 
ATOM   60   C CD  . LYS A 1 8   ? 8.88700   71.46800 261.65200 1.000 69.27539  ? 11  LYS A CD  1 
ATOM   61   C CE  . LYS A 1 8   ? 8.46700   70.53900 260.52900 1.000 65.40513  ? 11  LYS A CE  1 
ATOM   62   N NZ  . LYS A 1 8   ? 6.97100   70.38100 260.53300 1.000 63.16199  ? 11  LYS A NZ  1 
ATOM   63   N N   . SER A 1 9   ? 12.52100  73.99000 265.39600 1.000 69.20834  ? 12  SER A N   1 
ATOM   64   C CA  . SER A 1 9   ? 12.71900  75.05700 266.36900 1.000 70.11139  ? 12  SER A CA  1 
ATOM   65   C C   . SER A 1 9   ? 14.18600  75.40400 266.57500 1.000 71.47137  ? 12  SER A C   1 
ATOM   66   O O   . SER A 1 9   ? 14.48600  76.40300 267.24700 1.000 66.01328  ? 12  SER A O   1 
ATOM   67   C CB  . SER A 1 9   ? 12.10100  74.67400 267.71900 1.000 69.05146  ? 12  SER A CB  1 
ATOM   68   O OG  . SER A 1 9   ? 10.71600  74.97000 267.76700 1.000 74.51226  ? 12  SER A OG  1 
ATOM   69   N N   . GLY A 1 10  ? 15.09300  74.60600 266.01600 1.000 68.20355  ? 13  GLY A N   1 
ATOM   70   C CA  . GLY A 1 10  ? 16.51700  74.83700 266.12500 1.000 64.67076  ? 13  GLY A CA  1 
ATOM   71   C C   . GLY A 1 10  ? 17.25400  73.53400 266.33700 1.000 71.77028  ? 13  GLY A C   1 
ATOM   72   O O   . GLY A 1 10  ? 16.61800  72.49700 266.55200 1.000 71.51252  ? 13  GLY A O   1 
ATOM   73   N N   . LYS A 1 11  ? 18.58300  73.55500 266.27800 1.000 72.36615  ? 14  LYS A N   1 
ATOM   74   C CA  . LYS A 1 11  ? 19.34500  72.35300 266.58200 1.000 74.01153  ? 14  LYS A CA  1 
ATOM   75   C C   . LYS A 1 11  ? 19.30100  72.06600 268.08600 1.000 74.07419  ? 14  LYS A C   1 
ATOM   76   O O   . LYS A 1 11  ? 19.13700  72.97500 268.90700 1.000 71.40507  ? 14  LYS A O   1 
ATOM   77   C CB  . LYS A 1 11  ? 20.79200  72.51000 266.10300 1.000 77.13789  ? 14  LYS A CB  1 
ATOM   78   C CG  . LYS A 1 11  ? 20.99700  72.44300 264.57900 1.000 77.93825  ? 14  LYS A CG  1 
ATOM   79   C CD  . LYS A 1 11  ? 22.39400  72.95700 264.17800 1.000 83.46190  ? 14  LYS A CD  1 
ATOM   80   C CE  . LYS A 1 11  ? 22.91800  72.33100 262.88500 1.000 84.98633  ? 14  LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 11  ? 24.39500  72.53200 262.69200 1.000 88.78382  ? 14  LYS A NZ  1 
ATOM   82   N N   . VAL A 1 12  ? 19.41100  70.78000 268.44400 1.000 73.30404  ? 15  VAL A N   1 
ATOM   83   C CA  . VAL A 1 12  ? 19.56100  70.36100 269.83600 1.000 73.41140  ? 15  VAL A CA  1 
ATOM   84   C C   . VAL A 1 12  ? 20.62500  69.27500 269.89800 1.000 76.00236  ? 15  VAL A C   1 
ATOM   85   O O   . VAL A 1 12  ? 20.74300  68.44300 268.99200 1.000 75.69707  ? 15  VAL A O   1 
ATOM   86   C CB  . VAL A 1 12  ? 18.24000  69.85400 270.48700 1.000 71.09919  ? 15  VAL A CB  1 
ATOM   87   C CG1 . VAL A 1 12  ? 17.07100  70.80700 270.22700 1.000 69.13053  ? 15  VAL A CG1 1 
ATOM   88   C CG2 . VAL A 1 12  ? 17.89700  68.44200 270.04500 1.000 67.16121  ? 15  VAL A CG2 1 
ATOM   89   N N   . MET A 1 13  ? 21.40200  69.28900 270.98500 1.000 75.29782  ? 16  MET A N   1 
ATOM   90   C CA  . MET A 1 13  ? 22.50600  68.35900 271.20500 1.000 71.65986  ? 16  MET A CA  1 
ATOM   91   C C   . MET A 1 13  ? 22.19100  67.52500 272.43900 1.000 78.71336  ? 16  MET A C   1 
ATOM   92   O O   . MET A 1 13  ? 22.18700  68.04000 273.56500 1.000 79.04612  ? 16  MET A O   1 
ATOM   93   C CB  . MET A 1 13  ? 23.83200  69.10800 271.36500 1.000 78.20209  ? 16  MET A CB  1 
ATOM   94   C CG  . MET A 1 13  ? 24.99300  68.31100 272.00100 1.000 84.22359  ? 16  MET A CG  1 
ATOM   95   S SD  . MET A 1 13  ? 25.92100  67.22000 270.88900 1.000 86.25008  ? 16  MET A SD  1 
ATOM   96   C CE  . MET A 1 13  ? 26.36500  68.37400 269.59100 1.000 80.90060  ? 16  MET A CE  1 
ATOM   97   N N   . GLY A 1 14  ? 21.92100  66.24600 272.22600 1.000 78.12864  ? 17  GLY A N   1 
ATOM   98   C CA  . GLY A 1 14  ? 21.66200  65.32000 273.30200 1.000 76.77341  ? 17  GLY A CA  1 
ATOM   99   C C   . GLY A 1 14  ? 22.92800  64.69900 273.84400 1.000 78.69608  ? 17  GLY A C   1 
ATOM   100  O O   . GLY A 1 14  ? 24.03400  65.21600 273.66900 1.000 76.72280  ? 17  GLY A O   1 
ATOM   101  N N   . THR A 1 15  ? 22.75500  63.56000 274.51400 1.000 75.32708  ? 18  THR A N   1 
ATOM   102  C CA  . THR A 1 15  ? 23.85700  62.86000 275.15100 1.000 77.17554  ? 18  THR A CA  1 
ATOM   103  C C   . THR A 1 15  ? 23.66500  61.36200 275.00400 1.000 76.42711  ? 18  THR A C   1 
ATOM   104  O O   . THR A 1 15  ? 22.54500  60.88000 274.81000 1.000 77.14017  ? 18  THR A O   1 
ATOM   105  C CB  . THR A 1 15  ? 23.98600  63.21700 276.63900 1.000 85.92115  ? 18  THR A CB  1 
ATOM   106  O OG1 . THR A 1 15  ? 24.75600  62.20500 277.30500 1.000 89.70891  ? 18  THR A OG1 1 
ATOM   107  C CG2 . THR A 1 15  ? 22.61300  63.32000 277.29300 1.000 85.11777  ? 18  THR A CG2 1 
ATOM   108  N N   . ARG A 1 16  ? 24.77500  60.63000 275.09400 1.000 75.57215  ? 19  ARG A N   1 
ATOM   109  C CA  . ARG A 1 16  ? 24.75100  59.17700 275.01100 1.000 78.23226  ? 19  ARG A CA  1 
ATOM   110  C C   . ARG A 1 16  ? 24.62200  58.61000 276.41800 1.000 81.76675  ? 19  ARG A C   1 
ATOM   111  O O   . ARG A 1 16  ? 25.41800  58.94000 277.30400 1.000 80.48066  ? 19  ARG A O   1 
ATOM   112  C CB  . ARG A 1 16  ? 26.01100  58.64500 274.31900 1.000 78.96019  ? 19  ARG A CB  1 
ATOM   113  C CG  . ARG A 1 16  ? 26.01500  57.12900 274.11400 1.000 86.78009  ? 19  ARG A CG  1 
ATOM   114  C CD  . ARG A 1 16  ? 27.18800  56.66400 273.24800 1.000 94.19648  ? 19  ARG A CD  1 
ATOM   115  N NE  . ARG A 1 16  ? 27.10700  55.24100 272.89400 1.000 99.93321  ? 19  ARG A NE  1 
ATOM   116  C CZ  . ARG A 1 16  ? 26.40600  54.75200 271.86600 1.000 98.33589  ? 19  ARG A CZ  1 
ATOM   117  N NH1 . ARG A 1 16  ? 25.70600  55.57000 271.08400 1.000 94.76002  ? 19  ARG A NH1 1 
ATOM   118  N NH2 . ARG A 1 16  ? 26.39400  53.44000 271.62100 1.000 91.41886  ? 19  ARG A NH2 1 
ATOM   119  N N   . VAL A 1 17  ? 23.61100  57.77200 276.62800 1.000 80.37847  ? 20  VAL A N   1 
ATOM   120  C CA  . VAL A 1 17  ? 23.35200  57.22500 277.95500 1.000 77.21418  ? 20  VAL A CA  1 
ATOM   121  C C   . VAL A 1 17  ? 23.44700  55.70500 277.91300 1.000 77.36532  ? 20  VAL A C   1 
ATOM   122  O O   . VAL A 1 17  ? 23.04300  55.08100 276.92400 1.000 76.86972  ? 20  VAL A O   1 
ATOM   123  C CB  . VAL A 1 17  ? 21.98600  57.67700 278.49600 1.000 76.92232  ? 20  VAL A CB  1 
ATOM   124  C CG1 . VAL A 1 17  ? 21.87100  59.19100 278.43100 1.000 78.29191  ? 20  VAL A CG1 1 
ATOM   125  C CG2 . VAL A 1 17  ? 20.85400  57.01000 277.73900 1.000 77.68861  ? 20  VAL A CG2 1 
ATOM   126  N N   . PRO A 1 18  ? 23.97600  55.07400 278.95600 1.000 79.96409  ? 21  PRO A N   1 
ATOM   127  C CA  . PRO A 1 18  ? 24.01300  53.61200 278.99000 1.000 81.14577  ? 21  PRO A CA  1 
ATOM   128  C C   . PRO A 1 18  ? 22.69600  53.04400 279.48900 1.000 79.00788  ? 21  PRO A C   1 
ATOM   129  O O   . PRO A 1 18  ? 21.94600  53.69000 280.22600 1.000 77.86014  ? 21  PRO A O   1 
ATOM   130  C CB  . PRO A 1 18  ? 25.15400  53.32100 279.96800 1.000 73.16279  ? 21  PRO A CB  1 
ATOM   131  C CG  . PRO A 1 18  ? 25.09400  54.46500 280.90000 1.000 73.12473  ? 21  PRO A CG  1 
ATOM   132  C CD  . PRO A 1 18  ? 24.61700  55.66600 280.14200 1.000 71.35344  ? 21  PRO A CD  1 
ATOM   133  N N   . VAL A 1 19  ? 22.41200  51.81900 279.05700 1.000 76.92552  ? 22  VAL A N   1 
ATOM   134  C CA  . VAL A 1 19  ? 21.19000  51.14600 279.46900 1.000 80.55254  ? 22  VAL A CA  1 
ATOM   135  C C   . VAL A 1 19  ? 21.36200  49.64600 279.29000 1.000 84.59690  ? 22  VAL A C   1 
ATOM   136  O O   . VAL A 1 19  ? 21.36900  49.13800 278.16200 1.000 80.84041  ? 22  VAL A O   1 
ATOM   137  C CB  . VAL A 1 19  ? 19.97400  51.68200 278.69100 1.000 78.56284  ? 22  VAL A CB  1 
ATOM   138  C CG1 . VAL A 1 19  ? 20.30800  51.88000 277.22800 1.000 75.76871  ? 22  VAL A CG1 1 
ATOM   139  C CG2 . VAL A 1 19  ? 18.78500  50.75400 278.86400 1.000 82.62725  ? 22  VAL A CG2 1 
ATOM   140  N N   . LEU A 1 20  ? 21.51900  48.93400 280.40600 1.000 85.41164  ? 23  LEU A N   1 
ATOM   141  C CA  . LEU A 1 20  ? 21.69600  47.48200 280.41300 1.000 87.89355  ? 23  LEU A CA  1 
ATOM   142  C C   . LEU A 1 20  ? 22.86300  47.06700 279.51100 1.000 91.89488  ? 23  LEU A C   1 
ATOM   143  O O   . LEU A 1 20  ? 22.69000  46.40000 278.48700 1.000 91.34417  ? 23  LEU A O   1 
ATOM   144  C CB  . LEU A 1 20  ? 20.40400  46.76900 279.99300 1.000 87.81054  ? 23  LEU A CB  1 
ATOM   145  C CG  . LEU A 1 20  ? 19.06600  47.31700 280.49300 1.000 85.46294  ? 23  LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 20  ? 17.92100  46.45000 279.98800 1.000 77.05943  ? 23  LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 20  ? 19.05700  47.42300 282.02300 1.000 87.63630  ? 23  LEU A CD2 1 
ATOM   148  N N   . SER A 1 21  ? 24.06400  47.50200 279.89600 1.000 90.38446  ? 24  SER A N   1 
ATOM   149  C CA  . SER A 1 21  ? 25.32800  47.12900 279.26200 1.000 93.03700  ? 24  SER A CA  1 
ATOM   150  C C   . SER A 1 21  ? 25.40800  47.49600 277.77400 1.000 90.78548  ? 24  SER A C   1 
ATOM   151  O O   . SER A 1 21  ? 26.31800  47.02700 277.07300 1.000 89.43305  ? 24  SER A O   1 
ATOM   152  C CB  . SER A 1 21  ? 25.62300  45.63200 279.44800 1.000 94.97355  ? 24  SER A CB  1 
ATOM   153  O OG  . SER A 1 21  ? 24.75500  44.81900 278.67500 1.000 94.15592  ? 24  SER A OG  1 
ATOM   154  N N   . SER A 1 22  ? 24.48400  48.32200 277.27100 1.000 89.59066  ? 25  SER A N   1 
ATOM   155  C CA  . SER A 1 22  ? 24.57300  48.90600 275.93300 1.000 90.38127  ? 25  SER A CA  1 
ATOM   156  C C   . SER A 1 22  ? 24.36600  50.41500 276.03400 1.000 88.97647  ? 25  SER A C   1 
ATOM   157  O O   . SER A 1 22  ? 24.43400  50.96600 277.13900 1.000 86.22922  ? 25  SER A O   1 
ATOM   158  C CB  . SER A 1 22  ? 23.55200  48.27700 274.98400 1.000 85.45650  ? 25  SER A CB  1 
ATOM   159  O OG  . SER A 1 22  ? 23.40500  49.07100 273.82200 1.000 87.56216  ? 25  SER A OG  1 
ATOM   160  N N   . HIS A 1 23  ? 24.11800  51.10200 274.91500 1.000 79.57779  ? 26  HIS A N   1 
ATOM   161  C CA  . HIS A 1 23  ? 23.95400  52.55100 274.96300 1.000 84.45140  ? 26  HIS A CA  1 
ATOM   162  C C   . HIS A 1 23  ? 22.86600  52.98800 273.99000 1.000 85.23576  ? 26  HIS A C   1 
ATOM   163  O O   . HIS A 1 23  ? 22.66500  52.36200 272.94800 1.000 86.79162  ? 26  HIS A O   1 
ATOM   164  C CB  . HIS A 1 23  ? 25.25700  53.31100 274.61700 1.000 87.97704  ? 26  HIS A CB  1 
ATOM   165  C CG  . HIS A 1 23  ? 26.47900  52.86000 275.37200 1.000 97.35464  ? 26  HIS A CG  1 
ATOM   166  N ND1 . HIS A 1 23  ? 26.64700  53.06500 276.73000 1.000 93.74256  ? 26  HIS A ND1 1 
ATOM   167  C CD2 . HIS A 1 23  ? 27.62000  52.26100 274.94300 1.000 101.02067 ? 26  HIS A CD2 1 
ATOM   168  C CE1 . HIS A 1 23  ? 27.82200  52.58800 277.10800 1.000 90.71825  ? 26  HIS A CE1 1 
ATOM   169  N NE2 . HIS A 1 23  ? 28.43300  52.09500 276.04300 1.000 107.68060 ? 26  HIS A NE2 1 
ATOM   170  N N   . ILE A 1 24  ? 22.16100  54.07500 274.33900 1.000 79.82502  ? 27  ILE A N   1 
ATOM   171  C CA  . ILE A 1 24  ? 21.29600  54.78900 273.39700 1.000 74.96901  ? 27  ILE A CA  1 
ATOM   172  C C   . ILE A 1 24  ? 21.40200  56.29200 273.62900 1.000 74.30480  ? 27  ILE A C   1 
ATOM   173  O O   . ILE A 1 24  ? 22.25500  56.76300 274.39000 1.000 75.84725  ? 27  ILE A O   1 
ATOM   174  C CB  . ILE A 1 24  ? 19.81900  54.35500 273.47600 1.000 74.94647  ? 27  ILE A CB  1 
ATOM   175  C CG1 . ILE A 1 24  ? 19.15700  54.87500 274.74300 1.000 79.76429  ? 27  ILE A CG1 1 
ATOM   176  C CG2 . ILE A 1 24  ? 19.66000  52.84200 273.37300 1.000 79.65171  ? 27  ILE A CG2 1 
ATOM   177  C CD1 . ILE A 1 24  ? 17.69800  54.47900 274.83300 1.000 82.76748  ? 27  ILE A CD1 1 
ATOM   178  N N   . SER A 1 25  ? 20.53900  57.05700 272.96500 1.000 74.06193  ? 28  SER A N   1 
ATOM   179  C CA  . SER A 1 25  ? 20.63000  58.51000 272.93200 1.000 76.12687  ? 28  SER A CA  1 
ATOM   180  C C   . SER A 1 25  ? 19.47700  59.14100 273.69600 1.000 73.77795  ? 28  SER A C   1 
ATOM   181  O O   . SER A 1 25  ? 18.38200  58.57600 273.78600 1.000 76.40645  ? 28  SER A O   1 
ATOM   182  C CB  . SER A 1 25  ? 20.62700  59.03700 271.49000 1.000 72.60809  ? 28  SER A CB  1 
ATOM   183  O OG  . SER A 1 25  ? 21.81500  58.66500 270.82300 1.000 77.04839  ? 28  SER A OG  1 
ATOM   184  N N   . ALA A 1 26  ? 19.71900  60.33500 274.21600 1.000 62.92814  ? 29  ALA A N   1 
ATOM   185  C CA  . ALA A 1 26  ? 18.71000  61.02200 274.99600 1.000 68.69308  ? 29  ALA A CA  1 
ATOM   186  C C   . ALA A 1 26  ? 18.78900  62.51500 274.73800 1.000 68.52628  ? 29  ALA A C   1 
ATOM   187  O O   . ALA A 1 26  ? 19.88000  63.08700 274.68100 1.000 68.78819  ? 29  ALA A O   1 
ATOM   188  C CB  . ALA A 1 26  ? 18.87300  60.73200 276.49900 1.000 73.53530  ? 29  ALA A CB  1 
ATOM   189  N N   . PHE A 1 27  ? 17.62300  63.13700 274.59500 1.000 67.49105  ? 30  PHE A N   1 
ATOM   190  C CA  . PHE A 1 27  ? 17.49300  64.57900 274.39500 1.000 67.61732  ? 30  PHE A CA  1 
ATOM   191  C C   . PHE A 1 27  ? 16.56500  65.05700 275.49800 1.000 67.99170  ? 30  PHE A C   1 
ATOM   192  O O   . PHE A 1 27  ? 15.34400  64.90200 275.40400 1.000 67.27701  ? 30  PHE A O   1 
ATOM   193  C CB  . PHE A 1 27  ? 16.95500  64.91500 272.99700 1.000 71.50587  ? 30  PHE A CB  1 
ATOM   194  C CG  . PHE A 1 27  ? 17.81000  64.37300 271.88300 1.000 70.03149  ? 30  PHE A CG  1 
ATOM   195  C CD1 . PHE A 1 27  ? 17.67500  63.05500 271.46700 1.000 65.58452  ? 30  PHE A CD1 1 
ATOM   196  C CD2 . PHE A 1 27  ? 18.77900  65.16300 271.29500 1.000 68.84818  ? 30  PHE A CD2 1 
ATOM   197  C CE1 . PHE A 1 27  ? 18.47700  62.54800 270.49000 1.000 65.68683  ? 30  PHE A CE1 1 
ATOM   198  C CE2 . PHE A 1 27  ? 19.57100  64.66500 270.31000 1.000 72.12286  ? 30  PHE A CE2 1 
ATOM   199  C CZ  . PHE A 1 27  ? 19.42200  63.35400 269.90500 1.000 74.19576  ? 30  PHE A CZ  1 
ATOM   200  N N   . LEU A 1 28  ? 17.15200  65.62100 276.54200 1.000 71.48788  ? 31  LEU A N   1 
ATOM   201  C CA  . LEU A 1 28  ? 16.44000  65.94500 277.76500 1.000 63.38267  ? 31  LEU A CA  1 
ATOM   202  C C   . LEU A 1 28  ? 16.18700  67.44100 277.84900 1.000 66.52841  ? 31  LEU A C   1 
ATOM   203  O O   . LEU A 1 28  ? 17.02500  68.25000 277.44500 1.000 70.59832  ? 31  LEU A O   1 
ATOM   204  C CB  . LEU A 1 28  ? 17.24500  65.48600 278.97300 1.000 66.23194  ? 31  LEU A CB  1 
ATOM   205  C CG  . LEU A 1 28  ? 17.73100  64.04500 278.91800 1.000 67.39938  ? 31  LEU A CG  1 
ATOM   206  C CD1 . LEU A 1 28  ? 18.51200  63.71800 280.18000 1.000 63.58054  ? 31  LEU A CD1 1 
ATOM   207  C CD2 . LEU A 1 28  ? 16.55000  63.10200 278.73800 1.000 68.93685  ? 31  LEU A CD2 1 
ATOM   208  N N   . GLY A 1 29  ? 15.02700  67.80400 278.38200 1.000 66.45836  ? 32  GLY A N   1 
ATOM   209  C CA  . GLY A 1 29  ? 14.74000  69.20600 278.62600 1.000 63.89375  ? 32  GLY A CA  1 
ATOM   210  C C   . GLY A 1 29  ? 14.71400  70.06200 277.38000 1.000 69.38880  ? 32  GLY A C   1 
ATOM   211  O O   . GLY A 1 29  ? 15.25500  71.17400 277.38900 1.000 69.35566  ? 32  GLY A O   1 
ATOM   212  N N   . ILE A 1 30  ? 14.10900  69.56300 276.30500 1.000 66.36452  ? 33  ILE A N   1 
ATOM   213  C CA  . ILE A 1 30  ? 13.86800  70.37300 275.10700 1.000 67.08414  ? 33  ILE A CA  1 
ATOM   214  C C   . ILE A 1 30  ? 12.63500  71.24400 275.34800 1.000 67.27117  ? 33  ILE A C   1 
ATOM   215  O O   . ILE A 1 30  ? 11.58500  70.71600 275.74600 1.000 62.21545  ? 33  ILE A O   1 
ATOM   216  C CB  . ILE A 1 30  ? 13.67300  69.48000 273.88300 1.000 65.06970  ? 33  ILE A CB  1 
ATOM   217  C CG1 . ILE A 1 30  ? 14.89900  68.60700 273.62400 1.000 65.68688  ? 33  ILE A CG1 1 
ATOM   218  C CG2 . ILE A 1 30  ? 13.35100  70.30800 272.66400 1.000 58.93684  ? 33  ILE A CG2 1 
ATOM   219  C CD1 . ILE A 1 30  ? 14.59300  67.44400 272.68400 1.000 60.57356  ? 33  ILE A CD1 1 
ATOM   220  N N   . PRO A 1 31  ? 12.71400  72.55800 275.12300 1.000 66.16928  ? 34  PRO A N   1 
ATOM   221  C CA  . PRO A 1 31  ? 11.52400  73.39800 275.28500 1.000 63.71404  ? 34  PRO A CA  1 
ATOM   222  C C   . PRO A 1 31  ? 10.51800  73.17900 274.17000 1.000 65.71691  ? 34  PRO A C   1 
ATOM   223  O O   . PRO A 1 31  ? 10.87700  72.93900 273.01500 1.000 68.56798  ? 34  PRO A O   1 
ATOM   224  C CB  . PRO A 1 31  ? 12.08700  74.82100 275.24500 1.000 67.91039  ? 34  PRO A CB  1 
ATOM   225  C CG  . PRO A 1 31  ? 13.32700  74.70900 274.45900 1.000 66.90471  ? 34  PRO A CG  1 
ATOM   226  C CD  . PRO A 1 31  ? 13.91000  73.36300 274.82500 1.000 68.02393  ? 34  PRO A CD  1 
ATOM   227  N N   . PHE A 1 32  ? 9.24300   73.26900 274.52900 1.000 67.70388  ? 35  PHE A N   1 
ATOM   228  C CA  . PHE A 1 32  ? 8.16500   73.26000 273.56000 1.000 59.69673  ? 35  PHE A CA  1 
ATOM   229  C C   . PHE A 1 32  ? 7.21500   74.42600 273.77100 1.000 66.85609  ? 35  PHE A C   1 
ATOM   230  O O   . PHE A 1 32  ? 6.29000   74.60900 272.97200 1.000 68.70452  ? 35  PHE A O   1 
ATOM   231  C CB  . PHE A 1 32  ? 7.39600   71.92800 273.61000 1.000 58.53119  ? 35  PHE A CB  1 
ATOM   232  C CG  . PHE A 1 32  ? 6.73200   71.65300 274.92500 1.000 64.83681  ? 35  PHE A CG  1 
ATOM   233  C CD1 . PHE A 1 32  ? 5.45100   72.10500 275.17500 1.000 64.36695  ? 35  PHE A CD1 1 
ATOM   234  C CD2 . PHE A 1 32  ? 7.38500   70.93700 275.91300 1.000 67.88883  ? 35  PHE A CD2 1 
ATOM   235  C CE1 . PHE A 1 32  ? 4.83400   71.85700 276.38800 1.000 65.21764  ? 35  PHE A CE1 1 
ATOM   236  C CE2 . PHE A 1 32  ? 6.77000   70.68200 277.13000 1.000 66.26597  ? 35  PHE A CE2 1 
ATOM   237  C CZ  . PHE A 1 32  ? 5.49400   71.13900 277.36800 1.000 66.84029  ? 35  PHE A CZ  1 
ATOM   238  N N   . ALA A 1 33  ? 7.42300   75.22800 274.81000 1.000 66.58742  ? 36  ALA A N   1 
ATOM   239  C CA  . ALA A 1 33  ? 6.59800   76.39800 275.04300 1.000 65.62401  ? 36  ALA A CA  1 
ATOM   240  C C   . ALA A 1 33  ? 7.47900   77.52400 275.55000 1.000 67.63827  ? 36  ALA A C   1 
ATOM   241  O O   . ALA A 1 33  ? 8.59300   77.29900 276.02700 1.000 68.25145  ? 36  ALA A O   1 
ATOM   242  C CB  . ALA A 1 33  ? 5.47800   76.11300 276.04700 1.000 68.32701  ? 36  ALA A CB  1 
ATOM   243  N N   . GLU A 1 34  ? 6.97100   78.74500 275.41900 1.000 72.28037  ? 37  GLU A N   1 
ATOM   244  C CA  . GLU A 1 34  ? 7.57600   79.86800 276.11700 1.000 76.26805  ? 37  GLU A CA  1 
ATOM   245  C C   . GLU A 1 34  ? 7.39100   79.68500 277.62200 1.000 73.06762  ? 37  GLU A C   1 
ATOM   246  O O   . GLU A 1 34  ? 6.32700   79.23700 278.06000 1.000 71.04188  ? 37  GLU A O   1 
ATOM   247  C CB  . GLU A 1 34  ? 6.95100   81.19200 275.66800 1.000 76.85034  ? 37  GLU A CB  1 
ATOM   248  C CG  . GLU A 1 34  ? 7.48500   81.70300 274.33400 1.000 80.96667  ? 37  GLU A CG  1 
ATOM   249  C CD  . GLU A 1 34  ? 8.97000   82.06700 274.40000 1.000 85.67790  ? 37  GLU A CD  1 
ATOM   250  O OE1 . GLU A 1 34  ? 9.30000   83.09200 275.04700 1.000 84.33535  ? 37  GLU A OE1 1 
ATOM   251  O OE2 . GLU A 1 34  ? 9.80200   81.32200 273.82100 1.000 79.66769  ? 37  GLU A OE2 1 
ATOM   252  N N   . PRO A 1 35  ? 8.41200   79.98300 278.42600 1.000 76.78156  ? 38  PRO A N   1 
ATOM   253  C CA  . PRO A 1 35  ? 8.26500   79.91900 279.89300 1.000 73.52044  ? 38  PRO A CA  1 
ATOM   254  C C   . PRO A 1 35  ? 7.07800   80.73700 280.36400 1.000 73.10313  ? 38  PRO A C   1 
ATOM   255  O O   . PRO A 1 35  ? 7.00600   81.95000 280.10900 1.000 75.97726  ? 38  PRO A O   1 
ATOM   256  C CB  . PRO A 1 35  ? 9.58800   80.50600 280.40000 1.000 68.23006  ? 38  PRO A CB  1 
ATOM   257  C CG  . PRO A 1 35  ? 10.56100  80.12100 279.34100 1.000 77.26468  ? 38  PRO A CG  1 
ATOM   258  C CD  . PRO A 1 35  ? 9.80700   80.23600 278.03000 1.000 75.95268  ? 38  PRO A CD  1 
ATOM   259  N N   . PRO A 1 36  ? 6.10600   80.09700 281.03100 1.000 69.51586  ? 39  PRO A N   1 
ATOM   260  C CA  . PRO A 1 36  ? 4.84300   80.76200 281.42600 1.000 73.23938  ? 39  PRO A CA  1 
ATOM   261  C C   . PRO A 1 36  ? 4.95200   81.46300 282.77700 1.000 77.59310  ? 39  PRO A C   1 
ATOM   262  O O   . PRO A 1 36  ? 4.33800   81.08000 283.79500 1.000 78.14322  ? 39  PRO A O   1 
ATOM   263  C CB  . PRO A 1 36  ? 3.85600   79.59400 281.44200 1.000 72.71130  ? 39  PRO A CB  1 
ATOM   264  C CG  . PRO A 1 36  ? 4.67700   78.44300 281.84200 1.000 69.75932  ? 39  PRO A CG  1 
ATOM   265  C CD  . PRO A 1 36  ? 6.05600   78.64700 281.27000 1.000 69.99952  ? 39  PRO A CD  1 
ATOM   266  N N   . VAL A 1 37  ? 5.73900   82.53200 282.78300 1.000 77.19808  ? 40  VAL A N   1 
ATOM   267  C CA  . VAL A 1 37  ? 6.06300   83.26600 283.99000 1.000 72.72072  ? 40  VAL A CA  1 
ATOM   268  C C   . VAL A 1 37  ? 5.45000   84.66200 283.90600 1.000 75.70272  ? 40  VAL A C   1 
ATOM   269  O O   . VAL A 1 37  ? 4.85400   85.04300 282.89700 1.000 77.32162  ? 40  VAL A O   1 
ATOM   270  C CB  . VAL A 1 37  ? 7.58000   83.32300 284.21200 1.000 71.53925  ? 40  VAL A CB  1 
ATOM   271  C CG1 . VAL A 1 37  ? 8.11500   81.92200 284.42700 1.000 75.93311  ? 40  VAL A CG1 1 
ATOM   272  C CG2 . VAL A 1 37  ? 8.25400   83.95400 283.01000 1.000 64.54910  ? 40  VAL A CG2 1 
ATOM   273  N N   . GLY A 1 38  ? 5.59400   85.42100 284.99600 1.000 73.95674  ? 41  GLY A N   1 
ATOM   274  C CA  . GLY A 1 38  ? 5.07900   86.77100 285.09900 1.000 70.58668  ? 41  GLY A CA  1 
ATOM   275  C C   . GLY A 1 38  ? 3.64400   86.92800 284.64700 1.000 76.93843  ? 41  GLY A C   1 
ATOM   276  O O   . GLY A 1 38  ? 2.73600   86.27200 285.16700 1.000 78.85229  ? 41  GLY A O   1 
ATOM   277  N N   . ASN A 1 39  ? 3.42700   87.79700 283.65800 1.000 80.03992  ? 42  ASN A N   1 
ATOM   278  C CA  . ASN A 1 39  ? 2.09000   87.99400 283.11400 1.000 83.99995  ? 42  ASN A CA  1 
ATOM   279  C C   . ASN A 1 39  ? 1.54200   86.75600 282.41800 1.000 80.15150  ? 42  ASN A C   1 
ATOM   280  O O   . ASN A 1 39  ? 0.34100   86.71000 282.13100 1.000 79.30710  ? 42  ASN A O   1 
ATOM   281  C CB  . ASN A 1 39  ? 2.09400   89.17300 282.14100 1.000 87.98775  ? 42  ASN A CB  1 
ATOM   282  C CG  . ASN A 1 39  ? 1.35900   90.37600 282.69300 1.000 96.33618  ? 42  ASN A CG  1 
ATOM   283  O OD1 . ASN A 1 39  ? 1.28700   90.57100 283.91700 1.000 95.57838  ? 42  ASN A OD1 1 
ATOM   284  N ND2 . ASN A 1 39  ? 0.78600   91.18300 281.79600 1.000 97.22678  ? 42  ASN A ND2 1 
ATOM   285  N N   . MET A 1 40  ? 2.37900   85.76100 282.14000 1.000 74.96848  ? 43  MET A N   1 
ATOM   286  C CA  . MET A 1 40  ? 1.90600   84.56600 281.46600 1.000 78.73880  ? 43  MET A CA  1 
ATOM   287  C C   . MET A 1 40  ? 1.41400   83.49200 282.42100 1.000 79.01011  ? 43  MET A C   1 
ATOM   288  O O   . MET A 1 40  ? 0.74600   82.55500 281.96800 1.000 79.80025  ? 43  MET A O   1 
ATOM   289  C CB  . MET A 1 40  ? 3.00300   83.99100 280.56800 1.000 81.44202  ? 43  MET A CB  1 
ATOM   290  C CG  . MET A 1 40  ? 3.27900   84.86800 279.37400 1.000 83.04627  ? 43  MET A CG  1 
ATOM   291  S SD  . MET A 1 40  ? 4.22200   84.04900 278.08900 1.000 89.65267  ? 43  MET A SD  1 
ATOM   292  C CE  . MET A 1 40  ? 4.14800   85.34000 276.85700 1.000 98.48824  ? 43  MET A CE  1 
ATOM   293  N N   . ARG A 1 41  ? 1.63000   83.67000 283.70300 1.000 80.96593  ? 44  ARG A N   1 
ATOM   294  C CA  . ARG A 1 41  ? 1.16600   82.71100 284.65700 1.000 76.81839  ? 44  ARG A CA  1 
ATOM   295  C C   . ARG A 1 41  ? -0.31200  82.66500 284.53700 1.000 77.09666  ? 44  ARG A C   1 
ATOM   296  O O   . ARG A 1 41  ? -0.94200  83.66700 284.49000 1.000 78.31342  ? 44  ARG A O   1 
ATOM   297  C CB  . ARG A 1 41  ? 1.55700   83.18000 286.04000 1.000 76.02365  ? 44  ARG A CB  1 
ATOM   298  C CG  . ARG A 1 41  ? 1.03600   82.35800 287.18000 1.000 76.13512  ? 44  ARG A CG  1 
ATOM   299  C CD  . ARG A 1 41  ? 1.23100   83.06600 288.49000 1.000 72.09038  ? 44  ARG A CD  1 
ATOM   300  N NE  . ARG A 1 41  ? 2.53800   82.82800 289.03400 1.000 71.60806  ? 44  ARG A NE  1 
ATOM   301  C CZ  . ARG A 1 41  ? 2.88800   83.17200 290.25100 1.000 73.39964  ? 44  ARG A CZ  1 
ATOM   302  N NH1 . ARG A 1 41  ? 2.03500   83.76800 291.03200 1.000 70.14557  ? 44  ARG A NH1 1 
ATOM   303  N NH2 . ARG A 1 41  ? 4.08700   82.93400 290.67700 1.000 68.90310  ? 44  ARG A NH2 1 
ATOM   304  N N   . PHE A 1 42  ? -0.84800  81.46900 284.47400 1.000 76.39415  ? 45  PHE A N   1 
ATOM   305  C CA  . PHE A 1 42  ? -2.26700  81.20300 284.36400 1.000 75.71271  ? 45  PHE A CA  1 
ATOM   306  C C   . PHE A 1 42  ? -2.75500  81.33800 282.95900 1.000 75.35107  ? 45  PHE A C   1 
ATOM   307  O O   . PHE A 1 42  ? -3.89000  81.09100 282.69700 1.000 74.59555  ? 45  PHE A O   1 
ATOM   308  C CB  . PHE A 1 42  ? -3.08200  82.17300 285.18300 1.000 76.63155  ? 45  PHE A CB  1 
ATOM   309  C CG  . PHE A 1 42  ? -2.82700  82.11700 286.64000 1.000 76.87848  ? 45  PHE A CG  1 
ATOM   310  C CD1 . PHE A 1 42  ? -2.83800  80.94600 287.29500 1.000 70.31560  ? 45  PHE A CD1 1 
ATOM   311  C CD2 . PHE A 1 42  ? -2.62100  83.26500 287.35000 1.000 76.44172  ? 45  PHE A CD2 1 
ATOM   312  C CE1 . PHE A 1 42  ? -2.61500  80.90300 288.63300 1.000 75.33518  ? 45  PHE A CE1 1 
ATOM   313  C CE2 . PHE A 1 42  ? -2.39500  83.23400 288.68700 1.000 76.62038  ? 45  PHE A CE2 1 
ATOM   314  C CZ  . PHE A 1 42  ? -2.39400  82.04400 289.33100 1.000 75.53645  ? 45  PHE A CZ  1 
ATOM   315  N N   . ARG A 1 43  ? -1.89300  81.74100 282.05500 1.000 78.64163  ? 46  ARG A N   1 
ATOM   316  C CA  . ARG A 1 43  ? -2.28600  81.95000 280.67600 1.000 76.32212  ? 46  ARG A CA  1 
ATOM   317  C C   . ARG A 1 43  ? -2.06900  80.77700 279.79500 1.000 68.86434  ? 46  ARG A C   1 
ATOM   318  O O   . ARG A 1 43  ? -1.27900  79.93200 280.09600 1.000 66.89357  ? 46  ARG A O   1 
ATOM   319  C CB  . ARG A 1 43  ? -1.55400  83.14600 280.09900 1.000 79.17228  ? 46  ARG A CB  1 
ATOM   320  C CG  . ARG A 1 43  ? -2.41700  84.37400 279.96800 1.000 83.40760  ? 46  ARG A CG  1 
ATOM   321  C CD  . ARG A 1 43  ? -1.89300  85.32800 278.92400 1.000 85.56974  ? 46  ARG A CD  1 
ATOM   322  N NE  . ARG A 1 43  ? -2.88500  86.33600 278.58200 1.000 97.91813  ? 46  ARG A NE  1 
ATOM   323  C CZ  . ARG A 1 43  ? -3.40900  86.49400 277.37300 1.000 94.72003  ? 46  ARG A CZ  1 
ATOM   324  N NH1 . ARG A 1 43  ? -3.02800  85.71800 276.37700 1.000 88.05987  ? 46  ARG A NH1 1 
ATOM   325  N NH2 . ARG A 1 43  ? -4.30600  87.43900 277.16200 1.000 90.72179  ? 46  ARG A NH2 1 
ATOM   326  N N   . ARG A 1 44  ? -2.77300  80.74000 278.68600 1.000 68.44253  ? 47  ARG A N   1 
ATOM   327  C CA  . ARG A 1 44  ? -2.62800  79.64800 277.76600 1.000 72.60109  ? 47  ARG A CA  1 
ATOM   328  C C   . ARG A 1 44  ? -1.20000  79.65000 277.34400 1.000 69.91722  ? 47  ARG A C   1 
ATOM   329  O O   . ARG A 1 44  ? -0.55700  80.65000 277.38800 1.000 74.36539  ? 47  ARG A O   1 
ATOM   330  C CB  . ARG A 1 44  ? -3.49300  79.85300 276.55900 1.000 70.79505  ? 47  ARG A CB  1 
ATOM   331  C CG  . ARG A 1 44  ? -4.95700  79.72400 276.83300 1.000 73.68538  ? 47  ARG A CG  1 
ATOM   332  C CD  . ARG A 1 44  ? -5.73000  79.93700 275.56000 1.000 80.16180  ? 47  ARG A CD  1 
ATOM   333  N NE  . ARG A 1 44  ? -7.01800  79.28100 275.57800 1.000 81.39651  ? 47  ARG A NE  1 
ATOM   334  C CZ  . ARG A 1 44  ? -8.14400  79.89000 275.87600 1.000 84.50408  ? 47  ARG A CZ  1 
ATOM   335  N NH1 . ARG A 1 44  ? -8.14100  81.17200 276.19100 1.000 78.59578  ? 47  ARG A NH1 1 
ATOM   336  N NH2 . ARG A 1 44  ? -9.26800  79.21200 275.86000 1.000 84.38665  ? 47  ARG A NH2 1 
ATOM   337  N N   . PRO A 1 45  ? -0.68300  78.51500 276.96800 1.000 63.14870  ? 48  PRO A N   1 
ATOM   338  C CA  . PRO A 1 45  ? 0.73500   78.42800 276.60600 1.000 62.56199  ? 48  PRO A CA  1 
ATOM   339  C C   . PRO A 1 45  ? 0.99300   78.93700 275.20400 1.000 69.63937  ? 48  PRO A C   1 
ATOM   340  O O   . PRO A 1 45  ? 0.19400   78.74200 274.28400 1.000 68.35667  ? 48  PRO A O   1 
ATOM   341  C CB  . PRO A 1 45  ? 1.04700   76.93100 276.70900 1.000 62.21789  ? 48  PRO A CB  1 
ATOM   342  C CG  . PRO A 1 45  ? -0.26800  76.24700 276.55000 1.000 64.31887  ? 48  PRO A CG  1 
ATOM   343  C CD  . PRO A 1 45  ? -1.33800  77.19600 277.02900 1.000 63.53762  ? 48  PRO A CD  1 
ATOM   344  N N   . GLU A 1 46  ? 2.15200   79.57500 275.04700 1.000 74.35909  ? 49  GLU A N   1 
ATOM   345  C CA  . GLU A 1 46  ? 2.62100   80.04100 273.75200 1.000 73.29937  ? 49  GLU A CA  1 
ATOM   346  C C   . GLU A 1 46  ? 3.76800   79.16900 273.25500 1.000 72.08784  ? 49  GLU A C   1 
ATOM   347  O O   . GLU A 1 46  ? 4.49100   78.57400 274.05800 1.000 71.98659  ? 49  GLU A O   1 
ATOM   348  C CB  . GLU A 1 46  ? 3.08400   81.49800 273.82700 1.000 72.71688  ? 49  GLU A CB  1 
ATOM   349  C CG  . GLU A 1 46  ? 1.93600   82.46600 273.95100 1.000 77.35937  ? 49  GLU A CG  1 
ATOM   350  C CD  . GLU A 1 46  ? 2.36800   83.88900 273.71300 1.000 91.48571  ? 49  GLU A CD  1 
ATOM   351  O OE1 . GLU A 1 46  ? 3.53200   84.22000 274.06500 1.000 86.91932  ? 49  GLU A OE1 1 
ATOM   352  O OE2 . GLU A 1 46  ? 1.54700   84.66300 273.15600 1.000 93.48956  ? 49  GLU A OE2 1 
ATOM   353  N N   . PRO A 1 47  ? 3.96900   79.07400 271.93900 1.000 74.74053  ? 50  PRO A N   1 
ATOM   354  C CA  . PRO A 1 47  ? 4.99300   78.15800 271.41800 1.000 71.00808  ? 50  PRO A CA  1 
ATOM   355  C C   . PRO A 1 47  ? 6.38800   78.75500 271.51500 1.000 74.16741  ? 50  PRO A C   1 
ATOM   356  O O   . PRO A 1 47  ? 6.58400   79.96200 271.34400 1.000 76.79707  ? 50  PRO A O   1 
ATOM   357  C CB  . PRO A 1 47  ? 4.57100   77.95400 269.95900 1.000 64.30237  ? 50  PRO A CB  1 
ATOM   358  C CG  . PRO A 1 47  ? 3.37100   78.87900 269.72700 1.000 65.74817  ? 50  PRO A CG  1 
ATOM   359  C CD  . PRO A 1 47  ? 3.31800   79.83200 270.85600 1.000 69.57645  ? 50  PRO A CD  1 
ATOM   360  N N   . LYS A 1 48  ? 7.36400   77.89400 271.79700 1.000 70.90319  ? 51  LYS A N   1 
ATOM   361  C CA  . LYS A 1 48  ? 8.73500   78.35200 271.99200 1.000 71.84679  ? 51  LYS A CA  1 
ATOM   362  C C   . LYS A 1 48  ? 9.24700   79.07700 270.75200 1.000 77.71071  ? 51  LYS A C   1 
ATOM   363  O O   . LYS A 1 48  ? 9.30300   78.49400 269.66400 1.000 74.82082  ? 51  LYS A O   1 
ATOM   364  C CB  . LYS A 1 48  ? 9.63600   77.16300 272.31900 1.000 70.78022  ? 51  LYS A CB  1 
ATOM   365  C CG  . LYS A 1 48  ? 11.08900  77.53100 272.61700 1.000 76.58549  ? 51  LYS A CG  1 
ATOM   366  C CD  . LYS A 1 48  ? 11.22500  78.51800 273.78500 1.000 72.91014  ? 51  LYS A CD  1 
ATOM   367  C CE  . LYS A 1 48  ? 12.68600  78.64600 274.23300 1.000 76.28458  ? 51  LYS A CE  1 
ATOM   368  N NZ  . LYS A 1 48  ? 12.88800  79.71400 275.25200 1.000 76.61392  ? 51  LYS A NZ  1 
ATOM   369  N N   . LYS A 1 49  ? 9.59600   80.35500 270.91300 1.000 79.31676  ? 52  LYS A N   1 
ATOM   370  C CA  . LYS A 1 49  ? 10.32700  81.06900 269.87800 1.000 76.35854  ? 52  LYS A CA  1 
ATOM   371  C C   . LYS A 1 49  ? 11.54300  80.24300 269.46200 1.000 78.96839  ? 52  LYS A C   1 
ATOM   372  O O   . LYS A 1 49  ? 12.28400  79.75700 270.33200 1.000 80.62303  ? 52  LYS A O   1 
ATOM   373  C CB  . LYS A 1 49  ? 10.78300  82.44400 270.37400 1.000 81.74632  ? 52  LYS A CB  1 
ATOM   374  C CG  . LYS A 1 49  ? 9.65500   83.41800 270.70300 1.000 88.34274  ? 52  LYS A CG  1 
ATOM   375  C CD  . LYS A 1 49  ? 10.15700  84.86500 270.82500 1.000 94.91054  ? 52  LYS A CD  1 
ATOM   376  C CE  . LYS A 1 49  ? 11.23800  85.04200 271.91000 1.000 98.14272  ? 52  LYS A CE  1 
ATOM   377  N NZ  . LYS A 1 49  ? 10.72700  85.13400 273.31800 1.000 84.46934  ? 52  LYS A NZ  1 
ATOM   378  N N   . PRO A 1 50  ? 11.76900  80.04000 268.16500 1.000 77.56815  ? 53  PRO A N   1 
ATOM   379  C CA  . PRO A 1 50  ? 12.91000  79.22200 267.74300 1.000 77.82763  ? 53  PRO A CA  1 
ATOM   380  C C   . PRO A 1 50  ? 14.22300  79.93100 268.02600 1.000 79.59667  ? 53  PRO A C   1 
ATOM   381  O O   . PRO A 1 50  ? 14.29300  81.16000 268.12100 1.000 77.98020  ? 53  PRO A O   1 
ATOM   382  C CB  . PRO A 1 50  ? 12.67800  79.02700 266.24200 1.000 69.52294  ? 53  PRO A CB  1 
ATOM   383  C CG  . PRO A 1 50  ? 11.81800  80.16900 265.85300 1.000 73.58175  ? 53  PRO A CG  1 
ATOM   384  C CD  . PRO A 1 50  ? 10.95600  80.48900 267.02600 1.000 77.48829  ? 53  PRO A CD  1 
ATOM   385  N N   . TRP A 1 51  ? 15.27200  79.13500 268.19900 1.000 78.24659  ? 54  TRP A N   1 
ATOM   386  C CA  . TRP A 1 51  ? 16.51400  79.64100 268.75900 1.000 83.01337  ? 54  TRP A CA  1 
ATOM   387  C C   . TRP A 1 51  ? 17.66100  79.46600 267.77500 1.000 83.59739  ? 54  TRP A C   1 
ATOM   388  O O   . TRP A 1 51  ? 17.66400  78.54700 266.94700 1.000 79.03457  ? 54  TRP A O   1 
ATOM   389  C CB  . TRP A 1 51  ? 16.85000  78.94200 270.09700 1.000 77.42717  ? 54  TRP A CB  1 
ATOM   390  C CG  . TRP A 1 51  ? 16.93700  77.46600 269.98000 1.000 71.72800  ? 54  TRP A CG  1 
ATOM   391  C CD1 . TRP A 1 51  ? 18.03000  76.73400 269.60800 1.000 72.49782  ? 54  TRP A CD1 1 
ATOM   392  C CD2 . TRP A 1 51  ? 15.88400  76.53000 270.21500 1.000 68.58989  ? 54  TRP A CD2 1 
ATOM   393  N NE1 . TRP A 1 51  ? 17.72000  75.39400 269.59600 1.000 70.41683  ? 54  TRP A NE1 1 
ATOM   394  C CE2 . TRP A 1 51  ? 16.40700  75.24200 269.96400 1.000 69.65154  ? 54  TRP A CE2 1 
ATOM   395  C CE3 . TRP A 1 51  ? 14.54700  76.65300 270.60700 1.000 65.15177  ? 54  TRP A CE3 1 
ATOM   396  C CZ2 . TRP A 1 51  ? 15.64300  74.08300 270.10700 1.000 64.30644  ? 54  TRP A CZ2 1 
ATOM   397  C CZ3 . TRP A 1 51  ? 13.78800  75.49900 270.75100 1.000 65.09814  ? 54  TRP A CZ3 1 
ATOM   398  C CH2 . TRP A 1 51  ? 14.34000  74.23100 270.50100 1.000 63.47923  ? 54  TRP A CH2 1 
ATOM   399  N N   . SER A 1 52  ? 18.63300  80.36900 267.87300 1.000 89.64689  ? 55  SER A N   1 
ATOM   400  C CA  . SER A 1 52  ? 19.86600  80.27400 267.10900 1.000 87.39376  ? 55  SER A CA  1 
ATOM   401  C C   . SER A 1 52  ? 20.91600  79.57300 267.95700 1.000 89.94118  ? 55  SER A C   1 
ATOM   402  O O   . SER A 1 52  ? 20.98800  79.77200 269.17500 1.000 86.40082  ? 55  SER A O   1 
ATOM   403  C CB  . SER A 1 52  ? 20.35200  81.66800 266.69600 1.000 91.62578  ? 55  SER A CB  1 
ATOM   404  O OG  . SER A 1 52  ? 19.39800  82.33800 265.87700 1.000 90.50760  ? 55  SER A OG  1 
ATOM   405  N N   . GLY A 1 53  ? 21.73100  78.75700 267.31700 1.000 86.74306  ? 56  GLY A N   1 
ATOM   406  C CA  . GLY A 1 53  ? 22.71200  77.99600 268.04300 1.000 84.01792  ? 56  GLY A CA  1 
ATOM   407  C C   . GLY A 1 53  ? 22.19400  76.61100 268.34200 1.000 77.80388  ? 56  GLY A C   1 
ATOM   408  O O   . GLY A 1 53  ? 21.29500  76.08900 267.68000 1.000 82.46493  ? 56  GLY A O   1 
ATOM   409  N N   . VAL A 1 54  ? 22.76600  76.01300 269.37400 1.000 73.04020  ? 57  VAL A N   1 
ATOM   410  C CA  . VAL A 1 54  ? 22.46600  74.63300 269.72700 1.000 76.18983  ? 57  VAL A CA  1 
ATOM   411  C C   . VAL A 1 54  ? 22.05900  74.56500 271.19600 1.000 80.28202  ? 57  VAL A C   1 
ATOM   412  O O   . VAL A 1 54  ? 22.71100  75.16000 272.06400 1.000 80.92677  ? 57  VAL A O   1 
ATOM   413  C CB  . VAL A 1 54  ? 23.66700  73.70900 269.42800 1.000 78.94934  ? 57  VAL A CB  1 
ATOM   414  C CG1 . VAL A 1 54  ? 23.31100  72.24600 269.69400 1.000 80.49613  ? 57  VAL A CG1 1 
ATOM   415  C CG2 . VAL A 1 54  ? 24.12000  73.88000 267.97900 1.000 78.29340  ? 57  VAL A CG2 1 
ATOM   416  N N   . TRP A 1 55  ? 20.97900  73.83200 271.46900 1.000 75.90439  ? 58  TRP A N   1 
ATOM   417  C CA  . TRP A 1 55  ? 20.45600  73.67000 272.81600 1.000 77.07289  ? 58  TRP A CA  1 
ATOM   418  C C   . TRP A 1 55  ? 21.19600  72.53700 273.52300 1.000 80.21740  ? 58  TRP A C   1 
ATOM   419  O O   . TRP A 1 55  ? 21.30200  71.43200 272.97400 1.000 74.48891  ? 58  TRP A O   1 
ATOM   420  C CB  . TRP A 1 55  ? 18.95800  73.37300 272.75900 1.000 73.80347  ? 58  TRP A CB  1 
ATOM   421  C CG  . TRP A 1 55  ? 18.27700  73.58200 274.04100 1.000 74.49998  ? 58  TRP A CG  1 
ATOM   422  C CD1 . TRP A 1 55  ? 18.17800  72.69400 275.07800 1.000 73.84578  ? 58  TRP A CD1 1 
ATOM   423  C CD2 . TRP A 1 55  ? 17.60200  74.76700 274.45500 1.000 73.11686  ? 58  TRP A CD2 1 
ATOM   424  N NE1 . TRP A 1 55  ? 17.47600  73.25700 276.10900 1.000 70.62874  ? 58  TRP A NE1 1 
ATOM   425  C CE2 . TRP A 1 55  ? 17.11200  74.53300 275.75600 1.000 72.80176  ? 58  TRP A CE2 1 
ATOM   426  C CE3 . TRP A 1 55  ? 17.36400  76.00800 273.85400 1.000 73.16031  ? 58  TRP A CE3 1 
ATOM   427  C CZ2 . TRP A 1 55  ? 16.39200  75.49600 276.46700 1.000 68.71029  ? 58  TRP A CZ2 1 
ATOM   428  C CZ3 . TRP A 1 55  ? 16.64500  76.96600 274.56000 1.000 75.73757  ? 58  TRP A CZ3 1 
ATOM   429  C CH2 . TRP A 1 55  ? 16.17200  76.70500 275.85500 1.000 75.07687  ? 58  TRP A CH2 1 
ATOM   430  N N   . ASN A 1 56  ? 21.71400  72.81300 274.73200 1.000 76.95969  ? 59  ASN A N   1 
ATOM   431  C CA  . ASN A 1 56  ? 22.45300  71.81700 275.51900 1.000 77.68869  ? 59  ASN A CA  1 
ATOM   432  C C   . ASN A 1 56  ? 21.42100  70.90400 276.17300 1.000 82.35576  ? 59  ASN A C   1 
ATOM   433  O O   . ASN A 1 56  ? 21.09100  71.02000 277.35600 1.000 90.82046  ? 59  ASN A O   1 
ATOM   434  C CB  . ASN A 1 56  ? 23.37400  72.49400 276.54000 1.000 83.15118  ? 59  ASN A CB  1 
ATOM   435  C CG  . ASN A 1 56  ? 24.13400  71.49300 277.44000 1.000 93.42017  ? 59  ASN A CG  1 
ATOM   436  O OD1 . ASN A 1 56  ? 24.24300  70.31000 277.11100 1.000 92.30850  ? 59  ASN A OD1 1 
ATOM   437  N ND2 . ASN A 1 56  ? 24.67000  71.98800 278.58600 1.000 98.26987  ? 59  ASN A ND2 1 
ATOM   438  N N   . ALA A 1 57  ? 20.88600  69.98600 275.37200 1.000 74.21767  ? 60  ALA A N   1 
ATOM   439  C CA  . ALA A 1 57  ? 19.79500  69.11800 275.81000 1.000 71.34512  ? 60  ALA A CA  1 
ATOM   440  C C   . ALA A 1 57  ? 20.32000  67.80500 276.36100 1.000 76.45873  ? 60  ALA A C   1 
ATOM   441  O O   . ALA A 1 57  ? 19.89100  66.72400 275.95800 1.000 76.17899  ? 60  ALA A O   1 
ATOM   442  C CB  . ALA A 1 57  ? 18.82400  68.87000 274.66400 1.000 76.21249  ? 60  ALA A CB  1 
ATOM   443  N N   . SER A 1 58  ? 21.25800  67.90700 277.30600 1.000 83.43771  ? 61  SER A N   1 
ATOM   444  C CA  . SER A 1 58  ? 21.91100  66.74900 277.89700 1.000 81.89653  ? 61  SER A CA  1 
ATOM   445  C C   . SER A 1 58  ? 21.53000  66.49500 279.34600 1.000 81.73354  ? 61  SER A C   1 
ATOM   446  O O   . SER A 1 58  ? 21.77700  65.38900 279.83800 1.000 84.82359  ? 61  SER A O   1 
ATOM   447  C CB  . SER A 1 58  ? 23.43700  66.89900 277.82000 1.000 81.36256  ? 61  SER A CB  1 
ATOM   448  O OG  . SER A 1 58  ? 23.86100  67.99100 278.62400 1.000 87.76692  ? 61  SER A OG  1 
ATOM   449  N N   . THR A 1 59  ? 20.95700  67.47900 280.04600 1.000 79.80216  ? 62  THR A N   1 
ATOM   450  C CA  . THR A 1 59  ? 20.52800  67.30200 281.42800 1.000 77.09917  ? 62  THR A CA  1 
ATOM   451  C C   . THR A 1 59  ? 19.02300  67.50700 281.56600 1.000 75.54435  ? 62  THR A C   1 
ATOM   452  O O   . THR A 1 59  ? 18.40500  68.26200 280.80900 1.000 71.60290  ? 62  THR A O   1 
ATOM   453  C CB  . THR A 1 59  ? 21.25100  68.26200 282.37900 1.000 79.51595  ? 62  THR A CB  1 
ATOM   454  O OG1 . THR A 1 59  ? 21.02700  69.61700 281.96600 1.000 77.91510  ? 62  THR A OG1 1 
ATOM   455  C CG2 . THR A 1 59  ? 22.74100  67.96500 282.40500 1.000 82.55645  ? 62  THR A CG2 1 
ATOM   456  N N   . TYR A 1 60  ? 18.45000  66.82100 282.55600 1.000 77.10471  ? 63  TYR A N   1 
ATOM   457  C CA  . TYR A 1 60  ? 17.03300  66.93200 282.87100 1.000 72.79469  ? 63  TYR A CA  1 
ATOM   458  C C   . TYR A 1 60  ? 16.65400  68.38300 283.18200 1.000 72.43571  ? 63  TYR A C   1 
ATOM   459  O O   . TYR A 1 60  ? 17.47900  69.16300 283.66800 1.000 77.24554  ? 63  TYR A O   1 
ATOM   460  C CB  . TYR A 1 60  ? 16.69800  66.05300 284.07500 1.000 69.60963  ? 63  TYR A CB  1 
ATOM   461  C CG  . TYR A 1 60  ? 16.18600  64.66000 283.77600 1.000 71.02905  ? 63  TYR A CG  1 
ATOM   462  C CD1 . TYR A 1 60  ? 15.43400  64.38400 282.63100 1.000 70.24354  ? 63  TYR A CD1 1 
ATOM   463  C CD2 . TYR A 1 60  ? 16.44400  63.61600 284.65900 1.000 68.28938  ? 63  TYR A CD2 1 
ATOM   464  C CE1 . TYR A 1 60  ? 14.95400  63.08900 282.38300 1.000 69.75204  ? 63  TYR A CE1 1 
ATOM   465  C CE2 . TYR A 1 60  ? 15.98100  62.32900 284.42200 1.000 68.97383  ? 63  TYR A CE2 1 
ATOM   466  C CZ  . TYR A 1 60  ? 15.23500  62.06600 283.28900 1.000 73.93339  ? 63  TYR A CZ  1 
ATOM   467  O OH  . TYR A 1 60  ? 14.77700  60.77900 283.08100 1.000 75.12382  ? 63  TYR A OH  1 
ATOM   468  N N   . PRO A 1 61  ? 15.40100  68.76300 282.94100 1.000 68.84515  ? 64  PRO A N   1 
ATOM   469  C CA  . PRO A 1 61  ? 14.97300  70.13900 283.21800 1.000 68.27787  ? 64  PRO A CA  1 
ATOM   470  C C   . PRO A 1 61  ? 14.31500  70.30200 284.58200 1.000 68.51135  ? 64  PRO A C   1 
ATOM   471  O O   . PRO A 1 61  ? 13.99500  69.31200 285.24300 1.000 67.62658  ? 64  PRO A O   1 
ATOM   472  C CB  . PRO A 1 61  ? 13.96100  70.39400 282.10400 1.000 67.72554  ? 64  PRO A CB  1 
ATOM   473  C CG  . PRO A 1 61  ? 13.26900  69.03500 282.00800 1.000 67.25307  ? 64  PRO A CG  1 
ATOM   474  C CD  . PRO A 1 61  ? 14.34400  67.99400 282.25900 1.000 68.06358  ? 64  PRO A CD  1 
ATOM   475  N N   . ASN A 1 62  ? 14.08000  71.55000 284.99000 1.000 69.99417  ? 65  ASN A N   1 
ATOM   476  C CA  . ASN A 1 62  ? 13.31900  71.84000 286.19500 1.000 65.64922  ? 65  ASN A CA  1 
ATOM   477  C C   . ASN A 1 62  ? 11.96700  71.14400 286.15400 1.000 66.67467  ? 65  ASN A C   1 
ATOM   478  O O   . ASN A 1 62  ? 11.44700  70.79000 285.09400 1.000 71.52660  ? 65  ASN A O   1 
ATOM   479  C CB  . ASN A 1 62  ? 13.08500  73.34100 286.35400 1.000 66.55047  ? 65  ASN A CB  1 
ATOM   480  C CG  . ASN A 1 62  ? 14.36100  74.13700 286.29800 1.000 74.53133  ? 65  ASN A CG  1 
ATOM   481  O OD1 . ASN A 1 62  ? 15.43100  73.66200 286.69800 1.000 75.07703  ? 65  ASN A OD1 1 
ATOM   482  N ND2 . ASN A 1 62  ? 14.26100  75.36300 285.79300 1.000 72.28079  ? 65  ASN A ND2 1 
ATOM   483  N N   . ASN A 1 63  ? 11.39400  70.97000 287.32700 1.000 67.98308  ? 66  ASN A N   1 
ATOM   484  C CA  . ASN A 1 63  ? 10.11300  70.35400 287.48300 1.000 66.46986  ? 66  ASN A CA  1 
ATOM   485  C C   . ASN A 1 63  ? 9.21700   71.50200 287.69500 1.000 71.48049  ? 66  ASN A C   1 
ATOM   486  O O   . ASN A 1 63  ? 9.68800   72.53700 288.02800 1.000 71.18609  ? 66  ASN A O   1 
ATOM   487  C CB  . ASN A 1 63  ? 10.12100  69.47200 288.68700 1.000 64.53133  ? 66  ASN A CB  1 
ATOM   488  C CG  . ASN A 1 63  ? 10.93700  68.26800 288.47900 1.000 65.25432  ? 66  ASN A CG  1 
ATOM   489  O OD1 . ASN A 1 63  ? 11.12900  67.85600 287.38300 1.000 70.55121  ? 66  ASN A OD1 1 
ATOM   490  N ND2 . ASN A 1 63  ? 11.42500  67.70300 289.52400 1.000 64.54938  ? 66  ASN A ND2 1 
ATOM   491  N N   . CYS A 1 64  ? 7.93000   71.34400 287.48000 1.000 70.40134  ? 67  CYS A N   1 
ATOM   492  C CA  . CYS A 1 64  ? 7.02800   72.45800 287.61500 1.000 69.04263  ? 67  CYS A CA  1 
ATOM   493  C C   . CYS A 1 64  ? 6.64500   72.60000 289.06500 1.000 68.33166  ? 67  CYS A C   1 
ATOM   494  O O   . CYS A 1 64  ? 6.68500   71.65300 289.76500 1.000 66.90807  ? 67  CYS A O   1 
ATOM   495  C CB  . CYS A 1 64  ? 5.87100   72.34500 286.60400 1.000 70.52184  ? 67  CYS A CB  1 
ATOM   496  S SG  . CYS A 1 64  ? 6.22300   73.02600 284.96800 0.600 69.17416  ? 67  CYS A SG  1 
ATOM   497  N N   . GLN A 1 65  ? 6.30900   73.80200 289.50600 1.000 70.14548  ? 68  GLN A N   1 
ATOM   498  C CA  . GLN A 1 65  ? 5.97400   74.09800 290.89400 1.000 68.89250  ? 68  GLN A CA  1 
ATOM   499  C C   . GLN A 1 65  ? 4.80700   73.32800 291.41300 1.000 67.91709  ? 68  GLN A C   1 
ATOM   500  O O   . GLN A 1 65  ? 3.75300   73.38900 290.85300 1.000 67.15426  ? 68  GLN A O   1 
ATOM   501  C CB  . GLN A 1 65  ? 5.72500   75.57100 291.05800 1.000 67.23791  ? 68  GLN A CB  1 
ATOM   502  C CG  . GLN A 1 65  ? 6.94000   76.39900 290.79900 1.000 67.71353  ? 68  GLN A CG  1 
ATOM   503  C CD  . GLN A 1 65  ? 7.67600   76.72300 292.04400 1.000 71.99726  ? 68  GLN A CD  1 
ATOM   504  O OE1 . GLN A 1 65  ? 7.51800   76.07600 293.03300 1.000 70.11482  ? 68  GLN A OE1 1 
ATOM   505  N NE2 . GLN A 1 65  ? 8.48400   77.73800 291.99700 1.000 70.35339  ? 68  GLN A NE2 1 
ATOM   506  N N   . GLN A 1 66  ? 4.99800   72.62500 292.51700 1.000 65.28834  ? 69  GLN A N   1 
ATOM   507  C CA  . GLN A 1 66  ? 3.96600   71.73600 293.03700 1.000 66.47629  ? 69  GLN A CA  1 
ATOM   508  C C   . GLN A 1 66  ? 4.06900   71.58200 294.55200 1.000 70.21588  ? 69  GLN A C   1 
ATOM   509  O O   . GLN A 1 66  ? 5.03200   72.01500 295.19000 1.000 73.09858  ? 69  GLN A O   1 
ATOM   510  C CB  . GLN A 1 66  ? 4.05900   70.36600 292.37900 1.000 63.48900  ? 69  GLN A CB  1 
ATOM   511  C CG  . GLN A 1 66  ? 5.46200   69.80900 292.42400 1.000 64.60356  ? 69  GLN A CG  1 
ATOM   512  C CD  . GLN A 1 66  ? 5.61600   68.57600 291.57200 1.000 62.76422  ? 69  GLN A CD  1 
ATOM   513  O OE1 . GLN A 1 66  ? 5.21100   67.48000 291.96300 1.000 64.92680  ? 69  GLN A OE1 1 
ATOM   514  N NE2 . GLN A 1 66  ? 6.18300   68.74800 290.38600 1.000 66.31673  ? 69  GLN A NE2 1 
ATOM   515  N N   . TYR A 1 67  ? 3.04300   70.95000 295.11900 1.000 71.89295  ? 70  TYR A N   1 
ATOM   516  C CA  . TYR A 1 67  ? 3.08600   70.51500 296.50700 1.000 67.94587  ? 70  TYR A CA  1 
ATOM   517  C C   . TYR A 1 67  ? 3.97700   69.28800 296.63100 1.000 68.60143  ? 70  TYR A C   1 
ATOM   518  O O   . TYR A 1 67  ? 3.92400   68.38300 295.80100 1.000 66.33675  ? 70  TYR A O   1 
ATOM   519  C CB  . TYR A 1 67  ? 1.67400   70.19800 297.00800 1.000 67.35614  ? 70  TYR A CB  1 
ATOM   520  C CG  . TYR A 1 67  ? 1.59300   69.65500 298.42800 1.000 74.10720  ? 70  TYR A CG  1 
ATOM   521  C CD1 . TYR A 1 67  ? 1.69200   68.28500 298.67800 1.000 71.28138  ? 70  TYR A CD1 1 
ATOM   522  C CD2 . TYR A 1 67  ? 1.40400   70.50800 299.51800 1.000 74.03196  ? 70  TYR A CD2 1 
ATOM   523  C CE1 . TYR A 1 67  ? 1.61100   67.77900 299.96800 1.000 73.79464  ? 70  TYR A CE1 1 
ATOM   524  C CE2 . TYR A 1 67  ? 1.32800   70.01000 300.82300 1.000 71.51106  ? 70  TYR A CE2 1 
ATOM   525  C CZ  . TYR A 1 67  ? 1.42900   68.64200 301.03900 1.000 75.45491  ? 70  TYR A CZ  1 
ATOM   526  O OH  . TYR A 1 67  ? 1.36100   68.12200 302.31200 1.000 71.69354  ? 70  TYR A OH  1 
ATOM   527  N N   . VAL A 1 68  ? 4.79900   69.25100 297.67700 1.000 73.19191  ? 71  VAL A N   1 
ATOM   528  C CA  . VAL A 1 68  ? 5.73200   68.15300 297.88500 1.000 67.29683  ? 71  VAL A CA  1 
ATOM   529  C C   . VAL A 1 68  ? 5.25600   67.33400 299.06800 1.000 69.55758  ? 71  VAL A C   1 
ATOM   530  O O   . VAL A 1 68  ? 4.95800   67.88200 300.13200 1.000 78.73548  ? 71  VAL A O   1 
ATOM   531  C CB  . VAL A 1 68  ? 7.16800   68.64600 298.11100 1.000 61.85935  ? 71  VAL A CB  1 
ATOM   532  C CG1 . VAL A 1 68  ? 8.09800   67.45900 298.14700 1.000 60.50873  ? 71  VAL A CG1 1 
ATOM   533  C CG2 . VAL A 1 68  ? 7.56500   69.64200 297.03600 1.000 59.07755  ? 71  VAL A CG2 1 
ATOM   534  N N   . ASP A 1 69  ? 5.21800   66.02100 298.88500 1.000 68.37037  ? 72  ASP A N   1 
ATOM   535  C CA  . ASP A 1 69  ? 4.76600   65.09700 299.91200 1.000 64.16935  ? 72  ASP A CA  1 
ATOM   536  C C   . ASP A 1 69  ? 5.82700   64.96600 300.99900 1.000 73.62042  ? 72  ASP A C   1 
ATOM   537  O O   . ASP A 1 69  ? 6.98400   64.63700 300.71400 1.000 70.94152  ? 72  ASP A O   1 
ATOM   538  C CB  . ASP A 1 69  ? 4.47400   63.74500 299.27000 1.000 69.15748  ? 72  ASP A CB  1 
ATOM   539  C CG  . ASP A 1 69  ? 4.00900   62.71300 300.25800 1.000 72.54031  ? 72  ASP A CG  1 
ATOM   540  O OD1 . ASP A 1 69  ? 2.97500   62.94300 300.90700 1.000 77.13175  ? 72  ASP A OD1 1 
ATOM   541  O OD2 . ASP A 1 69  ? 4.67500   61.66600 300.39100 1.000 74.73056  ? 72  ASP A OD2 1 
ATOM   542  N N   . GLU A 1 70  ? 5.43700   65.21900 302.25000 1.000 74.61887  ? 73  GLU A N   1 
ATOM   543  C CA  . GLU A 1 70  ? 6.33700   65.02200 303.37600 1.000 69.81986  ? 73  GLU A CA  1 
ATOM   544  C C   . GLU A 1 70  ? 5.66100   64.23800 304.49000 1.000 76.52938  ? 73  GLU A C   1 
ATOM   545  O O   . GLU A 1 70  ? 5.98100   64.41600 305.67300 1.000 71.26694  ? 73  GLU A O   1 
ATOM   546  C CB  . GLU A 1 70  ? 6.84800   66.35400 303.90000 1.000 71.26685  ? 73  GLU A CB  1 
ATOM   547  C CG  . GLU A 1 70  ? 7.80700   67.03900 302.96900 1.000 79.21966  ? 73  GLU A CG  1 
ATOM   548  C CD  . GLU A 1 70  ? 8.02200   68.49400 303.35100 1.000 84.91236  ? 73  GLU A CD  1 
ATOM   549  O OE1 . GLU A 1 70  ? 7.93700   68.80500 304.55900 1.000 88.46257  ? 73  GLU A OE1 1 
ATOM   550  O OE2 . GLU A 1 70  ? 8.25600   69.33100 302.45100 1.000 88.16292  ? 73  GLU A OE2 1 
ATOM   551  N N   . GLN A 1 71  ? 4.71700   63.36700 304.13600 1.000 75.42523  ? 74  GLN A N   1 
ATOM   552  C CA  . GLN A 1 71  ? 4.10400   62.54000 305.16700 1.000 76.71242  ? 74  GLN A CA  1 
ATOM   553  C C   . GLN A 1 71  ? 5.10600   61.53500 305.74300 1.000 77.39989  ? 74  GLN A C   1 
ATOM   554  O O   . GLN A 1 71  ? 5.00800   61.17100 306.92300 1.000 78.91860  ? 74  GLN A O   1 
ATOM   555  C CB  . GLN A 1 71  ? 2.87200   61.83600 304.59200 1.000 77.72225  ? 74  GLN A CB  1 
ATOM   556  C CG  . GLN A 1 71  ? 2.09600   60.97900 305.59000 1.000 80.54933  ? 74  GLN A CG  1 
ATOM   557  C CD  . GLN A 1 71  ? 0.96600   61.72000 306.28600 1.000 85.92837  ? 74  GLN A CD  1 
ATOM   558  O OE1 . GLN A 1 71  ? 0.31600   62.60000 305.70300 1.000 81.66587  ? 74  GLN A OE1 1 
ATOM   559  N NE2 . GLN A 1 71  ? 0.71700   61.35500 307.54500 1.000 82.90159  ? 74  GLN A NE2 1 
ATOM   560  N N   . PHE A 1 72  ? 6.08800   61.10300 304.94500 1.000 73.88823  ? 75  PHE A N   1 
ATOM   561  C CA  . PHE A 1 72  ? 7.05700   60.07900 305.34900 1.000 70.06649  ? 75  PHE A CA  1 
ATOM   562  C C   . PHE A 1 72  ? 8.47000   60.50000 304.95000 1.000 72.58563  ? 75  PHE A C   1 
ATOM   563  O O   . PHE A 1 72  ? 9.07600   59.92200 304.03300 1.000 61.72048  ? 75  PHE A O   1 
ATOM   564  C CB  . PHE A 1 72  ? 6.69700   58.72900 304.72500 1.000 67.73732  ? 75  PHE A CB  1 
ATOM   565  C CG  . PHE A 1 72  ? 5.31400   58.26300 305.06300 1.000 68.88415  ? 75  PHE A CG  1 
ATOM   566  C CD1 . PHE A 1 72  ? 5.02500   57.78400 306.32400 1.000 69.81537  ? 75  PHE A CD1 1 
ATOM   567  C CD2 . PHE A 1 72  ? 4.30200   58.30300 304.12100 1.000 69.16530  ? 75  PHE A CD2 1 
ATOM   568  C CE1 . PHE A 1 72  ? 3.75200   57.35800 306.64700 1.000 68.78708  ? 75  PHE A CE1 1 
ATOM   569  C CE2 . PHE A 1 72  ? 3.02700   57.87100 304.43000 1.000 70.47983  ? 75  PHE A CE2 1 
ATOM   570  C CZ  . PHE A 1 72  ? 2.75000   57.40400 305.69900 1.000 76.20977  ? 75  PHE A CZ  1 
ATOM   571  N N   . PRO A 1 73  ? 9.03500   61.49800 305.64500 1.000 70.15961  ? 76  PRO A N   1 
ATOM   572  C CA  . PRO A 1 73  ? 10.34600  62.03700 305.24500 1.000 68.21032  ? 76  PRO A CA  1 
ATOM   573  C C   . PRO A 1 73  ? 11.44000  60.98200 305.21300 1.000 70.03772  ? 76  PRO A C   1 
ATOM   574  O O   . PRO A 1 73  ? 11.67600  60.26700 306.19200 1.000 70.62771  ? 76  PRO A O   1 
ATOM   575  C CB  . PRO A 1 73  ? 10.62100  63.10000 306.30900 1.000 54.82272  ? 76  PRO A CB  1 
ATOM   576  C CG  . PRO A 1 73  ? 9.28900   63.59200 306.63100 1.000 62.09539  ? 76  PRO A CG  1 
ATOM   577  C CD  . PRO A 1 73  ? 8.36900   62.39600 306.59700 1.000 62.94916  ? 76  PRO A CD  1 
ATOM   578  N N   . GLY A 1 74  ? 12.12200  60.90800 304.06700 1.000 68.18800  ? 77  GLY A N   1 
ATOM   579  C CA  . GLY A 1 74  ? 13.19000  59.96500 303.84100 1.000 69.88407  ? 77  GLY A CA  1 
ATOM   580  C C   . GLY A 1 74  ? 12.74300  58.65100 303.24100 1.000 72.64622  ? 77  GLY A C   1 
ATOM   581  O O   . GLY A 1 74  ? 13.56200  57.94200 302.64700 1.000 69.74511  ? 77  GLY A O   1 
ATOM   582  N N   . PHE A 1 75  ? 11.46600  58.31700 303.37300 1.000 69.17173  ? 78  PHE A N   1 
ATOM   583  C CA  . PHE A 1 75  ? 10.95500  57.04400 302.89500 1.000 64.26589  ? 78  PHE A CA  1 
ATOM   584  C C   . PHE A 1 75  ? 10.95800  57.03300 301.37200 1.000 68.93034  ? 78  PHE A C   1 
ATOM   585  O O   . PHE A 1 75  ? 10.35000  57.90300 300.74300 1.000 71.35729  ? 78  PHE A O   1 
ATOM   586  C CB  . PHE A 1 75  ? 9.54900   56.84900 303.45000 1.000 61.16447  ? 78  PHE A CB  1 
ATOM   587  C CG  . PHE A 1 75  ? 8.96100   55.52300 303.14400 1.000 64.96318  ? 78  PHE A CG  1 
ATOM   588  C CD1 . PHE A 1 75  ? 9.60700   54.36800 303.51700 1.000 65.85579  ? 78  PHE A CD1 1 
ATOM   589  C CD2 . PHE A 1 75  ? 7.75300   55.42800 302.49000 1.000 68.04999  ? 78  PHE A CD2 1 
ATOM   590  C CE1 . PHE A 1 75  ? 9.06200   53.13800 303.23600 1.000 71.33823  ? 78  PHE A CE1 1 
ATOM   591  C CE2 . PHE A 1 75  ? 7.20200   54.20700 302.20900 1.000 67.76503  ? 78  PHE A CE2 1 
ATOM   592  C CZ  . PHE A 1 75  ? 7.85600   53.05900 302.58400 1.000 71.76617  ? 78  PHE A CZ  1 
ATOM   593  N N   . SER A 1 76  ? 11.64000  56.06100 300.76500 1.000 70.55460  ? 79  SER A N   1 
ATOM   594  C CA  . SER A 1 76  ? 11.75200  56.06300 299.30500 1.000 64.06322  ? 79  SER A CA  1 
ATOM   595  C C   . SER A 1 76  ? 10.39100  55.86000 298.64500 1.000 69.54854  ? 79  SER A C   1 
ATOM   596  O O   . SER A 1 76  ? 10.08400  56.49600 297.62800 1.000 67.83837  ? 79  SER A O   1 
ATOM   597  C CB  . SER A 1 76  ? 12.74300  54.99400 298.83800 1.000 59.79320  ? 79  SER A CB  1 
ATOM   598  O OG  . SER A 1 76  ? 12.22800  53.68500 299.02900 1.000 67.91977  ? 79  SER A OG  1 
ATOM   599  N N   . GLY A 1 77  ? 9.54600   55.00500 299.22800 1.000 72.28544  ? 80  GLY A N   1 
ATOM   600  C CA  . GLY A 1 77  ? 8.22200   54.77400 298.67100 1.000 68.86148  ? 80  GLY A CA  1 
ATOM   601  C C   . GLY A 1 77  ? 7.41600   56.03500 298.43800 1.000 66.57554  ? 80  GLY A C   1 
ATOM   602  O O   . GLY A 1 77  ? 6.53500   56.04900 297.57800 1.000 69.46283  ? 80  GLY A O   1 
ATOM   603  N N   . SER A 1 78  ? 7.68200   57.09300 299.19300 1.000 68.29738  ? 81  SER A N   1 
ATOM   604  C CA  . SER A 1 78  ? 6.98500   58.35300 298.99000 1.000 69.55979  ? 81  SER A CA  1 
ATOM   605  C C   . SER A 1 78  ? 7.83800   59.38000 298.25500 1.000 68.85214  ? 81  SER A C   1 
ATOM   606  O O   . SER A 1 78  ? 7.28800   60.24900 297.56600 1.000 63.40102  ? 81  SER A O   1 
ATOM   607  C CB  . SER A 1 78  ? 6.50700   58.92200 300.34500 1.000 66.61255  ? 81  SER A CB  1 
ATOM   608  O OG  . SER A 1 78  ? 7.45000   59.79900 300.95500 1.000 61.86786  ? 81  SER A OG  1 
ATOM   609  N N   . GLU A 1 79  ? 9.16900   59.27100 298.38000 1.000 70.94070  ? 82  GLU A N   1 
ATOM   610  C CA  . GLU A 1 79  ? 10.10800  60.22000 297.79100 1.000 68.91103  ? 82  GLU A CA  1 
ATOM   611  C C   . GLU A 1 79  ? 10.25900  60.01900 296.29200 1.000 69.63862  ? 82  GLU A C   1 
ATOM   612  O O   . GLU A 1 79  ? 10.55600  60.97600 295.56600 1.000 69.85139  ? 82  GLU A O   1 
ATOM   613  C CB  . GLU A 1 79  ? 11.49200  60.08600 298.44200 1.000 69.65155  ? 82  GLU A CB  1 
ATOM   614  C CG  . GLU A 1 79  ? 11.58200  60.42400 299.91100 1.000 69.42860  ? 82  GLU A CG  1 
ATOM   615  C CD  . GLU A 1 79  ? 11.58800  61.91600 300.18200 1.000 82.30085  ? 82  GLU A CD  1 
ATOM   616  O OE1 . GLU A 1 79  ? 11.53000  62.70300 299.18900 1.000 78.47824  ? 82  GLU A OE1 1 
ATOM   617  O OE2 . GLU A 1 79  ? 11.65300  62.29000 301.39500 1.000 77.19533  ? 82  GLU A OE2 1 
ATOM   618  N N   . MET A 1 80  ? 10.08800  58.78600 295.81500 1.000 67.11204  ? 83  MET A N   1 
ATOM   619  C CA  . MET A 1 80  ? 10.25000  58.52600 294.39500 1.000 67.51146  ? 83  MET A CA  1 
ATOM   620  C C   . MET A 1 80  ? 9.20400   59.24800 293.55400 1.000 68.23140  ? 83  MET A C   1 
ATOM   621  O O   . MET A 1 80  ? 9.33700   59.29400 292.32300 1.000 69.76423  ? 83  MET A O   1 
ATOM   622  C CB  . MET A 1 80  ? 10.21000  57.01500 294.12800 1.000 65.27013  ? 83  MET A CB  1 
ATOM   623  C CG  . MET A 1 80  ? 8.83900   56.39700 294.25000 1.000 67.55421  ? 83  MET A CG  1 
ATOM   624  S SD  . MET A 1 80  ? 8.86700   54.61400 293.99800 1.000 77.25534  ? 83  MET A SD  1 
ATOM   625  C CE  . MET A 1 80  ? 8.45000   54.50300 292.25300 1.000 68.54235  ? 83  MET A CE  1 
ATOM   626  N N   . TRP A 1 81  ? 8.18200   59.82200 294.18100 1.000 65.04647  ? 84  TRP A N   1 
ATOM   627  C CA  . TRP A 1 81  ? 7.17800   60.58200 293.45900 1.000 65.97511  ? 84  TRP A CA  1 
ATOM   628  C C   . TRP A 1 81  ? 7.38500   62.08200 293.55600 1.000 63.79321  ? 84  TRP A C   1 
ATOM   629  O O   . TRP A 1 81  ? 6.80100   62.81600 292.76000 1.000 66.09213  ? 84  TRP A O   1 
ATOM   630  C CB  . TRP A 1 81  ? 5.77400   60.21100 293.96000 1.000 66.07540  ? 84  TRP A CB  1 
ATOM   631  C CG  . TRP A 1 81  ? 5.55400   58.72800 293.97300 1.000 62.53848  ? 84  TRP A CG  1 
ATOM   632  C CD1 . TRP A 1 81  ? 5.64500   57.90800 295.04300 1.000 66.99401  ? 84  TRP A CD1 1 
ATOM   633  C CD2 . TRP A 1 81  ? 5.25000   57.88900 292.84800 1.000 69.59417  ? 84  TRP A CD2 1 
ATOM   634  N NE1 . TRP A 1 81  ? 5.39700   56.60800 294.67400 1.000 68.43020  ? 84  TRP A NE1 1 
ATOM   635  C CE2 . TRP A 1 81  ? 5.15200   56.57100 293.32900 1.000 66.80888  ? 84  TRP A CE2 1 
ATOM   636  C CE3 . TRP A 1 81  ? 5.04500   58.12800 291.48100 1.000 67.63208  ? 84  TRP A CE3 1 
ATOM   637  C CZ2 . TRP A 1 81  ? 4.86100   55.49600 292.50000 1.000 65.05979  ? 84  TRP A CZ2 1 
ATOM   638  C CZ3 . TRP A 1 81  ? 4.74900   57.06300 290.66400 1.000 61.92811  ? 84  TRP A CZ3 1 
ATOM   639  C CH2 . TRP A 1 81  ? 4.66800   55.76100 291.17300 1.000 66.14667  ? 84  TRP A CH2 1 
ATOM   640  N N   . ASN A 1 82  ? 8.20700   62.55100 294.48500 1.000 63.28901  ? 85  ASN A N   1 
ATOM   641  C CA  . ASN A 1 82  ? 8.46500   63.97400 294.62900 1.000 62.64362  ? 85  ASN A CA  1 
