data_6TT8
# 
_entry.id   6TT8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.339 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6TT8         
WWPDB D_1292105975 
BMRB  34471        
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        'Haddock model of NDM-1/morin complex' 
_pdbx_database_related.db_id          34471 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        6TT8 
_pdbx_database_status.recvd_initial_deposition_date   2019-12-25 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Riviere, G.'        1  ? 
'Oueslati, S.'       2  ? 
'Gayral, M.'         3  ? 
'Crechet, J.B.'      4  ? 
'Nhiri, N.'          5  ? 
'Jacquet, E.'        6  ? 
'Cintrat, J.C.'      7  ? 
'Giraud, F.'         8  ? 
'van Heijenoort, C.' 9  ? 
'Lescop, E.'         10 ? 
'Pethe, S.'          11 ? 
'Iorga, B.I.'        12 ? 
'Naas, T.'           13 ? 
'Guittet, E.'        14 ? 
'Morellet, N.'       15 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Acs Omega' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2470-1343 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            5 
_citation.language                  ? 
_citation.page_first                10466 
_citation.page_last                 10480 
_citation.title                     
;NMR Characterization of the Influence of Zinc(II) Ions on the Structural and Dynamic Behavior of the New Delhi Metallo-beta-Lactamase-1 and on the Binding with Flavonols as Inhibitors.
;
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acsomega.0c00590 
_citation.pdbx_database_id_PubMed   32426604 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Riviere, G.'        1  ? 
primary 'Oueslati, S.'       2  ? 
primary 'Gayral, M.'         3  ? 
primary 'Crechet, J.B.'      4  ? 
primary 'Nhiri, N.'          5  ? 
primary 'Jacquet, E.'        6  ? 
primary 'Cintrat, J.C.'      7  ? 
primary 'Giraud, F.'         8  ? 
primary 'van Heijenoort, C.' 9  ? 
primary 'Lescop, E.'         10 ? 
primary 'Pethe, S.'          11 ? 
primary 'Iorga, B.I.'        12 ? 
primary 'Naas, T.'           13 ? 
primary 'Guittet, E.'        14 ? 
primary 'Morellet, N.'       15 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Metallo beta lactamase NDM-1'                                  23974.957 1 ? ? ? ? 
2 non-polymer syn 'ZINC ION'                                                      65.409    2 ? ? ? ? 
3 non-polymer syn '2-[2,4-bis(oxidanyl)phenyl]-3,5,7-tris(oxidanyl)chromen-4-one' 302.236   1 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Metallo beta-lactamase,Metallo-beta-lactamase,NDM-1,NDM carbapenemase,NDM-1 metallo-beta-lactamase,NDM1 metallo-beta-lactamase,New Delhi Metallo carbapenemase-1,New Delhi metallo-beta-lactamse 1,Subclass B1 metallo-beta-lactamase NDM-1
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAH
QDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTD
IAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAH
QDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTD
IAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   GLN n 
1 3   ARG n 
1 4   PHE n 
1 5   GLY n 
1 6   ASP n 
1 7   LEU n 
1 8   VAL n 
1 9   PHE n 
1 10  ARG n 
1 11  GLN n 
1 12  LEU n 
1 13  ALA n 
1 14  PRO n 
1 15  ASN n 
1 16  VAL n 
1 17  TRP n 
1 18  GLN n 
1 19  HIS n 
1 20  THR n 
1 21  SER n 
1 22  TYR n 
1 23  LEU n 
1 24  ASP n 
1 25  MET n 
1 26  PRO n 
1 27  GLY n 
1 28  PHE n 
1 29  GLY n 
1 30  ALA n 
1 31  VAL n 
1 32  ALA n 
1 33  SER n 
1 34  ASN n 
1 35  GLY n 
1 36  LEU n 
1 37  ILE n 
1 38  VAL n 
1 39  ARG n 
1 40  ASP n 
1 41  GLY n 
1 42  GLY n 
1 43  ARG n 
1 44  VAL n 
1 45  LEU n 
1 46  VAL n 
1 47  VAL n 
1 48  ASP n 
1 49  THR n 
1 50  ALA n 
1 51  TRP n 
1 52  THR n 
1 53  ASP n 
1 54  ASP n 
1 55  GLN n 
1 56  THR n 
1 57  ALA n 
1 58  GLN n 
1 59  ILE n 
1 60  LEU n 
1 61  ASN n 
1 62  TRP n 
1 63  ILE n 
1 64  LYS n 
1 65  GLN n 
1 66  GLU n 
1 67  ILE n 
1 68  ASN n 
1 69  LEU n 
1 70  PRO n 
1 71  VAL n 
1 72  ALA n 
1 73  LEU n 
1 74  ALA n 
1 75  VAL n 
1 76  VAL n 
1 77  THR n 
1 78  HIS n 
1 79  ALA n 
1 80  HIS n 
1 81  GLN n 
1 82  ASP n 
1 83  LYS n 
1 84  MET n 
1 85  GLY n 
1 86  GLY n 
1 87  MET n 
1 88  ASP n 
1 89  ALA n 
1 90  LEU n 
1 91  HIS n 
1 92  ALA n 
1 93  ALA n 
1 94  GLY n 
1 95  ILE n 
1 96  ALA n 
1 97  THR n 
1 98  TYR n 
1 99  ALA n 
1 100 ASN n 
1 101 ALA n 
1 102 LEU n 
1 103 SER n 
1 104 ASN n 
1 105 GLN n 
1 106 LEU n 
1 107 ALA n 
1 108 PRO n 
1 109 GLN n 
1 110 GLU n 
1 111 GLY n 
1 112 MET n 
1 113 VAL n 
1 114 ALA n 
1 115 ALA n 
1 116 GLN n 
1 117 HIS n 
1 118 SER n 
1 119 LEU n 
1 120 THR n 
1 121 PHE n 
1 122 ALA n 
1 123 ALA n 
1 124 ASN n 
1 125 GLY n 
1 126 TRP n 
1 127 VAL n 
1 128 GLU n 
1 129 PRO n 
1 130 ALA n 
1 131 THR n 
1 132 ALA n 
1 133 PRO n 
1 134 ASN n 
1 135 PHE n 
1 136 GLY n 
1 137 PRO n 
1 138 LEU n 
1 139 LYS n 
1 140 VAL n 
1 141 PHE n 
1 142 TYR n 
1 143 PRO n 
1 144 GLY n 
1 145 PRO n 
1 146 GLY n 
1 147 HIS n 
1 148 THR n 
1 149 SER n 
1 150 ASP n 
1 151 ASN n 
1 152 ILE n 
1 153 THR n 
1 154 VAL n 
1 155 GLY n 
1 156 ILE n 
1 157 ASP n 
1 158 GLY n 
1 159 THR n 
1 160 ASP n 
1 161 ILE n 
1 162 ALA n 
1 163 PHE n 
1 164 GLY n 
1 165 GLY n 
1 166 CYS n 
1 167 LEU n 
1 168 ILE n 
1 169 LYS n 
1 170 ASP n 
1 171 SER n 
1 172 LYS n 
1 173 ALA n 
1 174 LYS n 
1 175 SER n 
1 176 LEU n 
1 177 GLY n 
1 178 ASN n 
1 179 LEU n 
1 180 GLY n 
1 181 ASP n 
1 182 ALA n 
1 183 ASP n 
1 184 THR n 
1 185 GLU n 
1 186 HIS n 
1 187 TYR n 
1 188 ALA n 
1 189 ALA n 
1 190 SER n 
1 191 ALA n 
1 192 ARG n 
1 193 ALA n 
1 194 PHE n 
1 195 GLY n 
1 196 ALA n 
1 197 ALA n 
1 198 PHE n 
1 199 PRO n 
1 200 LYS n 
1 201 ALA n 
1 202 SER n 
1 203 MET n 
1 204 ILE n 
1 205 VAL n 
1 206 MET n 
1 207 SER n 
1 208 HIS n 
1 209 SER n 
1 210 ALA n 
1 211 PRO n 
1 212 ASP n 
1 213 SER n 
1 214 ARG n 
1 215 ALA n 
1 216 ALA n 
1 217 ILE n 
1 218 THR n 
1 219 HIS n 
1 220 THR n 
1 221 ALA n 
1 222 ARG n 
1 223 MET n 
1 224 ALA n 
1 225 ASP n 
1 226 LYS n 
1 227 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   227 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 
;blaNDM-1, bla NDM-1, blaNDM-1_1, blaNDM-1_2, blaNDM-1_3, blaNDM1, NDM-1, BANRA_05884, C3483_29595, C7V41_28630, D647_p47098, EC13450_007, FAQ72_26810, FAQ97_27095, FAS39_27275, NCTC13443_00040, p2146_00143, pCRE380_21, PMK1_ndm00067, PMK1_ndm00076, PMK1_ndm00085, pN11x00042NDM_090, pNDM-SX04_5, pNDM10469_138, SAMEA3531848_05178, TR3_031, TR4_031
;
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Klebsiella pneumoniae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     573 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    E9NWK5_KLEPN 
_struct_ref.pdbx_db_accession          E9NWK5 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAH
QDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTD
IAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKL
;
_struct_ref.pdbx_align_begin           43 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6TT8 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 227 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             E9NWK5 
_struct_ref_seq.db_align_beg                  43 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  269 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       43 
_struct_ref_seq.pdbx_auth_seq_align_end       269 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                         ?     'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                        ?     'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                      ?     'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                 ?     'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                        ?     'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                       ?     'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                 ?     'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                         ?     'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                       ?     'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                      ?     'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                         ?     'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                          ?     'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                      ?     'C5 H11 N O2 S'  149.211 
MRI non-polymer         . '2-[2,4-bis(oxidanyl)phenyl]-3,5,7-tris(oxidanyl)chromen-4-one' Morin 'C15 H10 O7'     302.236 
PHE 'L-peptide linking' y PHENYLALANINE                                                   ?     'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                         ?     'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                          ?     'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                       ?     'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                      ?     'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                        ?     'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                          ?     'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'                                                      ?     'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1 1 1 '2D 1H-15N HSQC' 1 isotropic 
2 1 1 '2D 1H-15N HSQC' 2 isotropic 
3 1 1 '3D HNCO'        2 isotropic 
4 1 1 '3D HNCA'        2 isotropic 
5 1 1 '3D HNCACB'      2 isotropic 
6 1 1 '3D HN(CO)CA'    2 isotropic 
7 1 1 '3D HN(COCA)CB'  2 isotropic 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            293 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1 
_pdbx_nmr_exptl_sample_conditions.pH                     7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         150 
_pdbx_nmr_exptl_sample_conditions.details                ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   mM 
_pdbx_nmr_exptl_sample_conditions.label                  condition_1 
_pdbx_nmr_exptl_sample_conditions.pH_err                 0.05 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           ? 
_pdbx_nmr_exptl_sample_conditions.temperature_err        ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'320 uM [U-13C; U-15N] NDM-1, 1280 uM morin, 0.1 mM Bis-tris, 150 mM sodium chloride, 2.5 % DMSO, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
_pdbx_nmr_sample_details.label            '15N, 13C sample' 
_pdbx_nmr_sample_details.type             solution 
_pdbx_nmr_sample_details.details          ? 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.details 
1 'AVANCE III' ? Bruker 800 ? 
2 'AVANCE II'  ? Bruker 600 ? 
# 
_pdbx_nmr_refine.entry_id           6TT8 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   4 
# 
_pdbx_nmr_ensemble.entry_id                                      6TT8 
_pdbx_nmr_ensemble.conformers_calculated_total_number            2800 
_pdbx_nmr_ensemble.conformers_submitted_total_number             56 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             6TT8 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 collection                  TopSpin           ? 'Bruker Biospin' 
2 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN             
3 'data analysis'             'CcpNmr Analysis' ? CCPN             
4 'structure calculation'     HADDOCK           ? Bonvin           
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6TT8 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6TT8 
_struct.title                        'Haddock model of NDM-1/morin complex' 
_struct.pdbx_descriptor              'Metallo beta lactamase NDM-1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6TT8 
_struct_keywords.text            
'complex, inhibitor, morin, New-Delhi Metallo-beta-lactamase-1, Haddock, antimicrobial resistance, METAL BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 THR A 52  ? GLU A 66  ? THR A 94  GLU A 108 1 ? 15 
HELX_P HELX_P2 AA2 GLY A 86  ? GLY A 94  ? GLY A 128 GLY A 136 1 ? 9  
HELX_P HELX_P3 AA3 ALA A 101 ? GLY A 111 ? ALA A 143 GLY A 153 1 ? 11 
HELX_P HELX_P4 AA4 HIS A 186 ? PHE A 198 ? HIS A 228 PHE A 240 1 ? 13 
HELX_P HELX_P5 AA5 ARG A 214 ? ASP A 225 ? ARG A 256 ASP A 267 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A HIS 78  NE2 ? ? ? 1_555 B ZN  . ZN  ? ? A HIS 120 A ZN  301 1_555 ? ? ? ? ? ? ? 1.910 ? ? 
metalc2 metalc ? ? A HIS 80  ND1 ? ? ? 1_555 B ZN  . ZN  ? ? A HIS 122 A ZN  301 1_555 ? ? ? ? ? ? ? 1.831 ? ? 
metalc3 metalc ? ? A HIS 147 NE2 ? ? ? 1_555 B ZN  . ZN  ? ? A HIS 189 A ZN  301 1_555 ? ? ? ? ? ? ? 1.958 ? ? 
metalc4 metalc ? ? A HIS 208 NE2 ? ? ? 1_555 C ZN  . ZN  ? ? A HIS 250 A ZN  302 1_555 ? ? ? ? ? ? ? 1.872 ? ? 
metalc5 metalc ? ? B ZN  .   ZN  ? ? ? 1_555 D MRI . OAC ? ? A ZN  301 A MRI 303 1_555 ? ? ? ? ? ? ? 2.046 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 8 ? 
AA2 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? parallel      
AA1 6 7 ? parallel      
AA1 7 8 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLN A 2   ? PHE A 4   ? GLN A 44  PHE A 46  
AA1 2 LEU A 7   ? ALA A 13  ? LEU A 49  ALA A 55  
AA1 3 VAL A 16  ? MET A 25  ? VAL A 58  MET A 67  
AA1 4 GLY A 29  ? ASP A 40  ? GLY A 71  ASP A 82  
AA1 5 ARG A 43  ? VAL A 47  ? ARG A 85  VAL A 89  
AA1 6 VAL A 71  ? VAL A 75  ? VAL A 113 VAL A 117 
AA1 7 ALA A 96  ? ASN A 100 ? ALA A 138 ASN A 142 
AA1 8 HIS A 117 ? LEU A 119 ? HIS A 159 LEU A 161 
AA2 1 LEU A 138 ? PHE A 141 ? LEU A 180 PHE A 183 
AA2 2 THR A 153 ? ILE A 156 ? THR A 195 ILE A 198 
AA2 3 ILE A 161 ? GLY A 165 ? ILE A 203 GLY A 207 
AA2 4 MET A 203 ? MET A 206 ? MET A 245 MET A 248 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLN A 2   ? N GLN A 44  O PHE A 9   ? O PHE A 51  
AA1 2 3 N ARG A 10  ? N ARG A 52  O GLN A 18  ? O GLN A 60  
AA1 3 4 N MET A 25  ? N MET A 67  O GLY A 29  ? O GLY A 71  
AA1 4 5 N VAL A 38  ? N VAL A 80  O LEU A 45  ? O LEU A 87  
AA1 5 6 N VAL A 44  ? N VAL A 86  O ALA A 72  ? O ALA A 114 
AA1 6 7 N ALA A 74  ? N ALA A 116 O TYR A 98  ? O TYR A 140 
AA1 7 8 N ALA A 99  ? N ALA A 141 O LEU A 119 ? O LEU A 161 
AA2 1 2 N PHE A 141 ? N PHE A 183 O THR A 153 ? O THR A 195 
AA2 2 3 N VAL A 154 ? N VAL A 196 O PHE A 163 ? O PHE A 205 
AA2 3 4 N GLY A 164 ? N GLY A 206 O VAL A 205 ? O VAL A 247 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN  301 ? 5  'binding site for residue ZN A 301'  
AC2 Software A ZN  302 ? 4  'binding site for residue ZN A 302'  
AC3 Software A MRI 303 ? 11 'binding site for residue MRI A 303' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  HIS A 78  ? HIS A 120 . ? 1_555 ? 
2  AC1 5  HIS A 80  ? HIS A 122 . ? 1_555 ? 
3  AC1 5  ASP A 82  ? ASP A 124 . ? 1_555 ? 
4  AC1 5  HIS A 147 ? HIS A 189 . ? 1_555 ? 
5  AC1 5  MRI D .   ? MRI A 303 . ? 1_555 ? 
6  AC2 4  ASP A 82  ? ASP A 124 . ? 1_555 ? 
7  AC2 4  CYS A 166 ? CYS A 208 . ? 1_555 ? 
8  AC2 4  HIS A 208 ? HIS A 250 . ? 1_555 ? 
9  AC2 4  MRI D .   ? MRI A 303 . ? 1_555 ? 
10 AC3 11 PHE A 28  ? PHE A 70  . ? 1_555 ? 
11 AC3 11 HIS A 78  ? HIS A 120 . ? 1_555 ? 
12 AC3 11 HIS A 80  ? HIS A 122 . ? 1_555 ? 
13 AC3 11 GLN A 81  ? GLN A 123 . ? 1_555 ? 
14 AC3 11 ASP A 82  ? ASP A 124 . ? 1_555 ? 
15 AC3 11 HIS A 147 ? HIS A 189 . ? 1_555 ? 
16 AC3 11 GLY A 177 ? GLY A 219 . ? 1_555 ? 
17 AC3 11 ASN A 178 ? ASN A 220 . ? 1_555 ? 
18 AC3 11 HIS A 208 ? HIS A 250 . ? 1_555 ? 
19 AC3 11 ZN  B .   ? ZN  A 301 . ? 1_555 ? 
20 AC3 11 ZN  C .   ? ZN  A 302 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6TT8 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1      N  N    . ASP A 1 1   ? -9.122  -12.132 12.789  1.00 15.00 ?  43  ASP A N    1  
ATOM   2      C  CA   . ASP A 1 1   ? -9.251  -12.047 11.341  1.00 15.00 ?  43  ASP A CA   1  
ATOM   3      C  C    . ASP A 1 1   ? -10.640 -12.496 10.918  1.00 15.00 ?  43  ASP A C    1  
ATOM   4      O  O    . ASP A 1 1   ? -11.116 -13.552 11.337  1.00 15.00 ?  43  ASP A O    1  
ATOM   5      C  CB   . ASP A 1 1   ? -8.197  -12.913 10.641  1.00 15.00 ?  43  ASP A CB   1  
ATOM   6      C  CG   . ASP A 1 1   ? -6.777  -12.578 11.054  1.00 15.00 ?  43  ASP A CG   1  
ATOM   7      O  OD1  . ASP A 1 1   ? -6.316  -11.451 10.786  1.00 15.00 ?  43  ASP A OD1  1  
ATOM   8      O  OD2  . ASP A 1 1   ? -6.101  -13.450 11.642  1.00 15.00 -1 43  ASP A OD2  1  
ATOM   9      H  H1   . ASP A 1 1   ? -8.982  -13.009 13.203  1.00 15.00 ?  43  ASP A H1   1  
ATOM   10     H  HA   . ASP A 1 1   ? -9.112  -11.016 11.053  1.00 15.00 ?  43  ASP A HA   1  
ATOM   11     H  HB2  . ASP A 1 1   ? -8.383  -13.951 10.869  1.00 15.00 ?  43  ASP A HB2  1  
ATOM   12     H  HB3  . ASP A 1 1   ? -8.283  -12.767 9.573   1.00 15.00 ?  43  ASP A HB3  1  
ATOM   13     N  N    . GLN A 1 2   ? -11.298 -11.688 10.108  1.00 15.00 ?  44  GLN A N    1  
ATOM   14     C  CA   . GLN A 1 2   ? -12.628 -12.010 9.617   1.00 15.00 ?  44  GLN A CA   1  
ATOM   15     C  C    . GLN A 1 2   ? -12.563 -12.308 8.127   1.00 15.00 ?  44  GLN A C    1  
ATOM   16     O  O    . GLN A 1 2   ? -12.052 -11.501 7.354   1.00 15.00 ?  44  GLN A O    1  
ATOM   17     C  CB   . GLN A 1 2   ? -13.593 -10.848 9.873   1.00 15.00 ?  44  GLN A CB   1  
ATOM   18     C  CG   . GLN A 1 2   ? -15.032 -11.153 9.483   1.00 15.00 ?  44  GLN A CG   1  
ATOM   19     C  CD   . GLN A 1 2   ? -15.835 -9.904  9.171   1.00 15.00 ?  44  GLN A CD   1  
ATOM   20     O  OE1  . GLN A 1 2   ? -15.300 -8.902  8.692   1.00 15.00 ?  44  GLN A OE1  1  
ATOM   21     N  NE2  . GLN A 1 2   ? -17.126 -9.950  9.450   1.00 15.00 ?  44  GLN A NE2  1  
ATOM   22     H  H    . GLN A 1 2   ? -10.871 -10.846 9.818   1.00 15.00 ?  44  GLN A H    1  
ATOM   23     H  HA   . GLN A 1 2   ? -12.977 -12.887 10.140  1.00 15.00 ?  44  GLN A HA   1  
ATOM   24     H  HB2  . GLN A 1 2   ? -13.571 -10.608 10.925  1.00 15.00 ?  44  GLN A HB2  1  
ATOM   25     H  HB3  . GLN A 1 2   ? -13.264 -9.986  9.310   1.00 15.00 ?  44  GLN A HB3  1  
ATOM   26     H  HG2  . GLN A 1 2   ? -15.031 -11.790 8.610   1.00 15.00 ?  44  GLN A HG2  1  
ATOM   27     H  HG3  . GLN A 1 2   ? -15.512 -11.672 10.301  1.00 15.00 ?  44  GLN A HG3  1  
ATOM   28     H  HE21 . GLN A 1 2   ? -17.486 -10.775 9.841   1.00 15.00 ?  44  GLN A HE21 1  
ATOM   29     H  HE22 . GLN A 1 2   ? -17.671 -9.160  9.260   1.00 15.00 ?  44  GLN A HE22 1  
ATOM   30     N  N    . ARG A 1 3   ? -13.061 -13.465 7.718   1.00 15.00 ?  45  ARG A N    1  
ATOM   31     C  CA   . ARG A 1 3   ? -13.037 -13.823 6.311   1.00 15.00 ?  45  ARG A CA   1  
ATOM   32     C  C    . ARG A 1 3   ? -14.296 -13.341 5.602   1.00 15.00 ?  45  ARG A C    1  
ATOM   33     O  O    . ARG A 1 3   ? -15.417 -13.573 6.062   1.00 15.00 ?  45  ARG A O    1  
ATOM   34     C  CB   . ARG A 1 3   ? -12.879 -15.331 6.131   1.00 15.00 ?  45  ARG A CB   1  
ATOM   35     C  CG   . ARG A 1 3   ? -12.819 -15.752 4.668   1.00 15.00 ?  45  ARG A CG   1  
ATOM   36     C  CD   . ARG A 1 3   ? -12.553 -17.235 4.510   1.00 15.00 ?  45  ARG A CD   1  
ATOM   37     N  NE   . ARG A 1 3   ? -12.598 -17.636 3.107   1.00 15.00 ?  45  ARG A NE   1  
ATOM   38     C  CZ   . ARG A 1 3   ? -12.178 -18.812 2.659   1.00 15.00 ?  45  ARG A CZ   1  
ATOM   39     N  NH1  . ARG A 1 3   ? -11.674 -19.706 3.495   1.00 15.00 1  45  ARG A NH1  1  
ATOM   40     N  NH2  . ARG A 1 3   ? -12.270 -19.097 1.365   1.00 15.00 ?  45  ARG A NH2  1  
ATOM   41     H  H    . ARG A 1 3   ? -13.449 -14.086 8.370   1.00 15.00 ?  45  ARG A H    1  
ATOM   42     H  HA   . ARG A 1 3   ? -12.181 -13.331 5.866   1.00 15.00 ?  45  ARG A HA   1  
ATOM   43     H  HB2  . ARG A 1 3   ? -11.970 -15.650 6.619   1.00 15.00 ?  45  ARG A HB2  1  
ATOM   44     H  HB3  . ARG A 1 3   ? -13.719 -15.828 6.592   1.00 15.00 ?  45  ARG A HB3  1  
ATOM   45     H  HG2  . ARG A 1 3   ? -13.763 -15.519 4.199   1.00 15.00 ?  45  ARG A HG2  1  
ATOM   46     H  HG3  . ARG A 1 3   ? -12.030 -15.200 4.177   1.00 15.00 ?  45  ARG A HG3  1  
ATOM   47     H  HD2  . ARG A 1 3   ? -11.573 -17.459 4.906   1.00 15.00 ?  45  ARG A HD2  1  
ATOM   48     H  HD3  . ARG A 1 3   ? -13.300 -17.786 5.060   1.00 15.00 ?  45  ARG A HD3  1  
ATOM   49     H  HE   . ARG A 1 3   ? -12.970 -16.987 2.462   1.00 15.00 ?  45  ARG A HE   1  
ATOM   50     H  HH11 . ARG A 1 3   ? -11.343 -20.631 3.141   1.00 15.00 ?  45  ARG A HH11 1  
ATOM   51     H  HH12 . ARG A 1 3   ? -11.610 -19.488 4.513   1.00 15.00 ?  45  ARG A HH12 1  
ATOM   52     H  HH21 . ARG A 1 3   ? -11.940 -20.017 1.005   1.00 15.00 ?  45  ARG A HH21 1  
ATOM   53     H  HH22 . ARG A 1 3   ? -12.679 -18.402 0.703   1.00 15.00 ?  45  ARG A HH22 1  
ATOM   54     N  N    . PHE A 1 4   ? -14.098 -12.659 4.489   1.00 15.00 ?  46  PHE A N    1  
ATOM   55     C  CA   . PHE A 1 4   ? -15.184 -12.147 3.681   1.00 15.00 ?  46  PHE A CA   1  
ATOM   56     C  C    . PHE A 1 4   ? -15.038 -12.701 2.269   1.00 15.00 ?  46  PHE A C    1  
ATOM   57     O  O    . PHE A 1 4   ? -14.405 -12.083 1.412   1.00 15.00 ?  46  PHE A O    1  
ATOM   58     C  CB   . PHE A 1 4   ? -15.153 -10.615 3.667   1.00 15.00 ?  46  PHE A CB   1  
ATOM   59     C  CG   . PHE A 1 4   ? -16.350 -9.980  3.016   1.00 15.00 ?  46  PHE A CG   1  
ATOM   60     C  CD1  . PHE A 1 4   ? -16.250 -9.402  1.758   1.00 15.00 ?  46  PHE A CD1  1  
ATOM   61     C  CD2  . PHE A 1 4   ? -17.574 -9.958  3.660   1.00 15.00 ?  46  PHE A CD2  1  
ATOM   62     C  CE1  . PHE A 1 4   ? -17.348 -8.816  1.158   1.00 15.00 ?  46  PHE A CE1  1  
ATOM   63     C  CE2  . PHE A 1 4   ? -18.678 -9.373  3.066   1.00 15.00 ?  46  PHE A CE2  1  
ATOM   64     C  CZ   . PHE A 1 4   ? -18.565 -8.801  1.813   1.00 15.00 ?  46  PHE A CZ   1  
ATOM   65     H  H    . PHE A 1 4   ? -13.172 -12.495 4.187   1.00 15.00 ?  46  PHE A H    1  
ATOM   66     H  HA   . PHE A 1 4   ? -16.116 -12.489 4.107   1.00 15.00 ?  46  PHE A HA   1  
ATOM   67     H  HB2  . PHE A 1 4   ? -15.102 -10.252 4.684   1.00 15.00 ?  46  PHE A HB2  1  
ATOM   68     H  HB3  . PHE A 1 4   ? -14.274 -10.291 3.132   1.00 15.00 ?  46  PHE A HB3  1  
ATOM   69     H  HD1  . PHE A 1 4   ? -15.299 -9.410  1.245   1.00 15.00 ?  46  PHE A HD1  1  
ATOM   70     H  HD2  . PHE A 1 4   ? -17.664 -10.404 4.636   1.00 15.00 ?  46  PHE A HD2  1  
ATOM   71     H  HE1  . PHE A 1 4   ? -17.256 -8.369  0.175   1.00 15.00 ?  46  PHE A HE1  1  
ATOM   72     H  HE2  . PHE A 1 4   ? -19.628 -9.362  3.583   1.00 15.00 ?  46  PHE A HE2  1  
ATOM   73     H  HZ   . PHE A 1 4   ? -19.427 -8.343  1.346   1.00 15.00 ?  46  PHE A HZ   1  
ATOM   74     N  N    . GLY A 1 5   ? -15.581 -13.891 2.046   1.00 15.00 ?  47  GLY A N    1  
ATOM   75     C  CA   . GLY A 1 5   ? -15.485 -14.519 0.745   1.00 15.00 ?  47  GLY A CA   1  
ATOM   76     C  C    . GLY A 1 5   ? -14.102 -15.074 0.493   1.00 15.00 ?  47  GLY A C    1  
ATOM   77     O  O    . GLY A 1 5   ? -13.701 -16.067 1.105   1.00 15.00 ?  47  GLY A O    1  
ATOM   78     H  H    . GLY A 1 5   ? -16.040 -14.356 2.777   1.00 15.00 ?  47  GLY A H    1  
ATOM   79     H  HA2  . GLY A 1 5   ? -16.201 -15.325 0.686   1.00 15.00 ?  47  GLY A HA2  1  
ATOM   80     H  HA3  . GLY A 1 5   ? -15.711 -13.787 -0.019  1.00 15.00 ?  47  GLY A HA3  1  
ATOM   81     N  N    . ASP A 1 6   ? -13.359 -14.412 -0.380  1.00 15.00 ?  48  ASP A N    1  
ATOM   82     C  CA   . ASP A 1 6   ? -12.010 -14.848 -0.717  1.00 15.00 ?  48  ASP A CA   1  
ATOM   83     C  C    . ASP A 1 6   ? -10.967 -13.939 -0.079  1.00 15.00 ?  48  ASP A C    1  
ATOM   84     O  O    . ASP A 1 6   ? -9.767  -14.185 -0.193  1.00 15.00 ?  48  ASP A O    1  
ATOM   85     C  CB   . ASP A 1 6   ? -11.805 -14.854 -2.231  1.00 15.00 ?  48  ASP A CB   1  
ATOM   86     C  CG   . ASP A 1 6   ? -12.445 -16.042 -2.917  1.00 15.00 ?  48  ASP A CG   1  
ATOM   87     O  OD1  . ASP A 1 6   ? -12.448 -17.149 -2.339  1.00 15.00 ?  48  ASP A OD1  1  
ATOM   88     O  OD2  . ASP A 1 6   ? -12.937 -15.875 -4.055  1.00 15.00 -1 48  ASP A OD2  1  
ATOM   89     H  H    . ASP A 1 6   ? -13.723 -13.604 -0.802  1.00 15.00 ?  48  ASP A H    1  
ATOM   90     H  HA   . ASP A 1 6   ? -11.879 -15.852 -0.339  1.00 15.00 ?  48  ASP A HA   1  
ATOM   91     H  HB2  . ASP A 1 6   ? -12.233 -13.957 -2.647  1.00 15.00 ?  48  ASP A HB2  1  
ATOM   92     H  HB3  . ASP A 1 6   ? -10.744 -14.870 -2.442  1.00 15.00 ?  48  ASP A HB3  1  
ATOM   93     N  N    . LEU A 1 7   ? -11.427 -12.884 0.584   1.00 15.00 ?  49  LEU A N    1  
ATOM   94     C  CA   . LEU A 1 7   ? -10.522 -11.934 1.220   1.00 15.00 ?  49  LEU A CA   1  
ATOM   95     C  C    . LEU A 1 7   ? -10.659 -11.978 2.737   1.00 15.00 ?  49  LEU A C    1  
ATOM   96     O  O    . LEU A 1 7   ? -11.702 -12.363 3.265   1.00 15.00 ?  49  LEU A O    1  
ATOM   97     C  CB   . LEU A 1 7   ? -10.793 -10.510 0.722   1.00 15.00 ?  49  LEU A CB   1  
ATOM   98     C  CG   . LEU A 1 7   ? -10.317 -10.203 -0.702  1.00 15.00 ?  49  LEU A CG   1  
ATOM   99     C  CD1  . LEU A 1 7   ? -11.336 -10.675 -1.728  1.00 15.00 ?  49  LEU A CD1  1  
ATOM   100    C  CD2  . LEU A 1 7   ? -10.048 -8.716  -0.864  1.00 15.00 ?  49  LEU A CD2  1  
ATOM   101    H  H    . LEU A 1 7   ? -12.395 -12.747 0.657   1.00 15.00 ?  49  LEU A H    1  
ATOM   102    H  HA   . LEU A 1 7   ? -9.514  -12.211 0.951   1.00 15.00 ?  49  LEU A HA   1  
ATOM   103    H  HB2  . LEU A 1 7   ? -11.858 -10.334 0.768   1.00 15.00 ?  49  LEU A HB2  1  
ATOM   104    H  HB3  . LEU A 1 7   ? -10.303 -9.823  1.394   1.00 15.00 ?  49  LEU A HB3  1  
ATOM   105    H  HG   . LEU A 1 7   ? -9.395  -10.732 -0.885  1.00 15.00 ?  49  LEU A HG   1  
ATOM   106    H  HD11 . LEU A 1 7   ? -12.272 -10.166 -1.564  1.00 15.00 ?  49  LEU A HD11 1  
ATOM   107    H  HD12 . LEU A 1 7   ? -11.482 -11.740 -1.623  1.00 15.00 ?  49  LEU A HD12 1  
ATOM   108    H  HD13 . LEU A 1 7   ? -10.975 -10.454 -2.722  1.00 15.00 ?  49  LEU A HD13 1  
ATOM   109    H  HD21 . LEU A 1 7   ? -9.214  -8.431  -0.242  1.00 15.00 ?  49  LEU A HD21 1  
ATOM   110    H  HD22 . LEU A 1 7   ? -10.925 -8.157  -0.569  1.00 15.00 ?  49  LEU A HD22 1  
ATOM   111    H  HD23 . LEU A 1 7   ? -9.817  -8.504  -1.896  1.00 15.00 ?  49  LEU A HD23 1  
ATOM   112    N  N    . VAL A 1 8   ? -9.600  -11.588 3.429   1.00 15.00 ?  50  VAL A N    1  
ATOM   113    C  CA   . VAL A 1 8   ? -9.591  -11.570 4.886   1.00 15.00 ?  50  VAL A CA   1  
ATOM   114    C  C    . VAL A 1 8   ? -9.476  -10.132 5.379   1.00 15.00 ?  50  VAL A C    1  
ATOM   115    O  O    . VAL A 1 8   ? -8.669  -9.361  4.869   1.00 15.00 ?  50  VAL A O    1  
ATOM   116    C  CB   . VAL A 1 8   ? -8.428  -12.420 5.453   1.00 15.00 ?  50  VAL A CB   1  
ATOM   117    C  CG1  . VAL A 1 8   ? -8.263  -12.208 6.954   1.00 15.00 ?  50  VAL A CG1  1  
ATOM   118    C  CG2  . VAL A 1 8   ? -8.650  -13.895 5.140   1.00 15.00 ?  50  VAL A CG2  1  
ATOM   119    H  H    . VAL A 1 8   ? -8.797  -11.291 2.946   1.00 15.00 ?  50  VAL A H    1  
ATOM   120    H  HA   . VAL A 1 8   ? -10.525 -11.992 5.232   1.00 15.00 ?  50  VAL A HA   1  
ATOM   121    H  HB   . VAL A 1 8   ? -7.514  -12.109 4.970   1.00 15.00 ?  50  VAL A HB   1  
ATOM   122    H  HG11 . VAL A 1 8   ? -9.152  -12.549 7.468   1.00 15.00 ?  50  VAL A HG11 1  
ATOM   123    H  HG12 . VAL A 1 8   ? -8.114  -11.157 7.153   1.00 15.00 ?  50  VAL A HG12 1  
ATOM   124    H  HG13 . VAL A 1 8   ? -7.406  -12.765 7.305   1.00 15.00 ?  50  VAL A HG13 1  
ATOM   125    H  HG21 . VAL A 1 8   ? -8.945  -14.003 4.106   1.00 15.00 ?  50  VAL A HG21 1  
ATOM   126    H  HG22 . VAL A 1 8   ? -9.427  -14.287 5.779   1.00 15.00 ?  50  VAL A HG22 1  
ATOM   127    H  HG23 . VAL A 1 8   ? -7.736  -14.441 5.310   1.00 15.00 ?  50  VAL A HG23 1  
ATOM   128    N  N    . PHE A 1 9   ? -10.302 -9.772  6.345   1.00 15.00 ?  51  PHE A N    1  
ATOM   129    C  CA   . PHE A 1 9   ? -10.295 -8.429  6.900   1.00 15.00 ?  51  PHE A CA   1  
ATOM   130    C  C    . PHE A 1 9   ? -9.959  -8.470  8.385   1.00 15.00 ?  51  PHE A C    1  
ATOM   131    O  O    . PHE A 1 9   ? -10.500 -9.284  9.132   1.00 15.00 ?  51  PHE A O    1  
ATOM   132    C  CB   . PHE A 1 9   ? -11.650 -7.754  6.675   1.00 15.00 ?  51  PHE A CB   1  
ATOM   133    C  CG   . PHE A 1 9   ? -11.906 -7.405  5.237   1.00 15.00 ?  51  PHE A CG   1  
ATOM   134    C  CD1  . PHE A 1 9   ? -12.464 -8.333  4.372   1.00 15.00 ?  51  PHE A CD1  1  
ATOM   135    C  CD2  . PHE A 1 9   ? -11.591 -6.149  4.752   1.00 15.00 ?  51  PHE A CD2  1  
ATOM   136    C  CE1  . PHE A 1 9   ? -12.702 -8.011  3.047   1.00 15.00 ?  51  PHE A CE1  1  
ATOM   137    C  CE2  . PHE A 1 9   ? -11.826 -5.822  3.429   1.00 15.00 ?  51  PHE A CE2  1  
ATOM   138    C  CZ   . PHE A 1 9   ? -12.382 -6.755  2.575   1.00 15.00 ?  51  PHE A CZ   1  
ATOM   139    H  H    . PHE A 1 9   ? -10.943 -10.432 6.703   1.00 15.00 ?  51  PHE A H    1  
ATOM   140    H  HA   . PHE A 1 9   ? -9.533  -7.865  6.387   1.00 15.00 ?  51  PHE A HA   1  
ATOM   141    H  HB2  . PHE A 1 9   ? -12.436 -8.418  7.003   1.00 15.00 ?  51  PHE A HB2  1  
ATOM   142    H  HB3  . PHE A 1 9   ? -11.689 -6.841  7.252   1.00 15.00 ?  51  PHE A HB3  1  
ATOM   143    H  HD1  . PHE A 1 9   ? -12.711 -9.318  4.742   1.00 15.00 ?  51  PHE A HD1  1  
ATOM   144    H  HD2  . PHE A 1 9   ? -11.157 -5.420  5.419   1.00 15.00 ?  51  PHE A HD2  1  
ATOM   145    H  HE1  . PHE A 1 9   ? -13.135 -8.743  2.380   1.00 15.00 ?  51  PHE A HE1  1  
ATOM   146    H  HE2  . PHE A 1 9   ? -11.576 -4.837  3.060   1.00 15.00 ?  51  PHE A HE2  1  
ATOM   147    H  HZ   . PHE A 1 9   ? -12.566 -6.502  1.541   1.00 15.00 ?  51  PHE A HZ   1  
ATOM   148    N  N    . ARG A 1 10  ? -9.062  -7.600  8.803   1.00 15.00 ?  52  ARG A N    1  
ATOM   149    C  CA   . ARG A 1 10  ? -8.650  -7.546  10.196  1.00 15.00 ?  52  ARG A CA   1  
ATOM   150    C  C    . ARG A 1 10  ? -8.602  -6.103  10.684  1.00 15.00 ?  52  ARG A C    1  
ATOM   151    O  O    . ARG A 1 10  ? -8.007  -5.243  10.038  1.00 15.00 ?  52  ARG A O    1  
ATOM   152    C  CB   . ARG A 1 10  ? -7.274  -8.195  10.347  1.00 15.00 ?  52  ARG A CB   1  
ATOM   153    C  CG   . ARG A 1 10  ? -6.734  -8.194  11.772  1.00 15.00 ?  52  ARG A CG   1  
ATOM   154    C  CD   . ARG A 1 10  ? -5.296  -8.685  11.816  1.00 15.00 ?  52  ARG A CD   1  
ATOM   155    N  NE   . ARG A 1 10  ? -4.796  -8.838  13.181  1.00 15.00 ?  52  ARG A NE   1  
ATOM   156    C  CZ   . ARG A 1 10  ? -4.659  -10.011 13.801  1.00 15.00 ?  52  ARG A CZ   1  
ATOM   157    N  NH1  . ARG A 1 10  ? -4.988  -11.142 13.191  1.00 15.00 1  52  ARG A NH1  1  
ATOM   158    N  NH2  . ARG A 1 10  ? -4.185  -10.051 15.038  1.00 15.00 ?  52  ARG A NH2  1  
ATOM   159    H  H    . ARG A 1 10  ? -8.657  -6.979  8.156   1.00 15.00 ?  52  ARG A H    1  
ATOM   160    H  HA   . ARG A 1 10  ? -9.371  -8.101  10.780  1.00 15.00 ?  52  ARG A HA   1  
ATOM   161    H  HB2  . ARG A 1 10  ? -7.334  -9.219  10.008  1.00 15.00 ?  52  ARG A HB2  1  
ATOM   162    H  HB3  . ARG A 1 10  ? -6.574  -7.664  9.719   1.00 15.00 ?  52  ARG A HB3  1  
ATOM   163    H  HG2  . ARG A 1 10  ? -6.775  -7.189  12.164  1.00 15.00 ?  52  ARG A HG2  1  
ATOM   164    H  HG3  . ARG A 1 10  ? -7.347  -8.845  12.379  1.00 15.00 ?  52  ARG A HG3  1  
ATOM   165    H  HD2  . ARG A 1 10  ? -5.240  -9.640  11.318  1.00 15.00 ?  52  ARG A HD2  1  
ATOM   166    H  HD3  . ARG A 1 10  ? -4.671  -7.973  11.295  1.00 15.00 ?  52  ARG A HD3  1  
ATOM   167    H  HE   . ARG A 1 10  ? -4.553  -8.015  13.668  1.00 15.00 ?  52  ARG A HE   1  
ATOM   168    H  HH11 . ARG A 1 10  ? -4.874  -12.055 13.683  1.00 15.00 ?  52  ARG A HH11 1  
ATOM   169    H  HH12 . ARG A 1 10  ? -5.370  -11.128 12.210  1.00 15.00 ?  52  ARG A HH12 1  
ATOM   170    H  HH21 . ARG A 1 10  ? -4.070  -10.969 15.528  1.00 15.00 ?  52  ARG A HH21 1  
ATOM   171    H  HH22 . ARG A 1 10  ? -3.924  -9.167  15.526  1.00 15.00 ?  52  ARG A HH22 1  
ATOM   172    N  N    . GLN A 1 11  ? -9.233  -5.838  11.821  1.00 15.00 ?  53  GLN A N    1  
ATOM   173    C  CA   . GLN A 1 11  ? -9.244  -4.492  12.380  1.00 15.00 ?  53  GLN A CA   1  
ATOM   174    C  C    . GLN A 1 11  ? -7.986  -4.232  13.200  1.00 15.00 ?  53  GLN A C    1  
ATOM   175    O  O    . GLN A 1 11  ? -7.712  -4.932  14.178  1.00 15.00 ?  53  GLN A O    1  
ATOM   176    C  CB   . GLN A 1 11  ? -10.486 -4.268  13.253  1.00 15.00 ?  53  GLN A CB   1  
ATOM   177    C  CG   . GLN A 1 11  ? -10.391 -3.049  14.168  1.00 15.00 ?  53  GLN A CG   1  
ATOM   178    C  CD   . GLN A 1 11  ? -11.743 -2.533  14.610  1.00 15.00 ?  53  GLN A CD   1  
ATOM   179    O  OE1  . GLN A 1 11  ? -12.305 -2.989  15.606  1.00 15.00 ?  53  GLN A OE1  1  
ATOM   180    N  NE2  . GLN A 1 11  ? -12.272 -1.563  13.882  1.00 15.00 ?  53  GLN A NE2  1  
ATOM   181    H  H    . GLN A 1 11  ? -9.704  -6.560  12.293  1.00 15.00 ?  53  GLN A H    1  
ATOM   182    H  HA   . GLN A 1 11  ? -9.269  -3.797  11.553  1.00 15.00 ?  53  GLN A HA   1  
ATOM   183    H  HB2  . GLN A 1 11  ? -11.347 -4.141  12.611  1.00 15.00 ?  53  GLN A HB2  1  
ATOM   184    H  HB3  . GLN A 1 11  ? -10.636 -5.139  13.869  1.00 15.00 ?  53  GLN A HB3  1  
ATOM   185    H  HG2  . GLN A 1 11  ? -9.828  -3.322  15.049  1.00 15.00 ?  53  GLN A HG2  1  
ATOM   186    H  HG3  . GLN A 1 11  ? -9.872  -2.260  13.643  1.00 15.00 ?  53  GLN A HG3  1  
ATOM   187    H  HE21 . GLN A 1 11  ? -11.768 -1.235  13.106  1.00 15.00 ?  53  GLN A HE21 1  
ATOM   188    H  HE22 . GLN A 1 11  ? -13.145 -1.203  14.153  1.00 15.00 ?  53  GLN A HE22 1  
ATOM   189    N  N    . LEU A 1 12  ? -7.220  -3.230  12.791  1.00 15.00 ?  54  LEU A N    1  
ATOM   190    C  CA   . LEU A 1 12  ? -6.006  -2.861  13.501  1.00 15.00 ?  54  LEU A CA   1  
ATOM   191    C  C    . LEU A 1 12  ? -6.334  -1.779  14.517  1.00 15.00 ?  54  LEU A C    1  
ATOM   192    O  O    . LEU A 1 12  ? -5.939  -1.854  15.681  1.00 15.00 ?  54  LEU A O    1  
ATOM   193    C  CB   . LEU A 1 12  ? -4.939  -2.356  12.526  1.00 15.00 ?  54  LEU A CB   1  
ATOM   194    C  CG   . LEU A 1 12  ? -4.552  -3.332  11.416  1.00 15.00 ?  54  LEU A CG   1  
ATOM   195    C  CD1  . LEU A 1 12  ? -3.500  -2.705  10.513  1.00 15.00 ?  54  LEU A CD1  1  
ATOM   196    C  CD2  . LEU A 1 12  ? -4.055  -4.653  12.001  1.00 15.00 ?  54  LEU A CD2  1  
ATOM   197    H  H    . LEU A 1 12  ? -7.482  -2.718  11.997  1.00 15.00 ?  54  LEU A H    1  
ATOM   198    H  HA   . LEU A 1 12  ? -5.637  -3.733  14.020  1.00 15.00 ?  54  LEU A HA   1  
ATOM   199    H  HB2  . LEU A 1 12  ? -5.305  -1.449  12.065  1.00 15.00 ?  54  LEU A HB2  1  
ATOM   200    H  HB3  . LEU A 1 12  ? -4.049  -2.117  13.090  1.00 15.00 ?  54  LEU A HB3  1  
ATOM   201    H  HG   . LEU A 1 12  ? -5.424  -3.540  10.811  1.00 15.00 ?  54  LEU A HG   1  
ATOM   202    H  HD11 . LEU A 1 12  ? -2.597  -2.522  11.081  1.00 15.00 ?  54  LEU A HD11 1  
ATOM   203    H  HD12 . LEU A 1 12  ? -3.878  -1.770  10.125  1.00 15.00 ?  54  LEU A HD12 1  
ATOM   204    H  HD13 . LEU A 1 12  ? -3.284  -3.373  9.694   1.00 15.00 ?  54  LEU A HD13 1  
ATOM   205    H  HD21 . LEU A 1 12  ? -4.864  -5.146  12.520  1.00 15.00 ?  54  LEU A HD21 1  
ATOM   206    H  HD22 . LEU A 1 12  ? -3.250  -4.463  12.691  1.00 15.00 ?  54  LEU A HD22 1  
ATOM   207    H  HD23 . LEU A 1 12  ? -3.701  -5.290  11.203  1.00 15.00 ?  54  LEU A HD23 1  
ATOM   208    N  N    . ALA A 1 13  ? -7.080  -0.786  14.058  1.00 15.00 ?  55  ALA A N    1  
ATOM   209    C  CA   . ALA A 1 13  ? -7.501  0.325   14.890  1.00 15.00 ?  55  ALA A CA   1  
ATOM   210    C  C    . ALA A 1 13  ? -8.983  0.583   14.654  1.00 15.00 ?  55  ALA A C    1  
ATOM   211    O  O    . ALA A 1 13  ? -9.521  0.146   13.635  1.00 15.00 ?  55  ALA A O    1  
ATOM   212    C  CB   . ALA A 1 13  ? -6.676  1.562   14.568  1.00 15.00 ?  55  ALA A CB   1  
ATOM   213    H  H    . ALA A 1 13  ? -7.369  -0.804  13.119  1.00 15.00 ?  55  ALA A H    1  
ATOM   214    H  HA   . ALA A 1 13  ? -7.341  0.056   15.926  1.00 15.00 ?  55  ALA A HA   1  
ATOM   215    H  HB1  . ALA A 1 13  ? -6.844  2.312   15.324  1.00 15.00 ?  55  ALA A HB1  1  
ATOM   216    H  HB2  . ALA A 1 13  ? -6.973  1.950   13.607  1.00 15.00 ?  55  ALA A HB2  1  
ATOM   217    H  HB3  . ALA A 1 13  ? -5.629  1.301   14.546  1.00 15.00 ?  55  ALA A HB3  1  
ATOM   218    N  N    . PRO A 1 14  ? -9.663  1.295   15.569  1.00 15.00 ?  56  PRO A N    1  
ATOM   219    C  CA   . PRO A 1 14  ? -11.102 1.587   15.448  1.00 15.00 ?  56  PRO A CA   1  
ATOM   220    C  C    . PRO A 1 14  ? -11.510 2.160   14.089  1.00 15.00 ?  56  PRO A C    1  
ATOM   221    O  O    . PRO A 1 14  ? -12.612 1.892   13.604  1.00 15.00 ?  56  PRO A O    1  
ATOM   222    C  CB   . PRO A 1 14  ? -11.342 2.620   16.546  1.00 15.00 ?  56  PRO A CB   1  
ATOM   223    C  CG   . PRO A 1 14  ? -10.293 2.349   17.567  1.00 15.00 ?  56  PRO A CG   1  
ATOM   224    C  CD   . PRO A 1 14  ? -9.090  1.858   16.810  1.00 15.00 ?  56  PRO A CD   1  
ATOM   225    H  HA   . PRO A 1 14  ? -11.695 0.708   15.649  1.00 15.00 ?  56  PRO A HA   1  
ATOM   226    H  HB2  . PRO A 1 14  ? -11.241 3.618   16.136  1.00 15.00 ?  56  PRO A HB2  1  
ATOM   227    H  HB3  . PRO A 1 14  ? -12.321 2.487   16.974  1.00 15.00 ?  56  PRO A HB3  1  
ATOM   228    H  HG2  . PRO A 1 14  ? -10.057 3.260   18.102  1.00 15.00 ?  56  PRO A HG2  1  
ATOM   229    H  HG3  . PRO A 1 14  ? -10.633 1.586   18.252  1.00 15.00 ?  56  PRO A HG3  1  
ATOM   230    H  HD2  . PRO A 1 14  ? -8.424  2.679   16.589  1.00 15.00 ?  56  PRO A HD2  1  
ATOM   231    H  HD3  . PRO A 1 14  ? -8.575  1.098   17.375  1.00 15.00 ?  56  PRO A HD3  1  
ATOM   232    N  N    . ASN A 1 15  ? -10.633 2.944   13.478  1.00 15.00 ?  57  ASN A N    1  
ATOM   233    C  CA   . ASN A 1 15  ? -10.929 3.546   12.179  1.00 15.00 ?  57  ASN A CA   1  
ATOM   234    C  C    . ASN A 1 15  ? -9.946  3.098   11.097  1.00 15.00 ?  57  ASN A C    1  
ATOM   235    O  O    . ASN A 1 15  ? -9.934  3.658   9.999   1.00 15.00 ?  57  ASN A O    1  
ATOM   236    C  CB   . ASN A 1 15  ? -10.915 5.075   12.282  1.00 15.00 ?  57  ASN A CB   1  
ATOM   237    C  CG   . ASN A 1 15  ? -9.549  5.642   12.652  1.00 15.00 ?  57  ASN A CG   1  
ATOM   238    O  OD1  . ASN A 1 15  ? -8.785  5.025   13.395  1.00 15.00 ?  57  ASN A OD1  1  
ATOM   239    N  ND2  . ASN A 1 15  ? -9.232  6.826   12.139  1.00 15.00 ?  57  ASN A ND2  1  
ATOM   240    H  H    . ASN A 1 15  ? -9.779  3.144   13.916  1.00 15.00 ?  57  ASN A H    1  
ATOM   241    H  HA   . ASN A 1 15  ? -11.920 3.228   11.891  1.00 15.00 ?  57  ASN A HA   1  
ATOM   242    H  HB2  . ASN A 1 15  ? -11.209 5.489   11.332  1.00 15.00 ?  57  ASN A HB2  1  
ATOM   243    H  HB3  . ASN A 1 15  ? -11.629 5.377   13.035  1.00 15.00 ?  57  ASN A HB3  1  
ATOM   244    H  HD21 . ASN A 1 15  ? -9.880  7.272   11.558  1.00 15.00 ?  57  ASN A HD21 1  
ATOM   245    H  HD22 . ASN A 1 15  ? -8.355  7.211   12.369  1.00 15.00 ?  57  ASN A HD22 1  
ATOM   246    N  N    . VAL A 1 16  ? -9.137  2.088   11.402  1.00 15.00 ?  58  VAL A N    1  
ATOM   247    C  CA   . VAL A 1 16  ? -8.155  1.573   10.446  1.00 15.00 ?  58  VAL A CA   1  
ATOM   248    C  C    . VAL A 1 16  ? -8.262  0.054   10.315  1.00 15.00 ?  58  VAL A C    1  
ATOM   249    O  O    . VAL A 1 16  ? -7.940  -0.690  11.248  1.00 15.00 ?  58  VAL A O    1  
ATOM   250    C  CB   . VAL A 1 16  ? -6.710  1.947   10.841  1.00 15.00 ?  58  VAL A CB   1  
ATOM   251    C  CG1  . VAL A 1 16  ? -5.726  1.458   9.791   1.00 15.00 ?  58  VAL A CG1  1  
ATOM   252    C  CG2  . VAL A 1 16  ? -6.566  3.447   11.036  1.00 15.00 ?  58  VAL A CG2  1  
ATOM   253    H  H    . VAL A 1 16  ? -9.205  1.672   12.287  1.00 15.00 ?  58  VAL A H    1  
ATOM   254    H  HA   . VAL A 1 16  ? -8.367  2.018   9.482   1.00 15.00 ?  58  VAL A HA   1  
ATOM   255    H  HB   . VAL A 1 16  ? -6.476  1.459   11.774  1.00 15.00 ?  58  VAL A HB   1  
ATOM   256    H  HG11 . VAL A 1 16  ? -4.743  1.843   10.015  1.00 15.00 ?  58  VAL A HG11 1  
ATOM   257    H  HG12 . VAL A 1 16  ? -6.035  1.807   8.817   1.00 15.00 ?  58  VAL A HG12 1  
ATOM   258    H  HG13 . VAL A 1 16  ? -5.701  0.379   9.796   1.00 15.00 ?  58  VAL A HG13 1  
ATOM   259    H  HG21 . VAL A 1 16  ? -7.247  3.777   11.807  1.00 15.00 ?  58  VAL A HG21 1  
ATOM   260    H  HG22 . VAL A 1 16  ? -6.795  3.952   10.108  1.00 15.00 ?  58  VAL A HG22 1  
ATOM   261    H  HG23 . VAL A 1 16  ? -5.551  3.675   11.329  1.00 15.00 ?  58  VAL A HG23 1  
ATOM   262    N  N    . TRP A 1 17  ? -8.717  -0.393  9.158   1.00 15.00 ?  59  TRP A N    1  
ATOM   263    C  CA   . TRP A 1 17  ? -8.872  -1.815  8.886   1.00 15.00 ?  59  TRP A CA   1  
ATOM   264    C  C    . TRP A 1 17  ? -7.852  -2.281  7.861   1.00 15.00 ?  59  TRP A C    1  
ATOM   265    O  O    . TRP A 1 17  ? -7.388  -1.498  7.036   1.00 15.00 ?  59  TRP A O    1  
ATOM   266    C  CB   . TRP A 1 17  ? -10.284 -2.112  8.372   1.00 15.00 ?  59  TRP A CB   1  
ATOM   267    C  CG   . TRP A 1 17  ? -11.367 -1.748  9.345   1.00 15.00 ?  59  TRP A CG   1  
ATOM   268    C  CD1  . TRP A 1 17  ? -11.920 -2.553  10.302  1.00 15.00 ?  59  TRP A CD1  1  
ATOM   269    C  CD2  . TRP A 1 17  ? -12.024 -0.479  9.459   1.00 15.00 ?  59  TRP A CD2  1  
ATOM   270    N  NE1  . TRP A 1 17  ? -12.891 -1.867  10.990  1.00 15.00 ?  59  TRP A NE1  1  
ATOM   271    C  CE2  . TRP A 1 17  ? -12.969 -0.589  10.495  1.00 15.00 ?  59  TRP A CE2  1  
ATOM   272    C  CE3  . TRP A 1 17  ? -11.907 0.738   8.784   1.00 15.00 ?  59  TRP A CE3  1  
ATOM   273    C  CZ2  . TRP A 1 17  ? -13.787 0.473   10.871  1.00 15.00 ?  59  TRP A CZ2  1  
ATOM   274    C  CZ3  . TRP A 1 17  ? -12.719 1.790   9.161   1.00 15.00 ?  59  TRP A CZ3  1  
ATOM   275    C  CH2  . TRP A 1 17  ? -13.648 1.652   10.197  1.00 15.00 ?  59  TRP A CH2  1  
ATOM   276    H  H    . TRP A 1 17  ? -8.954  0.257   8.456   1.00 15.00 ?  59  TRP A H    1  
ATOM   277    H  HA   . TRP A 1 17  ? -8.711  -2.351  9.810   1.00 15.00 ?  59  TRP A HA   1  
ATOM   278    H  HB2  . TRP A 1 17  ? -10.452 -1.556  7.463   1.00 15.00 ?  59  TRP A HB2  1  
ATOM   279    H  HB3  . TRP A 1 17  ? -10.368 -3.169  8.162   1.00 15.00 ?  59  TRP A HB3  1  
ATOM   280    H  HD1  . TRP A 1 17  ? -11.635 -3.581  10.474  1.00 15.00 ?  59  TRP A HD1  1  
ATOM   281    H  HE1  . TRP A 1 17  ? -13.436 -2.232  11.720  1.00 15.00 ?  59  TRP A HE1  1  
ATOM   282    H  HE3  . TRP A 1 17  ? -11.196 0.867   7.982   1.00 15.00 ?  59  TRP A HE3  1  
ATOM   283    H  HZ2  . TRP A 1 17  ? -14.511 0.384   11.667  1.00 15.00 ?  59  TRP A HZ2  1  
ATOM   284    H  HZ3  . TRP A 1 17  ? -12.639 2.740   8.655   1.00 15.00 ?  59  TRP A HZ3  1  
ATOM   285    H  HH2  . TRP A 1 17  ? -14.261 2.504   10.458  1.00 15.00 ?  59  TRP A HH2  1  
ATOM   286    N  N    . GLN A 1 18  ? -7.512  -3.557  7.917   1.00 15.00 ?  60  GLN A N    1  
ATOM   287    C  CA   . GLN A 1 18  ? -6.560  -4.142  6.989   1.00 15.00 ?  60  GLN A CA   1  
ATOM   288    C  C    . GLN A 1 18  ? -7.239  -5.219  6.159   1.00 15.00 ?  60  GLN A C    1  
ATOM   289    O  O    . GLN A 1 18  ? -7.980  -6.045  6.695   1.00 15.00 ?  60  GLN A O    1  
ATOM   290    C  CB   . GLN A 1 18  ? -5.382  -4.746  7.755   1.00 15.00 ?  60  GLN A CB   1  
ATOM   291    C  CG   . GLN A 1 18  ? -4.307  -5.345  6.865   1.00 15.00 ?  60  GLN A CG   1  
ATOM   292    C  CD   . GLN A 1 18  ? -3.544  -6.461  7.550   1.00 15.00 ?  60  GLN A CD   1  
ATOM   293    O  OE1  . GLN A 1 18  ? -2.567  -6.222  8.258   1.00 15.00 ?  60  GLN A OE1  1  
ATOM   294    N  NE2  . GLN A 1 18  ? -3.985  -7.691  7.337   1.00 15.00 ?  60  GLN A NE2  1  
ATOM   295    H  H    . GLN A 1 18  ? -7.912  -4.132  8.610   1.00 15.00 ?  60  GLN A H    1  
ATOM   296    H  HA   . GLN A 1 18  ? -6.202  -3.364  6.332   1.00 15.00 ?  60  GLN A HA   1  
ATOM   297    H  HB2  . GLN A 1 18  ? -4.927  -3.974  8.358   1.00 15.00 ?  60  GLN A HB2  1  
ATOM   298    H  HB3  . GLN A 1 18  ? -5.755  -5.524  8.406   1.00 15.00 ?  60  GLN A HB3  1  
ATOM   299    H  HG2  . GLN A 1 18  ? -4.775  -5.744  5.977   1.00 15.00 ?  60  GLN A HG2  1  
ATOM   300    H  HG3  . GLN A 1 18  ? -3.614  -4.567  6.588   1.00 15.00 ?  60  GLN A HG3  1  
ATOM   301    H  HE21 . GLN A 1 18  ? -4.768  -7.811  6.757   1.00 15.00 ?  60  GLN A HE21 1  
ATOM   302    H  HE22 . GLN A 1 18  ? -3.509  -8.432  7.762   1.00 15.00 ?  60  GLN A HE22 1  
ATOM   303    N  N    . HIS A 1 19  ? -7.001  -5.201  4.857   1.00 15.00 ?  61  HIS A N    1  
ATOM   304    C  CA   . HIS A 1 19  ? -7.578  -6.201  3.974   1.00 15.00 ?  61  HIS A CA   1  
ATOM   305    C  C    . HIS A 1 19  ? -6.474  -7.072  3.385   1.00 15.00 ?  61  HIS A C    1  
ATOM   306    O  O    . HIS A 1 19  ? -5.359  -6.603  3.154   1.00 15.00 ?  61  HIS A O    1  
ATOM   307    C  CB   . HIS A 1 19  ? -8.431  -5.553  2.866   1.00 15.00 ?  61  HIS A CB   1  
ATOM   308    C  CG   . HIS A 1 19  ? -7.666  -4.814  1.801   1.00 15.00 ?  61  HIS A CG   1  
ATOM   309    N  ND1  . HIS A 1 19  ? -7.081  -5.471  0.741   1.00 15.00 ?  61  HIS A ND1  1  
ATOM   310    C  CD2  . HIS A 1 19  ? -7.465  -3.482  1.658   1.00 15.00 ?  61  HIS A CD2  1  
ATOM   311    C  CE1  . HIS A 1 19  ? -6.548  -4.530  -0.018  1.00 15.00 ?  61  HIS A CE1  1  
ATOM   312    N  NE2  . HIS A 1 19  ? -6.757  -3.310  0.499   1.00 15.00 ?  61  HIS A NE2  1  
ATOM   313    H  H    . HIS A 1 19  ? -6.415  -4.508  4.482   1.00 15.00 ?  61  HIS A H    1  
ATOM   314    H  HA   . HIS A 1 19  ? -8.217  -6.831  4.581   1.00 15.00 ?  61  HIS A HA   1  
ATOM   315    H  HB2  . HIS A 1 19  ? -9.005  -6.324  2.373   1.00 15.00 ?  61  HIS A HB2  1  
ATOM   316    H  HB3  . HIS A 1 19  ? -9.113  -4.852  3.325   1.00 15.00 ?  61  HIS A HB3  1  
ATOM   317    H  HD2  . HIS A 1 19  ? -7.800  -2.702  2.326   1.00 15.00 ?  61  HIS A HD2  1  
ATOM   318    H  HE1  . HIS A 1 19  ? -6.021  -4.719  -0.942  1.00 15.00 ?  61  HIS A HE1  1  
ATOM   319    H  HE2  . HIS A 1 19  ? -6.464  -2.453  0.116   1.00 15.00 ?  61  HIS A HE2  1  
ATOM   320    N  N    . THR A 1 20  ? -6.774  -8.343  3.200   1.00 15.00 ?  62  THR A N    1  
ATOM   321    C  CA   . THR A 1 20  ? -5.819  -9.278  2.646   1.00 15.00 ?  62  THR A CA   1  
ATOM   322    C  C    . THR A 1 20  ? -6.447  -10.075 1.510   1.00 15.00 ?  62  THR A C    1  
ATOM   323    O  O    . THR A 1 20  ? -7.387  -10.846 1.720   1.00 15.00 ?  62  THR A O    1  
ATOM   324    C  CB   . THR A 1 20  ? -5.304  -10.242 3.731   1.00 15.00 ?  62  THR A CB   1  
ATOM   325    O  OG1  . THR A 1 20  ? -4.782  -9.494  4.840   1.00 15.00 ?  62  THR A OG1  1  
ATOM   326    C  CG2  . THR A 1 20  ? -4.223  -11.155 3.171   1.00 15.00 ?  62  THR A CG2  1  
ATOM   327    H  H    . THR A 1 20  ? -7.666  -8.665  3.460   1.00 15.00 ?  62  THR A H    1  
ATOM   328    H  HA   . THR A 1 20  ? -4.983  -8.718  2.258   1.00 15.00 ?  62  THR A HA   1  
ATOM   329    H  HB   . THR A 1 20  ? -6.128  -10.850 4.070   1.00 15.00 ?  62  THR A HB   1  
ATOM   330    H  HG1  . THR A 1 20  ? -4.057  -8.932  4.533   1.00 15.00 ?  62  THR A HG1  1  
ATOM   331    H  HG21 . THR A 1 20  ? -4.580  -11.618 2.263   1.00 15.00 ?  62  THR A HG21 1  
ATOM   332    H  HG22 . THR A 1 20  ? -3.985  -11.919 3.894   1.00 15.00 ?  62  THR A HG22 1  
ATOM   333    H  HG23 . THR A 1 20  ? -3.340  -10.573 2.956   1.00 15.00 ?  62  THR A HG23 1  
ATOM   334    N  N    . SER A 1 21  ? -5.931  -9.876  0.309   1.00 15.00 ?  63  SER A N    1  
ATOM   335    C  CA   . SER A 1 21  ? -6.426  -10.576 -0.862  1.00 15.00 ?  63  SER A CA   1  
ATOM   336    C  C    . SER A 1 21  ? -5.502  -11.742 -1.202  1.00 15.00 ?  63  SER A C    1  
ATOM   337    O  O    . SER A 1 21  ? -4.280  -11.627 -1.082  1.00 15.00 ?  63  SER A O    1  
ATOM   338    C  CB   . SER A 1 21  ? -6.535  -9.608  -2.041  1.00 15.00 ?  63  SER A CB   1  
ATOM   339    O  OG   . SER A 1 21  ? -5.458  -8.682  -2.047  1.00 15.00 ?  63  SER A OG   1  
ATOM   340    H  H    . SER A 1 21  ? -5.184  -9.244  0.208   1.00 15.00 ?  63  SER A H    1  
ATOM   341    H  HA   . SER A 1 21  ? -7.406  -10.963 -0.628  1.00 15.00 ?  63  SER A HA   1  
ATOM   342    H  HB2  . SER A 1 21  ? -6.522  -10.166 -2.965  1.00 15.00 ?  63  SER A HB2  1  
ATOM   343    H  HB3  . SER A 1 21  ? -7.464  -9.060  -1.966  1.00 15.00 ?  63  SER A HB3  1  
ATOM   344    H  HG   . SER A 1 21  ? -5.667  -7.944  -1.467  1.00 15.00 ?  63  SER A HG   1  
ATOM   345    N  N    . TYR A 1 22  ? -6.082  -12.865 -1.606  1.00 15.00 ?  64  TYR A N    1  
ATOM   346    C  CA   . TYR A 1 22  ? -5.295  -14.043 -1.946  1.00 15.00 ?  64  TYR A CA   1  
ATOM   347    C  C    . TYR A 1 22  ? -5.413  -14.384 -3.424  1.00 15.00 ?  64  TYR A C    1  
ATOM   348    O  O    . TYR A 1 22  ? -6.514  -14.454 -3.965  1.00 15.00 ?  64  TYR A O    1  
ATOM   349    C  CB   . TYR A 1 22  ? -5.738  -15.246 -1.110  1.00 15.00 ?  64  TYR A CB   1  
ATOM   350    C  CG   . TYR A 1 22  ? -5.480  -15.101 0.371   1.00 15.00 ?  64  TYR A CG   1  
ATOM   351    C  CD1  . TYR A 1 22  ? -6.441  -14.548 1.210   1.00 15.00 ?  64  TYR A CD1  1  
ATOM   352    C  CD2  . TYR A 1 22  ? -4.282  -15.526 0.932   1.00 15.00 ?  64  TYR A CD2  1  
ATOM   353    C  CE1  . TYR A 1 22  ? -6.212  -14.427 2.567   1.00 15.00 ?  64  TYR A CE1  1  
ATOM   354    C  CE2  . TYR A 1 22  ? -4.048  -15.405 2.288   1.00 15.00 ?  64  TYR A CE2  1  
ATOM   355    C  CZ   . TYR A 1 22  ? -5.017  -14.856 3.099   1.00 15.00 ?  64  TYR A CZ   1  
ATOM   356    O  OH   . TYR A 1 22  ? -4.791  -14.737 4.453   1.00 15.00 ?  64  TYR A OH   1  
ATOM   357    H  H    . TYR A 1 22  ? -7.061  -12.904 -1.680  1.00 15.00 ?  64  TYR A H    1  
ATOM   358    H  HA   . TYR A 1 22  ? -4.262  -13.822 -1.721  1.00 15.00 ?  64  TYR A HA   1  
ATOM   359    H  HB2  . TYR A 1 22  ? -6.798  -15.394 -1.244  1.00 15.00 ?  64  TYR A HB2  1  
ATOM   360    H  HB3  . TYR A 1 22  ? -5.212  -16.126 -1.452  1.00 15.00 ?  64  TYR A HB3  1  
ATOM   361    H  HD1  . TYR A 1 22  ? -7.379  -14.214 0.788   1.00 15.00 ?  64  TYR A HD1  1  
ATOM   362    H  HD2  . TYR A 1 22  ? -3.527  -15.952 0.292   1.00 15.00 ?  64  TYR A HD2  1  
ATOM   363    H  HE1  . TYR A 1 22  ? -6.968  -13.991 3.206   1.00 15.00 ?  64  TYR A HE1  1  
ATOM   364    H  HE2  . TYR A 1 22  ? -3.109  -15.741 2.705   1.00 15.00 ?  64  TYR A HE2  1  
ATOM   365    H  HH   . TYR A 1 22  ? -5.497  -15.191 4.935   1.00 15.00 ?  64  TYR A HH   1  
ATOM   366    N  N    . LEU A 1 23  ? -4.272  -14.585 -4.068  1.00 15.00 ?  65  LEU A N    1  
ATOM   367    C  CA   . LEU A 1 23  ? -4.234  -14.941 -5.480  1.00 15.00 ?  65  LEU A CA   1  
ATOM   368    C  C    . LEU A 1 23  ? -3.648  -16.334 -5.636  1.00 15.00 ?  65  LEU A C    1  
ATOM   369    O  O    . LEU A 1 23  ? -2.498  -16.575 -5.270  1.00 15.00 ?  65  LEU A O    1  
ATOM   370    C  CB   . LEU A 1 23  ? -3.397  -13.937 -6.279  1.00 15.00 ?  65  LEU A CB   1  
ATOM   371    C  CG   . LEU A 1 23  ? -3.426  -14.130 -7.800  1.00 15.00 ?  65  LEU A CG   1  
ATOM   372    C  CD1  . LEU A 1 23  ? -4.771  -13.698 -8.372  1.00 15.00 ?  65  LEU A CD1  1  
ATOM   373    C  CD2  . LEU A 1 23  ? -2.288  -13.365 -8.459  1.00 15.00 ?  65  LEU A CD2  1  
ATOM   374    H  H    . LEU A 1 23  ? -3.425  -14.492 -3.575  1.00 15.00 ?  65  LEU A H    1  
ATOM   375    H  HA   . LEU A 1 23  ? -5.246  -14.941 -5.857  1.00 15.00 ?  65  LEU A HA   1  
ATOM   376    H  HB2  . LEU A 1 23  ? -3.757  -12.942 -6.054  1.00 15.00 ?  65  LEU A HB2  1  
ATOM   377    H  HB3  . LEU A 1 23  ? -2.372  -14.013 -5.948  1.00 15.00 ?  65  LEU A HB3  1  
ATOM   378    H  HG   . LEU A 1 23  ? -3.295  -15.179 -8.023  1.00 15.00 ?  65  LEU A HG   1  
ATOM   379    H  HD11 . LEU A 1 23  ? -5.554  -14.311 -7.952  1.00 15.00 ?  65  LEU A HD11 1  
ATOM   380    H  HD12 . LEU A 1 23  ? -4.761  -13.816 -9.446  1.00 15.00 ?  65  LEU A HD12 1  
ATOM   381    H  HD13 . LEU A 1 23  ? -4.951  -12.665 -8.121  1.00 15.00 ?  65  LEU A HD13 1  
ATOM   382    H  HD21 . LEU A 1 23  ? -2.335  -12.325 -8.168  1.00 15.00 ?  65  LEU A HD21 1  
ATOM   383    H  HD22 . LEU A 1 23  ? -2.376  -13.440 -9.534  1.00 15.00 ?  65  LEU A HD22 1  
ATOM   384    H  HD23 . LEU A 1 23  ? -1.345  -13.785 -8.142  1.00 15.00 ?  65  LEU A HD23 1  
ATOM   385    N  N    . ASP A 1 24  ? -4.446  -17.249 -6.153  1.00 15.00 ?  66  ASP A N    1  
ATOM   386    C  CA   . ASP A 1 24  ? -4.005  -18.625 -6.345  1.00 15.00 ?  66  ASP A CA   1  
ATOM   387    C  C    . ASP A 1 24  ? -3.135  -18.752 -7.582  1.00 15.00 ?  66  ASP A C    1  
ATOM   388    O  O    . ASP A 1 24  ? -3.597  -18.549 -8.705  1.00 15.00 ?  66  ASP A O    1  
ATOM   389    C  CB   . ASP A 1 24  ? -5.206  -19.570 -6.459  1.00 15.00 ?  66  ASP A CB   1  
ATOM   390    C  CG   . ASP A 1 24  ? -4.805  -20.993 -6.791  1.00 15.00 ?  66  ASP A CG   1  
ATOM   391    O  OD1  . ASP A 1 24  ? -5.343  -21.553 -7.770  1.00 15.00 ?  66  ASP A OD1  1  
ATOM   392    O  OD2  . ASP A 1 24  ? -3.955  -21.560 -6.075  1.00 15.00 -1 66  ASP A OD2  1  
ATOM   393    H  H    . ASP A 1 24  ? -5.355  -16.995 -6.417  1.00 15.00 ?  66  ASP A H    1  
ATOM   394    H  HA   . ASP A 1 24  ? -3.421  -18.907 -5.480  1.00 15.00 ?  66  ASP A HA   1  
ATOM   395    H  HB2  . ASP A 1 24  ? -5.740  -19.578 -5.520  1.00 15.00 ?  66  ASP A HB2  1  
ATOM   396    H  HB3  . ASP A 1 24  ? -5.862  -19.212 -7.239  1.00 15.00 ?  66  ASP A HB3  1  
ATOM   397    N  N    . MET A 1 25  ? -1.870  -19.057 -7.365  1.00 15.00 ?  67  MET A N    1  
ATOM   398    C  CA   . MET A 1 25  ? -0.929  -19.243 -8.452  1.00 15.00 ?  67  MET A CA   1  
ATOM   399    C  C    . MET A 1 25  ? -0.655  -20.730 -8.618  1.00 15.00 ?  67  MET A C    1  
ATOM   400    O  O    . MET A 1 25  ? -0.009  -21.341 -7.763  1.00 15.00 ?  67  MET A O    1  
ATOM   401    C  CB   . MET A 1 25  ? 0.382   -18.499 -8.181  1.00 15.00 ?  67  MET A CB   1  
ATOM   402    C  CG   . MET A 1 25  ? 0.328   -17.011 -8.494  1.00 15.00 ?  67  MET A CG   1  
ATOM   403    S  SD   . MET A 1 25  ? 1.926   -16.202 -8.277  1.00 15.00 ?  67  MET A SD   1  
ATOM   404    C  CE   . MET A 1 25  ? 1.492   -14.488 -8.565  1.00 15.00 ?  67  MET A CE   1  
ATOM   405    H  H    . MET A 1 25  ? -1.559  -19.173 -6.436  1.00 15.00 ?  67  MET A H    1  
ATOM   406    H  HA   . MET A 1 25  ? -1.379  -18.862 -9.355  1.00 15.00 ?  67  MET A HA   1  
ATOM   407    H  HB2  . MET A 1 25  ? 0.636   -18.617 -7.139  1.00 15.00 ?  67  MET A HB2  1  
ATOM   408    H  HB3  . MET A 1 25  ? 1.165   -18.941 -8.783  1.00 15.00 ?  67  MET A HB3  1  
ATOM   409    H  HG2  . MET A 1 25  ? 0.014   -16.884 -9.520  1.00 15.00 ?  67  MET A HG2  1  
ATOM   410    H  HG3  . MET A 1 25  ? -0.388  -16.541 -7.837  1.00 15.00 ?  67  MET A HG3  1  
ATOM   411    H  HE1  . MET A 1 25  ? 2.327   -13.855 -8.305  1.00 15.00 ?  67  MET A HE1  1  
ATOM   412    H  HE2  . MET A 1 25  ? 0.642   -14.225 -7.957  1.00 15.00 ?  67  MET A HE2  1  
ATOM   413    H  HE3  . MET A 1 25  ? 1.246   -14.351 -9.607  1.00 15.00 ?  67  MET A HE3  1  
ATOM   414    N  N    . PRO A 1 26  ? -1.173  -21.334 -9.697  1.00 15.00 ?  68  PRO A N    1  
ATOM   415    C  CA   . PRO A 1 26  ? -0.994  -22.765 -9.982  1.00 15.00 ?  68  PRO A CA   1  
ATOM   416    C  C    . PRO A 1 26  ? 0.469   -23.197 -9.937  1.00 15.00 ?  68  PRO A C    1  
ATOM   417    O  O    . PRO A 1 26  ? 1.280   -22.771 -10.760 1.00 15.00 ?  68  PRO A O    1  
ATOM   418    C  CB   . PRO A 1 26  ? -1.557  -22.917 -11.395 1.00 15.00 ?  68  PRO A CB   1  
ATOM   419    C  CG   . PRO A 1 26  ? -2.531  -21.802 -11.544 1.00 15.00 ?  68  PRO A CG   1  
ATOM   420    C  CD   . PRO A 1 26  ? -1.984  -20.665 -10.731 1.00 15.00 ?  68  PRO A CD   1  
ATOM   421    H  HA   . PRO A 1 26  ? -1.564  -23.377 -9.300  1.00 15.00 ?  68  PRO A HA   1  
ATOM   422    H  HB2  . PRO A 1 26  ? -0.760  -22.836 -12.121 1.00 15.00 ?  68  PRO A HB2  1  
ATOM   423    H  HB3  . PRO A 1 26  ? -2.059  -23.866 -11.495 1.00 15.00 ?  68  PRO A HB3  1  
ATOM   424    H  HG2  . PRO A 1 26  ? -2.611  -21.525 -12.586 1.00 15.00 ?  68  PRO A HG2  1  
ATOM   425    H  HG3  . PRO A 1 26  ? -3.494  -22.097 -11.156 1.00 15.00 ?  68  PRO A HG3  1  
ATOM   426    H  HD2  . PRO A 1 26  ? -1.371  -20.023 -11.346 1.00 15.00 ?  68  PRO A HD2  1  
ATOM   427    H  HD3  . PRO A 1 26  ? -2.791  -20.103 -10.282 1.00 15.00 ?  68  PRO A HD3  1  
ATOM   428    N  N    . GLY A 1 27  ? 0.795   -24.026 -8.953  1.00 15.00 ?  69  GLY A N    1  
ATOM   429    C  CA   . GLY A 1 27  ? 2.151   -24.521 -8.807  1.00 15.00 ?  69  GLY A CA   1  
ATOM   430    C  C    . GLY A 1 27  ? 2.938   -23.783 -7.739  1.00 15.00 ?  69  GLY A C    1  
ATOM   431    O  O    . GLY A 1 27  ? 4.073   -24.148 -7.435  1.00 15.00 ?  69  GLY A O    1  
ATOM   432    H  H    . GLY A 1 27  ? 0.104   -24.304 -8.314  1.00 15.00 ?  69  GLY A H    1  
ATOM   433    H  HA2  . GLY A 1 27  ? 2.111   -25.569 -8.546  1.00 15.00 ?  69  GLY A HA2  1  
ATOM   434    H  HA3  . GLY A 1 27  ? 2.663   -24.419 -9.753  1.00 15.00 ?  69  GLY A HA3  1  
ATOM   435    N  N    . PHE A 1 28  ? 2.342   -22.742 -7.169  1.00 15.00 ?  70  PHE A N    1  
ATOM   436    C  CA   . PHE A 1 28  ? 3.005   -21.965 -6.134  1.00 15.00 ?  70  PHE A CA   1  
ATOM   437    C  C    . PHE A 1 28  ? 2.161   -21.922 -4.864  1.00 15.00 ?  70  PHE A C    1  
ATOM   438    O  O    . PHE A 1 28  ? 2.643   -22.227 -3.773  1.00 15.00 ?  70  PHE A O    1  
ATOM   439    C  CB   . PHE A 1 28  ? 3.292   -20.542 -6.635  1.00 15.00 ?  70  PHE A CB   1  
ATOM   440    C  CG   . PHE A 1 28  ? 3.945   -19.659 -5.609  1.00 15.00 ?  70  PHE A CG   1  
ATOM   441    C  CD1  . PHE A 1 28  ? 3.236   -18.631 -5.008  1.00 15.00 ?  70  PHE A CD1  1  
ATOM   442    C  CD2  . PHE A 1 28  ? 5.268   -19.860 -5.243  1.00 15.00 ?  70  PHE A CD2  1  
ATOM   443    C  CE1  . PHE A 1 28  ? 3.835   -17.820 -4.062  1.00 15.00 ?  70  PHE A CE1  1  
ATOM   444    C  CE2  . PHE A 1 28  ? 5.870   -19.054 -4.297  1.00 15.00 ?  70  PHE A CE2  1  
ATOM   445    C  CZ   . PHE A 1 28  ? 5.153   -18.033 -3.704  1.00 15.00 ?  70  PHE A CZ   1  
ATOM   446    H  H    . PHE A 1 28  ? 1.438   -22.485 -7.458  1.00 15.00 ?  70  PHE A H    1  
ATOM   447    H  HA   . PHE A 1 28  ? 3.941   -22.449 -5.906  1.00 15.00 ?  70  PHE A HA   1  
ATOM   448    H  HB2  . PHE A 1 28  ? 3.947   -20.593 -7.493  1.00 15.00 ?  70  PHE A HB2  1  
ATOM   449    H  HB3  . PHE A 1 28  ? 2.361   -20.079 -6.928  1.00 15.00 ?  70  PHE A HB3  1  
ATOM   450    H  HD1  . PHE A 1 28  ? 2.204   -18.468 -5.283  1.00 15.00 ?  70  PHE A HD1  1  
ATOM   451    H  HD2  . PHE A 1 28  ? 5.832   -20.657 -5.710  1.00 15.00 ?  70  PHE A HD2  1  
ATOM   452    H  HE1  . PHE A 1 28  ? 3.274   -17.020 -3.604  1.00 15.00 ?  70  PHE A HE1  1  
ATOM   453    H  HE2  . PHE A 1 28  ? 6.900   -19.223 -4.017  1.00 15.00 ?  70  PHE A HE2  1  
ATOM   454    H  HZ   . PHE A 1 28  ? 5.623   -17.404 -2.964  1.00 15.00 ?  70  PHE A HZ   1  
ATOM   455    N  N    . GLY A 1 29  ? 0.903   -21.545 -5.012  1.00 15.00 ?  71  GLY A N    1  
ATOM   456    C  CA   . GLY A 1 29  ? 0.015   -21.461 -3.874  1.00 15.00 ?  71  GLY A CA   1  
ATOM   457    C  C    . GLY A 1 29  ? -0.757  -20.163 -3.863  1.00 15.00 ?  71  GLY A C    1  
ATOM   458    O  O    . GLY A 1 29  ? -0.897  -19.512 -4.902  1.00 15.00 ?  71  GLY A O    1  
ATOM   459    H  H    . GLY A 1 29  ? 0.572   -21.311 -5.906  1.00 15.00 ?  71  GLY A H    1  
ATOM   460    H  HA2  . GLY A 1 29  ? -0.681  -22.286 -3.907  1.00 15.00 ?  71  GLY A HA2  1  
ATOM   461    H  HA3  . GLY A 1 29  ? 0.598   -21.527 -2.966  1.00 15.00 ?  71  GLY A HA3  1  
ATOM   462    N  N    . ALA A 1 30  ? -1.256  -19.779 -2.697  1.00 15.00 ?  72  ALA A N    1  
ATOM   463    C  CA   . ALA A 1 30  ? -2.026  -18.552 -2.568  1.00 15.00 ?  72  ALA A CA   1  
ATOM   464    C  C    . ALA A 1 30  ? -1.153  -17.398 -2.085  1.00 15.00 ?  72  ALA A C    1  
ATOM   465    O  O    . ALA A 1 30  ? -0.590  -17.441 -0.988  1.00 15.00 ?  72  ALA A O    1  
ATOM   466    C  CB   . ALA A 1 30  ? -3.205  -18.758 -1.626  1.00 15.00 ?  72  ALA A CB   1  
ATOM   467    H  H    . ALA A 1 30  ? -1.104  -20.336 -1.906  1.00 15.00 ?  72  ALA A H    1  
ATOM   468    H  HA   . ALA A 1 30  ? -2.417  -18.305 -3.543  1.00 15.00 ?  72  ALA A HA   1  
ATOM   469    H  HB1  . ALA A 1 30  ? -3.814  -19.574 -1.985  1.00 15.00 ?  72  ALA A HB1  1  
ATOM   470    H  HB2  . ALA A 1 30  ? -3.799  -17.857 -1.588  1.00 15.00 ?  72  ALA A HB2  1  
ATOM   471    H  HB3  . ALA A 1 30  ? -2.840  -18.990 -0.638  1.00 15.00 ?  72  ALA A HB3  1  
ATOM   472    N  N    . VAL A 1 31  ? -1.029  -16.370 -2.916  1.00 15.00 ?  73  VAL A N    1  
ATOM   473    C  CA   . VAL A 1 31  ? -0.240  -15.197 -2.564  1.00 15.00 ?  73  VAL A CA   1  
ATOM   474    C  C    . VAL A 1 31  ? -1.131  -14.199 -1.838  1.00 15.00 ?  73  VAL A C    1  
ATOM   475    O  O    . VAL A 1 31  ? -2.301  -14.049 -2.185  1.00 15.00 ?  73  VAL A O    1  
ATOM   476    C  CB   . VAL A 1 31  ? 0.384   -14.524 -3.805  1.00 15.00 ?  73  VAL A CB   1  
ATOM   477    C  CG1  . VAL A 1 31  ? 1.664   -13.797 -3.434  1.00 15.00 ?  73  VAL A CG1  1  
ATOM   478    C  CG2  . VAL A 1 31  ? 0.652   -15.543 -4.899  1.00 15.00 ?  73  VAL A CG2  1  
ATOM   479    H  H    . VAL A 1 31  ? -1.484  -16.401 -3.790  1.00 15.00 ?  73  VAL A H    1  
ATOM   480    H  HA   . VAL A 1 31  ? 0.554   -15.514 -1.902  1.00 15.00 ?  73  VAL A HA   1  
ATOM   481    H  HB   . VAL A 1 31  ? -0.320  -13.797 -4.185  1.00 15.00 ?  73  VAL A HB   1  
ATOM   482    H  HG11 . VAL A 1 31  ? 2.390   -14.512 -3.078  1.00 15.00 ?  73  VAL A HG11 1  
ATOM   483    H  HG12 . VAL A 1 31  ? 1.459   -13.076 -2.658  1.00 15.00 ?  73  VAL A HG12 1  
ATOM   484    H  HG13 . VAL A 1 31  ? 2.055   -13.291 -4.304  1.00 15.00 ?  73  VAL A HG13 1  
ATOM   485    H  HG21 . VAL A 1 31  ? 1.339   -15.126 -5.621  1.00 15.00 ?  73  VAL A HG21 1  
ATOM   486    H  HG22 . VAL A 1 31  ? -0.276  -15.792 -5.392  1.00 15.00 ?  73  VAL A HG22 1  
ATOM   487    H  HG23 . VAL A 1 31  ? 1.080   -16.435 -4.466  1.00 15.00 ?  73  VAL A HG23 1  
ATOM   488    N  N    . ALA A 1 32  ? -0.599  -13.515 -0.842  1.00 15.00 ?  74  ALA A N    1  
ATOM   489    C  CA   . ALA A 1 32  ? -1.402  -12.575 -0.081  1.00 15.00 ?  74  ALA A CA   1  
ATOM   490    C  C    . ALA A 1 32  ? -0.903  -11.143 -0.212  1.00 15.00 ?  74  ALA A C    1  
ATOM   491    O  O    . ALA A 1 32  ? 0.299   -10.885 -0.161  1.00 15.00 ?  74  ALA A O    1  
ATOM   492    C  CB   . ALA A 1 32  ? -1.420  -12.987 1.377   1.00 15.00 ?  74  ALA A CB   1  
ATOM   493    H  H    . ALA A 1 32  ? 0.347   -13.639 -0.611  1.00 15.00 ?  74  ALA A H    1  
ATOM   494    H  HA   . ALA A 1 32  ? -2.415  -12.630 -0.455  1.00 15.00 ?  74  ALA A HA   1  
ATOM   495    H  HB1  . ALA A 1 32  ? -0.436  -12.843 1.797   1.00 15.00 ?  74  ALA A HB1  1  
ATOM   496    H  HB2  . ALA A 1 32  ? -1.699  -14.029 1.453   1.00 15.00 ?  74  ALA A HB2  1  
ATOM   497    H  HB3  . ALA A 1 32  ? -2.133  -12.378 1.915   1.00 15.00 ?  74  ALA A HB3  1  
ATOM   498    N  N    . SER A 1 33  ? -1.844  -10.222 -0.380  1.00 15.00 ?  75  SER A N    1  
ATOM   499    C  CA   . SER A 1 33  ? -1.535  -8.804  -0.484  1.00 15.00 ?  75  SER A CA   1  
ATOM   500    C  C    . SER A 1 33  ? -2.385  -8.044  0.528   1.00 15.00 ?  75  SER A C    1  
ATOM   501    O  O    . SER A 1 33  ? -3.594  -8.264  0.613   1.00 15.00 ?  75  SER A O    1  
ATOM   502    C  CB   . SER A 1 33  ? -1.799  -8.289  -1.902  1.00 15.00 ?  75  SER A CB   1  
ATOM   503    O  OG   . SER A 1 33  ? -1.161  -7.040  -2.113  1.00 15.00 ?  75  SER A OG   1  
ATOM   504    H  H    . SER A 1 33  ? -2.785  -10.504 -0.430  1.00 15.00 ?  75  SER A H    1  
ATOM   505    H  HA   . SER A 1 33  ? -0.490  -8.667  -0.243  1.00 15.00 ?  75  SER A HA   1  
ATOM   506    H  HB2  . SER A 1 33  ? -1.417  -9.001  -2.619  1.00 15.00 ?  75  SER A HB2  1  
ATOM   507    H  HB3  . SER A 1 33  ? -2.863  -8.169  -2.049  1.00 15.00 ?  75  SER A HB3  1  
ATOM   508    H  HG   . SER A 1 33  ? -1.228  -6.796  -3.048  1.00 15.00 ?  75  SER A HG   1  
ATOM   509    N  N    . ASN A 1 34  ? -1.753  -7.179  1.312   1.00 15.00 ?  76  ASN A N    1  
ATOM   510    C  CA   . ASN A 1 34  ? -2.464  -6.410  2.328   1.00 15.00 ?  76  ASN A CA   1  
ATOM   511    C  C    . ASN A 1 34  ? -2.659  -4.963  1.902   1.00 15.00 ?  76  ASN A C    1  
ATOM   512    O  O    . ASN A 1 34  ? -1.877  -4.409  1.119   1.00 15.00 ?  76  ASN A O    1  
ATOM   513    C  CB   . ASN A 1 34  ? -1.720  -6.440  3.671   1.00 15.00 ?  76  ASN A CB   1  
ATOM   514    C  CG   . ASN A 1 34  ? -1.553  -7.835  4.234   1.00 15.00 ?  76  ASN A CG   1  
ATOM   515    O  OD1  . ASN A 1 34  ? -2.296  -8.756  3.900   1.00 15.00 ?  76  ASN A OD1  1  
ATOM   516    N  ND2  . ASN A 1 34  ? -0.571  -7.999  5.103   1.00 15.00 ?  76  ASN A ND2  1  
ATOM   517    H  H    . ASN A 1 34  ? -0.786  -7.055  1.204   1.00 15.00 ?  76  ASN A H    1  
ATOM   518    H  HA   . ASN A 1 34  ? -3.435  -6.859  2.462   1.00 15.00 ?  76  ASN A HA   1  
ATOM   519    H  HB2  . ASN A 1 34  ? -0.739  -6.015  3.537   1.00 15.00 ?  76  ASN A HB2  1  
ATOM   520    H  HB3  . ASN A 1 34  ? -2.266  -5.848  4.392   1.00 15.00 ?  76  ASN A HB3  1  
ATOM   521    H  HD21 . ASN A 1 34  ? -0.020  -7.220  5.332   1.00 15.00 ?  76  ASN A HD21 1  
ATOM   522    H  HD22 . ASN A 1 34  ? -0.429  -8.891  5.480   1.00 15.00 ?  76  ASN A HD22 1  
ATOM   523    N  N    . GLY A 1 35  ? -3.712  -4.364  2.430   1.00 15.00 ?  77  GLY A N    1  
ATOM   524    C  CA   . GLY A 1 35  ? -4.031  -2.981  2.153   1.00 15.00 ?  77  GLY A CA   1  
ATOM   525    C  C    . GLY A 1 35  ? -4.653  -2.335  3.374   1.00 15.00 ?  77  GLY A C    1  
ATOM   526    O  O    . GLY A 1 35  ? -4.961  -3.031  4.340   1.00 15.00 ?  77  GLY A O    1  
ATOM   527    H  H    . GLY A 1 35  ? -4.301  -4.882  3.026   1.00 15.00 ?  77  GLY A H    1  
ATOM   528    H  HA2  . GLY A 1 35  ? -3.126  -2.451  1.886   1.00 15.00 ?  77  GLY A HA2  1  
ATOM   529    H  HA3  . GLY A 1 35  ? -4.730  -2.934  1.332   1.00 15.00 ?  77  GLY A HA3  1  
ATOM   530    N  N    . LEU A 1 36  ? -4.864  -1.029  3.342   1.00 15.00 ?  78  LEU A N    1  
ATOM   531    C  CA   . LEU A 1 36  ? -5.437  -0.337  4.492   1.00 15.00 ?  78  LEU A CA   1  
ATOM   532    C  C    . LEU A 1 36  ? -6.707  0.425   4.137   1.00 15.00 ?  78  LEU A C    1  
ATOM   533    O  O    . LEU A 1 36  ? -6.827  1.001   3.054   1.00 15.00 ?  78  LEU A O    1  
ATOM   534    C  CB   . LEU A 1 36  ? -4.417  0.634   5.093   1.00 15.00 ?  78  LEU A CB   1  
ATOM   535    C  CG   . LEU A 1 36  ? -3.373  0.012   6.024   1.00 15.00 ?  78  LEU A CG   1  
ATOM   536    C  CD1  . LEU A 1 36  ? -2.485  1.093   6.621   1.00 15.00 ?  78  LEU A CD1  1  
ATOM   537    C  CD2  . LEU A 1 36  ? -4.042  -0.797  7.129   1.00 15.00 ?  78  LEU A CD2  1  
ATOM   538    H  H    . LEU A 1 36  ? -4.643  -0.521  2.531   1.00 15.00 ?  78  LEU A H    1  
ATOM   539    H  HA   . LEU A 1 36  ? -5.680  -1.081  5.233   1.00 15.00 ?  78  LEU A HA   1  
ATOM   540    H  HB2  . LEU A 1 36  ? -3.896  1.115   4.279   1.00 15.00 ?  78  LEU A HB2  1  
ATOM   541    H  HB3  . LEU A 1 36  ? -4.955  1.387   5.646   1.00 15.00 ?  78  LEU A HB3  1  
ATOM   542    H  HG   . LEU A 1 36  ? -2.746  -0.657  5.454   1.00 15.00 ?  78  LEU A HG   1  
ATOM   543    H  HD11 . LEU A 1 36  ? -1.846  0.658   7.374   1.00 15.00 ?  78  LEU A HD11 1  
ATOM   544    H  HD12 . LEU A 1 36  ? -3.100  1.859   7.070   1.00 15.00 ?  78  LEU A HD12 1  
ATOM   545    H  HD13 . LEU A 1 36  ? -1.877  1.529   5.844   1.00 15.00 ?  78  LEU A HD13 1  
ATOM   546    H  HD21 . LEU A 1 36  ? -3.315  -1.045  7.884   1.00 15.00 ?  78  LEU A HD21 1  
ATOM   547    H  HD22 . LEU A 1 36  ? -4.450  -1.705  6.714   1.00 15.00 ?  78  LEU A HD22 1  
ATOM   548    H  HD23 . LEU A 1 36  ? -4.837  -0.218  7.573   1.00 15.00 ?  78  LEU A HD23 1  
ATOM   549    N  N    . ILE A 1 37  ? -7.652  0.410   5.066   1.00 15.00 ?  79  ILE A N    1  
ATOM   550    C  CA   . ILE A 1 37  ? -8.918  1.110   4.917   1.00 15.00 ?  79  ILE A CA   1  
ATOM   551    C  C    . ILE A 1 37  ? -9.101  2.034   6.111   1.00 15.00 ?  79  ILE A C    1  
ATOM   552    O  O    . ILE A 1 37  ? -9.175  1.572   7.249   1.00 15.00 ?  79  ILE A O    1  
ATOM   553    C  CB   . ILE A 1 37  ? -10.113 0.134   4.846   1.00 15.00 ?  79  ILE A CB   1  
ATOM   554    C  CG1  . ILE A 1 37  ? -9.868  -0.940  3.782   1.00 15.00 ?  79  ILE A CG1  1  
ATOM   555    C  CG2  . ILE A 1 37  ? -11.399 0.889   4.551   1.00 15.00 ?  79  ILE A CG2  1  
ATOM   556    C  CD1  . ILE A 1 37  ? -10.845 -2.094  3.839   1.00 15.00 ?  79  ILE A CD1  1  
ATOM   557    H  H    . ILE A 1 37  ? -7.490  -0.095  5.896   1.00 15.00 ?  79  ILE A H    1  
ATOM   558    H  HA   . ILE A 1 37  ? -8.883  1.696   4.008   1.00 15.00 ?  79  ILE A HA   1  
ATOM   559    H  HB   . ILE A 1 37  ? -10.218 -0.343  5.809   1.00 15.00 ?  79  ILE A HB   1  
ATOM   560    H  HG12 . ILE A 1 37  ? -9.949  -0.491  2.803   1.00 15.00 ?  79  ILE A HG12 1  
ATOM   561    H  HG13 . ILE A 1 37  ? -8.872  -1.340  3.910   1.00 15.00 ?  79  ILE A HG13 1  
ATOM   562    H  HG21 . ILE A 1 37  ? -11.293 1.429   3.622   1.00 15.00 ?  79  ILE A HG21 1  
ATOM   563    H  HG22 . ILE A 1 37  ? -11.600 1.585   5.351   1.00 15.00 ?  79  ILE A HG22 1  
ATOM   564    H  HG23 . ILE A 1 37  ? -12.217 0.189   4.469   1.00 15.00 ?  79  ILE A HG23 1  
ATOM   565    H  HD11 . ILE A 1 37  ? -10.582 -2.747  4.655   1.00 15.00 ?  79  ILE A HD11 1  
ATOM   566    H  HD12 . ILE A 1 37  ? -10.806 -2.643  2.910   1.00 15.00 ?  79  ILE A HD12 1  
ATOM   567    H  HD13 . ILE A 1 37  ? -11.845 -1.713  3.991   1.00 15.00 ?  79  ILE A HD13 1  
ATOM   568    N  N    . VAL A 1 38  ? -9.156  3.331   5.859   1.00 15.00 ?  80  VAL A N    1  
ATOM   569    C  CA   . VAL A 1 38  ? -9.295  4.304   6.934   1.00 15.00 ?  80  VAL A CA   1  
ATOM   570    C  C    . VAL A 1 38  ? -10.594 5.091   6.822   1.00 15.00 ?  80  VAL A C    1  
ATOM   571    O  O    . VAL A 1 38  ? -10.995 5.499   5.733   1.00 15.00 ?  80  VAL A O    1  
ATOM   572    C  CB   . VAL A 1 38  ? -8.109  5.300   6.943   1.00 15.00 ?  80  VAL A CB   1  
ATOM   573    C  CG1  . VAL A 1 38  ? -8.089  6.117   8.231   1.00 15.00 ?  80  VAL A CG1  1  
ATOM   574    C  CG2  . VAL A 1 38  ? -6.783  4.574   6.750   1.00 15.00 ?  80  VAL A CG2  1  
ATOM   575    H  H    . VAL A 1 38  ? -9.109  3.643   4.928   1.00 15.00 ?  80  VAL A H    1  
ATOM   576    H  HA   . VAL A 1 38  ? -9.291  3.765   7.873   1.00 15.00 ?  80  VAL A HA   1  
ATOM   577    H  HB   . VAL A 1 38  ? -8.241  5.983   6.119   1.00 15.00 ?  80  VAL A HB   1  
ATOM   578    H  HG11 . VAL A 1 38  ? -8.995  6.701   8.302   1.00 15.00 ?  80  VAL A HG11 1  
ATOM   579    H  HG12 . VAL A 1 38  ? -7.238  6.783   8.221   1.00 15.00 ?  80  VAL A HG12 1  
ATOM   580    H  HG13 . VAL A 1 38  ? -8.019  5.455   9.080   1.00 15.00 ?  80  VAL A HG13 1  
ATOM   581    H  HG21 . VAL A 1 38  ? -5.988  5.296   6.661   1.00 15.00 ?  80  VAL A HG21 1  
ATOM   582    H  HG22 . VAL A 1 38  ? -6.829  3.976   5.853   1.00 15.00 ?  80  VAL A HG22 1  
ATOM   583    H  HG23 . VAL A 1 38  ? -6.596  3.934   7.599   1.00 15.00 ?  80  VAL A HG23 1  
ATOM   584    N  N    . ARG A 1 39  ? -11.255 5.293   7.950   1.00 15.00 ?  81  ARG A N    1  
ATOM   585    C  CA   . ARG A 1 39  ? -12.492 6.051   7.976   1.00 15.00 ?  81  ARG A CA   1  
ATOM   586    C  C    . ARG A 1 39  ? -12.227 7.456   8.498   1.00 15.00 ?  81  ARG A C    1  
ATOM   587    O  O    . ARG A 1 39  ? -11.891 7.636   9.671   1.00 15.00 ?  81  ARG A O    1  
ATOM   588    C  CB   . ARG A 1 39  ? -13.538 5.367   8.856   1.00 15.00 ?  81  ARG A CB   1  
ATOM   589    C  CG   . ARG A 1 39  ? -14.839 6.146   8.964   1.00 15.00 ?  81  ARG A CG   1  
ATOM   590    C  CD   . ARG A 1 39  ? -15.721 5.625   10.085  1.00 15.00 ?  81  ARG A CD   1  
ATOM   591    N  NE   . ARG A 1 39  ? -16.863 6.503   10.316  1.00 15.00 ?  81  ARG A NE   1  
ATOM   592    C  CZ   . ARG A 1 39  ? -18.079 6.075   10.651  1.00 15.00 ?  81  ARG A CZ   1  
ATOM   593    N  NH1  . ARG A 1 39  ? -18.318 4.775   10.798  1.00 15.00 1  81  ARG A NH1  1  
ATOM   594    N  NH2  . ARG A 1 39  ? -19.054 6.950   10.833  1.00 15.00 ?  81  ARG A NH2  1  
ATOM   595    H  H    . ARG A 1 39  ? -10.897 4.922   8.789   1.00 15.00 ?  81  ARG A H    1  
ATOM   596    H  HA   . ARG A 1 39  ? -12.867 6.114   6.964   1.00 15.00 ?  81  ARG A HA   1  
ATOM   597    H  HB2  . ARG A 1 39  ? -13.755 4.395   8.442   1.00 15.00 ?  81  ARG A HB2  1  
ATOM   598    H  HB3  . ARG A 1 39  ? -13.132 5.246   9.849   1.00 15.00 ?  81  ARG A HB3  1  
ATOM   599    H  HG2  . ARG A 1 39  ? -14.611 7.184   9.159   1.00 15.00 ?  81  ARG A HG2  1  
ATOM   600    H  HG3  . ARG A 1 39  ? -15.374 6.063   8.027   1.00 15.00 ?  81  ARG A HG3  1  
ATOM   601    H  HD2  . ARG A 1 39  ? -16.082 4.643   9.817   1.00 15.00 ?  81  ARG A HD2  1  
ATOM   602    H  HD3  . ARG A 1 39  ? -15.135 5.560   10.991  1.00 15.00 ?  81  ARG A HD3  1  
ATOM   603    H  HE   . ARG A 1 39  ? -16.717 7.474   10.209  1.00 15.00 ?  81  ARG A HE   1  
ATOM   604    H  HH11 . ARG A 1 39  ? -19.273 4.444   11.059  1.00 15.00 ?  81  ARG A HH11 1  
ATOM   605    H  HH12 . ARG A 1 39  ? -17.557 4.078   10.652  1.00 15.00 ?  81  ARG A HH12 1  
ATOM   606    H  HH21 . ARG A 1 39  ? -18.872 7.973   10.719  1.00 15.00 ?  81  ARG A HH21 1  
ATOM   607    H  HH22 . ARG A 1 39  ? -20.009 6.622   11.090  1.00 15.00 ?  81  ARG A HH22 1  
ATOM   608    N  N    . ASP A 1 40  ? -12.370 8.441   7.628   1.00 15.00 ?  82  ASP A N    1  
ATOM   609    C  CA   . ASP A 1 40  ? -12.155 9.834   8.003   1.00 15.00 ?  82  ASP A CA   1  
ATOM   610    C  C    . ASP A 1 40  ? -13.496 10.542  8.115   1.00 15.00 ?  82  ASP A C    1  
ATOM   611    O  O    . ASP A 1 40  ? -14.002 11.108  7.144   1.00 15.00 ?  82  ASP A O    1  
ATOM   612    C  CB   . ASP A 1 40  ? -11.259 10.540  6.975   1.00 15.00 ?  82  ASP A CB   1  
ATOM   613    C  CG   . ASP A 1 40  ? -10.932 11.972  7.359   1.00 15.00 ?  82  ASP A CG   1  
ATOM   614    O  OD1  . ASP A 1 40  ? -10.449 12.200  8.489   1.00 15.00 ?  82  ASP A OD1  1  
ATOM   615    O  OD2  . ASP A 1 40  ? -11.138 12.879  6.524   1.00 15.00 -1 82  ASP A OD2  1  
ATOM   616    H  H    . ASP A 1 40  ? -12.644 8.230   6.709   1.00 15.00 ?  82  ASP A H    1  
ATOM   617    H  HA   . ASP A 1 40  ? -11.673 9.851   8.968   1.00 15.00 ?  82  ASP A HA   1  
ATOM   618    H  HB2  . ASP A 1 40  ? -10.332 9.997   6.881   1.00 15.00 ?  82  ASP A HB2  1  
ATOM   619    H  HB3  . ASP A 1 40  ? -11.762 10.551  6.018   1.00 15.00 ?  82  ASP A HB3  1  
ATOM   620    N  N    . GLY A 1 41  ? -14.085 10.483  9.299   1.00 15.00 ?  83  GLY A N    1  
ATOM   621    C  CA   . GLY A 1 41  ? -15.371 11.108  9.519   1.00 15.00 ?  83  GLY A CA   1  
ATOM   622    C  C    . GLY A 1 41  ? -16.492 10.320  8.882   1.00 15.00 ?  83  GLY A C    1  
ATOM   623    O  O    . GLY A 1 41  ? -16.822 9.222   9.336   1.00 15.00 ?  83  GLY A O    1  
ATOM   624    H  H    . GLY A 1 41  ? -13.640 10.015  10.035  1.00 15.00 ?  83  GLY A H    1  
ATOM   625    H  HA2  . GLY A 1 41  ? -15.551 11.178  10.582  1.00 15.00 ?  83  GLY A HA2  1  
ATOM   626    H  HA3  . GLY A 1 41  ? -15.358 12.105  9.099   1.00 15.00 ?  83  GLY A HA3  1  
ATOM   627    N  N    . GLY A 1 42  ? -17.053 10.867  7.814   1.00 15.00 ?  84  GLY A N    1  
ATOM   628    C  CA   . GLY A 1 42  ? -18.140 10.207  7.121   1.00 15.00 ?  84  GLY A CA   1  
ATOM   629    C  C    . GLY A 1 42  ? -17.741 9.730   5.739   1.00 15.00 ?  84  GLY A C    1  
ATOM   630    O  O    . GLY A 1 42  ? -18.595 9.443   4.902   1.00 15.00 ?  84  GLY A O    1  
ATOM   631    H  H    . GLY A 1 42  ? -16.729 11.736  7.494   1.00 15.00 ?  84  GLY A H    1  
ATOM   632    H  HA2  . GLY A 1 42  ? -18.464 9.359   7.706   1.00 15.00 ?  84  GLY A HA2  1  
ATOM   633    H  HA3  . GLY A 1 42  ? -18.963 10.900  7.025   1.00 15.00 ?  84  GLY A HA3  1  
ATOM   634    N  N    . ARG A 1 43  ? -16.444 9.647   5.500   1.00 15.00 ?  85  ARG A N    1  
ATOM   635    C  CA   . ARG A 1 43  ? -15.926 9.199   4.216   1.00 15.00 ?  85  ARG A CA   1  
ATOM   636    C  C    . ARG A 1 43  ? -14.872 8.121   4.431   1.00 15.00 ?  85  ARG A C    1  
ATOM   637    O  O    . ARG A 1 43  ? -14.236 8.063   5.486   1.00 15.00 ?  85  ARG A O    1  
ATOM   638    C  CB   . ARG A 1 43  ? -15.325 10.373  3.444   1.00 15.00 ?  85  ARG A CB   1  
ATOM   639    C  CG   . ARG A 1 43  ? -14.082 10.946  4.104   1.00 15.00 ?  85  ARG A CG   1  
ATOM   640    C  CD   . ARG A 1 43  ? -13.615 12.230  3.442   1.00 15.00 ?  85  ARG A CD   1  
ATOM   641    N  NE   . ARG A 1 43  ? -12.373 12.701  4.041   1.00 15.00 ?  85  ARG A NE   1  
ATOM   642    C  CZ   . ARG A 1 43  ? -11.335 13.160  3.355   1.00 15.00 ?  85  ARG A CZ   1  
ATOM   643    N  NH1  . ARG A 1 43  ? -11.379 13.234  2.031   1.00 15.00 1  85  ARG A NH1  1  
ATOM   644    N  NH2  . ARG A 1 43  ? -10.247 13.529  4.004   1.00 15.00 ?  85  ARG A NH2  1  
ATOM   645    H  H    . ARG A 1 43  ? -15.811 9.885   6.211   1.00 15.00 ?  85  ARG A H    1  
ATOM   646    H  HA   . ARG A 1 43  ? -16.745 8.780   3.651   1.00 15.00 ?  85  ARG A HA   1  
ATOM   647    H  HB2  . ARG A 1 43  ? -15.060 10.040  2.451   1.00 15.00 ?  85  ARG A HB2  1  
ATOM   648    H  HB3  . ARG A 1 43  ? -16.064 11.156  3.369   1.00 15.00 ?  85  ARG A HB3  1  
ATOM   649    H  HG2  . ARG A 1 43  ? -14.302 11.152  5.141   1.00 15.00 ?  85  ARG A HG2  1  
ATOM   650    H  HG3  . ARG A 1 43  ? -13.287 10.214  4.045   1.00 15.00 ?  85  ARG A HG3  1  
ATOM   651    H  HD2  . ARG A 1 43  ? -13.451 12.041  2.393   1.00 15.00 ?  85  ARG A HD2  1  
ATOM   652    H  HD3  . ARG A 1 43  ? -14.374 12.989  3.562   1.00 15.00 ?  85  ARG A HD3  1  
ATOM   653    H  HE   . ARG A 1 43  ? -12.311 12.672  5.030   1.00 15.00 ?  85  ARG A HE   1  
ATOM   654    H  HH11 . ARG A 1 43  ? -12.238 12.943  1.516   1.00 15.00 ?  85  ARG A HH11 1  
ATOM   655    H  HH12 . ARG A 1 43  ? -10.552 13.589  1.496   1.00 15.00 ?  85  ARG A HH12 1  
ATOM   656    H  HH21 . ARG A 1 43  ? -10.220 13.455  5.049   1.00 15.00 ?  85  ARG A HH21 1  
ATOM   657    H  HH22 . ARG A 1 43  ? -9.419  13.888  3.487   1.00 15.00 ?  85  ARG A HH22 1  
ATOM   658    N  N    . VAL A 1 44  ? -14.688 7.270   3.435   1.00 15.00 ?  86  VAL A N    1  
ATOM   659    C  CA   . VAL A 1 44  ? -13.714 6.195   3.530   1.00 15.00 ?  86  VAL A CA   1  
ATOM   660    C  C    . VAL A 1 44  ? -12.536 6.437   2.594   1.00 15.00 ?  86  VAL A C    1  
ATOM   661    O  O    . VAL A 1 44  ? -12.707 6.905   1.466   1.00 15.00 ?  86  VAL A O    1  
ATOM   662    C  CB   . VAL A 1 44  ? -14.362 4.830   3.200   1.00 15.00 ?  86  VAL A CB   1  
ATOM   663    C  CG1  . VAL A 1 44  ? -13.418 3.684   3.526   1.00 15.00 ?  86  VAL A CG1  1  
ATOM   664    C  CG2  . VAL A 1 44  ? -15.679 4.673   3.941   1.00 15.00 ?  86  VAL A CG2  1  
ATOM   665    H  H    . VAL A 1 44  ? -15.228 7.356   2.618   1.00 15.00 ?  86  VAL A H    1  
ATOM   666    H  HA   . VAL A 1 44  ? -13.353 6.164   4.548   1.00 15.00 ?  86  VAL A HA   1  
ATOM   667    H  HB   . VAL A 1 44  ? -14.567 4.800   2.140   1.00 15.00 ?  86  VAL A HB   1  
ATOM   668    H  HG11 . VAL A 1 44  ? -12.894 3.896   4.446   1.00 15.00 ?  86  VAL A HG11 1  
ATOM   669    H  HG12 . VAL A 1 44  ? -12.707 3.564   2.724   1.00 15.00 ?  86  VAL A HG12 1  
ATOM   670    H  HG13 . VAL A 1 44  ? -13.984 2.769   3.639   1.00 15.00 ?  86  VAL A HG13 1  
ATOM   671    H  HG21 . VAL A 1 44  ? -16.317 5.516   3.724   1.00 15.00 ?  86  VAL A HG21 1  
ATOM   672    H  HG22 . VAL A 1 44  ? -15.488 4.628   5.002   1.00 15.00 ?  86  VAL A HG22 1  
ATOM   673    H  HG23 . VAL A 1 44  ? -16.167 3.763   3.621   1.00 15.00 ?  86  VAL A HG23 1  
ATOM   674    N  N    . LEU A 1 45  ? -11.342 6.137   3.081   1.00 15.00 ?  87  LEU A N    1  
ATOM   675    C  CA   . LEU A 1 45  ? -10.123 6.290   2.306   1.00 15.00 ?  87  LEU A CA   1  
ATOM   676    C  C    . LEU A 1 45  ? -9.444  4.930   2.183   1.00 15.00 ?  87  LEU A C    1  
ATOM   677    O  O    . LEU A 1 45  ? -9.238  4.250   3.186   1.00 15.00 ?  87  LEU A O    1  
ATOM   678    C  CB   . LEU A 1 45  ? -9.185  7.292   2.982   1.00 15.00 ?  87  LEU A CB   1  
ATOM   679    C  CG   . LEU A 1 45  ? -9.779  8.686   3.197   1.00 15.00 ?  87  LEU A CG   1  
ATOM   680    C  CD1  . LEU A 1 45  ? -8.912  9.496   4.138   1.00 15.00 ?  87  LEU A CD1  1  
ATOM   681    C  CD2  . LEU A 1 45  ? -9.919  9.407   1.873   1.00 15.00 ?  87  LEU A CD2  1  
ATOM   682    H  H    . LEU A 1 45  ? -11.277 5.794   4.002   1.00 15.00 ?  87  LEU A H    1  
ATOM   683    H  HA   . LEU A 1 45  ? -10.388 6.649   1.321   1.00 15.00 ?  87  LEU A HA   1  