ATOM   642  C C   . ASN A 1 82  ? 9.43600   64.46900 293.55900 1.000 66.15849  ? 85  ASN A C   1 
ATOM   643  O O   . ASN A 1 82  ? 10.19800  63.68400 292.98100 1.000 63.13851  ? 85  ASN A O   1 
ATOM   644  C CB  . ASN A 1 82  ? 9.04000   64.27600 296.01000 1.000 65.60587  ? 85  ASN A CB  1 
ATOM   645  C CG  . ASN A 1 82  ? 8.05300   64.02200 297.13500 1.000 69.88832  ? 85  ASN A CG  1 
ATOM   646  O OD1 . ASN A 1 82  ? 6.83700   64.18300 296.98400 1.000 72.41689  ? 85  ASN A OD1 1 
ATOM   647  N ND2 . ASN A 1 82  ? 8.57900   63.62600 298.28000 1.000 73.08784  ? 85  ASN A ND2 1 
ATOM   648  N N   . PRO A 1 83  ? 9.42600   65.77900 293.28800 1.000 66.72710  ? 86  PRO A N   1 
ATOM   649  C CA  . PRO A 1 83  ? 10.42800  66.37700 292.39100 1.000 60.62266  ? 86  PRO A CA  1 
ATOM   650  C C   . PRO A 1 83  ? 11.85500  66.00900 292.77900 1.000 63.88537  ? 86  PRO A C   1 
ATOM   651  O O   . PRO A 1 83  ? 12.25600  66.13800 293.94000 1.000 67.63767  ? 86  PRO A O   1 
ATOM   652  C CB  . PRO A 1 83  ? 10.18900  67.88400 292.55300 1.000 57.58532  ? 86  PRO A CB  1 
ATOM   653  C CG  . PRO A 1 83  ? 8.78100   68.01800 293.00600 1.000 60.64342  ? 86  PRO A CG  1 
ATOM   654  C CD  . PRO A 1 83  ? 8.45100   66.77100 293.78400 1.000 63.94392  ? 86  PRO A CD  1 
ATOM   655  N N   . ASN A 1 84  ? 12.63200  65.56000 291.79000 1.000 64.08558  ? 87  ASN A N   1 
ATOM   656  C CA  . ASN A 1 84  ? 14.05100  65.28400 291.96400 1.000 58.31663  ? 87  ASN A CA  1 
ATOM   657  C C   . ASN A 1 84  ? 14.93100  66.34000 291.30500 1.000 61.18548  ? 87  ASN A C   1 
ATOM   658  O O   . ASN A 1 84  ? 16.14500  66.14600 291.19900 1.000 62.06178  ? 87  ASN A O   1 
ATOM   659  C CB  . ASN A 1 84  ? 14.38700  63.90300 291.41700 1.000 58.59753  ? 87  ASN A CB  1 
ATOM   660  C CG  . ASN A 1 84  ? 13.89600  63.71700 290.00200 1.000 65.54515  ? 87  ASN A CG  1 
ATOM   661  O OD1 . ASN A 1 84  ? 13.36300  64.64700 289.39400 1.000 67.41444  ? 87  ASN A OD1 1 
ATOM   662  N ND2 . ASN A 1 84  ? 14.06300  62.51600 289.46900 1.000 64.92678  ? 87  ASN A ND2 1 
ATOM   663  N N   . ARG A 1 85  ? 14.34200  67.44300 290.85200 1.000 62.47643  ? 88  ARG A N   1 
ATOM   664  C CA  . ARG A 1 85  ? 15.07000  68.58700 290.32100 1.000 70.07376  ? 88  ARG A CA  1 
ATOM   665  C C   . ARG A 1 85  ? 14.42000  69.84600 290.86200 1.000 67.39198  ? 88  ARG A C   1 
ATOM   666  O O   . ARG A 1 85  ? 13.27400  69.81800 291.30700 1.000 72.00323  ? 88  ARG A O   1 
ATOM   667  C CB  . ARG A 1 85  ? 15.06400  68.61400 288.78900 1.000 70.53133  ? 88  ARG A CB  1 
ATOM   668  C CG  . ARG A 1 85  ? 15.78100  67.45500 288.17700 1.000 65.35421  ? 88  ARG A CG  1 
ATOM   669  C CD  . ARG A 1 85  ? 16.64200  67.93800 287.03100 1.000 76.88456  ? 88  ARG A CD  1 
ATOM   670  N NE  . ARG A 1 85  ? 18.07700  67.75000 287.23200 1.000 77.05015  ? 88  ARG A NE  1 
ATOM   671  C CZ  . ARG A 1 85  ? 18.67000  66.58300 287.48400 1.000 78.58046  ? 88  ARG A CZ  1 
ATOM   672  N NH1 . ARG A 1 85  ? 17.96300  65.46000 287.61500 1.000 71.93346  ? 88  ARG A NH1 1 
ATOM   673  N NH2 . ARG A 1 85  ? 19.99000  66.54400 287.62900 1.000 84.89441  ? 88  ARG A NH2 1 
ATOM   674  N N   . GLU A 1 86  ? 15.14700  70.95800 290.82700 1.000 71.66214  ? 89  GLU A N   1 
ATOM   675  C CA  . GLU A 1 86  ? 14.60600  72.15600 291.45500 1.000 74.60961  ? 89  GLU A CA  1 
ATOM   676  C C   . GLU A 1 86  ? 13.36100  72.61800 290.70400 1.000 72.01724  ? 89  GLU A C   1 
ATOM   677  O O   . GLU A 1 86  ? 13.20500  72.38300 289.50600 1.000 74.06575  ? 89  GLU A O   1 
ATOM   678  C CB  . GLU A 1 86  ? 15.65600  73.27000 291.53000 1.000 75.51346  ? 89  GLU A CB  1 
ATOM   679  C CG  . GLU A 1 86  ? 16.22800  73.72200 290.20100 1.000 87.94450  ? 89  GLU A CG  1 
ATOM   680  C CD  . GLU A 1 86  ? 16.94500  75.07200 290.30400 1.000 99.85990  ? 89  GLU A CD  1 
ATOM   681  O OE1 . GLU A 1 86  ? 17.25500  75.65900 289.22800 1.000 99.71304  ? 89  GLU A OE1 1 
ATOM   682  O OE2 . GLU A 1 86  ? 17.19000  75.53600 291.45600 1.000 89.91951  ? 89  GLU A OE2 1 
ATOM   683  N N   . MET A 1 87  ? 12.44100  73.22400 291.43700 1.000 67.35625  ? 90  MET A N   1 
ATOM   684  C CA  . MET A 1 87  ? 11.14700  73.59800 290.89600 1.000 65.91248  ? 90  MET A CA  1 
ATOM   685  C C   . MET A 1 87  ? 11.22200  75.00500 290.34000 1.000 68.70926  ? 90  MET A C   1 
ATOM   686  O O   . MET A 1 87  ? 11.78300  75.90300 290.97200 1.000 72.01033  ? 90  MET A O   1 
ATOM   687  C CB  . MET A 1 87  ? 10.05400  73.52200 291.96600 1.000 67.29250  ? 90  MET A CB  1 
ATOM   688  C CG  . MET A 1 87  ? 9.65700   72.10200 292.35600 1.000 67.25775  ? 90  MET A CG  1 
ATOM   689  S SD  . MET A 1 87  ? 8.28300   72.05000 293.53000 1.000 68.48404  ? 90  MET A SD  1 
ATOM   690  C CE  . MET A 1 87  ? 9.12000   72.58100 295.03100 1.000 65.01783  ? 90  MET A CE  1 
ATOM   691  N N   . SER A 1 88  ? 10.64800  75.19100 289.16100 1.000 71.87009  ? 91  SER A N   1 
ATOM   692  C CA  . SER A 1 88  ? 10.58200  76.49000 288.52000 1.000 69.40796  ? 91  SER A CA  1 
ATOM   693  C C   . SER A 1 88  ? 9.23700   76.58800 287.83500 1.000 67.38663  ? 91  SER A C   1 
ATOM   694  O O   . SER A 1 88  ? 8.68500   75.57500 287.39900 1.000 65.99273  ? 91  SER A O   1 
ATOM   695  C CB  . SER A 1 88  ? 11.70700  76.66600 287.49400 1.000 69.53501  ? 91  SER A CB  1 
ATOM   696  O OG  . SER A 1 88  ? 11.74900  77.99600 287.01500 1.000 75.43799  ? 91  SER A OG  1 
ATOM   697  N N   . GLU A 1 89  ? 8.74900   77.79300 287.70500 1.000 65.15146  ? 92  GLU A N   1 
ATOM   698  C CA  . GLU A 1 89  ? 7.54700   77.98900 286.96700 1.000 65.14673  ? 92  GLU A CA  1 
ATOM   699  C C   . GLU A 1 89  ? 7.86000   77.70500 285.52000 1.000 77.01541  ? 92  GLU A C   1 
ATOM   700  O O   . GLU A 1 89  ? 6.97400   77.48100 284.74300 1.000 75.15227  ? 92  GLU A O   1 
ATOM   701  C CB  . GLU A 1 89  ? 7.00900   79.37800 287.12400 1.000 67.15869  ? 92  GLU A CB  1 
ATOM   702  C CG  . GLU A 1 89  ? 6.11200   79.53200 288.31600 1.000 72.82487  ? 92  GLU A CG  1 
ATOM   703  C CD  . GLU A 1 89  ? 5.22900   80.72400 288.22200 1.000 76.68975  ? 92  GLU A CD  1 
ATOM   704  O OE1 . GLU A 1 89  ? 4.14600   80.60600 287.66200 1.000 80.43487  ? 92  GLU A OE1 1 
ATOM   705  O OE2 . GLU A 1 89  ? 5.60800   81.77300 288.72500 1.000 71.18079  ? 92  GLU A OE2 1 
ATOM   706  N N   . ASP A 1 90  ? 9.13300   77.67300 285.19900 1.000 75.41500  ? 93  ASP A N   1 
ATOM   707  C CA  . ASP A 1 90  ? 9.57100   77.38200 283.86800 1.000 66.91273  ? 93  ASP A CA  1 
ATOM   708  C C   . ASP A 1 90  ? 9.75500   75.90200 283.74800 1.000 68.03184  ? 93  ASP A C   1 
ATOM   709  O O   . ASP A 1 90  ? 10.84800  75.42200 283.72200 1.000 64.25740  ? 93  ASP A O   1 
ATOM   710  C CB  . ASP A 1 90  ? 10.87800  78.09800 283.63400 1.000 69.86814  ? 93  ASP A CB  1 
ATOM   711  C CG  . ASP A 1 90  ? 11.48100  77.78300 282.31500 1.000 87.02505  ? 93  ASP A CG  1 
ATOM   712  O OD1 . ASP A 1 90  ? 10.90500  76.99200 281.56200 1.000 84.20234  ? 93  ASP A OD1 1 
ATOM   713  O OD2 . ASP A 1 90  ? 12.53400  78.34900 282.01000 1.000 81.60670  ? 93  ASP A OD2 1 
ATOM   714  N N   . CYS A 1 91  ? 8.66100   75.16500 283.68600 1.000 71.09602  ? 94  CYS A N   1 
ATOM   715  C CA  . CYS A 1 91  ? 8.75500   73.72600 283.60100 1.000 69.02136  ? 94  CYS A CA  1 
ATOM   716  C C   . CYS A 1 91  ? 8.48200   73.12600 282.25700 1.000 71.76550  ? 94  CYS A C   1 
ATOM   717  O O   . CYS A 1 91  ? 8.72300   71.97900 282.06200 1.000 71.54461  ? 94  CYS A O   1 
ATOM   718  C CB  . CYS A 1 91  ? 7.94100   73.03100 284.71200 1.000 66.62301  ? 94  CYS A CB  1 
ATOM   719  S SG  . CYS A 1 91  ? 6.15300   73.09600 284.85400 0.600 69.03409  ? 94  CYS A SG  1 
ATOM   720  N N   . LEU A 1 92  ? 7.99100   73.90100 281.32300 1.000 62.99651  ? 95  LEU A N   1 
ATOM   721  C CA  . LEU A 1 92  ? 7.61800   73.38200 280.02500 1.000 63.10136  ? 95  LEU A CA  1 
ATOM   722  C C   . LEU A 1 92  ? 8.66200   72.80900 279.10000 1.000 67.32493  ? 95  LEU A C   1 
ATOM   723  O O   . LEU A 1 92  ? 9.08300   73.43900 278.18200 1.000 66.84975  ? 95  LEU A O   1 
ATOM   724  C CB  . LEU A 1 92  ? 6.81500   74.43600 279.32400 1.000 65.87221  ? 95  LEU A CB  1 
ATOM   725  C CG  . LEU A 1 92  ? 5.63500   74.80600 280.19000 1.000 63.69921  ? 95  LEU A CG  1 
ATOM   726  C CD1 . LEU A 1 92  ? 4.78600   75.83600 279.51900 1.000 64.09961  ? 95  LEU A CD1 1 
ATOM   727  C CD2 . LEU A 1 92  ? 4.80600   73.58700 280.45200 1.000 64.50811  ? 95  LEU A CD2 1 
ATOM   728  N N   . TYR A 1 93  ? 9.03000   71.57100 279.34100 1.000 62.66020  ? 96  TYR A N   1 
ATOM   729  C CA  . TYR A 1 93  ? 10.05900  70.88600 278.57900 1.000 62.62556  ? 96  TYR A CA  1 
ATOM   730  C C   . TYR A 1 93  ? 9.61200   69.46200 278.28800 1.000 62.84130  ? 96  TYR A C   1 
ATOM   731  O O   . TYR A 1 93  ? 8.58200   69.00500 278.78000 1.000 66.50073  ? 96  TYR A O   1 
ATOM   732  C CB  . TYR A 1 93  ? 11.38800  70.91300 279.33500 1.000 61.64176  ? 96  TYR A CB  1 
ATOM   733  C CG  . TYR A 1 93  ? 11.86200  72.32000 279.54300 1.000 62.57750  ? 96  TYR A CG  1 
ATOM   734  C CD1 . TYR A 1 93  ? 11.45100  73.05600 280.63400 1.000 66.08835  ? 96  TYR A CD1 1 
ATOM   735  C CD2 . TYR A 1 93  ? 12.70500  72.92000 278.63500 1.000 64.81484  ? 96  TYR A CD2 1 
ATOM   736  C CE1 . TYR A 1 93  ? 11.87000  74.35700 280.81800 1.000 69.17724  ? 96  TYR A CE1 1 
ATOM   737  C CE2 . TYR A 1 93  ? 13.13400  74.21400 278.80900 1.000 68.58964  ? 96  TYR A CE2 1 
ATOM   738  C CZ  . TYR A 1 93  ? 12.71600  74.93000 279.90100 1.000 68.63573  ? 96  TYR A CZ  1 
ATOM   739  O OH  . TYR A 1 93  ? 13.14900  76.22700 280.06500 1.000 74.59619  ? 96  TYR A OH  1 
ATOM   740  N N   . LEU A 1 94  ? 10.38400  68.76100 277.45700 1.000 62.17624  ? 97  LEU A N   1 
ATOM   741  C CA  . LEU A 1 94  ? 10.10300  67.36200 277.17300 1.000 58.73767  ? 97  LEU A CA  1 
ATOM   742  C C   . LEU A 1 94  ? 11.40800  66.62500 276.89900 1.000 63.53223  ? 97  LEU A C   1 
ATOM   743  O O   . LEU A 1 94  ? 12.44400  67.23300 276.62100 1.000 66.43295  ? 97  LEU A O   1 
ATOM   744  C CB  . LEU A 1 94  ? 9.11900   67.22100 276.00400 1.000 64.71777  ? 97  LEU A CB  1 
ATOM   745  C CG  . LEU A 1 94  ? 9.42000   67.69300 274.57400 1.000 63.20604  ? 97  LEU A CG  1 
ATOM   746  C CD1 . LEU A 1 94  ? 10.07200  66.59700 273.75400 1.000 56.30720  ? 97  LEU A CD1 1 
ATOM   747  C CD2 . LEU A 1 94  ? 8.13900   68.17100 273.90400 1.000 57.47488  ? 97  LEU A CD2 1 
ATOM   748  N N   . ASN A 1 95  ? 11.34700  65.29900 276.97200 1.000 60.37916  ? 98  ASN A N   1 
ATOM   749  C CA  . ASN A 1 95  ? 12.53700  64.46600 276.93400 1.000 61.98697  ? 98  ASN A CA  1 
ATOM   750  C C   . ASN A 1 95  ? 12.31900  63.33000 275.96000 1.000 64.50004  ? 98  ASN A C   1 
ATOM   751  O O   . ASN A 1 95  ? 11.26700  62.68800 275.98100 1.000 68.87911  ? 98  ASN A O   1 
ATOM   752  C CB  . ASN A 1 95  ? 12.86500  63.89300 278.32000 1.000 67.63923  ? 98  ASN A CB  1 
ATOM   753  C CG  . ASN A 1 95  ? 12.70600  64.92600 279.42500 1.000 70.03095  ? 98  ASN A CG  1 
ATOM   754  O OD1 . ASN A 1 95  ? 13.31400  65.99800 279.37000 1.000 69.79418  ? 98  ASN A OD1 1 
ATOM   755  N ND2 . ASN A 1 95  ? 11.85600  64.62500 280.41600 1.000 66.28987  ? 98  ASN A ND2 1 
ATOM   756  N N   . ILE A 1 96  ? 13.32300  63.07600 275.12300 1.000 66.17424  ? 99  ILE A N   1 
ATOM   757  C CA  . ILE A 1 96  ? 13.24700  62.06100 274.08000 1.000 67.39989  ? 99  ILE A CA  1 
ATOM   758  C C   . ILE A 1 96  ? 14.37000  61.05900 274.29200 1.000 68.55112  ? 99  ILE A C   1 
ATOM   759  O O   . ILE A 1 96  ? 15.54500  61.43800 274.35200 1.000 68.38890  ? 99  ILE A O   1 
ATOM   760  C CB  . ILE A 1 96  ? 13.34200  62.67300 272.67400 1.000 63.79721  ? 99  ILE A CB  1 
ATOM   761  C CG1 . ILE A 1 96  ? 12.48000  63.93700 272.57200 1.000 62.75217  ? 99  ILE A CG1 1 
ATOM   762  C CG2 . ILE A 1 96  ? 12.93400  61.64300 271.64000 1.000 64.07920  ? 99  ILE A CG2 1 
ATOM   763  C CD1 . ILE A 1 96  ? 12.20700  64.40700 271.15800 1.000 60.45425  ? 99  ILE A CD1 1 
ATOM   764  N N   . TRP A 1 97  ? 14.01300  59.78700 274.39200 1.000 69.23725  ? 100 TRP A N   1 
ATOM   765  C CA  . TRP A 1 97  ? 14.96800  58.69300 274.30400 1.000 67.19280  ? 100 TRP A CA  1 
ATOM   766  C C   . TRP A 1 97  ? 14.90100  58.10000 272.90100 1.000 69.94431  ? 100 TRP A C   1 
ATOM   767  O O   . TRP A 1 97  ? 13.81800  57.70800 272.44800 1.000 72.06804  ? 100 TRP A O   1 
ATOM   768  C CB  . TRP A 1 97  ? 14.66800  57.63900 275.36500 1.000 70.13003  ? 100 TRP A CB  1 
ATOM   769  C CG  . TRP A 1 97  ? 15.05400  58.09700 276.73700 1.000 72.59150  ? 100 TRP A CG  1 
ATOM   770  C CD1 . TRP A 1 97  ? 16.25400  57.90600 277.35400 1.000 69.12819  ? 100 TRP A CD1 1 
ATOM   771  C CD2 . TRP A 1 97  ? 14.24800  58.84600 277.65300 1.000 75.33537  ? 100 TRP A CD2 1 
ATOM   772  N NE1 . TRP A 1 97  ? 16.24200  58.47700 278.59100 1.000 69.33842  ? 100 TRP A NE1 1 
ATOM   773  C CE2 . TRP A 1 97  ? 15.02300  59.06300 278.80200 1.000 72.40220  ? 100 TRP A CE2 1 
ATOM   774  C CE3 . TRP A 1 97  ? 12.94300  59.35200 277.61500 1.000 75.45992  ? 100 TRP A CE3 1 
ATOM   775  C CZ2 . TRP A 1 97  ? 14.54000  59.75600 279.90300 1.000 73.94372  ? 100 TRP A CZ2 1 
ATOM   776  C CZ3 . TRP A 1 97  ? 12.46700  60.04100 278.71100 1.000 71.91245  ? 100 TRP A CZ3 1 
ATOM   777  C CH2 . TRP A 1 97  ? 13.26500  60.23800 279.83700 1.000 71.73406  ? 100 TRP A CH2 1 
ATOM   778  N N   . VAL A 1 98  ? 16.03200  58.05300 272.20800 1.000 74.74160  ? 101 VAL A N   1 
ATOM   779  C CA  . VAL A 1 98  ? 16.11800  57.58400 270.83000 1.000 70.52060  ? 101 VAL A CA  1 
ATOM   780  C C   . VAL A 1 98  ? 17.01100  56.35200 270.78800 1.000 69.47487  ? 101 VAL A C   1 
ATOM   781  O O   . VAL A 1 98  ? 18.12100  56.40400 271.34400 1.000 74.51470  ? 101 VAL A O   1 
ATOM   782  C CB  . VAL A 1 98  ? 16.65100  58.65100 269.86400 1.000 66.53240  ? 101 VAL A CB  1 
ATOM   783  C CG1 . VAL A 1 98  ? 16.49100  58.17900 268.43300 1.000 71.47505  ? 101 VAL A CG1 1 
ATOM   784  C CG2 . VAL A 1 98  ? 15.94900  59.97700 270.06000 1.000 65.71789  ? 101 VAL A CG2 1 
ATOM   785  N N   . PRO A 1 99  ? 16.62100  55.30400 270.12200 1.000 67.87894  ? 102 PRO A N   1 
ATOM   786  C CA  . PRO A 1 99  ? 17.48900  54.15300 270.05700 1.000 72.36406  ? 102 PRO A CA  1 
ATOM   787  C C   . PRO A 1 99  ? 18.70300  54.50800 269.25500 1.000 78.81535  ? 102 PRO A C   1 
ATOM   788  O O   . PRO A 1 99  ? 18.78600  55.58800 268.72900 1.000 73.34597  ? 102 PRO A O   1 
ATOM   789  C CB  . PRO A 1 99  ? 16.65700  53.14900 269.30600 1.000 67.63210  ? 102 PRO A CB  1 
ATOM   790  C CG  . PRO A 1 99  ? 15.28400  53.50900 269.64800 1.000 65.92750  ? 102 PRO A CG  1 
ATOM   791  C CD  . PRO A 1 99  ? 15.25700  54.97900 269.73400 1.000 67.48172  ? 102 PRO A CD  1 
ATOM   792  N N   . SER A 1 100 ? 19.65400  53.60200 269.18100 1.000 80.00134  ? 103 SER A N   1 
ATOM   793  C CA  . SER A 1 100 ? 20.84100  53.85100 268.41000 1.000 82.85314  ? 103 SER A CA  1 
ATOM   794  C C   . SER A 1 100 ? 21.20400  52.56500 267.77100 1.000 84.33665  ? 103 SER A C   1 
ATOM   795  O O   . SER A 1 100 ? 21.28100  51.58400 268.45700 1.000 80.51809  ? 103 SER A O   1 
ATOM   796  C CB  . SER A 1 100 ? 22.00700  54.30700 269.22800 1.000 81.88436  ? 103 SER A CB  1 
ATOM   797  O OG  . SER A 1 100 ? 23.02400  54.67100 268.33500 1.000 89.21917  ? 103 SER A OG  1 
ATOM   798  N N   . PRO A 1 101 ? 21.41500  52.51000 266.39600 1.000 83.75276  ? 104 PRO A N   1 
ATOM   799  C CA  . PRO A 1 101 ? 21.32500  53.76900 265.63700 1.000 80.85342  ? 104 PRO A CA  1 
ATOM   800  C C   . PRO A 1 101 ? 19.95400  54.36700 265.47800 1.000 80.47459  ? 104 PRO A C   1 
ATOM   801  O O   . PRO A 1 101 ? 18.96300  53.71900 265.64600 1.000 78.45497  ? 104 PRO A O   1 
ATOM   802  C CB  . PRO A 1 101 ? 21.81900  53.38400 264.26200 1.000 85.65682  ? 104 PRO A CB  1 
ATOM   803  C CG  . PRO A 1 101 ? 22.58800  52.14700 264.45000 1.000 87.84795  ? 104 PRO A CG  1 
ATOM   804  C CD  . PRO A 1 101 ? 21.72100  51.41900 265.37600 1.000 83.17364  ? 104 PRO A CD  1 
ATOM   805  N N   . ARG A 1 102 ? 19.92900  55.63300 265.12400 1.000 77.09606  ? 105 ARG A N   1 
ATOM   806  C CA  . ARG A 1 102 ? 18.71700  56.37100 264.93200 1.000 71.28557  ? 105 ARG A CA  1 
ATOM   807  C C   . ARG A 1 102 ? 17.90500  55.70800 263.88700 1.000 80.33583  ? 105 ARG A C   1 
ATOM   808  O O   . ARG A 1 102 ? 18.30700  55.66100 262.74900 1.000 82.81715  ? 105 ARG A O   1 
ATOM   809  C CB  . ARG A 1 102 ? 19.06500  57.75600 264.45200 1.000 64.32849  ? 105 ARG A CB  1 
ATOM   810  C CG  . ARG A 1 102 ? 18.05900  58.81000 264.80700 1.000 66.24359  ? 105 ARG A CG  1 
ATOM   811  C CD  . ARG A 1 102 ? 18.31800  60.07900 264.03900 1.000 64.46243  ? 105 ARG A CD  1 
ATOM   812  N NE  . ARG A 1 102 ? 19.15500  60.97800 264.78600 1.000 69.36377  ? 105 ARG A NE  1 
ATOM   813  C CZ  . ARG A 1 102 ? 19.72500  62.05100 264.27700 1.000 70.85974  ? 105 ARG A CZ  1 
ATOM   814  N NH1 . ARG A 1 102 ? 19.55300  62.36300 263.02700 1.000 72.08864  ? 105 ARG A NH1 1 
ATOM   815  N NH2 . ARG A 1 102 ? 20.46000  62.82000 265.01900 1.000 69.50028  ? 105 ARG A NH2 1 
ATOM   816  N N   . PRO A 1 103 ? 16.70400  55.16900 264.30800 1.000 83.67330  ? 106 PRO A N   1 
ATOM   817  C CA  . PRO A 1 103 ? 15.92800  54.51500 263.24700 1.000 80.84633  ? 106 PRO A CA  1 
ATOM   818  C C   . PRO A 1 103 ? 15.35900  55.51900 262.28000 1.000 77.96631  ? 106 PRO A C   1 
ATOM   819  O O   . PRO A 1 103 ? 15.61900  56.68000 262.47200 1.000 75.92664  ? 106 PRO A O   1 
ATOM   820  C CB  . PRO A 1 103 ? 14.83100  53.81900 264.00600 1.000 78.94484  ? 106 PRO A CB  1 
ATOM   821  C CG  . PRO A 1 103 ? 14.59000  54.68500 265.14800 1.000 72.34651  ? 106 PRO A CG  1 
ATOM   822  C CD  . PRO A 1 103 ? 15.94100  54.98000 265.61500 1.000 71.52508  ? 106 PRO A CD  1 
ATOM   823  N N   . LYS A 1 104 ? 14.61700  55.10200 261.26100 1.000 70.03121  ? 107 LYS A N   1 
ATOM   824  C CA  . LYS A 1 104 ? 14.09000  56.09700 260.34100 1.000 74.42994  ? 107 LYS A CA  1 
ATOM   825  C C   . LYS A 1 104 ? 12.60200  56.36800 260.52400 1.000 77.12898  ? 107 LYS A C   1 
ATOM   826  O O   . LYS A 1 104 ? 12.18100  57.53100 260.45500 1.000 69.36422  ? 107 LYS A O   1 
ATOM   827  C CB  . LYS A 1 104 ? 14.38700  55.67900 258.90000 1.000 81.03059  ? 107 LYS A CB  1 
ATOM   828  C CG  . LYS A 1 104 ? 15.81600  55.16400 258.70300 1.000 79.99637  ? 107 LYS A CG  1 
ATOM   829  C CD  . LYS A 1 104 ? 16.86800  56.25000 258.92800 1.000 82.59755  ? 107 LYS A CD  1 
ATOM   830  C CE  . LYS A 1 104 ? 18.24000  55.82200 258.38700 1.000 82.17964  ? 107 LYS A CE  1 
ATOM   831  N NZ  . LYS A 1 104 ? 19.20000  56.96500 258.25800 1.000 78.44905  ? 107 LYS A NZ  1 
ATOM   832  N N   . SER A 1 105 ? 11.78000  55.33300 260.78900 1.000 78.04064  ? 108 SER A N   1 
ATOM   833  C CA  . SER A 1 105 ? 10.38000  55.61700 261.13700 1.000 78.62335  ? 108 SER A CA  1 
ATOM   834  C C   . SER A 1 105 ? 9.82400   54.47700 261.99900 1.000 79.89313  ? 108 SER A C   1 
ATOM   835  O O   . SER A 1 105 ? 9.04500   53.63800 261.53300 1.000 81.30971  ? 108 SER A O   1 
ATOM   836  C CB  . SER A 1 105 ? 9.51600   55.84400 259.89800 1.000 75.62063  ? 108 SER A CB  1 
ATOM   837  O OG  . SER A 1 105 ? 9.29700   57.23100 259.68600 1.000 77.10670  ? 108 SER A OG  1 
ATOM   838  N N   . THR A 1 106 ? 10.21800  54.47100 263.27900 1.000 76.22411  ? 109 THR A N   1 
ATOM   839  C CA  . THR A 1 106 ? 9.65600   53.56700 264.27700 1.000 71.42440  ? 109 THR A CA  1 
ATOM   840  C C   . THR A 1 106 ? 8.49500   54.22400 265.01000 1.000 70.40497  ? 109 THR A C   1 
ATOM   841  O O   . THR A 1 106 ? 8.25300   55.43000 264.91100 1.000 69.26803  ? 109 THR A O   1 
ATOM   842  C CB  . THR A 1 106 ? 10.69800  53.13800 265.31400 1.000 74.65167  ? 109 THR A CB  1 
ATOM   843  O OG1 . THR A 1 106 ? 11.62900  54.20600 265.52800 1.000 78.82867  ? 109 THR A OG1 1 
ATOM   844  C CG2 . THR A 1 106 ? 11.41500  51.86000 264.90800 1.000 74.41046  ? 109 THR A CG2 1 
ATOM   845  N N   . THR A 1 107 ? 7.80300   53.39400 265.78800 1.000 72.89077  ? 110 THR A N   1 
ATOM   846  C CA  . THR A 1 107 ? 6.71700   53.83400 266.65500 1.000 68.43798  ? 110 THR A CA  1 
ATOM   847  C C   . THR A 1 107 ? 7.19300   54.84700 267.69800 1.000 67.42128  ? 110 THR A C   1 
ATOM   848  O O   . THR A 1 107 ? 8.31000   54.75000 268.21500 1.000 67.78089  ? 110 THR A O   1 
ATOM   849  C CB  . THR A 1 107 ? 6.12300   52.61300 267.35000 1.000 69.67578  ? 110 THR A CB  1 
ATOM   850  O OG1 . THR A 1 107 ? 5.75000   51.63300 266.36700 1.000 66.04142  ? 110 THR A OG1 1 
ATOM   851  C CG2 . THR A 1 107 ? 4.91400   52.99600 268.19200 1.000 73.48179  ? 110 THR A CG2 1 
ATOM   852  N N   . VAL A 1 108 ? 6.32600   55.81600 268.01400 1.000 65.54238  ? 111 VAL A N   1 
ATOM   853  C CA  . VAL A 1 108 ? 6.58200   56.86700 268.99800 1.000 66.80977  ? 111 VAL A CA  1 
ATOM   854  C C   . VAL A 1 108 ? 5.59300   56.71900 270.15200 1.000 65.00680  ? 111 VAL A C   1 
ATOM   855  O O   . VAL A 1 108 ? 4.38200   56.62500 269.92100 1.000 65.23316  ? 111 VAL A O   1 
ATOM   856  C CB  . VAL A 1 108 ? 6.44600   58.26700 268.37000 1.000 64.43329  ? 111 VAL A CB  1 
ATOM   857  C CG1 . VAL A 1 108 ? 6.66400   59.35600 269.41900 1.000 65.47631  ? 111 VAL A CG1 1 
ATOM   858  C CG2 . VAL A 1 108 ? 7.40400   58.43100 267.22700 1.000 64.23799  ? 111 VAL A CG2 1 
ATOM   859  N N   . MET A 1 109 ? 6.09900   56.73200 271.39000 1.000 62.04692  ? 112 MET A N   1 
ATOM   860  C CA  . MET A 1 109 ? 5.25500   56.70600 272.58800 1.000 60.00663  ? 112 MET A CA  1 
ATOM   861  C C   . MET A 1 109 ? 5.50300   57.94900 273.42600 1.000 60.20587  ? 112 MET A C   1 
ATOM   862  O O   . MET A 1 109 ? 6.63500   58.18600 273.86700 1.000 61.57631  ? 112 MET A O   1 
ATOM   863  C CB  . MET A 1 109 ? 5.50600   55.45800 273.42800 1.000 54.84824  ? 112 MET A CB  1 
ATOM   864  C CG  . MET A 1 109 ? 5.08600   54.19400 272.73200 1.000 60.87123  ? 112 MET A CG  1 
ATOM   865  S SD  . MET A 1 109 ? 5.50300   52.73800 273.68500 1.000 62.00758  ? 112 MET A SD  1 
ATOM   866  C CE  . MET A 1 109 ? 3.93400   52.36100 274.47800 1.000 57.26156  ? 112 MET A CE  1 
ATOM   867  N N   . VAL A 1 110 ? 4.44300   58.72200 273.66100 1.000 57.07462  ? 113 VAL A N   1 
ATOM   868  C CA  . VAL A 1 110 ? 4.49800   59.91700 274.50200 1.000 61.43654  ? 113 VAL A CA  1 
ATOM   869  C C   . VAL A 1 110 ? 3.90900   59.59600 275.87800 1.000 57.50443  ? 113 VAL A C   1 
ATOM   870  O O   . VAL A 1 110 ? 2.75900   59.15400 275.98400 1.000 57.72456  ? 113 VAL A O   1 
ATOM   871  C CB  . VAL A 1 110 ? 3.75800   61.09100 273.84100 1.000 61.70080  ? 113 VAL A CB  1 
ATOM   872  C CG1 . VAL A 1 110 ? 3.80600   62.31600 274.72900 1.000 60.56948  ? 113 VAL A CG1 1 
ATOM   873  C CG2 . VAL A 1 110 ? 4.36500   61.39500 272.50400 1.000 61.77883  ? 113 VAL A CG2 1 
ATOM   874  N N   . TRP A 1 111 ? 4.69400   59.82900 276.93200 1.000 60.06789  ? 114 TRP A N   1 
ATOM   875  C CA  . TRP A 1 111 ? 4.27200   59.58400 278.31500 1.000 60.49155  ? 114 TRP A CA  1 
ATOM   876  C C   . TRP A 1 111 ? 3.70800   60.84600 278.95600 1.000 59.31135  ? 114 TRP A C   1 
ATOM   877  O O   . TRP A 1 111 ? 4.28400   61.93400 278.83600 1.000 57.24480  ? 114 TRP A O   1 
ATOM   878  C CB  . TRP A 1 111 ? 5.44000   59.07500 279.15600 1.000 55.37767  ? 114 TRP A CB  1 
ATOM   879  C CG  . TRP A 1 111 ? 5.14100   58.97200 280.61600 1.000 59.88219  ? 114 TRP A CG  1 
ATOM   880  C CD1 . TRP A 1 111 ? 5.63600   59.76700 281.62700 1.000 63.09079  ? 114 TRP A CD1 1 
ATOM   881  C CD2 . TRP A 1 111 ? 4.29100   58.01200 281.25000 1.000 62.49929  ? 114 TRP A CD2 1 
ATOM   882  N NE1 . TRP A 1 111 ? 5.13600   59.36100 282.84200 1.000 56.57232  ? 114 TRP A NE1 1 
ATOM   883  C CE2 . TRP A 1 111 ? 4.31200   58.28300 282.64000 1.000 61.37197  ? 114 TRP A CE2 1 
ATOM   884  C CE3 . TRP A 1 111 ? 3.51100   56.94800 280.78300 1.000 59.90704  ? 114 TRP A CE3 1 
ATOM   885  C CZ2 . TRP A 1 111 ? 3.57800   57.52400 283.56100 1.000 60.87260  ? 114 TRP A CZ2 1 
ATOM   886  C CZ3 . TRP A 1 111 ? 2.78700   56.19500 281.70100 1.000 60.65998  ? 114 TRP A CZ3 1 
ATOM   887  C CH2 . TRP A 1 111 ? 2.82300   56.49000 283.07200 1.000 57.05074  ? 114 TRP A CH2 1 
ATOM   888  N N   . ILE A 1 112 ? 2.57600   60.69300 279.64000 1.000 59.07654  ? 115 ILE A N   1 
ATOM   889  C CA  . ILE A 1 112 ? 1.93000   61.78800 280.36200 1.000 60.35897  ? 115 ILE A CA  1 
ATOM   890  C C   . ILE A 1 112 ? 1.83200   61.40300 281.84100 1.000 61.30049  ? 115 ILE A C   1 
ATOM   891  O O   . ILE A 1 112 ? 1.04200   60.52600 282.21700 1.000 61.23293  ? 115 ILE A O   1 
ATOM   892  C CB  . ILE A 1 112 ? 0.55200   62.12400 279.78000 1.000 58.50114  ? 115 ILE A CB  1 
ATOM   893  C CG1 . ILE A 1 112 ? 0.65300   62.31800 278.25700 1.000 57.33529  ? 115 ILE A CG1 1 
ATOM   894  C CG2 . ILE A 1 112 ? -0.03400  63.35900 280.48800 1.000 53.57905  ? 115 ILE A CG2 1 
ATOM   895  C CD1 . ILE A 1 112 ? -0.62500  62.84600 277.60100 1.000 47.57604  ? 115 ILE A CD1 1 
ATOM   896  N N   . TYR A 1 113 ? 2.61800   62.06700 282.68300 1.000 57.95494  ? 116 TYR A N   1 
ATOM   897  C CA  . TYR A 1 113 ? 2.65400   61.71100 284.08900 1.000 58.20283  ? 116 TYR A CA  1 
ATOM   898  C C   . TYR A 1 113 ? 1.35500   62.09900 284.79200 1.000 63.07481  ? 116 TYR A C   1 
ATOM   899  O O   . TYR A 1 113 ? 0.56800   62.91600 284.29500 1.000 60.29072  ? 116 TYR A O   1 
ATOM   900  C CB  . TYR A 1 113 ? 3.85700   62.35800 284.78300 1.000 58.80359  ? 116 TYR A CB  1 
ATOM   901  C CG  . TYR A 1 113 ? 3.94700   63.87600 284.79100 1.000 58.84385  ? 116 TYR A CG  1 
ATOM   902  C CD1 . TYR A 1 113 ? 2.95900   64.67000 285.37700 1.000 59.18500  ? 116 TYR A CD1 1 
ATOM   903  C CD2 . TYR A 1 113 ? 5.06600   64.50800 284.28400 1.000 59.42079  ? 116 TYR A CD2 1 
ATOM   904  C CE1 . TYR A 1 113 ? 3.07700   66.04800 285.41600 1.000 59.66342  ? 116 TYR A CE1 1 
ATOM   905  C CE2 . TYR A 1 113 ? 5.18900   65.88200 284.31300 1.000 59.86969  ? 116 TYR A CE2 1 
ATOM   906  C CZ  . TYR A 1 113 ? 4.19600   66.64700 284.87200 1.000 60.63625  ? 116 TYR A CZ  1 
ATOM   907  O OH  . TYR A 1 113 ? 4.34800   68.01400 284.88200 1.000 60.63978  ? 116 TYR A OH  1 
ATOM   908  N N   . GLY A 1 114 ? 1.14300   61.48800 285.97100 1.000 59.24680  ? 117 GLY A N   1 
ATOM   909  C CA  . GLY A 1 114 ? -0.00100  61.73600 286.80700 1.000 54.73412  ? 117 GLY A CA  1 
ATOM   910  C C   . GLY A 1 114 ? 0.37400   62.42600 288.10300 1.000 62.84703  ? 117 GLY A C   1 
ATOM   911  O O   . GLY A 1 114 ? 1.42100   63.07700 288.20600 1.000 65.10798  ? 117 GLY A O   1 
ATOM   912  N N   . GLY A 1 115 ? -0.48200  62.25300 289.12400 1.000 60.25626  ? 118 GLY A N   1 
ATOM   913  C CA  . GLY A 1 115 ? -0.34100  62.98900 290.36700 1.000 56.95855  ? 118 GLY A CA  1 
ATOM   914  C C   . GLY A 1 115 ? -1.47300  63.96900 290.63700 1.000 60.64867  ? 118 GLY A C   1 
ATOM   915  O O   . GLY A 1 115 ? -1.24900  65.09200 291.11800 1.000 55.37969  ? 118 GLY A O   1 
ATOM   916  N N   . GLY A 1 116 ? -2.68100  63.61200 290.27800 1.000 58.36852  ? 119 GLY A N   1 
ATOM   917  C CA  . GLY A 1 116 ? -3.82700  64.43000 290.57100 1.000 56.37978  ? 119 GLY A CA  1 
ATOM   918  C C   . GLY A 1 116 ? -3.89100  65.82000 290.03600 1.000 59.21667  ? 119 GLY A C   1 
ATOM   919  O O   . GLY A 1 116 ? -4.59500  66.62500 290.54300 1.000 58.52499  ? 119 GLY A O   1 
ATOM   920  N N   . PHE A 1 117 ? -3.12600  66.11500 289.02300 1.000 62.73796  ? 120 PHE A N   1 
ATOM   921  C CA  . PHE A 1 117 ? -3.15300  67.41000 288.40100 1.000 56.46138  ? 120 PHE A CA  1 
ATOM   922  C C   . PHE A 1 117 ? -2.52100  68.43900 289.30000 1.000 64.13557  ? 120 PHE A C   1 
ATOM   923  O O   . PHE A 1 117 ? -2.37000  69.56900 288.92600 1.000 58.21974  ? 120 PHE A O   1 
ATOM   924  C CB  . PHE A 1 117 ? -4.57100  67.80300 288.05300 1.000 51.42429  ? 120 PHE A CB  1 
ATOM   925  C CG  . PHE A 1 117 ? -5.18400  66.99400 286.95900 1.000 57.90008  ? 120 PHE A CG  1 
ATOM   926  C CD1 . PHE A 1 117 ? -4.67700  67.01300 285.71200 1.000 58.18496  ? 120 PHE A CD1 1 
ATOM   927  C CD2 . PHE A 1 117 ? -6.29100  66.25000 287.18500 1.000 57.30647  ? 120 PHE A CD2 1 
ATOM   928  C CE1 . PHE A 1 117 ? -5.24200  66.28900 284.71700 1.000 49.07608  ? 120 PHE A CE1 1 
ATOM   929  C CE2 . PHE A 1 117 ? -6.86100  65.51400 286.19600 1.000 54.81006  ? 120 PHE A CE2 1 
ATOM   930  C CZ  . PHE A 1 117 ? -6.33100  65.53900 284.96200 1.000 49.58765  ? 120 PHE A CZ  1 
ATOM   931  N N   . TYR A 1 118 ? -2.11900  68.03200 290.48700 1.000 63.88279  ? 121 TYR A N   1 
ATOM   932  C CA  . TYR A 1 118 ? -1.48400  68.93600 291.41200 1.000 60.68693  ? 121 TYR A CA  1 
ATOM   933  C C   . TYR A 1 118 ? -0.02900  68.63500 291.57700 1.000 62.76766  ? 121 TYR A C   1 
ATOM   934  O O   . TYR A 1 118 ? 0.65400   69.30700 292.27900 1.000 65.52616  ? 121 TYR A O   1 
ATOM   935  C CB  . TYR A 1 118 ? -2.15800  68.86600 292.76500 1.000 61.39962  ? 121 TYR A CB  1 
ATOM   936  C CG  . TYR A 1 118 ? -1.80900  67.66400 293.56700 1.000 63.37158  ? 121 TYR A CG  1 
ATOM   937  C CD1 . TYR A 1 118 ? -0.69300  67.64500 294.33400 1.000 60.38194  ? 121 TYR A CD1 1 
ATOM   938  C CD2 . TYR A 1 118 ? -2.57100  66.55400 293.53200 1.000 64.27204  ? 121 TYR A CD2 1 
ATOM   939  C CE1 . TYR A 1 118 ? -0.35500  66.54800 295.06300 1.000 60.16782  ? 121 TYR A CE1 1 
ATOM   940  C CE2 . TYR A 1 118 ? -2.23900  65.45100 294.26100 1.000 58.55035  ? 121 TYR A CE2 1 
ATOM   941  C CZ  . TYR A 1 118 ? -1.12800  65.46300 295.02100 1.000 62.43780  ? 121 TYR A CZ  1 
ATOM   942  O OH  . TYR A 1 118 ? -0.79700  64.37100 295.73700 1.000 63.21008  ? 121 TYR A OH  1 
ATOM   943  N N   . SER A 1 119 ? 0.44700   67.60400 290.93500 1.000 60.86346  ? 122 SER A N   1 
ATOM   944  C CA  . SER A 1 119 ? 1.84800   67.24200 291.10300 1.000 62.19403  ? 122 SER A CA  1 
ATOM   945  C C   . SER A 1 119 ? 2.26200   66.29300 289.99200 1.000 57.84920  ? 122 SER A C   1 
ATOM   946  O O   . SER A 1 119 ? 1.42600   65.64200 289.36800 1.000 59.92074  ? 122 SER A O   1 
ATOM   947  C CB  . SER A 1 119 ? 2.10300   66.59100 292.47100 1.000 56.16938  ? 122 SER A CB  1 
ATOM   948  O OG  . SER A 1 119 ? 1.53100   65.28900 292.54100 1.000 54.52399  ? 122 SER A OG  1 
ATOM   949  N N   . GLY A 1 120 ? 3.56300   66.19600 289.78500 1.000 59.55894  ? 123 GLY A N   1 
ATOM   950  C CA  . GLY A 1 120 ? 4.15200   65.27800 288.82300 1.000 64.89800  ? 123 GLY A CA  1 
ATOM   951  C C   . GLY A 1 120 ? 5.43100   65.83900 288.22000 1.000 66.20266  ? 123 GLY A C   1 
ATOM   952  O O   . GLY A 1 120 ? 5.68500   67.04700 288.18900 1.000 61.73854  ? 123 GLY A O   1 
ATOM   953  N N   . SER A 1 121 ? 6.26800   64.93200 287.72200 1.000 62.86862  ? 124 SER A N   1 
ATOM   954  C CA  . SER A 1 121 ? 7.55300   65.30600 287.15100 1.000 62.17041  ? 124 SER A CA  1 
ATOM   955  C C   . SER A 1 121 ? 7.88100   64.32700 286.03800 1.000 68.18482  ? 124 SER A C   1 
ATOM   956  O O   . SER A 1 121 ? 7.73000   63.11400 286.21600 1.000 65.51514  ? 124 SER A O   1 
ATOM   957  C CB  . SER A 1 121 ? 8.66200   65.29500 288.21000 1.000 65.42712  ? 124 SER A CB  1 
ATOM   958  O OG  . SER A 1 121 ? 8.60900   66.43500 289.05800 1.000 66.55511  ? 124 SER A OG  1 
ATOM   959  N N   . SER A 1 122 ? 8.30500   64.85300 284.88600 1.000 70.75495  ? 125 SER A N   1 
ATOM   960  C CA  . SER A 1 122 ? 8.72900   63.97900 283.80000 1.000 61.74714  ? 125 SER A CA  1 
ATOM   961  C C   . SER A 1 122 ? 10.05000  63.30300 284.10600 1.000 69.50132  ? 125 SER A C   1 
ATOM   962  O O   . SER A 1 122 ? 10.44500  62.38500 283.37700 1.000 69.08347  ? 125 SER A O   1 
ATOM   963  C CB  . SER A 1 122 ? 8.83900   64.76900 282.49700 1.000 67.51952  ? 125 SER A CB  1 
ATOM   964  O OG  . SER A 1 122 ? 9.85000   65.76500 282.55400 1.000 69.87966  ? 125 SER A OG  1 
ATOM   965  N N   . THR A 1 123 ? 10.70500  63.69900 285.20000 1.000 70.64899  ? 126 THR A N   1 
ATOM   966  C CA  . THR A 1 123 ? 12.09900  63.37800 285.45300 1.000 68.74302  ? 126 THR A CA  1 
ATOM   967  C C   . THR A 1 123 ? 12.28500  62.27500 286.48700 1.000 66.25059  ? 126 THR A C   1 
ATOM   968  O O   . THR A 1 123 ? 13.42200  61.98700 286.86800 1.000 68.22043  ? 126 THR A O   1 
ATOM   969  C CB  . THR A 1 123 ? 12.82400  64.64700 285.88800 1.000 65.54121  ? 126 THR A CB  1 
ATOM   970  O OG1 . THR A 1 123 ? 12.30900  65.05900 287.14600 1.000 69.04557  ? 126 THR A OG1 1 
ATOM   971  C CG2 . THR A 1 123 ? 12.53000  65.75200 284.92000 1.000 68.23429  ? 126 THR A CG2 1 
ATOM   972  N N   . LEU A 1 124 ? 11.21300  61.63100 286.93000 1.000 62.73984  ? 127 LEU A N   1 
ATOM   973  C CA  . LEU A 1 124 ? 11.35300  60.62800 287.97500 1.000 66.77315  ? 127 LEU A CA  1 
ATOM   974  C C   . LEU A 1 124 ? 12.11100  59.40900 287.46700 1.000 65.00630  ? 127 LEU A C   1 
ATOM   975  O O   . LEU A 1 124 ? 12.07300  59.06900 286.28400 1.000 71.07084  ? 127 LEU A O   1 
ATOM   976  C CB  . LEU A 1 124 ? 9.98700   60.18800 288.50400 1.000 66.11220  ? 127 LEU A CB  1 
ATOM   977  C CG  . LEU A 1 124 ? 9.00700   61.28400 288.90800 1.000 64.12987  ? 127 LEU A CG  1 
ATOM   978  C CD1 . LEU A 1 124 ? 7.77200   60.66000 289.51500 1.000 64.05698  ? 127 LEU A CD1 1 
ATOM   979  C CD2 . LEU A 1 124 ? 9.67100   62.26400 289.85400 1.000 63.59659  ? 127 LEU A CD2 1 
ATOM   980  N N   . ASP A 1 125 ? 12.79800  58.73500 288.38800 1.000 68.35243  ? 128 ASP A N   1 
ATOM   981  C CA  . ASP A 1 125 ? 13.52400  57.52900 288.01300 1.000 69.01893  ? 128 ASP A CA  1 
ATOM   982  C C   . ASP A 1 125 ? 12.58700  56.45700 287.46600 1.000 68.08544  ? 128 ASP A C   1 
ATOM   983  O O   . ASP A 1 125 ? 12.99800  55.64300 286.63700 1.000 73.67907  ? 128 ASP A O   1 
ATOM   984  C CB  . ASP A 1 125 ? 14.31800  57.00600 289.21300 1.000 68.50929  ? 128 ASP A CB  1 
ATOM   985  C CG  . ASP A 1 125 ? 15.26000  58.05600 289.78700 1.000 76.82040  ? 128 ASP A CG  1 
ATOM   986  O OD1 . ASP A 1 125 ? 15.76000  58.88100 288.99100 1.000 72.78540  ? 128 ASP A OD1 1 
ATOM   987  O OD2 . ASP A 1 125 ? 15.49500  58.06200 291.02200 1.000 84.34139  ? 128 ASP A OD2 1 
ATOM   988  N N   . VAL A 1 126 ? 11.32100  56.45600 287.89000 1.000 65.69433  ? 129 VAL A N   1 
ATOM   989  C CA  . VAL A 1 126 ? 10.37100  55.44700 287.42600 1.000 62.60422  ? 129 VAL A CA  1 
ATOM   990  C C   . VAL A 1 126 ? 9.82000   55.76800 286.04100 1.000 69.51543  ? 129 VAL A C   1 
ATOM   991  O O   . VAL A 1 126 ? 9.11100   54.93700 285.44500 1.000 69.93853  ? 129 VAL A O   1 
ATOM   992  C CB  . VAL A 1 126 ? 9.27100   55.30300 288.49900 1.000 61.67681  ? 129 VAL A CB  1 
ATOM   993  C CG1 . VAL A 1 126 ? 8.34700   56.52400 288.52600 1.000 58.32783  ? 129 VAL A CG1 1 
ATOM   994  C CG2 . VAL A 1 126 ? 8.50300   53.99900 288.34000 1.000 60.53064  ? 129 VAL A CG2 1 
ATOM   995  N N   . TYR A 1 127 ? 10.14100  56.94300 285.49300 1.000 66.63893  ? 130 TYR A N   1 
ATOM   996  C CA  . TYR A 1 127 ? 9.67600   57.35200 284.17600 1.000 67.06653  ? 130 TYR A CA  1 
ATOM   997  C C   . TYR A 1 127 ? 10.79100  57.30700 283.13300 1.000 72.30663  ? 130 TYR A C   1 
ATOM   998  O O   . TYR A 1 127 ? 10.67300  57.94300 282.08300 1.000 70.17111  ? 130 TYR A O   1 
ATOM   999  C CB  . TYR A 1 127 ? 9.08000   58.75800 284.23600 1.000 62.92981  ? 130 TYR A CB  1 
ATOM   1000 C CG  . TYR A 1 127 ? 7.86100   58.88900 285.10500 1.000 58.89556  ? 130 TYR A CG  1 
ATOM   1001 C CD1 . TYR A 1 127 ? 7.07600   57.78500 285.42500 1.000 62.71061  ? 130 TYR A CD1 1 
ATOM   1002 C CD2 . TYR A 1 127 ? 7.48300   60.12500 285.60600 1.000 61.02447  ? 130 TYR A CD2 1 
ATOM   1003 C CE1 . TYR A 1 127 ? 5.93800   57.91200 286.24800 1.000 61.12368  ? 130 TYR A CE1 1 
ATOM   1004 C CE2 . TYR A 1 127 ? 6.35600   60.26300 286.41900 1.000 63.53064  ? 130 TYR A CE2 1 
ATOM   1005 C CZ  . TYR A 1 127 ? 5.59400   59.15700 286.73400 1.000 60.88306  ? 130 TYR A CZ  1 
ATOM   1006 O OH  . TYR A 1 127 ? 4.48800   59.32400 287.52300 1.000 57.87645  ? 130 TYR A OH  1 
ATOM   1007 N N   . ASN A 1 128 ? 11.86800  56.56600 283.39700 1.000 76.02134  ? 131 ASN A N   1 
ATOM   1008 C CA  . ASN A 1 128 ? 13.04600  56.63100 282.54100 1.000 78.54469  ? 131 ASN A CA  1 
ATOM   1009 C C   . ASN A 1 128 ? 12.78600  55.92800 281.21600 1.000 73.77819  ? 131 ASN A C   1 
ATOM   1010 O O   . ASN A 1 128 ? 12.59300  54.70600 281.16600 1.000 76.79525  ? 131 ASN A O   1 
ATOM   1011 C CB  . ASN A 1 128 ? 14.25600  56.02300 283.24300 1.000 81.25889  ? 131 ASN A CB  1 
ATOM   1012 C CG  . ASN A 1 128 ? 15.56700  56.55400 282.68800 1.000 80.41278  ? 131 ASN A CG  1 
ATOM   1013 O OD1 . ASN A 1 128 ? 15.76900  56.59500 281.47700 1.000 76.52825  ? 131 ASN A OD1 1 
ATOM   1014 N ND2 . ASN A 1 128 ? 16.44800  56.99900 283.57600 1.000 86.36218  ? 131 ASN A ND2 1 
ATOM   1015 N N   . GLY A 1 129 ? 12.81000  56.70100 280.13600 1.000 72.87749  ? 132 GLY A N   1 
ATOM   1016 C CA  . GLY A 1 129 ? 12.47400  56.13400 278.84700 1.000 75.40767  ? 132 GLY A CA  1 
ATOM   1017 C C   . GLY A 1 129 ? 13.45600  55.10700 278.33700 1.000 77.39182  ? 132 GLY A C   1 
ATOM   1018 O O   . GLY A 1 129 ? 13.09900  54.33700 277.43900 1.000 76.24521  ? 132 GLY A O   1 
ATOM   1019 N N   . LYS A 1 130 ? 14.66600  55.05200 278.91000 1.000 79.94536  ? 133 LYS A N   1 
ATOM   1020 C CA  . LYS A 1 130 ? 15.75900  54.34900 278.24300 1.000 79.33622  ? 133 LYS A CA  1 
ATOM   1021 C C   . LYS A 1 130 ? 15.51200  52.84400 278.18200 1.000 76.18381  ? 133 LYS A C   1 
ATOM   1022 O O   . LYS A 1 130 ? 15.75800  52.21700 277.15100 1.000 76.64466  ? 133 LYS A O   1 
ATOM   1023 C CB  . LYS A 1 130 ? 17.09800  54.67300 278.92100 1.000 79.83647  ? 133 LYS A CB  1 
ATOM   1024 C CG  . LYS A 1 130 ? 17.35700  54.08300 280.31700 1.000 78.67561  ? 133 LYS A CG  1 
ATOM   1025 C CD  . LYS A 1 130 ? 18.69900  54.60100 280.86900 1.000 77.39322  ? 133 LYS A CD  1 
ATOM   1026 C CE  . LYS A 1 130 ? 19.16000  53.84300 282.10000 1.000 79.91169  ? 133 LYS A CE  1 
ATOM   1027 N NZ  . LYS A 1 130 ? 20.44800  54.35600 282.64100 1.000 77.88971  ? 133 LYS A NZ  1 
ATOM   1028 N N   . TYR A 1 131 ? 15.00600  52.24400 279.25300 1.000 80.46355  ? 134 TYR A N   1 
ATOM   1029 C CA  . TYR A 1 131 ? 14.79900  50.80200 279.21800 1.000 76.70027  ? 134 TYR A CA  1 
ATOM   1030 C C   . TYR A 1 131 ? 13.73000  50.43200 278.20200 1.000 75.28304  ? 134 TYR A C   1 
ATOM   1031 O O   . TYR A 1 131 ? 13.83100  49.40300 277.53000 1.000 77.90403  ? 134 TYR A O   1 
ATOM   1032 C CB  . TYR A 1 131 ? 14.43600  50.30000 280.61400 1.000 77.59027  ? 134 TYR A CB  1 
ATOM   1033 C CG  . TYR A 1 131 ? 15.37300  50.80100 281.69200 1.000 78.24093  ? 134 TYR A CG  1 
ATOM   1034 C CD1 . TYR A 1 131 ? 16.68000  50.34300 281.76900 1.000 79.35815  ? 134 TYR A CD1 1 
ATOM   1035 C CD2 . TYR A 1 131 ? 14.94500  51.73000 282.63700 1.000 81.69127  ? 134 TYR A CD2 1 
ATOM   1036 C CE1 . TYR A 1 131 ? 17.54400  50.79700 282.75300 1.000 86.07863  ? 134 TYR A CE1 1 
ATOM   1037 C CE2 . TYR A 1 131 ? 15.79900  52.19600 283.63300 1.000 83.13347  ? 134 TYR A CE2 1 
ATOM   1038 C CZ  . TYR A 1 131 ? 17.10100  51.72300 283.68700 1.000 87.27307  ? 134 TYR A CZ  1 
ATOM   1039 O OH  . TYR A 1 131 ? 17.96400  52.17400 284.66700 1.000 83.22231  ? 134 TYR A OH  1 
ATOM   1040 N N   . LEU A 1 132 ? 12.70700  51.26500 278.05800 1.000 74.93213  ? 135 LEU A N   1 
ATOM   1041 C CA  . LEU A 1 132 ? 11.64800  50.96400 277.10700 1.000 72.89475  ? 135 LEU A CA  1 
ATOM   1042 C C   . LEU A 1 132 ? 12.09700  51.24800 275.67300 1.000 75.42528  ? 135 LEU A C   1 
ATOM   1043 O O   . LEU A 1 132 ? 11.92600  50.40900 274.78000 1.000 75.34377  ? 135 LEU A O   1 
ATOM   1044 C CB  . LEU A 1 132 ? 10.39900  51.77000 277.46800 1.000 71.52021  ? 135 LEU A CB  1 
ATOM   1045 C CG  . LEU A 1 132 ? 9.05200   51.43300 276.83600 1.000 63.33720  ? 135 LEU A CG  1 
ATOM   1046 C CD1 . LEU A 1 132 ? 8.84000   49.93000 276.71400 1.000 60.71124  ? 135 LEU A CD1 1 
ATOM   1047 C CD2 . LEU A 1 132 ? 7.99100   52.05200 277.69300 1.000 58.80189  ? 135 LEU A CD2 1 
ATOM   1048 N N   . ALA A 1 133 ? 12.67100  52.42900 275.43700 1.000 75.82780  ? 136 ALA A N   1 
ATOM   1049 C CA  . ALA A 1 133 ? 13.14600  52.77000 274.10100 1.000 72.66363  ? 136 ALA A CA  1 
ATOM   1050 C C   . ALA A 1 133 ? 14.12900  51.72900 273.59000 1.000 76.13295  ? 136 ALA A C   1 
ATOM   1051 O O   . ALA A 1 133 ? 14.07200  51.32500 272.42300 1.000 77.57340  ? 136 ALA A O   1 
ATOM   1052 C CB  . ALA A 1 133 ? 13.79000  54.15500 274.11100 1.000 68.47656  ? 136 ALA A CB  1 
ATOM   1053 N N   . TYR A 1 134 ? 15.02200  51.26300 274.46000 1.000 75.82610  ? 137 TYR A N   1 
ATOM   1054 C CA  . TYR A 1 134 ? 16.04300  50.31600 274.03900 1.000 72.72993  ? 137 TYR A CA  1 
ATOM   1055 C C   . TYR A 1 134 ? 15.45400  48.92800 273.82500 1.000 77.13900  ? 137 TYR A C   1 
ATOM   1056 O O   . TYR A 1 134 ? 15.69200  48.29900 272.79100 1.000 82.94963  ? 137 TYR A O   1 
ATOM   1057 C CB  . TYR A 1 134 ? 17.17300  50.28100 275.06500 1.000 75.57494  ? 137 TYR A CB  1 
ATOM   1058 C CG  . TYR A 1 134 ? 18.12700  49.13500 274.87900 1.000 80.86413  ? 137 TYR A CG  1 
ATOM   1059 C CD1 . TYR A 1 134 ? 19.06600  49.14700 273.84800 1.000 85.70189  ? 137 TYR A CD1 1 
ATOM   1060 C CD2 . TYR A 1 134 ? 18.10000  48.03900 275.72900 1.000 78.76377  ? 137 TYR A CD2 1 
ATOM   1061 C CE1 . TYR A 1 134 ? 19.95000  48.09700 273.66600 1.000 84.36862  ? 137 TYR A CE1 1 
ATOM   1062 C CE2 . TYR A 1 134 ? 18.97800  46.98500 275.55900 1.000 84.48197  ? 137 TYR A CE2 1 
ATOM   1063 C CZ  . TYR A 1 134 ? 19.90000  47.01800 274.52400 1.000 87.39314  ? 137 TYR A CZ  1 
ATOM   1064 O OH  . TYR A 1 134 ? 20.77800  45.97700 274.35200 1.000 88.97049  ? 137 TYR A OH  1 
ATOM   1065 N N   . THR A 1 135 ? 14.66300  48.43700 274.77900 1.000 76.40249  ? 138 THR A N   1 
ATOM   1066 C CA  . THR A 1 135 ? 14.19300  47.05600 274.68400 1.000 77.34137  ? 138 THR A CA  1 
ATOM   1067 C C   . THR A 1 135 ? 13.27600  46.85000 273.48100 1.000 77.86000  ? 138 THR A C   1 
ATOM   1068 O O   . THR A 1 135 ? 13.33400  45.80200 272.82300 1.000 71.44477  ? 138 THR A O   1 
ATOM   1069 C CB  . THR A 1 135 ? 13.49000  46.65100 275.97900 1.000 72.09765  ? 138 THR A CB  1 
ATOM   1070 O OG1 . THR A 1 135 ? 14.37800  46.88500 277.07400 1.000 79.71037  ? 138 THR A OG1 1 
ATOM   1071 C CG2 . THR A 1 135 ? 13.12500  45.17300 275.97100 1.000 68.08747  ? 138 THR A CG2 1 
ATOM   1072 N N   . GLU A 1 136 ? 12.43900  47.84100 273.16500 1.000 80.46497  ? 139 GLU A N   1 
ATOM   1073 C CA  . GLU A 1 136 ? 11.37500  47.68500 272.17900 1.000 79.94926  ? 139 GLU A CA  1 
ATOM   1074 C C   . GLU A 1 136 ? 11.57300  48.50300 270.91000 1.000 78.43373  ? 139 GLU A C   1 
ATOM   1075 O O   . GLU A 1 136 ? 10.70200  48.46500 270.03700 1.000 76.98319  ? 139 GLU A O   1 
ATOM   1076 C CB  . GLU A 1 136 ? 10.02000  48.04000 272.80700 1.000 72.67694  ? 139 GLU A CB  1 
ATOM   1077 C CG  . GLU A 1 136 ? 9.56400   47.04100 273.86500 1.000 75.07997  ? 139 GLU A CG  1 
ATOM   1078 C CD  . GLU A 1 136 ? 9.16900   45.68300 273.28700 1.000 80.52669  ? 139 GLU A CD  1 
ATOM   1079 O OE1 . GLU A 1 136 ? 8.43100   45.64800 272.27300 1.000 79.69519  ? 139 GLU A OE1 1 
ATOM   1080 O OE2 . GLU A 1 136 ? 9.58900   44.64400 273.85000 1.000 79.74429  ? 139 GLU A OE2 1 
ATOM   1081 N N   . GLU A 1 137 ? 12.68700  49.23000 270.77500 1.000 79.29520  ? 140 GLU A N   1 
ATOM   1082 C CA  . GLU A 1 137 ? 13.03100  49.99000 269.57400 1.000 75.11022  ? 140 GLU A CA  1 
ATOM   1083 C C   . GLU A 1 137 ? 12.10400  51.17100 269.33900 1.000 73.21739  ? 140 GLU A C   1 
ATOM   1084 O O   . GLU A 1 137 ? 12.03400  51.69400 268.22100 1.000 81.91963  ? 140 GLU A O   1 
ATOM   1085 C CB  . GLU A 1 137 ? 13.04100  49.10200 268.32200 1.000 79.70177  ? 140 GLU A CB  1 
ATOM   1086 C CG  . GLU A 1 137 ? 13.75400  47.77100 268.48800 1.000 87.42634  ? 140 GLU A CG  1 
ATOM   1087 C CD  . GLU A 1 137 ? 15.24700  47.88500 268.25700 1.000 97.82537  ? 140 GLU A CD  1 
ATOM   1088 O OE1 . GLU A 1 137 ? 15.63100  48.36200 267.15900 1.000 94.12262  ? 140 GLU A OE1 1 
ATOM   1089 O OE2 . GLU A 1 137 ? 16.02600  47.50700 269.17100 1.000 92.07540  ? 140 GLU A OE2 1 
ATOM   1090 N N   . VAL A 1 138 ? 11.38700  51.60500 270.34900 1.000 69.40543  ? 141 VAL A N   1 
ATOM   1091 C CA  . VAL A 1 138 ? 10.47800  52.72600 270.19400 1.000 69.17240  ? 141 VAL A CA  1 
ATOM   1092 C C   . VAL A 1 138 ? 11.21200  54.01100 270.54800 1.000 69.57985  ? 141 VAL A C   1 
ATOM   1093 O O   . VAL A 1 138 ? 12.26500  54.00300 271.18900 1.000 71.38876  ? 141 VAL A O   1 
ATOM   1094 C CB  . VAL A 1 138 ? 9.20500   52.55400 271.05300 1.000 73.35463  ? 141 VAL A CB  1 
ATOM   1095 C CG1 . VAL A 1 138 ? 8.52400   51.23500 270.73100 1.000 71.24139  ? 141 VAL A CG1 1 
ATOM   1096 C CG2 . VAL A 1 138 ? 9.52100   52.65600 272.55000 1.000 70.52345  ? 141 VAL A CG2 1 
ATOM   1097 N N   . VAL A 1 139 ? 10.65800  55.13000 270.10200 1.000 67.65868  ? 142 VAL A N   1 
ATOM   1098 C CA  . VAL A 1 139 ? 11.09900  56.45400 270.51800 1.000 66.49068  ? 142 VAL A CA  1 
ATOM   1099 C C   . VAL A 1 139 ? 10.19700  56.88300 271.67100 1.000 70.85068  ? 142 VAL A C   1 
ATOM   1100 O O   . VAL A 1 139 ? 8.99500   57.10200 271.48200 1.000 70.16328  ? 142 VAL A O   1 
ATOM   1101 C CB  . VAL A 1 139 ? 11.05700  57.45300 269.35300 1.000 66.15600  ? 142 VAL A CB  1 
ATOM   1102 C CG1 . VAL A 1 139 ? 11.01000  58.88400 269.86300 1.000 66.92549  ? 142 VAL A CG1 1 
ATOM   1103 C CG2 . VAL A 1 139 ? 12.26900  57.26000 268.47500 1.000 69.55261  ? 142 VAL A CG2 1 
ATOM   1104 N N   . LEU A 1 140 ? 10.77400  56.98000 272.87400 1.000 70.40557  ? 143 LEU A N   1 
ATOM   1105 C CA  . LEU A 1 140 ? 10.04000  57.32100 274.08700 1.000 65.87019  ? 143 LEU A CA  1 
ATOM   1106 C C   . LEU A 1 140 ? 10.11400  58.82700 274.33400 1.000 66.28776  ? 143 LEU A C   1 
ATOM   1107 O O   . LEU A 1 140 ? 11.20800  59.40000 274.37700 1.000 65.64329  ? 143 LEU A O   1 
ATOM   1108 C CB  . LEU A 1 140 ? 10.61900  56.54400 275.26600 1.000 66.47776  ? 143 LEU A CB  1 
ATOM   1109 C CG  . LEU A 1 140 ? 9.71000   56.22400 276.45600 1.000 69.53101  ? 143 LEU A CG  1 
ATOM   1110 C CD1 . LEU A 1 140 ? 9.57200   57.42000 277.40500 1.000 66.78066  ? 143 LEU A CD1 1 
ATOM   1111 C CD2 . LEU A 1 140 ? 8.34900   55.74900 275.96400 1.000 63.38497  ? 143 LEU A CD2 1 
ATOM   1112 N N   . VAL A 1 141 ? 8.95800   59.46500 274.48900 1.000 60.96426  ? 144 VAL A N   1 
ATOM   1113 C CA  . VAL A 1 141 ? 8.87700   60.89000 274.79000 1.000 62.58229  ? 144 VAL A CA  1 
ATOM   1114 C C   . VAL A 1 141 ? 8.10100   61.09200 276.08600 1.000 62.89496  ? 144 VAL A C   1 
ATOM   1115 O O   . VAL A 1 141 ? 7.06200   60.45900 276.29800 1.000 65.95575  ? 144 VAL A O   1 
ATOM   1116 C CB  . VAL A 1 141 ? 8.20100   61.66800 273.64800 1.000 61.11295  ? 144 VAL A CB  1 
ATOM   1117 C CG1 . VAL A 1 141 ? 7.92800   63.11000 274.08600 1.000 62.46356  ? 144 VAL A CG1 1 
ATOM   1118 C CG2 . VAL A 1 141 ? 9.07200   61.64200 272.43900 1.000 63.24345  ? 144 VAL A CG2 1 
ATOM   1119 N N   . SER A 1 142 ? 8.58800   61.97600 276.95000 1.000 58.07134  ? 145 SER A N   1 
ATOM   1120 C CA  . SER A 1 142 ? 7.82300   62.34300 278.13700 1.000 67.09270  ? 145 SER A CA  1 
ATOM   1121 C C   . SER A 1 142 ? 7.69700   63.85700 278.19300 1.000 64.92328  ? 145 SER A C   1 
ATOM   1122 O O   . SER A 1 142 ? 8.69400   64.58000 278.10800 1.000 60.65952  ? 145 SER A O   1 
ATOM   1123 C CB  . SER A 1 142 ? 8.43300   61.78500 279.44700 1.000 63.71233  ? 145 SER A CB  1 
ATOM   1124 O OG  . SER A 1 142 ? 9.62800   62.44100 279.85000 1.000 64.92237  ? 145 SER A OG  1 
ATOM   1125 N N   . LEU A 1 143 ? 6.46900   64.33000 278.30200 1.000 63.60501  ? 146 LEU A N   1 
ATOM   1126 C CA  . LEU A 1 143 ? 6.22700   65.75300 278.41400 1.000 62.73048  ? 146 LEU A CA  1 
ATOM   1127 C C   . LEU A 1 143 ? 6.07700   66.14600 279.88000 1.000 62.74833  ? 146 LEU A C   1 
ATOM   1128 O O   . LEU A 1 143 ? 6.10200   65.31900 280.78800 1.000 59.97651  ? 146 LEU A O   1 
ATOM   1129 C CB  . LEU A 1 143 ? 4.98900   66.14600 277.60600 1.000 60.56524  ? 146 LEU A CB  1 
ATOM   1130 C CG  . LEU A 1 143 ? 3.79900   65.18500 277.59500 1.000 60.62049  ? 146 LEU A CG  1 
ATOM   1131 C CD1 . LEU A 1 143 ? 3.06300   65.19800 278.90800 1.000 61.26506  ? 146 LEU A CD1 1 
ATOM   1132 C CD2 . LEU A 1 143 ? 2.85700   65.55300 276.47900 1.000 60.24661  ? 146 LEU A CD2 1 
ATOM   1133 N N   . SER A 1 144 ? 5.94100   67.44000 280.09500 1.000 61.75430  ? 147 SER A N   1 
ATOM   1134 C CA  . SER A 1 144 ? 5.59600   67.98600 281.38600 1.000 62.06350  ? 147 SER A CA  1 
ATOM   1135 C C   . SER A 1 144 ? 4.48400   68.99800 281.16600 1.000 61.87100  ? 147 SER A C   1 
ATOM   1136 O O   . SER A 1 144 ? 4.25600   69.45100 280.04300 1.000 67.69380  ? 147 SER A O   1 
ATOM   1137 C CB  . SER A 1 144 ? 6.81100   68.61900 282.05700 1.000 64.50353  ? 147 SER A CB  1 
ATOM   1138 O OG  . SER A 1 144 ? 7.33800   69.65100 281.26000 1.000 63.50381  ? 147 SER A OG  1 
ATOM   1139 N N   . TYR A 1 145 ? 3.76200   69.32500 282.23300 1.000 60.36372  ? 148 TYR A N   1 
ATOM   1140 C CA  . TYR A 1 145 ? 2.69200   70.30600 282.12100 1.000 62.24128  ? 148 TYR A CA  1 
ATOM   1141 C C   . TYR A 1 145 ? 2.48300   70.97900 283.46900 1.000 62.57518  ? 148 TYR A C   1 
ATOM   1142 O O   . TYR A 1 145 ? 2.81700   70.43000 284.52100 1.000 63.17329  ? 148 TYR A O   1 
ATOM   1143 C CB  . TYR A 1 145 ? 1.38400   69.67600 281.61700 1.000 61.15047  ? 148 TYR A CB  1 
ATOM   1144 C CG  . TYR A 1 145 ? 0.91800   68.48500 282.41200 1.000 61.74081  ? 148 TYR A CG  1 
ATOM   1145 C CD1 . TYR A 1 145 ? 1.39800   67.22200 282.12600 1.000 59.28477  ? 148 TYR A CD1 1 
ATOM   1146 C CD2 . TYR A 1 145 ? 0.00100   68.62500 283.45800 1.000 64.15525  ? 148 TYR A CD2 1 
ATOM   1147 C CE1 . TYR A 1 145 ? 0.98300   66.12800 282.84000 1.000 60.59638  ? 148 TYR A CE1 1 
ATOM   1148 C CE2 . TYR A 1 145 ? -0.42300  67.52500 284.19700 1.000 59.78479  ? 148 TYR A CE2 1 
ATOM   1149 C CZ  . TYR A 1 145 ? 0.07600   66.27800 283.87700 1.000 62.98064  ? 148 TYR A CZ  1 
ATOM   1150 O OH  . TYR A 1 145 ? -0.32000  65.16100 284.56700 1.000 59.18324  ? 148 TYR A OH  1 
ATOM   1151 N N   . ARG A 1 146 ? 1.93700   72.18800 283.42300 1.000 60.68419  ? 149 ARG A N   1 
ATOM   1152 C CA  . ARG A 1 146 ? 1.72100   72.94500 284.64400 1.000 65.32329  ? 149 ARG A CA  1 
ATOM   1153 C C   . ARG A 1 146 ? 0.65600   72.26700 285.49600 1.000 66.17346  ? 149 ARG A C   1 
ATOM   1154 O O   . ARG A 1 146 ? -0.43500  71.94700 285.00900 1.000 65.42630  ? 149 ARG A O   1 
ATOM   1155 C CB  . ARG A 1 146 ? 1.32200   74.37900 284.31600 1.000 64.71058  ? 149 ARG A CB  1 
ATOM   1156 C CG  . ARG A 1 146 ? 2.48900   75.29300 284.05500 1.000 63.51562  ? 149 ARG A CG  1 
ATOM   1157 C CD  . ARG A 1 146 ? 1.99900   76.62100 283.52400 1.000 68.32575  ? 149 ARG A CD  1 
ATOM   1158 N NE  . ARG A 1 146 ? 1.31300   76.46500 282.24700 1.000 65.78725  ? 149 ARG A NE  1 
ATOM   1159 C CZ  . ARG A 1 146 ? 0.65900   77.44100 281.62300 1.000 69.16528  ? 149 ARG A CZ  1 
ATOM   1160 N NH1 . ARG A 1 146 ? 0.59700   78.65200 282.16500 1.000 65.88256  ? 149 ARG A NH1 1 
ATOM   1161 N NH2 . ARG A 1 146 ? 0.06200   77.20600 280.45400 1.000 64.19855  ? 149 ARG A NH2 1 
ATOM   1162 N N   . VAL A 1 147 ? 0.98700   72.03100 286.76300 1.000 63.55075  ? 150 VAL A N   1 
ATOM   1163 C CA  . VAL A 1 147 ? 0.09400   71.37200 287.69900 1.000 59.36648  ? 150 VAL A CA  1 
ATOM   1164 C C   . VAL A 1 147 ? -0.42100  72.40300 288.68900 1.000 64.27704  ? 150 VAL A C   1 
ATOM   1165 O O   . VAL A 1 147 ? 0.05100   73.54200 288.75200 1.000 63.91197  ? 150 VAL A O   1 
ATOM   1166 C CB  . VAL A 1 147 ? 0.78300   70.21700 288.43800 1.000 58.19549  ? 150 VAL A CB  1 
ATOM   1167 C CG1 . VAL A 1 147 ? 0.91600   69.02000 287.53600 1.000 62.68192  ? 150 VAL A CG1 1 
ATOM   1168 C CG2 . VAL A 1 147 ? 2.13800   70.67200 288.91000 1.000 61.74639  ? 150 VAL A CG2 1 
ATOM   1169 N N   . GLY A 1 148 ? -1.40400  71.98700 289.47900 1.000 62.11700  ? 151 GLY A N   1 
ATOM   1170 C CA  . GLY A 1 148 ? -1.78200  72.82200 290.59600 1.000 66.92714  ? 151 GLY A CA  1 
ATOM   1171 C C   . GLY A 1 148 ? -2.64300  73.99400 290.16700 1.000 60.77277  ? 151 GLY A C   1 
ATOM   1172 O O   . GLY A 1 148 ? -3.44300  73.90800 289.24200 1.000 61.55564  ? 151 GLY A O   1 
ATOM   1173 N N   . ALA A 1 149 ? -2.50000  75.10400 290.88300 1.000 66.77783  ? 152 ALA A N   1 
ATOM   1174 C CA  . ALA A 1 149 ? -3.19400  76.31100 290.46500 1.000 65.58535  ? 152 ALA A CA  1 
ATOM   1175 C C   . ALA A 1 149 ? -2.57700  76.87800 289.19700 1.000 64.66700  ? 152 ALA A C   1 
ATOM   1176 O O   . ALA A 1 149 ? -3.27600  77.51500 288.39900 1.000 62.87274  ? 152 ALA A O   1 
ATOM   1177 C CB  . ALA A 1 149 ? -3.17200  77.34400 291.59000 1.000 57.27097  ? 152 ALA A CB  1 
ATOM   1178 N N   . PHE A 1 150 ? -1.27600  76.64400 288.99900 1.000 62.35519  ? 153 PHE A N   1 
ATOM   1179 C CA  . PHE A 1 150 ? -0.55200  77.18000 287.86000 1.000 63.24754  ? 153 PHE A CA  1 
ATOM   1180 C C   . PHE A 1 150 ? -1.06000  76.61300 286.53800 1.000 66.13323  ? 153 PHE A C   1 
ATOM   1181 O O   . PHE A 1 150 ? -0.93700  77.27200 285.49700 1.000 64.63318  ? 153 PHE A O   1 
ATOM   1182 C CB  . PHE A 1 150 ? 0.93900   76.88300 288.02300 1.000 64.75217  ? 153 PHE A CB  1 
ATOM   1183 C CG  . PHE A 1 150 ? 1.48000   77.26100 289.36300 1.000 67.61838  ? 153 PHE A CG  1 
ATOM   1184 C CD1 . PHE A 1 150 ? 1.88200   78.56200 289.61900 1.000 71.35560  ? 153 PHE A CD1 1 
ATOM   1185 C CD2 . PHE A 1 150 ? 1.57700   76.32000 290.37600 1.000 70.42715  ? 153 PHE A CD2 1 
ATOM   1186 C CE1 . PHE A 1 150 ? 2.37400   78.92400 290.86300 1.000 70.50987  ? 153 PHE A CE1 1 
ATOM   1187 C CE2 . PHE A 1 150 ? 2.06600   76.67200 291.61900 1.000 70.62948  ? 153 PHE A CE2 1 
ATOM   1188 C CZ  . PHE A 1 150 ? 2.46800   77.98000 291.86100 1.000 70.62304  ? 153 PHE A CZ  1 
ATOM   1189 N N   . GLY A 1 151 ? -1.63200  75.41500 286.56500 1.000 63.28629  ? 154 GLY A N   1 
ATOM   1190 C CA  . GLY A 1 151 ? -2.13900  74.78700 285.37300 1.000 61.04672  ? 154 GLY A CA  1 
ATOM   1191 C C   . GLY A 1 151 ? -3.64900  74.68300 285.30200 1.000 63.30071  ? 154 GLY A C   1 
ATOM   1192 O O   . GLY A 1 151 ? -4.17600  74.38100 284.22700 1.000 65.44805  ? 154 GLY A O   1 
ATOM   1193 N N   . PHE A 1 152 ? -4.37800  74.91000 286.40500 1.000 57.29929  ? 155 PHE A N   1 
ATOM   1194 C CA  . PHE A 1 152 ? -5.80900  74.65200 286.31000 1.000 55.19646  ? 155 PHE A CA  1 
ATOM   1195 C C   . PHE A 1 152 ? -6.68800  75.63800 287.08300 1.000 58.10666  ? 155 PHE A C   1 
ATOM   1196 O O   . PHE A 1 152 ? -7.85100  75.32200 287.35500 1.000 59.72183  ? 155 PHE A O   1 
ATOM   1197 C CB  . PHE A 1 152 ? -6.08700  73.21300 286.74200 1.000 54.90076  ? 155 PHE A CB  1 
ATOM   1198 C CG  . PHE A 1 152 ? -5.42800  72.18400 285.86100 1.000 59.70379  ? 155 PHE A CG  1 
ATOM   1199 C CD1 . PHE A 1 152 ? -6.01500  71.78900 284.66400 1.000 56.58072  ? 155 PHE A CD1 1 
ATOM   1200 C CD2 . PHE A 1 152 ? -4.20600  71.63200 286.21000 1.000 58.90544  ? 155 PHE A CD2 1 
ATOM   1201 C CE1 . PHE A 1 152 ? -5.40900  70.85900 283.86100 1.000 52.78927  ? 155 PHE A CE1 1 
ATOM   1202 C CE2 . PHE A 1 152 ? -3.58800  70.69300 285.39100 1.000 56.77794  ? 155 PHE A CE2 1 
ATOM   1203 C CZ  . PHE A 1 152 ? -4.19200  70.30700 284.22800 1.000 56.47644  ? 155 PHE A CZ  1 
ATOM   1204 N N   . LEU A 1 153 ? -6.18900  76.82600 287.42400 1.000 58.88451  ? 156 LEU A N   1 
ATOM   1205 C CA  . LEU A 1 153 ? -7.05900  77.87200 287.95900 1.000 64.01911  ? 156 LEU A CA  1 
ATOM   1206 C C   . LEU A 1 153 ? -8.09700  78.25300 286.90800 1.000 63.28920  ? 156 LEU A C   1 
ATOM   1207 O O   . LEU A 1 153 ? -7.75400  78.42500 285.73700 1.000 65.68440  ? 156 LEU A O   1 
ATOM   1208 C CB  . LEU A 1 153 ? -6.22600  79.09100 288.35600 1.000 63.95809  ? 156 LEU A CB  1 
ATOM   1209 C CG  . LEU A 1 153 ? -6.95600  80.18500 289.13700 1.000 67.58391  ? 156 LEU A CG  1 
ATOM   1210 C CD1 . LEU A 1 153 ? -6.97700  79.85900 290.63100 1.000 64.34006  ? 156 LEU A CD1 1 
ATOM   1211 C CD2 . LEU A 1 153 ? -6.32600  81.54800 288.89000 1.000 68.29818  ? 156 LEU A CD2 1 
ATOM   1212 N N   . ALA A 1 154 ? -9.38200  78.37900 287.30500 1.000 62.26845  ? 157 ALA A N   1 
ATOM   1213 C CA  . ALA A 1 154 ? -10.47100 78.42300 286.31000 1.000 64.97943  ? 157 ALA A CA  1 
ATOM   1214 C C   . ALA A 1 154 ? -11.50700 79.53100 286.56600 1.000 70.72331  ? 157 ALA A C   1 
ATOM   1215 O O   . ALA A 1 154 ? -12.62900 79.27400 287.01700 1.000 66.05950  ? 157 ALA A O   1 
ATOM   1216 C CB  . ALA A 1 154 ? -11.14300 77.06100 286.21800 1.000 64.32291  ? 157 ALA A CB  1 
ATOM   1217 N N   . LEU A 1 155 ? -11.15300 80.76100 286.18000 1.000 72.08991  ? 158 LEU A N   1 
ATOM   1218 C CA  . LEU A 1 155 ? -12.11000 81.86700 286.09500 1.000 69.26996  ? 158 LEU A CA  1 
ATOM   1219 C C   . LEU A 1 155 ? -12.63300 81.95900 284.66100 1.000 69.34931  ? 158 LEU A C   1 
ATOM   1220 O O   . LEU A 1 155 ? -12.15300 82.73600 283.84000 1.000 69.13209  ? 158 LEU A O   1 
ATOM   1221 C CB  . LEU A 1 155 ? -11.45400 83.16500 286.54400 1.000 68.07830  ? 158 LEU A CB  1 
ATOM   1222 C CG  . LEU A 1 155 ? -10.88100 83.12800 287.96100 1.000 75.75340  ? 158 LEU A CG  1 
ATOM   1223 C CD1 . LEU A 1 155 ? -9.84900  84.22100 288.14300 1.000 76.76520  ? 158 LEU A CD1 1 
ATOM   1224 C CD2 . LEU A 1 155 ? -11.98100 83.24100 289.01300 1.000 69.61513  ? 158 LEU A CD2 1 
ATOM   1225 N N   . HIS A 1 156 ? -13.66100 81.16300 284.37300 1.000 67.96618  ? 159 HIS A N   1 
ATOM   1226 C CA  . HIS A 1 156 ? -14.20400 81.05600 283.02300 1.000 66.55008  ? 159 HIS A CA  1 
ATOM   1227 C C   . HIS A 1 156 ? -14.81200 82.36800 282.54300 1.000 73.03826  ? 159 HIS A C   1 
ATOM   1228 O O   . HIS A 1 156 ? -15.43700 83.09700 283.31200 1.000 70.42849  ? 159 HIS A O   1 
ATOM   1229 C CB  . HIS A 1 156 ? -15.26900 79.96500 282.96400 1.000 64.11309  ? 159 HIS A CB  1 
ATOM   1230 C CG  . HIS A 1 156 ? -15.89300 79.78600 281.61200 1.000 78.60932  ? 159 HIS A CG  1 
ATOM   1231 N ND1 . HIS A 1 156 ? -15.28000 79.08600 280.58900 1.000 75.48300  ? 159 HIS A ND1 1 
ATOM   1232 C CD2 . HIS A 1 156 ? -17.08500 80.20400 281.12000 1.000 74.93357  ? 159 HIS A CD2 1 
ATOM   1233 C CE1 . HIS A 1 156 ? -16.06900 79.08100 279.52900 1.000 74.71281  ? 159 HIS A CE1 1 
ATOM   1234 N NE2 . HIS A 1 156 ? -17.16900 79.75400 279.82300 1.000 75.82386  ? 159 HIS A NE2 1 
ATOM   1235 N N   . GLY A 1 157 ? -14.67000 82.63800 281.23400 1.000 76.54715  ? 160 GLY A N   1 
ATOM   1236 C CA  . GLY A 1 157 ? -15.04000 83.91500 280.65800 1.000 73.54243  ? 160 GLY A CA  1 
ATOM   1237 C C   . GLY A 1 157 ? -13.94300 84.95600 280.70400 1.000 74.77604  ? 160 GLY A C   1 
ATOM   1238 O O   . GLY A 1 157 ? -14.07200 86.01100 280.06500 1.000 81.84458  ? 160 GLY A O   1 
ATOM   1239 N N   . SER A 1 158 ? -12.88600 84.70100 281.45900 1.000 69.83310  ? 161 SER A N   1 
ATOM   1240 C CA  . SER A 1 158 ? -11.66300 85.47700 281.41700 1.000 74.72718  ? 161 SER A CA  1 
ATOM   1241 C C   . SER A 1 158 ? -10.69300 84.81200 280.45200 1.000 79.05985  ? 161 SER A C   1 
ATOM   1242 O O   . SER A 1 158 ? -10.71000 83.59100 280.27000 1.000 81.40695  ? 161 SER A O   1 
ATOM   1243 C CB  . SER A 1 158 ? -11.04700 85.57700 282.81700 1.000 79.67502  ? 161 SER A CB  1 
ATOM   1244 O OG  . SER A 1 158 ? -9.64600  85.80400 282.77600 1.000 80.85144  ? 161 SER A OG  1 
ATOM   1245 N N   . GLN A 1 159 ? -9.86400  85.62400 279.80900 1.000 76.79482  ? 162 GLN A N   1 
ATOM   1246 C CA  . GLN A 1 159 ? -8.85500  85.09800 278.90500 1.000 81.04536  ? 162 GLN A CA  1 
ATOM   1247 C C   . GLN A 1 159 ? -7.48300  85.08100 279.54600 1.000 80.37698  ? 162 GLN A C   1 
ATOM   1248 O O   . GLN A 1 159 ? -6.51900  84.61500 278.92200 1.000 80.04932  ? 162 GLN A O   1 
ATOM   1249 C CB  . GLN A 1 159 ? -8.83100  85.90000 277.59400 1.000 75.77540  ? 162 GLN A CB  1 
ATOM   1250 C CG  . GLN A 1 159 ? -9.99700  85.57400 276.69100 1.000 72.41496  ? 162 GLN A CG  1 
ATOM   1251 C CD  . GLN A 1 159 ? -10.08800 84.07700 276.41600 1.000 84.08137  ? 162 GLN A CD  1 
ATOM   1252 O OE1 . GLN A 1 159 ? -9.08200  83.43800 276.09400 1.000 82.84399  ? 162 GLN A OE1 1 
ATOM   1253 N NE2 . GLN A 1 159 ? -11.28700 83.50700 276.55900 1.000 80.64154  ? 162 GLN A NE2 1 
ATOM   1254 N N   . GLU A 1 160 ? -7.38000  85.57200 280.78000 1.000 75.03948  ? 163 GLU A N   1 
ATOM   1255 C CA  . GLU A 1 160 ? -6.12900  85.52400 281.52400 1.000 83.27294  ? 163 GLU A CA  1 
ATOM   1256 C C   . GLU A 1 160 ? -5.97900  84.24800 282.34400 1.000 81.67619  ? 163 GLU A C   1 
ATOM   1257 O O   . GLU A 1 160 ? -4.84600  83.80800 282.58500 1.000 81.99388  ? 163 GLU A O   1 
ATOM   1258 C CB  . GLU A 1 160 ? -6.01200  86.74200 282.45000 1.000 84.28370  ? 163 GLU A CB  1 
ATOM   1259 C CG  . GLU A 1 160 ? -6.06100  88.09600 281.74900 1.000 89.76898  ? 163 GLU A CG  1 
ATOM   1260 C CD  . GLU A 1 160 ? -4.81400  88.40700 280.91400 1.000 94.17088  ? 163 GLU A CD  1 
ATOM   1261 O OE1 . GLU A 1 160 ? -3.97900  87.50200 280.66300 1.000 88.95402  ? 163 GLU A OE1 1 
ATOM   1262 O OE2 . GLU A 1 160 ? -4.67200  89.58000 280.50900 1.000 99.45009  ? 163 GLU A OE2 1 
ATOM   1263 N N   . ALA A 1 161 ? -7.09100  83.65600 282.78700 1.000 81.03806  ? 164 ALA A N   1 
ATOM   1264 C CA  . ALA A 1 161 ? -7.08700  82.39600 283.53500 1.000 78.69834  ? 164 ALA A CA  1 
ATOM   1265 C C   . ALA A 1 161 ? -8.30500  81.58300 283.11200 1.000 75.13947  ? 164 ALA A C   1 
ATOM   1266 O O   . ALA A 1 161 ? -9.22600  81.34300 283.90400 1.000 74.00789  ? 164 ALA A O   1 
ATOM   1267 C CB  . ALA A 1 161 ? -7.07200  82.65000 285.04600 1.000 65.37307  ? 164 ALA A CB  1 
ATOM   1268 N N   . PRO A 1 162 ? -8.32800  81.11900 281.85800 1.000 72.32948  ? 165 PRO A N   1 
ATOM   1269 C CA  . PRO A 1 162 ? -9.54100  80.47000 281.33600 1.000 73.18118  ? 165 PRO A CA  1 
ATOM   1270 C C   . PRO A 1 162 ? -9.76200  79.08200 281.89400 1.000 73.20967  ? 165 PRO A C   1 
ATOM   1271 O O   . PRO A 1 162 ? -10.87000 78.54000 281.75800 1.000 74.35485  ? 165 PRO A O   1 
ATOM   1272 C CB  . PRO A 1 162 ? -9.27100  80.40800 279.82800 1.000 72.69726  ? 165 PRO A CB  1 
ATOM   1273 C CG  . PRO A 1 162 ? -7.78600  80.16600 279.76200 1.000 69.83197  ? 165 PRO A CG  1 
ATOM   1274 C CD  . PRO A 1 162 ? -7.17900  80.92900 280.95100 1.000 73.52238  ? 165 PRO A CD  1 
ATOM   1275 N N   . GLY A 1 163 ? -8.73500  78.49100 282.50100 1.000 70.31506  ? 166 GLY A N   1 
ATOM   1276 C CA  . GLY A 1 163 ? -8.74900  77.09700 282.87200 1.000 65.08418  ? 166 GLY A CA  1 
ATOM   1277 C C   . GLY A 1 163 ? -8.08300  76.21100 281.83700 1.000 65.85119  ? 166 GLY A C   1 
ATOM   1278 O O   . GLY A 1 163 ? -7.73400  76.62700 280.73200 1.000 68.10276  ? 166 GLY A O   1 
ATOM   1279 N N   . ASN A 1 164 ? -7.88100  74.95900 282.23400 1.000 64.91035  ? 167 ASN A N   1 
ATOM   1280 C CA  . ASN A 1 164 ? -7.40700  73.86700 281.39400 1.000 59.10842  ? 167 ASN A CA  1 
ATOM   1281 C C   . ASN A 1 164 ? -6.01200  74.07900 280.82500 1.000 62.32211  ? 167 ASN A C   1 
ATOM   1282 O O   . ASN A 1 164 ? -5.59500  73.31100 279.94800 1.000 64.04217  ? 167 ASN A O   1 
ATOM   1283 C CB  . ASN A 1 164 ? -8.37300  73.60400 280.24400 1.000 58.87789  ? 167 ASN A CB  1 
ATOM   1284 C CG  . ASN A 1 164 ? -9.68100  73.05700 280.71100 1.000 66.52716  ? 167 ASN A CG  1 
ATOM   1285 O OD1 . ASN A 1 164 ? -10.68500 73.76200 280.72200 1.000 71.22270  ? 167 ASN A OD1 1 
ATOM   1286 N ND2 . ASN A 1 164 ? -9.69000  71.78700 281.09500 1.000 66.10530  ? 167 ASN A ND2 1 
ATOM   1287 N N   . VAL A 1 165 ? -5.26300  75.08000 281.29500 1.000 58.06380  ? 168 VAL A N   1 
ATOM   1288 C CA  . VAL A 1 165 ? -4.04900  75.41800 280.56000 1.000 61.21587  ? 168 VAL A CA  1 
ATOM   1289 C C   . VAL A 1 165 ? -3.02300  74.29200 280.66100 1.000 59.98368  ? 168 VAL A C   1 
ATOM   1290 O O   . VAL A 1 165 ? -2.22300  74.08900 279.74300 1.000 64.94955  ? 168 VAL A O   1 
ATOM   1291 C CB  . VAL A 1 165 ? -3.47800  76.78100 281.00900 1.000 62.21402  ? 168 VAL A CB  1 
ATOM   1292 C CG1 . VAL A 1 165 ? -4.49200  77.89500 280.74800 1.000 63.93462  ? 168 VAL A CG1 1 
ATOM   1293 C CG2 . VAL A 1 165 ? -3.06400  76.75700 282.45100 1.000 62.78910  ? 168 VAL A CG2 1 
ATOM   1294 N N   . GLY A 1 166 ? -3.05200  73.51300 281.73400 1.000 63.39633  ? 169 GLY A N   1 
ATOM   1295 C CA  . GLY A 1 166 ? -2.12500  72.39800 281.83500 1.000 65.68170  ? 169 GLY A CA  1 
ATOM   1296 C C   . GLY A 1 166 ? -2.36000  71.34000 280.77900 1.000 62.06178  ? 169 GLY A C   1 
ATOM   1297 O O   . GLY A 1 166 ? -1.43700  70.61700 280.39700 1.000 63.43695  ? 169 GLY A O   1 
ATOM   1298 N N   . LEU A 1 167 ? -3.59900  71.21500 280.31300 1.000 59.11041  ? 170 LEU A N   1 
ATOM   1299 C CA  . LEU A 1 167 ? -3.87900  70.33600 279.18700 1.000 60.96527  ? 170 LEU A CA  1 
ATOM   1300 C C   . LEU A 1 167 ? -3.36000  70.94000 277.88600 1.000 61.82728  ? 170 LEU A C   1 
ATOM   1301 O O   . LEU A 1 167 ? -2.83600  70.22600 277.02000 1.000 62.65684  ? 170 LEU A O   1 
ATOM   1302 C CB  . LEU A 1 167 ? -5.38000  70.08400 279.10500 1.000 59.45828  ? 170 LEU A CB  1 
ATOM   1303 C CG  . LEU A 1 167 ? -5.99100  69.22500 280.20000 1.000 55.77053  ? 170 LEU A CG  1 
ATOM   1304 C CD1 . LEU A 1 167 ? -7.49400  69.25600 280.08000 1.000 55.12581  ? 170 LEU A CD1 1 
ATOM   1305 C CD2 . LEU A 1 167 ? -5.46500  67.81300 280.06400 1.000 57.00927  ? 170 LEU A CD2 1 
ATOM   1306 N N   . LEU A 1 168 ? -3.50900  72.25800 277.73400 1.000 62.49958  ? 171 LEU A N   1 
ATOM   1307 C CA  . LEU A 1 168 ? -2.94200  72.95400 276.58600 1.000 59.32186  ? 171 LEU A CA  1 
ATOM   1308 C C   . LEU A 1 168 ? -1.42700  72.83100 276.56700 1.000 62.77159  ? 171 LEU A C   1 
ATOM   1309 O O   . LEU A 1 168 ? -0.82200  72.69500 275.49500 1.000 68.51387  ? 171 LEU A O   1 
ATOM   1310 C CB  . LEU A 1 168 ? -3.36000  74.41800 276.61600 1.000 56.89151  ? 171 LEU A CB  1 
ATOM   1311 C CG  . LEU A 1 168 ? -4.87100  74.61200 276.58400 1.000 58.39875  ? 171 LEU A CG  1 
ATOM   1312 C CD1 . LEU A 1 168 ? -5.21500  76.08400 276.63100 1.000 60.56612  ? 171 LEU A CD1 1 
ATOM   1313 C CD2 . LEU A 1 168 ? -5.48200  73.93000 275.37100 1.000 47.67831  ? 171 LEU A CD2 1 
ATOM   1314 N N   . ASP A 1 169 ? -0.79300  72.90000 277.73900 1.000 59.46337  ? 172 ASP A N   1 
ATOM   1315 C CA  . ASP A 1 169 ? 0.60200   72.49000 277.85800 1.000 63.70047  ? 172 ASP A CA  1 
ATOM   1316 C C   . ASP A 1 169 ? 0.81200   71.12500 277.20900 1.000 62.86622  ? 172 ASP A C   1 
ATOM   1317 O O   . ASP A 1 169 ? 1.66700   70.95400 276.33500 1.000 62.77338  ? 172 ASP A O   1 
ATOM   1318 C CB  . ASP A 1 169 ? 1.02800   72.43800 279.33500 1.000 60.90002  ? 172 ASP A CB  1 
ATOM   1319 C CG  . ASP A 1 169 ? 1.08800   73.80900 280.00300 1.000 64.68486  ? 172 ASP A CG  1 
ATOM   1320 O OD1 . ASP A 1 169 ? 0.95000   74.84900 279.32900 1.000 62.45905  ? 172 ASP A OD1 1 
ATOM   1321 O OD2 . ASP A 1 169 ? 1.27600   73.84500 281.24200 1.000 71.88710  ? 172 ASP A OD2 1 
ATOM   1322 N N   . GLN A 1 170 ? 0.03300   70.13400 277.63600 1.000 60.80813  ? 173 GLN A N   1 
ATOM   1323 C CA  . GLN A 1 170 ? 0.17300   68.80300 277.06700 1.000 60.41152  ? 173 GLN A CA  1 
ATOM   1324 C C   . GLN A 1 170 ? -0.04600  68.84200 275.56400 1.000 62.08960  ? 173 GLN A C   1 
ATOM   1325 O O   . GLN A 1 170 ? 0.70400   68.23700 274.79000 1.000 61.96103  ? 173 GLN A O   1 
ATOM   1326 C CB  . GLN A 1 170 ? -0.82200  67.84600 277.72000 1.000 59.22948  ? 173 GLN A CB  1 
ATOM   1327 C CG  . GLN A 1 170 ? -0.64000  67.60500 279.17300 1.000 57.86334  ? 173 GLN A CG  1 
ATOM   1328 C CD  . GLN A 1 170 ? -1.73000  66.69500 279.70500 1.000 61.96116  ? 173 GLN A CD  1 
ATOM   1329 O OE1 . GLN A 1 170 ? -2.45600  66.07900 278.92400 1.000 61.96121  ? 173 GLN A OE1 1 
ATOM   1330 N NE2 . GLN A 1 170 ? -1.86100  66.61000 281.03000 1.000 57.26450  ? 173 GLN A NE2 1 
ATOM   1331 N N   . ARG A 1 171 ? -1.07900  69.55300 275.13400 1.000 60.72901  ? 174 ARG A N   1 
ATOM   1332 C CA  . ARG A 1 171 ? -1.37800  69.59700 273.71600 1.000 60.18085  ? 174 ARG A CA  1 
ATOM   1333 C C   . ARG A 1 171 ? -0.20800  70.16300 272.92800 1.000 63.42449  ? 174 ARG A C   1 
ATOM   1334 O O   . ARG A 1 171 ? 0.16900   69.61200 271.89000 1.000 64.99427  ? 174 ARG A O   1 
ATOM   1335 C CB  . ARG A 1 171 ? -2.63400  70.42000 273.48800 1.000 58.23213  ? 174 ARG A CB  1 
ATOM   1336 C CG  . ARG A 1 171 ? -3.18300  70.24000 272.12800 1.000 56.37196  ? 174 ARG A CG  1 
ATOM   1337 C CD  . ARG A 1 171 ? -4.27800  71.20400 271.91900 1.000 49.14855  ? 174 ARG A CD  1 
ATOM   1338 N NE  . ARG A 1 171 ? -5.55100  70.60100 272.22900 1.000 45.40943  ? 174 ARG A NE  1 
ATOM   1339 C CZ  . ARG A 1 171 ? -6.66100  71.31100 272.30700 1.000 54.91957  ? 174 ARG A CZ  1 
ATOM   1340 N NH1 . ARG A 1 171 ? -6.59800  72.62700 272.11100 1.000 50.79932  ? 174 ARG A NH1 1 
ATOM   1341 N NH2 . ARG A 1 171 ? -7.81400  70.71700 272.58900 1.000 55.74927  ? 174 ARG A NH2 1 
ATOM   1342 N N   . MET A 1 172 ? 0.39500   71.24900 273.41300 1.000 61.93016  ? 175 MET A N   1 
ATOM   1343 C CA  . MET A 1 172 ? 1.49100   71.85600 272.66800 1.000 61.43534  ? 175 MET A CA  1 
ATOM   1344 C C   . MET A 1 172 ? 2.68300   70.91700 272.57300 1.000 62.95689  ? 175 MET A C   1 
ATOM   1345 O O   . MET A 1 172 ? 3.32300   70.82200 271.52200 1.000 68.61810  ? 175 MET A O   1 
ATOM   1346 C CB  . MET A 1 172 ? 1.89900   73.17300 273.30400 1.000 63.81549  ? 175 MET A CB  1 
ATOM   1347 C CG  . MET A 1 172 ? 2.76000   74.02600 272.40500 1.000 64.59949  ? 175 MET A CG  1 
ATOM   1348 S SD  . MET A 1 172 ? 2.70800   75.74300 272.94000 1.000 72.52848  ? 175 MET A SD  1 
ATOM   1349 C CE  . MET A 1 172 ? 1.16800   76.28800 272.21600 1.000 71.74228  ? 175 MET A CE  1 
ATOM   1350 N N   . ALA A 1 173 ? 2.99500   70.20500 273.65300 1.000 63.99360  ? 176 ALA A N   1 
ATOM   1351 C CA  . ALA A 1 173 ? 4.02600   69.17500 273.56600 1.000 62.03044  ? 176 ALA A CA  1 
ATOM   1352 C C   . ALA A 1 173 ? 3.65300   68.10600 272.54500 1.000 63.91567  ? 176 ALA A C   1 
ATOM   1353 O O   . ALA A 1 173 ? 4.52600   67.56700 271.85700 1.000 67.85186  ? 176 ALA A O   1 
ATOM   1354 C CB  . ALA A 1 173 ? 4.26000   68.54600 274.93300 1.000 57.40044  ? 176 ALA A CB  1 
ATOM   1355 N N   . LEU A 1 174 ? 2.36200   67.78300 272.42600 1.000 62.30899  ? 177 LEU A N   1 
ATOM   1356 C CA  . LEU A 1 174 ? 1.94800   66.79600 271.43200 1.000 63.24578  ? 177 LEU A CA  1 
ATOM   1357 C C   . LEU A 1 174 ? 2.03500   67.36700 270.01700 1.000 65.31060  ? 177 LEU A C   1 
ATOM   1358 O O   . LEU A 1 174 ? 2.33800   66.64200 269.05800 1.000 61.86999  ? 177 LEU A O   1 
ATOM   1359 C CB  . LEU A 1 174 ? 0.53000   66.31500 271.73000 1.000 61.35229  ? 177 LEU A CB  1 
ATOM   1360 C CG  . LEU A 1 174 ? 0.31400   65.30600 272.84700 1.000 65.46418  ? 177 LEU A CG  1 
ATOM   1361 C CD1 . LEU A 1 174 ? -1.11600  64.74600 272.77900 1.000 57.87908  ? 177 LEU A CD1 1 
ATOM   1362 C CD2 . LEU A 1 174 ? 1.37300   64.19300 272.80400 1.000 62.45024  ? 177 LEU A CD2 1 
ATOM   1363 N N   . GLN A 1 175 ? 1.74100   68.65900 269.86900 1.000 66.48153  ? 178 GLN A N   1 
ATOM   1364 C CA  . GLN A 1 175 ? 1.92000   69.32800 268.58900 1.000 69.65628  ? 178 GLN A CA  1 
ATOM   1365 C C   . GLN A 1 175 ? 3.39200   69.37200 268.21000 1.000 70.91825  ? 178 GLN A C   1 
ATOM   1366 O O   . GLN A 1 175 ? 3.74200   69.22300 267.03500 1.000 72.27684  ? 178 GLN A O   1 
ATOM   1367 C CB  . GLN A 1 175 ? 1.33200   70.74100 268.65700 1.000 71.12089  ? 178 GLN A CB  1 
ATOM   1368 C CG  . GLN A 1 175 ? 1.43500   71.56300 267.37700 1.000 73.04167  ? 178 GLN A CG  1 
ATOM   1369 C CD  . GLN A 1 175 ? 0.39800   71.16700 266.33100 1.000 80.33721  ? 178 GLN A CD  1 
ATOM   1370 O OE1 . GLN A 1 175 ? -0.77200  71.56200 266.41500 1.000 81.67964  ? 178 GLN A OE1 1 
ATOM   1371 N NE2 . GLN A 1 175 ? 0.82600   70.39100 265.33200 1.000 75.71315  ? 178 GLN A NE2 1 
ATOM   1372 N N   . TRP A 1 176 ? 4.27000   69.55800 269.19600 1.000 67.44138  ? 179 TRP A N   1 
ATOM   1373 C CA  . TRP A 1 176 ? 5.70000   69.56700 268.91400 1.000 64.57950  ? 179 TRP A CA  1 
ATOM   1374 C C   . TRP A 1 176 ? 6.19200   68.18300 268.50700 1.000 66.28047  ? 179 TRP A C   1 
ATOM   1375 O O   . TRP A 1 176 ? 7.08600   68.06400 267.66500 1.000 67.87088  ? 179 TRP A O   1 
ATOM   1376 C CB  . TRP A 1 176 ? 6.45600   70.07200 270.13400 1.000 60.66188  ? 179 TRP A CB  1 
ATOM   1377 C CG  . TRP A 1 176 ? 7.86000   70.47100 269.88200 1.000 58.25782  ? 179 TRP A CG  1 
ATOM   1378 C CD1 . TRP A 1 176 ? 8.33500   71.74500 269.72600 1.000 59.57079  ? 179 TRP A CD1 1 
ATOM   1379 C CD2 . TRP A 1 176 ? 8.99700   69.60400 269.79100 1.000 59.35199  ? 179 TRP A CD2 1 
ATOM   1380 N NE1 . TRP A 1 176 ? 9.69700   71.72100 269.51700 1.000 63.77965  ? 179 TRP A NE1 1 
ATOM   1381 C CE2 . TRP A 1 176 ? 10.12700  70.41800 269.55600 1.000 61.70563  ? 179 TRP A CE2 1 
ATOM   1382 C CE3 . TRP A 1 176 ? 9.17200   68.22000 269.88500 1.000 58.53358  ? 179 TRP A CE3 1 
ATOM   1383 C CZ2 . TRP A 1 176 ? 11.40800  69.89200 269.41100 1.000 56.76578  ? 179 TRP A CZ2 1 
ATOM   1384 C CZ3 . TRP A 1 176 ? 10.45400  67.69800 269.73900 1.000 57.56170  ? 179 TRP A CZ3 1 
ATOM   1385 C CH2 . TRP A 1 176 ? 11.54900  68.53000 269.50800 1.000 56.34828  ? 179 TRP A CH2 1 
ATOM   1386 N N   . VAL A 1 177 ? 5.63400   67.12200 269.09400 1.000 64.25367  ? 180 VAL A N   1 
ATOM   1387 C CA  . VAL A 1 177 ? 6.01700   65.77900 268.66700 1.000 62.95886  ? 180 VAL A CA  1 
ATOM   1388 C C   . VAL A 1 177 ? 5.53500   65.52000 267.24900 1.000 66.28651  ? 180 VAL A C   1 
ATOM   1389 O O   . VAL A 1 177 ? 6.25100   64.92800 266.43300 1.000 67.36453  ? 180 VAL A O   1 
ATOM   1390 C CB  . VAL A 1 177 ? 5.47400   64.72400 269.64600 1.000 61.91216  ? 180 VAL A CB  1 
ATOM   1391 C CG1 . VAL A 1 177 ? 5.76500   63.31200 269.14800 1.000 59.12962  ? 180 VAL A CG1 1 
ATOM   1392 C CG2 . VAL A 1 177 ? 6.07700   64.93400 270.99900 1.000 60.31399  ? 180 VAL A CG2 1 
ATOM   1393 N N   . HIS A 1 178 ? 4.31300   65.95100 266.93300 1.000 68.06796  ? 181 HIS A N   1 
ATOM   1394 C CA  . HIS A 1 178 ? 3.79200   65.75500 265.58600 1.000 63.16822  ? 181 HIS A CA  1 
ATOM   1395 C C   . HIS A 1 178 ? 4.66900   66.46600 264.56500 1.000 67.91047  ? 181 HIS A C   1 
ATOM   1396 O O   . HIS A 1 178 ? 4.95900   65.91900 263.49600 1.000 70.38392  ? 181 HIS A O   1 
ATOM   1397 C CB  . HIS A 1 178 ? 2.34700   66.25400 265.52400 1.000 63.91327  ? 181 HIS A CB  1 
ATOM   1398 C CG  . HIS A 1 178 ? 1.75100   66.26000 264.14700 1.000 76.85481  ? 181 HIS A CG  1 
ATOM   1399 N ND1 . HIS A 1 178 ? 0.97400   65.22500 263.66800 1.000 74.82019  ? 181 HIS A ND1 1 
ATOM   1400 C CD2 . HIS A 1 178 ? 1.80100   67.18500 263.15500 1.000 70.61284  ? 181 HIS A CD2 1 
ATOM   1401 C CE1 . HIS A 1 178 ? 0.58600   65.50300 262.43600 1.000 77.66378  ? 181 HIS A CE1 1 
ATOM   1402 N NE2 . HIS A 1 178 ? 1.07400   66.68600 262.10100 1.000 76.54181  ? 181 HIS A NE2 1 
ATOM   1403 N N   . ASP A 1 179 ? 5.13600   67.67100 264.89500 1.000 68.02888  ? 182 ASP A N   1 
ATOM   1404 C CA  . ASP A 1 179 ? 5.89000   68.47000 263.93900 1.000 62.42306  ? 182 ASP A CA  1 
ATOM   1405 C C   . ASP A 1 179 ? 7.33500   68.01600 263.80500 1.000 67.18234  ? 182 ASP A C   1 
ATOM   1406 O O   . ASP A 1 179 ? 7.90900   68.12400 262.71500 1.000 72.19053  ? 182 ASP A O   1 
ATOM   1407 C CB  . ASP A 1 179 ? 5.84200   69.94800 264.33000 1.000 59.52081  ? 182 ASP A CB  1 
ATOM   1408 C CG  . ASP A 1 179 ? 4.43100   70.51600 264.27700 1.000 67.75951  ? 182 ASP A CG  1 
ATOM   1409 O OD1 . ASP A 1 179 ? 3.48300   69.73000 264.04800 1.000 72.50476  ? 182 ASP A OD1 1 
ATOM   1410 O OD2 . ASP A 1 179 ? 4.25800   71.74000 264.45500 1.000 62.71761  ? 182 ASP A OD2 1 
ATOM   1411 N N   . ASN A 1 180 ? 7.93800   67.48500 264.86400 1.000 62.55764  ? 183 ASN A N   1 
ATOM   1412 C CA  . ASN A 1 180 ? 9.38200   67.32900 264.88700 1.000 61.51806  ? 183 ASN A CA  1 
ATOM   1413 C C   . ASN A 1 180 ? 9.90000   65.93200 265.17500 1.000 64.74225  ? 183 ASN A C   1 
ATOM   1414 O O   . ASN A 1 180 ? 11.12000  65.74900 265.14900 1.000 68.86468  ? 183 ASN A O   1 
ATOM   1415 C CB  . ASN A 1 180 ? 9.99800   68.27300 265.92500 1.000 60.79856  ? 183 ASN A CB  1 
ATOM   1416 C CG  . ASN A 1 180 ? 9.76400   69.71400 265.59400 1.000 65.77234  ? 183 ASN A CG  1 
ATOM   1417 O OD1 . ASN A 1 180 ? 10.53000  70.31700 264.84100 1.000 69.48115  ? 183 ASN A OD1 1 
ATOM   1418 N ND2 . ASN A 1 180 ? 8.70700   70.28900 266.15200 1.000 64.03466  ? 183 ASN A ND2 1 
ATOM   1419 N N   . ILE A 1 181 ? 9.04800   64.94900 265.47500 1.000 65.41014  ? 184 ILE A N   1 
ATOM   1420 C CA  . ILE A 1 181 ? 9.60900   63.67800 265.92400 1.000 66.06582  ? 184 ILE A CA  1 
ATOM   1421 C C   . ILE A 1 181 ? 10.26300  62.93500 264.75400 1.000 70.24132  ? 184 ILE A C   1 
ATOM   1422 O O   . ILE A 1 181 ? 11.09400  62.04400 264.97000 1.000 68.05981  ? 184 ILE A O   1 
ATOM   1423 C CB  . ILE A 1 181 ? 8.53500   62.83900 266.65300 1.000 61.63719  ? 184 ILE A CB  1 
ATOM   1424 C CG1 . ILE A 1 181 ? 9.17000   61.72500 267.48100 1.000 64.27870  ? 184 ILE A CG1 1 
ATOM   1425 C CG2 . ILE A 1 181 ? 7.54600   62.23200 265.69000 1.000 65.65524  ? 184 ILE A CG2 1 
ATOM   1426 C CD1 . ILE A 1 181 ? 9.91100   62.19900 268.69300 1.000 59.88009  ? 184 ILE A CD1 1 
ATOM   1427 N N   . GLN A 1 182 ? 9.94800   63.32900 263.51300 1.000 71.25786  ? 185 GLN A N   1 
ATOM   1428 C CA  . GLN A 1 182 ? 10.54800  62.69800 262.34000 1.000 70.83949  ? 185 GLN A CA  1 
ATOM   1429 C C   . GLN A 1 182 ? 12.05700  62.93800 262.27500 1.000 72.57639  ? 185 GLN A C   1 
ATOM   1430 O O   . GLN A 1 182 ? 12.80600  62.07100 261.80200 1.000 71.64994  ? 185 GLN A O   1 
ATOM   1431 C CB  . GLN A 1 182 ? 9.85500   63.20900 261.07300 1.000 66.71839  ? 185 GLN A CB  1 
ATOM   1432 C CG  . GLN A 1 182 ? 9.97000   64.71800 260.88300 1.000 70.07844  ? 185 GLN A CG  1 
ATOM   1433 C CD  . GLN A 1 182 ? 9.03000   65.26200 259.82400 1.000 75.08036  ? 185 GLN A CD  1 
ATOM   1434 O OE1 . GLN A 1 182 ? 7.81300   65.17600 259.96100 1.000 79.77195  ? 185 GLN A OE1 1 
ATOM   1435 N NE2 . GLN A 1 182 ? 9.59100   65.84000 258.76900 1.000 71.93702  ? 185 GLN A NE2 1 
ATOM   1436 N N   . PHE A 1 183 ? 12.52700  64.09000 262.75400 1.000 69.92445  ? 186 PHE A N   1 
ATOM   1437 C CA  . PHE A 1 183 ? 13.95900  64.35000 262.78900 1.000 69.73023  ? 186 PHE A CA  1 
ATOM   1438 C C   . PHE A 1 183 ? 14.67700  63.54800 263.86300 1.000 73.87442  ? 186 PHE A C   1 
ATOM   1439 O O   . PHE A 1 183 ? 15.91100  63.54500 263.89900 1.000 76.91547  ? 186 PHE A O   1 
ATOM   1440 C CB  . PHE A 1 183 ? 14.20600  65.84000 262.98600 1.000 65.16529  ? 186 PHE A CB  1 
ATOM   1441 C CG  . PHE A 1 183 ? 13.49300  66.67600 261.98900 1.000 68.31214  ? 186 PHE A CG  1 
ATOM   1442 C CD1 . PHE A 1 183 ? 13.71400  66.48400 260.63600 1.000 67.98936  ? 186 PHE A CD1 1 
ATOM   1443 C CD2 . PHE A 1 183 ? 12.57900  67.62800 262.38400 1.000 68.22799  ? 186 PHE A CD2 1 
ATOM   1444 C CE1 . PHE A 1 183 ? 13.04700  67.23700 259.69600 1.000 67.73779  ? 186 PHE A CE1 1 
ATOM   1445 C CE2 . PHE A 1 183 ? 11.90500  68.39300 261.44100 1.000 69.95460  ? 186 PHE A CE2 1 
ATOM   1446 C CZ  . PHE A 1 183 ? 12.14000  68.19500 260.09800 1.000 66.44187  ? 186 PHE A CZ  1 
ATOM   1447 N N   . PHE A 1 184 ? 13.94400  62.88000 264.74500 1.000 76.10457  ? 187 PHE A N   1 
ATOM   1448 C CA  . PHE A 1 184 ? 14.53800  61.94700 265.68400 1.000 72.58394  ? 187 PHE A CA  1 
ATOM   1449 C C   . PHE A 1 184 ? 14.30400  60.51100 265.27000 1.000 70.84987  ? 187 PHE A C   1 
ATOM   1450 O O   . PHE A 1 184 ? 14.50100  59.60800 266.08500 1.000 73.20358  ? 187 PHE A O   1 
ATOM   1451 C CB  . PHE A 1 184 ? 13.98400  62.17100 267.09100 1.000 68.04344  ? 187 PHE A CB  1 
ATOM   1452 C CG  . PHE A 1 184 ? 14.27800  63.52100 267.65200 1.000 63.60518  ? 187 PHE A CG  1 
ATOM   1453 C CD1 . PHE A 1 184 ? 13.46800  64.59800 267.34400 1.000 61.94529  ? 187 PHE A CD1 1 
ATOM   1454 C CD2 . PHE A 1 184 ? 15.35000  63.71100 268.50700 1.000 64.10412  ? 187 PHE A CD2 1 
ATOM   1455 C CE1 . PHE A 1 184 ? 13.72400  65.84600 267.87200 1.000 64.56610  ? 187 PHE A CE1 1 
ATOM   1456 C CE2 . PHE A 1 184 ? 15.61500  64.95800 269.03600 1.000 62.03268  ? 187 PHE A CE2 1 
ATOM   1457 C CZ  . PHE A 1 184 ? 14.80100  66.02900 268.71900 1.000 60.51101  ? 187 PHE A CZ  1 
ATOM   1458 N N   . GLY A 1 185 ? 13.86600  60.28200 264.03400 1.000 71.28717  ? 188 GLY A N   1 
ATOM   1459 C CA  . GLY A 1 185 ? 13.56100  58.93900 263.57700 1.000 73.85296  ? 188 GLY A CA  1 
ATOM   1460 C C   . GLY A 1 185 ? 12.23600  58.39700 264.05600 1.000 73.19028  ? 188 GLY A C   1 
ATOM   1461 O O   . GLY A 1 185 ? 12.02900  57.17400 264.03500 1.000 74.34247  ? 188 GLY A O   1 
ATOM   1462 N N   . GLY A 1 186 ? 11.33200  59.26800 264.49000 1.000 67.52878  ? 189 GLY A N   1 
ATOM   1463 C CA  . GLY A 1 186 ? 10.01200  58.86100 264.92500 1.000 67.11648  ? 189 GLY A CA  1 
ATOM   1464 C C   . GLY A 1 186 ? 9.00200   59.01800 263.80000 1.000 73.02108  ? 189 GLY A C   1 
ATOM   1465 O O   . GLY A 1 186 ? 9.05500   59.97900 263.03000 1.000 73.62626  ? 189 GLY A O   1 
ATOM   1466 N N   . ASP A 1 187 ? 8.08900   58.05500 263.71400 1.000 71.25071  ? 190 ASP A N   1 
ATOM   1467 C CA  . ASP A 1 187 ? 6.98100   58.12900 262.77000 1.000 70.71279  ? 190 ASP A CA  1 
ATOM   1468 C C   . ASP A 1 187 ? 5.84800   58.97200 263.34800 1.000 70.06254  ? 190 ASP A C   1 
ATOM   1469 O O   . ASP A 1 187 ? 5.10200   58.48600 264.20300 1.000 65.31268  ? 190 ASP A O   1 
ATOM   1470 C CB  . ASP A 1 187 ? 6.48300   56.72100 262.44200 1.000 75.66198  ? 190 ASP A CB  1 
ATOM   1471 C CG  . ASP A 1 187 ? 5.34900   56.72300 261.43700 1.000 73.35394  ? 190 ASP A CG  1 
ATOM   1472 O OD1 . ASP A 1 187 ? 5.12700   57.77700 260.81500 1.000 69.11953  ? 190 ASP A OD1 1 
ATOM   1473 O OD2 . ASP A 1 187 ? 4.68400   55.67700 261.27800 1.000 71.20557  ? 190 ASP A OD2 1 
ATOM   1474 N N   . PRO A 1 188 ? 5.65800   60.21800 262.89800 1.000 69.51460  ? 191 PRO A N   1 
ATOM   1475 C CA  . PRO A 1 188 ? 4.66800   61.09400 263.54000 1.000 71.22820  ? 191 PRO A CA  1 
ATOM   1476 C C   . PRO A 1 188 ? 3.22200   60.69400 263.30100 1.000 68.42228  ? 191 PRO A C   1 
ATOM   1477 O O   . PRO A 1 188 ? 2.32200   61.41000 263.74800 1.000 66.81771  ? 191 PRO A O   1 
ATOM   1478 C CB  . PRO A 1 188 ? 4.96700   62.46300 262.91200 1.000 67.70905  ? 191 PRO A CB  1 
ATOM   1479 C CG  . PRO A 1 188 ? 5.49700   62.15100 261.62200 1.000 58.59608  ? 191 PRO A CG  1 
ATOM   1480 C CD  . PRO A 1 188 ? 6.31300   60.89500 261.77500 1.000 65.04992  ? 191 PRO A CD  1 
ATOM   1481 N N   . LYS A 1 189 ? 3.02900   59.57300 262.66200 1.000 73.35612  ? 192 LYS A N   1 
ATOM   1482 C CA  . LYS A 1 189 ? 1.71500   59.06300 262.41500 1.000 74.14913  ? 192 LYS A CA  1 
ATOM   1483 C C   . LYS A 1 189 ? 1.53300   57.76200 263.12800 1.000 69.74197  ? 192 LYS A C   1 
ATOM   1484 O O   . LYS A 1 189 ? 0.77400   56.93600 262.73700 1.000 71.47426  ? 192 LYS A O   1 
ATOM   1485 C CB  . LYS A 1 189 ? 1.42000   58.95600 260.94000 1.000 73.49499  ? 192 LYS A CB  1 
ATOM   1486 C CG  . LYS A 1 189 ? 2.43600   58.22100 260.11800 1.000 72.39524  ? 192 LYS A CG  1 
ATOM   1487 C CD  . LYS A 1 189 ? 1.94400   58.20000 258.69200 1.000 82.28263  ? 192 LYS A CD  1 
ATOM   1488 C CE  . LYS A 1 189 ? 3.02900   57.87800 257.69200 1.000 75.77644  ? 192 LYS A CE  1 
ATOM   1489 N NZ  . LYS A 1 189 ? 2.40900   57.70800 256.36100 1.000 78.50580  ? 192 LYS A NZ  1 
ATOM   1490 N N   . THR A 1 190 ? 2.30000   57.60200 264.16700 1.000 73.08883  ? 193 THR A N   1 
ATOM   1491 C CA  . THR A 1 190 ? 2.20700   56.43600 264.96300 1.000 72.27317  ? 193 THR A CA  1 
ATOM   1492 C C   . THR A 1 190 ? 2.63200   56.78500 266.34600 1.000 68.24582  ? 193 THR A C   1 
ATOM   1493 O O   . THR A 1 190 ? 3.53300   56.21800 266.87300 1.000 66.28073  ? 193 THR A O   1 
ATOM   1494 C CB  . THR A 1 190 ? 3.04700   55.34600 264.36300 1.000 67.68448  ? 193 THR A CB  1 
ATOM   1495 O OG1 . THR A 1 190 ? 2.45800   55.01200 263.12200 1.000 76.25775  ? 193 THR A OG1 1 
ATOM   1496 C CG2 . THR A 1 190 ? 3.00400   54.16900 265.19700 1.000 70.36704  ? 193 THR A CG2 1 
ATOM   1497 N N   . VAL A 1 191 ? 1.93600   57.72400 266.93300 1.000 63.31085  ? 194 VAL A N   1 
ATOM   1498 C CA  . VAL A 1 191 ? 2.23300   58.15100 268.24600 1.000 65.17465  ? 194 VAL A CA  1 
ATOM   1499 C C   . VAL A 1 191 ? 1.19300   57.63400 269.15100 1.000 59.85952  ? 194 VAL A C   1 
ATOM   1500 O O   . VAL A 1 191 ? 0.04800   57.86200 268.94500 1.000 61.37799  ? 194 VAL A O   1 
ATOM   1501 C CB  . VAL A 1 191 ? 2.10700   59.64300 268.30500 1.000 65.16632  ? 194 VAL A CB  1 
ATOM   1502 C CG1 . VAL A 1 191 ? 2.40900   60.15500 269.68000 1.000 58.25922  ? 194 VAL A CG1 1 
ATOM   1503 C CG2 . VAL A 1 191 ? 3.06100   60.25300 267.33200 1.000 65.43223  ? 194 VAL A CG2 1 
ATOM   1504 N N   . THR A 1 192 ? 1.61300   56.94700 270.18100 1.000 59.73466  ? 195 THR A N   1 
ATOM   1505 C CA  . THR A 1 192 ? 0.70000   56.42700 271.14200 1.000 65.17643  ? 195 THR A CA  1 
ATOM   1506 C C   . THR A 1 192 ? 0.93500   57.21200 272.38800 1.000 60.13355  ? 195 THR A C   1 
ATOM   1507 O O   . THR A 1 192 ? 2.02000   57.26100 272.85400 1.000 54.98901  ? 195 THR A O   1 
ATOM   1508 C CB  . THR A 1 192 ? 1.01300   54.97400 271.42100 1.000 62.36354  ? 195 THR A CB  1 
ATOM   1509 O OG1 . THR A 1 192 ? 0.88800   54.24500 270.21700 1.000 68.02178  ? 195 THR A OG1 1 
ATOM   1510 C CG2 . THR A 1 192 ? 0.07800   54.43700 272.36700 1.000 60.76795  ? 195 THR A CG2 1 
ATOM   1511 N N   . ILE A 1 193 ? -0.09700  57.82500 272.93300 1.000 57.61996  ? 196 ILE A N   1 
ATOM   1512 C CA  . ILE A 1 193 ? 0.05300   58.56800 274.14000 1.000 60.39226  ? 196 ILE A CA  1 
ATOM   1513 C C   . ILE A 1 193 ? -0.43100  57.70900 275.23600 1.000 58.03736  ? 196 ILE A C   1 
ATOM   1514 O O   . ILE A 1 193 ? -1.43300  57.08800 275.12400 1.000 57.44002  ? 196 ILE A O   1 
ATOM   1515 C CB  . ILE A 1 193 ? -0.74900  59.83600 274.14800 1.000 56.26775  ? 196 ILE A CB  1 
ATOM   1516 C CG1 . ILE A 1 193 ? -2.19900  59.54200 273.95000 1.000 55.75317  ? 196 ILE A CG1 1 
ATOM   1517 C CG2 . ILE A 1 193 ? -0.28500  60.74100 273.06000 1.000 59.50701  ? 196 ILE A CG2 1 
ATOM   1518 C CD1 . ILE A 1 193 ? -3.02300  60.78600 274.01900 1.000 47.27606  ? 196 ILE A CD1 1 
ATOM   1519 N N   . PHE A 1 194 ? 0.32700   57.65400 276.29900 1.000 55.84899  ? 197 PHE A N   1 
ATOM   1520 C CA  . PHE A 1 194 ? -0.07200  56.85300 277.45300 1.000 55.47147  ? 197 PHE A CA  1 
ATOM   1521 C C   . PHE A 1 194 ? 0.17800   57.63200 278.73600 1.000 58.42564  ? 197 PHE A C   1 
ATOM   1522 O O   . PHE A 1 194 ? 1.00000   58.55300 278.79000 1.000 61.77383  ? 197 PHE A O   1 
ATOM   1523 C CB  . PHE A 1 194 ? 0.61100   55.46600 277.50600 1.000 52.68915  ? 197 PHE A CB  1 
ATOM   1524 C CG  . PHE A 1 194 ? 2.12100   55.48000 277.60900 1.000 55.55066  ? 197 PHE A CG  1 
ATOM   1525 C CD1 . PHE A 1 194 ? 2.89900   56.37900 276.89800 1.000 55.76905  ? 197 PHE A CD1 1 
ATOM   1526 C CD2 . PHE A 1 194 ? 2.76900   54.52700 278.39600 1.000 58.18469  ? 197 PHE A CD2 1 
ATOM   1527 C CE1 . PHE A 1 194 ? 4.29300   56.35400 277.00300 1.000 59.34387  ? 197 PHE A CE1 1 
ATOM   1528 C CE2 . PHE A 1 194 ? 4.16500   54.48700 278.50100 1.000 53.96851  ? 197 PHE A CE2 1 
ATOM   1529 C CZ  . PHE A 1 194 ? 4.92900   55.40100 277.81100 1.000 54.04408  ? 197 PHE A CZ  1 
ATOM   1530 N N   . GLY A 1 195 ? -0.57800  57.27500 279.76700 1.000 59.75683  ? 198 GLY A N   1 
ATOM   1531 C CA  . GLY A 1 195 ? -0.43500  57.92900 281.05500 1.000 55.27672  ? 198 GLY A CA  1 
ATOM   1532 C C   . GLY A 1 195 ? -1.09000  57.11100 282.14100 1.000 58.08082  ? 198 GLY A C   1 
ATOM   1533 O O   . GLY A 1 195 ? -1.87100  56.18600 281.88600 1.000 53.27656  ? 198 GLY A O   1 
ATOM   1534 N N   . GLU A 1 196 ? -0.80300  57.50000 283.36700 1.000 61.93372  ? 199 GLU A N   1 
ATOM   1535 C CA  . GLU A 1 196 ? -1.40200  56.86400 284.50500 1.000 58.90931  ? 199 GLU A CA  1 
ATOM   1536 C C   . GLU A 1 196 ? -2.02400  57.87400 285.40500 1.000 57.19412  ? 199 GLU A C   1 
ATOM   1537 O O   . GLU A 1 196 ? -1.64400  58.99200 285.44100 1.000 60.89247  ? 199 GLU A O   1 
ATOM   1538 C CB  . GLU A 1 196 ? -0.44600  55.94900 285.25200 1.000 57.27603  ? 199 GLU A CB  1 
ATOM   1539 C CG  . GLU A 1 196 ? 0.19800   56.49400 286.49600 1.000 62.97821  ? 199 GLU A CG  1 
ATOM   1540 C CD  . GLU A 1 196 ? -0.42900  56.00900 287.74800 1.000 67.48305  ? 199 GLU A CD  1 
ATOM   1541 O OE1 . GLU A 1 196 ? -0.49200  56.78900 288.67800 1.000 61.66001  ? 199 GLU A OE1 1 
ATOM   1542 O OE2 . GLU A 1 196 ? -0.82700  54.85800 287.81000 1.000 78.20384  ? 199 GLU A OE2 1 
ATOM   1543 N N   . SER A 1 197 ? -3.00800  57.43900 286.13500 1.000 59.23031  ? 200 SER A N   1 
ATOM   1544 C CA  . SER A 1 197 ? -3.71300  58.29000 287.05500 1.000 60.63589  ? 200 SER A CA  1 
ATOM   1545 C C   . SER A 1 197 ? -4.13900  59.49800 286.31700 1.000 57.05970  ? 200 SER A C   1 
ATOM   1546 O O   . SER A 1 197 ? -4.69500  59.37200 285.28100 1.000 62.71716  ? 200 SER A O   1 
ATOM   1547 C CB  . SER A 1 197 ? -2.79600  58.61100 288.22700 1.000 63.50746  ? 200 SER A CB  1 
ATOM   1548 O OG  . SER A 1 197 ? -3.33200  59.59000 289.08300 1.000 67.46623  ? 200 SER A OG  1 
ATOM   1549 N N   . ALA A 1 198 ? -3.85400  60.66900 286.82600 1.000 48.42931  ? 201 ALA A N   1 
ATOM   1550 C CA  . ALA A 1 198 ? -4.19900  61.87500 286.16000 1.000 55.23275  ? 201 ALA A CA  1 
ATOM   1551 C C   . ALA A 1 198 ? -3.69400  61.84300 284.76200 1.000 59.40257  ? 201 ALA A C   1 
ATOM   1552 O O   . ALA A 1 198 ? -4.28900  62.38300 283.89400 1.000 53.74454  ? 201 ALA A O   1 
ATOM   1553 C CB  . ALA A 1 198 ? -3.61300  63.02600 286.89400 1.000 51.75737  ? 201 ALA A CB  1 
ATOM   1554 N N   . GLY A 1 199 ? -2.57900  61.19900 284.53100 1.000 59.19015  ? 202 GLY A N   1 
ATOM   1555 C CA  . GLY A 1 199 ? -2.08200  61.13100 283.17100 1.000 57.79619  ? 202 GLY A CA  1 
ATOM   1556 C C   . GLY A 1 199 ? -2.91800  60.24700 282.27700 1.000 60.15875  ? 202 GLY A C   1 
ATOM   1557 O O   . GLY A 1 199 ? -3.03200  60.51400 281.07400 1.000 57.79295  ? 202 GLY A O   1 
ATOM   1558 N N   . GLY A 1 200 ? -3.49800  59.18400 282.83600 1.000 54.41926  ? 203 GLY A N   1 
ATOM   1559 C CA  . GLY A 1 200 ? -4.46400  58.40500 282.08700 1.000 52.28981  ? 203 GLY A CA  1 
ATOM   1560 C C   . GLY A 1 200 ? -5.75900  59.16300 281.87700 1.000 54.90916  ? 203 GLY A C   1 
ATOM   1561 O O   . GLY A 1 200 ? -6.40800  59.01700 280.84200 1.000 57.92629  ? 203 GLY A O   1 
ATOM   1562 N N   . ALA A 1 201 ? -6.15200  60.00000 282.83500 1.000 57.79795  ? 204 ALA A N   1 
ATOM   1563 C CA  . ALA A 1 201 ? -7.33200  60.81800 282.58400 1.000 59.25219  ? 204 ALA A CA  1 
ATOM   1564 C C   . ALA A 1 201 ? -7.04500  61.87500 281.52100 1.000 57.11346  ? 204 ALA A C   1 
ATOM   1565 O O   . ALA A 1 201 ? -7.93400  62.22600 280.73800 1.000 59.50894  ? 204 ALA A O   1 
ATOM   1566 C CB  . ALA A 1 201 ? -7.82800  61.45400 283.88500 1.000 52.03703  ? 204 ALA A CB  1 
ATOM   1567 N N   . SER A 1 202 ? -5.81000  62.37100 281.46700 1.000 52.09827  ? 205 SER A N   1 
ATOM   1568 C CA  . SER A 1 202 ? -5.40500  63.28500 280.40900 1.000 56.72542  ? 205 SER A CA  1 
ATOM   1569 C C   . SER A 1 202 ? -5.45600  62.60600 279.03600 1.000 61.07063  ? 205 SER A C   1 
ATOM   1570 O O   . SER A 1 202 ? -5.99900  63.16000 278.07000 1.000 59.34512  ? 205 SER A O   1 
ATOM   1571 C CB  . SER A 1 202 ? -3.99500  63.80400 280.70700 1.000 56.63818  ? 205 SER A CB  1 
ATOM   1572 O OG  . SER A 1 202 ? -3.99100  64.74200 281.76400 1.000 56.53577  ? 205 SER A OG  1 
ATOM   1573 N N   . VAL A 1 203 ? -4.87900  61.40600 278.93300 1.000 59.63537  ? 206 VAL A N   1 
ATOM   1574 C CA  . VAL A 1 203 ? -4.86300  60.67700 277.67200 1.000 50.86317  ? 206 VAL A CA  1 
ATOM   1575 C C   . VAL A 1 203 ? -6.27700  60.53900 277.13600 1.000 56.89004  ? 206 VAL A C   1 
ATOM   1576 O O   . VAL A 1 203 ? -6.54700  60.79600 275.95700 1.000 65.21125  ? 206 VAL A O   1 
ATOM   1577 C CB  . VAL A 1 203 ? -4.19000  59.31100 277.86800 1.000 53.08969  ? 206 VAL A CB  1 
ATOM   1578 C CG1 . VAL A 1 203 ? -4.66300  58.32800 276.83600 1.000 55.33554  ? 206 VAL A CG1 1 
ATOM   1579 C CG2 . VAL A 1 203 ? -2.67700  59.47700 277.81400 1.000 52.20719  ? 206 VAL A CG2 1 
ATOM   1580 N N   . GLY A 1 204 ? -7.20900  60.15900 278.00400 1.000 55.79497  ? 207 GLY A N   1 
ATOM   1581 C CA  . GLY A 1 204 ? -8.59600  60.05600 277.59900 1.000 55.16459  ? 207 GLY A CA  1 
ATOM   1582 C C   . GLY A 1 204 ? -9.26600  61.39000 277.38100 1.000 59.35129  ? 207 GLY A C   1 
ATOM   1583 O O   . GLY A 1 204 ? -10.29400 61.44900 276.69700 1.000 63.48838  ? 207 GLY A O   1 
ATOM   1584 N N   . MET A 1 205 ? -8.72600  62.46400 277.96000 1.000 57.82891  ? 208 MET A N   1 
ATOM   1585 C CA  . MET A 1 205 ? -9.28500  63.78400 277.68100 1.000 58.78029  ? 208 MET A CA  1 
ATOM   1586 C C   . MET A 1 205 ? -8.92100  64.24300 276.27700 1.000 63.20135  ? 208 MET A C   1 
ATOM   1587 O O   . MET A 1 205 ? -9.75000  64.83100 275.57200 1.000 65.66694  ? 208 MET A O   1 
ATOM   1588 C CB  . MET A 1 205 ? -8.81400  64.80000 278.71500 1.000 54.18847  ? 208 MET A CB  1 
ATOM   1589 C CG  . MET A 1 205 ? -9.59900  64.74500 280.00500 1.000 62.43447  ? 208 MET A CG  1 
ATOM   1590 S SD  . MET A 1 205 ? -8.84500  65.54900 281.45100 1.000 61.55664  ? 208 MET A SD  1 
ATOM   1591 C CE  . MET A 1 205 ? -10.27600 65.61900 282.51300 1.000 54.65856  ? 208 MET A CE  1 
ATOM   1592 N N   . HIS A 1 206 ? -7.68700  63.97800 275.84900 1.000 58.91831  ? 209 HIS A N   1 
ATOM   1593 C CA  . HIS A 1 206 ? -7.29900  64.29200 274.48100 1.000 60.91503  ? 209 HIS A CA  1 
ATOM   1594 C C   . HIS A 1 206 ? -8.07700  63.45900 273.46300 1.000 63.27487  ? 209 HIS A C   1 
ATOM   1595 O O   . HIS A 1 206 ? -8.24100  63.88600 272.31100 1.000 60.93492  ? 209 HIS A O   1 
ATOM   1596 C CB  . HIS A 1 206 ? -5.78800  64.09700 274.33100 1.000 59.82316  ? 209 HIS A CB  1 
ATOM   1597 C CG  . HIS A 1 206 ? -4.97800  65.08100 275.12300 1.000 61.10899  ? 209 HIS A CG  1 
ATOM   1598 N ND1 . HIS A 1 206 ? -5.15600  66.44600 275.01600 1.000 64.73711  ? 209 HIS A ND1 1 
ATOM   1599 C CD2 . HIS A 1 206 ? -3.99500  64.90200 276.03800 1.000 57.37354  ? 209 HIS A CD2 1 
ATOM   1600 C CE1 . HIS A 1 206 ? -4.31900  67.06400 275.83200 1.000 57.71563  ? 209 HIS A CE1 1 
ATOM   1601 N NE2 . HIS A 1 206 ? -3.59600  66.15000 276.45500 1.000 58.79002  ? 209 HIS A NE2 1 
ATOM   1602 N N   . ILE A 1 207 ? -8.56100  62.28400 273.87000 1.000 61.33862  ? 210 ILE A N   1 
ATOM   1603 C CA  . ILE A 1 207 ? -9.45200  61.50200 273.02800 1.000 58.53838  ? 210 ILE A CA  1 
ATOM   1604 C C   . ILE A 1 207 ? -10.77300 62.23700 272.83000 1.000 62.68364  ? 210 ILE A C   1 
ATOM   1605 O O   . ILE A 1 207 ? -11.33200 62.25000 271.72600 1.000 62.58404  ? 210 ILE A O   1 
ATOM   1606 C CB  . ILE A 1 207 ? -9.64600  60.11300 273.65300 1.000 54.42222  ? 210 ILE A CB  1 
ATOM   1607 C CG1 . ILE A 1 207 ? -8.34600  59.33900 273.58600 1.000 51.04322  ? 210 ILE A CG1 1 
ATOM   1608 C CG2 . ILE A 1 207 ? -10.74800 59.32400 272.97700 1.000 57.15251  ? 210 ILE A CG2 1 
ATOM   1609 C CD1 . ILE A 1 207 ? -8.50600  57.93300 274.08000 1.000 53.26674  ? 210 ILE A CD1 1 
ATOM   1610 N N   . LEU A 1 208 ? -11.27800 62.88600 273.88300 1.000 62.63728  ? 211 LEU A N   1 
ATOM   1611 C CA  . LEU A 1 208 ? -12.54900 63.60500 273.78600 1.000 64.24912  ? 211 LEU A CA  1 
ATOM   1612 C C   . LEU A 1 208 ? -12.40000 64.96200 273.10800 1.000 64.18960  ? 211 LEU A C   1 
ATOM   1613 O O   . LEU A 1 208 ? -13.22200 65.32900 272.26900 1.000 69.49085  ? 211 LEU A O   1 
ATOM   1614 C CB  . LEU A 1 208 ? -13.15900 63.80400 275.17300 1.000 63.04244  ? 211 LEU A CB  1 
ATOM   1615 C CG  . LEU A 1 208 ? -13.41400 62.58200 276.03400 1.000 58.70562  ? 211 LEU A CG  1 
ATOM   1616 C CD1 . LEU A 1 208 ? -13.51400 63.07200 277.44900 1.000 64.38336  ? 211 LEU A CD1 1 
ATOM   1617 C CD2 . LEU A 1 208 ? -14.68000 61.88700 275.63100 1.000 54.47794  ? 211 LEU A CD2 1 
ATOM   1618 N N   . SER A 1 209 ? -11.39000 65.73400 273.47800 1.000 62.48820  ? 212 SER A N   1 
ATOM   1619 C CA  . SER A 1 209 ? -11.30700 67.11800 273.01800 1.000 58.90715  ? 212 SER A CA  1 
ATOM   1620 C C   . SER A 1 209 ? -10.95300 67.17600 271.54100 1.000 65.91372  ? 212 SER A C   1 
ATOM   1621 O O   . SER A 1 209 ? -9.92000  66.62000 271.13900 1.000 66.66303  ? 212 SER A O   1 
ATOM   1622 C CB  . SER A 1 209 ? -10.25700 67.87500 273.80100 1.000 61.31036  ? 212 SER A CB  1 
ATOM   1623 O OG  . SER A 1 209 ? -9.80900  69.00300 273.07200 1.000 61.21947  ? 212 SER A OG  1 
ATOM   1624 N N   . PRO A 1 210 ? -11.73800 67.88400 270.71500 1.000 71.82321  ? 213 PRO A N   1 
ATOM   1625 C CA  . PRO A 1 210 ? -11.46400 67.86500 269.26100 1.000 61.93654  ? 213 PRO A CA  1 
ATOM   1626 C C   . PRO A 1 210 ? -10.14200 68.51500 268.89500 1.000 60.34143  ? 213 PRO A C   1 
ATOM   1627 O O   . PRO A 1 210 ? -9.44200  68.01900 268.00800 1.000 64.92046  ? 213 PRO A O   1 
ATOM   1628 C CB  . PRO A 1 210 ? -12.66200 68.62200 268.66400 1.000 61.46240  ? 213 PRO A CB  1 
ATOM   1629 C CG  . PRO A 1 210 ? -13.67300 68.79900 269.81000 1.000 64.76289  ? 213 PRO A CG  1 
ATOM   1630 C CD  . PRO A 1 210 ? -12.85500 68.78200 271.06800 1.000 63.19863  ? 213 PRO A CD  1 
ATOM   1631 N N   . GLY A 1 211 ? -9.76100  69.59600 269.57000 1.000 58.77798  ? 214 GLY A N   1 
ATOM   1632 C CA  . GLY A 1 211 ? -8.49700  70.25900 269.30200 1.000 54.77614  ? 214 GLY A CA  1 
ATOM   1633 C C   . GLY A 1 211 ? -7.26500  69.39100 269.48900 1.000 61.10238  ? 214 GLY A C   1 
ATOM   1634 O O   . GLY A 1 211 ? -6.13900  69.82700 269.22900 1.000 63.97150  ? 214 GLY A O   1 
ATOM   1635 N N   . SER A 1 212 ? -7.45400  68.15000 269.92700 1.000 61.89988  ? 215 SER A N   1 
ATOM   1636 C CA  . SER A 1 212 ? -6.33500  67.30300 270.29500 1.000 59.33228  ? 215 SER A CA  1 
ATOM   1637 C C   . SER A 1 212 ? -6.24500  66.01300 269.49900 1.000 63.10596  ? 215 SER A C   1 
ATOM   1638 O O   . SER A 1 212 ? -5.15600  65.42900 269.45000 1.000 62.79867  ? 215 SER A O   1 
ATOM   1639 C CB  . SER A 1 212 ? -6.40500  66.95400 271.79800 1.000 60.02811  ? 215 SER A CB  1 
ATOM   1640 O OG  . SER A 1 212 ? -6.27100  68.11800 272.60000 1.000 53.90319  ? 215 SER A OG  1 
ATOM   1641 N N   . ARG A 1 213 ? -7.33700  65.57200 268.84800 1.000 63.86122  ? 216 ARG A N   1 
ATOM   1642 C CA  . ARG A 1 213 ? -7.41400  64.19700 268.35500 1.000 59.93539  ? 216 ARG A CA  1 
ATOM   1643 C C   . ARG A 1 213 ? -6.44200  63.94700 267.21700 1.000 62.56475  ? 216 ARG A C   1 
ATOM   1644 O O   . ARG A 1 213 ? -5.93500  62.82800 267.06000 1.000 63.53452  ? 216 ARG A O   1 
ATOM   1645 C CB  . ARG A 1 213 ? -8.82600  63.86900 267.89000 1.000 58.07285  ? 216 ARG A CB  1 
ATOM   1646 C CG  . ARG A 1 213 ? -9.91600  64.54300 268.66800 1.000 61.67595  ? 216 ARG A CG  1 
ATOM   1647 C CD  . ARG A 1 213 ? -11.27100 64.04500 268.21900 1.000 62.18395  ? 216 ARG A CD  1 
ATOM   1648 N NE  . ARG A 1 213 ? -12.33500 64.55100 269.07600 1.000 66.01725  ? 216 ARG A NE  1 
ATOM   1649 C CZ  . ARG A 1 213 ? -13.62400 64.54900 268.75000 1.000 67.04500  ? 216 ARG A CZ  1 
ATOM   1650 N NH1 . ARG A 1 213 ? -14.00600 64.07900 267.56700 1.000 67.83545  ? 216 ARG A NH1 1 
ATOM   1651 N NH2 . ARG A 1 213 ? -14.53200 65.03200 269.59800 1.000 60.95901  ? 216 ARG A NH2 1 
ATOM   1652 N N   . ASP A 1 214 ? -6.18500  64.95600 266.39600 1.000 63.76262  ? 217 ASP A N   1 
ATOM   1653 C CA  . ASP A 1 214 ? -5.41200  64.68400 265.19600 1.000 65.12599  ? 217 ASP A CA  1 
ATOM   1654 C C   . ASP A 1 214 ? -3.91200  64.67400 265.46300 1.000 65.92671  ? 217 ASP A C   1 
ATOM   1655 O O   . ASP A 1 214 ? -3.13100  64.49100 264.51900 1.000 69.61992  ? 217 ASP A O   1 
ATOM   1656 C CB  . ASP A 1 214 ? -5.77000  65.70300 264.10600 1.000 72.56822  ? 217 ASP A CB  1 
ATOM   1657 C CG  . ASP A 1 214 ? -7.28900  65.86700 263.91700 1.000 74.97175  ? 217 ASP A CG  1 
ATOM   1658 O OD1 . ASP A 1 214 ? -8.05100  64.95400 264.33600 1.000 69.28680  ? 217 ASP A OD1 1 
ATOM   1659 O OD2 . ASP A 1 214 ? -7.71000  66.91000 263.33700 1.000 70.46579  ? 217 ASP A OD2 1 
ATOM   1660 N N   . LEU A 1 215 ? -3.49700  64.83900 266.72300 1.000 61.48497  ? 218 LEU A N   1 
ATOM   1661 C CA  . LEU A 1 215 ? -2.08900  64.92500 267.09700 1.000 61.25644  ? 218 LEU A CA  1 
ATOM   1662 C C   . LEU A 1 215 ? -1.51200  63.60900 267.59800 1.000 61.62786  ? 218 LEU A C   1 
ATOM   1663 O O   . LEU A 1 215 ? -0.33400  63.56900 267.97400 1.000 64.25157  ? 218 LEU A O   1 
ATOM   1664 C CB  . LEU A 1 215 ? -1.89000  65.98700 268.17400 1.000 58.87777  ? 218 LEU A CB  1 
ATOM   1665 C CG  . LEU A 1 215 ? -2.34100  67.40500 267.84800 1.000 66.26772  ? 218 LEU A CG  1 
ATOM   1666 C CD1 . LEU A 1 215 ? -2.33400  68.26600 269.12600 1.000 68.14601  ? 218 LEU A CD1 1 
ATOM   1667 C CD2 . LEU A 1 215 ? -1.46100  68.00300 266.80300 1.000 59.37627  ? 218 LEU A CD2 1 
ATOM   1668 N N   . PHE A 1 216 ? -2.30200  62.54300 267.62000 1.000 55.05398  ? 219 PHE A N   1 
ATOM   1669 C CA  . PHE A 1 216 ? -1.81900  61.26000 268.10100 1.000 57.63959  ? 219 PHE A CA  1 
ATOM   1670 C C   . PHE A 1 216 ? -2.69200  60.20100 267.46100 1.000 54.60542  ? 219 PHE A C   1 
ATOM   1671 O O   . PHE A 1 216 ? -3.82400  60.47000 267.05200 1.000 48.59515  ? 219 PHE A O   1 
ATOM   1672 C CB  . PHE A 1 216 ? -1.85400  61.15900 269.64400 1.000 58.55583  ? 219 PHE A CB  1 
ATOM   1673 C CG  . PHE A 1 216 ? -3.24400  61.04100 270.20300 1.000 53.63641  ? 219 PHE A CG  1 
ATOM   1674 C CD1 . PHE A 1 216 ? -4.02900  62.17400 270.40100 1.000 55.21928  ? 219 PHE A CD1 1 
ATOM   1675 C CD2 . PHE A 1 216 ? -3.78900  59.79800 270.47400 1.000 51.88747  ? 219 PHE A CD2 1 
ATOM   1676 C CE1 . PHE A 1 216 ? -5.32100  62.06700 270.86500 1.000 53.15669  ? 219 PHE A CE1 1 
ATOM   1677 C CE2 . PHE A 1 216 ? -5.07900  59.68200 270.94000 1.000 53.85986  ? 219 PHE A CE2 1 
ATOM   1678 C CZ  . PHE A 1 216 ? -5.84600  60.81800 271.14000 1.000 56.21984  ? 219 PHE A CZ  1 
ATOM   1679 N N   . ARG A 1 217 ? -2.15700  58.98500 267.40800 1.000 56.60375  ? 220 ARG A N   1 
ATOM   1680 C CA  . ARG A 1 217 ? -2.79800  57.88600 266.70300 1.000 60.00234  ? 220 ARG A CA  1 
ATOM   1681 C C   . ARG A 1 217 ? -3.62900  57.01700 267.64200 1.000 62.30204  ? 220 ARG A C   1 
ATOM   1682 O O   . ARG A 1 217 ? -4.84400  56.88700 267.45700 1.000 62.58518  ? 220 ARG A O   1 
ATOM   1683 C CB  . ARG A 1 217 ? -1.72100  57.07300 265.97600 1.000 64.27239  ? 220 ARG A CB  1 
ATOM   1684 C CG  . ARG A 1 217 ? -2.18900  55.79300 265.32600 1.000 66.93447  ? 220 ARG A CG  1 
ATOM   1685 C CD  . ARG A 1 217 ? -3.22200  56.03700 264.25200 1.000 68.74914  ? 220 ARG A CD  1 
ATOM   1686 N NE  . ARG A 1 217 ? -3.39300  54.82900 263.45600 1.000 75.88635  ? 220 ARG A NE  1 
ATOM   1687 C CZ  . ARG A 1 217 ? -2.69100  54.53900 262.36100 1.000 75.93487  ? 220 ARG A CZ  1 
ATOM   1688 N NH1 . ARG A 1 217 ? -1.76100  55.37600 261.90100 1.000 65.74396  ? 220 ARG A NH1 1 
ATOM   1689 N NH2 . ARG A 1 217 ? -2.92300  53.39900 261.72500 1.000 77.15440  ? 220 ARG A NH2 1 
ATOM   1690 N N   . ARG A 1 218 ? -3.00800  56.43900 268.66800 1.000 60.50424  ? 221 ARG A N   1 
ATOM   1691 C CA  . ARG A 1 218 ? -3.71400  55.55700 269.59000 1.000 61.42157  ? 221 ARG A CA  1 
ATOM   1692 C C   . ARG A 1 218 ? -3.33800  55.90300 271.03900 1.000 57.83548  ? 221 ARG A C   1 
ATOM   1693 O O   . ARG A 1 218 ? -2.55900  56.82900 271.29300 1.000 59.88850  ? 221 ARG A O   1 
ATOM   1694 C CB  . ARG A 1 218 ? -3.42300  54.09800 269.23300 1.000 61.09279  ? 221 ARG A CB  1 
ATOM   1695 C CG  . ARG A 1 218 ? -1.99700  53.85600 268.83900 1.000 62.71269  ? 221 ARG A CG  1 
ATOM   1696 C CD  . ARG A 1 218 ? -1.74400  52.37800 268.69100 1.000 62.04802  ? 221 ARG A CD  1 
ATOM   1697 N NE  . ARG A 1 218 ? -2.48900  51.84900 267.55700 1.000 69.25278  ? 221 ARG A NE  1 
ATOM   1698 C CZ  . ARG A 1 218 ? -2.04500  51.87400 266.30600 1.000 64.43128  ? 221 ARG A CZ  1 
ATOM   1699 N NH1 . ARG A 1 218 ? -0.85900  52.39200 266.02700 1.000 68.45364  ? 221 ARG A NH1 1 
ATOM   1700 N NH2 . ARG A 1 218 ? -2.78200  51.37400 265.34200 1.000 62.41387  ? 221 ARG A NH2 1 
ATOM   1701 N N   . ALA A 1 219 ? -3.89400  55.15900 272.00600 1.000 56.20737  ? 222 ALA A N   1 
ATOM   1702 C CA  . ALA A 1 219 ? -3.91800  55.63700 273.38800 1.000 59.58027  ? 222 ALA A CA  1 
ATOM   1703 C C   . ALA A 1 219 ? -3.84300  54.50600 274.39900 1.000 57.70674  ? 222 ALA A C   1 
ATOM   1704 O O   . ALA A 1 219 ? -4.50600  53.48000 274.23300 1.000 58.39467  ? 222 ALA A O   1 
ATOM   1705 C CB  . ALA A 1 219 ? -5.19300  56.44200 273.66400 1.000 52.98188  ? 222 ALA A CB  1 
ATOM   1706 N N   . ILE A 1 220 ? -3.08200  54.73000 275.47200 1.000 54.90259  ? 223 ILE A N   1 
ATOM   1707 C CA  . ILE A 1 220 ? -3.04700  53.82400 276.62400 1.000 58.56854  ? 223 ILE A CA  1 
ATOM   1708 C C   . ILE A 1 220 ? -3.37000  54.59500 277.90500 1.000 56.51120  ? 223 ILE A C   1 
ATOM   1709 O O   . ILE A 1 220 ? -2.71500  55.59300 278.23000 1.000 52.00839  ? 223 ILE A O   1 
ATOM   1710 C CB  . ILE A 1 220 ? -1.69700  53.10800 276.76200 1.000 57.03160  ? 223 ILE A CB  1 
ATOM   1711 C CG1 . ILE A 1 220 ? -1.48200  52.11200 275.63200 1.000 54.46697  ? 223 ILE A CG1 1 
ATOM   1712 C CG2 . ILE A 1 220 ? -1.60100  52.42400 278.12800 1.000 55.56168  ? 223 ILE A CG2 1 
ATOM   1713 C CD1 . ILE A 1 220 ? -0.13800  51.48600 275.67500 1.000 56.63741  ? 223 ILE A CD1 1 
ATOM   1714 N N   . LEU A 1 221 ? -4.35700  54.11300 278.64300 1.000 55.40390  ? 224 LEU A N   1 
ATOM   1715 C CA  . LEU A 1 221 ? -4.77000  54.72100 279.90500 1.000 59.52380  ? 224 LEU A CA  1 
ATOM   1716 C C   . LEU A 1 221 ? -4.55300  53.72400 281.03300 1.000 57.67121  ? 224 LEU A C   1 
ATOM   1717 O O   . LEU A 1 221 ? -5.09400  52.61600 280.99200 1.000 54.29850  ? 224 LEU A O   1 
ATOM   1718 C CB  . LEU A 1 221 ? -6.24200  55.14600 279.87000 1.000 56.04344  ? 224 LEU A CB  1 
ATOM   1719 C CG  . LEU A 1 221 ? -6.74200  56.05800 278.75900 1.000 51.81370  ? 224 LEU A CG  1 
ATOM   1720 C CD1 . LEU A 1 221 ? -6.89400  55.27300 277.47300 1.000 57.42640  ? 224 LEU A CD1 1 
ATOM   1721 C CD2 . LEU A 1 221 ? -8.07600  56.64600 279.17100 1.000 50.64883  ? 224 LEU A CD2 1 
ATOM   1722 N N   . GLN A 1 222 ? -3.79600  54.12000 282.05000 1.000 56.04506  ? 225 GLN A N   1 
ATOM   1723 C CA  . GLN A 1 222 ? -3.51000  53.23100 283.16800 1.000 57.70752  ? 225 GLN A CA  1 
ATOM   1724 C C   . GLN A 1 222 ? -4.06800  53.83400 284.44900 1.000 58.88541  ? 225 GLN A C   1 
ATOM   1725 O O   . GLN A 1 222 ? -3.56000  54.85200 284.93400 1.000 59.23420  ? 225 GLN A O   1 
ATOM   1726 C CB  . GLN A 1 222 ? -2.01400  52.98900 283.28100 1.000 61.29554  ? 225 GLN A CB  1 
ATOM   1727 C CG  . GLN A 1 222 ? -1.38800  52.53700 281.99700 1.000 60.72613  ? 225 GLN A CG  1 
ATOM   1728 C CD  . GLN A 1 222 ? 0.12300   52.64500 282.02700 1.000 64.39117  ? 225 GLN A CD  1 
ATOM   1729 O OE1 . GLN A 1 222 ? 0.78600   52.45000 281.01300 1.000 71.01742  ? 225 GLN A OE1 1 
ATOM   1730 N NE2 . GLN A 1 222 ? 0.67600   52.95200 283.19100 1.000 60.47469  ? 225 GLN A NE2 1 
ATOM   1731 N N   . SER A 1 223 ? -5.09600  53.19600 285.01100 1.000 58.82634  ? 226 SER A N   1 
ATOM   1732 C CA  . SER A 1 223 ? -5.67300  53.64700 286.28400 1.000 62.28112  ? 226 SER A CA  1 
ATOM   1733 C C   . SER A 1 223 ? -6.12600  55.09800 286.17800 1.000 59.66931  ? 226 SER A C   1 
ATOM   1734 O O   . SER A 1 223 ? -5.91200  55.90900 287.07400 1.000 61.45327  ? 226 SER A O   1 
ATOM   1735 C CB  . SER A 1 223 ? -4.68800  53.48800 287.45200 1.000 57.26468  ? 226 SER A CB  1 
ATOM   1736 O OG  . SER A 1 223 ? -4.26600  52.14700 287.63900 1.000 58.42319  ? 226 SER A OG  1 
ATOM   1737 N N   . GLY A 1 224 ? -6.73500  55.43900 285.06300 1.000 56.91368  ? 227 GLY A N   1 
ATOM   1738 C CA  . GLY A 1 224 ? -7.14800  56.80800 284.85300 1.000 59.34908  ? 227 GLY A CA  1 
ATOM   1739 C C   . GLY A 1 224 ? -8.22100  56.83900 283.79600 1.000 60.11270  ? 227 GLY A C   1 
ATOM   1740 O O   . GLY A 1 224 ? -8.35500  55.91500 282.98800 1.000 57.83626  ? 227 GLY A O   1 
ATOM   1741 N N   . SER A 1 225 ? -8.98500  57.90700 283.81300 1.000 54.87592  ? 228 SER A N   1 
ATOM   1742 C CA  . SER A 1 225 ? -10.18000 57.89900 282.99900 1.000 53.31716  ? 228 SER A CA  1 
ATOM   1743 C C   . SER A 1 225 ? -10.71300 59.31400 282.97500 1.000 54.80967  ? 228 SER A C   1 
ATOM   1744 O O   . SER A 1 225 ? -10.81500 59.94400 284.02600 1.000 53.90542  ? 228 SER A O   1 
ATOM   1745 C CB  . SER A 1 225 ? -11.20100 56.92100 283.56600 1.000 52.27732  ? 228 SER A CB  1 
ATOM   1746 O OG  . SER A 1 225 ? -12.30300 56.80100 282.71400 1.000 55.76288  ? 228 SER A OG  1 
ATOM   1747 N N   . PRO A 1 226 ? -11.02100 59.86600 281.80500 1.000 58.74011  ? 229 PRO A N   1 
ATOM   1748 C CA  . PRO A 1 226 ? -11.42300 61.27900 281.76600 1.000 58.89020  ? 229 PRO A CA  1 
ATOM   1749 C C   . PRO A 1 226 ? -12.61600 61.59600 282.65900 1.000 55.21068  ? 229 PRO A C   1 
ATOM   1750 O O   . PRO A 1 226 ? -12.68500 62.70500 283.20200 1.000 55.75987  ? 229 PRO A O   1 
ATOM   1751 C CB  . PRO A 1 226 ? -11.73400 61.51000 280.28000 1.000 59.38497  ? 229 PRO A CB  1 
ATOM   1752 C CG  . PRO A 1 226 ? -12.01400 60.13400 279.73200 1.000 59.70491  ? 229 PRO A CG  1 
ATOM   1753 C CD  . PRO A 1 226 ? -11.09200 59.22500 280.48200 1.000 55.68629  ? 229 PRO A CD  1 
ATOM   1754 N N   . ASN A 1 227 ? -13.53800 60.65000 282.85300 1.000 50.99217  ? 230 ASN A N   1 
ATOM   1755 C CA  . ASN A 1 227 ? -14.74600 60.87600 283.63800 1.000 54.24440  ? 230 ASN A CA  1 
ATOM   1756 C C   . ASN A 1 227 ? -14.57800 60.53200 285.12100 1.000 57.34200  ? 230 ASN A C   1 
ATOM   1757 O O   . ASN A 1 227 ? -15.57700 60.33100 285.81800 1.000 63.41873  ? 230 ASN A O   1 
ATOM   1758 C CB  . ASN A 1 227 ? -15.90800 60.06600 283.06200 1.000 51.14228  ? 230 ASN A CB  1 
ATOM   1759 C CG  . ASN A 1 227 ? -15.62000 58.57200 283.04000 1.000 56.66593  ? 230 ASN A CG  1 
ATOM   1760 O OD1 . ASN A 1 227 ? -14.47600 58.15400 282.84600 1.000 55.43579  ? 230 ASN A OD1 1 
ATOM   1761 N ND2 . ASN A 1 227 ? -16.65500 57.76200 283.24200 1.000 56.20715  ? 230 ASN A ND2 1 
ATOM   1762 N N   . CYS A 1 228 ? -13.35200 60.43300 285.61600 1.000 55.08694  ? 231 CYS A N   1 
ATOM   1763 C CA  . CYS A 1 228 ? -13.17700 60.12800 287.02100 1.000 55.73228  ? 231 CYS A CA  1 
ATOM   1764 C C   . CYS A 1 228 ? -13.79800 61.24900 287.85700 1.000 59.15786  ? 231 CYS A C   1 
ATOM   1765 O O   . CYS A 1 228 ? -13.82400 62.40500 287.42000 1.000 58.67838  ? 231 CYS A O   1 
ATOM   1766 C CB  . CYS A 1 228 ? -11.69100 59.95800 287.34000 1.000 56.61074  ? 231 CYS A CB  1 
ATOM   1767 S SG  . CYS A 1 228 ? -11.03000 58.32900 286.90100 1.000 58.74818  ? 231 CYS A SG  1 
ATOM   1768 N N   . PRO A 1 229 ? -14.33100 60.93800 289.04800 1.000 58.29743  ? 232 PRO A N   1 
ATOM   1769 C CA  . PRO A 1 229 ? -15.00900 61.98300 289.83600 1.000 52.14229  ? 232 PRO A CA  1 
ATOM   1770 C C   . PRO A 1 229 ? -14.08300 63.09100 290.30200 1.000 52.17151  ? 232 PRO A C   1 
ATOM   1771 O O   . PRO A 1 229 ? -14.55200 64.21100 290.56800 1.000 49.91850  ? 232 PRO A O   1 
ATOM   1772 C CB  . PRO A 1 229 ? -15.61400 61.20600 291.01600 1.000 48.02179  ? 232 PRO A CB  1 
ATOM   1773 C CG  . PRO A 1 229 ? -14.87500 59.95100 291.08700 1.000 52.00664  ? 232 PRO A CG  1 
ATOM   1774 C CD  . PRO A 1 229 ? -14.42200 59.61700 289.69300 1.000 58.40817  ? 232 PRO A CD  1 
ATOM   1775 N N   . TRP A 1 230 ? -12.78400 62.82400 290.38400 1.000 54.13825  ? 233 TRP A N   1 
ATOM   1776 C CA  . TRP A 1 230 ? -11.78800 63.81300 290.78100 1.000 56.23042  ? 233 TRP A CA  1 
ATOM   1777 C C   . TRP A 1 230 ? -11.15900 64.53900 289.59500 1.000 59.30535  ? 233 TRP A C   1 
ATOM   1778 O O   . TRP A 1 230 ? -10.49800 65.56800 289.79300 1.000 57.76777  ? 233 TRP A O   1 
ATOM   1779 C CB  . TRP A 1 230 ? -10.67600 63.12900 291.59300 1.000 55.02853  ? 233 TRP A CB  1 
ATOM   1780 C CG  . TRP A 1 230 ? -10.19400 61.87700 290.91300 1.000 56.29232  ? 233 TRP A CG  1 
ATOM   1781 C CD1 . TRP A 1 230 ? -10.68200 60.61400 291.08400 1.000 56.54942  ? 233 TRP A CD1 1 
ATOM   1782 C CD2 . TRP A 1 230 ? -9.17500  61.78100 289.91300 1.000 56.05932  ? 233 TRP A CD2 1 
ATOM   1783 N NE1 . TRP A 1 230 ? -10.00800 59.72900 290.28000 1.000 57.56928  ? 233 TRP A NE1 1 
ATOM   1784 C CE2 . TRP A 1 230 ? -9.07800  60.41900 289.54500 1.000 61.14749  ? 233 TRP A CE2 1 
ATOM   1785 C CE3 . TRP A 1 230 ? -8.32900  62.70800 289.29700 1.000 51.66641  ? 233 TRP A CE3 1 
ATOM   1786 C CZ2 . TRP A 1 230 ? -8.17000  59.96500 288.58400 1.000 57.97257  ? 233 TRP A CZ2 1 
ATOM   1787 C CZ3 . TRP A 1 230 ? -7.41800  62.25000 288.35600 1.000 56.60140  ? 233 TRP A CZ3 1 
ATOM   1788 C CH2 . TRP A 1 230 ? -7.34800  60.89300 288.00800 1.000 56.91572  ? 233 TRP A CH2 1 
ATOM   1789 N N   . ALA A 1 231 ? -11.34400 64.03500 288.37100 1.000 55.33901  ? 234 ALA A N   1 
ATOM   1790 C CA  . ALA A 1 231 ? -10.58500 64.55800 287.24700 1.000 54.93187  ? 234 ALA A CA  1 
ATOM   1791 C C   . ALA A 1 231 ? -11.11200 65.87400 286.69300 1.000 55.48466  ? 234 ALA A C   1 
ATOM   1792 O O   . ALA A 1 231 ? -10.36000 66.55200 285.99600 1.000 63.16915  ? 234 ALA A O   1 
ATOM   1793 C CB  . ALA A 1 231 ? -10.53300 63.53400 286.12500 1.000 55.18359  ? 234 ALA A CB  1 
ATOM   1794 N N   . SER A 1 232 ? -12.35700 66.26800 286.96600 1.000 53.70482  ? 235 SER A N   1 
ATOM   1795 C CA  . SER A 1 232 ? -12.84500 67.52800 286.40700 1.000 57.62149  ? 235 SER A CA  1 
ATOM   1796 C C   . SER A 1 232 ? -13.89100 68.17000 287.30900 1.000 59.07542  ? 235 SER A C   1 
ATOM   1797 O O   . SER A 1 232 ? -14.61200 67.48600 288.03700 1.000 63.68302  ? 235 SER A O   1 
ATOM   1798 C CB  . SER A 1 232 ? -13.43600 67.33300 285.00700 1.000 57.20255  ? 235 SER A CB  1 
ATOM   1799 O OG  . SER A 1 232 ? -14.56500 66.48100 285.04600 1.000 54.40689  ? 235 SER A OG  1 
ATOM   1800 N N   . VAL A 1 233 ? -14.00000 69.49900 287.22000 1.000 59.29561  ? 236 VAL A N   1 
ATOM   1801 C CA  . VAL A 1 233 ? -15.03600 70.24800 287.92600 1.000 59.09631  ? 236 VAL A CA  1 
ATOM   1802 C C   . VAL A 1 233 ? -15.85400 71.06000 286.92900 1.000 62.24735  ? 236 VAL A C   1 
ATOM   1803 O O   . VAL A 1 233 ? -15.45300 71.28000 285.78300 1.000 58.87611  ? 236 VAL A O   1 
ATOM   1804 C CB  . VAL A 1 233 ? -14.46600 71.18400 289.01000 1.000 59.22747  ? 236 VAL A CB  1 
ATOM   1805 C CG1 . VAL A 1 233 ? -13.66100 70.40100 290.00500 1.000 58.34557  ? 236 VAL A CG1 1 
ATOM   1806 C CG2 . VAL A 1 233 ? -13.64700 72.30500 288.38700 1.000 51.95454  ? 236 VAL A CG2 1 