ATOM   684    H  HB2  . LEU A 1 45  ? -8.895  6.892   3.942   1.00 15.00 ?  87  LEU A HB2  1  
ATOM   685    H  HB3  . LEU A 1 45  ? -8.299  7.394   2.370   1.00 15.00 ?  87  LEU A HB3  1  
ATOM   686    H  HG   . LEU A 1 45  ? -10.763 8.592   3.637   1.00 15.00 ?  87  LEU A HG   1  
ATOM   687    H  HD11 . LEU A 1 45  ? -8.730  8.932   5.038   1.00 15.00 ?  87  LEU A HD11 1  
ATOM   688    H  HD12 . LEU A 1 45  ? -9.419  10.414  4.386   1.00 15.00 ?  87  LEU A HD12 1  
ATOM   689    H  HD13 . LEU A 1 45  ? -7.973  9.722   3.655   1.00 15.00 ?  87  LEU A HD13 1  
ATOM   690    H  HD21 . LEU A 1 45  ? -10.243 10.423  2.047   1.00 15.00 ?  87  LEU A HD21 1  
ATOM   691    H  HD22 . LEU A 1 45  ? -10.648 8.896   1.260   1.00 15.00 ?  87  LEU A HD22 1  
ATOM   692    H  HD23 . LEU A 1 45  ? -8.965  9.416   1.367   1.00 15.00 ?  87  LEU A HD23 1  
ATOM   693    N  N    . VAL A 1 46  ? -9.105  4.527   0.967   1.00 15.00 ?  88  VAL A N    1  
ATOM   694    C  CA   . VAL A 1 46  ? -8.490  3.222   0.758   1.00 15.00 ?  88  VAL A CA   1  
ATOM   695    C  C    . VAL A 1 46  ? -7.060  3.345   0.240   1.00 15.00 ?  88  VAL A C    1  
ATOM   696    O  O    . VAL A 1 46  ? -6.759  4.187   -0.607  1.00 15.00 ?  88  VAL A O    1  
ATOM   697    C  CB   . VAL A 1 46  ? -9.314  2.369   -0.235  1.00 15.00 ?  88  VAL A CB   1  
ATOM   698    C  CG1  . VAL A 1 46  ? -8.781  0.943   -0.308  1.00 15.00 ?  88  VAL A CG1  1  
ATOM   699    C  CG2  . VAL A 1 46  ? -10.786 2.368   0.150   1.00 15.00 ?  88  VAL A CG2  1  
ATOM   700    H  H    . VAL A 1 46  ? -9.253  5.122   0.197   1.00 15.00 ?  88  VAL A H    1  
ATOM   701    H  HA   . VAL A 1 46  ? -8.474  2.709   1.708   1.00 15.00 ?  88  VAL A HA   1  
ATOM   702    H  HB   . VAL A 1 46  ? -9.225  2.811   -1.215  1.00 15.00 ?  88  VAL A HB   1  
ATOM   703    H  HG11 . VAL A 1 46  ? -9.322  0.394   -1.063  1.00 15.00 ?  88  VAL A HG11 1  
ATOM   704    H  HG12 . VAL A 1 46  ? -8.911  0.463   0.650   1.00 15.00 ?  88  VAL A HG12 1  
ATOM   705    H  HG13 . VAL A 1 46  ? -7.732  0.965   -0.561  1.00 15.00 ?  88  VAL A HG13 1  
ATOM   706    H  HG21 . VAL A 1 46  ? -11.334 1.729   -0.527  1.00 15.00 ?  88  VAL A HG21 1  
ATOM   707    H  HG22 . VAL A 1 46  ? -11.172 3.372   0.087   1.00 15.00 ?  88  VAL A HG22 1  
ATOM   708    H  HG23 . VAL A 1 46  ? -10.897 2.002   1.160   1.00 15.00 ?  88  VAL A HG23 1  
ATOM   709    N  N    . VAL A 1 47  ? -6.180  2.503   0.767   1.00 15.00 ?  89  VAL A N    1  
ATOM   710    C  CA   . VAL A 1 47  ? -4.788  2.482   0.354   1.00 15.00 ?  89  VAL A CA   1  
ATOM   711    C  C    . VAL A 1 47  ? -4.489  1.172   -0.368  1.00 15.00 ?  89  VAL A C    1  
ATOM   712    O  O    . VAL A 1 47  ? -4.565  0.099   0.238   1.00 15.00 ?  89  VAL A O    1  
ATOM   713    C  CB   . VAL A 1 47  ? -3.833  2.636   1.559   1.00 15.00 ?  89  VAL A CB   1  
ATOM   714    C  CG1  . VAL A 1 47  ? -2.378  2.662   1.106   1.00 15.00 ?  89  VAL A CG1  1  
ATOM   715    C  CG2  . VAL A 1 47  ? -4.167  3.891   2.354   1.00 15.00 ?  89  VAL A CG2  1  
ATOM   716    H  H    . VAL A 1 47  ? -6.480  1.869   1.459   1.00 15.00 ?  89  VAL A H    1  
ATOM   717    H  HA   . VAL A 1 47  ? -4.626  3.308   -0.327  1.00 15.00 ?  89  VAL A HA   1  
ATOM   718    H  HB   . VAL A 1 47  ? -3.967  1.783   2.207   1.00 15.00 ?  89  VAL A HB   1  
ATOM   719    H  HG11 . VAL A 1 47  ? -1.734  2.730   1.972   1.00 15.00 ?  89  VAL A HG11 1  
ATOM   720    H  HG12 . VAL A 1 47  ? -2.212  3.516   0.466   1.00 15.00 ?  89  VAL A HG12 1  
ATOM   721    H  HG13 . VAL A 1 47  ? -2.153  1.756   0.563   1.00 15.00 ?  89  VAL A HG13 1  
ATOM   722    H  HG21 . VAL A 1 47  ? -3.481  3.981   3.185   1.00 15.00 ?  89  VAL A HG21 1  
ATOM   723    H  HG22 . VAL A 1 47  ? -5.177  3.824   2.726   1.00 15.00 ?  89  VAL A HG22 1  
ATOM   724    H  HG23 . VAL A 1 47  ? -4.073  4.757   1.714   1.00 15.00 ?  89  VAL A HG23 1  
ATOM   725    N  N    . ASP A 1 48  ? -4.169  1.282   -1.658  1.00 15.00 ?  90  ASP A N    1  
ATOM   726    C  CA   . ASP A 1 48  ? -3.852  0.135   -2.517  1.00 15.00 ?  90  ASP A CA   1  
ATOM   727    C  C    . ASP A 1 48  ? -5.087  -0.702  -2.830  1.00 15.00 ?  90  ASP A C    1  
ATOM   728    O  O    . ASP A 1 48  ? -6.092  -0.657  -2.116  1.00 15.00 ?  90  ASP A O    1  
ATOM   729    C  CB   . ASP A 1 48  ? -2.771  -0.754  -1.899  1.00 15.00 ?  90  ASP A CB   1  
ATOM   730    C  CG   . ASP A 1 48  ? -1.371  -0.303  -2.250  1.00 15.00 ?  90  ASP A CG   1  
ATOM   731    O  OD1  . ASP A 1 48  ? -1.167  0.214   -3.364  1.00 15.00 ?  90  ASP A OD1  1  
ATOM   732    O  OD2  . ASP A 1 48  ? -0.461  -0.491  -1.418  1.00 15.00 -1 90  ASP A OD2  1  
ATOM   733    H  H    . ASP A 1 48  ? -4.142  2.184   -2.054  1.00 15.00 ?  90  ASP A H    1  
ATOM   734    H  HA   . ASP A 1 48  ? -3.474  0.532   -3.446  1.00 15.00 ?  90  ASP A HA   1  
ATOM   735    H  HB2  . ASP A 1 48  ? -2.875  -0.741  -0.822  1.00 15.00 ?  90  ASP A HB2  1  
ATOM   736    H  HB3  . ASP A 1 48  ? -2.902  -1.767  -2.253  1.00 15.00 ?  90  ASP A HB3  1  
ATOM   737    N  N    . THR A 1 49  ? -5.011  -1.464  -3.911  1.00 15.00 ?  91  THR A N    1  
ATOM   738    C  CA   . THR A 1 49  ? -6.115  -2.318  -4.320  1.00 15.00 ?  91  THR A CA   1  
ATOM   739    C  C    . THR A 1 49  ? -5.744  -3.784  -4.121  1.00 15.00 ?  91  THR A C    1  
ATOM   740    O  O    . THR A 1 49  ? -4.699  -4.087  -3.542  1.00 15.00 ?  91  THR A O    1  
ATOM   741    C  CB   . THR A 1 49  ? -6.504  -2.074  -5.796  1.00 15.00 ?  91  THR A CB   1  
ATOM   742    O  OG1  . THR A 1 49  ? -5.491  -2.576  -6.679  1.00 15.00 ?  91  THR A OG1  1  
ATOM   743    C  CG2  . THR A 1 49  ? -6.701  -0.589  -6.055  1.00 15.00 ?  91  THR A CG2  1  
ATOM   744    H  H    . THR A 1 49  ? -4.188  -1.456  -4.446  1.00 15.00 ?  91  THR A H    1  
ATOM   745    H  HA   . THR A 1 49  ? -6.968  -2.082  -3.698  1.00 15.00 ?  91  THR A HA   1  
ATOM   746    H  HB   . THR A 1 49  ? -7.433  -2.584  -5.999  1.00 15.00 ?  91  THR A HB   1  
ATOM   747    H  HG1  . THR A 1 49  ? -4.619  -2.306  -6.354  1.00 15.00 ?  91  THR A HG1  1  
ATOM   748    H  HG21 . THR A 1 49  ? -5.749  -0.083  -5.997  1.00 15.00 ?  91  THR A HG21 1  
ATOM   749    H  HG22 . THR A 1 49  ? -7.367  -0.183  -5.310  1.00 15.00 ?  91  THR A HG22 1  
ATOM   750    H  HG23 . THR A 1 49  ? -7.125  -0.446  -7.039  1.00 15.00 ?  91  THR A HG23 1  
ATOM   751    N  N    . ALA A 1 50  ? -6.595  -4.684  -4.591  1.00 15.00 ?  92  ALA A N    1  
ATOM   752    C  CA   . ALA A 1 50  ? -6.342  -6.112  -4.463  1.00 15.00 ?  92  ALA A CA   1  
ATOM   753    C  C    . ALA A 1 50  ? -5.657  -6.652  -5.713  1.00 15.00 ?  92  ALA A C    1  
ATOM   754    O  O    . ALA A 1 50  ? -5.263  -5.886  -6.592  1.00 15.00 ?  92  ALA A O    1  
ATOM   755    C  CB   . ALA A 1 50  ? -7.639  -6.863  -4.194  1.00 15.00 ?  92  ALA A CB   1  
ATOM   756    H  H    . ALA A 1 50  ? -7.412  -4.383  -5.044  1.00 15.00 ?  92  ALA A H    1  
ATOM   757    H  HA   . ALA A 1 50  ? -5.687  -6.260  -3.618  1.00 15.00 ?  92  ALA A HA   1  
ATOM   758    H  HB1  . ALA A 1 50  ? -8.265  -6.838  -5.075  1.00 15.00 ?  92  ALA A HB1  1  
ATOM   759    H  HB2  . ALA A 1 50  ? -8.159  -6.400  -3.372  1.00 15.00 ?  92  ALA A HB2  1  
ATOM   760    H  HB3  . ALA A 1 50  ? -7.412  -7.889  -3.939  1.00 15.00 ?  92  ALA A HB3  1  
ATOM   761    N  N    . TRP A 1 51  ? -5.525  -7.971  -5.793  1.00 15.00 ?  93  TRP A N    1  
ATOM   762    C  CA   . TRP A 1 51  ? -4.891  -8.608  -6.940  1.00 15.00 ?  93  TRP A CA   1  
ATOM   763    C  C    . TRP A 1 51  ? -5.698  -8.386  -8.212  1.00 15.00 ?  93  TRP A C    1  
ATOM   764    O  O    . TRP A 1 51  ? -5.143  -8.095  -9.272  1.00 15.00 ?  93  TRP A O    1  
ATOM   765    C  CB   . TRP A 1 51  ? -4.743  -10.111 -6.703  1.00 15.00 ?  93  TRP A CB   1  
ATOM   766    C  CG   . TRP A 1 51  ? -3.729  -10.468 -5.664  1.00 15.00 ?  93  TRP A CG   1  
ATOM   767    C  CD1  . TRP A 1 51  ? -3.977  -10.813 -4.371  1.00 15.00 ?  93  TRP A CD1  1  
ATOM   768    C  CD2  . TRP A 1 51  ? -2.309  -10.531 -5.834  1.00 15.00 ?  93  TRP A CD2  1  
ATOM   769    N  NE1  . TRP A 1 51  ? -2.800  -11.091 -3.723  1.00 15.00 ?  93  TRP A NE1  1  
ATOM   770    C  CE2  . TRP A 1 51  ? -1.761  -10.920 -4.599  1.00 15.00 ?  93  TRP A CE2  1  
ATOM   771    C  CE3  . TRP A 1 51  ? -1.451  -10.293 -6.912  1.00 15.00 ?  93  TRP A CE3  1  
ATOM   772    C  CZ2  . TRP A 1 51  ? -0.394  -11.080 -4.414  1.00 15.00 ?  93  TRP A CZ2  1  
ATOM   773    C  CZ3  . TRP A 1 51  ? -0.093  -10.453 -6.726  1.00 15.00 ?  93  TRP A CZ3  1  
ATOM   774    C  CH2  . TRP A 1 51  ? 0.424   -10.842 -5.485  1.00 15.00 ?  93  TRP A CH2  1  
ATOM   775    H  H    . TRP A 1 51  ? -5.850  -8.530  -5.058  1.00 15.00 ?  93  TRP A H    1  
ATOM   776    H  HA   . TRP A 1 51  ? -3.909  -8.173  -7.065  1.00 15.00 ?  93  TRP A HA   1  
ATOM   777    H  HB2  . TRP A 1 51  ? -5.694  -10.512 -6.388  1.00 15.00 ?  93  TRP A HB2  1  
ATOM   778    H  HB3  . TRP A 1 51  ? -4.451  -10.583 -7.630  1.00 15.00 ?  93  TRP A HB3  1  
ATOM   779    H  HD1  . TRP A 1 51  ? -4.962  -10.859 -3.934  1.00 15.00 ?  93  TRP A HD1  1  
ATOM   780    H  HE1  . TRP A 1 51  ? -2.719  -11.365 -2.785  1.00 15.00 ?  93  TRP A HE1  1  
ATOM   781    H  HE3  . TRP A 1 51  ? -1.835  -9.994  -7.876  1.00 15.00 ?  93  TRP A HE3  1  
ATOM   782    H  HZ2  . TRP A 1 51  ? 0.022   -11.379 -3.467  1.00 15.00 ?  93  TRP A HZ2  1  
ATOM   783    H  HZ3  . TRP A 1 51  ? 0.585   -10.274 -7.546  1.00 15.00 ?  93  TRP A HZ3  1  
ATOM   784    H  HH2  . TRP A 1 51  ? 1.493   -10.954 -5.387  1.00 15.00 ?  93  TRP A HH2  1  
ATOM   785    N  N    . THR A 1 52  ? -7.010  -8.532  -8.108  1.00 15.00 ?  94  THR A N    1  
ATOM   786    C  CA   . THR A 1 52  ? -7.881  -8.359  -9.256  1.00 15.00 ?  94  THR A CA   1  
ATOM   787    C  C    . THR A 1 52  ? -8.974  -7.338  -8.979  1.00 15.00 ?  94  THR A C    1  
ATOM   788    O  O    . THR A 1 52  ? -9.187  -6.929  -7.829  1.00 15.00 ?  94  THR A O    1  
ATOM   789    C  CB   . THR A 1 52  ? -8.529  -9.697  -9.653  1.00 15.00 ?  94  THR A CB   1  
ATOM   790    O  OG1  . THR A 1 52  ? -9.005  -10.372 -8.484  1.00 15.00 ?  94  THR A OG1  1  
ATOM   791    C  CG2  . THR A 1 52  ? -7.540  -10.584 -10.394 1.00 15.00 ?  94  THR A CG2  1  
ATOM   792    H  H    . THR A 1 52  ? -7.400  -8.763  -7.243  1.00 15.00 ?  94  THR A H    1  
ATOM   793    H  HA   . THR A 1 52  ? -7.282  -8.014  -10.085 1.00 15.00 ?  94  THR A HA   1  
ATOM   794    H  HB   . THR A 1 52  ? -9.365  -9.492  -10.301 1.00 15.00 ?  94  THR A HB   1  
ATOM   795    H  HG1  . THR A 1 52  ? -9.018  -11.324 -8.648  1.00 15.00 ?  94  THR A HG1  1  
ATOM   796    H  HG21 . THR A 1 52  ? -7.448  -10.243 -11.416 1.00 15.00 ?  94  THR A HG21 1  
ATOM   797    H  HG22 . THR A 1 52  ? -7.893  -11.607 -10.382 1.00 15.00 ?  94  THR A HG22 1  
ATOM   798    H  HG23 . THR A 1 52  ? -6.576  -10.531 -9.912  1.00 15.00 ?  94  THR A HG23 1  
ATOM   799    N  N    . ASP A 1 53  ? -9.674  -6.932  -10.034 1.00 15.00 ?  95  ASP A N    1  
ATOM   800    C  CA   . ASP A 1 53  ? -10.756 -5.965  -9.910  1.00 15.00 ?  95  ASP A CA   1  
ATOM   801    C  C    . ASP A 1 53  ? -11.897 -6.561  -9.104  1.00 15.00 ?  95  ASP A C    1  
ATOM   802    O  O    . ASP A 1 53  ? -12.549 -5.869  -8.326  1.00 15.00 ?  95  ASP A O    1  
ATOM   803    C  CB   . ASP A 1 53  ? -11.264 -5.531  -11.290 1.00 15.00 ?  95  ASP A CB   1  
ATOM   804    C  CG   . ASP A 1 53  ? -10.260 -4.684  -12.047 1.00 15.00 ?  95  ASP A CG   1  
ATOM   805    O  OD1  . ASP A 1 53  ? -10.121 -3.487  -11.728 1.00 15.00 ?  95  ASP A OD1  1  
ATOM   806    O  OD2  . ASP A 1 53  ? -9.606  -5.221  -12.971 1.00 15.00 -1 95  ASP A OD2  1  
ATOM   807    H  H    . ASP A 1 53  ? -9.451  -7.285  -10.919 1.00 15.00 ?  95  ASP A H    1  
ATOM   808    H  HA   . ASP A 1 53  ? -10.371 -5.103  -9.385  1.00 15.00 ?  95  ASP A HA   1  
ATOM   809    H  HB2  . ASP A 1 53  ? -11.476 -6.410  -11.880 1.00 15.00 ?  95  ASP A HB2  1  
ATOM   810    H  HB3  . ASP A 1 53  ? -12.173 -4.960  -11.169 1.00 15.00 ?  95  ASP A HB3  1  
ATOM   811    N  N    . ASP A 1 54  ? -12.121 -7.856  -9.286  1.00 15.00 ?  96  ASP A N    1  
ATOM   812    C  CA   . ASP A 1 54  ? -13.184 -8.561  -8.577  1.00 15.00 ?  96  ASP A CA   1  
ATOM   813    C  C    . ASP A 1 54  ? -12.951 -8.512  -7.075  1.00 15.00 ?  96  ASP A C    1  
ATOM   814    O  O    . ASP A 1 54  ? -13.843 -8.146  -6.311  1.00 15.00 ?  96  ASP A O    1  
ATOM   815    C  CB   . ASP A 1 54  ? -13.266 -10.014 -9.038  1.00 15.00 ?  96  ASP A CB   1  
ATOM   816    C  CG   . ASP A 1 54  ? -14.457 -10.734 -8.441  1.00 15.00 ?  96  ASP A CG   1  
ATOM   817    O  OD1  . ASP A 1 54  ? -15.461 -10.922 -9.160  1.00 15.00 ?  96  ASP A OD1  1  
ATOM   818    O  OD2  . ASP A 1 54  ? -14.403 -11.113 -7.251  1.00 15.00 -1 96  ASP A OD2  1  
ATOM   819    H  H    . ASP A 1 54  ? -11.555 -8.352  -9.914  1.00 15.00 ?  96  ASP A H    1  
ATOM   820    H  HA   . ASP A 1 54  ? -14.117 -8.068  -8.801  1.00 15.00 ?  96  ASP A HA   1  
ATOM   821    H  HB2  . ASP A 1 54  ? -13.354 -10.040 -10.114 1.00 15.00 ?  96  ASP A HB2  1  
ATOM   822    H  HB3  . ASP A 1 54  ? -12.366 -10.532 -8.741  1.00 15.00 ?  96  ASP A HB3  1  
ATOM   823    N  N    . GLN A 1 55  ? -11.739 -8.862  -6.659  1.00 15.00 ?  97  GLN A N    1  
ATOM   824    C  CA   . GLN A 1 55  ? -11.383 -8.859  -5.248  1.00 15.00 ?  97  GLN A CA   1  
ATOM   825    C  C    . GLN A 1 55  ? -11.485 -7.451  -4.672  1.00 15.00 ?  97  GLN A C    1  
ATOM   826    O  O    . GLN A 1 55  ? -11.929 -7.261  -3.544  1.00 15.00 ?  97  GLN A O    1  
ATOM   827    C  CB   . GLN A 1 55  ? -9.974  -9.413  -5.059  1.00 15.00 ?  97  GLN A CB   1  
ATOM   828    C  CG   . GLN A 1 55  ? -9.843  -10.867 -5.475  1.00 15.00 ?  97  GLN A CG   1  
ATOM   829    C  CD   . GLN A 1 55  ? -8.529  -11.484 -5.050  1.00 15.00 ?  97  GLN A CD   1  
ATOM   830    O  OE1  . GLN A 1 55  ? -7.509  -10.802 -4.941  1.00 15.00 ?  97  GLN A OE1  1  
ATOM   831    N  NE2  . GLN A 1 55  ? -8.549  -12.783 -4.801  1.00 15.00 ?  97  GLN A NE2  1  
ATOM   832    H  H    . GLN A 1 55  ? -11.068 -9.136  -7.321  1.00 15.00 ?  97  GLN A H    1  
ATOM   833    H  HA   . GLN A 1 55  ? -12.083 -9.497  -4.729  1.00 15.00 ?  97  GLN A HA   1  
ATOM   834    H  HB2  . GLN A 1 55  ? -9.288  -8.828  -5.655  1.00 15.00 ?  97  GLN A HB2  1  
ATOM   835    H  HB3  . GLN A 1 55  ? -9.697  -9.331  -4.019  1.00 15.00 ?  97  GLN A HB3  1  
ATOM   836    H  HG2  . GLN A 1 55  ? -10.646 -11.429 -5.025  1.00 15.00 ?  97  GLN A HG2  1  
ATOM   837    H  HG3  . GLN A 1 55  ? -9.921  -10.928 -6.551  1.00 15.00 ?  97  GLN A HG3  1  
ATOM   838    H  HE21 . GLN A 1 55  ? -9.401  -13.261 -4.905  1.00 15.00 ?  97  GLN A HE21 1  
ATOM   839    H  HE22 . GLN A 1 55  ? -7.709  -13.221 -4.530  1.00 15.00 ?  97  GLN A HE22 1  
ATOM   840    N  N    . THR A 1 56  ? -11.080 -6.466  -5.465  1.00 15.00 ?  98  THR A N    1  
ATOM   841    C  CA   . THR A 1 56  ? -11.151 -5.075  -5.040  1.00 15.00 ?  98  THR A CA   1  
ATOM   842    C  C    . THR A 1 56  ? -12.611 -4.650  -4.867  1.00 15.00 ?  98  THR A C    1  
ATOM   843    O  O    . THR A 1 56  ? -12.945 -3.876  -3.970  1.00 15.00 ?  98  THR A O    1  
ATOM   844    C  CB   . THR A 1 56  ? -10.438 -4.155  -6.049  1.00 15.00 ?  98  THR A CB   1  
ATOM   845    O  OG1  . THR A 1 56  ? -9.092  -4.612  -6.243  1.00 15.00 ?  98  THR A OG1  1  
ATOM   846    C  CG2  . THR A 1 56  ? -10.417 -2.712  -5.564  1.00 15.00 ?  98  THR A CG2  1  
ATOM   847    H  H    . THR A 1 56  ? -10.720 -6.679  -6.353  1.00 15.00 ?  98  THR A H    1  
ATOM   848    H  HA   . THR A 1 56  ? -10.646 -4.992  -4.089  1.00 15.00 ?  98  THR A HA   1  
ATOM   849    H  HB   . THR A 1 56  ? -10.965 -4.197  -6.991  1.00 15.00 ?  98  THR A HB   1  
ATOM   850    H  HG1  . THR A 1 56  ? -9.079  -5.307  -6.913  1.00 15.00 ?  98  THR A HG1  1  
ATOM   851    H  HG21 . THR A 1 56  ? -11.428 -2.342  -5.489  1.00 15.00 ?  98  THR A HG21 1  
ATOM   852    H  HG22 . THR A 1 56  ? -9.861  -2.106  -6.265  1.00 15.00 ?  98  THR A HG22 1  
ATOM   853    H  HG23 . THR A 1 56  ? -9.943  -2.668  -4.594  1.00 15.00 ?  98  THR A HG23 1  
ATOM   854    N  N    . ALA A 1 57  ? -13.481 -5.195  -5.716  1.00 15.00 ?  99  ALA A N    1  
ATOM   855    C  CA   . ALA A 1 57  ? -14.906 -4.899  -5.655  1.00 15.00 ?  99  ALA A CA   1  
ATOM   856    C  C    . ALA A 1 57  ? -15.503 -5.453  -4.369  1.00 15.00 ?  99  ALA A C    1  
ATOM   857    O  O    . ALA A 1 57  ? -16.435 -4.877  -3.803  1.00 15.00 ?  99  ALA A O    1  
ATOM   858    C  CB   . ALA A 1 57  ? -15.620 -5.477  -6.865  1.00 15.00 ?  99  ALA A CB   1  
ATOM   859    H  H    . ALA A 1 57  ? -13.150 -5.813  -6.407  1.00 15.00 ?  99  ALA A H    1  
ATOM   860    H  HA   . ALA A 1 57  ? -15.028 -3.826  -5.668  1.00 15.00 ?  99  ALA A HA   1  
ATOM   861    H  HB1  . ALA A 1 57  ? -15.046 -5.267  -7.757  1.00 15.00 ?  99  ALA A HB1  1  
ATOM   862    H  HB2  . ALA A 1 57  ? -16.597 -5.028  -6.955  1.00 15.00 ?  99  ALA A HB2  1  
ATOM   863    H  HB3  . ALA A 1 57  ? -15.726 -6.546  -6.746  1.00 15.00 ?  99  ALA A HB3  1  
ATOM   864    N  N    . GLN A 1 58  ? -14.954 -6.576  -3.910  1.00 15.00 ?  100 GLN A N    1  
ATOM   865    C  CA   . GLN A 1 58  ? -15.411 -7.209  -2.680  1.00 15.00 ?  100 GLN A CA   1  
ATOM   866    C  C    . GLN A 1 58  ? -15.076 -6.316  -1.492  1.00 15.00 ?  100 GLN A C    1  
ATOM   867    O  O    . GLN A 1 58  ? -15.837 -6.232  -0.530  1.00 15.00 ?  100 GLN A O    1  
ATOM   868    C  CB   . GLN A 1 58  ? -14.774 -8.591  -2.507  1.00 15.00 ?  100 GLN A CB   1  
ATOM   869    C  CG   . GLN A 1 58  ? -15.098 -9.554  -3.642  1.00 15.00 ?  100 GLN A CG   1  
ATOM   870    C  CD   . GLN A 1 58  ? -14.615 -10.969 -3.388  1.00 15.00 ?  100 GLN A CD   1  
ATOM   871    O  OE1  . GLN A 1 58  ? -14.563 -11.428 -2.247  1.00 15.00 ?  100 GLN A OE1  1  
ATOM   872    N  NE2  . GLN A 1 58  ? -14.267 -11.672 -4.455  1.00 15.00 ?  100 GLN A NE2  1  
ATOM   873    H  H    . GLN A 1 58  ? -14.226 -6.995  -4.419  1.00 15.00 ?  100 GLN A H    1  
ATOM   874    H  HA   . GLN A 1 58  ? -16.483 -7.319  -2.744  1.00 15.00 ?  100 GLN A HA   1  
ATOM   875    H  HB2  . GLN A 1 58  ? -13.699 -8.477  -2.455  1.00 15.00 ?  100 GLN A HB2  1  
ATOM   876    H  HB3  . GLN A 1 58  ? -15.128 -9.025  -1.582  1.00 15.00 ?  100 GLN A HB3  1  
ATOM   877    H  HG2  . GLN A 1 58  ? -16.168 -9.580  -3.780  1.00 15.00 ?  100 GLN A HG2  1  
ATOM   878    H  HG3  . GLN A 1 58  ? -14.631 -9.187  -4.545  1.00 15.00 ?  100 GLN A HG3  1  
ATOM   879    H  HE21 . GLN A 1 58  ? -14.339 -11.242 -5.342  1.00 15.00 ?  100 GLN A HE21 1  
ATOM   880    H  HE22 . GLN A 1 58  ? -13.954 -12.589 -4.324  1.00 15.00 ?  100 GLN A HE22 1  
ATOM   881    N  N    . ILE A 1 59  ? -13.936 -5.637  -1.581  1.00 15.00 ?  101 ILE A N    1  
ATOM   882    C  CA   . ILE A 1 59  ? -13.504 -4.719  -0.534  1.00 15.00 ?  101 ILE A CA   1  
ATOM   883    C  C    . ILE A 1 59  ? -14.508 -3.579  -0.419  1.00 15.00 ?  101 ILE A C    1  
ATOM   884    O  O    . ILE A 1 59  ? -14.917 -3.194  0.677   1.00 15.00 ?  101 ILE A O    1  
ATOM   885    C  CB   . ILE A 1 59  ? -12.111 -4.129  -0.838  1.00 15.00 ?  101 ILE A CB   1  
ATOM   886    C  CG1  . ILE A 1 59  ? -11.099 -5.244  -1.115  1.00 15.00 ?  101 ILE A CG1  1  
ATOM   887    C  CG2  . ILE A 1 59  ? -11.642 -3.249  0.314   1.00 15.00 ?  101 ILE A CG2  1  
ATOM   888    C  CD1  . ILE A 1 59  ? -9.755  -4.727  -1.576  1.00 15.00 ?  101 ILE A CD1  1  
ATOM   889    H  H    . ILE A 1 59  ? -13.366 -5.764  -2.370  1.00 15.00 ?  101 ILE A H    1  
ATOM   890    H  HA   . ILE A 1 59  ? -13.464 -5.255  0.401   1.00 15.00 ?  101 ILE A HA   1  
ATOM   891    H  HB   . ILE A 1 59  ? -12.197 -3.507  -1.715  1.00 15.00 ?  101 ILE A HB   1  
ATOM   892    H  HG12 . ILE A 1 59  ? -10.944 -5.820  -0.215  1.00 15.00 ?  101 ILE A HG12 1  
ATOM   893    H  HG13 . ILE A 1 59  ? -11.489 -5.891  -1.889  1.00 15.00 ?  101 ILE A HG13 1  
ATOM   894    H  HG21 . ILE A 1 59  ? -11.857 -3.740  1.252   1.00 15.00 ?  101 ILE A HG21 1  
ATOM   895    H  HG22 . ILE A 1 59  ? -12.158 -2.300  0.276   1.00 15.00 ?  101 ILE A HG22 1  
ATOM   896    H  HG23 . ILE A 1 59  ? -10.577 -3.082  0.229   1.00 15.00 ?  101 ILE A HG23 1  
ATOM   897    H  HD11 . ILE A 1 59  ? -9.109  -5.561  -1.807  1.00 15.00 ?  101 ILE A HD11 1  
ATOM   898    H  HD12 . ILE A 1 59  ? -9.311  -4.134  -0.789  1.00 15.00 ?  101 ILE A HD12 1  
ATOM   899    H  HD13 . ILE A 1 59  ? -9.887  -4.117  -2.456  1.00 15.00 ?  101 ILE A HD13 1  
ATOM   900    N  N    . LEU A 1 60  ? -14.925 -3.071  -1.572  1.00 15.00 ?  102 LEU A N    1  
ATOM   901    C  CA   . LEU A 1 60  ? -15.893 -1.986  -1.632  1.00 15.00 ?  102 LEU A CA   1  
ATOM   902    C  C    . LEU A 1 60  ? -17.237 -2.456  -1.089  1.00 15.00 ?  102 LEU A C    1  
ATOM   903    O  O    . LEU A 1 60  ? -17.990 -1.681  -0.493  1.00 15.00 ?  102 LEU A O    1  
ATOM   904    C  CB   . LEU A 1 60  ? -16.043 -1.495  -3.073  1.00 15.00 ?  102 LEU A CB   1  
ATOM   905    C  CG   . LEU A 1 60  ? -14.738 -1.083  -3.752  1.00 15.00 ?  102 LEU A CG   1  
ATOM   906    C  CD1  . LEU A 1 60  ? -14.986 -0.724  -5.209  1.00 15.00 ?  102 LEU A CD1  1  
ATOM   907    C  CD2  . LEU A 1 60  ? -14.090 0.079   -3.013  1.00 15.00 ?  102 LEU A CD2  1  
ATOM   908    H  H    . LEU A 1 60  ? -14.568 -3.438  -2.410  1.00 15.00 ?  102 LEU A H    1  
ATOM   909    H  HA   . LEU A 1 60  ? -15.527 -1.177  -1.016  1.00 15.00 ?  102 LEU A HA   1  
ATOM   910    H  HB2  . LEU A 1 60  ? -16.491 -2.287  -3.655  1.00 15.00 ?  102 LEU A HB2  1  
ATOM   911    H  HB3  . LEU A 1 60  ? -16.712 -0.647  -3.075  1.00 15.00 ?  102 LEU A HB3  1  
ATOM   912    H  HG   . LEU A 1 60  ? -14.050 -1.920  -3.730  1.00 15.00 ?  102 LEU A HG   1  
ATOM   913    H  HD11 . LEU A 1 60  ? -15.408 -1.573  -5.720  1.00 15.00 ?  102 LEU A HD11 1  
ATOM   914    H  HD12 . LEU A 1 60  ? -14.053 -0.452  -5.679  1.00 15.00 ?  102 LEU A HD12 1  
ATOM   915    H  HD13 . LEU A 1 60  ? -15.673 0.108   -5.264  1.00 15.00 ?  102 LEU A HD13 1  
ATOM   916    H  HD21 . LEU A 1 60  ? -13.291 0.489   -3.615  1.00 15.00 ?  102 LEU A HD21 1  
ATOM   917    H  HD22 . LEU A 1 60  ? -13.690 -0.275  -2.075  1.00 15.00 ?  102 LEU A HD22 1  
ATOM   918    H  HD23 . LEU A 1 60  ? -14.827 0.847   -2.823  1.00 15.00 ?  102 LEU A HD23 1  
ATOM   919    N  N    . ASN A 1 61  ? -17.528 -3.740  -1.292  1.00 15.00 ?  103 ASN A N    1  
ATOM   920    C  CA   . ASN A 1 61  ? -18.769 -4.327  -0.805  1.00 15.00 ?  103 ASN A CA   1  
ATOM   921    C  C    . ASN A 1 61  ? -18.724 -4.412  0.716   1.00 15.00 ?  103 ASN A C    1  
ATOM   922    O  O    . ASN A 1 61  ? -19.713 -4.140  1.396   1.00 15.00 ?  103 ASN A O    1  
ATOM   923    C  CB   . ASN A 1 61  ? -18.982 -5.721  -1.412  1.00 15.00 ?  103 ASN A CB   1  
ATOM   924    C  CG   . ASN A 1 61  ? -20.442 -6.015  -1.719  1.00 15.00 ?  103 ASN A CG   1  
ATOM   925    O  OD1  . ASN A 1 61  ? -21.348 -5.403  -1.151  1.00 15.00 ?  103 ASN A OD1  1  
ATOM   926    N  ND2  . ASN A 1 61  ? -20.678 -6.965  -2.616  1.00 15.00 ?  103 ASN A ND2  1  
ATOM   927    H  H    . ASN A 1 61  ? -16.895 -4.301  -1.791  1.00 15.00 ?  103 ASN A H    1  
ATOM   928    H  HA   . ASN A 1 61  ? -19.579 -3.680  -1.097  1.00 15.00 ?  103 ASN A HA   1  
ATOM   929    H  HB2  . ASN A 1 61  ? -18.420 -5.793  -2.331  1.00 15.00 ?  103 ASN A HB2  1  
ATOM   930    H  HB3  . ASN A 1 61  ? -18.621 -6.465  -0.718  1.00 15.00 ?  103 ASN A HB3  1  
ATOM   931    H  HD21 . ASN A 1 61  ? -19.909 -7.422  -3.024  1.00 15.00 ?  103 ASN A HD21 1  
ATOM   932    H  HD22 . ASN A 1 61  ? -21.612 -7.173  -2.838  1.00 15.00 ?  103 ASN A HD22 1  
ATOM   933    N  N    . TRP A 1 62  ? -17.557 -4.780  1.240   1.00 15.00 ?  104 TRP A N    1  
ATOM   934    C  CA   . TRP A 1 62  ? -17.344 -4.887  2.682   1.00 15.00 ?  104 TRP A CA   1  
ATOM   935    C  C    . TRP A 1 62  ? -17.479 -3.512  3.328   1.00 15.00 ?  104 TRP A C    1  
ATOM   936    O  O    . TRP A 1 62  ? -18.127 -3.361  4.366   1.00 15.00 ?  104 TRP A O    1  
ATOM   937    C  CB   . TRP A 1 62  ? -15.956 -5.480  2.965   1.00 15.00 ?  104 TRP A CB   1  
ATOM   938    C  CG   . TRP A 1 62  ? -15.673 -5.718  4.422   1.00 15.00 ?  104 TRP A CG   1  
ATOM   939    C  CD1  . TRP A 1 62  ? -15.963 -6.841  5.140   1.00 15.00 ?  104 TRP A CD1  1  
ATOM   940    C  CD2  . TRP A 1 62  ? -15.033 -4.817  5.333   1.00 15.00 ?  104 TRP A CD2  1  
ATOM   941    N  NE1  . TRP A 1 62  ? -15.545 -6.695  6.441   1.00 15.00 ?  104 TRP A NE1  1  
ATOM   942    C  CE2  . TRP A 1 62  ? -14.969 -5.460  6.583   1.00 15.00 ?  104 TRP A CE2  1  
ATOM   943    C  CE3  . TRP A 1 62  ? -14.507 -3.529  5.211   1.00 15.00 ?  104 TRP A CE3  1  
ATOM   944    C  CZ2  . TRP A 1 62  ? -14.402 -4.858  7.703   1.00 15.00 ?  104 TRP A CZ2  1  
ATOM   945    C  CZ3  . TRP A 1 62  ? -13.944 -2.933  6.321   1.00 15.00 ?  104 TRP A CZ3  1  
ATOM   946    C  CH2  . TRP A 1 62  ? -13.894 -3.597  7.554   1.00 15.00 ?  104 TRP A CH2  1  
ATOM   947    H  H    . TRP A 1 62  ? -16.813 -4.996  0.633   1.00 15.00 ?  104 TRP A H    1  
ATOM   948    H  HA   . TRP A 1 62  ? -18.099 -5.540  3.089   1.00 15.00 ?  104 TRP A HA   1  
ATOM   949    H  HB2  . TRP A 1 62  ? -15.870 -6.429  2.455   1.00 15.00 ?  104 TRP A HB2  1  
ATOM   950    H  HB3  . TRP A 1 62  ? -15.200 -4.809  2.585   1.00 15.00 ?  104 TRP A HB3  1  
ATOM   951    H  HD1  . TRP A 1 62  ? -16.454 -7.711  4.732   1.00 15.00 ?  104 TRP A HD1  1  
ATOM   952    H  HE1  . TRP A 1 62  ? -15.640 -7.368  7.151   1.00 15.00 ?  104 TRP A HE1  1  
ATOM   953    H  HE3  . TRP A 1 62  ? -14.538 -3.002  4.268   1.00 15.00 ?  104 TRP A HE3  1  
ATOM   954    H  HZ2  . TRP A 1 62  ? -14.356 -5.357  8.661   1.00 15.00 ?  104 TRP A HZ2  1  
ATOM   955    H  HZ3  . TRP A 1 62  ? -13.532 -1.939  6.245   1.00 15.00 ?  104 TRP A HZ3  1  
ATOM   956    H  HH2  . TRP A 1 62  ? -13.445 -3.092  8.395   1.00 15.00 ?  104 TRP A HH2  1  
ATOM   957    N  N    . ILE A 1 63  ? -16.873 -2.510  2.695   1.00 15.00 ?  105 ILE A N    1  
ATOM   958    C  CA   . ILE A 1 63  ? -16.928 -1.144  3.188   1.00 15.00 ?  105 ILE A CA   1  
ATOM   959    C  C    . ILE A 1 63  ? -18.377 -0.679  3.292   1.00 15.00 ?  105 ILE A C    1  
ATOM   960    O  O    . ILE A 1 63  ? -18.773 -0.061  4.275   1.00 15.00 ?  105 ILE A O    1  
ATOM   961    C  CB   . ILE A 1 63  ? -16.138 -0.187  2.264   1.00 15.00 ?  105 ILE A CB   1  
ATOM   962    C  CG1  . ILE A 1 63  ? -14.636 -0.494  2.338   1.00 15.00 ?  105 ILE A CG1  1  
ATOM   963    C  CG2  . ILE A 1 63  ? -16.404 1.266   2.633   1.00 15.00 ?  105 ILE A CG2  1  
ATOM   964    C  CD1  . ILE A 1 63  ? -13.800 0.297   1.354   1.00 15.00 ?  105 ILE A CD1  1  
ATOM   965    H  H    . ILE A 1 63  ? -16.370 -2.701  1.874   1.00 15.00 ?  105 ILE A H    1  
ATOM   966    H  HA   . ILE A 1 63  ? -16.477 -1.122  4.171   1.00 15.00 ?  105 ILE A HA   1  
ATOM   967    H  HB   . ILE A 1 63  ? -16.477 -0.343  1.252   1.00 15.00 ?  105 ILE A HB   1  
ATOM   968    H  HG12 . ILE A 1 63  ? -14.279 -0.269  3.330   1.00 15.00 ?  105 ILE A HG12 1  
ATOM   969    H  HG13 . ILE A 1 63  ? -14.482 -1.545  2.138   1.00 15.00 ?  105 ILE A HG13 1  
ATOM   970    H  HG21 . ILE A 1 63  ? -16.095 1.444   3.650   1.00 15.00 ?  105 ILE A HG21 1  
ATOM   971    H  HG22 . ILE A 1 63  ? -17.460 1.474   2.537   1.00 15.00 ?  105 ILE A HG22 1  
ATOM   972    H  HG23 . ILE A 1 63  ? -15.846 1.912   1.970   1.00 15.00 ?  105 ILE A HG23 1  
ATOM   973    H  HD11 . ILE A 1 63  ? -14.250 0.242   0.375   1.00 15.00 ?  105 ILE A HD11 1  
ATOM   974    H  HD12 . ILE A 1 63  ? -12.803 -0.118  1.316   1.00 15.00 ?  105 ILE A HD12 1  
ATOM   975    H  HD13 . ILE A 1 63  ? -13.750 1.328   1.672   1.00 15.00 ?  105 ILE A HD13 1  
ATOM   976    N  N    . LYS A 1 64  ? -19.164 -1.017  2.283   1.00 15.00 ?  106 LYS A N    1  
ATOM   977    C  CA   . LYS A 1 64  ? -20.573 -0.641  2.241   1.00 15.00 ?  106 LYS A CA   1  
ATOM   978    C  C    . LYS A 1 64  ? -21.384 -1.465  3.244   1.00 15.00 ?  106 LYS A C    1  
ATOM   979    O  O    . LYS A 1 64  ? -22.372 -0.991  3.798   1.00 15.00 ?  106 LYS A O    1  
ATOM   980    C  CB   . LYS A 1 64  ? -21.121 -0.839  0.820   1.00 15.00 ?  106 LYS A CB   1  
ATOM   981    C  CG   . LYS A 1 64  ? -22.617 -0.598  0.684   1.00 15.00 ?  106 LYS A CG   1  
ATOM   982    C  CD   . LYS A 1 64  ? -22.980 0.864   0.904   1.00 15.00 ?  106 LYS A CD   1  
ATOM   983    C  CE   . LYS A 1 64  ? -24.468 1.100   0.705   1.00 15.00 ?  106 LYS A CE   1  
ATOM   984    N  NZ   . LYS A 1 64  ? -25.278 0.346   1.700   1.00 15.00 1  106 LYS A NZ   1  
ATOM   985    H  H    . LYS A 1 64  ? -18.785 -1.539  1.541   1.00 15.00 ?  106 LYS A H    1  
ATOM   986    H  HA   . LYS A 1 64  ? -20.649 0.403   2.506   1.00 15.00 ?  106 LYS A HA   1  
ATOM   987    H  HB2  . LYS A 1 64  ? -20.612 -0.161  0.155   1.00 15.00 ?  106 LYS A HB2  1  
ATOM   988    H  HB3  . LYS A 1 64  ? -20.914 -1.853  0.510   1.00 15.00 ?  106 LYS A HB3  1  
ATOM   989    H  HG2  . LYS A 1 64  ? -22.928 -0.888  -0.308  1.00 15.00 ?  106 LYS A HG2  1  
ATOM   990    H  HG3  . LYS A 1 64  ? -23.133 -1.201  1.414   1.00 15.00 ?  106 LYS A HG3  1  
ATOM   991    H  HD2  . LYS A 1 64  ? -22.715 1.146   1.911   1.00 15.00 ?  106 LYS A HD2  1  
ATOM   992    H  HD3  . LYS A 1 64  ? -22.430 1.472   0.203   1.00 15.00 ?  106 LYS A HD3  1  
ATOM   993    H  HE2  . LYS A 1 64  ? -24.671 2.157   0.809   1.00 15.00 ?  106 LYS A HE2  1  
ATOM   994    H  HE3  . LYS A 1 64  ? -24.743 0.777   -0.288  1.00 15.00 ?  106 LYS A HE3  1  
ATOM   995    H  HZ1  . LYS A 1 64  ? -26.290 0.561   1.577   1.00 15.00 ?  106 LYS A HZ1  1  
ATOM   996    H  HZ2  . LYS A 1 64  ? -24.995 0.610   2.670   1.00 15.00 ?  106 LYS A HZ2  1  
ATOM   997    H  HZ3  . LYS A 1 64  ? -25.136 -0.676  1.578   1.00 15.00 ?  106 LYS A HZ3  1  
ATOM   998    N  N    . GLN A 1 65  ? -20.948 -2.692  3.481   1.00 15.00 ?  107 GLN A N    1  
ATOM   999    C  CA   . GLN A 1 65  ? -21.634 -3.592  4.397   1.00 15.00 ?  107 GLN A CA   1  
ATOM   1000   C  C    . GLN A 1 65  ? -21.411 -3.197  5.858   1.00 15.00 ?  107 GLN A C    1  
ATOM   1001   O  O    . GLN A 1 65  ? -22.362 -3.071  6.630   1.00 15.00 ?  107 GLN A O    1  
ATOM   1002   C  CB   . GLN A 1 65  ? -21.141 -5.025  4.179   1.00 15.00 ?  107 GLN A CB   1  
ATOM   1003   C  CG   . GLN A 1 65  ? -21.840 -6.055  5.051   1.00 15.00 ?  107 GLN A CG   1  
ATOM   1004   C  CD   . GLN A 1 65  ? -21.149 -7.403  5.030   1.00 15.00 ?  107 GLN A CD   1  
ATOM   1005   O  OE1  . GLN A 1 65  ? -21.479 -8.274  4.224   1.00 15.00 ?  107 GLN A OE1  1  
ATOM   1006   N  NE2  . GLN A 1 65  ? -20.191 -7.590  5.922   1.00 15.00 ?  107 GLN A NE2  1  
ATOM   1007   H  H    . GLN A 1 65  ? -20.137 -3.007  3.022   1.00 15.00 ?  107 GLN A H    1  
ATOM   1008   H  HA   . GLN A 1 65  ? -22.690 -3.547  4.179   1.00 15.00 ?  107 GLN A HA   1  
ATOM   1009   H  HB2  . GLN A 1 65  ? -21.295 -5.294  3.146   1.00 15.00 ?  107 GLN A HB2  1  
ATOM   1010   H  HB3  . GLN A 1 65  ? -20.085 -5.062  4.397   1.00 15.00 ?  107 GLN A HB3  1  
ATOM   1011   H  HG2  . GLN A 1 65  ? -21.855 -5.694  6.068   1.00 15.00 ?  107 GLN A HG2  1  
ATOM   1012   H  HG3  . GLN A 1 65  ? -22.854 -6.179  4.699   1.00 15.00 ?  107 GLN A HG3  1  
ATOM   1013   H  HE21 . GLN A 1 65  ? -19.986 -6.856  6.546   1.00 15.00 ?  107 GLN A HE21 1  
ATOM   1014   H  HE22 . GLN A 1 65  ? -19.727 -8.452  5.927   1.00 15.00 ?  107 GLN A HE22 1  
ATOM   1015   N  N    . GLU A 1 66  ? -20.150 -2.995  6.226   1.00 15.00 ?  108 GLU A N    1  
ATOM   1016   C  CA   . GLU A 1 66  ? -19.793 -2.657  7.600   1.00 15.00 ?  108 GLU A CA   1  
ATOM   1017   C  C    . GLU A 1 66  ? -19.840 -1.154  7.874   1.00 15.00 ?  108 GLU A C    1  
ATOM   1018   O  O    . GLU A 1 66  ? -20.633 -0.688  8.693   1.00 15.00 ?  108 GLU A O    1  
ATOM   1019   C  CB   . GLU A 1 66  ? -18.395 -3.193  7.929   1.00 15.00 ?  108 GLU A CB   1  
ATOM   1020   C  CG   . GLU A 1 66  ? -18.291 -4.706  7.842   1.00 15.00 ?  108 GLU A CG   1  
ATOM   1021   C  CD   . GLU A 1 66  ? -19.176 -5.393  8.851   1.00 15.00 ?  108 GLU A CD   1  
ATOM   1022   O  OE1  . GLU A 1 66  ? -19.001 -5.143  10.063  1.00 15.00 ?  108 GLU A OE1  1  
ATOM   1023   O  OE2  . GLU A 1 66  ? -20.051 -6.184  8.440   1.00 15.00 -1 108 GLU A OE2  1  
ATOM   1024   H  H    . GLU A 1 66  ? -19.437 -3.077  5.551   1.00 15.00 ?  108 GLU A H    1  
ATOM   1025   H  HA   . GLU A 1 66  ? -20.505 -3.144  8.247   1.00 15.00 ?  108 GLU A HA   1  
ATOM   1026   H  HB2  . GLU A 1 66  ? -17.682 -2.764  7.242   1.00 15.00 ?  108 GLU A HB2  1  
ATOM   1027   H  HB3  . GLU A 1 66  ? -18.136 -2.895  8.935   1.00 15.00 ?  108 GLU A HB3  1  
ATOM   1028   H  HG2  . GLU A 1 66  ? -18.590 -5.017  6.853   1.00 15.00 ?  108 GLU A HG2  1  
ATOM   1029   H  HG3  . GLU A 1 66  ? -17.267 -5.003  8.020   1.00 15.00 ?  108 GLU A HG3  1  
ATOM   1030   N  N    . ILE A 1 67  ? -18.991 -0.402  7.183   1.00 15.00 ?  109 ILE A N    1  
ATOM   1031   C  CA   . ILE A 1 67  ? -18.902 1.043   7.383   1.00 15.00 ?  109 ILE A CA   1  
ATOM   1032   C  C    . ILE A 1 67  ? -20.136 1.769   6.843   1.00 15.00 ?  109 ILE A C    1  
ATOM   1033   O  O    . ILE A 1 67  ? -20.625 2.712   7.464   1.00 15.00 ?  109 ILE A O    1  
ATOM   1034   C  CB   . ILE A 1 67  ? -17.627 1.614   6.726   1.00 15.00 ?  109 ILE A CB   1  
ATOM   1035   C  CG1  . ILE A 1 67  ? -16.430 0.696   7.006   1.00 15.00 ?  109 ILE A CG1  1  
ATOM   1036   C  CG2  . ILE A 1 67  ? -17.344 3.016   7.243   1.00 15.00 ?  109 ILE A CG2  1  
ATOM   1037   C  CD1  . ILE A 1 67  ? -15.176 1.093   6.256   1.00 15.00 ?  109 ILE A CD1  1  
ATOM   1038   H  H    . ILE A 1 67  ? -18.421 -0.826  6.508   1.00 15.00 ?  109 ILE A H    1  
ATOM   1039   H  HA   . ILE A 1 67  ? -18.838 1.223   8.445   1.00 15.00 ?  109 ILE A HA   1  
ATOM   1040   H  HB   . ILE A 1 67  ? -17.788 1.671   5.661   1.00 15.00 ?  109 ILE A HB   1  
ATOM   1041   H  HG12 . ILE A 1 67  ? -16.203 0.721   8.063   1.00 15.00 ?  109 ILE A HG12 1  
ATOM   1042   H  HG13 . ILE A 1 67  ? -16.685 -0.316  6.720   1.00 15.00 ?  109 ILE A HG13 1  
ATOM   1043   H  HG21 . ILE A 1 67  ? -18.199 3.648   7.057   1.00 15.00 ?  109 ILE A HG21 1  
ATOM   1044   H  HG22 . ILE A 1 67  ? -16.478 3.420   6.736   1.00 15.00 ?  109 ILE A HG22 1  
ATOM   1045   H  HG23 . ILE A 1 67  ? -17.152 2.974   8.306   1.00 15.00 ?  109 ILE A HG23 1  
ATOM   1046   H  HD11 . ILE A 1 67  ? -15.167 2.165   6.119   1.00 15.00 ?  109 ILE A HD11 1  
ATOM   1047   H  HD12 . ILE A 1 67  ? -15.163 0.606   5.294   1.00 15.00 ?  109 ILE A HD12 1  
ATOM   1048   H  HD13 . ILE A 1 67  ? -14.304 0.795   6.822   1.00 15.00 ?  109 ILE A HD13 1  
ATOM   1049   N  N    . ASN A 1 68  ? -20.622 1.324   5.687   1.00 15.00 ?  110 ASN A N    1  
ATOM   1050   C  CA   . ASN A 1 68  ? -21.807 1.910   5.043   1.00 15.00 ?  110 ASN A CA   1  
ATOM   1051   C  C    . ASN A 1 68  ? -21.548 3.369   4.659   1.00 15.00 ?  110 ASN A C    1  
ATOM   1052   O  O    . ASN A 1 68  ? -22.450 4.209   4.687   1.00 15.00 ?  110 ASN A O    1  
ATOM   1053   C  CB   . ASN A 1 68  ? -23.038 1.804   5.958   1.00 15.00 ?  110 ASN A CB   1  
ATOM   1054   C  CG   . ASN A 1 68  ? -24.349 1.827   5.188   1.00 15.00 ?  110 ASN A CG   1  
ATOM   1055   O  OD1  . ASN A 1 68  ? -24.415 1.408   4.033   1.00 15.00 ?  110 ASN A OD1  1  
ATOM   1056   N  ND2  . ASN A 1 68  ? -25.403 2.312   5.825   1.00 15.00 ?  110 ASN A ND2  1  
ATOM   1057   H  H    . ASN A 1 68  ? -20.160 0.578   5.241   1.00 15.00 ?  110 ASN A H    1  
ATOM   1058   H  HA   . ASN A 1 68  ? -21.998 1.349   4.138   1.00 15.00 ?  110 ASN A HA   1  
ATOM   1059   H  HB2  . ASN A 1 68  ? -22.985 0.878   6.514   1.00 15.00 ?  110 ASN A HB2  1  
ATOM   1060   H  HB3  . ASN A 1 68  ? -23.035 2.632   6.650   1.00 15.00 ?  110 ASN A HB3  1  
ATOM   1061   H  HD21 . ASN A 1 68  ? -25.283 2.629   6.746   1.00 15.00 ?  110 ASN A HD21 1  
ATOM   1062   H  HD22 . ASN A 1 68  ? -26.261 2.329   5.354   1.00 15.00 ?  110 ASN A HD22 1  
ATOM   1063   N  N    . LEU A 1 69  ? -20.304 3.659   4.299   1.00 15.00 ?  111 LEU A N    1  
ATOM   1064   C  CA   . LEU A 1 69  ? -19.912 5.004   3.904   1.00 15.00 ?  111 LEU A CA   1  
ATOM   1065   C  C    . LEU A 1 69  ? -19.236 4.983   2.534   1.00 15.00 ?  111 LEU A C    1  
ATOM   1066   O  O    . LEU A 1 69  ? -18.644 3.976   2.144   1.00 15.00 ?  111 LEU A O    1  
ATOM   1067   C  CB   . LEU A 1 69  ? -18.972 5.613   4.948   1.00 15.00 ?  111 LEU A CB   1  
ATOM   1068   C  CG   . LEU A 1 69  ? -19.626 5.998   6.277   1.00 15.00 ?  111 LEU A CG   1  
ATOM   1069   C  CD1  . LEU A 1 69  ? -18.591 6.589   7.219   1.00 15.00 ?  111 LEU A CD1  1  
ATOM   1070   C  CD2  . LEU A 1 69  ? -20.763 6.982   6.048   1.00 15.00 ?  111 LEU A CD2  1  
ATOM   1071   H  H    . LEU A 1 69  ? -19.627 2.951   4.300   1.00 15.00 ?  111 LEU A H    1  
ATOM   1072   H  HA   . LEU A 1 69  ? -20.805 5.605   3.842   1.00 15.00 ?  111 LEU A HA   1  
ATOM   1073   H  HB2  . LEU A 1 69  ? -18.189 4.898   5.152   1.00 15.00 ?  111 LEU A HB2  1  
ATOM   1074   H  HB3  . LEU A 1 69  ? -18.524 6.501   4.524   1.00 15.00 ?  111 LEU A HB3  1  
ATOM   1075   H  HG   . LEU A 1 69  ? -20.035 5.111   6.743   1.00 15.00 ?  111 LEU A HG   1  
ATOM   1076   H  HD11 . LEU A 1 69  ? -17.885 5.823   7.511   1.00 15.00 ?  111 LEU A HD11 1  
ATOM   1077   H  HD12 . LEU A 1 69  ? -19.084 6.977   8.095   1.00 15.00 ?  111 LEU A HD12 1  
ATOM   1078   H  HD13 . LEU A 1 69  ? -18.067 7.389   6.717   1.00 15.00 ?  111 LEU A HD13 1  
ATOM   1079   H  HD21 . LEU A 1 69  ? -21.107 7.361   6.999   1.00 15.00 ?  111 LEU A HD21 1  
ATOM   1080   H  HD22 . LEU A 1 69  ? -21.577 6.482   5.543   1.00 15.00 ?  111 LEU A HD22 1  
ATOM   1081   H  HD23 . LEU A 1 69  ? -20.410 7.804   5.441   1.00 15.00 ?  111 LEU A HD23 1  
ATOM   1082   N  N    . PRO A 1 70  ? -19.321 6.088   1.785   1.00 15.00 ?  112 PRO A N    1  
ATOM   1083   C  CA   . PRO A 1 70  ? -18.725 6.180   0.456   1.00 15.00 ?  112 PRO A CA   1  
ATOM   1084   C  C    . PRO A 1 70  ? -17.221 6.437   0.488   1.00 15.00 ?  112 PRO A C    1  
ATOM   1085   O  O    . PRO A 1 70  ? -16.709 7.139   1.369   1.00 15.00 ?  112 PRO A O    1  
ATOM   1086   C  CB   . PRO A 1 70  ? -19.457 7.369   -0.163  1.00 15.00 ?  112 PRO A CB   1  
ATOM   1087   C  CG   . PRO A 1 70  ? -19.810 8.245   0.988   1.00 15.00 ?  112 PRO A CG   1  
ATOM   1088   C  CD   . PRO A 1 70  ? -20.012 7.334   2.172   1.00 15.00 ?  112 PRO A CD   1  
ATOM   1089   H  HA   . PRO A 1 70  ? -18.926 5.296   -0.123  1.00 15.00 ?  112 PRO A HA   1  
ATOM   1090   H  HB2  . PRO A 1 70  ? -18.803 7.880   -0.859  1.00 15.00 ?  112 PRO A HB2  1  
ATOM   1091   H  HB3  . PRO A 1 70  ? -20.351 7.034   -0.663  1.00 15.00 ?  112 PRO A HB3  1  
ATOM   1092   H  HG2  . PRO A 1 70  ? -19.000 8.940   1.177   1.00 15.00 ?  112 PRO A HG2  1  
ATOM   1093   H  HG3  . PRO A 1 70  ? -20.721 8.782   0.776   1.00 15.00 ?  112 PRO A HG3  1  
ATOM   1094   H  HD2  . PRO A 1 70  ? -19.561 7.760   3.056   1.00 15.00 ?  112 PRO A HD2  1  
ATOM   1095   H  HD3  . PRO A 1 70  ? -21.065 7.155   2.337   1.00 15.00 ?  112 PRO A HD3  1  
ATOM   1096   N  N    . VAL A 1 71  ? -16.512 5.852   -0.467  1.00 15.00 ?  113 VAL A N    1  
ATOM   1097   C  CA   . VAL A 1 71  ? -15.072 6.030   -0.563  1.00 15.00 ?  113 VAL A CA   1  
ATOM   1098   C  C    . VAL A 1 71  ? -14.758 7.337   -1.284  1.00 15.00 ?  113 VAL A C    1  
ATOM   1099   O  O    . VAL A 1 71  ? -15.227 7.577   -2.400  1.00 15.00 ?  113 VAL A O    1  
ATOM   1100   C  CB   . VAL A 1 71  ? -14.396 4.857   -1.302  1.00 15.00 ?  113 VAL A CB   1  
ATOM   1101   C  CG1  . VAL A 1 71  ? -12.883 5.016   -1.304  1.00 15.00 ?  113 VAL A CG1  1  
ATOM   1102   C  CG2  . VAL A 1 71  ? -14.786 3.530   -0.679  1.00 15.00 ?  113 VAL A CG2  1  
ATOM   1103   H  H    . VAL A 1 71  ? -16.973 5.284   -1.124  1.00 15.00 ?  113 VAL A H    1  
ATOM   1104   H  HA   . VAL A 1 71  ? -14.672 6.079   0.440   1.00 15.00 ?  113 VAL A HA   1  
ATOM   1105   H  HB   . VAL A 1 71  ? -14.735 4.860   -2.327  1.00 15.00 ?  113 VAL A HB   1  
ATOM   1106   H  HG11 . VAL A 1 71  ? -12.612 5.900   -1.863  1.00 15.00 ?  113 VAL A HG11 1  
ATOM   1107   H  HG12 . VAL A 1 71  ? -12.432 4.147   -1.761  1.00 15.00 ?  113 VAL A HG12 1  
ATOM   1108   H  HG13 . VAL A 1 71  ? -12.531 5.109   -0.288  1.00 15.00 ?  113 VAL A HG13 1  
ATOM   1109   H  HG21 . VAL A 1 71  ? -14.376 2.722   -1.269  1.00 15.00 ?  113 VAL A HG21 1  
ATOM   1110   H  HG22 . VAL A 1 71  ? -15.861 3.448   -0.652  1.00 15.00 ?  113 VAL A HG22 1  
ATOM   1111   H  HG23 . VAL A 1 71  ? -14.393 3.475   0.328   1.00 15.00 ?  113 VAL A HG23 1  
ATOM   1112   N  N    . ALA A 1 72  ? -13.968 8.181   -0.640  1.00 15.00 ?  114 ALA A N    1  
ATOM   1113   C  CA   . ALA A 1 72  ? -13.601 9.469   -1.208  1.00 15.00 ?  114 ALA A CA   1  
ATOM   1114   C  C    . ALA A 1 72  ? -12.545 9.306   -2.293  1.00 15.00 ?  114 ALA A C    1  
ATOM   1115   O  O    . ALA A 1 72  ? -12.712 9.787   -3.416  1.00 15.00 ?  114 ALA A O    1  
ATOM   1116   C  CB   . ALA A 1 72  ? -13.098 10.406  -0.120  1.00 15.00 ?  114 ALA A CB   1  
ATOM   1117   H  H    . ALA A 1 72  ? -13.610 7.923   0.239   1.00 15.00 ?  114 ALA A H    1  
ATOM   1118   H  HA   . ALA A 1 72  ? -14.487 9.906   -1.643  1.00 15.00 ?  114 ALA A HA   1  
ATOM   1119   H  HB1  . ALA A 1 72  ? -12.145 10.054  0.246   1.00 15.00 ?  114 ALA A HB1  1  
ATOM   1120   H  HB2  . ALA A 1 72  ? -13.808 10.428  0.691   1.00 15.00 ?  114 ALA A HB2  1  
ATOM   1121   H  HB3  . ALA A 1 72  ? -12.984 11.399  -0.527  1.00 15.00 ?  114 ALA A HB3  1  
ATOM   1122   N  N    . LEU A 1 73  ? -11.465 8.617   -1.956  1.00 15.00 ?  115 LEU A N    1  
ATOM   1123   C  CA   . LEU A 1 73  ? -10.380 8.396   -2.899  1.00 15.00 ?  115 LEU A CA   1  
ATOM   1124   C  C    . LEU A 1 73  ? -9.568  7.168   -2.517  1.00 15.00 ?  115 LEU A C    1  
ATOM   1125   O  O    . LEU A 1 73  ? -9.641  6.693   -1.381  1.00 15.00 ?  115 LEU A O    1  
ATOM   1126   C  CB   . LEU A 1 73  ? -9.473  9.632   -2.956  1.00 15.00 ?  115 LEU A CB   1  
ATOM   1127   C  CG   . LEU A 1 73  ? -8.850  10.057  -1.618  1.00 15.00 ?  115 LEU A CG   1  
ATOM   1128   C  CD1  . LEU A 1 73  ? -7.386  9.643   -1.545  1.00 15.00 ?  115 LEU A CD1  1  
ATOM   1129   C  CD2  . LEU A 1 73  ? -8.984  11.562  -1.422  1.00 15.00 ?  115 LEU A CD2  1  
ATOM   1130   H  H    . LEU A 1 73  ? -11.388 8.254   -1.049  1.00 15.00 ?  115 LEU A H    1  
ATOM   1131   H  HA   . LEU A 1 73  ? -10.819 8.237   -3.874  1.00 15.00 ?  115 LEU A HA   1  
ATOM   1132   H  HB2  . LEU A 1 73  ? -8.674  9.431   -3.654  1.00 15.00 ?  115 LEU A HB2  1  
ATOM   1133   H  HB3  . LEU A 1 73  ? -10.055 10.460  -3.333  1.00 15.00 ?  115 LEU A HB3  1  
ATOM   1134   H  HG   . LEU A 1 73  ? -9.376  9.567   -0.814  1.00 15.00 ?  115 LEU A HG   1  
ATOM   1135   H  HD11 . LEU A 1 73  ? -6.838  10.119  -2.345  1.00 15.00 ?  115 LEU A HD11 1  
ATOM   1136   H  HD12 . LEU A 1 73  ? -7.309  8.571   -1.647  1.00 15.00 ?  115 LEU A HD12 1  
ATOM   1137   H  HD13 . LEU A 1 73  ? -6.973  9.946   -0.593  1.00 15.00 ?  115 LEU A HD13 1  
ATOM   1138   H  HD21 . LEU A 1 73  ? -10.029 11.830  -1.387  1.00 15.00 ?  115 LEU A HD21 1  
ATOM   1139   H  HD22 . LEU A 1 73  ? -8.506  12.078  -2.243  1.00 15.00 ?  115 LEU A HD22 1  
ATOM   1140   H  HD23 . LEU A 1 73  ? -8.509  11.847  -0.494  1.00 15.00 ?  115 LEU A HD23 1  
ATOM   1141   N  N    . ALA A 1 74  ? -8.808  6.658   -3.472  1.00 15.00 ?  116 ALA A N    1  
ATOM   1142   C  CA   . ALA A 1 74  ? -7.966  5.497   -3.252  1.00 15.00 ?  116 ALA A CA   1  
ATOM   1143   C  C    . ALA A 1 74  ? -6.573  5.757   -3.812  1.00 15.00 ?  116 ALA A C    1  
ATOM   1144   O  O    . ALA A 1 74  ? -6.423  6.124   -4.979  1.00 15.00 ?  116 ALA A O    1  
ATOM   1145   C  CB   . ALA A 1 74  ? -8.589  4.268   -3.893  1.00 15.00 ?  116 ALA A CB   1  
ATOM   1146   H  H    . ALA A 1 74  ? -8.814  7.078   -4.363  1.00 15.00 ?  116 ALA A H    1  
ATOM   1147   H  HA   . ALA A 1 74  ? -7.896  5.327   -2.185  1.00 15.00 ?  116 ALA A HA   1  
ATOM   1148   H  HB1  . ALA A 1 74  ? -7.870  3.462   -3.908  1.00 15.00 ?  116 ALA A HB1  1  
ATOM   1149   H  HB2  . ALA A 1 74  ? -8.887  4.506   -4.904  1.00 15.00 ?  116 ALA A HB2  1  
ATOM   1150   H  HB3  . ALA A 1 74  ? -9.457  3.969   -3.323  1.00 15.00 ?  116 ALA A HB3  1  
ATOM   1151   N  N    . VAL A 1 75  ? -5.561  5.589   -2.983  1.00 15.00 ?  117 VAL A N    1  
ATOM   1152   C  CA   . VAL A 1 75  ? -4.191  5.828   -3.404  1.00 15.00 ?  117 VAL A CA   1  
ATOM   1153   C  C    . VAL A 1 75  ? -3.376  4.538   -3.340  1.00 15.00 ?  117 VAL A C    1  
ATOM   1154   O  O    . VAL A 1 75  ? -3.464  3.791   -2.368  1.00 15.00 ?  117 VAL A O    1  
ATOM   1155   C  CB   . VAL A 1 75  ? -3.529  6.930   -2.541  1.00 15.00 ?  117 VAL A CB   1  
ATOM   1156   C  CG1  . VAL A 1 75  ? -3.593  6.594   -1.059  1.00 15.00 ?  117 VAL A CG1  1  
ATOM   1157   C  CG2  . VAL A 1 75  ? -2.092  7.164   -2.968  1.00 15.00 ?  117 VAL A CG2  1  
ATOM   1158   H  H    . VAL A 1 75  ? -5.735  5.284   -2.066  1.00 15.00 ?  117 VAL A H    1  
ATOM   1159   H  HA   . VAL A 1 75  ? -4.214  6.172   -4.430  1.00 15.00 ?  117 VAL A HA   1  
ATOM   1160   H  HB   . VAL A 1 75  ? -4.076  7.852   -2.696  1.00 15.00 ?  117 VAL A HB   1  
ATOM   1161   H  HG11 . VAL A 1 75  ? -4.609  6.350   -0.785  1.00 15.00 ?  117 VAL A HG11 1  
ATOM   1162   H  HG12 . VAL A 1 75  ? -3.259  7.445   -0.483  1.00 15.00 ?  117 VAL A HG12 1  
ATOM   1163   H  HG13 . VAL A 1 75  ? -2.953  5.750   -0.854  1.00 15.00 ?  117 VAL A HG13 1  
ATOM   1164   H  HG21 . VAL A 1 75  ? -2.077  7.751   -3.874  1.00 15.00 ?  117 VAL A HG21 1  
ATOM   1165   H  HG22 . VAL A 1 75  ? -1.614  6.213   -3.149  1.00 15.00 ?  117 VAL A HG22 1  
ATOM   1166   H  HG23 . VAL A 1 75  ? -1.564  7.688   -2.183  1.00 15.00 ?  117 VAL A HG23 1  
ATOM   1167   N  N    . VAL A 1 76  ? -2.611  4.270   -4.393  1.00 15.00 ?  118 VAL A N    1  
ATOM   1168   C  CA   . VAL A 1 76  ? -1.788  3.069   -4.454  1.00 15.00 ?  118 VAL A CA   1  
ATOM   1169   C  C    . VAL A 1 76  ? -0.334  3.393   -4.126  1.00 15.00 ?  118 VAL A C    1  
ATOM   1170   O  O    . VAL A 1 76  ? 0.070   4.556   -4.166  1.00 15.00 ?  118 VAL A O    1  
ATOM   1171   C  CB   . VAL A 1 76  ? -1.863  2.401   -5.842  1.00 15.00 ?  118 VAL A CB   1  
ATOM   1172   C  CG1  . VAL A 1 76  ? -3.271  1.892   -6.116  1.00 15.00 ?  118 VAL A CG1  1  
ATOM   1173   C  CG2  . VAL A 1 76  ? -1.425  3.369   -6.933  1.00 15.00 ?  118 VAL A CG2  1  
ATOM   1174   H  H    . VAL A 1 76  ? -2.594  4.900   -5.143  1.00 15.00 ?  118 VAL A H    1  
ATOM   1175   H  HA   . VAL A 1 76  ? -2.165  2.370   -3.722  1.00 15.00 ?  118 VAL A HA   1  
ATOM   1176   H  HB   . VAL A 1 76  ? -1.192  1.555   -5.848  1.00 15.00 ?  118 VAL A HB   1  
ATOM   1177   H  HG11 . VAL A 1 76  ? -3.302  1.427   -7.089  1.00 15.00 ?  118 VAL A HG11 1  
ATOM   1178   H  HG12 . VAL A 1 76  ? -3.964  2.718   -6.090  1.00 15.00 ?  118 VAL A HG12 1  
ATOM   1179   H  HG13 . VAL A 1 76  ? -3.548  1.168   -5.364  1.00 15.00 ?  118 VAL A HG13 1  
ATOM   1180   H  HG21 . VAL A 1 76  ? -2.187  4.120   -7.074  1.00 15.00 ?  118 VAL A HG21 1  
ATOM   1181   H  HG22 . VAL A 1 76  ? -1.277  2.829   -7.856  1.00 15.00 ?  118 VAL A HG22 1  
ATOM   1182   H  HG23 . VAL A 1 76  ? -0.502  3.846   -6.641  1.00 15.00 ?  118 VAL A HG23 1  
ATOM   1183   N  N    . THR A 1 77  ? 0.444   2.369   -3.806  1.00 15.00 ?  119 THR A N    1  
ATOM   1184   C  CA   . THR A 1 77  ? 1.846   2.560   -3.465  1.00 15.00 ?  119 THR A CA   1  
ATOM   1185   C  C    . THR A 1 77  ? 2.747   2.527   -4.698  1.00 15.00 ?  119 THR A C    1  
ATOM   1186   O  O    . THR A 1 77  ? 3.755   3.229   -4.746  1.00 15.00 ?  119 THR A O    1  
ATOM   1187   C  CB   . THR A 1 77  ? 2.329   1.502   -2.461  1.00 15.00 ?  119 THR A CB   1  
ATOM   1188   O  OG1  . THR A 1 77  ? 1.829   0.212   -2.830  1.00 15.00 ?  119 THR A OG1  1  
ATOM   1189   C  CG2  . THR A 1 77  ? 1.870   1.846   -1.054  1.00 15.00 ?  119 THR A CG2  1  
ATOM   1190   H  H    . THR A 1 77  ? 0.058   1.460   -3.779  1.00 15.00 ?  119 THR A H    1  
ATOM   1191   H  HA   . THR A 1 77  ? 1.936   3.530   -2.994  1.00 15.00 ?  119 THR A HA   1  
ATOM   1192   H  HB   . THR A 1 77  ? 3.407   1.479   -2.476  1.00 15.00 ?  119 THR A HB   1  
ATOM   1193   H  HG1  . THR A 1 77  ? 0.947   0.085   -2.434  1.00 15.00 ?  119 THR A HG1  1  
ATOM   1194   H  HG21 . THR A 1 77  ? 2.218   2.834   -0.794  1.00 15.00 ?  119 THR A HG21 1  
ATOM   1195   H  HG22 . THR A 1 77  ? 2.273   1.127   -0.358  1.00 15.00 ?  119 THR A HG22 1  
ATOM   1196   H  HG23 . THR A 1 77  ? 0.791   1.821   -1.015  1.00 15.00 ?  119 THR A HG23 1  
ATOM   1197   N  N    . HIS A 1 78  ? 2.399   1.695   -5.679  1.00 15.00 ?  120 HIS A N    1  
ATOM   1198   C  CA   . HIS A 1 78  ? 3.187   1.590   -6.911  1.00 15.00 ?  120 HIS A CA   1  
ATOM   1199   C  C    . HIS A 1 78  ? 2.437   0.822   -7.992  1.00 15.00 ?  120 HIS A C    1  
ATOM   1200   O  O    . HIS A 1 78  ? 1.478   0.096   -7.706  1.00 15.00 ?  120 HIS A O    1  
ATOM   1201   C  CB   . HIS A 1 78  ? 4.569   0.960   -6.653  1.00 15.00 ?  120 HIS A CB   1  
ATOM   1202   C  CG   . HIS A 1 78  ? 4.560   -0.437  -6.113  1.00 15.00 ?  120 HIS A CG   1  
ATOM   1203   N  ND1  . HIS A 1 78  ? 4.013   -0.798  -4.906  1.00 15.00 ?  120 HIS A ND1  1  
ATOM   1204   C  CD2  . HIS A 1 78  ? 5.097   -1.567  -6.631  1.00 15.00 ?  120 HIS A CD2  1  
ATOM   1205   C  CE1  . HIS A 1 78  ? 4.233   -2.106  -4.728  1.00 15.00 ?  120 HIS A CE1  1  
ATOM   1206   N  NE2  . HIS A 1 78  ? 4.887   -2.625  -5.748  1.00 15.00 ?  120 HIS A NE2  1  
ATOM   1207   H  H    . HIS A 1 78  ? 1.596   1.142   -5.578  1.00 15.00 ?  120 HIS A H    1  
ATOM   1208   H  HA   . HIS A 1 78  ? 3.336   2.596   -7.270  1.00 15.00 ?  120 HIS A HA   1  
ATOM   1209   H  HB2  . HIS A 1 78  ? 5.120   0.940   -7.581  1.00 15.00 ?  120 HIS A HB2  1  
ATOM   1210   H  HB3  . HIS A 1 78  ? 5.100   1.579   -5.951  1.00 15.00 ?  120 HIS A HB3  1  
ATOM   1211   H  HD1  . HIS A 1 78  ? 3.531   -0.203  -4.288  1.00 15.00 ?  120 HIS A HD1  1  
ATOM   1212   H  HD2  . HIS A 1 78  ? 5.613   -1.646  -7.578  1.00 15.00 ?  120 HIS A HD2  1  
ATOM   1213   H  HE1  . HIS A 1 78  ? 3.919   -2.666  -3.860  1.00 15.00 ?  120 HIS A HE1  1  
ATOM   1214   N  N    . ALA A 1 79  ? 2.888   0.985   -9.231  1.00 15.00 ?  121 ALA A N    1  
ATOM   1215   C  CA   . ALA A 1 79  ? 2.255   0.342   -10.374 1.00 15.00 ?  121 ALA A CA   1  
ATOM   1216   C  C    . ALA A 1 79  ? 2.675   -1.115  -10.526 1.00 15.00 ?  121 ALA A C    1  
ATOM   1217   O  O    . ALA A 1 79  ? 3.463   -1.454  -11.404 1.00 15.00 ?  121 ALA A O    1  
ATOM   1218   C  CB   . ALA A 1 79  ? 2.564   1.111   -11.649 1.00 15.00 ?  121 ALA A CB   1  
ATOM   1219   H  H    . ALA A 1 79  ? 3.680   1.559   -9.379  1.00 15.00 ?  121 ALA A H    1  
ATOM   1220   H  HA   . ALA A 1 79  ? 1.188   0.376   -10.220 1.00 15.00 ?  121 ALA A HA   1  
ATOM   1221   H  HB1  . ALA A 1 79  ? 2.308   2.150   -11.512 1.00 15.00 ?  121 ALA A HB1  1  
ATOM   1222   H  HB2  . ALA A 1 79  ? 1.987   0.702   -12.465 1.00 15.00 ?  121 ALA A HB2  1  
ATOM   1223   H  HB3  . ALA A 1 79  ? 3.617   1.028   -11.874 1.00 15.00 ?  121 ALA A HB3  1  
ATOM   1224   N  N    . HIS A 1 80  ? 2.144   -1.973  -9.673  1.00 15.00 ?  122 HIS A N    1  
ATOM   1225   C  CA   . HIS A 1 80  ? 2.460   -3.392  -9.737  1.00 15.00 ?  122 HIS A CA   1  
ATOM   1226   C  C    . HIS A 1 80  ? 1.195   -4.228  -9.634  1.00 15.00 ?  122 HIS A C    1  
ATOM   1227   O  O    . HIS A 1 80  ? 0.187   -3.783  -9.091  1.00 15.00 ?  122 HIS A O    1  
ATOM   1228   C  CB   . HIS A 1 80  ? 3.451   -3.780  -8.639  1.00 15.00 ?  122 HIS A CB   1  
ATOM   1229   C  CG   . HIS A 1 80  ? 4.863   -3.910  -9.127  1.00 15.00 ?  122 HIS A CG   1  
ATOM   1230   N  ND1  . HIS A 1 80  ? 5.866   -4.386  -8.314  1.00 15.00 ?  122 HIS A ND1  1  
ATOM   1231   C  CD2  . HIS A 1 80  ? 5.383   -3.623  -10.345 1.00 15.00 ?  122 HIS A CD2  1  
ATOM   1232   C  CE1  . HIS A 1 80  ? 6.964   -4.382  -9.055  1.00 15.00 ?  122 HIS A CE1  1  
ATOM   1233   N  NE2  . HIS A 1 80  ? 6.716   -3.933  -10.288 1.00 15.00 ?  122 HIS A NE2  1  
ATOM   1234   H  H    . HIS A 1 80  ? 1.529   -1.644  -8.981  1.00 15.00 ?  122 HIS A H    1  
ATOM   1235   H  HA   . HIS A 1 80  ? 2.916   -3.580  -10.696 1.00 15.00 ?  122 HIS A HA   1  
ATOM   1236   H  HB2  . HIS A 1 80  ? 3.437   -3.027  -7.865  1.00 15.00 ?  122 HIS A HB2  1  
ATOM   1237   H  HB3  . HIS A 1 80  ? 3.157   -4.729  -8.215  1.00 15.00 ?  122 HIS A HB3  1  
ATOM   1238   H  HD2  . HIS A 1 80  ? 4.857   -3.213  -11.195 1.00 15.00 ?  122 HIS A HD2  1  
ATOM   1239   H  HE1  . HIS A 1 80  ? 7.939   -4.685  -8.703  1.00 15.00 ?  122 HIS A HE1  1  
ATOM   1240   H  HE2  . HIS A 1 80  ? 7.364   -3.854  -11.024 1.00 15.00 ?  122 HIS A HE2  1  
ATOM   1241   N  N    . GLN A 1 81  ? 1.265   -5.444  -10.156 1.00 15.00 ?  123 GLN A N    1  
ATOM   1242   C  CA   . GLN A 1 81  ? 0.130   -6.370  -10.165 1.00 15.00 ?  123 GLN A CA   1  
ATOM   1243   C  C    . GLN A 1 81  ? -0.402  -6.673  -8.758  1.00 15.00 ?  123 GLN A C    1  
ATOM   1244   O  O    . GLN A 1 81  ? -1.588  -6.940  -8.583  1.00 15.00 ?  123 GLN A O    1  
ATOM   1245   C  CB   . GLN A 1 81  ? 0.544   -7.676  -10.852 1.00 15.00 ?  123 GLN A CB   1  
ATOM   1246   C  CG   . GLN A 1 81  ? -0.573  -8.708  -10.947 1.00 15.00 ?  123 GLN A CG   1  
ATOM   1247   C  CD   . GLN A 1 81  ? -0.170  -9.932  -11.750 1.00 15.00 ?  123 GLN A CD   1  
ATOM   1248   O  OE1  . GLN A 1 81  ? 1.000   -10.313 -11.777 1.00 15.00 ?  123 GLN A OE1  1  
ATOM   1249   N  NE2  . GLN A 1 81  ? -1.134  -10.553 -12.414 1.00 15.00 ?  123 GLN A NE2  1  
ATOM   1250   H  H    . GLN A 1 81  ? 2.112   -5.728  -10.568 1.00 15.00 ?  123 GLN A H    1  
ATOM   1251   H  HA   . GLN A 1 81  ? -0.661  -5.913  -10.740 1.00 15.00 ?  123 GLN A HA   1  
ATOM   1252   H  HB2  . GLN A 1 81  ? 0.882   -7.450  -11.853 1.00 15.00 ?  123 GLN A HB2  1  
ATOM   1253   H  HB3  . GLN A 1 81  ? 1.360   -8.111  -10.297 1.00 15.00 ?  123 GLN A HB3  1  
ATOM   1254   H  HG2  . GLN A 1 81  ? -0.837  -9.024  -9.948  1.00 15.00 ?  123 GLN A HG2  1  
ATOM   1255   H  HG3  . GLN A 1 81  ? -1.431  -8.250  -11.416 1.00 15.00 ?  123 GLN A HG3  1  
ATOM   1256   H  HE21 . GLN A 1 81  ? -2.047  -10.196 -12.355 1.00 15.00 ?  123 GLN A HE21 1  
ATOM   1257   H  HE22 . GLN A 1 81  ? -0.897  -11.348 -12.942 1.00 15.00 ?  123 GLN A HE22 1  
ATOM   1258   N  N    . ASP A 1 82  ? 0.464   -6.607  -7.760  1.00 15.00 ?  124 ASP A N    1  
ATOM   1259   C  CA   . ASP A 1 82  ? 0.068   -6.911  -6.388  1.00 15.00 ?  124 ASP A CA   1  
ATOM   1260   C  C    . ASP A 1 82  ? -0.541  -5.708  -5.676  1.00 15.00 ?  124 ASP A C    1  
ATOM   1261   O  O    . ASP A 1 82  ? -0.982  -5.828  -4.532  1.00 15.00 ?  124 ASP A O    1  
ATOM   1262   C  CB   . ASP A 1 82  ? 1.270   -7.430  -5.578  1.00 15.00 ?  124 ASP A CB   1  
ATOM   1263   C  CG   . ASP A 1 82  ? 2.390   -6.413  -5.421  1.00 15.00 ?  124 ASP A CG   1  
ATOM   1264   O  OD1  . ASP A 1 82  ? 2.603   -5.605  -6.346  1.00 15.00 ?  124 ASP A OD1  1  
ATOM   1265   O  OD2  . ASP A 1 82  ? 3.090   -6.443  -4.380  1.00 15.00 -1 124 ASP A OD2  1  
ATOM   1266   H  H    . ASP A 1 82  ? 1.389   -6.331  -7.941  1.00 15.00 ?  124 ASP A H    1  
ATOM   1267   H  HA   . ASP A 1 82  ? -0.675  -7.691  -6.437  1.00 15.00 ?  124 ASP A HA   1  
ATOM   1268   H  HB2  . ASP A 1 82  ? 0.931   -7.707  -4.592  1.00 15.00 ?  124 ASP A HB2  1  
ATOM   1269   H  HB3  . ASP A 1 82  ? 1.671   -8.304  -6.069  1.00 15.00 ?  124 ASP A HB3  1  
ATOM   1270   N  N    . LYS A 1 83  ? -0.579  -4.555  -6.339  1.00 15.00 ?  125 LYS A N    1  
ATOM   1271   C  CA   . LYS A 1 83  ? -1.121  -3.349  -5.710  1.00 15.00 ?  125 LYS A CA   1  
ATOM   1272   C  C    . LYS A 1 83  ? -2.114  -2.606  -6.600  1.00 15.00 ?  125 LYS A C    1  
ATOM   1273   O  O    . LYS A 1 83  ? -3.031  -1.955  -6.096  1.00 15.00 ?  125 LYS A O    1  
ATOM   1274   C  CB   . LYS A 1 83  ? 0.018   -2.409  -5.312  1.00 15.00 ?  125 LYS A CB   1  
ATOM   1275   C  CG   . LYS A 1 83  ? 1.101   -3.087  -4.485  1.00 15.00 ?  125 LYS A CG   1  
ATOM   1276   C  CD   . LYS A 1 83  ? 0.937   -2.822  -2.999  1.00 15.00 ?  125 LYS A CD   1  
ATOM   1277   C  CE   . LYS A 1 83  ? -0.213  -3.617  -2.401  1.00 15.00 ?  125 LYS A CE   1  
ATOM   1278   N  NZ   . LYS A 1 83  ? -0.550  -3.146  -1.036  1.00 15.00 1  125 LYS A NZ   1  
ATOM   1279   H  H    . LYS A 1 83  ? -0.235  -4.513  -7.254  1.00 15.00 ?  125 LYS A H    1  
ATOM   1280   H  HA   . LYS A 1 83  ? -1.640  -3.657  -4.817  1.00 15.00 ?  125 LYS A HA   1  
ATOM   1281   H  HB2  . LYS A 1 83  ? 0.473   -2.009  -6.208  1.00 15.00 ?  125 LYS A HB2  1  
ATOM   1282   H  HB3  . LYS A 1 83  ? -0.390  -1.594  -4.732  1.00 15.00 ?  125 LYS A HB3  1  
ATOM   1283   H  HG2  . LYS A 1 83  ? 1.049   -4.149  -4.656  1.00 15.00 ?  125 LYS A HG2  1  
ATOM   1284   H  HG3  . LYS A 1 83  ? 2.066   -2.719  -4.803  1.00 15.00 ?  125 LYS A HG3  1  
ATOM   1285   H  HD2  . LYS A 1 83  ? 1.849   -3.099  -2.494  1.00 15.00 ?  125 LYS A HD2  1  
ATOM   1286   H  HD3  . LYS A 1 83  ? 0.749   -1.766  -2.850  1.00 15.00 ?  125 LYS A HD3  1  
ATOM   1287   H  HE2  . LYS A 1 83  ? -1.078  -3.503  -3.035  1.00 15.00 ?  125 LYS A HE2  1  
ATOM   1288   H  HE3  . LYS A 1 83  ? 0.068   -4.657  -2.355  1.00 15.00 ?  125 LYS A HE3  1  
ATOM   1289   H  HZ1  . LYS A 1 83  ? 0.229   -3.365  -0.379  1.00 15.00 ?  125 LYS A HZ1  1  
ATOM   1290   H  HZ2  . LYS A 1 83  ? -1.416  -3.611  -0.693  1.00 15.00 ?  125 LYS A HZ2  1  
ATOM   1291   H  HZ3  . LYS A 1 83  ? -0.698  -2.108  -1.048  1.00 15.00 ?  125 LYS A HZ3  1  
ATOM   1292   N  N    . MET A 1 84  ? -1.937  -2.691  -7.907  1.00 15.00 ?  126 MET A N    1  
ATOM   1293   C  CA   . MET A 1 84  ? -2.825  -2.009  -8.841  1.00 15.00 ?  126 MET A CA   1  
ATOM   1294   C  C    . MET A 1 84  ? -3.576  -3.016  -9.708  1.00 15.00 ?  126 MET A C    1  
ATOM   1295   O  O    . MET A 1 84  ? -3.557  -2.932  -10.935 1.00 15.00 ?  126 MET A O    1  
ATOM   1296   C  CB   . MET A 1 84  ? -2.024  -1.040  -9.718  1.00 15.00 ?  126 MET A CB   1  
ATOM   1297   C  CG   . MET A 1 84  ? -1.903  0.355   -9.123  1.00 15.00 ?  126 MET A CG   1  
ATOM   1298   S  SD   . MET A 1 84  ? -0.765  1.420   -10.028 1.00 15.00 ?  126 MET A SD   1  
ATOM   1299   C  CE   . MET A 1 84  ? -1.609  1.565   -11.597 1.00 15.00 ?  126 MET A CE   1  
ATOM   1300   H  H    . MET A 1 84  ? -1.193  -3.229  -8.260  1.00 15.00 ?  126 MET A H    1  
ATOM   1301   H  HA   . MET A 1 84  ? -3.541  -1.445  -8.265  1.00 15.00 ?  126 MET A HA   1  
ATOM   1302   H  HB2  . MET A 1 84  ? -1.031  -1.439  -9.858  1.00 15.00 ?  126 MET A HB2  1  
ATOM   1303   H  HB3  . MET A 1 84  ? -2.509  -0.959  -10.677 1.00 15.00 ?  126 MET A HB3  1  
ATOM   1304   H  HG2  . MET A 1 84  ? -2.880  0.816   -9.129  1.00 15.00 ?  126 MET A HG2  1  
ATOM   1305   H  HG3  . MET A 1 84  ? -1.558  0.266   -8.103  1.00 15.00 ?  126 MET A HG3  1  
ATOM   1306   H  HE1  . MET A 1 84  ? -0.960  2.054   -12.308 1.00 15.00 ?  126 MET A HE1  1  
ATOM   1307   H  HE2  . MET A 1 84  ? -2.509  2.150   -11.470 1.00 15.00 ?  126 MET A HE2  1  
ATOM   1308   H  HE3  . MET A 1 84  ? -1.865  0.582   -11.959 1.00 15.00 ?  126 MET A HE3  1  
ATOM   1309   N  N    . GLY A 1 85  ? -4.242  -3.965  -9.062  1.00 15.00 ?  127 GLY A N    1  
ATOM   1310   C  CA   . GLY A 1 85  ? -4.980  -4.975  -9.789  1.00 15.00 ?  127 GLY A CA   1  
ATOM   1311   C  C    . GLY A 1 85  ? -6.456  -4.649  -9.896  1.00 15.00 ?  127 GLY A C    1  
ATOM   1312   O  O    . GLY A 1 85  ? -7.160  -5.212  -10.734 1.00 15.00 ?  127 GLY A O    1  
ATOM   1313   H  H    . GLY A 1 85  ? -4.243  -3.974  -8.080  1.00 15.00 ?  127 GLY A H    1  
ATOM   1314   H  HA2  . GLY A 1 85  ? -4.570  -5.061  -10.785 1.00 15.00 ?  127 GLY A HA2  1  
ATOM   1315   H  HA3  . GLY A 1 85  ? -4.867  -5.921  -9.281  1.00 15.00 ?  127 GLY A HA3  1  
ATOM   1316   N  N    . GLY A 1 86  ? -6.928  -3.743  -9.049  1.00 15.00 ?  128 GLY A N    1  
ATOM   1317   C  CA   . GLY A 1 86  ? -8.329  -3.370  -9.078  1.00 15.00 ?  128 GLY A CA   1  
ATOM   1318   C  C    . GLY A 1 86  ? -8.528  -1.896  -9.344  1.00 15.00 ?  128 GLY A C    1  
ATOM   1319   O  O    . GLY A 1 86  ? -9.289  -1.227  -8.645  1.00 15.00 ?  128 GLY A O    1  
ATOM   1320   H  H    . GLY A 1 86  ? -6.322  -3.328  -8.395  1.00 15.00 ?  128 GLY A H    1  
ATOM   1321   H  HA2  . GLY A 1 86  ? -8.822  -3.935  -9.855  1.00 15.00 ?  128 GLY A HA2  1  
ATOM   1322   H  HA3  . GLY A 1 86  ? -8.777  -3.617  -8.127  1.00 15.00 ?  128 GLY A HA3  1  
ATOM   1323   N  N    . MET A 1 87  ? -7.863  -1.397  -10.371 1.00 15.00 ?  129 MET A N    1  
ATOM   1324   C  CA   . MET A 1 87  ? -7.953  0.009   -10.730 1.00 15.00 ?  129 MET A CA   1  
ATOM   1325   C  C    . MET A 1 87  ? -9.261  0.295   -11.449 1.00 15.00 ?  129 MET A C    1  
ATOM   1326   O  O    . MET A 1 87  ? -9.948  1.274   -11.149 1.00 15.00 ?  129 MET A O    1  
ATOM   1327   C  CB   . MET A 1 87  ? -6.780  0.405   -11.625 1.00 15.00 ?  129 MET A CB   1  
ATOM   1328   C  CG   . MET A 1 87  ? -5.428  0.278   -10.946 1.00 15.00 ?  129 MET A CG   1  
ATOM   1329   S  SD   . MET A 1 87  ? -5.263  1.355   -9.507  1.00 15.00 ?  129 MET A SD   1  
ATOM   1330   C  CE   . MET A 1 87  ? -5.211  2.965   -10.292 1.00 15.00 ?  129 MET A CE   1  
ATOM   1331   H  H    . MET A 1 87  ? -7.313  -1.997  -10.918 1.00 15.00 ?  129 MET A H    1  
ATOM   1332   H  HA   . MET A 1 87  ? -7.916  0.589   -9.820  1.00 15.00 ?  129 MET A HA   1  
ATOM   1333   H  HB2  . MET A 1 87  ? -6.783  -0.230  -12.500 1.00 15.00 ?  129 MET A HB2  1  
ATOM   1334   H  HB3  . MET A 1 87  ? -6.907  1.430   -11.935 1.00 15.00 ?  129 MET A HB3  1  
ATOM   1335   H  HG2  . MET A 1 87  ? -5.296  -0.745  -10.628 1.00 15.00 ?  129 MET A HG2  1  
ATOM   1336   H  HG3  . MET A 1 87  ? -4.658  0.533   -11.659 1.00 15.00 ?  129 MET A HG3  1  
ATOM   1337   H  HE1  . MET A 1 87  ? -4.394  2.996   -10.995 1.00 15.00 ?  129 MET A HE1  1  
ATOM   1338   H  HE2  . MET A 1 87  ? -5.070  3.727   -9.542  1.00 15.00 ?  129 MET A HE2  1  
ATOM   1339   H  HE3  . MET A 1 87  ? -6.140  3.143   -10.813 1.00 15.00 ?  129 MET A HE3  1  
ATOM   1340   N  N    . ASP A 1 88  ? -9.613  -0.584  -12.377 1.00 15.00 ?  130 ASP A N    1  
ATOM   1341   C  CA   . ASP A 1 88  ? -10.835 -0.431  -13.156 1.00 15.00 ?  130 ASP A CA   1  
ATOM   1342   C  C    . ASP A 1 88  ? -12.059 -0.538  -12.258 1.00 15.00 ?  130 ASP A C    1  
ATOM   1343   O  O    . ASP A 1 88  ? -13.074 0.116   -12.501 1.00 15.00 ?  130 ASP A O    1  
ATOM   1344   C  CB   . ASP A 1 88  ? -10.905 -1.484  -14.266 1.00 15.00 ?  130 ASP A CB   1  
ATOM   1345   C  CG   . ASP A 1 88  ? -11.274 -0.888  -15.610 1.00 15.00 ?  130 ASP A CG   1  
ATOM   1346   O  OD1  . ASP A 1 88  ? -11.549 0.329   -15.676 1.00 15.00 ?  130 ASP A OD1  1  
ATOM   1347   O  OD2  . ASP A 1 88  ? -11.288 -1.637  -16.610 1.00 15.00 -1 130 ASP A OD2  1  
ATOM   1348   H  H    . ASP A 1 88  ? -9.043  -1.367  -12.531 1.00 15.00 ?  130 ASP A H    1  
ATOM   1349   H  HA   . ASP A 1 88  ? -10.817 0.551   -13.606 1.00 15.00 ?  130 ASP A HA   1  
ATOM   1350   H  HB2  . ASP A 1 88  ? -9.945  -1.966  -14.358 1.00 15.00 ?  130 ASP A HB2  1  
ATOM   1351   H  HB3  . ASP A 1 88  ? -11.650 -2.222  -14.006 1.00 15.00 ?  130 ASP A HB3  1  
ATOM   1352   N  N    . ALA A 1 89  ? -11.956 -1.364  -11.219 1.00 15.00 ?  131 ALA A N    1  
ATOM   1353   C  CA   . ALA A 1 89  ? -13.043 -1.542  -10.262 1.00 15.00 ?  131 ALA A CA   1  
ATOM   1354   C  C    . ALA A 1 89  ? -13.369 -0.227  -9.565  1.00 15.00 ?  131 ALA A C    1  
ATOM   1355   O  O    . ALA A 1 89  ? -14.537 0.124   -9.399  1.00 15.00 ?  131 ALA A O    1  
ATOM   1356   C  CB   . ALA A 1 89  ? -12.678 -2.601  -9.235  1.00 15.00 ?  131 ALA A CB   1  
ATOM   1357   H  H    . ALA A 1 89  ? -11.126 -1.887  -11.108 1.00 15.00 ?  131 ALA A H    1  
ATOM   1358   H  HA   . ALA A 1 89  ? -13.913 -1.879  -10.804 1.00 15.00 ?  131 ALA A HA   1  
ATOM   1359   H  HB1  . ALA A 1 89  ? -12.672 -3.572  -9.708  1.00 15.00 ?  131 ALA A HB1  1  
ATOM   1360   H  HB2  . ALA A 1 89  ? -13.405 -2.594  -8.437  1.00 15.00 ?  131 ALA A HB2  1  
ATOM   1361   H  HB3  . ALA A 1 89  ? -11.699 -2.391  -8.831  1.00 15.00 ?  131 ALA A HB3  1  
ATOM   1362   N  N    . LEU A 1 90  ? -12.333 0.500   -9.168  1.00 15.00 ?  132 LEU A N    1  
ATOM   1363   C  CA   . LEU A 1 90  ? -12.512 1.782   -8.493  1.00 15.00 ?  132 LEU A CA   1  
ATOM   1364   C  C    . LEU A 1 90  ? -13.098 2.806   -9.459  1.00 15.00 ?  132 LEU A C    1  
ATOM   1365   O  O    . LEU A 1 90  ? -13.949 3.618   -9.090  1.00 15.00 ?  132 LEU A O    1  
ATOM   1366   C  CB   . LEU A 1 90  ? -11.177 2.294   -7.947  1.00 15.00 ?  132 LEU A CB   1  
ATOM   1367   C  CG   . LEU A 1 90  ? -10.438 1.337   -7.012  1.00 15.00 ?  132 LEU A CG   1  
ATOM   1368   C  CD1  . LEU A 1 90  ? -9.063  1.887   -6.684  1.00 15.00 ?  132 LEU A CD1  1  
ATOM   1369   C  CD2  . LEU A 1 90  ? -11.235 1.112   -5.738  1.00 15.00 ?  132 LEU A CD2  1  
ATOM   1370   H  H    . LEU A 1 90  ? -11.424 0.168   -9.335  1.00 15.00 ?  132 LEU A H    1  
ATOM   1371   H  HA   . LEU A 1 90  ? -13.201 1.638   -7.672  1.00 15.00 ?  132 LEU A HA   1  
ATOM   1372   H  HB2  . LEU A 1 90  ? -10.532 2.519   -8.784  1.00 15.00 ?  132 LEU A HB2  1  
ATOM   1373   H  HB3  . LEU A 1 90  ? -11.367 3.212   -7.407  1.00 15.00 ?  132 LEU A HB3  1  
ATOM   1374   H  HG   . LEU A 1 90  ? -10.311 0.383   -7.506  1.00 15.00 ?  132 LEU A HG   1  
ATOM   1375   H  HD11 . LEU A 1 90  ? -8.401  1.719   -7.521  1.00 15.00 ?  132 LEU A HD11 1  
ATOM   1376   H  HD12 . LEU A 1 90  ? -8.672  1.387   -5.812  1.00 15.00 ?  132 LEU A HD12 1  
ATOM   1377   H  HD13 . LEU A 1 90  ? -9.133  2.947   -6.490  1.00 15.00 ?  132 LEU A HD13 1  
ATOM   1378   H  HD21 . LEU A 1 90  ? -11.330 2.047   -5.208  1.00 15.00 ?  132 LEU A HD21 1  
ATOM   1379   H  HD22 . LEU A 1 90  ? -10.724 0.394   -5.115  1.00 15.00 ?  132 LEU A HD22 1  
ATOM   1380   H  HD23 . LEU A 1 90  ? -12.216 0.739   -5.989  1.00 15.00 ?  132 LEU A HD23 1  
ATOM   1381   N  N    . HIS A 1 91  ? -12.642 2.749   -10.704 1.00 15.00 ?  133 HIS A N    1  
ATOM   1382   C  CA   . HIS A 1 91  ? -13.113 3.663   -11.744 1.00 15.00 ?  133 HIS A CA   1  
ATOM   1383   C  C    . HIS A 1 91  ? -14.592 3.430   -12.027 1.00 15.00 ?  133 HIS A C    1  
ATOM   1384   O  O    . HIS A 1 91  ? -15.339 4.368   -12.307 1.00 15.00 ?  133 HIS A O    1  
ATOM   1385   C  CB   . HIS A 1 91  ? -12.308 3.482   -13.036 1.00 15.00 ?  133 HIS A CB   1  
ATOM   1386   C  CG   . HIS A 1 91  ? -10.860 3.844   -12.906 1.00 15.00 ?  133 HIS A CG   1  
ATOM   1387   N  ND1  . HIS A 1 91  ? -9.863  3.320   -13.697 1.00 15.00 ?  133 HIS A ND1  1  
ATOM   1388   C  CD2  . HIS A 1 91  ? -10.245 4.694   -12.045 1.00 15.00 ?  133 HIS A CD2  1  
ATOM   1389   C  CE1  . HIS A 1 91  ? -8.702  3.850   -13.300 1.00 15.00 ?  133 HIS A CE1  1  
ATOM   1390   N  NE2  . HIS A 1 91  ? -8.879  4.690   -12.300 1.00 15.00 ?  133 HIS A NE2  1  
ATOM   1391   H  H    . HIS A 1 91  ? -11.959 2.078   -10.931 1.00 15.00 ?  133 HIS A H    1  
ATOM   1392   H  HA   . HIS A 1 91  ? -12.982 4.673   -11.385 1.00 15.00 ?  133 HIS A HA   1  
ATOM   1393   H  HB2  . HIS A 1 91  ? -12.366 2.448   -13.346 1.00 15.00 ?  133 HIS A HB2  1  
ATOM   1394   H  HB3  . HIS A 1 91  ? -12.737 4.106   -13.807 1.00 15.00 ?  133 HIS A HB3  1  
ATOM   1395   H  HD1  . HIS A 1 91  ? -9.981  2.679   -14.429 1.00 15.00 ?  133 HIS A HD1  1  
ATOM   1396   H  HD2  . HIS A 1 91  ? -10.730 5.286   -11.284 1.00 15.00 ?  133 HIS A HD2  1  
ATOM   1397   H  HE1  . HIS A 1 91  ? -7.745  3.614   -13.739 1.00 15.00 ?  133 HIS A HE1  1  
ATOM   1398   N  N    . ALA A 1 92  ? -15.005 2.174   -11.951 1.00 15.00 ?  134 ALA A N    1  
ATOM   1399   C  CA   . ALA A 1 92  ? -16.393 1.806   -12.185 1.00 15.00 ?  134 ALA A CA   1  
ATOM   1400   C  C    . ALA A 1 92  ? -17.269 2.211   -11.004 1.00 15.00 ?  134 ALA A C    1  
ATOM   1401   O  O    . ALA A 1 92  ? -18.452 2.510   -11.166 1.00 15.00 ?  134 ALA A O    1  
ATOM   1402   C  CB   . ALA A 1 92  ? -16.502 0.314   -12.432 1.00 15.00 ?  134 ALA A CB   1  
ATOM   1403   H  H    . ALA A 1 92  ? -14.352 1.468   -11.739 1.00 15.00 ?  134 ALA A H    1  
ATOM   1404   H  HA   . ALA A 1 92  ? -16.731 2.323   -13.071 1.00 15.00 ?  134 ALA A HA   1  
ATOM   1405   H  HB1  . ALA A 1 92  ? -15.925 0.047   -13.304 1.00 15.00 ?  134 ALA A HB1  1  
ATOM   1406   H  HB2  . ALA A 1 92  ? -17.536 0.049   -12.589 1.00 15.00 ?  134 ALA A HB2  1  
ATOM   1407   H  HB3  . ALA A 1 92  ? -16.121 -0.218  -11.575 1.00 15.00 ?  134 ALA A HB3  1  
ATOM   1408   N  N    . ALA A 1 93  ? -16.678 2.219   -9.813  1.00 15.00 ?  135 ALA A N    1  
ATOM   1409   C  CA   . ALA A 1 93  ? -17.396 2.582   -8.595  1.00 15.00 ?  135 ALA A CA   1  
ATOM   1410   C  C    . ALA A 1 93  ? -17.450 4.096   -8.414  1.00 15.00 ?  135 ALA A C    1  
ATOM   1411   O  O    . ALA A 1 93  ? -18.159 4.606   -7.548  1.00 15.00 ?  135 ALA A O    1  
ATOM   1412   C  CB   . ALA A 1 93  ? -16.745 1.921   -7.390  1.00 15.00 ?  135 ALA A CB   1  
ATOM   1413   H  H    . ALA A 1 93  ? -15.734 1.959   -9.752  1.00 15.00 ?  135 ALA A H    1  
ATOM   1414   H  HA   . ALA A 1 93  ? -18.405 2.207   -8.678  1.00 15.00 ?  135 ALA A HA   1  
ATOM   1415   H  HB1  . ALA A 1 93  ? -15.671 1.999   -7.473  1.00 15.00 ?  135 ALA A HB1  1  
ATOM   1416   H  HB2  . ALA A 1 93  ? -17.027 0.880   -7.354  1.00 15.00 ?  135 ALA A HB2  1  
ATOM   1417   H  HB3  . ALA A 1 93  ? -17.073 2.416   -6.487  1.00 15.00 ?  135 ALA A HB3  1  
ATOM   1418   N  N    . GLY A 1 94  ? -16.695 4.807   -9.231  1.00 15.00 ?  136 GLY A N    1  
ATOM   1419   C  CA   . GLY A 1 94  ? -16.675 6.254   -9.150  1.00 15.00 ?  136 GLY A CA   1  
ATOM   1420   C  C    . GLY A 1 94  ? -15.793 6.756   -8.023  1.00 15.00 ?  136 GLY A C    1  
ATOM   1421   O  O    . GLY A 1 94  ? -16.176 7.649   -7.264  1.00 15.00 ?  136 GLY A O    1  
ATOM   1422   H  H    . GLY A 1 94  ? -16.142 4.347   -9.898  1.00 15.00 ?  136 GLY A H    1  
ATOM   1423   H  HA2  . GLY A 1 94  ? -16.312 6.650   -10.086 1.00 15.00 ?  136 GLY A HA2  1  
ATOM   1424   H  HA3  . GLY A 1 94  ? -17.683 6.606   -8.987  1.00 15.00 ?  136 GLY A HA3  1  
ATOM   1425   N  N    . ILE A 1 95  ? -14.612 6.172   -7.904  1.00 15.00 ?  137 ILE A N    1  
ATOM   1426   C  CA   . ILE A 1 95  ? -13.670 6.565   -6.866  1.00 15.00 ?  137 ILE A CA   1  
ATOM   1427   C  C    . ILE A 1 95  ? -12.418 7.180   -7.476  1.00 15.00 ?  137 ILE A C    1  
ATOM   1428   O  O    . ILE A 1 95  ? -11.805 6.599   -8.371  1.00 15.00 ?  137 ILE A O    1  
ATOM   1429   C  CB   . ILE A 1 95  ? -13.265 5.368   -5.980  1.00 15.00 ?  137 ILE A CB   1  
ATOM   1430   C  CG1  . ILE A 1 95  ? -14.506 4.754   -5.332  1.00 15.00 ?  137 ILE A CG1  1  
ATOM   1431   C  CG2  . ILE A 1 95  ? -12.271 5.808   -4.912  1.00 15.00 ?  137 ILE A CG2  1  
ATOM   1432   C  CD1  . ILE A 1 95  ? -14.251 3.431   -4.643  1.00 15.00 ?  137 ILE A CD1  1  
ATOM   1433   H  H    . ILE A 1 95  ? -14.363 5.457   -8.530  1.00 15.00 ?  137 ILE A H    1  
ATOM   1434   H  HA   . ILE A 1 95  ? -14.154 7.301   -6.239  1.00 15.00 ?  137 ILE A HA   1  
ATOM   1435   H  HB   . ILE A 1 95  ? -12.788 4.630   -6.606  1.00 15.00 ?  137 ILE A HB   1  
ATOM   1436   H  HG12 . ILE A 1 95  ? -14.889 5.441   -4.593  1.00 15.00 ?  137 ILE A HG12 1  
ATOM   1437   H  HG13 . ILE A 1 95  ? -15.258 4.596   -6.091  1.00 15.00 ?  137 ILE A HG13 1  
ATOM   1438   H  HG21 . ILE A 1 95  ? -11.430 6.295   -5.383  1.00 15.00 ?  137 ILE A HG21 1  
ATOM   1439   H  HG22 . ILE A 1 95  ? -11.928 4.947   -4.361  1.00 15.00 ?  137 ILE A HG22 1  
ATOM   1440   H  HG23 . ILE A 1 95  ? -12.755 6.498   -4.236  1.00 15.00 ?  137 ILE A HG23 1  
ATOM   1441   H  HD11 . ILE A 1 95  ? -13.417 3.530   -3.962  1.00 15.00 ?  137 ILE A HD11 1  
ATOM   1442   H  HD12 . ILE A 1 95  ? -14.028 2.673   -5.381  1.00 15.00 ?  137 ILE A HD12 1  
ATOM   1443   H  HD13 . ILE A 1 95  ? -15.131 3.144   -4.086  1.00 15.00 ?  137 ILE A HD13 1  
ATOM   1444   N  N    . ALA A 1 96  ? -12.061 8.368   -6.997  1.00 15.00 ?  138 ALA A N    1  
ATOM   1445   C  CA   . ALA A 1 96  ? -10.883 9.072   -7.479  1.00 15.00 ?  138 ALA A CA   1  
ATOM   1446   C  C    . ALA A 1 96  ? -9.613  8.285   -7.168  1.00 15.00 ?  138 ALA A C    1  
ATOM   1447   O  O    . ALA A 1 96  ? -9.286  8.048   -6.002  1.00 15.00 ?  138 ALA A O    1  
ATOM   1448   C  CB   . ALA A 1 96  ? -10.813 10.459  -6.858  1.00 15.00 ?  138 ALA A CB   1  
ATOM   1449   H  H    . ALA A 1 96  ? -12.613 8.787   -6.300  1.00 15.00 ?  138 ALA A H    1  
ATOM   1450   H  HA   . ALA A 1 96  ? -10.976 9.187   -8.551  1.00 15.00 ?  138 ALA A HA   1  
ATOM   1451   H  HB1  . ALA A 1 96  ? -9.968  10.996  -7.266  1.00 15.00 ?  138 ALA A HB1  1  
ATOM   1452   H  HB2  . ALA A 1 96  ? -10.696 10.367  -5.788  1.00 15.00 ?  138 ALA A HB2  1  
ATOM   1453   H  HB3  . ALA A 1 96  ? -11.721 10.998  -7.078  1.00 15.00 ?  138 ALA A HB3  1  
ATOM   1454   N  N    . THR A 1 97  ? -8.910  7.875   -8.214  1.00 15.00 ?  139 THR A N    1  
ATOM   1455   C  CA   . THR A 1 97  ? -7.688  7.108   -8.062  1.00 15.00 ?  139 THR A CA   1  
ATOM   1456   C  C    . THR A 1 97  ? -6.455  8.007   -8.059  1.00 15.00 ?  139 THR A C    1  
ATOM   1457   O  O    . THR A 1 97  ? -6.245  8.805   -8.978  1.00 15.00 ?  139 THR A O    1  
ATOM   1458   C  CB   . THR A 1 97  ? -7.562  6.075   -9.194  1.00 15.00 ?  139 THR A CB   1  
ATOM   1459   O  OG1  . THR A 1 97  ? -8.051  6.634   -10.425 1.00 15.00 ?  139 THR A OG1  1  
ATOM   1460   C  CG2  . THR A 1 97  ? -8.339  4.815   -8.860  1.00 15.00 ?  139 THR A CG2  1  
ATOM   1461   H  H    . THR A 1 97  ? -9.229  8.085   -9.115  1.00 15.00 ?  139 THR A H    1  
ATOM   1462   H  HA   . THR A 1 97  ? -7.740  6.581   -7.123  1.00 15.00 ?  139 THR A HA   1  
ATOM   1463   H  HB   . THR A 1 97  ? -6.519  5.819   -9.309  1.00 15.00 ?  139 THR A HB   1  
ATOM   1464   H  HG1  . THR A 1 97  ? -8.453  5.930   -10.958 1.00 15.00 ?  139 THR A HG1  1  
ATOM   1465   H  HG21 . THR A 1 97  ? -8.165  4.073   -9.627  1.00 15.00 ?  139 THR A HG21 1  
ATOM   1466   H  HG22 . THR A 1 97  ? -9.394  5.044   -8.814  1.00 15.00 ?  139 THR A HG22 1  
ATOM   1467   H  HG23 . THR A 1 97  ? -8.012  4.432   -7.906  1.00 15.00 ?  139 THR A HG23 1  
ATOM   1468   N  N    . TYR A 1 98  ? -5.648  7.876   -7.017  1.00 15.00 ?  140 TYR A N    1  
ATOM   1469   C  CA   . TYR A 1 98  ? -4.428  8.657   -6.882  1.00 15.00 ?  140 TYR A CA   1  
ATOM   1470   C  C    . TYR A 1 98  ? -3.216  7.742   -6.952  1.00 15.00 ?  140 TYR A C    1  
ATOM   1471   O  O    . TYR A 1 98  ? -3.188  6.691   -6.311  1.00 15.00 ?  140 TYR A O    1  
ATOM   1472   C  CB   . TYR A 1 98  ? -4.420  9.424   -5.557  1.00 15.00 ?  140 TYR A CB   1  
ATOM   1473   C  CG   . TYR A 1 98  ? -5.229  10.701  -5.574  1.00 15.00 ?  140 TYR A CG   1  
ATOM   1474   C  CD1  . TYR A 1 98  ? -6.545  10.719  -5.136  1.00 15.00 ?  140 TYR A CD1  1  
ATOM   1475   C  CD2  . TYR A 1 98  ? -4.667  11.893  -6.011  1.00 15.00 ?  140 TYR A CD2  1  
ATOM   1476   C  CE1  . TYR A 1 98  ? -7.280  11.887  -5.131  1.00 15.00 ?  140 TYR A CE1  1  
ATOM   1477   C  CE2  . TYR A 1 98  ? -5.397  13.067  -6.014  1.00 15.00 ?  140 TYR A CE2  1  
ATOM   1478   C  CZ   . TYR A 1 98  ? -6.702  13.060  -5.569  1.00 15.00 ?  140 TYR A CZ   1  
ATOM   1479   O  OH   . TYR A 1 98  ? -7.426  14.230  -5.558  1.00 15.00 ?  140 TYR A OH   1  
ATOM   1480   H  H    . TYR A 1 98  ? -5.878  7.226   -6.314  1.00 15.00 ?  140 TYR A H    1  
ATOM   1481   H  HA   . TYR A 1 98  ? -4.387  9.359   -7.700  1.00 15.00 ?  140 TYR A HA   1  
ATOM   1482   H  HB2  . TYR A 1 98  ? -4.823  8.791   -4.781  1.00 15.00 ?  140 TYR A HB2  1  
ATOM   1483   H  HB3  . TYR A 1 98  ? -3.402  9.683   -5.308  1.00 15.00 ?  140 TYR A HB3  1  
ATOM   1484   H  HD1  . TYR A 1 98  ? -6.996  9.800   -4.795  1.00 15.00 ?  140 TYR A HD1  1  
ATOM   1485   H  HD2  . TYR A 1 98  ? -3.643  11.894  -6.359  1.00 15.00 ?  140 TYR A HD2  1  
ATOM   1486   H  HE1  . TYR A 1 98  ? -8.303  11.879  -4.786  1.00 15.00 ?  140 TYR A HE1  1  
ATOM   1487   H  HE2  . TYR A 1 98  ? -4.945  13.986  -6.357  1.00 15.00 ?  140 TYR A HE2  1  
ATOM   1488   H  HH   . TYR A 1 98  ? -7.848  14.338  -4.696  1.00 15.00 ?  140 TYR A HH   1  
ATOM   1489   N  N    . ALA A 1 99  ? -2.226  8.134   -7.737  1.00 15.00 ?  141 ALA A N    1  
ATOM   1490   C  CA   . ALA A 1 99  ? -1.009  7.353   -7.880  1.00 15.00 ?  141 ALA A CA   1  
ATOM   1491   C  C    . ALA A 1 99  ? 0.169   8.251   -8.209  1.00 15.00 ?  141 ALA A C    1  
ATOM   1492   O  O    . ALA A 1 99  ? -0.014  9.392   -8.638  1.00 15.00 ?  141 ALA A O    1  
ATOM   1493   C  CB   . ALA A 1 99  ? -1.177  6.300   -8.963  1.00 15.00 ?  141 ALA A CB   1  
ATOM   1494   H  H    . ALA A 1 99  ? -2.315  8.976   -8.239  1.00 15.00 ?  141 ALA A H    1  
ATOM   1495   H  HA   . ALA A 1 99  ? -0.822  6.850   -6.944  1.00 15.00 ?  141 ALA A HA   1  
ATOM   1496   H  HB1  . ALA A 1 99  ? -0.344  5.612   -8.933  1.00 15.00 ?  141 ALA A HB1  1  
ATOM   1497   H  HB2  . ALA A 1 99  ? -1.210  6.780   -9.929  1.00 15.00 ?  141 ALA A HB2  1  
ATOM   1498   H  HB3  . ALA A 1 99  ? -2.097  5.758   -8.799  1.00 15.00 ?  141 ALA A HB3  1  
ATOM   1499   N  N    . ASN A 1 100 ? 1.374   7.737   -8.009  1.00 15.00 ?  142 ASN A N    1  
ATOM   1500   C  CA   . ASN A 1 100 ? 2.590   8.487   -8.298  1.00 15.00 ?  142 ASN A CA   1  
ATOM   1501   C  C    . ASN A 1 100 ? 2.631   8.805   -9.791  1.00 15.00 ?  142 ASN A C    1  
ATOM   1502   O  O    . ASN A 1 100 ? 2.196   7.991   -10.607 1.00 15.00 ?  142 ASN A O    1  
ATOM   1503   C  CB   . ASN A 1 100 ? 3.820   7.656   -7.892  1.00 15.00 ?  142 ASN A CB   1  
ATOM   1504   C  CG   . ASN A 1 100 ? 5.147   8.403   -7.984  1.00 15.00 ?  142 ASN A CG   1  
ATOM   1505   O  OD1  . ASN A 1 100 ? 5.261   9.438   -8.636  1.00 15.00 ?  142 ASN A OD1  1  
ATOM   1506   N  ND2  . ASN A 1 100 ? 6.175   7.864   -7.346  1.00 15.00 ?  142 ASN A ND2  1  
ATOM   1507   H  H    . ASN A 1 100 ? 1.449   6.819   -7.674  1.00 15.00 ?  142 ASN A H    1  
ATOM   1508   H  HA   . ASN A 1 100 ? 2.569   9.408   -7.733  1.00 15.00 ?  142 ASN A HA   1  
ATOM   1509   H  HB2  . ASN A 1 100 ? 3.696   7.326   -6.873  1.00 15.00 ?  142 ASN A HB2  1  
ATOM   1510   H  HB3  . ASN A 1 100 ? 3.876   6.789   -8.535  1.00 15.00 ?  142 ASN A HB3  1  
ATOM   1511   H  HD21 . ASN A 1 100 ? 6.030   7.023   -6.855  1.00 15.00 ?  142 ASN A HD21 1  
ATOM   1512   H  HD22 . ASN A 1 100 ? 7.042   8.323   -7.398  1.00 15.00 ?  142 ASN A HD22 1  
ATOM   1513   N  N    . ALA A 1 101 ? 3.135   9.982   -10.146 1.00 15.00 ?  143 ALA A N    1  
ATOM   1514   C  CA   . ALA A 1 101 ? 3.228   10.383  -11.545 1.00 15.00 ?  143 ALA A CA   1  
ATOM   1515   C  C    . ALA A 1 101 ? 4.008   9.344   -12.346 1.00 15.00 ?  143 ALA A C    1  
ATOM   1516   O  O    . ALA A 1 101 ? 3.742   9.115   -13.530 1.00 15.00 ?  143 ALA A O    1  
ATOM   1517   C  CB   . ALA A 1 101 ? 3.889   11.743  -11.660 1.00 15.00 ?  143 ALA A CB   1  
ATOM   1518   H  H    . ALA A 1 101 ? 3.461   10.599  -9.449  1.00 15.00 ?  143 ALA A H    1  
ATOM   1519   H  HA   . ALA A 1 101 ? 2.227   10.456  -11.942 1.00 15.00 ?  143 ALA A HA   1  
ATOM   1520   H  HB1  . ALA A 1 101 ? 3.368   12.448  -11.031 1.00 15.00 ?  143 ALA A HB1  1  
ATOM   1521   H  HB2  . ALA A 1 101 ? 3.853   12.076  -12.687 1.00 15.00 ?  143 ALA A HB2  1  
ATOM   1522   H  HB3  . ALA A 1 101 ? 4.920   11.668  -11.342 1.00 15.00 ?  143 ALA A HB3  1  
ATOM   1523   N  N    . LEU A 1 102 ? 4.967   8.710   -11.683 1.00 15.00 ?  144 LEU A N    1  
ATOM   1524   C  CA   . LEU A 1 102 ? 5.778   7.679   -12.308 1.00 15.00 ?  144 LEU A CA   1  
ATOM   1525   C  C    . LEU A 1 102 ? 4.966   6.396   -12.456 1.00 15.00 ?  144 LEU A C    1  
ATOM   1526   O  O    . LEU A 1 102 ? 5.050   5.713   -13.476 1.00 15.00 ?  144 LEU A O    1  
ATOM   1527   C  CB   . LEU A 1 102 ? 7.040   7.418   -11.486 1.00 15.00 ?  144 LEU A CB   1  
ATOM   1528   C  CG   . LEU A 1 102 ? 8.246   6.927   -12.290 1.00 15.00 ?  144 LEU A CG   1  
ATOM   1529   C  CD1  . LEU A 1 102 ? 8.685   7.978   -13.297 1.00 15.00 ?  144 LEU A CD1  1  
ATOM   1530   C  CD2  . LEU A 1 102 ? 9.391   6.559   -11.361 1.00 15.00 ?  144 LEU A CD2  1  