ATOM   1807 N N   . SER A 1 234 ? -17.01500 71.51300 287.39500 1.000 60.51160  ? 237 SER A N   1 
ATOM   1808 C CA  . SER A 1 234 ? -17.83600 72.43300 286.62600 1.000 61.70734  ? 237 SER A CA  1 
ATOM   1809 C C   . SER A 1 234 ? -17.25500 73.83900 286.68100 1.000 65.28035  ? 237 SER A C   1 
ATOM   1810 O O   . SER A 1 234 ? -16.40700 74.16600 287.51600 1.000 65.92643  ? 237 SER A O   1 
ATOM   1811 C CB  . SER A 1 234 ? -19.26400 72.46700 287.15400 1.000 63.59186  ? 237 SER A CB  1 
ATOM   1812 O OG  . SER A 1 234 ? -19.29000 73.08100 288.43600 1.000 69.99791  ? 237 SER A OG  1 
ATOM   1813 N N   . VAL A 1 235 ? -17.75000 74.68200 285.77900 1.000 66.86792  ? 238 VAL A N   1 
ATOM   1814 C CA  . VAL A 1 235 ? -17.27200 76.05700 285.69200 1.000 63.71171  ? 238 VAL A CA  1 
ATOM   1815 C C   . VAL A 1 235 ? -17.55800 76.80700 286.98500 1.000 58.67290  ? 238 VAL A C   1 
ATOM   1816 O O   . VAL A 1 235 ? -16.70000 77.53600 287.49300 1.000 63.18966  ? 238 VAL A O   1 
ATOM   1817 C CB  . VAL A 1 235 ? -17.90900 76.75100 284.47400 1.000 61.31638  ? 238 VAL A CB  1 
ATOM   1818 C CG1 . VAL A 1 235 ? -17.70800 78.23300 284.55300 1.000 64.89228  ? 238 VAL A CG1 1 
ATOM   1819 C CG2 . VAL A 1 235 ? -17.30200 76.22000 283.22300 1.000 64.59936  ? 238 VAL A CG2 1 
ATOM   1820 N N   . ALA A 1 236 ? -18.76900 76.65100 287.53000 1.000 62.10915  ? 239 ALA A N   1 
ATOM   1821 C CA  . ALA A 1 236 ? -19.11300 77.30600 288.79200 1.000 62.27551  ? 239 ALA A CA  1 
ATOM   1822 C C   . ALA A 1 236 ? -18.18200 76.86700 289.91000 1.000 62.68950  ? 239 ALA A C   1 
ATOM   1823 O O   . ALA A 1 236 ? -17.67800 77.69900 290.67300 1.000 62.30665  ? 239 ALA A O   1 
ATOM   1824 C CB  . ALA A 1 236 ? -20.56300 77.00800 289.17700 1.000 55.70481  ? 239 ALA A CB  1 
ATOM   1825 N N   . GLU A 1 237 ? -17.93300 75.56200 290.01500 1.000 64.70173  ? 240 GLU A N   1 
ATOM   1826 C CA  . GLU A 1 237 ? -17.07600 75.06800 291.08400 1.000 63.74042  ? 240 GLU A CA  1 
ATOM   1827 C C   . GLU A 1 237 ? -15.63700 75.53600 290.90600 1.000 65.47185  ? 240 GLU A C   1 
ATOM   1828 O O   . GLU A 1 237 ? -14.95800 75.86700 291.89100 1.000 65.47285  ? 240 GLU A O   1 
ATOM   1829 C CB  . GLU A 1 237 ? -17.14700 73.54200 291.15200 1.000 61.99455  ? 240 GLU A CB  1 
ATOM   1830 C CG  . GLU A 1 237 ? -16.11500 72.91200 292.07600 1.000 61.46766  ? 240 GLU A CG  1 
ATOM   1831 C CD  . GLU A 1 237 ? -16.29800 73.26600 293.56200 1.000 67.48324  ? 240 GLU A CD  1 
ATOM   1832 O OE1 . GLU A 1 237 ? -17.17600 74.09200 293.90500 1.000 67.77372  ? 240 GLU A OE1 1 
ATOM   1833 O OE2 . GLU A 1 237 ? -15.55900 72.69500 294.39700 1.000 66.20304  ? 240 GLU A OE2 1 
ATOM   1834 N N   . GLY A 1 238 ? -15.15500 75.56600 289.66000 1.000 58.73896  ? 241 GLY A N   1 
ATOM   1835 C CA  . GLY A 1 238 ? -13.80700 76.04000 289.41300 1.000 61.48703  ? 241 GLY A CA  1 
ATOM   1836 C C   . GLY A 1 238 ? -13.64500 77.51000 289.72200 1.000 63.30043  ? 241 GLY A C   1 
ATOM   1837 O O   . GLY A 1 238 ? -12.57300 77.94500 290.15900 1.000 61.82414  ? 241 GLY A O   1 
ATOM   1838 N N   . ARG A 1 239 ? -14.70000 78.29400 289.49900 1.000 60.08111  ? 242 ARG A N   1 
ATOM   1839 C CA  . ARG A 1 239 ? -14.66900 79.69700 289.87800 1.000 60.64955  ? 242 ARG A CA  1 
ATOM   1840 C C   . ARG A 1 239 ? -14.65000 79.83800 291.39500 1.000 62.93432  ? 242 ARG A C   1 
ATOM   1841 O O   . ARG A 1 239 ? -13.81600 80.56100 291.95000 1.000 63.86893  ? 242 ARG A O   1 
ATOM   1842 C CB  . ARG A 1 239 ? -15.87000 80.41900 289.26500 1.000 58.38482  ? 242 ARG A CB  1 
ATOM   1843 C CG  . ARG A 1 239 ? -15.97300 81.89500 289.61700 1.000 62.43059  ? 242 ARG A CG  1 
ATOM   1844 C CD  . ARG A 1 239 ? -17.04200 82.59600 288.77600 1.000 65.53659  ? 242 ARG A CD  1 
ATOM   1845 N NE  . ARG A 1 239 ? -16.59100 82.75700 287.39900 1.000 76.01639  ? 242 ARG A NE  1 
ATOM   1846 C CZ  . ARG A 1 239 ? -15.72900 83.69200 287.01000 1.000 75.60476  ? 242 ARG A CZ  1 
ATOM   1847 N NH1 . ARG A 1 239 ? -15.23600 84.55300 287.89200 1.000 71.65802  ? 242 ARG A NH1 1 
ATOM   1848 N NH2 . ARG A 1 239 ? -15.35500 83.76500 285.74200 1.000 74.25874  ? 242 ARG A NH2 1 
ATOM   1849 N N   . ARG A 1 240 ? -15.55200 79.12900 292.08200 1.000 59.81642  ? 243 ARG A N   1 
ATOM   1850 C CA  . ARG A 1 240 ? -15.61800 79.20200 293.53700 1.000 67.23244  ? 243 ARG A CA  1 
ATOM   1851 C C   . ARG A 1 240 ? -14.27500 78.87200 294.17500 1.000 69.57843  ? 243 ARG A C   1 
ATOM   1852 O O   . ARG A 1 240 ? -13.85400 79.54400 295.12800 1.000 61.94221  ? 243 ARG A O   1 
ATOM   1853 C CB  . ARG A 1 240 ? -16.68900 78.25300 294.07100 1.000 63.56454  ? 243 ARG A CB  1 
ATOM   1854 C CG  . ARG A 1 240 ? -16.79700 78.31200 295.57400 1.000 61.73144  ? 243 ARG A CG  1 
ATOM   1855 C CD  . ARG A 1 240 ? -17.52300 77.11200 296.19500 1.000 63.02624  ? 243 ARG A CD  1 
ATOM   1856 N NE  . ARG A 1 240 ? -16.73400 75.88400 296.15700 1.000 63.35231  ? 243 ARG A NE  1 
ATOM   1857 C CZ  . ARG A 1 240 ? -15.63700 75.67200 296.87700 1.000 65.17646  ? 243 ARG A CZ  1 
ATOM   1858 N NH1 . ARG A 1 240 ? -15.17600 76.60800 297.70400 1.000 64.35491  ? 243 ARG A NH1 1 
ATOM   1859 N NH2 . ARG A 1 240 ? -14.99700 74.51500 296.76700 1.000 63.17447  ? 243 ARG A NH2 1 
ATOM   1860 N N   . ARG A 1 241 ? -13.59400 77.83000 293.66400 1.000 66.44117  ? 244 ARG A N   1 
ATOM   1861 C CA  . ARG A 1 241 ? -12.30800 77.43500 294.23300 1.000 62.89075  ? 244 ARG A CA  1 
ATOM   1862 C C   . ARG A 1 241 ? -11.24400 78.46800 293.92700 1.000 64.76429  ? 244 ARG A C   1 
ATOM   1863 O O   . ARG A 1 241 ? -10.36300 78.71600 294.75800 1.000 63.93290  ? 244 ARG A O   1 
ATOM   1864 C CB  . ARG A 1 241 ? -11.86600 76.06300 293.71600 1.000 61.77559  ? 244 ARG A CB  1 
ATOM   1865 C CG  . ARG A 1 241 ? -12.80500 74.89800 294.01100 1.000 61.58589  ? 244 ARG A CG  1 
ATOM   1866 C CD  . ARG A 1 241 ? -12.15600 73.57500 293.63800 1.000 54.70808  ? 244 ARG A CD  1 
ATOM   1867 N NE  . ARG A 1 241 ? -13.03900 72.42800 293.82500 1.000 52.59865  ? 244 ARG A NE  1 
ATOM   1868 C CZ  . ARG A 1 241 ? -12.68900 71.16700 293.56800 1.000 57.81169  ? 244 ARG A CZ  1 
ATOM   1869 N NH1 . ARG A 1 241 ? -11.46800 70.88900 293.10300 1.000 53.86882  ? 244 ARG A NH1 1 
ATOM   1870 N NH2 . ARG A 1 241 ? -13.55600 70.17700 293.77500 1.000 50.26249  ? 244 ARG A NH2 1 
ATOM   1871 N N   . ALA A 1 242 ? -11.30600 79.07400 292.73500 1.000 68.13591  ? 245 ALA A N   1 
ATOM   1872 C CA  . ALA A 1 242 ? -10.37400 80.14600 292.39500 1.000 66.33429  ? 245 ALA A CA  1 
ATOM   1873 C C   . ALA A 1 242 ? -10.56600 81.35500 293.30700 1.000 69.88553  ? 245 ALA A C   1 
ATOM   1874 O O   . ALA A 1 242 ? -9.58900  81.94300 293.78800 1.000 68.02085  ? 245 ALA A O   1 
ATOM   1875 C CB  . ALA A 1 242 ? -10.55400 80.54400 290.94000 1.000 64.13723  ? 245 ALA A CB  1 
ATOM   1876 N N   . VAL A 1 243 ? -11.82200 81.72700 293.56400 1.000 68.69144  ? 246 VAL A N   1 
ATOM   1877 C CA  . VAL A 1 243 ? -12.12600 82.84000 294.46100 1.000 73.25560  ? 246 VAL A CA  1 
ATOM   1878 C C   . VAL A 1 243 ? -11.68900 82.52400 295.88900 1.000 74.05457  ? 246 VAL A C   1 
ATOM   1879 O O   . VAL A 1 243 ? -11.21200 83.40300 296.62100 1.000 74.13733  ? 246 VAL A O   1 
ATOM   1880 C CB  . VAL A 1 243 ? -13.62800 83.16900 294.39000 1.000 71.26067  ? 246 VAL A CB  1 
ATOM   1881 C CG1 . VAL A 1 243 ? -14.00500 84.18200 295.45700 1.000 74.82605  ? 246 VAL A CG1 1 
ATOM   1882 C CG2 . VAL A 1 243 ? -13.98800 83.66700 293.01100 1.000 65.39573  ? 246 VAL A CG2 1 
ATOM   1883 N N   . GLU A 1 244 ? -11.85400 81.27100 296.31300 1.000 74.26659  ? 247 GLU A N   1 
ATOM   1884 C CA  . GLU A 1 244 ? -11.45400 80.89500 297.66300 1.000 68.34307  ? 247 GLU A CA  1 
ATOM   1885 C C   . GLU A 1 244 ? -9.94100  80.85400 297.80800 1.000 70.08084  ? 247 GLU A C   1 
ATOM   1886 O O   . GLU A 1 244 ? -9.41900  81.18600 298.87600 1.000 74.33163  ? 247 GLU A O   1 
ATOM   1887 C CB  . GLU A 1 244 ? -12.06800 79.54900 298.03300 1.000 65.80374  ? 247 GLU A CB  1 
ATOM   1888 C CG  . GLU A 1 244 ? -11.97600 79.20800 299.49600 1.000 77.36147  ? 247 GLU A CG  1 
ATOM   1889 C CD  . GLU A 1 244 ? -12.85200 80.10500 300.37100 1.000 85.22501  ? 247 GLU A CD  1 
ATOM   1890 O OE1 . GLU A 1 244 ? -13.62000 80.92200 299.80400 1.000 84.74254  ? 247 GLU A OE1 1 
ATOM   1891 O OE2 . GLU A 1 244 ? -12.77300 79.98600 301.62300 1.000 74.49648  ? 247 GLU A OE2 1 
ATOM   1892 N N   . LEU A 1 245 ? -9.21600  80.45800 296.75700 1.000 70.31143  ? 248 LEU A N   1 
ATOM   1893 C CA  . LEU A 1 245 ? -7.76800  80.63400 296.77500 1.000 71.25645  ? 248 LEU A CA  1 
ATOM   1894 C C   . LEU A 1 245 ? -7.40900  82.09700 296.99100 1.000 75.69550  ? 248 LEU A C   1 
ATOM   1895 O O   . LEU A 1 245 ? -6.49200  82.41400 297.75900 1.000 73.70526  ? 248 LEU A O   1 
ATOM   1896 C CB  . LEU A 1 245 ? -7.14200  80.12600 295.47900 1.000 67.32163  ? 248 LEU A CB  1 
ATOM   1897 C CG  . LEU A 1 245 ? -5.61900  80.27500 295.42000 1.000 66.03367  ? 248 LEU A CG  1 
ATOM   1898 C CD1 . LEU A 1 245 ? -4.97300  79.27100 296.32400 1.000 66.70636  ? 248 LEU A CD1 1 
ATOM   1899 C CD2 . LEU A 1 245 ? -5.07200  80.13300 293.98800 1.000 68.07493  ? 248 LEU A CD2 1 
ATOM   1900 N N   . GLY A 1 246 ? -8.13600  83.00400 296.32900 1.000 74.05040  ? 249 GLY A N   1 
ATOM   1901 C CA  . GLY A 1 246 ? -7.89200  84.42300 296.53200 1.000 75.22976  ? 249 GLY A CA  1 
ATOM   1902 C C   . GLY A 1 246 ? -8.11700  84.84700 297.96900 1.000 75.64032  ? 249 GLY A C   1 
ATOM   1903 O O   . GLY A 1 246 ? -7.32600  85.60000 298.53900 1.000 74.56212  ? 249 GLY A O   1 
ATOM   1904 N N   . ARG A 1 247 ? -9.19200  84.35000 298.57600 1.000 76.80077  ? 250 ARG A N   1 
ATOM   1905 C CA  . ARG A 1 247 ? -9.52300  84.71700 299.94400 1.000 76.53908  ? 250 ARG A CA  1 
ATOM   1906 C C   . ARG A 1 247 ? -8.46000  84.25100 300.93800 1.000 74.95895  ? 250 ARG A C   1 
ATOM   1907 O O   . ARG A 1 247 ? -8.20200  84.94600 301.92600 1.000 72.77511  ? 250 ARG A O   1 
ATOM   1908 C CB  . ARG A 1 247 ? -10.89400 84.15000 300.30100 1.000 76.18556  ? 250 ARG A CB  1 
ATOM   1909 C CG  . ARG A 1 247 ? -11.52600 84.82200 301.49600 1.000 78.53609  ? 250 ARG A CG  1 
ATOM   1910 C CD  . ARG A 1 247 ? -12.88600 84.23200 301.82100 1.000 82.19679  ? 250 ARG A CD  1 
ATOM   1911 N NE  . ARG A 1 247 ? -13.97400 84.86700 301.07900 1.000 85.83722  ? 250 ARG A NE  1 
ATOM   1912 C CZ  . ARG A 1 247 ? -14.55000 84.34000 300.00200 1.000 88.07685  ? 250 ARG A CZ  1 
ATOM   1913 N NH1 . ARG A 1 247 ? -14.13900 83.16800 299.52700 1.000 84.11100  ? 250 ARG A NH1 1 
ATOM   1914 N NH2 . ARG A 1 247 ? -15.53800 84.98500 299.39700 1.000 88.79187  ? 250 ARG A NH2 1 
ATOM   1915 N N   . ASN A 1 248 ? -7.82200  83.10000 300.69100 1.000 74.65509  ? 251 ASN A N   1 
ATOM   1916 C CA  . ASN A 1 248 ? -6.77600  82.61800 301.60000 1.000 74.55308  ? 251 ASN A CA  1 
ATOM   1917 C C   . ASN A 1 248 ? -5.51600  83.47900 301.54000 1.000 76.29792  ? 251 ASN A C   1 
ATOM   1918 O O   . ASN A 1 248 ? -4.75000  83.52000 302.51300 1.000 79.81342  ? 251 ASN A O   1 
ATOM   1919 C CB  . ASN A 1 248 ? -6.41000  81.16000 301.28700 1.000 73.24679  ? 251 ASN A CB  1 
ATOM   1920 C CG  . ASN A 1 248 ? -7.36500  80.14700 301.92100 1.000 71.24022  ? 251 ASN A CG  1 
ATOM   1921 O OD1 . ASN A 1 248 ? -6.95100  79.32300 302.73800 1.000 72.33220  ? 251 ASN A OD1 1 
ATOM   1922 N ND2 . ASN A 1 248 ? -8.63800  80.19200 301.53200 1.000 66.17697  ? 251 ASN A ND2 1 
ATOM   1923 N N   . LEU A 1 249 ? -5.26700  84.14700 300.41100 1.000 80.06374  ? 252 LEU A N   1 
ATOM   1924 C CA  . LEU A 1 249 ? -4.09800  85.00200 300.24200 1.000 80.52149  ? 252 LEU A CA  1 
ATOM   1925 C C   . LEU A 1 249 ? -4.44800  86.47900 300.35900 1.000 80.56088  ? 252 LEU A C   1 
ATOM   1926 O O   . LEU A 1 249 ? -3.66900  87.33400 299.92000 1.000 80.53951  ? 252 LEU A O   1 
ATOM   1927 C CB  . LEU A 1 249 ? -3.41100  84.70100 298.90900 1.000 75.02154  ? 252 LEU A CB  1 
ATOM   1928 C CG  . LEU A 1 249 ? -2.86900  83.26500 298.88100 1.000 73.49062  ? 252 LEU A CG  1 
ATOM   1929 C CD1 . LEU A 1 249 ? -2.27800  82.87600 297.54700 1.000 72.92269  ? 252 LEU A CD1 1 
ATOM   1930 C CD2 . LEU A 1 249 ? -1.84600  83.06400 299.99400 1.000 78.65825  ? 252 LEU A CD2 1 
ATOM   1931 N N   . ASN A 1 250 ? -5.59400  86.78100 300.96800 1.000 80.29204  ? 253 ASN A N   1 
ATOM   1932 C CA  . ASN A 1 250 ? -6.05300  88.14100 301.23500 1.000 82.70876  ? 253 ASN A CA  1 
ATOM   1933 C C   . ASN A 1 250 ? -5.98400  88.98300 299.96500 1.000 85.16211  ? 253 ASN A C   1 
ATOM   1934 O O   . ASN A 1 250 ? -5.22900  89.94900 299.85300 1.000 87.76291  ? 253 ASN A O   1 
ATOM   1935 C CB  . ASN A 1 250 ? -5.25900  88.76900 302.38400 1.000 87.05369  ? 253 ASN A CB  1 
ATOM   1936 C CG  . ASN A 1 250 ? -5.45600  88.01800 303.71800 1.000 97.02703  ? 253 ASN A CG  1 
ATOM   1937 O OD1 . ASN A 1 250 ? -4.72300  87.06800 304.02900 1.000 94.37846  ? 253 ASN A OD1 1 
ATOM   1938 N ND2 . ASN A 1 250 ? -6.45200  88.44500 304.50300 1.000 94.40519  ? 253 ASN A ND2 1 
ATOM   1939 N N   . CYS A 1 251 ? -6.78300  88.57000 298.99200 1.000 78.26035  ? 254 CYS A N   1 
ATOM   1940 C CA  . CYS A 1 251 ? -6.81900  89.20000 297.68800 1.000 83.92556  ? 254 CYS A CA  1 
ATOM   1941 C C   . CYS A 1 251 ? -8.08900  90.02200 297.55300 1.000 88.15501  ? 254 CYS A C   1 
ATOM   1942 O O   . CYS A 1 251 ? -9.11800  89.71500 298.16100 1.000 88.04820  ? 254 CYS A O   1 
ATOM   1943 C CB  . CYS A 1 251 ? -6.74900  88.15900 296.55100 1.000 87.24986  ? 254 CYS A CB  1 
ATOM   1944 S SG  . CYS A 1 251 ? -5.06100  87.55900 296.10500 1.000 85.98291  ? 254 CYS A SG  1 
ATOM   1945 N N   . ASN A 1 252 ? -8.00100  91.07900 296.75500 1.000 91.28192  ? 255 ASN A N   1 
ATOM   1946 C CA  . ASN A 1 252 ? -9.19700  91.77500 296.31500 1.000 90.52274  ? 255 ASN A CA  1 
ATOM   1947 C C   . ASN A 1 252 ? -9.98700  90.84300 295.40900 1.000 88.31839  ? 255 ASN A C   1 
ATOM   1948 O O   . ASN A 1 252 ? -9.44900  90.32500 294.42800 1.000 83.32431  ? 255 ASN A O   1 
ATOM   1949 C CB  . ASN A 1 252 ? -8.80900  93.06000 295.58700 1.000 93.36134  ? 255 ASN A CB  1 
ATOM   1950 C CG  . ASN A 1 252 ? -9.97900  94.00400 295.41100 1.000 96.60335  ? 255 ASN A CG  1 
ATOM   1951 O OD1 . ASN A 1 252 ? -10.95800 93.67200 294.74800 1.000 93.93585  ? 255 ASN A OD1 1 
ATOM   1952 N ND2 . ASN A 1 252 ? -9.87200  95.20100 295.98500 1.000 101.89010 ? 255 ASN A ND2 1 
ATOM   1953 N N   . LEU A 1 253 ? -11.25300 90.60100 295.74600 1.000 88.14738  ? 256 LEU A N   1 
ATOM   1954 C CA  . LEU A 1 253 ? -12.05400 89.60700 295.04100 1.000 86.84820  ? 256 LEU A CA  1 
ATOM   1955 C C   . LEU A 1 253 ? -13.13900 90.22200 294.16300 1.000 90.69447  ? 256 LEU A C   1 
ATOM   1956 O O   . LEU A 1 253 ? -14.03600 89.50200 293.71000 1.000 89.94035  ? 256 LEU A O   1 
ATOM   1957 C CB  . LEU A 1 253 ? -12.69300 88.64500 296.04400 1.000 84.73393  ? 256 LEU A CB  1 
ATOM   1958 C CG  . LEU A 1 253 ? -11.81100 88.05100 297.14500 1.000 85.01282  ? 256 LEU A CG  1 
ATOM   1959 C CD1 . LEU A 1 253 ? -12.69300 87.38400 298.17200 1.000 84.17565  ? 256 LEU A CD1 1 
ATOM   1960 C CD2 . LEU A 1 253 ? -10.78200 87.06000 296.60900 1.000 80.73051  ? 256 LEU A CD2 1 
ATOM   1961 N N   . ASN A 1 254 ? -13.08000 91.52800 293.90000 1.000 93.17186  ? 257 ASN A N   1 
ATOM   1962 C CA  . ASN A 1 254 ? -14.19600 92.19700 293.23900 1.000 92.53019  ? 257 ASN A CA  1 
ATOM   1963 C C   . ASN A 1 254 ? -14.29700 91.79400 291.77200 1.000 92.63191  ? 257 ASN A C   1 
ATOM   1964 O O   . ASN A 1 254 ? -15.32800 91.27400 291.33200 1.000 95.29018  ? 257 ASN A O   1 
ATOM   1965 C CB  . ASN A 1 254 ? -14.06200 93.71200 293.39800 1.000 93.81876  ? 257 ASN A CB  1 
ATOM   1966 C CG  . ASN A 1 254 ? -14.29900 94.16100 294.83400 1.000 97.83183  ? 257 ASN A CG  1 
ATOM   1967 O OD1 . ASN A 1 254 ? -15.12000 93.57500 295.54300 1.000 93.04169  ? 257 ASN A OD1 1 
ATOM   1968 N ND2 . ASN A 1 254 ? -13.57600 95.19600 295.27200 1.000 102.19046 ? 257 ASN A ND2 1 
ATOM   1969 N N   . SER A 1 255 ? -13.23600 92.00900 291.00100 1.000 90.59721  ? 258 SER A N   1 
ATOM   1970 C CA  . SER A 1 255 ? -13.22300 91.66200 289.58800 1.000 90.61190  ? 258 SER A CA  1 
ATOM   1971 C C   . SER A 1 255 ? -12.30600 90.47300 289.33600 1.000 90.36491  ? 258 SER A C   1 
ATOM   1972 O O   . SER A 1 255 ? -11.42800 90.15000 290.14700 1.000 81.47462  ? 258 SER A O   1 
ATOM   1973 C CB  . SER A 1 255 ? -12.76100 92.84800 288.73100 1.000 92.94407  ? 258 SER A CB  1 
ATOM   1974 O OG  . SER A 1 255 ? -11.36200 93.05000 288.86100 1.000 92.66996  ? 258 SER A OG  1 
ATOM   1975 N N   . ASP A 1 256 ? -12.51100 89.82700 288.18000 1.000 88.95428  ? 259 ASP A N   1 
ATOM   1976 C CA  . ASP A 1 256 ? -11.61000 88.74800 287.79000 1.000 81.41837  ? 259 ASP A CA  1 
ATOM   1977 C C   . ASP A 1 256 ? -10.23300 89.28800 287.46500 1.000 79.74033  ? 259 ASP A C   1 
ATOM   1978 O O   . ASP A 1 256 ? -9.22900  88.61500 287.70700 1.000 80.04307  ? 259 ASP A O   1 
ATOM   1979 C CB  . ASP A 1 256 ? -12.16000 87.97600 286.59800 1.000 84.96120  ? 259 ASP A CB  1 
ATOM   1980 C CG  . ASP A 1 256 ? -13.55700 87.45600 286.83600 1.000 90.09325  ? 259 ASP A CG  1 
ATOM   1981 O OD1 . ASP A 1 256 ? -14.46700 88.29200 287.05500 1.000 91.43512  ? 259 ASP A OD1 1 
ATOM   1982 O OD2 . ASP A 1 256 ? -13.74000 86.21900 286.79600 1.000 85.25982  ? 259 ASP A OD2 1 
ATOM   1983 N N   . GLU A 1 257 ? -10.15900 90.50000 286.91900 1.000 85.09042  ? 260 GLU A N   1 
ATOM   1984 C CA  . GLU A 1 257 ? -8.84300  91.07300 286.67600 1.000 89.07650  ? 260 GLU A CA  1 
ATOM   1985 C C   . GLU A 1 257 ? -8.13200  91.35700 287.97900 1.000 82.16090  ? 260 GLU A C   1 
ATOM   1986 O O   . GLU A 1 257 ? -6.90200  91.23000 288.05800 1.000 77.84840  ? 260 GLU A O   1 
ATOM   1987 C CB  . GLU A 1 257 ? -8.94700  92.34200 285.83200 1.000 93.76098  ? 260 GLU A CB  1 
ATOM   1988 C CG  . GLU A 1 257 ? -8.74300  92.08500 284.33500 1.000 108.37053 ? 260 GLU A CG  1 
ATOM   1989 C CD  . GLU A 1 257 ? -7.26500  91.95500 283.93900 1.000 115.17401 ? 260 GLU A CD  1 
ATOM   1990 O OE1 . GLU A 1 257 ? -6.87600  92.56000 282.91000 1.000 116.24543 ? 260 GLU A OE1 1 
ATOM   1991 O OE2 . GLU A 1 257 ? -6.49400  91.26200 284.65100 1.000 107.59017 ? 260 GLU A OE2 1 
ATOM   1992 N N   . GLU A 1 258 ? -8.90000  91.70300 289.01500 1.000 86.98316  ? 261 GLU A N   1 
ATOM   1993 C CA  . GLU A 1 258 ? -8.31600  92.00900 290.31400 1.000 83.18471  ? 261 GLU A CA  1 
ATOM   1994 C C   . GLU A 1 258 ? -7.81100  90.74800 291.00500 1.000 79.33425  ? 261 GLU A C   1 
ATOM   1995 O O   . GLU A 1 258 ? -6.73400  90.75500 291.61300 1.000 79.95289  ? 261 GLU A O   1 
ATOM   1996 C CB  . GLU A 1 258 ? -9.34500  92.73000 291.17300 1.000 86.15178  ? 261 GLU A CB  1 
ATOM   1997 C CG  . GLU A 1 258 ? -8.74000  93.72500 292.13500 1.000 94.76257  ? 261 GLU A CG  1 
ATOM   1998 C CD  . GLU A 1 258 ? -9.15400  95.14800 291.83000 1.000 102.40941 ? 261 GLU A CD  1 
ATOM   1999 O OE1 . GLU A 1 258 ? -8.35200  96.07100 292.11200 1.000 99.66070  ? 261 GLU A OE1 1 
ATOM   2000 O OE2 . GLU A 1 258 ? -10.27900 95.33400 291.30500 1.000 103.90212 ? 261 GLU A OE2 1 
ATOM   2001 N N   . LEU A 1 259 ? -8.56500  89.65000 290.90800 1.000 75.38266  ? 262 LEU A N   1 
ATOM   2002 C CA  . LEU A 1 259 ? -8.10800  88.38500 291.47700 1.000 75.59682  ? 262 LEU A CA  1 
ATOM   2003 C C   . LEU A 1 259 ? -6.84900  87.88200 290.77800 1.000 78.12259  ? 262 LEU A C   1 
ATOM   2004 O O   . LEU A 1 259 ? -5.87200  87.50700 291.43700 1.000 75.49603  ? 262 LEU A O   1 
ATOM   2005 C CB  . LEU A 1 259 ? -9.22700  87.34200 291.40000 1.000 80.30467  ? 262 LEU A CB  1 
ATOM   2006 C CG  . LEU A 1 259 ? -8.98400  85.97500 292.05200 1.000 76.44577  ? 262 LEU A CG  1 
ATOM   2007 C CD1 . LEU A 1 259 ? -8.25800  86.12900 293.35400 1.000 74.33982  ? 262 LEU A CD1 1 
ATOM   2008 C CD2 . LEU A 1 259 ? -10.30100 85.23800 292.28000 1.000 74.50345  ? 262 LEU A CD2 1 
ATOM   2009 N N   . ILE A 1 260 ? -6.85100  87.87700 289.43900 1.000 79.34520  ? 263 ILE A N   1 
ATOM   2010 C CA  . ILE A 1 260 ? -5.72600  87.32500 288.68500 1.000 75.52099  ? 263 ILE A CA  1 
ATOM   2011 C C   . ILE A 1 260 ? -4.46700  88.15300 288.90100 1.000 77.17892  ? 263 ILE A C   1 
ATOM   2012 O O   . ILE A 1 260 ? -3.36900  87.60400 289.06300 1.000 74.82173  ? 263 ILE A O   1 
ATOM   2013 C CB  . ILE A 1 260 ? -6.07000  87.22400 287.18900 1.000 80.44957  ? 263 ILE A CB  1 
ATOM   2014 C CG1 . ILE A 1 260 ? -7.31300  86.37100 286.97100 1.000 75.57430  ? 263 ILE A CG1 1 
ATOM   2015 C CG2 . ILE A 1 260 ? -4.89900  86.62800 286.41600 1.000 77.63375  ? 263 ILE A CG2 1 
ATOM   2016 C CD1 . ILE A 1 260 ? -7.86300  86.49900 285.59400 1.000 79.31873  ? 263 ILE A CD1 1 
ATOM   2017 N N   . HIS A 1 261 ? -4.59100  89.48300 288.87600 1.000 82.41609  ? 264 HIS A N   1 
ATOM   2018 C CA  . HIS A 1 261 ? -3.42600  90.31100 289.16100 1.000 84.73253  ? 264 HIS A CA  1 
ATOM   2019 C C   . HIS A 1 261 ? -2.88600  90.02600 290.55100 1.000 86.80216  ? 264 HIS A C   1 
ATOM   2020 O O   . HIS A 1 261 ? -1.66700  89.90900 290.73700 1.000 91.44689  ? 264 HIS A O   1 
ATOM   2021 C CB  . HIS A 1 261 ? -3.74100  91.80200 289.03300 1.000 92.16155  ? 264 HIS A CB  1 
ATOM   2022 C CG  . HIS A 1 261 ? -2.67000  92.67600 289.62100 1.000 100.69819 ? 264 HIS A CG  1 
ATOM   2023 N ND1 . HIS A 1 261 ? -1.43800  92.85100 289.02400 1.000 104.86728 ? 264 HIS A ND1 1 
ATOM   2024 C CD2 . HIS A 1 261 ? -2.62600  93.37600 290.78200 1.000 102.05090 ? 264 HIS A CD2 1 
ATOM   2025 C CE1 . HIS A 1 261 ? -0.69100  93.63700 289.77900 1.000 108.05449 ? 264 HIS A CE1 1 
ATOM   2026 N NE2 . HIS A 1 261 ? -1.38800  93.96900 290.85200 1.000 106.03748 ? 264 HIS A NE2 1 
ATOM   2027 N N   . CYS A 1 262 ? -3.77900  89.91700 291.54500 1.000 83.57750  ? 265 CYS A N   1 
ATOM   2028 C CA  . CYS A 1 262 ? -3.33000  89.63800 292.90500 1.000 81.01185  ? 265 CYS A CA  1 
ATOM   2029 C C   . CYS A 1 262 ? -2.59900  88.30500 292.97600 1.000 81.47071  ? 265 CYS A C   1 
ATOM   2030 O O   . CYS A 1 262 ? -1.57200  88.18800 293.65900 1.000 84.28463  ? 265 CYS A O   1 
ATOM   2031 C CB  . CYS A 1 262 ? -4.51100  89.65700 293.87600 1.000 82.11875  ? 265 CYS A CB  1 
ATOM   2032 S SG  . CYS A 1 262 ? -4.04600  89.25900 295.60800 1.000 103.40871 ? 265 CYS A SG  1 
ATOM   2033 N N   . LEU A 1 263 ? -3.09900  87.29300 292.25800 1.000 75.20374  ? 266 LEU A N   1 
ATOM   2034 C CA  . LEU A 1 263 ? -2.48200  85.97500 292.31200 1.000 73.28834  ? 266 LEU A CA  1 
ATOM   2035 C C   . LEU A 1 263 ? -1.15000  85.92800 291.57400 1.000 77.55709  ? 266 LEU A C   1 
ATOM   2036 O O   . LEU A 1 263 ? -0.29500  85.10100 291.90100 1.000 78.37626  ? 266 LEU A O   1 
ATOM   2037 C CB  . LEU A 1 263 ? -3.44400  84.93300 291.75700 1.000 72.15027  ? 266 LEU A CB  1 
ATOM   2038 C CG  . LEU A 1 263 ? -4.59000  84.61500 292.71400 1.000 74.13401  ? 266 LEU A CG  1 
ATOM   2039 C CD1 . LEU A 1 263 ? -5.74600  83.94100 292.01700 1.000 71.39645  ? 266 LEU A CD1 1 
ATOM   2040 C CD2 . LEU A 1 263 ? -4.07600  83.74700 293.84300 1.000 76.93839  ? 266 LEU A CD2 1 
ATOM   2041 N N   . ARG A 1 264 ? -0.94400  86.78700 290.57800 1.000 81.46643  ? 267 ARG A N   1 
ATOM   2042 C CA  . ARG A 1 264 ? 0.34600   86.76600 289.89800 1.000 81.46338  ? 267 ARG A CA  1 
ATOM   2043 C C   . ARG A 1 264 ? 1.42700   87.46000 290.71600 1.000 79.17631  ? 267 ARG A C   1 
ATOM   2044 O O   . ARG A 1 264 ? 2.61100   87.13100 290.57700 1.000 82.03903  ? 267 ARG A O   1 
ATOM   2045 C CB  . ARG A 1 264 ? 0.23100   87.39700 288.51400 1.000 79.32340  ? 267 ARG A CB  1 
ATOM   2046 C CG  . ARG A 1 264 ? -0.52100  86.54200 287.49600 1.000 80.64879  ? 267 ARG A CG  1 
ATOM   2047 C CD  . ARG A 1 264 ? -0.53100  87.22800 286.14500 1.000 76.26546  ? 267 ARG A CD  1 
ATOM   2048 N NE  . ARG A 1 264 ? -1.31700  86.52400 285.14800 1.000 80.50158  ? 267 ARG A NE  1 
ATOM   2049 C CZ  . ARG A 1 264 ? -2.17500  87.13000 284.33000 1.000 86.91260  ? 267 ARG A CZ  1 
ATOM   2050 N NH1 . ARG A 1 264 ? -2.35400  88.44100 284.44400 1.000 88.19088  ? 267 ARG A NH1 1 
ATOM   2051 N NH2 . ARG A 1 264 ? -2.86300  86.43800 283.41600 1.000 78.19291  ? 267 ARG A NH2 1 
ATOM   2052 N N   . GLU A 1 265 ? 1.04900   88.41000 291.57100 1.000 79.18768  ? 268 GLU A N   1 
ATOM   2053 C CA  . GLU A 1 265 ? 2.03900   89.04500 292.43500 1.000 87.06045  ? 268 GLU A CA  1 
ATOM   2054 C C   . GLU A 1 265 ? 2.66400   88.03300 293.38800 1.000 84.05708  ? 268 GLU A C   1 
ATOM   2055 O O   . GLU A 1 265 ? 3.85400   88.12900 293.71200 1.000 80.59080  ? 268 GLU A O   1 
ATOM   2056 C CB  . GLU A 1 265 ? 1.40200   90.18900 293.22500 1.000 93.38102  ? 268 GLU A CB  1 
ATOM   2057 C CG  . GLU A 1 265 ? 1.50100   91.57100 292.57900 1.000 101.28386 ? 268 GLU A CG  1 
ATOM   2058 C CD  . GLU A 1 265 ? 1.29200   92.70500 293.59400 1.000 109.29846 ? 268 GLU A CD  1 
ATOM   2059 O OE1 . GLU A 1 265 ? 0.99300   92.40800 294.77900 1.000 103.48826 ? 268 GLU A OE1 1 
ATOM   2060 O OE2 . GLU A 1 265 ? 1.43300   93.89000 293.20400 1.000 113.89804 ? 268 GLU A OE2 1 
ATOM   2061 N N   . LYS A 1 266 ? 1.87900   87.04300 293.82400 1.000 82.59519  ? 269 LYS A N   1 
ATOM   2062 C CA  . LYS A 1 266 ? 2.32000   86.07700 294.82500 1.000 76.29598  ? 269 LYS A CA  1 
ATOM   2063 C C   . LYS A 1 266 ? 3.45100   85.20400 294.29500 1.000 73.01277  ? 269 LYS A C   1 
ATOM   2064 O O   . LYS A 1 266 ? 3.53600   84.91000 293.10100 1.000 82.51732  ? 269 LYS A O   1 
ATOM   2065 C CB  . LYS A 1 266 ? 1.14600   85.19400 295.25700 1.000 73.15192  ? 269 LYS A CB  1 
ATOM   2066 C CG  . LYS A 1 266 ? -0.06200  85.96800 295.78200 1.000 81.57533  ? 269 LYS A CG  1 
ATOM   2067 C CD  . LYS A 1 266 ? 0.26000   86.75500 297.05800 1.000 78.24071  ? 269 LYS A CD  1 
ATOM   2068 C CE  . LYS A 1 266 ? -0.90800  87.64800 297.45700 1.000 81.80541  ? 269 LYS A CE  1 
ATOM   2069 N NZ  . LYS A 1 266 ? -0.61600  88.48300 298.67000 1.000 89.50411  ? 269 LYS A NZ  1 
ATOM   2070 N N   . LYS A 1 267 ? 4.33400   84.79400 295.19400 1.000 71.59769  ? 270 LYS A N   1 
ATOM   2071 C CA  . LYS A 1 267 ? 5.33000   83.80400 294.84200 1.000 75.30680  ? 270 LYS A CA  1 
ATOM   2072 C C   . LYS A 1 267 ? 4.65300   82.44400 294.69100 1.000 74.06310  ? 270 LYS A C   1 
ATOM   2073 O O   . LYS A 1 267 ? 3.55500   82.22900 295.20700 1.000 73.29544  ? 270 LYS A O   1 
ATOM   2074 C CB  . LYS A 1 267 ? 6.43700   83.75300 295.89900 1.000 75.99917  ? 270 LYS A CB  1 
ATOM   2075 C CG  . LYS A 1 267 ? 7.31800   85.01000 295.94800 1.000 74.97671  ? 270 LYS A CG  1 
ATOM   2076 C CD  . LYS A 1 267 ? 8.21500   85.04900 297.17900 1.000 81.58697  ? 270 LYS A CD  1 
ATOM   2077 C CE  . LYS A 1 267 ? 8.70500   86.47100 297.48200 1.000 84.57482  ? 270 LYS A CE  1 
ATOM   2078 N NZ  . LYS A 1 267 ? 9.38400   86.59100 298.82200 1.000 88.44485  ? 270 LYS A NZ  1 
ATOM   2079 N N   . PRO A 1 268 ? 5.27300   81.51900 293.95500 1.000 73.22290  ? 271 PRO A N   1 
ATOM   2080 C CA  . PRO A 1 268 ? 4.68300   80.18000 293.80100 1.000 71.45174  ? 271 PRO A CA  1 
ATOM   2081 C C   . PRO A 1 268 ? 4.32300   79.50600 295.12300 1.000 73.59487  ? 271 PRO A C   1 
ATOM   2082 O O   . PRO A 1 268 ? 3.16100   79.13400 295.33800 1.000 74.33557  ? 271 PRO A O   1 
ATOM   2083 C CB  . PRO A 1 268 ? 5.78100   79.40200 293.06600 1.000 69.84644  ? 271 PRO A CB  1 
ATOM   2084 C CG  . PRO A 1 268 ? 6.53700   80.43100 292.32200 1.000 68.95273  ? 271 PRO A CG  1 
ATOM   2085 C CD  . PRO A 1 268 ? 6.45600   81.71000 293.09700 1.000 71.93272  ? 271 PRO A CD  1 
ATOM   2086 N N   . GLN A 1 269 ? 5.30200   79.35400 296.02100 1.000 71.93867  ? 272 GLN A N   1 
ATOM   2087 C CA  . GLN A 1 269 ? 5.06500   78.60300 297.25100 1.000 73.25440  ? 272 GLN A CA  1 
ATOM   2088 C C   . GLN A 1 269 ? 3.92700   79.17900 298.09300 1.000 71.46352  ? 272 GLN A C   1 
ATOM   2089 O O   . GLN A 1 269 ? 3.38100   78.46300 298.93600 1.000 70.93985  ? 272 GLN A O   1 
ATOM   2090 C CB  . GLN A 1 269 ? 6.35500   78.52500 298.07000 1.000 72.84240  ? 272 GLN A CB  1 
ATOM   2091 C CG  . GLN A 1 269 ? 6.35700   77.48400 299.20000 1.000 67.66768  ? 272 GLN A CG  1 
ATOM   2092 C CD  . GLN A 1 269 ? 5.90000   76.09400 298.76000 1.000 74.51549  ? 272 GLN A CD  1 
ATOM   2093 O OE1 . GLN A 1 269 ? 6.25400   75.59900 297.67400 1.000 74.95244  ? 272 GLN A OE1 1 
ATOM   2094 N NE2 . GLN A 1 269 ? 5.09200   75.46000 299.60400 1.000 71.42664  ? 272 GLN A NE2 1 
ATOM   2095 N N   . GLU A 1 270 ? 3.52800   80.43400 297.86400 1.000 73.02674  ? 273 GLU A N   1 
ATOM   2096 C CA  . GLU A 1 270 ? 2.40300   80.99400 298.61000 1.000 73.04745  ? 273 GLU A CA  1 
ATOM   2097 C C   . GLU A 1 270 ? 1.07500   80.40800 298.16800 1.000 73.92656  ? 273 GLU A C   1 
ATOM   2098 O O   . GLU A 1 270 ? 0.15300   80.29400 298.97800 1.000 76.28911  ? 273 GLU A O   1 
ATOM   2099 C CB  . GLU A 1 270 ? 2.35000   82.50400 298.44600 1.000 74.96747  ? 273 GLU A CB  1 
ATOM   2100 C CG  . GLU A 1 270 ? 3.68600   83.17200 298.60600 1.000 80.52147  ? 273 GLU A CG  1 
ATOM   2101 C CD  . GLU A 1 270 ? 3.54200   84.63600 298.90800 1.000 81.49173  ? 273 GLU A CD  1 
ATOM   2102 O OE1 . GLU A 1 270 ? 3.05100   84.97100 300.01000 1.000 82.69131  ? 273 GLU A OE1 1 
ATOM   2103 O OE2 . GLU A 1 270 ? 3.89900   85.44700 298.03300 1.000 86.33812  ? 273 GLU A OE2 1 
ATOM   2104 N N   . LEU A 1 271 ? 0.94000   80.06500 296.89000 1.000 73.83736  ? 274 LEU A N   1 
ATOM   2105 C CA  . LEU A 1 271 ? -0.28500  79.42000 296.44200 1.000 73.36430  ? 274 LEU A CA  1 
ATOM   2106 C C   . LEU A 1 271 ? -0.29900  77.94500 296.81200 1.000 73.00384  ? 274 LEU A C   1 
ATOM   2107 O O   . LEU A 1 271 ? -1.36900  77.38000 297.06000 1.000 71.29168  ? 274 LEU A O   1 
ATOM   2108 C CB  . LEU A 1 271 ? -0.45300  79.59200 294.92800 1.000 69.93512  ? 274 LEU A CB  1 
ATOM   2109 C CG  . LEU A 1 271 ? -0.91200  80.96000 294.41800 1.000 69.68268  ? 274 LEU A CG  1 
ATOM   2110 C CD1 . LEU A 1 271 ? 0.24000   81.93800 294.29600 1.000 71.64794  ? 274 LEU A CD1 1 
ATOM   2111 C CD2 . LEU A 1 271 ? -1.58700  80.80100 293.09500 1.000 79.23288  ? 274 LEU A CD2 1 
ATOM   2112 N N   . ILE A 1 272 ? 0.87300   77.31400 296.85000 1.000 70.71426  ? 275 ILE A N   1 
ATOM   2113 C CA  . ILE A 1 272 ? 0.95100   75.90900 297.21800 1.000 69.68558  ? 275 ILE A CA  1 
ATOM   2114 C C   . ILE A 1 272 ? 0.60300   75.72300 298.68900 1.000 73.39735  ? 275 ILE A C   1 
ATOM   2115 O O   . ILE A 1 272 ? 0.00800   74.71100 299.07500 1.000 73.46508  ? 275 ILE A O   1 
ATOM   2116 C CB  . ILE A 1 272 ? 2.35200   75.37300 296.88000 1.000 72.19391  ? 275 ILE A CB  1 
ATOM   2117 C CG1 . ILE A 1 272 ? 2.59200   75.45100 295.37300 1.000 68.95771  ? 275 ILE A CG1 1 
ATOM   2118 C CG2 . ILE A 1 272 ? 2.53700   73.95900 297.40600 1.000 71.94886  ? 275 ILE A CG2 1 
ATOM   2119 C CD1 . ILE A 1 272 ? 3.99900   75.15000 294.96100 1.000 69.71585  ? 275 ILE A CD1 1 
ATOM   2120 N N   . ASP A 1 273 ? 0.94900   76.70600 299.52600 1.000 73.24059  ? 276 ASP A N   1 
ATOM   2121 C CA  . ASP A 1 273 ? 0.73900   76.59200 300.96600 1.000 71.97285  ? 276 ASP A CA  1 
ATOM   2122 C C   . ASP A 1 273 ? -0.73100  76.51400 301.33100 1.000 75.78704  ? 276 ASP A C   1 
ATOM   2123 O O   . ASP A 1 273 ? -1.08800  75.89700 302.34600 1.000 77.65798  ? 276 ASP A O   1 
ATOM   2124 C CB  . ASP A 1 273 ? 1.36300   77.78200 301.68700 1.000 73.34173  ? 276 ASP A CB  1 
ATOM   2125 C CG  . ASP A 1 273 ? 2.84600   77.63100 301.87000 1.000 78.34912  ? 276 ASP A CG  1 
ATOM   2126 O OD1 . ASP A 1 273 ? 3.33800   76.47700 301.79200 1.000 79.60786  ? 276 ASP A OD1 1 
ATOM   2127 O OD2 . ASP A 1 273 ? 3.51500   78.66700 302.09700 1.000 78.63104  ? 276 ASP A OD2 1 
ATOM   2128 N N   . VAL A 1 274 ? -1.59000  77.15800 300.54400 1.000 68.62157  ? 277 VAL A N   1 
ATOM   2129 C CA  . VAL A 1 274 ? -3.01500  77.24300 300.84000 1.000 72.15791  ? 277 VAL A CA  1 
ATOM   2130 C C   . VAL A 1 274 ? -3.85700  76.50800 299.82600 1.000 68.28611  ? 277 VAL A C   1 
ATOM   2131 O O   . VAL A 1 274 ? -5.09400  76.55300 299.91600 1.000 67.06527  ? 277 VAL A O   1 
ATOM   2132 C CB  . VAL A 1 274 ? -3.47800  78.70600 300.95100 1.000 73.28150  ? 277 VAL A CB  1 
ATOM   2133 C CG1 . VAL A 1 274 ? -2.81300  79.39300 302.16100 1.000 67.64811  ? 277 VAL A CG1 1 
ATOM   2134 C CG2 . VAL A 1 274 ? -3.19200  79.44000 299.64000 1.000 70.27362  ? 277 VAL A CG2 1 
ATOM   2135 N N   . GLU A 1 275 ? -3.22500  75.82600 298.86400 1.000 73.47962  ? 278 GLU A N   1 
ATOM   2136 C CA  . GLU A 1 275 ? -3.93500  75.17300 297.76600 1.000 69.91891  ? 278 GLU A CA  1 
ATOM   2137 C C   . GLU A 1 275 ? -4.98500  74.19500 298.27600 1.000 70.14213  ? 278 GLU A C   1 
ATOM   2138 O O   . GLU A 1 275 ? -6.10000  74.13900 297.74900 1.000 65.74356  ? 278 GLU A O   1 
ATOM   2139 C CB  . GLU A 1 275 ? -2.92900  74.45300 296.85900 1.000 70.36726  ? 278 GLU A CB  1 
ATOM   2140 C CG  . GLU A 1 275 ? -3.50400  73.27400 296.07000 1.000 74.83937  ? 278 GLU A CG  1 
ATOM   2141 C CD  . GLU A 1 275 ? -2.45100  72.51200 295.25900 1.000 77.71982  ? 278 GLU A CD  1 
ATOM   2142 O OE1 . GLU A 1 275 ? -1.49500  73.14400 294.74800 1.000 76.07915  ? 278 GLU A OE1 1 
ATOM   2143 O OE2 . GLU A 1 275 ? -2.58900  71.27200 295.13300 1.000 77.49851  ? 278 GLU A OE2 1 
ATOM   2144 N N   . TRP A 1 276 ? -4.65800  73.42900 299.31800 1.000 72.27117  ? 279 TRP A N   1 
ATOM   2145 C CA  . TRP A 1 276 ? -5.58000  72.40600 299.78400 1.000 67.55658  ? 279 TRP A CA  1 
ATOM   2146 C C   . TRP A 1 276 ? -6.73600  72.97000 300.58300 1.000 67.79798  ? 279 TRP A C   1 
ATOM   2147 O O   . TRP A 1 276 ? -7.68000  72.22800 300.86400 1.000 71.75333  ? 279 TRP A O   1 
ATOM   2148 C CB  . TRP A 1 276 ? -4.84500  71.37200 300.62500 1.000 63.43209  ? 279 TRP A CB  1 
ATOM   2149 C CG  . TRP A 1 276 ? -3.84400  70.57600 299.85900 1.000 63.50114  ? 279 TRP A CG  1 
ATOM   2150 C CD1 . TRP A 1 276 ? -2.49200  70.78600 299.80700 1.000 66.20091  ? 279 TRP A CD1 1 
ATOM   2151 C CD2 . TRP A 1 276 ? -4.10400  69.43800 299.03300 1.000 64.28854  ? 279 TRP A CD2 1 
ATOM   2152 N NE1 . TRP A 1 276 ? -1.89500  69.84300 299.00400 1.000 67.09275  ? 279 TRP A NE1 1 
ATOM   2153 C CE2 . TRP A 1 276 ? -2.86300  69.00300 298.51700 1.000 68.45409  ? 279 TRP A CE2 1 
ATOM   2154 C CE3 . TRP A 1 276 ? -5.26500  68.75200 298.66800 1.000 62.26758  ? 279 TRP A CE3 1 
ATOM   2155 C CZ2 . TRP A 1 276 ? -2.75200  67.90500 297.66200 1.000 64.70627  ? 279 TRP A CZ2 1 
ATOM   2156 C CZ3 . TRP A 1 276 ? -5.15300  67.66500 297.81700 1.000 61.55518  ? 279 TRP A CZ3 1 
ATOM   2157 C CH2 . TRP A 1 276 ? -3.90500  67.25000 297.32800 1.000 62.47877  ? 279 TRP A CH2 1 
ATOM   2158 N N   . ASN A 1 277 ? -6.70400  74.25300 300.93200 1.000 65.30060  ? 280 ASN A N   1 
ATOM   2159 C CA  . ASN A 1 277 ? -7.74300  74.82200 301.77800 1.000 66.01153  ? 280 ASN A CA  1 
ATOM   2160 C C   . ASN A 1 277 ? -9.03800  75.13100 301.03400 1.000 67.92376  ? 280 ASN A C   1 
ATOM   2161 O O   . ASN A 1 277 ? -10.00800 75.54200 301.67800 1.000 72.51582  ? 280 ASN A O   1 
ATOM   2162 C CB  . ASN A 1 277 ? -7.23100  76.09400 302.46200 1.000 66.43683  ? 280 ASN A CB  1 
ATOM   2163 C CG  . ASN A 1 277 ? -6.03400  75.83200 303.38100 1.000 71.16809  ? 280 ASN A CG  1 
ATOM   2164 O OD1 . ASN A 1 277 ? -5.74400  74.68900 303.75400 1.000 68.98845  ? 280 ASN A OD1 1 
ATOM   2165 N ND2 . ASN A 1 277 ? -5.33600  76.89800 303.74700 1.000 67.92076  ? 280 ASN A ND2 1 
ATOM   2166 N N   . VAL A 1 278 ? -9.10000  74.93400 299.71400 1.000 64.60962  ? 281 VAL A N   1 
ATOM   2167 C CA  . VAL A 1 278 ? -10.25700 75.36100 298.92800 1.000 66.21643  ? 281 VAL A CA  1 
ATOM   2168 C C   . VAL A 1 278 ? -11.16200 74.20900 298.53400 1.000 64.67083  ? 281 VAL A C   1 
ATOM   2169 O O   . VAL A 1 278 ? -12.21400 74.44200 297.92200 1.000 60.72301  ? 281 VAL A O   1 
ATOM   2170 C CB  . VAL A 1 278 ? -9.83400  76.12900 297.65800 1.000 66.15543  ? 281 VAL A CB  1 
ATOM   2171 C CG1 . VAL A 1 278 ? -8.97500  77.32300 298.01000 1.000 66.22837  ? 281 VAL A CG1 1 
ATOM   2172 C CG2 . VAL A 1 278 ? -9.12100  75.20200 296.66900 1.000 60.74718  ? 281 VAL A CG2 1 
ATOM   2173 N N   . LEU A 1 279 ? -10.77900 72.97600 298.83500 1.000 64.26806  ? 282 LEU A N   1 
ATOM   2174 C CA  . LEU A 1 279 ? -11.67200 71.85900 298.57800 1.000 62.27943  ? 282 LEU A CA  1 
ATOM   2175 C C   . LEU A 1 279 ? -12.99700 72.08400 299.30000 1.000 63.79283  ? 282 LEU A C   1 
ATOM   2176 O O   . LEU A 1 279 ? -13.02100 72.63000 300.40800 1.000 64.77931  ? 282 LEU A O   1 
ATOM   2177 C CB  . LEU A 1 279 ? -11.03900 70.54700 299.03400 1.000 57.58812  ? 282 LEU A CB  1 
ATOM   2178 C CG  . LEU A 1 279 ? -9.87800  70.12200 298.15000 1.000 60.70414  ? 282 LEU A CG  1 
ATOM   2179 C CD1 . LEU A 1 279 ? -9.21500  68.90400 298.74400 1.000 61.68217  ? 282 LEU A CD1 1 
ATOM   2180 C CD2 . LEU A 1 279 ? -10.37800 69.82900 296.72700 1.000 55.91405  ? 282 LEU A CD2 1 
ATOM   2181 N N   . PRO A 1 280 ? -14.11900 71.70400 298.69600 1.000 65.29034  ? 283 PRO A N   1 
ATOM   2182 C CA  . PRO A 1 280 ? -15.41400 71.98200 299.33000 1.000 66.28736  ? 283 PRO A CA  1 
ATOM   2183 C C   . PRO A 1 280 ? -15.75700 71.04500 300.47600 1.000 60.70995  ? 283 PRO A C   1 
ATOM   2184 O O   . PRO A 1 280 ? -16.64500 71.37000 301.27000 1.000 57.94648  ? 283 PRO A O   1 
ATOM   2185 C CB  . PRO A 1 280 ? -16.40400 71.81500 298.16900 1.000 56.77089  ? 283 PRO A CB  1 
ATOM   2186 C CG  . PRO A 1 280 ? -15.77000 70.79200 297.34100 1.000 59.70649  ? 283 PRO A CG  1 
ATOM   2187 C CD  . PRO A 1 280 ? -14.28300 71.06400 297.38700 1.000 59.57449  ? 283 PRO A CD  1 
ATOM   2188 N N   . PHE A 1 281 ? -15.10400 69.89600 300.58500 1.000 63.32508  ? 284 PHE A N   1 
ATOM   2189 C CA  . PHE A 1 281 ? -15.50400 68.86500 301.52700 1.000 61.85933  ? 284 PHE A CA  1 
ATOM   2190 C C   . PHE A 1 281 ? -14.28900 68.30300 302.25600 1.000 66.20922  ? 284 PHE A C   1 
ATOM   2191 O O   . PHE A 1 281 ? -13.13300 68.55300 301.90300 1.000 66.38280  ? 284 PHE A O   1 
ATOM   2192 C CB  . PHE A 1 281 ? -16.24000 67.71000 300.82900 1.000 61.18624  ? 284 PHE A CB  1 
ATOM   2193 C CG  . PHE A 1 281 ? -17.46600 68.12500 300.06700 1.000 63.32840  ? 284 PHE A CG  1 
ATOM   2194 C CD1 . PHE A 1 281 ? -18.52800 68.74600 300.71100 1.000 60.07905  ? 284 PHE A CD1 1 
ATOM   2195 C CD2 . PHE A 1 281 ? -17.57200 67.85600 298.69900 1.000 64.15073  ? 284 PHE A CD2 1 
ATOM   2196 C CE1 . PHE A 1 281 ? -19.67100 69.11100 299.99300 1.000 63.05156  ? 284 PHE A CE1 1 
ATOM   2197 C CE2 . PHE A 1 281 ? -18.70300 68.21300 297.98000 1.000 55.13371  ? 284 PHE A CE2 1 
ATOM   2198 C CZ  . PHE A 1 281 ? -19.75200 68.84100 298.62800 1.000 61.09624  ? 284 PHE A CZ  1 
ATOM   2199 N N   . ASP A 1 282 ? -14.57300 67.54100 303.30400 1.000 70.13088  ? 285 ASP A N   1 
ATOM   2200 C CA  . ASP A 1 282 ? -13.56800 66.68500 303.90900 1.000 67.96450  ? 285 ASP A CA  1 
ATOM   2201 C C   . ASP A 1 282 ? -13.51200 65.41700 303.07600 1.000 63.42823  ? 285 ASP A C   1 
ATOM   2202 O O   . ASP A 1 282 ? -14.50500 64.68100 302.99500 1.000 62.89563  ? 285 ASP A O   1 
ATOM   2203 C CB  . ASP A 1 282 ? -13.92800 66.38300 305.36000 1.000 67.61415  ? 285 ASP A CB  1 
ATOM   2204 C CG  . ASP A 1 282 ? -12.71200 66.16400 306.23600 1.000 73.20495  ? 285 ASP A CG  1 
ATOM   2205 O OD1 . ASP A 1 282 ? -11.62100 65.86900 305.69500 1.000 72.01356  ? 285 ASP A OD1 1 
ATOM   2206 O OD2 . ASP A 1 282 ? -12.85800 66.28800 307.47800 1.000 77.76660  ? 285 ASP A OD2 1 
ATOM   2207 N N   . SER A 1 283 ? -12.37400 65.16800 302.43800 1.000 57.66622  ? 286 SER A N   1 
ATOM   2208 C CA  . SER A 1 283 ? -12.38100 64.16600 301.38900 1.000 63.15353  ? 286 SER A CA  1 
ATOM   2209 C C   . SER A 1 283 ? -11.04200 63.46000 301.31800 1.000 62.08052  ? 286 SER A C   1 
ATOM   2210 O O   . SER A 1 283 ? -10.03400 63.93700 301.84100 1.000 67.67891  ? 286 SER A O   1 
ATOM   2211 C CB  . SER A 1 283 ? -12.69500 64.80000 300.03200 1.000 63.36693  ? 286 SER A CB  1 
ATOM   2212 O OG  . SER A 1 283 ? -11.68400 65.74100 299.69200 1.000 61.97837  ? 286 SER A OG  1 
ATOM   2213 N N   . ILE A 1 284 ? -11.05600 62.31200 300.65800 1.000 54.15126  ? 287 ILE A N   1 
ATOM   2214 C CA  . ILE A 1 284 ? -9.85300  61.71500 300.10900 1.000 54.53350  ? 287 ILE A CA  1 
ATOM   2215 C C   . ILE A 1 284 ? -10.06600 61.54800 298.61100 1.000 60.30584  ? 287 ILE A C   1 
ATOM   2216 O O   . ILE A 1 284 ? -11.20100 61.40400 298.14000 1.000 60.29190  ? 287 ILE A O   1 
ATOM   2217 C CB  . ILE A 1 284 ? -9.51600  60.36900 300.77500 1.000 58.58776  ? 287 ILE A CB  1 
ATOM   2218 C CG1 . ILE A 1 284 ? -10.74900 59.46700 300.80200 1.000 59.82683  ? 287 ILE A CG1 1 
ATOM   2219 C CG2 . ILE A 1 284 ? -8.99500  60.57900 302.17500 1.000 59.20170  ? 287 ILE A CG2 1 
ATOM   2220 C CD1 . ILE A 1 284 ? -10.41900 58.03400 301.13500 1.000 61.12168  ? 287 ILE A CD1 1 
ATOM   2221 N N   . PHE A 1 285 ? -8.96200  61.58600 297.85800 1.000 58.29073  ? 288 PHE A N   1 
ATOM   2222 C CA  . PHE A 1 285 ? -8.99800  61.43300 296.40000 1.000 57.58582  ? 288 PHE A CA  1 
ATOM   2223 C C   . PHE A 1 285 ? -9.77300  62.57700 295.73900 1.000 55.71366  ? 288 PHE A C   1 
ATOM   2224 O O   . PHE A 1 285 ? -10.57300 62.36300 294.82400 1.000 52.18126  ? 288 PHE A O   1 
ATOM   2225 C CB  . PHE A 1 285 ? -9.58200  60.07400 296.00500 1.000 58.39213  ? 288 PHE A CB  1 
ATOM   2226 C CG  . PHE A 1 285 ? -8.88100  59.42000 294.85800 1.000 58.33858  ? 288 PHE A CG  1 
ATOM   2227 C CD1 . PHE A 1 285 ? -8.55800  60.13800 293.71900 1.000 61.81841  ? 288 PHE A CD1 1 
ATOM   2228 C CD2 . PHE A 1 285 ? -8.53100  58.08800 294.92400 1.000 58.20669  ? 288 PHE A CD2 1 
ATOM   2229 C CE1 . PHE A 1 285 ? -7.90500  59.53400 292.66100 1.000 58.04725  ? 288 PHE A CE1 1 
ATOM   2230 C CE2 . PHE A 1 285 ? -7.88800  57.47900 293.86600 1.000 60.95402  ? 288 PHE A CE2 1 
ATOM   2231 C CZ  . PHE A 1 285 ? -7.57000  58.20200 292.73600 1.000 60.57039  ? 288 PHE A CZ  1 
ATOM   2232 N N   . ARG A 1 286 ? -9.55800  63.79700 296.23900 1.000 56.13932  ? 289 ARG A N   1 
ATOM   2233 C CA  . ARG A 1 286 ? -10.04000 65.02100 295.61900 1.000 51.31677  ? 289 ARG A CA  1 
ATOM   2234 C C   . ARG A 1 286 ? -8.90300  66.03100 295.63900 1.000 56.54941  ? 289 ARG A C   1 
ATOM   2235 O O   . ARG A 1 286 ? -8.19600  66.16100 296.64300 1.000 57.05946  ? 289 ARG A O   1 
ATOM   2236 C CB  . ARG A 1 286 ? -11.26900 65.60600 296.32800 1.000 49.52754  ? 289 ARG A CB  1 
ATOM   2237 C CG  . ARG A 1 286 ? -12.49800 64.70800 296.32800 1.000 53.15719  ? 289 ARG A CG  1 
ATOM   2238 C CD  . ARG A 1 286 ? -13.05000 64.53000 294.92200 1.000 53.02223  ? 289 ARG A CD  1 
ATOM   2239 N NE  . ARG A 1 286 ? -14.28700 63.75900 294.84700 1.000 50.20601  ? 289 ARG A NE  1 
ATOM   2240 C CZ  . ARG A 1 286 ? -14.33500 62.43600 294.74000 1.000 52.35947  ? 289 ARG A CZ  1 
ATOM   2241 N NH1 . ARG A 1 286 ? -13.21300 61.72500 294.71700 1.000 49.38226  ? 289 ARG A NH1 1 
ATOM   2242 N NH2 . ARG A 1 286 ? -15.51000 61.82500 294.65600 1.000 52.74412  ? 289 ARG A NH2 1 
ATOM   2243 N N   . PHE A 1 287 ? -8.71900  66.73000 294.51500 1.000 63.13974  ? 290 PHE A N   1 
ATOM   2244 C CA  . PHE A 1 287 ? -7.62300  67.67000 294.33300 1.000 58.83805  ? 290 PHE A CA  1 
ATOM   2245 C C   . PHE A 1 287 ? -8.19400  69.01200 293.91700 1.000 56.83409  ? 290 PHE A C   1 
ATOM   2246 O O   . PHE A 1 287 ? -9.25600  69.09000 293.29000 1.000 54.14794  ? 290 PHE A O   1 
ATOM   2247 C CB  . PHE A 1 287 ? -6.62700  67.13800 293.31600 1.000 58.11497  ? 290 PHE A CB  1 
ATOM   2248 C CG  . PHE A 1 287 ? -6.43700  65.65800 293.41300 1.000 60.88463  ? 290 PHE A CG  1 
ATOM   2249 C CD1 . PHE A 1 287 ? -5.69500  65.11100 294.44800 1.000 57.60536  ? 290 PHE A CD1 1 
ATOM   2250 C CD2 . PHE A 1 287 ? -7.04700  64.80000 292.50400 1.000 61.84799  ? 290 PHE A CD2 1 
ATOM   2251 C CE1 . PHE A 1 287 ? -5.53600  63.73200 294.55600 1.000 62.68443  ? 290 PHE A CE1 1 
ATOM   2252 C CE2 . PHE A 1 287 ? -6.89900  63.41000 292.60900 1.000 58.19255  ? 290 PHE A CE2 1 
ATOM   2253 C CZ  . PHE A 1 287 ? -6.14400  62.87500 293.63100 1.000 58.51927  ? 290 PHE A CZ  1 
ATOM   2254 N N   . SER A 1 288 ? -7.47500  70.07300 294.28300 1.000 60.19679  ? 291 SER A N   1 
ATOM   2255 C CA  . SER A 1 288 ? -8.05700  71.41200 294.26000 1.000 62.54217  ? 291 SER A CA  1 
ATOM   2256 C C   . SER A 1 288 ? -8.26100  71.93200 292.84000 1.000 60.09100  ? 291 SER A C   1 
ATOM   2257 O O   . SER A 1 288 ? -9.38300  72.27700 292.44700 1.000 56.92872  ? 291 SER A O   1 
ATOM   2258 C CB  . SER A 1 288 ? -7.18200  72.36800 295.06000 1.000 62.51782  ? 291 SER A CB  1 
ATOM   2259 O OG  . SER A 1 288 ? -7.40500  72.17300 296.44600 1.000 68.83522  ? 291 SER A OG  1 
ATOM   2260 N N   . PHE A 1 289 ? -7.19800  72.02300 292.06400 1.000 57.07657  ? 292 PHE A N   1 
ATOM   2261 C CA  . PHE A 1 289 ? -7.28200  72.65800 290.75300 1.000 60.45016  ? 292 PHE A CA  1 
ATOM   2262 C C   . PHE A 1 289 ? -7.14100  71.60800 289.66400 1.000 61.06539  ? 292 PHE A C   1 
ATOM   2263 O O   . PHE A 1 289 ? -6.04100  71.09900 289.41600 1.000 60.68078  ? 292 PHE A O   1 
ATOM   2264 C CB  . PHE A 1 289 ? -6.23900  73.75400 290.64200 1.000 54.81274  ? 292 PHE A CB  1 
ATOM   2265 C CG  . PHE A 1 289 ? -6.42800  74.78900 291.65700 1.000 59.81465  ? 292 PHE A CG  1 
ATOM   2266 C CD1 . PHE A 1 289 ? -7.39400  75.75500 291.48300 1.000 59.93264  ? 292 PHE A CD1 1 
ATOM   2267 C CD2 . PHE A 1 289 ? -5.72000  74.74400 292.84900 1.000 68.55547  ? 292 PHE A CD2 1 
ATOM   2268 C CE1 . PHE A 1 289 ? -7.60400  76.71400 292.45100 1.000 66.22178  ? 292 PHE A CE1 1 
ATOM   2269 C CE2 . PHE A 1 289 ? -5.92600  75.69100 293.82600 1.000 65.91968  ? 292 PHE A CE2 1 
ATOM   2270 C CZ  . PHE A 1 289 ? -6.86700  76.68200 293.62900 1.000 64.85520  ? 292 PHE A CZ  1 
ATOM   2271 N N   . VAL A 1 290 ? -8.25800  71.30500 289.01000 1.000 55.67809  ? 293 VAL A N   1 
ATOM   2272 C CA  . VAL A 1 290 ? -8.32400  70.21400 288.04200 1.000 60.44539  ? 293 VAL A CA  1 
ATOM   2273 C C   . VAL A 1 290 ? -8.96600  70.72300 286.74900 1.000 61.14656  ? 293 VAL A C   1 
ATOM   2274 O O   . VAL A 1 290 ? -9.44900  71.86300 286.72300 1.000 61.30720  ? 293 VAL A O   1 
ATOM   2275 C CB  . VAL A 1 290 ? -9.07900  69.02500 288.65700 1.000 58.40609  ? 293 VAL A CB  1 
ATOM   2276 C CG1 . VAL A 1 290 ? -8.23700  68.38500 289.73600 1.000 57.65578  ? 293 VAL A CG1 1 
ATOM   2277 C CG2 . VAL A 1 290 ? -10.38700 69.49500 289.24700 1.000 54.33118  ? 293 VAL A CG2 1 
ATOM   2278 N N   . PRO A 1 291 ? -8.95800  69.95400 285.65100 1.000 60.54891  ? 294 PRO A N   1 
ATOM   2279 C CA  . PRO A 1 291 ? -9.62500  70.40800 284.42200 1.000 57.99497  ? 294 PRO A CA  1 
ATOM   2280 C C   . PRO A 1 291 ? -11.07000 70.82000 284.66200 1.000 60.22737  ? 294 PRO A C   1 
ATOM   2281 O O   . PRO A 1 291 ? -11.78100 70.22400 285.47100 1.000 61.94405  ? 294 PRO A O   1 
ATOM   2282 C CB  . PRO A 1 291 ? -9.54300  69.17800 283.52000 1.000 55.99034  ? 294 PRO A CB  1 
ATOM   2283 C CG  . PRO A 1 291 ? -8.30300  68.51700 283.93300 1.000 50.70098  ? 294 PRO A CG  1 
ATOM   2284 C CD  . PRO A 1 291 ? -8.15500  68.74300 285.40200 1.000 58.46613  ? 294 PRO A CD  1 
ATOM   2285 N N   . VAL A 1 292 ? -11.51000 71.85500 283.95300 1.000 59.45183  ? 295 VAL A N   1 
ATOM   2286 C CA  . VAL A 1 292 ? -12.88300 72.34200 284.04400 1.000 58.08221  ? 295 VAL A CA  1 
ATOM   2287 C C   . VAL A 1 292 ? -13.59700 72.04800 282.73200 1.000 60.25264  ? 295 VAL A C   1 
ATOM   2288 O O   . VAL A 1 292 ? -13.03800 72.27500 281.65400 1.000 61.89630  ? 295 VAL A O   1 
ATOM   2289 C CB  . VAL A 1 292 ? -12.92500 73.84300 284.36200 1.000 56.45196  ? 295 VAL A CB  1 
ATOM   2290 C CG1 . VAL A 1 292 ? -11.84800 74.55600 283.61100 1.000 61.25572  ? 295 VAL A CG1 1 
ATOM   2291 C CG2 . VAL A 1 292 ? -14.26700 74.41700 283.99200 1.000 60.54595  ? 295 VAL A CG2 1 
ATOM   2292 N N   . ILE A 1 293 ? -14.82400 71.53600 282.82500 1.000 58.62647  ? 296 ILE A N   1 
ATOM   2293 C CA  . ILE A 1 293 ? -15.70600 71.42300 281.66700 1.000 60.74126  ? 296 ILE A CA  1 
ATOM   2294 C C   . ILE A 1 293 ? -16.11300 72.83500 281.24700 1.000 66.62398  ? 296 ILE A C   1 
ATOM   2295 O O   . ILE A 1 293 ? -16.93400 73.47000 281.91500 1.000 62.94379  ? 296 ILE A O   1 
ATOM   2296 C CB  . ILE A 1 293 ? -16.93500 70.56700 281.97500 1.000 57.59891  ? 296 ILE A CB  1 
ATOM   2297 C CG1 . ILE A 1 293 ? -16.53200 69.31000 282.74400 1.000 56.41692  ? 296 ILE A CG1 1 
ATOM   2298 C CG2 . ILE A 1 293 ? -17.67000 70.24000 280.67900 1.000 57.15830  ? 296 ILE A CG2 1 
ATOM   2299 C CD1 . ILE A 1 293 ? -15.44800 68.48900 282.08100 1.000 56.42719  ? 296 ILE A CD1 1 
ATOM   2300 N N   . ASP A 1 294 ? -15.56000 73.31800 280.12000 1.000 67.61853  ? 297 ASP A N   1 
ATOM   2301 C CA  . ASP A 1 294 ? -15.54400 74.74100 279.79600 1.000 68.21974  ? 297 ASP A CA  1 
ATOM   2302 C C   . ASP A 1 294 ? -16.29500 75.12300 278.52500 1.000 71.96105  ? 297 ASP A C   1 
ATOM   2303 O O   . ASP A 1 294 ? -16.54400 76.31400 278.31600 1.000 76.98376  ? 297 ASP A O   1 
ATOM   2304 C CB  . ASP A 1 294 ? -14.09000 75.23200 279.66300 1.000 67.27235  ? 297 ASP A CB  1 
ATOM   2305 C CG  . ASP A 1 294 ? -13.35900 74.58800 278.47600 1.000 72.43297  ? 297 ASP A CG  1 
ATOM   2306 O OD1 . ASP A 1 294 ? -13.83600 73.54300 277.98400 1.000 70.73856  ? 297 ASP A OD1 1 
ATOM   2307 O OD2 . ASP A 1 294 ? -12.30900 75.11500 278.03100 1.000 71.06385  ? 297 ASP A OD2 1 
ATOM   2308 N N   . GLY A 1 295 ? -16.59300 74.15200 277.70900 1.000 67.29803  ? 298 GLY A N   1 
ATOM   2309 C CA  . GLY A 1 295 ? -17.27600 74.37300 276.47500 1.000 71.60894  ? 298 GLY A CA  1 
ATOM   2310 C C   . GLY A 1 295 ? -16.29300 74.54500 275.35900 1.000 76.30118  ? 298 GLY A C   1 
ATOM   2311 O O   . GLY A 1 295 ? -16.66400 74.47300 274.21900 1.000 74.66702  ? 298 GLY A O   1 
ATOM   2312 N N   . GLU A 1 296 ? -15.02900 74.74100 275.68200 1.000 78.12707  ? 299 GLU A N   1 
ATOM   2313 C CA  . GLU A 1 296 ? -14.03000 74.87800 274.65600 1.000 70.15986  ? 299 GLU A CA  1 
ATOM   2314 C C   . GLU A 1 296 ? -13.17200 73.64200 274.56500 1.000 68.69637  ? 299 GLU A C   1 
ATOM   2315 O O   . GLU A 1 296 ? -13.26400 72.93600 273.60300 1.000 59.82610  ? 299 GLU A O   1 
ATOM   2316 C CB  . GLU A 1 296 ? -13.16100 76.08600 274.91300 1.000 74.23482  ? 299 GLU A CB  1 
ATOM   2317 C CG  . GLU A 1 296 ? -13.90700 77.40000 274.99300 1.000 85.74782  ? 299 GLU A CG  1 
ATOM   2318 C CD  . GLU A 1 296 ? -13.77600 78.25100 273.74500 1.000 102.59456 ? 299 GLU A CD  1 
ATOM   2319 O OE1 . GLU A 1 296 ? -14.51200 79.25100 273.62300 1.000 102.50019 ? 299 GLU A OE1 1 
ATOM   2320 O OE2 . GLU A 1 296 ? -12.93600 77.93000 272.88900 1.000 100.18054 ? 299 GLU A OE2 1 
ATOM   2321 N N   . PHE A 1 297 ? -12.35600 73.35500 275.56900 1.000 71.18447  ? 300 PHE A N   1 
ATOM   2322 C CA  . PHE A 1 297 ? -11.51300 72.17800 275.50100 1.000 64.98159  ? 300 PHE A CA  1 
ATOM   2323 C C   . PHE A 1 297 ? -12.44200 71.02800 275.45700 1.000 65.15802  ? 300 PHE A C   1 
ATOM   2324 O O   . PHE A 1 297 ? -12.26100 70.14100 274.68700 1.000 63.03155  ? 300 PHE A O   1 
ATOM   2325 C CB  . PHE A 1 297 ? -10.58000 72.09000 276.66900 1.000 60.09578  ? 300 PHE A CB  1 
ATOM   2326 C CG  . PHE A 1 297 ? -9.48900  71.09600 276.49700 1.000 58.01353  ? 300 PHE A CG  1 
ATOM   2327 C CD1 . PHE A 1 297 ? -9.74700  69.77300 276.54900 1.000 59.56912  ? 300 PHE A CD1 1 
ATOM   2328 C CD2 . PHE A 1 297 ? -8.21700  71.49300 276.32100 1.000 53.15348  ? 300 PHE A CD2 1 
ATOM   2329 C CE1 . PHE A 1 297 ? -8.75200  68.86100 276.41500 1.000 58.87397  ? 300 PHE A CE1 1 
ATOM   2330 C CE2 . PHE A 1 297 ? -7.21800  70.59000 276.18400 1.000 54.35645  ? 300 PHE A CE2 1 
ATOM   2331 C CZ  . PHE A 1 297 ? -7.48000  69.27500 276.23700 1.000 53.33000  ? 300 PHE A CZ  1 
ATOM   2332 N N   . PHE A 1 298 ? -13.46200 71.06600 276.28500 1.000 62.93327  ? 301 PHE A N   1 
ATOM   2333 C CA  . PHE A 1 298 ? -14.51900 70.06400 276.25200 1.000 62.67113  ? 301 PHE A CA  1 
ATOM   2334 C C   . PHE A 1 298 ? -15.75400 70.73800 275.68000 1.000 67.23879  ? 301 PHE A C   1 
ATOM   2335 O O   . PHE A 1 298 ? -16.27100 71.68400 276.29000 1.000 65.20527  ? 301 PHE A O   1 
ATOM   2336 C CB  . PHE A 1 298 ? -14.80400 69.49900 277.65200 1.000 70.54118  ? 301 PHE A CB  1 
ATOM   2337 C CG  . PHE A 1 298 ? -13.58800 68.90200 278.32900 1.000 63.78886  ? 301 PHE A CG  1 
ATOM   2338 C CD1 . PHE A 1 298 ? -13.13900 67.62900 277.99200 1.000 61.50838  ? 301 PHE A CD1 1 
ATOM   2339 C CD2 . PHE A 1 298 ? -12.87500 69.63400 279.26500 1.000 60.99618  ? 301 PHE A CD2 1 
ATOM   2340 C CE1 . PHE A 1 298 ? -12.01900 67.09600 278.57800 1.000 61.65606  ? 301 PHE A CE1 1 
ATOM   2341 C CE2 . PHE A 1 298 ? -11.75200 69.10800 279.86600 1.000 61.52883  ? 301 PHE A CE2 1 
ATOM   2342 C CZ  . PHE A 1 298 ? -11.32400 67.83200 279.52800 1.000 64.70326  ? 301 PHE A CZ  1 
ATOM   2343 N N   . PRO A 1 299 ? -16.22400 70.33900 274.49400 1.000 75.48146  ? 302 PRO A N   1 
ATOM   2344 C CA  . PRO A 1 299 ? -17.37100 71.04200 273.89500 1.000 68.45805  ? 302 PRO A CA  1 
ATOM   2345 C C   . PRO A 1 299 ? -18.60300 71.03400 274.78100 1.000 72.02603  ? 302 PRO A C   1 
ATOM   2346 O O   . PRO A 1 299 ? -19.24800 72.07500 274.95100 1.000 76.94817  ? 302 PRO A O   1 
ATOM   2347 C CB  . PRO A 1 299 ? -17.58700 70.27000 272.59500 1.000 60.14340  ? 302 PRO A CB  1 
ATOM   2348 C CG  . PRO A 1 299 ? -16.25700 69.68700 272.29200 1.000 56.93318  ? 302 PRO A CG  1 
ATOM   2349 C CD  . PRO A 1 299 ? -15.67800 69.31400 273.59000 1.000 68.87720  ? 302 PRO A CD  1 
ATOM   2350 N N   . THR A 1 300 ? -18.93500 69.89100 275.37400 1.000 72.19529  ? 303 THR A N   1 
ATOM   2351 C CA  . THR A 1 300 ? -20.10500 69.76000 276.23100 1.000 71.21551  ? 303 THR A CA  1 
ATOM   2352 C C   . THR A 1 300 ? -19.72300 68.88300 277.41800 1.000 69.14263  ? 303 THR A C   1 
ATOM   2353 O O   . THR A 1 300 ? -18.54500 68.59200 277.64400 1.000 72.68120  ? 303 THR A O   1 
ATOM   2354 C CB  . THR A 1 300 ? -21.29400 69.17500 275.45500 1.000 71.35180  ? 303 THR A CB  1 
ATOM   2355 O OG1 . THR A 1 300 ? -20.90100 67.95100 274.82500 1.000 66.68575  ? 303 THR A OG1 1 
ATOM   2356 C CG2 . THR A 1 300 ? -21.78200 70.15000 274.39800 1.000 74.15219  ? 303 THR A CG2 1 
ATOM   2357 N N   . SER A 1 301 ? -20.73100 68.46100 278.18100 1.000 67.29376  ? 304 SER A N   1 
ATOM   2358 C CA  . SER A 1 301 ? -20.51500 67.54500 279.29400 1.000 59.00348  ? 304 SER A CA  1 
ATOM   2359 C C   . SER A 1 301 ? -19.86200 66.25700 278.80800 1.000 60.78473  ? 304 SER A C   1 
ATOM   2360 O O   . SER A 1 301 ? -20.05800 65.82900 277.66800 1.000 67.06751  ? 304 SER A O   1 
ATOM   2361 C CB  . SER A 1 301 ? -21.84200 67.23100 279.97200 1.000 61.18886  ? 304 SER A CB  1 
ATOM   2362 O OG  . SER A 1 301 ? -22.44700 66.09000 279.40300 1.000 60.06707  ? 304 SER A OG  1 
ATOM   2363 N N   . LEU A 1 302 ? -19.06700 65.63600 279.68100 1.000 58.31231  ? 305 LEU A N   1 
ATOM   2364 C CA  . LEU A 1 302 ? -18.35500 64.43100 279.26900 1.000 60.11260  ? 305 LEU A CA  1 
ATOM   2365 C C   . LEU A 1 302 ? -19.30700 63.27300 279.00900 1.000 68.31181  ? 305 LEU A C   1 
ATOM   2366 O O   . LEU A 1 302 ? -19.04700 62.44700 278.12500 1.000 70.46256  ? 305 LEU A O   1 
ATOM   2367 C CB  . LEU A 1 302 ? -17.32300 64.02600 280.31600 1.000 56.65055  ? 305 LEU A CB  1 
ATOM   2368 C CG  . LEU A 1 302 ? -16.22600 65.03100 280.63800 1.000 59.07978  ? 305 LEU A CG  1 
ATOM   2369 C CD1 . LEU A 1 302 ? -15.20900 64.41700 281.57000 1.000 57.42720  ? 305 LEU A CD1 1 
ATOM   2370 C CD2 . LEU A 1 302 ? -15.56700 65.48200 279.36200 1.000 64.78192  ? 305 LEU A CD2 1 
ATOM   2371 N N   . GLU A 1 303 ? -20.41400 63.19000 279.75000 1.000 69.09861  ? 306 GLU A N   1 
ATOM   2372 C CA  . GLU A 1 303 ? -21.30500 62.04900 279.57600 1.000 68.68548  ? 306 GLU A CA  1 
ATOM   2373 C C   . GLU A 1 303 ? -22.02800 62.11300 278.23300 1.000 70.37781  ? 306 GLU A C   1 
ATOM   2374 O O   . GLU A 1 303 ? -22.23900 61.08100 277.58100 1.000 72.96169  ? 306 GLU A O   1 
ATOM   2375 C CB  . GLU A 1 303 ? -22.28900 61.97300 280.74300 1.000 74.26567  ? 306 GLU A CB  1 
ATOM   2376 C CG  . GLU A 1 303 ? -23.17700 60.72300 280.75500 1.000 78.69363  ? 306 GLU A CG  1 
ATOM   2377 C CD  . GLU A 1 303 ? -22.40300 59.40500 280.86500 1.000 80.73001  ? 306 GLU A CD  1 
ATOM   2378 O OE1 . GLU A 1 303 ? -21.24400 59.40800 281.34600 1.000 82.73246  ? 306 GLU A OE1 1 
ATOM   2379 O OE2 . GLU A 1 303 ? -22.96900 58.35600 280.47400 1.000 82.50853  ? 306 GLU A OE2 1 
ATOM   2380 N N   . SER A 1 304 ? -22.39200 63.31500 277.78400 1.000 65.87247  ? 307 SER A N   1 
ATOM   2381 C CA  . SER A 1 304 ? -23.03000 63.43300 276.47600 1.000 64.80476  ? 307 SER A CA  1 
ATOM   2382 C C   . SER A 1 304 ? -22.03800 63.14800 275.34800 1.000 63.56605  ? 307 SER A C   1 
ATOM   2383 O O   . SER A 1 304 ? -22.39200 62.50400 274.35600 1.000 62.13624  ? 307 SER A O   1 
ATOM   2384 C CB  . SER A 1 304 ? -23.65800 64.81700 276.32800 1.000 60.87014  ? 307 SER A CB  1 
ATOM   2385 O OG  . SER A 1 304 ? -22.68300 65.83700 276.41500 1.000 61.60568  ? 307 SER A OG  1 
ATOM   2386 N N   . MET A 1 305 ? -20.79000 63.61000 275.48700 1.000 62.15405  ? 308 MET A N   1 
ATOM   2387 C CA  . MET A 1 305 ? -19.73900 63.22400 274.55000 1.000 61.44885  ? 308 MET A CA  1 
ATOM   2388 C C   . MET A 1 305 ? -19.57400 61.70700 274.48100 1.000 63.37508  ? 308 MET A C   1 
ATOM   2389 O O   . MET A 1 305 ? -19.41500 61.13600 273.39100 1.000 60.63876  ? 308 MET A O   1 
ATOM   2390 C CB  . MET A 1 305 ? -18.41600 63.88300 274.94100 1.000 58.42350  ? 308 MET A CB  1 
ATOM   2391 C CG  . MET A 1 305 ? -18.48100 65.38400 274.98600 1.000 62.11008  ? 308 MET A CG  1 
ATOM   2392 S SD  . MET A 1 305 ? -16.86100 66.17200 275.11600 1.000 75.92336  ? 308 MET A SD  1 
ATOM   2393 C CE  . MET A 1 305 ? -16.06800 65.58100 273.63400 1.000 62.27427  ? 308 MET A CE  1 
ATOM   2394 N N   . LEU A 1 306 ? -19.59800 61.03100 275.63100 1.000 62.88258  ? 309 LEU A N   1 
ATOM   2395 C CA  . LEU A 1 306 ? -19.42900 59.58300 275.58800 1.000 65.00191  ? 309 LEU A CA  1 
ATOM   2396 C C   . LEU A 1 306 ? -20.65300 58.87800 275.00200 1.000 67.24931  ? 309 LEU A C   1 
ATOM   2397 O O   . LEU A 1 306 ? -20.50600 57.85300 274.32100 1.000 64.12727  ? 309 LEU A O   1 
ATOM   2398 C CB  . LEU A 1 306 ? -19.10800 59.05500 276.97800 1.000 64.28127  ? 309 LEU A CB  1 
ATOM   2399 C CG  . LEU A 1 306 ? -17.73800 59.46500 277.50800 1.000 64.75048  ? 309 LEU A CG  1 
ATOM   2400 C CD1 . LEU A 1 306 ? -17.54400 58.94600 278.93300 1.000 64.72933  ? 309 LEU A CD1 1 
ATOM   2401 C CD2 . LEU A 1 306 ? -16.63100 58.97000 276.61500 1.000 58.23606  ? 309 LEU A CD2 1 
ATOM   2402 N N   . ASN A 1 307 ? -21.85800 59.41100 275.24400 1.000 65.57225  ? 310 ASN A N   1 
ATOM   2403 C CA  . ASN A 1 307 ? -23.06500 58.78400 274.71500 1.000 67.03505  ? 310 ASN A CA  1 
ATOM   2404 C C   . ASN A 1 307 ? -23.21200 58.98900 273.21200 1.000 67.33383  ? 310 ASN A C   1 
ATOM   2405 O O   . ASN A 1 307 ? -23.77500 58.13000 272.52300 1.000 67.68101  ? 310 ASN A O   1 
ATOM   2406 C CB  . ASN A 1 307 ? -24.28900 59.32800 275.44200 1.000 63.69899  ? 310 ASN A CB  1 
ATOM   2407 C CG  . ASN A 1 307 ? -24.49300 58.66300 276.76600 1.000 79.05407  ? 310 ASN A CG  1 
ATOM   2408 O OD1 . ASN A 1 307 ? -24.32300 57.44700 276.87500 1.000 77.34400  ? 310 ASN A OD1 1 
ATOM   2409 N ND2 . ASN A 1 307 ? -24.83500 59.44800 277.79900 1.000 81.87451  ? 310 ASN A ND2 1 
ATOM   2410 N N   . SER A 1 308 ? -22.71000 60.10800 272.69200 1.000 61.98128  ? 311 SER A N   1 
ATOM   2411 C CA  . SER A 1 308 ? -22.95100 60.52900 271.32000 1.000 60.27413  ? 311 SER A CA  1 
ATOM   2412 C C   . SER A 1 308 ? -21.76100 60.26900 270.40900 1.000 62.86388  ? 311 SER A C   1 
ATOM   2413 O O   . SER A 1 308 ? -21.58500 60.98500 269.42300 1.000 70.45995  ? 311 SER A O   1 
ATOM   2414 C CB  . SER A 1 308 ? -23.30700 62.01400 271.28600 1.000 63.97152  ? 311 SER A CB  1 
ATOM   2415 O OG  . SER A 1 308 ? -22.17700 62.83500 271.57700 1.000 60.00617  ? 311 SER A OG  1 
ATOM   2416 N N   . GLY A 1 309 ? -20.93500 59.27400 270.72200 1.000 65.10290  ? 312 GLY A N   1 
ATOM   2417 C CA  . GLY A 1 309 ? -19.73200 58.98500 269.95800 1.000 62.92690  ? 312 GLY A CA  1 
ATOM   2418 C C   . GLY A 1 309 ? -18.83900 60.17300 269.62900 1.000 62.74809  ? 312 GLY A C   1 
ATOM   2419 O O   . GLY A 1 309 ? -18.07200 60.12300 268.66500 1.000 65.87075  ? 312 GLY A O   1 
ATOM   2420 N N   . ASN A 1 310 ? -18.91400 61.24800 270.41300 1.000 57.07230  ? 313 ASN A N   1 
ATOM   2421 C CA  . ASN A 1 310 ? -18.19800 62.48300 270.09200 1.000 56.25923  ? 313 ASN A CA  1 
ATOM   2422 C C   . ASN A 1 310 ? -16.76600 62.39600 270.62600 1.000 61.44735  ? 313 ASN A C   1 
ATOM   2423 O O   . ASN A 1 310 ? -16.41300 62.98700 271.65000 1.000 65.52099  ? 313 ASN A O   1 
ATOM   2424 C CB  . ASN A 1 310 ? -18.95700 63.67700 270.66300 1.000 56.77070  ? 313 ASN A CB  1 
ATOM   2425 C CG  . ASN A 1 310 ? -18.31300 65.00300 270.32100 1.000 56.55052  ? 313 ASN A CG  1 
ATOM   2426 O OD1 . ASN A 1 310 ? -17.25800 65.04700 269.69900 1.000 58.72471  ? 313 ASN A OD1 1 
ATOM   2427 N ND2 . ASN A 1 310 ? -18.94400 66.09300 270.73100 1.000 54.16481  ? 313 ASN A ND2 1 
ATOM   2428 N N   . PHE A 1 311 ? -15.92400 61.64500 269.91600 1.000 61.78020  ? 314 PHE A N   1 
ATOM   2429 C CA  . PHE A 1 311 ? -14.52600 61.50100 270.32500 1.000 63.61540  ? 314 PHE A CA  1 
ATOM   2430 C C   . PHE A 1 311 ? -13.72400 60.75500 269.26500 1.000 63.05802  ? 314 PHE A C   1 
ATOM   2431 O O   . PHE A 1 311 ? -14.27400 60.03900 268.42400 1.000 58.43623  ? 314 PHE A O   1 
ATOM   2432 C CB  . PHE A 1 311 ? -14.38100 60.78200 271.67300 1.000 56.25731  ? 314 PHE A CB  1 
ATOM   2433 C CG  . PHE A 1 311 ? -15.27400 59.59000 271.83100 1.000 62.04199  ? 314 PHE A CG  1 
ATOM   2434 C CD1 . PHE A 1 311 ? -14.92800 58.36600 271.27100 1.000 58.82483  ? 314 PHE A CD1 1 
ATOM   2435 C CD2 . PHE A 1 311 ? -16.45300 59.68400 272.57000 1.000 60.58383  ? 314 PHE A CD2 1 
ATOM   2436 C CE1 . PHE A 1 311 ? -15.75500 57.26200 271.42500 1.000 56.50876  ? 314 PHE A CE1 1 
ATOM   2437 C CE2 . PHE A 1 311 ? -17.27900 58.58600 272.73000 1.000 57.59073  ? 314 PHE A CE2 1 
ATOM   2438 C CZ  . PHE A 1 311 ? -16.92700 57.37200 272.15700 1.000 59.94494  ? 314 PHE A CZ  1 
ATOM   2439 N N   . LYS A 1 312 ? -12.40600 60.91900 269.34500 1.000 61.70949  ? 315 LYS A N   1 
ATOM   2440 C CA  . LYS A 1 312 ? -11.48500 60.21100 268.46900 1.000 61.02716  ? 315 LYS A CA  1 
ATOM   2441 C C   . LYS A 1 312 ? -11.74200 58.71300 268.51300 1.000 60.83351  ? 315 LYS A C   1 
ATOM   2442 O O   . LYS A 1 312 ? -11.62300 58.08600 269.57300 1.000 59.26330  ? 315 LYS A O   1 
ATOM   2443 C CB  . LYS A 1 312 ? -10.03900 60.51800 268.87100 1.000 59.78596  ? 315 LYS A CB  1 
ATOM   2444 C CG  . LYS A 1 312 ? -8.99900  59.71600 268.09400 1.000 59.73012  ? 315 LYS A CG  1 
ATOM   2445 C CD  . LYS A 1 312 ? -7.66100  60.41800 268.06100 1.000 56.21666  ? 315 LYS A CD  1 
ATOM   2446 C CE  . LYS A 1 312 ? -6.75600  59.81400 267.01600 1.000 56.57661  ? 315 LYS A CE  1 
ATOM   2447 N NZ  . LYS A 1 312 ? -7.28600  60.05400 265.63200 1.000 67.50297  ? 315 LYS A NZ  1 
ATOM   2448 N N   . LYS A 1 313 ? -12.10500 58.14600 267.35300 1.000 60.34473  ? 316 LYS A N   1 
ATOM   2449 C CA  . LYS A 1 313 ? -12.29000 56.70500 267.21200 1.000 59.71861  ? 316 LYS A CA  1 
ATOM   2450 C C   . LYS A 1 313 ? -10.98900 56.08000 266.72900 1.000 57.17711  ? 316 LYS A C   1 
ATOM   2451 O O   . LYS A 1 313 ? -10.51000 56.40600 265.64600 1.000 68.14843  ? 316 LYS A O   1 
ATOM   2452 C CB  . LYS A 1 313 ? -13.42700 56.37300 266.25400 1.000 56.37436  ? 316 LYS A CB  1 
ATOM   2453 C CG  . LYS A 1 313 ? -14.81000 56.72800 266.77200 1.000 58.42989  ? 316 LYS A CG  1 
ATOM   2454 C CD  . LYS A 1 313 ? -15.20900 58.09400 266.25300 1.000 69.96687  ? 316 LYS A CD  1 
ATOM   2455 C CE  . LYS A 1 313 ? -16.65100 58.43700 266.56200 1.000 70.34725  ? 316 LYS A CE  1 
ATOM   2456 N NZ  . LYS A 1 313 ? -17.02500 59.74300 265.91900 1.000 75.73136  ? 316 LYS A NZ  1 
ATOM   2457 N N   . THR A 1 314 ? -10.41900 55.20200 267.54200 1.000 58.12633  ? 317 THR A N   1 
ATOM   2458 C CA  . THR A 1 314 ? -9.14700  54.54100 267.29000 1.000 59.35984  ? 317 THR A CA  1 
ATOM   2459 C C   . THR A 1 314 ? -9.13400  53.28400 268.16400 1.000 64.90147  ? 317 THR A C   1 
ATOM   2460 O O   . THR A 1 314 ? -10.19700 52.76300 268.52400 1.000 63.03254  ? 317 THR A O   1 
ATOM   2461 C CB  . THR A 1 314 ? -7.97000  55.50500 267.55300 1.000 60.47682  ? 317 THR A CB  1 
ATOM   2462 O OG1 . THR A 1 314 ? -6.74400  54.76900 267.62600 1.000 59.70931  ? 317 THR A OG1 1 
ATOM   2463 C CG2 . THR A 1 314 ? -8.14800  56.28300 268.85100 1.000 64.52238  ? 317 THR A CG2 1 
ATOM   2464 N N   . GLN A 1 315 ? -7.94300  52.78700 268.49800 1.000 61.77333  ? 318 GLN A N   1 
ATOM   2465 C CA  . GLN A 1 315 ? -7.80600  51.72800 269.48600 1.000 61.18351  ? 318 GLN A CA  1 
ATOM   2466 C C   . GLN A 1 315 ? -7.29000  52.31300 270.78900 1.000 63.12172  ? 318 GLN A C   1 
ATOM   2467 O O   . GLN A 1 315 ? -6.55300  53.30300 270.78900 1.000 61.85879  ? 318 GLN A O   1 
ATOM   2468 C CB  . GLN A 1 315 ? -6.84900  50.62200 269.03900 1.000 62.98362  ? 318 GLN A CB  1 
ATOM   2469 C CG  . GLN A 1 315 ? -7.12800  50.03200 267.67300 1.000 67.56857  ? 318 GLN A CG  1 
ATOM   2470 C CD  . GLN A 1 315 ? -6.44300  50.81000 266.58100 1.000 68.72778  ? 318 GLN A CD  1 
ATOM   2471 O OE1 . GLN A 1 315 ? -5.25500  51.13100 266.69500 1.000 69.33693  ? 318 GLN A OE1 1 
ATOM   2472 N NE2 . GLN A 1 315 ? -7.18700  51.14600 265.52200 1.000 68.63530  ? 318 GLN A NE2 1 
ATOM   2473 N N   . ILE A 1 316 ? -7.67300  51.67900 271.90000 1.000 64.50315  ? 319 ILE A N   1 
ATOM   2474 C CA  . ILE A 1 316 ? -7.20900  52.05800 273.22900 1.000 56.49058  ? 319 ILE A CA  1 
ATOM   2475 C C   . ILE A 1 316 ? -6.81000  50.79900 273.98000 1.000 58.58218  ? 319 ILE A C   1 
ATOM   2476 O O   . ILE A 1 316 ? -7.44300  49.74600 273.83500 1.000 59.39940  ? 319 ILE A O   1 
ATOM   2477 C CB  . ILE A 1 316 ? -8.28300  52.83100 274.01500 1.000 57.06063  ? 319 ILE A CB  1 
ATOM   2478 C CG1 . ILE A 1 316 ? -9.56700  52.00300 274.09500 1.000 61.35184  ? 319 ILE A CG1 1 
ATOM   2479 C CG2 . ILE A 1 316 ? -8.55300  54.19300 273.38800 1.000 56.57226  ? 319 ILE A CG2 1 
ATOM   2480 C CD1 . ILE A 1 316 ? -10.54600 52.49400 275.14300 1.000 56.89768  ? 319 ILE A CD1 1 
ATOM   2481 N N   . LEU A 1 317 ? -5.75700  50.91000 274.77700 1.000 55.09758  ? 320 LEU A N   1 
ATOM   2482 C CA  . LEU A 1 317 ? -5.36000  49.87800 275.72600 1.000 59.89188  ? 320 LEU A CA  1 
ATOM   2483 C C   . LEU A 1 317 ? -5.40100  50.46200 277.14200 1.000 60.14758  ? 320 LEU A C   1 
ATOM   2484 O O   . LEU A 1 317 ? -4.81100  51.51900 277.40000 1.000 56.55618  ? 320 LEU A O   1 
ATOM   2485 C CB  . LEU A 1 317 ? -3.96800  49.35900 275.36600 1.000 55.03319  ? 320 LEU A CB  1 
ATOM   2486 C CG  . LEU A 1 317 ? -3.47600  48.12300 276.10400 1.000 59.84160  ? 320 LEU A CG  1 
ATOM   2487 C CD1 . LEU A 1 317 ? -2.48800  47.40000 275.22500 1.000 61.05973  ? 320 LEU A CD1 1 
ATOM   2488 C CD2 . LEU A 1 317 ? -2.84400  48.47100 277.44600 1.000 57.74358  ? 320 LEU A CD2 1 
ATOM   2489 N N   . LEU A 1 318 ? -6.09700  49.79200 278.06300 1.000 57.55514  ? 321 LEU A N   1 
ATOM   2490 C CA  . LEU A 1 318 ? -6.30800  50.39800 279.38000 1.000 59.09796  ? 321 LEU A CA  1 
ATOM   2491 C C   . LEU A 1 318 ? -6.52500  49.33600 280.45300 1.000 56.84329  ? 321 LEU A C   1 
ATOM   2492 O O   . LEU A 1 318 ? -6.83200  48.17700 280.16200 1.000 57.09972  ? 321 LEU A O   1 
ATOM   2493 C CB  . LEU A 1 318 ? -7.48500  51.40100 279.37000 1.000 57.78288  ? 321 LEU A CB  1 
ATOM   2494 C CG  . LEU A 1 318 ? -8.95100  50.96800 279.19600 1.000 57.54413  ? 321 LEU A CG  1 
ATOM   2495 C CD1 . LEU A 1 318 ? -9.86200  52.17400 279.05100 1.000 52.70577  ? 321 LEU A CD1 1 
ATOM   2496 C CD2 . LEU A 1 318 ? -9.14200  50.03500 278.01100 1.000 60.96315  ? 321 LEU A CD2 1 
ATOM   2497 N N   . GLY A 1 319 ? -6.35900  49.74300 281.70900 1.000 58.22664  ? 322 GLY A N   1 
ATOM   2498 C CA  . GLY A 1 319 ? -6.60700  48.81100 282.79900 1.000 58.82114  ? 322 GLY A CA  1 
ATOM   2499 C C   . GLY A 1 319 ? -6.32200  49.41200 284.15600 1.000 57.71643  ? 322 GLY A C   1 
ATOM   2500 O O   . GLY A 1 319 ? -5.94800  50.58500 284.28900 1.000 58.89443  ? 322 GLY A O   1 
ATOM   2501 N N   . VAL A 1 320 ? -6.49100  48.56400 285.17600 1.000 59.98009  ? 323 VAL A N   1 
ATOM   2502 C CA  . VAL A 1 320 ? -6.47000  48.96300 286.57900 1.000 56.14569  ? 323 VAL A CA  1 
ATOM   2503 C C   . VAL A 1 320 ? -5.58800  48.00900 287.37800 1.000 59.99171  ? 323 VAL A C   1 
ATOM   2504 O O   . VAL A 1 320 ? -5.27900  46.89500 286.94700 1.000 61.41052  ? 323 VAL A O   1 
ATOM   2505 C CB  . VAL A 1 320 ? -7.88700  48.98600 287.18700 1.000 53.92911  ? 323 VAL A CB  1 
ATOM   2506 C CG1 . VAL A 1 320 ? -8.81700  49.86600 286.38100 1.000 56.31901  ? 323 VAL A CG1 1 
ATOM   2507 C CG2 . VAL A 1 320 ? -8.43600  47.57900 287.27700 1.000 56.85660  ? 323 VAL A CG2 1 
ATOM   2508 N N   . ASN A 1 321 ? -5.19400  48.46500 288.57100 1.000 64.62515  ? 324 ASN A N   1 
ATOM   2509 C CA  . ASN A 1 321 ? -4.53600  47.64900 289.58800 1.000 62.41001  ? 324 ASN A CA  1 
ATOM   2510 C C   . ASN A 1 321 ? -5.56400  47.04900 290.56100 1.000 63.82974  ? 324 ASN A C   1 
ATOM   2511 O O   . ASN A 1 321 ? -6.70800  47.50900 290.66100 1.000 61.35080  ? 324 ASN A O   1 
ATOM   2512 C CB  . ASN A 1 321 ? -3.51200  48.47200 290.36900 1.000 60.73088  ? 324 ASN A CB  1 
ATOM   2513 C CG  . ASN A 1 321 ? -2.45600  49.09800 289.48900 1.000 63.96380  ? 324 ASN A CG  1 
ATOM   2514 O OD1 . ASN A 1 321 ? -2.47200  48.94900 288.26800 1.000 65.99956  ? 324 ASN A OD1 1 
ATOM   2515 N ND2 . ASN A 1 321 ? -1.52400  49.81900 290.11400 1.000 64.13626  ? 324 ASN A ND2 1 
ATOM   2516 N N   . LYS A 1 322 ? -5.12500  46.02200 291.30500 1.000 63.99638  ? 325 LYS A N   1 
ATOM   2517 C CA  . LYS A 1 322 ? -6.03400  45.27400 292.17700 1.000 65.11482  ? 325 LYS A CA  1 
ATOM   2518 C C   . LYS A 1 322 ? -6.53400  46.12500 293.33500 1.000 62.57739  ? 325 LYS A C   1 
ATOM   2519 O O   . LYS A 1 322 ? -7.72700  46.11700 293.64600 1.000 67.40784  ? 325 LYS A O   1 
ATOM   2520 C CB  . LYS A 1 322 ? -5.36000  44.00700 292.71700 1.000 63.36138  ? 325 LYS A CB  1 
ATOM   2521 C CG  . LYS A 1 322 ? -6.23600  43.23400 293.71200 1.000 56.33667  ? 325 LYS A CG  1 
ATOM   2522 C CD  . LYS A 1 322 ? -5.65500  41.87600 294.06100 1.000 53.24905  ? 325 LYS A CD  1 
ATOM   2523 C CE  . LYS A 1 322 ? -6.13000  41.41000 295.42300 1.000 66.41747  ? 325 LYS A CE  1 
ATOM   2524 N NZ  . LYS A 1 322 ? -5.56900  42.24100 296.57900 1.000 63.64483  ? 325 LYS A NZ  1 
ATOM   2525 N N   . ASP A 1 323 ? -5.64000  46.84800 294.00100 1.000 60.28174  ? 326 ASP A N   1 
ATOM   2526 C CA  . ASP A 1 323 ? -5.98000  47.57300 295.22700 1.000 67.48846  ? 326 ASP A CA  1 
ATOM   2527 C C   . ASP A 1 323 ? -5.62800  49.04300 295.01500 1.000 68.01413  ? 326 ASP A C   1 
ATOM   2528 O O   . ASP A 1 323 ? -4.59500  49.53300 295.48000 1.000 66.85209  ? 326 ASP A O   1 
ATOM   2529 C CB  . ASP A 1 323 ? -5.23400  46.95100 296.50400 1.000 60.31203  ? 326 ASP A CB  1 
ATOM   2530 C CG  . ASP A 1 323 ? -5.57500  45.47800 296.73800 1.000 65.14664  ? 326 ASP A CG  1 
ATOM   2531 O OD1 . ASP A 1 323 ? -6.73600  45.15900 297.14200 1.000 64.73538  ? 326 ASP A OD1 1 
ATOM   2532 O OD2 . ASP A 1 323 ? -4.66500  44.64000 296.51500 1.000 60.50637  ? 326 ASP A OD2 1 
ATOM   2533 N N   . GLU A 1 324 ? -6.51400  49.75500 294.31800 1.000 68.51077  ? 327 GLU A N   1 
ATOM   2534 C CA  . GLU A 1 324 ? -6.25300  51.14300 293.94700 1.000 62.43138  ? 327 GLU A CA  1 
ATOM   2535 C C   . GLU A 1 324 ? -6.46600  52.10800 295.10400 1.000 64.40365  ? 327 GLU A C   1 
ATOM   2536 O O   . GLU A 1 324 ? -5.84500  53.17600 295.13800 1.000 66.88622  ? 327 GLU A O   1 
ATOM   2537 C CB  . GLU A 1 324 ? -7.15300  51.55000 292.77900 1.000 58.30764  ? 327 GLU A CB  1 
ATOM   2538 C CG  . GLU A 1 324 ? -6.90800  50.79900 291.49900 1.000 60.85750  ? 327 GLU A CG  1 
ATOM   2539 C CD  . GLU A 1 324 ? -5.85100  51.48200 290.64400 1.000 66.45673  ? 327 GLU A CD  1 
ATOM   2540 O OE1 . GLU A 1 324 ? -5.07400  52.31800 291.18400 1.000 64.93028  ? 327 GLU A OE1 1 
ATOM   2541 O OE2 . GLU A 1 324 ? -5.81000  51.19900 289.42200 1.000 65.80947  ? 327 GLU A OE2 1 
ATOM   2542 N N   . GLY A 1 325 ? -7.34000  51.77700 296.04400 1.000 59.40422  ? 328 GLY A N   1 
ATOM   2543 C CA  . GLY A 1 325 ? -7.67300  52.75500 297.06300 1.000 63.43043  ? 328 GLY A CA  1 
ATOM   2544 C C   . GLY A 1 325 ? -6.70500  52.85300 298.22900 1.000 64.25103  ? 328 GLY A C   1 
ATOM   2545 O O   . GLY A 1 325 ? -6.65700  53.88000 298.92300 1.000 60.34130  ? 328 GLY A O   1 
ATOM   2546 N N   . SER A 1 326 ? -5.91600  51.79900 298.44900 1.000 61.15988  ? 329 SER A N   1 
ATOM   2547 C CA  . SER A 1 326 ? -5.19300  51.69200 299.70800 1.000 60.68032  ? 329 SER A CA  1 
ATOM   2548 C C   . SER A 1 326 ? -4.18200  52.82400 299.88400 1.000 59.96706  ? 329 SER A C   1 
ATOM   2549 O O   . SER A 1 326 ? -3.97100  53.29500 301.00500 1.000 68.76036  ? 329 SER A O   1 
ATOM   2550 C CB  . SER A 1 326 ? -4.53800  50.31400 299.81900 1.000 57.59608  ? 329 SER A CB  1 
ATOM   2551 O OG  . SER A 1 326 ? -3.37500  50.23500 299.03900 1.000 63.79703  ? 329 SER A OG  1 
ATOM   2552 N N   . PHE A 1 327 ? -3.59300  53.30700 298.79800 1.000 60.34371  ? 330 PHE A N   1 
ATOM   2553 C CA  . PHE A 1 327 ? -2.63700  54.41000 298.88500 1.000 65.03490  ? 330 PHE A CA  1 
ATOM   2554 C C   . PHE A 1 327 ? -3.27800  55.67500 299.45400 1.000 66.75808  ? 330 PHE A C   1 
ATOM   2555 O O   . PHE A 1 327 ? -2.62200  56.45300 300.15500 1.000 66.69941  ? 330 PHE A O   1 
ATOM   2556 C CB  . PHE A 1 327 ? -2.06200  54.68800 297.49000 1.000 67.51630  ? 330 PHE A CB  1 
ATOM   2557 C CG  . PHE A 1 327 ? -0.62100  55.13400 297.48600 1.000 71.70486  ? 330 PHE A CG  1 
ATOM   2558 C CD1 . PHE A 1 327 ? -0.03100  55.66400 298.62500 1.000 64.88777  ? 330 PHE A CD1 1 
ATOM   2559 C CD2 . PHE A 1 327 ? 0.14300   55.03600 296.32500 1.000 69.93941  ? 330 PHE A CD2 1 
ATOM   2560 C CE1 . PHE A 1 327 ? 1.29600   56.07300 298.61300 1.000 66.18827  ? 330 PHE A CE1 1 
ATOM   2561 C CE2 . PHE A 1 327 ? 1.47100   55.43300 296.30800 1.000 72.24800  ? 330 PHE A CE2 1 
ATOM   2562 C CZ  . PHE A 1 327 ? 2.04600   55.96300 297.46000 1.000 70.30008  ? 330 PHE A CZ  1 
ATOM   2563 N N   . PHE A 1 328 ? -4.55600  55.90700 299.15700 1.000 66.01934  ? 331 PHE A N   1 
ATOM   2564 C CA  . PHE A 1 328 ? -5.18400  57.17300 299.51300 1.000 62.41080  ? 331 PHE A CA  1 
ATOM   2565 C C   . PHE A 1 328 ? -5.78800  57.14700 300.89200 1.000 61.23991  ? 331 PHE A C   1 
ATOM   2566 O O   . PHE A 1 328 ? -5.92900  58.20300 301.51400 1.000 64.47291  ? 331 PHE A O   1 
ATOM   2567 C CB  . PHE A 1 328 ? -6.25700  57.54100 298.48900 1.000 63.16748  ? 331 PHE A CB  1 
ATOM   2568 C CG  . PHE A 1 328 ? -5.69500  57.82000 297.13200 1.000 67.30145  ? 331 PHE A CG  1 
ATOM   2569 C CD1 . PHE A 1 328 ? -5.43400  56.78200 296.24300 1.000 63.11281  ? 331 PHE A CD1 1 
ATOM   2570 C CD2 . PHE A 1 328 ? -5.37400  59.11400 296.76300 1.000 66.26602  ? 331 PHE A CD2 1 
ATOM   2571 C CE1 . PHE A 1 328 ? -4.88600  57.03800 295.02100 1.000 58.11684  ? 331 PHE A CE1 1 
ATOM   2572 C CE2 . PHE A 1 328 ? -4.82800  59.37000 295.52700 1.000 65.62298  ? 331 PHE A CE2 1 
ATOM   2573 C CZ  . PHE A 1 328 ? -4.59100  58.33100 294.65900 1.000 63.26865  ? 331 PHE A CZ  1 
ATOM   2574 N N   . LEU A 1 329 ? -6.16900  55.95600 301.35700 1.000 63.57246  ? 332 LEU A N   1 
ATOM   2575 C CA  . LEU A 1 329 ? -6.59400  55.78000 302.73800 1.000 57.83270  ? 332 LEU A CA  1 
ATOM   2576 C C   . LEU A 1 329 ? -5.43300  56.02300 303.69400 1.000 60.35004  ? 332 LEU A C   1 
ATOM   2577 O O   . LEU A 1 329 ? -5.60600  56.65800 304.74100 1.000 61.29878  ? 332 LEU A O   1 
ATOM   2578 C CB  . LEU A 1 329 ? -7.16600  54.37700 302.92100 1.000 56.70260  ? 332 LEU A CB  1 
ATOM   2579 C CG  . LEU A 1 329 ? -8.44200  54.05300 302.15300 1.000 54.72496  ? 332 LEU A CG  1 
ATOM   2580 C CD1 . LEU A 1 329 ? -8.55700  52.55600 301.95700 1.000 55.86288  ? 332 LEU A CD1 1 
ATOM   2581 C CD2 . LEU A 1 329 ? -9.65900  54.59900 302.85700 1.000 52.89414  ? 332 LEU A CD2 1 
ATOM   2582 N N   . LEU A 1 330 ? -4.23600  55.54300 303.33300 1.000 58.37288  ? 333 LEU A N   1 
ATOM   2583 C CA  . LEU A 1 330 ? -3.04600  55.80100 304.13700 1.000 60.01292  ? 333 LEU A CA  1 
ATOM   2584 C C   . LEU A 1 330 ? -2.84700  57.28600 304.41500 1.000 59.36056  ? 333 LEU A C   1 
ATOM   2585 O O   . LEU A 1 330 ? -2.36100  57.66000 305.48500 1.000 66.97062  ? 333 LEU A O   1 
ATOM   2586 C CB  . LEU A 1 330 ? -1.81300  55.22800 303.43700 1.000 62.79190  ? 333 LEU A CB  1 
ATOM   2587 C CG  . LEU A 1 330 ? -0.46900  55.53900 304.10900 1.000 66.46133  ? 333 LEU A CG  1 
ATOM   2588 C CD1 . LEU A 1 330 ? -0.44900  55.00900 305.53000 1.000 62.36564  ? 333 LEU A CD1 1 
ATOM   2589 C CD2 . LEU A 1 330 ? 0.69400   54.97600 303.31400 1.000 66.85299  ? 333 LEU A CD2 1 
ATOM   2590 N N   . TYR A 1 331 ? -3.23500  58.14500 303.48900 1.000 61.85335  ? 334 TYR A N   1 
ATOM   2591 C CA  . TYR A 1 331 ? -2.90400  59.55200 303.62300 1.000 62.82114  ? 334 TYR A CA  1 
ATOM   2592 C C   . TYR A 1 331 ? -3.94700  60.34400 304.38700 1.000 68.05592  ? 334 TYR A C   1 
ATOM   2593 O O   . TYR A 1 331 ? -3.58400  61.30900 305.07700 1.000 71.41077  ? 334 TYR A O   1 
ATOM   2594 C CB  . TYR A 1 331 ? -2.66300  60.16800 302.24100 1.000 60.67879  ? 334 TYR A CB  1 
ATOM   2595 C CG  . TYR A 1 331 ? -1.22000  59.98900 301.85500 1.000 66.01110  ? 334 TYR A CG  1 
ATOM   2596 C CD1 . TYR A 1 331 ? -0.71300  58.72600 301.57200 1.000 64.22956  ? 334 TYR A CD1 1 
ATOM   2597 C CD2 . TYR A 1 331 ? -0.34300  61.06300 301.84000 1.000 68.85474  ? 334 TYR A CD2 1 
ATOM   2598 C CE1 . TYR A 1 331 ? 0.62100   58.54400 301.24900 1.000 61.34645  ? 334 TYR A CE1 1 
ATOM   2599 C CE2 . TYR A 1 331 ? 0.99300   60.88500 301.52400 1.000 67.76213  ? 334 TYR A CE2 1 
ATOM   2600 C CZ  . TYR A 1 331 ? 1.46700   59.62400 301.23000 1.000 63.11559  ? 334 TYR A CZ  1 
ATOM   2601 O OH  . TYR A 1 331 ? 2.79200   59.44000 300.91900 1.000 63.56484  ? 334 TYR A OH  1 
ATOM   2602 N N   . GLY A 1 332 ? -5.21600  59.95200 304.32100 1.000 60.43998  ? 335 GLY A N   1 
ATOM   2603 C CA  . GLY A 1 332 ? -6.23200  60.77900 304.93600 1.000 60.42488  ? 335 GLY A CA  1 
ATOM   2604 C C   . GLY A 1 332 ? -7.32500  60.05300 305.68500 1.000 66.53996  ? 335 GLY A C   1 
ATOM   2605 O O   . GLY A 1 332 ? -8.17700  60.70200 306.30100 1.000 69.00989  ? 335 GLY A O   1 
ATOM   2606 N N   . ALA A 1 333 ? -7.32600  58.70300 305.64700 1.000 63.30922  ? 336 ALA A N   1 
ATOM   2607 C CA  . ALA A 1 333 ? -8.40100  58.06500 306.40100 1.000 62.70395  ? 336 ALA A CA  1 
ATOM   2608 C C   . ALA A 1 333 ? -7.94100  57.64900 307.80800 1.000 62.15784  ? 336 ALA A C   1 
ATOM   2609 O O   . ALA A 1 333 ? -6.79900  57.21000 307.99800 1.000 57.30013  ? 336 ALA A O   1 
ATOM   2610 C CB  . ALA A 1 333 ? -8.92000  56.84100 305.64500 1.000 59.32836  ? 336 ALA A CB  1 
ATOM   2611 N N   . PRO A 1 334 ? -8.81800  57.75700 308.81000 1.000 63.29815  ? 337 PRO A N   1 
ATOM   2612 C CA  . PRO A 1 334 ? -8.42400  57.42500 310.18700 1.000 66.68317  ? 337 PRO A CA  1 
ATOM   2613 C C   . PRO A 1 334 ? -8.36300  55.92200 310.43200 1.000 64.26213  ? 337 PRO A C   1 
ATOM   2614 O O   . PRO A 1 334 ? -9.26000  55.16400 310.04500 1.000 68.91511  ? 337 PRO A O   1 
ATOM   2615 C CB  . PRO A 1 334 ? -9.52400  58.07800 311.03100 1.000 67.68603  ? 337 PRO A CB  1 
ATOM   2616 C CG  . PRO A 1 334 ? -10.73400 58.06100 310.11200 1.000 60.21430  ? 337 PRO A CG  1 
ATOM   2617 C CD  . PRO A 1 334 ? -10.21200 58.23000 308.72700 1.000 64.08112  ? 337 PRO A CD  1 
ATOM   2618 N N   . GLY A 1 335 ? -7.28200  55.49500 311.08300 1.000 53.13094  ? 338 GLY A N   1 
ATOM   2619 C CA  . GLY A 1 335 ? -7.04800  54.10600 311.39700 1.000 55.56384  ? 338 GLY A CA  1 
ATOM   2620 C C   . GLY A 1 335 ? -5.85200  53.53100 310.68000 1.000 60.07565  ? 338 GLY A C   1 
ATOM   2621 O O   . GLY A 1 335 ? -5.18300  52.63500 311.22000 1.000 64.26088  ? 338 GLY A O   1 
ATOM   2622 N N   . PHE A 1 336 ? -5.56300  54.04800 309.48700 1.000 58.24358  ? 339 PHE A N   1 
ATOM   2623 C CA  . PHE A 1 336 ? -4.50000  53.55400 308.62700 1.000 58.11910  ? 339 PHE A CA  1 
ATOM   2624 C C   . PHE A 1 336 ? -3.18000  54.19200 309.03400 1.000 59.23439  ? 339 PHE A C   1 
ATOM   2625 O O   . PHE A 1 336 ? -3.12700  55.37700 309.38600 1.000 61.18923  ? 339 PHE A O   1 
ATOM   2626 C CB  . PHE A 1 336 ? -4.80700  53.87800 307.15200 1.000 60.99343  ? 339 PHE A CB  1 
ATOM   2627 C CG  . PHE A 1 336 ? -6.09500  53.28100 306.65000 1.000 55.95783  ? 339 PHE A CG  1 
ATOM   2628 C CD1 . PHE A 1 336 ? -7.30900  53.91900 306.87200 1.000 56.32123  ? 339 PHE A CD1 1 
ATOM   2629 C CD2 . PHE A 1 336 ? -6.09200  52.07900 305.95900 1.000 56.09098  ? 339 PHE A CD2 1 
ATOM   2630 C CE1 . PHE A 1 336 ? -8.50200  53.36100 306.42100 1.000 57.54897  ? 339 PHE A CE1 1 
ATOM   2631 C CE2 . PHE A 1 336 ? -7.27400  51.51100 305.49900 1.000 56.31395  ? 339 PHE A CE2 1 
ATOM   2632 C CZ  . PHE A 1 336 ? -8.48400  52.15000 305.73200 1.000 56.80973  ? 339 PHE A CZ  1 
ATOM   2633 N N   . SER A 1 337 ? -2.11400  53.39500 308.99100 1.000 55.19236  ? 340 SER A N   1 
ATOM   2634 C CA  . SER A 1 337 ? -0.77400  53.87700 309.27100 1.000 56.57341  ? 340 SER A CA  1 
ATOM   2635 C C   . SER A 1 337 ? 0.18700   53.00100 308.48500 1.000 61.42231  ? 340 SER A C   1 
ATOM   2636 O O   . SER A 1 337 ? -0.08000  51.81700 308.26200 1.000 62.99799  ? 340 SER A O   1 
ATOM   2637 C CB  . SER A 1 337 ? -0.43000  53.85000 310.78200 1.000 66.04827  ? 340 SER A CB  1 
ATOM   2638 O OG  . SER A 1 337 ? -1.55400  53.58400 311.63700 1.000 64.01529  ? 340 SER A OG  1 
ATOM   2639 N N   . LYS A 1 338 ? 1.30800   53.59500 308.06300 1.000 60.93162  ? 341 LYS A N   1 
ATOM   2640 C CA  . LYS A 1 338 ? 2.32200   52.86100 307.31100 1.000 59.66331  ? 341 LYS A CA  1 
ATOM   2641 C C   . LYS A 1 338 ? 2.85000   51.65300 308.07000 1.000 60.35102  ? 341 LYS A C   1 
ATOM   2642 O O   . LYS A 1 338 ? 3.33700   50.70100 307.45700 1.000 60.28267  ? 341 LYS A O   1 
ATOM   2643 C CB  . LYS A 1 338 ? 3.48900   53.79700 306.96200 1.000 67.00083  ? 341 LYS A CB  1 
ATOM   2644 C CG  . LYS A 1 338 ? 4.66100   53.15500 306.19100 1.000 68.61526  ? 341 LYS A CG  1 
ATOM   2645 C CD  . LYS A 1 338 ? 5.81500   54.13900 305.96200 1.000 68.19531  ? 341 LYS A CD  1 
ATOM   2646 C CE  . LYS A 1 338 ? 6.93200   53.95000 306.99300 1.000 73.30657  ? 341 LYS A CE  1 
ATOM   2647 N NZ  . LYS A 1 338 ? 7.88900   55.11100 307.12600 1.000 67.99100  ? 341 LYS A NZ  1 
ATOM   2648 N N   . ASP A 1 339 ? 2.78200   51.66500 309.40200 1.000 67.18370  ? 342 ASP A N   1 
ATOM   2649 C CA  . ASP A 1 339 ? 3.53400   50.69400 310.18600 1.000 61.15838  ? 342 ASP A CA  1 
ATOM   2650 C C   . ASP A 1 339 ? 2.65200   49.73600 310.98300 1.000 62.69040  ? 342 ASP A C   1 
ATOM   2651 O O   . ASP A 1 339 ? 3.18000   48.89600 311.72200 1.000 61.36809  ? 342 ASP A O   1 
ATOM   2652 C CB  . ASP A 1 339 ? 4.53300   51.43100 311.09000 1.000 60.97891  ? 342 ASP A CB  1 
ATOM   2653 C CG  . ASP A 1 339 ? 5.70400   52.07000 310.29500 1.000 71.75732  ? 342 ASP A CG  1 
ATOM   2654 O OD1 . ASP A 1 339 ? 5.83800   51.78400 309.07700 1.000 66.56635  ? 342 ASP A OD1 1 
ATOM   2655 O OD2 . ASP A 1 339 ? 6.49300   52.85600 310.88200 1.000 73.01740  ? 342 ASP A OD2 1 
ATOM   2656 N N   . SER A 1 340 ? 1.33200   49.79600 310.82500 1.000 63.50465  ? 343 SER A N   1 
ATOM   2657 C CA  . SER A 1 340 ? 0.43700   48.79800 311.39300 1.000 62.45797  ? 343 SER A CA  1 
ATOM   2658 C C   . SER A 1 340 ? -0.27800  48.04200 310.28100 1.000 68.50224  ? 343 SER A C   1 
ATOM   2659 O O   . SER A 1 340 ? -0.31300  48.47700 309.12600 1.000 71.00085  ? 343 SER A O   1 
ATOM   2660 C CB  . SER A 1 340 ? -0.59400  49.43600 312.33700 1.000 64.38362  ? 343 SER A CB  1 
ATOM   2661 O OG  . SER A 1 340 ? -1.35400  50.45700 311.70900 1.000 64.08815  ? 343 SER A OG  1 
ATOM   2662 N N   . GLU A 1 341 ? -0.86600  46.90100 310.63500 1.000 66.90416  ? 344 GLU A N   1 
ATOM   2663 C CA  . GLU A 1 341 ? -1.76300  46.23400 309.69800 1.000 70.03115  ? 344 GLU A CA  1 
ATOM   2664 C C   . GLU A 1 341 ? -3.03000  47.03200 309.43600 1.000 67.30947  ? 344 GLU A C   1 
ATOM   2665 O O   . GLU A 1 341 ? -3.85300  46.59900 308.62700 1.000 63.87876  ? 344 GLU A O   1 
ATOM   2666 C CB  . GLU A 1 341 ? -2.17000  44.86400 310.21700 1.000 79.39758  ? 344 GLU A CB  1 
ATOM   2667 C CG  . GLU A 1 341 ? -1.19500  43.75400 309.98000 1.000 79.48575  ? 344 GLU A CG  1 
ATOM   2668 C CD  . GLU A 1 341 ? -1.42000  42.62400 310.97000 1.000 105.65851 ? 344 GLU A CD  1 
ATOM   2669 O OE1 . GLU A 1 341 ? -2.30800  42.76900 311.85700 1.000 100.16588 ? 344 GLU A OE1 1 
ATOM   2670 O OE2 . GLU A 1 341 ? -0.70700  41.60100 310.86900 1.000 112.83631 ? 344 GLU A OE2 1 
ATOM   2671 N N   . SER A 1 342 ? -3.22200  48.14200 310.14500 1.000 67.66921  ? 345 SER A N   1 
ATOM   2672 C CA  . SER A 1 342 ? -4.32900  49.07100 309.93200 1.000 62.95475  ? 345 SER A CA  1 
ATOM   2673 C C   . SER A 1 342 ? -5.68500  48.36400 309.91500 1.000 62.76243  ? 345 SER A C   1 
ATOM   2674 O O   . SER A 1 342 ? -6.53500  48.62300 309.06500 1.000 64.07815  ? 345 SER A O   1 
ATOM   2675 C CB  . SER A 1 342 ? -4.10600  49.89000 308.65700 1.000 64.28468  ? 345 SER A CB  1 
ATOM   2676 O OG  . SER A 1 342 ? -2.85500  50.57100 308.68600 1.000 64.04816  ? 345 SER A OG  1 
ATOM   2677 N N   . LYS A 1 343 ? -5.89200  47.46800 310.88100 1.000 65.00790  ? 346 LYS A N   1 
ATOM   2678 C CA  . LYS A 1 343 ? -7.23700  46.97000 311.15200 1.000 63.49244  ? 346 LYS A CA  1 
ATOM   2679 C C   . LYS A 1 343 ? -8.13800  48.13300 311.55100 1.000 60.78714  ? 346 LYS A C   1 
ATOM   2680 O O   . LYS A 1 343 ? -7.72400  49.05000 312.27300 1.000 57.14294  ? 346 LYS A O   1 
ATOM   2681 C CB  . LYS A 1 343 ? -7.22000  45.91100 312.25600 1.000 65.57933  ? 346 LYS A CB  1 
ATOM   2682 C CG  . LYS A 1 343 ? -6.31500  44.72900 311.98400 1.000 71.60179  ? 346 LYS A CG  1 
ATOM   2683 C CD  . LYS A 1 343 ? -6.43200  43.68200 313.08700 1.000 81.87793  ? 346 LYS A CD  1 
ATOM   2684 C CE  . LYS A 1 343 ? -5.47200  42.51400 312.84500 1.000 88.50314  ? 346 LYS A CE  1 
ATOM   2685 N NZ  . LYS A 1 343 ? -5.86200  41.30000 313.61800 1.000 88.50549  ? 346 LYS A NZ  1 
ATOM   2686 N N   . ILE A 1 344 ? -9.37200  48.10600 311.06700 1.000 58.83828  ? 347 ILE A N   1 
ATOM   2687 C CA  . ILE A 1 344 ? -10.20500 49.29900 311.01600 1.000 65.21703  ? 347 ILE A CA  1 
ATOM   2688 C C   . ILE A 1 344 ? -11.47500 49.03300 311.80300 1.000 63.20369  ? 347 ILE A C   1 
ATOM   2689 O O   . ILE A 1 344 ? -12.30500 48.19700 311.41100 1.000 59.42356  ? 347 ILE A O   1 
ATOM   2690 C CB  . ILE A 1 344 ? -10.52200 49.72700 309.57100 1.000 63.63261  ? 347 ILE A CB  1 
ATOM   2691 C CG1 . ILE A 1 344 ? -9.23000  50.05000 308.83100 1.000 57.01829  ? 347 ILE A CG1 1 
ATOM   2692 C CG2 . ILE A 1 344 ? -11.42400 50.96300 309.56800 1.000 59.16106  ? 347 ILE A CG2 1 
ATOM   2693 C CD1 . ILE A 1 344 ? -8.49800  51.24900 309.40200 1.000 51.36944  ? 347 ILE A CD1 1 
ATOM   2694 N N   . SER A 1 345 ? -11.63200 49.76000 312.90400 1.000 66.59354  ? 348 SER A N   1 
ATOM   2695 C CA  . SER A 1 345 ? -12.82400 49.64100 313.72400 1.000 67.32313  ? 348 SER A CA  1 
ATOM   2696 C C   . SER A 1 345 ? -14.07400 49.89700 312.89100 1.000 72.55040  ? 348 SER A C   1 
ATOM   2697 O O   . SER A 1 345 ? -14.04000 50.54400 311.84400 1.000 72.62090  ? 348 SER A O   1 
ATOM   2698 C CB  . SER A 1 345 ? -12.76400 50.62600 314.88000 1.000 68.31012  ? 348 SER A CB  1 
ATOM   2699 O OG  . SER A 1 345 ? -12.76200 51.94600 314.38700 1.000 74.17045  ? 348 SER A OG  1 
ATOM   2700 N N   . ARG A 1 346 ? -15.18800 49.34800 313.36700 1.000 78.94855  ? 349 ARG A N   1 
ATOM   2701 C CA  . ARG A 1 346 ? -16.48300 49.67200 312.78400 1.000 76.38209  ? 349 ARG A CA  1 
ATOM   2702 C C   . ARG A 1 346 ? -16.67400 51.17600 312.67200 1.000 75.00262  ? 349 ARG A C   1 
ATOM   2703 O O   . ARG A 1 346 ? -17.23300 51.66700 311.69100 1.000 72.02892  ? 349 ARG A O   1 
ATOM   2704 C CB  . ARG A 1 346 ? -17.59300 49.07200 313.64500 1.000 86.24430  ? 349 ARG A CB  1 
ATOM   2705 C CG  . ARG A 1 346 ? -18.96300 49.21800 313.04900 1.000 81.84912  ? 349 ARG A CG  1 
ATOM   2706 C CD  . ARG A 1 346 ? -19.00300 48.44200 311.76000 1.000 82.24121  ? 349 ARG A CD  1 
ATOM   2707 N NE  . ARG A 1 346 ? -20.01400 48.98700 310.87000 1.000 88.42239  ? 349 ARG A NE  1 
ATOM   2708 C CZ  . ARG A 1 346 ? -20.09500 48.72000 309.57100 1.000 81.49138  ? 349 ARG A CZ  1 
ATOM   2709 N NH1 . ARG A 1 346 ? -19.21400 47.90100 308.99800 1.000 76.37646  ? 349 ARG A NH1 1 
ATOM   2710 N NH2 . ARG A 1 346 ? -21.06400 49.27900 308.85500 1.000 78.34095  ? 349 ARG A NH2 1 
ATOM   2711 N N   . GLU A 1 347 ? -16.22800 51.92100 313.68400 1.000 78.70854  ? 350 GLU A N   1 
ATOM   2712 C CA  . GLU A 1 347 ? -16.46500 53.36100 313.70900 1.000 78.55940  ? 350 GLU A CA  1 
ATOM   2713 C C   . GLU A 1 347 ? -15.58400 54.08100 312.69900 1.000 76.92709  ? 350 GLU A C   1 
ATOM   2714 O O   . GLU A 1 347 ? -16.01300 55.06300 312.08000 1.000 72.85910  ? 350 GLU A O   1 
ATOM   2715 C CB  . GLU A 1 347 ? -16.22200 53.91100 315.11800 1.000 76.38727  ? 350 GLU A CB  1 
ATOM   2716 C CG  . GLU A 1 347 ? -17.22100 53.40700 316.16500 1.000 85.68017  ? 350 GLU A CG  1 
ATOM   2717 C CD  . GLU A 1 347 ? -16.57700 52.57100 317.27700 1.000 87.97187  ? 350 GLU A CD  1 
ATOM   2718 O OE1 . GLU A 1 347 ? -15.34500 52.31400 317.22900 1.000 86.53298  ? 350 GLU A OE1 1 
ATOM   2719 O OE2 . GLU A 1 347 ? -17.31600 52.17100 318.21000 1.000 91.22611  ? 350 GLU A OE2 1 
ATOM   2720 N N   . ASP A 1 348 ? -14.34500 53.61700 312.53200 1.000 75.69706  ? 351 ASP A N   1 
ATOM   2721 C CA  . ASP A 1 348 ? -13.43600 54.25700 311.59200 1.000 71.94721  ? 351 ASP A CA  1 
ATOM   2722 C C   . ASP A 1 348 ? -13.75600 53.87100 310.15400 1.000 73.33224  ? 351 ASP A C   1 
ATOM   2723 O O   . ASP A 1 348 ? -13.46400 54.63400 309.22800 1.000 72.60592  ? 351 ASP A O   1 
ATOM   2724 C CB  . ASP A 1 348 ? -11.99200 53.90600 311.94200 1.000 70.80309  ? 351 ASP A CB  1 
ATOM   2725 C CG  . ASP A 1 348 ? -11.34800 54.93100 312.84500 0.500 63.64927  ? 351 ASP A CG  1 
ATOM   2726 O OD1 . ASP A 1 348 ? -11.87600 56.06400 312.92800 0.500 61.76437  ? 351 ASP A OD1 1 
ATOM   2727 O OD2 . ASP A 1 348 ? -10.31200 54.60100 313.45800 0.500 59.68363  ? 351 ASP A OD2 1 
ATOM   2728 N N   . PHE A 1 349 ? -14.36400 52.70600 309.94900 1.000 72.59380  ? 352 PHE A N   1 
ATOM   2729 C CA  . PHE A 1 349 ? -14.93000 52.39600 308.64400 1.000 67.33395  ? 352 PHE A CA  1 
ATOM   2730 C C   . PHE A 1 349 ? -15.98500 53.42300 308.25200 1.000 67.29975  ? 352 PHE A C   1 
ATOM   2731 O O   . PHE A 1 349 ? -15.92800 53.99400 307.16200 1.000 75.08009  ? 352 PHE A O   1 
ATOM   2732 C CB  . PHE A 1 349 ? -15.51800 50.99000 308.66000 1.000 70.32309  ? 352 PHE A CB  1 
ATOM   2733 C CG  . PHE A 1 349 ? -16.13000 50.58400 307.36900 1.000 71.43467  ? 352 PHE A CG  1 
ATOM   2734 C CD1 . PHE A 1 349 ? -15.35000 50.06400 306.35700 1.000 68.70890  ? 352 PHE A CD1 1 
ATOM   2735 C CD2 . PHE A 1 349 ? -17.48800 50.73100 307.15900 1.000 72.70699  ? 352 PHE A CD2 1 
ATOM   2736 C CE1 . PHE A 1 349 ? -15.91600 49.69100 305.15600 1.000 71.64757  ? 352 PHE A CE1 1 
ATOM   2737 C CE2 . PHE A 1 349 ? -18.06300 50.36200 305.95400 1.000 70.59164  ? 352 PHE A CE2 1 
ATOM   2738 C CZ  . PHE A 1 349 ? -17.27900 49.84100 304.95300 1.000 72.07912  ? 352 PHE A CZ  1 
ATOM   2739 N N   . MET A 1 350 ? -16.96700 53.65100 309.12000 1.000 71.37250  ? 353 MET A N   1 
ATOM   2740 C CA  . MET A 1 350 ? -17.94500 54.73100 309.00500 1.000 70.92355  ? 353 MET A CA  1 
ATOM   2741 C C   . MET A 1 350 ? -17.29700 56.04900 308.59300 1.000 70.91154  ? 353 MET A C   1 
ATOM   2742 O O   . MET A 1 350 ? -17.81000 56.76200 307.72200 1.000 71.19970  ? 353 MET A O   1 
ATOM   2743 C CB  . MET A 1 350 ? -18.66000 54.92000 310.35200 1.000 81.26443  ? 353 MET A CB  1 
ATOM   2744 C CG  . MET A 1 350 ? -20.19100 54.99200 310.32300 1.000 93.16894  ? 353 MET A CG  1 
ATOM   2745 S SD  . MET A 1 350 ? -21.01300 53.59900 311.15500 1.000 101.36562 ? 353 MET A SD  1 
ATOM   2746 C CE  . MET A 1 350 ? -21.29400 52.50800 309.73800 1.000 84.25968  ? 353 MET A CE  1 
ATOM   2747 N N   . SER A 1 351 ? -16.16700 56.38300 309.22000 1.000 69.55455  ? 354 SER A N   1 
ATOM   2748 C CA  . SER A 1 351 ? -15.49600 57.64300 308.91100 1.000 67.05914  ? 354 SER A CA  1 
ATOM   2749 C C   . SER A 1 351 ? -14.86600 57.60400 307.52800 1.000 65.35208  ? 354 SER A C   1 
ATOM   2750 O O   . SER A 1 351 ? -14.87800 58.60800 306.81000 1.000 69.66452  ? 354 SER A O   1 
ATOM   2751 C CB  . SER A 1 351 ? -14.43700 57.96200 309.97100 1.000 68.43726  ? 354 SER A CB  1 
ATOM   2752 O OG  . SER A 1 351 ? -15.02200 58.30000 311.22500 1.000 73.77354  ? 354 SER A OG  1 
ATOM   2753 N N   . GLY A 1 352 ? -14.30700 56.45700 307.13900 1.000 64.92734  ? 355 GLY A N   1 
ATOM   2754 C CA  . GLY A 1 352 ? -13.74300 56.33800 305.80500 1.000 62.41206  ? 355 GLY A CA  1 
ATOM   2755 C C   . GLY A 1 352 ? -14.78000 56.49100 304.70700 1.000 64.20977  ? 355 GLY A C   1 
ATOM   2756 O O   . GLY A 1 352 ? -14.51900 57.12300 303.67700 1.000 59.08278  ? 355 GLY A O   1 
ATOM   2757 N N   . VAL A 1 353 ? -15.97500 55.92100 304.91600 1.000 63.40314  ? 356 VAL A N   1 
ATOM   2758 C CA  . VAL A 1 353 ? -17.04400 56.00700 303.92100 1.000 61.79966  ? 356 VAL A CA  1 
ATOM   2759 C C   . VAL A 1 353 ? -17.44500 57.46100 303.68600 1.000 59.67419  ? 356 VAL A C   1 
ATOM   2760 O O   . VAL A 1 353 ? -17.72500 57.87100 302.55800 1.000 67.08610  ? 356 VAL A O   1 
ATOM   2761 C CB  . VAL A 1 353 ? -18.24200 55.14500 304.36400 1.000 63.35305  ? 356 VAL A CB  1 
ATOM   2762 C CG1 . VAL A 1 353 ? -19.41800 55.28000 303.39800 1.000 59.96542  ? 356 VAL A CG1 1 
ATOM   2763 C CG2 . VAL A 1 353 ? -17.82700 53.69300 304.47800 1.000 65.33117  ? 356 VAL A CG2 1 
ATOM   2764 N N   . LYS A 1 354 ? -17.46300 58.26200 304.74300 1.000 62.87240  ? 357 LYS A N   1 
ATOM   2765 C CA  . LYS A 1 354 ? -17.70200 59.69500 304.60800 1.000 63.46764  ? 357 LYS A CA  1 
ATOM   2766 C C   . LYS A 1 354 ? -16.63400 60.35700 303.73600 1.000 59.74367  ? 357 LYS A C   1 
ATOM   2767 O O   . LYS A 1 354 ? -16.95200 61.13100 302.82900 1.000 59.49984  ? 357 LYS A O   1 
ATOM   2768 C CB  . LYS A 1 354 ? -17.74100 60.32700 306.01500 1.000 66.61447  ? 357 LYS A CB  1 
ATOM   2769 C CG  . LYS A 1 354 ? -18.07300 61.81900 306.10300 1.000 62.63493  ? 357 LYS A CG  1 
ATOM   2770 C CD  . LYS A 1 354 ? -19.56700 62.06600 305.94200 1.000 69.86848  ? 357 LYS A CD  1 
ATOM   2771 C CE  . LYS A 1 354 ? -19.90400 63.55800 305.89500 1.000 71.35778  ? 357 LYS A CE  1 
ATOM   2772 N NZ  . LYS A 1 354 ? -21.36000 63.79200 305.67300 1.000 74.79341  ? 357 LYS A NZ  1 
ATOM   2773 N N   . LEU A 1 355 ? -15.35600 60.09400 304.01800 1.000 56.12938  ? 358 LEU A N   1 
ATOM   2774 C CA  . LEU A 1 355 ? -14.29500 60.79500 303.30800 1.000 58.92306  ? 358 LEU A CA  1 
ATOM   2775 C C   . LEU A 1 355 ? -14.12700 60.30400 301.87000 1.000 64.91997  ? 358 LEU A C   1 
ATOM   2776 O O   . LEU A 1 355 ? -13.48900 60.99000 301.05800 1.000 61.45241  ? 358 LEU A O   1 
ATOM   2777 C CB  . LEU A 1 355 ? -12.97200 60.63700 304.04900 1.000 53.47457  ? 358 LEU A CB  1 
ATOM   2778 C CG  . LEU A 1 355 ? -12.81500 61.25200 305.42300 1.000 58.85347  ? 358 LEU A CG  1 
ATOM   2779 C CD1 . LEU A 1 355 ? -11.63000 60.59900 306.11600 1.000 62.91052  ? 358 LEU A CD1 1 
ATOM   2780 C CD2 . LEU A 1 355 ? -12.62600 62.75800 305.34300 1.000 57.97834  ? 358 LEU A CD2 1 
ATOM   2781 N N   . SER A 1 356 ? -14.65600 59.12600 301.54200 1.000 61.55122  ? 359 SER A N   1 
ATOM   2782 C CA  . SER A 1 356 ? -14.50300 58.59500 300.19900 1.000 61.09272  ? 359 SER A CA  1 
ATOM   2783 C C   . SER A 1 356 ? -15.58700 59.07700 299.24700 1.000 61.57548  ? 359 SER A C   1 
ATOM   2784 O O   . SER A 1 356 ? -15.30400 59.29900 298.06400 1.000 60.98999  ? 359 SER A O   1 
ATOM   2785 C CB  . SER A 1 356 ? -14.48300 57.07200 300.24000 1.000 57.65873  ? 359 SER A CB  1 
ATOM   2786 O OG  . SER A 1 356 ? -13.33400 56.64400 300.94000 1.000 59.14534  ? 359 SER A OG  1 
ATOM   2787 N N   . VAL A 1 357 ? -16.80600 59.27300 299.73400 1.000 57.56695  ? 360 VAL A N   1 
ATOM   2788 C CA  . VAL A 1 357 ? -17.88900 59.77900 298.90300 1.000 58.20551  ? 360 VAL A CA  1 
ATOM   2789 C C   . VAL A 1 357 ? -18.36900 61.11100 299.46900 1.000 62.15476  ? 360 VAL A C   1 
ATOM   2790 O O   . VAL A 1 357 ? -19.51600 61.21100 299.92700 1.000 64.77044  ? 360 VAL A O   1 
ATOM   2791 C CB  . VAL A 1 357 ? -19.02700 58.75700 298.82300 1.000 61.40239  ? 360 VAL A CB  1 
ATOM   2792 C CG1 . VAL A 1 357 ? -19.90500 59.02600 297.61900 1.000 59.12996  ? 360 VAL A CG1 1 
ATOM   2793 C CG2 . VAL A 1 357 ? -18.45000 57.36100 298.76300 1.000 62.35560  ? 360 VAL A CG2 1 
ATOM   2794 N N   . PRO A 1 358 ? -17.54500 62.16200 299.43000 1.000 60.72370  ? 361 PRO A N   1 
ATOM   2795 C CA  . PRO A 1 358 ? -17.88500 63.40900 300.13600 1.000 63.87536  ? 361 PRO A CA  1 
ATOM   2796 C C   . PRO A 1 358 ? -19.10500 64.15200 299.60300 1.000 64.90836  ? 361 PRO A C   1 
ATOM   2797 O O   . PRO A 1 358 ? -19.59700 65.05300 300.29400 1.000 66.60922  ? 361 PRO A O   1 
ATOM   2798 C CB  . PRO A 1 358 ? -16.61600 64.25600 299.96800 1.000 63.31003  ? 361 PRO A CB  1 
ATOM   2799 C CG  . PRO A 1 358 ? -15.94500 63.69900 298.78300 1.000 61.02975  ? 361 PRO A CG  1 
ATOM   2800 C CD  . PRO A 1 358 ? -16.21800 62.23800 298.80400 1.000 61.49223  ? 361 PRO A CD  1 
ATOM   2801 N N   . HIS A 1 359 ? -19.59900 63.83100 298.41600 1.000 63.57525  ? 362 HIS A N   1 
ATOM   2802 C CA  . HIS A 1 359 ? -20.75400 64.51600 297.84200 1.000 67.86662  ? 362 HIS A CA  1 
ATOM   2803 C C   . HIS A 1 359 ? -22.07100 63.83100 298.18300 1.000 70.43672  ? 362 HIS A C   1 
ATOM   2804 O O   . HIS A 1 359 ? -23.12800 64.28600 297.73100 1.000 67.20484  ? 362 HIS A O   1 
ATOM   2805 C CB  . HIS A 1 359 ? -20.61200 64.59200 296.31700 1.000 63.11382  ? 362 HIS A CB  1 
ATOM   2806 C CG  . HIS A 1 359 ? -20.30800 63.26800 295.69700 1.000 66.15018  ? 362 HIS A CG  1 
ATOM   2807 N ND1 . HIS A 1 359 ? -19.10300 62.62000 295.88400 1.000 70.32541  ? 362 HIS A ND1 1 
ATOM   2808 C CD2 . HIS A 1 359 ? -21.06300 62.44100 294.93800 1.000 66.83717  ? 362 HIS A CD2 1 
ATOM   2809 C CE1 . HIS A 1 359 ? -19.12100 61.46400 295.24600 1.000 63.65014  ? 362 HIS A CE1 1 
ATOM   2810 N NE2 . HIS A 1 359 ? -20.29900 61.33100 294.66200 1.000 66.78828  ? 362 HIS A NE2 1 
ATOM   2811 N N   . ALA A 1 360 ? -22.03000 62.74200 298.94900 1.000 67.56295  ? 363 ALA A N   1 
ATOM   2812 C CA  . ALA A 1 360 ? -23.20100 61.91000 299.17000 1.000 67.10595  ? 363 ALA A CA  1 
ATOM   2813 C C   . ALA A 1 360 ? -23.93900 62.33400 300.43100 1.000 66.49470  ? 363 ALA A C   1 
ATOM   2814 O O   . ALA A 1 360 ? -23.32100 62.57300 301.47300 1.000 65.62654  ? 363 ALA A O   1 
ATOM   2815 C CB  . ALA A 1 360 ? -22.79800 60.43900 299.27300 1.000 64.61150  ? 363 ALA A CB  1 
ATOM   2816 N N   . ASN A 1 361 ? -25.26700 62.41800 300.32100 1.000 65.27887  ? 364 ASN A N   1 
ATOM   2817 C CA  . ASN A 1 361 ? -26.13200 62.64100 301.46600 1.000 62.59097  ? 364 ASN A CA  1 
ATOM   2818 C C   . ASN A 1 361 ? -26.15700 61.38600 302.33900 1.000 66.54375  ? 364 ASN A C   1 
ATOM   2819 O O   . ASN A 1 361 ? -25.56200 60.35500 302.01300 1.000 66.33912  ? 364 ASN A O   1 
ATOM   2820 C CB  . ASN A 1 361 ? -27.53400 63.06000 301.00700 1.000 61.14941  ? 364 ASN A CB  1 
ATOM   2821 C CG  . ASN A 1 361 ? -28.25200 61.99300 300.19000 1.000 60.87525  ? 364 ASN A CG  1 
ATOM   2822 O OD1 . ASN A 1 361 ? -27.84000 60.84100 300.14200 1.000 64.09377  ? 364 ASN A OD1 1 
ATOM   2823 N ND2 . ASN A 1 361 ? -29.34700 62.38400 299.54400 1.000 59.59739  ? 364 ASN A ND2 1 
ATOM   2824 N N   . ASP A 1 362 ? -26.84600 61.48000 303.47800 1.000 68.75380  ? 365 ASP A N   1 
ATOM   2825 C CA  . ASP A 1 362 ? -26.84500 60.37200 304.42300 1.000 64.35381  ? 365 ASP A CA  1 
ATOM   2826 C C   . ASP A 1 362 ? -27.35800 59.08800 303.77600 1.000 67.10146  ? 365 ASP A C   1 
ATOM   2827 O O   . ASP A 1 362 ? -26.77000 58.01400 303.96800 1.000 65.02871  ? 365 ASP A O   1 
ATOM   2828 C CB  . ASP A 1 362 ? -27.67800 60.72900 305.65600 1.000 71.57391  ? 365 ASP A CB  1 
ATOM   2829 C CG  . ASP A 1 362 ? -26.93700 61.63300 306.62700 0.500 71.35281  ? 365 ASP A CG  1 
ATOM   2830 O OD1 . ASP A 1 362 ? -25.70700 61.45900 306.77700 0.500 69.33355  ? 365 ASP A OD1 1 
ATOM   2831 O OD2 . ASP A 1 362 ? -27.58600 62.51000 307.24400 0.500 68.82196  ? 365 ASP A OD2 1 
ATOM   2832 N N   . LEU A 1 363 ? -28.44600 59.17600 302.99600 1.000 65.41551  ? 366 LEU A N   1 
ATOM   2833 C CA  . LEU A 1 363 ? -29.01000 57.96700 302.39500 1.000 62.07970  ? 366 LEU A CA  1 
ATOM   2834 C C   . LEU A 1 363 ? -28.01800 57.31700 301.44000 1.000 62.28029  ? 366 LEU A C   1 
ATOM   2835 O O   . LEU A 1 363 ? -27.90700 56.08500 301.38900 1.000 61.71538  ? 366 LEU A O   1 
ATOM   2836 C CB  . LEU A 1 363 ? -30.32400 58.28000 301.67600 1.000 61.34693  ? 366 LEU A CB  1 
ATOM   2837 C CG  . LEU A 1 363 ? -31.02200 57.05400 301.05400 1.000 69.19749  ? 366 LEU A CG  1 
ATOM   2838 C CD1 . LEU A 1 363 ? -31.43500 56.07300 302.13300 1.000 68.09723  ? 366 LEU A CD1 1 
ATOM   2839 C CD2 . LEU A 1 363 ? -32.22700 57.40900 300.16300 1.000 64.90879  ? 366 LEU A CD2 1 
ATOM   2840 N N   . GLY A 1 364 ? -27.27100 58.12800 300.69200 1.000 61.06047  ? 367 GLY A N   1 
ATOM   2841 C CA  . GLY A 1 364 ? -26.21700 57.58100 299.85600 1.000 61.77678  ? 367 GLY A CA  1 
ATOM   2842 C C   . GLY A 1 364 ? -25.09500 56.96300 300.66200 1.000 55.21891  ? 367 GLY A C   1 
ATOM   2843 O O   . GLY A 1 364 ? -24.56200 55.91500 300.29400 1.000 50.35496  ? 367 GLY A O   1 
ATOM   2844 N N   . LEU A 1 365 ? -24.73400 57.59600 301.78300 1.000 64.63605  ? 368 LEU A N   1 
ATOM   2845 C CA  . LEU A 1 365 ? -23.73400 57.03100 302.69100 1.000 59.87340  ? 368 LEU A CA  1 
ATOM   2846 C C   . LEU A 1 365 ? -24.15100 55.66300 303.21000 1.000 57.72626  ? 368 LEU A C   1 
ATOM   2847 O O   . LEU A 1 365 ? -23.32400 54.74600 303.29900 1.000 55.76359  ? 368 LEU A O   1 
ATOM   2848 C CB  . LEU A 1 365 ? -23.49800 57.98500 303.85000 1.000 54.42889  ? 368 LEU A CB  1 
ATOM   2849 C CG  . LEU A 1 365 ? -22.42800 59.01500 303.53400 1.000 61.64428  ? 368 LEU A CG  1 
ATOM   2850 C CD1 . LEU A 1 365 ? -22.10300 59.81600 304.77000 1.000 62.24342  ? 368 LEU A CD1 1 
ATOM   2851 C CD2 . LEU A 1 365 ? -21.18300 58.31800 303.00200 1.000 60.30040  ? 368 LEU A CD2 1 
ATOM   2852 N N   . ASP A 1 366 ? -25.43300 55.50900 303.55400 1.000 61.69356  ? 369 ASP A N   1 
ATOM   2853 C CA  . ASP A 1 366 ? -25.95400 54.20600 303.95900 1.000 60.80026  ? 369 ASP A CA  1 
ATOM   2854 C C   . ASP A 1 366 ? -25.88300 53.19300 302.82700 1.000 56.87424  ? 369 ASP A C   1 
ATOM   2855 O O   . ASP A 1 366 ? -25.55500 52.02300 303.06300 1.000 52.83496  ? 369 ASP A O   1 
ATOM   2856 C CB  . ASP A 1 366 ? -27.39300 54.34300 304.45200 1.000 64.07007  ? 369 ASP A CB  1 
ATOM   2857 C CG  . ASP A 1 366 ? -27.47500 54.75000 305.91200 1.000 72.62877  ? 369 ASP A CG  1 
ATOM   2858 O OD1 . ASP A 1 366 ? -26.40500 54.95200 306.54800 1.000 72.26237  ? 369 ASP A OD1 1 
ATOM   2859 O OD2 . ASP A 1 366 ? -28.61700 54.85000 306.42300 1.000 76.61392  ? 369 ASP A OD2 1 
ATOM   2860 N N   . ALA A 1 367 ? -26.19500 53.62100 301.59100 1.000 59.33559  ? 370 ALA A N   1 
ATOM   2861 C CA  . ALA A 1 367 ? -26.16000 52.71200 300.44000 1.000 53.54167  ? 370 ALA A CA  1 
ATOM   2862 C C   . ALA A 1 367 ? -24.76400 52.14300 300.22700 1.000 53.57839  ? 370 ALA A C   1 
ATOM   2863 O O   . ALA A 1 367 ? -24.58900 50.92100 300.13700 1.000 55.33098  ? 370 ALA A O   1 
ATOM   2864 C CB  . ALA A 1 367 ? -26.64200 53.42700 299.18300 1.000 51.97538  ? 370 ALA A CB  1 
ATOM   2865 N N   . VAL A 1 368 ? -23.75600 53.01800 300.16000 1.000 51.21209  ? 371 VAL A N   1 
ATOM   2866 C CA  . VAL A 1 368 ? -22.36300 52.57300 300.09300 1.000 53.45910  ? 371 VAL A CA  1 
ATOM   2867 C C   . VAL A 1 368 ? -22.06800 51.56400 301.19500 1.000 56.79764  ? 371 VAL A C   1 
ATOM   2868 O O   . VAL A 1 368 ? -21.57700 50.45600 300.93600 1.000 56.04743  ? 371 VAL A O   1 
ATOM   2869 C CB  . VAL A 1 368 ? -21.40600 53.77600 300.18300 1.000 55.34279  ? 371 VAL A CB  1 
ATOM   2870 C CG1 . VAL A 1 368 ? -19.95800 53.30100 300.26600 1.000 51.73155  ? 371 VAL A CG1 1 
ATOM   2871 C CG2 . VAL A 1 368 ? -21.60300 54.72700 299.01400 1.000 51.69717  ? 371 VAL A CG2 1 
ATOM   2872 N N   . THR A 1 369 ? -22.36600 51.94000 302.44600 1.000 55.87033  ? 372 THR A N   1 
ATOM   2873 C CA  . THR A 1 369 ? -22.04700 51.08500 303.58400 1.000 54.88329  ? 372 THR A CA  1 
ATOM   2874 C C   . THR A 1 369 ? -22.67500 49.71200 303.43700 1.000 57.28830  ? 372 THR A C   1 
ATOM   2875 O O   . THR A 1 369 ? -21.98900 48.68800 303.54100 1.000 57.41885  ? 372 THR A O   1 
ATOM   2876 C CB  . THR A 1 369 ? -22.50700 51.72800 304.88600 1.000 59.02744  ? 372 THR A CB  1 
ATOM   2877 O OG1 . THR A 1 369 ? -21.61700 52.79200 305.21800 1.000 64.51903  ? 372 THR A OG1 1 
ATOM   2878 C CG2 . THR A 1 369 ? -22.48200 50.70300 306.00000 1.000 60.83869  ? 372 THR A CG2 1 
ATOM   2879 N N   . LEU A 1 370 ? -23.98500 49.67500 303.18300 1.000 57.33140  ? 373 LEU A N   1 
ATOM   2880 C CA  . LEU A 1 370 ? -24.67200 48.40300 303.01700 1.000 52.56323  ? 373 LEU A CA  1 
ATOM   2881 C C   . LEU A 1 370 ? -23.97000 47.54600 301.98500 1.000 59.20147  ? 373 LEU A C   1 
ATOM   2882 O O   . LEU A 1 370 ? -23.67800 46.37000 302.23700 1.000 61.21105  ? 373 LEU A O   1 
ATOM   2883 C CB  . LEU A 1 370 ? -26.12700 48.64700 302.63000 1.000 51.94204  ? 373 LEU A CB  1 
ATOM   2884 C CG  . LEU A 1 370 ? -26.98900 47.46000 302.19000 1.000 60.95311  ? 373 LEU A CG  1 
ATOM   2885 C CD1 . LEU A 1 370 ? -27.15400 46.34200 303.25700 1.000 51.61225  ? 373 LEU A CD1 1 
ATOM   2886 C CD2 . LEU A 1 370 ? -28.33900 48.00800 301.74600 1.000 63.56051  ? 373 LEU A CD2 1 
ATOM   2887 N N   . GLN A 1 371 ? -23.61900 48.15700 300.84100 1.000 57.76216  ? 374 GLN A N   1 
ATOM   2888 C CA  . GLN A 1 371 ? -23.09600 47.42000 299.69500 1.000 60.19981  ? 374 GLN A CA  1 
ATOM   2889 C C   . GLN A 1 371 ? -21.73000 46.80800 299.97200 1.000 60.32861  ? 374 GLN A C   1 
ATOM   2890 O O   . GLN A 1 371 ? -21.35700 45.81500 299.33700 1.000 58.60791  ? 374 GLN A O   1 
ATOM   2891 C CB  . GLN A 1 371 ? -23.01200 48.35400 298.48100 1.000 61.56279  ? 374 GLN A CB  1 
ATOM   2892 C CG  . GLN A 1 371 ? -22.72500 47.67900 297.15700 1.000 57.96832  ? 374 GLN A CG  1 
ATOM   2893 C CD  . GLN A 1 371 ? -23.94600 46.96800 296.59900 1.000 69.60670  ? 374 GLN A CD  1 
ATOM   2894 O OE1 . GLN A 1 371 ? -25.03100 46.99700 297.21100 1.000 63.84352  ? 374 GLN A OE1 1 
ATOM   2895 N NE2 . GLN A 1 371 ? -23.78100 46.31700 295.42900 1.000 69.91020  ? 374 GLN A NE2 1 
ATOM   2896 N N   . TYR A 1 372 ? -20.96300 47.38300 300.89600 1.000 59.97176  ? 375 TYR A N   1 
ATOM   2897 C CA  . TYR A 1 372 ? -19.57100 46.99100 301.08800 1.000 63.86669  ? 375 TYR A CA  1 
ATOM   2898 C C   . TYR A 1 372 ? -19.29500 46.35600 302.45600 1.000 63.72551  ? 375 TYR A C   1 
ATOM   2899 O O   . TYR A 1 372 ? -18.12900 46.10300 302.77200 1.000 65.06803  ? 375 TYR A O   1 
ATOM   2900 C CB  . TYR A 1 372 ? -18.65800 48.20500 300.83700 1.000 61.12746  ? 375 TYR A CB  1 
ATOM   2901 C CG  . TYR A 1 372 ? -18.34200 48.39200 299.35700 1.000 62.04221  ? 375 TYR A CG  1 
ATOM   2902 C CD1 . TYR A 1 372 ? -19.20700 49.10200 298.51200 1.000 63.52065  ? 375 TYR A CD1 1 
ATOM   2903 C CD2 . TYR A 1 372 ? -17.20100 47.82500 298.79300 1.000 60.13641  ? 375 TYR A CD2 1 
ATOM   2904 C CE1 . TYR A 1 372 ? -18.93400 49.24100 297.15800 1.000 60.26734  ? 375 TYR A CE1 1 
ATOM   2905 C CE2 . TYR A 1 372 ? -16.92600 47.96200 297.44200 1.000 62.37397  ? 375 TYR A CE2 1 
ATOM   2906 C CZ  . TYR A 1 372 ? -17.79400 48.67000 296.63200 1.000 62.24478  ? 375 TYR A CZ  1 
ATOM   2907 O OH  . TYR A 1 372 ? -17.51700 48.81300 295.29400 1.000 62.11868  ? 375 TYR A OH  1 
ATOM   2908 N N   . THR A 1 373 ? -20.33500 46.03700 303.23900 1.000 59.67714  ? 376 THR A N   1 
ATOM   2909 C CA  . THR A 1 373 ? -20.21400 45.48100 304.58900 1.000 61.57859  ? 376 THR A CA  1 
ATOM   2910 C C   . THR A 1 373 ? -20.65200 44.02100 304.62400 1.000 62.72048  ? 376 THR A C   1 
ATOM   2911 O O   . THR A 1 373 ? -21.81600 43.71800 304.34600 1.000 66.09095  ? 376 THR A O   1 
ATOM   2912 C CB  . THR A 1 373 ? -21.07700 46.26400 305.57800 1.000 62.23349  ? 376 THR A CB  1 
ATOM   2913 O OG1 . THR A 1 373 ? -20.68800 47.64100 305.58800 1.000 68.24084  ? 376 THR A OG1 1 
ATOM   2914 C CG2 . THR A 1 373 ? -20.91800 45.69900 306.95200 1.000 67.94714  ? 376 THR A CG2 1 
ATOM   2915 N N   . ASP A 1 374 ? -19.74400 43.12600 305.01500 1.000 61.58994  ? 377 ASP A N   1 
ATOM   2916 C CA  . ASP A 1 374 ? -20.13200 41.74100 305.30100 1.000 64.75127  ? 377 ASP A CA  1 
ATOM   2917 C C   . ASP A 1 374 ? -20.87300 41.72000 306.62600 1.000 70.99556  ? 377 ASP A C   1 
ATOM   2918 O O   . ASP A 1 374 ? -20.25400 41.79500 307.68700 1.000 71.00191  ? 377 ASP A O   1 
ATOM   2919 C CB  . ASP A 1 374 ? -18.91800 40.81900 305.35800 1.000 66.55229  ? 377 ASP A CB  1 
ATOM   2920 C CG  . ASP A 1 374 ? -19.30500 39.36800 305.64600 1.000 72.23934  ? 377 ASP A CG  1 
ATOM   2921 O OD1 . ASP A 1 374 ? -20.52400 39.07300 305.70000 1.000 69.91415  ? 377 ASP A OD1 1 
ATOM   2922 O OD2 . ASP A 1 374 ? -18.39900 38.51800 305.81700 1.000 70.15848  ? 377 ASP A OD2 1 
ATOM   2923 N N   . TRP A 1 375 ? -22.20300 41.59100 306.58500 1.000 71.64096  ? 378 TRP A N   1 
ATOM   2924 C CA  . TRP A 1 375 ? -22.98600 41.72700 307.81200 1.000 70.78106  ? 378 TRP A CA  1 
ATOM   2925 C C   . TRP A 1 375 ? -23.03700 40.45700 308.65600 1.000 73.48554  ? 378 TRP A C   1 
ATOM   2926 O O   . TRP A 1 375 ? -23.60200 40.49500 309.75200 1.000 77.26163  ? 378 TRP A O   1 
ATOM   2927 C CB  . TRP A 1 375 ? -24.41100 42.18900 307.49000 1.000 71.93129  ? 378 TRP A CB  1 
ATOM   2928 C CG  . TRP A 1 375 ? -24.50000 43.66300 307.16800 1.000 73.49162  ? 378 TRP A CG  1 
ATOM   2929 C CD1 . TRP A 1 375 ? -24.75100 44.23400 305.94100 1.000 73.70118  ? 378 TRP A CD1 1 
ATOM   2930 C CD2 . TRP A 1 375 ? -24.32000 44.75000 308.08200 1.000 70.15073  ? 378 TRP A CD2 1 
ATOM   2931 N NE1 . TRP A 1 375 ? -24.74200 45.60700 306.04500 1.000 70.89021  ? 378 TRP A NE1 1 
ATOM   2932 C CE2 . TRP A 1 375 ? -24.47900 45.95000 307.34300 1.000 67.41732  ? 378 TRP A CE2 1 
ATOM   2933 C CE3 . TRP A 1 375 ? -24.02800 44.82800 309.45100 1.000 76.64218  ? 378 TRP A CE3 1 
ATOM   2934 C CZ2 . TRP A 1 375 ? -24.36000 47.20500 307.92500 1.000 76.90681  ? 378 TRP A CZ2 1 
ATOM   2935 C CZ3 . TRP A 1 375 ? -23.91100 46.07900 310.03800 1.000 79.00392  ? 378 TRP A CZ3 1 
ATOM   2936 C CH2 . TRP A 1 375 ? -24.07900 47.25400 309.27300 1.000 83.30173  ? 378 TRP A CH2 1 
ATOM   2937 N N   . MET A 1 376 ? -22.40200 39.40200 308.20600 1.000 77.33841  ? 379 MET A N   1 
ATOM   2938 C CA  . MET A 1 376 ? -22.30600 38.20700 308.99200 1.000 77.65287  ? 379 MET A CA  1 
ATOM   2939 C C   . MET A 1 376 ? -21.09800 38.32100 309.89100 1.000 78.40810  ? 379 MET A C   1 
ATOM   2940 O O   . MET A 1 376 ? -20.93400 37.53200 310.77600 1.000 82.52638  ? 379 MET A O   1 
ATOM   2941 C CB  . MET A 1 376 ? -22.11000 37.00300 308.09700 1.000 77.91997  ? 379 MET A CB  1 
ATOM   2942 C CG  . MET A 1 376 ? -23.38400 36.29700 307.70800 1.000 84.40897  ? 379 MET A CG  1 
ATOM   2943 S SD  . MET A 1 376 ? -23.10500 34.77100 306.82200 1.000 94.45061  ? 379 MET A SD  1 
ATOM   2944 C CE  . MET A 1 376 ? -21.85900 35.27400 305.66700 1.000 77.16177  ? 379 MET A CE  1 
ATOM   2945 N N   . ASP A 1 377 ? -20.23500 39.28800 309.62700 1.000 75.54911  ? 380 ASP A N   1 
ATOM   2946 C CA  . ASP A 1 377 ? -19.02300 39.51600 310.37900 1.000 73.71917  ? 380 ASP A CA  1 
ATOM   2947 C C   . ASP A 1 377 ? -18.64700 40.98400 310.30700 1.000 73.21186  ? 380 ASP A C   1 
ATOM   2948 O O   . ASP A 1 377 ? -17.58300 41.33400 309.87900 1.000 69.19925  ? 380 ASP A O   1 
ATOM   2949 C CB  . ASP A 1 377 ? -17.95800 38.66800 309.72700 1.000 68.82207  ? 380 ASP A CB  1 
ATOM   2950 C CG  . ASP A 1 377 ? -16.69200 38.65800 310.46000 1.000 73.51002  ? 380 ASP A CG  1 
ATOM   2951 O OD1 . ASP A 1 377 ? -16.61300 39.21100 311.55100 1.000 81.45379  ? 380 ASP A OD1 1 
ATOM   2952 O OD2 . ASP A 1 377 ? -15.75800 38.06700 309.94000 1.000 75.08020  ? 380 ASP A OD2 1 
ATOM   2953 N N   . ASP A 1 378 ? -19.52500 41.84700 310.76200 1.000 77.07454  ? 381 ASP A N   1 
ATOM   2954 C CA  . ASP A 1 378 ? -19.34000 43.28400 310.67600 1.000 76.33456  ? 381 ASP A CA  1 
ATOM   2955 C C   . ASP A 1 378 ? -18.20200 43.97800 311.38000 1.000 76.43729  ? 381 ASP A C   1 
ATOM   2956 O O   . ASP A 1 378 ? -17.76400 45.00900 310.95900 1.000 75.77198  ? 381 ASP A O   1 
ATOM   2957 C CB  . ASP A 1 378 ? -20.63200 43.98400 311.03500 1.000 79.16113  ? 381 ASP A CB  1 
ATOM   2958 C CG  . ASP A 1 378 ? -21.07300 43.68200 312.39300 1.000 83.84765  ? 381 ASP A CG  1 
ATOM   2959 O OD1 . ASP A 1 378 ? -21.28300 42.51200 312.68400 1.000 87.01117  ? 381 ASP A OD1 1 
ATOM   2960 O OD2 . ASP A 1 378 ? -21.20800 44.61500 313.17900 1.000 83.74017  ? 381 ASP A OD2 1 
ATOM   2961 N N   . ASN A 1 379 ? -17.77100 43.44800 312.49000 1.000 81.10635  ? 382 ASN A N   1 
ATOM   2962 C CA  . ASN A 1 379 ? -16.71900 44.06300 313.29900 1.000 81.39043  ? 382 ASN A CA  1 
ATOM   2963 C C   . ASN A 1 379 ? -15.37100 43.40100 313.07100 1.000 77.48683  ? 382 ASN A C   1 
ATOM   2964 O O   . ASN A 1 379 ? -14.60000 43.18200 314.01000 1.000 81.92559  ? 382 ASN A O   1 
ATOM   2965 C CB  . ASN A 1 379 ? -17.08800 44.05600 314.77800 1.000 79.16554  ? 382 ASN A CB  1 
ATOM   2966 C CG  . ASN A 1 379 ? -17.18500 45.45800 315.33400 1.000 84.88385  ? 382 ASN A CG  1 
ATOM   2967 O OD1 . ASN A 1 379 ? -16.16800 46.06600 315.70000 1.000 83.35703  ? 382 ASN A OD1 1 
ATOM   2968 N ND2 . ASN A 1 379 ? -18.40500 46.00700 315.35000 1.000 83.61928  ? 382 ASN A ND2 1 
ATOM   2969 N N   . ASN A 1 380 ? -15.08300 43.08500 311.80900 1.000 74.34849  ? 383 ASN A N   1 
ATOM   2970 C CA  . ASN A 1 380 ? -13.82500 42.49100 311.37900 1.000 66.58591  ? 383 ASN A CA  1 