ATOM   1531   H  H    . LEU A 1 102 ? 5.135   8.950   -10.744 1.00 15.00 ?  144 LEU A H    1  
ATOM   1532   H  HA   . LEU A 1 102 ? 6.061   8.030   -13.289 1.00 15.00 ?  144 LEU A HA   1  
ATOM   1533   H  HB2  . LEU A 1 102 ? 7.313   8.335   -10.984 1.00 15.00 ?  144 LEU A HB2  1  
ATOM   1534   H  HB3  . LEU A 1 102 ? 6.808   6.675   -10.739 1.00 15.00 ?  144 LEU A HB3  1  
ATOM   1535   H  HG   . LEU A 1 102 ? 7.963   6.038   -12.837 1.00 15.00 ?  144 LEU A HG   1  
ATOM   1536   H  HD11 . LEU A 1 102 ? 8.750   8.940   -12.811 1.00 15.00 ?  144 LEU A HD11 1  
ATOM   1537   H  HD12 . LEU A 1 102 ? 7.962   8.030   -14.100 1.00 15.00 ?  144 LEU A HD12 1  
ATOM   1538   H  HD13 . LEU A 1 102 ? 9.648   7.713   -13.702 1.00 15.00 ?  144 LEU A HD13 1  
ATOM   1539   H  HD21 . LEU A 1 102 ? 9.058   5.802   -10.665 1.00 15.00 ?  144 LEU A HD21 1  
ATOM   1540   H  HD22 . LEU A 1 102 ? 9.711   7.432   -10.813 1.00 15.00 ?  144 LEU A HD22 1  
ATOM   1541   H  HD23 . LEU A 1 102 ? 10.217  6.174   -11.940 1.00 15.00 ?  144 LEU A HD23 1  
ATOM   1542   N  N    . SER A 1 103 ? 4.165   6.085   -11.437 1.00 15.00 ?  145 SER A N    1  
ATOM   1543   C  CA   . SER A 1 103 ? 3.320   4.893   -11.451 1.00 15.00 ?  145 SER A CA   1  
ATOM   1544   C  C    . SER A 1 103 ? 2.324   4.952   -12.605 1.00 15.00 ?  145 SER A C    1  
ATOM   1545   O  O    . SER A 1 103 ? 2.104   3.963   -13.299 1.00 15.00 ?  145 SER A O    1  
ATOM   1546   C  CB   . SER A 1 103 ? 2.561   4.753   -10.127 1.00 15.00 ?  145 SER A CB   1  
ATOM   1547   O  OG   . SER A 1 103 ? 3.443   4.828   -9.023  1.00 15.00 ?  145 SER A OG   1  
ATOM   1548   H  H    . SER A 1 103 ? 4.144   6.668   -10.651 1.00 15.00 ?  145 SER A H    1  
ATOM   1549   H  HA   . SER A 1 103 ? 3.959   4.035   -11.583 1.00 15.00 ?  145 SER A HA   1  
ATOM   1550   H  HB2  . SER A 1 103 ? 1.835   5.551   -10.044 1.00 15.00 ?  145 SER A HB2  1  
ATOM   1551   H  HB3  . SER A 1 103 ? 2.053   3.801   -10.106 1.00 15.00 ?  145 SER A HB3  1  
ATOM   1552   H  HG   . SER A 1 103 ? 4.051   4.067   -9.046  1.00 15.00 ?  145 SER A HG   1  
ATOM   1553   N  N    . ASN A 1 104 ? 1.733   6.124   -12.816 1.00 15.00 ?  146 ASN A N    1  
ATOM   1554   C  CA   . ASN A 1 104 ? 0.764   6.307   -13.892 1.00 15.00 ?  146 ASN A CA   1  
ATOM   1555   C  C    . ASN A 1 104 ? 1.428   6.128   -15.252 1.00 15.00 ?  146 ASN A C    1  
ATOM   1556   O  O    . ASN A 1 104 ? 0.787   5.732   -16.225 1.00 15.00 ?  146 ASN A O    1  
ATOM   1557   C  CB   . ASN A 1 104 ? 0.105   7.690   -13.799 1.00 15.00 ?  146 ASN A CB   1  
ATOM   1558   C  CG   . ASN A 1 104 ? -1.010  7.735   -12.770 1.00 15.00 ?  146 ASN A CG   1  
ATOM   1559   O  OD1  . ASN A 1 104 ? -1.554  6.701   -12.388 1.00 15.00 ?  146 ASN A OD1  1  
ATOM   1560   N  ND2  . ASN A 1 104 ? -1.368  8.931   -12.323 1.00 15.00 ?  146 ASN A ND2  1  
ATOM   1561   H  H    . ASN A 1 104 ? 1.943   6.879   -12.223 1.00 15.00 ?  146 ASN A H    1  
ATOM   1562   H  HA   . ASN A 1 104 ? 0.003   5.549   -13.781 1.00 15.00 ?  146 ASN A HA   1  
ATOM   1563   H  HB2  . ASN A 1 104 ? 0.849   8.421   -13.521 1.00 15.00 ?  146 ASN A HB2  1  
ATOM   1564   H  HB3  . ASN A 1 104 ? -0.307  7.951   -14.764 1.00 15.00 ?  146 ASN A HB3  1  
ATOM   1565   H  HD21 . ASN A 1 104 ? -0.899  9.724   -12.676 1.00 15.00 ?  146 ASN A HD21 1  
ATOM   1566   H  HD22 . ASN A 1 104 ? -2.086  8.981   -11.653 1.00 15.00 ?  146 ASN A HD22 1  
ATOM   1567   N  N    . GLN A 1 105 ? 2.720   6.410   -15.306 1.00 15.00 ?  147 GLN A N    1  
ATOM   1568   C  CA   . GLN A 1 105 ? 3.486   6.275   -16.537 1.00 15.00 ?  147 GLN A CA   1  
ATOM   1569   C  C    . GLN A 1 105 ? 3.925   4.825   -16.738 1.00 15.00 ?  147 GLN A C    1  
ATOM   1570   O  O    . GLN A 1 105 ? 4.029   4.343   -17.869 1.00 15.00 ?  147 GLN A O    1  
ATOM   1571   C  CB   . GLN A 1 105 ? 4.701   7.203   -16.485 1.00 15.00 ?  147 GLN A CB   1  
ATOM   1572   C  CG   . GLN A 1 105 ? 5.468   7.304   -17.792 1.00 15.00 ?  147 GLN A CG   1  
ATOM   1573   C  CD   . GLN A 1 105 ? 6.679   8.206   -17.679 1.00 15.00 ?  147 GLN A CD   1  
ATOM   1574   O  OE1  . GLN A 1 105 ? 7.262   8.349   -16.604 1.00 15.00 ?  147 GLN A OE1  1  
ATOM   1575   N  NE2  . GLN A 1 105 ? 7.070   8.816   -18.785 1.00 15.00 ?  147 GLN A NE2  1  
ATOM   1576   H  H    . GLN A 1 105 ? 3.171   6.726   -14.494 1.00 15.00 ?  147 GLN A H    1  
ATOM   1577   H  HA   . GLN A 1 105 ? 2.854   6.569   -17.360 1.00 15.00 ?  147 GLN A HA   1  
ATOM   1578   H  HB2  . GLN A 1 105 ? 4.368   8.193   -16.217 1.00 15.00 ?  147 GLN A HB2  1  
ATOM   1579   H  HB3  . GLN A 1 105 ? 5.380   6.846   -15.725 1.00 15.00 ?  147 GLN A HB3  1  
ATOM   1580   H  HG2  . GLN A 1 105 ? 5.795   6.319   -18.082 1.00 15.00 ?  147 GLN A HG2  1  
ATOM   1581   H  HG3  . GLN A 1 105 ? 4.811   7.705   -18.549 1.00 15.00 ?  147 GLN A HG3  1  
ATOM   1582   H  HE21 . GLN A 1 105 ? 6.562   8.656   -19.609 1.00 15.00 ?  147 GLN A HE21 1  
ATOM   1583   H  HE22 . GLN A 1 105 ? 7.849   9.410   -18.735 1.00 15.00 ?  147 GLN A HE22 1  
ATOM   1584   N  N    . LEU A 1 106 ? 4.152   4.127   -15.632 1.00 15.00 ?  148 LEU A N    1  
ATOM   1585   C  CA   . LEU A 1 106 ? 4.594   2.738   -15.670 1.00 15.00 ?  148 LEU A CA   1  
ATOM   1586   C  C    . LEU A 1 106 ? 3.417   1.775   -15.790 1.00 15.00 ?  148 LEU A C    1  
ATOM   1587   O  O    . LEU A 1 106 ? 3.590   0.630   -16.201 1.00 15.00 ?  148 LEU A O    1  
ATOM   1588   C  CB   . LEU A 1 106 ? 5.413   2.409   -14.419 1.00 15.00 ?  148 LEU A CB   1  
ATOM   1589   C  CG   . LEU A 1 106 ? 6.789   3.079   -14.350 1.00 15.00 ?  148 LEU A CG   1  
ATOM   1590   C  CD1  . LEU A 1 106 ? 7.350   3.005   -12.939 1.00 15.00 ?  148 LEU A CD1  1  
ATOM   1591   C  CD2  . LEU A 1 106 ? 7.749   2.429   -15.334 1.00 15.00 ?  148 LEU A CD2  1  
ATOM   1592   H  H    . LEU A 1 106 ? 4.032   4.564   -14.760 1.00 15.00 ?  148 LEU A H    1  
ATOM   1593   H  HA   . LEU A 1 106 ? 5.227   2.621   -16.538 1.00 15.00 ?  148 LEU A HA   1  
ATOM   1594   H  HB2  . LEU A 1 106 ? 4.843   2.712   -13.552 1.00 15.00 ?  148 LEU A HB2  1  
ATOM   1595   H  HB3  . LEU A 1 106 ? 5.559   1.339   -14.377 1.00 15.00 ?  148 LEU A HB3  1  
ATOM   1596   H  HG   . LEU A 1 106 ? 6.689   4.121   -14.615 1.00 15.00 ?  148 LEU A HG   1  
ATOM   1597   H  HD11 . LEU A 1 106 ? 7.584   1.979   -12.697 1.00 15.00 ?  148 LEU A HD11 1  
ATOM   1598   H  HD12 . LEU A 1 106 ? 6.616   3.380   -12.242 1.00 15.00 ?  148 LEU A HD12 1  
ATOM   1599   H  HD13 . LEU A 1 106 ? 8.246   3.605   -12.875 1.00 15.00 ?  148 LEU A HD13 1  
ATOM   1600   H  HD21 . LEU A 1 106 ? 8.713   2.915   -15.270 1.00 15.00 ?  148 LEU A HD21 1  
ATOM   1601   H  HD22 . LEU A 1 106 ? 7.359   2.528   -16.339 1.00 15.00 ?  148 LEU A HD22 1  
ATOM   1602   H  HD23 . LEU A 1 106 ? 7.858   1.379   -15.092 1.00 15.00 ?  148 LEU A HD23 1  
ATOM   1603   N  N    . ALA A 1 107 ? 2.223   2.250   -15.447 1.00 15.00 ?  149 ALA A N    1  
ATOM   1604   C  CA   . ALA A 1 107 ? 1.013   1.430   -15.508 1.00 15.00 ?  149 ALA A CA   1  
ATOM   1605   C  C    . ALA A 1 107 ? 0.830   0.755   -16.876 1.00 15.00 ?  149 ALA A C    1  
ATOM   1606   O  O    . ALA A 1 107 ? 0.712   -0.469  -16.940 1.00 15.00 ?  149 ALA A O    1  
ATOM   1607   C  CB   . ALA A 1 107 ? -0.213  2.253   -15.136 1.00 15.00 ?  149 ALA A CB   1  
ATOM   1608   H  H    . ALA A 1 107 ? 2.155   3.177   -15.128 1.00 15.00 ?  149 ALA A H    1  
ATOM   1609   H  HA   . ALA A 1 107 ? 1.117   0.653   -14.766 1.00 15.00 ?  149 ALA A HA   1  
ATOM   1610   H  HB1  . ALA A 1 107 ? -0.081  2.668   -14.147 1.00 15.00 ?  149 ALA A HB1  1  
ATOM   1611   H  HB2  . ALA A 1 107 ? -1.090  1.624   -15.150 1.00 15.00 ?  149 ALA A HB2  1  
ATOM   1612   H  HB3  . ALA A 1 107 ? -0.336  3.055   -15.847 1.00 15.00 ?  149 ALA A HB3  1  
ATOM   1613   N  N    . PRO A 1 108 ? 0.816   1.514   -18.000 1.00 15.00 ?  150 PRO A N    1  
ATOM   1614   C  CA   . PRO A 1 108 ? 0.654   0.920   -19.337 1.00 15.00 ?  150 PRO A CA   1  
ATOM   1615   C  C    . PRO A 1 108 ? 1.828   0.021   -19.723 1.00 15.00 ?  150 PRO A C    1  
ATOM   1616   O  O    . PRO A 1 108 ? 1.741   -0.750  -20.677 1.00 15.00 ?  150 PRO A O    1  
ATOM   1617   C  CB   . PRO A 1 108 ? 0.582   2.132   -20.272 1.00 15.00 ?  150 PRO A CB   1  
ATOM   1618   C  CG   . PRO A 1 108 ? 1.212   3.248   -19.521 1.00 15.00 ?  150 PRO A CG   1  
ATOM   1619   C  CD   . PRO A 1 108 ? 0.923   2.986   -18.071 1.00 15.00 ?  150 PRO A CD   1  
ATOM   1620   H  HA   . PRO A 1 108 ? -0.263  0.356   -19.406 1.00 15.00 ?  150 PRO A HA   1  
ATOM   1621   H  HB2  . PRO A 1 108 ? 1.125   1.925   -21.186 1.00 15.00 ?  150 PRO A HB2  1  
ATOM   1622   H  HB3  . PRO A 1 108 ? -0.446  2.366   -20.491 1.00 15.00 ?  150 PRO A HB3  1  
ATOM   1623   H  HG2  . PRO A 1 108 ? 2.279   3.253   -19.703 1.00 15.00 ?  150 PRO A HG2  1  
ATOM   1624   H  HG3  . PRO A 1 108 ? 0.773   4.186   -19.820 1.00 15.00 ?  150 PRO A HG3  1  
ATOM   1625   H  HD2  . PRO A 1 108 ? 1.734   3.345   -17.452 1.00 15.00 ?  150 PRO A HD2  1  
ATOM   1626   H  HD3  . PRO A 1 108 ? -0.006  3.453   -17.785 1.00 15.00 ?  150 PRO A HD3  1  
ATOM   1627   N  N    . GLN A 1 109 ? 2.915   0.115   -18.970 1.00 15.00 ?  151 GLN A N    1  
ATOM   1628   C  CA   . GLN A 1 109 ? 4.102   -0.684  -19.229 1.00 15.00 ?  151 GLN A CA   1  
ATOM   1629   C  C    . GLN A 1 109 ? 4.017   -2.027  -18.508 1.00 15.00 ?  151 GLN A C    1  
ATOM   1630   O  O    . GLN A 1 109 ? 4.451   -3.053  -19.032 1.00 15.00 ?  151 GLN A O    1  
ATOM   1631   C  CB   . GLN A 1 109 ? 5.352   0.079   -18.788 1.00 15.00 ?  151 GLN A CB   1  
ATOM   1632   C  CG   . GLN A 1 109 ? 5.712   1.245   -19.698 1.00 15.00 ?  151 GLN A CG   1  
ATOM   1633   C  CD   . GLN A 1 109 ? 6.850   2.083   -19.149 1.00 15.00 ?  151 GLN A CD   1  
ATOM   1634   O  OE1  . GLN A 1 109 ? 8.019   1.754   -19.334 1.00 15.00 ?  151 GLN A OE1  1  
ATOM   1635   N  NE2  . GLN A 1 109 ? 6.521   3.177   -18.477 1.00 15.00 ?  151 GLN A NE2  1  
ATOM   1636   H  H    . GLN A 1 109 ? 2.913   0.736   -18.207 1.00 15.00 ?  151 GLN A H    1  
ATOM   1637   H  HA   . GLN A 1 109 ? 4.154   -0.861  -20.292 1.00 15.00 ?  151 GLN A HA   1  
ATOM   1638   H  HB2  . GLN A 1 109 ? 5.188   0.465   -17.793 1.00 15.00 ?  151 GLN A HB2  1  
ATOM   1639   H  HB3  . GLN A 1 109 ? 6.189   -0.604  -18.765 1.00 15.00 ?  151 GLN A HB3  1  
ATOM   1640   H  HG2  . GLN A 1 109 ? 6.004   0.857   -20.663 1.00 15.00 ?  151 GLN A HG2  1  
ATOM   1641   H  HG3  . GLN A 1 109 ? 4.844   1.877   -19.813 1.00 15.00 ?  151 GLN A HG3  1  
ATOM   1642   H  HE21 . GLN A 1 109 ? 5.567   3.386   -18.368 1.00 15.00 ?  151 GLN A HE21 1  
ATOM   1643   H  HE22 . GLN A 1 109 ? 7.243   3.734   -18.117 1.00 15.00 ?  151 GLN A HE22 1  
ATOM   1644   N  N    . GLU A 1 110 ? 3.449   -2.014  -17.308 1.00 15.00 ?  152 GLU A N    1  
ATOM   1645   C  CA   . GLU A 1 110 ? 3.298   -3.231  -16.518 1.00 15.00 ?  152 GLU A CA   1  
ATOM   1646   C  C    . GLU A 1 110 ? 1.994   -3.946  -16.862 1.00 15.00 ?  152 GLU A C    1  
ATOM   1647   O  O    . GLU A 1 110 ? 1.717   -5.041  -16.363 1.00 15.00 ?  152 GLU A O    1  
ATOM   1648   C  CB   . GLU A 1 110 ? 3.339   -2.901  -15.025 1.00 15.00 ?  152 GLU A CB   1  
ATOM   1649   C  CG   . GLU A 1 110 ? 4.713   -2.482  -14.530 1.00 15.00 ?  152 GLU A CG   1  
ATOM   1650   C  CD   . GLU A 1 110 ? 5.695   -3.636  -14.505 1.00 15.00 ?  152 GLU A CD   1  
ATOM   1651   O  OE1  . GLU A 1 110 ? 5.361   -4.695  -13.933 1.00 15.00 ?  152 GLU A OE1  1  
ATOM   1652   O  OE2  . GLU A 1 110 ? 6.814   -3.492  -15.049 1.00 15.00 -1 152 GLU A OE2  1  
ATOM   1653   H  H    . GLU A 1 110 ? 3.133   -1.161  -16.939 1.00 15.00 ?  152 GLU A H    1  
ATOM   1654   H  HA   . GLU A 1 110 ? 4.122   -3.882  -16.756 1.00 15.00 ?  152 GLU A HA   1  
ATOM   1655   H  HB2  . GLU A 1 110 ? 2.648   -2.096  -14.823 1.00 15.00 ?  152 GLU A HB2  1  
ATOM   1656   H  HB3  . GLU A 1 110 ? 3.031   -3.775  -14.468 1.00 15.00 ?  152 GLU A HB3  1  
ATOM   1657   H  HG2  . GLU A 1 110 ? 5.097   -1.712  -15.184 1.00 15.00 ?  152 GLU A HG2  1  
ATOM   1658   H  HG3  . GLU A 1 110 ? 4.617   -2.089  -13.529 1.00 15.00 ?  152 GLU A HG3  1  
ATOM   1659   N  N    . GLY A 1 111 ? 1.194   -3.311  -17.703 1.00 15.00 ?  153 GLY A N    1  
ATOM   1660   C  CA   . GLY A 1 111 ? -0.071  -3.887  -18.112 1.00 15.00 ?  153 GLY A CA   1  
ATOM   1661   C  C    . GLY A 1 111 ? -1.186  -3.616  -17.124 1.00 15.00 ?  153 GLY A C    1  
ATOM   1662   O  O    . GLY A 1 111 ? -2.023  -4.482  -16.868 1.00 15.00 ?  153 GLY A O    1  
ATOM   1663   H  H    . GLY A 1 111 ? 1.468   -2.440  -18.052 1.00 15.00 ?  153 GLY A H    1  
ATOM   1664   H  HA2  . GLY A 1 111 ? -0.348  -3.473  -19.070 1.00 15.00 ?  153 GLY A HA2  1  
ATOM   1665   H  HA3  . GLY A 1 111 ? 0.050   -4.956  -18.216 1.00 15.00 ?  153 GLY A HA3  1  
ATOM   1666   N  N    . MET A 1 112 ? -1.200  -2.414  -16.562 1.00 15.00 ?  154 MET A N    1  
ATOM   1667   C  CA   . MET A 1 112 ? -2.223  -2.030  -15.598 1.00 15.00 ?  154 MET A CA   1  
ATOM   1668   C  C    . MET A 1 112 ? -2.859  -0.710  -16.009 1.00 15.00 ?  154 MET A C    1  
ATOM   1669   O  O    . MET A 1 112 ? -2.330  -0.002  -16.865 1.00 15.00 ?  154 MET A O    1  
ATOM   1670   C  CB   . MET A 1 112 ? -1.617  -1.906  -14.197 1.00 15.00 ?  154 MET A CB   1  
ATOM   1671   C  CG   . MET A 1 112 ? -1.056  -3.211  -13.662 1.00 15.00 ?  154 MET A CG   1  
ATOM   1672   S  SD   . MET A 1 112 ? -2.308  -4.499  -13.499 1.00 15.00 ?  154 MET A SD   1  
ATOM   1673   C  CE   . MET A 1 112 ? -1.295  -5.963  -13.692 1.00 15.00 ?  154 MET A CE   1  
ATOM   1674   H  H    . MET A 1 112 ? -0.511  -1.757  -16.811 1.00 15.00 ?  154 MET A H    1  
ATOM   1675   H  HA   . MET A 1 112 ? -2.980  -2.801  -15.591 1.00 15.00 ?  154 MET A HA   1  
ATOM   1676   H  HB2  . MET A 1 112 ? -0.817  -1.183  -14.228 1.00 15.00 ?  154 MET A HB2  1  
ATOM   1677   H  HB3  . MET A 1 112 ? -2.377  -1.556  -13.515 1.00 15.00 ?  154 MET A HB3  1  
ATOM   1678   H  HG2  . MET A 1 112 ? -0.293  -3.558  -14.342 1.00 15.00 ?  154 MET A HG2  1  
ATOM   1679   H  HG3  . MET A 1 112 ? -0.615  -3.028  -12.694 1.00 15.00 ?  154 MET A HG3  1  
ATOM   1680   H  HE1  . MET A 1 112 ? -0.931  -6.016  -14.707 1.00 15.00 ?  154 MET A HE1  1  
ATOM   1681   H  HE2  . MET A 1 112 ? -1.886  -6.842  -13.474 1.00 15.00 ?  154 MET A HE2  1  
ATOM   1682   H  HE3  . MET A 1 112 ? -0.456  -5.913  -13.013 1.00 15.00 ?  154 MET A HE3  1  
ATOM   1683   N  N    . VAL A 1 113 ? -3.992  -0.380  -15.396 1.00 15.00 ?  155 VAL A N    1  
ATOM   1684   C  CA   . VAL A 1 113 ? -4.699  0.863   -15.702 1.00 15.00 ?  155 VAL A CA   1  
ATOM   1685   C  C    . VAL A 1 113 ? -4.166  1.999   -14.839 1.00 15.00 ?  155 VAL A C    1  
ATOM   1686   O  O    . VAL A 1 113 ? -4.022  1.844   -13.626 1.00 15.00 ?  155 VAL A O    1  
ATOM   1687   C  CB   . VAL A 1 113 ? -6.219  0.725   -15.466 1.00 15.00 ?  155 VAL A CB   1  
ATOM   1688   C  CG1  . VAL A 1 113 ? -6.966  1.940   -15.997 1.00 15.00 ?  155 VAL A CG1  1  
ATOM   1689   C  CG2  . VAL A 1 113 ? -6.748  -0.548  -16.109 1.00 15.00 ?  155 VAL A CG2  1  
ATOM   1690   H  H    . VAL A 1 113 ? -4.357  -0.980  -14.713 1.00 15.00 ?  155 VAL A H    1  
ATOM   1691   H  HA   . VAL A 1 113 ? -4.533  1.101   -16.744 1.00 15.00 ?  155 VAL A HA   1  
ATOM   1692   H  HB   . VAL A 1 113 ? -6.393  0.661   -14.401 1.00 15.00 ?  155 VAL A HB   1  
ATOM   1693   H  HG11 . VAL A 1 113 ? -8.026  1.811   -15.833 1.00 15.00 ?  155 VAL A HG11 1  
ATOM   1694   H  HG12 . VAL A 1 113 ? -6.777  2.043   -17.054 1.00 15.00 ?  155 VAL A HG12 1  
ATOM   1695   H  HG13 . VAL A 1 113 ? -6.626  2.827   -15.481 1.00 15.00 ?  155 VAL A HG13 1  
ATOM   1696   H  HG21 . VAL A 1 113 ? -7.828  -0.559  -16.054 1.00 15.00 ?  155 VAL A HG21 1  
ATOM   1697   H  HG22 . VAL A 1 113 ? -6.354  -1.407  -15.586 1.00 15.00 ?  155 VAL A HG22 1  
ATOM   1698   H  HG23 . VAL A 1 113 ? -6.438  -0.583  -17.143 1.00 15.00 ?  155 VAL A HG23 1  
ATOM   1699   N  N    . ALA A 1 114 ? -3.871  3.133   -15.463 1.00 15.00 ?  156 ALA A N    1  
ATOM   1700   C  CA   . ALA A 1 114 ? -3.344  4.287   -14.743 1.00 15.00 ?  156 ALA A CA   1  
ATOM   1701   C  C    . ALA A 1 114 ? -4.439  4.978   -13.942 1.00 15.00 ?  156 ALA A C    1  
ATOM   1702   O  O    . ALA A 1 114 ? -5.621  4.864   -14.263 1.00 15.00 ?  156 ALA A O    1  
ATOM   1703   C  CB   . ALA A 1 114 ? -2.699  5.270   -15.710 1.00 15.00 ?  156 ALA A CB   1  
ATOM   1704   H  H    . ALA A 1 114 ? -4.018  3.199   -16.431 1.00 15.00 ?  156 ALA A H    1  
ATOM   1705   H  HA   . ALA A 1 114 ? -2.580  3.935   -14.064 1.00 15.00 ?  156 ALA A HA   1  
ATOM   1706   H  HB1  . ALA A 1 114 ? -1.925  4.770   -16.271 1.00 15.00 ?  156 ALA A HB1  1  
ATOM   1707   H  HB2  . ALA A 1 114 ? -2.267  6.088   -15.156 1.00 15.00 ?  156 ALA A HB2  1  
ATOM   1708   H  HB3  . ALA A 1 114 ? -3.446  5.651   -16.388 1.00 15.00 ?  156 ALA A HB3  1  
ATOM   1709   N  N    . ALA A 1 115 ? -4.041  5.692   -12.905 1.00 15.00 ?  157 ALA A N    1  
ATOM   1710   C  CA   . ALA A 1 115 ? -4.982  6.404   -12.056 1.00 15.00 ?  157 ALA A CA   1  
ATOM   1711   C  C    . ALA A 1 115 ? -5.435  7.701   -12.715 1.00 15.00 ?  157 ALA A C    1  
ATOM   1712   O  O    . ALA A 1 115 ? -4.750  8.236   -13.588 1.00 15.00 ?  157 ALA A O    1  
ATOM   1713   C  CB   . ALA A 1 115 ? -4.349  6.689   -10.707 1.00 15.00 ?  157 ALA A CB   1  
ATOM   1714   H  H    . ALA A 1 115 ? -3.077  5.754   -12.706 1.00 15.00 ?  157 ALA A H    1  
ATOM   1715   H  HA   . ALA A 1 115 ? -5.843  5.769   -11.901 1.00 15.00 ?  157 ALA A HA   1  
ATOM   1716   H  HB1  . ALA A 1 115 ? -3.352  7.081   -10.850 1.00 15.00 ?  157 ALA A HB1  1  
ATOM   1717   H  HB2  . ALA A 1 115 ? -4.300  5.776   -10.135 1.00 15.00 ?  157 ALA A HB2  1  
ATOM   1718   H  HB3  . ALA A 1 115 ? -4.947  7.414   -10.179 1.00 15.00 ?  157 ALA A HB3  1  
ATOM   1719   N  N    . GLN A 1 116 ? -6.583  8.203   -12.287 1.00 15.00 ?  158 GLN A N    1  
ATOM   1720   C  CA   . GLN A 1 116 ? -7.138  9.431   -12.836 1.00 15.00 ?  158 GLN A CA   1  
ATOM   1721   C  C    . GLN A 1 116 ? -6.311  10.644  -12.418 1.00 15.00 ?  158 GLN A C    1  
ATOM   1722   O  O    . GLN A 1 116 ? -6.254  11.645  -13.135 1.00 15.00 ?  158 GLN A O    1  
ATOM   1723   C  CB   . GLN A 1 116 ? -8.589  9.605   -12.381 1.00 15.00 ?  158 GLN A CB   1  
ATOM   1724   C  CG   . GLN A 1 116 ? -9.533  8.558   -12.940 1.00 15.00 ?  158 GLN A CG   1  
ATOM   1725   C  CD   . GLN A 1 116 ? -10.857 8.549   -12.214 1.00 15.00 ?  158 GLN A CD   1  
ATOM   1726   O  OE1  . GLN A 1 116 ? -10.930 8.864   -11.024 1.00 15.00 ?  158 GLN A OE1  1  
ATOM   1727   N  NE2  . GLN A 1 116 ? -11.916 8.198   -12.921 1.00 15.00 ?  158 GLN A NE2  1  
ATOM   1728   H  H    . GLN A 1 116 ? -7.076  7.735   -11.574 1.00 15.00 ?  158 GLN A H    1  
ATOM   1729   H  HA   . GLN A 1 116 ? -7.116  9.354   -13.911 1.00 15.00 ?  158 GLN A HA   1  
ATOM   1730   H  HB2  . GLN A 1 116 ? -8.627  9.549   -11.302 1.00 15.00 ?  158 GLN A HB2  1  
ATOM   1731   H  HB3  . GLN A 1 116 ? -8.937  10.579  -12.695 1.00 15.00 ?  158 GLN A HB3  1  
ATOM   1732   H  HG2  . GLN A 1 116 ? -9.711  8.769   -13.984 1.00 15.00 ?  158 GLN A HG2  1  
ATOM   1733   H  HG3  . GLN A 1 116 ? -9.073  7.585   -12.840 1.00 15.00 ?  158 GLN A HG3  1  
ATOM   1734   H  HE21 . GLN A 1 116 ? -11.788 7.969   -13.867 1.00 15.00 ?  158 GLN A HE21 1  
ATOM   1735   H  HE22 . GLN A 1 116 ? -12.787 8.186   -12.474 1.00 15.00 ?  158 GLN A HE22 1  
ATOM   1736   N  N    . HIS A 1 117 ? -5.655  10.546  -11.270 1.00 15.00 ?  159 HIS A N    1  
ATOM   1737   C  CA   . HIS A 1 117 ? -4.853  11.650  -10.764 1.00 15.00 ?  159 HIS A CA   1  
ATOM   1738   C  C    . HIS A 1 117 ? -3.405  11.223  -10.560 1.00 15.00 ?  159 HIS A C    1  
ATOM   1739   O  O    . HIS A 1 117 ? -3.120  10.053  -10.292 1.00 15.00 ?  159 HIS A O    1  
ATOM   1740   C  CB   . HIS A 1 117 ? -5.418  12.172  -9.439  1.00 15.00 ?  159 HIS A CB   1  
ATOM   1741   C  CG   . HIS A 1 117 ? -6.901  12.382  -9.450  1.00 15.00 ?  159 HIS A CG   1  
ATOM   1742   N  ND1  . HIS A 1 117 ? -7.451  13.575  -9.847  1.00 15.00 ?  159 HIS A ND1  1  
ATOM   1743   C  CD2  . HIS A 1 117 ? -7.897  11.524  -9.113  1.00 15.00 ?  159 HIS A CD2  1  
ATOM   1744   C  CE1  . HIS A 1 117 ? -8.760  13.420  -9.749  1.00 15.00 ?  159 HIS A CE1  1  
ATOM   1745   N  NE2  . HIS A 1 117 ? -9.075  12.197  -9.309  1.00 15.00 ?  159 HIS A NE2  1  
ATOM   1746   H  H    . HIS A 1 117 ? -5.706  9.710   -10.754 1.00 15.00 ?  159 HIS A H    1  
ATOM   1747   H  HA   . HIS A 1 117 ? -4.885  12.444  -11.495 1.00 15.00 ?  159 HIS A HA   1  
ATOM   1748   H  HB2  . HIS A 1 117 ? -5.187  11.466  -8.656  1.00 15.00 ?  159 HIS A HB2  1  
ATOM   1749   H  HB3  . HIS A 1 117 ? -4.951  13.120  -9.211  1.00 15.00 ?  159 HIS A HB3  1  
ATOM   1750   H  HD2  . HIS A 1 117 ? -7.786  10.509  -8.762  1.00 15.00 ?  159 HIS A HD2  1  
ATOM   1751   H  HE1  . HIS A 1 117 ? -9.483  14.181  -9.996  1.00 15.00 ?  159 HIS A HE1  1  
ATOM   1752   H  HE2  . HIS A 1 117 ? -9.979  11.843  -9.166  1.00 15.00 ?  159 HIS A HE2  1  
ATOM   1753   N  N    . SER A 1 118 ? -2.501  12.181  -10.689 1.00 15.00 ?  160 SER A N    1  
ATOM   1754   C  CA   . SER A 1 118 ? -1.079  11.932  -10.516 1.00 15.00 ?  160 SER A CA   1  
ATOM   1755   C  C    . SER A 1 118 ? -0.524  12.739  -9.346  1.00 15.00 ?  160 SER A C    1  
ATOM   1756   O  O    . SER A 1 118 ? -0.862  13.914  -9.168  1.00 15.00 ?  160 SER A O    1  
ATOM   1757   C  CB   . SER A 1 118 ? -0.323  12.276  -11.803 1.00 15.00 ?  160 SER A CB   1  
ATOM   1758   O  OG   . SER A 1 118 ? -0.876  11.590  -12.916 1.00 15.00 ?  160 SER A OG   1  
ATOM   1759   H  H    . SER A 1 118 ? -2.802  13.088  -10.911 1.00 15.00 ?  160 SER A H    1  
ATOM   1760   H  HA   . SER A 1 118 ? -0.951  10.884  -10.306 1.00 15.00 ?  160 SER A HA   1  
ATOM   1761   H  HB2  . SER A 1 118 ? -0.381  13.340  -11.987 1.00 15.00 ?  160 SER A HB2  1  
ATOM   1762   H  HB3  . SER A 1 118 ? 0.710   11.989  -11.697 1.00 15.00 ?  160 SER A HB3  1  
ATOM   1763   H  HG   . SER A 1 118 ? -1.241  12.231  -13.536 1.00 15.00 ?  160 SER A HG   1  
ATOM   1764   N  N    . LEU A 1 119 ? 0.312   12.097  -8.546  1.00 15.00 ?  161 LEU A N    1  
ATOM   1765   C  CA   . LEU A 1 119 ? 0.923   12.741  -7.391  1.00 15.00 ?  161 LEU A CA   1  
ATOM   1766   C  C    . LEU A 1 119 ? 2.355   13.155  -7.689  1.00 15.00 ?  161 LEU A C    1  
ATOM   1767   O  O    . LEU A 1 119 ? 3.105   12.406  -8.316  1.00 15.00 ?  161 LEU A O    1  
ATOM   1768   C  CB   . LEU A 1 119 ? 0.919   11.795  -6.187  1.00 15.00 ?  161 LEU A CB   1  
ATOM   1769   C  CG   . LEU A 1 119 ? -0.461  11.372  -5.687  1.00 15.00 ?  161 LEU A CG   1  
ATOM   1770   C  CD1  . LEU A 1 119 ? -0.351  10.139  -4.806  1.00 15.00 ?  161 LEU A CD1  1  
ATOM   1771   C  CD2  . LEU A 1 119 ? -1.116  12.506  -4.919  1.00 15.00 ?  161 LEU A CD2  1  
ATOM   1772   H  H    . LEU A 1 119 ? 0.514   11.153  -8.731  1.00 15.00 ?  161 LEU A H    1  
ATOM   1773   H  HA   . LEU A 1 119 ? 0.343   13.619  -7.153  1.00 15.00 ?  161 LEU A HA   1  
ATOM   1774   H  HB2  . LEU A 1 119 ? 1.471   10.906  -6.456  1.00 15.00 ?  161 LEU A HB2  1  
ATOM   1775   H  HB3  . LEU A 1 119 ? 1.436   12.283  -5.375  1.00 15.00 ?  161 LEU A HB3  1  
ATOM   1776   H  HG   . LEU A 1 119 ? -1.085  11.129  -6.532  1.00 15.00 ?  161 LEU A HG   1  
ATOM   1777   H  HD11 . LEU A 1 119 ? 0.241   9.387   -5.309  1.00 15.00 ?  161 LEU A HD11 1  
ATOM   1778   H  HD12 . LEU A 1 119 ? -1.339  9.746   -4.610  1.00 15.00 ?  161 LEU A HD12 1  
ATOM   1779   H  HD13 . LEU A 1 119 ? 0.123   10.409  -3.874  1.00 15.00 ?  161 LEU A HD13 1  
ATOM   1780   H  HD21 . LEU A 1 119 ? -2.096  12.199  -4.589  1.00 15.00 ?  161 LEU A HD21 1  
ATOM   1781   H  HD22 . LEU A 1 119 ? -1.206  13.370  -5.560  1.00 15.00 ?  161 LEU A HD22 1  
ATOM   1782   H  HD23 . LEU A 1 119 ? -0.508  12.756  -4.061  1.00 15.00 ?  161 LEU A HD23 1  
ATOM   1783   N  N    . THR A 1 120 ? 2.731   14.344  -7.240  1.00 15.00 ?  162 THR A N    1  
ATOM   1784   C  CA   . THR A 1 120 ? 4.085   14.834  -7.438  1.00 15.00 ?  162 THR A CA   1  
ATOM   1785   C  C    . THR A 1 120 ? 4.746   15.067  -6.087  1.00 15.00 ?  162 THR A C    1  
ATOM   1786   O  O    . THR A 1 120 ? 4.094   15.509  -5.139  1.00 15.00 ?  162 THR A O    1  
ATOM   1787   C  CB   . THR A 1 120 ? 4.117   16.129  -8.272  1.00 15.00 ?  162 THR A CB   1  
ATOM   1788   O  OG1  . THR A 1 120 ? 3.073   17.021  -7.848  1.00 15.00 ?  162 THR A OG1  1  
ATOM   1789   C  CG2  . THR A 1 120 ? 3.948   15.821  -9.755  1.00 15.00 ?  162 THR A CG2  1  
ATOM   1790   H  H    . THR A 1 120 ? 2.082   14.909  -6.766  1.00 15.00 ?  162 THR A H    1  
ATOM   1791   H  HA   . THR A 1 120 ? 4.637   14.069  -7.970  1.00 15.00 ?  162 THR A HA   1  
ATOM   1792   H  HB   . THR A 1 120 ? 5.073   16.608  -8.126  1.00 15.00 ?  162 THR A HB   1  
ATOM   1793   H  HG1  . THR A 1 120 ? 2.784   16.779  -6.960  1.00 15.00 ?  162 THR A HG1  1  
ATOM   1794   H  HG21 . THR A 1 120 ? 4.650   15.052  -10.048 1.00 15.00 ?  162 THR A HG21 1  
ATOM   1795   H  HG22 . THR A 1 120 ? 4.134   16.713  -10.331 1.00 15.00 ?  162 THR A HG22 1  
ATOM   1796   H  HG23 . THR A 1 120 ? 2.939   15.477  -9.936  1.00 15.00 ?  162 THR A HG23 1  
ATOM   1797   N  N    . PHE A 1 121 ? 6.027   14.758  -5.989  1.00 15.00 ?  163 PHE A N    1  
ATOM   1798   C  CA   . PHE A 1 121 ? 6.743   14.912  -4.733  1.00 15.00 ?  163 PHE A CA   1  
ATOM   1799   C  C    . PHE A 1 121 ? 7.847   15.959  -4.852  1.00 15.00 ?  163 PHE A C    1  
ATOM   1800   O  O    . PHE A 1 121 ? 8.311   16.263  -5.952  1.00 15.00 ?  163 PHE A O    1  
ATOM   1801   C  CB   . PHE A 1 121 ? 7.339   13.563  -4.302  1.00 15.00 ?  163 PHE A CB   1  
ATOM   1802   C  CG   . PHE A 1 121 ? 6.320   12.465  -4.158  1.00 15.00 ?  163 PHE A CG   1  
ATOM   1803   C  CD1  . PHE A 1 121 ? 5.679   12.250  -2.947  1.00 15.00 ?  163 PHE A CD1  1  
ATOM   1804   C  CD2  . PHE A 1 121 ? 5.997   11.648  -5.234  1.00 15.00 ?  163 PHE A CD2  1  
ATOM   1805   C  CE1  . PHE A 1 121 ? 4.734   11.250  -2.813  1.00 15.00 ?  163 PHE A CE1  1  
ATOM   1806   C  CE2  . PHE A 1 121 ? 5.056   10.645  -5.104  1.00 15.00 ?  163 PHE A CE2  1  
ATOM   1807   C  CZ   . PHE A 1 121 ? 4.424   10.447  -3.893  1.00 15.00 ?  163 PHE A CZ   1  
ATOM   1808   H  H    . PHE A 1 121 ? 6.508   14.427  -6.777  1.00 15.00 ?  163 PHE A H    1  
ATOM   1809   H  HA   . PHE A 1 121 ? 6.034   15.235  -3.986  1.00 15.00 ?  163 PHE A HA   1  
ATOM   1810   H  HB2  . PHE A 1 121 ? 8.058   13.250  -5.045  1.00 15.00 ?  163 PHE A HB2  1  
ATOM   1811   H  HB3  . PHE A 1 121 ? 7.837   13.686  -3.353  1.00 15.00 ?  163 PHE A HB3  1  
ATOM   1812   H  HD1  . PHE A 1 121 ? 5.920   12.876  -2.100  1.00 15.00 ?  163 PHE A HD1  1  
ATOM   1813   H  HD2  . PHE A 1 121 ? 6.489   11.798  -6.182  1.00 15.00 ?  163 PHE A HD2  1  
ATOM   1814   H  HE1  . PHE A 1 121 ? 4.241   11.094  -1.866  1.00 15.00 ?  163 PHE A HE1  1  
ATOM   1815   H  HE2  . PHE A 1 121 ? 4.815   10.014  -5.950  1.00 15.00 ?  163 PHE A HE2  1  
ATOM   1816   H  HZ   . PHE A 1 121 ? 3.686   9.668   -3.793  1.00 15.00 ?  163 PHE A HZ   1  
ATOM   1817   N  N    . ALA A 1 122 ? 8.245   16.519  -3.715  1.00 15.00 ?  164 ALA A N    1  
ATOM   1818   C  CA   . ALA A 1 122 ? 9.300   17.519  -3.670  1.00 15.00 ?  164 ALA A CA   1  
ATOM   1819   C  C    . ALA A 1 122 ? 10.675  16.850  -3.655  1.00 15.00 ?  164 ALA A C    1  
ATOM   1820   O  O    . ALA A 1 122 ? 10.776  15.624  -3.759  1.00 15.00 ?  164 ALA A O    1  
ATOM   1821   C  CB   . ALA A 1 122 ? 9.113   18.422  -2.455  1.00 15.00 ?  164 ALA A CB   1  
ATOM   1822   H  H    . ALA A 1 122 ? 7.797   16.258  -2.874  1.00 15.00 ?  164 ALA A H    1  
ATOM   1823   H  HA   . ALA A 1 122 ? 9.220   18.127  -4.558  1.00 15.00 ?  164 ALA A HA   1  
ATOM   1824   H  HB1  . ALA A 1 122 ? 9.325   17.868  -1.551  1.00 15.00 ?  164 ALA A HB1  1  
ATOM   1825   H  HB2  . ALA A 1 122 ? 8.091   18.776  -2.429  1.00 15.00 ?  164 ALA A HB2  1  
ATOM   1826   H  HB3  . ALA A 1 122 ? 9.782   19.265  -2.524  1.00 15.00 ?  164 ALA A HB3  1  
ATOM   1827   N  N    . ALA A 1 123 ? 11.725  17.656  -3.513  1.00 15.00 ?  165 ALA A N    1  
ATOM   1828   C  CA   . ALA A 1 123 ? 13.094  17.148  -3.503  1.00 15.00 ?  165 ALA A CA   1  
ATOM   1829   C  C    . ALA A 1 123 ? 13.350  16.233  -2.307  1.00 15.00 ?  165 ALA A C    1  
ATOM   1830   O  O    . ALA A 1 123 ? 14.105  15.265  -2.408  1.00 15.00 ?  165 ALA A O    1  
ATOM   1831   C  CB   . ALA A 1 123 ? 14.091  18.300  -3.508  1.00 15.00 ?  165 ALA A CB   1  
ATOM   1832   H  H    . ALA A 1 123 ? 11.572  18.621  -3.409  1.00 15.00 ?  165 ALA A H    1  
ATOM   1833   H  HA   . ALA A 1 123 ? 13.240  16.582  -4.415  1.00 15.00 ?  165 ALA A HA   1  
ATOM   1834   H  HB1  . ALA A 1 123 ? 15.094  17.904  -3.433  1.00 15.00 ?  165 ALA A HB1  1  
ATOM   1835   H  HB2  . ALA A 1 123 ? 13.897  18.951  -2.667  1.00 15.00 ?  165 ALA A HB2  1  
ATOM   1836   H  HB3  . ALA A 1 123 ? 13.993  18.860  -4.428  1.00 15.00 ?  165 ALA A HB3  1  
ATOM   1837   N  N    . ASN A 1 124 ? 12.712  16.533  -1.179  1.00 15.00 ?  166 ASN A N    1  
ATOM   1838   C  CA   . ASN A 1 124 ? 12.888  15.730  0.031   1.00 15.00 ?  166 ASN A CA   1  
ATOM   1839   C  C    . ASN A 1 124 ? 12.053  14.451  -0.015  1.00 15.00 ?  166 ASN A C    1  
ATOM   1840   O  O    . ASN A 1 124 ? 12.214  13.568  0.825   1.00 15.00 ?  166 ASN A O    1  
ATOM   1841   C  CB   . ASN A 1 124 ? 12.546  16.539  1.291   1.00 15.00 ?  166 ASN A CB   1  
ATOM   1842   C  CG   . ASN A 1 124 ? 11.171  17.179  1.238   1.00 15.00 ?  166 ASN A CG   1  
ATOM   1843   O  OD1  . ASN A 1 124 ? 10.290  16.745  0.496   1.00 15.00 ?  166 ASN A OD1  1  
ATOM   1844   N  ND2  . ASN A 1 124 ? 10.973  18.218  2.031   1.00 15.00 ?  166 ASN A ND2  1  
ATOM   1845   H  H    . ASN A 1 124 ? 12.117  17.317  -1.157  1.00 15.00 ?  166 ASN A H    1  
ATOM   1846   H  HA   . ASN A 1 124 ? 13.928  15.449  0.076   1.00 15.00 ?  166 ASN A HA   1  
ATOM   1847   H  HB2  . ASN A 1 124 ? 12.578  15.883  2.149   1.00 15.00 ?  166 ASN A HB2  1  
ATOM   1848   H  HB3  . ASN A 1 124 ? 13.282  17.320  1.418   1.00 15.00 ?  166 ASN A HB3  1  
ATOM   1849   H  HD21 . ASN A 1 124 ? 11.713  18.513  2.603   1.00 15.00 ?  166 ASN A HD21 1  
ATOM   1850   H  HD22 . ASN A 1 124 ? 10.092  18.651  2.017   1.00 15.00 ?  166 ASN A HD22 1  
ATOM   1851   N  N    . GLY A 1 125 ? 11.159  14.360  -0.992  1.00 15.00 ?  167 GLY A N    1  
ATOM   1852   C  CA   . GLY A 1 125 ? 10.329  13.175  -1.134  1.00 15.00 ?  167 GLY A CA   1  
ATOM   1853   C  C    . GLY A 1 125 ? 8.919   13.362  -0.608  1.00 15.00 ?  167 GLY A C    1  
ATOM   1854   O  O    . GLY A 1 125 ? 8.093   12.459  -0.722  1.00 15.00 ?  167 GLY A O    1  
ATOM   1855   H  H    . GLY A 1 125 ? 11.066  15.100  -1.628  1.00 15.00 ?  167 GLY A H    1  
ATOM   1856   H  HA2  . GLY A 1 125 ? 10.274  12.917  -2.180  1.00 15.00 ?  167 GLY A HA2  1  
ATOM   1857   H  HA3  . GLY A 1 125 ? 10.793  12.358  -0.599  1.00 15.00 ?  167 GLY A HA3  1  
ATOM   1858   N  N    . TRP A 1 126 ? 8.633   14.515  -0.025  1.00 15.00 ?  168 TRP A N    1  
ATOM   1859   C  CA   . TRP A 1 126 ? 7.298   14.776  0.497   1.00 15.00 ?  168 TRP A CA   1  
ATOM   1860   C  C    . TRP A 1 126 ? 6.343   15.103  -0.643  1.00 15.00 ?  168 TRP A C    1  
ATOM   1861   O  O    . TRP A 1 126 ? 6.735   15.726  -1.628  1.00 15.00 ?  168 TRP A O    1  
ATOM   1862   C  CB   . TRP A 1 126 ? 7.320   15.909  1.526   1.00 15.00 ?  168 TRP A CB   1  
ATOM   1863   C  CG   . TRP A 1 126 ? 7.685   15.439  2.897   1.00 15.00 ?  168 TRP A CG   1  
ATOM   1864   C  CD1  . TRP A 1 126 ? 8.793   15.779  3.614   1.00 15.00 ?  168 TRP A CD1  1  
ATOM   1865   C  CD2  . TRP A 1 126 ? 6.936   14.534  3.712   1.00 15.00 ?  168 TRP A CD2  1  
ATOM   1866   N  NE1  . TRP A 1 126 ? 8.777   15.142  4.832   1.00 15.00 ?  168 TRP A NE1  1  
ATOM   1867   C  CE2  . TRP A 1 126 ? 7.646   14.371  4.914   1.00 15.00 ?  168 TRP A CE2  1  
ATOM   1868   C  CE3  . TRP A 1 126 ? 5.730   13.845  3.542   1.00 15.00 ?  168 TRP A CE3  1  
ATOM   1869   C  CZ2  . TRP A 1 126 ? 7.190   13.550  5.940   1.00 15.00 ?  168 TRP A CZ2  1  
ATOM   1870   C  CZ3  . TRP A 1 126 ? 5.281   13.030  4.560   1.00 15.00 ?  168 TRP A CZ3  1  
ATOM   1871   C  CH2  . TRP A 1 126 ? 6.008   12.889  5.746   1.00 15.00 ?  168 TRP A CH2  1  
ATOM   1872   H  H    . TRP A 1 126 ? 9.324   15.208  0.048   1.00 15.00 ?  168 TRP A H    1  
ATOM   1873   H  HA   . TRP A 1 126 ? 6.954   13.873  0.981   1.00 15.00 ?  168 TRP A HA   1  
ATOM   1874   H  HB2  . TRP A 1 126 ? 8.043   16.652  1.227   1.00 15.00 ?  168 TRP A HB2  1  
ATOM   1875   H  HB3  . TRP A 1 126 ? 6.343   16.363  1.576   1.00 15.00 ?  168 TRP A HB3  1  
ATOM   1876   H  HD1  . TRP A 1 126 ? 9.560   16.455  3.264   1.00 15.00 ?  168 TRP A HD1  1  
ATOM   1877   H  HE1  . TRP A 1 126 ? 9.464   15.222  5.527   1.00 15.00 ?  168 TRP A HE1  1  
ATOM   1878   H  HE3  . TRP A 1 126 ? 5.156   13.939  2.630   1.00 15.00 ?  168 TRP A HE3  1  
ATOM   1879   H  HZ2  . TRP A 1 126 ? 7.737   13.429  6.860   1.00 15.00 ?  168 TRP A HZ2  1  
ATOM   1880   H  HZ3  . TRP A 1 126 ? 4.357   12.486  4.446   1.00 15.00 ?  168 TRP A HZ3  1  
ATOM   1881   H  HH2  . TRP A 1 126 ? 5.618   12.242  6.515   1.00 15.00 ?  168 TRP A HH2  1  
ATOM   1882   N  N    . VAL A 1 127 ? 5.097   14.673  -0.511  1.00 15.00 ?  169 VAL A N    1  
ATOM   1883   C  CA   . VAL A 1 127 ? 4.101   14.900  -1.549  1.00 15.00 ?  169 VAL A CA   1  
ATOM   1884   C  C    . VAL A 1 127 ? 3.634   16.354  -1.592  1.00 15.00 ?  169 VAL A C    1  
ATOM   1885   O  O    . VAL A 1 127 ? 3.458   17.004  -0.555  1.00 15.00 ?  169 VAL A O    1  
ATOM   1886   C  CB   . VAL A 1 127 ? 2.880   13.962  -1.376  1.00 15.00 ?  169 VAL A CB   1  
ATOM   1887   C  CG1  . VAL A 1 127 ? 2.085   14.317  -0.129  1.00 15.00 ?  169 VAL A CG1  1  
ATOM   1888   C  CG2  . VAL A 1 127 ? 1.983   13.998  -2.604  1.00 15.00 ?  169 VAL A CG2  1  
ATOM   1889   H  H    . VAL A 1 127 ? 4.839   14.189  0.302   1.00 15.00 ?  169 VAL A H    1  
ATOM   1890   H  HA   . VAL A 1 127 ? 4.565   14.664  -2.495  1.00 15.00 ?  169 VAL A HA   1  
ATOM   1891   H  HB   . VAL A 1 127 ? 3.249   12.953  -1.261  1.00 15.00 ?  169 VAL A HB   1  
ATOM   1892   H  HG11 . VAL A 1 127 ? 1.180   13.731  -0.102  1.00 15.00 ?  169 VAL A HG11 1  
ATOM   1893   H  HG12 . VAL A 1 127 ? 1.835   15.366  -0.154  1.00 15.00 ?  169 VAL A HG12 1  
ATOM   1894   H  HG13 . VAL A 1 127 ? 2.675   14.106  0.751   1.00 15.00 ?  169 VAL A HG13 1  
ATOM   1895   H  HG21 . VAL A 1 127 ? 1.180   13.285  -2.481  1.00 15.00 ?  169 VAL A HG21 1  
ATOM   1896   H  HG22 . VAL A 1 127 ? 2.560   13.743  -3.480  1.00 15.00 ?  169 VAL A HG22 1  
ATOM   1897   H  HG23 . VAL A 1 127 ? 1.570   14.992  -2.721  1.00 15.00 ?  169 VAL A HG23 1  
ATOM   1898   N  N    . GLU A 1 128 ? 3.460   16.857  -2.807  1.00 15.00 ?  170 GLU A N    1  
ATOM   1899   C  CA   . GLU A 1 128 ? 2.994   18.211  -3.029  1.00 15.00 ?  170 GLU A CA   1  
ATOM   1900   C  C    . GLU A 1 128 ? 1.516   18.307  -2.665  1.00 15.00 ?  170 GLU A C    1  
ATOM   1901   O  O    . GLU A 1 128 ? 0.688   17.576  -3.212  1.00 15.00 ?  170 GLU A O    1  
ATOM   1902   C  CB   . GLU A 1 128 ? 3.203   18.613  -4.492  1.00 15.00 ?  170 GLU A CB   1  
ATOM   1903   C  CG   . GLU A 1 128 ? 4.553   19.249  -4.772  1.00 15.00 ?  170 GLU A CG   1  
ATOM   1904   C  CD   . GLU A 1 128 ? 4.575   20.714  -4.394  1.00 15.00 ?  170 GLU A CD   1  
ATOM   1905   O  OE1  . GLU A 1 128 ? 3.617   21.436  -4.750  1.00 15.00 ?  170 GLU A OE1  1  
ATOM   1906   O  OE2  . GLU A 1 128 ? 5.544   21.157  -3.746  1.00 15.00 -1 170 GLU A OE2  1  
ATOM   1907   H  H    . GLU A 1 128 ? 3.657   16.290  -3.586  1.00 15.00 ?  170 GLU A H    1  
ATOM   1908   H  HA   . GLU A 1 128 ? 3.560   18.873  -2.393  1.00 15.00 ?  170 GLU A HA   1  
ATOM   1909   H  HB2  . GLU A 1 128 ? 3.106   17.734  -5.114  1.00 15.00 ?  170 GLU A HB2  1  
ATOM   1910   H  HB3  . GLU A 1 128 ? 2.435   19.320  -4.769  1.00 15.00 ?  170 GLU A HB3  1  
ATOM   1911   H  HG2  . GLU A 1 128 ? 5.311   18.731  -4.201  1.00 15.00 ?  170 GLU A HG2  1  
ATOM   1912   H  HG3  . GLU A 1 128 ? 4.771   19.156  -5.828  1.00 15.00 ?  170 GLU A HG3  1  
ATOM   1913   N  N    . PRO A 1 129 ? 1.166   19.204  -1.730  1.00 15.00 ?  171 PRO A N    1  
ATOM   1914   C  CA   . PRO A 1 129 ? -0.223  19.388  -1.289  1.00 15.00 ?  171 PRO A CA   1  
ATOM   1915   C  C    . PRO A 1 129 ? -1.170  19.690  -2.450  1.00 15.00 ?  171 PRO A C    1  
ATOM   1916   O  O    . PRO A 1 129 ? -2.349  19.340  -2.408  1.00 15.00 ?  171 PRO A O    1  
ATOM   1917   C  CB   . PRO A 1 129 ? -0.141  20.586  -0.341  1.00 15.00 ?  171 PRO A CB   1  
ATOM   1918   C  CG   . PRO A 1 129 ? 1.273   20.624  0.122   1.00 15.00 ?  171 PRO A CG   1  
ATOM   1919   C  CD   . PRO A 1 129 ? 2.097   20.104  -1.023  1.00 15.00 ?  171 PRO A CD   1  
ATOM   1920   H  HA   . PRO A 1 129 ? -0.581  18.523  -0.749  1.00 15.00 ?  171 PRO A HA   1  
ATOM   1921   H  HB2  . PRO A 1 129 ? -0.400  21.493  -0.875  1.00 15.00 ?  171 PRO A HB2  1  
ATOM   1922   H  HB3  . PRO A 1 129 ? -0.804  20.444  0.497   1.00 15.00 ?  171 PRO A HB3  1  
ATOM   1923   H  HG2  . PRO A 1 129 ? 1.551   21.642  0.360   1.00 15.00 ?  171 PRO A HG2  1  
ATOM   1924   H  HG3  . PRO A 1 129 ? 1.395   19.988  0.986   1.00 15.00 ?  171 PRO A HG3  1  
ATOM   1925   H  HD2  . PRO A 1 129 ? 2.411   20.917  -1.664  1.00 15.00 ?  171 PRO A HD2  1  
ATOM   1926   H  HD3  . PRO A 1 129 ? 2.954   19.560  -0.653  1.00 15.00 ?  171 PRO A HD3  1  
ATOM   1927   N  N    . ALA A 1 130 ? -0.642  20.326  -3.490  1.00 15.00 ?  172 ALA A N    1  
ATOM   1928   C  CA   . ALA A 1 130 ? -1.430  20.676  -4.668  1.00 15.00 ?  172 ALA A CA   1  
ATOM   1929   C  C    . ALA A 1 130 ? -1.942  19.433  -5.392  1.00 15.00 ?  172 ALA A C    1  
ATOM   1930   O  O    . ALA A 1 130 ? -3.030  19.443  -5.967  1.00 15.00 ?  172 ALA A O    1  
ATOM   1931   C  CB   . ALA A 1 130 ? -0.602  21.524  -5.621  1.00 15.00 ?  172 ALA A CB   1  
ATOM   1932   H  H    . ALA A 1 130 ? 0.309   20.574  -3.460  1.00 15.00 ?  172 ALA A H    1  
ATOM   1933   H  HA   . ALA A 1 130 ? -2.273  21.266  -4.340  1.00 15.00 ?  172 ALA A HA   1  
ATOM   1934   H  HB1  . ALA A 1 130 ? -0.416  22.488  -5.175  1.00 15.00 ?  172 ALA A HB1  1  
ATOM   1935   H  HB2  . ALA A 1 130 ? -1.139  21.651  -6.548  1.00 15.00 ?  172 ALA A HB2  1  
ATOM   1936   H  HB3  . ALA A 1 130 ? 0.337   21.030  -5.814  1.00 15.00 ?  172 ALA A HB3  1  
ATOM   1937   N  N    . THR A 1 131 ? -1.156  18.365  -5.368  1.00 15.00 ?  173 THR A N    1  
ATOM   1938   C  CA   . THR A 1 131 ? -1.546  17.131  -6.027  1.00 15.00 ?  173 THR A CA   1  
ATOM   1939   C  C    . THR A 1 131 ? -2.243  16.181  -5.065  1.00 15.00 ?  173 THR A C    1  
ATOM   1940   O  O    . THR A 1 131 ? -2.766  15.147  -5.472  1.00 15.00 ?  173 THR A O    1  
ATOM   1941   C  CB   . THR A 1 131 ? -0.336  16.423  -6.667  1.00 15.00 ?  173 THR A CB   1  
ATOM   1942   O  OG1  . THR A 1 131 ? 0.836   16.599  -5.853  1.00 15.00 ?  173 THR A OG1  1  
ATOM   1943   C  CG2  . THR A 1 131 ? -0.075  16.967  -8.062  1.00 15.00 ?  173 THR A CG2  1  
ATOM   1944   H  H    . THR A 1 131 ? -0.297  18.408  -4.901  1.00 15.00 ?  173 THR A H    1  
ATOM   1945   H  HA   . THR A 1 131 ? -2.236  17.389  -6.817  1.00 15.00 ?  173 THR A HA   1  
ATOM   1946   H  HB   . THR A 1 131 ? -0.556  15.369  -6.743  1.00 15.00 ?  173 THR A HB   1  
ATOM   1947   H  HG1  . THR A 1 131 ? 0.583   16.598  -4.919  1.00 15.00 ?  173 THR A HG1  1  
ATOM   1948   H  HG21 . THR A 1 131 ? 0.576   16.289  -8.596  1.00 15.00 ?  173 THR A HG21 1  
ATOM   1949   H  HG22 . THR A 1 131 ? 0.399   17.935  -7.987  1.00 15.00 ?  173 THR A HG22 1  
ATOM   1950   H  HG23 . THR A 1 131 ? -1.009  17.065  -8.594  1.00 15.00 ?  173 THR A HG23 1  
ATOM   1951   N  N    . ALA A 1 132 ? -2.275  16.548  -3.794  1.00 15.00 ?  174 ALA A N    1  
ATOM   1952   C  CA   . ALA A 1 132 ? -2.909  15.720  -2.775  1.00 15.00 ?  174 ALA A CA   1  
ATOM   1953   C  C    . ALA A 1 132 ? -3.972  16.509  -2.010  1.00 15.00 ?  174 ALA A C    1  
ATOM   1954   O  O    . ALA A 1 132 ? -3.786  16.849  -0.837  1.00 15.00 ?  174 ALA A O    1  
ATOM   1955   C  CB   . ALA A 1 132 ? -1.863  15.158  -1.821  1.00 15.00 ?  174 ALA A CB   1  
ATOM   1956   H  H    . ALA A 1 132 ? -1.883  17.407  -3.534  1.00 15.00 ?  174 ALA A H    1  
ATOM   1957   H  HA   . ALA A 1 132 ? -3.388  14.889  -3.275  1.00 15.00 ?  174 ALA A HA   1  
ATOM   1958   H  HB1  . ALA A 1 132 ? -1.236  14.459  -2.351  1.00 15.00 ?  174 ALA A HB1  1  
ATOM   1959   H  HB2  . ALA A 1 132 ? -2.358  14.652  -1.004  1.00 15.00 ?  174 ALA A HB2  1  
ATOM   1960   H  HB3  . ALA A 1 132 ? -1.260  15.963  -1.432  1.00 15.00 ?  174 ALA A HB3  1  
ATOM   1961   N  N    . PRO A 1 133 ? -5.106  16.812  -2.667  1.00 15.00 ?  175 PRO A N    1  
ATOM   1962   C  CA   . PRO A 1 133 ? -6.194  17.559  -2.063  1.00 15.00 ?  175 PRO A CA   1  
ATOM   1963   C  C    . PRO A 1 133 ? -7.246  16.659  -1.414  1.00 15.00 ?  175 PRO A C    1  
ATOM   1964   O  O    . PRO A 1 133 ? -7.590  15.604  -1.952  1.00 15.00 ?  175 PRO A O    1  
ATOM   1965   C  CB   . PRO A 1 133 ? -6.790  18.300  -3.255  1.00 15.00 ?  175 PRO A CB   1  
ATOM   1966   C  CG   . PRO A 1 133 ? -6.459  17.481  -4.464  1.00 15.00 ?  175 PRO A CG   1  
ATOM   1967   C  CD   . PRO A 1 133 ? -5.420  16.460  -4.060  1.00 15.00 ?  175 PRO A CD   1  
ATOM   1968   H  HA   . PRO A 1 133 ? -5.831  18.272  -1.340  1.00 15.00 ?  175 PRO A HA   1  
ATOM   1969   H  HB2  . PRO A 1 133 ? -7.864  18.386  -3.130  1.00 15.00 ?  175 PRO A HB2  1  
ATOM   1970   H  HB3  . PRO A 1 133 ? -6.346  19.277  -3.341  1.00 15.00 ?  175 PRO A HB3  1  
ATOM   1971   H  HG2  . PRO A 1 133 ? -7.351  16.985  -4.823  1.00 15.00 ?  175 PRO A HG2  1  
ATOM   1972   H  HG3  . PRO A 1 133 ? -6.056  18.121  -5.232  1.00 15.00 ?  175 PRO A HG3  1  
ATOM   1973   H  HD2  . PRO A 1 133 ? -5.827  15.462  -4.121  1.00 15.00 ?  175 PRO A HD2  1  
ATOM   1974   H  HD3  . PRO A 1 133 ? -4.543  16.548  -4.687  1.00 15.00 ?  175 PRO A HD3  1  
ATOM   1975   N  N    . ASN A 1 134 ? -7.744  17.088  -0.256  1.00 15.00 ?  176 ASN A N    1  
ATOM   1976   C  CA   . ASN A 1 134 ? -8.771  16.351  0.489   1.00 15.00 ?  176 ASN A CA   1  
ATOM   1977   C  C    . ASN A 1 134 ? -8.290  14.955  0.874   1.00 15.00 ?  176 ASN A C    1  
ATOM   1978   O  O    . ASN A 1 134 ? -9.066  13.998  0.860   1.00 15.00 ?  176 ASN A O    1  
ATOM   1979   C  CB   . ASN A 1 134 ? -10.069 16.246  -0.326  1.00 15.00 ?  176 ASN A CB   1  
ATOM   1980   C  CG   . ASN A 1 134 ? -10.640 17.597  -0.709  1.00 15.00 ?  176 ASN A CG   1  
ATOM   1981   O  OD1  . ASN A 1 134 ? -10.524 18.570  0.036   1.00 15.00 ?  176 ASN A OD1  1  
ATOM   1982   N  ND2  . ASN A 1 134 ? -11.258 17.667  -1.875  1.00 15.00 ?  176 ASN A ND2  1  
ATOM   1983   H  H    . ASN A 1 134 ? -7.407  17.935  0.115   1.00 15.00 ?  176 ASN A H    1  
ATOM   1984   H  HA   . ASN A 1 134 ? -8.973  16.903  1.394   1.00 15.00 ?  176 ASN A HA   1  
ATOM   1985   H  HB2  . ASN A 1 134 ? -9.873  15.694  -1.232  1.00 15.00 ?  176 ASN A HB2  1  
ATOM   1986   H  HB3  . ASN A 1 134 ? -10.812 15.716  0.256   1.00 15.00 ?  176 ASN A HB3  1  
ATOM   1987   H  HD21 . ASN A 1 134 ? -11.311 16.851  -2.421  1.00 15.00 ?  176 ASN A HD21 1  
ATOM   1988   H  HD22 . ASN A 1 134 ? -11.643 18.528  -2.148  1.00 15.00 ?  176 ASN A HD22 1  
ATOM   1989   N  N    . PHE A 1 135 ? -7.022  14.838  1.239   1.00 15.00 ?  177 PHE A N    1  
ATOM   1990   C  CA   . PHE A 1 135 ? -6.454  13.549  1.621   1.00 15.00 ?  177 PHE A CA   1  
ATOM   1991   C  C    . PHE A 1 135 ? -6.725  13.244  3.091   1.00 15.00 ?  177 PHE A C    1  
ATOM   1992   O  O    . PHE A 1 135 ? -6.746  12.083  3.501   1.00 15.00 ?  177 PHE A O    1  
ATOM   1993   C  CB   . PHE A 1 135 ? -4.952  13.532  1.344   1.00 15.00 ?  177 PHE A CB   1  
ATOM   1994   C  CG   . PHE A 1 135 ? -4.598  12.873  0.042   1.00 15.00 ?  177 PHE A CG   1  
ATOM   1995   C  CD1  . PHE A 1 135 ? -5.195  13.278  -1.139  1.00 15.00 ?  177 PHE A CD1  1  
ATOM   1996   C  CD2  . PHE A 1 135 ? -3.672  11.846  0.000   1.00 15.00 ?  177 PHE A CD2  1  
ATOM   1997   C  CE1  . PHE A 1 135 ? -4.872  12.674  -2.337  1.00 15.00 ?  177 PHE A CE1  1  
ATOM   1998   C  CE2  . PHE A 1 135 ? -3.343  11.238  -1.195  1.00 15.00 ?  177 PHE A CE2  1  
ATOM   1999   C  CZ   . PHE A 1 135 ? -3.943  11.652  -2.365  1.00 15.00 ?  177 PHE A CZ   1  
ATOM   2000   H  H    . PHE A 1 135 ? -6.450  15.636  1.249   1.00 15.00 ?  177 PHE A H    1  
ATOM   2001   H  HA   . PHE A 1 135 ? -6.928  12.787  1.017   1.00 15.00 ?  177 PHE A HA   1  
ATOM   2002   H  HB2  . PHE A 1 135 ? -4.590  14.546  1.312   1.00 15.00 ?  177 PHE A HB2  1  
ATOM   2003   H  HB3  . PHE A 1 135 ? -4.452  12.996  2.138   1.00 15.00 ?  177 PHE A HB3  1  
ATOM   2004   H  HD1  . PHE A 1 135 ? -5.920  14.081  -1.118  1.00 15.00 ?  177 PHE A HD1  1  
ATOM   2005   H  HD2  . PHE A 1 135 ? -3.202  11.520  0.917   1.00 15.00 ?  177 PHE A HD2  1  
ATOM   2006   H  HE1  . PHE A 1 135 ? -5.348  12.999  -3.248  1.00 15.00 ?  177 PHE A HE1  1  
ATOM   2007   H  HE2  . PHE A 1 135 ? -2.616  10.443  -1.212  1.00 15.00 ?  177 PHE A HE2  1  
ATOM   2008   H  HZ   . PHE A 1 135 ? -3.691  11.179  -3.302  1.00 15.00 ?  177 PHE A HZ   1  
ATOM   2009   N  N    . GLY A 1 136 ? -6.933  14.287  3.879   1.00 15.00 ?  178 GLY A N    1  
ATOM   2010   C  CA   . GLY A 1 136 ? -7.206  14.109  5.292   1.00 15.00 ?  178 GLY A CA   1  
ATOM   2011   C  C    . GLY A 1 136 ? -5.996  13.619  6.066   1.00 15.00 ?  178 GLY A C    1  
ATOM   2012   O  O    . GLY A 1 136 ? -4.950  14.271  6.066   1.00 15.00 ?  178 GLY A O    1  
ATOM   2013   H  H    . GLY A 1 136 ? -6.891  15.191  3.498   1.00 15.00 ?  178 GLY A H    1  
ATOM   2014   H  HA2  . GLY A 1 136 ? -7.528  15.053  5.705   1.00 15.00 ?  178 GLY A HA2  1  
ATOM   2015   H  HA3  . GLY A 1 136 ? -8.004  13.391  5.402   1.00 15.00 ?  178 GLY A HA3  1  
ATOM   2016   N  N    . PRO A 1 137 ? -6.103  12.452  6.722   1.00 15.00 ?  179 PRO A N    1  
ATOM   2017   C  CA   . PRO A 1 137 ? -5.010  11.885  7.513   1.00 15.00 ?  179 PRO A CA   1  
ATOM   2018   C  C    . PRO A 1 137 ? -4.016  11.073  6.682   1.00 15.00 ?  179 PRO A C    1  
ATOM   2019   O  O    . PRO A 1 137 ? -3.112  10.448  7.230   1.00 15.00 ?  179 PRO A O    1  
ATOM   2020   C  CB   . PRO A 1 137 ? -5.753  10.977  8.489   1.00 15.00 ?  179 PRO A CB   1  
ATOM   2021   C  CG   . PRO A 1 137 ? -6.951  10.503  7.739   1.00 15.00 ?  179 PRO A CG   1  
ATOM   2022   C  CD   . PRO A 1 137 ? -7.307  11.595  6.760   1.00 15.00 ?  179 PRO A CD   1  
ATOM   2023   H  HA   . PRO A 1 137 ? -4.481  12.649  8.062   1.00 15.00 ?  179 PRO A HA   1  
ATOM   2024   H  HB2  . PRO A 1 137 ? -5.120  10.149  8.780   1.00 15.00 ?  179 PRO A HB2  1  
ATOM   2025   H  HB3  . PRO A 1 137 ? -6.061  11.538  9.358   1.00 15.00 ?  179 PRO A HB3  1  
ATOM   2026   H  HG2  . PRO A 1 137 ? -6.712  9.589   7.211   1.00 15.00 ?  179 PRO A HG2  1  
ATOM   2027   H  HG3  . PRO A 1 137 ? -7.771  10.339  8.418   1.00 15.00 ?  179 PRO A HG3  1  
ATOM   2028   H  HD2  . PRO A 1 137 ? -7.506  11.172  5.789   1.00 15.00 ?  179 PRO A HD2  1  
ATOM   2029   H  HD3  . PRO A 1 137 ? -8.165  12.148  7.115   1.00 15.00 ?  179 PRO A HD3  1  
ATOM   2030   N  N    . LEU A 1 138 ? -4.184  11.081  5.365   1.00 15.00 ?  180 LEU A N    1  
ATOM   2031   C  CA   . LEU A 1 138 ? -3.289  10.335  4.486   1.00 15.00 ?  180 LEU A CA   1  
ATOM   2032   C  C    . LEU A 1 138 ? -2.071  11.173  4.106   1.00 15.00 ?  180 LEU A C    1  
ATOM   2033   O  O    . LEU A 1 138 ? -2.143  12.033  3.229   1.00 15.00 ?  180 LEU A O    1  
ATOM   2034   C  CB   . LEU A 1 138 ? -4.018  9.881   3.217   1.00 15.00 ?  180 LEU A CB   1  
ATOM   2035   C  CG   . LEU A 1 138 ? -5.150  8.872   3.427   1.00 15.00 ?  180 LEU A CG   1  
ATOM   2036   C  CD1  . LEU A 1 138 ? -5.761  8.492   2.090   1.00 15.00 ?  180 LEU A CD1  1  
ATOM   2037   C  CD2  . LEU A 1 138 ? -4.645  7.625   4.136   1.00 15.00 ?  180 LEU A CD2  1  
ATOM   2038   H  H    . LEU A 1 138 ? -4.920  11.600  4.976   1.00 15.00 ?  180 LEU A H    1  
ATOM   2039   H  HA   . LEU A 1 138 ? -2.953  9.463   5.026   1.00 15.00 ?  180 LEU A HA   1  
ATOM   2040   H  HB2  . LEU A 1 138 ? -4.428  10.754  2.736   1.00 15.00 ?  180 LEU A HB2  1  
ATOM   2041   H  HB3  . LEU A 1 138 ? -3.291  9.434   2.554   1.00 15.00 ?  180 LEU A HB3  1  
ATOM   2042   H  HG   . LEU A 1 138 ? -5.923  9.321   4.037   1.00 15.00 ?  180 LEU A HG   1  
ATOM   2043   H  HD11 . LEU A 1 138 ? -6.400  9.290   1.743   1.00 15.00 ?  180 LEU A HD11 1  
ATOM   2044   H  HD12 . LEU A 1 138 ? -6.338  7.589   2.205   1.00 15.00 ?  180 LEU A HD12 1  
ATOM   2045   H  HD13 . LEU A 1 138 ? -4.973  8.326   1.370   1.00 15.00 ?  180 LEU A HD13 1  
ATOM   2046   H  HD21 . LEU A 1 138 ? -4.176  7.903   5.070   1.00 15.00 ?  180 LEU A HD21 1  
ATOM   2047   H  HD22 . LEU A 1 138 ? -3.925  7.122   3.507   1.00 15.00 ?  180 LEU A HD22 1  
ATOM   2048   H  HD23 . LEU A 1 138 ? -5.477  6.962   4.334   1.00 15.00 ?  180 LEU A HD23 1  
ATOM   2049   N  N    . LYS A 1 139 ? -0.959  10.924  4.778   1.00 15.00 ?  181 LYS A N    1  
ATOM   2050   C  CA   . LYS A 1 139 ? 0.275   11.637  4.496   1.00 15.00 ?  181 LYS A CA   1  
ATOM   2051   C  C    . LYS A 1 139 ? 1.176   10.770  3.623   1.00 15.00 ?  181 LYS A C    1  
ATOM   2052   O  O    . LYS A 1 139 ? 1.828   9.843   4.108   1.00 15.00 ?  181 LYS A O    1  
ATOM   2053   C  CB   . LYS A 1 139 ? 0.976   12.011  5.803   1.00 15.00 ?  181 LYS A CB   1  
ATOM   2054   C  CG   . LYS A 1 139 ? 1.684   13.356  5.753   1.00 15.00 ?  181 LYS A CG   1  
ATOM   2055   C  CD   . LYS A 1 139 ? 2.207   13.761  7.123   1.00 15.00 ?  181 LYS A CD   1  
ATOM   2056   C  CE   . LYS A 1 139 ? 2.908   15.111  7.077   1.00 15.00 ?  181 LYS A CE   1  
ATOM   2057   N  NZ   . LYS A 1 139 ? 1.975   16.222  6.734   1.00 15.00 1  181 LYS A NZ   1  
ATOM   2058   H  H    . LYS A 1 139 ? -0.969  10.236  5.484   1.00 15.00 ?  181 LYS A H    1  
ATOM   2059   H  HA   . LYS A 1 139 ? 0.024   12.537  3.956   1.00 15.00 ?  181 LYS A HA   1  
ATOM   2060   H  HB2  . LYS A 1 139 ? 0.241   12.044  6.592   1.00 15.00 ?  181 LYS A HB2  1  
ATOM   2061   H  HB3  . LYS A 1 139 ? 1.707   11.251  6.036   1.00 15.00 ?  181 LYS A HB3  1  
ATOM   2062   H  HG2  . LYS A 1 139 ? 2.518   13.289  5.071   1.00 15.00 ?  181 LYS A HG2  1  
ATOM   2063   H  HG3  . LYS A 1 139 ? 0.990   14.108  5.405   1.00 15.00 ?  181 LYS A HG3  1  
ATOM   2064   H  HD2  . LYS A 1 139 ? 1.376   13.820  7.810   1.00 15.00 ?  181 LYS A HD2  1  
ATOM   2065   H  HD3  . LYS A 1 139 ? 2.909   13.013  7.463   1.00 15.00 ?  181 LYS A HD3  1  
ATOM   2066   H  HE2  . LYS A 1 139 ? 3.346   15.308  8.043   1.00 15.00 ?  181 LYS A HE2  1  
ATOM   2067   H  HE3  . LYS A 1 139 ? 3.689   15.066  6.333   1.00 15.00 ?  181 LYS A HE3  1  
ATOM   2068   H  HZ1  . LYS A 1 139 ? 1.218   15.877  6.109   1.00 15.00 ?  181 LYS A HZ1  1  
ATOM   2069   H  HZ2  . LYS A 1 139 ? 2.487   16.988  6.245   1.00 15.00 ?  181 LYS A HZ2  1  
ATOM   2070   H  HZ3  . LYS A 1 139 ? 1.542   16.608  7.598   1.00 15.00 ?  181 LYS A HZ3  1  
ATOM   2071   N  N    . VAL A 1 140 ? 1.187   11.060  2.332   1.00 15.00 ?  182 VAL A N    1  
ATOM   2072   C  CA   . VAL A 1 140 ? 1.988   10.299  1.379   1.00 15.00 ?  182 VAL A CA   1  
ATOM   2073   C  C    . VAL A 1 140 ? 3.441   10.779  1.363   1.00 15.00 ?  182 VAL A C    1  
ATOM   2074   O  O    . VAL A 1 140 ? 3.710   11.979  1.406   1.00 15.00 ?  182 VAL A O    1  
ATOM   2075   C  CB   . VAL A 1 140 ? 1.400   10.396  -0.046  1.00 15.00 ?  182 VAL A CB   1  
ATOM   2076   C  CG1  . VAL A 1 140 ? 2.052   9.379   -0.968  1.00 15.00 ?  182 VAL A CG1  1  
ATOM   2077   C  CG2  . VAL A 1 140 ? -0.110  10.197  -0.017  1.00 15.00 ?  182 VAL A CG2  1  
ATOM   2078   H  H    . VAL A 1 140 ? 0.644   11.806  2.010   1.00 15.00 ?  182 VAL A H    1  
ATOM   2079   H  HA   . VAL A 1 140 ? 1.966   9.262   1.685   1.00 15.00 ?  182 VAL A HA   1  
ATOM   2080   H  HB   . VAL A 1 140 ? 1.604   11.384  -0.432  1.00 15.00 ?  182 VAL A HB   1  
ATOM   2081   H  HG11 . VAL A 1 140 ? 3.125   9.469   -0.898  1.00 15.00 ?  182 VAL A HG11 1  
ATOM   2082   H  HG12 . VAL A 1 140 ? 1.739   9.560   -1.985  1.00 15.00 ?  182 VAL A HG12 1  
ATOM   2083   H  HG13 . VAL A 1 140 ? 1.754   8.383   -0.674  1.00 15.00 ?  182 VAL A HG13 1  
ATOM   2084   H  HG21 . VAL A 1 140 ? -0.585  11.086  0.368   1.00 15.00 ?  182 VAL A HG21 1  
ATOM   2085   H  HG22 . VAL A 1 140 ? -0.348  9.358   0.620   1.00 15.00 ?  182 VAL A HG22 1  
ATOM   2086   H  HG23 . VAL A 1 140 ? -0.467  10.003  -1.017  1.00 15.00 ?  182 VAL A HG23 1  
ATOM   2087   N  N    . PHE A 1 141 ? 4.368   9.830   1.310   1.00 15.00 ?  183 PHE A N    1  
ATOM   2088   C  CA   . PHE A 1 141 ? 5.789   10.136  1.289   1.00 15.00 ?  183 PHE A CA   1  
ATOM   2089   C  C    . PHE A 1 141 ? 6.520   9.225   0.309   1.00 15.00 ?  183 PHE A C    1  
ATOM   2090   O  O    . PHE A 1 141 ? 6.244   8.026   0.236   1.00 15.00 ?  183 PHE A O    1  
ATOM   2091   C  CB   . PHE A 1 141 ? 6.379   9.976   2.695   1.00 15.00 ?  183 PHE A CB   1  
ATOM   2092   C  CG   . PHE A 1 141 ? 7.869   10.139  2.759   1.00 15.00 ?  183 PHE A CG   1  
ATOM   2093   C  CD1  . PHE A 1 141 ? 8.446   11.396  2.680   1.00 15.00 ?  183 PHE A CD1  1  
ATOM   2094   C  CD2  . PHE A 1 141 ? 8.693   9.036   2.901   1.00 15.00 ?  183 PHE A CD2  1  
ATOM   2095   C  CE1  . PHE A 1 141 ? 9.815   11.547  2.739   1.00 15.00 ?  183 PHE A CE1  1  
ATOM   2096   C  CE2  . PHE A 1 141 ? 10.065  9.183   2.961   1.00 15.00 ?  183 PHE A CE2  1  
ATOM   2097   C  CZ   . PHE A 1 141 ? 10.625  10.440  2.880   1.00 15.00 ?  183 PHE A CZ   1  
ATOM   2098   H  H    . PHE A 1 141 ? 4.085   8.888   1.278   1.00 15.00 ?  183 PHE A H    1  
ATOM   2099   H  HA   . PHE A 1 141 ? 5.909   11.162  0.968   1.00 15.00 ?  183 PHE A HA   1  
ATOM   2100   H  HB2  . PHE A 1 141 ? 5.942   10.715  3.346   1.00 15.00 ?  183 PHE A HB2  1  
ATOM   2101   H  HB3  . PHE A 1 141 ? 6.137   8.990   3.064   1.00 15.00 ?  183 PHE A HB3  1  
ATOM   2102   H  HD1  . PHE A 1 141 ? 7.812   12.262  2.572   1.00 15.00 ?  183 PHE A HD1  1  
ATOM   2103   H  HD2  . PHE A 1 141 ? 8.256   8.049   2.964   1.00 15.00 ?  183 PHE A HD2  1  
ATOM   2104   H  HE1  . PHE A 1 141 ? 10.253  12.530  2.676   1.00 15.00 ?  183 PHE A HE1  1  
ATOM   2105   H  HE2  . PHE A 1 141 ? 10.701  8.315   3.072   1.00 15.00 ?  183 PHE A HE2  1  
ATOM   2106   H  HZ   . PHE A 1 141 ? 11.697  10.558  2.927   1.00 15.00 ?  183 PHE A HZ   1  
ATOM   2107   N  N    . TYR A 1 142 ? 7.434   9.807   -0.453  1.00 15.00 ?  184 TYR A N    1  
ATOM   2108   C  CA   . TYR A 1 142 ? 8.234   9.066   -1.415  1.00 15.00 ?  184 TYR A CA   1  
ATOM   2109   C  C    . TYR A 1 142 ? 9.639   8.862   -0.845  1.00 15.00 ?  184 TYR A C    1  
ATOM   2110   O  O    . TYR A 1 142 ? 10.433  9.801   -0.774  1.00 15.00 ?  184 TYR A O    1  
ATOM   2111   C  CB   . TYR A 1 142 ? 8.293   9.825   -2.747  1.00 15.00 ?  184 TYR A CB   1  
ATOM   2112   C  CG   . TYR A 1 142 ? 9.184   9.196   -3.798  1.00 15.00 ?  184 TYR A CG   1  
ATOM   2113   C  CD1  . TYR A 1 142 ? 8.934   7.919   -4.287  1.00 15.00 ?  184 TYR A CD1  1  
ATOM   2114   C  CD2  . TYR A 1 142 ? 10.273  9.889   -4.311  1.00 15.00 ?  184 TYR A CD2  1  
ATOM   2115   C  CE1  . TYR A 1 142 ? 9.743   7.351   -5.255  1.00 15.00 ?  184 TYR A CE1  1  
ATOM   2116   C  CE2  . TYR A 1 142 ? 11.087  9.328   -5.278  1.00 15.00 ?  184 TYR A CE2  1  
ATOM   2117   C  CZ   . TYR A 1 142 ? 10.818  8.058   -5.748  1.00 15.00 ?  184 TYR A CZ   1  
ATOM   2118   O  OH   . TYR A 1 142 ? 11.624  7.498   -6.720  1.00 15.00 ?  184 TYR A OH   1  
ATOM   2119   H  H    . TYR A 1 142 ? 7.580   10.776  -0.362  1.00 15.00 ?  184 TYR A H    1  
ATOM   2120   H  HA   . TYR A 1 142 ? 7.771   8.103   -1.570  1.00 15.00 ?  184 TYR A HA   1  
ATOM   2121   H  HB2  . TYR A 1 142 ? 7.298   9.885   -3.161  1.00 15.00 ?  184 TYR A HB2  1  
ATOM   2122   H  HB3  . TYR A 1 142 ? 8.656   10.826  -2.559  1.00 15.00 ?  184 TYR A HB3  1  
ATOM   2123   H  HD1  . TYR A 1 142 ? 8.095   7.365   -3.902  1.00 15.00 ?  184 TYR A HD1  1  
ATOM   2124   H  HD2  . TYR A 1 142 ? 10.486  10.880  -3.942  1.00 15.00 ?  184 TYR A HD2  1  
ATOM   2125   H  HE1  . TYR A 1 142 ? 9.529   6.358   -5.622  1.00 15.00 ?  184 TYR A HE1  1  
ATOM   2126   H  HE2  . TYR A 1 142 ? 11.928  9.887   -5.664  1.00 15.00 ?  184 TYR A HE2  1  
ATOM   2127   H  HH   . TYR A 1 142 ? 11.087  6.928   -7.297  1.00 15.00 ?  184 TYR A HH   1  
ATOM   2128   N  N    . PRO A 1 143 ? 9.954   7.636   -0.405  1.00 15.00 ?  185 PRO A N    1  
ATOM   2129   C  CA   . PRO A 1 143 ? 11.261  7.318   0.183   1.00 15.00 ?  185 PRO A CA   1  
ATOM   2130   C  C    . PRO A 1 143 ? 12.388  7.250   -0.844  1.00 15.00 ?  185 PRO A C    1  
ATOM   2131   O  O    . PRO A 1 143 ? 13.561  7.381   -0.495  1.00 15.00 ?  185 PRO A O    1  
ATOM   2132   C  CB   . PRO A 1 143 ? 11.033  5.947   0.816   1.00 15.00 ?  185 PRO A CB   1  
ATOM   2133   C  CG   . PRO A 1 143 ? 9.931   5.330   0.030   1.00 15.00 ?  185 PRO A CG   1  
ATOM   2134   C  CD   . PRO A 1 143 ? 9.055   6.461   -0.431  1.00 15.00 ?  185 PRO A CD   1  
ATOM   2135   H  HA   . PRO A 1 143 ? 11.527  8.025   0.951   1.00 15.00 ?  185 PRO A HA   1  
ATOM   2136   H  HB2  . PRO A 1 143 ? 11.936  5.356   0.743   1.00 15.00 ?  185 PRO A HB2  1  
ATOM   2137   H  HB3  . PRO A 1 143 ? 10.738  6.057   1.848   1.00 15.00 ?  185 PRO A HB3  1  
ATOM   2138   H  HG2  . PRO A 1 143 ? 10.342  4.799   -0.820  1.00 15.00 ?  185 PRO A HG2  1  
ATOM   2139   H  HG3  . PRO A 1 143 ? 9.365   4.658   0.655   1.00 15.00 ?  185 PRO A HG3  1  
ATOM   2140   H  HD2  . PRO A 1 143 ? 8.696   6.273   -1.433  1.00 15.00 ?  185 PRO A HD2  1  
ATOM   2141   H  HD3  . PRO A 1 143 ? 8.224   6.595   0.248   1.00 15.00 ?  185 PRO A HD3  1  
ATOM   2142   N  N    . GLY A 1 144 ? 12.035  7.034   -2.102  1.00 15.00 ?  186 GLY A N    1  
ATOM   2143   C  CA   . GLY A 1 144 ? 13.036  6.950   -3.144  1.00 15.00 ?  186 GLY A CA   1  
ATOM   2144   C  C    . GLY A 1 144 ? 13.025  5.602   -3.831  1.00 15.00 ?  186 GLY A C    1  
ATOM   2145   O  O    . GLY A 1 144 ? 12.065  4.843   -3.688  1.00 15.00 ?  186 GLY A O    1  
ATOM   2146   H  H    . GLY A 1 144 ? 11.091  6.918   -2.322  1.00 15.00 ?  186 GLY A H    1  
ATOM   2147   H  HA2  . GLY A 1 144 ? 12.842  7.718   -3.878  1.00 15.00 ?  186 GLY A HA2  1  
ATOM   2148   H  HA3  . GLY A 1 144 ? 14.011  7.113   -2.709  1.00 15.00 ?  186 GLY A HA3  1  
ATOM   2149   N  N    . PRO A 1 145 ? 14.082  5.275   -4.591  1.00 15.00 ?  187 PRO A N    1  
ATOM   2150   C  CA   . PRO A 1 145 ? 14.178  4.008   -5.308  1.00 15.00 ?  187 PRO A CA   1  
ATOM   2151   C  C    . PRO A 1 145 ? 14.421  2.833   -4.368  1.00 15.00 ?  187 PRO A C    1  
ATOM   2152   O  O    . PRO A 1 145 ? 15.419  2.790   -3.645  1.00 15.00 ?  187 PRO A O    1  
ATOM   2153   C  CB   . PRO A 1 145 ? 15.376  4.203   -6.252  1.00 15.00 ?  187 PRO A CB   1  
ATOM   2154   C  CG   . PRO A 1 145 ? 15.759  5.644   -6.145  1.00 15.00 ?  187 PRO A CG   1  
ATOM   2155   C  CD   . PRO A 1 145 ? 15.267  6.112   -4.806  1.00 15.00 ?  187 PRO A CD   1  
ATOM   2156   H  HA   . PRO A 1 145 ? 13.285  3.817   -5.887  1.00 15.00 ?  187 PRO A HA   1  
ATOM   2157   H  HB2  . PRO A 1 145 ? 16.193  3.563   -5.944  1.00 15.00 ?  187 PRO A HB2  1  
ATOM   2158   H  HB3  . PRO A 1 145 ? 15.085  3.973   -7.264  1.00 15.00 ?  187 PRO A HB3  1  
ATOM   2159   H  HG2  . PRO A 1 145 ? 16.833  5.741   -6.204  1.00 15.00 ?  187 PRO A HG2  1  
ATOM   2160   H  HG3  . PRO A 1 145 ? 15.284  6.212   -6.930  1.00 15.00 ?  187 PRO A HG3  1  
ATOM   2161   H  HD2  . PRO A 1 145 ? 16.013  5.935   -4.042  1.00 15.00 ?  187 PRO A HD2  1  
ATOM   2162   H  HD3  . PRO A 1 145 ? 14.999  7.157   -4.843  1.00 15.00 ?  187 PRO A HD3  1  
ATOM   2163   N  N    . GLY A 1 146 ? 13.501  1.884   -4.379  1.00 15.00 ?  188 GLY A N    1  
ATOM   2164   C  CA   . GLY A 1 146 ? 13.630  0.716   -3.534  1.00 15.00 ?  188 GLY A CA   1  
ATOM   2165   C  C    . GLY A 1 146 ? 13.165  -0.530  -4.251  1.00 15.00 ?  188 GLY A C    1  
ATOM   2166   O  O    . GLY A 1 146 ? 13.907  -1.091  -5.050  1.00 15.00 ?  188 GLY A O    1  
ATOM   2167   H  H    . GLY A 1 146 ? 12.724  1.971   -4.978  1.00 15.00 ?  188 GLY A H    1  
ATOM   2168   H  HA2  . GLY A 1 146 ? 14.666  0.596   -3.256  1.00 15.00 ?  188 GLY A HA2  1  
ATOM   2169   H  HA3  . GLY A 1 146 ? 13.034  0.856   -2.643  1.00 15.00 ?  188 GLY A HA3  1  
ATOM   2170   N  N    . HIS A 1 147 ? 11.936  -0.957  -3.966  1.00 15.00 ?  189 HIS A N    1  
ATOM   2171   C  CA   . HIS A 1 147 ? 11.351  -2.128  -4.620  1.00 15.00 ?  189 HIS A CA   1  
ATOM   2172   C  C    . HIS A 1 147 ? 11.145  -1.789  -6.093  1.00 15.00 ?  189 HIS A C    1  
ATOM   2173   O  O    . HIS A 1 147 ? 11.256  -2.637  -6.975  1.00 15.00 ?  189 HIS A O    1  
ATOM   2174   C  CB   . HIS A 1 147 ? 10.023  -2.510  -3.935  1.00 15.00 ?  189 HIS A CB   1  
ATOM   2175   C  CG   . HIS A 1 147 ? 9.165   -3.480  -4.699  1.00 15.00 ?  189 HIS A CG   1  
ATOM   2176   N  ND1  . HIS A 1 147 ? 9.621   -4.650  -5.271  1.00 15.00 ?  189 HIS A ND1  1  
ATOM   2177   C  CD2  . HIS A 1 147 ? 7.836   -3.430  -4.963  1.00 15.00 ?  189 HIS A CD2  1  
ATOM   2178   C  CE1  . HIS A 1 147 ? 8.577   -5.258  -5.849  1.00 15.00 ?  189 HIS A CE1  1  
ATOM   2179   N  NE2  . HIS A 1 147 ? 7.467   -4.557  -5.693  1.00 15.00 ?  189 HIS A NE2  1  
ATOM   2180   H  H    . HIS A 1 147 ? 11.400  -0.455  -3.315  1.00 15.00 ?  189 HIS A H    1  
ATOM   2181   H  HA   . HIS A 1 147 ? 12.050  -2.945  -4.537  1.00 15.00 ?  189 HIS A HA   1  
ATOM   2182   H  HB2  . HIS A 1 147 ? 10.241  -2.955  -2.975  1.00 15.00 ?  189 HIS A HB2  1  
ATOM   2183   H  HB3  . HIS A 1 147 ? 9.444   -1.611  -3.777  1.00 15.00 ?  189 HIS A HB3  1  
ATOM   2184   H  HD1  . HIS A 1 147 ? 10.549  -4.969  -5.278  1.00 15.00 ?  189 HIS A HD1  1  
ATOM   2185   H  HD2  . HIS A 1 147 ? 7.161   -2.645  -4.664  1.00 15.00 ?  189 HIS A HD2  1  
ATOM   2186   H  HE1  . HIS A 1 147 ? 8.632   -6.195  -6.377  1.00 15.00 ?  189 HIS A HE1  1  
ATOM   2187   N  N    . THR A 1 148 ? 10.839  -0.523  -6.323  1.00 15.00 ?  190 THR A N    1  
ATOM   2188   C  CA   . THR A 1 148 ? 10.659  0.030   -7.650  1.00 15.00 ?  190 THR A CA   1  
ATOM   2189   C  C    . THR A 1 148 ? 11.103  1.486   -7.611  1.00 15.00 ?  190 THR A C    1  
ATOM   2190   O  O    . THR A 1 148 ? 11.559  1.968   -6.567  1.00 15.00 ?  190 THR A O    1  
ATOM   2191   C  CB   . THR A 1 148 ? 9.200   -0.052  -8.150  1.00 15.00 ?  190 THR A CB   1  
ATOM   2192   O  OG1  . THR A 1 148 ? 8.296   0.409   -7.138  1.00 15.00 ?  190 THR A OG1  1  
ATOM   2193   C  CG2  . THR A 1 148 ? 8.835   -1.474  -8.558  1.00 15.00 ?  190 THR A CG2  1  
ATOM   2194   H  H    . THR A 1 148 ? 10.730  0.078   -5.554  1.00 15.00 ?  190 THR A H    1  
ATOM   2195   H  HA   . THR A 1 148 ? 11.296  -0.517  -8.332  1.00 15.00 ?  190 THR A HA   1  
ATOM   2196   H  HB   . THR A 1 148 ? 9.104   0.588   -9.018  1.00 15.00 ?  190 THR A HB   1  
ATOM   2197   H  HG1  . THR A 1 148 ? 7.573   0.904   -7.566  1.00 15.00 ?  190 THR A HG1  1  
ATOM   2198   H  HG21 . THR A 1 148 ? 9.639   -1.897  -9.144  1.00 15.00 ?  190 THR A HG21 1  
ATOM   2199   H  HG22 . THR A 1 148 ? 7.930   -1.461  -9.147  1.00 15.00 ?  190 THR A HG22 1  
ATOM   2200   H  HG23 . THR A 1 148 ? 8.681   -2.074  -7.674  1.00 15.00 ?  190 THR A HG23 1  
ATOM   2201   N  N    . SER A 1 149 ? 10.989  2.188   -8.722  1.00 15.00 ?  191 SER A N    1  
ATOM   2202   C  CA   . SER A 1 149 ? 11.386  3.583   -8.769  1.00 15.00 ?  191 SER A CA   1  
ATOM   2203   C  C    . SER A 1 149 ? 10.194  4.494   -8.495  1.00 15.00 ?  191 SER A C    1  
ATOM   2204   O  O    . SER A 1 149 ? 10.350  5.701   -8.302  1.00 15.00 ?  191 SER A O    1  
ATOM   2205   C  CB   . SER A 1 149 ? 11.977  3.888   -10.143 1.00 15.00 ?  191 SER A CB   1  
ATOM   2206   O  OG   . SER A 1 149 ? 11.886  2.752   -10.989 1.00 15.00 ?  191 SER A OG   1  
ATOM   2207   H  H    . SER A 1 149 ? 10.653  1.759   -9.539  1.00 15.00 ?  191 SER A H    1  
ATOM   2208   H  HA   . SER A 1 149 ? 12.142  3.744   -8.014  1.00 15.00 ?  191 SER A HA   1  
ATOM   2209   H  HB2  . SER A 1 149 ? 11.433  4.705   -10.596 1.00 15.00 ?  191 SER A HB2  1  
ATOM   2210   H  HB3  . SER A 1 149 ? 13.016  4.162   -10.035 1.00 15.00 ?  191 SER A HB3  1  
ATOM   2211   H  HG   . SER A 1 149 ? 12.622  2.758   -11.615 1.00 15.00 ?  191 SER A HG   1  
ATOM   2212   N  N    . ASP A 1 150 ? 9.006   3.900   -8.454  1.00 15.00 ?  192 ASP A N    1  
ATOM   2213   C  CA   . ASP A 1 150 ? 7.774   4.651   -8.246  1.00 15.00 ?  192 ASP A CA   1  
ATOM   2214   C  C    . ASP A 1 150 ? 7.132   4.359   -6.892  1.00 15.00 ?  192 ASP A C    1  
ATOM   2215   O  O    . ASP A 1 150 ? 6.144   4.997   -6.531  1.00 15.00 ?  192 ASP A O    1  
ATOM   2216   C  CB   . ASP A 1 150 ? 6.773   4.308   -9.355  1.00 15.00 ?  192 ASP A CB   1  
ATOM   2217   C  CG   . ASP A 1 150 ? 6.204   2.905   -9.208  1.00 15.00 ?  192 ASP A CG   1  
ATOM   2218   O  OD1  . ASP A 1 150 ? 6.985   1.968   -8.914  1.00 15.00 ?  192 ASP A OD1  1  
ATOM   2219   O  OD2  . ASP A 1 150 ? 4.980   2.735   -9.388  1.00 15.00 -1 192 ASP A OD2  1  
ATOM   2220   H  H    . ASP A 1 150 ? 8.951   2.927   -8.571  1.00 15.00 ?  192 ASP A H    1  
ATOM   2221   H  HA   . ASP A 1 150 ? 8.012   5.702   -8.305  1.00 15.00 ?  192 ASP A HA   1  
ATOM   2222   H  HB2  . ASP A 1 150 ? 5.955   5.015   -9.329  1.00 15.00 ?  192 ASP A HB2  1  
ATOM   2223   H  HB3  . ASP A 1 150 ? 7.269   4.375   -10.312 1.00 15.00 ?  192 ASP A HB3  1  
ATOM   2224   N  N    . ASN A 1 151 ? 7.699   3.418   -6.140  1.00 15.00 ?  193 ASN A N    1  
ATOM   2225   C  CA   . ASN A 1 151 ? 7.134   3.039   -4.840  1.00 15.00 ?  193 ASN A CA   1  
ATOM   2226   C  C    . ASN A 1 151 ? 7.067   4.204   -3.858  1.00 15.00 ?  193 ASN A C    1  
ATOM   2227   O  O    . ASN A 1 151 ? 8.007   4.989   -3.721  1.00 15.00 ?  193 ASN A O    1  
ATOM   2228   C  CB   . ASN A 1 151 ? 7.885   1.850   -4.203  1.00 15.00 ?  193 ASN A CB   1  
ATOM   2229   C  CG   . ASN A 1 151 ? 9.399   2.014   -4.096  1.00 15.00 ?  193 ASN A CG   1  
ATOM   2230   O  OD1  . ASN A 1 151 ? 10.123  1.025   -4.034  1.00 15.00 ?  193 ASN A OD1  1  
ATOM   2231   N  ND2  . ASN A 1 151 ? 9.892   3.238   -4.053  1.00 15.00 ?  193 ASN A ND2  1  
ATOM   2232   H  H    . ASN A 1 151 ? 8.506   2.967   -6.463  1.00 15.00 ?  193 ASN A H    1  
ATOM   2233   H  HA   . ASN A 1 151 ? 6.122   2.726   -5.028  1.00 15.00 ?  193 ASN A HA   1  
ATOM   2234   H  HB2  . ASN A 1 151 ? 7.501   1.697   -3.209  1.00 15.00 ?  193 ASN A HB2  1  
ATOM   2235   H  HB3  . ASN A 1 151 ? 7.685   0.963   -4.790  1.00 15.00 ?  193 ASN A HB3  1  
ATOM   2236   H  HD21 . ASN A 1 151 ? 9.261   3.996   -4.090  1.00 15.00 ?  193 ASN A HD21 1  
ATOM   2237   H  HD22 . ASN A 1 151 ? 10.866  3.348   -3.985  1.00 15.00 ?  193 ASN A HD22 1  
ATOM   2238   N  N    . ILE A 1 152 ? 5.933   4.318   -3.192  1.00 15.00 ?  194 ILE A N    1  
ATOM   2239   C  CA   . ILE A 1 152 ? 5.726   5.359   -2.205  1.00 15.00 ?  194 ILE A CA   1  
ATOM   2240   C  C    . ILE A 1 152 ? 5.200   4.750   -0.915  1.00 15.00 ?  194 ILE A C    1  
ATOM   2241   O  O    . ILE A 1 152 ? 4.910   3.552   -0.858  1.00 15.00 ?  194 ILE A O    1  
ATOM   2242   C  CB   . ILE A 1 152 ? 4.746   6.445   -2.709  1.00 15.00 ?  194 ILE A CB   1  
ATOM   2243   C  CG1  . ILE A 1 152 ? 3.390   5.828   -3.070  1.00 15.00 ?  194 ILE A CG1  1  
ATOM   2244   C  CG2  . ILE A 1 152 ? 5.342   7.166   -3.912  1.00 15.00 ?  194 ILE A CG2  1  
ATOM   2245   C  CD1  . ILE A 1 152 ? 2.398   6.822   -3.646  1.00 15.00 ?  194 ILE A CD1  1  
ATOM   2246   H  H    . ILE A 1 152 ? 5.203   3.686   -3.380  1.00 15.00 ?  194 ILE A H    1  
ATOM   2247   H  HA   . ILE A 1 152 ? 6.681   5.826   -2.008  1.00 15.00 ?  194 ILE A HA   1  
ATOM   2248   H  HB   . ILE A 1 152 ? 4.608   7.168   -1.917  1.00 15.00 ?  194 ILE A HB   1  
ATOM   2249   H  HG12 . ILE A 1 152 ? 3.544   5.051   -3.803  1.00 15.00 ?  194 ILE A HG12 1  
ATOM   2250   H  HG13 . ILE A 1 152 ? 2.951   5.396   -2.180  1.00 15.00 ?  194 ILE A HG13 1  
ATOM   2251   H  HG21 . ILE A 1 152 ? 4.560   7.685   -4.446  1.00 15.00 ?  194 ILE A HG21 1  
ATOM   2252   H  HG22 . ILE A 1 152 ? 5.808   6.446   -4.567  1.00 15.00 ?  194 ILE A HG22 1  
ATOM   2253   H  HG23 . ILE A 1 152 ? 6.080   7.878   -3.575  1.00 15.00 ?  194 ILE A HG23 1  
ATOM   2254   H  HD11 . ILE A 1 152 ? 1.897   7.342   -2.845  1.00 15.00 ?  194 ILE A HD11 1  
ATOM   2255   H  HD12 . ILE A 1 152 ? 1.669   6.297   -4.247  1.00 15.00 ?  194 ILE A HD12 1  
ATOM   2256   H  HD13 . ILE A 1 152 ? 2.924   7.535   -4.261  1.00 15.00 ?  194 ILE A HD13 1  
ATOM   2257   N  N    . THR A 1 153 ? 5.100   5.564   0.116   1.00 15.00 ?  195 THR A N    1  
ATOM   2258   C  CA   . THR A 1 153 ? 4.610   5.116   1.404   1.00 15.00 ?  195 THR A CA   1  
ATOM   2259   C  C    . THR A 1 153 ? 3.540   6.080   1.911   1.00 15.00 ?  195 THR A C    1  
ATOM   2260   O  O    . THR A 1 153 ? 3.516   7.245   1.505   1.00 15.00 ?  195 THR A O    1  
ATOM   2261   C  CB   . THR A 1 153 ? 5.760   5.013   2.426   1.00 15.00 ?  195 THR A CB   1  
ATOM   2262   O  OG1  . THR A 1 153 ? 6.606   6.171   2.342   1.00 15.00 ?  195 THR A OG1  1  
ATOM   2263   C  CG2  . THR A 1 153 ? 6.592   3.759   2.177   1.00 15.00 ?  195 THR A CG2  1  
ATOM   2264   H  H    . THR A 1 153 ? 5.361   6.505   0.011   1.00 15.00 ?  195 THR A H    1  
ATOM   2265   H  HA   . THR A 1 153 ? 4.172   4.136   1.275   1.00 15.00 ?  195 THR A HA   1  
ATOM   2266   H  HB   . THR A 1 153 ? 5.336   4.953   3.417   1.00 15.00 ?  195 THR A HB   1  
ATOM   2267   H  HG1  . THR A 1 153 ? 6.257   6.778   1.677   1.00 15.00 ?  195 THR A HG1  1  
ATOM   2268   H  HG21 . THR A 1 153 ? 5.945   2.895   2.154   1.00 15.00 ?  195 THR A HG21 1  
ATOM   2269   H  HG22 . THR A 1 153 ? 7.315   3.645   2.970   1.00 15.00 ?  195 THR A HG22 1  
ATOM   2270   H  HG23 . THR A 1 153 ? 7.109   3.849   1.231   1.00 15.00 ?  195 THR A HG23 1  
ATOM   2271   N  N    . VAL A 1 154 ? 2.653   5.607   2.779   1.00 15.00 ?  196 VAL A N    1  
ATOM   2272   C  CA   . VAL A 1 154 ? 1.588   6.452   3.301   1.00 15.00 ?  196 VAL A CA   1  
ATOM   2273   C  C    . VAL A 1 154 ? 1.492   6.336   4.818   1.00 15.00 ?  196 VAL A C    1  
ATOM   2274   O  O    . VAL A 1 154 ? 1.447   5.235   5.360   1.00 15.00 ?  196 VAL A O    1  
ATOM   2275   C  CB   . VAL A 1 154 ? 0.213   6.096   2.682   1.00 15.00 ?  196 VAL A CB   1  
ATOM   2276   C  CG1  . VAL A 1 154 ? -0.854  7.074   3.147   1.00 15.00 ?  196 VAL A CG1  1  
ATOM   2277   C  CG2  . VAL A 1 154 ? 0.286   6.071   1.159   1.00 15.00 ?  196 VAL A CG2  1  
ATOM   2278   H  H    . VAL A 1 154 ? 2.723   4.677   3.085   1.00 15.00 ?  196 VAL A H    1  
ATOM   2279   H  HA   . VAL A 1 154 ? 1.817   7.474   3.043   1.00 15.00 ?  196 VAL A HA   1  
ATOM   2280   H  HB   . VAL A 1 154 ? -0.066  5.110   3.023   1.00 15.00 ?  196 VAL A HB   1  
ATOM   2281   H  HG11 . VAL A 1 154 ? -1.714  7.010   2.499   1.00 15.00 ?  196 VAL A HG11 1  
ATOM   2282   H  HG12 . VAL A 1 154 ? -0.455  8.076   3.120   1.00 15.00 ?  196 VAL A HG12 1  
ATOM   2283   H  HG13 . VAL A 1 154 ? -1.147  6.832   4.157   1.00 15.00 ?  196 VAL A HG13 1  
ATOM   2284   H  HG21 . VAL A 1 154 ? -0.700  5.904   0.752   1.00 15.00 ?  196 VAL A HG21 1  
ATOM   2285   H  HG22 . VAL A 1 154 ? 0.945   5.275   0.844   1.00 15.00 ?  196 VAL A HG22 1  
ATOM   2286   H  HG23 . VAL A 1 154 ? 0.666   7.015   0.802   1.00 15.00 ?  196 VAL A HG23 1  
ATOM   2287   N  N    . GLY A 1 155 ? 1.479   7.477   5.490   1.00 15.00 ?  197 GLY A N    1  
ATOM   2288   C  CA   . GLY A 1 155 ? 1.363   7.495   6.931   1.00 15.00 ?  197 GLY A CA   1  
ATOM   2289   C  C    . GLY A 1 155 ? -0.021  7.933   7.360   1.00 15.00 ?  197 GLY A C    1  
ATOM   2290   O  O    . GLY A 1 155 ? -0.611  8.823   6.741   1.00 15.00 ?  197 GLY A O    1  
ATOM   2291   H  H    . GLY A 1 155 ? 1.545   8.329   4.999   1.00 15.00 ?  197 GLY A H    1  
ATOM   2292   H  HA2  . GLY A 1 155 ? 1.555   6.505   7.316   1.00 15.00 ?  197 GLY A HA2  1  
ATOM   2293   H  HA3  . GLY A 1 155 ? 2.091   8.183   7.339   1.00 15.00 ?  197 GLY A HA3  1  
ATOM   2294   N  N    . ILE A 1 156 ? -0.547  7.308   8.400   1.00 15.00 ?  198 ILE A N    1  
ATOM   2295   C  CA   . ILE A 1 156 ? -1.875  7.645   8.894   1.00 15.00 ?  198 ILE A CA   1  
ATOM   2296   C  C    . ILE A 1 156 ? -1.776  8.672   10.016  1.00 15.00 ?  198 ILE A C    1  
ATOM   2297   O  O    . ILE A 1 156 ? -1.591  8.318   11.185  1.00 15.00 ?  198 ILE A O    1  
ATOM   2298   C  CB   . ILE A 1 156 ? -2.643  6.398   9.394   1.00 15.00 ?  198 ILE A CB   1  
ATOM   2299   C  CG1  . ILE A 1 156 ? -2.492  5.234   8.408   1.00 15.00 ?  198 ILE A CG1  1  
ATOM   2300   C  CG2  . ILE A 1 156 ? -4.118  6.726   9.598   1.00 15.00 ?  198 ILE A CG2  1  
ATOM   2301   C  CD1  . ILE A 1 156 ? -2.988  5.544   7.010   1.00 15.00 ?  198 ILE A CD1  1  
ATOM   2302   H  H    . ILE A 1 156 ? -0.029  6.608   8.857   1.00 15.00 ?  198 ILE A H    1  
ATOM   2303   H  HA   . ILE A 1 156 ? -2.429  8.080   8.075   1.00 15.00 ?  198 ILE A HA   1  
ATOM   2304   H  HB   . ILE A 1 156 ? -2.230  6.110   10.351  1.00 15.00 ?  198 ILE A HB   1  
ATOM   2305   H  HG12 . ILE A 1 156 ? -1.448  4.968   8.337   1.00 15.00 ?  198 ILE A HG12 1  
ATOM   2306   H  HG13 . ILE A 1 156 ? -3.050  4.387   8.776   1.00 15.00 ?  198 ILE A HG13 1  
ATOM   2307   H  HG21 . ILE A 1 156 ? -4.234  7.328   10.488  1.00 15.00 ?  198 ILE A HG21 1  
ATOM   2308   H  HG22 . ILE A 1 156 ? -4.680  5.810   9.708   1.00 15.00 ?  198 ILE A HG22 1  
ATOM   2309   H  HG23 . ILE A 1 156 ? -4.487  7.274   8.741   1.00 15.00 ?  198 ILE A HG23 1  
ATOM   2310   H  HD11 . ILE A 1 156 ? -2.406  6.354   6.593   1.00 15.00 ?  198 ILE A HD11 1  
ATOM   2311   H  HD12 . ILE A 1 156 ? -4.025  5.836   7.054   1.00 15.00 ?  198 ILE A HD12 1  
ATOM   2312   H  HD13 . ILE A 1 156 ? -2.885  4.669   6.388   1.00 15.00 ?  198 ILE A HD13 1  
ATOM   2313   N  N    . ASP A 1 157 ? -1.891  9.942   9.646   1.00 15.00 ?  199 ASP A N    1  
ATOM   2314   C  CA   . ASP A 1 157 ? -1.809  11.048  10.598  1.00 15.00 ?  199 ASP A CA   1  
ATOM   2315   C  C    . ASP A 1 157 ? -2.887  10.926  11.672  1.00 15.00 ?  199 ASP A C    1  
ATOM   2316   O  O    . ASP A 1 157 ? -4.009  10.495  11.396  1.00 15.00 ?  199 ASP A O    1  
ATOM   2317   C  CB   . ASP A 1 157 ? -1.939  12.386  9.863   1.00 15.00 ?  199 ASP A CB   1  
ATOM   2318   C  CG   . ASP A 1 157 ? -1.826  13.579  10.792  1.00 15.00 ?  199 ASP A CG   1  
ATOM   2319   O  OD1  . ASP A 1 157 ? -0.863  13.636  11.588  1.00 15.00 ?  199 ASP A OD1  1  
ATOM   2320   O  OD2  . ASP A 1 157 ? -2.693  14.476  10.714  1.00 15.00 -1 199 ASP A OD2  1  
ATOM   2321   H  H    . ASP A 1 157 ? -2.047  10.144  8.694   1.00 15.00 ?  199 ASP A H    1  
ATOM   2322   H  HA   . ASP A 1 157 ? -0.839  11.001  11.075  1.00 15.00 ?  199 ASP A HA   1  
ATOM   2323   H  HB2  . ASP A 1 157 ? -1.158  12.460  9.124   1.00 15.00 ?  199 ASP A HB2  1  
ATOM   2324   H  HB3  . ASP A 1 157 ? -2.899  12.427  9.371   1.00 15.00 ?  199 ASP A HB3  1  
ATOM   2325   N  N    . GLY A 1 158 ? -2.531  11.301  12.894  1.00 15.00 ?  200 GLY A N    1  
ATOM   2326   C  CA   . GLY A 1 158 ? -3.461  11.209  14.004  1.00 15.00 ?  200 GLY A CA   1  
ATOM   2327   C  C    . GLY A 1 158 ? -3.259  9.926   14.781  1.00 15.00 ?  200 GLY A C    1  
ATOM   2328   O  O    . GLY A 1 158 ? -3.736  9.778   15.907  1.00 15.00 ?  200 GLY A O    1  
ATOM   2329   H  H    . GLY A 1 158 ? -1.627  11.655  13.041  1.00 15.00 ?  200 GLY A H    1  
ATOM   2330   H  HA2  . GLY A 1 158 ? -3.311  12.053  14.662  1.00 15.00 ?  200 GLY A HA2  1  
ATOM   2331   H  HA3  . GLY A 1 158 ? -4.471  11.231  13.621  1.00 15.00 ?  200 GLY A HA3  1  
ATOM   2332   N  N    . THR A 1 159 ? -2.526  9.001   14.176  1.00 15.00 ?  201 THR A N    1  
ATOM   2333   C  CA   . THR A 1 159 ? -2.244  7.713   14.790  1.00 15.00 ?  201 THR A CA   1  
ATOM   2334   C  C    . THR A 1 159 ? -0.777  7.346   14.592  1.00 15.00 ?  201 THR A C    1  
ATOM   2335   O  O    . THR A 1 159 ? -0.037  8.077   13.932  1.00 15.00 ?  201 THR A O    1  
ATOM   2336   C  CB   . THR A 1 159 ? -3.146  6.618   14.193  1.00 15.00 ?  201 THR A CB   1  
ATOM   2337   O  OG1  . THR A 1 159 ? -3.528  6.976   12.858  1.00 15.00 ?  201 THR A OG1  1  
ATOM   2338   C  CG2  . THR A 1 159 ? -4.390  6.418   15.049  1.00 15.00 ?  201 THR A CG2  1  
ATOM   2339   H  H    . THR A 1 159 ? -2.156  9.194   13.289  1.00 15.00 ?  201 THR A H    1  
ATOM   2340   H  HA   . THR A 1 159 ? -2.450  7.790   15.850  1.00 15.00 ?  201 THR A HA   1  
ATOM   2341   H  HB   . THR A 1 159 ? -2.595  5.691   14.166  1.00 15.00 ?  201 THR A HB   1  
ATOM   2342   H  HG1  . THR A 1 159 ? -2.816  7.484   12.447  1.00 15.00 ?  201 THR A HG1  1  
ATOM   2343   H  HG21 . THR A 1 159 ? -5.062  5.734   14.554  1.00 15.00 ?  201 THR A HG21 1  
ATOM   2344   H  HG22 . THR A 1 159 ? -4.884  7.367   15.193  1.00 15.00 ?  201 THR A HG22 1  
ATOM   2345   H  HG23 . THR A 1 159 ? -4.107  6.010   16.009  1.00 15.00 ?  201 THR A HG23 1  
ATOM   2346   N  N    . ASP A 1 160 ? -0.357  6.223   15.160  1.00 15.00 ?  202 ASP A N    1  
ATOM   2347   C  CA   . ASP A 1 160 ? 1.030   5.773   15.046  1.00 15.00 ?  202 ASP A CA   1  
ATOM   2348   C  C    . ASP A 1 160 ? 1.140   4.628   14.035  1.00 15.00 ?  202 ASP A C    1  
ATOM   2349   O  O    . ASP A 1 160 ? 1.908   3.682   14.219  1.00 15.00 ?  202 ASP A O    1  
ATOM   2350   C  CB   . ASP A 1 160 ? 1.554   5.327   16.422  1.00 15.00 ?  202 ASP A CB   1  
ATOM   2351   C  CG   . ASP A 1 160 ? 0.881   4.070   16.937  1.00 15.00 ?  202 ASP A CG   1  
ATOM   2352   O  OD1  . ASP A 1 160 ? 1.598   3.091   17.238  1.00 15.00 ?  202 ASP A OD1  1  
ATOM   2353   O  OD2  . ASP A 1 160 ? -0.366  4.061   17.050  1.00 15.00 -1 202 ASP A OD2  1  
ATOM   2354   H  H    . ASP A 1 160 ? -0.989  5.674   15.674  1.00 15.00 ?  202 ASP A H    1  
ATOM   2355   H  HA   . ASP A 1 160 ? 1.623   6.604   14.694  1.00 15.00 ?  202 ASP A HA   1  
ATOM   2356   H  HB2  . ASP A 1 160 ? 2.615   5.137   16.353  1.00 15.00 ?  202 ASP A HB2  1  
ATOM   2357   H  HB3  . ASP A 1 160 ? 1.384   6.121   17.134  1.00 15.00 ?  202 ASP A HB3  1  
ATOM   2358   N  N    . ILE A 1 161 ? 0.388   4.735   12.946  1.00 15.00 ?  203 ILE A N    1  
ATOM   2359   C  CA   . ILE A 1 161 ? 0.389   3.700   11.918  1.00 15.00 ?  203 ILE A CA   1  
ATOM   2360   C  C    . ILE A 1 161 ? 0.960   4.222   10.600  1.00 15.00 ?  203 ILE A C    1  
ATOM   2361   O  O    . ILE A 1 161 ? 0.678   5.352   10.190  1.00 15.00 ?  203 ILE A O    1  
ATOM   2362   C  CB   . ILE A 1 161 ? -1.037  3.158   11.669  1.00 15.00 ?  203 ILE A CB   1  
ATOM   2363   C  CG1  . ILE A 1 161 ? -1.727  2.836   12.996  1.00 15.00 ?  203 ILE A CG1  1  
ATOM   2364   C  CG2  . ILE A 1 161 ? -0.994  1.919   10.783  1.00 15.00 ?  203 ILE A CG2  1  
ATOM   2365   C  CD1  . ILE A 1 161 ? -3.210  2.573   12.858  1.00 15.00 ?  203 ILE A CD1  1  
ATOM   2366   H  H    . ILE A 1 161 ? -0.167  5.533   12.823  1.00 15.00 ?  203 ILE A H    1  
ATOM   2367   H  HA   . ILE A 1 161 ? 1.003   2.887   12.271  1.00 15.00 ?  203 ILE A HA   1  
ATOM   2368   H  HB   . ILE A 1 161 ? -1.602  3.918   11.152  1.00 15.00 ?  203 ILE A HB   1  
ATOM   2369   H  HG12 . ILE A 1 161 ? -1.274  1.953   13.423  1.00 15.00 ?  203 ILE A HG12 1  
ATOM   2370   H  HG13 . ILE A 1 161 ? -1.595  3.668   13.673  1.00 15.00 ?  203 ILE A HG13 1  
ATOM   2371   H  HG21 . ILE A 1 161 ? -1.998  1.556   10.627  1.00 15.00 ?  203 ILE A HG21 1  
ATOM   2372   H  HG22 . ILE A 1 161 ? -0.405  1.151   11.264  1.00 15.00 ?  203 ILE A HG22 1  
ATOM   2373   H  HG23 . ILE A 1 161 ? -0.550  2.170   9.831   1.00 15.00 ?  203 ILE A HG23 1  
ATOM   2374   H  HD11 . ILE A 1 161 ? -3.362  1.669   12.289  1.00 15.00 ?  203 ILE A HD11 1  
ATOM   2375   H  HD12 . ILE A 1 161 ? -3.673  3.404   12.349  1.00 15.00 ?  203 ILE A HD12 1  
ATOM   2376   H  HD13 . ILE A 1 161 ? -3.646  2.460   13.838  1.00 15.00 ?  203 ILE A HD13 1  