ATOM   2971 C C   . ASN A 1 380 ? -13.00200 43.61200 310.75000 1.000 70.32826  ? 383 ASN A C   1 
ATOM   2972 O O   . ASN A 1 380 ? -13.36000 44.12900 309.68800 1.000 73.40616  ? 383 ASN A O   1 
ATOM   2973 C CB  . ASN A 1 380 ? -14.10800 41.34800 310.40300 1.000 65.40040  ? 383 ASN A CB  1 
ATOM   2974 C CG  . ASN A 1 380 ? -12.85000 40.70400 309.83400 1.000 66.59763  ? 383 ASN A CG  1 
ATOM   2975 O OD1 . ASN A 1 380 ? -11.76000 41.27300 309.88200 1.000 69.08426  ? 383 ASN A OD1 1 
ATOM   2976 N ND2 . ASN A 1 380 ? -13.00900 39.51300 309.25900 1.000 64.76835  ? 383 ASN A ND2 1 
ATOM   2977 N N   . GLY A 1 381 ? -11.91100 44.00000 311.41200 1.000 69.30578  ? 384 GLY A N   1 
ATOM   2978 C CA  . GLY A 1 381 ? -11.09600 45.12600 310.97800 1.000 63.75502  ? 384 GLY A CA  1 
ATOM   2979 C C   . GLY A 1 381 ? -10.22900 44.84900 309.76900 1.000 65.51855  ? 384 GLY A C   1 
ATOM   2980 O O   . GLY A 1 381 ? -9.64500  45.78700 309.21800 1.000 67.03274  ? 384 GLY A O   1 
ATOM   2981 N N   . ILE A 1 382 ? -10.10900 43.59400 309.35500 1.000 59.51369  ? 385 ILE A N   1 
ATOM   2982 C CA  . ILE A 1 382 ? -9.49300  43.32500 308.06700 1.000 64.46322  ? 385 ILE A CA  1 
ATOM   2983 C C   . ILE A 1 382 ? -10.51700 43.49100 306.95000 1.000 66.76980  ? 385 ILE A C   1 
ATOM   2984 O O   . ILE A 1 382 ? -10.24800 44.14000 305.93400 1.000 60.59691  ? 385 ILE A O   1 
ATOM   2985 C CB  . ILE A 1 382 ? -8.85100  41.92600 308.06400 1.000 64.88566  ? 385 ILE A CB  1 
ATOM   2986 C CG1 . ILE A 1 382 ? -7.48000  41.98800 308.73700 1.000 68.50699  ? 385 ILE A CG1 1 
ATOM   2987 C CG2 . ILE A 1 382 ? -8.71200  41.39900 306.66200 1.000 60.27974  ? 385 ILE A CG2 1 
ATOM   2988 C CD1 . ILE A 1 382 ? -6.67000  40.73000 308.55600 1.000 67.82956  ? 385 ILE A CD1 1 
ATOM   2989 N N   . LYS A 1 383 ? -11.71900 42.93900 307.14300 1.000 67.16240  ? 386 LYS A N   1 
ATOM   2990 C CA  . LYS A 1 383 ? -12.79400 43.12800 306.17800 1.000 62.97271  ? 386 LYS A CA  1 
ATOM   2991 C C   . LYS A 1 383 ? -13.22000 44.58900 306.07400 1.000 66.02957  ? 386 LYS A C   1 
ATOM   2992 O O   . LYS A 1 383 ? -13.62000 45.04200 304.99400 1.000 70.70272  ? 386 LYS A O   1 
ATOM   2993 C CB  . LYS A 1 383 ? -13.98000 42.24400 306.54500 1.000 59.29299  ? 386 LYS A CB  1 
ATOM   2994 C CG  . LYS A 1 383 ? -13.84100 40.83000 306.02500 1.000 60.32957  ? 386 LYS A CG  1 
ATOM   2995 C CD  . LYS A 1 383 ? -15.04300 39.99700 306.39200 1.000 69.57207  ? 386 LYS A CD  1 
ATOM   2996 C CE  . LYS A 1 383 ? -14.96500 38.61100 305.78600 1.000 70.99799  ? 386 LYS A CE  1 
ATOM   2997 N NZ  . LYS A 1 383 ? -15.92900 37.67500 306.44700 1.000 78.18128  ? 386 LYS A NZ  1 
ATOM   2998 N N   . ASN A 1 384 ? -13.15100 45.34300 307.16900 1.000 63.73353  ? 387 ASN A N   1 
ATOM   2999 C CA  . ASN A 1 384 ? -13.43600 46.76900 307.07800 1.000 65.57380  ? 387 ASN A CA  1 
ATOM   3000 C C   . ASN A 1 384 ? -12.32800 47.51000 306.35000 1.000 66.57899  ? 387 ASN A C   1 
ATOM   3001 O O   . ASN A 1 384 ? -12.59400 48.49600 305.66200 1.000 69.51050  ? 387 ASN A O   1 
ATOM   3002 C CB  . ASN A 1 384 ? -13.63000 47.36600 308.46600 1.000 66.61586  ? 387 ASN A CB  1 
ATOM   3003 C CG  . ASN A 1 384 ? -14.91800 46.91300 309.11200 1.000 73.08322  ? 387 ASN A CG  1 
ATOM   3004 O OD1 . ASN A 1 384 ? -15.85300 46.50300 308.41800 1.000 68.94191  ? 387 ASN A OD1 1 
ATOM   3005 N ND2 . ASN A 1 384 ? -14.98300 46.98900 310.45000 1.000 73.63722  ? 387 ASN A ND2 1 
ATOM   3006 N N   . ARG A 1 385 ? -11.08700 47.06300 306.50000 1.000 64.34420  ? 388 ARG A N   1 
ATOM   3007 C CA  . ARG A 1 385 ? -9.96100  47.73400 305.86500 1.000 62.43976  ? 388 ARG A CA  1 
ATOM   3008 C C   . ARG A 1 385 ? -9.94700  47.44800 304.36900 1.000 65.01132  ? 388 ARG A C   1 
ATOM   3009 O O   . ARG A 1 385 ? -9.90200  48.36600 303.54200 1.000 62.92625  ? 388 ARG A O   1 
ATOM   3010 C CB  . ARG A 1 385 ? -8.66600  47.27400 306.54400 1.000 63.11961  ? 388 ARG A CB  1 
ATOM   3011 C CG  . ARG A 1 385 ? -7.39100  47.94600 306.10800 1.000 61.95274  ? 388 ARG A CG  1 
ATOM   3012 C CD  . ARG A 1 385 ? -6.51700  46.96500 305.36500 1.000 65.02910  ? 388 ARG A CD  1 
ATOM   3013 N NE  . ARG A 1 385 ? -5.80500  46.04700 306.24000 1.000 63.54965  ? 388 ARG A NE  1 
ATOM   3014 C CZ  . ARG A 1 385 ? -5.46300  44.81000 305.88900 1.000 64.49290  ? 388 ARG A CZ  1 
ATOM   3015 N NH1 . ARG A 1 385 ? -5.79400  44.34900 304.69400 1.000 62.57466  ? 388 ARG A NH1 1 
ATOM   3016 N NH2 . ARG A 1 385 ? -4.80700  44.02800 306.73400 1.000 63.61783  ? 388 ARG A NH2 1 
ATOM   3017 N N   . ASP A 1 386 ? -10.01600 46.16800 304.01300 1.000 66.60468  ? 389 ASP A N   1 
ATOM   3018 C CA  . ASP A 1 386 ? -10.11100 45.76900 302.61800 1.000 59.38693  ? 389 ASP A CA  1 
ATOM   3019 C C   . ASP A 1 386 ? -11.34300 46.35900 301.94500 1.000 64.42544  ? 389 ASP A C   1 
ATOM   3020 O O   . ASP A 1 386 ? -11.30800 46.70800 300.75500 1.000 63.84371  ? 389 ASP A O   1 
ATOM   3021 C CB  . ASP A 1 386 ? -10.14300 44.25100 302.54400 1.000 57.73570  ? 389 ASP A CB  1 
ATOM   3022 C CG  . ASP A 1 386 ? -8.79900  43.65500 302.75700 1.000 57.68786  ? 389 ASP A CG  1 
ATOM   3023 O OD1 . ASP A 1 386 ? -7.84700  44.45800 302.88300 1.000 59.67064  ? 389 ASP A OD1 1 
ATOM   3024 O OD2 . ASP A 1 386 ? -8.69300  42.40600 302.80200 1.000 66.10020  ? 389 ASP A OD2 1 
ATOM   3025 N N   . GLY A 1 387 ? -12.45400 46.42600 302.67000 1.000 62.74613  ? 390 GLY A N   1 
ATOM   3026 C CA  . GLY A 1 387 ? -13.64500 47.02600 302.10800 1.000 61.43161  ? 390 GLY A CA  1 
ATOM   3027 C C   . GLY A 1 387 ? -13.43300 48.47600 301.73200 1.000 63.62492  ? 390 GLY A C   1 
ATOM   3028 O O   . GLY A 1 387 ? -13.91600 48.93500 300.69400 1.000 66.64300  ? 390 GLY A O   1 
ATOM   3029 N N   . LEU A 1 388 ? -12.69500 49.21700 302.56000 1.000 63.17317  ? 391 LEU A N   1 
ATOM   3030 C CA  . LEU A 1 388 ? -12.44000 50.61800 302.24500 1.000 60.97758  ? 391 LEU A CA  1 
ATOM   3031 C C   . LEU A 1 388 ? -11.56900 50.75300 300.99700 1.000 60.40051  ? 391 LEU A C   1 
ATOM   3032 O O   . LEU A 1 388 ? -11.89300 51.52000 300.08200 1.000 60.94267  ? 391 LEU A O   1 
ATOM   3033 C CB  . LEU A 1 388 ? -11.80800 51.31000 303.44600 1.000 56.67766  ? 391 LEU A CB  1 
ATOM   3034 C CG  . LEU A 1 388 ? -12.83000 51.89000 304.41600 1.000 63.84990  ? 391 LEU A CG  1 
ATOM   3035 C CD1 . LEU A 1 388 ? -12.17200 52.34300 305.71900 1.000 65.39285  ? 391 LEU A CD1 1 
ATOM   3036 C CD2 . LEU A 1 388 ? -13.59000 53.04200 303.75700 1.000 64.22184  ? 391 LEU A CD2 1 
ATOM   3037 N N   . ASP A 1 389 ? -10.45800 50.01700 300.94600 1.000 59.48413  ? 392 ASP A N   1 
ATOM   3038 C CA  . ASP A 1 389 ? -9.65000  49.85200 299.74100 1.000 62.89181  ? 392 ASP A CA  1 
ATOM   3039 C C   . ASP A 1 389 ? -10.50900 49.65600 298.48300 1.000 62.63294  ? 392 ASP A C   1 
ATOM   3040 O O   . ASP A 1 389 ? -10.25000 50.27200 297.44300 1.000 64.39161  ? 392 ASP A O   1 
ATOM   3041 C CB  . ASP A 1 389 ? -8.68400  48.67000 299.95400 1.000 66.04621  ? 392 ASP A CB  1 
ATOM   3042 C CG  . ASP A 1 389 ? -8.08400  48.12900 298.65200 1.000 71.87598  ? 392 ASP A CG  1 
ATOM   3043 O OD1 . ASP A 1 389 ? -7.42500  48.93300 297.93800 1.000 65.56389  ? 392 ASP A OD1 1 
ATOM   3044 O OD2 . ASP A 1 389 ? -8.25200  46.89800 298.37500 1.000 75.67664  ? 392 ASP A OD2 1 
ATOM   3045 N N   . ASP A 1 390 ? -11.55200 48.82800 298.55500 1.000 62.44252  ? 393 ASP A N   1 
ATOM   3046 C CA  . ASP A 1 390 ? -12.41200 48.67500 297.38900 1.000 58.73949  ? 393 ASP A CA  1 
ATOM   3047 C C   . ASP A 1 390 ? -13.35300 49.85400 297.21100 1.000 57.37475  ? 393 ASP A C   1 
ATOM   3048 O O   . ASP A 1 390 ? -13.69200 50.19200 296.08000 1.000 57.15907  ? 393 ASP A O   1 
ATOM   3049 C CB  . ASP A 1 390 ? -13.22400 47.38600 297.47000 1.000 58.20516  ? 393 ASP A CB  1 
ATOM   3050 C CG  . ASP A 1 390 ? -12.36500 46.14700 297.36800 1.000 64.46894  ? 393 ASP A CG  1 
ATOM   3051 O OD1 . ASP A 1 390 ? -11.55400 46.02800 296.41900 1.000 60.32375  ? 393 ASP A OD1 1 
ATOM   3052 O OD2 . ASP A 1 390 ? -12.49500 45.28400 298.26200 1.000 73.61887  ? 393 ASP A OD2 1 
ATOM   3053 N N   . ILE A 1 391 ? -13.81900 50.48000 298.28800 1.000 59.65049  ? 394 ILE A N   1 
ATOM   3054 C CA  . ILE A 1 391 ? -14.70600 51.63000 298.10200 1.000 61.09737  ? 394 ILE A CA  1 
ATOM   3055 C C   . ILE A 1 391 ? -13.99700 52.72600 297.31100 1.000 57.15811  ? 394 ILE A C   1 
ATOM   3056 O O   . ILE A 1 391 ? -14.57800 53.33600 296.40400 1.000 48.72512  ? 394 ILE A O   1 
ATOM   3057 C CB  . ILE A 1 391 ? -15.22700 52.14200 299.46000 1.000 55.82136  ? 394 ILE A CB  1 
ATOM   3058 C CG1 . ILE A 1 391 ? -16.35700 51.24500 299.95500 1.000 58.13823  ? 394 ILE A CG1 1 
ATOM   3059 C CG2 . ILE A 1 391 ? -15.75200 53.56400 299.35900 1.000 47.03169  ? 394 ILE A CG2 1 
ATOM   3060 C CD1 . ILE A 1 391 ? -16.90500 51.65600 301.27800 1.000 57.58919  ? 394 ILE A CD1 1 
ATOM   3061 N N   . VAL A 1 392 ? -12.72500 52.97300 297.62800 1.000 56.70705  ? 395 VAL A N   1 
ATOM   3062 C CA  . VAL A 1 392 ? -11.98900 54.07300 297.01500 1.000 57.11401  ? 395 VAL A CA  1 
ATOM   3063 C C   . VAL A 1 392 ? -11.48900 53.69400 295.62200 1.000 59.70391  ? 395 VAL A C   1 
ATOM   3064 O O   . VAL A 1 392 ? -11.47200 54.52300 294.70900 1.000 58.33953  ? 395 VAL A O   1 
ATOM   3065 C CB  . VAL A 1 392 ? -10.83300 54.49300 297.93600 1.000 58.23293  ? 395 VAL A CB  1 
ATOM   3066 C CG1 . VAL A 1 392 ? -10.09100 55.67800 297.33800 1.000 61.51656  ? 395 VAL A CG1 1 
ATOM   3067 C CG2 . VAL A 1 392 ? -11.34400 54.79400 299.33500 1.000 53.00607  ? 395 VAL A CG2 1 
ATOM   3068 N N   . GLY A 1 393 ? -11.06100 52.44600 295.44300 1.000 59.46813  ? 396 GLY A N   1 
ATOM   3069 C CA  . GLY A 1 393 ? -10.69200 51.98900 294.11800 1.000 54.11595  ? 396 GLY A CA  1 
ATOM   3070 C C   . GLY A 1 393 ? -11.85900 52.00500 293.15100 1.000 53.44265  ? 396 GLY A C   1 
ATOM   3071 O O   . GLY A 1 393 ? -11.75400 52.53200 292.04500 1.000 61.07801  ? 396 GLY A O   1 
ATOM   3072 N N   . ASP A 1 394 ? -12.98700 51.42400 293.55100 1.000 51.13406  ? 397 ASP A N   1 
ATOM   3073 C CA  . ASP A 1 394 ? -14.12100 51.31000 292.64500 1.000 54.55091  ? 397 ASP A CA  1 
ATOM   3074 C C   . ASP A 1 394 ? -14.66400 52.68000 292.27300 1.000 56.13730  ? 397 ASP A C   1 
ATOM   3075 O O   . ASP A 1 394 ? -14.77400 53.01800 291.09000 1.000 60.84943  ? 397 ASP A O   1 
ATOM   3076 C CB  . ASP A 1 394 ? -15.21600 50.45200 293.27100 1.000 54.96521  ? 397 ASP A CB  1 
ATOM   3077 C CG  . ASP A 1 394 ? -14.76800 49.02600 293.51400 1.000 61.42223  ? 397 ASP A CG  1 
ATOM   3078 O OD1 . ASP A 1 394 ? -13.61800 48.69600 293.14700 1.000 59.87817  ? 397 ASP A OD1 1 
ATOM   3079 O OD2 . ASP A 1 394 ? -15.55600 48.23800 294.08600 1.000 63.64134  ? 397 ASP A OD2 1 
ATOM   3080 N N   . HIS A 1 395 ? -14.99300 53.48600 293.26900 1.000 51.78778  ? 398 HIS A N   1 
ATOM   3081 C CA  . HIS A 1 395 ? -15.59900 54.78400 293.01100 1.000 53.98667  ? 398 HIS A CA  1 
ATOM   3082 C C   . HIS A 1 395 ? -14.69000 55.66700 292.16700 1.000 56.33979  ? 398 HIS A C   1 
ATOM   3083 O O   . HIS A 1 395 ? -15.13300 56.28100 291.18800 1.000 59.89279  ? 398 HIS A O   1 
ATOM   3084 C CB  . HIS A 1 395 ? -15.91900 55.43700 294.34500 1.000 53.44418  ? 398 HIS A CB  1 
ATOM   3085 C CG  . HIS A 1 395 ? -16.28300 56.87800 294.25800 1.000 52.92876  ? 398 HIS A CG  1 
ATOM   3086 N ND1 . HIS A 1 395 ? -17.43900 57.31600 293.65300 1.000 53.27119  ? 398 HIS A ND1 1 
ATOM   3087 C CD2 . HIS A 1 395 ? -15.67300 57.98100 294.75500 1.000 55.14227  ? 398 HIS A CD2 1 
ATOM   3088 C CE1 . HIS A 1 395 ? -17.51900 58.63000 293.76700 1.000 56.03723  ? 398 HIS A CE1 1 
ATOM   3089 N NE2 . HIS A 1 395 ? -16.46300 59.05800 294.43800 1.000 54.99620  ? 398 HIS A NE2 1 
ATOM   3090 N N   . ASN A 1 396 ? -13.40300 55.70400 292.50000 1.000 54.31646  ? 399 ASN A N   1 
ATOM   3091 C CA  . ASN A 1 396 ? -12.51500 56.73000 291.97300 1.000 56.96809  ? 399 ASN A CA  1 
ATOM   3092 C C   . ASN A 1 396 ? -11.75700 56.33300 290.71900 1.000 57.55183  ? 399 ASN A C   1 
ATOM   3093 O O   . ASN A 1 396 ? -11.26300 57.21800 290.01600 1.000 55.97427  ? 399 ASN A O   1 
ATOM   3094 C CB  . ASN A 1 396 ? -11.49600 57.13400 293.03200 1.000 54.01423  ? 399 ASN A CB  1 
ATOM   3095 C CG  . ASN A 1 396 ? -12.08800 58.01300 294.06400 1.000 57.14344  ? 399 ASN A CG  1 
ATOM   3096 O OD1 . ASN A 1 396 ? -12.47200 59.15100 293.77700 1.000 54.82995  ? 399 ASN A OD1 1 
ATOM   3097 N ND2 . ASN A 1 396 ? -12.17500 57.50600 295.29000 1.000 60.05588  ? 399 ASN A ND2 1 
ATOM   3098 N N   . VAL A 1 397 ? -11.62400 55.04200 290.43900 1.000 56.91399  ? 400 VAL A N   1 
ATOM   3099 C CA  . VAL A 1 397 ? -10.76800 54.57300 289.36000 1.000 52.58074  ? 400 VAL A CA  1 
ATOM   3100 C C   . VAL A 1 397 ? -11.50000 53.48900 288.57900 1.000 55.50588  ? 400 VAL A C   1 
ATOM   3101 O O   . VAL A 1 397 ? -11.94100 53.72600 287.45200 1.000 56.56814  ? 400 VAL A O   1 
ATOM   3102 C CB  . VAL A 1 397 ? -9.42600  54.05800 289.91200 1.000 55.43759  ? 400 VAL A CB  1 
ATOM   3103 C CG1 . VAL A 1 397 ? -8.65500  53.33000 288.83600 1.000 57.95340  ? 400 VAL A CG1 1 
ATOM   3104 C CG2 . VAL A 1 397 ? -8.59500  55.20300 290.49400 1.000 52.83594  ? 400 VAL A CG2 1 
ATOM   3105 N N   . ILE A 1 398 ? -11.67900 52.30900 289.18600 1.000 56.70379  ? 401 ILE A N   1 
ATOM   3106 C CA  . ILE A 1 398 ? -12.11100 51.13600 288.42400 1.000 56.85121  ? 401 ILE A CA  1 
ATOM   3107 C C   . ILE A 1 398 ? -13.49100 51.34800 287.82700 1.000 58.70976  ? 401 ILE A C   1 
ATOM   3108 O O   . ILE A 1 398 ? -13.70900 51.09600 286.63900 1.000 60.48449  ? 401 ILE A O   1 
ATOM   3109 C CB  . ILE A 1 398 ? -12.08400 49.87300 289.29300 1.000 59.28653  ? 401 ILE A CB  1 
ATOM   3110 C CG1 . ILE A 1 398 ? -10.67400 49.64200 289.84900 1.000 58.63474  ? 401 ILE A CG1 1 
ATOM   3111 C CG2 . ILE A 1 398 ? -12.59400 48.68800 288.47700 1.000 51.38884  ? 401 ILE A CG2 1 
ATOM   3112 C CD1 . ILE A 1 398 ? -10.55700 48.48900 290.80400 1.000 52.86471  ? 401 ILE A CD1 1 
ATOM   3113 N N   . CYS A 1 399 ? -14.44000 51.82100 288.62300 1.000 56.37053  ? 402 CYS A N   1 
ATOM   3114 C CA  . CYS A 1 399 ? -15.77000 51.93300 288.02900 1.000 59.07089  ? 402 CYS A CA  1 
ATOM   3115 C C   . CYS A 1 399 ? -15.95900 53.09200 287.04100 1.000 58.98594  ? 402 CYS A C   1 
ATOM   3116 O O   . CYS A 1 399 ? -16.73500 52.93300 286.09100 1.000 56.88858  ? 402 CYS A O   1 
ATOM   3117 C CB  . CYS A 1 399 ? -16.83400 51.99800 289.12100 1.000 56.44707  ? 402 CYS A CB  1 
ATOM   3118 S SG  . CYS A 1 399 ? -17.08800 50.38200 289.87700 1.000 67.04237  ? 402 CYS A SG  1 
ATOM   3119 N N   . PRO A 1 400 ? -15.31700 54.25800 287.19700 1.000 54.51796  ? 403 PRO A N   1 
ATOM   3120 C CA  . PRO A 1 400 ? -15.38900 55.23800 286.10200 1.000 57.27380  ? 403 PRO A CA  1 
ATOM   3121 C C   . PRO A 1 400 ? -14.65600 54.78000 284.84500 1.000 58.52125  ? 403 PRO A C   1 
ATOM   3122 O O   . PRO A 1 400 ? -15.06900 55.13700 283.73300 1.000 53.74273  ? 403 PRO A O   1 
ATOM   3123 C CB  . PRO A 1 400 ? -14.76500 56.50600 286.70500 1.000 57.18327  ? 403 PRO A CB  1 
ATOM   3124 C CG  . PRO A 1 400 ? -13.97200 56.03400 287.84200 1.000 61.28205  ? 403 PRO A CG  1 
ATOM   3125 C CD  . PRO A 1 400 ? -14.70400 54.85000 288.39300 1.000 57.52643  ? 403 PRO A CD  1 
ATOM   3126 N N   . LEU A 1 401 ? -13.59100 53.98600 284.98400 1.000 59.37838  ? 404 LEU A N   1 
ATOM   3127 C CA  . LEU A 1 401 ? -12.92300 53.46900 283.79900 1.000 57.79037  ? 404 LEU A CA  1 
ATOM   3128 C C   . LEU A 1 401 ? -13.76500 52.40400 283.10800 1.000 57.47829  ? 404 LEU A C   1 
ATOM   3129 O O   . LEU A 1 401 ? -13.83600 52.38000 281.87800 1.000 63.16550  ? 404 LEU A O   1 
ATOM   3130 C CB  . LEU A 1 401 ? -11.54300 52.92400 284.15100 1.000 57.18681  ? 404 LEU A CB  1 
ATOM   3131 C CG  . LEU A 1 401 ? -10.80300 52.21800 283.00600 1.000 55.62000  ? 404 LEU A CG  1 
ATOM   3132 C CD1 . LEU A 1 401 ? -9.31200  52.51500 283.05300 1.000 55.03447  ? 404 LEU A CD1 1 
ATOM   3133 C CD2 . LEU A 1 401 ? -11.03000 50.70900 283.02800 1.000 54.42245  ? 404 LEU A CD2 1 
ATOM   3134 N N   . MET A 1 402 ? -14.46300 51.58000 283.83900 1.000 56.89187  ? 405 MET A N   1 
ATOM   3135 C CA  . MET A 1 402 ? -15.30600 50.62500 283.17600 1.000 59.87456  ? 405 MET A CA  1 
ATOM   3136 C C   . MET A 1 402 ? -16.37500 51.32100 282.40200 1.000 58.61852  ? 405 MET A C   1 
ATOM   3137 O O   . MET A 1 402 ? -16.76600 50.87000 281.36700 1.000 61.53581  ? 405 MET A O   1 
ATOM   3138 C CB  . MET A 1 402 ? -15.95000 49.66900 284.13600 1.000 62.55205  ? 405 MET A CB  1 
ATOM   3139 C CG  . MET A 1 402 ? -15.03700 48.61700 284.67800 1.000 58.22289  ? 405 MET A CG  1 
ATOM   3140 S SD  . MET A 1 402 ? -13.94200 48.03000 283.44500 1.000 65.67319  ? 405 MET A SD  1 
ATOM   3141 C CE  . MET A 1 402 ? -14.96700 46.89200 282.60700 1.000 60.07376  ? 405 MET A CE  1 
ATOM   3142 N N   . HIS A 1 403 ? -16.88800 52.40200 282.93300 1.000 56.27927  ? 406 HIS A N   1 
ATOM   3143 C CA  . HIS A 1 403 ? -17.90200 53.14500 282.23600 1.000 60.07934  ? 406 HIS A CA  1 
ATOM   3144 C C   . HIS A 1 403 ? -17.32100 53.68300 280.97100 1.000 64.46158  ? 406 HIS A C   1 
ATOM   3145 O O   . HIS A 1 403 ? -17.95500 53.65700 279.96500 1.000 63.81651  ? 406 HIS A O   1 
ATOM   3146 C CB  . HIS A 1 403 ? -18.39900 54.28100 283.06900 1.000 56.44063  ? 406 HIS A CB  1 
ATOM   3147 C CG  . HIS A 1 403 ? -19.61800 54.93400 282.52400 1.000 64.66899  ? 406 HIS A CG  1 
ATOM   3148 N ND1 . HIS A 1 403 ? -20.82300 54.28600 282.42200 1.000 65.58424  ? 406 HIS A ND1 1 
ATOM   3149 C CD2 . HIS A 1 403 ? -19.82500 56.18400 282.06600 1.000 64.62842  ? 406 HIS A CD2 1 
ATOM   3150 C CE1 . HIS A 1 403 ? -21.71900 55.11000 281.92300 1.000 68.02355  ? 406 HIS A CE1 1 
ATOM   3151 N NE2 . HIS A 1 403 ? -21.13600 56.26700 281.69500 1.000 65.20887  ? 406 HIS A NE2 1 
ATOM   3152 N N   . PHE A 1 404 ? -16.10700 54.19000 281.02500 1.000 61.96598  ? 407 PHE A N   1 
ATOM   3153 C CA  . PHE A 1 404 ? -15.48100 54.71700 279.84900 1.000 61.26426  ? 407 PHE A CA  1 
ATOM   3154 C C   . PHE A 1 404 ? -15.25700 53.62800 278.86100 1.000 63.09039  ? 407 PHE A C   1 
ATOM   3155 O O   . PHE A 1 404 ? -15.53500 53.76500 277.71300 1.000 62.42091  ? 407 PHE A O   1 
ATOM   3156 C CB  . PHE A 1 404 ? -14.15500 55.32500 280.21500 1.000 60.99679  ? 407 PHE A CB  1 
ATOM   3157 C CG  . PHE A 1 404 ? -13.41100 55.88700 279.06200 1.000 64.63987  ? 407 PHE A CG  1 
ATOM   3158 C CD1 . PHE A 1 404 ? -13.78100 57.05600 278.51100 1.000 66.68552  ? 407 PHE A CD1 1 
ATOM   3159 C CD2 . PHE A 1 404 ? -12.33100 55.24900 278.56200 1.000 61.97675  ? 407 PHE A CD2 1 
ATOM   3160 C CE1 . PHE A 1 404 ? -13.10200 57.56800 277.45800 1.000 59.72578  ? 407 PHE A CE1 1 
ATOM   3161 C CE2 . PHE A 1 404 ? -11.65000 55.74900 277.50900 1.000 60.96529  ? 407 PHE A CE2 1 
ATOM   3162 C CZ  . PHE A 1 404 ? -12.03100 56.91600 276.96500 1.000 52.87813  ? 407 PHE A CZ  1 
ATOM   3163 N N   . VAL A 1 405 ? -14.76800 52.51100 279.31600 1.000 60.09487  ? 408 VAL A N   1 
ATOM   3164 C CA  . VAL A 1 405 ? -14.50000 51.42900 278.38100 1.000 62.11630  ? 408 VAL A CA  1 
ATOM   3165 C C   . VAL A 1 405 ? -15.77900 50.79900 277.84000 1.000 61.68070  ? 408 VAL A C   1 
ATOM   3166 O O   . VAL A 1 405 ? -15.75400 50.20300 276.76600 1.000 63.15673  ? 408 VAL A O   1 
ATOM   3167 C CB  . VAL A 1 405 ? -13.59300 50.36500 279.02300 1.000 60.88444  ? 408 VAL A CB  1 
ATOM   3168 C CG1 . VAL A 1 405 ? -14.38900 49.40400 279.83600 1.000 62.67052  ? 408 VAL A CG1 1 
ATOM   3169 C CG2 . VAL A 1 405 ? -12.85700 49.61200 277.95200 1.000 69.32844  ? 408 VAL A CG2 1 
ATOM   3170 N N   . ASN A 1 406 ? -16.90400 50.89900 278.53900 1.000 62.39547  ? 409 ASN A N   1 
ATOM   3171 C CA  . ASN A 1 406 ? -18.12700 50.39200 277.93100 1.000 61.10459  ? 409 ASN A CA  1 
ATOM   3172 C C   . ASN A 1 406 ? -18.67000 51.37600 276.90600 1.000 65.51794  ? 409 ASN A C   1 
ATOM   3173 O O   . ASN A 1 406 ? -19.18000 50.96400 275.86200 1.000 66.83658  ? 409 ASN A O   1 
ATOM   3174 C CB  . ASN A 1 406 ? -19.17700 50.08300 279.00000 1.000 64.24055  ? 409 ASN A CB  1 
ATOM   3175 C CG  . ASN A 1 406 ? -18.97600 48.70000 279.64400 1.000 74.11947  ? 409 ASN A CG  1 
ATOM   3176 O OD1 . ASN A 1 406 ? -18.93700 47.67900 278.95000 1.000 74.06879  ? 409 ASN A OD1 1 
ATOM   3177 N ND2 . ASN A 1 406 ? -18.84600 48.66900 280.97700 1.000 69.27019  ? 409 ASN A ND2 1 
ATOM   3178 N N   . LYS A 1 407 ? -18.54400 52.67700 277.17600 1.000 65.34947  ? 410 LYS A N   1 
ATOM   3179 C CA  . LYS A 1 407 ? -19.01900 53.68800 276.23700 1.000 61.49178  ? 410 LYS A CA  1 
ATOM   3180 C C   . LYS A 1 407 ? -18.10700 53.80100 275.01600 1.000 69.17252  ? 410 LYS A C   1 
ATOM   3181 O O   . LYS A 1 407 ? -18.58700 53.97800 273.88400 1.000 63.66530  ? 410 LYS A O   1 
ATOM   3182 C CB  . LYS A 1 407 ? -19.11900 55.03700 276.94100 1.000 61.53276  ? 410 LYS A CB  1 
ATOM   3183 C CG  . LYS A 1 407 ? -20.22200 55.13000 277.95600 1.000 68.88642  ? 410 LYS A CG  1 
ATOM   3184 C CD  . LYS A 1 407 ? -21.56900 55.16800 277.27800 1.000 67.22679  ? 410 LYS A CD  1 
ATOM   3185 C CE  . LYS A 1 407 ? -22.67800 55.25800 278.29500 1.000 69.81212  ? 410 LYS A CE  1 
ATOM   3186 N NZ  . LYS A 1 407 ? -23.93500 54.76500 277.68200 1.000 76.72876  ? 410 LYS A NZ  1 
ATOM   3187 N N   . TYR A 1 408 ? -16.78900 53.73800 275.22600 1.000 67.24262  ? 411 TYR A N   1 
ATOM   3188 C CA  . TYR A 1 408 ? -15.87700 53.90900 274.10500 1.000 60.15474  ? 411 TYR A CA  1 
ATOM   3189 C C   . TYR A 1 408 ? -15.95900 52.72600 273.15700 1.000 64.53342  ? 411 TYR A C   1 
ATOM   3190 O O   . TYR A 1 408 ? -15.87600 52.89600 271.93400 1.000 64.04970  ? 411 TYR A O   1 
ATOM   3191 C CB  . TYR A 1 408 ? -14.43500 54.09100 274.58500 1.000 59.11765  ? 411 TYR A CB  1 
ATOM   3192 C CG  . TYR A 1 408 ? -13.50700 54.42000 273.43500 1.000 60.88988  ? 411 TYR A CG  1 
ATOM   3193 C CD1 . TYR A 1 408 ? -12.87000 53.41300 272.69900 1.000 56.71234  ? 411 TYR A CD1 1 
ATOM   3194 C CD2 . TYR A 1 408 ? -13.31400 55.74200 273.04900 1.000 61.29060  ? 411 TYR A CD2 1 
ATOM   3195 C CE1 . TYR A 1 408 ? -12.05500 53.72700 271.63200 1.000 62.16811  ? 411 TYR A CE1 1 
ATOM   3196 C CE2 . TYR A 1 408 ? -12.50100 56.06800 271.98100 1.000 65.60237  ? 411 TYR A CE2 1 
ATOM   3197 C CZ  . TYR A 1 408 ? -11.87500 55.06400 271.27100 1.000 64.92551  ? 411 TYR A CZ  1 
ATOM   3198 O OH  . TYR A 1 408 ? -11.07200 55.41400 270.20800 1.000 56.84345  ? 411 TYR A OH  1 
ATOM   3199 N N   . THR A 1 409 ? -16.09600 51.51800 273.70100 1.000 60.82429  ? 412 THR A N   1 
ATOM   3200 C CA  . THR A 1 409 ? -16.05200 50.33700 272.85100 1.000 65.10965  ? 412 THR A CA  1 
ATOM   3201 C C   . THR A 1 409 ? -17.21700 50.31300 271.86600 1.000 66.73808  ? 412 THR A C   1 
ATOM   3202 O O   . THR A 1 409 ? -17.05900 49.85700 270.72500 1.000 68.04627  ? 412 THR A O   1 
ATOM   3203 C CB  . THR A 1 409 ? -16.01000 49.08800 273.72400 1.000 60.48058  ? 412 THR A CB  1 
ATOM   3204 O OG1 . THR A 1 409 ? -14.65100 48.85000 274.10800 1.000 54.46704  ? 412 THR A OG1 1 
ATOM   3205 C CG2 . THR A 1 409 ? -16.55500 47.86900 272.99200 1.000 67.88351  ? 412 THR A CG2 1 
ATOM   3206 N N   . LYS A 1 410 ? -18.36200 50.86600 272.26700 1.000 62.39038  ? 413 LYS A N   1 
ATOM   3207 C CA  . LYS A 1 410 ? -19.53100 50.99600 271.40700 1.000 67.41434  ? 413 LYS A CA  1 
ATOM   3208 C C   . LYS A 1 410 ? -19.24800 51.69400 270.06900 1.000 67.45402  ? 413 LYS A C   1 
ATOM   3209 O O   . LYS A 1 410 ? -20.04200 51.55000 269.13600 1.000 64.63903  ? 413 LYS A O   1 
ATOM   3210 C CB  . LYS A 1 410 ? -20.60800 51.77600 272.16900 1.000 72.20423  ? 413 LYS A CB  1 
ATOM   3211 C CG  . LYS A 1 410 ? -21.79800 50.96400 272.66900 1.000 77.53993  ? 413 LYS A CG  1 
ATOM   3212 C CD  . LYS A 1 410 ? -23.08700 51.73300 272.37600 1.000 86.49370  ? 413 LYS A CD  1 
ATOM   3213 C CE  . LYS A 1 410 ? -23.15100 52.10100 270.86600 1.000 84.00687  ? 413 LYS A CE  1 
ATOM   3214 N NZ  . LYS A 1 410 ? -24.34400 52.90500 270.44200 1.000 82.12277  ? 413 LYS A NZ  1 
ATOM   3215 N N   . PHE A 1 411 ? -18.14900 52.45600 269.95600 1.000 65.22552  ? 414 PHE A N   1 
ATOM   3216 C CA  . PHE A 1 411 ? -17.87200 53.28300 268.78500 1.000 58.09210  ? 414 PHE A CA  1 
ATOM   3217 C C   . PHE A 1 411 ? -16.44000 53.21600 268.28600 1.000 60.69947  ? 414 PHE A C   1 
ATOM   3218 O O   . PHE A 1 411 ? -16.09100 53.97200 267.37700 1.000 67.46956  ? 414 PHE A O   1 
ATOM   3219 C CB  . PHE A 1 411 ? -18.14300 54.76800 269.07300 1.000 64.85191  ? 414 PHE A CB  1 
ATOM   3220 C CG  . PHE A 1 411 ? -19.57600 55.14700 269.12500 1.000 67.08779  ? 414 PHE A CG  1 
ATOM   3221 C CD1 . PHE A 1 411 ? -20.35600 55.12300 267.98200 1.000 65.81392  ? 414 PHE A CD1 1 
ATOM   3222 C CD2 . PHE A 1 411 ? -20.13500 55.59600 270.31700 1.000 65.15132  ? 414 PHE A CD2 1 
ATOM   3223 C CE1 . PHE A 1 411 ? -21.69000 55.49600 268.03300 1.000 72.63266  ? 414 PHE A CE1 1 
ATOM   3224 C CE2 . PHE A 1 411 ? -21.45800 55.97800 270.38800 1.000 65.58849  ? 414 PHE A CE2 1 
ATOM   3225 C CZ  . PHE A 1 411 ? -22.24400 55.92700 269.24800 1.000 79.04625  ? 414 PHE A CZ  1 
ATOM   3226 N N   . GLY A 1 412 ? -15.56700 52.40000 268.87800 1.000 62.44500  ? 415 GLY A N   1 
ATOM   3227 C CA  . GLY A 1 412 ? -14.16000 52.46700 268.60500 1.000 57.93088  ? 415 GLY A CA  1 
ATOM   3228 C C   . GLY A 1 412 ? -13.69100 51.30700 267.74800 1.000 60.60681  ? 415 GLY A C   1 
ATOM   3229 O O   . GLY A 1 412 ? -14.45400 50.42600 267.35800 1.000 63.17314  ? 415 GLY A O   1 
ATOM   3230 N N   . ASN A 1 413 ? -12.41400 51.34000 267.41500 1.000 62.08655  ? 416 ASN A N   1 
ATOM   3231 C CA  . ASN A 1 413 ? -11.79900 50.36400 266.53400 1.000 71.42983  ? 416 ASN A CA  1 
ATOM   3232 C C   . ASN A 1 413 ? -11.02000 49.31100 267.25600 1.000 68.14477  ? 416 ASN A C   1 
ATOM   3233 O O   . ASN A 1 413 ? -10.24200 48.62900 266.66300 1.000 73.14301  ? 416 ASN A O   1 
ATOM   3234 C CB  . ASN A 1 413 ? -10.94500 51.05700 265.47000 1.000 69.58058  ? 416 ASN A CB  1 
ATOM   3235 C CG  . ASN A 1 413 ? -10.72300 50.22200 264.22900 1.000 73.63604  ? 416 ASN A CG  1 
ATOM   3236 O OD1 . ASN A 1 413 ? -9.63100  50.19500 263.72300 1.000 81.48083  ? 416 ASN A OD1 1 
ATOM   3237 N ND2 . ASN A 1 413 ? -11.74900 49.57700 263.72100 1.000 77.71199  ? 416 ASN A ND2 1 
ATOM   3238 N N   . GLY A 1 414 ? -11.22400 49.18700 268.54600 1.000 70.83611  ? 417 GLY A N   1 
ATOM   3239 C CA  . GLY A 1 414 ? -10.53900 48.17200 269.31100 1.000 71.76889  ? 417 GLY A CA  1 
ATOM   3240 C C   . GLY A 1 414 ? -10.25400 48.53800 270.72700 1.000 63.07710  ? 417 GLY A C   1 
ATOM   3241 O O   . GLY A 1 414 ? -9.94700  49.64800 271.00400 1.000 65.04167  ? 417 GLY A O   1 
ATOM   3242 N N   . THR A 1 415 ? -10.37700 47.58100 271.62700 1.000 73.12534  ? 418 THR A N   1 
ATOM   3243 C CA  . THR A 1 415 ? -10.12900 47.84300 273.01800 1.000 64.99345  ? 418 THR A CA  1 
ATOM   3244 C C   . THR A 1 415 ? -9.48200  46.70400 273.71800 1.000 62.15305  ? 418 THR A C   1 
ATOM   3245 O O   . THR A 1 415 ? -9.92800  45.61500 273.60800 1.000 61.99400  ? 418 THR A O   1 
ATOM   3246 C CB  . THR A 1 415 ? -11.43600 48.06400 273.73300 1.000 60.60112  ? 418 THR A CB  1 
ATOM   3247 O OG1 . THR A 1 415 ? -12.16800 49.06300 273.05600 1.000 68.70561  ? 418 THR A OG1 1 
ATOM   3248 C CG2 . THR A 1 415 ? -11.19200 48.55400 275.05100 1.000 66.96554  ? 418 THR A CG2 1 
ATOM   3249 N N   . TYR A 1 416 ? -8.45000  46.97100 274.48300 1.000 61.85863  ? 419 TYR A N   1 
ATOM   3250 C CA  . TYR A 1 416 ? -7.78700  45.92900 275.25700 1.000 63.33768  ? 419 TYR A CA  1 
ATOM   3251 C C   . TYR A 1 416 ? -7.72500  46.32800 276.73100 1.000 61.67780  ? 419 TYR A C   1 
ATOM   3252 O O   . TYR A 1 416 ? -7.27500  47.43400 277.05500 1.000 62.00194  ? 419 TYR A O   1 
ATOM   3253 C CB  . TYR A 1 416 ? -6.39600  45.66100 274.68200 1.000 61.89055  ? 419 TYR A CB  1 
ATOM   3254 C CG  . TYR A 1 416 ? -6.44100  45.09800 273.27400 1.000 69.17637  ? 419 TYR A CG  1 
ATOM   3255 C CD1 . TYR A 1 416 ? -6.61900  43.73600 273.04800 1.000 72.19997  ? 419 TYR A CD1 1 
ATOM   3256 C CD2 . TYR A 1 416 ? -6.30900  45.92800 272.16800 1.000 65.45903  ? 419 TYR A CD2 1 
ATOM   3257 C CE1 . TYR A 1 416 ? -6.66100  43.22800 271.76200 1.000 70.75808  ? 419 TYR A CE1 1 
ATOM   3258 C CE2 . TYR A 1 416 ? -6.34500  45.43100 270.89700 1.000 66.94452  ? 419 TYR A CE2 1 
ATOM   3259 C CZ  . TYR A 1 416 ? -6.51600  44.08300 270.69100 1.000 70.14152  ? 419 TYR A CZ  1 
ATOM   3260 O OH  . TYR A 1 416 ? -6.55700  43.60000 269.39900 1.000 73.96303  ? 419 TYR A OH  1 
ATOM   3261 N N   . LEU A 1 417 ? -8.16100  45.42000 277.61800 1.000 58.95572  ? 420 LEU A N   1 
ATOM   3262 C CA  . LEU A 1 417 ? -8.43100  45.72300 279.02800 1.000 62.16161  ? 420 LEU A CA  1 
ATOM   3263 C C   . LEU A 1 417 ? -7.64400  44.80100 279.95100 1.000 63.11236  ? 420 LEU A C   1 
ATOM   3264 O O   . LEU A 1 417 ? -7.74800  43.57600 279.82900 1.000 64.78182  ? 420 LEU A O   1 
ATOM   3265 C CB  . LEU A 1 417 ? -9.92300  45.58200 279.34600 1.000 59.13474  ? 420 LEU A CB  1 
ATOM   3266 C CG  . LEU A 1 417 ? -10.27500 45.89000 280.79700 1.000 62.54581  ? 420 LEU A CG  1 
ATOM   3267 C CD1 . LEU A 1 417 ? -9.91300  47.32900 281.09800 1.000 60.82548  ? 420 LEU A CD1 1 
ATOM   3268 C CD2 . LEU A 1 417 ? -11.74100 45.61400 281.10400 1.000 62.45754  ? 420 LEU A CD2 1 
ATOM   3269 N N   . TYR A 1 418 ? -6.89000  45.37500 280.89600 1.000 53.12843  ? 421 TYR A N   1 
ATOM   3270 C CA  . TYR A 1 418 ? -6.06700  44.55500 281.77500 1.000 61.83005  ? 421 TYR A CA  1 
ATOM   3271 C C   . TYR A 1 418 ? -6.41200  44.75700 283.25000 1.000 67.10473  ? 421 TYR A C   1 
ATOM   3272 O O   . TYR A 1 418 ? -6.96500  45.78300 283.65700 1.000 66.85292  ? 421 TYR A O   1 
ATOM   3273 C CB  . TYR A 1 418 ? -4.57400  44.83000 281.56700 1.000 61.64458  ? 421 TYR A CB  1 
ATOM   3274 C CG  . TYR A 1 418 ? -4.10300  46.18500 282.04400 1.000 62.35716  ? 421 TYR A CG  1 
ATOM   3275 C CD1 . TYR A 1 418 ? -3.85200  46.42600 283.39900 1.000 60.40873  ? 421 TYR A CD1 1 
ATOM   3276 C CD2 . TYR A 1 418 ? -3.88900  47.22200 281.14000 1.000 56.28904  ? 421 TYR A CD2 1 
ATOM   3277 C CE1 . TYR A 1 418 ? -3.42500  47.66800 283.84000 1.000 60.55465  ? 421 TYR A CE1 1 
ATOM   3278 C CE2 . TYR A 1 418 ? -3.45200  48.46400 281.56700 1.000 56.92353  ? 421 TYR A CE2 1 
ATOM   3279 C CZ  . TYR A 1 418 ? -3.22100  48.68400 282.91800 1.000 60.76074  ? 421 TYR A CZ  1 
ATOM   3280 O OH  . TYR A 1 418 ? -2.78900  49.91700 283.35800 1.000 62.12776  ? 421 TYR A OH  1 
ATOM   3281 N N   . PHE A 1 419 ? -6.03700  43.76600 284.05400 1.000 64.99656  ? 422 PHE A N   1 
ATOM   3282 C CA  . PHE A 1 419 ? -6.13900  43.82300 285.51400 1.000 60.47347  ? 422 PHE A CA  1 
ATOM   3283 C C   . PHE A 1 419 ? -4.76200  43.45000 286.05600 1.000 61.35920  ? 422 PHE A C   1 
ATOM   3284 O O   . PHE A 1 419 ? -4.38900  42.27300 286.04100 1.000 65.86279  ? 422 PHE A O   1 
ATOM   3285 C CB  . PHE A 1 419 ? -7.22600  42.87300 286.01400 1.000 62.02218  ? 422 PHE A CB  1 
ATOM   3286 C CG  . PHE A 1 419 ? -7.50400  42.95500 287.49300 1.000 63.99167  ? 422 PHE A CG  1 
ATOM   3287 C CD1 . PHE A 1 419 ? -8.24200  43.99800 288.02100 1.000 61.55605  ? 422 PHE A CD1 1 
ATOM   3288 C CD2 . PHE A 1 419 ? -7.06800  41.95700 288.35000 1.000 63.48789  ? 422 PHE A CD2 1 
ATOM   3289 C CE1 . PHE A 1 419 ? -8.51100  44.05200 289.37100 1.000 57.48678  ? 422 PHE A CE1 1 
ATOM   3290 C CE2 . PHE A 1 419 ? -7.33200  42.02000 289.70200 1.000 61.54995  ? 422 PHE A CE2 1 
ATOM   3291 C CZ  . PHE A 1 419 ? -8.05300  43.06600 290.20800 1.000 58.48675  ? 422 PHE A CZ  1 
ATOM   3292 N N   . PHE A 1 420 ? -3.98800  44.45000 286.48100 1.000 58.58356  ? 423 PHE A N   1 
ATOM   3293 C CA  . PHE A 1 420 ? -2.64000  44.23300 287.00000 1.000 64.66946  ? 423 PHE A CA  1 
ATOM   3294 C C   . PHE A 1 420 ? -2.73600  43.89800 288.48600 1.000 67.68514  ? 423 PHE A C   1 
ATOM   3295 O O   . PHE A 1 420 ? -3.00100  44.78000 289.31200 1.000 68.67024  ? 423 PHE A O   1 
ATOM   3296 C CB  . PHE A 1 420 ? -1.77100  45.46900 286.78000 1.000 65.39651  ? 423 PHE A CB  1 
ATOM   3297 C CG  . PHE A 1 420 ? -0.38400  45.35300 287.36000 1.000 66.97989  ? 423 PHE A CG  1 
ATOM   3298 C CD1 . PHE A 1 420 ? 0.63100   44.74300 286.65200 1.000 67.43115  ? 423 PHE A CD1 1 
ATOM   3299 C CD2 . PHE A 1 420 ? -0.09400  45.85800 288.61200 1.000 71.21138  ? 423 PHE A CD2 1 
ATOM   3300 C CE1 . PHE A 1 420 ? 1.91100   44.63300 287.18600 1.000 69.44713  ? 423 PHE A CE1 1 
ATOM   3301 C CE2 . PHE A 1 420 ? 1.19200   45.75000 289.15300 1.000 72.95343  ? 423 PHE A CE2 1 
ATOM   3302 C CZ  . PHE A 1 420 ? 2.19200   45.14200 288.43200 1.000 68.14762  ? 423 PHE A CZ  1 
ATOM   3303 N N   . ASN A 1 421 ? -2.51200  42.63700 288.83800 1.000 65.47923  ? 424 ASN A N   1 
ATOM   3304 C CA  . ASN A 1 421 ? -2.66100  42.21600 290.22900 1.000 71.16497  ? 424 ASN A CA  1 
ATOM   3305 C C   . ASN A 1 421 ? -1.42800  41.45300 290.70000 1.000 68.90233  ? 424 ASN A C   1 
ATOM   3306 O O   . ASN A 1 421 ? -1.52300  40.36500 291.26100 1.000 64.66243  ? 424 ASN A O   1 
ATOM   3307 C CB  . ASN A 1 421 ? -3.92700  41.38200 290.40800 1.000 65.48746  ? 424 ASN A CB  1 
ATOM   3308 C CG  . ASN A 1 421 ? -3.93600  40.15300 289.53900 1.000 67.78440  ? 424 ASN A CG  1 
ATOM   3309 O OD1 . ASN A 1 421 ? -3.00800  39.92000 288.77000 1.000 73.26621  ? 424 ASN A OD1 1 
ATOM   3310 N ND2 . ASN A 1 421 ? -4.97900  39.35100 289.66100 1.000 72.60854  ? 424 ASN A ND2 1 
ATOM   3311 N N   . HIS A 1 422 ? -0.24300  42.00800 290.46400 1.000 68.98448  ? 425 HIS A N   1 
ATOM   3312 C CA  . HIS A 1 422 ? 0.98900   41.45700 291.01000 1.000 69.36327  ? 425 HIS A CA  1 
ATOM   3313 C C   . HIS A 1 422 ? 1.56700   42.43000 292.02700 1.000 74.28383  ? 425 HIS A C   1 
ATOM   3314 O O   . HIS A 1 422 ? 1.92300   43.56300 291.68100 1.000 76.09304  ? 425 HIS A O   1 
ATOM   3315 C CB  . HIS A 1 422 ? 2.02200   41.16600 289.92500 1.000 69.48356  ? 425 HIS A CB  1 
ATOM   3316 C CG  . HIS A 1 422 ? 3.32400   40.65700 290.46800 1.000 73.20226  ? 425 HIS A CG  1 
ATOM   3317 N ND1 . HIS A 1 422 ? 3.47600   39.37700 290.95700 1.000 75.71293  ? 425 HIS A ND1 1 
ATOM   3318 C CD2 . HIS A 1 422 ? 4.52600   41.26200 290.62100 1.000 70.64110  ? 425 HIS A CD2 1 
ATOM   3319 C CE1 . HIS A 1 422 ? 4.71700   39.21400 291.38300 1.000 74.19231  ? 425 HIS A CE1 1 
ATOM   3320 N NE2 . HIS A 1 422 ? 5.37600   40.34100 291.18500 1.000 71.53281  ? 425 HIS A NE2 1 
ATOM   3321 N N   . ARG A 1 423 ? 1.65400   41.98400 293.27500 1.000 68.78862  ? 426 ARG A N   1 
ATOM   3322 C CA  . ARG A 1 423 ? 2.38600   42.70200 294.31200 1.000 71.96706  ? 426 ARG A CA  1 
ATOM   3323 C C   . ARG A 1 423 ? 3.88000   42.52700 294.06300 1.000 70.38899  ? 426 ARG A C   1 
ATOM   3324 O O   . ARG A 1 423 ? 4.39700   41.40800 294.14900 1.000 71.28180  ? 426 ARG A O   1 
ATOM   3325 C CB  . ARG A 1 423 ? 1.97400   42.16500 295.68500 1.000 74.75391  ? 426 ARG A CB  1 
ATOM   3326 C CG  . ARG A 1 423 ? 2.95600   42.38500 296.81000 1.000 68.96929  ? 426 ARG A CG  1 
ATOM   3327 C CD  . ARG A 1 423 ? 2.81100   43.75000 297.40800 1.000 66.99756  ? 426 ARG A CD  1 
ATOM   3328 N NE  . ARG A 1 423 ? 3.71100   43.94300 298.53700 1.000 72.80137  ? 426 ARG A NE  1 
ATOM   3329 C CZ  . ARG A 1 423 ? 3.50400   44.84100 299.50000 1.000 77.52465  ? 426 ARG A CZ  1 
ATOM   3330 N NH1 . ARG A 1 423 ? 2.42100   45.61300 299.46000 1.000 70.18904  ? 426 ARG A NH1 1 
ATOM   3331 N NH2 . ARG A 1 423 ? 4.36700   44.96100 300.51000 1.000 75.87402  ? 426 ARG A NH2 1 
ATOM   3332 N N   . ALA A 1 424 ? 4.56900   43.62000 293.72900 1.000 70.18023  ? 427 ALA A N   1 
ATOM   3333 C CA  . ALA A 1 424 ? 6.00900   43.56100 293.49300 1.000 69.56420  ? 427 ALA A CA  1 
ATOM   3334 C C   . ALA A 1 424 ? 6.75300   43.06600 294.73000 1.000 75.42626  ? 427 ALA A C   1 
ATOM   3335 O O   . ALA A 1 424 ? 6.47400   43.48600 295.85800 1.000 80.15841  ? 427 ALA A O   1 
ATOM   3336 C CB  . ALA A 1 424 ? 6.53100   44.93400 293.09200 1.000 71.28426  ? 427 ALA A CB  1 
ATOM   3337 N N   . SER A 1 425 ? 7.73000   42.18200 294.51400 1.000 75.11766  ? 428 SER A N   1 
ATOM   3338 C CA  . SER A 1 425 ? 8.35100   41.47200 295.62900 1.000 71.88252  ? 428 SER A CA  1 
ATOM   3339 C C   . SER A 1 425 ? 9.25600   42.35800 296.48200 1.000 76.55266  ? 428 SER A C   1 
ATOM   3340 O O   . SER A 1 425 ? 9.57200   41.98300 297.61600 1.000 79.14102  ? 428 SER A O   1 
ATOM   3341 C CB  . SER A 1 425 ? 9.15600   40.28700 295.10400 1.000 72.99220  ? 428 SER A CB  1 
ATOM   3342 O OG  . SER A 1 425 ? 10.33700  40.74000 294.45800 1.000 75.84949  ? 428 SER A OG  1 
ATOM   3343 N N   . ASN A 1 426 ? 9.68600   43.51400 295.97000 1.000 77.73333  ? 429 ASN A N   1 
ATOM   3344 C CA  . ASN A 1 426 ? 10.59600  44.41200 296.67400 1.000 70.39980  ? 429 ASN A CA  1 
ATOM   3345 C C   . ASN A 1 426 ? 9.90300   45.67500 297.16600 1.000 64.61548  ? 429 ASN A C   1 
ATOM   3346 O O   . ASN A 1 426 ? 10.56200  46.69700 297.38400 1.000 62.85476  ? 429 ASN A O   1 
ATOM   3347 C CB  . ASN A 1 426 ? 11.77300  44.78400 295.77000 1.000 74.89426  ? 429 ASN A CB  1 
ATOM   3348 C CG  . ASN A 1 426 ? 11.33000  45.38300 294.43600 1.000 76.67517  ? 429 ASN A CG  1 
ATOM   3349 O OD1 . ASN A 1 426 ? 10.17600  45.23400 294.01600 1.000 75.83325  ? 429 ASN A OD1 1 
ATOM   3350 N ND2 . ASN A 1 426 ? 12.25400  46.06500 293.76500 1.000 75.76200  ? 429 ASN A ND2 1 
ATOM   3351 N N   . LEU A 1 427 ? 8.59200   45.62200 297.35600 1.000 62.45687  ? 430 LEU A N   1 
ATOM   3352 C CA  . LEU A 1 427 ? 7.81700   46.81900 297.64200 1.000 64.89778  ? 430 LEU A CA  1 
ATOM   3353 C C   . LEU A 1 427 ? 8.02500   47.26000 299.09000 1.000 74.19578  ? 430 LEU A C   1 
ATOM   3354 O O   . LEU A 1 427 ? 7.89500   46.45800 300.02800 1.000 70.29994  ? 430 LEU A O   1 
ATOM   3355 C CB  . LEU A 1 427 ? 6.33900   46.55300 297.35200 1.000 68.58208  ? 430 LEU A CB  1 
ATOM   3356 C CG  . LEU A 1 427 ? 5.60500   47.65200 296.58300 1.000 71.17916  ? 430 LEU A CG  1 
ATOM   3357 C CD1 . LEU A 1 427 ? 4.44100   47.08700 295.80100 1.000 73.09599  ? 430 LEU A CD1 1 
ATOM   3358 C CD2 . LEU A 1 427 ? 5.11400   48.70000 297.55600 1.000 71.14544  ? 430 LEU A CD2 1 
ATOM   3359 N N   . VAL A 1 428 ? 8.33400   48.54600 299.27000 1.000 73.73393  ? 431 VAL A N   1 
ATOM   3360 C CA  . VAL A 1 428 ? 8.64600   49.06400 300.59800 1.000 64.55046  ? 431 VAL A CA  1 
ATOM   3361 C C   . VAL A 1 428 ? 7.40900   49.38300 301.43500 1.000 68.49835  ? 431 VAL A C   1 
ATOM   3362 O O   . VAL A 1 428 ? 7.52800   49.53600 302.65800 1.000 74.86902  ? 431 VAL A O   1 
ATOM   3363 C CB  . VAL A 1 428 ? 9.54000   50.30900 300.47200 1.000 67.97668  ? 431 VAL A CB  1 
ATOM   3364 C CG1 . VAL A 1 428 ? 10.80100  49.96300 299.71200 1.000 64.96772  ? 431 VAL A CG1 1 
ATOM   3365 C CG2 . VAL A 1 428 ? 8.81100   51.41400 299.75100 1.000 70.44337  ? 431 VAL A CG2 1 
ATOM   3366 N N   . TRP A 1 429 ? 6.22700   49.48800 300.83100 1.000 71.79579  ? 432 TRP A N   1 
ATOM   3367 C CA  . TRP A 1 429 ? 5.01700   49.76600 301.59900 1.000 69.10418  ? 432 TRP A CA  1 
ATOM   3368 C C   . TRP A 1 429 ? 4.51400   48.49600 302.28600 1.000 65.47720  ? 432 TRP A C   1 
ATOM   3369 O O   . TRP A 1 429 ? 4.79700   47.38000 301.84100 1.000 66.94100  ? 432 TRP A O   1 
ATOM   3370 C CB  . TRP A 1 429 ? 3.91500   50.34000 300.70000 1.000 64.15283  ? 432 TRP A CB  1 
ATOM   3371 C CG  . TRP A 1 429 ? 4.24300   51.64300 299.99300 1.000 66.85219  ? 432 TRP A CG  1 
ATOM   3372 C CD1 . TRP A 1 429 ? 4.63500   51.80000 298.68700 1.000 66.78900  ? 432 TRP A CD1 1 
ATOM   3373 C CD2 . TRP A 1 429 ? 4.19000   52.96200 300.54800 1.000 66.90557  ? 432 TRP A CD2 1 
ATOM   3374 N NE1 . TRP A 1 429 ? 4.84100   53.13000 298.40500 1.000 61.08428  ? 432 TRP A NE1 1 
ATOM   3375 C CE2 . TRP A 1 429 ? 4.56700   53.86400 299.52700 1.000 67.51652  ? 432 TRP A CE2 1 
ATOM   3376 C CE3 . TRP A 1 429 ? 3.87600   53.46900 301.80600 1.000 64.42962  ? 432 TRP A CE3 1 
ATOM   3377 C CZ2 . TRP A 1 429 ? 4.62400   55.23600 299.73200 1.000 66.80174  ? 432 TRP A CZ2 1 
ATOM   3378 C CZ3 . TRP A 1 429 ? 3.94000   54.83400 302.00700 1.000 66.58930  ? 432 TRP A CZ3 1 
ATOM   3379 C CH2 . TRP A 1 429 ? 4.31400   55.70100 300.97700 1.000 67.78040  ? 432 TRP A CH2 1 
ATOM   3380 N N   . PRO A 1 430 ? 3.75900   48.64400 303.37400 1.000 62.77241  ? 433 PRO A N   1 
ATOM   3381 C CA  . PRO A 1 430 ? 3.19600   47.47500 304.05300 1.000 62.73921  ? 433 PRO A CA  1 
ATOM   3382 C C   . PRO A 1 430 ? 2.38100   46.57900 303.12900 1.000 66.21862  ? 433 PRO A C   1 
ATOM   3383 O O   . PRO A 1 430 ? 1.81600   47.02400 302.12800 1.000 70.55709  ? 433 PRO A O   1 
ATOM   3384 C CB  . PRO A 1 430 ? 2.30600   48.09700 305.13200 1.000 60.78180  ? 433 PRO A CB  1 
ATOM   3385 C CG  . PRO A 1 430 ? 2.14000   49.52800 304.73400 1.000 57.95410  ? 433 PRO A CG  1 
ATOM   3386 C CD  . PRO A 1 430 ? 3.41600   49.88600 304.08100 1.000 61.50660  ? 433 PRO A CD  1 
ATOM   3387 N N   . GLU A 1 431 ? 2.30300   45.30200 303.50300 1.000 70.16975  ? 434 GLU A N   1 
ATOM   3388 C CA  . GLU A 1 431 ? 1.59100   44.31400 302.71000 1.000 69.44484  ? 434 GLU A CA  1 
ATOM   3389 C C   . GLU A 1 431 ? 0.08300   44.49700 302.74100 1.000 67.61679  ? 434 GLU A C   1 
ATOM   3390 O O   . GLU A 1 431 ? -0.59900  44.02900 301.81900 1.000 74.41577  ? 434 GLU A O   1 
ATOM   3391 C CB  . GLU A 1 431 ? 1.94400   42.91700 303.19300 1.000 73.20152  ? 434 GLU A CB  1 
ATOM   3392 C CG  . GLU A 1 431 ? 3.42600   42.73800 303.38300 1.000 83.91174  ? 434 GLU A CG  1 
ATOM   3393 C CD  . GLU A 1 431 ? 3.84500   41.29700 303.23800 1.000 97.13710  ? 434 GLU A CD  1 
ATOM   3394 O OE1 . GLU A 1 431 ? 3.21600   40.57400 302.42900 1.000 95.32638  ? 434 GLU A OE1 1 
ATOM   3395 O OE2 . GLU A 1 431 ? 4.79700   40.88900 303.94100 1.000 102.46616 ? 434 GLU A OE2 1 
ATOM   3396 N N   . TRP A 1 432 ? -0.46300  45.16200 303.76000 1.000 63.35417  ? 435 TRP A N   1 
ATOM   3397 C CA  . TRP A 1 432 ? -1.90400  45.39500 303.75100 1.000 67.00843  ? 435 TRP A CA  1 
ATOM   3398 C C   . TRP A 1 432 ? -2.32100  46.28000 302.58400 1.000 67.04613  ? 435 TRP A C   1 
ATOM   3399 O O   . TRP A 1 432 ? -3.49200  46.27100 302.19200 1.000 68.12657  ? 435 TRP A O   1 
ATOM   3400 C CB  . TRP A 1 432 ? -2.37700  46.01300 305.07600 1.000 62.98562  ? 435 TRP A CB  1 
ATOM   3401 C CG  . TRP A 1 432 ? -1.88100  47.40300 305.33900 1.000 65.38074  ? 435 TRP A CG  1 
ATOM   3402 C CD1 . TRP A 1 432 ? -0.78400  47.74900 306.06700 1.000 66.79422  ? 435 TRP A CD1 1 
ATOM   3403 C CD2 . TRP A 1 432 ? -2.46700  48.63800 304.88500 1.000 66.57120  ? 435 TRP A CD2 1 
ATOM   3404 N NE1 . TRP A 1 432 ? -0.64100  49.12100 306.09200 1.000 65.25211  ? 435 TRP A NE1 1 
ATOM   3405 C CE2 . TRP A 1 432 ? -1.65900  49.68800 305.37300 1.000 63.82611  ? 435 TRP A CE2 1 
ATOM   3406 C CE3 . TRP A 1 432 ? -3.58700  48.95500 304.10300 1.000 65.39612  ? 435 TRP A CE3 1 
ATOM   3407 C CZ2 . TRP A 1 432 ? -1.94200  51.03000 305.11800 1.000 61.33147  ? 435 TRP A CZ2 1 
ATOM   3408 C CZ3 . TRP A 1 432 ? -3.86100  50.28500 303.84200 1.000 61.64306  ? 435 TRP A CZ3 1 
ATOM   3409 C CH2 . TRP A 1 432 ? -3.04300  51.30700 304.35100 1.000 64.00792  ? 435 TRP A CH2 1 
ATOM   3410 N N   . MET A 1 433 ? -1.38600  47.04000 302.01700 1.000 65.62722  ? 436 MET A N   1 
ATOM   3411 C CA  . MET A 1 433 ? -1.71100  47.94200 300.93000 1.000 64.59360  ? 436 MET A CA  1 
ATOM   3412 C C   . MET A 1 433 ? -1.89700  47.22100 299.60300 1.000 66.31184  ? 436 MET A C   1 
ATOM   3413 O O   . MET A 1 433 ? -2.49700  47.79400 298.69100 1.000 69.23795  ? 436 MET A O   1 
ATOM   3414 C CB  . MET A 1 433 ? -0.62900  49.01800 300.81200 1.000 62.48901  ? 436 MET A CB  1 
ATOM   3415 C CG  . MET A 1 433 ? -0.80000  50.14700 301.79300 1.000 60.99258  ? 436 MET A CG  1 
ATOM   3416 S SD  . MET A 1 433 ? 0.57900   51.30500 301.81100 1.000 62.77863  ? 436 MET A SD  1 
ATOM   3417 C CE  . MET A 1 433 ? -0.08100  52.61800 300.79700 1.000 72.51966  ? 436 MET A CE  1 
ATOM   3418 N N   . GLY A 1 434 ? -1.40600  45.99000 299.47100 1.000 65.95620  ? 437 GLY A N   1 
ATOM   3419 C CA  . GLY A 1 434 ? -1.71800  45.21600 298.27700 1.000 65.33179  ? 437 GLY A CA  1 
ATOM   3420 C C   . GLY A 1 434 ? -0.99600  45.72900 297.04300 1.000 67.06464  ? 437 GLY A C   1 
ATOM   3421 O O   . GLY A 1 434 ? 0.17000   46.13500 297.09300 1.000 68.68083  ? 437 GLY A O   1 
ATOM   3422 N N   . VAL A 1 435 ? -1.69600  45.70900 295.91300 1.000 67.05521  ? 438 VAL A N   1 
ATOM   3423 C CA  . VAL A 1 435 ? -1.13800  46.12400 294.62900 1.000 64.57154  ? 438 VAL A CA  1 
ATOM   3424 C C   . VAL A 1 435 ? -1.52000  47.58800 294.41200 1.000 66.64828  ? 438 VAL A C   1 
ATOM   3425 O O   . VAL A 1 435 ? -2.65600  47.90400 294.04300 1.000 66.34834  ? 438 VAL A O   1 
ATOM   3426 C CB  . VAL A 1 435 ? -1.62500  45.22300 293.49600 1.000 65.39097  ? 438 VAL A CB  1 
ATOM   3427 C CG1 . VAL A 1 435 ? -1.11200  45.73200 292.15200 1.000 66.28198  ? 438 VAL A CG1 1 
ATOM   3428 C CG2 . VAL A 1 435 ? -1.15000  43.80900 293.74000 1.000 64.27309  ? 438 VAL A CG2 1 
ATOM   3429 N N   . ILE A 1 436 ? -0.55100  48.48800 294.60600 1.000 64.33239  ? 439 ILE A N   1 
ATOM   3430 C CA  . ILE A 1 436 ? -0.81000  49.89900 294.88200 1.000 62.71879  ? 439 ILE A CA  1 
ATOM   3431 C C   . ILE A 1 436 ? -0.93800  50.72000 293.60500 1.000 64.60346  ? 439 ILE A C   1 
ATOM   3432 O O   . ILE A 1 436 ? -0.24400  50.48700 292.60600 1.000 70.14790  ? 439 ILE A O   1 
ATOM   3433 C CB  . ILE A 1 436 ? 0.30800   50.46200 295.78500 1.000 64.03317  ? 439 ILE A CB  1 
ATOM   3434 C CG1 . ILE A 1 436 ? 0.45800   49.62600 297.04900 1.000 66.38505  ? 439 ILE A CG1 1 
ATOM   3435 C CG2 . ILE A 1 436 ? 0.01200   51.87000 296.19000 1.000 62.67706  ? 439 ILE A CG2 1 
ATOM   3436 C CD1 . ILE A 1 436 ? 1.48800   50.17900 297.97400 1.000 65.45697  ? 439 ILE A CD1 1 
ATOM   3437 N N   . HIS A 1 437 ? -1.82800  51.71100 293.65500 1.000 62.00052  ? 440 HIS A N   1 
ATOM   3438 C CA  . HIS A 1 437 ? -1.96200  52.75400 292.64400 1.000 59.00145  ? 440 HIS A CA  1 
ATOM   3439 C C   . HIS A 1 437 ? -0.60400  53.23800 292.16600 1.000 63.95802  ? 440 HIS A C   1 
ATOM   3440 O O   . HIS A 1 437 ? 0.22700   53.67100 292.96400 1.000 62.49968  ? 440 HIS A O   1 
ATOM   3441 C CB  . HIS A 1 437 ? -2.75700  53.92300 293.23000 1.000 59.55486  ? 440 HIS A CB  1 
ATOM   3442 C CG  . HIS A 1 437 ? -3.08100  55.01100 292.25200 1.000 61.84122  ? 440 HIS A CG  1 
ATOM   3443 N ND1 . HIS A 1 437 ? -3.99100  54.85000 291.22800 1.000 64.38874  ? 440 HIS A ND1 1 
ATOM   3444 C CD2 . HIS A 1 437 ? -2.64100  56.28900 292.16700 1.000 62.42447  ? 440 HIS A CD2 1 
ATOM   3445 C CE1 . HIS A 1 437 ? -4.08900  55.98000 290.54800 1.000 68.73280  ? 440 HIS A CE1 1 
ATOM   3446 N NE2 . HIS A 1 437 ? -3.28700  56.87200 291.10300 1.000 67.82235  ? 440 HIS A NE2 1 
ATOM   3447 N N   . GLY A 1 438 ? -0.37100  53.15000 290.85600 1.000 71.79117  ? 441 GLY A N   1 
ATOM   3448 C CA  . GLY A 1 438 ? 0.86600   53.62300 290.27100 1.000 66.17558  ? 441 GLY A CA  1 
ATOM   3449 C C   . GLY A 1 438 ? 2.04900   52.69500 290.41700 1.000 68.37926  ? 441 GLY A C   1 
ATOM   3450 O O   . GLY A 1 438 ? 3.18500   53.12500 290.18100 1.000 64.99175  ? 441 GLY A O   1 
ATOM   3451 N N   . TYR A 1 439 ? 1.83200   51.43400 290.78800 1.000 68.13731  ? 442 TYR A N   1 
ATOM   3452 C CA  . TYR A 1 439 ? 2.94800   50.51900 290.96100 1.000 68.11608  ? 442 TYR A CA  1 
ATOM   3453 C C   . TYR A 1 439 ? 3.04400   49.50100 289.83500 1.000 67.75575  ? 442 TYR A C   1 
ATOM   3454 O O   . TYR A 1 439 ? 3.85200   48.57500 289.91100 1.000 73.23721  ? 442 TYR A O   1 
ATOM   3455 C CB  . TYR A 1 439 ? 2.89200   49.88100 292.36200 1.000 68.05320  ? 442 TYR A CB  1 
ATOM   3456 C CG  . TYR A 1 439 ? 3.67300   50.78100 293.30800 1.000 67.85858  ? 442 TYR A CG  1 
ATOM   3457 C CD1 . TYR A 1 439 ? 3.08500   51.91200 293.87400 1.000 66.38707  ? 442 TYR A CD1 1 
ATOM   3458 C CD2 . TYR A 1 439 ? 5.03100   50.57800 293.52000 1.000 67.30957  ? 442 TYR A CD2 1 
ATOM   3459 C CE1 . TYR A 1 439 ? 3.81800   52.77700 294.68000 1.000 63.47429  ? 442 TYR A CE1 1 
ATOM   3460 C CE2 . TYR A 1 439 ? 5.76600   51.43200 294.30800 1.000 67.05499  ? 442 TYR A CE2 1 
ATOM   3461 C CZ  . TYR A 1 439 ? 5.15700   52.52900 294.88700 1.000 65.00164  ? 442 TYR A CZ  1 
ATOM   3462 O OH  . TYR A 1 439 ? 5.90300   53.37600 295.66800 1.000 63.82620  ? 442 TYR A OH  1 
ATOM   3463 N N   . GLU A 1 440 ? 2.26800   49.68000 288.76900 1.000 67.81374  ? 443 GLU A N   1 
ATOM   3464 C CA  . GLU A 1 440 ? 2.53100   48.99900 287.50900 1.000 69.72268  ? 443 GLU A CA  1 
ATOM   3465 C C   . GLU A 1 440 ? 3.47200   49.79700 286.62300 1.000 68.49048  ? 443 GLU A C   1 
ATOM   3466 O O   . GLU A 1 440 ? 4.05100   49.23300 285.68600 1.000 67.68013  ? 443 GLU A O   1 
ATOM   3467 C CB  . GLU A 1 440 ? 1.22800   48.74100 286.73400 1.000 69.56251  ? 443 GLU A CB  1 
ATOM   3468 C CG  . GLU A 1 440 ? 0.73100   49.95300 285.91700 1.000 69.46731  ? 443 GLU A CG  1 
ATOM   3469 C CD  . GLU A 1 440 ? 0.26100   51.11200 286.79900 1.000 69.37272  ? 443 GLU A CD  1 
ATOM   3470 O OE1 . GLU A 1 440 ? -0.19700  50.83500 287.92700 1.000 70.91219  ? 443 GLU A OE1 1 
ATOM   3471 O OE2 . GLU A 1 440 ? 0.34700   52.28600 286.37500 1.000 65.68828  ? 443 GLU A OE2 1 
ATOM   3472 N N   . ILE A 1 441 ? 3.62900   51.09300 286.90800 1.000 66.55945  ? 444 ILE A N   1 
ATOM   3473 C CA  . ILE A 1 441 ? 4.50300   51.95400 286.12100 1.000 63.86634  ? 444 ILE A CA  1 
ATOM   3474 C C   . ILE A 1 441 ? 5.90100   51.36200 286.02600 1.000 62.62607  ? 444 ILE A C   1 
ATOM   3475 O O   . ILE A 1 441 ? 6.51800   51.35600 284.96000 1.000 68.96859  ? 444 ILE A O   1 
ATOM   3476 C CB  . ILE A 1 441 ? 4.52600   53.36600 286.73200 1.000 64.99179  ? 444 ILE A CB  1 
ATOM   3477 C CG1 . ILE A 1 441 ? 3.10100   53.91600 286.83200 1.000 61.62791  ? 444 ILE A CG1 1 
ATOM   3478 C CG2 . ILE A 1 441 ? 5.44300   54.28400 285.93000 1.000 61.84851  ? 444 ILE A CG2 1 
ATOM   3479 C CD1 . ILE A 1 441 ? 3.02600   55.30500 287.39300 1.000 57.56492  ? 444 ILE A CD1 1 
ATOM   3480 N N   . GLU A 1 442 ? 6.41800   50.83600 287.12900 1.000 69.17692  ? 445 GLU A N   1 
ATOM   3481 C CA  . GLU A 1 442 ? 7.78900   50.33900 287.11400 1.000 71.36675  ? 445 GLU A CA  1 
ATOM   3482 C C   . GLU A 1 442 ? 7.95600   49.15100 286.16900 1.000 70.20894  ? 445 GLU A C   1 
ATOM   3483 O O   . GLU A 1 442 ? 9.06700   48.90300 285.68500 1.000 67.85467  ? 445 GLU A O   1 
ATOM   3484 C CB  . GLU A 1 442 ? 8.22000   49.97900 288.53700 1.000 66.36610  ? 445 GLU A CB  1 
ATOM   3485 C CG  . GLU A 1 442 ? 7.22300   49.13300 289.29500 1.000 68.78437  ? 445 GLU A CG  1 
ATOM   3486 C CD  . GLU A 1 442 ? 7.53100   49.05300 290.79500 1.000 75.62245  ? 445 GLU A CD  1 
ATOM   3487 O OE1 . GLU A 1 442 ? 7.74400   50.11500 291.44400 1.000 68.94479  ? 445 GLU A OE1 1 
ATOM   3488 O OE2 . GLU A 1 442 ? 7.55500   47.91400 291.31900 1.000 75.45797  ? 445 GLU A OE2 1 
ATOM   3489 N N   . PHE A 1 443 ? 6.87100   48.41100 285.89200 1.000 65.52249  ? 446 PHE A N   1 
ATOM   3490 C CA  . PHE A 1 443 ? 6.93800   47.30300 284.94300 1.000 66.28867  ? 446 PHE A CA  1 
ATOM   3491 C C   . PHE A 1 443 ? 6.78300   47.78800 283.50400 1.000 68.79284  ? 446 PHE A C   1 
ATOM   3492 O O   . PHE A 1 443 ? 7.39200   47.23000 282.58900 1.000 64.37371  ? 446 PHE A O   1 
ATOM   3493 C CB  . PHE A 1 443 ? 5.86200   46.25900 285.26400 1.000 62.85891  ? 446 PHE A CB  1 
ATOM   3494 C CG  . PHE A 1 443 ? 6.11100   45.48000 286.53900 1.000 73.03488  ? 446 PHE A CG  1 
ATOM   3495 C CD1 . PHE A 1 443 ? 5.78900   46.02200 287.78400 1.000 74.96861  ? 446 PHE A CD1 1 
ATOM   3496 C CD2 . PHE A 1 443 ? 6.64800   44.20100 286.49300 1.000 69.46032  ? 446 PHE A CD2 1 
ATOM   3497 C CE1 . PHE A 1 443 ? 6.01700   45.31200 288.95300 1.000 67.43936  ? 446 PHE A CE1 1 
ATOM   3498 C CE2 . PHE A 1 443 ? 6.87400   43.49100 287.65600 1.000 71.43555  ? 446 PHE A CE2 1 
ATOM   3499 C CZ  . PHE A 1 443 ? 6.55700   44.04900 288.88800 1.000 68.43042  ? 446 PHE A CZ  1 
ATOM   3500 N N   . VAL A 1 444 ? 5.97100   48.82000 283.29400 1.000 71.19250  ? 447 VAL A N   1 
ATOM   3501 C CA  . VAL A 1 444 ? 5.79700   49.38300 281.96700 1.000 66.71015  ? 447 VAL A CA  1 
ATOM   3502 C C   . VAL A 1 444 ? 7.08900   50.01400 281.48200 1.000 69.52548  ? 447 VAL A C   1 
ATOM   3503 O O   . VAL A 1 444 ? 7.39400   49.96800 280.28000 1.000 69.93854  ? 447 VAL A O   1 
ATOM   3504 C CB  . VAL A 1 444 ? 4.64300   50.39400 281.98600 1.000 65.48136  ? 447 VAL A CB  1 
ATOM   3505 C CG1 . VAL A 1 444 ? 4.61800   51.20500 280.71000 1.000 63.73378  ? 447 VAL A CG1 1 
ATOM   3506 C CG2 . VAL A 1 444 ? 3.34000   49.67000 282.20100 1.000 64.49777  ? 447 VAL A CG2 1 
ATOM   3507 N N   . PHE A 1 445 ? 7.88200   50.59200 282.39100 1.000 63.43178  ? 448 PHE A N   1 
ATOM   3508 C CA  . PHE A 1 445 ? 9.15300   51.20400 282.02300 1.000 66.84377  ? 448 PHE A CA  1 
ATOM   3509 C C   . PHE A 1 445 ? 10.34500  50.27100 282.19900 1.000 70.91795  ? 448 PHE A C   1 
ATOM   3510 O O   . PHE A 1 445 ? 11.47900  50.67700 281.91100 1.000 70.93967  ? 448 PHE A O   1 
ATOM   3511 C CB  . PHE A 1 445 ? 9.37100   52.49300 282.80800 1.000 64.34882  ? 448 PHE A CB  1 
ATOM   3512 C CG  . PHE A 1 445 ? 8.63100   53.67900 282.24600 1.000 68.83676  ? 448 PHE A CG  1 
ATOM   3513 C CD1 . PHE A 1 445 ? 7.25700   53.80700 282.41600 1.000 67.87780  ? 448 PHE A CD1 1 
ATOM   3514 C CD2 . PHE A 1 445 ? 9.31100   54.67500 281.56200 1.000 66.84813  ? 448 PHE A CD2 1 
ATOM   3515 C CE1 . PHE A 1 445 ? 6.57100   54.91200 281.91500 1.000 63.19365  ? 448 PHE A CE1 1 
ATOM   3516 C CE2 . PHE A 1 445 ? 8.63600   55.77700 281.06000 1.000 67.66404  ? 448 PHE A CE2 1 
ATOM   3517 C CZ  . PHE A 1 445 ? 7.26200   55.89600 281.23700 1.000 65.53200  ? 448 PHE A CZ  1 
ATOM   3518 N N   . GLY A 1 446 ? 10.11300  49.03100 282.63100 1.000 68.44737  ? 449 GLY A N   1 
ATOM   3519 C CA  . GLY A 1 446 ? 11.14800  48.01700 282.60900 1.000 67.37535  ? 449 GLY A CA  1 
ATOM   3520 C C   . GLY A 1 446 ? 12.21100  48.14400 283.67200 1.000 70.97720  ? 449 GLY A C   1 
ATOM   3521 O O   . GLY A 1 446 ? 13.36400  47.78200 283.43100 1.000 73.89476  ? 449 GLY A O   1 
ATOM   3522 N N   . LEU A 1 447 ? 11.86400  48.63900 284.84700 1.000 74.62320  ? 450 LEU A N   1 
ATOM   3523 C CA  . LEU A 1 447 ? 12.83300  48.66900 285.93900 1.000 74.59079  ? 450 LEU A CA  1 
ATOM   3524 C C   . LEU A 1 447 ? 13.18200  47.26300 286.43700 1.000 70.01609  ? 450 LEU A C   1 
ATOM   3525 O O   . LEU A 1 447 ? 14.33500  47.04000 286.81900 1.000 71.42776  ? 450 LEU A O   1 
ATOM   3526 C CB  . LEU A 1 447 ? 12.32900  49.56200 287.07700 1.000 67.42006  ? 450 LEU A CB  1 
ATOM   3527 C CG  . LEU A 1 447 ? 12.72200  51.05000 286.99600 1.000 65.45217  ? 450 LEU A CG  1 
ATOM   3528 C CD1 . LEU A 1 447 ? 12.51800  51.64200 285.60800 1.000 70.35319  ? 450 LEU A CD1 1 
ATOM   3529 C CD2 . LEU A 1 447 ? 11.93600  51.87300 287.99100 1.000 75.20698  ? 450 LEU A CD2 1 
ATOM   3530 N N   . PRO A 1 448 ? 12.25800  46.28900 286.43900 1.000 70.69917  ? 451 PRO A N   1 
ATOM   3531 C CA  . PRO A 1 448 ? 12.67200  44.89600 286.69800 1.000 73.02649  ? 451 PRO A CA  1 
ATOM   3532 C C   . PRO A 1 448 ? 13.87200  44.41800 285.89900 1.000 78.57848  ? 451 PRO A C   1 
ATOM   3533 O O   . PRO A 1 448 ? 14.57300  43.51000 286.35600 1.000 85.46151  ? 451 PRO A O   1 
ATOM   3534 C CB  . PRO A 1 448 ? 11.41600  44.09700 286.33700 1.000 72.32414  ? 451 PRO A CB  1 
ATOM   3535 C CG  . PRO A 1 448 ? 10.31400  44.99300 286.75100 1.000 73.31218  ? 451 PRO A CG  1 
ATOM   3536 C CD  . PRO A 1 448 ? 10.78900  46.41300 286.49400 1.000 70.49221  ? 451 PRO A CD  1 
ATOM   3537 N N   . LEU A 1 449 ? 14.13700  44.98900 284.72100 1.000 80.83864  ? 452 LEU A N   1 
ATOM   3538 C CA  . LEU A 1 449 ? 15.25700  44.53000 283.90800 1.000 79.40628  ? 452 LEU A CA  1 
ATOM   3539 C C   . LEU A 1 449 ? 16.60000  44.90300 284.51000 1.000 80.73688  ? 452 LEU A C   1 
ATOM   3540 O O   . LEU A 1 449 ? 17.62500  44.33800 284.11700 1.000 86.84240  ? 452 LEU A O   1 
ATOM   3541 C CB  . LEU A 1 449 ? 15.15800  45.10500 282.50200 1.000 80.88780  ? 452 LEU A CB  1 
ATOM   3542 C CG  . LEU A 1 449 ? 14.39300  44.29600 281.46500 1.000 80.59155  ? 452 LEU A CG  1 
ATOM   3543 C CD1 . LEU A 1 449 ? 12.99000  43.95500 281.95700 1.000 76.08890  ? 452 LEU A CD1 1 
ATOM   3544 C CD2 . LEU A 1 449 ? 14.35200  45.09400 280.17500 1.000 74.01190  ? 452 LEU A CD2 1 
ATOM   3545 N N   . VAL A 1 450 ? 16.62400  45.85600 285.42800 1.000 81.45711  ? 453 VAL A N   1 
ATOM   3546 C CA  . VAL A 1 450 ? 17.84600  46.21500 286.12900 1.000 86.38244  ? 453 VAL A CA  1 
ATOM   3547 C C   . VAL A 1 450 ? 18.05600  45.21300 287.26100 1.000 91.03719  ? 453 VAL A C   1 
ATOM   3548 O O   . VAL A 1 450 ? 17.65200  45.45200 288.40600 1.000 84.30227  ? 453 VAL A O   1 
ATOM   3549 C CB  . VAL A 1 450 ? 17.77400  47.66600 286.63600 1.000 82.57984  ? 453 VAL A CB  1 
ATOM   3550 C CG1 . VAL A 1 450 ? 19.07600  48.08100 287.22500 1.000 83.51928  ? 453 VAL A CG1 1 
ATOM   3551 C CG2 . VAL A 1 450 ? 17.40600  48.59900 285.49800 1.000 80.41704  ? 453 VAL A CG2 1 
ATOM   3552 N N   . LYS A 1 451 ? 18.76400  44.15200 286.96400 1.000 97.26857  ? 454 LYS A N   1 
ATOM   3553 C CA  . LYS A 1 451 ? 18.94800  43.16300 287.97600 1.000 100.53558 ? 454 LYS A CA  1 