ATOM   2377   N  N    . ALA A 1 162 ? 1.759   3.395   9.938   1.00 15.00 ?  204 ALA A N    1  
ATOM   2378   C  CA   . ALA A 1 162 ? 2.359   3.764   8.664   1.00 15.00 ?  204 ALA A CA   1  
ATOM   2379   C  C    . ALA A 1 162 ? 2.353   2.580   7.705   1.00 15.00 ?  204 ALA A C    1  
ATOM   2380   O  O    . ALA A 1 162 ? 2.583   1.440   8.110   1.00 15.00 ?  204 ALA A O    1  
ATOM   2381   C  CB   . ALA A 1 162 ? 3.778   4.277   8.866   1.00 15.00 ?  204 ALA A CB   1  
ATOM   2382   H  H    . ALA A 1 162 ? 1.947   2.506   10.314  1.00 15.00 ?  204 ALA A H    1  
ATOM   2383   H  HA   . ALA A 1 162 ? 1.769   4.562   8.237   1.00 15.00 ?  204 ALA A HA   1  
ATOM   2384   H  HB1  . ALA A 1 162 ? 3.750   5.230   9.376   1.00 15.00 ?  204 ALA A HB1  1  
ATOM   2385   H  HB2  . ALA A 1 162 ? 4.256   4.399   7.906   1.00 15.00 ?  204 ALA A HB2  1  
ATOM   2386   H  HB3  . ALA A 1 162 ? 4.336   3.569   9.459   1.00 15.00 ?  204 ALA A HB3  1  
ATOM   2387   N  N    . PHE A 1 163 ? 2.079   2.855   6.437   1.00 15.00 ?  205 PHE A N    1  
ATOM   2388   C  CA   . PHE A 1 163 ? 2.044   1.818   5.417   1.00 15.00 ?  205 PHE A CA   1  
ATOM   2389   C  C    . PHE A 1 163 ? 3.346   1.818   4.624   1.00 15.00 ?  205 PHE A C    1  
ATOM   2390   O  O    . PHE A 1 163 ? 3.678   2.805   3.965   1.00 15.00 ?  205 PHE A O    1  
ATOM   2391   C  CB   . PHE A 1 163 ? 0.854   2.042   4.474   1.00 15.00 ?  205 PHE A CB   1  
ATOM   2392   C  CG   . PHE A 1 163 ? 0.463   0.825   3.686   1.00 15.00 ?  205 PHE A CG   1  
ATOM   2393   C  CD1  . PHE A 1 163 ? -0.071  -0.281  4.320   1.00 15.00 ?  205 PHE A CD1  1  
ATOM   2394   C  CD2  . PHE A 1 163 ? 0.626   0.790   2.313   1.00 15.00 ?  205 PHE A CD2  1  
ATOM   2395   C  CE1  . PHE A 1 163 ? -0.434  -1.402  3.602   1.00 15.00 ?  205 PHE A CE1  1  
ATOM   2396   C  CE2  . PHE A 1 163 ? 0.264   -0.327  1.587   1.00 15.00 ?  205 PHE A CE2  1  
ATOM   2397   C  CZ   . PHE A 1 163 ? -0.267  -1.426  2.232   1.00 15.00 ?  205 PHE A CZ   1  
ATOM   2398   H  H    . PHE A 1 163 ? 1.901   3.790   6.174   1.00 15.00 ?  205 PHE A H    1  
ATOM   2399   H  HA   . PHE A 1 163 ? 1.931   0.868   5.911   1.00 15.00 ?  205 PHE A HA   1  
ATOM   2400   H  HB2  . PHE A 1 163 ? -0.002  2.347   5.055   1.00 15.00 ?  205 PHE A HB2  1  
ATOM   2401   H  HB3  . PHE A 1 163 ? 1.104   2.825   3.773   1.00 15.00 ?  205 PHE A HB3  1  
ATOM   2402   H  HD1  . PHE A 1 163 ? -0.204  -0.261  5.389   1.00 15.00 ?  205 PHE A HD1  1  
ATOM   2403   H  HD2  . PHE A 1 163 ? 1.042   1.650   1.808   1.00 15.00 ?  205 PHE A HD2  1  
ATOM   2404   H  HE1  . PHE A 1 163 ? -0.848  -2.259  4.111   1.00 15.00 ?  205 PHE A HE1  1  
ATOM   2405   H  HE2  . PHE A 1 163 ? 0.397   -0.340  0.514   1.00 15.00 ?  205 PHE A HE2  1  
ATOM   2406   H  HZ   . PHE A 1 163 ? -0.551  -2.300  1.666   1.00 15.00 ?  205 PHE A HZ   1  
ATOM   2407   N  N    . GLY A 1 164 ? 4.078   0.713   4.693   1.00 15.00 ?  206 GLY A N    1  
ATOM   2408   C  CA   . GLY A 1 164 ? 5.343   0.610   3.987   1.00 15.00 ?  206 GLY A CA   1  
ATOM   2409   C  C    . GLY A 1 164 ? 5.195   -0.024  2.616   1.00 15.00 ?  206 GLY A C    1  
ATOM   2410   O  O    . GLY A 1 164 ? 6.154   -0.065  1.839   1.00 15.00 ?  206 GLY A O    1  
ATOM   2411   H  H    . GLY A 1 164 ? 3.753   -0.048  5.230   1.00 15.00 ?  206 GLY A H    1  
ATOM   2412   H  HA2  . GLY A 1 164 ? 5.756   1.599   3.866   1.00 15.00 ?  206 GLY A HA2  1  
ATOM   2413   H  HA3  . GLY A 1 164 ? 6.026   0.016   4.577   1.00 15.00 ?  206 GLY A HA3  1  
ATOM   2414   N  N    . GLY A 1 165 ? 3.992   -0.516  2.314   1.00 15.00 ?  207 GLY A N    1  
ATOM   2415   C  CA   . GLY A 1 165 ? 3.737   -1.152  1.030   1.00 15.00 ?  207 GLY A CA   1  
ATOM   2416   C  C    . GLY A 1 165 ? 4.546   -2.418  0.850   1.00 15.00 ?  207 GLY A C    1  
ATOM   2417   O  O    . GLY A 1 165 ? 4.516   -3.308  1.702   1.00 15.00 ?  207 GLY A O    1  
ATOM   2418   H  H    . GLY A 1 165 ? 3.269   -0.442  2.969   1.00 15.00 ?  207 GLY A H    1  
ATOM   2419   H  HA2  . GLY A 1 165 ? 2.688   -1.398  0.962   1.00 15.00 ?  207 GLY A HA2  1  
ATOM   2420   H  HA3  . GLY A 1 165 ? 3.987   -0.461  0.239   1.00 15.00 ?  207 GLY A HA3  1  
ATOM   2421   N  N    . CYS A 1 166 ? 5.273   -2.497  -0.253  1.00 15.00 ?  208 CYS A N    1  
ATOM   2422   C  CA   . CYS A 1 166 ? 6.093   -3.663  -0.538  1.00 15.00 ?  208 CYS A CA   1  
ATOM   2423   C  C    . CYS A 1 166 ? 7.572   -3.317  -0.410  1.00 15.00 ?  208 CYS A C    1  
ATOM   2424   O  O    . CYS A 1 166 ? 8.444   -4.167  -0.606  1.00 15.00 ?  208 CYS A O    1  
ATOM   2425   C  CB   . CYS A 1 166 ? 5.785   -4.195  -1.939  1.00 15.00 ?  208 CYS A CB   1  
ATOM   2426   S  SG   . CYS A 1 166 ? 4.059   -4.683  -2.163  1.00 15.00 ?  208 CYS A SG   1  
ATOM   2427   H  H    . CYS A 1 166 ? 5.261   -1.750  -0.890  1.00 15.00 ?  208 CYS A H    1  
ATOM   2428   H  HA   . CYS A 1 166 ? 5.848   -4.425  0.189   1.00 15.00 ?  208 CYS A HA   1  
ATOM   2429   H  HB2  . CYS A 1 166 ? 6.009   -3.428  -2.666  1.00 15.00 ?  208 CYS A HB2  1  
ATOM   2430   H  HB3  . CYS A 1 166 ? 6.400   -5.063  -2.132  1.00 15.00 ?  208 CYS A HB3  1  
ATOM   2431   H  HG   . CYS A 1 166 ? 3.877   -5.022  -3.436  1.00 15.00 ?  208 CYS A HG   1  
ATOM   2432   N  N    . LEU A 1 167 ? 7.841   -2.061  -0.069  1.00 15.00 ?  209 LEU A N    1  
ATOM   2433   C  CA   . LEU A 1 167 ? 9.203   -1.579  0.093   1.00 15.00 ?  209 LEU A CA   1  
ATOM   2434   C  C    . LEU A 1 167 ? 9.814   -2.136  1.374   1.00 15.00 ?  209 LEU A C    1  
ATOM   2435   O  O    . LEU A 1 167 ? 10.957  -2.596  1.376   1.00 15.00 ?  209 LEU A O    1  
ATOM   2436   C  CB   . LEU A 1 167 ? 9.222   -0.049  0.132   1.00 15.00 ?  209 LEU A CB   1  
ATOM   2437   C  CG   . LEU A 1 167 ? 10.587  0.576   0.422   1.00 15.00 ?  209 LEU A CG   1  
ATOM   2438   C  CD1  . LEU A 1 167 ? 11.463  0.547   -0.816  1.00 15.00 ?  209 LEU A CD1  1  
ATOM   2439   C  CD2  . LEU A 1 167 ? 10.427  1.997   0.929   1.00 15.00 ?  209 LEU A CD2  1  
ATOM   2440   H  H    . LEU A 1 167 ? 7.098   -1.443  0.087   1.00 15.00 ?  209 LEU A H    1  
ATOM   2441   H  HA   . LEU A 1 167 ? 9.783   -1.919  -0.754  1.00 15.00 ?  209 LEU A HA   1  
ATOM   2442   H  HB2  . LEU A 1 167 ? 8.880   0.315   -0.824  1.00 15.00 ?  209 LEU A HB2  1  
ATOM   2443   H  HB3  . LEU A 1 167 ? 8.529   0.281   0.893   1.00 15.00 ?  209 LEU A HB3  1  
ATOM   2444   H  HG   . LEU A 1 167 ? 11.080  0.002   1.190   1.00 15.00 ?  209 LEU A HG   1  
ATOM   2445   H  HD11 . LEU A 1 167 ? 10.971  1.075   -1.620  1.00 15.00 ?  209 LEU A HD11 1  
ATOM   2446   H  HD12 . LEU A 1 167 ? 11.638  -0.478  -1.109  1.00 15.00 ?  209 LEU A HD12 1  
ATOM   2447   H  HD13 . LEU A 1 167 ? 12.407  1.025   -0.598  1.00 15.00 ?  209 LEU A HD13 1  
ATOM   2448   H  HD21 . LEU A 1 167 ? 9.852   2.573   0.218   1.00 15.00 ?  209 LEU A HD21 1  
ATOM   2449   H  HD22 . LEU A 1 167 ? 11.401  2.447   1.051   1.00 15.00 ?  209 LEU A HD22 1  
ATOM   2450   H  HD23 . LEU A 1 167 ? 9.918   1.986   1.882   1.00 15.00 ?  209 LEU A HD23 1  
ATOM   2451   N  N    . ILE A 1 168 ? 9.032   -2.105  2.445   1.00 15.00 ?  210 ILE A N    1  
ATOM   2452   C  CA   . ILE A 1 168 ? 9.480   -2.584  3.748   1.00 15.00 ?  210 ILE A CA   1  
ATOM   2453   C  C    . ILE A 1 168 ? 8.925   -3.980  4.031   1.00 15.00 ?  210 ILE A C    1  
ATOM   2454   O  O    . ILE A 1 168 ? 7.798   -4.297  3.649   1.00 15.00 ?  210 ILE A O    1  
ATOM   2455   C  CB   . ILE A 1 168 ? 9.043   -1.612  4.876   1.00 15.00 ?  210 ILE A CB   1  
ATOM   2456   C  CG1  . ILE A 1 168 ? 9.448   -0.171  4.528   1.00 15.00 ?  210 ILE A CG1  1  
ATOM   2457   C  CG2  . ILE A 1 168 ? 9.637   -2.028  6.215   1.00 15.00 ?  210 ILE A CG2  1  
ATOM   2458   C  CD1  . ILE A 1 168 ? 10.946  0.038   4.435   1.00 15.00 ?  210 ILE A CD1  1  
ATOM   2459   H  H    . ILE A 1 168 ? 8.121   -1.757  2.355   1.00 15.00 ?  210 ILE A H    1  
ATOM   2460   H  HA   . ILE A 1 168 ? 10.559  -2.630  3.737   1.00 15.00 ?  210 ILE A HA   1  
ATOM   2461   H  HB   . ILE A 1 168 ? 7.968   -1.660  4.966   1.00 15.00 ?  210 ILE A HB   1  
ATOM   2462   H  HG12 . ILE A 1 168 ? 9.019   0.095   3.573   1.00 15.00 ?  210 ILE A HG12 1  
ATOM   2463   H  HG13 . ILE A 1 168 ? 9.066   0.498   5.285   1.00 15.00 ?  210 ILE A HG13 1  
ATOM   2464   H  HG21 . ILE A 1 168 ? 10.706  -2.147  6.119   1.00 15.00 ?  210 ILE A HG21 1  
ATOM   2465   H  HG22 . ILE A 1 168 ? 9.200   -2.966  6.526   1.00 15.00 ?  210 ILE A HG22 1  
ATOM   2466   H  HG23 . ILE A 1 168 ? 9.424   -1.274  6.954   1.00 15.00 ?  210 ILE A HG23 1  
ATOM   2467   H  HD11 . ILE A 1 168 ? 11.421  -0.362  5.320   1.00 15.00 ?  210 ILE A HD11 1  
ATOM   2468   H  HD12 . ILE A 1 168 ? 11.162  1.094   4.357   1.00 15.00 ?  210 ILE A HD12 1  
ATOM   2469   H  HD13 . ILE A 1 168 ? 11.324  -0.474  3.562   1.00 15.00 ?  210 ILE A HD13 1  
ATOM   2470   N  N    . LYS A 1 169 ? 9.737   -4.813  4.672   1.00 15.00 ?  211 LYS A N    1  
ATOM   2471   C  CA   . LYS A 1 169 ? 9.332   -6.172  5.025   1.00 15.00 ?  211 LYS A CA   1  
ATOM   2472   C  C    . LYS A 1 169 ? 9.206   -6.272  6.539   1.00 15.00 ?  211 LYS A C    1  
ATOM   2473   O  O    . LYS A 1 169 ? 9.364   -5.271  7.235   1.00 15.00 ?  211 LYS A O    1  
ATOM   2474   C  CB   . LYS A 1 169 ? 10.345  -7.210  4.525   1.00 15.00 ?  211 LYS A CB   1  
ATOM   2475   C  CG   . LYS A 1 169 ? 11.288  -6.700  3.447   1.00 15.00 ?  211 LYS A CG   1  
ATOM   2476   C  CD   . LYS A 1 169 ? 10.586  -6.529  2.113   1.00 15.00 ?  211 LYS A CD   1  
ATOM   2477   C  CE   . LYS A 1 169 ? 11.437  -5.724  1.152   1.00 15.00 ?  211 LYS A CE   1  
ATOM   2478   N  NZ   . LYS A 1 169 ? 10.801  -5.600  -0.184  1.00 15.00 1  211 LYS A NZ   1  
ATOM   2479   H  H    . LYS A 1 169 ? 10.630  -4.501  4.939   1.00 15.00 ?  211 LYS A H    1  
ATOM   2480   H  HA   . LYS A 1 169 ? 8.370   -6.363  4.572   1.00 15.00 ?  211 LYS A HA   1  
ATOM   2481   H  HB2  . LYS A 1 169 ? 10.939  -7.542  5.364   1.00 15.00 ?  211 LYS A HB2  1  
ATOM   2482   H  HB3  . LYS A 1 169 ? 9.803   -8.056  4.125   1.00 15.00 ?  211 LYS A HB3  1  
ATOM   2483   H  HG2  . LYS A 1 169 ? 11.682  -5.744  3.755   1.00 15.00 ?  211 LYS A HG2  1  
ATOM   2484   H  HG3  . LYS A 1 169 ? 12.098  -7.405  3.328   1.00 15.00 ?  211 LYS A HG3  1  
ATOM   2485   H  HD2  . LYS A 1 169 ? 10.400  -7.502  1.686   1.00 15.00 ?  211 LYS A HD2  1  
ATOM   2486   H  HD3  . LYS A 1 169 ? 9.650   -6.013  2.272   1.00 15.00 ?  211 LYS A HD3  1  
ATOM   2487   H  HE2  . LYS A 1 169 ? 11.589  -4.737  1.564   1.00 15.00 ?  211 LYS A HE2  1  
ATOM   2488   H  HE3  . LYS A 1 169 ? 12.393  -6.218  1.042   1.00 15.00 ?  211 LYS A HE3  1  
ATOM   2489   H  HZ1  . LYS A 1 169 ? 9.822   -5.253  -0.089  1.00 15.00 ?  211 LYS A HZ1  1  
ATOM   2490   H  HZ2  . LYS A 1 169 ? 10.787  -6.526  -0.660  1.00 15.00 ?  211 LYS A HZ2  1  
ATOM   2491   H  HZ3  . LYS A 1 169 ? 11.337  -4.930  -0.775  1.00 15.00 ?  211 LYS A HZ3  1  
ATOM   2492   N  N    . ASP A 1 170 ? 8.944   -7.467  7.054   1.00 15.00 ?  212 ASP A N    1  
ATOM   2493   C  CA   . ASP A 1 170 ? 8.799   -7.650  8.495   1.00 15.00 ?  212 ASP A CA   1  
ATOM   2494   C  C    . ASP A 1 170 ? 10.160  -7.894  9.151   1.00 15.00 ?  212 ASP A C    1  
ATOM   2495   O  O    . ASP A 1 170 ? 11.170  -8.057  8.463   1.00 15.00 ?  212 ASP A O    1  
ATOM   2496   C  CB   . ASP A 1 170 ? 7.817   -8.788  8.802   1.00 15.00 ?  212 ASP A CB   1  
ATOM   2497   C  CG   . ASP A 1 170 ? 8.444   -10.159 8.723   1.00 15.00 ?  212 ASP A CG   1  
ATOM   2498   O  OD1  . ASP A 1 170 ? 8.620   -10.790 9.788   1.00 15.00 ?  212 ASP A OD1  1  
ATOM   2499   O  OD2  . ASP A 1 170 ? 8.746   -10.621 7.605   1.00 15.00 -1 212 ASP A OD2  1  
ATOM   2500   H  H    . ASP A 1 170 ? 8.858   -8.243  6.462   1.00 15.00 ?  212 ASP A H    1  
ATOM   2501   H  HA   . ASP A 1 170 ? 8.394   -6.729  8.893   1.00 15.00 ?  212 ASP A HA   1  
ATOM   2502   H  HB2  . ASP A 1 170 ? 7.423   -8.654  9.799   1.00 15.00 ?  212 ASP A HB2  1  
ATOM   2503   H  HB3  . ASP A 1 170 ? 7.001   -8.744  8.094   1.00 15.00 ?  212 ASP A HB3  1  
ATOM   2504   N  N    . SER A 1 171 ? 10.181  -7.928  10.479  1.00 15.00 ?  213 SER A N    1  
ATOM   2505   C  CA   . SER A 1 171 ? 11.421  -8.105  11.232  1.00 15.00 ?  213 SER A CA   1  
ATOM   2506   C  C    . SER A 1 171 ? 11.990  -9.519  11.121  1.00 15.00 ?  213 SER A C    1  
ATOM   2507   O  O    . SER A 1 171 ? 13.144  -9.755  11.483  1.00 15.00 ?  213 SER A O    1  
ATOM   2508   C  CB   . SER A 1 171 ? 11.184  -7.759  12.703  1.00 15.00 ?  213 SER A CB   1  
ATOM   2509   O  OG   . SER A 1 171 ? 10.076  -8.475  13.223  1.00 15.00 ?  213 SER A OG   1  
ATOM   2510   H  H    . SER A 1 171 ? 9.333   -7.825  10.973  1.00 15.00 ?  213 SER A H    1  
ATOM   2511   H  HA   . SER A 1 171 ? 12.143  -7.413  10.830  1.00 15.00 ?  213 SER A HA   1  
ATOM   2512   H  HB2  . SER A 1 171 ? 12.063  -8.015  13.275  1.00 15.00 ?  213 SER A HB2  1  
ATOM   2513   H  HB3  . SER A 1 171 ? 10.987  -6.701  12.795  1.00 15.00 ?  213 SER A HB3  1  
ATOM   2514   H  HG   . SER A 1 171 ? 9.252   -8.082  12.883  1.00 15.00 ?  213 SER A HG   1  
ATOM   2515   N  N    . LYS A 1 172 ? 11.192  -10.457 10.639  1.00 15.00 ?  214 LYS A N    1  
ATOM   2516   C  CA   . LYS A 1 172 ? 11.642  -11.835 10.510  1.00 15.00 ?  214 LYS A CA   1  
ATOM   2517   C  C    . LYS A 1 172 ? 11.731  -12.231 9.040   1.00 15.00 ?  214 LYS A C    1  
ATOM   2518   O  O    . LYS A 1 172 ? 11.714  -13.418 8.701   1.00 15.00 ?  214 LYS A O    1  
ATOM   2519   C  CB   . LYS A 1 172 ? 10.692  -12.782 11.258  1.00 15.00 ?  214 LYS A CB   1  
ATOM   2520   C  CG   . LYS A 1 172 ? 10.206  -12.239 12.596  1.00 15.00 ?  214 LYS A CG   1  
ATOM   2521   C  CD   . LYS A 1 172 ? 11.320  -12.196 13.633  1.00 15.00 ?  214 LYS A CD   1  
ATOM   2522   C  CE   . LYS A 1 172 ? 10.767  -11.914 15.022  1.00 15.00 ?  214 LYS A CE   1  
ATOM   2523   N  NZ   . LYS A 1 172 ? 10.335  -10.501 15.178  1.00 15.00 1  214 LYS A NZ   1  
ATOM   2524   H  H    . LYS A 1 172 ? 10.275  -10.222 10.357  1.00 15.00 ?  214 LYS A H    1  
ATOM   2525   H  HA   . LYS A 1 172 ? 12.625  -11.902 10.946  1.00 15.00 ?  214 LYS A HA   1  
ATOM   2526   H  HB2  . LYS A 1 172 ? 9.827   -12.973 10.637  1.00 15.00 ?  214 LYS A HB2  1  
ATOM   2527   H  HB3  . LYS A 1 172 ? 11.205  -13.718 11.440  1.00 15.00 ?  214 LYS A HB3  1  
ATOM   2528   H  HG2  . LYS A 1 172 ? 9.833   -11.235 12.451  1.00 15.00 ?  214 LYS A HG2  1  
ATOM   2529   H  HG3  . LYS A 1 172 ? 9.408   -12.867 12.962  1.00 15.00 ?  214 LYS A HG3  1  
ATOM   2530   H  HD2  . LYS A 1 172 ? 11.829  -13.148 13.644  1.00 15.00 ?  214 LYS A HD2  1  
ATOM   2531   H  HD3  . LYS A 1 172 ? 12.017  -11.415 13.366  1.00 15.00 ?  214 LYS A HD3  1  
ATOM   2532   H  HE2  . LYS A 1 172 ? 9.916   -12.559 15.192  1.00 15.00 ?  214 LYS A HE2  1  
ATOM   2533   H  HE3  . LYS A 1 172 ? 11.532  -12.132 15.751  1.00 15.00 ?  214 LYS A HE3  1  
ATOM   2534   H  HZ1  . LYS A 1 172 ? 11.162  -9.872  15.143  1.00 15.00 ?  214 LYS A HZ1  1  
ATOM   2535   H  HZ2  . LYS A 1 172 ? 9.853   -10.371 16.091  1.00 15.00 ?  214 LYS A HZ2  1  
ATOM   2536   H  HZ3  . LYS A 1 172 ? 9.683   -10.236 14.413  1.00 15.00 ?  214 LYS A HZ3  1  
ATOM   2537   N  N    . ALA A 1 173 ? 11.826  -11.237 8.169   1.00 15.00 ?  215 ALA A N    1  
ATOM   2538   C  CA   . ALA A 1 173 ? 11.915  -11.480 6.736   1.00 15.00 ?  215 ALA A CA   1  
ATOM   2539   C  C    . ALA A 1 173 ? 13.245  -12.124 6.369   1.00 15.00 ?  215 ALA A C    1  
ATOM   2540   O  O    . ALA A 1 173 ? 14.302  -11.717 6.854   1.00 15.00 ?  215 ALA A O    1  
ATOM   2541   C  CB   . ALA A 1 173 ? 11.735  -10.181 5.971   1.00 15.00 ?  215 ALA A CB   1  
ATOM   2542   H  H    . ALA A 1 173 ? 11.833  -10.312 8.497   1.00 15.00 ?  215 ALA A H    1  
ATOM   2543   H  HA   . ALA A 1 173 ? 11.113  -12.147 6.459   1.00 15.00 ?  215 ALA A HA   1  
ATOM   2544   H  HB1  . ALA A 1 173 ? 11.835  -10.367 4.914   1.00 15.00 ?  215 ALA A HB1  1  
ATOM   2545   H  HB2  . ALA A 1 173 ? 12.484  -9.473  6.286   1.00 15.00 ?  215 ALA A HB2  1  
ATOM   2546   H  HB3  . ALA A 1 173 ? 10.753  -9.776  6.175   1.00 15.00 ?  215 ALA A HB3  1  
ATOM   2547   N  N    . LYS A 1 174 ? 13.190  -13.142 5.529   1.00 15.00 ?  216 LYS A N    1  
ATOM   2548   C  CA   . LYS A 1 174 ? 14.395  -13.833 5.100   1.00 15.00 ?  216 LYS A CA   1  
ATOM   2549   C  C    . LYS A 1 174 ? 14.782  -13.394 3.694   1.00 15.00 ?  216 LYS A C    1  
ATOM   2550   O  O    . LYS A 1 174 ? 15.904  -13.620 3.242   1.00 15.00 ?  216 LYS A O    1  
ATOM   2551   C  CB   . LYS A 1 174 ? 14.188  -15.346 5.134   1.00 15.00 ?  216 LYS A CB   1  
ATOM   2552   C  CG   . LYS A 1 174 ? 13.938  -15.910 6.526   1.00 15.00 ?  216 LYS A CG   1  
ATOM   2553   C  CD   . LYS A 1 174 ? 13.722  -17.413 6.483   1.00 15.00 ?  216 LYS A CD   1  
ATOM   2554   C  CE   . LYS A 1 174 ? 13.659  -18.012 7.877   1.00 15.00 ?  216 LYS A CE   1  
ATOM   2555   N  NZ   . LYS A 1 174 ? 13.548  -19.492 7.834   1.00 15.00 1  216 LYS A NZ   1  
ATOM   2556   H  H    . LYS A 1 174 ? 12.314  -13.443 5.195   1.00 15.00 ?  216 LYS A H    1  
ATOM   2557   H  HA   . LYS A 1 174 ? 15.191  -13.567 5.780   1.00 15.00 ?  216 LYS A HA   1  
ATOM   2558   H  HB2  . LYS A 1 174 ? 13.340  -15.594 4.511   1.00 15.00 ?  216 LYS A HB2  1  
ATOM   2559   H  HB3  . LYS A 1 174 ? 15.071  -15.824 4.728   1.00 15.00 ?  216 LYS A HB3  1  
ATOM   2560   H  HG2  . LYS A 1 174 ? 14.794  -15.698 7.150   1.00 15.00 ?  216 LYS A HG2  1  
ATOM   2561   H  HG3  . LYS A 1 174 ? 13.057  -15.440 6.945   1.00 15.00 ?  216 LYS A HG3  1  
ATOM   2562   H  HD2  . LYS A 1 174 ? 12.792  -17.621 5.974   1.00 15.00 ?  216 LYS A HD2  1  
ATOM   2563   H  HD3  . LYS A 1 174 ? 14.539  -17.870 5.943   1.00 15.00 ?  216 LYS A HD3  1  
ATOM   2564   H  HE2  . LYS A 1 174 ? 14.556  -17.741 8.415   1.00 15.00 ?  216 LYS A HE2  1  
ATOM   2565   H  HE3  . LYS A 1 174 ? 12.797  -17.610 8.387   1.00 15.00 ?  216 LYS A HE3  1  
ATOM   2566   H  HZ1  . LYS A 1 174 ? 12.617  -19.772 7.464   1.00 15.00 ?  216 LYS A HZ1  1  
ATOM   2567   H  HZ2  . LYS A 1 174 ? 13.661  -19.885 8.789   1.00 15.00 ?  216 LYS A HZ2  1  
ATOM   2568   H  HZ3  . LYS A 1 174 ? 14.288  -19.889 7.219   1.00 15.00 ?  216 LYS A HZ3  1  
ATOM   2569   N  N    . SER A 1 175 ? 13.848  -12.753 3.014   1.00 15.00 ?  217 SER A N    1  
ATOM   2570   C  CA   . SER A 1 175 ? 14.072  -12.290 1.664   1.00 15.00 ?  217 SER A CA   1  
ATOM   2571   C  C    . SER A 1 175 ? 13.437  -10.921 1.476   1.00 15.00 ?  217 SER A C    1  
ATOM   2572   O  O    . SER A 1 175 ? 12.563  -10.522 2.248   1.00 15.00 ?  217 SER A O    1  
ATOM   2573   C  CB   . SER A 1 175 ? 13.485  -13.288 0.657   1.00 15.00 ?  217 SER A CB   1  
ATOM   2574   O  OG   . SER A 1 175 ? 13.693  -12.860 -0.681  1.00 15.00 ?  217 SER A OG   1  
ATOM   2575   H  H    . SER A 1 175 ? 12.984  -12.569 3.439   1.00 15.00 ?  217 SER A H    1  
ATOM   2576   H  HA   . SER A 1 175 ? 15.138  -12.212 1.508   1.00 15.00 ?  217 SER A HA   1  
ATOM   2577   H  HB2  . SER A 1 175 ? 13.957  -14.249 0.790   1.00 15.00 ?  217 SER A HB2  1  
ATOM   2578   H  HB3  . SER A 1 175 ? 12.424  -13.388 0.829   1.00 15.00 ?  217 SER A HB3  1  
ATOM   2579   H  HG   . SER A 1 175 ? 14.552  -13.177 -0.990  1.00 15.00 ?  217 SER A HG   1  
ATOM   2580   N  N    . LEU A 1 176 ? 13.890  -10.198 0.464   1.00 15.00 ?  218 LEU A N    1  
ATOM   2581   C  CA   . LEU A 1 176 ? 13.347  -8.883  0.166   1.00 15.00 ?  218 LEU A CA   1  
ATOM   2582   C  C    . LEU A 1 176 ? 12.211  -9.005  -0.846  1.00 15.00 ?  218 LEU A C    1  
ATOM   2583   O  O    . LEU A 1 176 ? 11.512  -8.030  -1.137  1.00 15.00 ?  218 LEU A O    1  
ATOM   2584   C  CB   . LEU A 1 176 ? 14.448  -7.966  -0.370  1.00 15.00 ?  218 LEU A CB   1  
ATOM   2585   C  CG   . LEU A 1 176 ? 15.539  -7.609  0.639   1.00 15.00 ?  218 LEU A CG   1  
ATOM   2586   C  CD1  . LEU A 1 176 ? 16.831  -7.262  -0.078  1.00 15.00 ?  218 LEU A CD1  1  
ATOM   2587   C  CD2  . LEU A 1 176 ? 15.095  -6.452  1.520   1.00 15.00 ?  218 LEU A CD2  1  
ATOM   2588   H  H    . LEU A 1 176 ? 14.613  -10.556 -0.098  1.00 15.00 ?  218 LEU A H    1  
ATOM   2589   H  HA   . LEU A 1 176 ? 12.957  -8.468  1.084   1.00 15.00 ?  218 LEU A HA   1  
ATOM   2590   H  HB2  . LEU A 1 176 ? 14.913  -8.454  -1.213  1.00 15.00 ?  218 LEU A HB2  1  
ATOM   2591   H  HB3  . LEU A 1 176 ? 13.990  -7.049  -0.712  1.00 15.00 ?  218 LEU A HB3  1  
ATOM   2592   H  HG   . LEU A 1 176 ? 15.727  -8.463  1.276   1.00 15.00 ?  218 LEU A HG   1  
ATOM   2593   H  HD11 . LEU A 1 176 ? 16.634  -6.505  -0.823  1.00 15.00 ?  218 LEU A HD11 1  
ATOM   2594   H  HD12 . LEU A 1 176 ? 17.227  -8.146  -0.557  1.00 15.00 ?  218 LEU A HD12 1  
ATOM   2595   H  HD13 . LEU A 1 176 ? 17.550  -6.885  0.637   1.00 15.00 ?  218 LEU A HD13 1  
ATOM   2596   H  HD21 . LEU A 1 176 ? 14.217  -6.744  2.079   1.00 15.00 ?  218 LEU A HD21 1  
ATOM   2597   H  HD22 . LEU A 1 176 ? 14.862  -5.594  0.903   1.00 15.00 ?  218 LEU A HD22 1  
ATOM   2598   H  HD23 . LEU A 1 176 ? 15.888  -6.196  2.208   1.00 15.00 ?  218 LEU A HD23 1  
ATOM   2599   N  N    . GLY A 1 177 ? 12.035  -10.209 -1.376  1.00 15.00 ?  219 GLY A N    1  
ATOM   2600   C  CA   . GLY A 1 177 ? 10.983  -10.451 -2.339  1.00 15.00 ?  219 GLY A CA   1  
ATOM   2601   C  C    . GLY A 1 177 ? 11.448  -10.221 -3.761  1.00 15.00 ?  219 GLY A C    1  
ATOM   2602   O  O    . GLY A 1 177 ? 12.573  -10.581 -4.119  1.00 15.00 ?  219 GLY A O    1  
ATOM   2603   H  H    . GLY A 1 177 ? 12.637  -10.943 -1.119  1.00 15.00 ?  219 GLY A H    1  
ATOM   2604   H  HA2  . GLY A 1 177 ? 10.643  -11.472 -2.241  1.00 15.00 ?  219 GLY A HA2  1  
ATOM   2605   H  HA3  . GLY A 1 177 ? 10.158  -9.787  -2.129  1.00 15.00 ?  219 GLY A HA3  1  
ATOM   2606   N  N    . ASN A 1 178 ? 10.591  -9.607  -4.563  1.00 15.00 ?  220 ASN A N    1  
ATOM   2607   C  CA   . ASN A 1 178 ? 10.907  -9.329  -5.956  1.00 15.00 ?  220 ASN A CA   1  
ATOM   2608   C  C    . ASN A 1 178 ? 11.848  -8.131  -6.062  1.00 15.00 ?  220 ASN A C    1  
ATOM   2609   O  O    . ASN A 1 178 ? 11.498  -7.014  -5.670  1.00 15.00 ?  220 ASN A O    1  
ATOM   2610   C  CB   . ASN A 1 178 ? 9.620   -9.073  -6.755  1.00 15.00 ?  220 ASN A CB   1  
ATOM   2611   C  CG   . ASN A 1 178 ? 9.836   -9.099  -8.261  1.00 15.00 ?  220 ASN A CG   1  
ATOM   2612   O  OD1  . ASN A 1 178 ? 10.891  -8.715  -8.766  1.00 15.00 ?  220 ASN A OD1  1  
ATOM   2613   N  ND2  . ASN A 1 178 ? 8.833   -9.560  -8.992  1.00 15.00 ?  220 ASN A ND2  1  
ATOM   2614   H  H    . ASN A 1 178 ? 9.725   -9.328  -4.209  1.00 15.00 ?  220 ASN A H    1  
ATOM   2615   H  HA   . ASN A 1 178 ? 11.403  -10.198 -6.360  1.00 15.00 ?  220 ASN A HA   1  
ATOM   2616   H  HB2  . ASN A 1 178 ? 8.891   -9.830  -6.506  1.00 15.00 ?  220 ASN A HB2  1  
ATOM   2617   H  HB3  . ASN A 1 178 ? 9.228   -8.104  -6.483  1.00 15.00 ?  220 ASN A HB3  1  
ATOM   2618   H  HD21 . ASN A 1 178 ? 8.020   -9.859  -8.532  1.00 15.00 ?  220 ASN A HD21 1  
ATOM   2619   H  HD22 . ASN A 1 178 ? 8.937   -9.583  -9.966  1.00 15.00 ?  220 ASN A HD22 1  
ATOM   2620   N  N    . LEU A 1 179 ? 13.043  -8.378  -6.584  1.00 15.00 ?  221 LEU A N    1  
ATOM   2621   C  CA   . LEU A 1 179 ? 14.047  -7.336  -6.750  1.00 15.00 ?  221 LEU A CA   1  
ATOM   2622   C  C    . LEU A 1 179 ? 14.345  -7.112  -8.231  1.00 15.00 ?  221 LEU A C    1  
ATOM   2623   O  O    . LEU A 1 179 ? 15.451  -6.720  -8.604  1.00 15.00 ?  221 LEU A O    1  
ATOM   2624   C  CB   . LEU A 1 179 ? 15.331  -7.719  -5.997  1.00 15.00 ?  221 LEU A CB   1  
ATOM   2625   C  CG   . LEU A 1 179 ? 15.192  -7.845  -4.478  1.00 15.00 ?  221 LEU A CG   1  
ATOM   2626   C  CD1  . LEU A 1 179 ? 16.441  -8.479  -3.885  1.00 15.00 ?  221 LEU A CD1  1  
ATOM   2627   C  CD2  . LEU A 1 179 ? 14.931  -6.483  -3.842  1.00 15.00 ?  221 LEU A CD2  1  
ATOM   2628   H  H    . LEU A 1 179 ? 13.262  -9.295  -6.864  1.00 15.00 ?  221 LEU A H    1  
ATOM   2629   H  HA   . LEU A 1 179 ? 13.652  -6.423  -6.331  1.00 15.00 ?  221 LEU A HA   1  
ATOM   2630   H  HB2  . LEU A 1 179 ? 15.680  -8.667  -6.381  1.00 15.00 ?  221 LEU A HB2  1  
ATOM   2631   H  HB3  . LEU A 1 179 ? 16.080  -6.970  -6.205  1.00 15.00 ?  221 LEU A HB3  1  
ATOM   2632   H  HG   . LEU A 1 179 ? 14.353  -8.489  -4.249  1.00 15.00 ?  221 LEU A HG   1  
ATOM   2633   H  HD11 . LEU A 1 179 ? 17.316  -7.957  -4.242  1.00 15.00 ?  221 LEU A HD11 1  
ATOM   2634   H  HD12 . LEU A 1 179 ? 16.496  -9.517  -4.183  1.00 15.00 ?  221 LEU A HD12 1  
ATOM   2635   H  HD13 . LEU A 1 179 ? 16.401  -8.417  -2.808  1.00 15.00 ?  221 LEU A HD13 1  
ATOM   2636   H  HD21 . LEU A 1 179 ? 15.683  -5.780  -4.174  1.00 15.00 ?  221 LEU A HD21 1  
ATOM   2637   H  HD22 . LEU A 1 179 ? 14.972  -6.574  -2.765  1.00 15.00 ?  221 LEU A HD22 1  
ATOM   2638   H  HD23 . LEU A 1 179 ? 13.953  -6.130  -4.135  1.00 15.00 ?  221 LEU A HD23 1  
ATOM   2639   N  N    . GLY A 1 180 ? 13.348  -7.359  -9.072  1.00 15.00 ?  222 GLY A N    1  
ATOM   2640   C  CA   . GLY A 1 180 ? 13.520  -7.183  -10.500 1.00 15.00 ?  222 GLY A CA   1  
ATOM   2641   C  C    . GLY A 1 180 ? 13.710  -5.733  -10.885 1.00 15.00 ?  222 GLY A C    1  
ATOM   2642   O  O    . GLY A 1 180 ? 14.785  -5.334  -11.329 1.00 15.00 ?  222 GLY A O    1  
ATOM   2643   H  H    . GLY A 1 180 ? 12.478  -7.659  -8.717  1.00 15.00 ?  222 GLY A H    1  
ATOM   2644   H  HA2  . GLY A 1 180 ? 14.383  -7.746  -10.820 1.00 15.00 ?  222 GLY A HA2  1  
ATOM   2645   H  HA3  . GLY A 1 180 ? 12.647  -7.565  -11.004 1.00 15.00 ?  222 GLY A HA3  1  
ATOM   2646   N  N    . ASP A 1 181 ? 12.672  -4.941  -10.690 1.00 15.00 ?  223 ASP A N    1  
ATOM   2647   C  CA   . ASP A 1 181 ? 12.710  -3.520  -11.021 1.00 15.00 ?  223 ASP A CA   1  
ATOM   2648   C  C    . ASP A 1 181 ? 13.156  -2.710  -9.809  1.00 15.00 ?  223 ASP A C    1  
ATOM   2649   O  O    . ASP A 1 181 ? 12.934  -1.499  -9.733  1.00 15.00 ?  223 ASP A O    1  
ATOM   2650   C  CB   . ASP A 1 181 ? 11.323  -3.050  -11.479 1.00 15.00 ?  223 ASP A CB   1  
ATOM   2651   C  CG   . ASP A 1 181 ? 10.990  -3.463  -12.900 1.00 15.00 ?  223 ASP A CG   1  
ATOM   2652   O  OD1  . ASP A 1 181 ? 11.213  -2.655  -13.825 1.00 15.00 ?  223 ASP A OD1  1  
ATOM   2653   O  OD2  . ASP A 1 181 ? 10.503  -4.600  -13.103 1.00 15.00 -1 223 ASP A OD2  1  
ATOM   2654   H  H    . ASP A 1 181 ? 11.850  -5.321  -10.306 1.00 15.00 ?  223 ASP A H    1  
ATOM   2655   H  HA   . ASP A 1 181 ? 13.421  -3.375  -11.820 1.00 15.00 ?  223 ASP A HA   1  
ATOM   2656   H  HB2  . ASP A 1 181 ? 10.578  -3.474  -10.826 1.00 15.00 ?  223 ASP A HB2  1  
ATOM   2657   H  HB3  . ASP A 1 181 ? 11.277  -1.972  -11.419 1.00 15.00 ?  223 ASP A HB3  1  
ATOM   2658   N  N    . ALA A 1 182 ? 13.803  -3.390  -8.873  1.00 15.00 ?  224 ALA A N    1  
ATOM   2659   C  CA   . ALA A 1 182 ? 14.267  -2.767  -7.644  1.00 15.00 ?  224 ALA A CA   1  
ATOM   2660   C  C    . ALA A 1 182 ? 15.658  -2.170  -7.794  1.00 15.00 ?  224 ALA A C    1  
ATOM   2661   O  O    . ALA A 1 182 ? 16.412  -2.529  -8.700  1.00 15.00 ?  224 ALA A O    1  
ATOM   2662   C  CB   . ALA A 1 182 ? 14.256  -3.791  -6.518  1.00 15.00 ?  224 ALA A CB   1  
ATOM   2663   H  H    . ALA A 1 182 ? 13.976  -4.341  -9.014  1.00 15.00 ?  224 ALA A H    1  
ATOM   2664   H  HA   . ALA A 1 182 ? 13.576  -1.982  -7.387  1.00 15.00 ?  224 ALA A HA   1  
ATOM   2665   H  HB1  . ALA A 1 182 ? 13.285  -4.260  -6.470  1.00 15.00 ?  224 ALA A HB1  1  
ATOM   2666   H  HB2  . ALA A 1 182 ? 14.464  -3.300  -5.580  1.00 15.00 ?  224 ALA A HB2  1  
ATOM   2667   H  HB3  . ALA A 1 182 ? 15.011  -4.541  -6.706  1.00 15.00 ?  224 ALA A HB3  1  
ATOM   2668   N  N    . ASP A 1 183 ? 15.985  -1.260  -6.891  1.00 15.00 ?  225 ASP A N    1  
ATOM   2669   C  CA   . ASP A 1 183 ? 17.287  -0.613  -6.881  1.00 15.00 ?  225 ASP A CA   1  
ATOM   2670   C  C    . ASP A 1 183 ? 18.093  -1.161  -5.711  1.00 15.00 ?  225 ASP A C    1  
ATOM   2671   O  O    . ASP A 1 183 ? 17.741  -0.944  -4.558  1.00 15.00 ?  225 ASP A O    1  
ATOM   2672   C  CB   . ASP A 1 183 ? 17.132  0.911   -6.761  1.00 15.00 ?  225 ASP A CB   1  
ATOM   2673   C  CG   . ASP A 1 183 ? 18.433  1.654   -6.987  1.00 15.00 ?  225 ASP A CG   1  
ATOM   2674   O  OD1  . ASP A 1 183 ? 19.408  1.388   -6.261  1.00 15.00 ?  225 ASP A OD1  1  
ATOM   2675   O  OD2  . ASP A 1 183 ? 18.491  2.521   -7.884  1.00 15.00 -1 225 ASP A OD2  1  
ATOM   2676   H  H    . ASP A 1 183 ? 15.329  -1.023  -6.196  1.00 15.00 ?  225 ASP A H    1  
ATOM   2677   H  HA   . ASP A 1 183 ? 17.790  -0.854  -7.803  1.00 15.00 ?  225 ASP A HA   1  
ATOM   2678   H  HB2  . ASP A 1 183 ? 16.415  1.253   -7.490  1.00 15.00 ?  225 ASP A HB2  1  
ATOM   2679   H  HB3  . ASP A 1 183 ? 16.772  1.151   -5.771  1.00 15.00 ?  225 ASP A HB3  1  
ATOM   2680   N  N    . THR A 1 184 ? 19.167  -1.873  -6.009  1.00 15.00 ?  226 THR A N    1  
ATOM   2681   C  CA   . THR A 1 184 ? 19.994  -2.483  -4.975  1.00 15.00 ?  226 THR A CA   1  
ATOM   2682   C  C    . THR A 1 184 ? 21.046  -1.523  -4.420  1.00 15.00 ?  226 THR A C    1  
ATOM   2683   O  O    . THR A 1 184 ? 21.882  -1.911  -3.604  1.00 15.00 ?  226 THR A O    1  
ATOM   2684   C  CB   . THR A 1 184 ? 20.696  -3.738  -5.527  1.00 15.00 ?  226 THR A CB   1  
ATOM   2685   O  OG1  . THR A 1 184 ? 21.318  -3.435  -6.783  1.00 15.00 ?  226 THR A OG1  1  
ATOM   2686   C  CG2  . THR A 1 184 ? 19.704  -4.876  -5.720  1.00 15.00 ?  226 THR A CG2  1  
ATOM   2687   H  H    . THR A 1 184 ? 19.418  -1.990  -6.949  1.00 15.00 ?  226 THR A H    1  
ATOM   2688   H  HA   . THR A 1 184 ? 19.347  -2.787  -4.168  1.00 15.00 ?  226 THR A HA   1  
ATOM   2689   H  HB   . THR A 1 184 ? 21.453  -4.052  -4.822  1.00 15.00 ?  226 THR A HB   1  
ATOM   2690   H  HG1  . THR A 1 184 ? 22.261  -3.271  -6.640  1.00 15.00 ?  226 THR A HG1  1  
ATOM   2691   H  HG21 . THR A 1 184 ? 18.941  -4.828  -4.958  1.00 15.00 ?  226 THR A HG21 1  
ATOM   2692   H  HG22 . THR A 1 184 ? 20.225  -5.820  -5.647  1.00 15.00 ?  226 THR A HG22 1  
ATOM   2693   H  HG23 . THR A 1 184 ? 19.245  -4.793  -6.693  1.00 15.00 ?  226 THR A HG23 1  
ATOM   2694   N  N    . GLU A 1 185 ? 21.001  -0.272  -4.846  1.00 15.00 ?  227 GLU A N    1  
ATOM   2695   C  CA   . GLU A 1 185 ? 21.971  0.711   -4.392  1.00 15.00 ?  227 GLU A CA   1  
ATOM   2696   C  C    . GLU A 1 185 ? 21.328  1.745   -3.472  1.00 15.00 ?  227 GLU A C    1  
ATOM   2697   O  O    . GLU A 1 185 ? 21.898  2.129   -2.450  1.00 15.00 ?  227 GLU A O    1  
ATOM   2698   C  CB   . GLU A 1 185 ? 22.604  1.395   -5.605  1.00 15.00 ?  227 GLU A CB   1  
ATOM   2699   C  CG   . GLU A 1 185 ? 23.486  2.585   -5.270  1.00 15.00 ?  227 GLU A CG   1  
ATOM   2700   C  CD   . GLU A 1 185 ? 24.263  3.074   -6.471  1.00 15.00 ?  227 GLU A CD   1  
ATOM   2701   O  OE1  . GLU A 1 185 ? 25.207  2.374   -6.893  1.00 15.00 ?  227 GLU A OE1  1  
ATOM   2702   O  OE2  . GLU A 1 185 ? 23.934  4.154   -7.003  1.00 15.00 -1 227 GLU A OE2  1  
ATOM   2703   H  H    . GLU A 1 185 ? 20.298  0.004   -5.479  1.00 15.00 ?  227 GLU A H    1  
ATOM   2704   H  HA   . GLU A 1 185 ? 22.738  0.189   -3.846  1.00 15.00 ?  227 GLU A HA   1  
ATOM   2705   H  HB2  . GLU A 1 185 ? 23.206  0.671   -6.134  1.00 15.00 ?  227 GLU A HB2  1  
ATOM   2706   H  HB3  . GLU A 1 185 ? 21.815  1.737   -6.261  1.00 15.00 ?  227 GLU A HB3  1  
ATOM   2707   H  HG2  . GLU A 1 185 ? 22.862  3.392   -4.911  1.00 15.00 ?  227 GLU A HG2  1  
ATOM   2708   H  HG3  . GLU A 1 185 ? 24.184  2.300   -4.496  1.00 15.00 ?  227 GLU A HG3  1  
ATOM   2709   N  N    . HIS A 1 186 ? 20.138  2.192   -3.838  1.00 15.00 ?  228 HIS A N    1  
ATOM   2710   C  CA   . HIS A 1 186 ? 19.427  3.204   -3.063  1.00 15.00 ?  228 HIS A CA   1  
ATOM   2711   C  C    . HIS A 1 186 ? 18.413  2.590   -2.100  1.00 15.00 ?  228 HIS A C    1  
ATOM   2712   O  O    . HIS A 1 186 ? 17.812  3.302   -1.291  1.00 15.00 ?  228 HIS A O    1  
ATOM   2713   C  CB   . HIS A 1 186 ? 18.724  4.186   -4.003  1.00 15.00 ?  228 HIS A CB   1  
ATOM   2714   C  CG   . HIS A 1 186 ? 19.661  4.867   -4.952  1.00 15.00 ?  228 HIS A CG   1  
ATOM   2715   N  ND1  . HIS A 1 186 ? 19.902  4.432   -6.236  1.00 15.00 ?  228 HIS A ND1  1  
ATOM   2716   C  CD2  . HIS A 1 186 ? 20.442  5.960   -4.774  1.00 15.00 ?  228 HIS A CD2  1  
ATOM   2717   C  CE1  . HIS A 1 186 ? 20.804  5.250   -6.785  1.00 15.00 ?  228 HIS A CE1  1  
ATOM   2718   N  NE2  . HIS A 1 186 ? 21.165  6.197   -5.938  1.00 15.00 ?  228 HIS A NE2  1  
ATOM   2719   H  H    . HIS A 1 186 ? 19.733  1.850   -4.672  1.00 15.00 ?  228 HIS A H    1  
ATOM   2720   H  HA   . HIS A 1 186 ? 20.161  3.746   -2.487  1.00 15.00 ?  228 HIS A HA   1  
ATOM   2721   H  HB2  . HIS A 1 186 ? 17.989  3.654   -4.586  1.00 15.00 ?  228 HIS A HB2  1  
ATOM   2722   H  HB3  . HIS A 1 186 ? 18.233  4.948   -3.415  1.00 15.00 ?  228 HIS A HB3  1  
ATOM   2723   H  HD1  . HIS A 1 186 ? 19.482  3.652   -6.676  1.00 15.00 ?  228 HIS A HD1  1  
ATOM   2724   H  HD2  . HIS A 1 186 ? 20.503  6.553   -3.874  1.00 15.00 ?  228 HIS A HD2  1  
ATOM   2725   H  HE1  . HIS A 1 186 ? 21.194  5.144   -7.787  1.00 15.00 ?  228 HIS A HE1  1  
ATOM   2726   N  N    . TYR A 1 187 ? 18.246  1.272   -2.167  1.00 15.00 ?  229 TYR A N    1  
ATOM   2727   C  CA   . TYR A 1 187 ? 17.293  0.568   -1.306  1.00 15.00 ?  229 TYR A CA   1  
ATOM   2728   C  C    . TYR A 1 187 ? 17.603  0.802   0.173   1.00 15.00 ?  229 TYR A C    1  
ATOM   2729   O  O    . TYR A 1 187 ? 16.698  1.078   0.968   1.00 15.00 ?  229 TYR A O    1  
ATOM   2730   C  CB   . TYR A 1 187 ? 17.309  -0.936  -1.608  1.00 15.00 ?  229 TYR A CB   1  
ATOM   2731   C  CG   . TYR A 1 187 ? 15.968  -1.619  -1.421  1.00 15.00 ?  229 TYR A CG   1  
ATOM   2732   C  CD1  . TYR A 1 187 ? 15.233  -1.453  -0.254  1.00 15.00 ?  229 TYR A CD1  1  
ATOM   2733   C  CD2  . TYR A 1 187 ? 15.438  -2.435  -2.416  1.00 15.00 ?  229 TYR A CD2  1  
ATOM   2734   C  CE1  . TYR A 1 187 ? 14.008  -2.069  -0.087  1.00 15.00 ?  229 TYR A CE1  1  
ATOM   2735   C  CE2  . TYR A 1 187 ? 14.212  -3.055  -2.253  1.00 15.00 ?  229 TYR A CE2  1  
ATOM   2736   C  CZ   . TYR A 1 187 ? 13.503  -2.869  -1.088  1.00 15.00 ?  229 TYR A CZ   1  
ATOM   2737   O  OH   . TYR A 1 187 ? 12.275  -3.470  -0.922  1.00 15.00 ?  229 TYR A OH   1  
ATOM   2738   H  H    . TYR A 1 187 ? 18.776  0.758   -2.812  1.00 15.00 ?  229 TYR A H    1  
ATOM   2739   H  HA   . TYR A 1 187 ? 16.310  0.955   -1.517  1.00 15.00 ?  229 TYR A HA   1  
ATOM   2740   H  HB2  . TYR A 1 187 ? 17.614  -1.084  -2.634  1.00 15.00 ?  229 TYR A HB2  1  
ATOM   2741   H  HB3  . TYR A 1 187 ? 18.021  -1.418  -0.958  1.00 15.00 ?  229 TYR A HB3  1  
ATOM   2742   H  HD1  . TYR A 1 187 ? 15.629  -0.823  0.530   1.00 15.00 ?  229 TYR A HD1  1  
ATOM   2743   H  HD2  . TYR A 1 187 ? 15.997  -2.581  -3.330  1.00 15.00 ?  229 TYR A HD2  1  
ATOM   2744   H  HE1  . TYR A 1 187 ? 13.456  -1.932  0.830   1.00 15.00 ?  229 TYR A HE1  1  
ATOM   2745   H  HE2  . TYR A 1 187 ? 13.816  -3.682  -3.038  1.00 15.00 ?  229 TYR A HE2  1  
ATOM   2746   H  HH   . TYR A 1 187 ? 11.733  -2.922  -0.338  1.00 15.00 ?  229 TYR A HH   1  
ATOM   2747   N  N    . ALA A 1 188 ? 18.883  0.717   0.523   1.00 15.00 ?  230 ALA A N    1  
ATOM   2748   C  CA   . ALA A 1 188 ? 19.326  0.897   1.903   1.00 15.00 ?  230 ALA A CA   1  
ATOM   2749   C  C    . ALA A 1 188 ? 18.968  2.280   2.443   1.00 15.00 ?  230 ALA A C    1  
ATOM   2750   O  O    . ALA A 1 188 ? 18.731  2.447   3.641   1.00 15.00 ?  230 ALA A O    1  
ATOM   2751   C  CB   . ALA A 1 188 ? 20.826  0.666   1.996   1.00 15.00 ?  230 ALA A CB   1  
ATOM   2752   H  H    . ALA A 1 188 ? 19.555  0.522   -0.170  1.00 15.00 ?  230 ALA A H    1  
ATOM   2753   H  HA   . ALA A 1 188 ? 18.839  0.149   2.507   1.00 15.00 ?  230 ALA A HA   1  
ATOM   2754   H  HB1  . ALA A 1 188 ? 21.343  1.463   1.482   1.00 15.00 ?  230 ALA A HB1  1  
ATOM   2755   H  HB2  . ALA A 1 188 ? 21.074  -0.279  1.533   1.00 15.00 ?  230 ALA A HB2  1  
ATOM   2756   H  HB3  . ALA A 1 188 ? 21.128  0.649   3.033   1.00 15.00 ?  230 ALA A HB3  1  
ATOM   2757   N  N    . ALA A 1 189 ? 18.922  3.264   1.561   1.00 15.00 ?  231 ALA A N    1  
ATOM   2758   C  CA   . ALA A 1 189 ? 18.597  4.623   1.959   1.00 15.00 ?  231 ALA A CA   1  
ATOM   2759   C  C    . ALA A 1 189 ? 17.088  4.836   2.016   1.00 15.00 ?  231 ALA A C    1  
ATOM   2760   O  O    . ALA A 1 189 ? 16.575  5.417   2.972   1.00 15.00 ?  231 ALA A O    1  
ATOM   2761   C  CB   . ALA A 1 189 ? 19.237  5.622   1.007   1.00 15.00 ?  231 ALA A CB   1  
ATOM   2762   H  H    . ALA A 1 189 ? 19.113  3.069   0.618   1.00 15.00 ?  231 ALA A H    1  
ATOM   2763   H  HA   . ALA A 1 189 ? 19.011  4.787   2.944   1.00 15.00 ?  231 ALA A HA   1  
ATOM   2764   H  HB1  . ALA A 1 189 ? 18.951  5.389   -0.007  1.00 15.00 ?  231 ALA A HB1  1  
ATOM   2765   H  HB2  . ALA A 1 189 ? 20.313  5.566   1.099   1.00 15.00 ?  231 ALA A HB2  1  
ATOM   2766   H  HB3  . ALA A 1 189 ? 18.903  6.617   1.255   1.00 15.00 ?  231 ALA A HB3  1  
ATOM   2767   N  N    . SER A 1 190 ? 16.388  4.348   1.002   1.00 15.00 ?  232 SER A N    1  
ATOM   2768   C  CA   . SER A 1 190 ? 14.940  4.492   0.917   1.00 15.00 ?  232 SER A CA   1  
ATOM   2769   C  C    . SER A 1 190 ? 14.225  3.860   2.112   1.00 15.00 ?  232 SER A C    1  
ATOM   2770   O  O    . SER A 1 190 ? 13.260  4.424   2.628   1.00 15.00 ?  232 SER A O    1  
ATOM   2771   C  CB   . SER A 1 190 ? 14.441  3.876   -0.388  1.00 15.00 ?  232 SER A CB   1  
ATOM   2772   O  OG   . SER A 1 190 ? 15.135  4.431   -1.494  1.00 15.00 ?  232 SER A OG   1  
ATOM   2773   H  H    . SER A 1 190 ? 16.861  3.889   0.270   1.00 15.00 ?  232 SER A H    1  
ATOM   2774   H  HA   . SER A 1 190 ? 14.718  5.547   0.906   1.00 15.00 ?  232 SER A HA   1  
ATOM   2775   H  HB2  . SER A 1 190 ? 14.611  2.810   -0.367  1.00 15.00 ?  232 SER A HB2  1  
ATOM   2776   H  HB3  . SER A 1 190 ? 13.385  4.074   -0.499  1.00 15.00 ?  232 SER A HB3  1  
ATOM   2777   H  HG   . SER A 1 190 ? 15.290  3.745   -2.160  1.00 15.00 ?  232 SER A HG   1  
ATOM   2778   N  N    . ALA A 1 191 ? 14.694  2.696   2.558   1.00 15.00 ?  233 ALA A N    1  
ATOM   2779   C  CA   . ALA A 1 191 ? 14.082  2.026   3.701   1.00 15.00 ?  233 ALA A CA   1  
ATOM   2780   C  C    . ALA A 1 191 ? 14.189  2.889   4.955   1.00 15.00 ?  233 ALA A C    1  
ATOM   2781   O  O    . ALA A 1 191 ? 13.260  2.954   5.758   1.00 15.00 ?  233 ALA A O    1  
ATOM   2782   C  CB   . ALA A 1 191 ? 14.725  0.668   3.932   1.00 15.00 ?  233 ALA A CB   1  
ATOM   2783   H  H    . ALA A 1 191 ? 15.462  2.276   2.105   1.00 15.00 ?  233 ALA A H    1  
ATOM   2784   H  HA   . ALA A 1 191 ? 13.038  1.871   3.473   1.00 15.00 ?  233 ALA A HA   1  
ATOM   2785   H  HB1  . ALA A 1 191 ? 14.563  0.044   3.068   1.00 15.00 ?  233 ALA A HB1  1  
ATOM   2786   H  HB2  . ALA A 1 191 ? 14.285  0.204   4.802   1.00 15.00 ?  233 ALA A HB2  1  
ATOM   2787   H  HB3  . ALA A 1 191 ? 15.786  0.796   4.088   1.00 15.00 ?  233 ALA A HB3  1  
ATOM   2788   N  N    . ARG A 1 192 ? 15.317  3.575   5.098   1.00 15.00 ?  234 ARG A N    1  
ATOM   2789   C  CA   . ARG A 1 192 ? 15.553  4.430   6.254   1.00 15.00 ?  234 ARG A CA   1  
ATOM   2790   C  C    . ARG A 1 192 ? 14.811  5.756   6.118   1.00 15.00 ?  234 ARG A C    1  
ATOM   2791   O  O    . ARG A 1 192 ? 14.422  6.363   7.117   1.00 15.00 ?  234 ARG A O    1  
ATOM   2792   C  CB   . ARG A 1 192 ? 17.050  4.676   6.424   1.00 15.00 ?  234 ARG A CB   1  
ATOM   2793   C  CG   . ARG A 1 192 ? 17.819  3.443   6.868   1.00 15.00 ?  234 ARG A CG   1  
ATOM   2794   C  CD   . ARG A 1 192 ? 19.314  3.712   6.926   1.00 15.00 ?  234 ARG A CD   1  
ATOM   2795   N  NE   . ARG A 1 192 ? 20.059  2.626   7.565   1.00 15.00 ?  234 ARG A NE   1  
ATOM   2796   C  CZ   . ARG A 1 192 ? 20.692  1.653   6.901   1.00 15.00 ?  234 ARG A CZ   1  
ATOM   2797   N  NH1  . ARG A 1 192 ? 20.667  1.607   5.575   1.00 15.00 1  234 ARG A NH1  1  
ATOM   2798   N  NH2  . ARG A 1 192 ? 21.367  0.726   7.563   1.00 15.00 ?  234 ARG A NH2  1  
ATOM   2799   H  H    . ARG A 1 192 ? 16.007  3.510   4.404   1.00 15.00 ?  234 ARG A H    1  
ATOM   2800   H  HA   . ARG A 1 192 ? 15.185  3.913   7.128   1.00 15.00 ?  234 ARG A HA   1  
ATOM   2801   H  HB2  . ARG A 1 192 ? 17.458  5.003   5.479   1.00 15.00 ?  234 ARG A HB2  1  
ATOM   2802   H  HB3  . ARG A 1 192 ? 17.196  5.453   7.161   1.00 15.00 ?  234 ARG A HB3  1  
ATOM   2803   H  HG2  . ARG A 1 192 ? 17.473  3.145   7.847   1.00 15.00 ?  234 ARG A HG2  1  
ATOM   2804   H  HG3  . ARG A 1 192 ? 17.632  2.646   6.162   1.00 15.00 ?  234 ARG A HG3  1  
ATOM   2805   H  HD2  . ARG A 1 192 ? 19.680  3.844   5.920   1.00 15.00 ?  234 ARG A HD2  1  
ATOM   2806   H  HD3  . ARG A 1 192 ? 19.477  4.620   7.485   1.00 15.00 ?  234 ARG A HD3  1  
ATOM   2807   H  HE   . ARG A 1 192 ? 20.093  2.629   8.548   1.00 15.00 ?  234 ARG A HE   1  
ATOM   2808   H  HH11 . ARG A 1 192 ? 21.180  0.834   5.072   1.00 15.00 ?  234 ARG A HH11 1  
ATOM   2809   H  HH12 . ARG A 1 192 ? 20.146  2.322   5.027   1.00 15.00 ?  234 ARG A HH12 1  
ATOM   2810   H  HH21 . ARG A 1 192 ? 21.411  0.747   8.604   1.00 15.00 ?  234 ARG A HH21 1  
ATOM   2811   H  HH22 . ARG A 1 192 ? 21.861  -0.030  7.040   1.00 15.00 ?  234 ARG A HH22 1  
ATOM   2812   N  N    . ALA A 1 193 ? 14.619  6.204   4.879   1.00 15.00 ?  235 ALA A N    1  
ATOM   2813   C  CA   . ALA A 1 193 ? 13.913  7.454   4.618   1.00 15.00 ?  235 ALA A CA   1  
ATOM   2814   C  C    . ALA A 1 193 ? 12.481  7.369   5.130   1.00 15.00 ?  235 ALA A C    1  
ATOM   2815   O  O    . ALA A 1 193 ? 11.951  8.325   5.695   1.00 15.00 ?  235 ALA A O    1  
ATOM   2816   C  CB   . ALA A 1 193 ? 13.930  7.778   3.133   1.00 15.00 ?  235 ALA A CB   1  
ATOM   2817   H  H    . ALA A 1 193 ? 14.976  5.686   4.123   1.00 15.00 ?  235 ALA A H    1  
ATOM   2818   H  HA   . ALA A 1 193 ? 14.428  8.247   5.143   1.00 15.00 ?  235 ALA A HA   1  
ATOM   2819   H  HB1  . ALA A 1 193 ? 13.540  6.941   2.574   1.00 15.00 ?  235 ALA A HB1  1  
ATOM   2820   H  HB2  . ALA A 1 193 ? 14.944  7.975   2.820   1.00 15.00 ?  235 ALA A HB2  1  
ATOM   2821   H  HB3  . ALA A 1 193 ? 13.320  8.650   2.948   1.00 15.00 ?  235 ALA A HB3  1  
ATOM   2822   N  N    . PHE A 1 194 ? 11.878  6.202   4.938   1.00 15.00 ?  236 PHE A N    1  
ATOM   2823   C  CA   . PHE A 1 194 ? 10.515  5.945   5.386   1.00 15.00 ?  236 PHE A CA   1  
ATOM   2824   C  C    . PHE A 1 194 ? 10.451  5.993   6.912   1.00 15.00 ?  236 PHE A C    1  
ATOM   2825   O  O    . PHE A 1 194 ? 9.558   6.612   7.490   1.00 15.00 ?  236 PHE A O    1  
ATOM   2826   C  CB   . PHE A 1 194 ? 10.048  4.576   4.865   1.00 15.00 ?  236 PHE A CB   1  
ATOM   2827   C  CG   . PHE A 1 194 ? 8.838   4.020   5.568   1.00 15.00 ?  236 PHE A CG   1  
ATOM   2828   C  CD1  . PHE A 1 194 ? 7.596   4.627   5.440   1.00 15.00 ?  236 PHE A CD1  1  
ATOM   2829   C  CD2  . PHE A 1 194 ? 8.942   2.884   6.355   1.00 15.00 ?  236 PHE A CD2  1  
ATOM   2830   C  CE1  . PHE A 1 194 ? 6.486   4.112   6.079   1.00 15.00 ?  236 PHE A CE1  1  
ATOM   2831   C  CE2  . PHE A 1 194 ? 7.836   2.366   6.998   1.00 15.00 ?  236 PHE A CE2  1  
ATOM   2832   C  CZ   . PHE A 1 194 ? 6.606   2.981   6.861   1.00 15.00 ?  236 PHE A CZ   1  
ATOM   2833   H  H    . PHE A 1 194 ? 12.366  5.487   4.476   1.00 15.00 ?  236 PHE A H    1  
ATOM   2834   H  HA   . PHE A 1 194 ? 9.877   6.717   4.982   1.00 15.00 ?  236 PHE A HA   1  
ATOM   2835   H  HB2  . PHE A 1 194 ? 9.804   4.664   3.818   1.00 15.00 ?  236 PHE A HB2  1  
ATOM   2836   H  HB3  . PHE A 1 194 ? 10.856  3.865   4.978   1.00 15.00 ?  236 PHE A HB3  1  
ATOM   2837   H  HD1  . PHE A 1 194 ? 7.502   5.511   4.830   1.00 15.00 ?  236 PHE A HD1  1  
ATOM   2838   H  HD2  . PHE A 1 194 ? 9.904   2.398   6.465   1.00 15.00 ?  236 PHE A HD2  1  
ATOM   2839   H  HE1  . PHE A 1 194 ? 5.527   4.593   5.968   1.00 15.00 ?  236 PHE A HE1  1  
ATOM   2840   H  HE2  . PHE A 1 194 ? 7.932   1.482   7.613   1.00 15.00 ?  236 PHE A HE2  1  
ATOM   2841   H  HZ   . PHE A 1 194 ? 5.738   2.575   7.360   1.00 15.00 ?  236 PHE A HZ   1  
ATOM   2842   N  N    . GLY A 1 195 ? 11.434  5.369   7.553   1.00 15.00 ?  237 GLY A N    1  
ATOM   2843   C  CA   . GLY A 1 195 ? 11.476  5.344   9.001   1.00 15.00 ?  237 GLY A CA   1  
ATOM   2844   C  C    . GLY A 1 195 ? 11.692  6.722   9.598   1.00 15.00 ?  237 GLY A C    1  
ATOM   2845   O  O    . GLY A 1 195 ? 11.162  7.030   10.667  1.00 15.00 ?  237 GLY A O    1  
ATOM   2846   H  H    . GLY A 1 195 ? 12.137  4.920   7.034   1.00 15.00 ?  237 GLY A H    1  
ATOM   2847   H  HA2  . GLY A 1 195 ? 10.543  4.945   9.370   1.00 15.00 ?  237 GLY A HA2  1  
ATOM   2848   H  HA3  . GLY A 1 195 ? 12.282  4.697   9.317   1.00 15.00 ?  237 GLY A HA3  1  
ATOM   2849   N  N    . ALA A 1 196 ? 12.473  7.545   8.904   1.00 15.00 ?  238 ALA A N    1  
ATOM   2850   C  CA   . ALA A 1 196 ? 12.763  8.899   9.360   1.00 15.00 ?  238 ALA A CA   1  
ATOM   2851   C  C    . ALA A 1 196 ? 11.569  9.817   9.121   1.00 15.00 ?  238 ALA A C    1  
ATOM   2852   O  O    . ALA A 1 196 ? 11.390  10.809  9.828   1.00 15.00 ?  238 ALA A O    1  
ATOM   2853   C  CB   . ALA A 1 196 ? 14.007  9.450   8.669   1.00 15.00 ?  238 ALA A CB   1  
ATOM   2854   H  H    . ALA A 1 196 ? 12.873  7.226   8.064   1.00 15.00 ?  238 ALA A H    1  
ATOM   2855   H  HA   . ALA A 1 196 ? 12.962  8.854   10.424  1.00 15.00 ?  238 ALA A HA   1  
ATOM   2856   H  HB1  . ALA A 1 196 ? 13.857  9.455   7.599   1.00 15.00 ?  238 ALA A HB1  1  
ATOM   2857   H  HB2  . ALA A 1 196 ? 14.861  8.833   8.910   1.00 15.00 ?  238 ALA A HB2  1  
ATOM   2858   H  HB3  . ALA A 1 196 ? 14.188  10.459  9.007   1.00 15.00 ?  238 ALA A HB3  1  
ATOM   2859   N  N    . ALA A 1 197 ? 10.754  9.481   8.124   1.00 15.00 ?  239 ALA A N    1  
ATOM   2860   C  CA   . ALA A 1 197 ? 9.573   10.268  7.798   1.00 15.00 ?  239 ALA A CA   1  
ATOM   2861   C  C    . ALA A 1 197 ? 8.505   10.075  8.862   1.00 15.00 ?  239 ALA A C    1  
ATOM   2862   O  O    . ALA A 1 197 ? 7.858   11.032  9.293   1.00 15.00 ?  239 ALA A O    1  
ATOM   2863   C  CB   . ALA A 1 197 ? 9.034   9.885   6.424   1.00 15.00 ?  239 ALA A CB   1  
ATOM   2864   H  H    . ALA A 1 197 ? 10.956  8.679   7.593   1.00 15.00 ?  239 ALA A H    1  
ATOM   2865   H  HA   . ALA A 1 197 ? 9.860   11.310  7.769   1.00 15.00 ?  239 ALA A HA   1  
ATOM   2866   H  HB1  . ALA A 1 197 ? 8.256   10.576  6.135   1.00 15.00 ?  239 ALA A HB1  1  
ATOM   2867   H  HB2  . ALA A 1 197 ? 8.628   8.882   6.460   1.00 15.00 ?  239 ALA A HB2  1  
ATOM   2868   H  HB3  . ALA A 1 197 ? 9.834   9.922   5.699   1.00 15.00 ?  239 ALA A HB3  1  
ATOM   2869   N  N    . PHE A 1 198 ? 8.339   8.833   9.297   1.00 15.00 ?  240 PHE A N    1  
ATOM   2870   C  CA   . PHE A 1 198 ? 7.356   8.505   10.322  1.00 15.00 ?  240 PHE A CA   1  
ATOM   2871   C  C    . PHE A 1 198 ? 8.030   7.813   11.503  1.00 15.00 ?  240 PHE A C    1  
ATOM   2872   O  O    . PHE A 1 198 ? 7.975   6.590   11.630  1.00 15.00 ?  240 PHE A O    1  
ATOM   2873   C  CB   . PHE A 1 198 ? 6.251   7.616   9.740   1.00 15.00 ?  240 PHE A CB   1  
ATOM   2874   C  CG   . PHE A 1 198 ? 5.586   8.201   8.521   1.00 15.00 ?  240 PHE A CG   1  
ATOM   2875   C  CD1  . PHE A 1 198 ? 4.703   9.262   8.639   1.00 15.00 ?  240 PHE A CD1  1  
ATOM   2876   C  CD2  . PHE A 1 198 ? 5.855   7.694   7.257   1.00 15.00 ?  240 PHE A CD2  1  
ATOM   2877   C  CE1  . PHE A 1 198 ? 4.099   9.807   7.523   1.00 15.00 ?  240 PHE A CE1  1  
ATOM   2878   C  CE2  . PHE A 1 198 ? 5.251   8.236   6.137   1.00 15.00 ?  240 PHE A CE2  1  
ATOM   2879   C  CZ   . PHE A 1 198 ? 4.375   9.296   6.271   1.00 15.00 ?  240 PHE A CZ   1  
ATOM   2880   H  H    . PHE A 1 198 ? 8.897   8.117   8.920   1.00 15.00 ?  240 PHE A H    1  
ATOM   2881   H  HA   . PHE A 1 198 ? 6.917   9.429   10.670  1.00 15.00 ?  240 PHE A HA   1  
ATOM   2882   H  HB2  . PHE A 1 198 ? 6.675   6.663   9.462   1.00 15.00 ?  240 PHE A HB2  1  
ATOM   2883   H  HB3  . PHE A 1 198 ? 5.491   7.459   10.492  1.00 15.00 ?  240 PHE A HB3  1  
ATOM   2884   H  HD1  . PHE A 1 198 ? 4.489   9.663   9.619   1.00 15.00 ?  240 PHE A HD1  1  
ATOM   2885   H  HD2  . PHE A 1 198 ? 6.540   6.865   7.153   1.00 15.00 ?  240 PHE A HD2  1  
ATOM   2886   H  HE1  . PHE A 1 198 ? 3.411   10.632  7.628   1.00 15.00 ?  240 PHE A HE1  1  
ATOM   2887   H  HE2  . PHE A 1 198 ? 5.466   7.835   5.159   1.00 15.00 ?  240 PHE A HE2  1  
ATOM   2888   H  HZ   . PHE A 1 198 ? 3.904   9.722   5.397   1.00 15.00 ?  240 PHE A HZ   1  
ATOM   2889   N  N    . PRO A 1 199 ? 8.688   8.591   12.383  1.00 15.00 ?  241 PRO A N    1  
ATOM   2890   C  CA   . PRO A 1 199 ? 9.380   8.049   13.555  1.00 15.00 ?  241 PRO A CA   1  
ATOM   2891   C  C    . PRO A 1 199 ? 8.431   7.776   14.721  1.00 15.00 ?  241 PRO A C    1  
ATOM   2892   O  O    . PRO A 1 199 ? 8.755   7.027   15.641  1.00 15.00 ?  241 PRO A O    1  
ATOM   2893   C  CB   . PRO A 1 199 ? 10.365  9.163   13.909  1.00 15.00 ?  241 PRO A CB   1  
ATOM   2894   C  CG   . PRO A 1 199 ? 9.703   10.421  13.462  1.00 15.00 ?  241 PRO A CG   1  
ATOM   2895   C  CD   . PRO A 1 199 ? 8.825   10.060  12.293  1.00 15.00 ?  241 PRO A CD   1  
ATOM   2896   H  HA   . PRO A 1 199 ? 9.919   7.144   13.312  1.00 15.00 ?  241 PRO A HA   1  
ATOM   2897   H  HB2  . PRO A 1 199 ? 10.537  9.174   14.978  1.00 15.00 ?  241 PRO A HB2  1  
ATOM   2898   H  HB3  . PRO A 1 199 ? 11.294  9.025   13.380  1.00 15.00 ?  241 PRO A HB3  1  
ATOM   2899   H  HG2  . PRO A 1 199 ? 9.109   10.825  14.270  1.00 15.00 ?  241 PRO A HG2  1  
ATOM   2900   H  HG3  . PRO A 1 199 ? 10.449  11.135  13.151  1.00 15.00 ?  241 PRO A HG3  1  
ATOM   2901   H  HD2  . PRO A 1 199 ? 7.863   10.542  12.381  1.00 15.00 ?  241 PRO A HD2  1  
ATOM   2902   H  HD3  . PRO A 1 199 ? 9.306   10.342  11.368  1.00 15.00 ?  241 PRO A HD3  1  
ATOM   2903   N  N    . LYS A 1 200 ? 7.248   8.375   14.667  1.00 15.00 ?  242 LYS A N    1  
ATOM   2904   C  CA   . LYS A 1 200 ? 6.256   8.197   15.719  1.00 15.00 ?  242 LYS A CA   1  
ATOM   2905   C  C    . LYS A 1 200 ? 5.307   7.060   15.373  1.00 15.00 ?  242 LYS A C    1  
ATOM   2906   O  O    . LYS A 1 200 ? 4.339   6.805   16.085  1.00 15.00 ?  242 LYS A O    1  
ATOM   2907   C  CB   . LYS A 1 200 ? 5.470   9.487   15.948  1.00 15.00 ?  242 LYS A CB   1  
ATOM   2908   C  CG   . LYS A 1 200 ? 6.250   10.546  16.705  1.00 15.00 ?  242 LYS A CG   1  
ATOM   2909   C  CD   . LYS A 1 200 ? 5.424   11.806  16.888  1.00 15.00 ?  242 LYS A CD   1  
ATOM   2910   C  CE   . LYS A 1 200 ? 6.043   12.735  17.921  1.00 15.00 ?  242 LYS A CE   1  
ATOM   2911   N  NZ   . LYS A 1 200 ? 5.946   12.182  19.298  1.00 15.00 1  242 LYS A NZ   1  
ATOM   2912   H  H    . LYS A 1 200 ? 7.037   8.944   13.898  1.00 15.00 ?  242 LYS A H    1  
ATOM   2913   H  HA   . LYS A 1 200 ? 6.785   7.942   16.624  1.00 15.00 ?  242 LYS A HA   1  
ATOM   2914   H  HB2  . LYS A 1 200 ? 5.179   9.898   14.992  1.00 15.00 ?  242 LYS A HB2  1  
ATOM   2915   H  HB3  . LYS A 1 200 ? 4.583   9.252   16.517  1.00 15.00 ?  242 LYS A HB3  1  
ATOM   2916   H  HG2  . LYS A 1 200 ? 6.515   10.156  17.676  1.00 15.00 ?  242 LYS A HG2  1  
ATOM   2917   H  HG3  . LYS A 1 200 ? 7.149   10.788  16.152  1.00 15.00 ?  242 LYS A HG3  1  
ATOM   2918   H  HD2  . LYS A 1 200 ? 5.365   12.325  15.943  1.00 15.00 ?  242 LYS A HD2  1  
ATOM   2919   H  HD3  . LYS A 1 200 ? 4.431   11.530  17.213  1.00 15.00 ?  242 LYS A HD3  1  
ATOM   2920   H  HE2  . LYS A 1 200 ? 7.084   12.882  17.678  1.00 15.00 ?  242 LYS A HE2  1  
ATOM   2921   H  HE3  . LYS A 1 200 ? 5.529   13.686  17.885  1.00 15.00 ?  242 LYS A HE3  1  
ATOM   2922   H  HZ1  . LYS A 1 200 ? 6.507   11.312  19.378  1.00 15.00 ?  242 LYS A HZ1  1  
ATOM   2923   H  HZ2  . LYS A 1 200 ? 4.958   11.959  19.527  1.00 15.00 ?  242 LYS A HZ2  1  
ATOM   2924   H  HZ3  . LYS A 1 200 ? 6.304   12.876  19.987  1.00 15.00 ?  242 LYS A HZ3  1  
ATOM   2925   N  N    . ALA A 1 201 ? 5.598   6.374   14.279  1.00 15.00 ?  243 ALA A N    1  
ATOM   2926   C  CA   . ALA A 1 201 ? 4.776   5.262   13.833  1.00 15.00 ?  243 ALA A CA   1  
ATOM   2927   C  C    . ALA A 1 201 ? 5.360   3.946   14.328  1.00 15.00 ?  243 ALA A C    1  
ATOM   2928   O  O    . ALA A 1 201 ? 6.476   3.573   13.955  1.00 15.00 ?  243 ALA A O    1  
ATOM   2929   C  CB   . ALA A 1 201 ? 4.656   5.269   12.312  1.00 15.00 ?  243 ALA A CB   1  
ATOM   2930   H  H    . ALA A 1 201 ? 6.397   6.613   13.769  1.00 15.00 ?  243 ALA A H    1  
ATOM   2931   H  HA   . ALA A 1 201 ? 3.788   5.389   14.252  1.00 15.00 ?  243 ALA A HA   1  
ATOM   2932   H  HB1  . ALA A 1 201 ? 4.514   6.282   11.969  1.00 15.00 ?  243 ALA A HB1  1  
ATOM   2933   H  HB2  . ALA A 1 201 ? 3.808   4.669   12.014  1.00 15.00 ?  243 ALA A HB2  1  
ATOM   2934   H  HB3  . ALA A 1 201 ? 5.555   4.863   11.874  1.00 15.00 ?  243 ALA A HB3  1  
ATOM   2935   N  N    . SER A 1 202 ? 4.621   3.264   15.192  1.00 15.00 ?  244 SER A N    1  
ATOM   2936   C  CA   . SER A 1 202 ? 5.067   1.996   15.745  1.00 15.00 ?  244 SER A CA   1  
ATOM   2937   C  C    . SER A 1 202 ? 4.471   0.832   14.963  1.00 15.00 ?  244 SER A C    1  
ATOM   2938   O  O    . SER A 1 202 ? 5.084   -0.231  14.842  1.00 15.00 ?  244 SER A O    1  
ATOM   2939   C  CB   . SER A 1 202 ? 4.669   1.900   17.215  1.00 15.00 ?  244 SER A CB   1  
ATOM   2940   O  OG   . SER A 1 202 ? 4.160   3.140   17.679  1.00 15.00 ?  244 SER A OG   1  
ATOM   2941   H  H    . SER A 1 202 ? 3.752   3.622   15.467  1.00 15.00 ?  244 SER A H    1  
ATOM   2942   H  HA   . SER A 1 202 ? 6.143   1.954   15.665  1.00 15.00 ?  244 SER A HA   1  
ATOM   2943   H  HB2  . SER A 1 202 ? 3.905   1.145   17.328  1.00 15.00 ?  244 SER A HB2  1  
ATOM   2944   H  HB3  . SER A 1 202 ? 5.534   1.634   17.807  1.00 15.00 ?  244 SER A HB3  1  
ATOM   2945   H  HG   . SER A 1 202 ? 3.201   3.180   17.493  1.00 15.00 ?  244 SER A HG   1  
ATOM   2946   N  N    . MET A 1 203 ? 3.273   1.041   14.427  1.00 15.00 ?  245 MET A N    1  
ATOM   2947   C  CA   . MET A 1 203 ? 2.597   0.009   13.659  1.00 15.00 ?  245 MET A CA   1  
ATOM   2948   C  C    . MET A 1 203 ? 2.942   0.133   12.178  1.00 15.00 ?  245 MET A C    1  
ATOM   2949   O  O    . MET A 1 203 ? 2.353   0.942   11.455  1.00 15.00 ?  245 MET A O    1  
ATOM   2950   C  CB   . MET A 1 203 ? 1.079   0.087   13.851  1.00 15.00 ?  245 MET A CB   1  
ATOM   2951   C  CG   . MET A 1 203 ? 0.332   -1.100  13.254  1.00 15.00 ?  245 MET A CG   1  
ATOM   2952   S  SD   . MET A 1 203 ? -1.464  -0.947  13.380  1.00 15.00 ?  245 MET A SD   1  
ATOM   2953   C  CE   . MET A 1 203 ? -1.682  -0.797  15.154  1.00 15.00 ?  245 MET A CE   1  
ATOM   2954   H  H    . MET A 1 203 ? 2.838   1.917   14.542  1.00 15.00 ?  245 MET A H    1  
ATOM   2955   H  HA   . MET A 1 203 ? 2.945   -0.947  14.018  1.00 15.00 ?  245 MET A HA   1  
ATOM   2956   H  HB2  . MET A 1 203 ? 0.858   0.132   14.907  1.00 15.00 ?  245 MET A HB2  1  
ATOM   2957   H  HB3  . MET A 1 203 ? 0.715   0.986   13.378  1.00 15.00 ?  245 MET A HB3  1  
ATOM   2958   H  HG2  . MET A 1 203 ? 0.596   -1.183  12.212  1.00 15.00 ?  245 MET A HG2  1  
ATOM   2959   H  HG3  . MET A 1 203 ? 0.638   -1.997  13.771  1.00 15.00 ?  245 MET A HG3  1  
ATOM   2960   H  HE1  . MET A 1 203 ? -1.284  -1.675  15.641  1.00 15.00 ?  245 MET A HE1  1  
ATOM   2961   H  HE2  . MET A 1 203 ? -2.732  -0.708  15.379  1.00 15.00 ?  245 MET A HE2  1  
ATOM   2962   H  HE3  . MET A 1 203 ? -1.163  0.081   15.511  1.00 15.00 ?  245 MET A HE3  1  
ATOM   2963   N  N    . ILE A 1 204 ? 3.906   -0.660  11.735  1.00 15.00 ?  246 ILE A N    1  
ATOM   2964   C  CA   . ILE A 1 204 ? 4.328   -0.642  10.345  1.00 15.00 ?  246 ILE A CA   1  
ATOM   2965   C  C    . ILE A 1 204 ? 3.596   -1.724  9.567   1.00 15.00 ?  246 ILE A C    1  
ATOM   2966   O  O    . ILE A 1 204 ? 3.855   -2.916  9.736   1.00 15.00 ?  246 ILE A O    1  
ATOM   2967   C  CB   . ILE A 1 204 ? 5.853   -0.845  10.217  1.00 15.00 ?  246 ILE A CB   1  
ATOM   2968   C  CG1  . ILE A 1 204 ? 6.600   0.187   11.074  1.00 15.00 ?  246 ILE A CG1  1  
ATOM   2969   C  CG2  . ILE A 1 204 ? 6.289   -0.758  8.758   1.00 15.00 ?  246 ILE A CG2  1  
ATOM   2970   C  CD1  . ILE A 1 204 ? 6.252   1.624   10.742  1.00 15.00 ?  246 ILE A CD1  1  
ATOM   2971   H  H    . ILE A 1 204 ? 4.343   -1.283  12.357  1.00 15.00 ?  246 ILE A H    1  
ATOM   2972   H  HA   . ILE A 1 204 ? 4.072   0.326   9.930   1.00 15.00 ?  246 ILE A HA   1  
ATOM   2973   H  HB   . ILE A 1 204 ? 6.089   -1.833  10.575  1.00 15.00 ?  246 ILE A HB   1  
ATOM   2974   H  HG12 . ILE A 1 204 ? 6.359   0.023   12.114  1.00 15.00 ?  246 ILE A HG12 1  
ATOM   2975   H  HG13 . ILE A 1 204 ? 7.664   0.061   10.933  1.00 15.00 ?  246 ILE A HG13 1  
ATOM   2976   H  HG21 . ILE A 1 204 ? 7.350   -0.949  8.689   1.00 15.00 ?  246 ILE A HG21 1  
ATOM   2977   H  HG22 . ILE A 1 204 ? 6.074   0.231   8.374   1.00 15.00 ?  246 ILE A HG22 1  
ATOM   2978   H  HG23 . ILE A 1 204 ? 5.752   -1.495  8.178   1.00 15.00 ?  246 ILE A HG23 1  
ATOM   2979   H  HD11 . ILE A 1 204 ? 5.209   1.800   10.952  1.00 15.00 ?  246 ILE A HD11 1  
ATOM   2980   H  HD12 . ILE A 1 204 ? 6.445   1.807   9.697   1.00 15.00 ?  246 ILE A HD12 1  
ATOM   2981   H  HD13 . ILE A 1 204 ? 6.857   2.288   11.342  1.00 15.00 ?  246 ILE A HD13 1  
ATOM   2982   N  N    . VAL A 1 205 ? 2.669   -1.302  8.725   1.00 15.00 ?  247 VAL A N    1  
ATOM   2983   C  CA   . VAL A 1 205 ? 1.885   -2.226  7.929   1.00 15.00 ?  247 VAL A CA   1  
ATOM   2984   C  C    . VAL A 1 205 ? 2.503   -2.404  6.549   1.00 15.00 ?  247 VAL A C    1  
ATOM   2985   O  O    . VAL A 1 205 ? 2.798   -1.432  5.852   1.00 15.00 ?  247 VAL A O    1  
ATOM   2986   C  CB   . VAL A 1 205 ? 0.426   -1.747  7.782   1.00 15.00 ?  247 VAL A CB   1  
ATOM   2987   C  CG1  . VAL A 1 205 ? -0.456  -2.856  7.221   1.00 15.00 ?  247 VAL A CG1  1  
ATOM   2988   C  CG2  . VAL A 1 205 ? -0.115  -1.247  9.114   1.00 15.00 ?  247 VAL A CG2  1  
ATOM   2989   H  H    . VAL A 1 205 ? 2.512   -0.336  8.629   1.00 15.00 ?  247 VAL A H    1  
ATOM   2990   H  HA   . VAL A 1 205 ? 1.883   -3.180  8.434   1.00 15.00 ?  247 VAL A HA   1  
ATOM   2991   H  HB   . VAL A 1 205 ? 0.411   -0.923  7.085   1.00 15.00 ?  247 VAL A HB   1  
ATOM   2992   H  HG11 . VAL A 1 205 ? -0.326  -3.755  7.808   1.00 15.00 ?  247 VAL A HG11 1  
ATOM   2993   H  HG12 . VAL A 1 205 ? -0.177  -3.050  6.195   1.00 15.00 ?  247 VAL A HG12 1  
ATOM   2994   H  HG13 . VAL A 1 205 ? -1.490  -2.545  7.261   1.00 15.00 ?  247 VAL A HG13 1  
ATOM   2995   H  HG21 . VAL A 1 205 ? -0.274  -2.084  9.775   1.00 15.00 ?  247 VAL A HG21 1  
ATOM   2996   H  HG22 . VAL A 1 205 ? -1.051  -0.737  8.955   1.00 15.00 ?  247 VAL A HG22 1  
ATOM   2997   H  HG23 . VAL A 1 205 ? 0.594   -0.568  9.562   1.00 15.00 ?  247 VAL A HG23 1  
ATOM   2998   N  N    . MET A 1 206 ? 2.691   -3.653  6.165   1.00 15.00 ?  248 MET A N    1  
ATOM   2999   C  CA   . MET A 1 206 ? 3.268   -3.982  4.874   1.00 15.00 ?  248 MET A CA   1  
ATOM   3000   C  C    . MET A 1 206 ? 2.235   -4.713  4.031   1.00 15.00 ?  248 MET A C    1  
ATOM   3001   O  O    . MET A 1 206 ? 1.159   -5.048  4.522   1.00 15.00 ?  248 MET A O    1  
ATOM   3002   C  CB   . MET A 1 206 ? 4.526   -4.830  5.051   1.00 15.00 ?  248 MET A CB   1  
ATOM   3003   C  CG   . MET A 1 206 ? 4.352   -5.963  6.042   1.00 15.00 ?  248 MET A CG   1  
ATOM   3004   S  SD   . MET A 1 206 ? 5.868   -6.355  6.925   1.00 15.00 ?  248 MET A SD   1  
ATOM   3005   C  CE   . MET A 1 206 ? 6.081   -4.872  7.905   1.00 15.00 ?  248 MET A CE   1  
ATOM   3006   H  H    . MET A 1 206 ? 2.408   -4.379  6.758   1.00 15.00 ?  248 MET A H    1  
ATOM   3007   H  HA   . MET A 1 206 ? 3.529   -3.056  4.384   1.00 15.00 ?  248 MET A HA   1  
ATOM   3008   H  HB2  . MET A 1 206 ? 4.792   -5.255  4.097   1.00 15.00 ?  248 MET A HB2  1  
ATOM   3009   H  HB3  . MET A 1 206 ? 5.333   -4.198  5.393   1.00 15.00 ?  248 MET A HB3  1  
ATOM   3010   H  HG2  . MET A 1 206 ? 3.595   -5.688  6.761   1.00 15.00 ?  248 MET A HG2  1  
ATOM   3011   H  HG3  . MET A 1 206 ? 4.031   -6.842  5.503   1.00 15.00 ?  248 MET A HG3  1  
ATOM   3012   H  HE1  . MET A 1 206 ? 6.947   -4.980  8.539   1.00 15.00 ?  248 MET A HE1  1  
ATOM   3013   H  HE2  . MET A 1 206 ? 5.205   -4.717  8.515   1.00 15.00 ?  248 MET A HE2  1  
ATOM   3014   H  HE3  . MET A 1 206 ? 6.220   -4.024  7.252   1.00 15.00 ?  248 MET A HE3  1  
ATOM   3015   N  N    . SER A 1 207 ? 2.564   -4.981  2.782   1.00 15.00 ?  249 SER A N    1  
ATOM   3016   C  CA   . SER A 1 207 ? 1.626   -5.638  1.879   1.00 15.00 ?  249 SER A CA   1  
ATOM   3017   C  C    . SER A 1 207 ? 1.821   -7.148  1.771   1.00 15.00 ?  249 SER A C    1  
ATOM   3018   O  O    . SER A 1 207 ? 0.983   -7.826  1.184   1.00 15.00 ?  249 SER A O    1  
ATOM   3019   C  CB   . SER A 1 207 ? 1.744   -5.014  0.499   1.00 15.00 ?  249 SER A CB   1  
ATOM   3020   O  OG   . SER A 1 207 ? 1.580   -3.609  0.575   1.00 15.00 ?  249 SER A OG   1  
ATOM   3021   H  H    . SER A 1 207 ? 3.455   -4.720  2.449   1.00 15.00 ?  249 SER A H    1  
ATOM   3022   H  HA   . SER A 1 207 ? 0.633   -5.447  2.251   1.00 15.00 ?  249 SER A HA   1  
ATOM   3023   H  HB2  . SER A 1 207 ? 2.721   -5.231  0.090   1.00 15.00 ?  249 SER A HB2  1  
ATOM   3024   H  HB3  . SER A 1 207 ? 0.981   -5.422  -0.146  1.00 15.00 ?  249 SER A HB3  1  
ATOM   3025   H  HG   . SER A 1 207 ? 1.878   -3.297  1.435   1.00 15.00 ?  249 SER A HG   1  
ATOM   3026   N  N    . HIS A 1 208 ? 2.893   -7.686  2.329   1.00 15.00 ?  250 HIS A N    1  
ATOM   3027   C  CA   . HIS A 1 208 ? 3.123   -9.127  2.225   1.00 15.00 ?  250 HIS A CA   1  
ATOM   3028   C  C    . HIS A 1 208 ? 3.365   -9.786  3.577   1.00 15.00 ?  250 HIS A C    1  
ATOM   3029   O  O    . HIS A 1 208 ? 3.800   -10.936 3.644   1.00 15.00 ?  250 HIS A O    1  
ATOM   3030   C  CB   . HIS A 1 208 ? 4.294   -9.409  1.287   1.00 15.00 ?  250 HIS A CB   1  
ATOM   3031   C  CG   . HIS A 1 208 ? 3.960   -9.189  -0.152  1.00 15.00 ?  250 HIS A CG   1  
ATOM   3032   N  ND1  . HIS A 1 208 ? 2.865   -9.746  -0.779  1.00 15.00 ?  250 HIS A ND1  1  
ATOM   3033   C  CD2  . HIS A 1 208 ? 4.587   -8.440  -1.093  1.00 15.00 ?  250 HIS A CD2  1  
ATOM   3034   C  CE1  . HIS A 1 208 ? 2.861   -9.332  -2.048  1.00 15.00 ?  250 HIS A CE1  1  
ATOM   3035   N  NE2  . HIS A 1 208 ? 3.886   -8.535  -2.293  1.00 15.00 ?  250 HIS A NE2  1  
ATOM   3036   H  H    . HIS A 1 208 ? 3.536   -7.120  2.803   1.00 15.00 ?  250 HIS A H    1  
ATOM   3037   H  HA   . HIS A 1 208 ? 2.233   -9.561  1.795   1.00 15.00 ?  250 HIS A HA   1  
ATOM   3038   H  HB2  . HIS A 1 208 ? 5.117   -8.757  1.538   1.00 15.00 ?  250 HIS A HB2  1  
ATOM   3039   H  HB3  . HIS A 1 208 ? 4.603   -10.439 1.407   1.00 15.00 ?  250 HIS A HB3  1  
ATOM   3040   H  HD1  . HIS A 1 208 ? 2.193   -10.336 -0.366  1.00 15.00 ?  250 HIS A HD1  1  
ATOM   3041   H  HD2  . HIS A 1 208 ? 5.487   -7.862  -0.948  1.00 15.00 ?  250 HIS A HD2  1  
ATOM   3042   H  HE1  . HIS A 1 208 ? 2.116   -9.614  -2.777  1.00 15.00 ?  250 HIS A HE1  1  
ATOM   3043   N  N    . SER A 1 209 ? 3.080   -9.070  4.649   1.00 15.00 ?  251 SER A N    1  
ATOM   3044   C  CA   . SER A 1 209 ? 3.265   -9.601  5.994   1.00 15.00 ?  251 SER A CA   1  
ATOM   3045   C  C    . SER A 1 209 ? 2.384   -8.830  6.972   1.00 15.00 ?  251 SER A C    1  
ATOM   3046   O  O    . SER A 1 209 ? 1.875   -7.759  6.633   1.00 15.00 ?  251 SER A O    1  
ATOM   3047   C  CB   . SER A 1 209 ? 4.746   -9.515  6.409   1.00 15.00 ?  251 SER A CB   1  
ATOM   3048   O  OG   . SER A 1 209 ? 5.576   -10.240 5.510   1.00 15.00 ?  251 SER A OG   1  
ATOM   3049   H  H    . SER A 1 209 ? 2.720   -8.165  4.540   1.00 15.00 ?  251 SER A H    1  
ATOM   3050   H  HA   . SER A 1 209 ? 2.958   -10.635 5.988   1.00 15.00 ?  251 SER A HA   1  
ATOM   3051   H  HB2  . SER A 1 209 ? 5.060   -8.481  6.411   1.00 15.00 ?  251 SER A HB2  1  
ATOM   3052   H  HB3  . SER A 1 209 ? 4.865   -9.927  7.402   1.00 15.00 ?  251 SER A HB3  1  
ATOM   3053   H  HG   . SER A 1 209 ? 5.022   -10.689 4.857   1.00 15.00 ?  251 SER A HG   1  
ATOM   3054   N  N    . ALA A 1 210 ? 2.185   -9.387  8.161   1.00 15.00 ?  252 ALA A N    1  
ATOM   3055   C  CA   . ALA A 1 210 ? 1.370   -8.750  9.186   1.00 15.00 ?  252 ALA A CA   1  
ATOM   3056   C  C    . ALA A 1 210 ? 2.046   -7.479  9.701   1.00 15.00 ?  252 ALA A C    1  
ATOM   3057   O  O    . ALA A 1 210 ? 3.261   -7.325  9.561   1.00 15.00 ?  252 ALA A O    1  
ATOM   3058   C  CB   . ALA A 1 210 ? 1.124   -9.728  10.330  1.00 15.00 ?  252 ALA A CB   1  
ATOM   3059   H  H    . ALA A 1 210 ? 2.600   -10.251 8.357   1.00 15.00 ?  252 ALA A H    1  
ATOM   3060   H  HA   . ALA A 1 210 ? 0.418   -8.491  8.747   1.00 15.00 ?  252 ALA A HA   1  
ATOM   3061   H  HB1  . ALA A 1 210 ? 0.569   -9.237  11.112  1.00 15.00 ?  252 ALA A HB1  1  
ATOM   3062   H  HB2  . ALA A 1 210 ? 2.072   -10.070 10.719  1.00 15.00 ?  252 ALA A HB2  1  
ATOM   3063   H  HB3  . ALA A 1 210 ? 0.560   -10.574 9.963   1.00 15.00 ?  252 ALA A HB3  1  
ATOM   3064   N  N    . PRO A 1 211 ? 1.272   -6.545  10.282  1.00 15.00 ?  253 PRO A N    1  
ATOM   3065   C  CA   . PRO A 1 211 ? 1.820   -5.295  10.825  1.00 15.00 ?  253 PRO A CA   1  
ATOM   3066   C  C    . PRO A 1 211 ? 2.873   -5.559  11.891  1.00 15.00 ?  253 PRO A C    1  
ATOM   3067   O  O    . PRO A 1 211 ? 2.588   -6.162  12.930  1.00 15.00 ?  253 PRO A O    1  
ATOM   3068   C  CB   . PRO A 1 211 ? 0.605   -4.597  11.439  1.00 15.00 ?  253 PRO A CB   1  
ATOM   3069   C  CG   . PRO A 1 211 ? -0.580  -5.213  10.786  1.00 15.00 ?  253 PRO A CG   1  
ATOM   3070   C  CD   . PRO A 1 211 ? -0.190  -6.623  10.447  1.00 15.00 ?  253 PRO A CD   1  
ATOM   3071   H  HA   . PRO A 1 211 ? 2.244   -4.676  10.046  1.00 15.00 ?  253 PRO A HA   1  
ATOM   3072   H  HB2  . PRO A 1 211 ? 0.590   -4.759  12.511  1.00 15.00 ?  253 PRO A HB2  1  
ATOM   3073   H  HB3  . PRO A 1 211 ? 0.639   -3.543  11.223  1.00 15.00 ?  253 PRO A HB3  1  
ATOM   3074   H  HG2  . PRO A 1 211 ? -1.418  -5.208  11.469  1.00 15.00 ?  253 PRO A HG2  1  
ATOM   3075   H  HG3  . PRO A 1 211 ? -0.825  -4.675  9.885   1.00 15.00 ?  253 PRO A HG3  1  
ATOM   3076   H  HD2  . PRO A 1 211 ? -0.454  -7.295  11.252  1.00 15.00 ?  253 PRO A HD2  1  
ATOM   3077   H  HD3  . PRO A 1 211 ? -0.663  -6.930  9.526   1.00 15.00 ?  253 PRO A HD3  1  
ATOM   3078   N  N    . ASP A 1 212 ? 4.081   -5.105  11.632  1.00 15.00 ?  254 ASP A N    1  
ATOM   3079   C  CA   . ASP A 1 212 ? 5.179   -5.305  12.556  1.00 15.00 ?  254 ASP A CA   1  
ATOM   3080   C  C    . ASP A 1 212 ? 5.510   -4.007  13.287  1.00 15.00 ?  254 ASP A C    1  
ATOM   3081   O  O    . ASP A 1 212 ? 4.790   -3.011  13.170  1.00 15.00 ?  254 ASP A O    1  
ATOM   3082   C  CB   . ASP A 1 212 ? 6.415   -5.805  11.807  1.00 15.00 ?  254 ASP A CB   1  
ATOM   3083   C  CG   . ASP A 1 212 ? 7.264   -6.752  12.633  1.00 15.00 ?  254 ASP A CG   1  
ATOM   3084   O  OD1  . ASP A 1 212 ? 7.249   -6.656  13.880  1.00 15.00 ?  254 ASP A OD1  1  
ATOM   3085   O  OD2  . ASP A 1 212 ? 7.954   -7.605  12.039  1.00 15.00 -1 254 ASP A OD2  1  
ATOM   3086   H  H    . ASP A 1 212 ? 4.238   -4.609  10.800  1.00 15.00 ?  254 ASP A H    1  
ATOM   3087   H  HA   . ASP A 1 212 ? 4.875   -6.050  13.275  1.00 15.00 ?  254 ASP A HA   1  
ATOM   3088   H  HB2  . ASP A 1 212 ? 6.101   -6.323  10.913  1.00 15.00 ?  254 ASP A HB2  1  
ATOM   3089   H  HB3  . ASP A 1 212 ? 7.021   -4.956  11.530  1.00 15.00 ?  254 ASP A HB3  1  
ATOM   3090   N  N    . SER A 1 213 ? 6.593   -4.033  14.044  1.00 15.00 ?  255 SER A N    1  
ATOM   3091   C  CA   . SER A 1 213 ? 7.044   -2.873  14.784  1.00 15.00 ?  255 SER A CA   1  
ATOM   3092   C  C    . SER A 1 213 ? 8.060   -2.099  13.947  1.00 15.00 ?  255 SER A C    1  
ATOM   3093   O  O    . SER A 1 213 ? 8.222   -2.370  12.754  1.00 15.00 ?  255 SER A O    1  
ATOM   3094   C  CB   . SER A 1 213 ? 7.659   -3.322  16.114  1.00 15.00 ?  255 SER A CB   1  
ATOM   3095   O  OG   . SER A 1 213 ? 8.494   -4.456  15.926  1.00 15.00 ?  255 SER A OG   1  
ATOM   3096   H  H    . SER A 1 213 ? 7.112   -4.867  14.100  1.00 15.00 ?  255 SER A H    1  
ATOM   3097   H  HA   . SER A 1 213 ? 6.190   -2.243  14.979  1.00 15.00 ?  255 SER A HA   1  
ATOM   3098   H  HB2  . SER A 1 213 ? 8.249   -2.520  16.531  1.00 15.00 ?  255 SER A HB2  1  
ATOM   3099   H  HB3  . SER A 1 213 ? 6.871   -3.582  16.806  1.00 15.00 ?  255 SER A HB3  1  
ATOM   3100   H  HG   . SER A 1 213 ? 7.953   -5.250  15.934  1.00 15.00 ?  255 SER A HG   1  
ATOM   3101   N  N    . ARG A 1 214 ? 8.760   -1.156  14.568  1.00 15.00 ?  256 ARG A N    1  
ATOM   3102   C  CA   . ARG A 1 214 ? 9.758   -0.363  13.856  1.00 15.00 ?  256 ARG A CA   1  
ATOM   3103   C  C    . ARG A 1 214 ? 10.990  -1.206  13.535  1.00 15.00 ?  256 ARG A C    1  
ATOM   3104   O  O    . ARG A 1 214 ? 11.858  -0.789  12.765  1.00 15.00 ?  256 ARG A O    1  
ATOM   3105   C  CB   . ARG A 1 214 ? 10.148  0.870   14.674  1.00 15.00 ?  256 ARG A CB   1  
ATOM   3106   C  CG   . ARG A 1 214 ? 8.991   1.831   14.889  1.00 15.00 ?  256 ARG A CG   1  
ATOM   3107   C  CD   . ARG A 1 214 ? 9.440   3.137   15.529  1.00 15.00 ?  256 ARG A CD   1  
ATOM   3108   N  NE   . ARG A 1 214 ? 10.441  3.849   14.722  1.00 15.00 ?  256 ARG A NE   1  
ATOM   3109   C  CZ   . ARG A 1 214 ? 10.175  4.533   13.603  1.00 15.00 ?  256 ARG A CZ   1  
ATOM   3110   N  NH1  . ARG A 1 214 ? 8.929   4.607   13.135  1.00 15.00 1  256 ARG A NH1  1  
ATOM   3111   N  NH2  . ARG A 1 214 ? 11.161  5.174   12.972  1.00 15.00 ?  256 ARG A NH2  1  
ATOM   3112   H  H    . ARG A 1 214 ? 8.606   -0.991  15.524  1.00 15.00 ?  256 ARG A H    1  
ATOM   3113   H  HA   . ARG A 1 214 ? 9.315   -0.036  12.928  1.00 15.00 ?  256 ARG A HA   1  
ATOM   3114   H  HB2  . ARG A 1 214 ? 10.512  0.551   15.639  1.00 15.00 ?  256 ARG A HB2  1  
ATOM   3115   H  HB3  . ARG A 1 214 ? 10.933  1.397   14.160  1.00 15.00 ?  256 ARG A HB3  1  
ATOM   3116   H  HG2  . ARG A 1 214 ? 8.538   2.049   13.934  1.00 15.00 ?  256 ARG A HG2  1  
ATOM   3117   H  HG3  . ARG A 1 214 ? 8.264   1.360   15.530  1.00 15.00 ?  256 ARG A HG3  1  
ATOM   3118   H  HD2  . ARG A 1 214 ? 8.577   3.777   15.654  1.00 15.00 ?  256 ARG A HD2  1  
ATOM   3119   H  HD3  . ARG A 1 214 ? 9.864   2.919   16.500  1.00 15.00 ?  256 ARG A HD3  1  
ATOM   3120   H  HE   . ARG A 1 214 ? 11.374  3.800   15.032  1.00 15.00 ?  256 ARG A HE   1  
ATOM   3121   H  HH11 . ARG A 1 214 ? 8.723   5.151   12.262  1.00 15.00 ?  256 ARG A HH11 1  
ATOM   3122   H  HH12 . ARG A 1 214 ? 8.146   4.113   13.631  1.00 15.00 ?  256 ARG A HH12 1  
ATOM   3123   H  HH21 . ARG A 1 214 ? 10.969  5.714   12.097  1.00 15.00 ?  256 ARG A HH21 1  
ATOM   3124   H  HH22 . ARG A 1 214 ? 12.135  5.141   13.352  1.00 15.00 ?  256 ARG A HH22 1  
ATOM   3125   N  N    . ALA A 1 215 ? 11.053  -2.396  14.124  1.00 15.00 ?  257 ALA A N    1  
ATOM   3126   C  CA   . ALA A 1 215 ? 12.159  -3.315  13.896  1.00 15.00 ?  257 ALA A CA   1  
ATOM   3127   C  C    . ALA A 1 215 ? 12.146  -3.814  12.458  1.00 15.00 ?  257 ALA A C    1  
ATOM   3128   O  O    . ALA A 1 215 ? 13.176  -4.215  11.913  1.00 15.00 ?  257 ALA A O    1  
ATOM   3129   C  CB   . ALA A 1 215 ? 12.081  -4.484  14.864  1.00 15.00 ?  257 ALA A CB   1  
ATOM   3130   H  H    . ALA A 1 215 ? 10.335  -2.658  14.739  1.00 15.00 ?  257 ALA A H    1  
ATOM   3131   H  HA   . ALA A 1 215 ? 13.079  -2.784  14.075  1.00 15.00 ?  257 ALA A HA   1  
ATOM   3132   H  HB1  . ALA A 1 215 ? 12.996  -5.054  14.817  1.00 15.00 ?  257 ALA A HB1  1  
ATOM   3133   H  HB2  . ALA A 1 215 ? 11.249  -5.119  14.592  1.00 15.00 ?  257 ALA A HB2  1  
ATOM   3134   H  HB3  . ALA A 1 215 ? 11.940  -4.113  15.866  1.00 15.00 ?  257 ALA A HB3  1  
ATOM   3135   N  N    . ALA A 1 216 ? 10.964  -3.785  11.850  1.00 15.00 ?  258 ALA A N    1  
ATOM   3136   C  CA   . ALA A 1 216 ? 10.795  -4.214  10.472  1.00 15.00 ?  258 ALA A CA   1  
ATOM   3137   C  C    . ALA A 1 216 ? 11.531  -3.272  9.523   1.00 15.00 ?  258 ALA A C    1  
ATOM   3138   O  O    . ALA A 1 216 ? 12.138  -3.704  8.539   1.00 15.00 ?  258 ALA A O    1  
ATOM   3139   C  CB   . ALA A 1 216 ? 9.319   -4.272  10.123  1.00 15.00 ?  258 ALA A CB   1  
ATOM   3140   H  H    . ALA A 1 216 ? 10.177  -3.466  12.349  1.00 15.00 ?  258 ALA A H    1  
ATOM   3141   H  HA   . ALA A 1 216 ? 11.208  -5.208  10.377  1.00 15.00 ?  258 ALA A HA   1  
ATOM   3142   H  HB1  . ALA A 1 216 ? 8.833   -3.371  10.470  1.00 15.00 ?  258 ALA A HB1  1  
ATOM   3143   H  HB2  . ALA A 1 216 ? 8.870   -5.131  10.599  1.00 15.00 ?  258 ALA A HB2  1  
ATOM   3144   H  HB3  . ALA A 1 216 ? 9.207   -4.351  9.051   1.00 15.00 ?  258 ALA A HB3  1  
ATOM   3145   N  N    . ILE A 1 217 ? 11.490  -1.982  9.842   1.00 15.00 ?  259 ILE A N    1  
ATOM   3146   C  CA   . ILE A 1 217 ? 12.145  -0.967  9.032   1.00 15.00 ?  259 ILE A CA   1  
ATOM   3147   C  C    . ILE A 1 217 ? 13.658  -1.159  9.053   1.00 15.00 ?  259 ILE A C    1  
ATOM   3148   O  O    . ILE A 1 217 ? 14.307  -1.221  8.004   1.00 15.00 ?  259 ILE A O    1  
ATOM   3149   C  CB   . ILE A 1 217 ? 11.805  0.452   9.530   1.00 15.00 ?  259 ILE A CB   1  
ATOM   3150   C  CG1  . ILE A 1 217 ? 10.286  0.638   9.622   1.00 15.00 ?  259 ILE A CG1  1  
ATOM   3151   C  CG2  . ILE A 1 217 ? 12.418  1.493   8.607   1.00 15.00 ?  259 ILE A CG2  1  
ATOM   3152   C  CD1  . ILE A 1 217 ? 9.871   1.958   10.236  1.00 15.00 ?  259 ILE A CD1  1  
ATOM   3153   H  H    . ILE A 1 217 ? 11.010  -1.709  10.651  1.00 15.00 ?  259 ILE A H    1  
ATOM   3154   H  HA   . ILE A 1 217 ? 11.792  -1.066  8.017   1.00 15.00 ?  259 ILE A HA   1  
ATOM   3155   H  HB   . ILE A 1 217 ? 12.237  0.580   10.512  1.00 15.00 ?  259 ILE A HB   1  
ATOM   3156   H  HG12 . ILE A 1 217 ? 9.862   0.589   8.628   1.00 15.00 ?  259 ILE A HG12 1  
ATOM   3157   H  HG13 . ILE A 1 217 ? 9.869   -0.156  10.225  1.00 15.00 ?  259 ILE A HG13 1  
ATOM   3158   H  HG21 . ILE A 1 217 ? 13.476  1.306   8.507   1.00 15.00 ?  259 ILE A HG21 1  
ATOM   3159   H  HG22 . ILE A 1 217 ? 12.266  2.479   9.021   1.00 15.00 ?  259 ILE A HG22 1  
ATOM   3160   H  HG23 . ILE A 1 217 ? 11.949  1.433   7.636   1.00 15.00 ?  259 ILE A HG23 1  
ATOM   3161   H  HD11 . ILE A 1 217 ? 8.796   1.990   10.320  1.00 15.00 ?  259 ILE A HD11 1  
ATOM   3162   H  HD12 . ILE A 1 217 ? 10.208  2.769   9.608   1.00 15.00 ?  259 ILE A HD12 1  
ATOM   3163   H  HD13 . ILE A 1 217 ? 10.312  2.056   11.217  1.00 15.00 ?  259 ILE A HD13 1  
ATOM   3164   N  N    . THR A 1 218 ? 14.208  -1.281  10.257  1.00 15.00 ?  260 THR A N    1  
ATOM   3165   C  CA   . THR A 1 218 ? 15.639  -1.469  10.434  1.00 15.00 ?  260 THR A CA   1  
ATOM   3166   C  C    . THR A 1 218 ? 16.095  -2.789  9.820   1.00 15.00 ?  260 THR A C    1  
ATOM   3167   O  O    . THR A 1 218 ? 17.195  -2.881  9.277   1.00 15.00 ?  260 THR A O    1  
ATOM   3168   C  CB   . THR A 1 218 ? 16.020  -1.424  11.925  1.00 15.00 ?  260 THR A CB   1  
ATOM   3169   O  OG1  . THR A 1 218 ? 14.933  -1.903  12.728  1.00 15.00 ?  260 THR A OG1  1  
ATOM   3170   C  CG2  . THR A 1 218 ? 16.375  -0.005  12.343  1.00 15.00 ?  260 THR A CG2  1  
ATOM   3171   H  H    . THR A 1 218 ? 13.634  -1.246  11.050  1.00 15.00 ?  260 THR A H    1  
ATOM   3172   H  HA   . THR A 1 218 ? 16.146  -0.659  9.931   1.00 15.00 ?  260 THR A HA   1  
ATOM   3173   H  HB   . THR A 1 218 ? 16.882  -2.056  12.082  1.00 15.00 ?  260 THR A HB   1  
ATOM   3174   H  HG1  . THR A 1 218 ? 15.255  -2.605  13.310  1.00 15.00 ?  260 THR A HG1  1  
ATOM   3175   H  HG21 . THR A 1 218 ? 17.290  0.299   11.854  1.00 15.00 ?  260 THR A HG21 1  
ATOM   3176   H  HG22 . THR A 1 218 ? 16.509  0.035   13.414  1.00 15.00 ?  260 THR A HG22 1  
ATOM   3177   H  HG23 . THR A 1 218 ? 15.575  0.663   12.056  1.00 15.00 ?  260 THR A HG23 1  
ATOM   3178   N  N    . HIS A 1 219 ? 15.240  -3.804  9.900   1.00 15.00 ?  261 HIS A N    1  
ATOM   3179   C  CA   . HIS A 1 219 ? 15.551  -5.111  9.333   1.00 15.00 ?  261 HIS A CA   1  
ATOM   3180   C  C    . HIS A 1 219 ? 15.673  -5.004  7.817   1.00 15.00 ?  261 HIS A C    1  
ATOM   3181   O  O    . HIS A 1 219 ? 16.632  -5.497  7.222   1.00 15.00 ?  261 HIS A O    1  
ATOM   3182   C  CB   . HIS A 1 219 ? 14.471  -6.132  9.704   1.00 15.00 ?  261 HIS A CB   1  
ATOM   3183   C  CG   . HIS A 1 219 ? 14.797  -7.530  9.280   1.00 15.00 ?  261 HIS A CG   1  
ATOM   3184   N  ND1  . HIS A 1 219 ? 15.773  -8.261  9.917   1.00 15.00 ?  261 HIS A ND1  1  
ATOM   3185   C  CD2  . HIS A 1 219 ? 14.254  -8.282  8.291   1.00 15.00 ?  261 HIS A CD2  1  
ATOM   3186   C  CE1  . HIS A 1 219 ? 15.799  -9.433  9.308   1.00 15.00 ?  261 HIS A CE1  1  
ATOM   3187   N  NE2  . HIS A 1 219 ? 14.900  -9.490  8.320   1.00 15.00 ?  261 HIS A NE2  1  
ATOM   3188   H  H    . HIS A 1 219 ? 14.379  -3.671  10.355  1.00 15.00 ?  261 HIS A H    1  
ATOM   3189   H  HA   . HIS A 1 219 ? 16.499  -5.434  9.738   1.00 15.00 ?  261 HIS A HA   1  
ATOM   3190   H  HB2  . HIS A 1 219 ? 14.338  -6.134  10.774  1.00 15.00 ?  261 HIS A HB2  1  
ATOM   3191   H  HB3  . HIS A 1 219 ? 13.542  -5.850  9.231   1.00 15.00 ?  261 HIS A HB3  1  
ATOM   3192   H  HD2  . HIS A 1 219 ? 13.463  -7.992  7.617   1.00 15.00 ?  261 HIS A HD2  1  
ATOM   3193   H  HE1  . HIS A 1 219 ? 16.452  -10.245 9.583   1.00 15.00 ?  261 HIS A HE1  1  
ATOM   3194   H  HE2  . HIS A 1 219 ? 14.730  -10.258 7.724   1.00 15.00 ?  261 HIS A HE2  1  
ATOM   3195   N  N    . THR A 1 220 ? 14.702  -4.340  7.206   1.00 15.00 ?  262 THR A N    1  
ATOM   3196   C  CA   . THR A 1 220 ? 14.700  -4.145  5.767   1.00 15.00 ?  262 THR A CA   1  
ATOM   3197   C  C    . THR A 1 220 ? 15.939  -3.364  5.341   1.00 15.00 ?  262 THR A C    1  
ATOM   3198   O  O    . THR A 1 220 ? 16.589  -3.701  4.351   1.00 15.00 ?  262 THR A O    1  
ATOM   3199   C  CB   . THR A 1 220 ? 13.432  -3.396  5.314   1.00 15.00 ?  262 THR A CB   1  
ATOM   3200   O  OG1  . THR A 1 220 ? 12.266  -4.100  5.762   1.00 15.00 ?  262 THR A OG1  1  
ATOM   3201   C  CG2  . THR A 1 220 ? 13.395  -3.251  3.797   1.00 15.00 ?  262 THR A CG2  1  
ATOM   3202   H  H    . THR A 1 220 ? 13.966  -3.973  7.739   1.00 15.00 ?  262 THR A H    1  
ATOM   3203   H  HA   . THR A 1 220 ? 14.712  -5.116  5.294   1.00 15.00 ?  262 THR A HA   1  
ATOM   3204   H  HB   . THR A 1 220 ? 13.438  -2.407  5.757   1.00 15.00 ?  262 THR A HB   1  
ATOM   3205   H  HG1  . THR A 1 220 ? 12.191  -4.016  6.722   1.00 15.00 ?  262 THR A HG1  1  
ATOM   3206   H  HG21 . THR A 1 220 ? 13.195  -4.212  3.348   1.00 15.00 ?  262 THR A HG21 1  
ATOM   3207   H  HG22 . THR A 1 220 ? 14.348  -2.882  3.448   1.00 15.00 ?  262 THR A HG22 1  
ATOM   3208   H  HG23 . THR A 1 220 ? 12.617  -2.556  3.521   1.00 15.00 ?  262 THR A HG23 1  
ATOM   3209   N  N    . ALA A 1 221 ? 16.272  -2.341  6.122   1.00 15.00 ?  263 ALA A N    1  
ATOM   3210   C  CA   . ALA A 1 221 ? 17.434  -1.509  5.853   1.00 15.00 ?  263 ALA A CA   1  
ATOM   3211   C  C    . ALA A 1 221 ? 18.722  -2.318  5.955   1.00 15.00 ?  263 ALA A C    1  
ATOM   3212   O  O    . ALA A 1 221 ? 19.604  -2.184  5.117   1.00 15.00 ?  263 ALA A O    1  
ATOM   3213   C  CB   . ALA A 1 221 ? 17.468  -0.325  6.811   1.00 15.00 ?  263 ALA A CB   1  
ATOM   3214   H  H    . ALA A 1 221 ? 15.706  -2.133  6.899   1.00 15.00 ?  263 ALA A H    1  
ATOM   3215   H  HA   . ALA A 1 221 ? 17.342  -1.124  4.848   1.00 15.00 ?  263 ALA A HA   1  
ATOM   3216   H  HB1  . ALA A 1 221 ? 16.533  0.214   6.749   1.00 15.00 ?  263 ALA A HB1  1  
ATOM   3217   H  HB2  . ALA A 1 221 ? 18.280  0.333   6.542   1.00 15.00 ?  263 ALA A HB2  1  
ATOM   3218   H  HB3  . ALA A 1 221 ? 17.611  -0.680  7.822   1.00 15.00 ?  263 ALA A HB3  1  
ATOM   3219   N  N    . ARG A 1 222 ? 18.813  -3.166  6.977   1.00 15.00 ?  264 ARG A N    1  
ATOM   3220   C  CA   . ARG A 1 222 ? 19.996  -3.998  7.183   1.00 15.00 ?  264 ARG A CA   1  
ATOM   3221   C  C    . ARG A 1 222 ? 20.148  -5.012  6.056   1.00 15.00 ?  264 ARG A C    1  
ATOM   3222   O  O    . ARG A 1 222 ? 21.262  -5.315  5.630   1.00 15.00 ?  264 ARG A O    1  
ATOM   3223   C  CB   . ARG A 1 222 ? 19.925  -4.721  8.530   1.00 15.00 ?  264 ARG A CB   1  
ATOM   3224   C  CG   . ARG A 1 222 ? 20.300  -3.841  9.714   1.00 15.00 ?  264 ARG A CG   1  
ATOM   3225   C  CD   . ARG A 1 222 ? 20.315  -4.620  11.020  1.00 15.00 ?  264 ARG A CD   1  
ATOM   3226   N  NE   . ARG A 1 222 ? 21.265  -5.737  10.980  1.00 15.00 ?  264 ARG A NE   1  
ATOM   3227   C  CZ   . ARG A 1 222 ? 22.446  -5.748  11.609  1.00 15.00 ?  264 ARG A CZ   1  
ATOM   3228   N  NH1  . ARG A 1 222 ? 22.832  -4.698  12.328  1.00 15.00 1  264 ARG A NH1  1  
ATOM   3229   N  NH2  . ARG A 1 222 ? 23.241  -6.809  11.514  1.00 15.00 ?  264 ARG A NH2  1  
ATOM   3230   H  H    . ARG A 1 222 ? 18.067  -3.229  7.613   1.00 15.00 ?  264 ARG A H    1  
ATOM   3231   H  HA   . ARG A 1 222 ? 20.859  -3.349  7.180   1.00 15.00 ?  264 ARG A HA   1  
ATOM   3232   H  HB2  . ARG A 1 222 ? 18.915  -5.076  8.679   1.00 15.00 ?  264 ARG A HB2  1  
ATOM   3233   H  HB3  . ARG A 1 222 ? 20.596  -5.566  8.509   1.00 15.00 ?  264 ARG A HB3  1  
ATOM   3234   H  HG2  . ARG A 1 222 ? 21.282  -3.428  9.548   1.00 15.00 ?  264 ARG A HG2  1  
ATOM   3235   H  HG3  . ARG A 1 222 ? 19.578  -3.039  9.793   1.00 15.00 ?  264 ARG A HG3  1  
ATOM   3236   H  HD2  . ARG A 1 222 ? 20.591  -3.951  11.821  1.00 15.00 ?  264 ARG A HD2  1  
ATOM   3237   H  HD3  . ARG A 1 222 ? 19.326  -5.010  11.203  1.00 15.00 ?  264 ARG A HD3  1  
ATOM   3238   H  HE   . ARG A 1 222 ? 21.002  -6.529  10.456  1.00 15.00 ?  264 ARG A HE   1  
ATOM   3239   H  HH11 . ARG A 1 222 ? 22.222  -3.859  12.410  1.00 15.00 ?  264 ARG A HH11 1  
ATOM   3240   H  HH12 . ARG A 1 222 ? 23.757  -4.716  12.817  1.00 15.00 ?  264 ARG A HH12 1  
ATOM   3241   H  HH21 . ARG A 1 222 ? 22.945  -7.635  10.948  1.00 15.00 ?  264 ARG A HH21 1  
ATOM   3242   H  HH22 . ARG A 1 222 ? 24.164  -6.821  12.007  1.00 15.00 ?  264 ARG A HH22 1  
ATOM   3243   N  N    . MET A 1 223 ? 19.025  -5.531  5.575   1.00 15.00 ?  265 MET A N    1  
ATOM   3244   C  CA   . MET A 1 223 ? 19.046  -6.499  4.485   1.00 15.00 ?  265 MET A CA   1  
ATOM   3245   C  C    . MET A 1 223 ? 19.428  -5.816  3.184   1.00 15.00 ?  265 MET A C    1  
ATOM   3246   O  O    . MET A 1 223 ? 20.137  -6.380  2.352   1.00 15.00 ?  265 MET A O    1  
ATOM   3247   C  CB   . MET A 1 223 ? 17.687  -7.179  4.325   1.00 15.00 ?  265 MET A CB   1  
ATOM   3248   C  CG   . MET A 1 223 ? 17.436  -8.297  5.328   1.00 15.00 ?  265 MET A CG   1  
ATOM   3249   S  SD   . MET A 1 223 ? 16.270  -9.538  4.722   1.00 15.00 ?  265 MET A SD   1  
ATOM   3250   C  CE   . MET A 1 223 ? 14.755  -8.582  4.625   1.00 15.00 ?  265 MET A CE   1  
ATOM   3251   H  H    . MET A 1 223 ? 18.163  -5.263  5.967   1.00 15.00 ?  265 MET A H    1  
ATOM   3252   H  HA   . MET A 1 223 ? 19.790  -7.243  4.722   1.00 15.00 ?  265 MET A HA   1  
ATOM   3253   H  HB2  . MET A 1 223 ? 16.911  -6.435  4.447   1.00 15.00 ?  265 MET A HB2  1  
ATOM   3254   H  HB3  . MET A 1 223 ? 17.623  -7.594  3.329   1.00 15.00 ?  265 MET A HB3  1  
ATOM   3255   H  HG2  . MET A 1 223 ? 18.375  -8.783  5.545   1.00 15.00 ?  265 MET A HG2  1  
ATOM   3256   H  HG3  . MET A 1 223 ? 17.038  -7.863  6.235   1.00 15.00 ?  265 MET A HG3  1  
ATOM   3257   H  HE1  . MET A 1 223 ? 13.958  -9.210  4.254   1.00 15.00 ?  265 MET A HE1  1  
ATOM   3258   H  HE2  . MET A 1 223 ? 14.900  -7.749  3.953   1.00 15.00 ?  265 MET A HE2  1  
ATOM   3259   H  HE3  . MET A 1 223 ? 14.497  -8.212  5.608   1.00 15.00 ?  265 MET A HE3  1  
ATOM   3260   N  N    . ALA A 1 224 ? 18.962  -4.585  3.024   1.00 15.00 ?  266 ALA A N    1  
ATOM   3261   C  CA   . ALA A 1 224 ? 19.249  -3.806  1.833   1.00 15.00 ?  266 ALA A CA   1  
ATOM   3262   C  C    . ALA A 1 224 ? 20.666  -3.244  1.888   1.00 15.00 ?  266 ALA A C    1  
ATOM   3263   O  O    . ALA A 1 224 ? 21.226  -2.829  0.871   1.00 15.00 ?  266 ALA A O    1  
ATOM   3264   C  CB   . ALA A 1 224 ? 18.236  -2.683  1.689   1.00 15.00 ?  266 ALA A CB   1  
ATOM   3265   H  H    . ALA A 1 224 ? 18.397  -4.192  3.723   1.00 15.00 ?  266 ALA A H    1  
ATOM   3266   H  HA   . ALA A 1 224 ? 19.160  -4.456  0.976   1.00 15.00 ?  266 ALA A HA   1  
ATOM   3267   H  HB1  . ALA A 1 224 ? 18.351  -1.989  2.507   1.00 15.00 ?  266 ALA A HB1  1  
ATOM   3268   H  HB2  . ALA A 1 224 ? 17.238  -3.096  1.702   1.00 15.00 ?  266 ALA A HB2  1  
ATOM   3269   H  HB3  . ALA A 1 224 ? 18.401  -2.166  0.755   1.00 15.00 ?  266 ALA A HB3  1  
ATOM   3270   N  N    . ASP A 1 225 ? 21.235  -3.239  3.084   1.00 15.00 ?  267 ASP A N    1  
ATOM   3271   C  CA   . ASP A 1 225 ? 22.589  -2.742  3.304   1.00 15.00 ?  267 ASP A CA   1  
ATOM   3272   C  C    . ASP A 1 225 ? 23.614  -3.677  2.675   1.00 15.00 ?  267 ASP A C    1  
ATOM   3273   O  O    . ASP A 1 225 ? 24.749  -3.283  2.405   1.00 15.00 ?  267 ASP A O    1  
ATOM   3274   C  CB   . ASP A 1 225 ? 22.861  -2.611  4.802   1.00 15.00 ?  267 ASP A CB   1  
ATOM   3275   C  CG   . ASP A 1 225 ? 23.231  -1.202  5.215   1.00 15.00 ?  267 ASP A CG   1  
ATOM   3276   O  OD1  . ASP A 1 225 ? 22.437  -0.272  4.964   1.00 15.00 ?  267 ASP A OD1  1  
ATOM   3277   O  OD2  . ASP A 1 225 ? 24.307  -1.020  5.820   1.00 15.00 -1 267 ASP A OD2  1  
ATOM   3278   H  H    . ASP A 1 225 ? 20.723  -3.566  3.851   1.00 15.00 ?  267 ASP A H    1  
ATOM   3279   H  HA   . ASP A 1 225 ? 22.669  -1.768  2.843   1.00 15.00 ?  267 ASP A HA   1  
ATOM   3280   H  HB2  . ASP A 1 225 ? 21.976  -2.903  5.347   1.00 15.00 ?  267 ASP A HB2  1  
ATOM   3281   H  HB3  . ASP A 1 225 ? 23.673  -3.271  5.071   1.00 15.00 ?  267 ASP A HB3  1  
ATOM   3282   N  N    . LYS A 1 226 ? 23.204  -4.918  2.447   1.00 15.00 ?  268 LYS A N    1  
ATOM   3283   C  CA   . LYS A 1 226 ? 24.081  -5.920  1.852   1.00 15.00 ?  268 LYS A CA   1  
ATOM   3284   C  C    . LYS A 1 226 ? 23.740  -6.142  0.378   1.00 15.00 ?  268 LYS A C    1  
ATOM   3285   O  O    . LYS A 1 226 ? 24.194  -7.108  -0.240  1.00 15.00 ?  268 LYS A O    1  
ATOM   3286   C  CB   . LYS A 1 226 ? 23.978  -7.238  2.627   1.00 15.00 ?  268 LYS A CB   1  
ATOM   3287   C  CG   . LYS A 1 226 ? 24.578  -7.175  4.024   1.00 15.00 ?  268 LYS A CG   1  
ATOM   3288   C  CD   . LYS A 1 226 ? 24.462  -8.511  4.737   1.00 15.00 ?  268 LYS A CD   1  
ATOM   3289   C  CE   . LYS A 1 226 ? 25.104  -8.471  6.117   1.00 15.00 ?  268 LYS A CE   1  
ATOM   3290   N  NZ   . LYS A 1 226 ? 26.576  -8.266  6.053   1.00 15.00 1  268 LYS A NZ   1  
ATOM   3291   H  H    . LYS A 1 226 ? 22.286  -5.168  2.686   1.00 15.00 ?  268 LYS A H    1  
ATOM   3292   H  HA   . LYS A 1 226 ? 25.094  -5.554  1.918   1.00 15.00 ?  268 LYS A HA   1  
ATOM   3293   H  HB2  . LYS A 1 226 ? 22.936  -7.506  2.720   1.00 15.00 ?  268 LYS A HB2  1  
ATOM   3294   H  HB3  . LYS A 1 226 ? 24.489  -8.011  2.076   1.00 15.00 ?  268 LYS A HB3  1  
ATOM   3295   H  HG2  . LYS A 1 226 ? 25.620  -6.901  3.950   1.00 15.00 ?  268 LYS A HG2  1  
ATOM   3296   H  HG3  . LYS A 1 226 ? 24.049  -6.430  4.595   1.00 15.00 ?  268 LYS A HG3  1  
ATOM   3297   H  HD2  . LYS A 1 226 ? 23.417  -8.758  4.846   1.00 15.00 ?  268 LYS A HD2  1  
ATOM   3298   H  HD3  . LYS A 1 226 ? 24.950  -9.269  4.142   1.00 15.00 ?  268 LYS A HD3  1  
ATOM   3299   H  HE2  . LYS A 1 226 ? 24.663  -7.661  6.677   1.00 15.00 ?  268 LYS A HE2  1  
ATOM   3300   H  HE3  . LYS A 1 226 ? 24.902  -9.404  6.619   1.00 15.00 ?  268 LYS A HE3  1  
ATOM   3301   H  HZ1  . LYS A 1 226 ? 26.794  -7.360  5.597   1.00 15.00 ?  268 LYS A HZ1  1  
ATOM   3302   H  HZ2  . LYS A 1 226 ? 27.023  -9.032  5.509   1.00 15.00 ?  268 LYS A HZ2  1  
ATOM   3303   H  HZ3  . LYS A 1 226 ? 26.977  -8.260  7.015   1.00 15.00 ?  268 LYS A HZ3  1  
ATOM   3304   N  N    . LEU A 1 227 ? 22.947  -5.246  -0.188  1.00 15.00 ?  269 LEU A N    1  
ATOM   3305   C  CA   . LEU A 1 227 ? 22.562  -5.357  -1.588  1.00 15.00 ?  269 LEU A CA   1  
ATOM   3306   C  C    . LEU A 1 227 ? 23.649  -4.802  -2.500  1.00 15.00 ?  269 LEU A C    1  
ATOM   3307   O  O    . LEU A 1 227 ? 23.789  -5.306  -3.639  1.00 15.00 ?  269 LEU A O    1  
ATOM   3308   C  CB   . LEU A 1 227 ? 21.250  -4.623  -1.849  1.00 15.00 ?  269 LEU A CB   1  
ATOM   3309   C  CG   . LEU A 1 227 ? 19.977  -5.409  -1.519  1.00 15.00 ?  269 LEU A CG   1  
ATOM   3310   C  CD1  . LEU A 1 227 ? 18.747  -4.545  -1.749  1.00 15.00 ?  269 LEU A CD1  1  
ATOM   3311   C  CD2  . LEU A 1 227 ? 19.894  -6.671  -2.361  1.00 15.00 ?  269 LEU A CD2  1  
ATOM   3312   O  OXT  . LEU A 1 227 ? 24.364  -3.868  -2.078  1.00 15.00 -1 269 LEU A OXT  1  
ATOM   3313   H  H    . LEU A 1 227 ? 22.615  -4.490  0.341   1.00 15.00 ?  269 LEU A H    1  
ATOM   3314   H  HA   . LEU A 1 227 ? 22.428  -6.403  -1.807  1.00 15.00 ?  269 LEU A HA   1  
ATOM   3315   H  HB2  . LEU A 1 227 ? 21.251  -3.714  -1.266  1.00 15.00 ?  269 LEU A HB2  1  
ATOM   3316   H  HB3  . LEU A 1 227 ? 21.218  -4.358  -2.894  1.00 15.00 ?  269 LEU A HB3  1  
ATOM   3317   H  HG   . LEU A 1 227 ? 19.998  -5.700  -0.480  1.00 15.00 ?  269 LEU A HG   1  
ATOM   3318   H  HD11 . LEU A 1 227 ? 18.804  -3.665  -1.131  1.00 15.00 ?  269 LEU A HD11 1  
ATOM   3319   H  HD12 . LEU A 1 227 ? 17.863  -5.106  -1.494  1.00 15.00 ?  269 LEU A HD12 1  
ATOM   3320   H  HD13 . LEU A 1 227 ? 18.699  -4.253  -2.787  1.00 15.00 ?  269 LEU A HD13 1  
ATOM   3321   H  HD21 . LEU A 1 227 ? 18.914  -7.111  -2.249  1.00 15.00 ?  269 LEU A HD21 1  
ATOM   3322   H  HD22 . LEU A 1 227 ? 20.643  -7.375  -2.036  1.00 15.00 ?  269 LEU A HD22 1  
ATOM   3323   H  HD23 . LEU A 1 227 ? 20.059  -6.418  -3.398  1.00 15.00 ?  269 LEU A HD23 1  
HETATM 3324   ZN ZN   . ZN  B 2 .   ? 5.727   -4.166  -6.502  1.00 15.00 ?  301 ZN  A ZN   1  
HETATM 3325   ZN ZN   . ZN  C 2 .   ? 4.292   -7.305  -3.644  1.00 15.00 ?  302 ZN  A ZN   1  
HETATM 3326   O  OAB  . MRI D 3 .   ? 6.233   -10.058 -3.313  1.00 15.00 ?  303 MRI A OAB  1  
HETATM 3327   C  CAM  . MRI D 3 .   ? 5.714   -9.905  -4.561  1.00 15.00 ?  303 MRI A CAM  1  
HETATM 3328   C  CAN  . MRI D 3 .   ? 5.429   -8.636  -5.055  1.00 15.00 ?  303 MRI A CAN  1  
HETATM 3329   O  OAD  . MRI D 3 .   ? 5.536   -7.641  -4.340  1.00 15.00 ?  303 MRI A OAD  1  
HETATM 3330   C  CAI  . MRI D 3 .   ? 4.981   -8.538  -6.368  1.00 15.00 ?  303 MRI A CAI  1  
HETATM 3331   C  CAO  . MRI D 3 .   ? 4.977   -7.315  -7.032  1.00 15.00 ?  303 MRI A CAO  1  
HETATM 3332   O  OAC  . MRI D 3 .   ? 5.372   -6.178  -6.395  1.00 15.00 ?  303 MRI A OAC  1  
HETATM 3333   C  CAS  . MRI D 3 .   ? 4.570   -7.251  -8.357  1.00 15.00 ?  303 MRI A CAS  1  
HETATM 3334   C  CAR  . MRI D 3 .   ? 4.169   -8.403  -9.017  1.00 15.00 ?  303 MRI A CAR  1  
HETATM 3335   O  OAF  . MRI D 3 .   ? 3.769   -8.342  -10.318 1.00 15.00 ?  303 MRI A OAF  1  
HETATM 3336   C  CAP  . MRI D 3 .   ? 4.176   -9.623  -8.353  1.00 15.00 ?  303 MRI A CAP  1  
HETATM 3337   C  CAJ  . MRI D 3 .   ? 4.584   -9.697  -7.028  1.00 15.00 ?  303 MRI A CAJ  1  
HETATM 3338   O  OAA  . MRI D 3 .   ? 4.544   -10.895 -6.387  1.00 15.00 ?  303 MRI A OAA  1  
HETATM 3339   C  CAK  . MRI D 3 .   ? 5.448   -11.003 -5.373  1.00 15.00 ?  303 MRI A CAK  1  
HETATM 3340   C  CAL  . MRI D 3 .   ? 6.058   -12.232 -5.134  1.00 15.00 ?  303 MRI A CAL  1  
HETATM 3341   C  CAT  . MRI D 3 .   ? 5.413   -13.396 -5.529  1.00 15.00 ?  303 MRI A CAT  1  
HETATM 3342   C  CAV  . MRI D 3 .   ? 6.000   -14.635 -5.292  1.00 15.00 ?  303 MRI A CAV  1  
HETATM 3343   C  CAW  . MRI D 3 .   ? 7.235   -14.707 -4.659  1.00 15.00 ?  303 MRI A CAW  1  
HETATM 3344   O  OAG  . MRI D 3 .   ? 7.811   -15.915 -4.434  1.00 15.00 ?  303 MRI A OAG  1  
HETATM 3345   C  CAU  . MRI D 3 .   ? 7.878   -13.542 -4.267  1.00 15.00 ?  303 MRI A CAU  1  
HETATM 3346   C  CAQ  . MRI D 3 .   ? 7.295   -12.303 -4.503  1.00 15.00 ?  303 MRI A CAQ  1  
HETATM 3347   O  OAE  . MRI D 3 .   ? 7.948   -11.170 -4.138  1.00 15.00 ?  303 MRI A OAE  1  
HETATM 3348   H  H1   . MRI D 3 .   ? 6.324   -11.029 -3.104  1.00 15.00 ?  303 MRI A H1   1  
HETATM 3349   H  H2   . MRI D 3 .   ? 5.654   -6.392  -5.458  1.00 15.00 ?  303 MRI A H2   1  
HETATM 3350   H  H4   . MRI D 3 .   ? 3.824   -7.396  -10.638 1.00 15.00 ?  303 MRI A H4   1  
HETATM 3351   H  H8   . MRI D 3 .   ? 7.216   -16.641 -4.781  1.00 15.00 ?  303 MRI A H8   1  
HETATM 3352   H  H10  . MRI D 3 .   ? 8.816   -11.410 -3.703  1.00 15.00 ?  303 MRI A H10  1  
ATOM   3353   N  N    . ASP A 1 1   ? -8.995  -11.641 12.554  1.00 15.00 ?  43  ASP A N    2  
ATOM   3354   C  CA   . ASP A 1 1   ? -9.016  -11.553 11.101  1.00 15.00 ?  43  ASP A CA   2  
ATOM   3355   C  C    . ASP A 1 1   ? -10.348 -12.066 10.563  1.00 15.00 ?  43  ASP A C    2  
ATOM   3356   O  O    . ASP A 1 1   ? -10.622 -13.267 10.614  1.00 15.00 ?  43  ASP A O    2  
ATOM   3357   C  CB   . ASP A 1 1   ? -7.870  -12.366 10.491  1.00 15.00 ?  43  ASP A CB   2  
ATOM   3358   C  CG   . ASP A 1 1   ? -6.497  -11.908 10.951  1.00 15.00 ?  43  ASP A CG   2  
ATOM   3359   O  OD1  . ASP A 1 1   ? -5.722  -11.404 10.116  1.00 15.00 ?  43  ASP A OD1  2  
ATOM   3360   O  OD2  . ASP A 1 1   ? -6.182  -12.060 12.147  1.00 15.00 -1 43  ASP A OD2  2  
ATOM   3361   H  H1   . ASP A 1 1   ? -8.463  -12.350 12.983  1.00 15.00 ?  43  ASP A H1   2  
ATOM   3362   H  HA   . ASP A 1 1   ? -8.901  -10.515 10.827  1.00 15.00 ?  43  ASP A HA   2  
ATOM   3363   H  HB2  . ASP A 1 1   ? -7.989  -13.404 10.763  1.00 15.00 ?  43  ASP A HB2  2  
ATOM   3364   H  HB3  . ASP A 1 1   ? -7.916  -12.274 9.416   1.00 15.00 ?  43  ASP A HB3  2  
ATOM   3365   N  N    . GLN A 1 2   ? -11.179 -11.165 10.064  1.00 15.00 ?  44  GLN A N    2  
ATOM   3366   C  CA   . GLN A 1 2   ? -12.477 -11.547 9.527   1.00 15.00 ?  44  GLN A CA   2  
ATOM   3367   C  C    . GLN A 1 2   ? -12.344 -11.966 8.070   1.00 15.00 ?  44  GLN A C    2  
ATOM   3368   O  O    . GLN A 1 2   ? -11.641 -11.324 7.294   1.00 15.00 ?  44  GLN A O    2  
ATOM   3369   C  CB   . GLN A 1 2   ? -13.475 -10.394 9.641   1.00 15.00 ?  44  GLN A CB   2  
ATOM   3370   C  CG   . GLN A 1 2   ? -14.904 -10.791 9.289   1.00 15.00 ?  44  GLN A CG   2  
ATOM   3371   C  CD   . GLN A 1 2   ? -15.662 -9.698  8.551   1.00 15.00 ?  44  GLN A CD   2  
ATOM   3372   O  OE1  . GLN A 1 2   ? -15.392 -8.511  8.722   1.00 15.00 ?  44  GLN A OE1  2  
ATOM   3373   N  NE2  . GLN A 1 2   ? -16.623 -10.093 7.725   1.00 15.00 ?  44  GLN A NE2  2  
ATOM   3374   H  H    . GLN A 1 2   ? -10.911 -10.216 10.045  1.00 15.00 ?  44  GLN A H    2  
ATOM   3375   H  HA   . GLN A 1 2   ? -12.837 -12.386 10.105  1.00 15.00 ?  44  GLN A HA   2  
ATOM   3376   H  HB2  . GLN A 1 2   ? -13.464 -10.025 10.656  1.00 15.00 ?  44  GLN A HB2  2  
ATOM   3377   H  HB3  . GLN A 1 2   ? -13.167 -9.603  8.975   1.00 15.00 ?  44  GLN A HB3  2  
ATOM   3378   H  HG2  . GLN A 1 2   ? -14.875 -11.673 8.664   1.00 15.00 ?  44  GLN A HG2  2  
ATOM   3379   H  HG3  . GLN A 1 2   ? -15.432 -11.020 10.203  1.00 15.00 ?  44  GLN A HG3  2  
ATOM   3380   H  HE21 . GLN A 1 2   ? -16.791 -11.055 7.632   1.00 15.00 ?  44  GLN A HE21 2  
ATOM   3381   H  HE22 . GLN A 1 2   ? -17.138 -9.406  7.250   1.00 15.00 ?  44  GLN A HE22 2  
ATOM   3382   N  N    . ARG A 1 3   ? -13.020 -13.038 7.699   1.00 15.00 ?  45  ARG A N    2  
ATOM   3383   C  CA   . ARG A 1 3   ? -12.964 -13.529 6.334   1.00 15.00 ?  45  ARG A CA   2  
ATOM   3384   C  C    . ARG A 1 3   ? -14.209 -13.121 5.562   1.00 15.00 ?  45  ARG A C    2  
ATOM   3385   O  O    . ARG A 1 3   ? -15.325 -13.506 5.912   1.00 15.00 ?  45  ARG A O    2  
ATOM   3386   C  CB   . ARG A 1 3   ? -12.809 -15.048 6.307   1.00 15.00 ?  45  ARG A CB   2  
ATOM   3387   C  CG   . ARG A 1 3   ? -11.389 -15.520 6.552   1.00 15.00 ?  45  ARG A CG   2  
ATOM   3388   C  CD   . ARG A 1 3   ? -11.145 -16.877 5.915   1.00 15.00 ?  45  ARG A CD   2  
ATOM   3389   N  NE   . ARG A 1 3   ? -9.741  -17.272 5.977   1.00 15.00 ?  45  ARG A NE   2  
ATOM   3390   C  CZ   . ARG A 1 3   ? -9.247  -18.355 5.378   1.00 15.00 ?  45  ARG A CZ   2  
ATOM   3391   N  NH1  . ARG A 1 3   ? -10.042 -19.157 4.676   1.00 15.00 1  45  ARG A NH1  2  
ATOM   3392   N  NH2  . ARG A 1 3   ? -7.957  -18.631 5.472   1.00 15.00 ?  45  ARG A NH2  2  
ATOM   3393   H  H    . ARG A 1 3   ? -13.584 -13.501 8.355   1.00 15.00 ?  45  ARG A H    2  
ATOM   3394   H  HA   . ARG A 1 3   ? -12.102 -13.082 5.861   1.00 15.00 ?  45  ARG A HA   2  
ATOM   3395   H  HB2  . ARG A 1 3   ? -13.447 -15.478 7.066   1.00 15.00 ?  45  ARG A HB2  2  
ATOM   3396   H  HB3  . ARG A 1 3   ? -13.122 -15.412 5.340   1.00 15.00 ?  45  ARG A HB3  2  
ATOM   3397   H  HG2  . ARG A 1 3   ? -10.704 -14.802 6.127   1.00 15.00 ?  45  ARG A HG2  2  
ATOM   3398   H  HG3  . ARG A 1 3   ? -11.222 -15.596 7.618   1.00 15.00 ?  45  ARG A HG3  2  
ATOM   3399   H  HD2  . ARG A 1 3   ? -11.736 -17.620 6.433   1.00 15.00 ?  45  ARG A HD2  2  
ATOM   3400   H  HD3  . ARG A 1 3   ? -11.450 -16.835 4.882   1.00 15.00 ?  45  ARG A HD3  2  
ATOM   3401   H  HE   . ARG A 1 3   ? -9.131  -16.699 6.498   1.00 15.00 ?  45  ARG A HE   2  
ATOM   3402   H  HH11 . ARG A 1 3   ? -9.649  -20.006 4.210   1.00 15.00 ?  45  ARG A HH11 2  
ATOM   3403   H  HH12 . ARG A 1 3   ? -11.060 -18.947 4.590   1.00 15.00 ?  45  ARG A HH12 2  
ATOM   3404   H  HH21 . ARG A 1 3   ? -7.566  -19.481 5.008   1.00 15.00 ?  45  ARG A HH21 2  
ATOM   3405   H  HH22 . ARG A 1 3   ? -7.326  -17.999 6.009   1.00 15.00 ?  45  ARG A HH22 2  
ATOM   3406   N  N    . PHE A 1 4   ? -14.009 -12.344 4.511   1.00 15.00 ?  46  PHE A N    2  
ATOM   3407   C  CA   . PHE A 1 4   ? -15.107 -11.877 3.684   1.00 15.00 ?  46  PHE A CA   2  
ATOM   3408   C  C    . PHE A 1 4   ? -14.855 -12.260 2.234   1.00 15.00 ?  46  PHE A C    2  
ATOM   3409   O  O    . PHE A 1 4   ? -13.937 -11.741 1.599   1.00 15.00 ?  46  PHE A O    2  
ATOM   3410   C  CB   . PHE A 1 4   ? -15.261 -10.360 3.818   1.00 15.00 ?  46  PHE A CB   2  
ATOM   3411   C  CG   . PHE A 1 4   ? -16.515 -9.817  3.194   1.00 15.00 ?  46  PHE A CG   2  
ATOM   3412   C  CD1  . PHE A 1 4   ? -16.490 -9.259  1.925   1.00 15.00 ?  46  PHE A CD1  2  
ATOM   3413   C  CD2  . PHE A 1 4   ? -17.717 -9.863  3.878   1.00 15.00 ?  46  PHE A CD2  2  
ATOM   3414   C  CE1  . PHE A 1 4   ? -17.643 -8.756  1.350   1.00 15.00 ?  46  PHE A CE1  2  
ATOM   3415   C  CE2  . PHE A 1 4   ? -18.875 -9.361  3.307   1.00 15.00 ?  46  PHE A CE2  2  
ATOM   3416   C  CZ   . PHE A 1 4   ? -18.836 -8.808  2.043   1.00 15.00 ?  46  PHE A CZ   2  
ATOM   3417   H  H    . PHE A 1 4   ? -13.088 -12.087 4.270   1.00 15.00 ?  46  PHE A H    2  
ATOM   3418   H  HA   . PHE A 1 4   ? -16.012 -12.360 4.025   1.00 15.00 ?  46  PHE A HA   2  
ATOM   3419   H  HB2  . PHE A 1 4   ? -15.275 -10.100 4.865   1.00 15.00 ?  46  PHE A HB2  2  
ATOM   3420   H  HB3  . PHE A 1 4   ? -14.419 -9.880  3.344   1.00 15.00 ?  46  PHE A HB3  2  
ATOM   3421   H  HD1  . PHE A 1 4   ? -15.558 -9.219  1.384   1.00 15.00 ?  46  PHE A HD1  2  
ATOM   3422   H  HD2  . PHE A 1 4   ? -17.748 -10.296 4.866   1.00 15.00 ?  46  PHE A HD2  2  
ATOM   3423   H  HE1  . PHE A 1 4   ? -17.611 -8.323  0.362   1.00 15.00 ?  46  PHE A HE1  2  
ATOM   3424   H  HE2  . PHE A 1 4   ? -19.810 -9.403  3.850   1.00 15.00 ?  46  PHE A HE2  2  
ATOM   3425   H  HZ   . PHE A 1 4   ? -19.739 -8.415  1.596   1.00 15.00 ?  46  PHE A HZ   2  
ATOM   3426   N  N    . GLY A 1 5   ? -15.659 -13.180 1.724   1.00 15.00 ?  47  GLY A N    2  
ATOM   3427   C  CA   . GLY A 1 5   ? -15.500 -13.627 0.355   1.00 15.00 ?  47  GLY A CA   2  
ATOM   3428   C  C    . GLY A 1 5   ? -14.194 -14.363 0.157   1.00 15.00 ?  47  GLY A C    2  
ATOM   3429   O  O    . GLY A 1 5   ? -14.032 -15.489 0.631   1.00 15.00 ?  47  GLY A O    2  
ATOM   3430   H  H    . GLY A 1 5   ? -16.367 -13.566 2.282   1.00 15.00 ?  47  GLY A H    2  
ATOM   3431   H  HA2  . GLY A 1 5   ? -16.315 -14.287 0.104   1.00 15.00 ?  47  GLY A HA2  2  
ATOM   3432   H  HA3  . GLY A 1 5   ? -15.525 -12.771 -0.303  1.00 15.00 ?  47  GLY A HA3  2  
ATOM   3433   N  N    . ASP A 1 6   ? -13.260 -13.722 -0.531  1.00 15.00 ?  48  ASP A N    2  
ATOM   3434   C  CA   . ASP A 1 6   ? -11.950 -14.309 -0.789  1.00 15.00 ?  48  ASP A CA   2  
ATOM   3435   C  C    . ASP A 1 6   ? -10.859 -13.475 -0.135  1.00 15.00 ?  48  ASP A C    2  
ATOM   3436   O  O    . ASP A 1 6   ? -9.670  -13.751 -0.300  1.00 15.00 ?  48  ASP A O    2  
ATOM   3437   C  CB   . ASP A 1 6   ? -11.679 -14.388 -2.297  1.00 15.00 ?  48  ASP A CB   2  
ATOM   3438   C  CG   . ASP A 1 6   ? -12.706 -15.207 -3.042  1.00 15.00 ?  48  ASP A CG   2  
ATOM   3439   O  OD1  . ASP A 1 6   ? -12.604 -16.453 -3.037  1.00 15.00 ?  48  ASP A OD1  2  
ATOM   3440   O  OD2  . ASP A 1 6   ? -13.619 -14.608 -3.647  1.00 15.00 -1 48  ASP A OD2  2  
ATOM   3441   H  H    . ASP A 1 6   ? -13.462 -12.821 -0.884  1.00 15.00 ?  48  ASP A H    2  
ATOM   3442   H  HA   . ASP A 1 6   ? -11.935 -15.303 -0.372  1.00 15.00 ?  48  ASP A HA   2  
ATOM   3443   H  HB2  . ASP A 1 6   ? -11.679 -13.387 -2.708  1.00 15.00 ?  48  ASP A HB2  2  
ATOM   3444   H  HB3  . ASP A 1 6   ? -10.708 -14.833 -2.458  1.00 15.00 ?  48  ASP A HB3  2  
ATOM   3445   N  N    . LEU A 1 7   ? -11.266 -12.459 0.615   1.00 15.00 ?  49  LEU A N    2  
ATOM   3446   C  CA   . LEU A 1 7   ? -10.316 -11.569 1.264   1.00 15.00 ?  49  LEU A CA   2  
ATOM   3447   C  C    . LEU A 1 7   ? -10.429 -11.628 2.780   1.00 15.00 ?  49  LEU A C    2  
ATOM   3448   O  O    . LEU A 1 7   ? -11.413 -12.122 3.331   1.00 15.00 ?  49  LEU A O    2  
ATOM   3449   C  CB   . LEU A 1 7   ? -10.527 -10.127 0.796   1.00 15.00 ?  49  LEU A CB   2  
ATOM   3450   C  CG   . LEU A 1 7   ? -9.863  -9.767  -0.533  1.00 15.00 ?  49  LEU A CG   2  
ATOM   3451   C  CD1  . LEU A 1 7   ? -10.737 -10.178 -1.707  1.00 15.00 ?  49  LEU A CD1  2  
ATOM   3452   C  CD2  . LEU A 1 7   ? -9.560  -8.280  -0.589  1.00 15.00 ?  49  LEU A CD2  2  
ATOM   3453   H  H    . LEU A 1 7   ? -12.230 -12.310 0.747   1.00 15.00 ?  49  LEU A H    2  
ATOM   3454   H  HA   . LEU A 1 7   ? -9.326  -11.885 0.976   1.00 15.00 ?  49  LEU A HA   2  
ATOM   3455   H  HB2  . LEU A 1 7   ? -11.590 -9.955  0.703   1.00 15.00 ?  49  LEU A HB2  2  
ATOM   3456   H  HB3  . LEU A 1 7   ? -10.140 -9.464  1.557   1.00 15.00 ?  49  LEU A HB3  2  
ATOM   3457   H  HG   . LEU A 1 7   ? -8.930  -10.300 -0.611  1.00 15.00 ?  49  LEU A HG   2  
ATOM   3458   H  HD11 . LEU A 1 7   ? -11.709 -9.717  -1.614  1.00 15.00 ?  49  LEU A HD11 2  
ATOM   3459   H  HD12 . LEU A 1 7   ? -10.847 -11.253 -1.715  1.00 15.00 ?  49  LEU A HD12 2  
ATOM   3460   H  HD13 . LEU A 1 7   ? -10.273 -9.855  -2.628  1.00 15.00 ?  49  LEU A HD13 2  
ATOM   3461   H  HD21 . LEU A 1 7   ? -10.448 -7.723  -0.326  1.00 15.00 ?  49  LEU A HD21 2  
ATOM   3462   H  HD22 . LEU A 1 7   ? -9.255  -8.013  -1.590  1.00 15.00 ?  49  LEU A HD22 2  
ATOM   3463   H  HD23 . LEU A 1 7   ? -8.764  -8.047  0.103   1.00 15.00 ?  49  LEU A HD23 2  
ATOM   3464   N  N    . VAL A 1 8   ? -9.403  -11.120 3.445   1.00 15.00 ?  50  VAL A N    2  
ATOM   3465   C  CA   . VAL A 1 8   ? -9.367  -11.078 4.898   1.00 15.00 ?  50  VAL A CA   2  
ATOM   3466   C  C    . VAL A 1 8   ? -9.330  -9.625  5.361   1.00 15.00 ?  50  VAL A C    2  
ATOM   3467   O  O    . VAL A 1 8   ? -8.592  -8.812  4.806   1.00 15.00 ?  50  VAL A O    2  
ATOM   3468   C  CB   . VAL A 1 8   ? -8.143  -11.843 5.459   1.00 15.00 ?  50  VAL A CB   2  
ATOM   3469   C  CG1  . VAL A 1 8   ? -8.133  -11.826 6.979   1.00 15.00 ?  50  VAL A CG1  2  
ATOM   3470   C  CG2  . VAL A 1 8   ? -8.122  -13.275 4.946   1.00 15.00 ?  50  VAL A CG2  2  
ATOM   3471   H  H    . VAL A 1 8   ? -8.645  -10.755 2.940   1.00 15.00 ?  50  VAL A H    2  
ATOM   3472   H  HA   . VAL A 1 8   ? -10.270 -11.547 5.271   1.00 15.00 ?  50  VAL A HA   2  
ATOM   3473   H  HB   . VAL A 1 8   ? -7.248  -11.349 5.114   1.00 15.00 ?  50  VAL A HB   2  
ATOM   3474   H  HG11 . VAL A 1 8   ? -9.080  -12.193 7.351   1.00 15.00 ?  50  VAL A HG11 2  
ATOM   3475   H  HG12 . VAL A 1 8   ? -7.977  -10.814 7.325   1.00 15.00 ?  50  VAL A HG12 2  
ATOM   3476   H  HG13 . VAL A 1 8   ? -7.334  -12.458 7.338   1.00 15.00 ?  50  VAL A HG13 2  
ATOM   3477   H  HG21 . VAL A 1 8   ? -7.276  -13.794 5.369   1.00 15.00 ?  50  VAL A HG21 2  
ATOM   3478   H  HG22 . VAL A 1 8   ? -8.042  -13.272 3.869   1.00 15.00 ?  50  VAL A HG22 2  
ATOM   3479   H  HG23 . VAL A 1 8   ? -9.033  -13.775 5.238   1.00 15.00 ?  50  VAL A HG23 2  
ATOM   3480   N  N    . PHE A 1 9   ? -10.143 -9.299  6.353   1.00 15.00 ?  51  PHE A N    2  
ATOM   3481   C  CA   . PHE A 1 9   ? -10.211 -7.943  6.871   1.00 15.00 ?  51  PHE A CA   2  
ATOM   3482   C  C    . PHE A 1 9   ? -9.944  -7.922  8.373   1.00 15.00 ?  51  PHE A C    2  
ATOM   3483   O  O    . PHE A 1 9   ? -10.607 -8.620  9.139   1.00 15.00 ?  51  PHE A O    2  
ATOM   3484   C  CB   . PHE A 1 9   ? -11.588 -7.335  6.586   1.00 15.00 ?  51  PHE A CB   2  
ATOM   3485   C  CG   . PHE A 1 9   ? -11.867 -7.100  5.127   1.00 15.00 ?  51  PHE A CG   2  
ATOM   3486   C  CD1  . PHE A 1 9   ? -12.339 -8.128  4.321   1.00 15.00 ?  51  PHE A CD1  2  
ATOM   3487   C  CD2  . PHE A 1 9   ? -11.655 -5.855  4.560   1.00 15.00 ?  51  PHE A CD2  2  
ATOM   3488   C  CE1  . PHE A 1 9   ? -12.592 -7.914  2.978   1.00 15.00 ?  51  PHE A CE1  2  
ATOM   3489   C  CE2  . PHE A 1 9   ? -11.909 -5.637  3.219   1.00 15.00 ?  51  PHE A CE2  2  
ATOM   3490   C  CZ   . PHE A 1 9   ? -12.375 -6.668  2.427   1.00 15.00 ?  51  PHE A CZ   2  
ATOM   3491   H  H    . PHE A 1 9   ? -10.713 -9.993  6.758   1.00 15.00 ?  51  PHE A H    2  
ATOM   3492   H  HA   . PHE A 1 9   ? -9.457  -7.359  6.368   1.00 15.00 ?  51  PHE A HA   2  
ATOM   3493   H  HB2  . PHE A 1 9   ? -12.348 -8.001  6.963   1.00 15.00 ?  51  PHE A HB2  2  
ATOM   3494   H  HB3  . PHE A 1 9   ? -11.665 -6.385  7.097   1.00 15.00 ?  51  PHE A HB3  2  
ATOM   3495   H  HD1  . PHE A 1 9   ? -12.512 -9.103  4.753   1.00 15.00 ?  51  PHE A HD1  2  
ATOM   3496   H  HD2  . PHE A 1 9   ? -11.289 -5.048  5.177   1.00 15.00 ?  51  PHE A HD2  2  
ATOM   3497   H  HE1  . PHE A 1 9   ? -12.956 -8.723  2.361   1.00 15.00 ?  51  PHE A HE1  2  
ATOM   3498   H  HE2  . PHE A 1 9   ? -11.740 -4.660  2.789   1.00 15.00 ?  51  PHE A HE2  2  
ATOM   3499   H  HZ   . PHE A 1 9   ? -12.569 -6.501  1.379   1.00 15.00 ?  51  PHE A HZ   2  
ATOM   3500   N  N    . ARG A 1 10  ? -8.975  -7.125  8.790   1.00 15.00 ?  52  ARG A N    2  
ATOM   3501   C  CA   . ARG A 1 10  ? -8.641  -7.016  10.198  1.00 15.00 ?  52  ARG A CA   2  
ATOM   3502   C  C    . ARG A 1 10  ? -8.500  -5.550  10.593  1.00 15.00 ?  52  ARG A C    2  
ATOM   3503   O  O    . ARG A 1 10  ? -7.829  -4.778  9.905   1.00 15.00 ?  52  ARG A O    2  
ATOM   3504   C  CB   . ARG A 1 10  ? -7.353  -7.778  10.512  1.00 15.00 ?  52  ARG A CB   2  
ATOM   3505   C  CG   . ARG A 1 10  ? -7.026  -7.811  11.995  1.00 15.00 ?  52  ARG A CG   2  
ATOM   3506   C  CD   . ARG A 1 10  ? -5.826  -8.692  12.287  1.00 15.00 ?  52  ARG A CD   2  
ATOM   3507   N  NE   . ARG A 1 10  ? -5.310  -8.482  13.643  1.00 15.00 ?  52  ARG A NE   2  
ATOM   3508   C  CZ   . ARG A 1 10  ? -5.043  -9.460  14.512  1.00 15.00 ?  52  ARG A CZ   2  
ATOM   3509   N  NH1  . ARG A 1 10  ? -5.227  -10.736 14.185  1.00 15.00 1  52  ARG A NH1  2  
ATOM   3510   N  NH2  . ARG A 1 10  ? -4.586  -9.161  15.723  1.00 15.00 ?  52  ARG A NH2  2  
ATOM   3511   H  H    . ARG A 1 10  ? -8.470  -6.592  8.133   1.00 15.00 ?  52  ARG A H    2  
ATOM   3512   H  HA   . ARG A 1 10  ? -9.453  -7.449  10.764  1.00 15.00 ?  52  ARG A HA   2  
ATOM   3513   H  HB2  . ARG A 1 10  ? -7.450  -8.796  10.161  1.00 15.00 ?  52  ARG A HB2  2  
ATOM   3514   H  HB3  . ARG A 1 10  ? -6.533  -7.304  9.996   1.00 15.00 ?  52  ARG A HB3  2  
ATOM   3515   H  HG2  . ARG A 1 10  ? -6.812  -6.806  12.327  1.00 15.00 ?  52  ARG A HG2  2  
ATOM   3516   H  HG3  . ARG A 1 10  ? -7.881  -8.194  12.529  1.00 15.00 ?  52  ARG A HG3  2  
ATOM   3517   H  HD2  . ARG A 1 10  ? -6.116  -9.725  12.176  1.00 15.00 ?  52  ARG A HD2  2  
ATOM   3518   H  HD3  . ARG A 1 10  ? -5.046  -8.457  11.576  1.00 15.00 ?  52  ARG A HD3  2  
ATOM   3519   H  HE   . ARG A 1 10  ? -5.161  -7.549  13.922  1.00 15.00 ?  52  ARG A HE   2  
ATOM   3520   H  HH11 . ARG A 1 10  ? -5.008  -11.487 14.873  1.00 15.00 ?  52  ARG A HH11 2  
ATOM   3521   H  HH12 . ARG A 1 10  ? -5.603  -11.002 13.236  1.00 15.00 ?  52  ARG A HH12 2  
ATOM   3522   H  HH21 . ARG A 1 10  ? -4.372  -9.922  16.407  1.00 15.00 ?  52  ARG A HH21 2  
ATOM   3523   H  HH22 . ARG A 1 10  ? -4.440  -8.166  16.003  1.00 15.00 ?  52  ARG A HH22 2  
ATOM   3524   N  N    . GLN A 1 11  ? -9.139  -5.169  11.691  1.00 15.00 ?  53  GLN A N    2  
ATOM   3525   C  CA   . GLN A 1 11  ? -9.085  -3.801  12.179  1.00 15.00 ?  53  GLN A CA   2  
ATOM   3526   C  C    . GLN A 1 11  ? -7.778  -3.547  12.920  1.00 15.00 ?  53  GLN A C    2  
ATOM   3527   O  O    . GLN A 1 11  ? -7.347  -4.365  13.733  1.00 15.00 ?  53  GLN A O    2  
ATOM   3528   C  CB   . GLN A 1 11  ? -10.269 -3.515  13.109  1.00 15.00 ?  53  GLN A CB   2  
ATOM   3529   C  CG   . GLN A 1 11  ? -10.349 -2.066  13.549  1.00 15.00 ?  53  GLN A CG   2  
ATOM   3530   C  CD   . GLN A 1 11  ? -11.603 -1.755  14.344  1.00 15.00 ?  53  GLN A CD   2  
ATOM   3531   O  OE1  . GLN A 1 11  ? -12.110 -2.591  15.091  1.00 15.00 ?  53  GLN A OE1  2  
ATOM   3532   N  NE2  . GLN A 1 11  ? -12.115 -0.546  14.183  1.00 15.00 ?  53  GLN A NE2  2  
ATOM   3533   H  H    . GLN A 1 11  ? -9.667  -5.830  12.191  1.00 15.00 ?  53  GLN A H    2  
ATOM   3534   H  HA   . GLN A 1 11  ? -9.140  -3.141  11.325  1.00 15.00 ?  53  GLN A HA   2  
ATOM   3535   H  HB2  . GLN A 1 11  ? -11.187 -3.767  12.599  1.00 15.00 ?  53  GLN A HB2  2  
ATOM   3536   H  HB3  . GLN A 1 11  ? -10.179 -4.130  13.991  1.00 15.00 ?  53  GLN A HB3  2  
ATOM   3537   H  HG2  . GLN A 1 11  ? -9.488  -1.845  14.163  1.00 15.00 ?  53  GLN A HG2  2  
ATOM   3538   H  HG3  . GLN A 1 11  ? -10.332 -1.436  12.672  1.00 15.00 ?  53  GLN A HG3  2  
ATOM   3539   H  HE21 . GLN A 1 11  ? -11.660 0.073   13.571  1.00 15.00 ?  53  GLN A HE21 2  
ATOM   3540   H  HE22 . GLN A 1 11  ? -12.935 -0.318  14.672  1.00 15.00 ?  53  GLN A HE22 2  
ATOM   3541   N  N    . LEU A 1 12  ? -7.141  -2.425  12.622  1.00 15.00 ?  54  LEU A N    2  
ATOM   3542   C  CA   . LEU A 1 12  ? -5.895  -2.059  13.277  1.00 15.00 ?  54  LEU A CA   2  
ATOM   3543   C  C    . LEU A 1 12  ? -6.148  -0.935  14.266  1.00 15.00 ?  54  LEU A C    2  
ATOM   3544   O  O    . LEU A 1 12  ? -5.553  -0.885  15.343  1.00 15.00 ?  54  LEU A O    2  
ATOM   3545   C  CB   . LEU A 1 12  ? -4.851  -1.625  12.246  1.00 15.00 ?  54  LEU A CB   2  
ATOM   3546   C  CG   . LEU A 1 12  ? -4.508  -2.672  11.182  1.00 15.00 ?  54  LEU A CG   2  
ATOM   3547   C  CD1  . LEU A 1 12  ? -3.469  -2.126  10.222  1.00 15.00 ?  54  LEU A CD1  2  
ATOM   3548   C  CD2  . LEU A 1 12  ? -4.010  -3.957  11.822  1.00 15.00 ?  54  LEU A CD2  2  
ATOM   3549   H  H    . LEU A 1 12  ? -7.519  -1.825  11.939  1.00 15.00 ?  54  LEU A H    2  
ATOM   3550   H  HA   . LEU A 1 12  ? -5.531  -2.925  13.809  1.00 15.00 ?  54  LEU A HA   2  
ATOM   3551   H  HB2  . LEU A 1 12  ? -5.222  -0.744  11.744  1.00 15.00 ?  54  LEU A HB2  2  
ATOM   3552   H  HB3  . LEU A 1 12  ? -3.945  -1.366  12.772  1.00 15.00 ?  54  LEU A HB3  2  
ATOM   3553   H  HG   . LEU A 1 12  ? -5.398  -2.904  10.613  1.00 15.00 ?  54  LEU A HG   2  
ATOM   3554   H  HD11 . LEU A 1 12  ? -3.838  -1.219  9.769   1.00 15.00 ?  54  LEU A HD11 2  
ATOM   3555   H  HD12 . LEU A 1 12  ? -3.269  -2.858  9.454   1.00 15.00 ?  54  LEU A HD12 2  
ATOM   3556   H  HD13 . LEU A 1 12  ? -2.560  -1.916  10.763  1.00 15.00 ?  54  LEU A HD13 2  
ATOM   3557   H  HD21 . LEU A 1 12  ? -4.829  -4.448  12.325  1.00 15.00 ?  54  LEU A HD21 2  
ATOM   3558   H  HD22 . LEU A 1 12  ? -3.234  -3.728  12.537  1.00 15.00 ?  54  LEU A HD22 2  
ATOM   3559   H  HD23 . LEU A 1 12  ? -3.615  -4.609  11.058  1.00 15.00 ?  54  LEU A HD23 2  
ATOM   3560   N  N    . ALA A 1 13  ? -7.053  -0.042  13.889  1.00 15.00 ?  55  ALA A N    2  
ATOM   3561   C  CA   . ALA A 1 13  ? -7.423  1.096   14.716  1.00 15.00 ?  55  ALA A CA   2  
ATOM   3562   C  C    . ALA A 1 13  ? -8.917  1.370   14.558  1.00 15.00 ?  55  ALA A C    2  
ATOM   3563   O  O    . ALA A 1 13  ? -9.521  0.895   13.598  1.00 15.00 ?  55  ALA A O    2  
ATOM   3564   C  CB   . ALA A 1 13  ? -6.595  2.315   14.332  1.00 15.00 ?  55  ALA A CB   2  
ATOM   3565   H  H    . ALA A 1 13  ? -7.493  -0.150  13.019  1.00 15.00 ?  55  ALA A H    2  
ATOM   3566   H  HA   . ALA A 1 13  ? -7.216  0.849   15.747  1.00 15.00 ?  55  ALA A HA   2  
ATOM   3567   H  HB1  . ALA A 1 13  ? -6.595  3.023   15.147  1.00 15.00 ?  55  ALA A HB1  2  
ATOM   3568   H  HB2  . ALA A 1 13  ? -7.022  2.778   13.456  1.00 15.00 ?  55  ALA A HB2  2  
ATOM   3569   H  HB3  . ALA A 1 13  ? -5.582  2.011   14.121  1.00 15.00 ?  55  ALA A HB3  2  
ATOM   3570   N  N    . PRO A 1 14  ? -9.534  2.128   15.485  1.00 15.00 ?  56  PRO A N    2  
ATOM   3571   C  CA   . PRO A 1 14  ? -10.974 2.445   15.443  1.00 15.00 ?  56  PRO A CA   2  
ATOM   3572   C  C    . PRO A 1 14  ? -11.486 2.833   14.055  1.00 15.00 ?  56  PRO A C    2  
ATOM   3573   O  O    . PRO A 1 14  ? -12.583 2.438   13.661  1.00 15.00 ?  56  PRO A O    2  
ATOM   3574   C  CB   . PRO A 1 14  ? -11.083 3.629   16.399  1.00 15.00 ?  56  PRO A CB   2  
ATOM   3575   C  CG   . PRO A 1 14  ? -10.014 3.393   17.405  1.00 15.00 ?  56  PRO A CG   2  
ATOM   3576   C  CD   . PRO A 1 14  ? -8.881  2.735   16.666  1.00 15.00 ?  56  PRO A CD   2  
ATOM   3577   H  HA   . PRO A 1 14  ? -11.565 1.625   15.822  1.00 15.00 ?  56  PRO A HA   2  
ATOM   3578   H  HB2  . PRO A 1 14  ? -10.912 4.552   15.857  1.00 15.00 ?  56  PRO A HB2  2  
ATOM   3579   H  HB3  . PRO A 1 14  ? -12.049 3.645   16.875  1.00 15.00 ?  56  PRO A HB3  2  
ATOM   3580   H  HG2  . PRO A 1 14  ? -9.693  4.337   17.827  1.00 15.00 ?  56  PRO A HG2  2  
ATOM   3581   H  HG3  . PRO A 1 14  ? -10.376 2.737   18.182  1.00 15.00 ?  56  PRO A HG3  2  
ATOM   3582   H  HD2  . PRO A 1 14  ? -8.153  3.475   16.364  1.00 15.00 ?  56  PRO A HD2  2  
ATOM   3583   H  HD3  . PRO A 1 14  ? -8.416  1.979   17.281  1.00 15.00 ?  56  PRO A HD3  2  
ATOM   3584   N  N    . ASN A 1 15  ? -10.691 3.591   13.310  1.00 15.00 ?  57  ASN A N    2  
ATOM   3585   C  CA   . ASN A 1 15  ? -11.091 4.024   11.977  1.00 15.00 ?  57  ASN A CA   2  
ATOM   3586   C  C    . ASN A 1 15  ? -10.121 3.529   10.912  1.00 15.00 ?  57  ASN A C    2  
ATOM   3587   O  O    . ASN A 1 15  ? -10.112 4.037   9.791   1.00 15.00 ?  57  ASN A O    2  
ATOM   3588   C  CB   . ASN A 1 15  ? -11.176 5.553   11.923  1.00 15.00 ?  57  ASN A CB   2  
ATOM   3589   C  CG   . ASN A 1 15  ? -12.478 6.088   12.490  1.00 15.00 ?  57  ASN A CG   2  
ATOM   3590   O  OD1  . ASN A 1 15  ? -13.529 5.458   12.381  1.00 15.00 ?  57  ASN A OD1  2  
ATOM   3591   N  ND2  . ASN A 1 15  ? -12.415 7.259   13.108  1.00 15.00 ?  57  ASN A ND2  2  
ATOM   3592   H  H    . ASN A 1 15  ? -9.819  3.872   13.667  1.00 15.00 ?  57  ASN A H    2  
ATOM   3593   H  HA   . ASN A 1 15  ? -12.067 3.613   11.771  1.00 15.00 ?  57  ASN A HA   2  
ATOM   3594   H  HB2  . ASN A 1 15  ? -10.362 5.971   12.495  1.00 15.00 ?  57  ASN A HB2  2  
ATOM   3595   H  HB3  . ASN A 1 15  ? -11.091 5.874   10.896  1.00 15.00 ?  57  ASN A HB3  2  
ATOM   3596   H  HD21 . ASN A 1 15  ? -11.544 7.707   13.163  1.00 15.00 ?  57  ASN A HD21 2  
ATOM   3597   H  HD22 . ASN A 1 15  ? -13.241 7.628   13.487  1.00 15.00 ?  57  ASN A HD22 2  
ATOM   3598   N  N    . VAL A 1 16  ? -9.321  2.525   11.247  1.00 15.00 ?  58  VAL A N    2  
ATOM   3599   C  CA   . VAL A 1 16  ? -8.344  1.994   10.302  1.00 15.00 ?  58  VAL A CA   2  
ATOM   3600   C  C    . VAL A 1 16  ? -8.445  0.471   10.180  1.00 15.00 ?  58  VAL A C    2  
ATOM   3601   O  O    . VAL A 1 16  ? -8.207  -0.255  11.150  1.00 15.00 ?  58  VAL A O    2  
ATOM   3602   C  CB   . VAL A 1 16  ? -6.896  2.368   10.702  1.00 15.00 ?  58  VAL A CB   2  
ATOM   3603   C  CG1  . VAL A 1 16  ? -5.917  1.926   9.625   1.00 15.00 ?  58  VAL A CG1  2  
ATOM   3604   C  CG2  . VAL A 1 16  ? -6.773  3.864   10.959  1.00 15.00 ?  58  VAL A CG2  2  
ATOM   3605   H  H    . VAL A 1 16  ? -9.400  2.120   12.139  1.00 15.00 ?  58  VAL A H    2  
ATOM   3606   H  HA   . VAL A 1 16  ? -8.550  2.433   9.339   1.00 15.00 ?  58  VAL A HA   2  
ATOM   3607   H  HB   . VAL A 1 16  ? -6.650  1.847   11.617  1.00 15.00 ?  58  VAL A HB   2  
ATOM   3608   H  HG11 . VAL A 1 16  ? -6.074  2.517   8.734   1.00 15.00 ?  58  VAL A HG11 2  
ATOM   3609   H  HG12 . VAL A 1 16  ? -6.079  0.883   9.395   1.00 15.00 ?  58  VAL A HG12 2  
ATOM   3610   H  HG13 . VAL A 1 16  ? -4.906  2.065   9.976   1.00 15.00 ?  58  VAL A HG13 2  
ATOM   3611   H  HG21 . VAL A 1 16  ? -7.115  4.408   10.089  1.00 15.00 ?  58  VAL A HG21 2  
ATOM   3612   H  HG22 . VAL A 1 16  ? -5.742  4.114   11.156  1.00 15.00 ?  58  VAL A HG22 2  
ATOM   3613   H  HG23 . VAL A 1 16  ? -7.379  4.132   11.813  1.00 15.00 ?  58  VAL A HG23 2  
ATOM   3614   N  N    . TRP A 1 17  ? -8.799  0.001   8.989   1.00 15.00 ?  59  TRP A N    2  
ATOM   3615   C  CA   . TRP A 1 17  ? -8.915  -1.430  8.722   1.00 15.00 ?  59  TRP A CA   2  
ATOM   3616   C  C    . TRP A 1 17  ? -7.882  -1.853  7.690   1.00 15.00 ?  59  TRP A C    2  
ATOM   3617   O  O    . TRP A 1 17  ? -7.460  -1.047  6.863   1.00 15.00 ?  59  TRP A O    2  
ATOM   3618   C  CB   . TRP A 1 17  ? -10.314 -1.778  8.207   1.00 15.00 ?  59  TRP A CB   2  
ATOM   3619   C  CG   . TRP A 1 17  ? -11.388 -1.640  9.247   1.00 15.00 ?  59  TRP A CG   2  
ATOM   3620   C  CD1  . TRP A 1 17  ? -11.805 -2.597  10.127  1.00 15.00 ?  59  TRP A CD1  2  
ATOM   3621   C  CD2  . TRP A 1 17  ? -12.182 -0.478  9.515   1.00 15.00 ?  59  TRP A CD2  2  
ATOM   3622   N  NE1  . TRP A 1 17  ? -12.804 -2.098  10.927  1.00 15.00 ?  59  TRP A NE1  2  
ATOM   3623   C  CE2  . TRP A 1 17  ? -13.060 -0.804  10.567  1.00 15.00 ?  59  TRP A CE2  2  
ATOM   3624   C  CE3  . TRP A 1 17  ? -12.237 0.807   8.966   1.00 15.00 ?  59  TRP A CE3  2  
ATOM   3625   C  CZ2  . TRP A 1 17  ? -13.980 0.106   11.079  1.00 15.00 ?  59  TRP A CZ2  2  
ATOM   3626   C  CZ3  . TRP A 1 17  ? -13.152 1.710   9.476   1.00 15.00 ?  59  TRP A CZ3  2  
ATOM   3627   C  CH2  . TRP A 1 17  ? -14.015 1.356   10.523  1.00 15.00 ?  59  TRP A CH2  2  
ATOM   3628   H  H    . TRP A 1 17  ? -8.987  0.636   8.261   1.00 15.00 ?  59  TRP A H    2  
ATOM   3629   H  HA   . TRP A 1 17  ? -8.734  -1.964  9.643   1.00 15.00 ?  59  TRP A HA   2  
ATOM   3630   H  HB2  . TRP A 1 17  ? -10.558 -1.122  7.381   1.00 15.00 ?  59  TRP A HB2  2  
ATOM   3631   H  HB3  . TRP A 1 17  ? -10.315 -2.801  7.858   1.00 15.00 ?  59  TRP A HB3  2  
ATOM   3632   H  HD1  . TRP A 1 17  ? -11.394 -3.595  10.181  1.00 15.00 ?  59  TRP A HD1  2  
ATOM   3633   H  HE1  . TRP A 1 17  ? -13.265 -2.594  11.641  1.00 15.00 ?  59  TRP A HE1  2  
ATOM   3634   H  HE3  . TRP A 1 17  ? -11.578 1.101   8.159   1.00 15.00 ?  59  TRP A HE3  2  
ATOM   3635   H  HZ2  . TRP A 1 17  ? -14.655 -0.153  11.883  1.00 15.00 ?  59  TRP A HZ2  2  
ATOM   3636   H  HZ3  . TRP A 1 17  ? -13.210 2.703   9.063   1.00 15.00 ?  59  TRP A HZ3  2  
ATOM   3637   H  HH2  . TRP A 1 17  ? -14.715 2.095   10.885  1.00 15.00 ?  59  TRP A HH2  2  
ATOM   3638   N  N    . GLN A 1 18  ? -7.469  -3.104  7.755   1.00 15.00 ?  60  GLN A N    2  
ATOM   3639   C  CA   . GLN A 1 18  ? -6.492  -3.639  6.819   1.00 15.00 ?  60  GLN A CA   2  
ATOM   3640   C  C    . GLN A 1 18  ? -7.099  -4.793  6.030   1.00 15.00 ?  60  GLN A C    2  
ATOM   3641   O  O    . GLN A 1 18  ? -7.643  -5.735  6.615   1.00 15.00 ?  60  GLN A O    2  
ATOM   3642   C  CB   . GLN A 1 18  ? -5.248  -4.118  7.573   1.00 15.00 ?  60  GLN A CB   2  
ATOM   3643   C  CG   . GLN A 1 18  ? -4.134  -4.616  6.670   1.00 15.00 ?  60  GLN A CG   2  
ATOM   3644   C  CD   . GLN A 1 18  ? -3.352  -5.751  7.297   1.00 15.00 ?  60  GLN A CD   2  
ATOM   3645   O  OE1  . GLN A 1 18  ? -2.362  -5.532  7.997   1.00 15.00 ?  60  GLN A OE1  2  
ATOM   3646   N  NE2  . GLN A 1 18  ? -3.791  -6.975  7.053   1.00 15.00 ?  60  GLN A NE2  2  
ATOM   3647   H  H    . GLN A 1 18  ? -7.821  -3.691  8.462   1.00 15.00 ?  60  GLN A H    2  
ATOM   3648   H  HA   . GLN A 1 18  ? -6.212  -2.855  6.134   1.00 15.00 ?  60  GLN A HA   2  
ATOM   3649   H  HB2  . GLN A 1 18  ? -4.863  -3.299  8.160   1.00 15.00 ?  60  GLN A HB2  2  
ATOM   3650   H  HB3  . GLN A 1 18  ? -5.532  -4.923  8.236   1.00 15.00 ?  60  GLN A HB3  2  
ATOM   3651   H  HG2  . GLN A 1 18  ? -4.566  -4.962  5.744   1.00 15.00 ?  60  GLN A HG2  2  
ATOM   3652   H  HG3  . GLN A 1 18  ? -3.458  -3.798  6.467   1.00 15.00 ?  60  GLN A HG3  2  
ATOM   3653   H  HE21 . GLN A 1 18  ? -4.587  -7.077  6.489   1.00 15.00 ?  60  GLN A HE21 2  
ATOM   3654   H  HE22 . GLN A 1 18  ? -3.303  -7.729  7.443   1.00 15.00 ?  60  GLN A HE22 2  
ATOM   3655   N  N    . HIS A 1 19  ? -7.024  -4.715  4.710   1.00 15.00 ?  61  HIS A N    2  
ATOM   3656   C  CA   . HIS A 1 19  ? -7.553  -5.776  3.860   1.00 15.00 ?  61  HIS A CA   2  
ATOM   3657   C  C    . HIS A 1 19  ? -6.409  -6.625  3.316   1.00 15.00 ?  61  HIS A C    2  
ATOM   3658   O  O    . HIS A 1 19  ? -5.280  -6.152  3.202   1.00 15.00 ?  61  HIS A O    2  
ATOM   3659   C  CB   . HIS A 1 19  ? -8.422  -5.212  2.720   1.00 15.00 ?  61  HIS A CB   2  
ATOM   3660   C  CG   . HIS A 1 19  ? -7.679  -4.530  1.604   1.00 15.00 ?  61  HIS A CG   2  
ATOM   3661   N  ND1  . HIS A 1 19  ? -7.035  -5.249  0.622   1.00 15.00 ?  61  HIS A ND1  2  
ATOM   3662   C  CD2  . HIS A 1 19  ? -7.543  -3.207  1.344   1.00 15.00 ?  61  HIS A CD2  2  
ATOM   3663   C  CE1  . HIS A 1 19  ? -6.526  -4.355  -0.208  1.00 15.00 ?  61  HIS A CE1  2  
ATOM   3664   N  NE2  . HIS A 1 19  ? -6.808  -3.106  0.190   1.00 15.00 ?  61  HIS A NE2  2  
ATOM   3665   H  H    . HIS A 1 19  ? -6.594  -3.935  4.296   1.00 15.00 ?  61  HIS A H    2  
ATOM   3666   H  HA   . HIS A 1 19  ? -8.169  -6.406  4.482   1.00 15.00 ?  61  HIS A HA   2  
ATOM   3667   H  HB2  . HIS A 1 19  ? -8.983  -6.023  2.282   1.00 15.00 ?  61  HIS A HB2  2  
ATOM   3668   H  HB3  . HIS A 1 19  ? -9.117  -4.497  3.138   1.00 15.00 ?  61  HIS A HB3  2  
ATOM   3669   H  HD2  . HIS A 1 19  ? -7.937  -2.389  1.929   1.00 15.00 ?  61  HIS A HD2  2  
ATOM   3670   H  HE1  . HIS A 1 19  ? -5.956  -4.598  -1.092  1.00 15.00 ?  61  HIS A HE1  2  
ATOM   3671   H  HE2  . HIS A 1 19  ? -6.540  -2.274  -0.263  1.00 15.00 ?  61  HIS A HE2  2  
ATOM   3672   N  N    . THR A 1 20  ? -6.693  -7.879  3.012   1.00 15.00 ?  62  THR A N    2  
ATOM   3673   C  CA   . THR A 1 20  ? -5.684  -8.781  2.496   1.00 15.00 ?  62  THR A CA   2  
ATOM   3674   C  C    . THR A 1 20  ? -6.229  -9.624  1.350   1.00 15.00 ?  62  THR A C    2  
ATOM   3675   O  O    . THR A 1 20  ? -7.172  -10.402 1.531   1.00 15.00 ?  62  THR A O    2  
ATOM   3676   C  CB   . THR A 1 20  ? -5.166  -9.716  3.605   1.00 15.00 ?  62  THR A CB   2  
ATOM   3677   O  OG1  . THR A 1 20  ? -4.753  -8.943  4.742   1.00 15.00 ?  62  THR A OG1  2  
ATOM   3678   C  CG2  . THR A 1 20  ? -3.998  -10.550 3.107   1.00 15.00 ?  62  THR A CG2  2  
ATOM   3679   H  H    . THR A 1 20  ? -7.607  -8.209  3.154   1.00 15.00 ?  62  THR A H    2  
ATOM   3680   H  HA   . THR A 1 20  ? -4.857  -8.189  2.136   1.00 15.00 ?  62  THR A HA   2  
ATOM   3681   H  HB   . THR A 1 20  ? -5.967  -10.380 3.899   1.00 15.00 ?  62  THR A HB   2  
ATOM   3682   H  HG1  . THR A 1 20  ? -4.039  -8.345  4.474   1.00 15.00 ?  62  THR A HG1  2  
ATOM   3683   H  HG21 . THR A 1 20  ? -4.278  -11.053 2.192   1.00 15.00 ?  62  THR A HG21 2  
ATOM   3684   H  HG22 . THR A 1 20  ? -3.738  -11.283 3.853   1.00 15.00 ?  62  THR A HG22 2  
ATOM   3685   H  HG23 . THR A 1 20  ? -3.150  -9.910  2.920   1.00 15.00 ?  62  THR A HG23 2  
ATOM   3686   N  N    . SER A 1 21  ? -5.646  -9.452  0.174   1.00 15.00 ?  63  SER A N    2  
ATOM   3687   C  CA   . SER A 1 21  ? -6.054  -10.204 -0.999  1.00 15.00 ?  63  SER A CA   2  
ATOM   3688   C  C    . SER A 1 21  ? -5.037  -11.307 -1.288  1.00 15.00 ?  63  SER A C    2  
ATOM   3689   O  O    . SER A 1 21  ? -3.842  -11.132 -1.046  1.00 15.00 ?  63  SER A O    2  
ATOM   3690   C  CB   . SER A 1 21  ? -6.201  -9.265  -2.197  1.00 15.00 ?  63  SER A CB   2  
ATOM   3691   O  OG   . SER A 1 21  ? -5.081  -8.404  -2.318  1.00 15.00 ?  63  SER A OG   2  
ATOM   3692   H  H    . SER A 1 21  ? -4.916  -8.798  0.092   1.00 15.00 ?  63  SER A H    2  
ATOM   3693   H  HA   . SER A 1 21  ? -7.008  -10.658 -0.786  1.00 15.00 ?  63  SER A HA   2  
ATOM   3694   H  HB2  . SER A 1 21  ? -6.295  -9.846  -3.100  1.00 15.00 ?  63  SER A HB2  2  
ATOM   3695   H  HB3  . SER A 1 21  ? -7.090  -8.664  -2.067  1.00 15.00 ?  63  SER A HB3  2  
ATOM   3696   H  HG   . SER A 1 21  ? -5.240  -7.595  -1.820  1.00 15.00 ?  63  SER A HG   2  
ATOM   3697   N  N    . TYR A 1 22  ? -5.507  -12.439 -1.797  1.00 15.00 ?  64  TYR A N    2  
ATOM   3698   C  CA   . TYR A 1 22  ? -4.625  -13.566 -2.085  1.00 15.00 ?  64  TYR A CA   2  
ATOM   3699   C  C    . TYR A 1 22  ? -4.684  -13.953 -3.559  1.00 15.00 ?  64  TYR A C    2  
ATOM   3700   O  O    . TYR A 1 22  ? -5.746  -13.888 -4.179  1.00 15.00 ?  64  TYR A O    2  
ATOM   3701   C  CB   . TYR A 1 22  ? -5.021  -14.779 -1.236  1.00 15.00 ?  64  TYR A CB   2  
ATOM   3702   C  CG   . TYR A 1 22  ? -4.709  -14.657 0.242   1.00 15.00 ?  64  TYR A CG   2  
ATOM   3703   C  CD1  . TYR A 1 22  ? -5.489  -13.868 1.075   1.00 15.00 ?  64  TYR A CD1  2  
ATOM   3704   C  CD2  . TYR A 1 22  ? -3.643  -15.348 0.803   1.00 15.00 ?  64  TYR A CD2  2  
ATOM   3705   C  CE1  . TYR A 1 22  ? -5.217  -13.771 2.427   1.00 15.00 ?  64  TYR A CE1  2  
ATOM   3706   C  CE2  . TYR A 1 22  ? -3.362  -15.255 2.154   1.00 15.00 ?  64  TYR A CE2  2  
ATOM   3707   C  CZ   . TYR A 1 22  ? -4.151  -14.465 2.961   1.00 15.00 ?  64  TYR A CZ   2  
ATOM   3708   O  OH   . TYR A 1 22  ? -3.880  -14.371 4.309   1.00 15.00 ?  64  TYR A OH   2  
ATOM   3709   H  H    . TYR A 1 22  ? -6.464  -12.517 -1.999  1.00 15.00 ?  64  TYR A H    2  
ATOM   3710   H  HA   . TYR A 1 22  ? -3.616  -13.274 -1.837  1.00 15.00 ?  64  TYR A HA   2  
ATOM   3711   H  HB2  . TYR A 1 22  ? -6.084  -14.935 -1.331  1.00 15.00 ?  64  TYR A HB2  2  
ATOM   3712   H  HB3  . TYR A 1 22  ? -4.505  -15.648 -1.614  1.00 15.00 ?  64  TYR A HB3  2  
ATOM   3713   H  HD1  . TYR A 1 22  ? -6.319  -13.324 0.655   1.00 15.00 ?  64  TYR A HD1  2  
ATOM   3714   H  HD2  . TYR A 1 22  ? -3.027  -15.968 0.167   1.00 15.00 ?  64  TYR A HD2  2  
ATOM   3715   H  HE1  . TYR A 1 22  ? -5.836  -13.149 3.057   1.00 15.00 ?  64  TYR A HE1  2  
ATOM   3716   H  HE2  . TYR A 1 22  ? -2.528  -15.799 2.571   1.00 15.00 ?  64  TYR A HE2  2  
ATOM   3717   H  HH   . TYR A 1 22  ? -2.954  -14.125 4.433   1.00 15.00 ?  64  TYR A HH   2  
ATOM   3718   N  N    . LEU A 1 23  ? -3.545  -14.356 -4.115  1.00 15.00 ?  65  LEU A N    2  
ATOM   3719   C  CA   . LEU A 1 23  ? -3.478  -14.786 -5.506  1.00 15.00 ?  65  LEU A CA   2  
ATOM   3720   C  C    . LEU A 1 23  ? -2.777  -16.131 -5.597  1.00 15.00 ?  65  LEU A C    2  
ATOM   3721   O  O    . LEU A 1 23  ? -1.745  -16.349 -4.953  1.00 15.00 ?  65  LEU A O    2  
ATOM   3722   C  CB   . LEU A 1 23  ? -2.739  -13.763 -6.373  1.00 15.00 ?  65  LEU A CB   2  
ATOM   3723   C  CG   . LEU A 1 23  ? -2.715  -14.090 -7.869  1.00 15.00 ?  65  LEU A CG   2  
ATOM   3724   C  CD1  . LEU A 1 23  ? -4.057  -13.780 -8.511  1.00 15.00 ?  65  LEU A CD1  2  
ATOM   3725   C  CD2  . LEU A 1 23  ? -1.603  -13.328 -8.570  1.00 15.00 ?  65  LEU A CD2  2  
ATOM   3726   H  H    . LEU A 1 23  ? -2.724  -14.358 -3.573  1.00 15.00 ?  65  LEU A H    2  
ATOM   3727   H  HA   . LEU A 1 23  ? -4.490  -14.894 -5.871  1.00 15.00 ?  65  LEU A HA   2  
ATOM   3728   H  HB2  . LEU A 1 23  ? -3.217  -12.802 -6.241  1.00 15.00 ?  65  LEU A HB2  2  
ATOM   3729   H  HB3  . LEU A 1 23  ? -1.720  -13.692 -6.025  1.00 15.00 ?  65  LEU A HB3  2  
ATOM   3730   H  HG   . LEU A 1 23  ? -2.526  -15.145 -7.993  1.00 15.00 ?  65  LEU A HG   2  
ATOM   3731   H  HD11 . LEU A 1 23  ? -4.850  -14.168 -7.888  1.00 15.00 ?  65  LEU A HD11 2  
ATOM   3732   H  HD12 . LEU A 1 23  ? -4.106  -14.244 -9.483  1.00 15.00 ?  65  LEU A HD12 2  
ATOM   3733   H  HD13 . LEU A 1 23  ? -4.170  -12.712 -8.613  1.00 15.00 ?  65  LEU A HD13 2  
ATOM   3734   H  HD21 . LEU A 1 23  ? -0.647  -13.734 -8.275  1.00 15.00 ?  65  LEU A HD21 2  
ATOM   3735   H  HD22 . LEU A 1 23  ? -1.649  -12.285 -8.291  1.00 15.00 ?  65  LEU A HD22 2  
ATOM   3736   H  HD23 . LEU A 1 23  ? -1.721  -13.421 -9.638  1.00 15.00 ?  65  LEU A HD23 2  
ATOM   3737   N  N    . ASP A 1 24  ? -3.334  -17.027 -6.398  1.00 15.00 ?  66  ASP A N    2  
ATOM   3738   C  CA   . ASP A 1 24  ? -2.762  -18.354 -6.571  1.00 15.00 ?  66  ASP A CA   2  
ATOM   3739   C  C    . ASP A 1 24  ? -1.625  -18.329 -7.579  1.00 15.00 ?  66  ASP A C    2  
ATOM   3740   O  O    . ASP A 1 24  ? -1.845  -18.419 -8.792  1.00 15.00 ?  66  ASP A O    2  
ATOM   3741   C  CB   . ASP A 1 24  ? -3.830  -19.347 -7.025  1.00 15.00 ?  66  ASP A CB   2  
ATOM   3742   C  CG   . ASP A 1 24  ? -4.169  -20.356 -5.953  1.00 15.00 ?  66  ASP A CG   2  
ATOM   3743   O  OD1  . ASP A 1 24  ? -3.475  -21.389 -5.861  1.00 15.00 ?  66  ASP A OD1  2  
ATOM   3744   O  OD2  . ASP A 1 24  ? -5.144  -20.127 -5.205  1.00 15.00 -1 66  ASP A OD2  2  
ATOM   3745   H  H    . ASP A 1 24  ? -4.151  -16.790 -6.886  1.00 15.00 ?  66  ASP A H    2  
ATOM   3746   H  HA   . ASP A 1 24  ? -2.374  -18.671 -5.615  1.00 15.00 ?  66  ASP A HA   2  
ATOM   3747   H  HB2  . ASP A 1 24  ? -4.728  -18.809 -7.282  1.00 15.00 ?  66  ASP A HB2  2  
ATOM   3748   H  HB3  . ASP A 1 24  ? -3.472  -19.880 -7.894  1.00 15.00 ?  66  ASP A HB3  2  
ATOM   3749   N  N    . MET A 1 25  ? -0.409  -18.183 -7.080  1.00 15.00 ?  67  MET A N    2  
ATOM   3750   C  CA   . MET A 1 25  ? 0.765   -18.151 -7.935  1.00 15.00 ?  67  MET A CA   2  
ATOM   3751   C  C    . MET A 1 25  ? 1.263   -19.572 -8.173  1.00 15.00 ?  67  MET A C    2  
ATOM   3752   O  O    . MET A 1 25  ? 0.954   -20.469 -7.383  1.00 15.00 ?  67  MET A O    2  
ATOM   3753   C  CB   . MET A 1 25  ? 1.867   -17.284 -7.316  1.00 15.00 ?  67  MET A CB   2  
ATOM   3754   C  CG   . MET A 1 25  ? 1.699   -15.800 -7.609  1.00 15.00 ?  67  MET A CG   2  
ATOM   3755   S  SD   . MET A 1 25  ? 3.143   -14.823 -7.145  1.00 15.00 ?  67  MET A SD   2  
ATOM   3756   C  CE   . MET A 1 25  ? 4.339   -15.364 -8.364  1.00 15.00 ?  67  MET A CE   2  
ATOM   3757   H  H    . MET A 1 25  ? -0.295  -18.108 -6.107  1.00 15.00 ?  67  MET A H    2  
ATOM   3758   H  HA   . MET A 1 25  ? 0.468   -17.725 -8.882  1.00 15.00 ?  67  MET A HA   2  
ATOM   3759   H  HB2  . MET A 1 25  ? 1.866   -17.419 -6.244  1.00 15.00 ?  67  MET A HB2  2  
ATOM   3760   H  HB3  . MET A 1 25  ? 2.820   -17.601 -7.712  1.00 15.00 ?  67  MET A HB3  2  
ATOM   3761   H  HG2  . MET A 1 25  ? 1.523   -15.678 -8.667  1.00 15.00 ?  67  MET A HG2  2  
ATOM   3762   H  HG3  . MET A 1 25  ? 0.844   -15.435 -7.059  1.00 15.00 ?  67  MET A HG3  2  
ATOM   3763   H  HE1  . MET A 1 25  ? 3.948   -15.184 -9.353  1.00 15.00 ?  67  MET A HE1  2  
ATOM   3764   H  HE2  . MET A 1 25  ? 4.533   -16.417 -8.238  1.00 15.00 ?  67  MET A HE2  2  
ATOM   3765   H  HE3  . MET A 1 25  ? 5.257   -14.810 -8.234  1.00 15.00 ?  67  MET A HE3  2  
ATOM   3766   N  N    . PRO A 1 26  ? 2.007   -19.789 -9.280  1.00 15.00 ?  68  PRO A N    2  
ATOM   3767   C  CA   . PRO A 1 26  ? 2.554   -21.100 -9.654  1.00 15.00 ?  68  PRO A CA   2  
ATOM   3768   C  C    . PRO A 1 26  ? 3.030   -21.934 -8.464  1.00 15.00 ?  68  PRO A C    2  
ATOM   3769   O  O    . PRO A 1 26  ? 3.810   -21.467 -7.629  1.00 15.00 ?  68  PRO A O    2  
ATOM   3770   C  CB   . PRO A 1 26  ? 3.736   -20.720 -10.538 1.00 15.00 ?  68  PRO A CB   2  
ATOM   3771   C  CG   . PRO A 1 26  ? 3.336   -19.447 -11.202 1.00 15.00 ?  68  PRO A CG   2  
ATOM   3772   C  CD   . PRO A 1 26  ? 2.364   -18.758 -10.277 1.00 15.00 ?  68  PRO A CD   2  
ATOM   3773   H  HA   . PRO A 1 26  ? 1.845   -21.672 -10.231 1.00 15.00 ?  68  PRO A HA   2  
ATOM   3774   H  HB2  . PRO A 1 26  ? 4.618   -20.575 -9.927  1.00 15.00 ?  68  PRO A HB2  2  
ATOM   3775   H  HB3  . PRO A 1 26  ? 3.913   -21.483 -11.276 1.00 15.00 ?  68  PRO A HB3  2  
ATOM   3776   H  HG2  . PRO A 1 26  ? 4.211   -18.829 -11.355 1.00 15.00 ?  68  PRO A HG2  2  
ATOM   3777   H  HG3  . PRO A 1 26  ? 2.856   -19.660 -12.147 1.00 15.00 ?  68  PRO A HG3  2  
ATOM   3778   H  HD2  . PRO A 1 26  ? 2.840   -17.913 -9.803  1.00 15.00 ?  68  PRO A HD2  2  
ATOM   3779   H  HD3  . PRO A 1 26  ? 1.491   -18.434 -10.825 1.00 15.00 ?  68  PRO A HD3  2  
ATOM   3780   N  N    . GLY A 1 27  ? 2.547   -23.167 -8.396  1.00 15.00 ?  69  GLY A N    2  
ATOM   3781   C  CA   . GLY A 1 27  ? 2.916   -24.059 -7.319  1.00 15.00 ?  69  GLY A CA   2  
ATOM   3782   C  C    . GLY A 1 27  ? 1.808   -24.209 -6.304  1.00 15.00 ?  69  GLY A C    2  
ATOM   3783   O  O    . GLY A 1 27  ? 0.644   -24.390 -6.666  1.00 15.00 ?  69  GLY A O    2  
ATOM   3784   H  H    . GLY A 1 27  ? 1.924   -23.475 -9.086  1.00 15.00 ?  69  GLY A H    2  
ATOM   3785   H  HA2  . GLY A 1 27  ? 3.145   -25.031 -7.731  1.00 15.00 ?  69  GLY A HA2  2  
ATOM   3786   H  HA3  . GLY A 1 27  ? 3.794   -23.673 -6.824  1.00 15.00 ?  69  GLY A HA3  2  
ATOM   3787   N  N    . PHE A 1 28  ? 2.168   -24.122 -5.036  1.00 15.00 ?  70  PHE A N    2  
ATOM   3788   C  CA   . PHE A 1 28  ? 1.208   -24.247 -3.952  1.00 15.00 ?  70  PHE A CA   2  
ATOM   3789   C  C    . PHE A 1 28  ? 1.458   -23.157 -2.921  1.00 15.00 ?  70  PHE A C    2  
ATOM   3790   O  O    . PHE A 1 28  ? 1.992   -23.417 -1.840  1.00 15.00 ?  70  PHE A O    2  
ATOM   3791   C  CB   . PHE A 1 28  ? 1.308   -25.625 -3.292  1.00 15.00 ?  70  PHE A CB   2  
ATOM   3792   C  CG   . PHE A 1 28  ? 0.958   -26.762 -4.209  1.00 15.00 ?  70  PHE A CG   2  
ATOM   3793   C  CD1  . PHE A 1 28  ? -0.363  -27.066 -4.479  1.00 15.00 ?  70  PHE A CD1  2  
ATOM   3794   C  CD2  . PHE A 1 28  ? 1.955   -27.522 -4.801  1.00 15.00 ?  70  PHE A CD2  2  
ATOM   3795   C  CE1  . PHE A 1 28  ? -0.687  -28.108 -5.325  1.00 15.00 ?  70  PHE A CE1  2  
ATOM   3796   C  CE2  . PHE A 1 28  ? 1.636   -28.565 -5.647  1.00 15.00 ?  70  PHE A CE2  2  
ATOM   3797   C  CZ   . PHE A 1 28  ? 0.314   -28.858 -5.910  1.00 15.00 ?  70  PHE A CZ   2  
ATOM   3798   H  H    . PHE A 1 28  ? 3.109   -23.948 -4.816  1.00 15.00 ?  70  PHE A H    2  
ATOM   3799   H  HA   . PHE A 1 28  ? 0.217   -24.121 -4.366  1.00 15.00 ?  70  PHE A HA   2  
ATOM   3800   H  HB2  . PHE A 1 28  ? 2.320   -25.777 -2.944  1.00 15.00 ?  70  PHE A HB2  2  
ATOM   3801   H  HB3  . PHE A 1 28  ? 0.635   -25.660 -2.449  1.00 15.00 ?  70  PHE A HB3  2  
ATOM   3802   H  HD1  . PHE A 1 28  ? -1.146  -26.478 -4.022  1.00 15.00 ?  70  PHE A HD1  2  
ATOM   3803   H  HD2  . PHE A 1 28  ? 2.991   -27.295 -4.596  1.00 15.00 ?  70  PHE A HD2  2  
ATOM   3804   H  HE1  . PHE A 1 28  ? -1.721  -28.334 -5.527  1.00 15.00 ?  70  PHE A HE1  2  
ATOM   3805   H  HE2  . PHE A 1 28  ? 2.421   -29.149 -6.104  1.00 15.00 ?  70  PHE A HE2  2  
ATOM   3806   H  HZ   . PHE A 1 28  ? 0.065   -29.671 -6.573  1.00 15.00 ?  70  PHE A HZ   2  
ATOM   3807   N  N    . GLY A 1 29  ? 1.086   -21.938 -3.272  1.00 15.00 ?  71  GLY A N    2  
ATOM   3808   C  CA   . GLY A 1 29  ? 1.277   -20.816 -2.383  1.00 15.00 ?  71  GLY A CA   2  
ATOM   3809   C  C    . GLY A 1 29  ? 0.475   -19.607 -2.810  1.00 15.00 ?  71  GLY A C    2  
ATOM   3810   O  O    . GLY A 1 29  ? 0.587   -19.141 -3.948  1.00 15.00 ?  71  GLY A O    2  
ATOM   3811   H  H    . GLY A 1 29  ? 0.666   -21.799 -4.147  1.00 15.00 ?  71  GLY A H    2  
ATOM   3812   H  HA2  . GLY A 1 29  ? 0.974   -21.104 -1.390  1.00 15.00 ?  71  GLY A HA2  2  
ATOM   3813   H  HA3  . GLY A 1 29  ? 2.326   -20.554 -2.368  1.00 15.00 ?  71  GLY A HA3  2  
ATOM   3814   N  N    . ALA A 1 30  ? -0.345  -19.109 -1.899  1.00 15.00 ?  72  ALA A N    2  
ATOM   3815   C  CA   . ALA A 1 30  ? -1.174  -17.951 -2.171  1.00 15.00 ?  72  ALA A CA   2  
ATOM   3816   C  C    . ALA A 1 30  ? -0.516  -16.693 -1.621  1.00 15.00 ?  72  ALA A C    2  
ATOM   3817   O  O    . ALA A 1 30  ? -0.387  -16.526 -0.406  1.00 15.00 ?  72  ALA A O    2  
ATOM   3818   C  CB   . ALA A 1 30  ? -2.566  -18.141 -1.577  1.00 15.00 ?  72  ALA A CB   2  
ATOM   3819   H  H    . ALA A 1 30  ? -0.379  -19.524 -1.010  1.00 15.00 ?  72  ALA A H    2  
ATOM   3820   H  HA   . ALA A 1 30  ? -1.275  -17.856 -3.242  1.00 15.00 ?  72  ALA A HA   2  
ATOM   3821   H  HB1  . ALA A 1 30  ? -3.167  -17.271 -1.785  1.00 15.00 ?  72  ALA A HB1  2  
ATOM   3822   H  HB2  . ALA A 1 30  ? -2.490  -18.281 -0.507  1.00 15.00 ?  72  ALA A HB2  2  
ATOM   3823   H  HB3  . ALA A 1 30  ? -3.029  -19.010 -2.020  1.00 15.00 ?  72  ALA A HB3  2  
ATOM   3824   N  N    . VAL A 1 31  ? -0.074  -15.824 -2.514  1.00 15.00 ?  73  VAL A N    2  
ATOM   3825   C  CA   . VAL A 1 31  ? 0.575   -14.589 -2.110  1.00 15.00 ?  73  VAL A CA   2  
ATOM   3826   C  C    . VAL A 1 31  ? -0.458  -13.595 -1.607  1.00 15.00 ?  73  VAL A C    2  
ATOM   3827   O  O    . VAL A 1 31  ? -1.479  -13.369 -2.253  1.00 15.00 ?  73  VAL A O    2  
ATOM   3828   C  CB   . VAL A 1 31  ? 1.382   -13.966 -3.265  1.00 15.00 ?  73  VAL A CB   2  
ATOM   3829   C  CG1  . VAL A 1 31  ? 2.188   -12.771 -2.781  1.00 15.00 ?  73  VAL A CG1  2  
ATOM   3830   C  CG2  . VAL A 1 31  ? 2.297   -15.002 -3.896  1.00 15.00 ?  73  VAL A CG2  2  
ATOM   3831   H  H    . VAL A 1 31  ? -0.196  -16.013 -3.468  1.00 15.00 ?  73  VAL A H    2  
ATOM   3832   H  HA   . VAL A 1 31  ? 1.259   -14.823 -1.306  1.00 15.00 ?  73  VAL A HA   2  
ATOM   3833   H  HB   . VAL A 1 31  ? 0.688   -13.624 -4.016  1.00 15.00 ?  73  VAL A HB   2  
ATOM   3834   H  HG11 . VAL A 1 31  ? 2.697   -12.318 -3.619  1.00 15.00 ?  73  VAL A HG11 2  
ATOM   3835   H  HG12 . VAL A 1 31  ? 2.915   -13.099 -2.051  1.00 15.00 ?  73  VAL A HG12 2  
ATOM   3836   H  HG13 . VAL A 1 31  ? 1.524   -12.049 -2.327  1.00 15.00 ?  73  VAL A HG13 2  
ATOM   3837   H  HG21 . VAL A 1 31  ? 3.047   -14.501 -4.494  1.00 15.00 ?  73  VAL A HG21 2  
ATOM   3838   H  HG22 . VAL A 1 31  ? 1.717   -15.659 -4.526  1.00 15.00 ?  73  VAL A HG22 2  
ATOM   3839   H  HG23 . VAL A 1 31  ? 2.781   -15.580 -3.122  1.00 15.00 ?  73  VAL A HG23 2  
ATOM   3840   N  N    . ALA A 1 32  ? -0.193  -13.026 -0.447  1.00 15.00 ?  74  ALA A N    2  
ATOM   3841   C  CA   . ALA A 1 32  ? -1.104  -12.073 0.152   1.00 15.00 ?  74  ALA A CA   2  
ATOM   3842   C  C    . ALA A 1 32  ? -0.603  -10.643 0.003   1.00 15.00 ?  74  ALA A C    2  
ATOM   3843   O  O    . ALA A 1 32  ? 0.604   -10.389 0.035   1.00 15.00 ?  74  ALA A O    2  
ATOM   3844   C  CB   . ALA A 1 32  ? -1.306  -12.407 1.621   1.00 15.00 ?  74  ALA A CB   2  
ATOM   3845   H  H    . ALA A 1 32  ? 0.645   -13.247 0.017   1.00 15.00 ?  74  ALA A H    2  
ATOM   3846   H  HA   . ALA A 1 32  ? -2.056  -12.166 -0.346  1.00 15.00 ?  74  ALA A HA   2  
ATOM   3847   H  HB1  . ALA A 1 32  ? -0.439  -12.101 2.184   1.00 15.00 ?  74  ALA A HB1  2  
ATOM   3848   H  HB2  . ALA A 1 32  ? -1.446  -13.471 1.730   1.00 15.00 ?  74  ALA A HB2  2  
ATOM   3849   H  HB3  . ALA A 1 32  ? -2.178  -11.888 1.992   1.00 15.00 ?  74  ALA A HB3  2  
ATOM   3850   N  N    . SER A 1 33  ? -1.537  -9.726  -0.188  1.00 15.00 ?  75  SER A N    2  
ATOM   3851   C  CA   . SER A 1 33  ? -1.222  -8.316  -0.303  1.00 15.00 ?  75  SER A CA   2  
ATOM   3852   C  C    . SER A 1 33  ? -2.166  -7.527  0.591   1.00 15.00 ?  75  SER A C    2  
ATOM   3853   O  O    . SER A 1 33  ? -3.388  -7.633  0.463   1.00 15.00 ?  75  SER A O    2  
ATOM   3854   C  CB   . SER A 1 33  ? -1.327  -7.835  -1.748  1.00 15.00 ?  75  SER A CB   2  
ATOM   3855   O  OG   . SER A 1 33  ? -0.669  -6.590  -1.910  1.00 15.00 ?  75  SER A OG   2  
ATOM   3856   H  H    . SER A 1 33  ? -2.474  -10.011 -0.257  1.00 15.00 ?  75  SER A H    2  
ATOM   3857   H  HA   . SER A 1 33  ? -0.208  -8.172  0.048   1.00 15.00 ?  75  SER A HA   2  
ATOM   3858   H  HB2  . SER A 1 33  ? -0.868  -8.563  -2.404  1.00 15.00 ?  75  SER A HB2  2  
ATOM   3859   H  HB3  . SER A 1 33  ? -2.366  -7.717  -2.010  1.00 15.00 ?  75  SER A HB3  2  
ATOM   3860   H  HG   . SER A 1 33  ? 0.006   -6.670  -2.607  1.00 15.00 ?  75  SER A HG   2  
ATOM   3861   N  N    . ASN A 1 34  ? -1.592  -6.772  1.514   1.00 15.00 ?  76  ASN A N    2  
ATOM   3862   C  CA   . ASN A 1 34  ? -2.374  -5.981  2.455   1.00 15.00 ?  76  ASN A CA   2  
ATOM   3863   C  C    . ASN A 1 34  ? -2.565  -4.548  1.979   1.00 15.00 ?  76  ASN A C    2  
ATOM   3864   O  O    . ASN A 1 34  ? -1.667  -3.939  1.389   1.00 15.00 ?  76  ASN A O    2  
ATOM   3865   C  CB   . ASN A 1 34  ? -1.716  -5.953  3.843   1.00 15.00 ?  76  ASN A CB   2  
ATOM   3866   C  CG   . ASN A 1 34  ? -1.476  -7.330  4.431   1.00 15.00 ?  76  ASN A CG   2  
ATOM   3867   O  OD1  . ASN A 1 34  ? -2.192  -8.281  4.138   1.00 15.00 ?  76  ASN A OD1  2  
ATOM   3868   N  ND2  . ASN A 1 34  ? -0.462  -7.442  5.273   1.00 15.00 ?  76  ASN A ND2  2  
ATOM   3869   H  H    . ASN A 1 34  ? -0.616  -6.762  1.575   1.00 15.00 ?  76  ASN A H    2  
ATOM   3870   H  HA   . ASN A 1 34  ? -3.343  -6.445  2.546   1.00 15.00 ?  76  ASN A HA   2  
ATOM   3871   H  HB2  . ASN A 1 34  ? -0.765  -5.447  3.773   1.00 15.00 ?  76  ASN A HB2  2  
ATOM   3872   H  HB3  . ASN A 1 34  ? -2.356  -5.405  4.518   1.00 15.00 ?  76  ASN A HB3  2  
ATOM   3873   H  HD21 . ASN A 1 34  ? 0.075   -6.638  5.464   1.00 15.00 ?  76  ASN A HD21 2  
ATOM   3874   H  HD22 . ASN A 1 34  ? -0.285  -8.319  5.674   1.00 15.00 ?  76  ASN A HD22 2  
ATOM   3875   N  N    . GLY A 1 35  ? -3.751  -4.031  2.248   1.00 15.00 ?  77  GLY A N    2  
ATOM   3876   C  CA   . GLY A 1 35  ? -4.096  -2.668  1.914   1.00 15.00 ?  77  GLY A CA   2  
ATOM   3877   C  C    . GLY A 1 35  ? -4.733  -2.010  3.114   1.00 15.00 ?  77  GLY A C    2  
ATOM   3878   O  O    . GLY A 1 35  ? -5.001  -2.685  4.107   1.00 15.00 ?  77  GLY A O    2  
ATOM   3879   H  H    . GLY A 1 35  ? -4.422  -4.600  2.691   1.00 15.00 ?  77  GLY A H    2  
ATOM   3880   H  HA2  . GLY A 1 35  ? -3.200  -2.126  1.638   1.00 15.00 ?  77  GLY A HA2  2  
ATOM   3881   H  HA3  . GLY A 1 35  ? -4.791  -2.662  1.091   1.00 15.00 ?  77  GLY A HA3  2  
ATOM   3882   N  N    . LEU A 1 36  ? -5.010  -0.723  3.046   1.00 15.00 ?  78  LEU A N    2  
ATOM   3883   C  CA   . LEU A 1 36  ? -5.596  -0.039  4.189   1.00 15.00 ?  78  LEU A CA   2  
ATOM   3884   C  C    . LEU A 1 36  ? -6.888  0.683   3.830   1.00 15.00 ?  78  LEU A C    2  
ATOM   3885   O  O    . LEU A 1 36  ? -7.056  1.189   2.720   1.00 15.00 ?  78  LEU A O    2  
ATOM   3886   C  CB   . LEU A 1 36  ? -4.592  0.945   4.796   1.00 15.00 ?  78  LEU A CB   2  
ATOM   3887   C  CG   . LEU A 1 36  ? -3.444  0.309   5.587   1.00 15.00 ?  78  LEU A CG   2  
ATOM   3888   C  CD1  . LEU A 1 36  ? -2.478  1.379   6.075   1.00 15.00 ?  78  LEU A CD1  2  
ATOM   3889   C  CD2  . LEU A 1 36  ? -3.982  -0.496  6.763   1.00 15.00 ?  78  LEU A CD2  2  
ATOM   3890   H  H    . LEU A 1 36  ? -4.839  -0.226  2.214   1.00 15.00 ?  78  LEU A H    2  
ATOM   3891   H  HA   . LEU A 1 36  ? -5.828  -0.792  4.928   1.00 15.00 ?  78  LEU A HA   2  
ATOM   3892   H  HB2  . LEU A 1 36  ? -4.166  1.525   3.996   1.00 15.00 ?  78  LEU A HB2  2  
ATOM   3893   H  HB3  . LEU A 1 36  ? -5.129  1.611   5.457   1.00 15.00 ?  78  LEU A HB3  2  
ATOM   3894   H  HG   . LEU A 1 36  ? -2.898  -0.365  4.940   1.00 15.00 ?  78  LEU A HG   2  
ATOM   3895   H  HD11 . LEU A 1 36  ? -1.818  0.957   6.818   1.00 15.00 ?  78  LEU A HD11 2  
ATOM   3896   H  HD12 . LEU A 1 36  ? -3.034  2.197   6.507   1.00 15.00 ?  78  LEU A HD12 2  
ATOM   3897   H  HD13 . LEU A 1 36  ? -1.895  1.744   5.243   1.00 15.00 ?  78  LEU A HD13 2  
ATOM   3898   H  HD21 . LEU A 1 36  ? -3.171  -0.738  7.433   1.00 15.00 ?  78  LEU A HD21 2  
ATOM   3899   H  HD22 . LEU A 1 36  ? -4.433  -1.409  6.403   1.00 15.00 ?  78  LEU A HD22 2  
ATOM   3900   H  HD23 . LEU A 1 36  ? -4.722  0.087   7.290   1.00 15.00 ?  78  LEU A HD23 2  
ATOM   3901   N  N    . ILE A 1 37  ? -7.797  0.693   4.793   1.00 15.00 ?  79  ILE A N    2  
ATOM   3902   C  CA   . ILE A 1 37  ? -9.096  1.343   4.666   1.00 15.00 ?  79  ILE A CA   2  
ATOM   3903   C  C    . ILE A 1 37  ? -9.312  2.265   5.859   1.00 15.00 ?  79  ILE A C    2  
ATOM   3904   O  O    . ILE A 1 37  ? -9.386  1.805   6.998   1.00 15.00 ?  79  ILE A O    2  
ATOM   3905   C  CB   . ILE A 1 37  ? -10.248 0.310   4.606   1.00 15.00 ?  79  ILE A CB   2  
ATOM   3906   C  CG1  . ILE A 1 37  ? -9.984  -0.721  3.506   1.00 15.00 ?  79  ILE A CG1  2  
ATOM   3907   C  CG2  . ILE A 1 37  ? -11.580 1.013   4.368   1.00 15.00 ?  79  ILE A CG2  2  
ATOM   3908   C  CD1  . ILE A 1 37  ? -10.954 -1.882  3.512   1.00 15.00 ?  79  ILE A CD1  2  
ATOM   3909   H  H    . ILE A 1 37  ? -7.582  0.235   5.639   1.00 15.00 ?  79  ILE A H    2  
ATOM   3910   H  HA   . ILE A 1 37  ? -9.104  1.926   3.757   1.00 15.00 ?  79  ILE A HA   2  
ATOM   3911   H  HB   . ILE A 1 37  ? -10.301 -0.194  5.559   1.00 15.00 ?  79  ILE A HB   2  
ATOM   3912   H  HG12 . ILE A 1 37  ? -10.056 -0.236  2.545   1.00 15.00 ?  79  ILE A HG12 2  
ATOM   3913   H  HG13 . ILE A 1 37  ? -8.988  -1.119  3.631   1.00 15.00 ?  79  ILE A HG13 2  
ATOM   3914   H  HG21 . ILE A 1 37  ? -11.744 1.749   5.141   1.00 15.00 ?  79  ILE A HG21 2  
ATOM   3915   H  HG22 . ILE A 1 37  ? -12.381 0.290   4.387   1.00 15.00 ?  79  ILE A HG22 2  
ATOM   3916   H  HG23 . ILE A 1 37  ? -11.562 1.501   3.406   1.00 15.00 ?  79  ILE A HG23 2  
ATOM   3917   H  HD11 . ILE A 1 37  ? -11.958 -1.511  3.389   1.00 15.00 ?  79  ILE A HD11 2  
ATOM   3918   H  HD12 . ILE A 1 37  ? -10.876 -2.410  4.449   1.00 15.00 ?  79  ILE A HD12 2  
ATOM   3919   H  HD13 . ILE A 1 37  ? -10.714 -2.551  2.699   1.00 15.00 ?  79  ILE A HD13 2  
ATOM   3920   N  N    . VAL A 1 38  ? -9.391  3.561   5.604   1.00 15.00 ?  80  VAL A N    2  
ATOM   3921   C  CA   . VAL A 1 38  ? -9.570  4.535   6.673   1.00 15.00 ?  80  VAL A CA   2  
ATOM   3922   C  C    . VAL A 1 38  ? -10.934 5.217   6.588   1.00 15.00 ?  80  VAL A C    2  
ATOM   3923   O  O    . VAL A 1 38  ? -11.384 5.611   5.510   1.00 15.00 ?  80  VAL A O    2  
ATOM   3924   C  CB   . VAL A 1 38  ? -8.470  5.619   6.637   1.00 15.00 ?  80  VAL A CB   2  
ATOM   3925   C  CG1  . VAL A 1 38  ? -8.522  6.486   7.888   1.00 15.00 ?  80  VAL A CG1  2  
ATOM   3926   C  CG2  . VAL A 1 38  ? -7.095  4.989   6.486   1.00 15.00 ?  80  VAL A CG2  2  
ATOM   3927   H  H    . VAL A 1 38  ? -9.340  3.871   4.671   1.00 15.00 ?  80  VAL A H    2  
ATOM   3928   H  HA   . VAL A 1 38  ? -9.500  4.011   7.616   1.00 15.00 ?  80  VAL A HA   2  
ATOM   3929   H  HB   . VAL A 1 38  ? -8.647  6.254   5.781   1.00 15.00 ?  80  VAL A HB   2  
ATOM   3930   H  HG11 . VAL A 1 38  ? -9.524  6.864   8.022   1.00 15.00 ?  80  VAL A HG11 2  
ATOM   3931   H  HG12 . VAL A 1 38  ? -7.837  7.315   7.781   1.00 15.00 ?  80  VAL A HG12 2  
ATOM   3932   H  HG13 . VAL A 1 38  ? -8.240  5.896   8.748   1.00 15.00 ?  80  VAL A HG13 2  
ATOM   3933   H  HG21 . VAL A 1 38  ? -6.391  5.737   6.149   1.00 15.00 ?  80  VAL A HG21 2  
ATOM   3934   H  HG22 . VAL A 1 38  ? -7.144  4.186   5.767   1.00 15.00 ?  80  VAL A HG22 2  
ATOM   3935   H  HG23 . VAL A 1 38  ? -6.773  4.600   7.441   1.00 15.00 ?  80  VAL A HG23 2  
ATOM   3936   N  N    . ARG A 1 39  ? -11.586 5.342   7.732   1.00 15.00 ?  81  ARG A N    2  
ATOM   3937   C  CA   . ARG A 1 39  ? -12.891 5.987   7.816   1.00 15.00 ?  81  ARG A CA   2  
ATOM   3938   C  C    . ARG A 1 39  ? -12.737 7.399   8.367   1.00 15.00 ?  81  ARG A C    2  
ATOM   3939   O  O    . ARG A 1 39  ? -12.515 7.592   9.562   1.00 15.00 ?  81  ARG A O    2  
ATOM   3940   C  CB   . ARG A 1 39  ? -13.831 5.154   8.698   1.00 15.00 ?  81  ARG A CB   2  
ATOM   3941   C  CG   . ARG A 1 39  ? -15.121 5.857   9.082   1.00 15.00 ?  81  ARG A CG   2  
ATOM   3942   C  CD   . ARG A 1 39  ? -16.036 4.927   9.865   1.00 15.00 ?  81  ARG A CD   2  
ATOM   3943   N  NE   . ARG A 1 39  ? -16.666 5.596   10.999  1.00 15.00 ?  81  ARG A NE   2  
ATOM   3944   C  CZ   . ARG A 1 39  ? -17.026 4.978   12.125  1.00 15.00 ?  81  ARG A CZ   2  
ATOM   3945   N  NH1  . ARG A 1 39  ? -16.815 3.673   12.272  1.00 15.00 1  81  ARG A NH1  2  
ATOM   3946   N  NH2  . ARG A 1 39  ? -17.586 5.669   13.103  1.00 15.00 ?  81  ARG A NH2  2  
ATOM   3947   H  H    . ARG A 1 39  ? -11.171 4.991   8.551   1.00 15.00 ?  81  ARG A H    2  
ATOM   3948   H  HA   . ARG A 1 39  ? -13.300 6.045   6.819   1.00 15.00 ?  81  ARG A HA   2  
ATOM   3949   H  HB2  . ARG A 1 39  ? -14.090 4.255   8.162   1.00 15.00 ?  81  ARG A HB2  2  
ATOM   3950   H  HB3  . ARG A 1 39  ? -13.310 4.884   9.603   1.00 15.00 ?  81  ARG A HB3  2  
ATOM   3951   H  HG2  . ARG A 1 39  ? -14.888 6.717   9.691   1.00 15.00 ?  81  ARG A HG2  2  
ATOM   3952   H  HG3  . ARG A 1 39  ? -15.626 6.174   8.181   1.00 15.00 ?  81  ARG A HG3  2  
ATOM   3953   H  HD2  . ARG A 1 39  ? -16.809 4.562   9.203   1.00 15.00 ?  81  ARG A HD2  2  
ATOM   3954   H  HD3  . ARG A 1 39  ? -15.455 4.094   10.231  1.00 15.00 ?  81  ARG A HD3  2  
ATOM   3955   H  HE   . ARG A 1 39  ? -16.831 6.563   10.920  1.00 15.00 ?  81  ARG A HE   2  
ATOM   3956   H  HH11 . ARG A 1 39  ? -17.092 3.189   13.157  1.00 15.00 ?  81  ARG A HH11 2  
ATOM   3957   H  HH12 . ARG A 1 39  ? -16.377 3.127   11.508  1.00 15.00 ?  81  ARG A HH12 2  
ATOM   3958   H  HH21 . ARG A 1 39  ? -17.874 5.193   13.988  1.00 15.00 ?  81  ARG A HH21 2  
ATOM   3959   H  HH22 . ARG A 1 39  ? -17.742 6.698   12.996  1.00 15.00 ?  81  ARG A HH22 2  
ATOM   3960   N  N    . ASP A 1 40  ? -12.839 8.384   7.491   1.00 15.00 ?  82  ASP A N    2  
ATOM   3961   C  CA   . ASP A 1 40  ? -12.698 9.778   7.890   1.00 15.00 ?  82  ASP A CA   2  
ATOM   3962   C  C    . ASP A 1 40  ? -14.054 10.472  7.973   1.00 15.00 ?  82  ASP A C    2  
ATOM   3963   O  O    . ASP A 1 40  ? -14.525 11.071  7.003   1.00 15.00 ?  82  ASP A O    2  
ATOM   3964   C  CB   . ASP A 1 40  ? -11.783 10.518  6.913   1.00 15.00 ?  82  ASP A CB   2  
ATOM   3965   C  CG   . ASP A 1 40  ? -11.593 11.978  7.278   1.00 15.00 ?  82  ASP A CG   2  
ATOM   3966   O  OD1  . ASP A 1 40  ? -11.566 12.297  8.485   1.00 15.00 ?  82  ASP A OD1  2  
ATOM   3967   O  OD2  . ASP A 1 40  ? -11.475 12.815  6.352   1.00 15.00 -1 82  ASP A OD2  2  
ATOM   3968   H  H    . ASP A 1 40  ? -13.014 8.170   6.546   1.00 15.00 ?  82  ASP A H    2  
ATOM   3969   H  HA   . ASP A 1 40  ? -12.245 9.791   8.872   1.00 15.00 ?  82  ASP A HA   2  
ATOM   3970   H  HB2  . ASP A 1 40  ? -10.813 10.040  6.903   1.00 15.00 ?  82  ASP A HB2  2  
ATOM   3971   H  HB3  . ASP A 1 40  ? -12.212 10.467  5.925   1.00 15.00 ?  82  ASP A HB3  2  
ATOM   3972   N  N    . GLY A 1 41  ? -14.679 10.383  9.138   1.00 15.00 ?  83  GLY A N    2  
ATOM   3973   C  CA   . GLY A 1 41  ? -15.969 11.012  9.359   1.00 15.00 ?  83  GLY A CA   2  
ATOM   3974   C  C    . GLY A 1 41  ? -17.089 10.353  8.581   1.00 15.00 ?  83  GLY A C    2  
ATOM   3975   O  O    . GLY A 1 41  ? -17.621 9.325   8.997   1.00 15.00 ?  83  GLY A O    2  
ATOM   3976   H  H    . GLY A 1 41  ? -14.257 9.877   9.863   1.00 15.00 ?  83  GLY A H    2  
ATOM   3977   H  HA2  . GLY A 1 41  ? -16.203 10.959  10.410  1.00 15.00 ?  83  GLY A HA2  2  
ATOM   3978   H  HA3  . GLY A 1 41  ? -15.910 12.050  9.068   1.00 15.00 ?  83  GLY A HA3  2  
ATOM   3979   N  N    . GLY A 1 42  ? -17.443 10.952  7.452   1.00 15.00 ?  84  GLY A N    2  
ATOM   3980   C  CA   . GLY A 1 42  ? -18.513 10.421  6.626   1.00 15.00 ?  84  GLY A CA   2  
ATOM   3981   C  C    . GLY A 1 42  ? -18.032 9.991   5.252   1.00 15.00 ?  84  GLY A C    2  
ATOM   3982   O  O    . GLY A 1 42  ? -18.824 9.875   4.316   1.00 15.00 ?  84  GLY A O    2  
ATOM   3983   H  H    . GLY A 1 42  ? -16.972 11.768  7.175   1.00 15.00 ?  84  GLY A H    2  
ATOM   3984   H  HA2  . GLY A 1 42  ? -18.949 9.568   7.126   1.00 15.00 ?  84  GLY A HA2  2  
ATOM   3985   H  HA3  . GLY A 1 42  ? -19.271 11.181  6.509   1.00 15.00 ?  84  GLY A HA3  2  
ATOM   3986   N  N    . ARG A 1 43  ? -16.736 9.755   5.136   1.00 15.00 ?  85  ARG A N    2  
ATOM   3987   C  CA   . ARG A 1 43  ? -16.146 9.330   3.875   1.00 15.00 ?  85  ARG A CA   2  
ATOM   3988   C  C    . ARG A 1 43  ? -15.095 8.255   4.121   1.00 15.00 ?  85  ARG A C    2  
ATOM   3989   O  O    . ARG A 1 43  ? -14.434 8.247   5.162   1.00 15.00 ?  85  ARG A O    2  
ATOM   3990   C  CB   . ARG A 1 43  ? -15.511 10.523  3.151   1.00 15.00 ?  85  ARG A CB   2  
ATOM   3991   C  CG   . ARG A 1 43  ? -14.373 11.158  3.930   1.00 15.00 ?  85  ARG A CG   2  
ATOM   3992   C  CD   . ARG A 1 43  ? -13.723 12.295  3.168   1.00 15.00 ?  85  ARG A CD   2  
ATOM   3993   N  NE   . ARG A 1 43  ? -12.468 12.696  3.798   1.00 15.00 ?  85  ARG A NE   2  
ATOM   3994   C  CZ   . ARG A 1 43  ? -11.410 13.153  3.141   1.00 15.00 ?  85  ARG A CZ   2  
ATOM   3995   N  NH1  . ARG A 1 43  ? -11.439 13.278  1.820   1.00 15.00 1  85  ARG A NH1  2  
ATOM   3996   N  NH2  . ARG A 1 43  ? -10.315 13.472  3.816   1.00 15.00 ?  85  ARG A NH2  2  
ATOM   3997   H  H    . ARG A 1 43  ? -16.158 9.863   5.921   1.00 15.00 ?  85  ARG A H    2  
ATOM   3998   H  HA   . ARG A 1 43  ? -16.931 8.918   3.261   1.00 15.00 ?  85  ARG A HA   2  
ATOM   3999   H  HB2  . ARG A 1 43  ? -15.127 10.188  2.200   1.00 15.00 ?  85  ARG A HB2  2  
ATOM   4000   H  HB3  . ARG A 1 43  ? -16.268 11.275  2.982   1.00 15.00 ?  85  ARG A HB3  2  
ATOM   4001   H  HG2  . ARG A 1 43  ? -14.757 11.541  4.863   1.00 15.00 ?  85  ARG A HG2  2  
ATOM   4002   H  HG3  . ARG A 1 43  ? -13.627 10.405  4.131   1.00 15.00 ?  85  ARG A HG3  2  
ATOM   4003   H  HD2  . ARG A 1 43  ? -13.527 11.970  2.157   1.00 15.00 ?  85  ARG A HD2  2  
ATOM   4004   H  HD3  . ARG A 1 43  ? -14.396 13.137  3.154   1.00 15.00 ?  85  ARG A HD3  2  
ATOM   4005   H  HE   . ARG A 1 43  ? -12.414 12.627  4.785   1.00 15.00 ?  85  ARG A HE   2  
ATOM   4006   H  HH11 . ARG A 1 43  ? -12.298 13.029  1.288   1.00 15.00 ?  85  ARG A HH11 2  
ATOM   4007   H  HH12 . ARG A 1 43  ? -10.596 13.630  1.308   1.00 15.00 ?  85  ARG A HH12 2  
ATOM   4008   H  HH21 . ARG A 1 43  ? -10.297 13.364  4.859   1.00 15.00 ?  85  ARG A HH21 2  
ATOM   4009   H  HH22 . ARG A 1 43  ? -9.475  13.835  3.319   1.00 15.00 ?  85  ARG A HH22 2  
ATOM   4010   N  N    . VAL A 1 44  ? -14.959 7.341   3.178   1.00 15.00 ?  86  VAL A N    2  
ATOM   4011   C  CA   . VAL A 1 44  ? -13.988 6.268   3.289   1.00 15.00 ?  86  VAL A CA   2  
ATOM   4012   C  C    . VAL A 1 44  ? -12.811 6.509   2.351   1.00 15.00 ?  86  VAL A C    2  
ATOM   4013   O  O    . VAL A 1 44  ? -12.986 6.941   1.210   1.00 15.00 ?  86  VAL A O    2  
ATOM   4014   C  CB   . VAL A 1 44  ? -14.630 4.895   2.979   1.00 15.00 ?  86  VAL A CB   2  
ATOM   4015   C  CG1  . VAL A 1 44  ? -13.603 3.771   3.060   1.00 15.00 ?  86  VAL A CG1  2  
ATOM   4016   C  CG2  . VAL A 1 44  ? -15.789 4.630   3.927   1.00 15.00 ?  86  VAL A CG2  2  
ATOM   4017   H  H    . VAL A 1 44  ? -15.535 7.386   2.379   1.00 15.00 ?  86  VAL A H    2  
ATOM   4018   H  HA   . VAL A 1 44  ? -13.626 6.251   4.306   1.00 15.00 ?  86  VAL A HA   2  
ATOM   4019   H  HB   . VAL A 1 44  ? -15.021 4.921   1.973   1.00 15.00 ?  86  VAL A HB   2  
ATOM   4020   H  HG11 . VAL A 1 44  ? -14.100 2.818   2.930   1.00 15.00 ?  86  VAL A HG11 2  
ATOM   4021   H  HG12 . VAL A 1 44  ? -13.117 3.795   4.024   1.00 15.00 ?  86  VAL A HG12 2  
ATOM   4022   H  HG13 . VAL A 1 44  ? -12.866 3.901   2.278   1.00 15.00 ?  86  VAL A HG13 2  
ATOM   4023   H  HG21 . VAL A 1 44  ? -16.431 3.866   3.511   1.00 15.00 ?  86  VAL A HG21 2  
ATOM   4024   H  HG22 . VAL A 1 44  ? -16.357 5.538   4.065   1.00 15.00 ?  86  VAL A HG22 2  
ATOM   4025   H  HG23 . VAL A 1 44  ? -15.406 4.296   4.880   1.00 15.00 ?  86  VAL A HG23 2  
ATOM   4026   N  N    . LEU A 1 45  ? -11.614 6.259   2.853   1.00 15.00 ?  87  LEU A N    2  
ATOM   4027   C  CA   . LEU A 1 45  ? -10.402 6.422   2.072   1.00 15.00 ?  87  LEU A CA   2  
ATOM   4028   C  C    . LEU A 1 45  ? -9.709  5.073   1.943   1.00 15.00 ?  87  LEU A C    2  
ATOM   4029   O  O    . LEU A 1 45  ? -9.431  4.414   2.947   1.00 15.00 ?  87  LEU A O    2  
ATOM   4030   C  CB   . LEU A 1 45  ? -9.475  7.440   2.734   1.00 15.00 ?  87  LEU A CB   2  
ATOM   4031   C  CG   . LEU A 1 45  ? -10.119 8.792   3.064   1.00 15.00 ?  87  LEU A CG   2  
ATOM   4032   C  CD1  . LEU A 1 45  ? -9.193  9.626   3.929   1.00 15.00 ?  87  LEU A CD1  2  
ATOM   4033   C  CD2  . LEU A 1 45  ? -10.454 9.541   1.787   1.00 15.00 ?  87  LEU A CD2  2  
ATOM   4034   H  H    . LEU A 1 45  ? -11.542 5.952   3.788   1.00 15.00 ?  87  LEU A H    2  
ATOM   4035   H  HA   . LEU A 1 45  ? -10.679 6.771   1.089   1.00 15.00 ?  87  LEU A HA   2  
ATOM   4036   H  HB2  . LEU A 1 45  ? -9.096  7.010   3.648   1.00 15.00 ?  87  LEU A HB2  2  
ATOM   4037   H  HB3  . LEU A 1 45  ? -8.646  7.617   2.066   1.00 15.00 ?  87  LEU A HB3  2  
ATOM   4038   H  HG   . LEU A 1 45  ? -11.035 8.629   3.612   1.00 15.00 ?  87  LEU A HG   2  
ATOM   4039   H  HD11 . LEU A 1 45  ? -9.683  10.556  4.187   1.00 15.00 ?  87  LEU A HD11 2  
ATOM   4040   H  HD12 . LEU A 1 45  ? -8.288  9.836   3.380   1.00 15.00 ?  87  LEU A HD12 2  
ATOM   4041   H  HD13 . LEU A 1 45  ? -8.951  9.081   4.831   1.00 15.00 ?  87  LEU A HD13 2  
ATOM   4042   H  HD21 . LEU A 1 45  ? -10.913 10.487  2.031   1.00 15.00 ?  87  LEU A HD21 2  
ATOM   4043   H  HD22 . LEU A 1 45  ? -11.136 8.950   1.192   1.00 15.00 ?  87  LEU A HD22 2  
ATOM   4044   H  HD23 . LEU A 1 45  ? -9.549  9.715   1.228   1.00 15.00 ?  87  LEU A HD23 2  
ATOM   4045   N  N    . VAL A 1 46  ? -9.443  4.653   0.716   1.00 15.00 ?  88  VAL A N    2  
ATOM   4046   C  CA   . VAL A 1 46  ? -8.816  3.360   0.483   1.00 15.00 ?  88  VAL A CA   2  
ATOM   4047   C  C    . VAL A 1 46  ? -7.375  3.517   0.005   1.00 15.00 ?  88  VAL A C    2  
ATOM   4048   O  O    . VAL A 1 46  ? -7.064  4.408   -0.783  1.00 15.00 ?  88  VAL A O    2  
ATOM   4049   C  CB   . VAL A 1 46  ? -9.606  2.536   -0.558  1.00 15.00 ?  88  VAL A CB   2  
ATOM   4050   C  CG1  . VAL A 1 46  ? -9.053  1.121   -0.666  1.00 15.00 ?  88  VAL A CG1  2  
ATOM   4051   C  CG2  . VAL A 1 46  ? -11.085 2.505   -0.208  1.00 15.00 ?  88  VAL A CG2  2  
ATOM   4052   H  H    . VAL A 1 46  ? -9.652  5.233   -0.051  1.00 15.00 ?  88  VAL A H    2  
ATOM   4053   H  HA   . VAL A 1 46  ? -8.819  2.816   1.416   1.00 15.00 ?  88  VAL A HA   2  
ATOM   4054   H  HB   . VAL A 1 46  ? -9.497  3.014   -1.520  1.00 15.00 ?  88  VAL A HB   2  
ATOM   4055   H  HG11 . VAL A 1 46  ? -9.579  0.589   -1.447  1.00 15.00 ?  88  VAL A HG11 2  
ATOM   4056   H  HG12 . VAL A 1 46  ? -9.188  0.605   0.275   1.00 15.00 ?  88  VAL A HG12 2  
ATOM   4057   H  HG13 . VAL A 1 46  ? -8.000  1.163   -0.907  1.00 15.00 ?  88  VAL A HG13 2  
ATOM   4058   H  HG21 . VAL A 1 46  ? -11.478 3.508   -0.206  1.00 15.00 ?  88  VAL A HG21 2  
ATOM   4059   H  HG22 . VAL A 1 46  ? -11.213 2.067   0.770   1.00 15.00 ?  88  VAL A HG22 2  
ATOM   4060   H  HG23 . VAL A 1 46  ? -11.614 1.914   -0.940  1.00 15.00 ?  88  VAL A HG23 2  
ATOM   4061   N  N    . VAL A 1 47  ? -6.506  2.645   0.500   1.00 15.00 ?  89  VAL A N    2  
ATOM   4062   C  CA   . VAL A 1 47  ? -5.100  2.637   0.126   1.00 15.00 ?  89  VAL A CA   2  
ATOM   4063   C  C    . VAL A 1 47  ? -4.742  1.274   -0.460  1.00 15.00 ?  89  VAL A C    2  
ATOM   4064   O  O    . VAL A 1 47  ? -4.810  0.261   0.243   1.00 15.00 ?  89  VAL A O    2  
ATOM   4065   C  CB   . VAL A 1 47  ? -4.180  2.924   1.336   1.00 15.00 ?  89  VAL A CB   2  
ATOM   4066   C  CG1  . VAL A 1 47  ? -2.722  2.999   0.901   1.00 15.00 ?  89  VAL A CG1  2  
ATOM   4067   C  CG2  . VAL A 1 47  ? -4.600  4.207   2.046   1.00 15.00 ?  89  VAL A CG2  2  
ATOM   4068   H  H    . VAL A 1 47  ? -6.825  1.971   1.144   1.00 15.00 ?  89  VAL A H    2  
ATOM   4069   H  HA   . VAL A 1 47  ? -4.939  3.400   -0.623  1.00 15.00 ?  89  VAL A HA   2  
ATOM   4070   H  HB   . VAL A 1 47  ? -4.280  2.107   2.034   1.00 15.00 ?  89  VAL A HB   2  