ATOM   3554 C C   . LYS A 1 451 ? 19.96300  43.63100 288.94100 1.000 99.85183  ? 454 LYS A C   1 
ATOM   3555 O O   . LYS A 1 451 ? 20.95300  43.00300 289.19500 1.000 105.98469 ? 454 LYS A O   1 
ATOM   3556 C CB  . LYS A 1 451 ? 19.35200  41.82200 287.36900 1.000 104.91012 ? 454 LYS A CB  1 
ATOM   3557 C CG  . LYS A 1 451 ? 18.19000  41.00600 286.83300 1.000 99.34807  ? 454 LYS A CG  1 
ATOM   3558 C CD  . LYS A 1 451 ? 17.51800  40.24000 287.94200 1.000 95.97757  ? 454 LYS A CD  1 
ATOM   3559 C CE  . LYS A 1 451 ? 16.35000  39.45500 287.40200 1.000 95.19195  ? 454 LYS A CE  1 
ATOM   3560 N NZ  . LYS A 1 451 ? 16.77400  38.10500 286.97300 1.000 94.04727  ? 454 LYS A NZ  1 
ATOM   3561 N N   . GLU A 1 452 ? 19.68700  44.80200 289.45000 1.000 98.96308  ? 455 GLU A N   1 
ATOM   3562 C CA  . GLU A 1 452 ? 20.41200  45.41500 290.53500 1.000 90.90022  ? 455 GLU A CA  1 
ATOM   3563 C C   . GLU A 1 452 ? 19.43600  46.21100 291.36600 1.000 88.14257  ? 455 GLU A C   1 
ATOM   3564 O O   . GLU A 1 452 ? 19.82900  47.02400 292.15400 1.000 86.95157  ? 455 GLU A O   1 
ATOM   3565 C CB  . GLU A 1 452 ? 21.62100  46.23600 290.12300 1.000 90.72833  ? 455 GLU A CB  1 
ATOM   3566 C CG  . GLU A 1 452 ? 21.45300  47.13800 288.93400 1.000 103.20983 ? 455 GLU A CG  1 
ATOM   3567 C CD  . GLU A 1 452 ? 21.84200  46.46400 287.64900 1.000 104.44807 ? 455 GLU A CD  1 
ATOM   3568 O OE1 . GLU A 1 452 ? 22.40000  47.12900 286.76400 1.000 103.75524 ? 455 GLU A OE1 1 
ATOM   3569 O OE2 . GLU A 1 452 ? 21.57000  45.26600 287.52600 1.000 102.57943 ? 455 GLU A OE2 1 
ATOM   3570 N N   . LEU A 1 453 ? 18.15300  45.97400 291.14800 1.000 88.92169  ? 456 LEU A N   1 
ATOM   3571 C CA  . LEU A 1 453 ? 17.10000  46.61100 291.86300 1.000 83.44628  ? 456 LEU A CA  1 
ATOM   3572 C C   . LEU A 1 453 ? 16.38100  45.54200 292.62600 1.000 82.12889  ? 456 LEU A C   1 
ATOM   3573 O O   . LEU A 1 453 ? 15.30900  45.74700 293.10900 1.000 81.80023  ? 456 LEU A O   1 
ATOM   3574 C CB  . LEU A 1 453 ? 16.16700  47.32000 290.92100 1.000 85.22803  ? 456 LEU A CB  1 
ATOM   3575 C CG  . LEU A 1 453 ? 16.67300  48.67100 290.44800 1.000 84.83372  ? 456 LEU A CG  1 
ATOM   3576 C CD1 . LEU A 1 453 ? 15.63100  49.36700 289.61700 1.000 78.08769  ? 456 LEU A CD1 1 
ATOM   3577 C CD2 . LEU A 1 453 ? 17.03600  49.53500 291.62200 1.000 77.97940  ? 456 LEU A CD2 1 
ATOM   3578 N N   . ASN A 1 454 ? 16.97300  44.37600 292.72500 1.000 83.76204  ? 457 ASN A N   1 
ATOM   3579 C CA  . ASN A 1 454 ? 16.33200  43.33000 293.51400 1.000 84.93676  ? 457 ASN A CA  1 
ATOM   3580 C C   . ASN A 1 454 ? 14.96400  42.99300 292.93900 1.000 83.76373  ? 457 ASN A C   1 
ATOM   3581 O O   . ASN A 1 454 ? 13.93900  43.39300 293.50100 1.000 87.25328  ? 457 ASN A O   1 
ATOM   3582 C CB  . ASN A 1 454 ? 16.18100  43.75500 294.98800 1.000 86.13338  ? 457 ASN A CB  1 
ATOM   3583 C CG  . ASN A 1 454 ? 17.51700  43.97200 295.69600 1.000 92.67546  ? 457 ASN A CG  1 
ATOM   3584 O OD1 . ASN A 1 454 ? 18.58300  43.69900 295.13600 1.000 91.37299  ? 457 ASN A OD1 1 
ATOM   3585 N ND2 . ASN A 1 454 ? 17.45900  44.45700 296.94300 1.000 92.58252  ? 457 ASN A ND2 1 
ATOM   3586 N N   . TYR A 1 455 ? 14.92500  42.28300 291.82000 1.000 78.60274  ? 458 TYR A N   1 
ATOM   3587 C CA  . TYR A 1 455 ? 13.66700  41.80200 291.27700 1.000 76.68236  ? 458 TYR A CA  1 
ATOM   3588 C C   . TYR A 1 455 ? 13.79800  40.31700 290.98900 1.000 78.14393  ? 458 TYR A C   1 
ATOM   3589 O O   . TYR A 1 455 ? 14.84700  39.85600 290.53000 1.000 81.14975  ? 458 TYR A O   1 
ATOM   3590 C CB  . TYR A 1 455 ? 13.26600  42.55300 289.99600 1.000 80.93686  ? 458 TYR A CB  1 
ATOM   3591 C CG  . TYR A 1 455 ? 12.51300  43.87100 290.18300 1.000 78.44407  ? 458 TYR A CG  1 
ATOM   3592 C CD1 . TYR A 1 455 ? 11.16200  43.89100 290.52000 1.000 72.75895  ? 458 TYR A CD1 1 
ATOM   3593 C CD2 . TYR A 1 455 ? 13.15400  45.09700 289.97600 1.000 79.36386  ? 458 TYR A CD2 1 
ATOM   3594 C CE1 . TYR A 1 455 ? 10.47600  45.09500 290.67000 1.000 72.41866  ? 458 TYR A CE1 1 
ATOM   3595 C CE2 . TYR A 1 455 ? 12.47800  46.30700 290.11300 1.000 70.81154  ? 458 TYR A CE2 1 
ATOM   3596 C CZ  . TYR A 1 455 ? 11.13800  46.30500 290.46500 1.000 72.61312  ? 458 TYR A CZ  1 
ATOM   3597 O OH  . TYR A 1 455 ? 10.46100  47.51100 290.59500 1.000 62.10342  ? 458 TYR A OH  1 
ATOM   3598 N N   . THR A 1 456 ? 12.73900  39.56900 291.27600 1.000 77.35360  ? 459 THR A N   1 
ATOM   3599 C CA  . THR A 1 456 ? 12.73800  38.15700 290.94100 1.000 77.40282  ? 459 THR A CA  1 
ATOM   3600 C C   . THR A 1 456 ? 12.78000  37.99800 289.43300 1.000 80.58565  ? 459 THR A C   1 
ATOM   3601 O O   . THR A 1 456 ? 12.31000  38.85600 288.68500 1.000 79.54466  ? 459 THR A O   1 
ATOM   3602 C CB  . THR A 1 456 ? 11.49800  37.45400 291.49100 1.000 80.24864  ? 459 THR A CB  1 
ATOM   3603 O OG1 . THR A 1 456 ? 10.42000  37.57200 290.55000 1.000 76.55317  ? 459 THR A OG1 1 
ATOM   3604 C CG2 . THR A 1 456 ? 11.09100  38.05600 292.83300 1.000 71.94635  ? 459 THR A CG2 1 
ATOM   3605 N N   . ALA A 1 457 ? 13.35800  36.88400 288.98700 1.000 86.49532  ? 460 ALA A N   1 
ATOM   3606 C CA  . ALA A 1 457 ? 13.45400  36.63500 287.55600 1.000 79.16513  ? 460 ALA A CA  1 
ATOM   3607 C C   . ALA A 1 457 ? 12.07300  36.59500 286.91200 1.000 80.75786  ? 460 ALA A C   1 
ATOM   3608 O O   . ALA A 1 457 ? 11.89100  37.08800 285.79400 1.000 85.67981  ? 460 ALA A O   1 
ATOM   3609 C CB  . ALA A 1 457 ? 14.21300  35.33500 287.30600 1.000 76.17128  ? 460 ALA A CB  1 
ATOM   3610 N N   . GLU A 1 458 ? 11.08400  36.02500 287.60800 1.000 81.49431  ? 461 GLU A N   1 
ATOM   3611 C CA  . GLU A 1 458 ? 9.71900   36.00900 287.08400 1.000 82.07998  ? 461 GLU A CA  1 
ATOM   3612 C C   . GLU A 1 458 ? 9.21100   37.41300 286.80900 1.000 80.32168  ? 461 GLU A C   1 
ATOM   3613 O O   . GLU A 1 458 ? 8.41700   37.61800 285.88300 1.000 78.66793  ? 461 GLU A O   1 
ATOM   3614 C CB  . GLU A 1 458 ? 8.77000   35.31100 288.06100 1.000 79.28982  ? 461 GLU A CB  1 
ATOM   3615 C CG  . GLU A 1 458 ? 9.01200   33.82700 288.22800 1.000 86.61687  ? 461 GLU A CG  1 
ATOM   3616 C CD  . GLU A 1 458 ? 10.18800  33.51000 289.14700 1.000 94.60433  ? 461 GLU A CD  1 
ATOM   3617 O OE1 . GLU A 1 458 ? 10.87600  34.45700 289.61700 1.000 89.47722  ? 461 GLU A OE1 1 
ATOM   3618 O OE2 . GLU A 1 458 ? 10.41400  32.30200 289.40100 1.000 93.43480  ? 461 GLU A OE2 1 
ATOM   3619 N N   . GLU A 1 459 ? 9.63900   38.38600 287.61000 1.000 78.31047  ? 462 GLU A N   1 
ATOM   3620 C CA  . GLU A 1 459 ? 9.16000   39.74700 287.42100 1.000 75.49239  ? 462 GLU A CA  1 
ATOM   3621 C C   . GLU A 1 459 ? 9.80100   40.38800 286.20000 1.000 80.65880  ? 462 GLU A C   1 
ATOM   3622 O O   . GLU A 1 459 ? 9.13700   41.13000 285.46600 1.000 81.13787  ? 462 GLU A O   1 
ATOM   3623 C CB  . GLU A 1 459 ? 9.42000   40.56700 288.67700 1.000 73.45600  ? 462 GLU A CB  1 
ATOM   3624 C CG  . GLU A 1 459 ? 8.65900   40.04700 289.88200 1.000 75.64439  ? 462 GLU A CG  1 
ATOM   3625 C CD  . GLU A 1 459 ? 8.92200   40.86100 291.13900 1.000 75.04648  ? 462 GLU A CD  1 
ATOM   3626 O OE1 . GLU A 1 459 ? 10.07500  41.31500 291.31600 1.000 74.52632  ? 462 GLU A OE1 1 
ATOM   3627 O OE2 . GLU A 1 459 ? 7.97200   41.04800 291.93700 1.000 68.06093  ? 462 GLU A OE2 1 
ATOM   3628 N N   . GLU A 1 460 ? 11.09000  40.12000 285.96000 1.000 81.21930  ? 463 GLU A N   1 
ATOM   3629 C CA  . GLU A 1 460 ? 11.68900  40.52300 284.69300 1.000 77.86713  ? 463 GLU A CA  1 
ATOM   3630 C C   . GLU A 1 460 ? 10.89900  39.93500 283.53300 1.000 74.00172  ? 463 GLU A C   1 
ATOM   3631 O O   . GLU A 1 460 ? 10.54900  40.63900 282.58100 1.000 72.09999  ? 463 GLU A O   1 
ATOM   3632 C CB  . GLU A 1 460 ? 13.15400  40.08700 284.62700 1.000 81.06208  ? 463 GLU A CB  1 
ATOM   3633 C CG  . GLU A 1 460 ? 13.86800  40.57700 283.36300 1.000 83.15842  ? 463 GLU A CG  1 
ATOM   3634 C CD  . GLU A 1 460 ? 15.29800  40.05900 283.21800 1.000 89.57676  ? 463 GLU A CD  1 
ATOM   3635 O OE1 . GLU A 1 460 ? 15.76400  39.27800 284.08400 1.000 94.87924  ? 463 GLU A OE1 1 
ATOM   3636 O OE2 . GLU A 1 460 ? 15.95600  40.44600 282.22400 1.000 89.07330  ? 463 GLU A OE2 1 
ATOM   3637 N N   . ALA A 1 461 ? 10.58900  38.63800 283.62300 1.000 74.15903  ? 464 ALA A N   1 
ATOM   3638 C CA  . ALA A 1 461 ? 9.71700   37.97900 282.65900 1.000 73.23728  ? 464 ALA A CA  1 
ATOM   3639 C C   . ALA A 1 461 ? 8.38400   38.70900 282.49700 1.000 76.84869  ? 464 ALA A C   1 
ATOM   3640 O O   . ALA A 1 461 ? 7.85600   38.82100 281.38100 1.000 79.84093  ? 464 ALA A O   1 
ATOM   3641 C CB  . ALA A 1 461 ? 9.48500   36.53400 283.09600 1.000 72.45957  ? 464 ALA A CB  1 
ATOM   3642 N N   . LEU A 1 462 ? 7.82400   39.21100 283.60000 1.000 74.88219  ? 465 LEU A N   1 
ATOM   3643 C CA  . LEU A 1 462 ? 6.56500   39.94500 283.52300 1.000 70.75813  ? 465 LEU A CA  1 
ATOM   3644 C C   . LEU A 1 462 ? 6.75400   41.31800 282.88800 1.000 71.70168  ? 465 LEU A C   1 
ATOM   3645 O O   . LEU A 1 462 ? 5.93400   41.74600 282.06700 1.000 75.66472  ? 465 LEU A O   1 
ATOM   3646 C CB  . LEU A 1 462 ? 5.96500   40.08100 284.91800 1.000 75.36848  ? 465 LEU A CB  1 
ATOM   3647 C CG  . LEU A 1 462 ? 4.75300   40.99600 285.05700 1.000 71.58213  ? 465 LEU A CG  1 
ATOM   3648 C CD1 . LEU A 1 462 ? 3.59700   40.51000 284.19200 1.000 67.76203  ? 465 LEU A CD1 1 
ATOM   3649 C CD2 . LEU A 1 462 ? 4.34700   41.09700 286.51800 1.000 68.29420  ? 465 LEU A CD2 1 
ATOM   3650 N N   . SER A 1 463 ? 7.82300   42.02800 283.25700 1.000 69.52908  ? 466 SER A N   1 
ATOM   3651 C CA  . SER A 1 463 ? 8.06600   43.35300 282.69500 1.000 67.58367  ? 466 SER A CA  1 
ATOM   3652 C C   . SER A 1 463 ? 8.28700   43.27900 281.18900 1.000 72.04021  ? 466 SER A C   1 
ATOM   3653 O O   . SER A 1 463 ? 7.72700   44.08100 280.42700 1.000 69.08915  ? 466 SER A O   1 
ATOM   3654 C CB  . SER A 1 463 ? 9.26500   43.99800 283.38900 1.000 70.93550  ? 466 SER A CB  1 
ATOM   3655 O OG  . SER A 1 463 ? 9.48200   45.33400 282.96700 1.000 71.08586  ? 466 SER A OG  1 
ATOM   3656 N N   . ARG A 1 464 ? 9.09900   42.31900 280.73800 1.000 76.36708  ? 467 ARG A N   1 
ATOM   3657 C CA  . ARG A 1 464 ? 9.30100   42.13900 279.30300 1.000 71.75426  ? 467 ARG A CA  1 
ATOM   3658 C C   . ARG A 1 464 ? 7.99600   41.76100 278.62000 1.000 69.66425  ? 467 ARG A C   1 
ATOM   3659 O O   . ARG A 1 464 ? 7.65700   42.31200 277.56900 1.000 61.63981  ? 467 ARG A O   1 
ATOM   3660 C CB  . ARG A 1 464 ? 10.38500  41.09000 279.05800 1.000 69.54948  ? 467 ARG A CB  1 
ATOM   3661 C CG  . ARG A 1 464 ? 11.75900  41.52900 279.53300 1.000 68.12276  ? 467 ARG A CG  1 
ATOM   3662 C CD  . ARG A 1 464 ? 12.85000  40.48700 279.30500 1.000 66.67168  ? 467 ARG A CD  1 
ATOM   3663 N NE  . ARG A 1 464 ? 14.17400  41.11100 279.34300 1.000 71.79744  ? 467 ARG A NE  1 
ATOM   3664 C CZ  . ARG A 1 464 ? 14.65500  41.89600 278.37800 1.000 81.39181  ? 467 ARG A CZ  1 
ATOM   3665 N NH1 . ARG A 1 464 ? 13.92200  42.15000 277.28600 1.000 70.95739  ? 467 ARG A NH1 1 
ATOM   3666 N NH2 . ARG A 1 464 ? 15.87200  42.43100 278.50000 1.000 80.53562  ? 467 ARG A NH2 1 
ATOM   3667 N N   . ARG A 1 465 ? 7.23500   40.84900 279.23000 1.000 73.82740  ? 468 ARG A N   1 
ATOM   3668 C CA  . ARG A 1 465 ? 5.91300   40.50700 278.71400 1.000 71.78905  ? 468 ARG A CA  1 
ATOM   3669 C C   . ARG A 1 465 ? 5.03200   41.74600 278.58600 1.000 73.24082  ? 468 ARG A C   1 
ATOM   3670 O O   . ARG A 1 465 ? 4.33600   41.91500 277.57900 1.000 72.94338  ? 468 ARG A O   1 
ATOM   3671 C CB  . ARG A 1 465 ? 5.26600   39.45900 279.62200 1.000 70.35982  ? 468 ARG A CB  1 
ATOM   3672 C CG  . ARG A 1 465 ? 3.96800   38.88000 279.10300 1.000 74.72707  ? 468 ARG A CG  1 
ATOM   3673 C CD  . ARG A 1 465 ? 3.61900   37.58200 279.82500 1.000 80.44850  ? 468 ARG A CD  1 
ATOM   3674 N NE  . ARG A 1 465 ? 2.84900   37.76700 281.06100 1.000 85.37242  ? 468 ARG A NE  1 
ATOM   3675 C CZ  . ARG A 1 465 ? 1.51600   37.71100 281.12800 1.000 86.93677  ? 468 ARG A CZ  1 
ATOM   3676 N NH1 . ARG A 1 465 ? 0.80500   37.48800 280.03000 1.000 88.73762  ? 468 ARG A NH1 1 
ATOM   3677 N NH2 . ARG A 1 465 ? 0.88400   37.87400 282.28400 1.000 78.01447  ? 468 ARG A NH2 1 
ATOM   3678 N N   . ILE A 1 466 ? 5.06800   42.63900 279.58100 1.000 73.60218  ? 469 ILE A N   1 
ATOM   3679 C CA  . ILE A 1 466 ? 4.20300   43.82100 279.55900 1.000 71.07411  ? 469 ILE A CA  1 
ATOM   3680 C C   . ILE A 1 466 ? 4.73400   44.86800 278.58900 1.000 66.65827  ? 469 ILE A C   1 
ATOM   3681 O O   . ILE A 1 466 ? 3.98300   45.39800 277.76500 1.000 66.60767  ? 469 ILE A O   1 
ATOM   3682 C CB  . ILE A 1 466 ? 4.03700   44.39600 280.98000 1.000 67.85621  ? 469 ILE A CB  1 
ATOM   3683 C CG1 . ILE A 1 466 ? 2.95400   43.62400 281.72900 1.000 67.40010  ? 469 ILE A CG1 1 
ATOM   3684 C CG2 . ILE A 1 466 ? 3.68500   45.88300 280.95500 1.000 63.06985  ? 469 ILE A CG2 1 
ATOM   3685 C CD1 . ILE A 1 466 ? 2.66800   44.16200 283.08900 1.000 59.26199  ? 469 ILE A CD1 1 
ATOM   3686 N N   . MET A 1 467 ? 6.02900   45.19200 278.68000 1.000 66.95344  ? 470 MET A N   1 
ATOM   3687 C CA  . MET A 1 467 ? 6.62300   46.15900 277.75900 1.000 72.34307  ? 470 MET A CA  1 
ATOM   3688 C C   . MET A 1 467 ? 6.37500   45.78100 276.30000 1.000 74.09929  ? 470 MET A C   1 
ATOM   3689 O O   . MET A 1 467 ? 6.19300   46.65700 275.44500 1.000 67.94807  ? 470 MET A O   1 
ATOM   3690 C CB  . MET A 1 467 ? 8.12600   46.27000 278.00800 1.000 74.01843  ? 470 MET A CB  1 
ATOM   3691 C CG  . MET A 1 467 ? 8.53700   47.19700 279.12800 1.000 70.40570  ? 470 MET A CG  1 
ATOM   3692 S SD  . MET A 1 467 ? 10.31200  47.53600 279.01700 1.000 74.44436  ? 470 MET A SD  1 
ATOM   3693 C CE  . MET A 1 467 ? 10.94300  45.93600 279.52300 1.000 75.20727  ? 470 MET A CE  1 
ATOM   3694 N N   . HIS A 1 468 ? 6.36200   44.48500 275.99500 1.000 73.15208  ? 471 HIS A N   1 
ATOM   3695 C CA  . HIS A 1 468 ? 6.10500   44.09000 274.62200 1.000 71.56380  ? 471 HIS A CA  1 
ATOM   3696 C C   . HIS A 1 468 ? 4.64400   44.31100 274.25100 1.000 71.97465  ? 471 HIS A C   1 
ATOM   3697 O O   . HIS A 1 468 ? 4.35300   44.79700 273.15300 1.000 72.62699  ? 471 HIS A O   1 
ATOM   3698 C CB  . HIS A 1 468 ? 6.52400   42.63700 274.38900 1.000 73.08120  ? 471 HIS A CB  1 
ATOM   3699 C CG  . HIS A 1 468 ? 6.74400   42.30900 272.94300 1.000 83.48778  ? 471 HIS A CG  1 
ATOM   3700 N ND1 . HIS A 1 468 ? 7.75700   42.87800 272.19700 1.000 81.09981  ? 471 HIS A ND1 1 
ATOM   3701 C CD2 . HIS A 1 468 ? 6.06200   41.50100 272.09600 1.000 82.95316  ? 471 HIS A CD2 1 
ATOM   3702 C CE1 . HIS A 1 468 ? 7.69800   42.42400 270.95800 1.000 78.52843  ? 471 HIS A CE1 1 
ATOM   3703 N NE2 . HIS A 1 468 ? 6.68200   41.58300 270.87200 1.000 82.95375  ? 471 HIS A NE2 1 
ATOM   3704 N N   . TYR A 1 469 ? 3.71000   43.97000 275.14500 1.000 69.62392  ? 472 TYR A N   1 
ATOM   3705 C CA  . TYR A 1 469 ? 2.30300   44.25900 274.87800 1.000 66.26103  ? 472 TYR A CA  1 
ATOM   3706 C C   . TYR A 1 469 ? 2.10500   45.73500 274.56600 1.000 66.55972  ? 472 TYR A C   1 
ATOM   3707 O O   . TYR A 1 469 ? 1.43400   46.09100 273.59300 1.000 66.37858  ? 472 TYR A O   1 
ATOM   3708 C CB  . TYR A 1 469 ? 1.42500   43.86800 276.06700 1.000 71.44748  ? 472 TYR A CB  1 
ATOM   3709 C CG  . TYR A 1 469 ? 1.21400   42.39000 276.30800 1.000 73.91565  ? 472 TYR A CG  1 
ATOM   3710 C CD1 . TYR A 1 469 ? 1.00800   41.50700 275.26000 1.000 74.70374  ? 472 TYR A CD1 1 
ATOM   3711 C CD2 . TYR A 1 469 ? 1.20500   41.88100 277.60100 1.000 72.97937  ? 472 TYR A CD2 1 
ATOM   3712 C CE1 . TYR A 1 469 ? 0.80700   40.15200 275.49600 1.000 77.75130  ? 472 TYR A CE1 1 
ATOM   3713 C CE2 . TYR A 1 469 ? 1.01200   40.53500 277.84500 1.000 77.17823  ? 472 TYR A CE2 1 
ATOM   3714 C CZ  . TYR A 1 469 ? 0.80900   39.67400 276.79300 1.000 81.90234  ? 472 TYR A CZ  1 
ATOM   3715 O OH  . TYR A 1 469 ? 0.61900   38.33100 277.05000 1.000 88.20709  ? 472 TYR A OH  1 
ATOM   3716 N N   . TRP A 1 470 ? 2.68600   46.61200 275.39000 1.000 66.88733  ? 473 TRP A N   1 
ATOM   3717 C CA  . TRP A 1 470 ? 2.51600   48.05000 275.19600 1.000 66.55915  ? 473 TRP A CA  1 
ATOM   3718 C C   . TRP A 1 470 ? 3.07900   48.49200 273.85000 1.000 67.57644  ? 473 TRP A C   1 
ATOM   3719 O O   . TRP A 1 470 ? 2.37600   49.10800 273.04200 1.000 66.28053  ? 473 TRP A O   1 
ATOM   3720 C CB  . TRP A 1 470 ? 3.19800   48.81600 276.33000 1.000 62.79200  ? 473 TRP A CB  1 
ATOM   3721 C CG  . TRP A 1 470 ? 2.33700   49.21500 277.51800 1.000 68.66677  ? 473 TRP A CG  1 
ATOM   3722 C CD1 . TRP A 1 470 ? 2.28200   50.45400 278.10600 1.000 67.71730  ? 473 TRP A CD1 1 
ATOM   3723 C CD2 . TRP A 1 470 ? 1.45700   48.37500 278.29000 1.000 68.89653  ? 473 TRP A CD2 1 
ATOM   3724 N NE1 . TRP A 1 470 ? 1.42200   50.43800 279.17900 1.000 66.01992  ? 473 TRP A NE1 1 
ATOM   3725 C CE2 . TRP A 1 470 ? 0.90500   49.17700 279.31500 1.000 63.40589  ? 473 TRP A CE2 1 
ATOM   3726 C CE3 . TRP A 1 470 ? 1.08200   47.03000 278.21300 1.000 67.49141  ? 473 TRP A CE3 1 
ATOM   3727 C CZ2 . TRP A 1 470 ? -0.00700  48.68400 280.23600 1.000 60.52481  ? 473 TRP A CZ2 1 
ATOM   3728 C CZ3 . TRP A 1 470 ? 0.18100   46.53900 279.13900 1.000 66.67348  ? 473 TRP A CZ3 1 
ATOM   3729 C CH2 . TRP A 1 470 ? -0.35600  47.36500 280.13600 1.000 64.23190  ? 473 TRP A CH2 1 
ATOM   3730 N N   . ALA A 1 471 ? 4.35200   48.18000 273.59300 1.000 69.91765  ? 474 ALA A N   1 
ATOM   3731 C CA  . ALA A 1 471 ? 5.00700   48.63600 272.36800 1.000 69.54057  ? 474 ALA A CA  1 
ATOM   3732 C C   . ALA A 1 471 ? 4.34200   48.05100 271.12500 1.000 64.34545  ? 474 ALA A C   1 
ATOM   3733 O O   . ALA A 1 471 ? 4.00000   48.78200 270.19200 1.000 63.69754  ? 474 ALA A O   1 
ATOM   3734 C CB  . ALA A 1 471 ? 6.49200   48.27600 272.41100 1.000 68.54749  ? 474 ALA A CB  1 
ATOM   3735 N N   . THR A 1 472 ? 4.15500   46.73000 271.09600 1.000 66.01305  ? 475 THR A N   1 
ATOM   3736 C CA  . THR A 1 472 ? 3.43600   46.10100 269.99300 1.000 65.79639  ? 475 THR A CA  1 
ATOM   3737 C C   . THR A 1 472 ? 2.04900   46.70000 269.81100 1.000 68.61678  ? 475 THR A C   1 
ATOM   3738 O O   . THR A 1 472 ? 1.56000   46.79500 268.67800 1.000 70.54156  ? 475 THR A O   1 
ATOM   3739 C CB  . THR A 1 472 ? 3.31800   44.59500 270.22100 1.000 70.72183  ? 475 THR A CB  1 
ATOM   3740 O OG1 . THR A 1 472 ? 4.61900   44.03600 270.43800 1.000 77.59304  ? 475 THR A OG1 1 
ATOM   3741 C CG2 . THR A 1 472 ? 2.66100   43.91600 269.03700 1.000 68.74914  ? 475 THR A CG2 1 
ATOM   3742 N N   . PHE A 1 473 ? 1.39000   47.10600 270.89700 1.000 64.44772  ? 476 PHE A N   1 
ATOM   3743 C CA  . PHE A 1 473 ? 0.11300   47.79300 270.73100 1.000 65.57942  ? 476 PHE A CA  1 
ATOM   3744 C C   . PHE A 1 473 ? 0.31100   49.16800 270.10700 1.000 63.13552  ? 476 PHE A C   1 
ATOM   3745 O O   . PHE A 1 473 ? -0.41900  49.55300 269.18700 1.000 62.76600  ? 476 PHE A O   1 
ATOM   3746 C CB  . PHE A 1 473 ? -0.63000  47.92600 272.06300 1.000 65.73958  ? 476 PHE A CB  1 
ATOM   3747 C CG  . PHE A 1 473 ? -1.77300  48.91300 272.01300 1.000 60.36869  ? 476 PHE A CG  1 
ATOM   3748 C CD1 . PHE A 1 473 ? -3.03200  48.51400 271.56500 1.000 57.51404  ? 476 PHE A CD1 1 
ATOM   3749 C CD2 . PHE A 1 473 ? -1.58200  50.24400 272.39500 1.000 57.18625  ? 476 PHE A CD2 1 
ATOM   3750 C CE1 . PHE A 1 473 ? -4.08000  49.41800 271.50200 1.000 55.66205  ? 476 PHE A CE1 1 
ATOM   3751 C CE2 . PHE A 1 473 ? -2.62200  51.16000 272.33100 1.000 55.93044  ? 476 PHE A CE2 1 
ATOM   3752 C CZ  . PHE A 1 473 ? -3.87600  50.74500 271.88900 1.000 57.35693  ? 476 PHE A CZ  1 
ATOM   3753 N N   . ALA A 1 474 ? 1.27400   49.93800 270.62000 1.000 62.80334  ? 477 ALA A N   1 
ATOM   3754 C CA  . ALA A 1 474 ? 1.51400   51.27300 270.08300 1.000 63.33120  ? 477 ALA A CA  1 
ATOM   3755 C C   . ALA A 1 474 ? 1.85300   51.21200 268.59800 1.000 67.85129  ? 477 ALA A C   1 
ATOM   3756 O O   . ALA A 1 474 ? 1.44700   52.09000 267.82200 1.000 67.57239  ? 477 ALA A O   1 
ATOM   3757 C CB  . ALA A 1 474 ? 2.63000   51.95800 270.87400 1.000 57.91572  ? 477 ALA A CB  1 
ATOM   3758 N N   . LYS A 1 475 ? 2.55800   50.15600 268.18700 1.000 67.05573  ? 478 LYS A N   1 
ATOM   3759 C CA  . LYS A 1 475 ? 3.01400   49.99700 266.81200 1.000 71.36251  ? 478 LYS A CA  1 
ATOM   3760 C C   . LYS A 1 475 ? 1.87600   49.59400 265.87400 1.000 69.03997  ? 478 LYS A C   1 
ATOM   3761 O O   . LYS A 1 475 ? 1.83800   50.04300 264.72800 1.000 67.00206  ? 478 LYS A O   1 
ATOM   3762 C CB  . LYS A 1 475 ? 4.15100   48.96500 266.78200 1.000 71.29780  ? 478 LYS A CB  1 
ATOM   3763 C CG  . LYS A 1 475 ? 4.58100   48.46600 265.41500 1.000 79.45363  ? 478 LYS A CG  1 
ATOM   3764 C CD  . LYS A 1 475 ? 5.35100   47.13100 265.55300 1.000 85.46390  ? 478 LYS A CD  1 
ATOM   3765 C CE  . LYS A 1 475 ? 5.67600   46.47800 264.18400 1.000 92.02915  ? 478 LYS A CE  1 
ATOM   3766 N NZ  . LYS A 1 475 ? 6.73400   47.20800 263.41900 1.000 88.17227  ? 478 LYS A NZ  1 
ATOM   3767 N N   . THR A 1 476 ? 0.93300   48.76800 266.34200 1.000 67.58968  ? 479 THR A N   1 
ATOM   3768 C CA  . THR A 1 476 ? -0.02600  48.11200 265.45400 1.000 61.31120  ? 479 THR A CA  1 
ATOM   3769 C C   . THR A 1 476 ? -1.49800  48.28300 265.84700 1.000 65.78139  ? 479 THR A C   1 
ATOM   3770 O O   . THR A 1 476 ? -2.37900  48.12900 264.99800 1.000 60.29924  ? 479 THR A O   1 
ATOM   3771 C CB  . THR A 1 476 ? 0.28500   46.60400 265.37100 1.000 62.33230  ? 479 THR A CB  1 
ATOM   3772 O OG1 . THR A 1 476 ? -0.47300  45.87000 266.35100 1.000 64.06593  ? 479 THR A OG1 1 
ATOM   3773 C CG2 . THR A 1 476 ? 1.75300   46.33800 265.60700 1.000 66.33136  ? 479 THR A CG2 1 
ATOM   3774 N N   . GLY A 1 477 ? -1.79100  48.55100 267.12500 1.000 71.89984  ? 480 GLY A N   1 
ATOM   3775 C CA  . GLY A 1 477 ? -3.16100  48.50700 267.62100 1.000 61.18736  ? 480 GLY A CA  1 
ATOM   3776 C C   . GLY A 1 477 ? -3.61200  47.14400 268.10100 1.000 62.30945  ? 480 GLY A C   1 
ATOM   3777 O O   . GLY A 1 477 ? -4.82100  46.87600 268.14500 1.000 61.62129  ? 480 GLY A O   1 
ATOM   3778 N N   . ASN A 1 478 ? -2.67600  46.26500 268.42300 1.000 61.04082  ? 481 ASN A N   1 
ATOM   3779 C CA  . ASN A 1 478 ? -2.92200  44.94000 268.96600 1.000 67.52251  ? 481 ASN A CA  1 
ATOM   3780 C C   . ASN A 1 478 ? -1.67600  44.55800 269.76600 1.000 74.59710  ? 481 ASN A C   1 
ATOM   3781 O O   . ASN A 1 478 ? -0.56900  44.52900 269.20500 1.000 77.95480  ? 481 ASN A O   1 
ATOM   3782 C CB  . ASN A 1 478 ? -3.21500  43.94600 267.84200 1.000 62.74162  ? 481 ASN A CB  1 
ATOM   3783 C CG  . ASN A 1 478 ? -3.69400  42.59800 268.34800 1.000 72.67716  ? 481 ASN A CG  1 
ATOM   3784 O OD1 . ASN A 1 478 ? -3.30300  42.14000 269.42100 1.000 78.72438  ? 481 ASN A OD1 1 
ATOM   3785 N ND2 . ASN A 1 478 ? -4.53900  41.94800 267.56500 1.000 74.06118  ? 481 ASN A ND2 1 
ATOM   3786 N N   . PRO A 1 479 ? -1.79600  44.30500 271.07800 1.000 70.65420  ? 482 PRO A N   1 
ATOM   3787 C CA  . PRO A 1 479 ? -0.60700  43.92300 271.85900 1.000 73.74134  ? 482 PRO A CA  1 
ATOM   3788 C C   . PRO A 1 479 ? -0.06000  42.55800 271.48700 1.000 74.31924  ? 482 PRO A C   1 
ATOM   3789 O O   . PRO A 1 479 ? 1.09200   42.25100 271.83000 1.000 71.52968  ? 482 PRO A O   1 
ATOM   3790 C CB  . PRO A 1 479 ? -1.12200  43.93700 273.30500 1.000 70.02201  ? 482 PRO A CB  1 
ATOM   3791 C CG  . PRO A 1 479 ? -2.57600  43.58700 273.16300 1.000 70.03748  ? 482 PRO A CG  1 
ATOM   3792 C CD  . PRO A 1 479 ? -3.02100  44.28900 271.89800 1.000 70.59170  ? 482 PRO A CD  1 
ATOM   3793 N N   . ASN A 1 480 ? -0.85700  41.74000 270.79600 1.000 79.73078  ? 483 ASN A N   1 
ATOM   3794 C CA  . ASN A 1 480 ? -0.47100  40.38600 270.42800 1.000 83.43579  ? 483 ASN A CA  1 
ATOM   3795 C C   . ASN A 1 480 ? 0.45600   40.38800 269.22300 1.000 87.70661  ? 483 ASN A C   1 
ATOM   3796 O O   . ASN A 1 480 ? 0.23500   41.11400 268.24600 1.000 83.06486  ? 483 ASN A O   1 
ATOM   3797 C CB  . ASN A 1 480 ? -1.71200  39.55100 270.11900 1.000 79.01751  ? 483 ASN A CB  1 
ATOM   3798 C CG  . ASN A 1 480 ? -2.62200  39.40500 271.31400 1.000 80.42395  ? 483 ASN A CG  1 
ATOM   3799 O OD1 . ASN A 1 480 ? -2.18300  38.98400 272.38500 1.000 79.92530  ? 483 ASN A OD1 1 
ATOM   3800 N ND2 . ASN A 1 480 ? -3.89100  39.76300 271.14700 1.000 75.08467  ? 483 ASN A ND2 1 
ATOM   3801 N N   . GLU A 1 481 ? 1.50200   39.57900 269.30500 1.000 95.92284  ? 484 GLU A N   1 
ATOM   3802 C CA  . GLU A 1 481 ? 2.33200   39.33100 268.13500 1.000 102.58582 ? 484 GLU A CA  1 
ATOM   3803 C C   . GLU A 1 481 ? 1.54800   38.48100 267.14300 1.000 109.70685 ? 484 GLU A C   1 
ATOM   3804 O O   . GLU A 1 481 ? 0.94000   37.47600 267.54100 1.000 107.46792 ? 484 GLU A O   1 
ATOM   3805 C CB  . GLU A 1 481 ? 3.63100   38.62100 268.52400 1.000 107.28410 ? 484 GLU A CB  1 
ATOM   3806 C CG  . GLU A 1 481 ? 4.76800   39.53400 268.97300 1.000 101.17345 ? 484 GLU A CG  1 
ATOM   3807 C CD  . GLU A 1 481 ? 5.47000   40.23000 267.80900 1.000 104.53997 ? 484 GLU A CD  1 
ATOM   3808 O OE1 . GLU A 1 481 ? 4.80700   40.55000 266.79300 1.000 107.44809 ? 484 GLU A OE1 1 
ATOM   3809 O OE2 . GLU A 1 481 ? 6.69800   40.45100 267.91100 1.000 99.90424  ? 484 GLU A OE2 1 
ATOM   3810 N N   . PRO A 1 482 ? 1.50600   38.85400 265.86300 1.000 115.07929 ? 485 PRO A N   1 
ATOM   3811 C CA  . PRO A 1 482 ? 0.88700   37.96700 264.87300 1.000 116.04785 ? 485 PRO A CA  1 
ATOM   3812 C C   . PRO A 1 482 ? 1.76000   36.73800 264.69500 1.000 119.39591 ? 485 PRO A C   1 
ATOM   3813 O O   . PRO A 1 482 ? 2.99100   36.83200 264.67400 1.000 118.28373 ? 485 PRO A O   1 
ATOM   3814 C CB  . PRO A 1 482 ? 0.82800   38.82500 263.60500 1.000 111.14515 ? 485 PRO A CB  1 
ATOM   3815 C CG  . PRO A 1 482 ? 1.94300   39.79800 263.76700 1.000 110.72099 ? 485 PRO A CG  1 
ATOM   3816 C CD  . PRO A 1 482 ? 2.09800   40.05500 265.24300 1.000 110.61703 ? 485 PRO A CD  1 
ATOM   3817 N N   . HIS A 1 483 ? 1.11300   35.57700 264.61100 1.000 120.16205 ? 486 HIS A N   1 
ATOM   3818 C CA  . HIS A 1 483 ? 1.80500   34.29000 264.65100 1.000 125.13780 ? 486 HIS A CA  1 
ATOM   3819 C C   . HIS A 1 483 ? 2.73100   34.22700 265.87400 1.000 125.48610 ? 486 HIS A C   1 
ATOM   3820 O O   . HIS A 1 483 ? 3.95300   34.36400 265.78600 1.000 124.67991 ? 486 HIS A O   1 
ATOM   3821 C CB  . HIS A 1 483 ? 2.58300   34.03500 263.34900 1.000 128.01382 ? 486 HIS A CB  1 
ATOM   3822 C CG  . HIS A 1 483 ? 1.89300   34.52500 262.10800 1.000 124.05094 ? 486 HIS A CG  1 
ATOM   3823 N ND1 . HIS A 1 483 ? 2.49900   35.38000 261.21000 1.000 121.64544 ? 486 HIS A ND1 1 
ATOM   3824 C CD2 . HIS A 1 483 ? 0.66100   34.26700 261.60700 1.000 123.75313 ? 486 HIS A CD2 1 
ATOM   3825 C CE1 . HIS A 1 483 ? 1.66700   35.63600 260.21600 1.000 125.56813 ? 486 HIS A CE1 1 
ATOM   3826 N NE2 . HIS A 1 483 ? 0.54500   34.97200 260.43100 1.000 127.62558 ? 486 HIS A NE2 1 
ATOM   3827 N N   . SER A 1 484 ? 2.09800   34.04300 267.03300 1.000 128.76324 ? 487 SER A N   1 
ATOM   3828 C CA  . SER A 1 484 ? 2.78700   33.98400 268.31500 1.000 128.51913 ? 487 SER A CA  1 
ATOM   3829 C C   . SER A 1 484 ? 2.30900   32.75800 269.08500 1.000 134.15409 ? 487 SER A C   1 
ATOM   3830 O O   . SER A 1 484 ? 1.23600   32.20900 268.81700 1.000 131.54367 ? 487 SER A O   1 
ATOM   3831 C CB  . SER A 1 484 ? 2.55400   35.26200 269.14500 1.000 123.32206 ? 487 SER A CB  1 
ATOM   3832 O OG  . SER A 1 484 ? 3.41900   35.33200 270.26700 1.000 125.34685 ? 487 SER A OG  1 
ATOM   3833 N N   . GLN A 1 485 ? 3.11900   32.34300 270.06200 1.000 138.02203 ? 488 GLN A N   1 
ATOM   3834 C CA  . GLN A 1 485 ? 2.90200   31.08500 270.77000 1.000 136.66613 ? 488 GLN A CA  1 
ATOM   3835 C C   . GLN A 1 485 ? 2.17300   31.24400 272.09900 1.000 133.51607 ? 488 GLN A C   1 
ATOM   3836 O O   . GLN A 1 485 ? 1.54700   30.28200 272.56000 1.000 128.77058 ? 488 GLN A O   1 
ATOM   3837 C CB  . GLN A 1 485 ? 4.24500   30.38000 271.01400 1.000 136.29318 ? 488 GLN A CB  1 
ATOM   3838 C CG  . GLN A 1 485 ? 5.36000   30.73900 270.01300 1.000 141.41653 ? 488 GLN A CG  1 
ATOM   3839 C CD  . GLN A 1 485 ? 5.19700   30.09300 268.63500 1.000 144.68102 ? 488 GLN A CD  1 
ATOM   3840 O OE1 . GLN A 1 485 ? 4.18200   30.27800 267.95500 1.000 140.88905 ? 488 GLN A OE1 1 
ATOM   3841 N NE2 . GLN A 1 485 ? 6.21200   29.33800 268.21600 1.000 143.98675 ? 488 GLN A NE2 1 
ATOM   3842 N N   . GLU A 1 486 ? 2.24200   32.41900 272.72500 1.000 131.82304 ? 489 GLU A N   1 
ATOM   3843 C CA  . GLU A 1 486 ? 1.54700   32.63900 273.98400 1.000 129.73681 ? 489 GLU A CA  1 
ATOM   3844 C C   . GLU A 1 486 ? 0.04200   32.75400 273.75300 1.000 125.83961 ? 489 GLU A C   1 
ATOM   3845 O O   . GLU A 1 486 ? -0.43500  32.89500 272.62100 1.000 122.96705 ? 489 GLU A O   1 
ATOM   3846 C CB  . GLU A 1 486 ? 2.07300   33.89400 274.68100 1.000 130.51216 ? 489 GLU A CB  1 
ATOM   3847 C CG  . GLU A 1 486 ? 3.28400   33.64800 275.56400 1.000 136.71689 ? 489 GLU A CG  1 
ATOM   3848 C CD  . GLU A 1 486 ? 4.49800   33.19600 274.77600 1.000 135.80907 ? 489 GLU A CD  1 
ATOM   3849 O OE1 . GLU A 1 486 ? 4.57200   33.51500 273.56900 1.000 132.96691 ? 489 GLU A OE1 1 
ATOM   3850 O OE2 . GLU A 1 486 ? 5.37500   32.52400 275.36500 1.000 134.14713 ? 489 GLU A OE2 1 
ATOM   3851 N N   . SER A 1 487 ? -0.71100  32.67900 274.85100 1.000 122.67070 ? 490 SER A N   1 
ATOM   3852 C CA  . SER A 1 487 ? -2.15400  32.86300 274.78300 1.000 114.61054 ? 490 SER A CA  1 
ATOM   3853 C C   . SER A 1 487 ? -2.47100  34.28300 274.33600 1.000 110.52771 ? 490 SER A C   1 
ATOM   3854 O O   . SER A 1 487 ? -1.75600  35.23300 274.67100 1.000 109.54459 ? 490 SER A O   1 
ATOM   3855 C CB  . SER A 1 487 ? -2.79300  32.57800 276.14200 1.000 113.36180 ? 490 SER A CB  1 
ATOM   3856 O OG  . SER A 1 487 ? -2.47700  31.27300 276.59900 1.000 116.10581 ? 490 SER A OG  1 
ATOM   3857 N N   . LYS A 1 488 ? -3.54100  34.43000 273.56200 1.000 103.90504 ? 491 LYS A N   1 
ATOM   3858 C CA  . LYS A 1 488 ? -3.88600  35.72100 272.98300 1.000 95.02141  ? 491 LYS A CA  1 
ATOM   3859 C C   . LYS A 1 488 ? -4.76300  36.52100 273.94100 1.000 96.41718  ? 491 LYS A C   1 
ATOM   3860 O O   . LYS A 1 488 ? -5.79400  36.02600 274.41000 1.000 97.70412  ? 491 LYS A O   1 
ATOM   3861 C CB  . LYS A 1 488 ? -4.58500  35.54200 271.63400 1.000 91.60241  ? 491 LYS A CB  1 
ATOM   3862 C CG  . LYS A 1 488 ? -3.62900  35.10800 270.51600 1.000 98.56511  ? 491 LYS A CG  1 
ATOM   3863 C CD  . LYS A 1 488 ? -4.15900  35.44500 269.13200 1.000 93.53137  ? 491 LYS A CD  1 
ATOM   3864 C CE  . LYS A 1 488 ? -3.16700  35.02000 268.06200 1.000 110.20508 ? 491 LYS A CE  1 
ATOM   3865 N NZ  . LYS A 1 488 ? -1.81500  35.61500 268.29300 1.000 112.48092 ? 491 LYS A NZ  1 
ATOM   3866 N N   . TRP A 1 489 ? -4.32700  37.75300 274.24800 1.000 90.02969  ? 492 TRP A N   1 
ATOM   3867 C CA  . TRP A 1 489 ? -5.08400  38.76600 274.97600 1.000 76.29225  ? 492 TRP A CA  1 
ATOM   3868 C C   . TRP A 1 489 ? -6.29800  39.15200 274.13700 1.000 76.62684  ? 492 TRP A C   1 
ATOM   3869 O O   . TRP A 1 489 ? -6.16500  39.88200 273.14500 1.000 74.29169  ? 492 TRP A O   1 
ATOM   3870 C CB  . TRP A 1 489 ? -4.17400  39.96800 275.27900 1.000 72.51268  ? 492 TRP A CB  1 
ATOM   3871 C CG  . TRP A 1 489 ? -4.79900  41.19300 275.96900 1.000 69.68185  ? 492 TRP A CG  1 
ATOM   3872 C CD1 . TRP A 1 489 ? -6.13200  41.45600 276.17500 1.000 68.29075  ? 492 TRP A CD1 1 
ATOM   3873 C CD2 . TRP A 1 489 ? -4.08900  42.30700 276.52600 1.000 62.06556  ? 492 TRP A CD2 1 
ATOM   3874 N NE1 . TRP A 1 489 ? -6.28700  42.66400 276.81000 1.000 63.59767  ? 492 TRP A NE1 1 
ATOM   3875 C CE2 . TRP A 1 489 ? -5.04900  43.20300 277.04300 1.000 65.27343  ? 492 TRP A CE2 1 
ATOM   3876 C CE3 . TRP A 1 489 ? -2.73200  42.63300 276.63700 1.000 63.49735  ? 492 TRP A CE3 1 
ATOM   3877 C CZ2 . TRP A 1 489 ? -4.69300  44.40400 277.66200 1.000 64.18529  ? 492 TRP A CZ2 1 
ATOM   3878 C CZ3 . TRP A 1 489 ? -2.37900  43.82400 277.24800 1.000 62.65514  ? 492 TRP A CZ3 1 
ATOM   3879 C CH2 . TRP A 1 489 ? -3.35500  44.69600 277.75300 1.000 62.62304  ? 492 TRP A CH2 1 
ATOM   3880 N N   . PRO A 1 490 ? -7.45600  38.67700 274.47600 1.000 75.53953  ? 493 PRO A N   1 
ATOM   3881 C CA  . PRO A 1 490 ? -8.62600  38.94900 273.67900 1.000 67.40530  ? 493 PRO A CA  1 
ATOM   3882 C C   . PRO A 1 490 ? -9.08600  40.35400 273.67700 1.000 69.61130  ? 493 PRO A C   1 
ATOM   3883 O O   . PRO A 1 490 ? -8.85700  41.06100 274.58900 1.000 80.08709  ? 493 PRO A O   1 
ATOM   3884 C CB  . PRO A 1 490 ? -9.67600  38.10300 274.35000 1.000 67.74367  ? 493 PRO A CB  1 
ATOM   3885 C CG  . PRO A 1 490 ? -9.24400  38.03600 275.73300 1.000 77.95415  ? 493 PRO A CG  1 
ATOM   3886 C CD  . PRO A 1 490 ? -7.78200  37.85900 275.63400 1.000 78.07691  ? 493 PRO A CD  1 
ATOM   3887 N N   . LEU A 1 491 ? -9.75000  40.74200 272.61800 1.000 73.65423  ? 494 LEU A N   1 
ATOM   3888 C CA  . LEU A 1 491 ? -10.29600 42.05900 272.46900 1.000 72.00447  ? 494 LEU A CA  1 
ATOM   3889 C C   . LEU A 1 491 ? -11.45600 42.14900 273.39300 1.000 72.47665  ? 494 LEU A C   1 
ATOM   3890 O O   . LEU A 1 491 ? -12.01600 41.15600 273.76400 1.000 72.98919  ? 494 LEU A O   1 
ATOM   3891 C CB  . LEU A 1 491 ? -10.80400 42.23700 271.06000 1.000 75.89230  ? 494 LEU A CB  1 
ATOM   3892 C CG  . LEU A 1 491 ? -10.42400 43.46600 270.25900 1.000 75.12796  ? 494 LEU A CG  1 
ATOM   3893 C CD1 . LEU A 1 491 ? -8.91700  43.62100 270.17300 1.000 74.15450  ? 494 LEU A CD1 1 
ATOM   3894 C CD2 . LEU A 1 491 ? -11.01100 43.24800 268.89400 1.000 63.53963  ? 494 LEU A CD2 1 
ATOM   3895 N N   . PHE A 1 492 ? -11.81100 43.35700 273.76800 1.000 72.67648  ? 495 PHE A N   1 
ATOM   3896 C CA  . PHE A 1 492 ? -12.89600 43.59200 274.66800 1.000 70.34484  ? 495 PHE A CA  1 
ATOM   3897 C C   . PHE A 1 492 ? -14.05600 43.96100 273.81900 1.000 72.55354  ? 495 PHE A C   1 
ATOM   3898 O O   . PHE A 1 492 ? -13.98700 44.86700 273.04800 1.000 75.90590  ? 495 PHE A O   1 
ATOM   3899 C CB  . PHE A 1 492 ? -12.52100 44.75100 275.55700 1.000 65.02939  ? 495 PHE A CB  1 
ATOM   3900 C CG  . PHE A 1 492 ? -13.58000 45.17200 276.49700 1.000 72.51738  ? 495 PHE A CG  1 
ATOM   3901 C CD1 . PHE A 1 492 ? -13.73200 44.55900 277.68800 1.000 72.83011  ? 495 PHE A CD1 1 
ATOM   3902 C CD2 . PHE A 1 492 ? -14.38900 46.21800 276.20600 1.000 71.73006  ? 495 PHE A CD2 1 
ATOM   3903 C CE1 . PHE A 1 492 ? -14.69800 44.95500 278.55800 1.000 66.97694  ? 495 PHE A CE1 1 
ATOM   3904 C CE2 . PHE A 1 492 ? -15.35700 46.62500 277.07100 1.000 67.09390  ? 495 PHE A CE2 1 
ATOM   3905 C CZ  . PHE A 1 492 ? -15.51000 45.99000 278.24700 1.000 65.56001  ? 495 PHE A CZ  1 
ATOM   3906 N N   . THR A 1 493 ? -15.13400 43.22500 273.95900 1.000 73.45390  ? 496 THR A N   1 
ATOM   3907 C CA  . THR A 1 493 ? -16.34800 43.46800 273.19900 1.000 76.09553  ? 496 THR A CA  1 
ATOM   3908 C C   . THR A 1 493 ? -17.50600 43.70900 274.15600 1.000 77.68609  ? 496 THR A C   1 
ATOM   3909 O O   . THR A 1 493 ? -17.51100 43.20700 275.28400 1.000 73.36111  ? 496 THR A O   1 
ATOM   3910 C CB  . THR A 1 493 ? -16.66700 42.29100 272.27300 1.000 72.80779  ? 496 THR A CB  1 
ATOM   3911 O OG1 . THR A 1 493 ? -17.09600 41.16900 273.05600 1.000 77.61310  ? 496 THR A OG1 1 
ATOM   3912 C CG2 . THR A 1 493 ? -15.42800 41.89800 271.49700 1.000 65.53297  ? 496 THR A CG2 1 
ATOM   3913 N N   . THR A 1 494 ? -18.48700 44.49200 273.70000 1.000 76.69669  ? 497 THR A N   1 
ATOM   3914 C CA  . THR A 1 494 ? -19.67300 44.72100 274.51800 1.000 77.94824  ? 497 THR A CA  1 
ATOM   3915 C C   . THR A 1 494 ? -20.38500 43.41500 274.84400 1.000 76.73666  ? 497 THR A C   1 
ATOM   3916 O O   . THR A 1 494 ? -20.95400 43.27200 275.92900 1.000 76.12331  ? 497 THR A O   1 
ATOM   3917 C CB  . THR A 1 494 ? -20.62900 45.68600 273.81400 1.000 81.31205  ? 497 THR A CB  1 
ATOM   3918 O OG1 . THR A 1 494 ? -19.97400 46.94400 273.60700 1.000 80.85349  ? 497 THR A OG1 1 
ATOM   3919 C CG2 . THR A 1 494 ? -21.87700 45.91500 274.66800 1.000 84.32711  ? 497 THR A CG2 1 
ATOM   3920 N N   . LYS A 1 495 ? -20.34600 42.44700 273.92800 1.000 81.68009  ? 498 LYS A N   1 
ATOM   3921 C CA  . LYS A 1 495 ? -21.00400 41.16700 274.16400 1.000 82.93325  ? 498 LYS A CA  1 
ATOM   3922 C C   . LYS A 1 495 ? -20.30700 40.37800 275.27300 1.000 78.57851  ? 498 LYS A C   1 
ATOM   3923 O O   . LYS A 1 495 ? -20.92000 40.04300 276.29000 1.000 84.77420  ? 498 LYS A O   1 
ATOM   3924 C CB  . LYS A 1 495 ? -21.04600 40.35900 272.86200 1.000 84.54505  ? 498 LYS A CB  1 
ATOM   3925 C CG  . LYS A 1 495 ? -21.84000 39.04100 272.93200 1.000 88.63815  ? 498 LYS A CG  1 
ATOM   3926 C CD  . LYS A 1 495 ? -21.43000 38.10100 271.78600 1.000 98.00047  ? 498 LYS A CD  1 
ATOM   3927 C CE  . LYS A 1 495 ? -22.56800 37.17300 271.33900 1.000 98.75756  ? 498 LYS A CE  1 
ATOM   3928 N NZ  . LYS A 1 495 ? -22.22400 36.40600 270.09400 1.000 91.87058  ? 498 LYS A NZ  1 
ATOM   3929 N N   . GLU A 1 496 ? -19.02300 40.07400 275.09900 1.000 76.63227  ? 499 GLU A N   1 
ATOM   3930 C CA  . GLU A 1 496 ? -18.34900 39.12600 275.97600 1.000 78.46197  ? 499 GLU A CA  1 
ATOM   3931 C C   . GLU A 1 496 ? -17.52400 39.77900 277.08800 1.000 80.08489  ? 499 GLU A C   1 
ATOM   3932 O O   . GLU A 1 496 ? -17.34400 39.16600 278.14800 1.000 76.79472  ? 499 GLU A O   1 
ATOM   3933 C CB  . GLU A 1 496 ? -17.46800 38.19500 275.13900 1.000 83.88336  ? 499 GLU A CB  1 
ATOM   3934 C CG  . GLU A 1 496 ? -18.26100 37.24900 274.22500 1.000 88.50490  ? 499 GLU A CG  1 
ATOM   3935 C CD  . GLU A 1 496 ? -17.35800 36.35500 273.37100 1.000 103.15709 ? 499 GLU A CD  1 
ATOM   3936 O OE1 . GLU A 1 496 ? -16.76400 36.86800 272.38500 1.000 97.62320  ? 499 GLU A OE1 1 
ATOM   3937 O OE2 . GLU A 1 496 ? -17.23000 35.14600 273.70000 1.000 102.36036 ? 499 GLU A OE2 1 
ATOM   3938 N N   . GLN A 1 497 ? -17.01900 40.99800 276.87700 1.000 79.40813  ? 500 GLN A N   1 
ATOM   3939 C CA  . GLN A 1 497 ? -16.42700 41.82800 277.93900 1.000 72.18854  ? 500 GLN A CA  1 
ATOM   3940 C C   . GLN A 1 497 ? -15.20200 41.17900 278.57000 1.000 68.46962  ? 500 GLN A C   1 
ATOM   3941 O O   . GLN A 1 497 ? -14.95800 41.32900 279.76200 1.000 74.00025  ? 500 GLN A O   1 
ATOM   3942 C CB  . GLN A 1 497 ? -17.45700 42.16900 279.01400 1.000 68.47810  ? 500 GLN A CB  1 
ATOM   3943 C CG  . GLN A 1 497 ? -18.75400 42.68500 278.44900 1.000 76.44138  ? 500 GLN A CG  1 
ATOM   3944 C CD  . GLN A 1 497 ? -19.38800 43.74800 279.30900 1.000 74.54593  ? 500 GLN A CD  1 
ATOM   3945 O OE1 . GLN A 1 497 ? -19.35400 43.67000 280.53700 1.000 80.61824  ? 500 GLN A OE1 1 
ATOM   3946 N NE2 . GLN A 1 497 ? -19.98200 44.75200 278.66800 1.000 72.15793  ? 500 GLN A NE2 1 
ATOM   3947 N N   . LYS A 1 498 ? -14.41900 40.46400 277.77100 1.000 73.79107  ? 501 LYS A N   1 
ATOM   3948 C CA  . LYS A 1 498 ? -13.26500 39.76400 278.31500 1.000 72.70361  ? 501 LYS A CA  1 
ATOM   3949 C C   . LYS A 1 498 ? -12.17500 40.75300 278.72100 1.000 68.55230  ? 501 LYS A C   1 
ATOM   3950 O O   . LYS A 1 498 ? -12.15300 41.91200 278.29800 1.000 67.20995  ? 501 LYS A O   1 
ATOM   3951 C CB  . LYS A 1 498 ? -12.69500 38.77300 277.29500 1.000 75.26290  ? 501 LYS A CB  1 
ATOM   3952 C CG  . LYS A 1 498 ? -13.71000 37.87700 276.60200 1.000 75.87971  ? 501 LYS A CG  1 
ATOM   3953 C CD  . LYS A 1 498 ? -12.98200 36.73700 275.91500 1.000 79.22070  ? 501 LYS A CD  1 
ATOM   3954 C CE  . LYS A 1 498 ? -13.92400 35.68000 275.37000 1.000 80.15446  ? 501 LYS A CE  1 
ATOM   3955 N NZ  . LYS A 1 498 ? -13.13600 34.46100 275.01600 1.000 80.51964  ? 501 LYS A NZ  1 
ATOM   3956 N N   . PHE A 1 499 ? -11.25700 40.27200 279.55000 1.000 65.16290  ? 502 PHE A N   1 
ATOM   3957 C CA  . PHE A 1 499 ? -10.05300 41.01200 279.90300 1.000 65.67008  ? 502 PHE A CA  1 
ATOM   3958 C C   . PHE A 1 499 ? -9.05500  39.99500 280.43000 1.000 65.41145  ? 502 PHE A C   1 
ATOM   3959 O O   . PHE A 1 499 ? -9.40300  38.83400 280.65900 1.000 66.04071  ? 502 PHE A O   1 
ATOM   3960 C CB  . PHE A 1 499 ? -10.34600 42.11800 280.92800 1.000 70.02376  ? 502 PHE A CB  1 
ATOM   3961 C CG  . PHE A 1 499 ? -10.69800 41.60500 282.30700 1.000 67.84371  ? 502 PHE A CG  1 
ATOM   3962 C CD1 . PHE A 1 499 ? -11.98800 41.17700 282.60500 1.000 68.83910  ? 502 PHE A CD1 1 
ATOM   3963 C CD2 . PHE A 1 499 ? -9.74000  41.56300 283.31700 1.000 67.90199  ? 502 PHE A CD2 1 
ATOM   3964 C CE1 . PHE A 1 499 ? -12.30100 40.70400 283.88400 1.000 68.63163  ? 502 PHE A CE1 1 
ATOM   3965 C CE2 . PHE A 1 499 ? -10.06300 41.09200 284.60000 1.000 63.38971  ? 502 PHE A CE2 1 
ATOM   3966 C CZ  . PHE A 1 499 ? -11.33300 40.66800 284.87300 1.000 59.40964  ? 502 PHE A CZ  1 
ATOM   3967 N N   . ILE A 1 500 ? -7.80900  40.43500 280.63100 1.000 67.41614  ? 503 ILE A N   1 
ATOM   3968 C CA  . ILE A 1 500 ? -6.76300  39.51500 281.06800 1.000 73.23820  ? 503 ILE A CA  1 
ATOM   3969 C C   . ILE A 1 500 ? -6.11700  39.97600 282.37700 1.000 70.43915  ? 503 ILE A C   1 
ATOM   3970 O O   . ILE A 1 500 ? -6.25200  41.12500 282.81300 1.000 68.93623  ? 503 ILE A O   1 
ATOM   3971 C CB  . ILE A 1 500 ? -5.68000  39.29300 279.98600 1.000 70.60799  ? 503 ILE A CB  1 
ATOM   3972 C CG1 . ILE A 1 500 ? -4.73900  40.49200 279.86400 1.000 70.17403  ? 503 ILE A CG1 1 
ATOM   3973 C CG2 . ILE A 1 500 ? -6.31700  39.01100 278.66000 1.000 72.31373  ? 503 ILE A CG2 1 
ATOM   3974 C CD1 . ILE A 1 500 ? -3.33600  40.09600 279.41300 1.000 66.75857  ? 503 ILE A CD1 1 
ATOM   3975 N N   . ASP A 1 501 ? -5.41200  39.03200 283.00600 1.000 73.94918  ? 504 ASP A N   1 
ATOM   3976 C CA  . ASP A 1 501 ? -4.57600  39.25300 284.18100 1.000 76.58884  ? 504 ASP A CA  1 
ATOM   3977 C C   . ASP A 1 501 ? -3.15800  39.62200 283.77900 1.000 76.39814  ? 504 ASP A C   1 
ATOM   3978 O O   . ASP A 1 501 ? -2.61200  39.08400 282.81600 1.000 81.37870  ? 504 ASP A O   1 
ATOM   3979 C CB  . ASP A 1 501 ? -4.48900  37.99000 285.03900 1.000 81.56875  ? 504 ASP A CB  1 
ATOM   3980 C CG  . ASP A 1 501 ? -5.74700  37.72500 285.82900 1.000 91.55698  ? 504 ASP A CG  1 
ATOM   3981 O OD1 . ASP A 1 501 ? -6.56500  38.66700 285.98400 1.000 88.17514  ? 504 ASP A OD1 1 
ATOM   3982 O OD2 . ASP A 1 501 ? -5.90400  36.57200 286.30700 1.000 94.02414  ? 504 ASP A OD2 1 
ATOM   3983 N N   . LEU A 1 502 ? -2.54000  40.49500 284.56300 1.000 70.97862  ? 505 LEU A N   1 
ATOM   3984 C CA  . LEU A 1 502 ? -1.12200  40.81300 284.40700 1.000 70.46941  ? 505 LEU A CA  1 
ATOM   3985 C C   . LEU A 1 502 ? -0.40700  40.47700 285.71700 1.000 74.90436  ? 505 LEU A C   1 
ATOM   3986 O O   . LEU A 1 502 ? -0.47100  41.23700 286.69100 1.000 74.83205  ? 505 LEU A O   1 
ATOM   3987 C CB  . LEU A 1 502 ? -0.93300  42.26900 284.00700 1.000 69.49063  ? 505 LEU A CB  1 
ATOM   3988 C CG  . LEU A 1 502 ? -1.41100  42.64100 282.60300 1.000 64.21915  ? 505 LEU A CG  1 
ATOM   3989 C CD1 . LEU A 1 502 ? -1.26200  44.12900 282.41200 1.000 61.51227  ? 505 LEU A CD1 1 
ATOM   3990 C CD2 . LEU A 1 502 ? -0.61900  41.90100 281.55300 1.000 61.83444  ? 505 LEU A CD2 1 
ATOM   3991 N N   . ASN A 1 503 ? 0.26200   39.32800 285.73800 1.000 74.69386  ? 506 ASN A N   1 
ATOM   3992 C CA  . ASN A 1 503 ? 0.97200   38.84200 286.91300 1.000 73.76457  ? 506 ASN A CA  1 
ATOM   3993 C C   . ASN A 1 503 ? 1.93900   37.76300 286.45300 1.000 76.20348  ? 506 ASN A C   1 
ATOM   3994 O O   . ASN A 1 503 ? 1.96900   37.39700 285.27600 1.000 84.11515  ? 506 ASN A O   1 
ATOM   3995 C CB  . ASN A 1 503 ? 0.00600   38.30600 287.97000 1.000 75.52682  ? 506 ASN A CB  1 
ATOM   3996 C CG  . ASN A 1 503 ? -0.89900  37.22700 287.42900 1.000 75.03930  ? 506 ASN A CG  1 
ATOM   3997 O OD1 . ASN A 1 503 ? -0.43200  36.17700 287.01400 1.000 79.06903  ? 506 ASN A OD1 1 
ATOM   3998 N ND2 . ASN A 1 503 ? -2.20200  37.47800 287.43600 1.000 76.10281  ? 506 ASN A ND2 1 
ATOM   3999 N N   . THR A 1 504 ? 2.71500   37.23400 287.39500 1.000 74.56082  ? 507 THR A N   1 
ATOM   4000 C CA  . THR A 1 504 ? 3.69700   36.21100 287.05900 1.000 73.46071  ? 507 THR A CA  1 
ATOM   4001 C C   . THR A 1 504 ? 3.06300   34.84800 286.76700 1.000 76.69775  ? 507 THR A C   1 
ATOM   4002 O O   . THR A 1 504 ? 3.74100   33.97000 286.22600 1.000 69.95871  ? 507 THR A O   1 
ATOM   4003 C CB  . THR A 1 504 ? 4.72800   36.09800 288.19100 1.000 78.08379  ? 507 THR A CB  1 
ATOM   4004 O OG1 . THR A 1 504 ? 4.05600   35.90900 289.44600 1.000 79.70359  ? 507 THR A OG1 1 
ATOM   4005 C CG2 . THR A 1 504 ? 5.57200   37.36400 288.27300 1.000 72.04643  ? 507 THR A CG2 1 
ATOM   4006 N N   . GLU A 1 505 ? 1.79100   34.64400 287.10800 1.000 82.93697  ? 508 GLU A N   1 
ATOM   4007 C CA  . GLU A 1 505 ? 1.12200   33.38000 286.82100 1.000 84.84390  ? 508 GLU A CA  1 
ATOM   4008 C C   . GLU A 1 505 ? 0.68700   33.32800 285.35400 1.000 84.66443  ? 508 GLU A C   1 
ATOM   4009 O O   . GLU A 1 505 ? 0.54200   34.36900 284.70600 1.000 83.81269  ? 508 GLU A O   1 
ATOM   4010 C CB  . GLU A 1 505 ? -0.08000  33.19400 287.75100 1.000 81.20695  ? 508 GLU A CB  1 
ATOM   4011 C CG  . GLU A 1 505 ? 0.19500   32.33100 288.97800 1.000 89.73671  ? 508 GLU A CG  1 
ATOM   4012 C CD  . GLU A 1 505 ? 1.02200   33.04400 290.05200 1.000 105.58209 ? 508 GLU A CD  1 
ATOM   4013 O OE1 . GLU A 1 505 ? 0.54600   34.08200 290.58200 1.000 109.74837 ? 508 GLU A OE1 1 
ATOM   4014 O OE2 . GLU A 1 505 ? 2.14300   32.56400 290.36800 1.000 102.00657 ? 508 GLU A OE2 1 
ATOM   4015 N N   . PRO A 1 506 ? 0.49300   32.12600 284.79500 1.000 86.75282  ? 509 PRO A N   1 
ATOM   4016 C CA  . PRO A 1 506 ? 0.11800   32.03200 283.37800 1.000 86.49087  ? 509 PRO A CA  1 
ATOM   4017 C C   . PRO A 1 506 ? -1.14800  32.82400 283.10000 1.000 87.13676  ? 509 PRO A C   1 
ATOM   4018 O O   . PRO A 1 506 ? -2.07700  32.83400 283.91000 1.000 84.55886  ? 509 PRO A O   1 
ATOM   4019 C CB  . PRO A 1 506 ? -0.09800  30.53000 283.16700 1.000 85.68480  ? 509 PRO A CB  1 
ATOM   4020 C CG  . PRO A 1 506 ? 0.75100   29.89300 284.20400 1.000 85.99948  ? 509 PRO A CG  1 
ATOM   4021 C CD  . PRO A 1 506 ? 0.65200   30.79100 285.39800 1.000 85.58074  ? 509 PRO A CD  1 
ATOM   4022 N N   . MET A 1 507 ? -1.16800  33.49800 281.94600 1.000 84.52046  ? 510 MET A N   1 
ATOM   4023 C CA  . MET A 1 507 ? -2.23600  34.44300 281.64700 1.000 82.94259  ? 510 MET A CA  1 
ATOM   4024 C C   . MET A 1 507 ? -3.59800  33.77400 281.76100 1.000 85.67952  ? 510 MET A C   1 
ATOM   4025 O O   . MET A 1 507 ? -3.76300  32.59900 281.41900 1.000 85.88589  ? 510 MET A O   1 
ATOM   4026 C CB  . MET A 1 507 ? -2.05200  35.02900 280.25000 1.000 85.83921  ? 510 MET A CB  1 
ATOM   4027 C CG  . MET A 1 507 ? -3.05000  36.13500 279.90300 1.000 88.98543  ? 510 MET A CG  1 
ATOM   4028 S SD  . MET A 1 507 ? -3.46600  36.20100 278.13200 1.000 105.49153 ? 510 MET A SD  1 
ATOM   4029 C CE  . MET A 1 507 ? -1.90100  36.69500 277.41900 1.000 93.57112  ? 510 MET A CE  1 
ATOM   4030 N N   . LYS A 1 508 ? -4.56700  34.52100 282.29100 1.000 84.47605  ? 511 LYS A N   1 
ATOM   4031 C CA  . LYS A 1 508 ? -5.93100  34.04200 282.43700 1.000 80.01503  ? 511 LYS A CA  1 
ATOM   4032 C C   . LYS A 1 508 ? -6.89400  35.13200 281.99900 1.000 78.92862  ? 511 LYS A C   1 
ATOM   4033 O O   . LYS A 1 508 ? -6.60200  36.32400 282.11000 1.000 80.65867  ? 511 LYS A O   1 
ATOM   4034 C CB  . LYS A 1 508 ? -6.24000  33.61200 283.87300 1.000 81.07452  ? 511 LYS A CB  1 
ATOM   4035 C CG  . LYS A 1 508 ? -6.10300  32.12000 284.09800 1.000 89.40239  ? 511 LYS A CG  1 
ATOM   4036 C CD  . LYS A 1 508 ? -7.39600  31.51300 284.63700 1.000 94.24530  ? 511 LYS A CD  1 
ATOM   4037 C CE  . LYS A 1 508 ? -7.15300  30.76700 285.95100 1.000 92.91178  ? 511 LYS A CE  1 
ATOM   4038 N NZ  . LYS A 1 508 ? -6.66700  31.68300 287.03000 1.000 92.02865  ? 511 LYS A NZ  1 
ATOM   4039 N N   . VAL A 1 509 ? -8.05200  34.70900 281.51200 1.000 77.34521  ? 512 VAL A N   1 
ATOM   4040 C CA  . VAL A 1 509 ? -9.03800  35.59900 280.92400 1.000 73.52571  ? 512 VAL A CA  1 
ATOM   4041 C C   . VAL A 1 509 ? -10.32800 35.50800 281.72600 1.000 75.28396  ? 512 VAL A C   1 
ATOM   4042 O O   . VAL A 1 509 ? -10.87200 34.41400 281.91700 1.000 78.40646  ? 512 VAL A O   1 
ATOM   4043 C CB  . VAL A 1 509 ? -9.27900  35.23800 279.45300 1.000 68.95378  ? 512 VAL A CB  1 
ATOM   4044 C CG1 . VAL A 1 509 ? -10.40700 36.05600 278.87900 1.000 71.72939  ? 512 VAL A CG1 1 
ATOM   4045 C CG2 . VAL A 1 509 ? -8.00400  35.45400 278.68600 1.000 79.15156  ? 512 VAL A CG2 1 
ATOM   4046 N N   . HIS A 1 510 ? -10.81000 36.65000 282.19200 1.000 70.70848  ? 513 HIS A N   1 
ATOM   4047 C CA  . HIS A 1 510 ? -12.09100 36.75000 282.87100 1.000 70.75325  ? 513 HIS A CA  1 
ATOM   4048 C C   . HIS A 1 510 ? -12.95800 37.74000 282.11600 1.000 69.42207  ? 513 HIS A C   1 
ATOM   4049 O O   . HIS A 1 510 ? -12.55000 38.30100 281.09800 1.000 71.77841  ? 513 HIS A O   1 
ATOM   4050 C CB  . HIS A 1 510 ? -11.92500 37.18800 284.33000 1.000 74.13417  ? 513 HIS A CB  1 
ATOM   4051 C CG  . HIS A 1 510 ? -10.64900 36.73000 284.95900 1.000 73.61179  ? 513 HIS A CG  1 
ATOM   4052 N ND1 . HIS A 1 510 ? -10.53900 35.53200 285.63200 1.000 75.10866  ? 513 HIS A ND1 1 
ATOM   4053 C CD2 . HIS A 1 510 ? -9.42900  37.31400 285.02200 1.000 71.50519  ? 513 HIS A CD2 1 
ATOM   4054 C CE1 . HIS A 1 510 ? -9.30200  35.39300 286.07400 1.000 76.89278  ? 513 HIS A CE1 1 
ATOM   4055 N NE2 . HIS A 1 510 ? -8.60900  36.45900 285.71600 1.000 72.25512  ? 513 HIS A NE2 1 
ATOM   4056 N N   . GLN A 1 511 ? -14.15600 37.98100 282.63800 1.000 71.08887  ? 514 GLN A N   1 
ATOM   4057 C CA  . GLN A 1 511 ? -15.07500 38.88900 281.98000 1.000 72.29008  ? 514 GLN A CA  1 
ATOM   4058 C C   . GLN A 1 511 ? -15.81800 39.72600 283.00900 1.000 70.96211  ? 514 GLN A C   1 
ATOM   4059 O O   . GLN A 1 511 ? -15.83000 39.42100 284.20300 1.000 68.37622  ? 514 GLN A O   1 
ATOM   4060 C CB  . GLN A 1 511 ? -16.06700 38.13500 281.08300 1.000 73.61183  ? 514 GLN A CB  1 
ATOM   4061 C CG  . GLN A 1 511 ? -16.15600 36.64600 281.33800 1.000 75.40568  ? 514 GLN A CG  1 
ATOM   4062 C CD  . GLN A 1 511 ? -16.78400 35.90000 280.17200 1.000 83.49350  ? 514 GLN A CD  1 
ATOM   4063 O OE1 . GLN A 1 511 ? -17.19200 36.50600 279.17600 1.000 79.23620  ? 514 GLN A OE1 1 
ATOM   4064 N NE2 . GLN A 1 511 ? -16.86000 34.57500 280.28900 1.000 86.53566  ? 514 GLN A NE2 1 
ATOM   4065 N N   . ARG A 1 512 ? -16.41000 40.81300 282.51300 1.000 73.10360  ? 515 ARG A N   1 
ATOM   4066 C CA  . ARG A 1 512 ? -17.27900 41.68700 283.29200 1.000 70.09122  ? 515 ARG A CA  1 
ATOM   4067 C C   . ARG A 1 512 ? -16.60700 42.10700 284.59900 1.000 66.26109  ? 515 ARG A C   1 
ATOM   4068 O O   . ARG A 1 512 ? -17.15800 41.96700 285.69100 1.000 63.91353  ? 515 ARG A O   1 
ATOM   4069 C CB  . ARG A 1 512 ? -18.62900 41.01200 283.53100 1.000 72.75857  ? 515 ARG A CB  1 
ATOM   4070 C CG  . ARG A 1 512 ? -19.48900 40.93700 282.28500 1.000 74.74088  ? 515 ARG A CG  1 
ATOM   4071 C CD  . ARG A 1 512 ? -20.87200 40.36000 282.54700 1.000 81.29260  ? 515 ARG A CD  1 
ATOM   4072 N NE  . ARG A 1 512 ? -21.63700 40.27200 281.30400 1.000 92.54665  ? 515 ARG A NE  1 
ATOM   4073 C CZ  . ARG A 1 512 ? -22.81100 39.65300 281.17600 1.000 98.54541  ? 515 ARG A CZ  1 
ATOM   4074 N NH1 . ARG A 1 512 ? -23.37800 39.05800 282.22100 1.000 92.80842  ? 515 ARG A NH1 1 
ATOM   4075 N NH2 . ARG A 1 512 ? -23.42000 39.62500 279.99400 1.000 101.59283 ? 515 ARG A NH2 1 
ATOM   4076 N N   . LEU A 1 513 ? -15.39600 42.64200 284.46000 1.000 67.52268  ? 516 LEU A N   1 
ATOM   4077 C CA  . LEU A 1 513 ? -14.55800 43.03100 285.58700 1.000 63.79403  ? 516 LEU A CA  1 
ATOM   4078 C C   . LEU A 1 513 ? -15.32000 43.92200 286.55000 1.000 63.69003  ? 516 LEU A C   1 
ATOM   4079 O O   . LEU A 1 513 ? -15.79000 45.00300 286.17500 1.000 64.06980  ? 516 LEU A O   1 
ATOM   4080 C CB  . LEU A 1 513 ? -13.28800 43.73200 285.07700 1.000 58.15659  ? 516 LEU A CB  1 
ATOM   4081 C CG  . LEU A 1 513 ? -12.51500 44.80300 285.86000 1.000 60.68899  ? 516 LEU A CG  1 
ATOM   4082 C CD1 . LEU A 1 513 ? -12.13200 44.41500 287.28400 1.000 62.07371  ? 516 LEU A CD1 1 
ATOM   4083 C CD2 . LEU A 1 513 ? -11.28100 45.15600 285.09600 1.000 59.65057  ? 516 LEU A CD2 1 
ATOM   4084 N N   . ARG A 1 514 ? -15.44400 43.42700 287.78400 1.000 61.92781  ? 517 ARG A N   1 
ATOM   4085 C CA  . ARG A 1 514 ? -16.09300 44.10500 288.90900 1.000 61.08802  ? 517 ARG A CA  1 
ATOM   4086 C C   . ARG A 1 514 ? -17.38900 44.77300 288.50400 1.000 56.13789  ? 517 ARG A C   1 
ATOM   4087 O O   . ARG A 1 514 ? -17.66500 45.91400 288.86700 1.000 56.36740  ? 517 ARG A O   1 
ATOM   4088 C CB  . ARG A 1 514 ? -15.15400 45.11200 289.55900 1.000 62.68198  ? 517 ARG A CB  1 
ATOM   4089 C CG  . ARG A 1 514 ? -14.02700 44.42300 290.28900 1.000 57.87315  ? 517 ARG A CG  1 
ATOM   4090 C CD  . ARG A 1 514 ? -13.24100 45.34900 291.13800 1.000 53.88564  ? 517 ARG A CD  1 
ATOM   4091 N NE  . ARG A 1 514 ? -14.00400 45.76300 292.30500 1.000 69.29797  ? 517 ARG A NE  1 
ATOM   4092 C CZ  . ARG A 1 514 ? -14.37200 44.95500 293.29700 1.000 64.23544  ? 517 ARG A CZ  1 
ATOM   4093 N NH1 . ARG A 1 514 ? -14.06800 43.65900 293.27000 1.000 64.16809  ? 517 ARG A NH1 1 
ATOM   4094 N NH2 . ARG A 1 514 ? -15.06100 45.45000 294.31000 1.000 60.92677  ? 517 ARG A NH2 1 
ATOM   4095 N N   . VAL A 1 515 ? -18.20300 44.03800 287.74800 1.000 63.41984  ? 518 VAL A N   1 
ATOM   4096 C CA  . VAL A 1 515 ? -19.43900 44.61800 287.23100 1.000 64.79036  ? 518 VAL A CA  1 
ATOM   4097 C C   . VAL A 1 515 ? -20.43100 44.82500 288.36300 1.000 63.27234  ? 518 VAL A C   1 
ATOM   4098 O O   . VAL A 1 515 ? -21.11800 45.85600 288.43000 1.000 62.95931  ? 518 VAL A O   1 
ATOM   4099 C CB  . VAL A 1 515 ? -20.03300 43.73200 286.12500 1.000 60.59731  ? 518 VAL A CB  1 
ATOM   4100 C CG1 . VAL A 1 515 ? -20.13000 42.28000 286.61300 1.000 67.46822  ? 518 VAL A CG1 1 
ATOM   4101 C CG2 . VAL A 1 515 ? -21.39700 44.24600 285.74900 1.000 55.97697  ? 518 VAL A CG2 1 
ATOM   4102 N N   . GLN A 1 516 ? -20.50300 43.85400 289.27700 1.000 63.34487  ? 519 GLN A N   1 
ATOM   4103 C CA  . GLN A 1 516 ? -21.41600 43.91500 290.41200 1.000 64.19313  ? 519 GLN A CA  1 
ATOM   4104 C C   . GLN A 1 516 ? -21.33900 45.26300 291.11100 1.000 60.76909  ? 519 GLN A C   1 
ATOM   4105 O O   . GLN A 1 516 ? -22.33600 45.98200 291.23700 1.000 58.67691  ? 519 GLN A O   1 
ATOM   4106 C CB  . GLN A 1 516 ? -21.08600 42.79200 291.38900 1.000 59.18117  ? 519 GLN A CB  1 
ATOM   4107 C CG  . GLN A 1 516 ? -22.16800 42.61900 292.40600 1.000 67.31936  ? 519 GLN A CG  1 
ATOM   4108 C CD  . GLN A 1 516 ? -23.47900 42.27300 291.75600 1.000 70.75972  ? 519 GLN A CD  1 
ATOM   4109 O OE1 . GLN A 1 516 ? -23.54100 41.37500 290.90800 1.000 70.64665  ? 519 GLN A OE1 1 
ATOM   4110 N NE2 . GLN A 1 516 ? -24.54200 42.98500 292.13700 1.000 71.97544  ? 519 GLN A NE2 1 
ATOM   4111 N N   . MET A 1 517 ? -20.14100 45.62700 291.55500 1.000 57.32304  ? 520 MET A N   1 
ATOM   4112 C CA  . MET A 1 517 ? -19.98100 46.90300 292.22300 1.000 55.01380  ? 520 MET A CA  1 
ATOM   4113 C C   . MET A 1 517 ? -20.09200 48.07300 291.25300 1.000 56.40780  ? 520 MET A C   1 
ATOM   4114 O O   . MET A 1 517 ? -20.56500 49.15200 291.63200 1.000 51.83153  ? 520 MET A O   1 
ATOM   4115 C CB  . MET A 1 517 ? -18.64900 46.90700 292.96100 1.000 59.42369  ? 520 MET A CB  1 
ATOM   4116 C CG  . MET A 1 517 ? -18.62900 45.92500 294.13200 1.000 70.57866  ? 520 MET A CG  1 
ATOM   4117 S SD  . MET A 1 517 ? -20.09200 46.01600 295.23000 1.000 70.97299  ? 520 MET A SD  1 
ATOM   4118 C CE  . MET A 1 517 ? -19.39100 45.34600 296.75000 1.000 64.23693  ? 520 MET A CE  1 
ATOM   4119 N N   . CYS A 1 518 ? -19.68800 47.88100 289.99300 1.000 63.14314  ? 521 CYS A N   1 
ATOM   4120 C CA  . CYS A 1 518 ? -19.70000 49.00000 289.06200 1.000 55.21145  ? 521 CYS A CA  1 
ATOM   4121 C C   . CYS A 1 518 ? -21.10000 49.33700 288.59700 1.000 54.57835  ? 521 CYS A C   1 
ATOM   4122 O O   . CYS A 1 518 ? -21.36100 50.50000 288.27200 1.000 54.73159  ? 521 CYS A O   1 
ATOM   4123 C CB  . CYS A 1 518 ? -18.78000 48.72300 287.88900 1.000 54.38503  ? 521 CYS A CB  1 
ATOM   4124 S SG  . CYS A 1 518 ? -17.04500 49.01300 288.35600 1.000 69.64767  ? 521 CYS A SG  1 
ATOM   4125 N N   . VAL A 1 519 ? -22.02100 48.36700 288.60200 1.000 55.92911  ? 522 VAL A N   1 
ATOM   4126 C CA  . VAL A 1 519 ? -23.42700 48.71900 288.42400 1.000 57.05916  ? 522 VAL A CA  1 
ATOM   4127 C C   . VAL A 1 519 ? -23.85000 49.69100 289.50700 1.000 58.81747  ? 522 VAL A C   1 
ATOM   4128 O O   . VAL A 1 519 ? -24.52600 50.68800 289.24000 1.000 64.57855  ? 522 VAL A O   1 
ATOM   4129 C CB  . VAL A 1 519 ? -24.32500 47.47000 288.43200 1.000 57.69701  ? 522 VAL A CB  1 
ATOM   4130 C CG1 . VAL A 1 519 ? -25.74800 47.87900 288.17800 1.000 57.16546  ? 522 VAL A CG1 1 
ATOM   4131 C CG2 . VAL A 1 519 ? -23.89000 46.47100 287.40300 1.000 62.33427  ? 522 VAL A CG2 1 
ATOM   4132 N N   . PHE A 1 520 ? -23.43900 49.42400 290.74700 1.000 60.78146  ? 523 PHE A N   1 
ATOM   4133 C CA  . PHE A 1 520 ? -23.83100 50.26900 291.86500 1.000 58.40117  ? 523 PHE A CA  1 
ATOM   4134 C C   . PHE A 1 520 ? -23.28700 51.68500 291.71300 1.000 60.62890  ? 523 PHE A C   1 
ATOM   4135 O O   . PHE A 1 520 ? -23.99700 52.66200 291.98500 1.000 63.06884  ? 523 PHE A O   1 