ATOM   4071   H  HG11 . VAL A 1 47  ? -2.505  2.176   0.235   1.00 15.00 ?  89  VAL A HG11 2  
ATOM   4072   H  HG12 . VAL A 1 47  ? -2.081  2.938   1.769   1.00 15.00 ?  89  VAL A HG12 2  
ATOM   4073   H  HG13 . VAL A 1 47  ? -2.549  3.932   0.388   1.00 15.00 ?  89  VAL A HG13 2  
ATOM   4074   H  HG21 . VAL A 1 47  ? -3.994  4.345   2.931   1.00 15.00 ?  89  VAL A HG21 2  
ATOM   4075   H  HG22 . VAL A 1 47  ? -5.638  4.136   2.327   1.00 15.00 ?  89  VAL A HG22 2  
ATOM   4076   H  HG23 . VAL A 1 47  ? -4.465  5.050   1.382   1.00 15.00 ?  89  VAL A HG23 2  
ATOM   4077   N  N    . ASP A 1 48  ? -4.394  1.274   -1.748  1.00 15.00 ?  90  ASP A N    2  
ATOM   4078   C  CA   . ASP A 1 48  ? -4.016  0.067   -2.496  1.00 15.00 ?  90  ASP A CA   2  
ATOM   4079   C  C    . ASP A 1 48  ? -5.223  -0.828  -2.781  1.00 15.00 ?  90  ASP A C    2  
ATOM   4080   O  O    . ASP A 1 48  ? -6.145  -0.943  -1.970  1.00 15.00 ?  90  ASP A O    2  
ATOM   4081   C  CB   . ASP A 1 48  ? -2.918  -0.721  -1.774  1.00 15.00 ?  90  ASP A CB   2  
ATOM   4082   C  CG   . ASP A 1 48  ? -1.523  -0.347  -2.239  1.00 15.00 ?  90  ASP A CG   2  
ATOM   4083   O  OD1  . ASP A 1 48  ? -1.385  0.292   -3.303  1.00 15.00 ?  90  ASP A OD1  2  
ATOM   4084   O  OD2  . ASP A 1 48  ? -0.548  -0.711  -1.545  1.00 15.00 -1 90  ASP A OD2  2  
ATOM   4085   H  H    . ASP A 1 48  ? -4.386  2.136   -2.224  1.00 15.00 ?  90  ASP A H    2  
ATOM   4086   H  HA   . ASP A 1 48  ? -3.626  0.399   -3.445  1.00 15.00 ?  90  ASP A HA   2  
ATOM   4087   H  HB2  . ASP A 1 48  ? -2.986  -0.526  -0.713  1.00 15.00 ?  90  ASP A HB2  2  
ATOM   4088   H  HB3  . ASP A 1 48  ? -3.068  -1.776  -1.949  1.00 15.00 ?  90  ASP A HB3  2  
ATOM   4089   N  N    . THR A 1 49  ? -5.217  -1.446  -3.957  1.00 15.00 ?  91  THR A N    2  
ATOM   4090   C  CA   . THR A 1 49  ? -6.308  -2.320  -4.372  1.00 15.00 ?  91  THR A CA   2  
ATOM   4091   C  C    . THR A 1 49  ? -5.938  -3.790  -4.183  1.00 15.00 ?  91  THR A C    2  
ATOM   4092   O  O    . THR A 1 49  ? -5.025  -4.111  -3.423  1.00 15.00 ?  91  THR A O    2  
ATOM   4093   C  CB   . THR A 1 49  ? -6.695  -2.071  -5.846  1.00 15.00 ?  91  THR A CB   2  
ATOM   4094   O  OG1  . THR A 1 49  ? -5.640  -2.481  -6.728  1.00 15.00 ?  91  THR A OG1  2  
ATOM   4095   C  CG2  . THR A 1 49  ? -7.000  -0.602  -6.079  1.00 15.00 ?  91  THR A CG2  2  
ATOM   4096   H  H    . THR A 1 49  ? -4.455  -1.316  -4.560  1.00 15.00 ?  91  THR A H    2  
ATOM   4097   H  HA   . THR A 1 49  ? -7.168  -2.094  -3.756  1.00 15.00 ?  91  THR A HA   2  
ATOM   4098   H  HB   . THR A 1 49  ? -7.582  -2.647  -6.071  1.00 15.00 ?  91  THR A HB   2  
ATOM   4099   H  HG1  . THR A 1 49  ? -4.842  -1.963  -6.542  1.00 15.00 ?  91  THR A HG1  2  
ATOM   4100   H  HG21 . THR A 1 49  ? -6.083  -0.033  -6.036  1.00 15.00 ?  91  THR A HG21 2  
ATOM   4101   H  HG22 . THR A 1 49  ? -7.680  -0.251  -5.316  1.00 15.00 ?  91  THR A HG22 2  
ATOM   4102   H  HG23 . THR A 1 49  ? -7.457  -0.478  -7.051  1.00 15.00 ?  91  THR A HG23 2  
ATOM   4103   N  N    . ALA A 1 50  ? -6.661  -4.673  -4.860  1.00 15.00 ?  92  ALA A N    2  
ATOM   4104   C  CA   . ALA A 1 50  ? -6.405  -6.102  -4.775  1.00 15.00 ?  92  ALA A CA   2  
ATOM   4105   C  C    . ALA A 1 50  ? -5.746  -6.602  -6.056  1.00 15.00 ?  92  ALA A C    2  
ATOM   4106   O  O    . ALA A 1 50  ? -5.478  -5.817  -6.965  1.00 15.00 ?  92  ALA A O    2  
ATOM   4107   C  CB   . ALA A 1 50  ? -7.698  -6.858  -4.512  1.00 15.00 ?  92  ALA A CB   2  
ATOM   4108   H  H    . ALA A 1 50  ? -7.383  -4.353  -5.442  1.00 15.00 ?  92  ALA A H    2  
ATOM   4109   H  HA   . ALA A 1 50  ? -5.739  -6.276  -3.943  1.00 15.00 ?  92  ALA A HA   2  
ATOM   4110   H  HB1  . ALA A 1 50  ? -8.458  -6.521  -5.203  1.00 15.00 ?  92  ALA A HB1  2  
ATOM   4111   H  HB2  . ALA A 1 50  ? -8.025  -6.678  -3.498  1.00 15.00 ?  92  ALA A HB2  2  
ATOM   4112   H  HB3  . ALA A 1 50  ? -7.530  -7.913  -4.653  1.00 15.00 ?  92  ALA A HB3  2  
ATOM   4113   N  N    . TRP A 1 51  ? -5.487  -7.904  -6.120  1.00 15.00 ?  93  TRP A N    2  
ATOM   4114   C  CA   . TRP A 1 51  ? -4.857  -8.503  -7.293  1.00 15.00 ?  93  TRP A CA   2  
ATOM   4115   C  C    . TRP A 1 51  ? -5.733  -8.356  -8.535  1.00 15.00 ?  93  TRP A C    2  
ATOM   4116   O  O    . TRP A 1 51  ? -5.239  -8.070  -9.629  1.00 15.00 ?  93  TRP A O    2  
ATOM   4117   C  CB   . TRP A 1 51  ? -4.580  -9.986  -7.056  1.00 15.00 ?  93  TRP A CB   2  
ATOM   4118   C  CG   . TRP A 1 51  ? -3.568  -10.266 -5.989  1.00 15.00 ?  93  TRP A CG   2  
ATOM   4119   C  CD1  . TRP A 1 51  ? -3.818  -10.515 -4.672  1.00 15.00 ?  93  TRP A CD1  2  
ATOM   4120   C  CD2  . TRP A 1 51  ? -2.148  -10.345 -6.151  1.00 15.00 ?  93  TRP A CD2  2  
ATOM   4121   N  NE1  . TRP A 1 51  ? -2.640  -10.744 -4.003  1.00 15.00 ?  93  TRP A NE1  2  
ATOM   4122   C  CE2  . TRP A 1 51  ? -1.601  -10.645 -4.891  1.00 15.00 ?  93  TRP A CE2  2  
ATOM   4123   C  CE3  . TRP A 1 51  ? -1.288  -10.192 -7.240  1.00 15.00 ?  93  TRP A CE3  2  
ATOM   4124   C  CZ2  . TRP A 1 51  ? -0.231  -10.798 -4.691  1.00 15.00 ?  93  TRP A CZ2  2  
ATOM   4125   C  CZ3  . TRP A 1 51  ? 0.072   -10.346 -7.042  1.00 15.00 ?  93  TRP A CZ3  2  
ATOM   4126   C  CH2  . TRP A 1 51  ? 0.588   -10.645 -5.776  1.00 15.00 ?  93  TRP A CH2  2  
ATOM   4127   H  H    . TRP A 1 51  ? -5.709  -8.474  -5.352  1.00 15.00 ?  93  TRP A H    2  
ATOM   4128   H  HA   . TRP A 1 51  ? -3.922  -7.992  -7.461  1.00 15.00 ?  93  TRP A HA   2  
ATOM   4129   H  HB2  . TRP A 1 51  ? -5.501  -10.471 -6.770  1.00 15.00 ?  93  TRP A HB2  2  
ATOM   4130   H  HB3  . TRP A 1 51  ? -4.223  -10.426 -7.976  1.00 15.00 ?  93  TRP A HB3  2  
ATOM   4131   H  HD1  . TRP A 1 51  ? -4.801  -10.528 -4.231  1.00 15.00 ?  93  TRP A HD1  2  
ATOM   4132   H  HE1  . TRP A 1 51  ? -2.558  -10.946 -3.043  1.00 15.00 ?  93  TRP A HE1  2  
ATOM   4133   H  HE3  . TRP A 1 51  ? -1.667  -9.958  -8.222  1.00 15.00 ?  93  TRP A HE3  2  
ATOM   4134   H  HZ2  . TRP A 1 51  ? 0.182   -11.030 -3.720  1.00 15.00 ?  93  TRP A HZ2  2  
ATOM   4135   H  HZ3  . TRP A 1 51  ? 0.752   -10.237 -7.872  1.00 15.00 ?  93  TRP A HZ3  2  
ATOM   4136   H  HH2  . TRP A 1 51  ? 1.657   -10.758 -5.667  1.00 15.00 ?  93  TRP A HH2  2  
ATOM   4137   N  N    . THR A 1 52  ? -7.030  -8.577  -8.368  1.00 15.00 ?  94  THR A N    2  
ATOM   4138   C  CA   . THR A 1 52  ? -7.969  -8.479  -9.473  1.00 15.00 ?  94  THR A CA   2  
ATOM   4139   C  C    . THR A 1 52  ? -9.074  -7.472  -9.176  1.00 15.00 ?  94  THR A C    2  
ATOM   4140   O  O    . THR A 1 52  ? -9.268  -7.057  -8.026  1.00 15.00 ?  94  THR A O    2  
ATOM   4141   C  CB   . THR A 1 52  ? -8.601  -9.849  -9.772  1.00 15.00 ?  94  THR A CB   2  
ATOM   4142   O  OG1  . THR A 1 52  ? -9.011  -10.468 -8.549  1.00 15.00 ?  94  THR A OG1  2  
ATOM   4143   C  CG2  . THR A 1 52  ? -7.618  -10.762 -10.486 1.00 15.00 ?  94  THR A CG2  2  
ATOM   4144   H  H    . THR A 1 52  ? -7.363  -8.814  -7.479  1.00 15.00 ?  94  THR A H    2  
ATOM   4145   H  HA   . THR A 1 52  ? -7.430  -8.158  -10.351 1.00 15.00 ?  94  THR A HA   2  
ATOM   4146   H  HB   . THR A 1 52  ? -9.467  -9.704  -10.405 1.00 15.00 ?  94  THR A HB   2  
ATOM   4147   H  HG1  . THR A 1 52  ? -8.352  -11.118 -8.287  1.00 15.00 ?  94  THR A HG1  2  
ATOM   4148   H  HG21 . THR A 1 52  ? -6.639  -10.649 -10.042 1.00 15.00 ?  94  THR A HG21 2  
ATOM   4149   H  HG22 . THR A 1 52  ? -7.572  -10.502 -11.531 1.00 15.00 ?  94  THR A HG22 2  
ATOM   4150   H  HG23 . THR A 1 52  ? -7.942  -11.787 -10.384 1.00 15.00 ?  94  THR A HG23 2  
ATOM   4151   N  N    . ASP A 1 53  ? -9.795  -7.087  -10.221 1.00 15.00 ?  95  ASP A N    2  
ATOM   4152   C  CA   . ASP A 1 53  ? -10.892 -6.132  -10.102 1.00 15.00 ?  95  ASP A CA   2  
ATOM   4153   C  C    . ASP A 1 53  ? -12.004 -6.705  -9.242  1.00 15.00 ?  95  ASP A C    2  
ATOM   4154   O  O    . ASP A 1 53  ? -12.531 -6.031  -8.360  1.00 15.00 ?  95  ASP A O    2  
ATOM   4155   C  CB   . ASP A 1 53  ? -11.455 -5.766  -11.482 1.00 15.00 ?  95  ASP A CB   2  
ATOM   4156   C  CG   . ASP A 1 53  ? -10.553 -4.824  -12.253 1.00 15.00 ?  95  ASP A CG   2  
ATOM   4157   O  OD1  . ASP A 1 53  ? -10.336 -3.681  -11.789 1.00 15.00 ?  95  ASP A OD1  2  
ATOM   4158   O  OD2  . ASP A 1 53  ? -10.059 -5.222  -13.329 1.00 15.00 -1 95  ASP A OD2  2  
ATOM   4159   H  H    . ASP A 1 53  ? -9.577  -7.452  -11.106 1.00 15.00 ?  95  ASP A H    2  
ATOM   4160   H  HA   . ASP A 1 53  ? -10.509 -5.241  -9.629  1.00 15.00 ?  95  ASP A HA   2  
ATOM   4161   H  HB2  . ASP A 1 53  ? -11.581 -6.666  -12.063 1.00 15.00 ?  95  ASP A HB2  2  
ATOM   4162   H  HB3  . ASP A 1 53  ? -12.416 -5.289  -11.356 1.00 15.00 ?  95  ASP A HB3  2  
ATOM   4163   N  N    . ASP A 1 54  ? -12.329 -7.970  -9.485  1.00 15.00 ?  96  ASP A N    2  
ATOM   4164   C  CA   . ASP A 1 54  ? -13.391 -8.650  -8.746  1.00 15.00 ?  96  ASP A CA   2  
ATOM   4165   C  C    . ASP A 1 54  ? -13.068 -8.705  -7.258  1.00 15.00 ?  96  ASP A C    2  
ATOM   4166   O  O    . ASP A 1 54  ? -13.938 -8.481  -6.416  1.00 15.00 ?  96  ASP A O    2  
ATOM   4167   C  CB   . ASP A 1 54  ? -13.612 -10.060 -9.291  1.00 15.00 ?  96  ASP A CB   2  
ATOM   4168   C  CG   . ASP A 1 54  ? -15.071 -10.466 -9.254  1.00 15.00 ?  96  ASP A CG   2  
ATOM   4169   O  OD1  . ASP A 1 54  ? -15.863 -9.916  -10.047 1.00 15.00 ?  96  ASP A OD1  2  
ATOM   4170   O  OD2  . ASP A 1 54  ? -15.431 -11.345 -8.447  1.00 15.00 -1 96  ASP A OD2  2  
ATOM   4171   H  H    . ASP A 1 54  ? -11.845 -8.459  -10.185 1.00 15.00 ?  96  ASP A H    2  
ATOM   4172   H  HA   . ASP A 1 54  ? -14.297 -8.078  -8.881  1.00 15.00 ?  96  ASP A HA   2  
ATOM   4173   H  HB2  . ASP A 1 54  ? -13.273 -10.104 -10.317 1.00 15.00 ?  96  ASP A HB2  2  
ATOM   4174   H  HB3  . ASP A 1 54  ? -13.046 -10.762 -8.701  1.00 15.00 ?  96  ASP A HB3  2  
ATOM   4175   N  N    . GLN A 1 55  ? -11.810 -8.988  -6.938  1.00 15.00 ?  97  GLN A N    2  
ATOM   4176   C  CA   . GLN A 1 55  ? -11.380 -9.050  -5.545  1.00 15.00 ?  97  GLN A CA   2  
ATOM   4177   C  C    . GLN A 1 55  ? -11.465 -7.667  -4.907  1.00 15.00 ?  97  GLN A C    2  
ATOM   4178   O  O    . GLN A 1 55  ? -11.715 -7.535  -3.710  1.00 15.00 ?  97  GLN A O    2  
ATOM   4179   C  CB   . GLN A 1 55  ? -9.954  -9.589  -5.447  1.00 15.00 ?  97  GLN A CB   2  
ATOM   4180   C  CG   . GLN A 1 55  ? -9.860  -11.102 -5.548  1.00 15.00 ?  97  GLN A CG   2  
ATOM   4181   C  CD   . GLN A 1 55  ? -8.440  -11.601 -5.391  1.00 15.00 ?  97  GLN A CD   2  
ATOM   4182   O  OE1  . GLN A 1 55  ? -7.487  -10.893 -5.711  1.00 15.00 ?  97  GLN A OE1  2  
ATOM   4183   N  NE2  . GLN A 1 55  ? -8.288  -12.831 -4.922  1.00 15.00 ?  97  GLN A NE2  2  
ATOM   4184   H  H    . GLN A 1 55  ? -11.159 -9.160  -7.652  1.00 15.00 ?  97  GLN A H    2  
ATOM   4185   H  HA   . GLN A 1 55  ? -12.046 -9.716  -5.020  1.00 15.00 ?  97  GLN A HA   2  
ATOM   4186   H  HB2  . GLN A 1 55  ? -9.366  -9.162  -6.247  1.00 15.00 ?  97  GLN A HB2  2  
ATOM   4187   H  HB3  . GLN A 1 55  ? -9.529  -9.286  -4.501  1.00 15.00 ?  97  GLN A HB3  2  
ATOM   4188   H  HG2  . GLN A 1 55  ? -10.468 -11.541 -4.774  1.00 15.00 ?  97  GLN A HG2  2  
ATOM   4189   H  HG3  . GLN A 1 55  ? -10.228 -11.411 -6.514  1.00 15.00 ?  97  GLN A HG3  2  
ATOM   4190   H  HE21 . GLN A 1 55  ? -9.092  -13.349 -4.706  1.00 15.00 ?  97  GLN A HE21 2  
ATOM   4191   H  HE22 . GLN A 1 55  ? -7.373  -13.179 -4.814  1.00 15.00 ?  97  GLN A HE22 2  
ATOM   4192   N  N    . THR A 1 56  ? -11.270 -6.641  -5.721  1.00 15.00 ?  98  THR A N    2  
ATOM   4193   C  CA   . THR A 1 56  ? -11.337 -5.269  -5.242  1.00 15.00 ?  98  THR A CA   2  
ATOM   4194   C  C    . THR A 1 56  ? -12.791 -4.862  -5.017  1.00 15.00 ?  98  THR A C    2  
ATOM   4195   O  O    . THR A 1 56  ? -13.103 -4.097  -4.104  1.00 15.00 ?  98  THR A O    2  
ATOM   4196   C  CB   . THR A 1 56  ? -10.650 -4.306  -6.229  1.00 15.00 ?  98  THR A CB   2  
ATOM   4197   O  OG1  . THR A 1 56  ? -9.308  -4.749  -6.477  1.00 15.00 ?  98  THR A OG1  2  
ATOM   4198   C  CG2  . THR A 1 56  ? -10.615 -2.887  -5.682  1.00 15.00 ?  98  THR A CG2  2  
ATOM   4199   H  H    . THR A 1 56  ? -11.078 -6.809  -6.669  1.00 15.00 ?  98  THR A H    2  
ATOM   4200   H  HA   . THR A 1 56  ? -10.808 -5.220  -4.300  1.00 15.00 ?  98  THR A HA   2  
ATOM   4201   H  HB   . THR A 1 56  ? -11.199 -4.306  -7.157  1.00 15.00 ?  98  THR A HB   2  
ATOM   4202   H  HG1  . THR A 1 56  ? -9.323  -5.496  -7.093  1.00 15.00 ?  98  THR A HG1  2  
ATOM   4203   H  HG21 . THR A 1 56  ? -11.616 -2.486  -5.659  1.00 15.00 ?  98  THR A HG21 2  
ATOM   4204   H  HG22 . THR A 1 56  ? -9.993  -2.275  -6.315  1.00 15.00 ?  98  THR A HG22 2  
ATOM   4205   H  HG23 . THR A 1 56  ? -10.209 -2.896  -4.680  1.00 15.00 ?  98  THR A HG23 2  
ATOM   4206   N  N    . ALA A 1 57  ? -13.681 -5.407  -5.839  1.00 15.00 ?  99  ALA A N    2  
ATOM   4207   C  CA   . ALA A 1 57  ? -15.105 -5.121  -5.720  1.00 15.00 ?  99  ALA A CA   2  
ATOM   4208   C  C    . ALA A 1 57  ? -15.634 -5.647  -4.391  1.00 15.00 ?  99  ALA A C    2  
ATOM   4209   O  O    . ALA A 1 57  ? -16.545 -5.067  -3.796  1.00 15.00 ?  99  ALA A O    2  
ATOM   4210   C  CB   . ALA A 1 57  ? -15.877 -5.735  -6.879  1.00 15.00 ?  99  ALA A CB   2  
ATOM   4211   H  H    . ALA A 1 57  ? -13.370 -6.013  -6.549  1.00 15.00 ?  99  ALA A H    2  
ATOM   4212   H  HA   . ALA A 1 57  ? -15.232 -4.048  -5.755  1.00 15.00 ?  99  ALA A HA   2  
ATOM   4213   H  HB1  . ALA A 1 57  ? -15.470 -5.382  -7.817  1.00 15.00 ?  99  ALA A HB1  2  
ATOM   4214   H  HB2  . ALA A 1 57  ? -16.917 -5.447  -6.808  1.00 15.00 ?  99  ALA A HB2  2  
ATOM   4215   H  HB3  . ALA A 1 57  ? -15.798 -6.811  -6.834  1.00 15.00 ?  99  ALA A HB3  2  
ATOM   4216   N  N    . GLN A 1 58  ? -15.051 -6.753  -3.932  1.00 15.00 ?  100 GLN A N    2  
ATOM   4217   C  CA   . GLN A 1 58  ? -15.435 -7.356  -2.660  1.00 15.00 ?  100 GLN A CA   2  
ATOM   4218   C  C    . GLN A 1 58  ? -15.189 -6.373  -1.521  1.00 15.00 ?  100 GLN A C    2  
ATOM   4219   O  O    . GLN A 1 58  ? -15.985 -6.266  -0.586  1.00 15.00 ?  100 GLN A O    2  
ATOM   4220   C  CB   . GLN A 1 58  ? -14.645 -8.641  -2.413  1.00 15.00 ?  100 GLN A CB   2  
ATOM   4221   C  CG   . GLN A 1 58  ? -15.075 -9.798  -3.295  1.00 15.00 ?  100 GLN A CG   2  
ATOM   4222   C  CD   . GLN A 1 58  ? -14.368 -11.095 -2.950  1.00 15.00 ?  100 GLN A CD   2  
ATOM   4223   O  OE1  . GLN A 1 58  ? -13.962 -11.317 -1.810  1.00 15.00 ?  100 GLN A OE1  2  
ATOM   4224   N  NE2  . GLN A 1 58  ? -14.223 -11.962 -3.936  1.00 15.00 ?  100 GLN A NE2  2  
ATOM   4225   H  H    . GLN A 1 58  ? -14.350 -7.179  -4.471  1.00 15.00 ?  100 GLN A H    2  
ATOM   4226   H  HA   . GLN A 1 58  ? -16.489 -7.586  -2.703  1.00 15.00 ?  100 GLN A HA   2  
ATOM   4227   H  HB2  . GLN A 1 58  ? -13.598 -8.447  -2.597  1.00 15.00 ?  100 GLN A HB2  2  
ATOM   4228   H  HB3  . GLN A 1 58  ? -14.771 -8.935  -1.381  1.00 15.00 ?  100 GLN A HB3  2  
ATOM   4229   H  HG2  . GLN A 1 58  ? -16.139 -9.946  -3.179  1.00 15.00 ?  100 GLN A HG2  2  
ATOM   4230   H  HG3  . GLN A 1 58  ? -14.859 -9.550  -4.323  1.00 15.00 ?  100 GLN A HG3  2  
ATOM   4231   H  HE21 . GLN A 1 58  ? -14.574 -11.718 -4.819  1.00 15.00 ?  100 GLN A HE21 2  
ATOM   4232   H  HE22 . GLN A 1 58  ? -13.784 -12.823 -3.741  1.00 15.00 ?  100 GLN A HE22 2  
ATOM   4233   N  N    . ILE A 1 59  ? -14.075 -5.652  -1.619  1.00 15.00 ?  101 ILE A N    2  
ATOM   4234   C  CA   . ILE A 1 59  ? -13.702 -4.653  -0.625  1.00 15.00 ?  101 ILE A CA   2  
ATOM   4235   C  C    . ILE A 1 59  ? -14.763 -3.566  -0.541  1.00 15.00 ?  101 ILE A C    2  
ATOM   4236   O  O    . ILE A 1 59  ? -15.166 -3.159  0.548   1.00 15.00 ?  101 ILE A O    2  
ATOM   4237   C  CB   . ILE A 1 59  ? -12.335 -4.011  -0.961  1.00 15.00 ?  101 ILE A CB   2  
ATOM   4238   C  CG1  . ILE A 1 59  ? -11.276 -5.095  -1.187  1.00 15.00 ?  101 ILE A CG1  2  
ATOM   4239   C  CG2  . ILE A 1 59  ? -11.899 -3.066  0.150   1.00 15.00 ?  101 ILE A CG2  2  
ATOM   4240   C  CD1  . ILE A 1 59  ? -9.961  -4.559  -1.702  1.00 15.00 ?  101 ILE A CD1  2  
ATOM   4241   H  H    . ILE A 1 59  ? -13.484 -5.801  -2.385  1.00 15.00 ?  101 ILE A H    2  
ATOM   4242   H  HA   . ILE A 1 59  ? -13.624 -5.144  0.333   1.00 15.00 ?  101 ILE A HA   2  
ATOM   4243   H  HB   . ILE A 1 59  ? -12.444 -3.431  -1.867  1.00 15.00 ?  101 ILE A HB   2  
ATOM   4244   H  HG12 . ILE A 1 59  ? -11.083 -5.601  -0.255  1.00 15.00 ?  101 ILE A HG12 2  
ATOM   4245   H  HG13 . ILE A 1 59  ? -11.649 -5.808  -1.909  1.00 15.00 ?  101 ILE A HG13 2  
ATOM   4246   H  HG21 . ILE A 1 59  ? -12.713 -2.395  0.392   1.00 15.00 ?  101 ILE A HG21 2  
ATOM   4247   H  HG22 . ILE A 1 59  ? -11.043 -2.491  -0.180  1.00 15.00 ?  101 ILE A HG22 2  
ATOM   4248   H  HG23 . ILE A 1 59  ? -11.633 -3.639  1.025   1.00 15.00 ?  101 ILE A HG23 2  
ATOM   4249   H  HD11 . ILE A 1 59  ? -9.252  -5.368  -1.792  1.00 15.00 ?  101 ILE A HD11 2  
ATOM   4250   H  HD12 . ILE A 1 59  ? -9.581  -3.822  -1.012  1.00 15.00 ?  101 ILE A HD12 2  
ATOM   4251   H  HD13 . ILE A 1 59  ? -10.112 -4.101  -2.668  1.00 15.00 ?  101 ILE A HD13 2  
ATOM   4252   N  N    . LEU A 1 60  ? -15.241 -3.130  -1.699  1.00 15.00 ?  102 LEU A N    2  
ATOM   4253   C  CA   . LEU A 1 60  ? -16.258 -2.092  -1.768  1.00 15.00 ?  102 LEU A CA   2  
ATOM   4254   C  C    . LEU A 1 60  ? -17.548 -2.564  -1.110  1.00 15.00 ?  102 LEU A C    2  
ATOM   4255   O  O    . LEU A 1 60  ? -18.256 -1.782  -0.472  1.00 15.00 ?  102 LEU A O    2  
ATOM   4256   C  CB   . LEU A 1 60  ? -16.528 -1.712  -3.223  1.00 15.00 ?  102 LEU A CB   2  
ATOM   4257   C  CG   . LEU A 1 60  ? -15.281 -1.448  -4.073  1.00 15.00 ?  102 LEU A CG   2  
ATOM   4258   C  CD1  . LEU A 1 60  ? -15.676 -1.024  -5.478  1.00 15.00 ?  102 LEU A CD1  2  
ATOM   4259   C  CD2  . LEU A 1 60  ? -14.397 -0.392  -3.425  1.00 15.00 ?  102 LEU A CD2  2  
ATOM   4260   H  H    . LEU A 1 60  ? -14.903 -3.525  -2.533  1.00 15.00 ?  102 LEU A H    2  
ATOM   4261   H  HA   . LEU A 1 60  ? -15.890 -1.226  -1.238  1.00 15.00 ?  102 LEU A HA   2  
ATOM   4262   H  HB2  . LEU A 1 60  ? -17.087 -2.513  -3.681  1.00 15.00 ?  102 LEU A HB2  2  
ATOM   4263   H  HB3  . LEU A 1 60  ? -17.136 -0.820  -3.231  1.00 15.00 ?  102 LEU A HB3  2  
ATOM   4264   H  HG   . LEU A 1 60  ? -14.707 -2.360  -4.152  1.00 15.00 ?  102 LEU A HG   2  
ATOM   4265   H  HD11 . LEU A 1 60  ? -16.186 -1.837  -5.973  1.00 15.00 ?  102 LEU A HD11 2  
ATOM   4266   H  HD12 . LEU A 1 60  ? -14.788 -0.760  -6.036  1.00 15.00 ?  102 LEU A HD12 2  
ATOM   4267   H  HD13 . LEU A 1 60  ? -16.333 -0.170  -5.422  1.00 15.00 ?  102 LEU A HD13 2  
ATOM   4268   H  HD21 . LEU A 1 60  ? -13.568 -0.167  -4.080  1.00 15.00 ?  102 LEU A HD21 2  
ATOM   4269   H  HD22 . LEU A 1 60  ? -14.025 -0.766  -2.484  1.00 15.00 ?  102 LEU A HD22 2  
ATOM   4270   H  HD23 . LEU A 1 60  ? -14.976 0.504   -3.254  1.00 15.00 ?  102 LEU A HD23 2  
ATOM   4271   N  N    . ASN A 1 61  ? -17.846 -3.848  -1.266  1.00 15.00 ?  103 ASN A N    2  
ATOM   4272   C  CA   . ASN A 1 61  ? -19.042 -4.430  -0.678  1.00 15.00 ?  103 ASN A CA   2  
ATOM   4273   C  C    . ASN A 1 61  ? -18.906 -4.494  0.836   1.00 15.00 ?  103 ASN A C    2  
ATOM   4274   O  O    . ASN A 1 61  ? -19.854 -4.207  1.566   1.00 15.00 ?  103 ASN A O    2  
ATOM   4275   C  CB   . ASN A 1 61  ? -19.308 -5.821  -1.258  1.00 15.00 ?  103 ASN A CB   2  
ATOM   4276   C  CG   . ASN A 1 61  ? -19.963 -5.752  -2.626  1.00 15.00 ?  103 ASN A CG   2  
ATOM   4277   O  OD1  . ASN A 1 61  ? -20.724 -4.825  -2.914  1.00 15.00 ?  103 ASN A OD1  2  
ATOM   4278   N  ND2  . ASN A 1 61  ? -19.677 -6.721  -3.479  1.00 15.00 ?  103 ASN A ND2  2  
ATOM   4279   H  H    . ASN A 1 61  ? -17.243 -4.418  -1.792  1.00 15.00 ?  103 ASN A H    2  
ATOM   4280   H  HA   . ASN A 1 61  ? -19.873 -3.785  -0.925  1.00 15.00 ?  103 ASN A HA   2  
ATOM   4281   H  HB2  . ASN A 1 61  ? -18.371 -6.353  -1.351  1.00 15.00 ?  103 ASN A HB2  2  
ATOM   4282   H  HB3  . ASN A 1 61  ? -19.963 -6.362  -0.592  1.00 15.00 ?  103 ASN A HB3  2  
ATOM   4283   H  HD21 . ASN A 1 61  ? -19.066 -7.433  -3.187  1.00 15.00 ?  103 ASN A HD21 2  
ATOM   4284   H  HD22 . ASN A 1 61  ? -20.084 -6.686  -4.370  1.00 15.00 ?  103 ASN A HD22 2  
ATOM   4285   N  N    . TRP A 1 62  ? -17.717 -4.858  1.304   1.00 15.00 ?  104 TRP A N    2  
ATOM   4286   C  CA   . TRP A 1 62  ? -17.452 -4.931  2.733   1.00 15.00 ?  104 TRP A CA   2  
ATOM   4287   C  C    . TRP A 1 62  ? -17.599 -3.539  3.341   1.00 15.00 ?  104 TRP A C    2  
ATOM   4288   O  O    . TRP A 1 62  ? -18.202 -3.367  4.397   1.00 15.00 ?  104 TRP A O    2  
ATOM   4289   C  CB   . TRP A 1 62  ? -16.042 -5.477  2.981   1.00 15.00 ?  104 TRP A CB   2  
ATOM   4290   C  CG   . TRP A 1 62  ? -15.726 -5.732  4.428   1.00 15.00 ?  104 TRP A CG   2  
ATOM   4291   C  CD1  . TRP A 1 62  ? -15.980 -6.875  5.130   1.00 15.00 ?  104 TRP A CD1  2  
ATOM   4292   C  CD2  . TRP A 1 62  ? -15.096 -4.831  5.346   1.00 15.00 ?  104 TRP A CD2  2  
ATOM   4293   N  NE1  . TRP A 1 62  ? -15.546 -6.738  6.427   1.00 15.00 ?  104 TRP A NE1  2  
ATOM   4294   C  CE2  . TRP A 1 62  ? -15.004 -5.492  6.584   1.00 15.00 ?  104 TRP A CE2  2  
ATOM   4295   C  CE3  . TRP A 1 62  ? -14.603 -3.526  5.242   1.00 15.00 ?  104 TRP A CE3  2  
ATOM   4296   C  CZ2  . TRP A 1 62  ? -14.438 -4.895  7.707   1.00 15.00 ?  104 TRP A CZ2  2  
ATOM   4297   C  CZ3  . TRP A 1 62  ? -14.044 -2.937  6.358   1.00 15.00 ?  104 TRP A CZ3  2  
ATOM   4298   C  CH2  . TRP A 1 62  ? -13.967 -3.620  7.575   1.00 15.00 ?  104 TRP A CH2  2  
ATOM   4299   H  H    . TRP A 1 62  ? -17.001 -5.088  0.670   1.00 15.00 ?  104 TRP A H    2  
ATOM   4300   H  HA   . TRP A 1 62  ? -18.179 -5.594  3.181   1.00 15.00 ?  104 TRP A HA   2  
ATOM   4301   H  HB2  . TRP A 1 62  ? -15.928 -6.411  2.450   1.00 15.00 ?  104 TRP A HB2  2  
ATOM   4302   H  HB3  . TRP A 1 62  ? -15.322 -4.766  2.606   1.00 15.00 ?  104 TRP A HB3  2  
ATOM   4303   H  HD1  . TRP A 1 62  ? -16.451 -7.754  4.712   1.00 15.00 ?  104 TRP A HD1  2  
ATOM   4304   H  HE1  . TRP A 1 62  ? -15.616 -7.426  7.130   1.00 15.00 ?  104 TRP A HE1  2  
ATOM   4305   H  HE3  . TRP A 1 62  ? -14.652 -2.982  4.310   1.00 15.00 ?  104 TRP A HE3  2  
ATOM   4306   H  HZ2  . TRP A 1 62  ? -14.370 -5.408  8.656   1.00 15.00 ?  104 TRP A HZ2  2  
ATOM   4307   H  HZ3  . TRP A 1 62  ? -13.659 -1.928  6.296   1.00 15.00 ?  104 TRP A HZ3  2  
ATOM   4308   H  HH2  . TRP A 1 62  ? -13.523 -3.117  8.421   1.00 15.00 ?  104 TRP A HH2  2  
ATOM   4309   N  N    . ILE A 1 63  ? -17.048 -2.549  2.645   1.00 15.00 ?  105 ILE A N    2  
ATOM   4310   C  CA   . ILE A 1 63  ? -17.117 -1.162  3.084   1.00 15.00 ?  105 ILE A CA   2  
ATOM   4311   C  C    . ILE A 1 63  ? -18.567 -0.687  3.169   1.00 15.00 ?  105 ILE A C    2  
ATOM   4312   O  O    . ILE A 1 63  ? -18.973 -0.066  4.148   1.00 15.00 ?  105 ILE A O    2  
ATOM   4313   C  CB   . ILE A 1 63  ? -16.329 -0.235  2.128   1.00 15.00 ?  105 ILE A CB   2  
ATOM   4314   C  CG1  . ILE A 1 63  ? -14.826 -0.502  2.249   1.00 15.00 ?  105 ILE A CG1  2  
ATOM   4315   C  CG2  . ILE A 1 63  ? -16.636 1.231   2.412   1.00 15.00 ?  105 ILE A CG2  2  
ATOM   4316   C  CD1  . ILE A 1 63  ? -13.997 0.165   1.170   1.00 15.00 ?  105 ILE A CD1  2  
ATOM   4317   H  H    . ILE A 1 63  ? -16.570 -2.764  1.811   1.00 15.00 ?  105 ILE A H    2  
ATOM   4318   H  HA   . ILE A 1 63  ? -16.670 -1.101  4.064   1.00 15.00 ?  105 ILE A HA   2  
ATOM   4319   H  HB   . ILE A 1 63  ? -16.644 -0.450  1.117   1.00 15.00 ?  105 ILE A HB   2  
ATOM   4320   H  HG12 . ILE A 1 63  ? -14.479 -0.138  3.202   1.00 15.00 ?  105 ILE A HG12 2  
ATOM   4321   H  HG13 . ILE A 1 63  ? -14.652 -1.567  2.190   1.00 15.00 ?  105 ILE A HG13 2  
ATOM   4322   H  HG21 . ILE A 1 63  ? -16.585 1.409   3.476   1.00 15.00 ?  105 ILE A HG21 2  
ATOM   4323   H  HG22 . ILE A 1 63  ? -17.626 1.468   2.053   1.00 15.00 ?  105 ILE A HG22 2  
ATOM   4324   H  HG23 . ILE A 1 63  ? -15.911 1.854   1.906   1.00 15.00 ?  105 ILE A HG23 2  
ATOM   4325   H  HD11 . ILE A 1 63  ? -12.947 0.018   1.382   1.00 15.00 ?  105 ILE A HD11 2  
ATOM   4326   H  HD12 . ILE A 1 63  ? -14.212 1.221   1.149   1.00 15.00 ?  105 ILE A HD12 2  
ATOM   4327   H  HD13 . ILE A 1 63  ? -14.235 -0.270  0.210   1.00 15.00 ?  105 ILE A HD13 2  
ATOM   4328   N  N    . LYS A 1 64  ? -19.344 -0.998  2.141   1.00 15.00 ?  106 LYS A N    2  
ATOM   4329   C  CA   . LYS A 1 64  ? -20.746 -0.599  2.082   1.00 15.00 ?  106 LYS A CA   2  
ATOM   4330   C  C    . LYS A 1 64  ? -21.566 -1.278  3.179   1.00 15.00 ?  106 LYS A C    2  
ATOM   4331   O  O    . LYS A 1 64  ? -22.518 -0.701  3.705   1.00 15.00 ?  106 LYS A O    2  
ATOM   4332   C  CB   . LYS A 1 64  ? -21.323 -0.939  0.705   1.00 15.00 ?  106 LYS A CB   2  
ATOM   4333   C  CG   . LYS A 1 64  ? -22.694 -0.335  0.446   1.00 15.00 ?  106 LYS A CG   2  
ATOM   4334   C  CD   . LYS A 1 64  ? -22.613 1.166   0.204   1.00 15.00 ?  106 LYS A CD   2  
ATOM   4335   C  CE   . LYS A 1 64  ? -23.177 1.955   1.375   1.00 15.00 ?  106 LYS A CE   2  
ATOM   4336   N  NZ   . LYS A 1 64  ? -24.662 1.896   1.429   1.00 15.00 1  106 LYS A NZ   2  
ATOM   4337   H  H    . LYS A 1 64  ? -18.962 -1.508  1.392   1.00 15.00 ?  106 LYS A H    2  
ATOM   4338   H  HA   . LYS A 1 64  ? -20.794 0.469   2.225   1.00 15.00 ?  106 LYS A HA   2  
ATOM   4339   H  HB2  . LYS A 1 64  ? -20.644 -0.575  -0.055  1.00 15.00 ?  106 LYS A HB2  2  
ATOM   4340   H  HB3  . LYS A 1 64  ? -21.405 -2.012  0.616   1.00 15.00 ?  106 LYS A HB3  2  
ATOM   4341   H  HG2  . LYS A 1 64  ? -23.128 -0.808  -0.422  1.00 15.00 ?  106 LYS A HG2  2  
ATOM   4342   H  HG3  . LYS A 1 64  ? -23.319 -0.518  1.307   1.00 15.00 ?  106 LYS A HG3  2  
ATOM   4343   H  HD2  . LYS A 1 64  ? -21.577 1.443   0.063   1.00 15.00 ?  106 LYS A HD2  2  
ATOM   4344   H  HD3  . LYS A 1 64  ? -23.175 1.408   -0.687  1.00 15.00 ?  106 LYS A HD3  2  
ATOM   4345   H  HE2  . LYS A 1 64  ? -22.777 1.545   2.291   1.00 15.00 ?  106 LYS A HE2  2  
ATOM   4346   H  HE3  . LYS A 1 64  ? -22.869 2.986   1.278   1.00 15.00 ?  106 LYS A HE3  2  
ATOM   4347   H  HZ1  . LYS A 1 64  ? -24.989 0.919   1.273   1.00 15.00 ?  106 LYS A HZ1  2  
ATOM   4348   H  HZ2  . LYS A 1 64  ? -25.071 2.510   0.693   1.00 15.00 ?  106 LYS A HZ2  2  
ATOM   4349   H  HZ3  . LYS A 1 64  ? -25.003 2.217   2.360   1.00 15.00 ?  106 LYS A HZ3  2  
ATOM   4350   N  N    . GLN A 1 65  ? -21.183 -2.489  3.529   1.00 15.00 ?  107 GLN A N    2  
ATOM   4351   C  CA   . GLN A 1 65  ? -21.898 -3.246  4.542   1.00 15.00 ?  107 GLN A CA   2  
ATOM   4352   C  C    . GLN A 1 65  ? -21.494 -2.838  5.959   1.00 15.00 ?  107 GLN A C    2  
ATOM   4353   O  O    . GLN A 1 65  ? -22.337 -2.438  6.760   1.00 15.00 ?  107 GLN A O    2  
ATOM   4354   C  CB   . GLN A 1 65  ? -21.643 -4.739  4.349   1.00 15.00 ?  107 GLN A CB   2  
ATOM   4355   C  CG   . GLN A 1 65  ? -22.565 -5.627  5.168   1.00 15.00 ?  107 GLN A CG   2  
ATOM   4356   C  CD   . GLN A 1 65  ? -22.227 -7.099  5.030   1.00 15.00 ?  107 GLN A CD   2  
ATOM   4357   O  OE1  . GLN A 1 65  ? -22.737 -7.784  4.142   1.00 15.00 ?  107 GLN A OE1  2  
ATOM   4358   N  NE2  . GLN A 1 65  ? -21.368 -7.598  5.905   1.00 15.00 ?  107 GLN A NE2  2  
ATOM   4359   H  H    . GLN A 1 65  ? -20.405 -2.893  3.086   1.00 15.00 ?  107 GLN A H    2  
ATOM   4360   H  HA   . GLN A 1 65  ? -22.953 -3.056  4.413   1.00 15.00 ?  107 GLN A HA   2  
ATOM   4361   H  HB2  . GLN A 1 65  ? -21.774 -4.984  3.305   1.00 15.00 ?  107 GLN A HB2  2  
ATOM   4362   H  HB3  . GLN A 1 65  ? -20.625 -4.957  4.636   1.00 15.00 ?  107 GLN A HB3  2  
ATOM   4363   H  HG2  . GLN A 1 65  ? -22.481 -5.349  6.207   1.00 15.00 ?  107 GLN A HG2  2  
ATOM   4364   H  HG3  . GLN A 1 65  ? -23.581 -5.475  4.835   1.00 15.00 ?  107 GLN A HG3  2  
ATOM   4365   H  HE21 . GLN A 1 65  ? -20.993 -6.992  6.592   1.00 15.00 ?  107 GLN A HE21 2  
ATOM   4366   H  HE22 . GLN A 1 65  ? -21.142 -8.547  5.842   1.00 15.00 ?  107 GLN A HE22 2  
ATOM   4367   N  N    . GLU A 1 66  ? -20.205 -2.920  6.252   1.00 15.00 ?  108 GLU A N    2  
ATOM   4368   C  CA   . GLU A 1 66  ? -19.700 -2.615  7.586   1.00 15.00 ?  108 GLU A CA   2  
ATOM   4369   C  C    . GLU A 1 66  ? -19.630 -1.116  7.876   1.00 15.00 ?  108 GLU A C    2  
ATOM   4370   O  O    . GLU A 1 66  ? -20.102 -0.659  8.915   1.00 15.00 ?  108 GLU A O    2  
ATOM   4371   C  CB   . GLU A 1 66  ? -18.316 -3.237  7.779   1.00 15.00 ?  108 GLU A CB   2  
ATOM   4372   C  CG   . GLU A 1 66  ? -18.260 -4.720  7.447   1.00 15.00 ?  108 GLU A CG   2  
ATOM   4373   C  CD   . GLU A 1 66  ? -19.126 -5.559  8.363   1.00 15.00 ?  108 GLU A CD   2  
ATOM   4374   O  OE1  . GLU A 1 66  ? -18.857 -5.592  9.582   1.00 15.00 ?  108 GLU A OE1  2  
ATOM   4375   O  OE2  . GLU A 1 66  ? -20.083 -6.193  7.867   1.00 15.00 -1 108 GLU A OE2  2  
ATOM   4376   H  H    . GLU A 1 66  ? -19.569 -3.202  5.552   1.00 15.00 ?  108 GLU A H    2  
ATOM   4377   H  HA   . GLU A 1 66  ? -20.375 -3.069  8.295   1.00 15.00 ?  108 GLU A HA   2  
ATOM   4378   H  HB2  . GLU A 1 66  ? -17.609 -2.720  7.148   1.00 15.00 ?  108 GLU A HB2  2  
ATOM   4379   H  HB3  . GLU A 1 66  ? -18.021 -3.114  8.809   1.00 15.00 ?  108 GLU A HB3  2  
ATOM   4380   H  HG2  . GLU A 1 66  ? -18.596 -4.860  6.431   1.00 15.00 ?  108 GLU A HG2  2  
ATOM   4381   H  HG3  . GLU A 1 66  ? -17.236 -5.055  7.535   1.00 15.00 ?  108 GLU A HG3  2  
ATOM   4382   N  N    . ILE A 1 67  ? -19.049 -0.349  6.968   1.00 15.00 ?  109 ILE A N    2  
ATOM   4383   C  CA   . ILE A 1 67  ? -18.893 1.086   7.186   1.00 15.00 ?  109 ILE A CA   2  
ATOM   4384   C  C    . ILE A 1 67  ? -20.122 1.872   6.729   1.00 15.00 ?  109 ILE A C    2  
ATOM   4385   O  O    . ILE A 1 67  ? -20.542 2.809   7.402   1.00 15.00 ?  109 ILE A O    2  
ATOM   4386   C  CB   . ILE A 1 67  ? -17.633 1.628   6.476   1.00 15.00 ?  109 ILE A CB   2  
ATOM   4387   C  CG1  . ILE A 1 67  ? -16.462 0.653   6.659   1.00 15.00 ?  109 ILE A CG1  2  
ATOM   4388   C  CG2  . ILE A 1 67  ? -17.268 3.001   7.026   1.00 15.00 ?  109 ILE A CG2  2  
ATOM   4389   C  CD1  . ILE A 1 67  ? -15.180 1.094   5.982   1.00 15.00 ?  109 ILE A CD1  2  
ATOM   4390   H  H    . ILE A 1 67  ? -18.735 -0.745  6.130   1.00 15.00 ?  109 ILE A H    2  
ATOM   4391   H  HA   . ILE A 1 67  ? -18.767 1.241   8.249   1.00 15.00 ?  109 ILE A HA   2  
ATOM   4392   H  HB   . ILE A 1 67  ? -17.852 1.731   5.425   1.00 15.00 ?  109 ILE A HB   2  
ATOM   4393   H  HG12 . ILE A 1 67  ? -16.255 0.547   7.713   1.00 15.00 ?  109 ILE A HG12 2  
ATOM   4394   H  HG13 . ILE A 1 67  ? -16.740 -0.309  6.253   1.00 15.00 ?  109 ILE A HG13 2  
ATOM   4395   H  HG21 . ILE A 1 67  ? -18.159 3.605   7.108   1.00 15.00 ?  109 ILE A HG21 2  
ATOM   4396   H  HG22 . ILE A 1 67  ? -16.570 3.480   6.363   1.00 15.00 ?  109 ILE A HG22 2  
ATOM   4397   H  HG23 . ILE A 1 67  ? -16.817 2.889   7.999   1.00 15.00 ?  109 ILE A HG23 2  
ATOM   4398   H  HD11 . ILE A 1 67  ? -15.025 2.149   6.154   1.00 15.00 ?  109 ILE A HD11 2  
ATOM   4399   H  HD12 . ILE A 1 67  ? -15.249 0.910   4.921   1.00 15.00 ?  109 ILE A HD12 2  
ATOM   4400   H  HD13 . ILE A 1 67  ? -14.348 0.538   6.387   1.00 15.00 ?  109 ILE A HD13 2  
ATOM   4401   N  N    . ASN A 1 68  ? -20.690 1.485   5.587   1.00 15.00 ?  110 ASN A N    2  
ATOM   4402   C  CA   . ASN A 1 68  ? -21.884 2.151   5.034   1.00 15.00 ?  110 ASN A CA   2  
ATOM   4403   C  C    . ASN A 1 68  ? -21.581 3.612   4.678   1.00 15.00 ?  110 ASN A C    2  
ATOM   4404   O  O    . ASN A 1 68  ? -22.444 4.487   4.760   1.00 15.00 ?  110 ASN A O    2  
ATOM   4405   C  CB   . ASN A 1 68  ? -23.067 2.060   6.019   1.00 15.00 ?  110 ASN A CB   2  
ATOM   4406   C  CG   . ASN A 1 68  ? -24.404 2.428   5.387   1.00 15.00 ?  110 ASN A CG   2  
ATOM   4407   O  OD1  . ASN A 1 68  ? -24.592 2.306   4.175   1.00 15.00 ?  110 ASN A OD1  2  
ATOM   4408   N  ND2  . ASN A 1 68  ? -25.346 2.872   6.208   1.00 15.00 ?  110 ASN A ND2  2  
ATOM   4409   H  H    . ASN A 1 68  ? -20.291 0.733   5.092   1.00 15.00 ?  110 ASN A H    2  
ATOM   4410   H  HA   . ASN A 1 68  ? -22.148 1.631   4.126   1.00 15.00 ?  110 ASN A HA   2  
ATOM   4411   H  HB2  . ASN A 1 68  ? -23.134 1.050   6.393   1.00 15.00 ?  110 ASN A HB2  2  
ATOM   4412   H  HB3  . ASN A 1 68  ? -22.886 2.731   6.846   1.00 15.00 ?  110 ASN A HB3  2  
ATOM   4413   H  HD21 . ASN A 1 68  ? -25.132 2.939   7.165   1.00 15.00 ?  110 ASN A HD21 2  
ATOM   4414   H  HD22 . ASN A 1 68  ? -26.217 3.111   5.829   1.00 15.00 ?  110 ASN A HD22 2  
ATOM   4415   N  N    . LEU A 1 69  ? -20.348 3.869   4.268   1.00 15.00 ?  111 LEU A N    2  
ATOM   4416   C  CA   . LEU A 1 69  ? -19.933 5.214   3.894   1.00 15.00 ?  111 LEU A CA   2  
ATOM   4417   C  C    . LEU A 1 69  ? -19.345 5.217   2.489   1.00 15.00 ?  111 LEU A C    2  
ATOM   4418   O  O    . LEU A 1 69  ? -18.761 4.220   2.051   1.00 15.00 ?  111 LEU A O    2  
ATOM   4419   C  CB   . LEU A 1 69  ? -18.910 5.763   4.892   1.00 15.00 ?  111 LEU A CB   2  
ATOM   4420   C  CG   . LEU A 1 69  ? -19.465 6.139   6.265   1.00 15.00 ?  111 LEU A CG   2  
ATOM   4421   C  CD1  . LEU A 1 69  ? -18.341 6.595   7.179   1.00 15.00 ?  111 LEU A CD1  2  
ATOM   4422   C  CD2  . LEU A 1 69  ? -20.516 7.228   6.133   1.00 15.00 ?  111 LEU A CD2  2  
ATOM   4423   H  H    . LEU A 1 69  ? -19.701 3.138   4.210   1.00 15.00 ?  111 LEU A H    2  
ATOM   4424   H  HA   . LEU A 1 69  ? -20.809 5.844   3.904   1.00 15.00 ?  111 LEU A HA   2  
ATOM   4425   H  HB2  . LEU A 1 69  ? -18.142 5.016   5.031   1.00 15.00 ?  111 LEU A HB2  2  
ATOM   4426   H  HB3  . LEU A 1 69  ? -18.456 6.643   4.462   1.00 15.00 ?  111 LEU A HB3  2  
ATOM   4427   H  HG   . LEU A 1 69  ? -19.931 5.271   6.709   1.00 15.00 ?  111 LEU A HG   2  
ATOM   4428   H  HD11 . LEU A 1 69  ? -18.740 6.805   8.159   1.00 15.00 ?  111 LEU A HD11 2  
ATOM   4429   H  HD12 . LEU A 1 69  ? -17.889 7.492   6.778   1.00 15.00 ?  111 LEU A HD12 2  
ATOM   4430   H  HD13 . LEU A 1 69  ? -17.595 5.818   7.252   1.00 15.00 ?  111 LEU A HD13 2  
ATOM   4431   H  HD21 . LEU A 1 69  ? -20.860 7.514   7.117   1.00 15.00 ?  111 LEU A HD21 2  
ATOM   4432   H  HD22 . LEU A 1 69  ? -21.350 6.860   5.554   1.00 15.00 ?  111 LEU A HD22 2  
ATOM   4433   H  HD23 . LEU A 1 69  ? -20.083 8.084   5.641   1.00 15.00 ?  111 LEU A HD23 2  
ATOM   4434   N  N    . PRO A 1 70  ? -19.502 6.329   1.760   1.00 15.00 ?  112 PRO A N    2  
ATOM   4435   C  CA   . PRO A 1 70  ? -18.986 6.456   0.395   1.00 15.00 ?  112 PRO A CA   2  
ATOM   4436   C  C    . PRO A 1 70  ? -17.473 6.653   0.354   1.00 15.00 ?  112 PRO A C    2  
ATOM   4437   O  O    . PRO A 1 70  ? -16.900 7.348   1.194   1.00 15.00 ?  112 PRO A O    2  
ATOM   4438   C  CB   . PRO A 1 70  ? -19.699 7.702   -0.127  1.00 15.00 ?  112 PRO A CB   2  
ATOM   4439   C  CG   . PRO A 1 70  ? -19.943 8.530   1.084   1.00 15.00 ?  112 PRO A CG   2  
ATOM   4440   C  CD   . PRO A 1 70  ? -20.203 7.554   2.201   1.00 15.00 ?  112 PRO A CD   2  
ATOM   4441   H  HA   . PRO A 1 70  ? -19.256 5.603   -0.213  1.00 15.00 ?  112 PRO A HA   2  
ATOM   4442   H  HB2  . PRO A 1 70  ? -19.066 8.222   -0.832  1.00 15.00 ?  112 PRO A HB2  2  
ATOM   4443   H  HB3  . PRO A 1 70  ? -20.636 7.432   -0.586  1.00 15.00 ?  112 PRO A HB3  2  
ATOM   4444   H  HG2  . PRO A 1 70  ? -19.068 9.129   1.302   1.00 15.00 ?  112 PRO A HG2  2  
ATOM   4445   H  HG3  . PRO A 1 70  ? -20.805 9.159   0.938   1.00 15.00 ?  112 PRO A HG3  2  
ATOM   4446   H  HD2  . PRO A 1 70  ? -19.791 7.924   3.129   1.00 15.00 ?  112 PRO A HD2  2  
ATOM   4447   H  HD3  . PRO A 1 70  ? -21.261 7.371   2.302   1.00 15.00 ?  112 PRO A HD3  2  
ATOM   4448   N  N    . VAL A 1 71  ? -16.831 6.038   -0.624  1.00 15.00 ?  113 VAL A N    2  
ATOM   4449   C  CA   . VAL A 1 71  ? -15.392 6.156   -0.781  1.00 15.00 ?  113 VAL A CA   2  
ATOM   4450   C  C    . VAL A 1 71  ? -15.068 7.431   -1.551  1.00 15.00 ?  113 VAL A C    2  
ATOM   4451   O  O    . VAL A 1 71  ? -15.526 7.620   -2.680  1.00 15.00 ?  113 VAL A O    2  
ATOM   4452   C  CB   . VAL A 1 71  ? -14.793 4.937   -1.519  1.00 15.00 ?  113 VAL A CB   2  
ATOM   4453   C  CG1  . VAL A 1 71  ? -13.279 5.060   -1.618  1.00 15.00 ?  113 VAL A CG1  2  
ATOM   4454   C  CG2  . VAL A 1 71  ? -15.181 3.638   -0.823  1.00 15.00 ?  113 VAL A CG2  2  
ATOM   4455   H  H    . VAL A 1 71  ? -17.337 5.495   -1.264  1.00 15.00 ?  113 VAL A H    2  
ATOM   4456   H  HA   . VAL A 1 71  ? -14.948 6.215   0.202   1.00 15.00 ?  113 VAL A HA   2  
ATOM   4457   H  HB   . VAL A 1 71  ? -15.196 4.920   -2.519  1.00 15.00 ?  113 VAL A HB   2  
ATOM   4458   H  HG11 . VAL A 1 71  ? -13.030 5.947   -2.182  1.00 15.00 ?  113 VAL A HG11 2  
ATOM   4459   H  HG12 . VAL A 1 71  ? -12.879 4.190   -2.114  1.00 15.00 ?  113 VAL A HG12 2  
ATOM   4460   H  HG13 . VAL A 1 71  ? -12.859 5.134   -0.627  1.00 15.00 ?  113 VAL A HG13 2  
ATOM   4461   H  HG21 . VAL A 1 71  ? -14.734 3.609   0.162   1.00 15.00 ?  113 VAL A HG21 2  
ATOM   4462   H  HG22 . VAL A 1 71  ? -14.828 2.799   -1.403  1.00 15.00 ?  113 VAL A HG22 2  
ATOM   4463   H  HG23 . VAL A 1 71  ? -16.255 3.586   -0.733  1.00 15.00 ?  113 VAL A HG23 2  
ATOM   4464   N  N    . ALA A 1 72  ? -14.298 8.309   -0.928  1.00 15.00 ?  114 ALA A N    2  
ATOM   4465   C  CA   . ALA A 1 72  ? -13.930 9.573   -1.548  1.00 15.00 ?  114 ALA A CA   2  
ATOM   4466   C  C    . ALA A 1 72  ? -12.853 9.372   -2.609  1.00 15.00 ?  114 ALA A C    2  
ATOM   4467   O  O    . ALA A 1 72  ? -12.975 9.865   -3.733  1.00 15.00 ?  114 ALA A O    2  
ATOM   4468   C  CB   . ALA A 1 72  ? -13.457 10.565  -0.491  1.00 15.00 ?  114 ALA A CB   2  
ATOM   4469   H  H    . ALA A 1 72  ? -13.958 8.096   -0.028  1.00 15.00 ?  114 ALA A H    2  
ATOM   4470   H  HA   . ALA A 1 72  ? -14.814 9.981   -2.018  1.00 15.00 ?  114 ALA A HA   2  
ATOM   4471   H  HB1  . ALA A 1 72  ? -12.457 10.303  -0.175  1.00 15.00 ?  114 ALA A HB1  2  
ATOM   4472   H  HB2  . ALA A 1 72  ? -14.123 10.532  0.359   1.00 15.00 ?  114 ALA A HB2  2  
ATOM   4473   H  HB3  . ALA A 1 72  ? -13.451 11.562  -0.908  1.00 15.00 ?  114 ALA A HB3  2  
ATOM   4474   N  N    . LEU A 1 73  ? -11.808 8.634   -2.253  1.00 15.00 ?  115 LEU A N    2  
ATOM   4475   C  CA   . LEU A 1 73  ? -10.714 8.390   -3.174  1.00 15.00 ?  115 LEU A CA   2  
ATOM   4476   C  C    . LEU A 1 73  ? -9.907  7.169   -2.760  1.00 15.00 ?  115 LEU A C    2  
ATOM   4477   O  O    . LEU A 1 73  ? -10.044 6.665   -1.642  1.00 15.00 ?  115 LEU A O    2  
ATOM   4478   C  CB   . LEU A 1 73  ? -9.804  9.622   -3.254  1.00 15.00 ?  115 LEU A CB   2  
ATOM   4479   C  CG   . LEU A 1 73  ? -9.279  10.140  -1.911  1.00 15.00 ?  115 LEU A CG   2  
ATOM   4480   C  CD1  . LEU A 1 73  ? -7.856  9.664   -1.672  1.00 15.00 ?  115 LEU A CD1  2  
ATOM   4481   C  CD2  . LEU A 1 73  ? -9.350  11.657  -1.861  1.00 15.00 ?  115 LEU A CD2  2  
ATOM   4482   H  H    . LEU A 1 73  ? -11.777 8.239   -1.356  1.00 15.00 ?  115 LEU A H    2  
ATOM   4483   H  HA   . LEU A 1 73  ? -11.139 8.207   -4.149  1.00 15.00 ?  115 LEU A HA   2  
ATOM   4484   H  HB2  . LEU A 1 73  ? -8.958  9.378   -3.876  1.00 15.00 ?  115 LEU A HB2  2  
ATOM   4485   H  HB3  . LEU A 1 73  ? -10.357 10.420  -3.728  1.00 15.00 ?  115 LEU A HB3  2  
ATOM   4486   H  HG   . LEU A 1 73  ? -9.898  9.747   -1.116  1.00 15.00 ?  115 LEU A HG   2  
ATOM   4487   H  HD11 . LEU A 1 73  ? -7.221  10.014  -2.472  1.00 15.00 ?  115 LEU A HD11 2  
ATOM   4488   H  HD12 . LEU A 1 73  ? -7.837  8.582   -1.642  1.00 15.00 ?  115 LEU A HD12 2  
ATOM   4489   H  HD13 . LEU A 1 73  ? -7.500  10.055  -0.732  1.00 15.00 ?  115 LEU A HD13 2  
ATOM   4490   H  HD21 . LEU A 1 73  ? -10.381 11.969  -1.914  1.00 15.00 ?  115 LEU A HD21 2  
ATOM   4491   H  HD22 . LEU A 1 73  ? -8.806  12.071  -2.697  1.00 15.00 ?  115 LEU A HD22 2  
ATOM   4492   H  HD23 . LEU A 1 73  ? -8.914  12.006  -0.937  1.00 15.00 ?  115 LEU A HD23 2  
ATOM   4493   N  N    . ALA A 1 74  ? -9.076  6.697   -3.678  1.00 15.00 ?  116 ALA A N    2  
ATOM   4494   C  CA   . ALA A 1 74  ? -8.229  5.544   -3.433  1.00 15.00 ?  116 ALA A CA   2  
ATOM   4495   C  C    . ALA A 1 74  ? -6.820  5.812   -3.942  1.00 15.00 ?  116 ALA A C    2  
ATOM   4496   O  O    . ALA A 1 74  ? -6.628  6.152   -5.112  1.00 15.00 ?  116 ALA A O    2  
ATOM   4497   C  CB   . ALA A 1 74  ? -8.809  4.307   -4.098  1.00 15.00 ?  116 ALA A CB   2  
ATOM   4498   H  H    . ALA A 1 74  ? -9.028  7.144   -4.552  1.00 15.00 ?  116 ALA A H    2  
ATOM   4499   H  HA   . ALA A 1 74  ? -8.195  5.375   -2.368  1.00 15.00 ?  116 ALA A HA   2  
ATOM   4500   H  HB1  . ALA A 1 74  ? -8.145  3.472   -3.951  1.00 15.00 ?  116 ALA A HB1  2  
ATOM   4501   H  HB2  . ALA A 1 74  ? -8.930  4.490   -5.155  1.00 15.00 ?  116 ALA A HB2  2  
ATOM   4502   H  HB3  . ALA A 1 74  ? -9.769  4.080   -3.662  1.00 15.00 ?  116 ALA A HB3  2  
ATOM   4503   N  N    . VAL A 1 75  ? -5.841  5.672   -3.067  1.00 15.00 ?  117 VAL A N    2  
ATOM   4504   C  CA   . VAL A 1 75  ? -4.451  5.912   -3.430  1.00 15.00 ?  117 VAL A CA   2  
ATOM   4505   C  C    . VAL A 1 75  ? -3.661  4.605   -3.406  1.00 15.00 ?  117 VAL A C    2  
ATOM   4506   O  O    . VAL A 1 75  ? -3.842  3.784   -2.511  1.00 15.00 ?  117 VAL A O    2  
ATOM   4507   C  CB   . VAL A 1 75  ? -3.803  6.953   -2.483  1.00 15.00 ?  117 VAL A CB   2  
ATOM   4508   C  CG1  . VAL A 1 75  ? -3.868  6.494   -1.033  1.00 15.00 ?  117 VAL A CG1  2  
ATOM   4509   C  CG2  . VAL A 1 75  ? -2.366  7.250   -2.889  1.00 15.00 ?  117 VAL A CG2  2  
ATOM   4510   H  H    . VAL A 1 75  ? -6.055  5.386   -2.148  1.00 15.00 ?  117 VAL A H    2  
ATOM   4511   H  HA   . VAL A 1 75  ? -4.433  6.310   -4.435  1.00 15.00 ?  117 VAL A HA   2  
ATOM   4512   H  HB   . VAL A 1 75  ? -4.366  7.868   -2.563  1.00 15.00 ?  117 VAL A HB   2  
ATOM   4513   H  HG11 . VAL A 1 75  ? -4.885  6.224   -0.787  1.00 15.00 ?  117 VAL A HG11 2  
ATOM   4514   H  HG12 . VAL A 1 75  ? -3.543  7.297   -0.388  1.00 15.00 ?  117 VAL A HG12 2  
ATOM   4515   H  HG13 . VAL A 1 75  ? -3.224  5.635   -0.896  1.00 15.00 ?  117 VAL A HG13 2  
ATOM   4516   H  HG21 . VAL A 1 75  ? -2.344  7.604   -3.910  1.00 15.00 ?  117 VAL A HG21 2  
ATOM   4517   H  HG22 . VAL A 1 75  ? -1.776  6.347   -2.810  1.00 15.00 ?  117 VAL A HG22 2  
ATOM   4518   H  HG23 . VAL A 1 75  ? -1.957  8.007   -2.236  1.00 15.00 ?  117 VAL A HG23 2  
ATOM   4519   N  N    . VAL A 1 76  ? -2.812  4.401   -4.402  1.00 15.00 ?  118 VAL A N    2  
ATOM   4520   C  CA   . VAL A 1 76  ? -2.003  3.189   -4.479  1.00 15.00 ?  118 VAL A CA   2  
ATOM   4521   C  C    . VAL A 1 76  ? -0.537  3.506   -4.190  1.00 15.00 ?  118 VAL A C    2  
ATOM   4522   O  O    . VAL A 1 76  ? -0.110  4.654   -4.314  1.00 15.00 ?  118 VAL A O    2  
ATOM   4523   C  CB   . VAL A 1 76  ? -2.126  2.504   -5.855  1.00 15.00 ?  118 VAL A CB   2  
ATOM   4524   C  CG1  . VAL A 1 76  ? -3.545  2.017   -6.084  1.00 15.00 ?  118 VAL A CG1  2  
ATOM   4525   C  CG2  . VAL A 1 76  ? -1.710  3.446   -6.970  1.00 15.00 ?  118 VAL A CG2  2  
ATOM   4526   H  H    . VAL A 1 76  ? -2.719  5.085   -5.101  1.00 15.00 ?  118 VAL A H    2  
ATOM   4527   H  HA   . VAL A 1 76  ? -2.367  2.505   -3.725  1.00 15.00 ?  118 VAL A HA   2  
ATOM   4528   H  HB   . VAL A 1 76  ? -1.468  1.648   -5.873  1.00 15.00 ?  118 VAL A HB   2  
ATOM   4529   H  HG11 . VAL A 1 76  ? -4.214  2.863   -6.103  1.00 15.00 ?  118 VAL A HG11 2  
ATOM   4530   H  HG12 . VAL A 1 76  ? -3.830  1.349   -5.287  1.00 15.00 ?  118 VAL A HG12 2  
ATOM   4531   H  HG13 . VAL A 1 76  ? -3.598  1.495   -7.029  1.00 15.00 ?  118 VAL A HG13 2  
ATOM   4532   H  HG21 . VAL A 1 76  ? -0.660  3.677   -6.874  1.00 15.00 ?  118 VAL A HG21 2  
ATOM   4533   H  HG22 . VAL A 1 76  ? -2.291  4.358   -6.899  1.00 15.00 ?  118 VAL A HG22 2  
ATOM   4534   H  HG23 . VAL A 1 76  ? -1.894  2.975   -7.923  1.00 15.00 ?  118 VAL A HG23 2  
ATOM   4535   N  N    . THR A 1 77  ? 0.232   2.488   -3.814  1.00 15.00 ?  119 THR A N    2  
ATOM   4536   C  CA   . THR A 1 77  ? 1.639   2.679   -3.487  1.00 15.00 ?  119 THR A CA   2  
ATOM   4537   C  C    . THR A 1 77  ? 2.538   2.688   -4.724  1.00 15.00 ?  119 THR A C    2  
ATOM   4538   O  O    . THR A 1 77  ? 3.518   3.433   -4.773  1.00 15.00 ?  119 THR A O    2  
ATOM   4539   C  CB   . THR A 1 77  ? 2.146   1.599   -2.516  1.00 15.00 ?  119 THR A CB   2  
ATOM   4540   O  OG1  . THR A 1 77  ? 1.658   0.312   -2.912  1.00 15.00 ?  119 THR A OG1  2  
ATOM   4541   C  CG2  . THR A 1 77  ? 1.708   1.898   -1.094  1.00 15.00 ?  119 THR A CG2  2  
ATOM   4542   H  H    . THR A 1 77  ? -0.163  1.586   -3.746  1.00 15.00 ?  119 THR A H    2  
ATOM   4543   H  HA   . THR A 1 77  ? 1.731   3.635   -2.992  1.00 15.00 ?  119 THR A HA   2  
ATOM   4544   H  HB   . THR A 1 77  ? 3.225   1.591   -2.550  1.00 15.00 ?  119 THR A HB   2  
ATOM   4545   H  HG1  . THR A 1 77  ? 0.810   0.135   -2.465  1.00 15.00 ?  119 THR A HG1  2  
ATOM   4546   H  HG21 . THR A 1 77  ? 2.055   2.881   -0.811  1.00 15.00 ?  119 THR A HG21 2  
ATOM   4547   H  HG22 . THR A 1 77  ? 2.129   1.162   -0.425  1.00 15.00 ?  119 THR A HG22 2  
ATOM   4548   H  HG23 . THR A 1 77  ? 0.631   1.866   -1.035  1.00 15.00 ?  119 THR A HG23 2  
ATOM   4549   N  N    . HIS A 1 78  ? 2.229   1.844   -5.705  1.00 15.00 ?  120 HIS A N    2  
ATOM   4550   C  CA   . HIS A 1 78  ? 3.032   1.773   -6.926  1.00 15.00 ?  120 HIS A CA   2  
ATOM   4551   C  C    . HIS A 1 78  ? 2.362   0.911   -7.985  1.00 15.00 ?  120 HIS A C    2  
ATOM   4552   O  O    . HIS A 1 78  ? 1.371   0.229   -7.715  1.00 15.00 ?  120 HIS A O    2  
ATOM   4553   C  CB   . HIS A 1 78  ? 4.445   1.250   -6.633  1.00 15.00 ?  120 HIS A CB   2  
ATOM   4554   C  CG   . HIS A 1 78  ? 4.511   -0.140  -6.079  1.00 15.00 ?  120 HIS A CG   2  
ATOM   4555   N  ND1  . HIS A 1 78  ? 4.005   -0.511  -4.850  1.00 15.00 ?  120 HIS A ND1  2  
ATOM   4556   C  CD2  . HIS A 1 78  ? 5.079   -1.253  -6.600  1.00 15.00 ?  120 HIS A CD2  2  
ATOM   4557   C  CE1  . HIS A 1 78  ? 4.281   -1.804  -4.665  1.00 15.00 ?  120 HIS A CE1  2  
ATOM   4558   N  NE2  . HIS A 1 78  ? 4.934   -2.305  -5.699  1.00 15.00 ?  120 HIS A NE2  2  
ATOM   4559   H  H    . HIS A 1 78  ? 1.442   1.267   -5.613  1.00 15.00 ?  120 HIS A H    2  
ATOM   4560   H  HA   . HIS A 1 78  ? 3.113   2.776   -7.315  1.00 15.00 ?  120 HIS A HA   2  
ATOM   4561   H  HB2  . HIS A 1 78  ? 5.017   1.261   -7.547  1.00 15.00 ?  120 HIS A HB2  2  
ATOM   4562   H  HB3  . HIS A 1 78  ? 4.916   1.909   -5.924  1.00 15.00 ?  120 HIS A HB3  2  
ATOM   4563   H  HD1  . HIS A 1 78  ? 3.504   0.065   -4.232  1.00 15.00 ?  120 HIS A HD1  2  
ATOM   4564   H  HD2  . HIS A 1 78  ? 5.573   -1.323  -7.557  1.00 15.00 ?  120 HIS A HD2  2  
ATOM   4565   H  HE1  . HIS A 1 78  ? 4.008   -2.366  -3.785  1.00 15.00 ?  120 HIS A HE1  2  
ATOM   4566   N  N    . ALA A 1 79  ? 2.921   0.945   -9.187  1.00 15.00 ?  121 ALA A N    2  
ATOM   4567   C  CA   . ALA A 1 79  ? 2.381   0.186   -10.302 1.00 15.00 ?  121 ALA A CA   2  
ATOM   4568   C  C    . ALA A 1 79  ? 2.766   -1.288  -10.232 1.00 15.00 ?  121 ALA A C    2  
ATOM   4569   O  O    . ALA A 1 79  ? 3.828   -1.690  -10.702 1.00 15.00 ?  121 ALA A O    2  
ATOM   4570   C  CB   . ALA A 1 79  ? 2.840   0.788   -11.622 1.00 15.00 ?  121 ALA A CB   2  
ATOM   4571   H  H    . ALA A 1 79  ? 3.722   1.510   -9.329  1.00 15.00 ?  121 ALA A H    2  
ATOM   4572   H  HA   . ALA A 1 79  ? 1.305   0.262   -10.261 1.00 15.00 ?  121 ALA A HA   2  
ATOM   4573   H  HB1  . ALA A 1 79  ? 2.559   1.829   -11.659 1.00 15.00 ?  121 ALA A HB1  2  
ATOM   4574   H  HB2  . ALA A 1 79  ? 2.371   0.260   -12.439 1.00 15.00 ?  121 ALA A HB2  2  
ATOM   4575   H  HB3  . ALA A 1 79  ? 3.913   0.703   -11.707 1.00 15.00 ?  121 ALA A HB3  2  
ATOM   4576   N  N    . HIS A 1 80  ? 1.907   -2.094  -9.625  1.00 15.00 ?  122 HIS A N    2  
ATOM   4577   C  CA   . HIS A 1 80  ? 2.156   -3.523  -9.526  1.00 15.00 ?  122 HIS A CA   2  
ATOM   4578   C  C    . HIS A 1 80  ? 0.837   -4.288  -9.524  1.00 15.00 ?  122 HIS A C    2  
ATOM   4579   O  O    . HIS A 1 80  ? -0.213  -3.720  -9.222  1.00 15.00 ?  122 HIS A O    2  
ATOM   4580   C  CB   . HIS A 1 80  ? 2.987   -3.860  -8.284  1.00 15.00 ?  122 HIS A CB   2  
ATOM   4581   C  CG   . HIS A 1 80  ? 4.327   -4.465  -8.610  1.00 15.00 ?  122 HIS A CG   2  
ATOM   4582   N  ND1  . HIS A 1 80  ? 5.221   -4.837  -7.624  1.00 15.00 ?  122 HIS A ND1  2  
ATOM   4583   C  CD2  . HIS A 1 80  ? 4.871   -4.743  -9.821  1.00 15.00 ?  122 HIS A CD2  2  
ATOM   4584   C  CE1  . HIS A 1 80  ? 6.275   -5.331  -8.262  1.00 15.00 ?  122 HIS A CE1  2  
ATOM   4585   N  NE2  . HIS A 1 80  ? 6.106   -5.291  -9.584  1.00 15.00 ?  122 HIS A NE2  2  
ATOM   4586   H  H    . HIS A 1 80  ? 1.091   -1.719  -9.233  1.00 15.00 ?  122 HIS A H    2  
ATOM   4587   H  HA   . HIS A 1 80  ? 2.710   -3.808  -10.406 1.00 15.00 ?  122 HIS A HA   2  
ATOM   4588   H  HB2  . HIS A 1 80  ? 3.156   -2.956  -7.718  1.00 15.00 ?  122 HIS A HB2  2  
ATOM   4589   H  HB3  . HIS A 1 80  ? 2.443   -4.564  -7.677  1.00 15.00 ?  122 HIS A HB3  2  
ATOM   4590   H  HD2  . HIS A 1 80  ? 4.424   -4.566  -10.787 1.00 15.00 ?  122 HIS A HD2  2  
ATOM   4591   H  HE1  . HIS A 1 80  ? 7.157   -5.718  -7.778  1.00 15.00 ?  122 HIS A HE1  2  
ATOM   4592   H  HE2  . HIS A 1 80  ? 6.752   -5.594  -10.265 1.00 15.00 ?  122 HIS A HE2  2  
ATOM   4593   N  N    . GLN A 1 81  ? 0.913   -5.576  -9.844  1.00 15.00 ?  123 GLN A N    2  
ATOM   4594   C  CA   . GLN A 1 81  ? -0.259  -6.454  -9.934  1.00 15.00 ?  123 GLN A CA   2  
ATOM   4595   C  C    . GLN A 1 81  ? -1.128  -6.454  -8.674  1.00 15.00 ?  123 GLN A C    2  
ATOM   4596   O  O    . GLN A 1 81  ? -2.352  -6.401  -8.760  1.00 15.00 ?  123 GLN A O    2  
ATOM   4597   C  CB   . GLN A 1 81  ? 0.206   -7.884  -10.234 1.00 15.00 ?  123 GLN A CB   2  
ATOM   4598   C  CG   . GLN A 1 81  ? -0.834  -8.742  -10.932 1.00 15.00 ?  123 GLN A CG   2  
ATOM   4599   C  CD   . GLN A 1 81  ? -0.259  -10.059 -11.423 1.00 15.00 ?  123 GLN A CD   2  
ATOM   4600   O  OE1  . GLN A 1 81  ? 0.941   -10.171 -11.673 1.00 15.00 ?  123 GLN A OE1  2  
ATOM   4601   N  NE2  . GLN A 1 81  ? -1.110  -11.057 -11.579 1.00 15.00 ?  123 GLN A NE2  2  
ATOM   4602   H  H    . GLN A 1 81  ? 1.796   -5.957  -10.035 1.00 15.00 ?  123 GLN A H    2  
ATOM   4603   H  HA   . GLN A 1 81  ? -0.860  -6.109  -10.761 1.00 15.00 ?  123 GLN A HA   2  
ATOM   4604   H  HB2  . GLN A 1 81  ? 1.081   -7.843  -10.866 1.00 15.00 ?  123 GLN A HB2  2  
ATOM   4605   H  HB3  . GLN A 1 81  ? 0.470   -8.365  -9.303  1.00 15.00 ?  123 GLN A HB3  2  
ATOM   4606   H  HG2  . GLN A 1 81  ? -1.632  -8.952  -10.239 1.00 15.00 ?  123 GLN A HG2  2  
ATOM   4607   H  HG3  . GLN A 1 81  ? -1.224  -8.199  -11.778 1.00 15.00 ?  123 GLN A HG3  2  
ATOM   4608   H  HE21 . GLN A 1 81  ? -2.058  -10.896 -11.374 1.00 15.00 ?  123 GLN A HE21 2  
ATOM   4609   H  HE22 . GLN A 1 81  ? -0.761  -11.919 -11.895 1.00 15.00 ?  123 GLN A HE22 2  
ATOM   4610   N  N    . ASP A 1 82  ? -0.497  -6.499  -7.512  1.00 15.00 ?  124 ASP A N    2  
ATOM   4611   C  CA   . ASP A 1 82  ? -1.224  -6.545  -6.245  1.00 15.00 ?  124 ASP A CA   2  
ATOM   4612   C  C    . ASP A 1 82  ? -1.521  -5.159  -5.692  1.00 15.00 ?  124 ASP A C    2  
ATOM   4613   O  O    . ASP A 1 82  ? -2.086  -5.030  -4.608  1.00 15.00 ?  124 ASP A O    2  
ATOM   4614   C  CB   . ASP A 1 82  ? -0.426  -7.335  -5.208  1.00 15.00 ?  124 ASP A CB   2  
ATOM   4615   C  CG   . ASP A 1 82  ? 0.939   -6.739  -4.921  1.00 15.00 ?  124 ASP A CG   2  
ATOM   4616   O  OD1  . ASP A 1 82  ? 1.709   -6.509  -5.887  1.00 15.00 ?  124 ASP A OD1  2  
ATOM   4617   O  OD2  . ASP A 1 82  ? 1.265   -6.530  -3.736  1.00 15.00 -1 124 ASP A OD2  2  
ATOM   4618   H  H    . ASP A 1 82  ? 0.484   -6.498  -7.499  1.00 15.00 ?  124 ASP A H    2  
ATOM   4619   H  HA   . ASP A 1 82  ? -2.161  -7.056  -6.422  1.00 15.00 ?  124 ASP A HA   2  
ATOM   4620   H  HB2  . ASP A 1 82  ? -0.986  -7.367  -4.285  1.00 15.00 ?  124 ASP A HB2  2  
ATOM   4621   H  HB3  . ASP A 1 82  ? -0.289  -8.345  -5.571  1.00 15.00 ?  124 ASP A HB3  2  
ATOM   4622   N  N    . LYS A 1 83  ? -1.150  -4.127  -6.431  1.00 15.00 ?  125 LYS A N    2  
ATOM   4623   C  CA   . LYS A 1 83  ? -1.370  -2.760  -5.979  1.00 15.00 ?  125 LYS A CA   2  
ATOM   4624   C  C    . LYS A 1 83  ? -2.366  -2.031  -6.876  1.00 15.00 ?  125 LYS A C    2  
ATOM   4625   O  O    . LYS A 1 83  ? -3.276  -1.360  -6.387  1.00 15.00 ?  125 LYS A O    2  
ATOM   4626   C  CB   . LYS A 1 83  ? -0.036  -2.004  -5.923  1.00 15.00 ?  125 LYS A CB   2  
ATOM   4627   C  CG   . LYS A 1 83  ? 1.068   -2.760  -5.189  1.00 15.00 ?  125 LYS A CG   2  
ATOM   4628   C  CD   . LYS A 1 83  ? 0.961   -2.599  -3.676  1.00 15.00 ?  125 LYS A CD   2  
ATOM   4629   C  CE   . LYS A 1 83  ? 0.147   -3.710  -3.039  1.00 15.00 ?  125 LYS A CE   2  
ATOM   4630   N  NZ   . LYS A 1 83  ? -0.333  -3.341  -1.685  1.00 15.00 1  125 LYS A NZ   2  
ATOM   4631   H  H    . LYS A 1 83  ? -0.731  -4.287  -7.302  1.00 15.00 ?  125 LYS A H    2  
ATOM   4632   H  HA   . LYS A 1 83  ? -1.782  -2.809  -4.983  1.00 15.00 ?  125 LYS A HA   2  
ATOM   4633   H  HB2  . LYS A 1 83  ? 0.302   -1.809  -6.933  1.00 15.00 ?  125 LYS A HB2  2  
ATOM   4634   H  HB3  . LYS A 1 83  ? -0.192  -1.061  -5.419  1.00 15.00 ?  125 LYS A HB3  2  
ATOM   4635   H  HG2  . LYS A 1 83  ? 0.993   -3.809  -5.433  1.00 15.00 ?  125 LYS A HG2  2  
ATOM   4636   H  HG3  . LYS A 1 83  ? 2.027   -2.383  -5.514  1.00 15.00 ?  125 LYS A HG3  2  
ATOM   4637   H  HD2  . LYS A 1 83  ? 1.953   -2.613  -3.252  1.00 15.00 ?  125 LYS A HD2  2  
ATOM   4638   H  HD3  . LYS A 1 83  ? 0.489   -1.652  -3.458  1.00 15.00 ?  125 LYS A HD3  2  
ATOM   4639   H  HE2  . LYS A 1 83  ? -0.705  -3.920  -3.669  1.00 15.00 ?  125 LYS A HE2  2  
ATOM   4640   H  HE3  . LYS A 1 83  ? 0.764   -4.592  -2.965  1.00 15.00 ?  125 LYS A HE3  2  
ATOM   4641   H  HZ1  . LYS A 1 83  ? -0.554  -2.319  -1.647  1.00 15.00 ?  125 LYS A HZ1  2  
ATOM   4642   H  HZ2  . LYS A 1 83  ? 0.400   -3.549  -0.976  1.00 15.00 ?  125 LYS A HZ2  2  
ATOM   4643   H  HZ3  . LYS A 1 83  ? -1.190  -3.880  -1.452  1.00 15.00 ?  125 LYS A HZ3  2  
ATOM   4644   N  N    . MET A 1 84  ? -2.205  -2.181  -8.179  1.00 15.00 ?  126 MET A N    2  
ATOM   4645   C  CA   . MET A 1 84  ? -3.076  -1.527  -9.144  1.00 15.00 ?  126 MET A CA   2  
ATOM   4646   C  C    . MET A 1 84  ? -3.814  -2.570  -9.978  1.00 15.00 ?  126 MET A C    2  
ATOM   4647   O  O    . MET A 1 84  ? -4.103  -2.353  -11.156 1.00 15.00 ?  126 MET A O    2  
ATOM   4648   C  CB   . MET A 1 84  ? -2.253  -0.607  -10.055 1.00 15.00 ?  126 MET A CB   2  
ATOM   4649   C  CG   . MET A 1 84  ? -1.711  0.630   -9.350  1.00 15.00 ?  126 MET A CG   2  
ATOM   4650   S  SD   . MET A 1 84  ? -0.659  1.645   -10.410 1.00 15.00 ?  126 MET A SD   2  
ATOM   4651   C  CE   . MET A 1 84  ? -1.884  2.547   -11.353 1.00 15.00 ?  126 MET A CE   2  
ATOM   4652   H  H    . MET A 1 84  ? -1.481  -2.758  -8.511  1.00 15.00 ?  126 MET A H    2  
ATOM   4653   H  HA   . MET A 1 84  ? -3.798  -0.933  -8.598  1.00 15.00 ?  126 MET A HA   2  
ATOM   4654   H  HB2  . MET A 1 84  ? -1.417  -1.168  -10.444 1.00 15.00 ?  126 MET A HB2  2  
ATOM   4655   H  HB3  . MET A 1 84  ? -2.874  -0.285  -10.878 1.00 15.00 ?  126 MET A HB3  2  
ATOM   4656   H  HG2  . MET A 1 84  ? -2.541  1.233   -9.018  1.00 15.00 ?  126 MET A HG2  2  
ATOM   4657   H  HG3  . MET A 1 84  ? -1.133  0.314   -8.493  1.00 15.00 ?  126 MET A HG3  2  
ATOM   4658   H  HE1  . MET A 1 84  ? -2.411  3.228   -10.700 1.00 15.00 ?  126 MET A HE1  2  
ATOM   4659   H  HE2  . MET A 1 84  ? -2.585  1.851   -11.788 1.00 15.00 ?  126 MET A HE2  2  
ATOM   4660   H  HE3  . MET A 1 84  ? -1.396  3.105   -12.139 1.00 15.00 ?  126 MET A HE3  2  
ATOM   4661   N  N    . GLY A 1 85  ? -4.129  -3.696  -9.353  1.00 15.00 ?  127 GLY A N    2  
ATOM   4662   C  CA   . GLY A 1 85  ? -4.820  -4.759  -10.048 1.00 15.00 ?  127 GLY A CA   2  
ATOM   4663   C  C    . GLY A 1 85  ? -6.312  -4.524  -10.150 1.00 15.00 ?  127 GLY A C    2  
ATOM   4664   O  O    . GLY A 1 85  ? -6.952  -4.990  -11.094 1.00 15.00 ?  127 GLY A O    2  
ATOM   4665   H  H    . GLY A 1 85  ? -3.891  -3.806  -8.408  1.00 15.00 ?  127 GLY A H    2  
ATOM   4666   H  HA2  . GLY A 1 85  ? -4.412  -4.837  -11.045 1.00 15.00 ?  127 GLY A HA2  2  
ATOM   4667   H  HA3  . GLY A 1 85  ? -4.647  -5.689  -9.528  1.00 15.00 ?  127 GLY A HA3  2  
ATOM   4668   N  N    . GLY A 1 86  ? -6.870  -3.793  -9.190  1.00 15.00 ?  128 GLY A N    2  
ATOM   4669   C  CA   . GLY A 1 86  ? -8.297  -3.520  -9.203  1.00 15.00 ?  128 GLY A CA   2  
ATOM   4670   C  C    . GLY A 1 86  ? -8.612  -2.044  -9.349  1.00 15.00 ?  128 GLY A C    2  
ATOM   4671   O  O    . GLY A 1 86  ? -9.417  -1.493  -8.598  1.00 15.00 ?  128 GLY A O    2  
ATOM   4672   H  H    . GLY A 1 86  ? -6.308  -3.441  -8.464  1.00 15.00 ?  128 GLY A H    2  
ATOM   4673   H  HA2  . GLY A 1 86  ? -8.743  -4.051  -10.028 1.00 15.00 ?  128 GLY A HA2  2  
ATOM   4674   H  HA3  . GLY A 1 86  ? -8.728  -3.881  -8.281  1.00 15.00 ?  128 GLY A HA3  2  
ATOM   4675   N  N    . MET A 1 87  ? -7.985  -1.403  -10.322 1.00 15.00 ?  129 MET A N    2  
ATOM   4676   C  CA   . MET A 1 87  ? -8.196  0.021   -10.560 1.00 15.00 ?  129 MET A CA   2  
ATOM   4677   C  C    . MET A 1 87  ? -9.481  0.258   -11.347 1.00 15.00 ?  129 MET A C    2  
ATOM   4678   O  O    . MET A 1 87  ? -10.240 1.179   -11.051 1.00 15.00 ?  129 MET A O    2  
ATOM   4679   C  CB   . MET A 1 87  ? -7.017  0.615   -11.329 1.00 15.00 ?  129 MET A CB   2  
ATOM   4680   C  CG   . MET A 1 87  ? -5.684  0.495   -10.611 1.00 15.00 ?  129 MET A CG   2  
ATOM   4681   S  SD   . MET A 1 87  ? -5.553  1.591   -9.184  1.00 15.00 ?  129 MET A SD   2  
ATOM   4682   C  CE   . MET A 1 87  ? -5.585  3.194   -9.982  1.00 15.00 ?  129 MET A CE   2  
ATOM   4683   H  H    . MET A 1 87  ? -7.373  -1.902  -10.905 1.00 15.00 ?  129 MET A H    2  
ATOM   4684   H  HA   . MET A 1 87  ? -8.276  0.510   -9.600  1.00 15.00 ?  129 MET A HA   2  
ATOM   4685   H  HB2  . MET A 1 87  ? -6.933  0.107   -12.275 1.00 15.00 ?  129 MET A HB2  2  
ATOM   4686   H  HB3  . MET A 1 87  ? -7.211  1.662   -11.507 1.00 15.00 ?  129 MET A HB3  2  
ATOM   4687   H  HG2  . MET A 1 87  ? -5.560  -0.524  -10.274 1.00 15.00 ?  129 MET A HG2  2  
ATOM   4688   H  HG3  . MET A 1 87  ? -4.893  0.739   -11.308 1.00 15.00 ?  129 MET A HG3  2  
ATOM   4689   H  HE1  . MET A 1 87  ? -4.899  3.198   -10.817 1.00 15.00 ?  129 MET A HE1  2  
ATOM   4690   H  HE2  . MET A 1 87  ? -5.291  3.954   -9.273  1.00 15.00 ?  129 MET A HE2  2  
ATOM   4691   H  HE3  . MET A 1 87  ? -6.584  3.404   -10.336 1.00 15.00 ?  129 MET A HE3  2  
ATOM   4692   N  N    . ASP A 1 88  ? -9.727  -0.596  -12.339 1.00 15.00 ?  130 ASP A N    2  
ATOM   4693   C  CA   . ASP A 1 88  ? -10.915 -0.469  -13.186 1.00 15.00 ?  130 ASP A CA   2  
ATOM   4694   C  C    . ASP A 1 88  ? -12.184 -0.576  -12.348 1.00 15.00 ?  130 ASP A C    2  
ATOM   4695   O  O    . ASP A 1 88  ? -13.157 0.143   -12.586 1.00 15.00 ?  130 ASP A O    2  
ATOM   4696   C  CB   . ASP A 1 88  ? -10.916 -1.540  -14.277 1.00 15.00 ?  130 ASP A CB   2  
ATOM   4697   C  CG   . ASP A 1 88  ? -11.681 -1.113  -15.516 1.00 15.00 ?  130 ASP A CG   2  
ATOM   4698   O  OD1  . ASP A 1 88  ? -12.930 -1.171  -15.512 1.00 15.00 ?  130 ASP A OD1  2  
ATOM   4699   O  OD2  . ASP A 1 88  ? -11.036 -0.727  -16.514 1.00 15.00 -1 130 ASP A OD2  2  
ATOM   4700   H  H    . ASP A 1 88  ? -9.104  -1.337  -12.497 1.00 15.00 ?  130 ASP A H    2  
ATOM   4701   H  HA   . ASP A 1 88  ? -10.886 0.509   -13.649 1.00 15.00 ?  130 ASP A HA   2  
ATOM   4702   H  HB2  . ASP A 1 88  ? -9.898  -1.753  -14.561 1.00 15.00 ?  130 ASP A HB2  2  
ATOM   4703   H  HB3  . ASP A 1 88  ? -11.371 -2.437  -13.887 1.00 15.00 ?  130 ASP A HB3  2  
ATOM   4704   N  N    . ALA A 1 89  ? -12.160 -1.470  -11.363 1.00 15.00 ?  131 ALA A N    2  
ATOM   4705   C  CA   . ALA A 1 89  ? -13.295 -1.667  -10.468 1.00 15.00 ?  131 ALA A CA   2  
ATOM   4706   C  C    . ALA A 1 89  ? -13.670 -0.365  -9.764  1.00 15.00 ?  131 ALA A C    2  
ATOM   4707   O  O    . ALA A 1 89  ? -14.850 -0.037  -9.630  1.00 15.00 ?  131 ALA A O    2  
ATOM   4708   C  CB   . ALA A 1 89  ? -12.978 -2.746  -9.442  1.00 15.00 ?  131 ALA A CB   2  
ATOM   4709   H  H    . ALA A 1 89  ? -11.359 -2.032  -11.249 1.00 15.00 ?  131 ALA A H    2  
ATOM   4710   H  HA   . ALA A 1 89  ? -14.135 -2.000  -11.059 1.00 15.00 ?  131 ALA A HA   2  
ATOM   4711   H  HB1  . ALA A 1 89  ? -12.541 -3.600  -9.938  1.00 15.00 ?  131 ALA A HB1  2  
ATOM   4712   H  HB2  . ALA A 1 89  ? -13.889 -3.046  -8.943  1.00 15.00 ?  131 ALA A HB2  2  
ATOM   4713   H  HB3  . ALA A 1 89  ? -12.281 -2.358  -8.714  1.00 15.00 ?  131 ALA A HB3  2  
ATOM   4714   N  N    . LEU A 1 90  ? -12.657 0.385   -9.343  1.00 15.00 ?  132 LEU A N    2  
ATOM   4715   C  CA   . LEU A 1 90  ? -12.871 1.655   -8.656  1.00 15.00 ?  132 LEU A CA   2  
ATOM   4716   C  C    . LEU A 1 90  ? -13.381 2.712   -9.629  1.00 15.00 ?  132 LEU A C    2  
ATOM   4717   O  O    . LEU A 1 90  ? -14.243 3.525   -9.290  1.00 15.00 ?  132 LEU A O    2  
ATOM   4718   C  CB   . LEU A 1 90  ? -11.572 2.132   -8.000  1.00 15.00 ?  132 LEU A CB   2  
ATOM   4719   C  CG   . LEU A 1 90  ? -10.903 1.130   -7.058  1.00 15.00 ?  132 LEU A CG   2  
ATOM   4720   C  CD1  . LEU A 1 90  ? -9.615  1.716   -6.501  1.00 15.00 ?  132 LEU A CD1  2  
ATOM   4721   C  CD2  . LEU A 1 90  ? -11.846 0.738   -5.931  1.00 15.00 ?  132 LEU A CD2  2  
ATOM   4722   H  H    . LEU A 1 90  ? -11.737 0.078   -9.501  1.00 15.00 ?  132 LEU A H    2  
ATOM   4723   H  HA   . LEU A 1 90  ? -13.615 1.495   -7.892  1.00 15.00 ?  132 LEU A HA   2  
ATOM   4724   H  HB2  . LEU A 1 90  ? -10.872 2.378   -8.785  1.00 15.00 ?  132 LEU A HB2  2  
ATOM   4725   H  HB3  . LEU A 1 90  ? -11.784 3.027   -7.439  1.00 15.00 ?  132 LEU A HB3  2  
ATOM   4726   H  HG   . LEU A 1 90  ? -10.649 0.235   -7.612  1.00 15.00 ?  132 LEU A HG   2  
ATOM   4727   H  HD11 . LEU A 1 90  ? -9.187  1.032   -5.784  1.00 15.00 ?  132 LEU A HD11 2  
ATOM   4728   H  HD12 . LEU A 1 90  ? -9.829  2.657   -6.017  1.00 15.00 ?  132 LEU A HD12 2  
ATOM   4729   H  HD13 . LEU A 1 90  ? -8.915  1.875   -7.306  1.00 15.00 ?  132 LEU A HD13 2  
ATOM   4730   H  HD21 . LEU A 1 90  ? -12.117 1.614   -5.360  1.00 15.00 ?  132 LEU A HD21 2  
ATOM   4731   H  HD22 . LEU A 1 90  ? -11.358 0.023   -5.284  1.00 15.00 ?  132 LEU A HD22 2  
ATOM   4732   H  HD23 . LEU A 1 90  ? -12.736 0.292   -6.349  1.00 15.00 ?  132 LEU A HD23 2  
ATOM   4733   N  N    . HIS A 1 91  ? -12.851 2.682   -10.848 1.00 15.00 ?  133 HIS A N    2  
ATOM   4734   C  CA   . HIS A 1 91  ? -13.251 3.628   -11.886 1.00 15.00 ?  133 HIS A CA   2  
ATOM   4735   C  C    . HIS A 1 91  ? -14.727 3.455   -12.226 1.00 15.00 ?  133 HIS A C    2  
ATOM   4736   O  O    . HIS A 1 91  ? -15.445 4.433   -12.444 1.00 15.00 ?  133 HIS A O    2  
ATOM   4737   C  CB   . HIS A 1 91  ? -12.397 3.446   -13.145 1.00 15.00 ?  133 HIS A CB   2  
ATOM   4738   C  CG   . HIS A 1 91  ? -11.006 3.999   -13.028 1.00 15.00 ?  133 HIS A CG   2  
ATOM   4739   N  ND1  . HIS A 1 91  ? -10.265 4.447   -14.100 1.00 15.00 ?  133 HIS A ND1  2  
ATOM   4740   C  CD2  . HIS A 1 91  ? -10.213 4.159   -11.939 1.00 15.00 ?  133 HIS A CD2  2  
ATOM   4741   C  CE1  . HIS A 1 91  ? -9.074  4.848   -13.641 1.00 15.00 ?  133 HIS A CE1  2  
ATOM   4742   N  NE2  . HIS A 1 91  ? -8.993  4.696   -12.335 1.00 15.00 ?  133 HIS A NE2  2  
ATOM   4743   H  H    . HIS A 1 91  ? -12.167 2.008   -11.054 1.00 15.00 ?  133 HIS A H    2  
ATOM   4744   H  HA   . HIS A 1 91  ? -13.102 4.624   -11.498 1.00 15.00 ?  133 HIS A HA   2  
ATOM   4745   H  HB2  . HIS A 1 91  ? -12.317 2.391   -13.366 1.00 15.00 ?  133 HIS A HB2  2  
ATOM   4746   H  HB3  . HIS A 1 91  ? -12.884 3.943   -13.972 1.00 15.00 ?  133 HIS A HB3  2  
ATOM   4747   H  HD1  . HIS A 1 91  ? -10.562 4.477   -15.035 1.00 15.00 ?  133 HIS A HD1  2  
ATOM   4748   H  HD2  . HIS A 1 91  ? -10.478 3.912   -10.922 1.00 15.00 ?  133 HIS A HD2  2  
ATOM   4749   H  HE1  . HIS A 1 91  ? -8.280  5.239   -14.256 1.00 15.00 ?  133 HIS A HE1  2  
ATOM   4750   N  N    . ALA A 1 92  ? -15.173 2.207   -12.257 1.00 15.00 ?  134 ALA A N    2  
ATOM   4751   C  CA   . ALA A 1 92  ? -16.565 1.896   -12.564 1.00 15.00 ?  134 ALA A CA   2  
ATOM   4752   C  C    . ALA A 1 92  ? -17.479 2.270   -11.402 1.00 15.00 ?  134 ALA A C    2  
ATOM   4753   O  O    . ALA A 1 92  ? -18.602 2.737   -11.606 1.00 15.00 ?  134 ALA A O    2  
ATOM   4754   C  CB   . ALA A 1 92  ? -16.709 0.421   -12.901 1.00 15.00 ?  134 ALA A CB   2  
ATOM   4755   H  H    . ALA A 1 92  ? -14.545 1.470   -12.081 1.00 15.00 ?  134 ALA A H    2  
ATOM   4756   H  HA   . ALA A 1 92  ? -16.850 2.470   -13.431 1.00 15.00 ?  134 ALA A HA   2  
ATOM   4757   H  HB1  . ALA A 1 92  ? -17.751 0.140   -12.856 1.00 15.00 ?  134 ALA A HB1  2  
ATOM   4758   H  HB2  . ALA A 1 92  ? -16.145 -0.166  -12.190 1.00 15.00 ?  134 ALA A HB2  2  
ATOM   4759   H  HB3  . ALA A 1 92  ? -16.333 0.241   -13.897 1.00 15.00 ?  134 ALA A HB3  2  
ATOM   4760   N  N    . ALA A 1 93  ? -16.991 2.072   -10.185 1.00 15.00 ?  135 ALA A N    2  
ATOM   4761   C  CA   . ALA A 1 93  ? -17.767 2.386   -8.990  1.00 15.00 ?  135 ALA A CA   2  
ATOM   4762   C  C    . ALA A 1 93  ? -17.884 3.894   -8.772  1.00 15.00 ?  135 ALA A C    2  
ATOM   4763   O  O    . ALA A 1 93  ? -18.797 4.362   -8.090  1.00 15.00 ?  135 ALA A O    2  
ATOM   4764   C  CB   . ALA A 1 93  ? -17.147 1.723   -7.772  1.00 15.00 ?  135 ALA A CB   2  
ATOM   4765   H  H    . ALA A 1 93  ? -16.089 1.693   -10.086 1.00 15.00 ?  135 ALA A H    2  
ATOM   4766   H  HA   . ALA A 1 93  ? -18.757 1.976   -9.126  1.00 15.00 ?  135 ALA A HA   2  
ATOM   4767   H  HB1  . ALA A 1 93  ? -16.184 2.168   -7.571  1.00 15.00 ?  135 ALA A HB1  2  
ATOM   4768   H  HB2  . ALA A 1 93  ? -17.022 0.666   -7.961  1.00 15.00 ?  135 ALA A HB2  2  
ATOM   4769   H  HB3  . ALA A 1 93  ? -17.793 1.864   -6.919  1.00 15.00 ?  135 ALA A HB3  2  
ATOM   4770   N  N    . GLY A 1 94  ? -16.955 4.647   -9.344  1.00 15.00 ?  136 GLY A N    2  
ATOM   4771   C  CA   . GLY A 1 94  ? -16.967 6.089   -9.198  1.00 15.00 ?  136 GLY A CA   2  
ATOM   4772   C  C    . GLY A 1 94  ? -16.099 6.543   -8.039  1.00 15.00 ?  136 GLY A C    2  
ATOM   4773   O  O    . GLY A 1 94  ? -16.578 7.188   -7.104  1.00 15.00 ?  136 GLY A O    2  
ATOM   4774   H  H    . GLY A 1 94  ? -16.243 4.216   -9.865  1.00 15.00 ?  136 GLY A H    2  
ATOM   4775   H  HA2  . GLY A 1 94  ? -16.601 6.540   -10.111 1.00 15.00 ?  136 GLY A HA2  2  
ATOM   4776   H  HA3  . GLY A 1 94  ? -17.981 6.419   -9.029  1.00 15.00 ?  136 GLY A HA3  2  
ATOM   4777   N  N    . ILE A 1 95  ? -14.828 6.178   -8.087  1.00 15.00 ?  137 ILE A N    2  
ATOM   4778   C  CA   . ILE A 1 95  ? -13.884 6.537   -7.043  1.00 15.00 ?  137 ILE A CA   2  
ATOM   4779   C  C    . ILE A 1 95  ? -12.634 7.175   -7.645  1.00 15.00 ?  137 ILE A C    2  
ATOM   4780   O  O    . ILE A 1 95  ? -12.009 6.606   -8.541  1.00 15.00 ?  137 ILE A O    2  
ATOM   4781   C  CB   . ILE A 1 95  ? -13.485 5.300   -6.205  1.00 15.00 ?  137 ILE A CB   2  
ATOM   4782   C  CG1  . ILE A 1 95  ? -14.732 4.651   -5.589  1.00 15.00 ?  137 ILE A CG1  2  
ATOM   4783   C  CG2  . ILE A 1 95  ? -12.495 5.694   -5.121  1.00 15.00 ?  137 ILE A CG2  2  
ATOM   4784   C  CD1  . ILE A 1 95  ? -14.495 3.251   -5.068  1.00 15.00 ?  137 ILE A CD1  2  
ATOM   4785   H  H    . ILE A 1 95  ? -14.512 5.644   -8.848  1.00 15.00 ?  137 ILE A H    2  
ATOM   4786   H  HA   . ILE A 1 95  ? -14.361 7.250   -6.390  1.00 15.00 ?  137 ILE A HA   2  
ATOM   4787   H  HB   . ILE A 1 95  ? -13.006 4.587   -6.858  1.00 15.00 ?  137 ILE A HB   2  
ATOM   4788   H  HG12 . ILE A 1 95  ? -15.076 5.258   -4.764  1.00 15.00 ?  137 ILE A HG12 2  
ATOM   4789   H  HG13 . ILE A 1 95  ? -15.509 4.598   -6.337  1.00 15.00 ?  137 ILE A HG13 2  
ATOM   4790   H  HG21 . ILE A 1 95  ? -11.666 6.223   -5.571  1.00 15.00 ?  137 ILE A HG21 2  
ATOM   4791   H  HG22 . ILE A 1 95  ? -12.131 4.809   -4.622  1.00 15.00 ?  137 ILE A HG22 2  
ATOM   4792   H  HG23 . ILE A 1 95  ? -12.987 6.337   -4.404  1.00 15.00 ?  137 ILE A HG23 2  
ATOM   4793   H  HD11 . ILE A 1 95  ? -13.712 3.271   -4.327  1.00 15.00 ?  137 ILE A HD11 2  
ATOM   4794   H  HD12 . ILE A 1 95  ? -14.200 2.610   -5.883  1.00 15.00 ?  137 ILE A HD12 2  
ATOM   4795   H  HD13 . ILE A 1 95  ? -15.401 2.872   -4.620  1.00 15.00 ?  137 ILE A HD13 2  
ATOM   4796   N  N    . ALA A 1 96  ? -12.298 8.367   -7.160  1.00 15.00 ?  138 ALA A N    2  
ATOM   4797   C  CA   . ALA A 1 96  ? -11.125 9.089   -7.633  1.00 15.00 ?  138 ALA A CA   2  
ATOM   4798   C  C    . ALA A 1 96  ? -9.857  8.336   -7.259  1.00 15.00 ?  138 ALA A C    2  
ATOM   4799   O  O    . ALA A 1 96  ? -9.564  8.137   -6.081  1.00 15.00 ?  138 ALA A O    2  
ATOM   4800   C  CB   . ALA A 1 96  ? -11.099 10.500  -7.062  1.00 15.00 ?  138 ALA A CB   2  
ATOM   4801   H  H    . ALA A 1 96  ? -12.853 8.768   -6.458  1.00 15.00 ?  138 ALA A H    2  
ATOM   4802   H  HA   . ALA A 1 96  ? -11.186 9.155   -8.710  1.00 15.00 ?  138 ALA A HA   2  
ATOM   4803   H  HB1  . ALA A 1 96  ? -10.994 10.451  -5.989  1.00 15.00 ?  138 ALA A HB1  2  
ATOM   4804   H  HB2  . ALA A 1 96  ? -12.021 11.001  -7.311  1.00 15.00 ?  138 ALA A HB2  2  
ATOM   4805   H  HB3  . ALA A 1 96  ? -10.265 11.046  -7.480  1.00 15.00 ?  138 ALA A HB3  2  
ATOM   4806   N  N    . THR A 1 97  ? -9.119  7.901   -8.260  1.00 15.00 ?  139 THR A N    2  
ATOM   4807   C  CA   . THR A 1 97  ? -7.896  7.157   -8.025  1.00 15.00 ?  139 THR A CA   2  
ATOM   4808   C  C    . THR A 1 97  ? -6.667  8.062   -8.069  1.00 15.00 ?  139 THR A C    2  
ATOM   4809   O  O    . THR A 1 97  ? -6.480  8.835   -9.010  1.00 15.00 ?  139 THR A O    2  
ATOM   4810   C  CB   . THR A 1 97  ? -7.742  6.022   -9.049  1.00 15.00 ?  139 THR A CB   2  
ATOM   4811   O  OG1  . THR A 1 97  ? -8.050  6.505   -10.363 1.00 15.00 ?  139 THR A OG1  2  
ATOM   4812   C  CG2  . THR A 1 97  ? -8.663  4.865   -8.698  1.00 15.00 ?  139 THR A CG2  2  
ATOM   4813   H  H    . THR A 1 97  ? -9.405  8.073   -9.182  1.00 15.00 ?  139 THR A H    2  
ATOM   4814   H  HA   . THR A 1 97  ? -7.964  6.710   -7.041  1.00 15.00 ?  139 THR A HA   2  
ATOM   4815   H  HB   . THR A 1 97  ? -6.721  5.673   -9.028  1.00 15.00 ?  139 THR A HB   2  
ATOM   4816   H  HG1  . THR A 1 97  ? -8.491  5.806   -10.869 1.00 15.00 ?  139 THR A HG1  2  
ATOM   4817   H  HG21 . THR A 1 97  ? -8.479  4.041   -9.369  1.00 15.00 ?  139 THR A HG21 2  
ATOM   4818   H  HG22 . THR A 1 97  ? -9.690  5.185   -8.795  1.00 15.00 ?  139 THR A HG22 2  
ATOM   4819   H  HG23 . THR A 1 97  ? -8.477  4.553   -7.684  1.00 15.00 ?  139 THR A HG23 2  
ATOM   4820   N  N    . TYR A 1 98  ? -5.841  7.958   -7.038  1.00 15.00 ?  140 TYR A N    2  
ATOM   4821   C  CA   . TYR A 1 98  ? -4.622  8.747   -6.933  1.00 15.00 ?  140 TYR A CA   2  
ATOM   4822   C  C    . TYR A 1 98  ? -3.411  7.828   -6.952  1.00 15.00 ?  140 TYR A C    2  
ATOM   4823   O  O    . TYR A 1 98  ? -3.382  6.820   -6.246  1.00 15.00 ?  140 TYR A O    2  
ATOM   4824   C  CB   . TYR A 1 98  ? -4.624  9.569   -5.637  1.00 15.00 ?  140 TYR A CB   2  
ATOM   4825   C  CG   . TYR A 1 98  ? -5.554  10.762  -5.653  1.00 15.00 ?  140 TYR A CG   2  
ATOM   4826   C  CD1  . TYR A 1 98  ? -6.903  10.619  -5.360  1.00 15.00 ?  140 TYR A CD1  2  
ATOM   4827   C  CD2  . TYR A 1 98  ? -5.076  12.032  -5.948  1.00 15.00 ?  140 TYR A CD2  2  
ATOM   4828   C  CE1  . TYR A 1 98  ? -7.753  11.710  -5.359  1.00 15.00 ?  140 TYR A CE1  2  
ATOM   4829   C  CE2  . TYR A 1 98  ? -5.920  13.128  -5.950  1.00 15.00 ?  140 TYR A CE2  2  
ATOM   4830   C  CZ   . TYR A 1 98  ? -7.256  12.961  -5.653  1.00 15.00 ?  140 TYR A CZ   2  
ATOM   4831   O  OH   . TYR A 1 98  ? -8.098  14.051  -5.647  1.00 15.00 ?  140 TYR A OH   2  
ATOM   4832   H  H    . TYR A 1 98  ? -6.051  7.317   -6.322  1.00 15.00 ?  140 TYR A H    2  
ATOM   4833   H  HA   . TYR A 1 98  ? -4.574  9.413   -7.781  1.00 15.00 ?  140 TYR A HA   2  
ATOM   4834   H  HB2  . TYR A 1 98  ? -4.922  8.933   -4.818  1.00 15.00 ?  140 TYR A HB2  2  
ATOM   4835   H  HB3  . TYR A 1 98  ? -3.623  9.933   -5.454  1.00 15.00 ?  140 TYR A HB3  2  
ATOM   4836   H  HD1  . TYR A 1 98  ? -7.290  9.636   -5.132  1.00 15.00 ?  140 TYR A HD1  2  
ATOM   4837   H  HD2  . TYR A 1 98  ? -4.029  12.157  -6.181  1.00 15.00 ?  140 TYR A HD2  2  
ATOM   4838   H  HE1  . TYR A 1 98  ? -8.803  11.580  -5.130  1.00 15.00 ?  140 TYR A HE1  2  
ATOM   4839   H  HE2  . TYR A 1 98  ? -5.529  14.109  -6.179  1.00 15.00 ?  140 TYR A HE2  2  
ATOM   4840   H  HH   . TYR A 1 98  ? -8.443  14.181  -4.758  1.00 15.00 ?  140 TYR A HH   2  
ATOM   4841   N  N    . ALA A 1 99  ? -2.429  8.167   -7.766  1.00 15.00 ?  141 ALA A N    2  
ATOM   4842   C  CA   . ALA A 1 99  ? -1.215  7.373   -7.865  1.00 15.00 ?  141 ALA A CA   2  
ATOM   4843   C  C    . ALA A 1 99  ? -0.028  8.269   -8.175  1.00 15.00 ?  141 ALA A C    2  
ATOM   4844   O  O    . ALA A 1 99  ? -0.205  9.401   -8.620  1.00 15.00 ?  141 ALA A O    2  
ATOM   4845   C  CB   . ALA A 1 99  ? -1.359  6.302   -8.937  1.00 15.00 ?  141 ALA A CB   2  
ATOM   4846   H  H    . ALA A 1 99  ? -2.517  8.974   -8.319  1.00 15.00 ?  141 ALA A H    2  
ATOM   4847   H  HA   . ALA A 1 99  ? -1.054  6.886   -6.915  1.00 15.00 ?  141 ALA A HA   2  
ATOM   4848   H  HB1  . ALA A 1 99  ? -1.525  6.769   -9.894  1.00 15.00 ?  141 ALA A HB1  2  
ATOM   4849   H  HB2  . ALA A 1 99  ? -2.198  5.666   -8.700  1.00 15.00 ?  141 ALA A HB2  2  
ATOM   4850   H  HB3  . ALA A 1 99  ? -0.458  5.710   -8.978  1.00 15.00 ?  141 ALA A HB3  2  
ATOM   4851   N  N    . ASN A 1 100 ? 1.173   7.768   -7.930  1.00 15.00 ?  142 ASN A N    2  
ATOM   4852   C  CA   . ASN A 1 100 ? 2.386   8.522   -8.204  1.00 15.00 ?  142 ASN A CA   2  
ATOM   4853   C  C    . ASN A 1 100 ? 2.499   8.773   -9.707  1.00 15.00 ?  142 ASN A C    2  
ATOM   4854   O  O    . ASN A 1 100 ? 2.089   7.934   -10.513 1.00 15.00 ?  142 ASN A O    2  
ATOM   4855   C  CB   . ASN A 1 100 ? 3.607   7.757   -7.672  1.00 15.00 ?  142 ASN A CB   2  
ATOM   4856   C  CG   . ASN A 1 100 ? 4.928   8.436   -7.985  1.00 15.00 ?  142 ASN A CG   2  
ATOM   4857   O  OD1  . ASN A 1 100 ? 5.002   9.653   -8.144  1.00 15.00 ?  142 ASN A OD1  2  
ATOM   4858   N  ND2  . ASN A 1 100 ? 5.984   7.647   -8.072  1.00 15.00 ?  142 ASN A ND2  2  
ATOM   4859   H  H    . ASN A 1 100 ? 1.249   6.860   -7.570  1.00 15.00 ?  142 ASN A H    2  
ATOM   4860   H  HA   . ASN A 1 100 ? 2.312   9.474   -7.694  1.00 15.00 ?  142 ASN A HA   2  
ATOM   4861   H  HB2  . ASN A 1 100 ? 3.523   7.661   -6.598  1.00 15.00 ?  142 ASN A HB2  2  
ATOM   4862   H  HB3  . ASN A 1 100 ? 3.618   6.770   -8.113  1.00 15.00 ?  142 ASN A HB3  2  
ATOM   4863   H  HD21 . ASN A 1 100 ? 5.854   6.683   -7.928  1.00 15.00 ?  142 ASN A HD21 2  
ATOM   4864   H  HD22 . ASN A 1 100 ? 6.852   8.054   -8.270  1.00 15.00 ?  142 ASN A HD22 2  
ATOM   4865   N  N    . ALA A 1 101 ? 3.035   9.936   -10.073 1.00 15.00 ?  143 ALA A N    2  
ATOM   4866   C  CA   . ALA A 1 101 ? 3.189   10.324  -11.476 1.00 15.00 ?  143 ALA A CA   2  
ATOM   4867   C  C    . ALA A 1 101 ? 3.895   9.246   -12.294 1.00 15.00 ?  143 ALA A C    2  
ATOM   4868   O  O    . ALA A 1 101 ? 3.458   8.895   -13.393 1.00 15.00 ?  143 ALA A O    2  
ATOM   4869   C  CB   . ALA A 1 101 ? 3.950   11.642  -11.573 1.00 15.00 ?  143 ALA A CB   2  
ATOM   4870   H  H    . ALA A 1 101 ? 3.342   10.555  -9.372  1.00 15.00 ?  143 ALA A H    2  
ATOM   4871   H  HA   . ALA A 1 101 ? 2.202   10.476  -11.885 1.00 15.00 ?  143 ALA A HA   2  
ATOM   4872   H  HB1  . ALA A 1 101 ? 3.623   12.306  -10.783 1.00 15.00 ?  143 ALA A HB1  2  
ATOM   4873   H  HB2  . ALA A 1 101 ? 3.755   12.102  -12.529 1.00 15.00 ?  143 ALA A HB2  2  
ATOM   4874   H  HB3  . ALA A 1 101 ? 5.010   11.455  -11.474 1.00 15.00 ?  143 ALA A HB3  2  
ATOM   4875   N  N    . LEU A 1 102 ? 4.975   8.712   -11.746 1.00 15.00 ?  144 LEU A N    2  
ATOM   4876   C  CA   . LEU A 1 102 ? 5.742   7.682   -12.428 1.00 15.00 ?  144 LEU A CA   2  
ATOM   4877   C  C    . LEU A 1 102 ? 4.940   6.384   -12.525 1.00 15.00 ?  144 LEU A C    2  
ATOM   4878   O  O    . LEU A 1 102 ? 5.003   5.684   -13.534 1.00 15.00 ?  144 LEU A O    2  
ATOM   4879   C  CB   . LEU A 1 102 ? 7.071   7.438   -11.706 1.00 15.00 ?  144 LEU A CB   2  
ATOM   4880   C  CG   . LEU A 1 102 ? 8.067   6.554   -12.461 1.00 15.00 ?  144 LEU A CG   2  
ATOM   4881   C  CD1  . LEU A 1 102 ? 8.455   7.184   -13.791 1.00 15.00 ?  144 LEU A CD1  2  
ATOM   4882   C  CD2  . LEU A 1 102 ? 9.301   6.303   -11.612 1.00 15.00 ?  144 LEU A CD2  2  
ATOM   4883   H  H    . LEU A 1 102 ? 5.261   9.018   -10.862 1.00 15.00 ?  144 LEU A H    2  
ATOM   4884   H  HA   . LEU A 1 102 ? 5.949   8.033   -13.426 1.00 15.00 ?  144 LEU A HA   2  
ATOM   4885   H  HB2  . LEU A 1 102 ? 7.537   8.395   -11.519 1.00 15.00 ?  144 LEU A HB2  2  
ATOM   4886   H  HB3  . LEU A 1 102 ? 6.857   6.969   -10.756 1.00 15.00 ?  144 LEU A HB3  2  
ATOM   4887   H  HG   . LEU A 1 102 ? 7.605   5.602   -12.666 1.00 15.00 ?  144 LEU A HG   2  
ATOM   4888   H  HD11 . LEU A 1 102 ? 8.947   8.130   -13.616 1.00 15.00 ?  144 LEU A HD11 2  
ATOM   4889   H  HD12 . LEU A 1 102 ? 7.570   7.343   -14.386 1.00 15.00 ?  144 LEU A HD12 2  
ATOM   4890   H  HD13 . LEU A 1 102 ? 9.128   6.521   -14.318 1.00 15.00 ?  144 LEU A HD13 2  
ATOM   4891   H  HD21 . LEU A 1 102 ? 9.785   7.245   -11.396 1.00 15.00 ?  144 LEU A HD21 2  
ATOM   4892   H  HD22 . LEU A 1 102 ? 9.983   5.662   -12.149 1.00 15.00 ?  144 LEU A HD22 2  
ATOM   4893   H  HD23 . LEU A 1 102 ? 9.010   5.828   -10.685 1.00 15.00 ?  144 LEU A HD23 2  
ATOM   4894   N  N    . SER A 1 103 ? 4.168   6.085   -11.485 1.00 15.00 ?  145 SER A N    2  
ATOM   4895   C  CA   . SER A 1 103 ? 3.356   4.876   -11.460 1.00 15.00 ?  145 SER A CA   2  
ATOM   4896   C  C    . SER A 1 103 ? 2.352   4.873   -12.605 1.00 15.00 ?  145 SER A C    2  
ATOM   4897   O  O    . SER A 1 103 ? 2.165   3.862   -13.276 1.00 15.00 ?  145 SER A O    2  
ATOM   4898   C  CB   . SER A 1 103 ? 2.616   4.768   -10.131 1.00 15.00 ?  145 SER A CB   2  
ATOM   4899   O  OG   . SER A 1 103 ? 3.502   4.971   -9.051  1.00 15.00 ?  145 SER A OG   2  
ATOM   4900   H  H    . SER A 1 103 ? 4.145   6.689   -10.713 1.00 15.00 ?  145 SER A H    2  
ATOM   4901   H  HA   . SER A 1 103 ? 4.016   4.028   -11.568 1.00 15.00 ?  145 SER A HA   2  
ATOM   4902   H  HB2  . SER A 1 103 ? 1.835   5.514   -10.089 1.00 15.00 ?  145 SER A HB2  2  
ATOM   4903   H  HB3  . SER A 1 103 ? 2.181   3.784   -10.044 1.00 15.00 ?  145 SER A HB3  2  
ATOM   4904   H  HG   . SER A 1 103 ? 4.066   4.179   -8.957  1.00 15.00 ?  145 SER A HG   2  
ATOM   4905   N  N    . ASN A 1 104 ? 1.727   6.019   -12.834 1.00 15.00 ?  146 ASN A N    2  
ATOM   4906   C  CA   . ASN A 1 104 ? 0.736   6.152   -13.894 1.00 15.00 ?  146 ASN A CA   2  
ATOM   4907   C  C    . ASN A 1 104 ? 1.378   6.043   -15.274 1.00 15.00 ?  146 ASN A C    2  
ATOM   4908   O  O    . ASN A 1 104 ? 0.720   5.673   -16.247 1.00 15.00 ?  146 ASN A O    2  
ATOM   4909   C  CB   . ASN A 1 104 ? -0.023  7.478   -13.760 1.00 15.00 ?  146 ASN A CB   2  
ATOM   4910   C  CG   . ASN A 1 104 ? -1.076  7.426   -12.669 1.00 15.00 ?  146 ASN A CG   2  
ATOM   4911   O  OD1  . ASN A 1 104 ? -1.538  6.350   -12.293 1.00 15.00 ?  146 ASN A OD1  2  
ATOM   4912   N  ND2  . ASN A 1 104 ? -1.471  8.585   -12.161 1.00 15.00 ?  146 ASN A ND2  2  
ATOM   4913   H  H    . ASN A 1 104 ? 1.930   6.795   -12.265 1.00 15.00 ?  146 ASN A H    2  
ATOM   4914   H  HA   . ASN A 1 104 ? 0.033   5.338   -13.780 1.00 15.00 ?  146 ASN A HA   2  
ATOM   4915   H  HB2  . ASN A 1 104 ? 0.677   8.265   -13.523 1.00 15.00 ?  146 ASN A HB2  2  
ATOM   4916   H  HB3  . ASN A 1 104 ? -0.510  7.705   -14.698 1.00 15.00 ?  146 ASN A HB3  2  
ATOM   4917   H  HD21 . ASN A 1 104 ? -1.067  9.414   -12.513 1.00 15.00 ?  146 ASN A HD21 2  
ATOM   4918   H  HD22 . ASN A 1 104 ? -2.153  8.577   -11.456 1.00 15.00 ?  146 ASN A HD22 2  
ATOM   4919   N  N    . GLN A 1 105 ? 2.666   6.357   -15.353 1.00 15.00 ?  147 GLN A N    2  
ATOM   4920   C  CA   . GLN A 1 105 ? 3.394   6.287   -16.615 1.00 15.00 ?  147 GLN A CA   2  
ATOM   4921   C  C    . GLN A 1 105 ? 3.823   4.849   -16.905 1.00 15.00 ?  147 GLN A C    2  
ATOM   4922   O  O    . GLN A 1 105 ? 3.811   4.401   -18.054 1.00 15.00 ?  147 GLN A O    2  
ATOM   4923   C  CB   . GLN A 1 105 ? 4.618   7.211   -16.570 1.00 15.00 ?  147 GLN A CB   2  
ATOM   4924   C  CG   . GLN A 1 105 ? 5.463   7.173   -17.835 1.00 15.00 ?  147 GLN A CG   2  
ATOM   4925   C  CD   . GLN A 1 105 ? 6.594   8.187   -17.824 1.00 15.00 ?  147 GLN A CD   2  
ATOM   4926   O  OE1  . GLN A 1 105 ? 6.464   9.281   -17.272 1.00 15.00 ?  147 GLN A OE1  2  
ATOM   4927   N  NE2  . GLN A 1 105 ? 7.714   7.827   -18.429 1.00 15.00 ?  147 GLN A NE2  2  
ATOM   4928   H  H    . GLN A 1 105 ? 3.137   6.637   -14.544 1.00 15.00 ?  147 GLN A H    2  
ATOM   4929   H  HA   . GLN A 1 105 ? 2.729   6.620   -17.399 1.00 15.00 ?  147 GLN A HA   2  
ATOM   4930   H  HB2  . GLN A 1 105 ? 4.282   8.227   -16.419 1.00 15.00 ?  147 GLN A HB2  2  
ATOM   4931   H  HB3  . GLN A 1 105 ? 5.243   6.922   -15.737 1.00 15.00 ?  147 GLN A HB3  2  
ATOM   4932   H  HG2  . GLN A 1 105 ? 5.890   6.184   -17.935 1.00 15.00 ?  147 GLN A HG2  2  
ATOM   4933   H  HG3  . GLN A 1 105 ? 4.827   7.376   -18.682 1.00 15.00 ?  147 GLN A HG3  2  
ATOM   4934   H  HE21 . GLN A 1 105 ? 7.753   6.935   -18.842 1.00 15.00 ?  147 GLN A HE21 2  
ATOM   4935   H  HE22 . GLN A 1 105 ? 8.461   8.461   -18.441 1.00 15.00 ?  147 GLN A HE22 2  
ATOM   4936   N  N    . LEU A 1 106 ? 4.184   4.125   -15.852 1.00 15.00 ?  148 LEU A N    2  
ATOM   4937   C  CA   . LEU A 1 106 ? 4.621   2.738   -15.982 1.00 15.00 ?  148 LEU A CA   2  
ATOM   4938   C  C    . LEU A 1 106 ? 3.439   1.772   -15.946 1.00 15.00 ?  148 LEU A C    2  
ATOM   4939   O  O    . LEU A 1 106 ? 3.597   0.583   -16.214 1.00 15.00 ?  148 LEU A O    2  
ATOM   4940   C  CB   . LEU A 1 106 ? 5.603   2.390   -14.859 1.00 15.00 ?  148 LEU A CB   2  
ATOM   4941   C  CG   . LEU A 1 106 ? 6.885   3.231   -14.821 1.00 15.00 ?  148 LEU A CG   2  
ATOM   4942   C  CD1  . LEU A 1 106 ? 7.585   3.074   -13.483 1.00 15.00 ?  148 LEU A CD1  2  
ATOM   4943   C  CD2  . LEU A 1 106 ? 7.814   2.827   -15.953 1.00 15.00 ?  148 LEU A CD2  2  
ATOM   4944   H  H    . LEU A 1 106 ? 4.167   4.538   -14.960 1.00 15.00 ?  148 LEU A H    2  
ATOM   4945   H  HA   . LEU A 1 106 ? 5.124   2.635   -16.932 1.00 15.00 ?  148 LEU A HA   2  
ATOM   4946   H  HB2  . LEU A 1 106 ? 5.092   2.507   -13.914 1.00 15.00 ?  148 LEU A HB2  2  
ATOM   4947   H  HB3  . LEU A 1 106 ? 5.886   1.352   -14.966 1.00 15.00 ?  148 LEU A HB3  2  
ATOM   4948   H  HG   . LEU A 1 106 ? 6.630   4.274   -14.950 1.00 15.00 ?  148 LEU A HG   2  
ATOM   4949   H  HD11 . LEU A 1 106 ? 7.863   2.041   -13.343 1.00 15.00 ?  148 LEU A HD11 2  
ATOM   4950   H  HD12 . LEU A 1 106 ? 6.917   3.379   -12.688 1.00 15.00 ?  148 LEU A HD12 2  
ATOM   4951   H  HD13 . LEU A 1 106 ? 8.471   3.691   -13.467 1.00 15.00 ?  148 LEU A HD13 2  
ATOM   4952   H  HD21 . LEU A 1 106 ? 7.442   3.231   -16.885 1.00 15.00 ?  148 LEU A HD21 2  
ATOM   4953   H  HD22 . LEU A 1 106 ? 7.850   1.750   -16.019 1.00 15.00 ?  148 LEU A HD22 2  
ATOM   4954   H  HD23 . LEU A 1 106 ? 8.805   3.211   -15.760 1.00 15.00 ?  148 LEU A HD23 2  
ATOM   4955   N  N    . ALA A 1 107 ? 2.259   2.295   -15.627 1.00 15.00 ?  149 ALA A N    2  
ATOM   4956   C  CA   . ALA A 1 107 ? 1.042   1.485   -15.532 1.00 15.00 ?  149 ALA A CA   2  
ATOM   4957   C  C    . ALA A 1 107 ? 0.801   0.622   -16.782 1.00 15.00 ?  149 ALA A C    2  
ATOM   4958   O  O    . ALA A 1 107 ? 0.662   -0.593  -16.660 1.00 15.00 ?  149 ALA A O    2  
ATOM   4959   C  CB   . ALA A 1 107 ? -0.169  2.362   -15.231 1.00 15.00 ?  149 ALA A CB   2  
ATOM   4960   H  H    . ALA A 1 107 ? 2.205   3.254   -15.436 1.00 15.00 ?  149 ALA A H    2  
ATOM   4961   H  HA   . ALA A 1 107 ? 1.172   0.820   -14.692 1.00 15.00 ?  149 ALA A HA   2  
ATOM   4962   H  HB1  . ALA A 1 107 ? -1.070  1.850   -15.540 1.00 15.00 ?  149 ALA A HB1  2  
ATOM   4963   H  HB2  . ALA A 1 107 ? -0.081  3.298   -15.765 1.00 15.00 ?  149 ALA A HB2  2  
ATOM   4964   H  HB3  . ALA A 1 107 ? -0.214  2.560   -14.171 1.00 15.00 ?  149 ALA A HB3  2  
ATOM   4965   N  N    . PRO A 1 108 ? 0.764   1.205   -18.004 1.00 15.00 ?  150 PRO A N    2  
ATOM   4966   C  CA   . PRO A 1 108 ? 0.528   0.423   -19.223 1.00 15.00 ?  150 PRO A CA   2  
ATOM   4967   C  C    . PRO A 1 108 ? 1.661   -0.557  -19.512 1.00 15.00 ?  150 PRO A C    2  
ATOM   4968   O  O    . PRO A 1 108 ? 1.460   -1.588  -20.155 1.00 15.00 ?  150 PRO A O    2  
ATOM   4969   C  CB   . PRO A 1 108 ? 0.444   1.475   -20.336 1.00 15.00 ?  150 PRO A CB   2  
ATOM   4970   C  CG   . PRO A 1 108 ? 0.274   2.782   -19.644 1.00 15.00 ?  150 PRO A CG   2  
ATOM   4971   C  CD   . PRO A 1 108 ? 0.942   2.639   -18.311 1.00 15.00 ?  150 PRO A CD   2  
ATOM   4972   H  HA   . PRO A 1 108 ? -0.405  -0.117  -19.166 1.00 15.00 ?  150 PRO A HA   2  
ATOM   4973   H  HB2  . PRO A 1 108 ? 1.359   1.459   -20.918 1.00 15.00 ?  150 PRO A HB2  2  
ATOM   4974   H  HB3  . PRO A 1 108 ? -0.404  1.276   -20.969 1.00 15.00 ?  150 PRO A HB3  2  
ATOM   4975   H  HG2  . PRO A 1 108 ? 0.749   3.562   -20.219 1.00 15.00 ?  150 PRO A HG2  2  
ATOM   4976   H  HG3  . PRO A 1 108 ? -0.775  2.997   -19.510 1.00 15.00 ?  150 PRO A HG3  2  
ATOM   4977   H  HD2  . PRO A 1 108 ? 1.990   2.896   -18.381 1.00 15.00 ?  150 PRO A HD2  2  
ATOM   4978   H  HD3  . PRO A 1 108 ? 0.450   3.255   -17.575 1.00 15.00 ?  150 PRO A HD3  2  
ATOM   4979   N  N    . GLN A 1 109 ? 2.846   -0.235  -19.015 1.00 15.00 ?  151 GLN A N    2  
ATOM   4980   C  CA   . GLN A 1 109 ? 4.017   -1.072  -19.221 1.00 15.00 ?  151 GLN A CA   2  
ATOM   4981   C  C    . GLN A 1 109 ? 3.939   -2.327  -18.363 1.00 15.00 ?  151 GLN A C    2  
ATOM   4982   O  O    . GLN A 1 109 ? 4.308   -3.418  -18.797 1.00 15.00 ?  151 GLN A O    2  
ATOM   4983   C  CB   . GLN A 1 109 ? 5.292   -0.285  -18.904 1.00 15.00 ?  151 GLN A CB   2  
ATOM   4984   C  CG   . GLN A 1 109 ? 5.395   1.022   -19.674 1.00 15.00 ?  151 GLN A CG   2  
ATOM   4985   C  CD   . GLN A 1 109 ? 6.641   1.817   -19.334 1.00 15.00 ?  151 GLN A CD   2  
ATOM   4986   O  OE1  . GLN A 1 109 ? 7.685   1.253   -19.018 1.00 15.00 ?  151 GLN A OE1  2  
ATOM   4987   N  NE2  . GLN A 1 109 ? 6.538   3.136   -19.402 1.00 15.00 ?  151 GLN A NE2  2  
ATOM   4988   H  H    . GLN A 1 109 ? 2.935   0.586   -18.486 1.00 15.00 ?  151 GLN A H    2  
ATOM   4989   H  HA   . GLN A 1 109 ? 4.034   -1.362  -20.261 1.00 15.00 ?  151 GLN A HA   2  
ATOM   4990   H  HB2  . GLN A 1 109 ? 5.314   -0.065  -17.846 1.00 15.00 ?  151 GLN A HB2  2  
ATOM   4991   H  HB3  . GLN A 1 109 ? 6.149   -0.894  -19.153 1.00 15.00 ?  151 GLN A HB3  2  
ATOM   4992   H  HG2  . GLN A 1 109 ? 5.409   0.800   -20.731 1.00 15.00 ?  151 GLN A HG2  2  
ATOM   4993   H  HG3  . GLN A 1 109 ? 4.527   1.622   -19.446 1.00 15.00 ?  151 GLN A HG3  2  
ATOM   4994   H  HE21 . GLN A 1 109 ? 5.674   3.522   -19.662 1.00 15.00 ?  151 GLN A HE21 2  
ATOM   4995   H  HE22 . GLN A 1 109 ? 7.333   3.674   -19.189 1.00 15.00 ?  151 GLN A HE22 2  
ATOM   4996   N  N    . GLU A 1 110 ? 3.444   -2.166  -17.143 1.00 15.00 ?  152 GLU A N    2  
ATOM   4997   C  CA   . GLU A 1 110 ? 3.302   -3.285  -16.223 1.00 15.00 ?  152 GLU A CA   2  
ATOM   4998   C  C    . GLU A 1 110 ? 2.016   -4.056  -16.507 1.00 15.00 ?  152 GLU A C    2  
ATOM   4999   O  O    . GLU A 1 110 ? 1.854   -5.196  -16.068 1.00 15.00 ?  152 GLU A O    2  
ATOM   5000   C  CB   . GLU A 1 110 ? 3.313   -2.786  -14.776 1.00 15.00 ?  152 GLU A CB   2  
ATOM   5001   C  CG   . GLU A 1 110 ? 4.588   -2.043  -14.397 1.00 15.00 ?  152 GLU A CG   2  
ATOM   5002   C  CD   . GLU A 1 110 ? 5.844   -2.825  -14.729 1.00 15.00 ?  152 GLU A CD   2  
ATOM   5003   O  OE1  . GLU A 1 110 ? 6.200   -3.744  -13.962 1.00 15.00 ?  152 GLU A OE1  2  
ATOM   5004   O  OE2  . GLU A 1 110 ? 6.471   -2.538  -15.773 1.00 15.00 -1 152 GLU A OE2  2  
ATOM   5005   H  H    . GLU A 1 110 ? 3.177   -1.267  -16.848 1.00 15.00 ?  152 GLU A H    2  
ATOM   5006   H  HA   . GLU A 1 110 ? 4.143   -3.947  -16.371 1.00 15.00 ?  152 GLU A HA   2  
ATOM   5007   H  HB2  . GLU A 1 110 ? 2.476   -2.120  -14.636 1.00 15.00 ?  152 GLU A HB2  2  
ATOM   5008   H  HB3  . GLU A 1 110 ? 3.202   -3.630  -14.112 1.00 15.00 ?  152 GLU A HB3  2  
ATOM   5009   H  HG2  . GLU A 1 110 ? 4.616   -1.110  -14.937 1.00 15.00 ?  152 GLU A HG2  2  
ATOM   5010   H  HG3  . GLU A 1 110 ? 4.572   -1.844  -13.335 1.00 15.00 ?  152 GLU A HG3  2  
ATOM   5011   N  N    . GLY A 1 111 ? 1.105   -3.422  -17.239 1.00 15.00 ?  153 GLY A N    2  
ATOM   5012   C  CA   . GLY A 1 111 ? -0.155  -4.058  -17.574 1.00 15.00 ?  153 GLY A CA   2  
ATOM   5013   C  C    . GLY A 1 111 ? -1.249  -3.712  -16.585 1.00 15.00 ?  153 GLY A C    2  
ATOM   5014   O  O    . GLY A 1 111 ? -2.158  -4.507  -16.341 1.00 15.00 ?  153 GLY A O    2  
ATOM   5015   H  H    . GLY A 1 111 ? 1.291   -2.511  -17.554 1.00 15.00 ?  153 GLY A H    2  
ATOM   5016   H  HA2  . GLY A 1 111 ? -0.458  -3.738  -18.561 1.00 15.00 ?  153 GLY A HA2  2  
ATOM   5017   H  HA3  . GLY A 1 111 ? -0.016  -5.130  -17.581 1.00 15.00 ?  153 GLY A HA3  2  
ATOM   5018   N  N    . MET A 1 112 ? -1.159  -2.519  -16.017 1.00 15.00 ?  154 MET A N    2  
ATOM   5019   C  CA   . MET A 1 112 ? -2.140  -2.061  -15.046 1.00 15.00 ?  154 MET A CA   2  
ATOM   5020   C  C    . MET A 1 112 ? -2.862  -0.833  -15.567 1.00 15.00 ?  154 MET A C    2  
ATOM   5021   O  O    . MET A 1 112 ? -2.407  -0.195  -16.515 1.00 15.00 ?  154 MET A O    2  
ATOM   5022   C  CB   . MET A 1 112 ? -1.470  -1.728  -13.711 1.00 15.00 ?  154 MET A CB   2  
ATOM   5023   C  CG   . MET A 1 112 ? -0.654  -2.868  -13.135 1.00 15.00 ?  154 MET A CG   2  
ATOM   5024   S  SD   . MET A 1 112 ? -1.638  -4.351  -12.852 1.00 15.00 ?  154 MET A SD   2  
ATOM   5025   C  CE   . MET A 1 112 ? -0.477  -5.619  -13.355 1.00 15.00 ?  154 MET A CE   2  
ATOM   5026   H  H    . MET A 1 112 ? -0.420  -1.923  -16.269 1.00 15.00 ?  154 MET A H    2  
ATOM   5027   H  HA   . MET A 1 112 ? -2.856  -2.853  -14.894 1.00 15.00 ?  154 MET A HA   2  
ATOM   5028   H  HB2  . MET A 1 112 ? -0.818  -0.880  -13.848 1.00 15.00 ?  154 MET A HB2  2  
ATOM   5029   H  HB3  . MET A 1 112 ? -2.240  -1.467  -12.998 1.00 15.00 ?  154 MET A HB3  2  
ATOM   5030   H  HG2  . MET A 1 112 ? 0.142   -3.108  -13.826 1.00 15.00 ?  154 MET A HG2  2  
ATOM   5031   H  HG3  . MET A 1 112 ? -0.228  -2.548  -12.197 1.00 15.00 ?  154 MET A HG3  2  
ATOM   5032   H  HE1  . MET A 1 112 ? -0.244  -5.495  -14.402 1.00 15.00 ?  154 MET A HE1  2  
ATOM   5033   H  HE2  . MET A 1 112 ? -0.915  -6.594  -13.196 1.00 15.00 ?  154 MET A HE2  2  
ATOM   5034   H  HE3  . MET A 1 112 ? 0.426   -5.530  -12.774 1.00 15.00 ?  154 MET A HE3  2  
ATOM   5035   N  N    . VAL A 1 113 ? -3.988  -0.508  -14.952 1.00 15.00 ?  155 VAL A N    2  
ATOM   5036   C  CA   . VAL A 1 113 ? -4.767  0.655   -15.348 1.00 15.00 ?  155 VAL A CA   2  
ATOM   5037   C  C    . VAL A 1 113 ? -4.270  1.894   -14.610 1.00 15.00 ?  155 VAL A C    2  
ATOM   5038   O  O    . VAL A 1 113 ? -4.223  1.911   -13.380 1.00 15.00 ?  155 VAL A O    2  
ATOM   5039   C  CB   . VAL A 1 113 ? -6.276  0.454   -15.067 1.00 15.00 ?  155 VAL A CB   2  
ATOM   5040   C  CG1  . VAL A 1 113 ? -7.073  1.704   -15.419 1.00 15.00 ?  155 VAL A CG1  2  
ATOM   5041   C  CG2  . VAL A 1 113 ? -6.807  -0.755  -15.828 1.00 15.00 ?  155 VAL A CG2  2  
ATOM   5042   H  H    . VAL A 1 113 ? -4.305  -1.065  -14.208 1.00 15.00 ?  155 VAL A H    2  
ATOM   5043   H  HA   . VAL A 1 113 ? -4.630  0.802   -16.408 1.00 15.00 ?  155 VAL A HA   2  
ATOM   5044   H  HB   . VAL A 1 113 ? -6.400  0.267   -14.014 1.00 15.00 ?  155 VAL A HB   2  
ATOM   5045   H  HG11 . VAL A 1 113 ? -8.127  1.509   -15.291 1.00 15.00 ?  155 VAL A HG11 2  
ATOM   5046   H  HG12 . VAL A 1 113 ? -6.880  1.976   -16.444 1.00 15.00 ?  155 VAL A HG12 2  
ATOM   5047   H  HG13 . VAL A 1 113 ? -6.777  2.515   -14.769 1.00 15.00 ?  155 VAL A HG13 2  
ATOM   5048   H  HG21 . VAL A 1 113 ? -7.823  -0.959  -15.514 1.00 15.00 ?  155 VAL A HG21 2  
ATOM   5049   H  HG22 . VAL A 1 113 ? -6.186  -1.613  -15.617 1.00 15.00 ?  155 VAL A HG22 2  
ATOM   5050   H  HG23 . VAL A 1 113 ? -6.791  -0.550  -16.889 1.00 15.00 ?  155 VAL A HG23 2  
ATOM   5051   N  N    . ALA A 1 114 ? -3.884  2.915   -15.367 1.00 15.00 ?  156 ALA A N    2  
ATOM   5052   C  CA   . ALA A 1 114 ? -3.386  4.154   -14.788 1.00 15.00 ?  156 ALA A CA   2  
ATOM   5053   C  C    . ALA A 1 114 ? -4.480  4.863   -14.002 1.00 15.00 ?  156 ALA A C    2  
ATOM   5054   O  O    . ALA A 1 114 ? -5.659  4.789   -14.352 1.00 15.00 ?  156 ALA A O    2  
ATOM   5055   C  CB   . ALA A 1 114 ? -2.826  5.058   -15.880 1.00 15.00 ?  156 ALA A CB   2  
ATOM   5056   H  H    . ALA A 1 114 ? -3.947  2.835   -16.343 1.00 15.00 ?  156 ALA A H    2  
ATOM   5057   H  HA   . ALA A 1 114 ? -2.581  3.903   -14.110 1.00 15.00 ?  156 ALA A HA   2  
ATOM   5058   H  HB1  . ALA A 1 114 ? -2.103  4.508   -16.466 1.00 15.00 ?  156 ALA A HB1  2  
ATOM   5059   H  HB2  . ALA A 1 114 ? -2.344  5.917   -15.429 1.00 15.00 ?  156 ALA A HB2  2  
ATOM   5060   H  HB3  . ALA A 1 114 ? -3.629  5.392   -16.521 1.00 15.00 ?  156 ALA A HB3  2  
ATOM   5061   N  N    . ALA A 1 115 ? -4.086  5.535   -12.932 1.00 15.00 ?  157 ALA A N    2  
ATOM   5062   C  CA   . ALA A 1 115 ? -5.034  6.250   -12.091 1.00 15.00 ?  157 ALA A CA   2  
ATOM   5063   C  C    . ALA A 1 115 ? -5.523  7.516   -12.780 1.00 15.00 ?  157 ALA A C    2  
ATOM   5064   O  O    . ALA A 1 115 ? -4.953  7.956   -13.780 1.00 15.00 ?  157 ALA A O    2  
ATOM   5065   C  CB   . ALA A 1 115 ? -4.404  6.588   -10.750 1.00 15.00 ?  157 ALA A CB   2  
ATOM   5066   H  H    . ALA A 1 115 ? -3.129  5.562   -12.703 1.00 15.00 ?  157 ALA A H    2  
ATOM   5067   H  HA   . ALA A 1 115 ? -5.876  5.598   -11.914 1.00 15.00 ?  157 ALA A HA   2  
ATOM   5068   H  HB1  . ALA A 1 115 ? -3.515  7.181   -10.912 1.00 15.00 ?  157 ALA A HB1  2  
ATOM   5069   H  HB2  . ALA A 1 115 ? -4.140  5.674   -10.238 1.00 15.00 ?  157 ALA A HB2  2  
ATOM   5070   H  HB3  . ALA A 1 115 ? -5.107  7.149   -10.150 1.00 15.00 ?  157 ALA A HB3  2  
ATOM   5071   N  N    . GLN A 1 116 ? -6.577  8.097   -12.237 1.00 15.00 ?  158 GLN A N    2  
ATOM   5072   C  CA   . GLN A 1 116 ? -7.159  9.304   -12.794 1.00 15.00 ?  158 GLN A CA   2  
ATOM   5073   C  C    . GLN A 1 116 ? -6.341  10.529  -12.409 1.00 15.00 ?  158 GLN A C    2  
ATOM   5074   O  O    . GLN A 1 116 ? -6.291  11.511  -13.153 1.00 15.00 ?  158 GLN A O    2  
ATOM   5075   C  CB   . GLN A 1 116 ? -8.596  9.461   -12.298 1.00 15.00 ?  158 GLN A CB   2  
ATOM   5076   C  CG   . GLN A 1 116 ? -9.533  8.389   -12.824 1.00 15.00 ?  158 GLN A CG   2  
ATOM   5077   C  CD   . GLN A 1 116 ? -10.877 8.383   -12.120 1.00 15.00 ?  158 GLN A CD   2  
ATOM   5078   O  OE1  . GLN A 1 116 ? -10.981 8.716   -10.938 1.00 15.00 ?  158 GLN A OE1  2  
ATOM   5079   N  NE2  . GLN A 1 116 ? -11.919 8.015   -12.848 1.00 15.00 ?  158 GLN A NE2  2  
ATOM   5080   H  H    . GLN A 1 116 ? -6.983  7.699   -11.436 1.00 15.00 ?  158 GLN A H    2  
ATOM   5081   H  HA   . GLN A 1 116 ? -7.163  9.208   -13.871 1.00 15.00 ?  158 GLN A HA   2  
ATOM   5082   H  HB2  . GLN A 1 116 ? -8.596  9.412   -11.220 1.00 15.00 ?  158 GLN A HB2  2  
ATOM   5083   H  HB3  . GLN A 1 116 ? -8.973  10.423  -12.606 1.00 15.00 ?  158 GLN A HB3  2  
ATOM   5084   H  HG2  . GLN A 1 116 ? -9.697  8.565   -13.876 1.00 15.00 ?  158 GLN A HG2  2  
ATOM   5085   H  HG3  . GLN A 1 116 ? -9.066  7.426   -12.689 1.00 15.00 ?  158 GLN A HG3  2  
ATOM   5086   H  HE21 . GLN A 1 116 ? -11.764 7.771   -13.787 1.00 15.00 ?  158 GLN A HE21 2  
ATOM   5087   H  HE22 . GLN A 1 116 ? -12.801 8.002   -12.422 1.00 15.00 ?  158 GLN A HE22 2  
ATOM   5088   N  N    . HIS A 1 117 ? -5.705  10.474  -11.247 1.00 15.00 ?  159 HIS A N    2  
ATOM   5089   C  CA   . HIS A 1 117 ? -4.898  11.591  -10.780 1.00 15.00 ?  159 HIS A CA   2  
ATOM   5090   C  C    . HIS A 1 117 ? -3.468  11.153  -10.475 1.00 15.00 ?  159 HIS A C    2  
ATOM   5091   O  O    . HIS A 1 117 ? -3.231  10.015  -10.058 1.00 15.00 ?  159 HIS A O    2  
ATOM   5092   C  CB   . HIS A 1 117 ? -5.515  12.218  -9.528  1.00 15.00 ?  159 HIS A CB   2  
ATOM   5093   C  CG   . HIS A 1 117 ? -6.871  12.813  -9.744  1.00 15.00 ?  159 HIS A CG   2  
ATOM   5094   N  ND1  . HIS A 1 117 ? -7.032  14.156  -10.001 1.00 15.00 ?  159 HIS A ND1  2  
ATOM   5095   C  CD2  . HIS A 1 117 ? -8.086  12.215  -9.718  1.00 15.00 ?  159 HIS A CD2  2  
ATOM   5096   C  CE1  . HIS A 1 117 ? -8.333  14.343  -10.126 1.00 15.00 ?  159 HIS A CE1  2  
ATOM   5097   N  NE2  . HIS A 1 117 ? -9.009  13.198  -9.961  1.00 15.00 ?  159 HIS A NE2  2  
ATOM   5098   H  H    . HIS A 1 117 ? -5.782  9.667   -10.688 1.00 15.00 ?  159 HIS A H    2  
ATOM   5099   H  HA   . HIS A 1 117 ? -4.877  12.327  -11.567 1.00 15.00 ?  159 HIS A HA   2  
ATOM   5100   H  HB2  . HIS A 1 117 ? -5.605  11.463  -8.760  1.00 15.00 ?  159 HIS A HB2  2  
ATOM   5101   H  HB3  . HIS A 1 117 ? -4.866  13.004  -9.173  1.00 15.00 ?  159 HIS A HB3  2  
ATOM   5102   H  HD2  . HIS A 1 117 ? -8.292  11.171  -9.536  1.00 15.00 ?  159 HIS A HD2  2  
ATOM   5103   H  HE1  . HIS A 1 117 ? -8.794  15.296  -10.332 1.00 15.00 ?  159 HIS A HE1  2  
ATOM   5104   H  HE2  . HIS A 1 117 ? -9.987  13.081  -10.001 1.00 15.00 ?  159 HIS A HE2  2  
ATOM   5105   N  N    . SER A 1 118 ? -2.519  12.059  -10.681 1.00 15.00 ?  160 SER A N    2  
ATOM   5106   C  CA   . SER A 1 118 ? -1.117  11.775  -10.414 1.00 15.00 ?  160 SER A CA   2  
ATOM   5107   C  C    . SER A 1 118 ? -0.603  12.652  -9.277  1.00 15.00 ?  160 SER A C    2  
ATOM   5108   O  O    . SER A 1 118 ? -0.880  13.851  -9.227  1.00 15.00 ?  160 SER A O    2  
ATOM   5109   C  CB   . SER A 1 118 ? -0.281  11.994  -11.676 1.00 15.00 ?  160 SER A CB   2  
ATOM   5110   O  OG   . SER A 1 118 ? -0.757  11.187  -12.742 1.00 15.00 ?  160 SER A OG   2  
ATOM   5111   H  H    . SER A 1 118 ? -2.766  12.944  -11.031 1.00 15.00 ?  160 SER A H    2  
ATOM   5112   H  HA   . SER A 1 118 ? -1.038  10.741  -10.116 1.00 15.00 ?  160 SER A HA   2  
ATOM   5113   H  HB2  . SER A 1 118 ? -0.345  13.030  -11.968 1.00 15.00 ?  160 SER A HB2  2  
ATOM   5114   H  HB3  . SER A 1 118 ? 0.749   11.738  -11.474 1.00 15.00 ?  160 SER A HB3  2  
ATOM   5115   H  HG   . SER A 1 118 ? -1.240  11.741  -13.366 1.00 15.00 ?  160 SER A HG   2  
ATOM   5116   N  N    . LEU A 1 119 ? 0.122   12.042  -8.353  1.00 15.00 ?  161 LEU A N    2  
ATOM   5117   C  CA   . LEU A 1 119 ? 0.679   12.754  -7.209  1.00 15.00 ?  161 LEU A CA   2  
ATOM   5118   C  C    . LEU A 1 119 ? 2.089   13.242  -7.510  1.00 15.00 ?  161 LEU A C    2  
ATOM   5119   O  O    . LEU A 1 119 ? 2.857   12.554  -8.181  1.00 15.00 ?  161 LEU A O    2  
ATOM   5120   C  CB   . LEU A 1 119 ? 0.711   11.833  -5.985  1.00 15.00 ?  161 LEU A CB   2  
ATOM   5121   C  CG   . LEU A 1 119 ? -0.617  11.170  -5.630  1.00 15.00 ?  161 LEU A CG   2  
ATOM   5122   C  CD1  . LEU A 1 119 ? -0.377  9.921   -4.800  1.00 15.00 ?  161 LEU A CD1  2  
ATOM   5123   C  CD2  . LEU A 1 119 ? -1.509  12.144  -4.880  1.00 15.00 ?  161 LEU A CD2  2  
ATOM   5124   H  H    . LEU A 1 119 ? 0.283   11.073  -8.438  1.00 15.00 ?  161 LEU A H    2  
ATOM   5125   H  HA   . LEU A 1 119 ? 0.047   13.601  -7.000  1.00 15.00 ?  161 LEU A HA   2  
ATOM   5126   H  HB2  . LEU A 1 119 ? 1.436   11.054  -6.166  1.00 15.00 ?  161 LEU A HB2  2  
ATOM   5127   H  HB3  . LEU A 1 119 ? 1.035   12.412  -5.134  1.00 15.00 ?  161 LEU A HB3  2  
ATOM   5128   H  HG   . LEU A 1 119 ? -1.125  10.877  -6.538  1.00 15.00 ?  161 LEU A HG   2  
ATOM   5129   H  HD11 . LEU A 1 119 ? 0.365   9.304   -5.285  1.00 15.00 ?  161 LEU A HD11 2  
ATOM   5130   H  HD12 . LEU A 1 119 ? -1.300  9.368   -4.709  1.00 15.00 ?  161 LEU A HD12 2  
ATOM   5131   H  HD13 . LEU A 1 119 ? -0.027  10.203  -3.819  1.00 15.00 ?  161 LEU A HD13 2  
ATOM   5132   H  HD21 . LEU A 1 119 ? -2.437  11.655  -4.617  1.00 15.00 ?  161 LEU A HD21 2  
ATOM   5133   H  HD22 . LEU A 1 119 ? -1.721  12.996  -5.503  1.00 15.00 ?  161 LEU A HD22 2  
ATOM   5134   H  HD23 . LEU A 1 119 ? -1.006  12.470  -3.983  1.00 15.00 ?  161 LEU A HD23 2  
ATOM   5135   N  N    . THR A 1 120 ? 2.416   14.432  -7.027  1.00 15.00 ?  162 THR A N    2  
ATOM   5136   C  CA   . THR A 1 120 ? 3.747   14.989  -7.224  1.00 15.00 ?  162 THR A CA   2  
ATOM   5137   C  C    . THR A 1 120 ? 4.456   15.088  -5.880  1.00 15.00 ?  162 THR A C    2  
ATOM   5138   O  O    . THR A 1 120 ? 3.820   15.355  -4.856  1.00 15.00 ?  162 THR A O    2  
ATOM   5139   C  CB   . THR A 1 120 ? 3.700   16.373  -7.905  1.00 15.00 ?  162 THR A CB   2  
ATOM   5140   O  OG1  . THR A 1 120 ? 2.786   17.239  -7.224  1.00 15.00 ?  162 THR A OG1  2  
ATOM   5141   C  CG2  . THR A 1 120 ? 3.280   16.238  -9.359  1.00 15.00 ?  162 THR A CG2  2  
ATOM   5142   H  H    . THR A 1 120 ? 1.748   14.949  -6.523  1.00 15.00 ?  162 THR A H    2  
ATOM   5143   H  HA   . THR A 1 120 ? 4.296   14.311  -7.860  1.00 15.00 ?  162 THR A HA   2  
ATOM   5144   H  HB   . THR A 1 120 ? 4.688   16.808  -7.872  1.00 15.00 ?  162 THR A HB   2  
ATOM   5145   H  HG1  . THR A 1 120 ? 2.088   16.714  -6.808  1.00 15.00 ?  162 THR A HG1  2  
ATOM   5146   H  HG21 . THR A 1 120 ? 4.103   15.851  -9.939  1.00 15.00 ?  162 THR A HG21 2  
ATOM   5147   H  HG22 . THR A 1 120 ? 2.992   17.204  -9.741  1.00 15.00 ?  162 THR A HG22 2  
ATOM   5148   H  HG23 . THR A 1 120 ? 2.445   15.561  -9.430  1.00 15.00 ?  162 THR A HG23 2  
ATOM   5149   N  N    . PHE A 1 121 ? 5.758   14.864  -5.869  1.00 15.00 ?  163 PHE A N    2  
ATOM   5150   C  CA   . PHE A 1 121 ? 6.510   14.910  -4.626  1.00 15.00 ?  163 PHE A CA   2  
ATOM   5151   C  C    . PHE A 1 121 ? 7.597   15.970  -4.672  1.00 15.00 ?  163 PHE A C    2  
ATOM   5152   O  O    . PHE A 1 121 ? 8.232   16.186  -5.707  1.00 15.00 ?  163 PHE A O    2  
ATOM   5153   C  CB   . PHE A 1 121 ? 7.110   13.535  -4.330  1.00 15.00 ?  163 PHE A CB   2  
ATOM   5154   C  CG   . PHE A 1 121 ? 6.066   12.481  -4.092  1.00 15.00 ?  163 PHE A CG   2  
ATOM   5155   C  CD1  . PHE A 1 121 ? 5.597   12.231  -2.813  1.00 15.00 ?  163 PHE A CD1  2  
ATOM   5156   C  CD2  . PHE A 1 121 ? 5.544   11.751  -5.150  1.00 15.00 ?  163 PHE A CD2  2  
ATOM   5157   C  CE1  . PHE A 1 121 ? 4.627   11.275  -2.589  1.00 15.00 ?  163 PHE A CE1  2  
ATOM   5158   C  CE2  . PHE A 1 121 ? 4.574   10.791  -4.931  1.00 15.00 ?  163 PHE A CE2  2  
ATOM   5159   C  CZ   . PHE A 1 121 ? 4.116   10.554  -3.650  1.00 15.00 ?  163 PHE A CZ   2  
ATOM   5160   H  H    . PHE A 1 121 ? 6.227   14.672  -6.709  1.00 15.00 ?  163 PHE A H    2  
ATOM   5161   H  HA   . PHE A 1 121 ? 5.818   15.162  -3.834  1.00 15.00 ?  163 PHE A HA   2  
ATOM   5162   H  HB2  . PHE A 1 121 ? 7.716   13.227  -5.166  1.00 15.00 ?  163 PHE A HB2  2  
ATOM   5163   H  HB3  . PHE A 1 121 ? 7.726   13.602  -3.442  1.00 15.00 ?  163 PHE A HB3  2  
ATOM   5164   H  HD1  . PHE A 1 121 ? 5.999   12.795  -1.983  1.00 15.00 ?  163 PHE A HD1  2  
ATOM   5165   H  HD2  . PHE A 1 121 ? 5.904   11.937  -6.149  1.00 15.00 ?  163 PHE A HD2  2  
ATOM   5166   H  HE1  . PHE A 1 121 ? 4.269   11.088  -1.588  1.00 15.00 ?  163 PHE A HE1  2  
ATOM   5167   H  HE2  . PHE A 1 121 ? 4.173   10.228  -5.761  1.00 15.00 ?  163 PHE A HE2  2  
ATOM   5168   H  HZ   . PHE A 1 121 ? 3.360   9.805   -3.478  1.00 15.00 ?  163 PHE A HZ   2  
ATOM   5169   N  N    . ALA A 1 122 ? 7.800   16.625  -3.537  1.00 15.00 ?  164 ALA A N    2  
ATOM   5170   C  CA   . ALA A 1 122 ? 8.797   17.673  -3.406  1.00 15.00 ?  164 ALA A CA   2  
ATOM   5171   C  C    . ALA A 1 122 ? 10.185  17.079  -3.184  1.00 15.00 ?  164 ALA A C    2  
ATOM   5172   O  O    . ALA A 1 122 ? 10.336  15.860  -3.065  1.00 15.00 ?  164 ALA A O    2  
ATOM   5173   C  CB   . ALA A 1 122 ? 8.415   18.599  -2.261  1.00 15.00 ?  164 ALA A CB   2  
ATOM   5174   H  H    . ALA A 1 122 ? 7.259   16.387  -2.751  1.00 15.00 ?  164 ALA A H    2  
ATOM   5175   H  HA   . ALA A 1 122 ? 8.804   18.248  -4.321  1.00 15.00 ?  164 ALA A HA   2  
ATOM   5176   H  HB1  . ALA A 1 122 ? 8.421   18.047  -1.333  1.00 15.00 ?  164 ALA A HB1  2  
ATOM   5177   H  HB2  . ALA A 1 122 ? 7.426   18.998  -2.436  1.00 15.00 ?  164 ALA A HB2  2  
ATOM   5178   H  HB3  . ALA A 1 122 ? 9.123   19.409  -2.201  1.00 15.00 ?  164 ALA A HB3  2  
ATOM   5179   N  N    . ALA A 1 123 ? 11.191  17.944  -3.112  1.00 15.00 ?  165 ALA A N    2  
ATOM   5180   C  CA   . ALA A 1 123 ? 12.574  17.516  -2.917  1.00 15.00 ?  165 ALA A CA   2  
ATOM   5181   C  C    . ALA A 1 123 ? 12.775  16.855  -1.558  1.00 15.00 ?  165 ALA A C    2  
ATOM   5182   O  O    . ALA A 1 123 ? 13.706  16.073  -1.371  1.00 15.00 ?  165 ALA A O    2  
ATOM   5183   C  CB   . ALA A 1 123 ? 13.516  18.698  -3.071  1.00 15.00 ?  165 ALA A CB   2  
ATOM   5184   H  H    . ALA A 1 123 ? 11.000  18.904  -3.190  1.00 15.00 ?  165 ALA A H    2  
ATOM   5185   H  HA   . ALA A 1 123 ? 12.809  16.797  -3.689  1.00 15.00 ?  165 ALA A HA   2  
ATOM   5186   H  HB1  . ALA A 1 123 ? 13.387  19.138  -4.049  1.00 15.00 ?  165 ALA A HB1  2  
ATOM   5187   H  HB2  . ALA A 1 123 ? 14.536  18.366  -2.956  1.00 15.00 ?  165 ALA A HB2  2  
ATOM   5188   H  HB3  . ALA A 1 123 ? 13.291  19.433  -2.314  1.00 15.00 ?  165 ALA A HB3  2  
ATOM   5189   N  N    . ASN A 1 124 ? 11.904  17.169  -0.605  1.00 15.00 ?  166 ASN A N    2  
ATOM   5190   C  CA   . ASN A 1 124 ? 11.996  16.587  0.732   1.00 15.00 ?  166 ASN A CA   2  
ATOM   5191   C  C    . ASN A 1 124 ? 11.432  15.166  0.739   1.00 15.00 ?  166 ASN A C    2  
ATOM   5192   O  O    . ASN A 1 124 ? 11.658  14.399  1.673   1.00 15.00 ?  166 ASN A O    2  
ATOM   5193   C  CB   . ASN A 1 124 ? 11.272  17.467  1.769   1.00 15.00 ?  166 ASN A CB   2  
ATOM   5194   C  CG   . ASN A 1 124 ? 9.778   17.581  1.536   1.00 15.00 ?  166 ASN A CG   2  
ATOM   5195   O  OD1  . ASN A 1 124 ? 9.267   17.230  0.476   1.00 15.00 ?  166 ASN A OD1  2  
ATOM   5196   N  ND2  . ASN A 1 124 ? 9.067   18.098  2.523   1.00 15.00 ?  166 ASN A ND2  2  
ATOM   5197   H  H    . ASN A 1 124 ? 11.182  17.807  -0.805  1.00 15.00 ?  166 ASN A H    2  
ATOM   5198   H  HA   . ASN A 1 124 ? 13.043  16.537  0.989   1.00 15.00 ?  166 ASN A HA   2  
ATOM   5199   H  HB2  . ASN A 1 124 ? 11.422  17.044  2.750   1.00 15.00 ?  166 ASN A HB2  2  
ATOM   5200   H  HB3  . ASN A 1 124 ? 11.698  18.460  1.745   1.00 15.00 ?  166 ASN A HB3  2  
ATOM   5201   H  HD21 . ASN A 1 124 ? 9.536   18.375  3.337   1.00 15.00 ?  166 ASN A HD21 2  
ATOM   5202   H  HD22 . ASN A 1 124 ? 8.097   18.187  2.399   1.00 15.00 ?  166 ASN A HD22 2  
ATOM   5203   N  N    . GLY A 1 125 ? 10.702  14.822  -0.320  1.00 15.00 ?  167 GLY A N    2  
ATOM   5204   C  CA   . GLY A 1 125 ? 10.124  13.498  -0.435  1.00 15.00 ?  167 GLY A CA   2  
ATOM   5205   C  C    . GLY A 1 125 ? 8.649   13.473  -0.107  1.00 15.00 ?  167 GLY A C    2  
ATOM   5206   O  O    . GLY A 1 125 ? 7.960   12.500  -0.397  1.00 15.00 ?  167 GLY A O    2  
ATOM   5207   H  H    . GLY A 1 125 ? 10.555  15.479  -1.034  1.00 15.00 ?  167 GLY A H    2  
ATOM   5208   H  HA2  . GLY A 1 125 ? 10.260  13.144  -1.447  1.00 15.00 ?  167 GLY A HA2  2  
ATOM   5209   H  HA3  . GLY A 1 125 ? 10.639  12.831  0.240   1.00 15.00 ?  167 GLY A HA3  2  
ATOM   5210   N  N    . TRP A 1 126 ? 8.151   14.548  0.477   1.00 15.00 ?  168 TRP A N    2  
ATOM   5211   C  CA   . TRP A 1 126 ? 6.748   14.617  0.849   1.00 15.00 ?  168 TRP A CA   2  
ATOM   5212   C  C    . TRP A 1 126 ? 5.891   15.017  -0.345  1.00 15.00 ?  168 TRP A C    2  
ATOM   5213   O  O    . TRP A 1 126 ? 6.347   15.742  -1.232  1.00 15.00 ?  168 TRP A O    2  
ATOM   5214   C  CB   . TRP A 1 126 ? 6.542   15.593  2.005   1.00 15.00 ?  168 TRP A CB   2  
ATOM   5215   C  CG   . TRP A 1 126 ? 7.054   15.073  3.314   1.00 15.00 ?  168 TRP A CG   2  
ATOM   5216   C  CD1  . TRP A 1 126 ? 8.239   15.387  3.908   1.00 15.00 ?  168 TRP A CD1  2  
ATOM   5217   C  CD2  . TRP A 1 126 ? 6.403   14.140  4.184   1.00 15.00 ?  168 TRP A CD2  2  
ATOM   5218   N  NE1  . TRP A 1 126 ? 8.366   14.717  5.099   1.00 15.00 ?  168 TRP A NE1  2  
ATOM   5219   C  CE2  . TRP A 1 126 ? 7.253   13.942  5.290   1.00 15.00 ?  168 TRP A CE2  2  
ATOM   5220   C  CE3  . TRP A 1 126 ? 5.188   13.456  4.141   1.00 15.00 ?  168 TRP A CE3  2  
ATOM   5221   C  CZ2  . TRP A 1 126 ? 6.923   13.089  6.337   1.00 15.00 ?  168 TRP A CZ2  2  
ATOM   5222   C  CZ3  . TRP A 1 126 ? 4.861   12.609  5.182   1.00 15.00 ?  168 TRP A CZ3  2  
ATOM   5223   C  CH2  . TRP A 1 126 ? 5.726   12.432  6.266   1.00 15.00 ?  168 TRP A CH2  2  
ATOM   5224   H  H    . TRP A 1 126 ? 8.734   15.322  0.642   1.00 15.00 ?  168 TRP A H    2  
ATOM   5225   H  HA   . TRP A 1 126 ? 6.453   13.629  1.170   1.00 15.00 ?  168 TRP A HA   2  
ATOM   5226   H  HB2  . TRP A 1 126 ? 7.062   16.516  1.789   1.00 15.00 ?  168 TRP A HB2  2  
ATOM   5227   H  HB3  . TRP A 1 126 ? 5.488   15.794  2.112   1.00 15.00 ?  168 TRP A HB3  2  
ATOM   5228   H  HD1  . TRP A 1 126 ? 8.962   16.072  3.493   1.00 15.00 ?  168 TRP A HD1  2  
ATOM   5229   H  HE1  . TRP A 1 126 ? 9.132   14.782  5.710   1.00 15.00 ?  168 TRP A HE1  2  
ATOM   5230   H  HE3  . TRP A 1 126 ? 4.509   13.581  3.311   1.00 15.00 ?  168 TRP A HE3  2  
ATOM   5231   H  HZ2  . TRP A 1 126 ? 7.580   12.938  7.181   1.00 15.00 ?  168 TRP A HZ2  2  
ATOM   5232   H  HZ3  . TRP A 1 126 ? 3.925   12.068  5.163   1.00 15.00 ?  168 TRP A HZ3  2  
ATOM   5233   H  HH2  . TRP A 1 126 ? 5.432   11.758  7.058   1.00 15.00 ?  168 TRP A HH2  2  
ATOM   5234   N  N    . VAL A 1 127 ? 4.659   14.529  -0.367  1.00 15.00 ?  169 VAL A N    2  
ATOM   5235   C  CA   . VAL A 1 127 ? 3.737   14.828  -1.455  1.00 15.00 ?  169 VAL A CA   2  
ATOM   5236   C  C    . VAL A 1 127 ? 3.327   16.301  -1.447  1.00 15.00 ?  169 VAL A C    2  
ATOM   5237   O  O    . VAL A 1 127 ? 3.207   16.930  -0.388  1.00 15.00 ?  169 VAL A O    2  
ATOM   5238   C  CB   . VAL A 1 127 ? 2.477   13.928  -1.387  1.00 15.00 ?  169 VAL A CB   2  
ATOM   5239   C  CG1  . VAL A 1 127 ? 1.588   14.316  -0.218  1.00 15.00 ?  169 VAL A CG1  2  
ATOM   5240   C  CG2  . VAL A 1 127 ? 1.694   13.972  -2.693  1.00 15.00 ?  169 VAL A CG2  2  
ATOM   5241   H  H    . VAL A 1 127 ? 4.362   13.945  0.365   1.00 15.00 ?  169 VAL A H    2  
ATOM   5242   H  HA   . VAL A 1 127 ? 4.248   14.619  -2.382  1.00 15.00 ?  169 VAL A HA   2  
ATOM   5243   H  HB   . VAL A 1 127 ? 2.806   12.912  -1.232  1.00 15.00 ?  169 VAL A HB   2  
ATOM   5244   H  HG11 . VAL A 1 127 ? 2.074   14.051  0.709   1.00 15.00 ?  169 VAL A HG11 2  
ATOM   5245   H  HG12 . VAL A 1 127 ? 0.645   13.793  -0.293  1.00 15.00 ?  169 VAL A HG12 2  
ATOM   5246   H  HG13 . VAL A 1 127 ? 1.411   15.383  -0.245  1.00 15.00 ?  169 VAL A HG13 2  
ATOM   5247   H  HG21 . VAL A 1 127 ? 2.283   13.535  -3.480  1.00 15.00 ?  169 VAL A HG21 2  
ATOM   5248   H  HG22 . VAL A 1 127 ? 1.466   14.997  -2.943  1.00 15.00 ?  169 VAL A HG22 2  
ATOM   5249   H  HG23 . VAL A 1 127 ? 0.778   13.417  -2.581  1.00 15.00 ?  169 VAL A HG23 2  
ATOM   5250   N  N    . GLU A 1 128 ? 3.154   16.851  -2.636  1.00 15.00 ?  170 GLU A N    2  
ATOM   5251   C  CA   . GLU A 1 128 ? 2.739   18.229  -2.790  1.00 15.00 ?  170 GLU A CA   2  
ATOM   5252   C  C    . GLU A 1 128 ? 1.241   18.341  -2.538  1.00 15.00 ?  170 GLU A C    2  
ATOM   5253   O  O    . GLU A 1 128 ? 0.447   17.626  -3.158  1.00 15.00 ?  170 GLU A O    2  
ATOM   5254   C  CB   . GLU A 1 128 ? 3.085   18.732  -4.194  1.00 15.00 ?  170 GLU A CB   2  
ATOM   5255   C  CG   . GLU A 1 128 ? 4.567   18.993  -4.408  1.00 15.00 ?  170 GLU A CG   2  
ATOM   5256   C  CD   . GLU A 1 128 ? 5.024   20.278  -3.751  1.00 15.00 ?  170 GLU A CD   2  
ATOM   5257   O  OE1  . GLU A 1 128 ? 5.129   21.305  -4.456  1.00 15.00 ?  170 GLU A OE1  2  
ATOM   5258   O  OE2  . GLU A 1 128 ? 5.272   20.278  -2.527  1.00 15.00 -1 170 GLU A OE2  2  
ATOM   5259   H  H    . GLU A 1 128 ? 3.310   16.309  -3.441  1.00 15.00 ?  170 GLU A H    2  
ATOM   5260   H  HA   . GLU A 1 128 ? 3.265   18.823  -2.059  1.00 15.00 ?  170 GLU A HA   2  
ATOM   5261   H  HB2  . GLU A 1 128 ? 2.764   17.996  -4.917  1.00 15.00 ?  170 GLU A HB2  2  
ATOM   5262   H  HB3  . GLU A 1 128 ? 2.551   19.652  -4.370  1.00 15.00 ?  170 GLU A HB3  2  
ATOM   5263   H  HG2  . GLU A 1 128 ? 5.133   18.172  -3.993  1.00 15.00 ?  170 GLU A HG2  2  
ATOM   5264   H  HG3  . GLU A 1 128 ? 4.755   19.061  -5.470  1.00 15.00 ?  170 GLU A HG3  2  
ATOM   5265   N  N    . PRO A 1 129 ? 0.836   19.231  -1.618  1.00 15.00 ?  171 PRO A N    2  
ATOM   5266   C  CA   . PRO A 1 129 ? -0.578  19.430  -1.271  1.00 15.00 ?  171 PRO A CA   2  
ATOM   5267   C  C    . PRO A 1 129 ? -1.435  19.780  -2.483  1.00 15.00 ?  171 PRO A C    2  
ATOM   5268   O  O    . PRO A 1 129 ? -2.637  19.523  -2.495  1.00 15.00 ?  171 PRO A O    2  
ATOM   5269   C  CB   . PRO A 1 129 ? -0.543  20.599  -0.283  1.00 15.00 ?  171 PRO A CB   2  
ATOM   5270   C  CG   . PRO A 1 129 ? 0.838   20.602  0.272   1.00 15.00 ?  171 PRO A CG   2  
ATOM   5271   C  CD   . PRO A 1 129 ? 1.727   20.107  -0.830  1.00 15.00 ?  171 PRO A CD   2  
ATOM   5272   H  HA   . PRO A 1 129 ? -0.988  18.558  -0.785  1.00 15.00 ?  171 PRO A HA   2  
ATOM   5273   H  HB2  . PRO A 1 129 ? -0.756  21.524  -0.802  1.00 15.00 ?  171 PRO A HB2  2  
ATOM   5274   H  HB3  . PRO A 1 129 ? -1.260  20.436  0.506   1.00 15.00 ?  171 PRO A HB3  2  
ATOM   5275   H  HG2  . PRO A 1 129 ? 1.115   21.606  0.564   1.00 15.00 ?  171 PRO A HG2  2  
ATOM   5276   H  HG3  . PRO A 1 129 ? 0.897   19.937  1.118   1.00 15.00 ?  171 PRO A HG3  2  
ATOM   5277   H  HD2  . PRO A 1 129 ? 2.083   20.933  -1.429  1.00 15.00 ?  171 PRO A HD2  2  
ATOM   5278   H  HD3  . PRO A 1 129 ? 2.559   19.551  -0.421  1.00 15.00 ?  171 PRO A HD3  2  
ATOM   5279   N  N    . ALA A 1 130 ? -0.800  20.346  -3.504  1.00 15.00 ?  172 ALA A N    2  
ATOM   5280   C  CA   . ALA A 1 130 ? -1.491  20.730  -4.728  1.00 15.00 ?  172 ALA A CA   2  
ATOM   5281   C  C    . ALA A 1 130 ? -2.008  19.511  -5.479  1.00 15.00 ?  172 ALA A C    2  
ATOM   5282   O  O    . ALA A 1 130 ? -2.946  19.608  -6.262  1.00 15.00 ?  172 ALA A O    2  
ATOM   5283   C  CB   . ALA A 1 130 ? -0.569  21.549  -5.615  1.00 15.00 ?  172 ALA A CB   2  
ATOM   5284   H  H    . ALA A 1 130 ? 0.159   20.522  -3.426  1.00 15.00 ?  172 ALA A H    2  
ATOM   5285   H  HA   . ALA A 1 130 ? -2.331  21.354  -4.455  1.00 15.00 ?  172 ALA A HA   2  
ATOM   5286   H  HB1  . ALA A 1 130 ? 0.121   20.893  -6.123  1.00 15.00 ?  172 ALA A HB1  2  
ATOM   5287   H  HB2  . ALA A 1 130 ? -0.017  22.250  -5.005  1.00 15.00 ?  172 ALA A HB2  2  
ATOM   5288   H  HB3  . ALA A 1 130 ? -1.155  22.089  -6.343  1.00 15.00 ?  172 ALA A HB3  2  
ATOM   5289   N  N    . THR A 1 131 ? -1.397  18.359  -5.237  1.00 15.00 ?  173 THR A N    2  
ATOM   5290   C  CA   . THR A 1 131 ? -1.822  17.138  -5.898  1.00 15.00 ?  173 THR A CA   2  
ATOM   5291   C  C    . THR A 1 131 ? -2.492  16.192  -4.911  1.00 15.00 ?  173 THR A C    2  
ATOM   5292   O  O    . THR A 1 131 ? -2.750  15.030  -5.224  1.00 15.00 ?  173 THR A O    2  
ATOM   5293   C  CB   . THR A 1 131 ? -0.644  16.420  -6.582  1.00 15.00 ?  173 THR A CB   2  
ATOM   5294   O  OG1  . THR A 1 131 ? 0.540   16.509  -5.771  1.00 15.00 ?  173 THR A OG1  2  
ATOM   5295   C  CG2  . THR A 1 131 ? -0.371  17.021  -7.953  1.00 15.00 ?  173 THR A CG2  2  
ATOM   5296   H  H    . THR A 1 131 ? -0.646  18.329  -4.601  1.00 15.00 ?  173 THR A H    2  
ATOM   5297   H  HA   . THR A 1 131 ? -2.541  17.410  -6.659  1.00 15.00 ?  173 THR A HA   2  
ATOM   5298   H  HB   . THR A 1 131 ? -0.906  15.379  -6.710  1.00 15.00 ?  173 THR A HB   2  
ATOM   5299   H  HG1  . THR A 1 131 ? 0.290   16.718  -4.862  1.00 15.00 ?  173 THR A HG1  2  
ATOM   5300   H  HG21 . THR A 1 131 ? -0.155  18.072  -7.848  1.00 15.00 ?  173 THR A HG21 2  
ATOM   5301   H  HG22 . THR A 1 131 ? -1.239  16.893  -8.586  1.00 15.00 ?  173 THR A HG22 2  
ATOM   5302   H  HG23 . THR A 1 131 ? 0.478   16.523  -8.402  1.00 15.00 ?  173 THR A HG23 2  
ATOM   5303   N  N    . ALA A 1 132 ? -2.784  16.698  -3.722  1.00 15.00 ?  174 ALA A N    2  
ATOM   5304   C  CA   . ALA A 1 132 ? -3.422  15.899  -2.691  1.00 15.00 ?  174 ALA A CA   2  
ATOM   5305   C  C    . ALA A 1 132 ? -4.578  16.669  -2.051  1.00 15.00 ?  174 ALA A C    2  
ATOM   5306   O  O    . ALA A 1 132 ? -4.473  17.132  -0.910  1.00 15.00 ?  174 ALA A O    2  
ATOM   5307   C  CB   . ALA A 1 132 ? -2.401  15.476  -1.639  1.00 15.00 ?  174 ALA A CB   2  
ATOM   5308   H  H    . ALA A 1 132 ? -2.577  17.639  -3.536  1.00 15.00 ?  174 ALA A H    2  
ATOM   5309   H  HA   . ALA A 1 132 ? -3.812  15.006  -3.158  1.00 15.00 ?  174 ALA A HA   2  
ATOM   5310   H  HB1  . ALA A 1 132 ? -1.577  14.968  -2.120  1.00 15.00 ?  174 ALA A HB1  2  
ATOM   5311   H  HB2  . ALA A 1 132 ? -2.869  14.809  -0.927  1.00 15.00 ?  174 ALA A HB2  2  
ATOM   5312   H  HB3  . ALA A 1 132 ? -2.033  16.353  -1.122  1.00 15.00 ?  174 ALA A HB3  2  
ATOM   5313   N  N    . PRO A 1 133 ? -5.690  16.839  -2.787  1.00 15.00 ?  175 PRO A N    2  
ATOM   5314   C  CA   . PRO A 1 133 ? -6.863  17.555  -2.302  1.00 15.00 ?  175 PRO A CA   2  
ATOM   5315   C  C    . PRO A 1 133 ? -7.761  16.675  -1.436  1.00 15.00 ?  175 PRO A C    2  
ATOM   5316   O  O    . PRO A 1 133 ? -8.203  15.609  -1.869  1.00 15.00 ?  175 PRO A O    2  
ATOM   5317   C  CB   . PRO A 1 133 ? -7.597  17.964  -3.595  1.00 15.00 ?  175 PRO A CB   2  
ATOM   5318   C  CG   . PRO A 1 133 ? -6.791  17.419  -4.734  1.00 15.00 ?  175 PRO A CG   2  
ATOM   5319   C  CD   . PRO A 1 133 ? -5.901  16.357  -4.154  1.00 15.00 ?  175 PRO A CD   2  
ATOM   5320   H  HA   . PRO A 1 133 ? -6.587  18.437  -1.746  1.00 15.00 ?  175 PRO A HA   2  
ATOM   5321   H  HB2  . PRO A 1 133 ? -8.594  17.542  -3.596  1.00 15.00 ?  175 PRO A HB2  2  
ATOM   5322   H  HB3  . PRO A 1 133 ? -7.649  19.037  -3.664  1.00 15.00 ?  175 PRO A HB3  2  
ATOM   5323   H  HG2  . PRO A 1 133 ? -7.449  16.992  -5.479  1.00 15.00 ?  175 PRO A HG2  2  
ATOM   5324   H  HG3  . PRO A 1 133 ? -6.190  18.205  -5.167  1.00 15.00 ?  175 PRO A HG3  2  
ATOM   5325   H  HD2  . PRO A 1 133 ? -6.401  15.399  -4.158  1.00 15.00 ?  175 PRO A HD2  2  
ATOM   5326   H  HD3  . PRO A 1 133 ? -4.968  16.304  -4.693  1.00 15.00 ?  175 PRO A HD3  2  
ATOM   5327   N  N    . ASN A 1 134 ? -8.008  17.131  -0.209  1.00 15.00 ?  176 ASN A N    2  
ATOM   5328   C  CA   . ASN A 1 134 ? -8.861  16.422  0.745   1.00 15.00 ?  176 ASN A CA   2  
ATOM   5329   C  C    . ASN A 1 134 ? -8.346  15.015  1.022   1.00 15.00 ?  176 ASN A C    2  
ATOM   5330   O  O    . ASN A 1 134 ? -9.053  14.030  0.802   1.00 15.00 ?  176 ASN A O    2  
ATOM   5331   C  CB   . ASN A 1 134 ? -10.308 16.353  0.245   1.00 15.00 ?  176 ASN A CB   2  
ATOM   5332   C  CG   . ASN A 1 134 ? -10.895 17.722  -0.050  1.00 15.00 ?  176 ASN A CG   2  
ATOM   5333   O  OD1  . ASN A 1 134 ? -10.833 18.207  -1.181  1.00 15.00 ?  176 ASN A OD1  2  
ATOM   5334   N  ND2  . ASN A 1 134 ? -11.469 18.353  0.959   1.00 15.00 ?  176 ASN A ND2  2  
ATOM   5335   H  H    . ASN A 1 134 ? -7.602  17.979  0.067   1.00 15.00 ?  176 ASN A H    2  
ATOM   5336   H  HA   . ASN A 1 134 ? -8.843  16.981  1.669   1.00 15.00 ?  176 ASN A HA   2  
ATOM   5337   H  HB2  . ASN A 1 134 ? -10.336 15.771  -0.662  1.00 15.00 ?  176 ASN A HB2  2  
ATOM   5338   H  HB3  . ASN A 1 134 ? -10.921 15.868  0.993   1.00 15.00 ?  176 ASN A HB3  2  
ATOM   5339   H  HD21 . ASN A 1 134 ? -11.489 17.911  1.835   1.00 15.00 ?  176 ASN A HD21 2  
ATOM   5340   H  HD22 . ASN A 1 134 ? -11.854 19.240  0.792   1.00 15.00 ?  176 ASN A HD22 2  
ATOM   5341   N  N    . PHE A 1 135 ? -7.117  14.917  1.501   1.00 15.00 ?  177 PHE A N    2  
ATOM   5342   C  CA   . PHE A 1 135 ? -6.521  13.622  1.810   1.00 15.00 ?  177 PHE A CA   2  
ATOM   5343   C  C    . PHE A 1 135 ? -6.712  13.288  3.283   1.00 15.00 ?  177 PHE A C    2  
ATOM   5344   O  O    . PHE A 1 135 ? -6.556  12.142  3.700   1.00 15.00 ?  177 PHE A O    2  
ATOM   5345   C  CB   . PHE A 1 135 ? -5.033  13.616  1.451   1.00 15.00 ?  177 PHE A CB   2  
ATOM   5346   C  CG   . PHE A 1 135 ? -4.735  12.919  0.157   1.00 15.00 ?  177 PHE A CG   2  
ATOM   5347   C  CD1  . PHE A 1 135 ? -5.439  13.239  -0.991  1.00 15.00 ?  177 PHE A CD1  2  
ATOM   5348   C  CD2  . PHE A 1 135 ? -3.748  11.949  0.086   1.00 15.00 ?  177 PHE A CD2  2  
ATOM   5349   C  CE1  . PHE A 1 135 ? -5.168  12.605  -2.185  1.00 15.00 ?  177 PHE A CE1  2  
ATOM   5350   C  CE2  . PHE A 1 135 ? -3.473  11.312  -1.107  1.00 15.00 ?  177 PHE A CE2  2  
ATOM   5351   C  CZ   . PHE A 1 135 ? -4.182  11.640  -2.243  1.00 15.00 ?  177 PHE A CZ   2  
ATOM   5352   H  H    . PHE A 1 135 ? -6.596  15.735  1.653   1.00 15.00 ?  177 PHE A H    2  
ATOM   5353   H  HA   . PHE A 1 135 ? -7.029  12.877  1.220   1.00 15.00 ?  177 PHE A HA   2  
ATOM   5354   H  HB2  . PHE A 1 135 ? -4.684  14.636  1.371   1.00 15.00 ?  177 PHE A HB2  2  
ATOM   5355   H  HB3  . PHE A 1 135 ? -4.484  13.115  2.235   1.00 15.00 ?  177 PHE A HB3  2  
ATOM   5356   H  HD1  . PHE A 1 135 ? -6.210  13.994  -0.944  1.00 15.00 ?  177 PHE A HD1  2  
ATOM   5357   H  HD2  . PHE A 1 135 ? -3.193  11.690  0.975   1.00 15.00 ?  177 PHE A HD2  2  
ATOM   5358   H  HE1  . PHE A 1 135 ? -5.723  12.864  -3.074  1.00 15.00 ?  177 PHE A HE1  2  
ATOM   5359   H  HE2  . PHE A 1 135 ? -2.702  10.561  -1.152  1.00 15.00 ?  177 PHE A HE2  2  
ATOM   5360   H  HZ   . PHE A 1 135 ? -3.968  11.141  -3.175  1.00 15.00 ?  177 PHE A HZ   2  
ATOM   5361   N  N    . GLY A 1 136 ? -7.047  14.305  4.063   1.00 15.00 ?  178 GLY A N    2  
ATOM   5362   C  CA   . GLY A 1 136 ? -7.272  14.126  5.481   1.00 15.00 ?  178 GLY A CA   2  
ATOM   5363   C  C    . GLY A 1 136 ? -6.048  13.627  6.222   1.00 15.00 ?  178 GLY A C    2  
ATOM   5364   O  O    . GLY A 1 136 ? -4.986  14.252  6.174   1.00 15.00 ?  178 GLY A O    2  
ATOM   5365   H  H    . GLY A 1 136 ? -7.143  15.199  3.667   1.00 15.00 ?  178 GLY A H    2  
ATOM   5366   H  HA2  . GLY A 1 136 ? -7.570  15.072  5.907   1.00 15.00 ?  178 GLY A HA2  2  
ATOM   5367   H  HA3  . GLY A 1 136 ? -8.074  13.416  5.616   1.00 15.00 ?  178 GLY A HA3  2  
ATOM   5368   N  N    . PRO A 1 137 ? -6.171  12.492  6.923   1.00 15.00 ?  179 PRO A N    2  
ATOM   5369   C  CA   . PRO A 1 137 ? -5.069  11.914  7.691   1.00 15.00 ?  179 PRO A CA   2  
ATOM   5370   C  C    . PRO A 1 137 ? -4.076  11.125  6.838   1.00 15.00 ?  179 PRO A C    2  
ATOM   5371   O  O    . PRO A 1 137 ? -3.113  10.571  7.361   1.00 15.00 ?  179 PRO A O    2  
ATOM   5372   C  CB   . PRO A 1 137 ? -5.790  10.990  8.671   1.00 15.00 ?  179 PRO A CB   2  
ATOM   5373   C  CG   . PRO A 1 137 ? -7.029  10.560  7.963   1.00 15.00 ?  179 PRO A CG   2  
ATOM   5374   C  CD   . PRO A 1 137 ? -7.410  11.695  7.048   1.00 15.00 ?  179 PRO A CD   2  
ATOM   5375   H  HA   . PRO A 1 137 ? -4.537  12.673  8.238   1.00 15.00 ?  179 PRO A HA   2  
ATOM   5376   H  HB2  . PRO A 1 137 ? -5.161  10.140  8.911   1.00 15.00 ?  179 PRO A HB2  2  
ATOM   5377   H  HB3  . PRO A 1 137 ? -6.046  11.528  9.567   1.00 15.00 ?  179 PRO A HB3  2  
ATOM   5378   H  HG2  . PRO A 1 137 ? -6.831  9.662   7.389   1.00 15.00 ?  179 PRO A HG2  2  
ATOM   5379   H  HG3  . PRO A 1 137 ? -7.817  10.383  8.678   1.00 15.00 ?  179 PRO A HG3  2  
ATOM   5380   H  HD2  . PRO A 1 137 ? -7.720  11.312  6.086   1.00 15.00 ?  179 PRO A HD2  2  
ATOM   5381   H  HD3  . PRO A 1 137 ? -8.201  12.284  7.489   1.00 15.00 ?  179 PRO A HD3  2  
ATOM   5382   N  N    . LEU A 1 138 ? -4.292  11.082  5.532   1.00 15.00 ?  180 LEU A N    2  
ATOM   5383   C  CA   . LEU A 1 138 ? -3.401  10.344  4.645   1.00 15.00 ?  180 LEU A CA   2  
ATOM   5384   C  C    . LEU A 1 138 ? -2.183  11.183  4.267   1.00 15.00 ?  180 LEU A C    2  
ATOM   5385   O  O    . LEU A 1 138 ? -2.265  12.096  3.442   1.00 15.00 ?  180 LEU A O    2  
ATOM   5386   C  CB   . LEU A 1 138 ? -4.138  9.887   3.380   1.00 15.00 ?  180 LEU A CB   2  
ATOM   5387   C  CG   . LEU A 1 138 ? -5.282  8.896   3.602   1.00 15.00 ?  180 LEU A CG   2  
ATOM   5388   C  CD1  . LEU A 1 138 ? -5.789  8.378   2.268   1.00 15.00 ?  180 LEU A CD1  2  
ATOM   5389   C  CD2  . LEU A 1 138 ? -4.829  7.735   4.475   1.00 15.00 ?  180 LEU A CD2  2  
ATOM   5390   H  H    . LEU A 1 138 ? -5.057  11.568  5.152   1.00 15.00 ?  180 LEU A H    2  
ATOM   5391   H  HA   . LEU A 1 138 ? -3.056  9.473   5.181   1.00 15.00 ?  180 LEU A HA   2  
ATOM   5392   H  HB2  . LEU A 1 138 ? -4.540  10.758  2.884   1.00 15.00 ?  180 LEU A HB2  2  
ATOM   5393   H  HB3  . LEU A 1 138 ? -3.416  9.423   2.725   1.00 15.00 ?  180 LEU A HB3  2  
ATOM   5394   H  HG   . LEU A 1 138 ? -6.100  9.399   4.101   1.00 15.00 ?  180 LEU A HG   2  
ATOM   5395   H  HD11 . LEU A 1 138 ? -5.865  9.196   1.567   1.00 15.00 ?  180 LEU A HD11 2  
ATOM   5396   H  HD12 . LEU A 1 138 ? -6.757  7.929   2.403   1.00 15.00 ?  180 LEU A HD12 2  
ATOM   5397   H  HD13 . LEU A 1 138 ? -5.100  7.639   1.886   1.00 15.00 ?  180 LEU A HD13 2  
ATOM   5398   H  HD21 . LEU A 1 138 ? -3.916  7.316   4.074   1.00 15.00 ?  180 LEU A HD21 2  
ATOM   5399   H  HD22 . LEU A 1 138 ? -5.596  6.978   4.487   1.00 15.00 ?  180 LEU A HD22 2  
ATOM   5400   H  HD23 . LEU A 1 138 ? -4.652  8.087   5.480   1.00 15.00 ?  180 LEU A HD23 2  
ATOM   5401   N  N    . LYS A 1 139 ? -1.056  10.886  4.898   1.00 15.00 ?  181 LYS A N    2  
ATOM   5402   C  CA   . LYS A 1 139 ? 0.187   11.592  4.623   1.00 15.00 ?  181 LYS A CA   2  
ATOM   5403   C  C    . LYS A 1 139 ? 1.058   10.752  3.701   1.00 15.00 ?  181 LYS A C    2  
ATOM   5404   O  O    . LYS A 1 139 ? 1.583   9.716   4.103   1.00 15.00 ?  181 LYS A O    2  
ATOM   5405   C  CB   . LYS A 1 139 ? 0.929   11.901  5.926   1.00 15.00 ?  181 LYS A CB   2  
ATOM   5406   C  CG   . LYS A 1 139 ? 0.076   12.628  6.958   1.00 15.00 ?  181 LYS A CG   2  
ATOM   5407   C  CD   . LYS A 1 139 ? -0.494  13.922  6.399   1.00 15.00 ?  181 LYS A CD   2  
ATOM   5408   C  CE   . LYS A 1 139 ? -1.525  14.528  7.340   1.00 15.00 ?  181 LYS A CE   2  
ATOM   5409   N  NZ   . LYS A 1 139 ? -2.201  15.711  6.742   1.00 15.00 1  181 LYS A NZ   2  
ATOM   5410   H  H    . LYS A 1 139 ? -1.059  10.167  5.573   1.00 15.00 ?  181 LYS A H    2  
ATOM   5411   H  HA   . LYS A 1 139 ? -0.060  12.517  4.124   1.00 15.00 ?  181 LYS A HA   2  
ATOM   5412   H  HB2  . LYS A 1 139 ? 1.267   10.973  6.359   1.00 15.00 ?  181 LYS A HB2  2  
ATOM   5413   H  HB3  . LYS A 1 139 ? 1.785   12.517  5.701   1.00 15.00 ?  181 LYS A HB3  2  
ATOM   5414   H  HG2  . LYS A 1 139 ? -0.741  11.987  7.254   1.00 15.00 ?  181 LYS A HG2  2  
ATOM   5415   H  HG3  . LYS A 1 139 ? 0.687   12.855  7.818   1.00 15.00 ?  181 LYS A HG3  2  
ATOM   5416   H  HD2  . LYS A 1 139 ? 0.309   14.628  6.256   1.00 15.00 ?  181 LYS A HD2  2  
ATOM   5417   H  HD3  . LYS A 1 139 ? -0.965  13.716  5.451   1.00 15.00 ?  181 LYS A HD3  2  
ATOM   5418   H  HE2  . LYS A 1 139 ? -2.269  13.779  7.565   1.00 15.00 ?  181 LYS A HE2  2  
ATOM   5419   H  HE3  . LYS A 1 139 ? -1.029  14.826  8.251   1.00 15.00 ?  181 LYS A HE3  2  
ATOM   5420   H  HZ1  . LYS A 1 139 ? -2.788  16.190  7.456   1.00 15.00 ?  181 LYS A HZ1  2  
ATOM   5421   H  HZ2  . LYS A 1 139 ? -2.815  15.414  5.954   1.00 15.00 ?  181 LYS A HZ2  2  
ATOM   5422   H  HZ3  . LYS A 1 139 ? -1.494  16.383  6.379   1.00 15.00 ?  181 LYS A HZ3  2  
ATOM   5423   N  N    . VAL A 1 140 ? 1.189   11.189  2.461   1.00 15.00 ?  182 VAL A N    2  
ATOM   5424   C  CA   . VAL A 1 140 ? 1.970   10.459  1.475   1.00 15.00 ?  182 VAL A CA   2  
ATOM   5425   C  C    . VAL A 1 140 ? 3.422   10.926  1.466   1.00 15.00 ?  182 VAL A C    2  
ATOM   5426   O  O    . VAL A 1 140 ? 3.702   12.127  1.511   1.00 15.00 ?  182 VAL A O    2  
ATOM   5427   C  CB   . VAL A 1 140 ? 1.371   10.608  0.058   1.00 15.00 ?  182 VAL A CB   2  
ATOM   5428   C  CG1  . VAL A 1 140 ? 1.832   9.474   -0.842  1.00 15.00 ?  182 VAL A CG1  2  
ATOM   5429   C  CG2  . VAL A 1 140 ? -0.150  10.668  0.113   1.00 15.00 ?  182 VAL A CG2  2  
ATOM   5430   H  H    . VAL A 1 140 ? 0.762   12.030  2.202   1.00 15.00 ?  182 VAL A H    2  
ATOM   5431   H  HA   . VAL A 1 140 ? 1.944   9.411   1.740   1.00 15.00 ?  182 VAL A HA   2  
ATOM   5432   H  HB   . VAL A 1 140 ? 1.726   11.536  -0.365  1.00 15.00 ?  182 VAL A HB   2  
ATOM   5433   H  HG11 . VAL A 1 140 ? 2.912   9.432   -0.844  1.00 15.00 ?  182 VAL A HG11 2  
ATOM   5434   H  HG12 . VAL A 1 140 ? 1.476   9.645   -1.848  1.00 15.00 ?  182 VAL A HG12 2  
ATOM   5435   H  HG13 . VAL A 1 140 ? 1.437   8.539   -0.474  1.00 15.00 ?  182 VAL A HG13 2  
ATOM   5436   H  HG21 . VAL A 1 140 ? -0.558  10.426  -0.857  1.00 15.00 ?  182 VAL A HG21 2  
ATOM   5437   H  HG22 . VAL A 1 140 ? -0.461  11.664  0.393   1.00 15.00 ?  182 VAL A HG22 2  
ATOM   5438   H  HG23 . VAL A 1 140 ? -0.513  9.960   0.841   1.00 15.00 ?  182 VAL A HG23 2  
ATOM   5439   N  N    . PHE A 1 141 ? 4.338   9.969   1.412   1.00 15.00 ?  183 PHE A N    2  
ATOM   5440   C  CA   . PHE A 1 141 ? 5.761   10.260  1.394   1.00 15.00 ?  183 PHE A CA   2  
ATOM   5441   C  C    . PHE A 1 141 ? 6.474   9.341   0.404   1.00 15.00 ?  183 PHE A C    2  
ATOM   5442   O  O    . PHE A 1 141 ? 6.176   8.150   0.332   1.00 15.00 ?  183 PHE A O    2  
ATOM   5443   C  CB   . PHE A 1 141 ? 6.346   10.079  2.802   1.00 15.00 ?  183 PHE A CB   2  
ATOM   5444   C  CG   . PHE A 1 141 ? 7.841   10.234  2.873   1.00 15.00 ?  183 PHE A CG   2  
ATOM   5445   C  CD1  . PHE A 1 141 ? 8.427   11.486  2.803   1.00 15.00 ?  183 PHE A CD1  2  
ATOM   5446   C  CD2  . PHE A 1 141 ? 8.662   9.124   3.013   1.00 15.00 ?  183 PHE A CD2  2  
ATOM   5447   C  CE1  . PHE A 1 141 ? 9.800   11.629  2.872   1.00 15.00 ?  183 PHE A CE1  2  
ATOM   5448   C  CE2  . PHE A 1 141 ? 10.034  9.261   3.081   1.00 15.00 ?  183 PHE A CE2  2  
ATOM   5449   C  CZ   . PHE A 1 141 ? 10.605  10.515  3.010   1.00 15.00 ?  183 PHE A CZ   2  
ATOM   5450   H  H    . PHE A 1 141 ? 4.046   9.028   1.380   1.00 15.00 ?  183 PHE A H    2  
ATOM   5451   H  HA   . PHE A 1 141 ? 5.894   11.286  1.082   1.00 15.00 ?  183 PHE A HA   2  
ATOM   5452   H  HB2  . PHE A 1 141 ? 5.908   10.813  3.462   1.00 15.00 ?  183 PHE A HB2  2  
ATOM   5453   H  HB3  . PHE A 1 141 ? 6.100   9.089   3.161   1.00 15.00 ?  183 PHE A HB3  2  
ATOM   5454   H  HD1  . PHE A 1 141 ? 7.802   12.357  2.693   1.00 15.00 ?  183 PHE A HD1  2  
ATOM   5455   H  HD2  . PHE A 1 141 ? 8.221   8.142   3.067   1.00 15.00 ?  183 PHE A HD2  2  
ATOM   5456   H  HE1  . PHE A 1 141 ? 10.243  12.614  2.816   1.00 15.00 ?  183 PHE A HE1  2  
ATOM   5457   H  HE2  . PHE A 1 141 ? 10.659  8.388   3.189   1.00 15.00 ?  183 PHE A HE2  2  
ATOM   5458   H  HZ   . PHE A 1 141 ? 11.677  10.623  3.065   1.00 15.00 ?  183 PHE A HZ   2  
ATOM   5459   N  N    . TYR A 1 142 ? 7.388   9.902   -0.374  1.00 15.00 ?  184 TYR A N    2  
ATOM   5460   C  CA   . TYR A 1 142 ? 8.160   9.132   -1.342  1.00 15.00 ?  184 TYR A CA   2  
ATOM   5461   C  C    . TYR A 1 142 ? 9.588   8.952   -0.830  1.00 15.00 ?  184 TYR A C    2  
ATOM   5462   O  O    . TYR A 1 142 ? 10.386  9.891   -0.854  1.00 15.00 ?  184 TYR A O    2  
ATOM   5463   C  CB   . TYR A 1 142 ? 8.156   9.834   -2.708  1.00 15.00 ?  184 TYR A CB   2  
ATOM   5464   C  CG   . TYR A 1 142 ? 9.028   9.176   -3.755  1.00 15.00 ?  184 TYR A CG   2  
ATOM   5465   C  CD1  . TYR A 1 142 ? 8.791   7.873   -4.171  1.00 15.00 ?  184 TYR A CD1  2  
ATOM   5466   C  CD2  . TYR A 1 142 ? 10.090  9.864   -4.331  1.00 15.00 ?  184 TYR A CD2  2  
ATOM   5467   C  CE1  . TYR A 1 142 ? 9.590   7.271   -5.128  1.00 15.00 ?  184 TYR A CE1  2  
ATOM   5468   C  CE2  . TYR A 1 142 ? 10.891  9.272   -5.289  1.00 15.00 ?  184 TYR A CE2  2  
ATOM   5469   C  CZ   . TYR A 1 142 ? 10.638  7.975   -5.684  1.00 15.00 ?  184 TYR A CZ   2  
ATOM   5470   O  OH   . TYR A 1 142 ? 11.434  7.379   -6.638  1.00 15.00 ?  184 TYR A OH   2  
ATOM   5471   H  H    . TYR A 1 142 ? 7.555   10.872  -0.299  1.00 15.00 ?  184 TYR A H    2  
ATOM   5472   H  HA   . TYR A 1 142 ? 7.700   8.163   -1.440  1.00 15.00 ?  184 TYR A HA   2  
ATOM   5473   H  HB2  . TYR A 1 142 ? 7.148   9.850   -3.088  1.00 15.00 ?  184 TYR A HB2  2  
ATOM   5474   H  HB3  . TYR A 1 142 ? 8.503   10.850  -2.579  1.00 15.00 ?  184 TYR A HB3  2  
ATOM   5475   H  HD1  . TYR A 1 142 ? 7.971   7.323   -3.734  1.00 15.00 ?  184 TYR A HD1  2  
ATOM   5476   H  HD2  . TYR A 1 142 ? 10.286  10.880  -4.021  1.00 15.00 ?  184 TYR A HD2  2  
ATOM   5477   H  HE1  . TYR A 1 142 ? 9.389   6.256   -5.437  1.00 15.00 ?  184 TYR A HE1  2  
ATOM   5478   H  HE2  . TYR A 1 142 ? 11.711  9.826   -5.724  1.00 15.00 ?  184 TYR A HE2  2  
ATOM   5479   H  HH   . TYR A 1 142 ? 10.878  6.891   -7.266  1.00 15.00 ?  184 TYR A HH   2  
ATOM   5480   N  N    . PRO A 1 143 ? 9.923   7.746   -0.341  1.00 15.00 ?  185 PRO A N    2  
ATOM   5481   C  CA   . PRO A 1 143 ? 11.256  7.455   0.191   1.00 15.00 ?  185 PRO A CA   2  
ATOM   5482   C  C    . PRO A 1 143 ? 12.339  7.543   -0.884  1.00 15.00 ?  185 PRO A C    2  
ATOM   5483   O  O    . PRO A 1 143 ? 13.366  8.199   -0.696  1.00 15.00 ?  185 PRO A O    2  
ATOM   5484   C  CB   . PRO A 1 143 ? 11.131  6.026   0.728   1.00 15.00 ?  185 PRO A CB   2  
ATOM   5485   C  CG   . PRO A 1 143 ? 9.952   5.435   0.035   1.00 15.00 ?  185 PRO A CG   2  
ATOM   5486   C  CD   . PRO A 1 143 ? 9.023   6.580   -0.255  1.00 15.00 ?  185 PRO A CD   2  
ATOM   5487   H  HA   . PRO A 1 143 ? 11.505  8.122   1.001   1.00 15.00 ?  185 PRO A HA   2  
ATOM   5488   H  HB2  . PRO A 1 143 ? 12.030  5.470   0.500   1.00 15.00 ?  185 PRO A HB2  2  
ATOM   5489   H  HB3  . PRO A 1 143 ? 10.964  6.046   1.792   1.00 15.00 ?  185 PRO A HB3  2  
ATOM   5490   H  HG2  . PRO A 1 143 ? 10.270  4.961   -0.884  1.00 15.00 ?  185 PRO A HG2  2  
ATOM   5491   H  HG3  . PRO A 1 143 ? 9.462   4.718   0.678   1.00 15.00 ?  185 PRO A HG3  2  
ATOM   5492   H  HD2  . PRO A 1 143 ? 8.510   6.419   -1.191  1.00 15.00 ?  185 PRO A HD2  2  
ATOM   5493   H  HD3  . PRO A 1 143 ? 8.312   6.705   0.548   1.00 15.00 ?  185 PRO A HD3  2  
ATOM   5494   N  N    . GLY A 1 144 ? 12.093  6.897   -2.012  1.00 15.00 ?  186 GLY A N    2  
ATOM   5495   C  CA   . GLY A 1 144 ? 13.050  6.901   -3.094  1.00 15.00 ?  186 GLY A CA   2  
ATOM   5496   C  C    . GLY A 1 144 ? 13.118  5.552   -3.772  1.00 15.00 ?  186 GLY A C    2  
ATOM   5497   O  O    . GLY A 1 144 ? 12.258  4.704   -3.538  1.00 15.00 ?  186 GLY A O    2  
ATOM   5498   H  H    . GLY A 1 144 ? 11.252  6.406   -2.110  1.00 15.00 ?  186 GLY A H    2  
ATOM   5499   H  HA2  . GLY A 1 144 ? 12.763  7.650   -3.819  1.00 15.00 ?  186 GLY A HA2  2  
ATOM   5500   H  HA3  . GLY A 1 144 ? 14.025  7.145   -2.700  1.00 15.00 ?  186 GLY A HA3  2  
ATOM   5501   N  N    . PRO A 1 145 ? 14.123  5.321   -4.622  1.00 15.00 ?  187 PRO A N    2  
ATOM   5502   C  CA   . PRO A 1 145 ? 14.279  4.046   -5.329  1.00 15.00 ?  187 PRO A CA   2  
ATOM   5503   C  C    . PRO A 1 145 ? 14.536  2.887   -4.365  1.00 15.00 ?  187 PRO A C    2  
ATOM   5504   O  O    . PRO A 1 145 ? 15.486  2.918   -3.583  1.00 15.00 ?  187 PRO A O    2  
ATOM   5505   C  CB   . PRO A 1 145 ? 15.500  4.278   -6.233  1.00 15.00 ?  187 PRO A CB   2  
ATOM   5506   C  CG   . PRO A 1 145 ? 15.693  5.756   -6.272  1.00 15.00 ?  187 PRO A CG   2  
ATOM   5507   C  CD   . PRO A 1 145 ? 15.187  6.274   -4.961  1.00 15.00 ?  187 PRO A CD   2  
ATOM   5508   H  HA   . PRO A 1 145 ? 13.412  3.823   -5.936  1.00 15.00 ?  187 PRO A HA   2  
ATOM   5509   H  HB2  . PRO A 1 145 ? 16.366  3.784   -5.810  1.00 15.00 ?  187 PRO A HB2  2  
ATOM   5510   H  HB3  . PRO A 1 145 ? 15.302  3.907   -7.224  1.00 15.00 ?  187 PRO A HB3  2  
ATOM   5511   H  HG2  . PRO A 1 145 ? 16.744  5.986   -6.388  1.00 15.00 ?  187 PRO A HG2  2  
ATOM   5512   H  HG3  . PRO A 1 145 ? 15.122  6.183   -7.083  1.00 15.00 ?  187 PRO A HG3  2  
ATOM   5513   H  HD2  . PRO A 1 145 ? 15.972  6.258   -4.215  1.00 15.00 ?  187 PRO A HD2  2  
ATOM   5514   H  HD3  . PRO A 1 145 ? 14.791  7.272   -5.072  1.00 15.00 ?  187 PRO A HD3  2  
ATOM   5515   N  N    . GLY A 1 146 ? 13.669  1.885   -4.407  1.00 15.00 ?  188 GLY A N    2  
ATOM   5516   C  CA   . GLY A 1 146 ? 13.815  0.731   -3.540  1.00 15.00 ?  188 GLY A CA   2  
ATOM   5517   C  C    . GLY A 1 146 ? 13.265  -0.516  -4.192  1.00 15.00 ?  188 GLY A C    2  
ATOM   5518   O  O    . GLY A 1 146 ? 13.937  -1.136  -5.008  1.00 15.00 ?  188 GLY A O    2  
ATOM   5519   H  H    . GLY A 1 146 ? 12.919  1.923   -5.045  1.00 15.00 ?  188 GLY A H    2  
ATOM   5520   H  HA2  . GLY A 1 146 ? 14.862  0.585   -3.318  1.00 15.00 ?  188 GLY A HA2  2  
ATOM   5521   H  HA3  . GLY A 1 146 ? 13.280  0.910   -2.619  1.00 15.00 ?  188 GLY A HA3  2  
ATOM   5522   N  N    . HIS A 1 147 ? 12.035  -0.874  -3.844  1.00 15.00 ?  189 HIS A N    2  
ATOM   5523   C  CA   . HIS A 1 147 ? 11.382  -2.043  -4.427  1.00 15.00 ?  189 HIS A CA   2  
ATOM   5524   C  C    . HIS A 1 147 ? 11.116  -1.756  -5.900  1.00 15.00 ?  189 HIS A C    2  
ATOM   5525   O  O    . HIS A 1 147 ? 11.171  -2.644  -6.747  1.00 15.00 ?  189 HIS A O    2  
ATOM   5526   C  CB   . HIS A 1 147 ? 10.075  -2.348  -3.673  1.00 15.00 ?  189 HIS A CB   2  
ATOM   5527   C  CG   . HIS A 1 147 ? 9.153   -3.303  -4.377  1.00 15.00 ?  189 HIS A CG   2  
ATOM   5528   N  ND1  . HIS A 1 147 ? 9.547   -4.520  -4.891  1.00 15.00 ?  189 HIS A ND1  2  
ATOM   5529   C  CD2  . HIS A 1 147 ? 7.828   -3.194  -4.653  1.00 15.00 ?  189 HIS A CD2  2  
ATOM   5530   C  CE1  . HIS A 1 147 ? 8.477   -5.098  -5.450  1.00 15.00 ?  189 HIS A CE1  2  
ATOM   5531   N  NE2  . HIS A 1 147 ? 7.403   -4.333  -5.334  1.00 15.00 ?  189 HIS A NE2  2  
ATOM   5532   H  H    . HIS A 1 147 ? 11.546  -0.327  -3.198  1.00 15.00 ?  189 HIS A H    2  
ATOM   5533   H  HA   . HIS A 1 147 ? 12.055  -2.886  -4.344  1.00 15.00 ?  189 HIS A HA   2  
ATOM   5534   H  HB2  . HIS A 1 147 ? 10.315  -2.776  -2.711  1.00 15.00 ?  189 HIS A HB2  2  
ATOM   5535   H  HB3  . HIS A 1 147 ? 9.539   -1.422  -3.520  1.00 15.00 ?  189 HIS A HB3  2  
ATOM   5536   H  HD1  . HIS A 1 147 ? 10.460  -4.886  -4.875  1.00 15.00 ?  189 HIS A HD1  2  
ATOM   5537   H  HD2  . HIS A 1 147 ? 7.190   -2.361  -4.389  1.00 15.00 ?  189 HIS A HD2  2  
ATOM   5538   H  HE1  . HIS A 1 147 ? 8.488   -6.063  -5.937  1.00 15.00 ?  189 HIS A HE1  2  
ATOM   5539   N  N    . THR A 1 148 ? 10.833  -0.495  -6.169  1.00 15.00 ?  190 THR A N    2  
ATOM   5540   C  CA   . THR A 1 148 ? 10.584  -0.004  -7.507  1.00 15.00 ?  190 THR A CA   2  
ATOM   5541   C  C    . THR A 1 148 ? 11.080  1.438   -7.588  1.00 15.00 ?  190 THR A C    2  
ATOM   5542   O  O    . THR A 1 148 ? 11.705  1.934   -6.646  1.00 15.00 ?  190 THR A O    2  
ATOM   5543   C  CB   . THR A 1 148 ? 9.079   -0.070  -7.876  1.00 15.00 ?  190 THR A CB   2  
ATOM   5544   O  OG1  . THR A 1 148 ? 8.264   0.258   -6.743  1.00 15.00 ?  190 THR A OG1  2  
ATOM   5545   C  CG2  . THR A 1 148 ? 8.701   -1.451  -8.392  1.00 15.00 ?  190 THR A CG2  2  
ATOM   5546   H  H    . THR A 1 148 ? 10.786  0.143   -5.425  1.00 15.00 ?  190 THR A H    2  
ATOM   5547   H  HA   . THR A 1 148 ? 11.146  -0.614  -8.203  1.00 15.00 ?  190 THR A HA   2  
ATOM   5548   H  HB   . THR A 1 148 ? 8.887   0.648   -8.657  1.00 15.00 ?  190 THR A HB   2  
ATOM   5549   H  HG1  . THR A 1 148 ? 7.493   0.752   -7.049  1.00 15.00 ?  190 THR A HG1  2  
ATOM   5550   H  HG21 . THR A 1 148 ? 7.626   -1.563  -8.374  1.00 15.00 ?  190 THR A HG21 2  
ATOM   5551   H  HG22 . THR A 1 148 ? 9.149   -2.204  -7.761  1.00 15.00 ?  190 THR A HG22 2  
ATOM   5552   H  HG23 . THR A 1 148 ? 9.062   -1.570  -9.404  1.00 15.00 ?  190 THR A HG23 2  
ATOM   5553   N  N    . SER A 1 149 ? 10.818  2.117   -8.693  1.00 15.00 ?  191 SER A N    2  
ATOM   5554   C  CA   . SER A 1 149 ? 11.247  3.500   -8.839  1.00 15.00 ?  191 SER A CA   2  
ATOM   5555   C  C    . SER A 1 149 ? 10.094  4.453   -8.532  1.00 15.00 ?  191 SER A C    2  
ATOM   5556   O  O    . SER A 1 149 ? 10.281  5.667   -8.430  1.00 15.00 ?  191 SER A O    2  
ATOM   5557   C  CB   . SER A 1 149 ? 11.761  3.749   -10.257 1.00 15.00 ?  191 SER A CB   2  
ATOM   5558   O  OG   . SER A 1 149 ? 12.626  2.706   -10.675 1.00 15.00 ?  191 SER A OG   2  
ATOM   5559   H  H    . SER A 1 149 ? 10.329  1.683   -9.427  1.00 15.00 ?  191 SER A H    2  
ATOM   5560   H  HA   . SER A 1 149 ? 12.045  3.674   -8.134  1.00 15.00 ?  191 SER A HA   2  
ATOM   5561   H  HB2  . SER A 1 149 ? 10.922  3.798   -10.938 1.00 15.00 ?  191 SER A HB2  2  
ATOM   5562   H  HB3  . SER A 1 149 ? 12.302  4.684   -10.285 1.00 15.00 ?  191 SER A HB3  2  
ATOM   5563   H  HG   . SER A 1 149 ? 12.525  1.957   -10.079 1.00 15.00 ?  191 SER A HG   2  
ATOM   5564   N  N    . ASP A 1 150 ? 8.908   3.889   -8.367  1.00 15.00 ?  192 ASP A N    2  
ATOM   5565   C  CA   . ASP A 1 150 ? 7.709   4.673   -8.111  1.00 15.00 ?  192 ASP A CA   2  
ATOM   5566   C  C    . ASP A 1 150 ? 7.054   4.326   -6.775  1.00 15.00 ?  192 ASP A C    2  
ATOM   5567   O  O    . ASP A 1 150 ? 5.966   4.814   -6.480  1.00 15.00 ?  192 ASP A O    2  
ATOM   5568   C  CB   . ASP A 1 150 ? 6.699   4.429   -9.236  1.00 15.00 ?  192 ASP A CB   2  
ATOM   5569   C  CG   . ASP A 1 150 ? 6.184   2.999   -9.244  1.00 15.00 ?  192 ASP A CG   2  
ATOM   5570   O  OD1  . ASP A 1 150 ? 7.016   2.066   -9.155  1.00 15.00 ?  192 ASP A OD1  2  
ATOM   5571   O  OD2  . ASP A 1 150 ? 4.955   2.807   -9.331  1.00 15.00 -1 192 ASP A OD2  2  
ATOM   5572   H  H    . ASP A 1 150 ? 8.826   2.914   -8.442  1.00 15.00 ?  192 ASP A H    2  
ATOM   5573   H  HA   . ASP A 1 150 ? 7.983   5.717   -8.111  1.00 15.00 ?  192 ASP A HA   2  
ATOM   5574   H  HB2  . ASP A 1 150 ? 5.859   5.098   -9.111  1.00 15.00 ?  192 ASP A HB2  2  
ATOM   5575   H  HB3  . ASP A 1 150 ? 7.172   4.629   -10.188 1.00 15.00 ?  192 ASP A HB3  2  
ATOM   5576   N  N    . ASN A 1 151 ? 7.719   3.510   -5.967  1.00 15.00 ?  193 ASN A N    2  
ATOM   5577   C  CA   . ASN A 1 151 ? 7.156   3.100   -4.679  1.00 15.00 ?  193 ASN A CA   2  
ATOM   5578   C  C    . ASN A 1 151 ? 7.031   4.264   -3.696  1.00 15.00 ?  193 ASN A C    2  
ATOM   5579   O  O    . ASN A 1 151 ? 8.006   4.947   -3.384  1.00 15.00 ?  193 ASN A O    2  
ATOM   5580   C  CB   . ASN A 1 151 ? 7.959   1.947   -4.038  1.00 15.00 ?  193 ASN A CB   2  
ATOM   5581   C  CG   . ASN A 1 151 ? 9.476   2.131   -4.054  1.00 15.00 ?  193 ASN A CG   2  
ATOM   5582   O  OD1  . ASN A 1 151 ? 10.218  1.157   -4.096  1.00 15.00 ?  193 ASN A OD1  2  
ATOM   5583   N  ND2  . ASN A 1 151 ? 9.949   3.363   -3.999  1.00 15.00 ?  193 ASN A ND2  2  
ATOM   5584   H  H    . ASN A 1 151 ? 8.605   3.183   -6.234  1.00 15.00 ?  193 ASN A H    2  
ATOM   5585   H  HA   . ASN A 1 151 ? 6.159   2.742   -4.877  1.00 15.00 ?  193 ASN A HA   2  
ATOM   5586   H  HB2  . ASN A 1 151 ? 7.652   1.843   -3.010  1.00 15.00 ?  193 ASN A HB2  2  
ATOM   5587   H  HB3  . ASN A 1 151 ? 7.726   1.031   -4.564  1.00 15.00 ?  193 ASN A HB3  2  
ATOM   5588   H  HD21 . ASN A 1 151 ? 9.306   4.107   -3.948  1.00 15.00 ?  193 ASN A HD21 2  
ATOM   5589   H  HD22 . ASN A 1 151 ? 10.926  3.492   -4.005  1.00 15.00 ?  193 ASN A HD22 2  
ATOM   5590   N  N    . ILE A 1 152 ? 5.816   4.502   -3.234  1.00 15.00 ?  194 ILE A N    2  
ATOM   5591   C  CA   . ILE A 1 152 ? 5.565   5.550   -2.265  1.00 15.00 ?  194 ILE A CA   2  
ATOM   5592   C  C    . ILE A 1 152 ? 5.032   4.934   -0.979  1.00 15.00 ?  194 ILE A C    2  
ATOM   5593   O  O    . ILE A 1 152 ? 4.596   3.781   -0.971  1.00 15.00 ?  194 ILE A O    2  
ATOM   5594   C  CB   . ILE A 1 152 ? 4.569   6.609   -2.793  1.00 15.00 ?  194 ILE A CB   2  
ATOM   5595   C  CG1  . ILE A 1 152 ? 3.195   5.979   -3.053  1.00 15.00 ?  194 ILE A CG1  2  
ATOM   5596   C  CG2  . ILE A 1 152 ? 5.114   7.253   -4.063  1.00 15.00 ?  194 ILE A CG2  2  
ATOM   5597   C  CD1  . ILE A 1 152 ? 2.145   6.970   -3.514  1.00 15.00 ?  194 ILE A CD1  2  
ATOM   5598   H  H    . ILE A 1 152 ? 5.062   3.962   -3.563  1.00 15.00 ?  194 ILE A H    2  
ATOM   5599   H  HA   . ILE A 1 152 ? 6.504   6.039   -2.052  1.00 15.00 ?  194 ILE A HA   2  
ATOM   5600   H  HB   . ILE A 1 152 ? 4.469   7.379   -2.042  1.00 15.00 ?  194 ILE A HB   2  
ATOM   5601   H  HG12 . ILE A 1 152 ? 3.294   5.225   -3.819  1.00 15.00 ?  194 ILE A HG12 2  
ATOM   5602   H  HG13 . ILE A 1 152 ? 2.840   5.517   -2.143  1.00 15.00 ?  194 ILE A HG13 2  
ATOM   5603   H  HG21 . ILE A 1 152 ? 4.338   7.843   -4.526  1.00 15.00 ?  194 ILE A HG21 2  
ATOM   5604   H  HG22 . ILE A 1 152 ? 5.440   6.483   -4.744  1.00 15.00 ?  194 ILE A HG22 2  
ATOM   5605   H  HG23 . ILE A 1 152 ? 5.949   7.892   -3.814  1.00 15.00 ?  194 ILE A HG23 2  
ATOM   5606   H  HD11 . ILE A 1 152 ? 2.397   7.328   -4.502  1.00 15.00 ?  194 ILE A HD11 2  
ATOM   5607   H  HD12 . ILE A 1 152 ? 2.111   7.802   -2.829  1.00 15.00 ?  194 ILE A HD12 2  
ATOM   5608   H  HD13 . ILE A 1 152 ? 1.179   6.486   -3.541  1.00 15.00 ?  194 ILE A HD13 2  
ATOM   5609   N  N    . THR A 1 153 ? 5.076   5.694   0.098   1.00 15.00 ?  195 THR A N    2  
ATOM   5610   C  CA   . THR A 1 153 ? 4.605   5.226   1.387   1.00 15.00 ?  195 THR A CA   2  
ATOM   5611   C  C    . THR A 1 153 ? 3.529   6.160   1.928   1.00 15.00 ?  195 THR A C    2  
ATOM   5612   O  O    . THR A 1 153 ? 3.507   7.351   1.598   1.00 15.00 ?  195 THR A O    2  
ATOM   5613   C  CB   . THR A 1 153 ? 5.767   5.113   2.395   1.00 15.00 ?  195 THR A CB   2  
ATOM   5614   O  OG1  . THR A 1 153 ? 6.640   6.246   2.276   1.00 15.00 ?  195 THR A OG1  2  
ATOM   5615   C  CG2  . THR A 1 153 ? 6.561   3.841   2.155   1.00 15.00 ?  195 THR A CG2  2  
ATOM   5616   H  H    . THR A 1 153 ? 5.422   6.608   0.023   1.00 15.00 ?  195 THR A H    2  
ATOM   5617   H  HA   . THR A 1 153 ? 4.177   4.243   1.249   1.00 15.00 ?  195 THR A HA   2  
ATOM   5618   H  HB   . THR A 1 153 ? 5.359   5.084   3.396   1.00 15.00 ?  195 THR A HB   2  
ATOM   5619   H  HG1  . THR A 1 153 ? 6.258   6.880   1.663   1.00 15.00 ?  195 THR A HG1  2  
ATOM   5620   H  HG21 . THR A 1 153 ? 5.906   2.985   2.229   1.00 15.00 ?  195 THR A HG21 2  
ATOM   5621   H  HG22 . THR A 1 153 ? 7.344   3.761   2.893   1.00 15.00 ?  195 THR A HG22 2  
ATOM   5622   H  HG23 . THR A 1 153 ? 7.001   3.875   1.169   1.00 15.00 ?  195 THR A HG23 2  
ATOM   5623   N  N    . VAL A 1 154 ? 2.626   5.618   2.738   1.00 15.00 ?  196 VAL A N    2  
ATOM   5624   C  CA   . VAL A 1 154 ? 1.538   6.408   3.302   1.00 15.00 ?  196 VAL A CA   2  
ATOM   5625   C  C    . VAL A 1 154 ? 1.483   6.277   4.821   1.00 15.00 ?  196 VAL A C    2  
ATOM   5626   O  O    . VAL A 1 154 ? 1.544   5.175   5.366   1.00 15.00 ?  196 VAL A O    2  
ATOM   5627   C  CB   . VAL A 1 154 ? 0.164   5.991   2.724   1.00 15.00 ?  196 VAL A CB   2  
ATOM   5628   C  CG1  . VAL A 1 154 ? -0.914  7.005   3.089   1.00 15.00 ?  196 VAL A CG1  2  
ATOM   5629   C  CG2  . VAL A 1 154 ? 0.234   5.822   1.216   1.00 15.00 ?  196 VAL A CG2  2  
ATOM   5630   H  H    . VAL A 1 154 ? 2.701   4.670   2.973   1.00 15.00 ?  196 VAL A H    2  
ATOM   5631   H  HA   . VAL A 1 154 ? 1.713   7.443   3.048   1.00 15.00 ?  196 VAL A HA   2  
ATOM   5632   H  HB   . VAL A 1 154 ? -0.110  5.038   3.157   1.00 15.00 ?  196 VAL A HB   2  
ATOM   5633   H  HG11 . VAL A 1 154 ? -0.752  7.919   2.538   1.00 15.00 ?  196 VAL A HG11 2  
ATOM   5634   H  HG12 . VAL A 1 154 ? -0.875  7.210   4.149   1.00 15.00 ?  196 VAL A HG12 2  
ATOM   5635   H  HG13 . VAL A 1 154 ? -1.883  6.603   2.836   1.00 15.00 ?  196 VAL A HG13 2  
ATOM   5636   H  HG21 . VAL A 1 154 ? -0.713  5.451   0.852   1.00 15.00 ?  196 VAL A HG21 2  
ATOM   5637   H  HG22 . VAL A 1 154 ? 1.019   5.121   0.965   1.00 15.00 ?  196 VAL A HG22 2  
ATOM   5638   H  HG23 . VAL A 1 154 ? 0.444   6.777   0.759   1.00 15.00 ?  196 VAL A HG23 2  
ATOM   5639   N  N    . GLY A 1 155 ? 1.382   7.410   5.494   1.00 15.00 ?  197 GLY A N    2  
ATOM   5640   C  CA   . GLY A 1 155 ? 1.294   7.420   6.937   1.00 15.00 ?  197 GLY A CA   2  
ATOM   5641   C  C    . GLY A 1 155 ? -0.036  7.968   7.403   1.00 15.00 ?  197 GLY A C    2  
ATOM   5642   O  O    . GLY A 1 155 ? -0.515  8.972   6.873   1.00 15.00 ?  197 GLY A O    2  
ATOM   5643   H  H    . GLY A 1 155 ? 1.377   8.262   5.000   1.00 15.00 ?  197 GLY A H    2  
ATOM   5644   H  HA2  . GLY A 1 155 ? 1.411   6.411   7.303   1.00 15.00 ?  197 GLY A HA2  2  
ATOM   5645   H  HA3  . GLY A 1 155 ? 2.086   8.036   7.332   1.00 15.00 ?  197 GLY A HA3  2  
ATOM   5646   N  N    . ILE A 1 156 ? -0.637  7.325   8.390   1.00 15.00 ?  198 ILE A N    2  
ATOM   5647   C  CA   . ILE A 1 156 ? -1.923  7.768   8.902   1.00 15.00 ?  198 ILE A CA   2  
ATOM   5648   C  C    . ILE A 1 156 ? -1.736  8.731   10.070  1.00 15.00 ?  198 ILE A C    2  
ATOM   5649   O  O    . ILE A 1 156 ? -1.160  8.368   11.097  1.00 15.00 ?  198 ILE A O    2  
ATOM   5650   C  CB   . ILE A 1 156 ? -2.787  6.582   9.366   1.00 15.00 ?  198 ILE A CB   2  
ATOM   5651   C  CG1  . ILE A 1 156 ? -2.719  5.436   8.353   1.00 15.00 ?  198 ILE A CG1  2  
ATOM   5652   C  CG2  . ILE A 1 156 ? -4.228  7.028   9.576   1.00 15.00 ?  198 ILE A CG2  2  
ATOM   5653   C  CD1  . ILE A 1 156 ? -3.165  4.109   8.923   1.00 15.00 ?  198 ILE A CD1  2  
ATOM   5654   H  H    . ILE A 1 156 ? -0.205  6.540   8.791   1.00 15.00 ?  198 ILE A H    2  
ATOM   5655   H  HA   . ILE A 1 156 ? -2.445  8.278   8.102   1.00 15.00 ?  198 ILE A HA   2  
ATOM   5656   H  HB   . ILE A 1 156 ? -2.402  6.239   10.313  1.00 15.00 ?  198 ILE A HB   2  
ATOM   5657   H  HG12 . ILE A 1 156 ? -3.357  5.668   7.513   1.00 15.00 ?  198 ILE A HG12 2  
ATOM   5658   H  HG13 . ILE A 1 156 ? -1.701  5.327   8.009   1.00 15.00 ?  198 ILE A HG13 2  
ATOM   5659   H  HG21 . ILE A 1 156 ? -4.249  7.857   10.270  1.00 15.00 ?  198 ILE A HG21 2  
ATOM   5660   H  HG22 . ILE A 1 156 ? -4.803  6.210   9.978   1.00 15.00 ?  198 ILE A HG22 2  
ATOM   5661   H  HG23 . ILE A 1 156 ? -4.652  7.336   8.630   1.00 15.00 ?  198 ILE A HG23 2  
ATOM   5662   H  HD11 . ILE A 1 156 ? -4.215  4.158   9.171   1.00 15.00 ?  198 ILE A HD11 2  
ATOM   5663   H  HD12 . ILE A 1 156 ? -2.595  3.888   9.811   1.00 15.00 ?  198 ILE A HD12 2  
ATOM   5664   H  HD13 . ILE A 1 156 ? -3.004  3.332   8.193   1.00 15.00 ?  198 ILE A HD13 2  
ATOM   5665   N  N    . ASP A 1 157 ? -2.208  9.958   9.894   1.00 15.00 ?  199 ASP A N    2  
ATOM   5666   C  CA   . ASP A 1 157 ? -2.110  10.982  10.930  1.00 15.00 ?  199 ASP A CA   2  
ATOM   5667   C  C    . ASP A 1 157 ? -3.147  10.732  12.019  1.00 15.00 ?  199 ASP A C    2  
ATOM   5668   O  O    . ASP A 1 157 ? -4.340  10.587  11.737  1.00 15.00 ?  199 ASP A O    2  
ATOM   5669   C  CB   . ASP A 1 157 ? -2.304  12.374  10.322  1.00 15.00 ?  199 ASP A CB   2  
ATOM   5670   C  CG   . ASP A 1 157 ? -1.950  13.489  11.287  1.00 15.00 ?  199 ASP A CG   2  
ATOM   5671   O  OD1  . ASP A 1 157 ? -0.753  13.641  11.613  1.00 15.00 ?  199 ASP A OD1  2  
ATOM   5672   O  OD2  . ASP A 1 157 ? -2.863  14.232  11.706  1.00 15.00 -1 199 ASP A OD2  2  
ATOM   5673   H  H    . ASP A 1 157 ? -2.634  10.187  9.037   1.00 15.00 ?  199 ASP A H    2  
ATOM   5674   H  HA   . ASP A 1 157 ? -1.126  10.923  11.367  1.00 15.00 ?  199 ASP A HA   2  
ATOM   5675   H  HB2  . ASP A 1 157 ? -1.677  12.468  9.449   1.00 15.00 ?  199 ASP A HB2  2  
ATOM   5676   H  HB3  . ASP A 1 157 ? -3.340  12.489  10.030  1.00 15.00 ?  199 ASP A HB3  2  
ATOM   5677   N  N    . GLY A 1 158 ? -2.688  10.662  13.259  1.00 15.00 ?  200 GLY A N    2  
ATOM   5678   C  CA   . GLY A 1 158 ? -3.585  10.420  14.371  1.00 15.00 ?  200 GLY A CA   2  
ATOM   5679   C  C    . GLY A 1 158 ? -3.379  9.043   14.963  1.00 15.00 ?  200 GLY A C    2  
ATOM   5680   O  O    . GLY A 1 158 ? -3.968  8.699   15.990  1.00 15.00 ?  200 GLY A O    2  
ATOM   5681   H  H    . GLY A 1 158 ? -1.726  10.774  13.424  1.00 15.00 ?  200 GLY A H    2  
ATOM   5682   H  HA2  . GLY A 1 158 ? -3.406  11.161  15.135  1.00 15.00 ?  200 GLY A HA2  2  
ATOM   5683   H  HA3  . GLY A 1 158 ? -4.606  10.508  14.029  1.00 15.00 ?  200 GLY A HA3  2  
ATOM   5684   N  N    . THR A 1 159 ? -2.545  8.254   14.307  1.00 15.00 ?  201 THR A N    2  
ATOM   5685   C  CA   . THR A 1 159 ? -2.242  6.907   14.756  1.00 15.00 ?  201 THR A CA   2  
ATOM   5686   C  C    . THR A 1 159 ? -0.770  6.607   14.514  1.00 15.00 ?  201 THR A C    2  
ATOM   5687   O  O    . THR A 1 159 ? -0.168  7.148   13.586  1.00 15.00 ?  201 THR A O    2  
ATOM   5688   C  CB   . THR A 1 159 ? -3.107  5.867   14.016  1.00 15.00 ?  201 THR A CB   2  
ATOM   5689   O  OG1  . THR A 1 159 ? -3.602  6.429   12.795  1.00 15.00 ?  201 THR A OG1  2  
ATOM   5690   C  CG2  . THR A 1 159 ? -4.274  5.405   14.877  1.00 15.00 ?  201 THR A CG2  2  
ATOM   5691   H  H    . THR A 1 159 ? -2.108  8.588   13.496  1.00 15.00 ?  201 THR A H    2  
ATOM   5692   H  HA   . THR A 1 159 ? -2.451  6.846   15.813  1.00 15.00 ?  201 THR A HA   2  
ATOM   5693   H  HB   . THR A 1 159 ? -2.488  5.010   13.785  1.00 15.00 ?  201 THR A HB   2  
ATOM   5694   H  HG1  . THR A 1 159 ? -3.743  7.372   12.914  1.00 15.00 ?  201 THR A HG1  2  
ATOM   5695   H  HG21 . THR A 1 159 ? -4.766  6.263   15.308  1.00 15.00 ?  201 THR A HG21 2  
ATOM   5696   H  HG22 . THR A 1 159 ? -3.910  4.762   15.664  1.00 15.00 ?  201 THR A HG22 2  
ATOM   5697   H  HG23 . THR A 1 159 ? -4.976  4.860   14.263  1.00 15.00 ?  201 THR A HG23 2  
ATOM   5698   N  N    . ASP A 1 160 ? -0.189  5.744   15.331  1.00 15.00 ?  202 ASP A N    2  
ATOM   5699   C  CA   . ASP A 1 160 ? 1.217   5.392   15.189  1.00 15.00 ?  202 ASP A CA   2  
ATOM   5700   C  C    . ASP A 1 160 ? 1.397   4.245   14.193  1.00 15.00 ?  202 ASP A C    2  
ATOM   5701   O  O    . ASP A 1 160 ? 2.243   3.366   14.371  1.00 15.00 ?  202 ASP A O    2  
ATOM   5702   C  CB   . ASP A 1 160 ? 1.811   5.023   16.552  1.00 15.00 ?  202 ASP A CB   2  
ATOM   5703   C  CG   . ASP A 1 160 ? 1.121   3.847   17.215  1.00 15.00 ?  202 ASP A CG   2  
ATOM   5704   O  OD1  . ASP A 1 160 ? -0.093  3.943   17.515  1.00 15.00 ?  202 ASP A OD1  2  
ATOM   5705   O  OD2  . ASP A 1 160 ? 1.798   2.829   17.464  1.00 15.00 -1 202 ASP A OD2  2  
ATOM   5706   H  H    . ASP A 1 160 ? -0.716  5.327   16.051  1.00 15.00 ?  202 ASP A H    2  
ATOM   5707   H  HA   . ASP A 1 160 ? 1.732   6.262   14.810  1.00 15.00 ?  202 ASP A HA   2  
ATOM   5708   H  HB2  . ASP A 1 160 ? 2.850   4.770   16.421  1.00 15.00 ?  202 ASP A HB2  2  
ATOM   5709   H  HB3  . ASP A 1 160 ? 1.734   5.876   17.211  1.00 15.00 ?  202 ASP A HB3  2  
ATOM   5710   N  N    . ILE A 1 161 ? 0.608   4.288   13.127  1.00 15.00 ?  203 ILE A N    2  
ATOM   5711   C  CA   . ILE A 1 161 ? 0.637   3.272   12.089  1.00 15.00 ?  203 ILE A CA   2  
ATOM   5712   C  C    . ILE A 1 161 ? 1.131   3.863   10.771  1.00 15.00 ?  203 ILE A C    2  
ATOM   5713   O  O    . ILE A 1 161 ? 0.672   4.929   10.351  1.00 15.00 ?  203 ILE A O    2  
ATOM   5714   C  CB   . ILE A 1 161 ? -0.768  2.671   11.872  1.00 15.00 ?  203 ILE A CB   2  
ATOM   5715   C  CG1  . ILE A 1 161 ? -1.330  2.128   13.189  1.00 15.00 ?  203 ILE A CG1  2  
ATOM   5716   C  CG2  . ILE A 1 161 ? -0.719  1.573   10.824  1.00 15.00 ?  203 ILE A CG2  2  
ATOM   5717   C  CD1  . ILE A 1 161 ? -2.788  1.722   13.109  1.00 15.00 ?  203 ILE A CD1  2  
ATOM   5718   H  H    . ILE A 1 161 ? -0.012  5.038   13.032  1.00 15.00 ?  203 ILE A H    2  
ATOM   5719   H  HA   . ILE A 1 161 ? 1.307   2.483   12.400  1.00 15.00 ?  203 ILE A HA   2  
ATOM   5720   H  HB   . ILE A 1 161 ? -1.413  3.456   11.510  1.00 15.00 ?  203 ILE A HB   2  
ATOM   5721   H  HG12 . ILE A 1 161 ? -0.762  1.258   13.481  1.00 15.00 ?  203 ILE A HG12 2  
ATOM   5722   H  HG13 . ILE A 1 161 ? -1.235  2.883   13.953  1.00 15.00 ?  203 ILE A HG13 2  
ATOM   5723   H  HG21 . ILE A 1 161 ? -0.370  1.986   9.890   1.00 15.00 ?  203 ILE A HG21 2  
ATOM   5724   H  HG22 . ILE A 1 161 ? -1.706  1.159   10.692  1.00 15.00 ?  203 ILE A HG22 2  
ATOM   5725   H  HG23 . ILE A 1 161 ? -0.043  0.798   11.149  1.00 15.00 ?  203 ILE A HG23 2  
ATOM   5726   H  HD11 . ILE A 1 161 ? -2.909  0.959   12.356  1.00 15.00 ?  203 ILE A HD11 2  
ATOM   5727   H  HD12 . ILE A 1 161 ? -3.388  2.582   12.848  1.00 15.00 ?  203 ILE A HD12 2  
ATOM   5728   H  HD13 . ILE A 1 161 ? -3.108  1.334   14.067  1.00 15.00 ?  203 ILE A HD13 2  
ATOM   5729   N  N    . ALA A 1 162 ? 2.078   3.181   10.140  1.00 15.00 ?  204 ALA A N    2  
ATOM   5730   C  CA   . ALA A 1 162 ? 2.629   3.617   8.863   1.00 15.00 ?  204 ALA A CA   2  
ATOM   5731   C  C    . ALA A 1 162 ? 2.579   2.475   7.856   1.00 15.00 ?  204 ALA A C    2  
ATOM   5732   O  O    . ALA A 1 162 ? 2.789   1.315   8.214   1.00 15.00 ?  204 ALA A O    2  
ATOM   5733   C  CB   . ALA A 1 162 ? 4.059   4.112   9.034   1.00 15.00 ?  204 ALA A CB   2  
ATOM   5734   H  H    . ALA A 1 162 ? 2.415   2.349   10.543  1.00 15.00 ?  204 ALA A H    2  
ATOM   5735   H  HA   . ALA A 1 162 ? 2.027   4.437   8.498   1.00 15.00 ?  204 ALA A HA   2  
ATOM   5736   H  HB1  . ALA A 1 162 ? 4.081   4.907   9.762   1.00 15.00 ?  204 ALA A HB1  2  
ATOM   5737   H  HB2  . ALA A 1 162 ? 4.427   4.483   8.088   1.00 15.00 ?  204 ALA A HB2  2  
ATOM   5738   H  HB3  . ALA A 1 162 ? 4.686   3.299   9.369   1.00 15.00 ?  204 ALA A HB3  2  
ATOM   5739   N  N    . PHE A 1 163 ? 2.293   2.801   6.603   1.00 15.00 ?  205 PHE A N    2  
ATOM   5740   C  CA   . PHE A 1 163 ? 2.211   1.800   5.548   1.00 15.00 ?  205 PHE A CA   2  
ATOM   5741   C  C    . PHE A 1 163 ? 3.484   1.809   4.703   1.00 15.00 ?  205 PHE A C    2  
ATOM   5742   O  O    . PHE A 1 163 ? 3.801   2.812   4.062   1.00 15.00 ?  205 PHE A O    2  
ATOM   5743   C  CB   . PHE A 1 163 ? 0.990   2.070   4.664   1.00 15.00 ?  205 PHE A CB   2  
ATOM   5744   C  CG   . PHE A 1 163 ? 0.603   0.912   3.782   1.00 15.00 ?  205 PHE A CG   2  
ATOM   5745   C  CD1  . PHE A 1 163 ? 0.265   -0.315  4.333   1.00 15.00 ?  205 PHE A CD1  2  
ATOM   5746   C  CD2  . PHE A 1 163 ? 0.566   1.055   2.406   1.00 15.00 ?  205 PHE A CD2  2  
ATOM   5747   C  CE1  . PHE A 1 163 ? -0.101  -1.373  3.527   1.00 15.00 ?  205 PHE A CE1  2  
ATOM   5748   C  CE2  . PHE A 1 163 ? 0.203   -0.002  1.597   1.00 15.00 ?  205 PHE A CE2  2  
ATOM   5749   C  CZ   . PHE A 1 163 ? -0.131  -1.216  2.157   1.00 15.00 ?  205 PHE A CZ   2  
ATOM   5750   H  H    . PHE A 1 163 ? 2.138   3.746   6.375   1.00 15.00 ?  205 PHE A H    2  
ATOM   5751   H  HA   . PHE A 1 163 ? 2.101   0.831   6.012   1.00 15.00 ?  205 PHE A HA   2  
ATOM   5752   H  HB2  . PHE A 1 163 ? 0.143   2.304   5.290   1.00 15.00 ?  205 PHE A HB2  2  
ATOM   5753   H  HB3  . PHE A 1 163 ? 1.201   2.917   4.026   1.00 15.00 ?  205 PHE A HB3  2  
ATOM   5754   H  HD1  . PHE A 1 163 ? 0.289   -0.438  5.406   1.00 15.00 ?  205 PHE A HD1  2  
ATOM   5755   H  HD2  . PHE A 1 163 ? 0.827   2.006   1.964   1.00 15.00 ?  205 PHE A HD2  2  
ATOM   5756   H  HE1  . PHE A 1 163 ? -0.359  -2.323  3.966   1.00 15.00 ?  205 PHE A HE1  2  
ATOM   5757   H  HE2  . PHE A 1 163 ? 0.180   0.121   0.526   1.00 15.00 ?  205 PHE A HE2  2  
ATOM   5758   H  HZ   . PHE A 1 163 ? -0.416  -2.041  1.524   1.00 15.00 ?  205 PHE A HZ   2  
ATOM   5759   N  N    . GLY A 1 164 ? 4.199   0.688   4.701   1.00 15.00 ?  206 GLY A N    2  
ATOM   5760   C  CA   . GLY A 1 164 ? 5.430   0.583   3.937   1.00 15.00 ?  206 GLY A CA   2  
ATOM   5761   C  C    . GLY A 1 164 ? 5.232   -0.161  2.632   1.00 15.00 ?  206 GLY A C    2  
ATOM   5762   O  O    . GLY A 1 164 ? 6.175   -0.332  1.860   1.00 15.00 ?  206 GLY A O    2  
ATOM   5763   H  H    . GLY A 1 164 ? 3.884   -0.084  5.226   1.00 15.00 ?  206 GLY A H    2  
ATOM   5764   H  HA2  . GLY A 1 164 ? 5.798   1.577   3.723   1.00 15.00 ?  206 GLY A HA2  2  