ATOM   4136 C CB  . PHE A 1 520 ? -23.34700 49.64100 293.17700 1.000 59.58296  ? 523 PHE A CB  1 
ATOM   4137 C CG  . PHE A 1 520 ? -23.40700 50.57300 294.35600 1.000 58.19953  ? 523 PHE A CG  1 
ATOM   4138 C CD1 . PHE A 1 520 ? -24.56700 50.68800 295.10100 1.000 60.09915  ? 523 PHE A CD1 1 
ATOM   4139 C CD2 . PHE A 1 520 ? -22.30600 51.33500 294.71300 1.000 52.60856  ? 523 PHE A CD2 1 
ATOM   4140 C CE1 . PHE A 1 520 ? -24.63400 51.54300 296.16900 1.000 58.49579  ? 523 PHE A CE1 1 
ATOM   4141 C CE2 . PHE A 1 520 ? -22.37300 52.19500 295.77600 1.000 58.90772  ? 523 PHE A CE2 1 
ATOM   4142 C CZ  . PHE A 1 520 ? -23.53700 52.29500 296.51100 1.000 57.74456  ? 523 PHE A CZ  1 
ATOM   4143 N N   . TRP A 1 521 ? -22.02300 51.81900 291.30900 1.000 56.51362  ? 524 TRP A N   1 
ATOM   4144 C CA  . TRP A 1 521 ? -21.41600 53.14700 291.25900 1.000 60.20075  ? 524 TRP A CA  1 
ATOM   4145 C C   . TRP A 1 521 ? -21.84800 53.93300 290.02700 1.000 60.18825  ? 524 TRP A C   1 
ATOM   4146 O O   . TRP A 1 521 ? -22.04900 55.14900 290.10100 1.000 63.68381  ? 524 TRP A O   1 
ATOM   4147 C CB  . TRP A 1 521 ? -19.88900 53.03600 291.29700 1.000 63.05511  ? 524 TRP A CB  1 
ATOM   4148 C CG  . TRP A 1 521 ? -19.35700 52.61900 292.63700 1.000 58.48112  ? 524 TRP A CG  1 
ATOM   4149 C CD1 . TRP A 1 521 ? -18.85600 51.40200 292.97200 1.000 59.19680  ? 524 TRP A CD1 1 
ATOM   4150 C CD2 . TRP A 1 521 ? -19.29300 53.42300 293.82200 1.000 56.17288  ? 524 TRP A CD2 1 
ATOM   4151 N NE1 . TRP A 1 521 ? -18.48200 51.39300 294.29800 1.000 58.69027  ? 524 TRP A NE1 1 
ATOM   4152 C CE2 . TRP A 1 521 ? -18.74100 52.62500 294.83800 1.000 55.61383  ? 524 TRP A CE2 1 
ATOM   4153 C CE3 . TRP A 1 521 ? -19.65100 54.74000 294.12100 1.000 59.50029  ? 524 TRP A CE3 1 
ATOM   4154 C CZ2 . TRP A 1 521 ? -18.52900 53.10100 296.12400 1.000 55.04030  ? 524 TRP A CZ2 1 
ATOM   4155 C CZ3 . TRP A 1 521 ? -19.44300 55.20900 295.39900 1.000 55.83316  ? 524 TRP A CZ3 1 
ATOM   4156 C CH2 . TRP A 1 521 ? -18.88800 54.39200 296.38500 1.000 54.64017  ? 524 TRP A CH2 1 
ATOM   4157 N N   . ASN A 1 522 ? -21.99500 53.26600 288.89300 1.000 60.66525  ? 525 ASN A N   1 
ATOM   4158 C CA  . ASN A 1 522 ? -22.26300 53.97200 287.65200 1.000 61.93028  ? 525 ASN A CA  1 
ATOM   4159 C C   . ASN A 1 522 ? -23.74500 54.20600 287.39600 1.000 66.71312  ? 525 ASN A C   1 
ATOM   4160 O O   . ASN A 1 522 ? -24.08600 55.13400 286.65600 1.000 67.15754  ? 525 ASN A O   1 
ATOM   4161 C CB  . ASN A 1 522 ? -21.63900 53.20800 286.48600 1.000 57.88326  ? 525 ASN A CB  1 
ATOM   4162 C CG  . ASN A 1 522 ? -20.11100 53.25300 286.51500 1.000 62.03679  ? 525 ASN A CG  1 
ATOM   4163 O OD1 . ASN A 1 522 ? -19.50600 54.30300 286.77200 1.000 66.39587  ? 525 ASN A OD1 1 
ATOM   4164 N ND2 . ASN A 1 522 ? -19.48400 52.11500 286.27100 1.000 57.30794  ? 525 ASN A ND2 1 
ATOM   4165 N N   . GLN A 1 523 ? -24.63700 53.41800 288.00200 1.000 67.93098  ? 526 GLN A N   1 
ATOM   4166 C CA  . GLN A 1 523 ? -26.04700 53.50900 287.64900 1.000 60.98981  ? 526 GLN A CA  1 
ATOM   4167 C C   . GLN A 1 523 ? -26.97500 53.66200 288.84600 1.000 62.03993  ? 526 GLN A C   1 
ATOM   4168 O O   . GLN A 1 523 ? -27.98700 54.36100 288.74300 1.000 65.22755  ? 526 GLN A O   1 
ATOM   4169 C CB  . GLN A 1 523 ? -26.43700 52.28400 286.83800 1.000 59.28814  ? 526 GLN A CB  1 
ATOM   4170 C CG  . GLN A 1 523 ? -25.45800 52.01300 285.73500 1.000 66.84444  ? 526 GLN A CG  1 
ATOM   4171 C CD  . GLN A 1 523 ? -25.66500 50.66800 285.09300 1.000 80.83894  ? 526 GLN A CD  1 
ATOM   4172 O OE1 . GLN A 1 523 ? -26.80300 50.19500 284.96000 1.000 82.70767  ? 526 GLN A OE1 1 
ATOM   4173 N NE2 . GLN A 1 523 ? -24.56100 50.03300 284.68300 1.000 81.86462  ? 526 GLN A NE2 1 
ATOM   4174 N N   . PHE A 1 524 ? -26.67400 53.02300 289.98000 1.000 65.49701  ? 527 PHE A N   1 
ATOM   4175 C CA  . PHE A 1 524 ? -27.60300 53.11000 291.10700 1.000 59.98349  ? 527 PHE A CA  1 
ATOM   4176 C C   . PHE A 1 524 ? -27.37100 54.35100 291.96900 1.000 60.34802  ? 527 PHE A C   1 
ATOM   4177 O O   . PHE A 1 524 ? -28.29100 55.15200 292.16600 1.000 60.99974  ? 527 PHE A O   1 
ATOM   4178 C CB  . PHE A 1 524 ? -27.54600 51.86200 291.99100 1.000 57.77847  ? 527 PHE A CB  1 
ATOM   4179 C CG  . PHE A 1 524 ? -28.45500 51.96600 293.19800 1.000 61.61372  ? 527 PHE A CG  1 
ATOM   4180 C CD1 . PHE A 1 524 ? -29.83300 51.93400 293.04100 1.000 59.27937  ? 527 PHE A CD1 1 
ATOM   4181 C CD2 . PHE A 1 524 ? -27.94000 52.16600 294.46500 1.000 59.14761  ? 527 PHE A CD2 1 
ATOM   4182 C CE1 . PHE A 1 524 ? -30.66800 52.06900 294.10900 1.000 59.11524  ? 527 PHE A CE1 1 
ATOM   4183 C CE2 . PHE A 1 524 ? -28.77100 52.31000 295.53400 1.000 63.03037  ? 527 PHE A CE2 1 
ATOM   4184 C CZ  . PHE A 1 524 ? -30.14400 52.25900 295.35700 1.000 63.76864  ? 527 PHE A CZ  1 
ATOM   4185 N N   . LEU A 1 525 ? -26.16400 54.50500 292.51800 1.000 59.56201  ? 528 LEU A N   1 
ATOM   4186 C CA  . LEU A 1 525 ? -25.89900 55.65400 293.38100 1.000 58.29421  ? 528 LEU A CA  1 
ATOM   4187 C C   . LEU A 1 525 ? -26.16700 56.99700 292.70800 1.000 61.87383  ? 528 LEU A C   1 
ATOM   4188 O O   . LEU A 1 525 ? -26.71400 57.88900 293.38300 1.000 60.60835  ? 528 LEU A O   1 
ATOM   4189 C CB  . LEU A 1 525 ? -24.46400 55.59700 293.91300 1.000 60.22896  ? 528 LEU A CB  1 
ATOM   4190 C CG  . LEU A 1 525 ? -24.13900 56.54500 295.08700 1.000 63.67698  ? 528 LEU A CG  1 
ATOM   4191 C CD1 . LEU A 1 525 ? -25.06000 56.29100 296.31100 1.000 54.92219  ? 528 LEU A CD1 1 
ATOM   4192 C CD2 . LEU A 1 525 ? -22.65700 56.46800 295.49200 1.000 49.47332  ? 528 LEU A CD2 1 
ATOM   4193 N N   . PRO A 1 526 ? -25.82500 57.22200 291.42800 1.000 62.33285  ? 529 PRO A N   1 
ATOM   4194 C CA  . PRO A 1 526 ? -26.18700 58.51300 290.81400 1.000 60.09890  ? 529 PRO A CA  1 
ATOM   4195 C C   . PRO A 1 526 ? -27.68500 58.73500 290.75000 1.000 62.10087  ? 529 PRO A C   1 
ATOM   4196 O O   . PRO A 1 526 ? -28.16000 59.84900 291.01900 1.000 61.08965  ? 529 PRO A O   1 
ATOM   4197 C CB  . PRO A 1 526 ? -25.56200 58.41900 289.42100 1.000 59.22272  ? 529 PRO A CB  1 
ATOM   4198 C CG  . PRO A 1 526 ? -24.48600 57.42300 289.56500 1.000 63.79940  ? 529 PRO A CG  1 
ATOM   4199 C CD  . PRO A 1 526 ? -24.99900 56.41600 290.51400 1.000 60.31236  ? 529 PRO A CD  1 
ATOM   4200 N N   . LYS A 1 527 ? -28.44500 57.69100 290.40900 1.000 63.16830  ? 530 LYS A N   1 
ATOM   4201 C CA  . LYS A 1 527 ? -29.89900 57.79600 290.43600 1.000 62.21372  ? 530 LYS A CA  1 
ATOM   4202 C C   . LYS A 1 527 ? -30.39300 58.13500 291.83600 1.000 68.25141  ? 530 LYS A C   1 
ATOM   4203 O O   . LYS A 1 527 ? -31.23100 59.03100 291.99600 1.000 70.86856  ? 530 LYS A O   1 
ATOM   4204 C CB  . LYS A 1 527 ? -30.53400 56.49900 289.92900 1.000 65.76668  ? 530 LYS A CB  1 
ATOM   4205 C CG  . LYS A 1 527 ? -32.02400 56.62800 289.61400 1.000 74.53004  ? 530 LYS A CG  1 
ATOM   4206 C CD  . LYS A 1 527 ? -32.59000 55.40300 288.88300 1.000 72.12689  ? 530 LYS A CD  1 
ATOM   4207 C CE  . LYS A 1 527 ? -34.10900 55.52400 288.65400 1.000 77.93798  ? 530 LYS A CE  1 
ATOM   4208 N NZ  . LYS A 1 527 ? -34.61900 54.58700 287.59600 1.000 85.61029  ? 530 LYS A NZ  1 
ATOM   4209 N N   . LEU A 1 528 ? -29.84700 57.46100 292.86400 1.000 66.35403  ? 531 LEU A N   1 
ATOM   4210 C CA  . LEU A 1 528 ? -30.26900 57.69900 294.24700 1.000 64.33933  ? 531 LEU A CA  1 
ATOM   4211 C C   . LEU A 1 528 ? -30.00600 59.14000 294.67400 1.000 66.17276  ? 531 LEU A C   1 
ATOM   4212 O O   . LEU A 1 528 ? -30.86700 59.78800 295.27500 1.000 70.24558  ? 531 LEU A O   1 
ATOM   4213 C CB  . LEU A 1 528 ? -29.56500 56.71600 295.19000 1.000 60.68243  ? 531 LEU A CB  1 
ATOM   4214 C CG  . LEU A 1 528 ? -29.76000 56.87900 296.70900 1.000 63.31464  ? 531 LEU A CG  1 
ATOM   4215 C CD1 . LEU A 1 528 ? -29.65100 55.54800 297.43200 1.000 61.35221  ? 531 LEU A CD1 1 
ATOM   4216 C CD2 . LEU A 1 528 ? -28.75900 57.86400 297.31900 1.000 68.04284  ? 531 LEU A CD2 1 
ATOM   4217 N N   . LEU A 1 529 ? -28.81500 59.65800 294.38200 1.000 67.11678  ? 532 LEU A N   1 
ATOM   4218 C CA  . LEU A 1 529 ? -28.48700 61.01500 294.81000 1.000 71.40606  ? 532 LEU A CA  1 
ATOM   4219 C C   . LEU A 1 529 ? -29.32100 62.06500 294.06900 1.000 78.10619  ? 532 LEU A C   1 
ATOM   4220 O O   . LEU A 1 529 ? -29.77500 63.04100 294.68400 1.000 81.32865  ? 532 LEU A O   1 
ATOM   4221 C CB  . LEU A 1 529 ? -26.99000 61.26300 294.62700 1.000 67.01794  ? 532 LEU A CB  1 
ATOM   4222 C CG  . LEU A 1 529 ? -26.10000 60.43900 295.56600 1.000 70.39004  ? 532 LEU A CG  1 
ATOM   4223 C CD1 . LEU A 1 529 ? -24.63800 60.47900 295.15100 1.000 66.39309  ? 532 LEU A CD1 1 
ATOM   4224 C CD2 . LEU A 1 529 ? -26.24600 60.89600 297.00900 1.000 65.07390  ? 532 LEU A CD2 1 
ATOM   4225 N N   . ASN A 1 530 ? -29.55000 61.87500 292.75500 1.000 72.48686  ? 533 ASN A N   1 
ATOM   4226 C CA  . ASN A 1 530 ? -30.38200 62.79400 291.97000 1.000 75.47560  ? 533 ASN A CA  1 
ATOM   4227 C C   . ASN A 1 530 ? -31.83000 62.86800 292.46800 1.000 81.87818  ? 533 ASN A C   1 
ATOM   4228 O O   . ASN A 1 530 ? -32.52600 63.84500 292.17000 1.000 84.87861  ? 533 ASN A O   1 
ATOM   4229 C CB  . ASN A 1 530 ? -30.35600 62.38400 290.48500 1.000 73.58500  ? 533 ASN A CB  1 
ATOM   4230 C CG  . ASN A 1 530 ? -31.03700 63.40700 289.55500 1.000 76.85320  ? 533 ASN A CG  1 
ATOM   4231 O OD1 . ASN A 1 530 ? -32.13000 63.16500 289.04000 1.000 81.67651  ? 533 ASN A OD1 1 
ATOM   4232 N ND2 . ASN A 1 530 ? -30.37900 64.53700 289.32500 1.000 79.82329  ? 533 ASN A ND2 1 
ATOM   4233 N N   . ALA A 1 531 ? -32.29300 61.88600 293.24100 1.000 81.07495  ? 534 ALA A N   1 
ATOM   4234 C CA  . ALA A 1 531 ? -33.70100 61.76000 293.58700 1.000 79.25372  ? 534 ALA A CA  1 
ATOM   4235 C C   . ALA A 1 531 ? -34.12700 62.60000 294.78600 1.000 89.20980  ? 534 ALA A C   1 
ATOM   4236 O O   . ALA A 1 531 ? -35.31300 62.55400 295.14500 1.000 94.73495  ? 534 ALA A O   1 
ATOM   4237 C CB  . ALA A 1 531 ? -34.03100 60.29200 293.86400 1.000 79.73665  ? 534 ALA A CB  1 
ATOM   4238 N N   . THR A 1 532 ? -33.20700 63.37600 295.37900 1.000 90.69240  ? 535 THR A N   1 
ATOM   4239 C CA  . THR A 1 532 ? -33.34600 64.02700 296.70600 1.000 95.50083  ? 535 THR A CA  1 
ATOM   4240 C C   . THR A 1 532 ? -33.10400 62.96700 297.78800 1.000 87.13186  ? 535 THR A C   1 
ATOM   4241 O O   . THR A 1 532 ? -32.15400 62.17800 297.70300 1.000 78.81241  ? 535 THR A O   1 
ATOM   4242 C CB  . THR A 1 532 ? -34.75000 64.75300 296.93800 1.000 101.72526 ? 535 THR A CB  1 
ATOM   4243 O OG1 . THR A 1 532 ? -34.71900 66.09000 296.40800 1.000 93.07374  ? 535 THR A OG1 1 
ATOM   4244 C CG2 . THR A 1 532 ? -35.15500 64.78800 298.43700 1.000 90.41366  ? 535 THR A CG2 1 
HETATM 4245 C C10 . N9T B 2 .   ? -1.81800  60.81500 297.07600 1.000 70.54742  ? 601 N9T A C10 1 
HETATM 4246 C C13 . N9T B 2 .   ? -0.24200  58.41100 296.84900 1.000 71.78297  ? 601 N9T A C13 1 
HETATM 4247 C C15 . N9T B 2 .   ? -0.32000  60.79300 296.97500 1.000 69.32431  ? 601 N9T A C15 1 
HETATM 4248 C C17 . N9T B 2 .   ? 1.54000   58.54400 293.54400 1.000 72.26988  ? 601 N9T A C17 1 
HETATM 4249 C C20 . N9T B 2 .   ? 0.83500   58.42400 290.88900 1.000 69.64886  ? 601 N9T A C20 1 
HETATM 4250 C C21 . N9T B 2 .   ? 0.61300   57.35000 291.70600 1.000 69.71445  ? 601 N9T A C21 1 
HETATM 4251 C C22 . N9T B 2 .   ? 0.97600   57.41800 293.01700 1.000 72.30074  ? 601 N9T A C22 1 
HETATM 4252 C C24 . N9T B 2 .   ? -2.34400  66.08700 300.98600 1.000 70.14954  ? 601 N9T A C24 1 
HETATM 4253 C C01 . N9T B 2 .   ? -2.35900  69.43900 303.34900 1.000 66.31738  ? 601 N9T A C01 1 
HETATM 4254 C C02 . N9T B 2 .   ? -3.55600  67.76400 302.11700 1.000 69.69885  ? 601 N9T A C02 1 
HETATM 4255 C C03 . N9T B 2 .   ? -4.74500  67.25700 301.62500 1.000 71.72749  ? 601 N9T A C03 1 
HETATM 4256 C C04 . N9T B 2 .   ? -6.21900  68.44400 303.07500 1.000 77.60560  ? 601 N9T A C04 1 
HETATM 4257 C C05 . N9T B 2 .   ? -4.73000  66.16900 300.81000 1.000 73.64893  ? 601 N9T A C05 1 
HETATM 4258 C C06 . N9T B 2 .   ? -3.66100  65.48400 300.41100 1.000 71.73065  ? 601 N9T A C06 1 
HETATM 4259 C C07 . N9T B 2 .   ? -3.22900  64.27300 299.55000 1.000 68.05792  ? 601 N9T A C07 1 
HETATM 4260 C C08 . N9T B 2 .   ? -1.91000  63.92300 299.42900 1.000 70.63184  ? 601 N9T A C08 1 
HETATM 4261 C C09 . N9T B 2 .   ? -2.32700  61.96400 297.90900 1.000 74.57458  ? 601 N9T A C09 1 
HETATM 4262 C C11 . N9T B 2 .   ? -2.22300  59.54500 297.74000 1.000 68.59767  ? 601 N9T A C11 1 
HETATM 4263 C C12 . N9T B 2 .   ? -1.73900  58.34400 296.98300 1.000 70.95954  ? 601 N9T A C12 1 
HETATM 4264 C C14 . N9T B 2 .   ? 0.09500   59.65800 296.07400 1.000 75.29858  ? 601 N9T A C14 1 
HETATM 4265 C C16 . N9T B 2 .   ? 1.92800   58.56100 295.01600 1.000 75.10369  ? 601 N9T A C16 1 
HETATM 4266 C C18 . N9T B 2 .   ? 1.77500   59.60800 292.72900 1.000 76.72493  ? 601 N9T A C18 1 
HETATM 4267 C C19 . N9T B 2 .   ? 1.41400   59.55000 291.40200 1.000 70.75369  ? 601 N9T A C19 1 
HETATM 4268 C C23 . N9T B 2 .   ? -0.95100  64.61500 300.03100 1.000 74.58743  ? 601 N9T A C23 1 
HETATM 4269 C C25 . N9T B 2 .   ? -2.35200  67.17400 301.79200 1.000 67.44887  ? 601 N9T A C25 1 
HETATM 4270 N N01 . N9T B 2 .   ? -1.45900  62.81300 298.64000 1.000 74.38313  ? 601 N9T A N01 1 
HETATM 4271 N N02 . N9T B 2 .   ? 1.49000   59.72500 295.75800 1.000 76.60689  ? 601 N9T A N02 1 
HETATM 4272 O O01 . N9T B 2 .   ? -3.56800  68.88200 302.94500 1.000 71.23734  ? 601 N9T A O01 1 
HETATM 4273 O O02 . N9T B 2 .   ? -5.99200  67.78500 301.87900 1.000 74.24968  ? 601 N9T A O02 1 
HETATM 4274 O O03 . N9T B 2 .   ? -3.46100  62.14700 297.92400 1.000 76.45167  ? 601 N9T A O03 1 
HETATM 4275 O O04 . N9T B 2 .   ? 0.36000   64.25000 299.87900 1.000 76.27394  ? 601 N9T A O04 1 
HETATM 4276 O O05 . N9T B 2 .   ? -1.18800  65.55900 300.71300 1.000 76.07623  ? 601 N9T A O05 1 
HETATM 4277 C C1  . NAG C 3 .   ? 25.40900  71.24600 279.61400 1.000 101.36293 ? 602 NAG A C1  1 
HETATM 4278 C C2  . NAG C 3 .   ? 26.94400  71.17800 279.45200 1.000 100.39774 ? 602 NAG A C2  1 
HETATM 4279 C C3  . NAG C 3 .   ? 27.55400  70.33400 280.58300 1.000 104.06500 ? 602 NAG A C3  1 
HETATM 4280 C C4  . NAG C 3 .   ? 27.17600  70.92300 281.94300 1.000 107.48739 ? 602 NAG A C4  1 
HETATM 4281 C C5  . NAG C 3 .   ? 25.65100  70.94300 282.07900 1.000 103.33725 ? 602 NAG A C5  1 
HETATM 4282 C C6  . NAG C 3 .   ? 25.14600  71.50300 283.39800 1.000 93.49951  ? 602 NAG A C6  1 
HETATM 4283 C C7  . NAG C 3 .   ? 27.45700  71.41900 277.04600 1.000 97.37649  ? 602 NAG A C7  1 
HETATM 4284 C C8  . NAG C 3 .   ? 27.88500  70.70300 275.79700 1.000 83.90161  ? 602 NAG A C8  1 
HETATM 4285 N N2  . NAG C 3 .   ? 27.33500  70.66000 278.14700 1.000 98.26623  ? 602 NAG A N2  1 
HETATM 4286 O O3  . NAG C 3 .   ? 28.96600  70.22300 280.43000 1.000 100.76423 ? 602 NAG A O3  1 
HETATM 4287 O O4  . NAG C 3 .   ? 27.75200  70.18700 283.02100 1.000 103.16158 ? 602 NAG A O4  1 
HETATM 4288 O O5  . NAG C 3 .   ? 25.06700  71.72000 281.01400 1.000 104.23179 ? 602 NAG A O5  1 
HETATM 4289 O O6  . NAG C 3 .   ? 25.74800  72.74000 283.75600 1.000 88.21587  ? 602 NAG A O6  1 
HETATM 4290 O O7  . NAG C 3 .   ? 27.22400  72.62800 277.05500 1.000 95.65952  ? 602 NAG A O7  1 
HETATM 4291 C C1  . NAG D 3 .   ? -11.40200 48.92400 263.05100 1.000 82.91683  ? 603 NAG A C1  1 
HETATM 4292 C C2  . NAG D 3 .   ? -12.26200 47.67300 263.04000 1.000 81.93797  ? 603 NAG A C2  1 
HETATM 4293 C C3  . NAG D 3 .   ? -12.11300 46.86200 261.77600 1.000 76.04972  ? 603 NAG A C3  1 
HETATM 4294 C C4  . NAG D 3 .   ? -12.33500 47.74900 260.58800 1.000 82.81147  ? 603 NAG A C4  1 
HETATM 4295 C C5  . NAG D 3 .   ? -11.37000 48.89000 260.63600 1.000 79.80672  ? 603 NAG A C5  1 
HETATM 4296 C C6  . NAG D 3 .   ? -11.70100 49.73700 259.45400 1.000 77.95156  ? 603 NAG A C6  1 
HETATM 4297 C C7  . NAG D 3 .   ? -12.59700 46.83800 265.22900 1.000 77.23265  ? 603 NAG A C7  1 
HETATM 4298 C C8  . NAG D 3 .   ? -11.93500 46.20200 266.38200 1.000 68.56245  ? 603 NAG A C8  1 
HETATM 4299 N N2  . NAG D 3 .   ? -11.91600 46.81500 264.12200 1.000 79.62745  ? 603 NAG A N2  1 
HETATM 4300 O O3  . NAG D 3 .   ? -13.14400 45.89300 261.75100 1.000 68.39483  ? 603 NAG A O3  1 
HETATM 4301 O O4  . NAG D 3 .   ? -12.17600 47.02700 259.36400 1.000 84.05677  ? 603 NAG A O4  1 
HETATM 4302 O O5  . NAG D 3 .   ? -11.59100 49.62800 261.83500 1.000 83.01509  ? 603 NAG A O5  1 
HETATM 4303 O O6  . NAG D 3 .   ? -10.50900 50.42400 259.14200 1.000 79.57411  ? 603 NAG A O6  1 
HETATM 4304 O O7  . NAG D 3 .   ? -13.68200 47.33300 265.30900 1.000 76.98879  ? 603 NAG A O7  1 
HETATM 4305 O O   . HOH E 4 .   ? -1.92000  52.94100 288.15700 1.000 69.14006  ? 701 HOH A O   1 
HETATM 4306 O O   . HOH E 4 .   ? -2.79600  60.42500 291.16900 1.000 69.69939  ? 702 HOH A O   1 
HETATM 4307 O O   . HOH E 4 .   ? 16.04000  41.94700 285.48400 1.000 88.79561  ? 703 HOH A O   1 
HETATM 4308 O O   . HOH E 4 .   ? 15.40100  57.50700 265.54300 1.000 85.50276  ? 704 HOH A O   1 
HETATM 4309 O O   . HOH E 4 .   ? -0.50400  36.43600 283.54900 1.000 79.91147  ? 705 HOH A O   1 
HETATM 4310 O O   . HOH E 4 .   ? 1.29300   63.35800 265.11200 1.000 69.24024  ? 706 HOH A O   1 
HETATM 4311 O O   . HOH E 4 .   ? -16.91600 66.69500 284.60000 1.000 52.71751  ? 707 HOH A O   1 
HETATM 4312 O O   . HOH E 4 .   ? 10.48200  60.24800 281.24200 1.000 70.28845  ? 708 HOH A O   1 
HETATM 4313 O O   . HOH E 4 .   ? -17.42200 40.55800 313.48900 1.000 68.82933  ? 709 HOH A O   1 
HETATM 4314 O O   . HOH E 4 .   ? 2.92400   63.24000 292.16100 1.000 70.51096  ? 710 HOH A O   1 
HETATM 4315 O O   . HOH E 4 .   ? -14.27200 63.75500 285.29400 1.000 57.33968  ? 711 HOH A O   1 
HETATM 4316 O O   . HOH E 4 .   ? -1.00900  65.43100 287.75400 1.000 58.38687  ? 712 HOH A O   1 
HETATM 4317 O O   . HOH E 4 .   ? 5.39600   51.89300 289.74000 1.000 65.88245  ? 713 HOH A O   1 
HETATM 4318 O O   . HOH E 4 .   ? -10.30700 78.30000 302.04900 1.000 67.28272  ? 714 HOH A O   1 
HETATM 4319 O O   . HOH E 4 .   ? 30.09300  69.12800 282.83800 1.000 96.76228  ? 715 HOH A O   1 
HETATM 4320 O O   . HOH E 4 .   ? -2.61500  50.34900 286.07700 1.000 66.27521  ? 716 HOH A O   1 
HETATM 4321 O O   . HOH E 4 .   ? -14.72900 40.78000 274.81700 1.000 72.17228  ? 717 HOH A O   1 
HETATM 4322 O O   . HOH E 4 .   ? -21.14900 55.34300 273.85400 1.000 57.27327  ? 718 HOH A O   1 
HETATM 4323 O O   . HOH E 4 .   ? 3.80100   61.91800 288.21300 1.000 55.32068  ? 719 HOH A O   1 
HETATM 4324 O O   . HOH E 4 .   ? 12.10600  79.19800 289.36600 1.000 70.67561  ? 720 HOH A O   1 
HETATM 4325 O O   . HOH E 4 .   ? 5.28600   62.82200 281.24400 1.000 65.77973  ? 721 HOH A O   1 
HETATM 4326 O O   . HOH E 4 .   ? 19.13700  76.27400 266.12500 1.000 66.31222  ? 722 HOH A O   1 
HETATM 4327 O O   . HOH E 4 .   ? 3.26700   74.24100 288.36900 1.000 64.72520  ? 723 HOH A O   1 
HETATM 4328 O O   . HOH E 4 .   ? -30.592   53.270   307.398   1.000 70.05878  ? 724 HOH A O   1 
HETATM 4329 O O   . HOH E 4 .   ? 1.94500   58.94900 286.63600 1.000 60.42992  ? 725 HOH A O   1 
HETATM 4330 O O   . HOH E 4 .   ? 1.73400   91.20100 297.11500 1.000 78.88722  ? 726 HOH A O   1 
HETATM 4331 O O   . HOH E 4 .   ? -8.81000  74.49400 284.93300 1.000 55.16318  ? 727 HOH A O   1 
HETATM 4332 O O   . HOH E 4 .   ? 0.81100   71.78600 293.77300 1.000 67.84625  ? 728 HOH A O   1 
HETATM 4333 O O   . HOH E 4 .   ? -4.99100  69.82500 295.43600 1.000 63.93061  ? 729 HOH A O   1 
HETATM 4334 O O   . HOH E 4 .   ? -4.90500  69.32700 291.18800 1.000 66.95673  ? 730 HOH A O   1 
HETATM 4335 O O   . HOH E 4 .   ? 4.02900   40.84400 275.05000 1.000 74.11870  ? 731 HOH A O   1 
HETATM 4336 O O   . HOH E 4 .   ? 6.80700   65.35600 291.20100 1.000 66.90472  ? 732 HOH A O   1 
HETATM 4337 O O   . HOH E 4 .   ? 22.31300  72.86300 259.88900 1.000 72.86499  ? 733 HOH A O   1 
HETATM 4338 O O   . HOH E 4 .   ? -6.16500  79.07200 283.40600 1.000 70.29519  ? 734 HOH A O   1 
HETATM 4339 O O   . HOH E 4 .   ? -4.24100  58.29400 307.76300 1.000 61.07265  ? 735 HOH A O   1 
HETATM 4340 O O   . HOH E 4 .   ? 4.30500   77.91200 285.43900 1.000 74.36676  ? 736 HOH A O   1 
HETATM 4341 O O   . HOH E 4 .   ? 7.53000   64.97400 262.95100 1.000 68.31231  ? 737 HOH A O   1 
HETATM 4342 O O   . HOH E 4 .   ? -3.51600  52.02400 296.16300 1.000 65.57387  ? 738 HOH A O   1 
HETATM 4343 O O   . HOH E 4 .   ? -16.76900 62.52600 266.03300 1.000 61.10816  ? 739 HOH A O   1 
HETATM 4344 O O   . HOH E 4 .   ? -18.98200 66.48600 282.35700 1.000 53.17628  ? 740 HOH A O   1 
HETATM 4345 O O   . HOH E 4 .   ? -12.46000 53.62200 316.62400 1.000 61.19701  ? 741 HOH A O   1 
HETATM 4346 O O   . HOH E 4 .   ? -17.12600 39.42800 286.89900 1.000 79.67011  ? 742 HOH A O   1 
HETATM 4347 O O   . HOH E 4 .   ? -9.53200  42.76200 276.74200 1.000 64.70474  ? 743 HOH A O   1 
HETATM 4348 O O   . HOH E 4 .   ? -14.847   54.581   318.850   1.000 74.81986  ? 744 HOH A O   1 
HETATM 4349 O O   . HOH E 4 .   ? -10.85800 66.87400 292.53000 1.000 49.92672  ? 745 HOH A O   1 
HETATM 4350 O O   . HOH E 4 .   ? 1.50700   39.22000 293.96400 1.000 66.34904  ? 746 HOH A O   1 
HETATM 4351 O O   . HOH E 4 .   ? -17.63900 45.85600 281.18800 1.000 72.13153  ? 747 HOH A O   1 
HETATM 4352 O O   . HOH E 4 .   ? -31.79500 65.16800 286.92000 1.000 68.64025  ? 748 HOH A O   1 
HETATM 4353 O O   . HOH E 4 .   ? -6.23000  62.50900 298.60800 1.000 59.35994  ? 749 HOH A O   1 
HETATM 4354 O O   . HOH E 4 .   ? -9.73100  77.45900 290.09900 1.000 66.50933  ? 750 HOH A O   1 
HETATM 4355 O O   . HOH E 4 .   ? 17.82500  72.32200 287.72500 1.000 80.12207  ? 751 HOH A O   1 
HETATM 4356 O O   . HOH E 4 .   ? -12.88700 75.89000 301.17600 1.000 68.76120  ? 752 HOH A O   1 
HETATM 4357 O O   . HOH E 4 .   ? 10.51000  43.37400 276.34200 1.000 70.43118  ? 753 HOH A O   1 
HETATM 4358 O O   . HOH E 4 .   ? -17.91000 56.68200 290.24100 1.000 61.38124  ? 754 HOH A O   1 
HETATM 4359 O O   . HOH E 4 .   ? 11.838    60.467   259.502   1.000 70.72741  ? 755 HOH A O   1 
HETATM 4360 O O   . HOH E 4 .   ? 6.29300   57.96400 258.08900 1.000 71.79282  ? 756 HOH A O   1 
HETATM 4361 O O   . HOH E 4 .   ? 5.657     65.467   308.437   1.000 74.97966  ? 757 HOH A O   1 
HETATM 4362 O O   . HOH E 4 .   ? 1.27500   79.47400 285.17700 1.000 66.71604  ? 758 HOH A O   1 
HETATM 4363 O O   . HOH E 4 .   ? -8.69000  65.07800 299.41600 1.000 61.47400  ? 759 HOH A O   1 
HETATM 4364 O O   . HOH E 4 .   ? 0.23200   59.83400 265.22800 1.000 70.13485  ? 760 HOH A O   1 
HETATM 4365 O O   . HOH E 4 .   ? 20.63700  75.42600 275.80100 1.000 71.63935  ? 761 HOH A O   1 
HETATM 4366 O O   . HOH E 4 .   ? -14.63400 50.48200 264.33100 1.000 67.63530  ? 762 HOH A O   1 
HETATM 4367 O O   . HOH E 4 .   ? 7.06000   68.81800 285.98500 1.000 72.73066  ? 763 HOH A O   1 
HETATM 4368 O O   . HOH E 4 .   ? -19.58900 73.96900 283.39300 1.000 60.21251  ? 764 HOH A O   1 
HETATM 4369 O O   . HOH E 4 .   ? 11.34800  57.49100 290.83700 1.000 63.56154  ? 765 HOH A O   1 
HETATM 4370 O O   . HOH E 4 .   ? 13.28200  72.95800 294.42800 1.000 60.98514  ? 766 HOH A O   1 
HETATM 4371 O O   . HOH E 4 .   ? -22.398   35.903   313.012   1.000 81.86882  ? 767 HOH A O   1 
HETATM 4372 O O   . HOH E 4 .   ? -5.38100  92.46800 295.73200 1.000 70.49827  ? 768 HOH A O   1 
HETATM 4373 O O   . HOH E 4 .   ? 9.31300   48.23500 267.17800 1.000 76.49123  ? 769 HOH A O   1 
HETATM 4374 O O   . HOH E 4 .   ? -9.39500  70.11000 302.52700 1.000 67.73340  ? 770 HOH A O   1 
HETATM 4375 O O   . HOH E 4 .   ? -30.64300 64.98800 297.84900 1.000 85.25828  ? 771 HOH A O   1 
HETATM 4376 O O   . HOH E 4 .   ? -0.05300  66.95400 304.94000 1.000 72.62546  ? 772 HOH A O   1 
HETATM 4377 O O   . HOH E 4 .   ? -18.04900 70.25800 290.18000 1.000 50.37599  ? 773 HOH A O   1 
HETATM 4378 O O   . HOH E 4 .   ? -11.84100 52.85000 261.55300 1.000 61.72750  ? 774 HOH A O   1 
HETATM 4379 O O   . HOH E 4 .   ? 1.14200   82.04100 301.53600 1.000 78.58798  ? 775 HOH A O   1 
HETATM 4380 O O   . HOH E 4 .   ? 6.55700   85.02700 274.95100 1.000 79.13863  ? 776 HOH A O   1 
HETATM 4381 O O   . HOH E 4 .   ? 19.87200  64.33200 284.15000 1.000 67.40288  ? 777 HOH A O   1 
HETATM 4382 O O   . HOH E 4 .   ? 8.75100   51.88000 296.36800 1.000 63.95982  ? 778 HOH A O   1 
HETATM 4383 O O   . HOH E 4 .   ? 6.28400   85.90600 291.52800 1.000 59.76929  ? 779 HOH A O   1 
HETATM 4384 O O   . HOH E 4 .   ? 4.40500   61.85400 290.67100 1.000 75.94808  ? 780 HOH A O   1 
HETATM 4385 O O   . HOH E 4 .   ? -20.07400 61.11500 266.04500 1.000 66.90435  ? 781 HOH A O   1 
HETATM 4386 O O   . HOH E 4 .   ? 2.65400   46.69100 309.18900 1.000 67.97769  ? 782 HOH A O   1 
HETATM 4387 O O   . HOH E 4 .   ? -1.46000  46.77100 314.00600 1.000 88.84962  ? 783 HOH A O   1 
HETATM 4388 O O   . HOH E 4 .   ? -12.52400 97.61500 297.49400 1.000 80.00623  ? 784 HOH A O   1 
HETATM 4389 O O   . HOH E 4 .   ? -31.75900 67.61200 297.57600 1.000 81.37182  ? 785 HOH A O   1 
HETATM 4390 O O   . HOH E 4 .   ? -25.99400 62.07700 275.65900 1.000 81.26246  ? 786 HOH A O   1 
HETATM 4391 O O   . HOH E 4 .   ? 21.08200  50.70100 283.58600 1.000 68.54858  ? 787 HOH A O   1 
HETATM 4392 O O   . HOH E 4 .   ? 0.72000   86.66600 278.50000 1.000 83.45307  ? 788 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   4   4   SER SER A . n 
A 1 2   GLU 2   5   5   GLU GLU A . n 
A 1 3   LEU 3   6   6   LEU LEU A . n 
A 1 4   LEU 4   7   7   LEU LEU A . n 
A 1 5   VAL 5   8   8   VAL VAL A . n 
A 1 6   ASN 6   9   9   ASN ASN A . n 
A 1 7   THR 7   10  10  THR THR A . n 
A 1 8   LYS 8   11  11  LYS LYS A . n 
A 1 9   SER 9   12  12  SER SER A . n 
A 1 10  GLY 10  13  13  GLY GLY A . n 
A 1 11  LYS 11  14  14  LYS LYS A . n 
A 1 12  VAL 12  15  15  VAL VAL A . n 
A 1 13  MET 13  16  16  MET MET A . n 
A 1 14  GLY 14  17  17  GLY GLY A . n 
A 1 15  THR 15  18  18  THR THR A . n 
A 1 16  ARG 16  19  19  ARG ARG A . n 
A 1 17  VAL 17  20  20  VAL VAL A . n 
A 1 18  PRO 18  21  21  PRO PRO A . n 
A 1 19  VAL 19  22  22  VAL VAL A . n 
A 1 20  LEU 20  23  23  LEU LEU A . n 
A 1 21  SER 21  24  24  SER SER A . n 
A 1 22  SER 22  25  25  SER SER A . n 
A 1 23  HIS 23  26  26  HIS HIS A . n 
A 1 24  ILE 24  27  27  ILE ILE A . n 
A 1 25  SER 25  28  28  SER SER A . n 
A 1 26  ALA 26  29  29  ALA ALA A . n 
A 1 27  PHE 27  30  30  PHE PHE A . n 
A 1 28  LEU 28  31  31  LEU LEU A . n 
A 1 29  GLY 29  32  32  GLY GLY A . n 
A 1 30  ILE 30  33  33  ILE ILE A . n 
A 1 31  PRO 31  34  34  PRO PRO A . n 
A 1 32  PHE 32  35  35  PHE PHE A . n 
A 1 33  ALA 33  36  36  ALA ALA A . n 
A 1 34  GLU 34  37  37  GLU GLU A . n 
A 1 35  PRO 35  38  38  PRO PRO A . n 
A 1 36  PRO 36  39  39  PRO PRO A . n 
A 1 37  VAL 37  40  40  VAL VAL A . n 
A 1 38  GLY 38  41  41  GLY GLY A . n 
A 1 39  ASN 39  42  42  ASN ASN A . n 
A 1 40  MET 40  43  43  MET MET A . n 
A 1 41  ARG 41  44  44  ARG ARG A . n 
A 1 42  PHE 42  45  45  PHE PHE A . n 
A 1 43  ARG 43  46  46  ARG ARG A . n 
A 1 44  ARG 44  47  47  ARG ARG A . n 
A 1 45  PRO 45  48  48  PRO PRO A . n 
A 1 46  GLU 46  49  49  GLU GLU A . n 
A 1 47  PRO 47  50  50  PRO PRO A . n 
A 1 48  LYS 48  51  51  LYS LYS A . n 
A 1 49  LYS 49  52  52  LYS LYS A . n 
A 1 50  PRO 50  53  53  PRO PRO A . n 
A 1 51  TRP 51  54  54  TRP TRP A . n 
A 1 52  SER 52  55  55  SER SER A . n 
A 1 53  GLY 53  56  56  GLY GLY A . n 
A 1 54  VAL 54  57  57  VAL VAL A . n 
A 1 55  TRP 55  58  58  TRP TRP A . n 
A 1 56  ASN 56  59  59  ASN ASN A . n 
A 1 57  ALA 57  60  60  ALA ALA A . n 
A 1 58  SER 58  61  61  SER SER A . n 
A 1 59  THR 59  62  62  THR THR A . n 
A 1 60  TYR 60  63  63  TYR TYR A . n 
A 1 61  PRO 61  64  64  PRO PRO A . n 
A 1 62  ASN 62  65  65  ASN ASN A . n 
A 1 63  ASN 63  66  66  ASN ASN A . n 
A 1 64  CYS 64  67  67  CYS CYS A . n 
A 1 65  GLN 65  68  68  GLN GLN A . n 
A 1 66  GLN 66  69  69  GLN GLN A . n 
A 1 67  TYR 67  70  70  TYR TYR A . n 
A 1 68  VAL 68  71  71  VAL VAL A . n 
A 1 69  ASP 69  72  72  ASP ASP A . n 
A 1 70  GLU 70  73  73  GLU GLU A . n 
A 1 71  GLN 71  74  74  GLN GLN A . n 
A 1 72  PHE 72  75  75  PHE PHE A . n 
A 1 73  PRO 73  76  76  PRO PRO A . n 
A 1 74  GLY 74  77  77  GLY GLY A . n 
A 1 75  PHE 75  78  78  PHE PHE A . n 
A 1 76  SER 76  79  79  SER SER A . n 
A 1 77  GLY 77  80  80  GLY GLY A . n 
A 1 78  SER 78  81  81  SER SER A . n 
A 1 79  GLU 79  82  82  GLU GLU A . n 
A 1 80  MET 80  83  83  MET MET A . n 
A 1 81  TRP 81  84  84  TRP TRP A . n 
A 1 82  ASN 82  85  85  ASN ASN A . n 
A 1 83  PRO 83  86  86  PRO PRO A . n 
A 1 84  ASN 84  87  87  ASN ASN A . n 
A 1 85  ARG 85  88  88  ARG ARG A . n 
A 1 86  GLU 86  89  89  GLU GLU A . n 
A 1 87  MET 87  90  90  MET MET A . n 
A 1 88  SER 88  91  91  SER SER A . n 
A 1 89  GLU 89  92  92  GLU GLU A . n 
A 1 90  ASP 90  93  93  ASP ASP A . n 
A 1 91  CYS 91  94  94  CYS CYS A . n 
A 1 92  LEU 92  95  95  LEU LEU A . n 
A 1 93  TYR 93  96  96  TYR TYR A . n 
A 1 94  LEU 94  97  97  LEU LEU A . n 
A 1 95  ASN 95  98  98  ASN ASN A . n 
A 1 96  ILE 96  99  99  ILE ILE A . n 
A 1 97  TRP 97  100 100 TRP TRP A . n 
A 1 98  VAL 98  101 101 VAL VAL A . n 
A 1 99  PRO 99  102 102 PRO PRO A . n 
A 1 100 SER 100 103 103 SER SER A . n 
A 1 101 PRO 101 104 104 PRO PRO A . n 
A 1 102 ARG 102 105 105 ARG ARG A . n 
A 1 103 PRO 103 106 106 PRO PRO A . n 
A 1 104 LYS 104 107 107 LYS LYS A . n 
A 1 105 SER 105 108 108 SER SER A . n 
A 1 106 THR 106 109 109 THR THR A . n 
A 1 107 THR 107 110 110 THR THR A . n 
A 1 108 VAL 108 111 111 VAL VAL A . n 
A 1 109 MET 109 112 112 MET MET A . n 
A 1 110 VAL 110 113 113 VAL VAL A . n 
A 1 111 TRP 111 114 114 TRP TRP A . n 
A 1 112 ILE 112 115 115 ILE ILE A . n 
A 1 113 TYR 113 116 116 TYR TYR A . n 
A 1 114 GLY 114 117 117 GLY GLY A . n 
A 1 115 GLY 115 118 118 GLY GLY A . n 
A 1 116 GLY 116 119 119 GLY GLY A . n 
A 1 117 PHE 117 120 120 PHE PHE A . n 
A 1 118 TYR 118 121 121 TYR TYR A . n 
A 1 119 SER 119 122 122 SER SER A . n 
A 1 120 GLY 120 123 123 GLY GLY A . n 
A 1 121 SER 121 124 124 SER SER A . n 
A 1 122 SER 122 125 125 SER SER A . n 
A 1 123 THR 123 126 126 THR THR A . n 
A 1 124 LEU 124 127 127 LEU LEU A . n 
A 1 125 ASP 125 128 128 ASP ASP A . n 
A 1 126 VAL 126 129 129 VAL VAL A . n 
A 1 127 TYR 127 130 130 TYR TYR A . n 
A 1 128 ASN 128 131 131 ASN ASN A . n 
A 1 129 GLY 129 132 132 GLY GLY A . n 
A 1 130 LYS 130 133 133 LYS LYS A . n 
A 1 131 TYR 131 134 134 TYR TYR A . n 
A 1 132 LEU 132 135 135 LEU LEU A . n 
A 1 133 ALA 133 136 136 ALA ALA A . n 
A 1 134 TYR 134 137 137 TYR TYR A . n 
A 1 135 THR 135 138 138 THR THR A . n 
A 1 136 GLU 136 139 139 GLU GLU A . n 
A 1 137 GLU 137 140 140 GLU GLU A . n 
A 1 138 VAL 138 141 141 VAL VAL A . n 
A 1 139 VAL 139 142 142 VAL VAL A . n 
A 1 140 LEU 140 143 143 LEU LEU A . n 
A 1 141 VAL 141 144 144 VAL VAL A . n 
A 1 142 SER 142 145 145 SER SER A . n 
A 1 143 LEU 143 146 146 LEU LEU A . n 
A 1 144 SER 144 147 147 SER SER A . n 
A 1 145 TYR 145 148 148 TYR TYR A . n 
A 1 146 ARG 146 149 149 ARG ARG A . n 
A 1 147 VAL 147 150 150 VAL VAL A . n 
A 1 148 GLY 148 151 151 GLY GLY A . n 
A 1 149 ALA 149 152 152 ALA ALA A . n 
A 1 150 PHE 150 153 153 PHE PHE A . n 
A 1 151 GLY 151 154 154 GLY GLY A . n 
A 1 152 PHE 152 155 155 PHE PHE A . n 
A 1 153 LEU 153 156 156 LEU LEU A . n 
A 1 154 ALA 154 157 157 ALA ALA A . n 
A 1 155 LEU 155 158 158 LEU LEU A . n 
A 1 156 HIS 156 159 159 HIS HIS A . n 
A 1 157 GLY 157 160 160 GLY GLY A . n 
A 1 158 SER 158 161 161 SER SER A . n 
A 1 159 GLN 159 162 162 GLN GLN A . n 
A 1 160 GLU 160 163 163 GLU GLU A . n 
A 1 161 ALA 161 164 164 ALA ALA A . n 
A 1 162 PRO 162 165 165 PRO PRO A . n 
A 1 163 GLY 163 166 166 GLY GLY A . n 
A 1 164 ASN 164 167 167 ASN ASN A . n 
A 1 165 VAL 165 168 168 VAL VAL A . n 
A 1 166 GLY 166 169 169 GLY GLY A . n 
A 1 167 LEU 167 170 170 LEU LEU A . n 
A 1 168 LEU 168 171 171 LEU LEU A . n 
A 1 169 ASP 169 172 172 ASP ASP A . n 
A 1 170 GLN 170 173 173 GLN GLN A . n 
A 1 171 ARG 171 174 174 ARG ARG A . n 
A 1 172 MET 172 175 175 MET MET A . n 
A 1 173 ALA 173 176 176 ALA ALA A . n 
A 1 174 LEU 174 177 177 LEU LEU A . n 
A 1 175 GLN 175 178 178 GLN GLN A . n 
A 1 176 TRP 176 179 179 TRP TRP A . n 
A 1 177 VAL 177 180 180 VAL VAL A . n 
A 1 178 HIS 178 181 181 HIS HIS A . n 
A 1 179 ASP 179 182 182 ASP ASP A . n 
A 1 180 ASN 180 183 183 ASN ASN A . n 
A 1 181 ILE 181 184 184 ILE ILE A . n 
A 1 182 GLN 182 185 185 GLN GLN A . n 
A 1 183 PHE 183 186 186 PHE PHE A . n 
A 1 184 PHE 184 187 187 PHE PHE A . n 
A 1 185 GLY 185 188 188 GLY GLY A . n 
A 1 186 GLY 186 189 189 GLY GLY A . n 
A 1 187 ASP 187 190 190 ASP ASP A . n 
A 1 188 PRO 188 191 191 PRO PRO A . n 
A 1 189 LYS 189 192 192 LYS LYS A . n 
A 1 190 THR 190 193 193 THR THR A . n 
A 1 191 VAL 191 194 194 VAL VAL A . n 
A 1 192 THR 192 195 195 THR THR A . n 
A 1 193 ILE 193 196 196 ILE ILE A . n 
A 1 194 PHE 194 197 197 PHE PHE A . n 
A 1 195 GLY 195 198 198 GLY GLY A . n 
A 1 196 GLU 196 199 199 GLU GLU A . n 
A 1 197 SER 197 200 200 SER SER A . n 
A 1 198 ALA 198 201 201 ALA ALA A . n 
A 1 199 GLY 199 202 202 GLY GLY A . n 
A 1 200 GLY 200 203 203 GLY GLY A . n 
A 1 201 ALA 201 204 204 ALA ALA A . n 
A 1 202 SER 202 205 205 SER SER A . n 
A 1 203 VAL 203 206 206 VAL VAL A . n 
A 1 204 GLY 204 207 207 GLY GLY A . n 
A 1 205 MET 205 208 208 MET MET A . n 
A 1 206 HIS 206 209 209 HIS HIS A . n 
A 1 207 ILE 207 210 210 ILE ILE A . n 
A 1 208 LEU 208 211 211 LEU LEU A . n 
A 1 209 SER 209 212 212 SER SER A . n 
A 1 210 PRO 210 213 213 PRO PRO A . n 
A 1 211 GLY 211 214 214 GLY GLY A . n 
A 1 212 SER 212 215 215 SER SER A . n 
A 1 213 ARG 213 216 216 ARG ARG A . n 
A 1 214 ASP 214 217 217 ASP ASP A . n 
A 1 215 LEU 215 218 218 LEU LEU A . n 
A 1 216 PHE 216 219 219 PHE PHE A . n 
A 1 217 ARG 217 220 220 ARG ARG A . n 
A 1 218 ARG 218 221 221 ARG ARG A . n 
A 1 219 ALA 219 222 222 ALA ALA A . n 
A 1 220 ILE 220 223 223 ILE ILE A . n 
A 1 221 LEU 221 224 224 LEU LEU A . n 
A 1 222 GLN 222 225 225 GLN GLN A . n 
A 1 223 SER 223 226 226 SER SER A . n 
A 1 224 GLY 224 227 227 GLY GLY A . n 
A 1 225 SER 225 228 228 SER SER A . n 
A 1 226 PRO 226 229 229 PRO PRO A . n 
A 1 227 ASN 227 230 230 ASN ASN A . n 
A 1 228 CYS 228 231 231 CYS CYS A . n 
A 1 229 PRO 229 232 232 PRO PRO A . n 
A 1 230 TRP 230 233 233 TRP TRP A . n 
A 1 231 ALA 231 234 234 ALA ALA A . n 
A 1 232 SER 232 235 235 SER SER A . n 
A 1 233 VAL 233 236 236 VAL VAL A . n 
A 1 234 SER 234 237 237 SER SER A . n 
A 1 235 VAL 235 238 238 VAL VAL A . n 
A 1 236 ALA 236 239 239 ALA ALA A . n 
A 1 237 GLU 237 240 240 GLU GLU A . n 
A 1 238 GLY 238 241 241 GLY GLY A . n 
A 1 239 ARG 239 242 242 ARG ARG A . n 
A 1 240 ARG 240 243 243 ARG ARG A . n 
A 1 241 ARG 241 244 244 ARG ARG A . n 
A 1 242 ALA 242 245 245 ALA ALA A . n 
A 1 243 VAL 243 246 246 VAL VAL A . n 
A 1 244 GLU 244 247 247 GLU GLU A . n 
A 1 245 LEU 245 248 248 LEU LEU A . n 
A 1 246 GLY 246 249 249 GLY GLY A . n 
A 1 247 ARG 247 250 250 ARG ARG A . n 
A 1 248 ASN 248 251 251 ASN ASN A . n 
A 1 249 LEU 249 252 252 LEU LEU A . n 
A 1 250 ASN 250 253 253 ASN ASN A . n 
A 1 251 CYS 251 254 254 CYS CYS A . n 
A 1 252 ASN 252 255 255 ASN ASN A . n 
A 1 253 LEU 253 256 256 LEU LEU A . n 
A 1 254 ASN 254 257 257 ASN ASN A . n 
A 1 255 SER 255 258 258 SER SER A . n 
A 1 256 ASP 256 259 259 ASP ASP A . n 
A 1 257 GLU 257 260 260 GLU GLU A . n 
A 1 258 GLU 258 261 261 GLU GLU A . n 
A 1 259 LEU 259 262 262 LEU LEU A . n 
A 1 260 ILE 260 263 263 ILE ILE A . n 
A 1 261 HIS 261 264 264 HIS HIS A . n 
A 1 262 CYS 262 265 265 CYS CYS A . n 
A 1 263 LEU 263 266 266 LEU LEU A . n 
A 1 264 ARG 264 267 267 ARG ARG A . n 
A 1 265 GLU 265 268 268 GLU GLU A . n 
A 1 266 LYS 266 269 269 LYS LYS A . n 
A 1 267 LYS 267 270 270 LYS LYS A . n 
A 1 268 PRO 268 271 271 PRO PRO A . n 
A 1 269 GLN 269 272 272 GLN GLN A . n 
A 1 270 GLU 270 273 273 GLU GLU A . n 
A 1 271 LEU 271 274 274 LEU LEU A . n 
A 1 272 ILE 272 275 275 ILE ILE A . n 
A 1 273 ASP 273 276 276 ASP ASP A . n 
A 1 274 VAL 274 277 277 VAL VAL A . n 
A 1 275 GLU 275 278 278 GLU GLU A . n 
A 1 276 TRP 276 279 279 TRP TRP A . n 
A 1 277 ASN 277 280 280 ASN ASN A . n 
A 1 278 VAL 278 281 281 VAL VAL A . n 
A 1 279 LEU 279 282 282 LEU LEU A . n 
A 1 280 PRO 280 283 283 PRO PRO A . n 
A 1 281 PHE 281 284 284 PHE PHE A . n 
A 1 282 ASP 282 285 285 ASP ASP A . n 
A 1 283 SER 283 286 286 SER SER A . n 
A 1 284 ILE 284 287 287 ILE ILE A . n 
A 1 285 PHE 285 288 288 PHE PHE A . n 
A 1 286 ARG 286 289 289 ARG ARG A . n 
A 1 287 PHE 287 290 290 PHE PHE A . n 
A 1 288 SER 288 291 291 SER SER A . n 
A 1 289 PHE 289 292 292 PHE PHE A . n 
A 1 290 VAL 290 293 293 VAL VAL A . n 
A 1 291 PRO 291 294 294 PRO PRO A . n 
A 1 292 VAL 292 295 295 VAL VAL A . n 
A 1 293 ILE 293 296 296 ILE ILE A . n 
A 1 294 ASP 294 297 297 ASP ASP A . n 
A 1 295 GLY 295 298 298 GLY GLY A . n 
A 1 296 GLU 296 299 299 GLU GLU A . n 
A 1 297 PHE 297 300 300 PHE PHE A . n 
A 1 298 PHE 298 301 301 PHE PHE A . n 
A 1 299 PRO 299 302 302 PRO PRO A . n 
A 1 300 THR 300 303 303 THR THR A . n 
A 1 301 SER 301 304 304 SER SER A . n 
A 1 302 LEU 302 305 305 LEU LEU A . n 
A 1 303 GLU 303 306 306 GLU GLU A . n 
A 1 304 SER 304 307 307 SER SER A . n 
A 1 305 MET 305 308 308 MET MET A . n 
A 1 306 LEU 306 309 309 LEU LEU A . n 
A 1 307 ASN 307 310 310 ASN ASN A . n 
A 1 308 SER 308 311 311 SER SER A . n 
A 1 309 GLY 309 312 312 GLY GLY A . n 
A 1 310 ASN 310 313 313 ASN ASN A . n 
A 1 311 PHE 311 314 314 PHE PHE A . n 
A 1 312 LYS 312 315 315 LYS LYS A . n 
A 1 313 LYS 313 316 316 LYS LYS A . n 
A 1 314 THR 314 317 317 THR THR A . n 
A 1 315 GLN 315 318 318 GLN GLN A . n 
A 1 316 ILE 316 319 319 ILE ILE A . n 
A 1 317 LEU 317 320 320 LEU LEU A . n 
A 1 318 LEU 318 321 321 LEU LEU A . n 
A 1 319 GLY 319 322 322 GLY GLY A . n 
A 1 320 VAL 320 323 323 VAL VAL A . n 
A 1 321 ASN 321 324 324 ASN ASN A . n 
A 1 322 LYS 322 325 325 LYS LYS A . n 
A 1 323 ASP 323 326 326 ASP ASP A . n 
A 1 324 GLU 324 327 327 GLU GLU A . n 
A 1 325 GLY 325 328 328 GLY GLY A . n 
A 1 326 SER 326 329 329 SER SER A . n 
A 1 327 PHE 327 330 330 PHE PHE A . n 
A 1 328 PHE 328 331 331 PHE PHE A . n 
A 1 329 LEU 329 332 332 LEU LEU A . n 
A 1 330 LEU 330 333 333 LEU LEU A . n 
A 1 331 TYR 331 334 334 TYR TYR A . n 
A 1 332 GLY 332 335 335 GLY GLY A . n 
A 1 333 ALA 333 336 336 ALA ALA A . n 
A 1 334 PRO 334 337 337 PRO PRO A . n 
A 1 335 GLY 335 338 338 GLY GLY A . n 
A 1 336 PHE 336 339 339 PHE PHE A . n 
A 1 337 SER 337 340 340 SER SER A . n 
A 1 338 LYS 338 341 341 LYS LYS A . n 
A 1 339 ASP 339 342 342 ASP ASP A . n 
A 1 340 SER 340 343 343 SER SER A . n 
A 1 341 GLU 341 344 344 GLU GLU A . n 
A 1 342 SER 342 345 345 SER SER A . n 
A 1 343 LYS 343 346 346 LYS LYS A . n 
A 1 344 ILE 344 347 347 ILE ILE A . n 
A 1 345 SER 345 348 348 SER SER A . n 
A 1 346 ARG 346 349 349 ARG ARG A . n 
A 1 347 GLU 347 350 350 GLU GLU A . n 
A 1 348 ASP 348 351 351 ASP ASP A . n 
A 1 349 PHE 349 352 352 PHE PHE A . n 
A 1 350 MET 350 353 353 MET MET A . n 
A 1 351 SER 351 354 354 SER SER A . n 
A 1 352 GLY 352 355 355 GLY GLY A . n 
A 1 353 VAL 353 356 356 VAL VAL A . n 
A 1 354 LYS 354 357 357 LYS LYS A . n 
A 1 355 LEU 355 358 358 LEU LEU A . n 
A 1 356 SER 356 359 359 SER SER A . n 
A 1 357 VAL 357 360 360 VAL VAL A . n 
A 1 358 PRO 358 361 361 PRO PRO A . n 
A 1 359 HIS 359 362 362 HIS HIS A . n 
A 1 360 ALA 360 363 363 ALA ALA A . n 
A 1 361 ASN 361 364 364 ASN ASN A . n 
A 1 362 ASP 362 365 365 ASP ASP A . n 
A 1 363 LEU 363 366 366 LEU LEU A . n 
A 1 364 GLY 364 367 367 GLY GLY A . n 
A 1 365 LEU 365 368 368 LEU LEU A . n 
A 1 366 ASP 366 369 369 ASP ASP A . n 
A 1 367 ALA 367 370 370 ALA ALA A . n 
A 1 368 VAL 368 371 371 VAL VAL A . n 
A 1 369 THR 369 372 372 THR THR A . n 
A 1 370 LEU 370 373 373 LEU LEU A . n 
A 1 371 GLN 371 374 374 GLN GLN A . n 
A 1 372 TYR 372 375 375 TYR TYR A . n 
A 1 373 THR 373 376 376 THR THR A . n 
A 1 374 ASP 374 377 377 ASP ASP A . n 
A 1 375 TRP 375 378 378 TRP TRP A . n 
A 1 376 MET 376 379 379 MET MET A . n 
A 1 377 ASP 377 380 380 ASP ASP A . n 
A 1 378 ASP 378 381 381 ASP ASP A . n 
A 1 379 ASN 379 382 382 ASN ASN A . n 
A 1 380 ASN 380 383 383 ASN ASN A . n 
A 1 381 GLY 381 384 384 GLY GLY A . n 
A 1 382 ILE 382 385 385 ILE ILE A . n 
A 1 383 LYS 383 386 386 LYS LYS A . n 
A 1 384 ASN 384 387 387 ASN ASN A . n 
A 1 385 ARG 385 388 388 ARG ARG A . n 
A 1 386 ASP 386 389 389 ASP ASP A . n 
A 1 387 GLY 387 390 390 GLY GLY A . n 
A 1 388 LEU 388 391 391 LEU LEU A . n 
A 1 389 ASP 389 392 392 ASP ASP A . n 
A 1 390 ASP 390 393 393 ASP ASP A . n 
A 1 391 ILE 391 394 394 ILE ILE A . n 
A 1 392 VAL 392 395 395 VAL VAL A . n 
A 1 393 GLY 393 396 396 GLY GLY A . n 
A 1 394 ASP 394 397 397 ASP ASP A . n 
A 1 395 HIS 395 398 398 HIS HIS A . n 
A 1 396 ASN 396 399 399 ASN ASN A . n 
A 1 397 VAL 397 400 400 VAL VAL A . n 
A 1 398 ILE 398 401 401 ILE ILE A . n 
A 1 399 CYS 399 402 402 CYS CYS A . n 
A 1 400 PRO 400 403 403 PRO PRO A . n 
A 1 401 LEU 401 404 404 LEU LEU A . n 
A 1 402 MET 402 405 405 MET MET A . n 
A 1 403 HIS 403 406 406 HIS HIS A . n 
A 1 404 PHE 404 407 407 PHE PHE A . n 
A 1 405 VAL 405 408 408 VAL VAL A . n 
A 1 406 ASN 406 409 409 ASN ASN A . n 
A 1 407 LYS 407 410 410 LYS LYS A . n 
A 1 408 TYR 408 411 411 TYR TYR A . n 
A 1 409 THR 409 412 412 THR THR A . n 
A 1 410 LYS 410 413 413 LYS LYS A . n 
A 1 411 PHE 411 414 414 PHE PHE A . n 
A 1 412 GLY 412 415 415 GLY GLY A . n 
A 1 413 ASN 413 416 416 ASN ASN A . n 
A 1 414 GLY 414 417 417 GLY GLY A . n 
A 1 415 THR 415 418 418 THR THR A . n 
A 1 416 TYR 416 419 419 TYR TYR A . n 
A 1 417 LEU 417 420 420 LEU LEU A . n 
A 1 418 TYR 418 421 421 TYR TYR A . n 
A 1 419 PHE 419 422 422 PHE PHE A . n 
A 1 420 PHE 420 423 423 PHE PHE A . n 
A 1 421 ASN 421 424 424 ASN ASN A . n 
A 1 422 HIS 422 425 425 HIS HIS A . n 
A 1 423 ARG 423 426 426 ARG ARG A . n 
A 1 424 ALA 424 427 427 ALA ALA A . n 
A 1 425 SER 425 428 428 SER SER A . n 
A 1 426 ASN 426 429 429 ASN ASN A . n 
A 1 427 LEU 427 430 430 LEU LEU A . n 
A 1 428 VAL 428 431 431 VAL VAL A . n 
A 1 429 TRP 429 432 432 TRP TRP A . n 
A 1 430 PRO 430 433 433 PRO PRO A . n 
A 1 431 GLU 431 434 434 GLU GLU A . n 
A 1 432 TRP 432 435 435 TRP TRP A . n 
A 1 433 MET 433 436 436 MET MET A . n 
A 1 434 GLY 434 437 437 GLY GLY A . n 
A 1 435 VAL 435 438 438 VAL VAL A . n 
A 1 436 ILE 436 439 439 ILE ILE A . n 
A 1 437 HIS 437 440 440 HIS HIS A . n 
A 1 438 GLY 438 441 441 GLY GLY A . n 
A 1 439 TYR 439 442 442 TYR TYR A . n 
A 1 440 GLU 440 443 443 GLU GLU A . n 
A 1 441 ILE 441 444 444 ILE ILE A . n 
A 1 442 GLU 442 445 445 GLU GLU A . n 
A 1 443 PHE 443 446 446 PHE PHE A . n 
A 1 444 VAL 444 447 447 VAL VAL A . n 
A 1 445 PHE 445 448 448 PHE PHE A . n 
A 1 446 GLY 446 449 449 GLY GLY A . n 
A 1 447 LEU 447 450 450 LEU LEU A . n 
A 1 448 PRO 448 451 451 PRO PRO A . n 
A 1 449 LEU 449 452 452 LEU LEU A . n 
A 1 450 VAL 450 453 453 VAL VAL A . n 
A 1 451 LYS 451 454 454 LYS LYS A . n 
A 1 452 GLU 452 455 455 GLU GLU A . n 
A 1 453 LEU 453 456 456 LEU LEU A . n 
A 1 454 ASN 454 457 457 ASN ASN A . n 
A 1 455 TYR 455 458 458 TYR TYR A . n 
A 1 456 THR 456 459 459 THR THR A . n 
A 1 457 ALA 457 460 460 ALA ALA A . n 
A 1 458 GLU 458 461 461 GLU GLU A . n 
A 1 459 GLU 459 462 462 GLU GLU A . n 
A 1 460 GLU 460 463 463 GLU GLU A . n 
A 1 461 ALA 461 464 464 ALA ALA A . n 
A 1 462 LEU 462 465 465 LEU LEU A . n 
A 1 463 SER 463 466 466 SER SER A . n 
A 1 464 ARG 464 467 467 ARG ARG A . n 
A 1 465 ARG 465 468 468 ARG ARG A . n 
A 1 466 ILE 466 469 469 ILE ILE A . n 
A 1 467 MET 467 470 470 MET MET A . n 
A 1 468 HIS 468 471 471 HIS HIS A . n 
A 1 469 TYR 469 472 472 TYR TYR A . n 
A 1 470 TRP 470 473 473 TRP TRP A . n 
A 1 471 ALA 471 474 474 ALA ALA A . n 
A 1 472 THR 472 475 475 THR THR A . n 
A 1 473 PHE 473 476 476 PHE PHE A . n 
A 1 474 ALA 474 477 477 ALA ALA A . n 
A 1 475 LYS 475 478 478 LYS LYS A . n 
A 1 476 THR 476 479 479 THR THR A . n 
A 1 477 GLY 477 480 480 GLY GLY A . n 
A 1 478 ASN 478 481 481 ASN ASN A . n 
A 1 479 PRO 479 482 482 PRO PRO A . n 
A 1 480 ASN 480 483 483 ASN ASN A . n 
A 1 481 GLU 481 484 484 GLU GLU A . n 
A 1 482 PRO 482 485 485 PRO PRO A . n 
A 1 483 HIS 483 486 486 HIS HIS A . n 
A 1 484 SER 484 487 487 SER SER A . n 
A 1 485 GLN 485 488 488 GLN GLN A . n 
A 1 486 GLU 486 489 489 GLU GLU A . n 
A 1 487 SER 487 490 490 SER SER A . n 
A 1 488 LYS 488 491 491 LYS LYS A . n 
A 1 489 TRP 489 492 492 TRP TRP A . n 
A 1 490 PRO 490 493 493 PRO PRO A . n 
A 1 491 LEU 491 494 494 LEU LEU A . n 
A 1 492 PHE 492 495 495 PHE PHE A . n 
A 1 493 THR 493 496 496 THR THR A . n 
A 1 494 THR 494 497 497 THR THR A . n 
A 1 495 LYS 495 498 498 LYS LYS A . n 
A 1 496 GLU 496 499 499 GLU GLU A . n 
A 1 497 GLN 497 500 500 GLN GLN A . n 
A 1 498 LYS 498 501 501 LYS LYS A . n 
A 1 499 PHE 499 502 502 PHE PHE A . n 
A 1 500 ILE 500 503 503 ILE ILE A . n 
A 1 501 ASP 501 504 504 ASP ASP A . n 
A 1 502 LEU 502 505 505 LEU LEU A . n 
A 1 503 ASN 503 506 506 ASN ASN A . n 
A 1 504 THR 504 507 507 THR THR A . n 
A 1 505 GLU 505 508 508 GLU GLU A . n 
A 1 506 PRO 506 509 509 PRO PRO A . n 
A 1 507 MET 507 510 510 MET MET A . n 
A 1 508 LYS 508 511 511 LYS LYS A . n 
A 1 509 VAL 509 512 512 VAL VAL A . n 
A 1 510 HIS 510 513 513 HIS HIS A . n 
A 1 511 GLN 511 514 514 GLN GLN A . n 
A 1 512 ARG 512 515 515 ARG ARG A . n 
A 1 513 LEU 513 516 516 LEU LEU A . n 
A 1 514 ARG 514 517 517 ARG ARG A . n 
A 1 515 VAL 515 518 518 VAL VAL A . n 
A 1 516 GLN 516 519 519 GLN GLN A . n 
A 1 517 MET 517 520 520 MET MET A . n 
A 1 518 CYS 518 521 521 CYS CYS A . n 
A 1 519 VAL 519 522 522 VAL VAL A . n 
A 1 520 PHE 520 523 523 PHE PHE A . n 
A 1 521 TRP 521 524 524 TRP TRP A . n 
A 1 522 ASN 522 525 525 ASN ASN A . n 
A 1 523 GLN 523 526 526 GLN GLN A . n 
A 1 524 PHE 524 527 527 PHE PHE A . n 
A 1 525 LEU 525 528 528 LEU LEU A . n 
A 1 526 PRO 526 529 529 PRO PRO A . n 
A 1 527 LYS 527 530 530 LYS LYS A . n 
A 1 528 LEU 528 531 531 LEU LEU A . n 
A 1 529 LEU 529 532 532 LEU LEU A . n 
A 1 530 ASN 530 533 533 ASN ASN A . n 
A 1 531 ALA 531 534 534 ALA ALA A . n 
A 1 532 THR 532 535 535 THR THR A . n 
A 1 533 GLU 533 536 ?   ?   ?   A . n 
A 1 534 THR 534 537 ?   ?   ?   A . n 
A 1 535 ILE 535 538 ?   ?   ?   A . n 
A 1 536 ASP 536 539 ?   ?   ?   A . n 
A 1 537 GLU 537 540 ?   ?   ?   A . n 
A 1 538 ALA 538 541 ?   ?   ?   A . n 
A 1 539 GLU 539 542 ?   ?   ?   A . n 
A 1 540 ARG 540 543 ?   ?   ?   A . n 
A 1 541 GLN 541 544 ?   ?   ?   A . n 
A 1 542 TRP 542 545 ?   ?   ?   A . n 
A 1 543 LYS 543 546 ?   ?   ?   A . n 
A 1 544 THR 544 547 ?   ?   ?   A . n 
A 1 545 GLU 545 548 ?   ?   ?   A . n 
A 1 546 PHE 546 549 ?   ?   ?   A . n 
A 1 547 HIS 547 550 ?   ?   ?   A . n 
A 1 548 ARG 548 551 ?   ?   ?   A . n 
A 1 549 TRP 549 552 ?   ?   ?   A . n 
A 1 550 SER 550 553 ?   ?   ?   A . n 
A 1 551 SER 551 554 ?   ?   ?   A . n 
A 1 552 TYR 552 555 ?   ?   ?   A . n 
A 1 553 MET 553 556 ?   ?   ?   A . n 
A 1 554 MET 554 557 ?   ?   ?   A . n 
A 1 555 HIS 555 558 ?   ?   ?   A . n 
A 1 556 TRP 556 559 ?   ?   ?   A . n 
A 1 557 LYS 557 560 ?   ?   ?   A . n 
A 1 558 ASN 558 561 ?   ?   ?   A . n 
A 1 559 GLN 559 562 ?   ?   ?   A . n 
A 1 560 PHE 560 563 ?   ?   ?   A . n 
A 1 561 ASP 561 564 ?   ?   ?   A . n 
A 1 562 HIS 562 565 ?   ?   ?   A . n 
A 1 563 TYR 563 566 ?   ?   ?   A . n 
A 1 564 SER 564 567 ?   ?   ?   A . n 
A 1 565 ARG 565 568 ?   ?   ?   A . n 
A 1 566 HIS 566 569 ?   ?   ?   A . n 
A 1 567 GLU 567 570 ?   ?   ?   A . n 
A 1 568 SER 568 571 ?   ?   ?   A . n 
A 1 569 CYS 569 572 ?   ?   ?   A . n 
A 1 570 ALA 570 573 ?   ?   ?   A . n 
A 1 571 GLU 571 574 ?   ?   ?   A . n 
A 1 572 LEU 572 575 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 N9T 1  601 1  N9T LIG A . 
C 3 NAG 1  602 2  NAG NAG A . 
D 3 NAG 1  603 3  NAG NAG A . 
E 4 HOH 1  701 82 HOH HOH A . 
E 4 HOH 2  702 92 HOH HOH A . 
E 4 HOH 3  703 52 HOH HOH A . 
E 4 HOH 4  704 55 HOH HOH A . 
E 4 HOH 5  705 8  HOH HOH A . 
E 4 HOH 6  706 51 HOH HOH A . 
E 4 HOH 7  707 2  HOH HOH A . 
E 4 HOH 8  708 10 HOH HOH A . 
E 4 HOH 9  709 42 HOH HOH A . 
E 4 HOH 10 710 91 HOH HOH A . 
E 4 HOH 11 711 9  HOH HOH A . 
E 4 HOH 12 712 94 HOH HOH A . 
E 4 HOH 13 713 30 HOH HOH A . 
E 4 HOH 14 714 32 HOH HOH A . 
E 4 HOH 15 715 28 HOH HOH A . 
E 4 HOH 16 716 19 HOH HOH A . 
E 4 HOH 17 717 15 HOH HOH A . 
E 4 HOH 18 718 67 HOH HOH A . 
E 4 HOH 19 719 83 HOH HOH A . 
E 4 HOH 20 720 58 HOH HOH A . 
E 4 HOH 21 721 21 HOH HOH A . 
E 4 HOH 22 722 37 HOH HOH A . 
E 4 HOH 23 723 6  HOH HOH A . 
E 4 HOH 24 724 78 HOH HOH A . 
E 4 HOH 25 725 84 HOH HOH A . 
E 4 HOH 26 726 54 HOH HOH A . 
E 4 HOH 27 727 18 HOH HOH A . 
E 4 HOH 28 728 81 HOH HOH A . 
E 4 HOH 29 729 85 HOH HOH A . 
E 4 HOH 30 730 93 HOH HOH A . 
E 4 HOH 31 731 76 HOH HOH A . 
E 4 HOH 32 732 50 HOH HOH A . 
E 4 HOH 33 733 47 HOH HOH A . 
E 4 HOH 34 734 77 HOH HOH A . 
E 4 HOH 35 735 41 HOH HOH A . 
E 4 HOH 36 736 69 HOH HOH A . 
E 4 HOH 37 737 3  HOH HOH A . 
E 4 HOH 38 738 4  HOH HOH A . 
E 4 HOH 39 739 57 HOH HOH A . 
E 4 HOH 40 740 36 HOH HOH A . 
E 4 HOH 41 741 13 HOH HOH A . 
E 4 HOH 42 742 56 HOH HOH A . 
E 4 HOH 43 743 61 HOH HOH A . 
E 4 HOH 44 744 26 HOH HOH A . 
E 4 HOH 45 745 12 HOH HOH A . 
E 4 HOH 46 746 53 HOH HOH A . 
E 4 HOH 47 747 5  HOH HOH A . 
E 4 HOH 48 748 11 HOH HOH A . 
E 4 HOH 49 749 1  HOH HOH A . 
E 4 HOH 50 750 27 HOH HOH A . 
E 4 HOH 51 751 62 HOH HOH A . 
E 4 HOH 52 752 35 HOH HOH A . 
E 4 HOH 53 753 72 HOH HOH A . 
E 4 HOH 54 754 68 HOH HOH A . 
E 4 HOH 55 755 31 HOH HOH A . 
E 4 HOH 56 756 49 HOH HOH A . 
E 4 HOH 57 757 75 HOH HOH A . 
E 4 HOH 58 758 16 HOH HOH A . 
E 4 HOH 59 759 74 HOH HOH A . 
E 4 HOH 60 760 29 HOH HOH A . 
E 4 HOH 61 761 17 HOH HOH A . 
E 4 HOH 62 762 45 HOH HOH A . 
E 4 HOH 63 763 46 HOH HOH A . 
E 4 HOH 64 764 23 HOH HOH A . 
E 4 HOH 65 765 34 HOH HOH A . 
E 4 HOH 66 766 60 HOH HOH A . 
E 4 HOH 67 767 66 HOH HOH A . 
E 4 HOH 68 768 70 HOH HOH A . 
E 4 HOH 69 769 90 HOH HOH A . 
E 4 HOH 70 770 59 HOH HOH A . 
E 4 HOH 71 771 38 HOH HOH A . 
E 4 HOH 72 772 95 HOH HOH A . 
E 4 HOH 73 773 40 HOH HOH A . 
E 4 HOH 74 774 63 HOH HOH A . 
E 4 HOH 75 775 44 HOH HOH A . 
E 4 HOH 76 776 65 HOH HOH A . 
E 4 HOH 77 777 71 HOH HOH A . 
E 4 HOH 78 778 24 HOH HOH A . 
E 4 HOH 79 779 86 HOH HOH A . 
E 4 HOH 80 780 88 HOH HOH A . 
E 4 HOH 81 781 33 HOH HOH A . 
E 4 HOH 82 782 39 HOH HOH A . 
E 4 HOH 83 783 43 HOH HOH A . 
E 4 HOH 84 784 14 HOH HOH A . 
E 4 HOH 85 785 73 HOH HOH A . 
E 4 HOH 86 786 48 HOH HOH A . 
E 4 HOH 87 787 80 HOH HOH A . 
E 4 HOH 88 788 25 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E 
1 2 A,B,C,D,E 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z           1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  
1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 6_559 -x,-x+y,-z+13/3 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 
0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 595.2700000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-06-10 
2 'Structure model' 1 1 2020-07-29 
3 'Structure model' 1 2 2021-05-12 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 2 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'      
2 2 'Structure model' 'Derived calculations' 
3 2 'Structure model' 'Structure summary'    
4 3 'Structure model' 'Derived calculations' 
5 3 'Structure model' 'Structure summary'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  2 'Structure model' chem_comp                 
2  2 'Structure model' entity                    
3  2 'Structure model' pdbx_chem_comp_identifier 
4  2 'Structure model' pdbx_entity_nonpoly       
5  2 'Structure model' struct_conn               
6  2 'Structure model' struct_site               
7  2 'Structure model' struct_site_gen           
8  3 'Structure model' chem_comp                 
9  3 'Structure model' pdbx_struct_assembly      
10 3 'Structure model' pdbx_struct_assembly_gen  
11 3 'Structure model' pdbx_struct_assembly_prop 
12 3 'Structure model' pdbx_struct_oper_list     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_chem_comp.name'                          
2 2 'Structure model' '_entity.pdbx_description'                 
3 2 'Structure model' '_pdbx_entity_nonpoly.name'                
4 2 'Structure model' '_struct_conn.pdbx_role'                   
5 3 'Structure model' '_chem_comp.pdbx_synonyms'                 
6 3 'Structure model' '_pdbx_struct_assembly.details'            
7 3 'Structure model' '_pdbx_struct_assembly.method_details'     
8 3 'Structure model' '_pdbx_struct_assembly.oligomeric_count'   
9 3 'Structure model' '_pdbx_struct_assembly.oligomeric_details' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 1 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 2 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .           3 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? .           4 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? .           5 
# 
_pdbx_entry_details.entry_id                 6TT0 
_pdbx_entry_details.has_ligand_of_interest   Y 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 ND2 A ASN 416 ? ? C1 A NAG 603 ? ? 1.00 
2 1 SG  A CYS 67  ? ? CB A CYS 94  ? ? 1.74 
3 1 CG  A ASN 416 ? ? C1 A NAG 603 ? ? 1.88 
4 1 ND2 A ASN 416 ? ? O5 A NAG 603 ? ? 1.89 
5 1 CB  A CYS 67  ? ? SG A CYS 94  ? ? 1.93 
6 1 ND2 A ASN 416 ? ? C2 A NAG 603 ? ? 2.09 
7 1 OE1 A GLU 5   ? ? OG A SER 103 ? ? 2.10 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA A CYS 94  ? ? CB A CYS 94  ? ? SG A CYS 94  ? ? 124.49 114.20 10.29 1.10 N 
2 1 C  A SER 103 ? ? N  A PRO 104 ? ? CD A PRO 104 ? ? 136.01 120.60 15.41 2.20 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 24  ? ? 59.16   12.82   
2  1 SER A 25  ? ? -129.28 -165.58 
3  1 PHE A 45  ? ? 81.07   -3.84   
4  1 ALA A 60  ? ? -93.36  52.07   
5  1 LEU A 95  ? ? -64.70  80.92   
6  1 SER A 108 ? ? -153.77 76.38   
7  1 PHE A 120 ? ? 71.81   -3.11   
8  1 PHE A 155 ? ? -143.06 19.89   
9  1 THR A 193 ? ? -152.20 59.18   
10 1 SER A 200 ? ? 51.82   -128.95 
11 1 GLU A 299 ? ? -106.36 -67.92  
12 1 THR A 317 ? ? -159.27 -155.73 
13 1 VAL A 360 ? ? -118.44 66.83   
14 1 ASP A 380 ? ? -152.19 59.21   
15 1 ASN A 382 ? ? -100.51 40.92   
16 1 VAL A 400 ? ? -136.21 -70.47  
17 1 GLU A 455 ? ? -145.76 13.98   
18 1 ASN A 457 ? ? 60.46   74.51   
19 1 HIS A 486 ? ? 51.70   75.04   
# 
_pdbx_unobs_or_zero_occ_atoms.id               1 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag     N 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id     NAG 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id      603 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id     O1 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id     ? 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id    D 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id    NAG 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id     1 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id    O1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLU 536 ? A GLU 533 
2  1 Y 1 A THR 537 ? A THR 534 
3  1 Y 1 A ILE 538 ? A ILE 535 
4  1 Y 1 A ASP 539 ? A ASP 536 
5  1 Y 1 A GLU 540 ? A GLU 537 
6  1 Y 1 A ALA 541 ? A ALA 538 
7  1 Y 1 A GLU 542 ? A GLU 539 
8  1 Y 1 A ARG 543 ? A ARG 540 
9  1 Y 1 A GLN 544 ? A GLN 541 
10 1 Y 1 A TRP 545 ? A TRP 542 
11 1 Y 1 A LYS 546 ? A LYS 543 
12 1 Y 1 A THR 547 ? A THR 544 
13 1 Y 1 A GLU 548 ? A GLU 545 
14 1 Y 1 A PHE 549 ? A PHE 546 
15 1 Y 1 A HIS 550 ? A HIS 547 
16 1 Y 1 A ARG 551 ? A ARG 548 
17 1 Y 1 A TRP 552 ? A TRP 549 
18 1 Y 1 A SER 553 ? A SER 550 
19 1 Y 1 A SER 554 ? A SER 551 
20 1 Y 1 A TYR 555 ? A TYR 552 
21 1 Y 1 A MET 556 ? A MET 553 
22 1 Y 1 A MET 557 ? A MET 554 
23 1 Y 1 A HIS 558 ? A HIS 555 
24 1 Y 1 A TRP 559 ? A TRP 556 
25 1 Y 1 A LYS 560 ? A LYS 557 
26 1 Y 1 A ASN 561 ? A ASN 558 
27 1 Y 1 A GLN 562 ? A GLN 559 
28 1 Y 1 A PHE 563 ? A PHE 560 
29 1 Y 1 A ASP 564 ? A ASP 561 
30 1 Y 1 A HIS 565 ? A HIS 562 
31 1 Y 1 A TYR 566 ? A TYR 563 
32 1 Y 1 A SER 567 ? A SER 564 
33 1 Y 1 A ARG 568 ? A ARG 565 
34 1 Y 1 A HIS 569 ? A HIS 566 
35 1 Y 1 A GLU 570 ? A GLU 567 
36 1 Y 1 A SER 571 ? A SER 568 
37 1 Y 1 A CYS 572 ? A CYS 569 
38 1 Y 1 A ALA 573 ? A ALA 570 
39 1 Y 1 A GLU 574 ? A GLU 571 
40 1 Y 1 A LEU 575 ? A LEU 572 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        N9T 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   N9T 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '(1~{R},3~{S})-~{N}-(6,7-dimethoxy-2-oxidanylidene-chromen-3-yl)-3-[(phenylmethyl)amino]cyclohexane-1-carboxamide' N9T 
3 2-acetamido-2-deoxy-beta-D-glucopyranose                                                                           NAG 
4 water                                                                                                              HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_space_group.name_H-M_alt     'P 31 2 1' 
_space_group.name_Hall        
;P 31 2"
;
_space_group.IT_number        152 
_space_group.crystal_system   trigonal 
_space_group.id               1 
# 
loop_
_space_group_symop.id 
_space_group_symop.operation_xyz 
1 x,y,z          
2 -y,x-y,z+1/3   
3 -x+y,-x,z+2/3  
4 x-y,-y,-z+2/3  
5 -x,-x+y,-z+1/3 
6 y,x,-z         
#