ATOM   5765   H  HA3  . GLY A 1 164 ? 6.169   0.061   4.530   1.00 15.00 ?  206 GLY A HA3  2  
ATOM   5766   N  N    . GLY A 1 165 ? 4.002   -0.612  2.392   1.00 15.00 ?  207 GLY A N    2  
ATOM   5767   C  CA   . GLY A 1 165 ? 3.692   -1.330  1.168   1.00 15.00 ?  207 GLY A CA   2  
ATOM   5768   C  C    . GLY A 1 165 ? 4.529   -2.582  0.997   1.00 15.00 ?  207 GLY A C    2  
ATOM   5769   O  O    . GLY A 1 165 ? 4.597   -3.419  1.895   1.00 15.00 ?  207 GLY A O    2  
ATOM   5770   H  H    . GLY A 1 165 ? 3.298   -0.452  3.056   1.00 15.00 ?  207 GLY A H    2  
ATOM   5771   H  HA2  . GLY A 1 165 ? 2.649   -1.609  1.180   1.00 15.00 ?  207 GLY A HA2  2  
ATOM   5772   H  HA3  . GLY A 1 165 ? 3.868   -0.675  0.328   1.00 15.00 ?  207 GLY A HA3  2  
ATOM   5773   N  N    . CYS A 1 166 ? 5.178   -2.703  -0.151  1.00 15.00 ?  208 CYS A N    2  
ATOM   5774   C  CA   . CYS A 1 166 ? 6.020   -3.860  -0.432  1.00 15.00 ?  208 CYS A CA   2  
ATOM   5775   C  C    . CYS A 1 166 ? 7.493   -3.477  -0.374  1.00 15.00 ?  208 CYS A C    2  
ATOM   5776   O  O    . CYS A 1 166 ? 8.370   -4.267  -0.736  1.00 15.00 ?  208 CYS A O    2  
ATOM   5777   C  CB   . CYS A 1 166 ? 5.680   -4.427  -1.812  1.00 15.00 ?  208 CYS A CB   2  
ATOM   5778   S  SG   . CYS A 1 166 ? 3.907   -4.488  -2.167  1.00 15.00 ?  208 CYS A SG   2  
ATOM   5779   H  H    . CYS A 1 166 ? 5.084   -2.004  -0.831  1.00 15.00 ?  208 CYS A H    2  
ATOM   5780   H  HA   . CYS A 1 166 ? 5.822   -4.612  0.317   1.00 15.00 ?  208 CYS A HA   2  
ATOM   5781   H  HB2  . CYS A 1 166 ? 6.145   -3.812  -2.569  1.00 15.00 ?  208 CYS A HB2  2  
ATOM   5782   H  HB3  . CYS A 1 166 ? 6.067   -5.433  -1.886  1.00 15.00 ?  208 CYS A HB3  2  
ATOM   5783   H  HG   . CYS A 1 166 ? 3.588   -5.746  -2.458  1.00 15.00 ?  208 CYS A HG   2  
ATOM   5784   N  N    . LEU A 1 167 ? 7.755   -2.255  0.079   1.00 15.00 ?  209 LEU A N    2  
ATOM   5785   C  CA   . LEU A 1 167 ? 9.116   -1.743  0.184   1.00 15.00 ?  209 LEU A CA   2  
ATOM   5786   C  C    . LEU A 1 167 ? 9.792   -2.260  1.450   1.00 15.00 ?  209 LEU A C    2  
ATOM   5787   O  O    . LEU A 1 167 ? 10.941  -2.697  1.415   1.00 15.00 ?  209 LEU A O    2  
ATOM   5788   C  CB   . LEU A 1 167 ? 9.095   -0.209  0.184   1.00 15.00 ?  209 LEU A CB   2  
ATOM   5789   C  CG   . LEU A 1 167 ? 10.420  0.462   0.549   1.00 15.00 ?  209 LEU A CG   2  
ATOM   5790   C  CD1  . LEU A 1 167 ? 11.420  0.337   -0.586  1.00 15.00 ?  209 LEU A CD1  2  
ATOM   5791   C  CD2  . LEU A 1 167 ? 10.195  1.921   0.905   1.00 15.00 ?  209 LEU A CD2  2  
ATOM   5792   H  H    . LEU A 1 167 ? 7.009   -1.680  0.361   1.00 15.00 ?  209 LEU A H    2  
ATOM   5793   H  HA   . LEU A 1 167 ? 9.670   -2.086  -0.675  1.00 15.00 ?  209 LEU A HA   2  
ATOM   5794   H  HB2  . LEU A 1 167 ? 8.807   0.126   -0.801  1.00 15.00 ?  209 LEU A HB2  2  
ATOM   5795   H  HB3  . LEU A 1 167 ? 8.346   0.122   0.889   1.00 15.00 ?  209 LEU A HB3  2  
ATOM   5796   H  HG   . LEU A 1 167 ? 10.835  -0.034  1.417   1.00 15.00 ?  209 LEU A HG   2  
ATOM   5797   H  HD11 . LEU A 1 167 ? 11.017  0.801   -1.473  1.00 15.00 ?  209 LEU A HD11 2  
ATOM   5798   H  HD12 . LEU A 1 167 ? 11.616  -0.706  -0.780  1.00 15.00 ?  209 LEU A HD12 2  
ATOM   5799   H  HD13 . LEU A 1 167 ? 12.339  0.832   -0.312  1.00 15.00 ?  209 LEU A HD13 2  
ATOM   5800   H  HD21 . LEU A 1 167 ? 11.150  2.412   1.022   1.00 15.00 ?  209 LEU A HD21 2  
ATOM   5801   H  HD22 . LEU A 1 167 ? 9.640   1.984   1.832   1.00 15.00 ?  209 LEU A HD22 2  
ATOM   5802   H  HD23 . LEU A 1 167 ? 9.636   2.399   0.115   1.00 15.00 ?  209 LEU A HD23 2  
ATOM   5803   N  N    . ILE A 1 168 ? 9.060   -2.225  2.554   1.00 15.00 ?  210 ILE A N    2  
ATOM   5804   C  CA   . ILE A 1 168 ? 9.580   -2.668  3.842   1.00 15.00 ?  210 ILE A CA   2  
ATOM   5805   C  C    . ILE A 1 168 ? 9.242   -4.134  4.086   1.00 15.00 ?  210 ILE A C    2  
ATOM   5806   O  O    . ILE A 1 168 ? 8.188   -4.612  3.667   1.00 15.00 ?  210 ILE A O    2  
ATOM   5807   C  CB   . ILE A 1 168 ? 9.007   -1.811  4.993   1.00 15.00 ?  210 ILE A CB   2  
ATOM   5808   C  CG1  . ILE A 1 168 ? 9.197   -0.321  4.688   1.00 15.00 ?  210 ILE A CG1  2  
ATOM   5809   C  CG2  . ILE A 1 168 ? 9.664   -2.177  6.318   1.00 15.00 ?  210 ILE A CG2  2  
ATOM   5810   C  CD1  . ILE A 1 168 ? 10.649  0.119   4.654   1.00 15.00 ?  210 ILE A CD1  2  
ATOM   5811   H  H    . ILE A 1 168 ? 8.136   -1.904  2.499   1.00 15.00 ?  210 ILE A H    2  
ATOM   5812   H  HA   . ILE A 1 168 ? 10.654  -2.549  3.829   1.00 15.00 ?  210 ILE A HA   2  
ATOM   5813   H  HB   . ILE A 1 168 ? 7.950   -2.019  5.075   1.00 15.00 ?  210 ILE A HB   2  
ATOM   5814   H  HG12 . ILE A 1 168 ? 8.762   -0.101  3.725   1.00 15.00 ?  210 ILE A HG12 2  
ATOM   5815   H  HG13 . ILE A 1 168 ? 8.691   0.262   5.446   1.00 15.00 ?  210 ILE A HG13 2  
ATOM   5816   H  HG21 . ILE A 1 168 ? 10.735  -2.066  6.230   1.00 15.00 ?  210 ILE A HG21 2  
ATOM   5817   H  HG22 . ILE A 1 168 ? 9.428   -3.201  6.564   1.00 15.00 ?  210 ILE A HG22 2  
ATOM   5818   H  HG23 . ILE A 1 168 ? 9.298   -1.524  7.095   1.00 15.00 ?  210 ILE A HG23 2  
ATOM   5819   H  HD11 . ILE A 1 168 ? 10.716  1.103   4.216   1.00 15.00 ?  210 ILE A HD11 2  
ATOM   5820   H  HD12 . ILE A 1 168 ? 11.223  -0.578  4.064   1.00 15.00 ?  210 ILE A HD12 2  
ATOM   5821   H  HD13 . ILE A 1 168 ? 11.041  0.144   5.660   1.00 15.00 ?  210 ILE A HD13 2  
ATOM   5822   N  N    . LYS A 1 169 ? 10.148  -4.841  4.745   1.00 15.00 ?  211 LYS A N    2  
ATOM   5823   C  CA   . LYS A 1 169 ? 9.947   -6.246  5.057   1.00 15.00 ?  211 LYS A CA   2  
ATOM   5824   C  C    . LYS A 1 169 ? 9.748   -6.420  6.554   1.00 15.00 ?  211 LYS A C    2  
ATOM   5825   O  O    . LYS A 1 169 ? 10.028  -5.505  7.331   1.00 15.00 ?  211 LYS A O    2  
ATOM   5826   C  CB   . LYS A 1 169 ? 11.145  -7.083  4.597   1.00 15.00 ?  211 LYS A CB   2  
ATOM   5827   C  CG   . LYS A 1 169 ? 11.573  -6.813  3.165   1.00 15.00 ?  211 LYS A CG   2  
ATOM   5828   C  CD   . LYS A 1 169 ? 10.494  -7.205  2.167   1.00 15.00 ?  211 LYS A CD   2  
ATOM   5829   C  CE   . LYS A 1 169 ? 10.538  -6.323  0.929   1.00 15.00 ?  211 LYS A CE   2  
ATOM   5830   N  NZ   . LYS A 1 169 ? 9.684   -6.854  -0.163  1.00 15.00 1  211 LYS A NZ   2  
ATOM   5831   H  H    . LYS A 1 169 ? 10.974  -4.404  5.047   1.00 15.00 ?  211 LYS A H    2  
ATOM   5832   H  HA   . LYS A 1 169 ? 9.058   -6.578  4.539   1.00 15.00 ?  211 LYS A HA   2  
ATOM   5833   H  HB2  . LYS A 1 169 ? 11.983  -6.873  5.244   1.00 15.00 ?  211 LYS A HB2  2  
ATOM   5834   H  HB3  . LYS A 1 169 ? 10.889  -8.130  4.682   1.00 15.00 ?  211 LYS A HB3  2  
ATOM   5835   H  HG2  . LYS A 1 169 ? 11.781  -5.760  3.055   1.00 15.00 ?  211 LYS A HG2  2  
ATOM   5836   H  HG3  . LYS A 1 169 ? 12.467  -7.384  2.956   1.00 15.00 ?  211 LYS A HG3  2  
ATOM   5837   H  HD2  . LYS A 1 169 ? 10.645  -8.231  1.869   1.00 15.00 ?  211 LYS A HD2  2  
ATOM   5838   H  HD3  . LYS A 1 169 ? 9.525   -7.103  2.633   1.00 15.00 ?  211 LYS A HD3  2  
ATOM   5839   H  HE2  . LYS A 1 169 ? 10.191  -5.335  1.192   1.00 15.00 ?  211 LYS A HE2  2  
ATOM   5840   H  HE3  . LYS A 1 169 ? 11.556  -6.265  0.580   1.00 15.00 ?  211 LYS A HE3  2  
ATOM   5841   H  HZ1  . LYS A 1 169 ? 10.178  -7.629  -0.658  1.00 15.00 ?  211 LYS A HZ1  2  
ATOM   5842   H  HZ2  . LYS A 1 169 ? 9.466   -6.101  -0.843  1.00 15.00 ?  211 LYS A HZ2  2  
ATOM   5843   H  HZ3  . LYS A 1 169 ? 8.793   -7.223  0.226   1.00 15.00 ?  211 LYS A HZ3  2  
ATOM   5844   N  N    . ASP A 1 170 ? 9.264   -7.586  6.956   1.00 15.00 ?  212 ASP A N    2  
ATOM   5845   C  CA   . ASP A 1 170 ? 9.025   -7.866  8.368   1.00 15.00 ?  212 ASP A CA   2  
ATOM   5846   C  C    . ASP A 1 170 ? 10.326  -8.217  9.079   1.00 15.00 ?  212 ASP A C    2  
ATOM   5847   O  O    . ASP A 1 170 ? 11.364  -8.416  8.445   1.00 15.00 ?  212 ASP A O    2  
ATOM   5848   C  CB   . ASP A 1 170 ? 8.010   -9.002  8.535   1.00 15.00 ?  212 ASP A CB   2  
ATOM   5849   C  CG   . ASP A 1 170 ? 8.435   -10.275 7.835   1.00 15.00 ?  212 ASP A CG   2  
ATOM   5850   O  OD1  . ASP A 1 170 ? 8.788   -11.252 8.526   1.00 15.00 ?  212 ASP A OD1  2  
ATOM   5851   O  OD2  . ASP A 1 170 ? 8.399   -10.310 6.585   1.00 15.00 -1 212 ASP A OD2  2  
ATOM   5852   H  H    . ASP A 1 170 ? 9.061   -8.277  6.291   1.00 15.00 ?  212 ASP A H    2  
ATOM   5853   H  HA   . ASP A 1 170 ? 8.621   -6.971  8.815   1.00 15.00 ?  212 ASP A HA   2  
ATOM   5854   H  HB2  . ASP A 1 170 ? 7.889   -9.215  9.589   1.00 15.00 ?  212 ASP A HB2  2  
ATOM   5855   H  HB3  . ASP A 1 170 ? 7.060   -8.688  8.128   1.00 15.00 ?  212 ASP A HB3  2  
ATOM   5856   N  N    . SER A 1 171 ? 10.257  -8.318  10.397  1.00 15.00 ?  213 SER A N    2  
ATOM   5857   C  CA   . SER A 1 171 ? 11.429  -8.617  11.208  1.00 15.00 ?  213 SER A CA   2  
ATOM   5858   C  C    . SER A 1 171 ? 11.809  -10.099 11.145  1.00 15.00 ?  213 SER A C    2  
ATOM   5859   O  O    . SER A 1 171 ? 12.701  -10.551 11.867  1.00 15.00 ?  213 SER A O    2  
ATOM   5860   C  CB   . SER A 1 171 ? 11.164  -8.199  12.653  1.00 15.00 ?  213 SER A CB   2  
ATOM   5861   O  OG   . SER A 1 171 ? 9.923   -8.711  13.112  1.00 15.00 ?  213 SER A OG   2  
ATOM   5862   H  H    . SER A 1 171 ? 9.388   -8.180  10.842  1.00 15.00 ?  213 SER A H    2  
ATOM   5863   H  HA   . SER A 1 171 ? 12.254  -8.032  10.825  1.00 15.00 ?  213 SER A HA   2  
ATOM   5864   H  HB2  . SER A 1 171 ? 11.953  -8.577  13.285  1.00 15.00 ?  213 SER A HB2  2  
ATOM   5865   H  HB3  . SER A 1 171 ? 11.138  -7.120  12.714  1.00 15.00 ?  213 SER A HB3  2  
ATOM   5866   H  HG   . SER A 1 171 ? 9.192   -8.232  12.681  1.00 15.00 ?  213 SER A HG   2  
ATOM   5867   N  N    . LYS A 1 172 ? 11.125  -10.853 10.293  1.00 15.00 ?  214 LYS A N    2  
ATOM   5868   C  CA   . LYS A 1 172 ? 11.402  -12.275 10.137  1.00 15.00 ?  214 LYS A CA   2  
ATOM   5869   C  C    . LYS A 1 172 ? 11.673  -12.618 8.675   1.00 15.00 ?  214 LYS A C    2  
ATOM   5870   O  O    . LYS A 1 172 ? 11.634  -13.785 8.280   1.00 15.00 ?  214 LYS A O    2  
ATOM   5871   C  CB   . LYS A 1 172 ? 10.230  -13.107 10.669  1.00 15.00 ?  214 LYS A CB   2  
ATOM   5872   C  CG   . LYS A 1 172 ? 10.035  -13.004 12.174  1.00 15.00 ?  214 LYS A CG   2  
ATOM   5873   C  CD   . LYS A 1 172 ? 10.992  -13.917 12.923  1.00 15.00 ?  214 LYS A CD   2  
ATOM   5874   C  CE   . LYS A 1 172 ? 11.435  -13.302 14.242  1.00 15.00 ?  214 LYS A CE   2  
ATOM   5875   N  NZ   . LYS A 1 172 ? 12.495  -12.275 14.051  1.00 15.00 1  214 LYS A NZ   2  
ATOM   5876   H  H    . LYS A 1 172 ? 10.407  -10.443 9.759   1.00 15.00 ?  214 LYS A H    2  
ATOM   5877   H  HA   . LYS A 1 172 ? 12.283  -12.503 10.713  1.00 15.00 ?  214 LYS A HA   2  
ATOM   5878   H  HB2  . LYS A 1 172 ? 9.322   -12.776 10.187  1.00 15.00 ?  214 LYS A HB2  2  
ATOM   5879   H  HB3  . LYS A 1 172 ? 10.400  -14.143 10.419  1.00 15.00 ?  214 LYS A HB3  2  
ATOM   5880   H  HG2  . LYS A 1 172 ? 10.211  -11.986 12.482  1.00 15.00 ?  214 LYS A HG2  2  
ATOM   5881   H  HG3  . LYS A 1 172 ? 9.021   -13.285 12.414  1.00 15.00 ?  214 LYS A HG3  2  
ATOM   5882   H  HD2  . LYS A 1 172 ? 10.496  -14.856 13.123  1.00 15.00 ?  214 LYS A HD2  2  
ATOM   5883   H  HD3  . LYS A 1 172 ? 11.861  -14.092 12.310  1.00 15.00 ?  214 LYS A HD3  2  
ATOM   5884   H  HE2  . LYS A 1 172 ? 10.583  -12.840 14.711  1.00 15.00 ?  214 LYS A HE2  2  
ATOM   5885   H  HE3  . LYS A 1 172 ? 11.815  -14.087 14.877  1.00 15.00 ?  214 LYS A HE3  2  
ATOM   5886   H  HZ1  . LYS A 1 172 ? 13.426  -12.731 13.948  1.00 15.00 ?  214 LYS A HZ1  2  
ATOM   5887   H  HZ2  . LYS A 1 172 ? 12.527  -11.634 14.870  1.00 15.00 ?  214 LYS A HZ2  2  
ATOM   5888   H  HZ3  . LYS A 1 172 ? 12.304  -11.713 13.196  1.00 15.00 ?  214 LYS A HZ3  2  
ATOM   5889   N  N    . ALA A 1 173 ? 11.955  -11.601 7.873   1.00 15.00 ?  215 ALA A N    2  
ATOM   5890   C  CA   . ALA A 1 173 ? 12.238  -11.804 6.462   1.00 15.00 ?  215 ALA A CA   2  
ATOM   5891   C  C    . ALA A 1 173 ? 13.658  -12.317 6.282   1.00 15.00 ?  215 ALA A C    2  
ATOM   5892   O  O    . ALA A 1 173 ? 14.535  -12.033 7.100   1.00 15.00 ?  215 ALA A O    2  
ATOM   5893   C  CB   . ALA A 1 173 ? 12.026  -10.511 5.692   1.00 15.00 ?  215 ALA A CB   2  
ATOM   5894   H  H    . ALA A 1 173 ? 11.974  -10.691 8.240   1.00 15.00 ?  215 ALA A H    2  
ATOM   5895   H  HA   . ALA A 1 173 ? 11.550  -12.542 6.080   1.00 15.00 ?  215 ALA A HA   2  
ATOM   5896   H  HB1  . ALA A 1 173 ? 12.397  -10.624 4.683   1.00 15.00 ?  215 ALA A HB1  2  
ATOM   5897   H  HB2  . ALA A 1 173 ? 12.555  -9.708  6.182   1.00 15.00 ?  215 ALA A HB2  2  
ATOM   5898   H  HB3  . ALA A 1 173 ? 10.970  -10.280 5.663   1.00 15.00 ?  215 ALA A HB3  2  
ATOM   5899   N  N    . LYS A 1 174 ? 13.879  -13.098 5.234   1.00 15.00 ?  216 LYS A N    2  
ATOM   5900   C  CA   . LYS A 1 174 ? 15.204  -13.653 4.957   1.00 15.00 ?  216 LYS A CA   2  
ATOM   5901   C  C    . LYS A 1 174 ? 15.749  -13.115 3.639   1.00 15.00 ?  216 LYS A C    2  
ATOM   5902   O  O    . LYS A 1 174 ? 16.910  -13.341 3.288   1.00 15.00 ?  216 LYS A O    2  
ATOM   5903   C  CB   . LYS A 1 174 ? 15.142  -15.186 4.906   1.00 15.00 ?  216 LYS A CB   2  
ATOM   5904   C  CG   . LYS A 1 174 ? 14.287  -15.807 6.000   1.00 15.00 ?  216 LYS A CG   2  
ATOM   5905   C  CD   . LYS A 1 174 ? 14.382  -17.320 5.974   1.00 15.00 ?  216 LYS A CD   2  
ATOM   5906   C  CE   . LYS A 1 174 ? 13.394  -17.963 6.935   1.00 15.00 ?  216 LYS A CE   2  
ATOM   5907   N  NZ   . LYS A 1 174 ? 13.205  -19.412 6.656   1.00 15.00 1  216 LYS A NZ   2  
ATOM   5908   H  H    . LYS A 1 174 ? 13.134  -13.318 4.635   1.00 15.00 ?  216 LYS A H    2  
ATOM   5909   H  HA   . LYS A 1 174 ? 15.864  -13.353 5.754   1.00 15.00 ?  216 LYS A HA   2  
ATOM   5910   H  HB2  . LYS A 1 174 ? 14.739  -15.490 3.953   1.00 15.00 ?  216 LYS A HB2  2  
ATOM   5911   H  HB3  . LYS A 1 174 ? 16.146  -15.575 5.000   1.00 15.00 ?  216 LYS A HB3  2  
ATOM   5912   H  HG2  . LYS A 1 174 ? 14.629  -15.452 6.962   1.00 15.00 ?  216 LYS A HG2  2  
ATOM   5913   H  HG3  . LYS A 1 174 ? 13.259  -15.515 5.853   1.00 15.00 ?  216 LYS A HG3  2  
ATOM   5914   H  HD2  . LYS A 1 174 ? 14.174  -17.665 4.974   1.00 15.00 ?  216 LYS A HD2  2  
ATOM   5915   H  HD3  . LYS A 1 174 ? 15.384  -17.609 6.257   1.00 15.00 ?  216 LYS A HD3  2  
ATOM   5916   H  HE2  . LYS A 1 174 ? 13.762  -17.846 7.943   1.00 15.00 ?  216 LYS A HE2  2  
ATOM   5917   H  HE3  . LYS A 1 174 ? 12.442  -17.459 6.839   1.00 15.00 ?  216 LYS A HE3  2  
ATOM   5918   H  HZ1  . LYS A 1 174 ? 12.582  -19.841 7.371   1.00 15.00 ?  216 LYS A HZ1  2  
ATOM   5919   H  HZ2  . LYS A 1 174 ? 14.120  -19.905 6.673   1.00 15.00 ?  216 LYS A HZ2  2  
ATOM   5920   H  HZ3  . LYS A 1 174 ? 12.773  -19.544 5.717   1.00 15.00 ?  216 LYS A HZ3  2  
ATOM   5921   N  N    . SER A 1 175 ? 14.904  -12.394 2.919   1.00 15.00 ?  217 SER A N    2  
ATOM   5922   C  CA   . SER A 1 175 ? 15.278  -11.831 1.635   1.00 15.00 ?  217 SER A CA   2  
ATOM   5923   C  C    . SER A 1 175 ? 14.371  -10.650 1.298   1.00 15.00 ?  217 SER A C    2  
ATOM   5924   O  O    . SER A 1 175 ? 13.339  -10.459 1.944   1.00 15.00 ?  217 SER A O    2  
ATOM   5925   C  CB   . SER A 1 175 ? 15.166  -12.914 0.563   1.00 15.00 ?  217 SER A CB   2  
ATOM   5926   O  OG   . SER A 1 175 ? 14.231  -13.914 0.947   1.00 15.00 ?  217 SER A OG   2  
ATOM   5927   H  H    . SER A 1 175 ? 14.004  -12.225 3.267   1.00 15.00 ?  217 SER A H    2  
ATOM   5928   H  HA   . SER A 1 175 ? 16.303  -11.494 1.696   1.00 15.00 ?  217 SER A HA   2  
ATOM   5929   H  HB2  . SER A 1 175 ? 14.837  -12.467 -0.360  1.00 15.00 ?  217 SER A HB2  2  
ATOM   5930   H  HB3  . SER A 1 175 ? 16.132  -13.377 0.418   1.00 15.00 ?  217 SER A HB3  2  
ATOM   5931   H  HG   . SER A 1 175 ? 13.651  -13.564 1.636   1.00 15.00 ?  217 SER A HG   2  
ATOM   5932   N  N    . LEU A 1 176 ? 14.746  -9.870  0.291   1.00 15.00 ?  218 LEU A N    2  
ATOM   5933   C  CA   . LEU A 1 176 ? 13.948  -8.723  -0.123  1.00 15.00 ?  218 LEU A CA   2  
ATOM   5934   C  C    . LEU A 1 176 ? 12.831  -9.176  -1.059  1.00 15.00 ?  218 LEU A C    2  
ATOM   5935   O  O    . LEU A 1 176 ? 11.768  -8.550  -1.134  1.00 15.00 ?  218 LEU A O    2  
ATOM   5936   C  CB   . LEU A 1 176 ? 14.827  -7.672  -0.812  1.00 15.00 ?  218 LEU A CB   2  
ATOM   5937   C  CG   . LEU A 1 176 ? 15.902  -7.032  0.079   1.00 15.00 ?  218 LEU A CG   2  
ATOM   5938   C  CD1  . LEU A 1 176 ? 16.667  -5.960  -0.686  1.00 15.00 ?  218 LEU A CD1  2  
ATOM   5939   C  CD2  . LEU A 1 176 ? 15.279  -6.448  1.341   1.00 15.00 ?  218 LEU A CD2  2  
ATOM   5940   H  H    . LEU A 1 176 ? 15.575  -10.073 -0.192  1.00 15.00 ?  218 LEU A H    2  
ATOM   5941   H  HA   . LEU A 1 176 ? 13.506  -8.289  0.764   1.00 15.00 ?  218 LEU A HA   2  
ATOM   5942   H  HB2  . LEU A 1 176 ? 15.320  -8.144  -1.648  1.00 15.00 ?  218 LEU A HB2  2  
ATOM   5943   H  HB3  . LEU A 1 176 ? 14.188  -6.887  -1.189  1.00 15.00 ?  218 LEU A HB3  2  
ATOM   5944   H  HG   . LEU A 1 176 ? 16.607  -7.790  0.377   1.00 15.00 ?  218 LEU A HG   2  
ATOM   5945   H  HD11 . LEU A 1 176 ? 15.990  -5.167  -0.971  1.00 15.00 ?  218 LEU A HD11 2  
ATOM   5946   H  HD12 . LEU A 1 176 ? 17.109  -6.394  -1.571  1.00 15.00 ?  218 LEU A HD12 2  
ATOM   5947   H  HD13 . LEU A 1 176 ? 17.447  -5.556  -0.056  1.00 15.00 ?  218 LEU A HD13 2  
ATOM   5948   H  HD21 . LEU A 1 176 ? 14.882  -7.247  1.950   1.00 15.00 ?  218 LEU A HD21 2  
ATOM   5949   H  HD22 . LEU A 1 176 ? 14.480  -5.775  1.068   1.00 15.00 ?  218 LEU A HD22 2  
ATOM   5950   H  HD23 . LEU A 1 176 ? 16.032  -5.907  1.895   1.00 15.00 ?  218 LEU A HD23 2  
ATOM   5951   N  N    . GLY A 1 177 ? 13.078  -10.269 -1.767  1.00 15.00 ?  219 GLY A N    2  
ATOM   5952   C  CA   . GLY A 1 177 ? 12.084  -10.804 -2.673  1.00 15.00 ?  219 GLY A CA   2  
ATOM   5953   C  C    . GLY A 1 177 ? 12.441  -10.591 -4.126  1.00 15.00 ?  219 GLY A C    2  
ATOM   5954   O  O    . GLY A 1 177 ? 13.530  -10.963 -4.566  1.00 15.00 ?  219 GLY A O    2  
ATOM   5955   H  H    . GLY A 1 177 ? 13.952  -10.708 -1.683  1.00 15.00 ?  219 GLY A H    2  
ATOM   5956   H  HA2  . GLY A 1 177 ? 11.981  -11.862 -2.491  1.00 15.00 ?  219 GLY A HA2  2  
ATOM   5957   H  HA3  . GLY A 1 177 ? 11.140  -10.323 -2.471  1.00 15.00 ?  219 GLY A HA3  2  
ATOM   5958   N  N    . ASN A 1 178 ? 11.524  -9.989  -4.873  1.00 15.00 ?  220 ASN A N    2  
ATOM   5959   C  CA   . ASN A 1 178 ? 11.744  -9.726  -6.289  1.00 15.00 ?  220 ASN A CA   2  
ATOM   5960   C  C    . ASN A 1 178 ? 12.690  -8.546  -6.461  1.00 15.00 ?  220 ASN A C    2  
ATOM   5961   O  O    . ASN A 1 178 ? 12.360  -7.413  -6.111  1.00 15.00 ?  220 ASN A O    2  
ATOM   5962   C  CB   . ASN A 1 178 ? 10.422  -9.449  -7.009  1.00 15.00 ?  220 ASN A CB   2  
ATOM   5963   C  CG   . ASN A 1 178 ? 10.608  -9.297  -8.510  1.00 15.00 ?  220 ASN A CG   2  
ATOM   5964   O  OD1  . ASN A 1 178 ? 10.961  -8.226  -9.000  1.00 15.00 ?  220 ASN A OD1  2  
ATOM   5965   N  ND2  . ASN A 1 178 ? 10.365  -10.368 -9.251  1.00 15.00 ?  220 ASN A ND2  2  
ATOM   5966   H  H    . ASN A 1 178 ? 10.682  -9.710  -4.463  1.00 15.00 ?  220 ASN A H    2  
ATOM   5967   H  HA   . ASN A 1 178 ? 12.200  -10.605 -6.719  1.00 15.00 ?  220 ASN A HA   2  
ATOM   5968   H  HB2  . ASN A 1 178 ? 9.744   -10.268 -6.832  1.00 15.00 ?  220 ASN A HB2  2  
ATOM   5969   H  HB3  . ASN A 1 178 ? 9.989   -8.537  -6.625  1.00 15.00 ?  220 ASN A HB3  2  
ATOM   5970   H  HD21 . ASN A 1 178 ? 10.081  -11.193 -8.798  1.00 15.00 ?  220 ASN A HD21 2  
ATOM   5971   H  HD22 . ASN A 1 178 ? 10.475  -10.295 -10.226 1.00 15.00 ?  220 ASN A HD22 2  
ATOM   5972   N  N    . LEU A 1 179 ? 13.872  -8.825  -6.982  1.00 15.00 ?  221 LEU A N    2  
ATOM   5973   C  CA   . LEU A 1 179 ? 14.876  -7.795  -7.203  1.00 15.00 ?  221 LEU A CA   2  
ATOM   5974   C  C    . LEU A 1 179 ? 14.953  -7.438  -8.678  1.00 15.00 ?  221 LEU A C    2  
ATOM   5975   O  O    . LEU A 1 179 ? 15.915  -6.817  -9.125  1.00 15.00 ?  221 LEU A O    2  
ATOM   5976   C  CB   . LEU A 1 179 ? 16.241  -8.282  -6.721  1.00 15.00 ?  221 LEU A CB   2  
ATOM   5977   C  CG   . LEU A 1 179 ? 16.319  -8.667  -5.243  1.00 15.00 ?  221 LEU A CG   2  
ATOM   5978   C  CD1  . LEU A 1 179 ? 17.608  -9.422  -4.955  1.00 15.00 ?  221 LEU A CD1  2  
ATOM   5979   C  CD2  . LEU A 1 179 ? 16.223  -7.431  -4.361  1.00 15.00 ?  221 LEU A CD2  2  
ATOM   5980   H  H    . LEU A 1 179 ? 14.080  -9.755  -7.225  1.00 15.00 ?  221 LEU A H    2  
ATOM   5981   H  HA   . LEU A 1 179 ? 14.590  -6.920  -6.641  1.00 15.00 ?  221 LEU A HA   2  
ATOM   5982   H  HB2  . LEU A 1 179 ? 16.516  -9.143  -7.310  1.00 15.00 ?  221 LEU A HB2  2  
ATOM   5983   H  HB3  . LEU A 1 179 ? 16.960  -7.501  -6.903  1.00 15.00 ?  221 LEU A HB3  2  
ATOM   5984   H  HG   . LEU A 1 179 ? 15.491  -9.315  -5.005  1.00 15.00 ?  221 LEU A HG   2  
ATOM   5985   H  HD11 . LEU A 1 179 ? 18.451  -8.827  -5.272  1.00 15.00 ?  221 LEU A HD11 2  
ATOM   5986   H  HD12 . LEU A 1 179 ? 17.603  -10.360 -5.492  1.00 15.00 ?  221 LEU A HD12 2  
ATOM   5987   H  HD13 . LEU A 1 179 ? 17.684  -9.615  -3.896  1.00 15.00 ?  221 LEU A HD13 2  
ATOM   5988   H  HD21 . LEU A 1 179 ? 16.912  -6.678  -4.718  1.00 15.00 ?  221 LEU A HD21 2  
ATOM   5989   H  HD22 . LEU A 1 179 ? 16.477  -7.697  -3.346  1.00 15.00 ?  221 LEU A HD22 2  
ATOM   5990   H  HD23 . LEU A 1 179 ? 15.217  -7.044  -4.392  1.00 15.00 ?  221 LEU A HD23 2  
ATOM   5991   N  N    . GLY A 1 180 ? 13.932  -7.833  -9.430  1.00 15.00 ?  222 GLY A N    2  
ATOM   5992   C  CA   . GLY A 1 180 ? 13.904  -7.560  -10.853 1.00 15.00 ?  222 GLY A CA   2  
ATOM   5993   C  C    . GLY A 1 180 ? 13.790  -6.083  -11.158 1.00 15.00 ?  222 GLY A C    2  
ATOM   5994   O  O    . GLY A 1 180 ? 14.640  -5.514  -11.842 1.00 15.00 ?  222 GLY A O    2  
ATOM   5995   H  H    . GLY A 1 180 ? 13.183  -8.307  -9.011  1.00 15.00 ?  222 GLY A H    2  
ATOM   5996   H  HA2  . GLY A 1 180 ? 14.810  -7.941  -11.300 1.00 15.00 ?  222 GLY A HA2  2  
ATOM   5997   H  HA3  . GLY A 1 180 ? 13.059  -8.072  -11.287 1.00 15.00 ?  222 GLY A HA3  2  
ATOM   5998   N  N    . ASP A 1 181 ? 12.754  -5.453  -10.627 1.00 15.00 ?  223 ASP A N    2  
ATOM   5999   C  CA   . ASP A 1 181 ? 12.524  -4.026  -10.852 1.00 15.00 ?  223 ASP A CA   2  
ATOM   6000   C  C    . ASP A 1 181 ? 12.938  -3.223  -9.628  1.00 15.00 ?  223 ASP A C    2  
ATOM   6001   O  O    . ASP A 1 181 ? 12.565  -2.058  -9.480  1.00 15.00 ?  223 ASP A O    2  
ATOM   6002   C  CB   . ASP A 1 181 ? 11.048  -3.761  -11.161 1.00 15.00 ?  223 ASP A CB   2  
ATOM   6003   C  CG   . ASP A 1 181 ? 10.603  -4.372  -12.476 1.00 15.00 ?  223 ASP A CG   2  
ATOM   6004   O  OD1  . ASP A 1 181 ? 10.832  -3.754  -13.536 1.00 15.00 ?  223 ASP A OD1  2  
ATOM   6005   O  OD2  . ASP A 1 181 ? 10.013  -5.480  -12.456 1.00 15.00 -1 223 ASP A OD2  2  
ATOM   6006   H  H    . ASP A 1 181 ? 12.124  -5.956  -10.068 1.00 15.00 ?  223 ASP A H    2  
ATOM   6007   H  HA   . ASP A 1 181 ? 13.125  -3.719  -11.693 1.00 15.00 ?  223 ASP A HA   2  
ATOM   6008   H  HB2  . ASP A 1 181 ? 10.442  -4.177  -10.371 1.00 15.00 ?  223 ASP A HB2  2  
ATOM   6009   H  HB3  . ASP A 1 181 ? 10.883  -2.695  -11.210 1.00 15.00 ?  223 ASP A HB3  2  
ATOM   6010   N  N    . ALA A 1 182 ? 13.721  -3.849  -8.766  1.00 15.00 ?  224 ALA A N    2  
ATOM   6011   C  CA   . ALA A 1 182 ? 14.170  -3.212  -7.538  1.00 15.00 ?  224 ALA A CA   2  
ATOM   6012   C  C    . ALA A 1 182 ? 15.539  -2.562  -7.699  1.00 15.00 ?  224 ALA A C    2  
ATOM   6013   O  O    . ALA A 1 182 ? 16.341  -2.965  -8.548  1.00 15.00 ?  224 ALA A O    2  
ATOM   6014   C  CB   . ALA A 1 182 ? 14.200  -4.227  -6.408  1.00 15.00 ?  224 ALA A CB   2  
ATOM   6015   H  H    . ALA A 1 182 ? 14.016  -4.760  -8.966  1.00 15.00 ?  224 ALA A H    2  
ATOM   6016   H  HA   . ALA A 1 182 ? 13.449  -2.449  -7.280  1.00 15.00 ?  224 ALA A HA   2  
ATOM   6017   H  HB1  . ALA A 1 182 ? 14.197  -3.710  -5.459  1.00 15.00 ?  224 ALA A HB1  2  
ATOM   6018   H  HB2  . ALA A 1 182 ? 15.094  -4.829  -6.490  1.00 15.00 ?  224 ALA A HB2  2  
ATOM   6019   H  HB3  . ALA A 1 182 ? 13.328  -4.863  -6.474  1.00 15.00 ?  224 ALA A HB3  2  
ATOM   6020   N  N    . ASP A 1 183 ? 15.795  -1.555  -6.874  1.00 15.00 ?  225 ASP A N    2  
ATOM   6021   C  CA   . ASP A 1 183 ? 17.060  -0.834  -6.890  1.00 15.00 ?  225 ASP A CA   2  
ATOM   6022   C  C    . ASP A 1 183 ? 17.879  -1.230  -5.671  1.00 15.00 ?  225 ASP A C    2  
ATOM   6023   O  O    . ASP A 1 183 ? 17.555  -0.860  -4.542  1.00 15.00 ?  225 ASP A O    2  
ATOM   6024   C  CB   . ASP A 1 183 ? 16.832  0.680   -6.894  1.00 15.00 ?  225 ASP A CB   2  
ATOM   6025   C  CG   . ASP A 1 183 ? 18.093  1.440   -7.246  1.00 15.00 ?  225 ASP A CG   2  
ATOM   6026   O  OD1  . ASP A 1 183 ? 18.757  1.968   -6.330  1.00 15.00 ?  225 ASP A OD1  2  
ATOM   6027   O  OD2  . ASP A 1 183 ? 18.438  1.496   -8.445  1.00 15.00 -1 225 ASP A OD2  2  
ATOM   6028   H  H    . ASP A 1 183 ? 15.112  -1.299  -6.214  1.00 15.00 ?  225 ASP A H    2  
ATOM   6029   H  HA   . ASP A 1 183 ? 17.596  -1.118  -7.782  1.00 15.00 ?  225 ASP A HA   2  
ATOM   6030   H  HB2  . ASP A 1 183 ? 16.067  0.927   -7.617  1.00 15.00 ?  225 ASP A HB2  2  
ATOM   6031   H  HB3  . ASP A 1 183 ? 16.508  0.991   -5.912  1.00 15.00 ?  225 ASP A HB3  2  
ATOM   6032   N  N    . THR A 1 184 ? 18.930  -1.996  -5.903  1.00 15.00 ?  226 THR A N    2  
ATOM   6033   C  CA   . THR A 1 184 ? 19.786  -2.489  -4.832  1.00 15.00 ?  226 THR A CA   2  
ATOM   6034   C  C    . THR A 1 184 ? 20.630  -1.394  -4.181  1.00 15.00 ?  226 THR A C    2  
ATOM   6035   O  O    . THR A 1 184 ? 20.975  -1.489  -2.998  1.00 15.00 ?  226 THR A O    2  
ATOM   6036   C  CB   . THR A 1 184 ? 20.736  -3.573  -5.369  1.00 15.00 ?  226 THR A CB   2  
ATOM   6037   O  OG1  . THR A 1 184 ? 20.346  -3.963  -6.693  1.00 15.00 ?  226 THR A OG1  2  
ATOM   6038   C  CG2  . THR A 1 184 ? 20.749  -4.790  -4.461  1.00 15.00 ?  226 THR A CG2  2  
ATOM   6039   H  H    . THR A 1 184 ? 19.140  -2.248  -6.827  1.00 15.00 ?  226 THR A H    2  
ATOM   6040   H  HA   . THR A 1 184 ? 19.156  -2.939  -4.081  1.00 15.00 ?  226 THR A HA   2  
ATOM   6041   H  HB   . THR A 1 184 ? 21.736  -3.165  -5.408  1.00 15.00 ?  226 THR A HB   2  
ATOM   6042   H  HG1  . THR A 1 184 ? 21.138  -4.191  -7.197  1.00 15.00 ?  226 THR A HG1  2  
ATOM   6043   H  HG21 . THR A 1 184 ? 19.782  -5.267  -4.485  1.00 15.00 ?  226 THR A HG21 2  
ATOM   6044   H  HG22 . THR A 1 184 ? 20.977  -4.481  -3.449  1.00 15.00 ?  226 THR A HG22 2  
ATOM   6045   H  HG23 . THR A 1 184 ? 21.501  -5.485  -4.800  1.00 15.00 ?  226 THR A HG23 2  
ATOM   6046   N  N    . GLU A 1 185 ? 20.960  -0.360  -4.943  1.00 15.00 ?  227 GLU A N    2  
ATOM   6047   C  CA   . GLU A 1 185 ? 21.805  0.714   -4.438  1.00 15.00 ?  227 GLU A CA   2  
ATOM   6048   C  C    . GLU A 1 185 ? 21.097  1.599   -3.411  1.00 15.00 ?  227 GLU A C    2  
ATOM   6049   O  O    . GLU A 1 185 ? 21.597  1.782   -2.301  1.00 15.00 ?  227 GLU A O    2  
ATOM   6050   C  CB   . GLU A 1 185 ? 22.331  1.570   -5.596  1.00 15.00 ?  227 GLU A CB   2  
ATOM   6051   C  CG   . GLU A 1 185 ? 23.601  2.338   -5.259  1.00 15.00 ?  227 GLU A CG   2  
ATOM   6052   C  CD   . GLU A 1 185 ? 24.711  1.432   -4.766  1.00 15.00 ?  227 GLU A CD   2  
ATOM   6053   O  OE1  . GLU A 1 185 ? 25.343  0.748   -5.598  1.00 15.00 ?  227 GLU A OE1  2  
ATOM   6054   O  OE2  . GLU A 1 185 ? 24.957  1.396   -3.543  1.00 15.00 -1 227 GLU A OE2  2  
ATOM   6055   H  H    . GLU A 1 185 ? 20.635  -0.319  -5.867  1.00 15.00 ?  227 GLU A H    2  
ATOM   6056   H  HA   . GLU A 1 185 ? 22.652  0.252   -3.950  1.00 15.00 ?  227 GLU A HA   2  
ATOM   6057   H  HB2  . GLU A 1 185 ? 22.541  0.928   -6.438  1.00 15.00 ?  227 GLU A HB2  2  
ATOM   6058   H  HB3  . GLU A 1 185 ? 21.572  2.284   -5.881  1.00 15.00 ?  227 GLU A HB3  2  
ATOM   6059   H  HG2  . GLU A 1 185 ? 23.947  2.848   -6.149  1.00 15.00 ?  227 GLU A HG2  2  
ATOM   6060   H  HG3  . GLU A 1 185 ? 23.376  3.064   -4.489  1.00 15.00 ?  227 GLU A HG3  2  
ATOM   6061   N  N    . HIS A 1 186 ? 19.933  2.125   -3.755  1.00 15.00 ?  228 HIS A N    2  
ATOM   6062   C  CA   . HIS A 1 186 ? 19.227  3.033   -2.853  1.00 15.00 ?  228 HIS A CA   2  
ATOM   6063   C  C    . HIS A 1 186 ? 18.223  2.330   -1.943  1.00 15.00 ?  228 HIS A C    2  
ATOM   6064   O  O    . HIS A 1 186 ? 17.561  2.986   -1.143  1.00 15.00 ?  228 HIS A O    2  
ATOM   6065   C  CB   . HIS A 1 186 ? 18.517  4.128   -3.658  1.00 15.00 ?  228 HIS A CB   2  
ATOM   6066   C  CG   . HIS A 1 186 ? 19.415  4.877   -4.594  1.00 15.00 ?  228 HIS A CG   2  
ATOM   6067   N  ND1  . HIS A 1 186 ? 19.636  4.516   -5.904  1.00 15.00 ?  228 HIS A ND1  2  
ATOM   6068   C  CD2  . HIS A 1 186 ? 20.145  6.003   -4.389  1.00 15.00 ?  228 HIS A CD2  2  
ATOM   6069   C  CE1  . HIS A 1 186 ? 20.472  5.414   -6.443  1.00 15.00 ?  228 HIS A CE1  2  
ATOM   6070   N  NE2  . HIS A 1 186 ? 20.810  6.339   -5.564  1.00 15.00 ?  228 HIS A NE2  2  
ATOM   6071   H  H    . HIS A 1 186 ? 19.541  1.912   -4.639  1.00 15.00 ?  228 HIS A H    2  
ATOM   6072   H  HA   . HIS A 1 186 ? 19.971  3.503   -2.230  1.00 15.00 ?  228 HIS A HA   2  
ATOM   6073   H  HB2  . HIS A 1 186 ? 17.728  3.681   -4.242  1.00 15.00 ?  228 HIS A HB2  2  
ATOM   6074   H  HB3  . HIS A 1 186 ? 18.087  4.844   -2.971  1.00 15.00 ?  228 HIS A HB3  2  
ATOM   6075   H  HD1  . HIS A 1 186 ? 19.260  3.721   -6.358  1.00 15.00 ?  228 HIS A HD1  2  
ATOM   6076   H  HD2  . HIS A 1 186 ? 20.204  6.558   -3.466  1.00 15.00 ?  228 HIS A HD2  2  
ATOM   6077   H  HE1  . HIS A 1 186 ? 20.819  5.389   -7.465  1.00 15.00 ?  228 HIS A HE1  2  
ATOM   6078   N  N    . TYR A 1 187 ? 18.117  1.010   -2.041  1.00 15.00 ?  229 TYR A N    2  
ATOM   6079   C  CA   . TYR A 1 187 ? 17.166  0.262   -1.214  1.00 15.00 ?  229 TYR A CA   2  
ATOM   6080   C  C    . TYR A 1 187 ? 17.389  0.518   0.279   1.00 15.00 ?  229 TYR A C    2  
ATOM   6081   O  O    . TYR A 1 187 ? 16.442  0.806   1.013   1.00 15.00 ?  229 TYR A O    2  
ATOM   6082   C  CB   . TYR A 1 187 ? 17.265  -1.236  -1.503  1.00 15.00 ?  229 TYR A CB   2  
ATOM   6083   C  CG   . TYR A 1 187 ? 15.984  -1.996  -1.218  1.00 15.00 ?  229 TYR A CG   2  
ATOM   6084   C  CD1  . TYR A 1 187 ? 15.536  -2.188  0.083   1.00 15.00 ?  229 TYR A CD1  2  
ATOM   6085   C  CD2  . TYR A 1 187 ? 15.222  -2.521  -2.255  1.00 15.00 ?  229 TYR A CD2  2  
ATOM   6086   C  CE1  . TYR A 1 187 ? 14.365  -2.877  0.342   1.00 15.00 ?  229 TYR A CE1  2  
ATOM   6087   C  CE2  . TYR A 1 187 ? 14.052  -3.212  -2.004  1.00 15.00 ?  229 TYR A CE2  2  
ATOM   6088   C  CZ   . TYR A 1 187 ? 13.627  -3.387  -0.703  1.00 15.00 ?  229 TYR A CZ   2  
ATOM   6089   O  OH   . TYR A 1 187 ? 12.458  -4.067  -0.446  1.00 15.00 ?  229 TYR A OH   2  
ATOM   6090   H  H    . TYR A 1 187 ? 18.675  0.529   -2.689  1.00 15.00 ?  229 TYR A H    2  
ATOM   6091   H  HA   . TYR A 1 187 ? 16.173  0.600   -1.469  1.00 15.00 ?  229 TYR A HA   2  
ATOM   6092   H  HB2  . TYR A 1 187 ? 17.512  -1.377  -2.545  1.00 15.00 ?  229 TYR A HB2  2  
ATOM   6093   H  HB3  . TYR A 1 187 ? 18.045  -1.663  -0.893  1.00 15.00 ?  229 TYR A HB3  2  
ATOM   6094   H  HD1  . TYR A 1 187 ? 16.118  -1.786  0.899   1.00 15.00 ?  229 TYR A HD1  2  
ATOM   6095   H  HD2  . TYR A 1 187 ? 15.559  -2.382  -3.272  1.00 15.00 ?  229 TYR A HD2  2  
ATOM   6096   H  HE1  . TYR A 1 187 ? 14.034  -3.015  1.361   1.00 15.00 ?  229 TYR A HE1  2  
ATOM   6097   H  HE2  . TYR A 1 187 ? 13.474  -3.610  -2.826  1.00 15.00 ?  229 TYR A HE2  2  
ATOM   6098   H  HH   . TYR A 1 187 ? 11.947  -3.578  0.215   1.00 15.00 ?  229 TYR A HH   2  
ATOM   6099   N  N    . ALA A 1 188 ? 18.637  0.428   0.720   1.00 15.00 ?  230 ALA A N    2  
ATOM   6100   C  CA   . ALA A 1 188 ? 18.967  0.631   2.126   1.00 15.00 ?  230 ALA A CA   2  
ATOM   6101   C  C    . ALA A 1 188 ? 18.648  2.055   2.581   1.00 15.00 ?  230 ALA A C    2  
ATOM   6102   O  O    . ALA A 1 188 ? 18.025  2.259   3.626   1.00 15.00 ?  230 ALA A O    2  
ATOM   6103   C  CB   . ALA A 1 188 ? 20.434  0.311   2.373   1.00 15.00 ?  230 ALA A CB   2  
ATOM   6104   H  H    . ALA A 1 188 ? 19.356  0.228   0.086   1.00 15.00 ?  230 ALA A H    2  
ATOM   6105   H  HA   . ALA A 1 188 ? 18.370  -0.059  2.707   1.00 15.00 ?  230 ALA A HA   2  
ATOM   6106   H  HB1  . ALA A 1 188 ? 21.050  1.006   1.825   1.00 15.00 ?  230 ALA A HB1  2  
ATOM   6107   H  HB2  . ALA A 1 188 ? 20.644  -0.694  2.040   1.00 15.00 ?  230 ALA A HB2  2  
ATOM   6108   H  HB3  . ALA A 1 188 ? 20.649  0.392   3.429   1.00 15.00 ?  230 ALA A HB3  2  
ATOM   6109   N  N    . ALA A 1 189 ? 19.067  3.032   1.789   1.00 15.00 ?  231 ALA A N    2  
ATOM   6110   C  CA   . ALA A 1 189 ? 18.836  4.434   2.117   1.00 15.00 ?  231 ALA A CA   2  
ATOM   6111   C  C    . ALA A 1 189 ? 17.349  4.769   2.130   1.00 15.00 ?  231 ALA A C    2  
ATOM   6112   O  O    . ALA A 1 189 ? 16.862  5.418   3.056   1.00 15.00 ?  231 ALA A O    2  
ATOM   6113   C  CB   . ALA A 1 189 ? 19.572  5.346   1.146   1.00 15.00 ?  231 ALA A CB   2  
ATOM   6114   H  H    . ALA A 1 189 ? 19.542  2.805   0.959   1.00 15.00 ?  231 ALA A H    2  
ATOM   6115   H  HA   . ALA A 1 189 ? 19.235  4.607   3.107   1.00 15.00 ?  231 ALA A HA   2  
ATOM   6116   H  HB1  . ALA A 1 189 ? 19.254  5.131   0.134   1.00 15.00 ?  231 ALA A HB1  2  
ATOM   6117   H  HB2  . ALA A 1 189 ? 20.636  5.182   1.232   1.00 15.00 ?  231 ALA A HB2  2  
ATOM   6118   H  HB3  . ALA A 1 189 ? 19.346  6.377   1.382   1.00 15.00 ?  231 ALA A HB3  2  
ATOM   6119   N  N    . SER A 1 190 ? 16.627  4.313   1.113   1.00 15.00 ?  232 SER A N    2  
ATOM   6120   C  CA   . SER A 1 190 ? 15.198  4.576   1.014   1.00 15.00 ?  232 SER A CA   2  
ATOM   6121   C  C    . SER A 1 190 ? 14.443  3.969   2.195   1.00 15.00 ?  232 SER A C    2  
ATOM   6122   O  O    . SER A 1 190 ? 13.506  4.573   2.721   1.00 15.00 ?  232 SER A O    2  
ATOM   6123   C  CB   . SER A 1 190 ? 14.656  4.032   -0.306  1.00 15.00 ?  232 SER A CB   2  
ATOM   6124   O  OG   . SER A 1 190 ? 15.314  4.636   -1.410  1.00 15.00 ?  232 SER A OG   2  
ATOM   6125   H  H    . SER A 1 190 ? 17.068  3.791   0.403   1.00 15.00 ?  232 SER A H    2  
ATOM   6126   H  HA   . SER A 1 190 ? 15.061  5.647   1.032   1.00 15.00 ?  232 SER A HA   2  
ATOM   6127   H  HB2  . SER A 1 190 ? 14.822  2.965   -0.346  1.00 15.00 ?  232 SER A HB2  2  
ATOM   6128   H  HB3  . SER A 1 190 ? 13.597  4.239   -0.372  1.00 15.00 ?  232 SER A HB3  2  
ATOM   6129   H  HG   . SER A 1 190 ? 15.556  3.952   -2.055  1.00 15.00 ?  232 SER A HG   2  
ATOM   6130   N  N    . ALA A 1 191 ? 14.854  2.775   2.616   1.00 15.00 ?  233 ALA A N    2  
ATOM   6131   C  CA   . ALA A 1 191 ? 14.222  2.109   3.750   1.00 15.00 ?  233 ALA A CA   2  
ATOM   6132   C  C    . ALA A 1 191 ? 14.440  2.923   5.018   1.00 15.00 ?  233 ALA A C    2  
ATOM   6133   O  O    . ALA A 1 191 ? 13.550  3.050   5.857   1.00 15.00 ?  233 ALA A O    2  
ATOM   6134   C  CB   . ALA A 1 191 ? 14.776  0.703   3.914   1.00 15.00 ?  233 ALA A CB   2  
ATOM   6135   H  H    . ALA A 1 191 ? 15.598  2.329   2.153   1.00 15.00 ?  233 ALA A H    2  
ATOM   6136   H  HA   . ALA A 1 191 ? 13.160  2.037   3.552   1.00 15.00 ?  233 ALA A HA   2  
ATOM   6137   H  HB1  . ALA A 1 191 ? 14.352  0.247   4.798   1.00 15.00 ?  233 ALA A HB1  2  
ATOM   6138   H  HB2  . ALA A 1 191 ? 15.848  0.753   4.010   1.00 15.00 ?  233 ALA A HB2  2  
ATOM   6139   H  HB3  . ALA A 1 191 ? 14.519  0.111   3.048   1.00 15.00 ?  233 ALA A HB3  2  
ATOM   6140   N  N    . ARG A 1 192 ? 15.640  3.477   5.144   1.00 15.00 ?  234 ARG A N    2  
ATOM   6141   C  CA   . ARG A 1 192 ? 15.998  4.293   6.291   1.00 15.00 ?  234 ARG A CA   2  
ATOM   6142   C  C    . ARG A 1 192 ? 15.246  5.619   6.252   1.00 15.00 ?  234 ARG A C    2  
ATOM   6143   O  O    . ARG A 1 192 ? 14.839  6.147   7.288   1.00 15.00 ?  234 ARG A O    2  
ATOM   6144   C  CB   . ARG A 1 192 ? 17.511  4.530   6.315   1.00 15.00 ?  234 ARG A CB   2  
ATOM   6145   C  CG   . ARG A 1 192 ? 18.292  3.324   6.803   1.00 15.00 ?  234 ARG A CG   2  
ATOM   6146   C  CD   . ARG A 1 192 ? 19.761  3.400   6.416   1.00 15.00 ?  234 ARG A CD   2  
ATOM   6147   N  NE   . ARG A 1 192 ? 20.505  2.258   6.954   1.00 15.00 ?  234 ARG A NE   2  
ATOM   6148   C  CZ   . ARG A 1 192 ? 21.445  1.583   6.294   1.00 15.00 ?  234 ARG A CZ   2  
ATOM   6149   N  NH1  . ARG A 1 192 ? 21.776  1.921   5.053   1.00 15.00 1  234 ARG A NH1  2  
ATOM   6150   N  NH2  . ARG A 1 192 ? 22.066  0.565   6.883   1.00 15.00 ?  234 ARG A NH2  2  
ATOM   6151   H  H    . ARG A 1 192 ? 16.303  3.334   4.437   1.00 15.00 ?  234 ARG A H    2  
ATOM   6152   H  HA   . ARG A 1 192 ? 15.713  3.757   7.186   1.00 15.00 ?  234 ARG A HA   2  
ATOM   6153   H  HB2  . ARG A 1 192 ? 17.846  4.768   5.316   1.00 15.00 ?  234 ARG A HB2  2  
ATOM   6154   H  HB3  . ARG A 1 192 ? 17.728  5.360   6.969   1.00 15.00 ?  234 ARG A HB3  2  
ATOM   6155   H  HG2  . ARG A 1 192 ? 18.218  3.269   7.877   1.00 15.00 ?  234 ARG A HG2  2  
ATOM   6156   H  HG3  . ARG A 1 192 ? 17.861  2.433   6.369   1.00 15.00 ?  234 ARG A HG3  2  
ATOM   6157   H  HD2  . ARG A 1 192 ? 19.838  3.399   5.333   1.00 15.00 ?  234 ARG A HD2  2  
ATOM   6158   H  HD3  . ARG A 1 192 ? 20.180  4.315   6.809   1.00 15.00 ?  234 ARG A HD3  2  
ATOM   6159   H  HE   . ARG A 1 192 ? 20.285  1.981   7.874   1.00 15.00 ?  234 ARG A HE   2  
ATOM   6160   H  HH11 . ARG A 1 192 ? 22.515  1.373   4.546   1.00 15.00 ?  234 ARG A HH11 2  
ATOM   6161   H  HH12 . ARG A 1 192 ? 21.313  2.729   4.582   1.00 15.00 ?  234 ARG A HH12 2  
ATOM   6162   H  HH21 . ARG A 1 192 ? 21.827  0.294   7.865   1.00 15.00 ?  234 ARG A HH21 2  
ATOM   6163   H  HH22 . ARG A 1 192 ? 22.803  0.032   6.367   1.00 15.00 ?  234 ARG A HH22 2  
ATOM   6164   N  N    . ALA A 1 193 ? 15.050  6.141   5.048   1.00 15.00 ?  235 ALA A N    2  
ATOM   6165   C  CA   . ALA A 1 193 ? 14.340  7.401   4.861   1.00 15.00 ?  235 ALA A CA   2  
ATOM   6166   C  C    . ALA A 1 193 ? 12.904  7.295   5.363   1.00 15.00 ?  235 ALA A C    2  
ATOM   6167   O  O    . ALA A 1 193 ? 12.384  8.223   5.975   1.00 15.00 ?  235 ALA A O    2  
ATOM   6168   C  CB   . ALA A 1 193 ? 14.360  7.823   3.399   1.00 15.00 ?  235 ALA A CB   2  
ATOM   6169   H  H    . ALA A 1 193 ? 15.405  5.667   4.258   1.00 15.00 ?  235 ALA A H    2  
ATOM   6170   H  HA   . ALA A 1 193 ? 14.855  8.159   5.438   1.00 15.00 ?  235 ALA A HA   2  
ATOM   6171   H  HB1  . ALA A 1 193 ? 13.630  7.246   2.849   1.00 15.00 ?  235 ALA A HB1  2  
ATOM   6172   H  HB2  . ALA A 1 193 ? 15.342  7.649   2.986   1.00 15.00 ?  235 ALA A HB2  2  
ATOM   6173   H  HB3  . ALA A 1 193 ? 14.115  8.875   3.325   1.00 15.00 ?  235 ALA A HB3  2  
ATOM   6174   N  N    . PHE A 1 194 ? 12.270  6.155   5.105   1.00 15.00 ?  236 PHE A N    2  
ATOM   6175   C  CA   . PHE A 1 194 ? 10.897  5.917   5.544   1.00 15.00 ?  236 PHE A CA   2  
ATOM   6176   C  C    . PHE A 1 194 ? 10.804  5.968   7.068   1.00 15.00 ?  236 PHE A C    2  
ATOM   6177   O  O    . PHE A 1 194 ? 9.942   6.652   7.631   1.00 15.00 ?  236 PHE A O    2  
ATOM   6178   C  CB   . PHE A 1 194 ? 10.416  4.559   5.023   1.00 15.00 ?  236 PHE A CB   2  
ATOM   6179   C  CG   . PHE A 1 194 ? 9.109   4.099   5.612   1.00 15.00 ?  236 PHE A CG   2  
ATOM   6180   C  CD1  . PHE A 1 194 ? 7.939   4.804   5.381   1.00 15.00 ?  236 PHE A CD1  2  
ATOM   6181   C  CD2  . PHE A 1 194 ? 9.054   2.956   6.397   1.00 15.00 ?  236 PHE A CD2  2  
ATOM   6182   C  CE1  . PHE A 1 194 ? 6.740   4.381   5.922   1.00 15.00 ?  236 PHE A CE1  2  
ATOM   6183   C  CE2  . PHE A 1 194 ? 7.857   2.527   6.938   1.00 15.00 ?  236 PHE A CE2  2  
ATOM   6184   C  CZ   . PHE A 1 194 ? 6.700   3.242   6.702   1.00 15.00 ?  236 PHE A CZ   2  
ATOM   6185   H  H    . PHE A 1 194 ? 12.732  5.456   4.591   1.00 15.00 ?  236 PHE A H    2  
ATOM   6186   H  HA   . PHE A 1 194 ? 10.275  6.697   5.128   1.00 15.00 ?  236 PHE A HA   2  
ATOM   6187   H  HB2  . PHE A 1 194 ? 10.294  4.616   3.952   1.00 15.00 ?  236 PHE A HB2  2  
ATOM   6188   H  HB3  . PHE A 1 194 ? 11.164  3.814   5.252   1.00 15.00 ?  236 PHE A HB3  2  
ATOM   6189   H  HD1  . PHE A 1 194 ? 7.966   5.695   4.771   1.00 15.00 ?  236 PHE A HD1  2  
ATOM   6190   H  HD2  . PHE A 1 194 ? 9.957   2.395   6.581   1.00 15.00 ?  236 PHE A HD2  2  
ATOM   6191   H  HE1  . PHE A 1 194 ? 5.833   4.941   5.734   1.00 15.00 ?  236 PHE A HE1  2  
ATOM   6192   H  HE2  . PHE A 1 194 ? 7.825   1.636   7.549   1.00 15.00 ?  236 PHE A HE2  2  
ATOM   6193   H  HZ   . PHE A 1 194 ? 5.763   2.913   7.127   1.00 15.00 ?  236 PHE A HZ   2  
ATOM   6194   N  N    . GLY A 1 195 ? 11.707  5.256   7.726   1.00 15.00 ?  237 GLY A N    2  
ATOM   6195   C  CA   . GLY A 1 195 ? 11.722  5.231   9.173   1.00 15.00 ?  237 GLY A CA   2  
ATOM   6196   C  C    . GLY A 1 195 ? 12.028  6.585   9.767   1.00 15.00 ?  237 GLY A C    2  
ATOM   6197   O  O    . GLY A 1 195 ? 11.599  6.890   10.881  1.00 15.00 ?  237 GLY A O    2  
ATOM   6198   H  H    . GLY A 1 195 ? 12.365  4.735   7.222   1.00 15.00 ?  237 GLY A H    2  
ATOM   6199   H  HA2  . GLY A 1 195 ? 10.756  4.908   9.526   1.00 15.00 ?  237 GLY A HA2  2  
ATOM   6200   H  HA3  . GLY A 1 195 ? 12.470  4.527   9.503   1.00 15.00 ?  237 GLY A HA3  2  
ATOM   6201   N  N    . ALA A 1 196 ? 12.772  7.396   9.021   1.00 15.00 ?  238 ALA A N    2  
ATOM   6202   C  CA   . ALA A 1 196 ? 13.139  8.730   9.468   1.00 15.00 ?  238 ALA A CA   2  
ATOM   6203   C  C    . ALA A 1 196 ? 11.994  9.715   9.250   1.00 15.00 ?  238 ALA A C    2  
ATOM   6204   O  O    . ALA A 1 196 ? 11.881  10.713  9.961   1.00 15.00 ?  238 ALA A O    2  
ATOM   6205   C  CB   . ALA A 1 196 ? 14.395  9.206   8.750   1.00 15.00 ?  238 ALA A CB   2  
ATOM   6206   H  H    . ALA A 1 196 ? 13.093  7.082   8.150   1.00 15.00 ?  238 ALA A H    2  
ATOM   6207   H  HA   . ALA A 1 196 ? 13.359  8.676   10.526  1.00 15.00 ?  238 ALA A HA   2  
ATOM   6208   H  HB1  . ALA A 1 196 ? 14.184  9.319   7.696   1.00 15.00 ?  238 ALA A HB1  2  
ATOM   6209   H  HB2  . ALA A 1 196 ? 15.183  8.482   8.886   1.00 15.00 ?  238 ALA A HB2  2  
ATOM   6210   H  HB3  . ALA A 1 196 ? 14.703  10.158  9.157   1.00 15.00 ?  238 ALA A HB3  2  
ATOM   6211   N  N    . ALA A 1 197 ? 11.159  9.438   8.256   1.00 15.00 ?  239 ALA A N    2  
ATOM   6212   C  CA   . ALA A 1 197 ? 10.020  10.295  7.954   1.00 15.00 ?  239 ALA A CA   2  
ATOM   6213   C  C    . ALA A 1 197 ? 8.945   10.140  9.021   1.00 15.00 ?  239 ALA A C    2  
ATOM   6214   O  O    . ALA A 1 197 ? 8.300   11.116  9.418   1.00 15.00 ?  239 ALA A O    2  
ATOM   6215   C  CB   . ALA A 1 197 ? 9.461   9.968   6.578   1.00 15.00 ?  239 ALA A CB   2  
ATOM   6216   H  H    . ALA A 1 197 ? 11.317  8.640   7.704   1.00 15.00 ?  239 ALA A H    2  
ATOM   6217   H  HA   . ALA A 1 197 ? 10.363  11.319  7.946   1.00 15.00 ?  239 ALA A HA   2  
ATOM   6218   H  HB1  . ALA A 1 197 ? 8.491   10.432  6.461   1.00 15.00 ?  239 ALA A HB1  2  
ATOM   6219   H  HB2  . ALA A 1 197 ? 9.363   8.898   6.473   1.00 15.00 ?  239 ALA A HB2  2  
ATOM   6220   H  HB3  . ALA A 1 197 ? 10.131  10.346  5.822   1.00 15.00 ?  239 ALA A HB3  2  
ATOM   6221   N  N    . PHE A 1 198 ? 8.757   8.909   9.482   1.00 15.00 ?  240 PHE A N    2  
ATOM   6222   C  CA   . PHE A 1 198 ? 7.773   8.616   10.516  1.00 15.00 ?  240 PHE A CA   2  
ATOM   6223   C  C    . PHE A 1 198 ? 8.464   8.033   11.750  1.00 15.00 ?  240 PHE A C    2  
ATOM   6224   O  O    . PHE A 1 198 ? 8.474   6.816   11.952  1.00 15.00 ?  240 PHE A O    2  
ATOM   6225   C  CB   . PHE A 1 198 ? 6.717   7.634   9.996   1.00 15.00 ?  240 PHE A CB   2  
ATOM   6226   C  CG   . PHE A 1 198 ? 5.971   8.120   8.787   1.00 15.00 ?  240 PHE A CG   2  
ATOM   6227   C  CD1  . PHE A 1 198 ? 4.894   8.978   8.922   1.00 15.00 ?  240 PHE A CD1  2  
ATOM   6228   C  CD2  . PHE A 1 198 ? 6.347   7.712   7.516   1.00 15.00 ?  240 PHE A CD2  2  
ATOM   6229   C  CE1  . PHE A 1 198 ? 4.204   9.421   7.812   1.00 15.00 ?  240 PHE A CE1  2  
ATOM   6230   C  CE2  . PHE A 1 198 ? 5.663   8.152   6.404   1.00 15.00 ?  240 PHE A CE2  2  
ATOM   6231   C  CZ   . PHE A 1 198 ? 4.589   9.008   6.552   1.00 15.00 ?  240 PHE A CZ   2  
ATOM   6232   H  H    . PHE A 1 198 ? 9.294   8.175   9.115   1.00 15.00 ?  240 PHE A H    2  
ATOM   6233   H  HA   . PHE A 1 198 ? 7.295   9.544   10.788  1.00 15.00 ?  240 PHE A HA   2  
ATOM   6234   H  HB2  . PHE A 1 198 ? 7.198   6.705   9.732   1.00 15.00 ?  240 PHE A HB2  2  
ATOM   6235   H  HB3  . PHE A 1 198 ? 5.996   7.447   10.778  1.00 15.00 ?  240 PHE A HB3  2  
ATOM   6236   H  HD1  . PHE A 1 198 ? 4.592   9.301   9.911   1.00 15.00 ?  240 PHE A HD1  2  
ATOM   6237   H  HD2  . PHE A 1 198 ? 7.188   7.044   7.400   1.00 15.00 ?  240 PHE A HD2  2  
ATOM   6238   H  HE1  . PHE A 1 198 ? 3.366   10.093  7.931   1.00 15.00 ?  240 PHE A HE1  2  
ATOM   6239   H  HE2  . PHE A 1 198 ? 5.967   7.828   5.422   1.00 15.00 ?  240 PHE A HE2  2  
ATOM   6240   H  HZ   . PHE A 1 198 ? 4.053   9.353   5.684   1.00 15.00 ?  240 PHE A HZ   2  
ATOM   6241   N  N    . PRO A 1 199 ? 9.061   8.893   12.588  1.00 15.00 ?  241 PRO A N    2  
ATOM   6242   C  CA   . PRO A 1 199 ? 9.773   8.469   13.789  1.00 15.00 ?  241 PRO A CA   2  
ATOM   6243   C  C    . PRO A 1 199 ? 8.841   8.079   14.934  1.00 15.00 ?  241 PRO A C    2  
ATOM   6244   O  O    . PRO A 1 199 ? 9.255   7.395   15.873  1.00 15.00 ?  241 PRO A O    2  
ATOM   6245   C  CB   . PRO A 1 199 ? 10.605  9.703   14.172  1.00 15.00 ?  241 PRO A CB   2  
ATOM   6246   C  CG   . PRO A 1 199 ? 10.406  10.700  13.077  1.00 15.00 ?  241 PRO A CG   2  
ATOM   6247   C  CD   . PRO A 1 199 ? 9.105   10.348  12.428  1.00 15.00 ?  241 PRO A CD   2  
ATOM   6248   H  HA   . PRO A 1 199 ? 10.436  7.642   13.578  1.00 15.00 ?  241 PRO A HA   2  
ATOM   6249   H  HB2  . PRO A 1 199 ? 10.257  10.098  15.116  1.00 15.00 ?  241 PRO A HB2  2  
ATOM   6250   H  HB3  . PRO A 1 199 ? 11.647  9.437   14.243  1.00 15.00 ?  241 PRO A HB3  2  
ATOM   6251   H  HG2  . PRO A 1 199 ? 10.364  11.698  13.493  1.00 15.00 ?  241 PRO A HG2  2  
ATOM   6252   H  HG3  . PRO A 1 199 ? 11.208  10.623  12.360  1.00 15.00 ?  241 PRO A HG3  2  
ATOM   6253   H  HD2  . PRO A 1 199 ? 8.280   10.818  12.940  1.00 15.00 ?  241 PRO A HD2  2  
ATOM   6254   H  HD3  . PRO A 1 199 ? 9.113   10.619  11.383  1.00 15.00 ?  241 PRO A HD3  2  
ATOM   6255   N  N    . LYS A 1 200 ? 7.589   8.506   14.862  1.00 15.00 ?  242 LYS A N    2  
ATOM   6256   C  CA   . LYS A 1 200 ? 6.629   8.203   15.917  1.00 15.00 ?  242 LYS A CA   2  
ATOM   6257   C  C    . LYS A 1 200 ? 5.672   7.087   15.502  1.00 15.00 ?  242 LYS A C    2  
ATOM   6258   O  O    . LYS A 1 200 ? 4.621   6.887   16.117  1.00 15.00 ?  242 LYS A O    2  
ATOM   6259   C  CB   . LYS A 1 200 ? 5.853   9.460   16.321  1.00 15.00 ?  242 LYS A CB   2  
ATOM   6260   C  CG   . LYS A 1 200 ? 6.733   10.542  16.927  1.00 15.00 ?  242 LYS A CG   2  
ATOM   6261   C  CD   . LYS A 1 200 ? 5.912   11.681  17.507  1.00 15.00 ?  242 LYS A CD   2  
ATOM   6262   C  CE   . LYS A 1 200 ? 6.797   12.692  18.231  1.00 15.00 ?  242 LYS A CE   2  
ATOM   6263   N  NZ   . LYS A 1 200 ? 7.424   12.119  19.454  1.00 15.00 1  242 LYS A NZ   2  
ATOM   6264   H  H    . LYS A 1 200 ? 7.302   9.034   14.082  1.00 15.00 ?  242 LYS A H    2  
ATOM   6265   H  HA   . LYS A 1 200 ? 7.193   7.862   16.773  1.00 15.00 ?  242 LYS A HA   2  
ATOM   6266   H  HB2  . LYS A 1 200 ? 5.361   9.868   15.451  1.00 15.00 ?  242 LYS A HB2  2  
ATOM   6267   H  HB3  . LYS A 1 200 ? 5.104   9.187   17.051  1.00 15.00 ?  242 LYS A HB3  2  
ATOM   6268   H  HG2  . LYS A 1 200 ? 7.327   10.108  17.719  1.00 15.00 ?  242 LYS A HG2  2  
ATOM   6269   H  HG3  . LYS A 1 200 ? 7.386   10.932  16.162  1.00 15.00 ?  242 LYS A HG3  2  
ATOM   6270   H  HD2  . LYS A 1 200 ? 5.390   12.182  16.705  1.00 15.00 ?  242 LYS A HD2  2  
ATOM   6271   H  HD3  . LYS A 1 200 ? 5.196   11.276  18.208  1.00 15.00 ?  242 LYS A HD3  2  
ATOM   6272   H  HE2  . LYS A 1 200 ? 7.576   13.015  17.557  1.00 15.00 ?  242 LYS A HE2  2  
ATOM   6273   H  HE3  . LYS A 1 200 ? 6.192   13.543  18.512  1.00 15.00 ?  242 LYS A HE3  2  
ATOM   6274   H  HZ1  . LYS A 1 200 ? 6.726   12.066  20.227  1.00 15.00 ?  242 LYS A HZ1  2  
ATOM   6275   H  HZ2  . LYS A 1 200 ? 8.221   12.712  19.761  1.00 15.00 ?  242 LYS A HZ2  2  
ATOM   6276   H  HZ3  . LYS A 1 200 ? 7.778   11.159  19.261  1.00 15.00 ?  242 LYS A HZ3  2  
ATOM   6277   N  N    . ALA A 1 201 ? 6.053   6.346   14.470  1.00 15.00 ?  243 ALA A N    2  
ATOM   6278   C  CA   . ALA A 1 201 ? 5.246   5.235   13.986  1.00 15.00 ?  243 ALA A CA   2  
ATOM   6279   C  C    . ALA A 1 201 ? 5.805   3.923   14.519  1.00 15.00 ?  243 ALA A C    2  
ATOM   6280   O  O    . ALA A 1 201 ? 6.963   3.592   14.267  1.00 15.00 ?  243 ALA A O    2  
ATOM   6281   C  CB   . ALA A 1 201 ? 5.207   5.220   12.464  1.00 15.00 ?  243 ALA A CB   2  
ATOM   6282   H  H    . ALA A 1 201 ? 6.904   6.547   14.026  1.00 15.00 ?  243 ALA A H    2  
ATOM   6283   H  HA   . ALA A 1 201 ? 4.238   5.364   14.353  1.00 15.00 ?  243 ALA A HA   2  
ATOM   6284   H  HB1  . ALA A 1 201 ? 4.559   4.423   12.129  1.00 15.00 ?  243 ALA A HB1  2  
ATOM   6285   H  HB2  . ALA A 1 201 ? 6.203   5.060   12.078  1.00 15.00 ?  243 ALA A HB2  2  
ATOM   6286   H  HB3  . ALA A 1 201 ? 4.829   6.165   12.105  1.00 15.00 ?  243 ALA A HB3  2  
ATOM   6287   N  N    . SER A 1 202 ? 4.994   3.192   15.267  1.00 15.00 ?  244 SER A N    2  
ATOM   6288   C  CA   . SER A 1 202 ? 5.423   1.924   15.839  1.00 15.00 ?  244 SER A CA   2  
ATOM   6289   C  C    . SER A 1 202 ? 4.927   0.749   15.006  1.00 15.00 ?  244 SER A C    2  
ATOM   6290   O  O    . SER A 1 202 ? 5.671   -0.196  14.748  1.00 15.00 ?  244 SER A O    2  
ATOM   6291   C  CB   . SER A 1 202 ? 4.911   1.802   17.271  1.00 15.00 ?  244 SER A CB   2  
ATOM   6292   O  OG   . SER A 1 202 ? 4.394   3.042   17.733  1.00 15.00 ?  244 SER A OG   2  
ATOM   6293   H  H    . SER A 1 202 ? 4.089   3.513   15.446  1.00 15.00 ?  244 SER A H    2  
ATOM   6294   H  HA   . SER A 1 202 ? 6.503   1.913   15.850  1.00 15.00 ?  244 SER A HA   2  
ATOM   6295   H  HB2  . SER A 1 202 ? 4.127   1.061   17.313  1.00 15.00 ?  244 SER A HB2  2  
ATOM   6296   H  HB3  . SER A 1 202 ? 5.723   1.503   17.914  1.00 15.00 ?  244 SER A HB3  2  
ATOM   6297   H  HG   . SER A 1 202 ? 3.420   3.008   17.705  1.00 15.00 ?  244 SER A HG   2  
ATOM   6298   N  N    . MET A 1 203 ? 3.675   0.820   14.574  1.00 15.00 ?  245 MET A N    2  
ATOM   6299   C  CA   . MET A 1 203 ? 3.097   -0.247  13.780  1.00 15.00 ?  245 MET A CA   2  
ATOM   6300   C  C    . MET A 1 203 ? 3.412   -0.032  12.308  1.00 15.00 ?  245 MET A C    2  
ATOM   6301   O  O    . MET A 1 203 ? 2.884   0.883   11.671  1.00 15.00 ?  245 MET A O    2  
ATOM   6302   C  CB   . MET A 1 203 ? 1.582   -0.329  13.987  1.00 15.00 ?  245 MET A CB   2  
ATOM   6303   C  CG   . MET A 1 203 ? 0.903   -1.326  13.058  1.00 15.00 ?  245 MET A CG   2  
ATOM   6304   S  SD   . MET A 1 203 ? -0.867  -1.499  13.369  1.00 15.00 ?  245 MET A SD   2  
ATOM   6305   C  CE   . MET A 1 203 ? -0.867  -2.512  14.848  1.00 15.00 ?  245 MET A CE   2  
ATOM   6306   H  H    . MET A 1 203 ? 3.138   1.617   14.772  1.00 15.00 ?  245 MET A H    2  
ATOM   6307   H  HA   . MET A 1 203 ? 3.544   -1.177  14.099  1.00 15.00 ?  245 MET A HA   2  
ATOM   6308   H  HB2  . MET A 1 203 ? 1.383   -0.623  15.007  1.00 15.00 ?  245 MET A HB2  2  
ATOM   6309   H  HB3  . MET A 1 203 ? 1.149   0.646   13.812  1.00 15.00 ?  245 MET A HB3  2  
ATOM   6310   H  HG2  . MET A 1 203 ? 1.041   -0.995  12.040  1.00 15.00 ?  245 MET A HG2  2  
ATOM   6311   H  HG3  . MET A 1 203 ? 1.371   -2.290  13.187  1.00 15.00 ?  245 MET A HG3  2  
ATOM   6312   H  HE1  . MET A 1 203 ? -0.448  -3.482  14.618  1.00 15.00 ?  245 MET A HE1  2  
ATOM   6313   H  HE2  . MET A 1 203 ? -1.882  -2.631  15.200  1.00 15.00 ?  245 MET A HE2  2  
ATOM   6314   H  HE3  . MET A 1 203 ? -0.275  -2.035  15.613  1.00 15.00 ?  245 MET A HE3  2  
ATOM   6315   N  N    . ILE A 1 204 ? 4.288   -0.865  11.778  1.00 15.00 ?  246 ILE A N    2  
ATOM   6316   C  CA   . ILE A 1 204 ? 4.671   -0.774  10.384  1.00 15.00 ?  246 ILE A CA   2  
ATOM   6317   C  C    . ILE A 1 204 ? 3.919   -1.820  9.580   1.00 15.00 ?  246 ILE A C    2  
ATOM   6318   O  O    . ILE A 1 204 ? 4.234   -3.010  9.639   1.00 15.00 ?  246 ILE A O    2  
ATOM   6319   C  CB   . ILE A 1 204 ? 6.190   -0.974  10.196  1.00 15.00 ?  246 ILE A CB   2  
ATOM   6320   C  CG1  . ILE A 1 204 ? 6.973   -0.036  11.120  1.00 15.00 ?  246 ILE A CG1  2  
ATOM   6321   C  CG2  . ILE A 1 204 ? 6.588   -0.748  8.740   1.00 15.00 ?  246 ILE A CG2  2  
ATOM   6322   C  CD1  . ILE A 1 204 ? 6.679   1.429   10.899  1.00 15.00 ?  246 ILE A CD1  2  
ATOM   6323   H  H    . ILE A 1 204 ? 4.685   -1.567  12.341  1.00 15.00 ?  246 ILE A H    2  
ATOM   6324   H  HA   . ILE A 1 204 ? 4.405   0.211   10.026  1.00 15.00 ?  246 ILE A HA   2  
ATOM   6325   H  HB   . ILE A 1 204 ? 6.425   -1.995  10.450  1.00 15.00 ?  246 ILE A HB   2  
ATOM   6326   H  HG12 . ILE A 1 204 ? 6.735   -0.268  12.147  1.00 15.00 ?  246 ILE A HG12 2  
ATOM   6327   H  HG13 . ILE A 1 204 ? 8.029   -0.188  10.958  1.00 15.00 ?  246 ILE A HG13 2  
ATOM   6328   H  HG21 . ILE A 1 204 ? 6.059   -1.447  8.109   1.00 15.00 ?  246 ILE A HG21 2  
ATOM   6329   H  HG22 . ILE A 1 204 ? 7.650   -0.897  8.628   1.00 15.00 ?  246 ILE A HG22 2  
ATOM   6330   H  HG23 . ILE A 1 204 ? 6.337   0.259   8.447   1.00 15.00 ?  246 ILE A HG23 2  
ATOM   6331   H  HD11 . ILE A 1 204 ? 5.642   1.627   11.123  1.00 15.00 ?  246 ILE A HD11 2  
ATOM   6332   H  HD12 . ILE A 1 204 ? 6.878   1.681   9.868   1.00 15.00 ?  246 ILE A HD12 2  
ATOM   6333   H  HD13 . ILE A 1 204 ? 7.307   2.022   11.544  1.00 15.00 ?  246 ILE A HD13 2  
ATOM   6334   N  N    . VAL A 1 205 ? 2.913   -1.377  8.847   1.00 15.00 ?  247 VAL A N    2  
ATOM   6335   C  CA   . VAL A 1 205 ? 2.104   -2.271  8.042   1.00 15.00 ?  247 VAL A CA   2  
ATOM   6336   C  C    . VAL A 1 205 ? 2.669   -2.394  6.637   1.00 15.00 ?  247 VAL A C    2  
ATOM   6337   O  O    . VAL A 1 205 ? 2.971   -1.401  5.977   1.00 15.00 ?  247 VAL A O    2  
ATOM   6338   C  CB   . VAL A 1 205 ? 0.639   -1.792  7.962   1.00 15.00 ?  247 VAL A CB   2  
ATOM   6339   C  CG1  . VAL A 1 205 ? -0.228  -2.788  7.200   1.00 15.00 ?  247 VAL A CG1  2  
ATOM   6340   C  CG2  . VAL A 1 205 ? 0.077   -1.554  9.355   1.00 15.00 ?  247 VAL A CG2  2  
ATOM   6341   H  H    . VAL A 1 205 ? 2.718   -0.412  8.834   1.00 15.00 ?  247 VAL A H    2  
ATOM   6342   H  HA   . VAL A 1 205 ? 2.121   -3.245  8.509   1.00 15.00 ?  247 VAL A HA   2  
ATOM   6343   H  HB   . VAL A 1 205 ? 0.621   -0.854  7.430   1.00 15.00 ?  247 VAL A HB   2  
ATOM   6344   H  HG11 . VAL A 1 205 ? 0.199   -2.960  6.223   1.00 15.00 ?  247 VAL A HG11 2  
ATOM   6345   H  HG12 . VAL A 1 205 ? -1.223  -2.385  7.090   1.00 15.00 ?  247 VAL A HG12 2  
ATOM   6346   H  HG13 . VAL A 1 205 ? -0.274  -3.719  7.745   1.00 15.00 ?  247 VAL A HG13 2  
ATOM   6347   H  HG21 . VAL A 1 205 ? 0.055   -2.484  9.902   1.00 15.00 ?  247 VAL A HG21 2  
ATOM   6348   H  HG22 . VAL A 1 205 ? -0.929  -1.162  9.276   1.00 15.00 ?  247 VAL A HG22 2  
ATOM   6349   H  HG23 . VAL A 1 205 ? 0.697   -0.843  9.875   1.00 15.00 ?  247 VAL A HG23 2  
ATOM   6350   N  N    . MET A 1 206 ? 2.819   -3.624  6.198   1.00 15.00 ?  248 MET A N    2  
ATOM   6351   C  CA   . MET A 1 206 ? 3.333   -3.911  4.875   1.00 15.00 ?  248 MET A CA   2  
ATOM   6352   C  C    . MET A 1 206 ? 2.307   -4.737  4.116   1.00 15.00 ?  248 MET A C    2  
ATOM   6353   O  O    . MET A 1 206 ? 1.331   -5.203  4.703   1.00 15.00 ?  248 MET A O    2  
ATOM   6354   C  CB   . MET A 1 206 ? 4.673   -4.636  4.963   1.00 15.00 ?  248 MET A CB   2  
ATOM   6355   C  CG   . MET A 1 206 ? 4.680   -5.784  5.960   1.00 15.00 ?  248 MET A CG   2  
ATOM   6356   S  SD   . MET A 1 206 ? 6.330   -6.162  6.572   1.00 15.00 ?  248 MET A SD   2  
ATOM   6357   C  CE   . MET A 1 206 ? 6.665   -4.704  7.558   1.00 15.00 ?  248 MET A CE   2  
ATOM   6358   H  H    . MET A 1 206 ? 2.560   -4.369  6.778   1.00 15.00 ?  248 MET A H    2  
ATOM   6359   H  HA   . MET A 1 206 ? 3.471   -2.967  4.361   1.00 15.00 ?  248 MET A HA   2  
ATOM   6360   H  HB2  . MET A 1 206 ? 4.922   -5.028  3.988   1.00 15.00 ?  248 MET A HB2  2  
ATOM   6361   H  HB3  . MET A 1 206 ? 5.431   -3.925  5.259   1.00 15.00 ?  248 MET A HB3  2  
ATOM   6362   H  HG2  . MET A 1 206 ? 4.056   -5.521  6.800   1.00 15.00 ?  248 MET A HG2  2  
ATOM   6363   H  HG3  . MET A 1 206 ? 4.279   -6.663  5.477   1.00 15.00 ?  248 MET A HG3  2  
ATOM   6364   H  HE1  . MET A 1 206 ? 7.655   -4.773  7.981   1.00 15.00 ?  248 MET A HE1  2  
ATOM   6365   H  HE2  . MET A 1 206 ? 5.938   -4.631  8.353   1.00 15.00 ?  248 MET A HE2  2  
ATOM   6366   H  HE3  . MET A 1 206 ? 6.601   -3.827  6.934   1.00 15.00 ?  248 MET A HE3  2  
ATOM   6367   N  N    . SER A 1 207 ? 2.527   -4.926  2.830   1.00 15.00 ?  249 SER A N    2  
ATOM   6368   C  CA   . SER A 1 207 ? 1.584   -5.661  2.007   1.00 15.00 ?  249 SER A CA   2  
ATOM   6369   C  C    . SER A 1 207 ? 1.853   -7.162  1.958   1.00 15.00 ?  249 SER A C    2  
ATOM   6370   O  O    . SER A 1 207 ? 0.932   -7.935  1.726   1.00 15.00 ?  249 SER A O    2  
ATOM   6371   C  CB   . SER A 1 207 ? 1.582   -5.088  0.592   1.00 15.00 ?  249 SER A CB   2  
ATOM   6372   O  OG   . SER A 1 207 ? 1.119   -3.747  0.594   1.00 15.00 ?  249 SER A OG   2  
ATOM   6373   H  H    . SER A 1 207 ? 3.341   -4.554  2.418   1.00 15.00 ?  249 SER A H    2  
ATOM   6374   H  HA   . SER A 1 207 ? 0.606   -5.508  2.429   1.00 15.00 ?  249 SER A HA   2  
ATOM   6375   H  HB2  . SER A 1 207 ? 2.586   -5.108  0.197   1.00 15.00 ?  249 SER A HB2  2  
ATOM   6376   H  HB3  . SER A 1 207 ? 0.931   -5.680  -0.037  1.00 15.00 ?  249 SER A HB3  2  
ATOM   6377   H  HG   . SER A 1 207 ? 0.273   -3.705  1.067   1.00 15.00 ?  249 SER A HG   2  
ATOM   6378   N  N    . HIS A 1 208 ? 3.079   -7.589  2.205   1.00 15.00 ?  250 HIS A N    2  
ATOM   6379   C  CA   . HIS A 1 208 ? 3.376   -9.015  2.109   1.00 15.00 ?  250 HIS A CA   2  
ATOM   6380   C  C    . HIS A 1 208 ? 3.647   -9.662  3.462   1.00 15.00 ?  250 HIS A C    2  
ATOM   6381   O  O    . HIS A 1 208 ? 4.010   -10.837 3.531   1.00 15.00 ?  250 HIS A O    2  
ATOM   6382   C  CB   . HIS A 1 208 ? 4.537   -9.248  1.143   1.00 15.00 ?  250 HIS A CB   2  
ATOM   6383   C  CG   . HIS A 1 208 ? 4.227   -8.809  -0.253  1.00 15.00 ?  250 HIS A CG   2  
ATOM   6384   N  ND1  . HIS A 1 208 ? 3.048   -9.097  -0.910  1.00 15.00 ?  250 HIS A ND1  2  
ATOM   6385   C  CD2  . HIS A 1 208 ? 4.957   -8.058  -1.109  1.00 15.00 ?  250 HIS A CD2  2  
ATOM   6386   C  CE1  . HIS A 1 208 ? 3.098   -8.522  -2.118  1.00 15.00 ?  250 HIS A CE1  2  
ATOM   6387   N  NE2  . HIS A 1 208 ? 4.235   -7.875  -2.289  1.00 15.00 ?  250 HIS A NE2  2  
ATOM   6388   H  H    . HIS A 1 208 ? 3.781   -6.954  2.457   1.00 15.00 ?  250 HIS A H    2  
ATOM   6389   H  HA   . HIS A 1 208 ? 2.500   -9.485  1.692   1.00 15.00 ?  250 HIS A HA   2  
ATOM   6390   H  HB2  . HIS A 1 208 ? 5.400   -8.694  1.483   1.00 15.00 ?  250 HIS A HB2  2  
ATOM   6391   H  HB3  . HIS A 1 208 ? 4.775   -10.301 1.119   1.00 15.00 ?  250 HIS A HB3  2  
ATOM   6392   H  HD1  . HIS A 1 208 ? 2.292   -9.620  -0.550  1.00 15.00 ?  250 HIS A HD1  2  
ATOM   6393   H  HD2  . HIS A 1 208 ? 5.940   -7.655  -0.913  1.00 15.00 ?  250 HIS A HD2  2  
ATOM   6394   H  HE1  . HIS A 1 208 ? 2.310   -8.579  -2.854  1.00 15.00 ?  250 HIS A HE1  2  
ATOM   6395   N  N    . SER A 1 209 ? 3.438   -8.913  4.534   1.00 15.00 ?  251 SER A N    2  
ATOM   6396   C  CA   . SER A 1 209 ? 3.643   -9.426  5.881   1.00 15.00 ?  251 SER A CA   2  
ATOM   6397   C  C    . SER A 1 209 ? 2.700   -8.712  6.844   1.00 15.00 ?  251 SER A C    2  
ATOM   6398   O  O    . SER A 1 209 ? 2.151   -7.662  6.506   1.00 15.00 ?  251 SER A O    2  
ATOM   6399   C  CB   . SER A 1 209 ? 5.097   -9.228  6.333   1.00 15.00 ?  251 SER A CB   2  
ATOM   6400   O  OG   . SER A 1 209 ? 6.012   -9.948  5.518   1.00 15.00 ?  251 SER A OG   2  
ATOM   6401   H  H    . SER A 1 209 ? 3.126   -7.992  4.420   1.00 15.00 ?  251 SER A H    2  
ATOM   6402   H  HA   . SER A 1 209 ? 3.412   -10.482 5.873   1.00 15.00 ?  251 SER A HA   2  
ATOM   6403   H  HB2  . SER A 1 209 ? 5.343   -8.178  6.283   1.00 15.00 ?  251 SER A HB2  2  
ATOM   6404   H  HB3  . SER A 1 209 ? 5.199   -9.568  7.354   1.00 15.00 ?  251 SER A HB3  2  
ATOM   6405   H  HG   . SER A 1 209 ? 6.890   -9.952  5.946   1.00 15.00 ?  251 SER A HG   2  
ATOM   6406   N  N    . ALA A 1 210 ? 2.513   -9.281  8.028   1.00 15.00 ?  252 ALA A N    2  
ATOM   6407   C  CA   . ALA A 1 210 ? 1.636   -8.693  9.033   1.00 15.00 ?  252 ALA A CA   2  
ATOM   6408   C  C    . ALA A 1 210 ? 2.277   -7.440  9.621   1.00 15.00 ?  252 ALA A C    2  
ATOM   6409   O  O    . ALA A 1 210 ? 3.494   -7.269  9.527   1.00 15.00 ?  252 ALA A O    2  
ATOM   6410   C  CB   . ALA A 1 210 ? 1.335   -9.720  10.123  1.00 15.00 ?  252 ALA A CB   2  
ATOM   6411   H  H    . ALA A 1 210 ? 2.993   -10.107 8.243   1.00 15.00 ?  252 ALA A H    2  
ATOM   6412   H  HA   . ALA A 1 210 ? 0.705   -8.420  8.553   1.00 15.00 ?  252 ALA A HA   2  
ATOM   6413   H  HB1  . ALA A 1 210 ? 0.602   -9.319  10.810  1.00 15.00 ?  252 ALA A HB1  2  
ATOM   6414   H  HB2  . ALA A 1 210 ? 2.243   -9.951  10.663  1.00 15.00 ?  252 ALA A HB2  2  
ATOM   6415   H  HB3  . ALA A 1 210 ? 0.948   -10.621 9.672   1.00 15.00 ?  252 ALA A HB3  2  
ATOM   6416   N  N    . PRO A 1 211 ? 1.473   -6.535  10.215  1.00 15.00 ?  253 PRO A N    2  
ATOM   6417   C  CA   . PRO A 1 211 ? 1.993   -5.301  10.817  1.00 15.00 ?  253 PRO A CA   2  
ATOM   6418   C  C    . PRO A 1 211 ? 3.131   -5.585  11.797  1.00 15.00 ?  253 PRO A C    2  
ATOM   6419   O  O    . PRO A 1 211 ? 2.937   -6.248  12.820  1.00 15.00 ?  253 PRO A O    2  
ATOM   6420   C  CB   . PRO A 1 211 ? 0.776   -4.724  11.546  1.00 15.00 ?  253 PRO A CB   2  
ATOM   6421   C  CG   . PRO A 1 211 ? -0.405  -5.272  10.827  1.00 15.00 ?  253 PRO A CG   2  
ATOM   6422   C  CD   . PRO A 1 211 ? 0.001   -6.635  10.343  1.00 15.00 ?  253 PRO A CD   2  
ATOM   6423   H  HA   . PRO A 1 211 ? 2.332   -4.603  10.065  1.00 15.00 ?  253 PRO A HA   2  
ATOM   6424   H  HB2  . PRO A 1 211 ? 0.782   -5.045  12.578  1.00 15.00 ?  253 PRO A HB2  2  
ATOM   6425   H  HB3  . PRO A 1 211 ? 0.783   -3.648  11.488  1.00 15.00 ?  253 PRO A HB3  2  
ATOM   6426   H  HG2  . PRO A 1 211 ? -1.245  -5.344  11.506  1.00 15.00 ?  253 PRO A HG2  2  
ATOM   6427   H  HG3  . PRO A 1 211 ? -0.654  -4.644  9.985   1.00 15.00 ?  253 PRO A HG3  2  
ATOM   6428   H  HD2  . PRO A 1 211 ? -0.270  -7.386  11.070  1.00 15.00 ?  253 PRO A HD2  2  
ATOM   6429   H  HD3  . PRO A 1 211 ? -0.457  -6.850  9.388   1.00 15.00 ?  253 PRO A HD3  2  
ATOM   6430   N  N    . ASP A 1 212 ? 4.315   -5.091  11.475  1.00 15.00 ?  254 ASP A N    2  
ATOM   6431   C  CA   . ASP A 1 212 ? 5.487   -5.306  12.307  1.00 15.00 ?  254 ASP A CA   2  
ATOM   6432   C  C    . ASP A 1 212 ? 5.791   -4.060  13.136  1.00 15.00 ?  254 ASP A C    2  
ATOM   6433   O  O    . ASP A 1 212 ? 4.942   -3.179  13.287  1.00 15.00 ?  254 ASP A O    2  
ATOM   6434   C  CB   . ASP A 1 212 ? 6.695   -5.682  11.433  1.00 15.00 ?  254 ASP A CB   2  
ATOM   6435   C  CG   . ASP A 1 212 ? 7.666   -6.613  12.140  1.00 15.00 ?  254 ASP A CG   2  
ATOM   6436   O  OD1  . ASP A 1 212 ? 8.309   -6.180  13.122  1.00 15.00 ?  254 ASP A OD1  2  
ATOM   6437   O  OD2  . ASP A 1 212 ? 7.794   -7.783  11.720  1.00 15.00 -1 254 ASP A OD2  2  
ATOM   6438   H  H    . ASP A 1 212 ? 4.403   -4.549  10.658  1.00 15.00 ?  254 ASP A H    2  
ATOM   6439   H  HA   . ASP A 1 212 ? 5.272   -6.124  12.981  1.00 15.00 ?  254 ASP A HA   2  
ATOM   6440   H  HB2  . ASP A 1 212 ? 6.342   -6.172  10.540  1.00 15.00 ?  254 ASP A HB2  2  
ATOM   6441   H  HB3  . ASP A 1 212 ? 7.226   -4.781  11.157  1.00 15.00 ?  254 ASP A HB3  2  
ATOM   6442   N  N    . SER A 1 213 ? 6.998   -4.002  13.667  1.00 15.00 ?  255 SER A N    2  
ATOM   6443   C  CA   . SER A 1 213 ? 7.440   -2.889  14.486  1.00 15.00 ?  255 SER A CA   2  
ATOM   6444   C  C    . SER A 1 213 ? 8.540   -2.107  13.767  1.00 15.00 ?  255 SER A C    2  
ATOM   6445   O  O    . SER A 1 213 ? 8.819   -2.357  12.594  1.00 15.00 ?  255 SER A O    2  
ATOM   6446   C  CB   . SER A 1 213 ? 7.953   -3.423  15.826  1.00 15.00 ?  255 SER A CB   2  
ATOM   6447   O  OG   . SER A 1 213 ? 8.783   -4.561  15.637  1.00 15.00 ?  255 SER A OG   2  
ATOM   6448   H  H    . SER A 1 213 ? 7.627   -4.741  13.493  1.00 15.00 ?  255 SER A H    2  
ATOM   6449   H  HA   . SER A 1 213 ? 6.595   -2.238  14.657  1.00 15.00 ?  255 SER A HA   2  
ATOM   6450   H  HB2  . SER A 1 213 ? 8.525   -2.652  16.320  1.00 15.00 ?  255 SER A HB2  2  
ATOM   6451   H  HB3  . SER A 1 213 ? 7.113   -3.703  16.445  1.00 15.00 ?  255 SER A HB3  2  
ATOM   6452   H  HG   . SER A 1 213 ? 8.429   -5.101  14.916  1.00 15.00 ?  255 SER A HG   2  
ATOM   6453   N  N    . ARG A 1 214 ? 9.174   -1.174  14.470  1.00 15.00 ?  256 ARG A N    2  
ATOM   6454   C  CA   . ARG A 1 214 ? 10.236  -0.368  13.877  1.00 15.00 ?  256 ARG A CA   2  
ATOM   6455   C  C    . ARG A 1 214 ? 11.470  -1.220  13.605  1.00 15.00 ?  256 ARG A C    2  
ATOM   6456   O  O    . ARG A 1 214 ? 12.330  -0.843  12.812  1.00 15.00 ?  256 ARG A O    2  
ATOM   6457   C  CB   . ARG A 1 214 ? 10.600  0.814   14.782  1.00 15.00 ?  256 ARG A CB   2  
ATOM   6458   C  CG   . ARG A 1 214 ? 9.468   1.810   14.946  1.00 15.00 ?  256 ARG A CG   2  
ATOM   6459   C  CD   . ARG A 1 214 ? 9.912   3.064   15.684  1.00 15.00 ?  256 ARG A CD   2  
ATOM   6460   N  NE   . ARG A 1 214 ? 10.885  3.849   14.917  1.00 15.00 ?  256 ARG A NE   2  
ATOM   6461   C  CZ   . ARG A 1 214 ? 10.572  4.653   13.891  1.00 15.00 ?  256 ARG A CZ   2  
ATOM   6462   N  NH1  . ARG A 1 214 ? 9.310   4.779   13.496  1.00 15.00 1  256 ARG A NH1  2  
ATOM   6463   N  NH2  . ARG A 1 214 ? 11.523  5.336   13.262  1.00 15.00 ?  256 ARG A NH2  2  
ATOM   6464   H  H    . ARG A 1 214 ? 8.921   -1.025  15.407  1.00 15.00 ?  256 ARG A H    2  
ATOM   6465   H  HA   . ARG A 1 214 ? 9.867   0.016   12.935  1.00 15.00 ?  256 ARG A HA   2  
ATOM   6466   H  HB2  . ARG A 1 214 ? 10.870  0.441   15.758  1.00 15.00 ?  256 ARG A HB2  2  
ATOM   6467   H  HB3  . ARG A 1 214 ? 11.449  1.333   14.354  1.00 15.00 ?  256 ARG A HB3  2  
ATOM   6468   H  HG2  . ARG A 1 214 ? 9.117   2.096   13.967  1.00 15.00 ?  256 ARG A HG2  2  
ATOM   6469   H  HG3  . ARG A 1 214 ? 8.664   1.340   15.497  1.00 15.00 ?  256 ARG A HG3  2  
ATOM   6470   H  HD2  . ARG A 1 214 ? 9.045   3.675   15.880  1.00 15.00 ?  256 ARG A HD2  2  
ATOM   6471   H  HD3  . ARG A 1 214 ? 10.360  2.772   16.622  1.00 15.00 ?  256 ARG A HD3  2  
ATOM   6472   H  HE   . ARG A 1 214 ? 11.831  3.771   15.186  1.00 15.00 ?  256 ARG A HE   2  
ATOM   6473   H  HH11 . ARG A 1 214 ? 9.070   5.414   12.696  1.00 15.00 ?  256 ARG A HH11 2  
ATOM   6474   H  HH12 . ARG A 1 214 ? 8.549   4.245   13.977  1.00 15.00 ?  256 ARG A HH12 2  
ATOM   6475   H  HH21 . ARG A 1 214 ? 11.281  5.961   12.455  1.00 15.00 ?  256 ARG A HH21 2  
ATOM   6476   H  HH22 . ARG A 1 214 ? 12.518  5.256   13.566  1.00 15.00 ?  256 ARG A HH22 2  
ATOM   6477   N  N    . ALA A 1 215 ? 11.532  -2.380  14.253  1.00 15.00 ?  257 ALA A N    2  
ATOM   6478   C  CA   . ALA A 1 215 ? 12.652  -3.296  14.082  1.00 15.00 ?  257 ALA A CA   2  
ATOM   6479   C  C    . ALA A 1 215 ? 12.682  -3.855  12.664  1.00 15.00 ?  257 ALA A C    2  
ATOM   6480   O  O    . ALA A 1 215 ? 13.724  -4.303  12.179  1.00 15.00 ?  257 ALA A O    2  
ATOM   6481   C  CB   . ALA A 1 215 ? 12.571  -4.429  15.089  1.00 15.00 ?  257 ALA A CB   2  
ATOM   6482   H  H    . ALA A 1 215 ? 10.799  -2.624  14.860  1.00 15.00 ?  257 ALA A H    2  
ATOM   6483   H  HA   . ALA A 1 215 ? 13.565  -2.747  14.264  1.00 15.00 ?  257 ALA A HA   2  
ATOM   6484   H  HB1  . ALA A 1 215 ? 13.503  -4.974  15.087  1.00 15.00 ?  257 ALA A HB1  2  
ATOM   6485   H  HB2  . ALA A 1 215 ? 11.765  -5.092  14.818  1.00 15.00 ?  257 ALA A HB2  2  
ATOM   6486   H  HB3  . ALA A 1 215 ? 12.391  -4.024  16.075  1.00 15.00 ?  257 ALA A HB3  2  
ATOM   6487   N  N    . ALA A 1 216 ? 11.522  -3.835  12.008  1.00 15.00 ?  258 ALA A N    2  
ATOM   6488   C  CA   . ALA A 1 216 ? 11.393  -4.317  10.641  1.00 15.00 ?  258 ALA A CA   2  
ATOM   6489   C  C    . ALA A 1 216 ? 12.140  -3.394  9.692   1.00 15.00 ?  258 ALA A C    2  
ATOM   6490   O  O    . ALA A 1 216 ? 12.743  -3.841  8.715   1.00 15.00 ?  258 ALA A O    2  
ATOM   6491   C  CB   . ALA A 1 216 ? 9.928   -4.394  10.253  1.00 15.00 ?  258 ALA A CB   2  
ATOM   6492   H  H    . ALA A 1 216 ? 10.723  -3.487  12.462  1.00 15.00 ?  258 ALA A H    2  
ATOM   6493   H  HA   . ALA A 1 216 ? 11.819  -5.309  10.584  1.00 15.00 ?  258 ALA A HA   2  
ATOM   6494   H  HB1  . ALA A 1 216 ? 9.481   -3.416  10.351  1.00 15.00 ?  258 ALA A HB1  2  
ATOM   6495   H  HB2  . ALA A 1 216 ? 9.418   -5.088  10.903  1.00 15.00 ?  258 ALA A HB2  2  
ATOM   6496   H  HB3  . ALA A 1 216 ? 9.842   -4.729  9.229   1.00 15.00 ?  258 ALA A HB3  2  
ATOM   6497   N  N    . ILE A 1 217 ? 12.103  -2.104  10.000  1.00 15.00 ?  259 ILE A N    2  
ATOM   6498   C  CA   . ILE A 1 217 ? 12.787  -1.098  9.196   1.00 15.00 ?  259 ILE A CA   2  
ATOM   6499   C  C    . ILE A 1 217 ? 14.290  -1.340  9.237   1.00 15.00 ?  259 ILE A C    2  
ATOM   6500   O  O    . ILE A 1 217 ? 14.966  -1.333  8.205   1.00 15.00 ?  259 ILE A O    2  
ATOM   6501   C  CB   . ILE A 1 217 ? 12.489  0.330   9.700   1.00 15.00 ?  259 ILE A CB   2  
ATOM   6502   C  CG1  . ILE A 1 217 ? 10.977  0.567   9.766   1.00 15.00 ?  259 ILE A CG1  2  
ATOM   6503   C  CG2  . ILE A 1 217 ? 13.151  1.364   8.797   1.00 15.00 ?  259 ILE A CG2  2  
ATOM   6504   C  CD1  . ILE A 1 217 ? 10.585  1.798   10.560  1.00 15.00 ?  259 ILE A CD1  2  
ATOM   6505   H  H    . ILE A 1 217 ? 11.605  -1.821  10.798  1.00 15.00 ?  259 ILE A H    2  
ATOM   6506   H  HA   . ILE A 1 217 ? 12.437  -1.187  8.178   1.00 15.00 ?  259 ILE A HA   2  
ATOM   6507   H  HB   . ILE A 1 217 ? 12.907  0.430   10.690  1.00 15.00 ?  259 ILE A HB   2  
ATOM   6508   H  HG12 . ILE A 1 217 ? 10.595  0.684   8.764   1.00 15.00 ?  259 ILE A HG12 2  
ATOM   6509   H  HG13 . ILE A 1 217 ? 10.507  -0.289  10.226  1.00 15.00 ?  259 ILE A HG13 2  
ATOM   6510   H  HG21 . ILE A 1 217 ? 14.220  1.336   8.942   1.00 15.00 ?  259 ILE A HG21 2  
ATOM   6511   H  HG22 . ILE A 1 217 ? 12.778  2.348   9.040   1.00 15.00 ?  259 ILE A HG22 2  
ATOM   6512   H  HG23 . ILE A 1 217 ? 12.923  1.138   7.765   1.00 15.00 ?  259 ILE A HG23 2  
ATOM   6513   H  HD11 . ILE A 1 217 ? 9.508   1.883   10.580  1.00 15.00 ?  259 ILE A HD11 2  
ATOM   6514   H  HD12 . ILE A 1 217 ? 11.008  2.679   10.096  1.00 15.00 ?  259 ILE A HD12 2  
ATOM   6515   H  HD13 . ILE A 1 217 ? 10.959  1.713   11.569  1.00 15.00 ?  259 ILE A HD13 2  
ATOM   6516   N  N    . THR A 1 218 ? 14.803  -1.564  10.441  1.00 15.00 ?  260 THR A N    2  
ATOM   6517   C  CA   . THR A 1 218 ? 16.214  -1.835  10.639  1.00 15.00 ?  260 THR A CA   2  
ATOM   6518   C  C    . THR A 1 218 ? 16.617  -3.123  9.924   1.00 15.00 ?  260 THR A C    2  
ATOM   6519   O  O    . THR A 1 218 ? 17.667  -3.190  9.291   1.00 15.00 ?  260 THR A O    2  
ATOM   6520   C  CB   . THR A 1 218 ? 16.530  -1.960  12.140  1.00 15.00 ?  260 THR A CB   2  
ATOM   6521   O  OG1  . THR A 1 218 ? 15.364  -1.612  12.896  1.00 15.00 ?  260 THR A OG1  2  
ATOM   6522   C  CG2  . THR A 1 218 ? 17.689  -1.057  12.545  1.00 15.00 ?  260 THR A CG2  2  
ATOM   6523   H  H    . THR A 1 218 ? 14.212  -1.534  11.229  1.00 15.00 ?  260 THR A H    2  
ATOM   6524   H  HA   . THR A 1 218 ? 16.781  -1.012  10.231  1.00 15.00 ?  260 THR A HA   2  
ATOM   6525   H  HB   . THR A 1 218 ? 16.797  -2.985  12.352  1.00 15.00 ?  260 THR A HB   2  
ATOM   6526   H  HG1  . THR A 1 218 ? 15.616  -1.042  13.631  1.00 15.00 ?  260 THR A HG1  2  
ATOM   6527   H  HG21 . THR A 1 218 ? 18.554  -1.283  11.940  1.00 15.00 ?  260 THR A HG21 2  
ATOM   6528   H  HG22 . THR A 1 218 ? 17.927  -1.225  13.586  1.00 15.00 ?  260 THR A HG22 2  
ATOM   6529   H  HG23 . THR A 1 218 ? 17.409  -0.025  12.404  1.00 15.00 ?  260 THR A HG23 2  
ATOM   6530   N  N    . HIS A 1 219 ? 15.760  -4.136  10.007  1.00 15.00 ?  261 HIS A N    2  
ATOM   6531   C  CA   . HIS A 1 219 ? 16.035  -5.415  9.370   1.00 15.00 ?  261 HIS A CA   2  
ATOM   6532   C  C    . HIS A 1 219 ? 16.085  -5.252  7.855   1.00 15.00 ?  261 HIS A C    2  
ATOM   6533   O  O    . HIS A 1 219 ? 16.999  -5.751  7.198   1.00 15.00 ?  261 HIS A O    2  
ATOM   6534   C  CB   . HIS A 1 219 ? 14.973  -6.441  9.761   1.00 15.00 ?  261 HIS A CB   2  
ATOM   6535   C  CG   . HIS A 1 219 ? 15.310  -7.837  9.350   1.00 15.00 ?  261 HIS A CG   2  
ATOM   6536   N  ND1  . HIS A 1 219 ? 16.417  -8.488  9.839   1.00 15.00 ?  261 HIS A ND1  2  
ATOM   6537   C  CD2  . HIS A 1 219 ? 14.653  -8.654  8.499   1.00 15.00 ?  261 HIS A CD2  2  
ATOM   6538   C  CE1  . HIS A 1 219 ? 16.404  -9.684  9.278   1.00 15.00 ?  261 HIS A CE1  2  
ATOM   6539   N  NE2  . HIS A 1 219 ? 15.356  -9.825  8.459   1.00 15.00 ?  261 HIS A NE2  2  
ATOM   6540   H  H    . HIS A 1 219 ? 14.920  -4.017  10.508  1.00 15.00 ?  261 HIS A H    2  
ATOM   6541   H  HA   . HIS A 1 219 ? 17.001  -5.757  9.714   1.00 15.00 ?  261 HIS A HA   2  
ATOM   6542   H  HB2  . HIS A 1 219 ? 14.852  -6.435  10.834  1.00 15.00 ?  261 HIS A HB2  2  
ATOM   6543   H  HB3  . HIS A 1 219 ? 14.040  -6.174  9.292   1.00 15.00 ?  261 HIS A HB3  2  
ATOM   6544   H  HD2  . HIS A 1 219 ? 13.739  -8.434  7.968   1.00 15.00 ?  261 HIS A HD2  2  
ATOM   6545   H  HE1  . HIS A 1 219 ? 17.136  -10.456 9.470   1.00 15.00 ?  261 HIS A HE1  2  
ATOM   6546   H  HE2  . HIS A 1 219 ? 15.138  -10.618 7.914   1.00 15.00 ?  261 HIS A HE2  2  
ATOM   6547   N  N    . THR A 1 220 ? 15.103  -4.536  7.311   1.00 15.00 ?  262 THR A N    2  
ATOM   6548   C  CA   . THR A 1 220 ? 15.037  -4.298  5.877   1.00 15.00 ?  262 THR A CA   2  
ATOM   6549   C  C    . THR A 1 220 ? 16.268  -3.518  5.412   1.00 15.00 ?  262 THR A C    2  
ATOM   6550   O  O    . THR A 1 220 ? 16.868  -3.830  4.376   1.00 15.00 ?  262 THR A O    2  
ATOM   6551   C  CB   . THR A 1 220 ? 13.754  -3.528  5.489   1.00 15.00 ?  262 THR A CB   2  
ATOM   6552   O  OG1  . THR A 1 220 ? 12.599  -4.196  6.014   1.00 15.00 ?  262 THR A OG1  2  
ATOM   6553   C  CG2  . THR A 1 220 ? 13.623  -3.415  3.981   1.00 15.00 ?  262 THR A CG2  2  
ATOM   6554   H  H    . THR A 1 220 ? 14.401  -4.166  7.892   1.00 15.00 ?  262 THR A H    2  
ATOM   6555   H  HA   . THR A 1 220 ? 15.022  -5.259  5.383   1.00 15.00 ?  262 THR A HA   2  
ATOM   6556   H  HB   . THR A 1 220 ? 13.806  -2.535  5.908   1.00 15.00 ?  262 THR A HB   2  
ATOM   6557   H  HG1  . THR A 1 220 ? 12.593  -4.129  6.977   1.00 15.00 ?  262 THR A HG1  2  
ATOM   6558   H  HG21 . THR A 1 220 ? 12.798  -2.761  3.742   1.00 15.00 ?  262 THR A HG21 2  
ATOM   6559   H  HG22 . THR A 1 220 ? 13.440  -4.393  3.566   1.00 15.00 ?  262 THR A HG22 2  
ATOM   6560   H  HG23 . THR A 1 220 ? 14.534  -3.010  3.567   1.00 15.00 ?  262 THR A HG23 2  
ATOM   6561   N  N    . ALA A 1 221 ? 16.654  -2.521  6.204   1.00 15.00 ?  263 ALA A N    2  
ATOM   6562   C  CA   . ALA A 1 221 ? 17.816  -1.696  5.896   1.00 15.00 ?  263 ALA A CA   2  
ATOM   6563   C  C    . ALA A 1 221 ? 19.083  -2.541  5.887   1.00 15.00 ?  263 ALA A C    2  
ATOM   6564   O  O    . ALA A 1 221 ? 19.899  -2.442  4.968   1.00 15.00 ?  263 ALA A O    2  
ATOM   6565   C  CB   . ALA A 1 221 ? 17.938  -0.561  6.903   1.00 15.00 ?  263 ALA A CB   2  
ATOM   6566   H  H    . ALA A 1 221 ? 16.142  -2.337  7.021   1.00 15.00 ?  263 ALA A H    2  
ATOM   6567   H  HA   . ALA A 1 221 ? 17.673  -1.266  4.912   1.00 15.00 ?  263 ALA A HA   2  
ATOM   6568   H  HB1  . ALA A 1 221 ? 18.751  0.090   6.617   1.00 15.00 ?  263 ALA A HB1  2  
ATOM   6569   H  HB2  . ALA A 1 221 ? 18.134  -0.971  7.883   1.00 15.00 ?  263 ALA A HB2  2  
ATOM   6570   H  HB3  . ALA A 1 221 ? 17.015  0.001   6.927   1.00 15.00 ?  263 ALA A HB3  2  
ATOM   6571   N  N    . ARG A 1 222 ? 19.233  -3.385  6.905   1.00 15.00 ?  264 ARG A N    2  
ATOM   6572   C  CA   . ARG A 1 222 ? 20.400  -4.254  7.019   1.00 15.00 ?  264 ARG A CA   2  
ATOM   6573   C  C    . ARG A 1 222 ? 20.465  -5.237  5.854   1.00 15.00 ?  264 ARG A C    2  
ATOM   6574   O  O    . ARG A 1 222 ? 21.534  -5.468  5.294   1.00 15.00 ?  264 ARG A O    2  
ATOM   6575   C  CB   . ARG A 1 222 ? 20.385  -5.027  8.334   1.00 15.00 ?  264 ARG A CB   2  
ATOM   6576   C  CG   . ARG A 1 222 ? 20.588  -4.156  9.555   1.00 15.00 ?  264 ARG A CG   2  
ATOM   6577   C  CD   . ARG A 1 222 ? 20.398  -4.951  10.833  1.00 15.00 ?  264 ARG A CD   2  
ATOM   6578   N  NE   . ARG A 1 222 ? 20.397  -4.087  12.013  1.00 15.00 ?  264 ARG A NE   2  
ATOM   6579   C  CZ   . ARG A 1 222 ? 19.674  -4.323  13.110  1.00 15.00 ?  264 ARG A CZ   2  
ATOM   6580   N  NH1  . ARG A 1 222 ? 18.902  -5.397  13.182  1.00 15.00 1  264 ARG A NH1  2  
ATOM   6581   N  NH2  . ARG A 1 222 ? 19.724  -3.479  14.141  1.00 15.00 ?  264 ARG A NH2  2  
ATOM   6582   H  H    . ARG A 1 222 ? 18.541  -3.421  7.603   1.00 15.00 ?  264 ARG A H    2  
ATOM   6583   H  HA   . ARG A 1 222 ? 21.275  -3.627  6.993   1.00 15.00 ?  264 ARG A HA   2  
ATOM   6584   H  HB2  . ARG A 1 222 ? 19.437  -5.532  8.431   1.00 15.00 ?  264 ARG A HB2  2  
ATOM   6585   H  HB3  . ARG A 1 222 ? 21.176  -5.763  8.311   1.00 15.00 ?  264 ARG A HB3  2  
ATOM   6586   H  HG2  . ARG A 1 222 ? 21.589  -3.752  9.532   1.00 15.00 ?  264 ARG A HG2  2  
ATOM   6587   H  HG3  . ARG A 1 222 ? 19.872  -3.349  9.536   1.00 15.00 ?  264 ARG A HG3  2  
ATOM   6588   H  HD2  . ARG A 1 222 ? 19.457  -5.478  10.776  1.00 15.00 ?  264 ARG A HD2  2  
ATOM   6589   H  HD3  . ARG A 1 222 ? 21.203  -5.666  10.922  1.00 15.00 ?  264 ARG A HD3  2  
ATOM   6590   H  HE   . ARG A 1 222 ? 20.965  -3.282  11.979  1.00 15.00 ?  264 ARG A HE   2  
ATOM   6591   H  HH11 . ARG A 1 222 ? 18.337  -5.585  14.042  1.00 15.00 ?  264 ARG A HH11 2  
ATOM   6592   H  HH12 . ARG A 1 222 ? 18.854  -6.059  12.384  1.00 15.00 ?  264 ARG A HH12 2  
ATOM   6593   H  HH21 . ARG A 1 222 ? 20.327  -2.629  14.099  1.00 15.00 ?  264 ARG A HH21 2  
ATOM   6594   H  HH22 . ARG A 1 222 ? 19.152  -3.662  14.997  1.00 15.00 ?  264 ARG A HH22 2  
ATOM   6595   N  N    . MET A 1 223 ? 19.319  -5.814  5.497   1.00 15.00 ?  265 MET A N    2  
ATOM   6596   C  CA   . MET A 1 223 ? 19.255  -6.767  4.393   1.00 15.00 ?  265 MET A CA   2  
ATOM   6597   C  C    . MET A 1 223 ? 19.733  -6.120  3.102   1.00 15.00 ?  265 MET A C    2  
ATOM   6598   O  O    . MET A 1 223 ? 20.537  -6.691  2.365   1.00 15.00 ?  265 MET A O    2  
ATOM   6599   C  CB   . MET A 1 223 ? 17.830  -7.293  4.211   1.00 15.00 ?  265 MET A CB   2  
ATOM   6600   C  CG   . MET A 1 223 ? 17.576  -8.616  4.914   1.00 15.00 ?  265 MET A CG   2  
ATOM   6601   S  SD   . MET A 1 223 ? 16.100  -9.454  4.307   1.00 15.00 ?  265 MET A SD   2  
ATOM   6602   C  CE   . MET A 1 223 ? 14.826  -8.309  4.826   1.00 15.00 ?  265 MET A CE   2  
ATOM   6603   H  H    . MET A 1 223 ? 18.499  -5.602  5.995   1.00 15.00 ?  265 MET A H    2  
ATOM   6604   H  HA   . MET A 1 223 ? 19.909  -7.593  4.629   1.00 15.00 ?  265 MET A HA   2  
ATOM   6605   H  HB2  . MET A 1 223 ? 17.134  -6.563  4.601   1.00 15.00 ?  265 MET A HB2  2  
ATOM   6606   H  HB3  . MET A 1 223 ? 17.639  -7.431  3.157   1.00 15.00 ?  265 MET A HB3  2  
ATOM   6607   H  HG2  . MET A 1 223 ? 18.426  -9.260  4.757   1.00 15.00 ?  265 MET A HG2  2  
ATOM   6608   H  HG3  . MET A 1 223 ? 17.457  -8.426  5.973   1.00 15.00 ?  265 MET A HG3  2  
ATOM   6609   H  HE1  . MET A 1 223 ? 13.864  -8.670  4.498   1.00 15.00 ?  265 MET A HE1  2  
ATOM   6610   H  HE2  . MET A 1 223 ? 15.016  -7.339  4.394   1.00 15.00 ?  265 MET A HE2  2  
ATOM   6611   H  HE3  . MET A 1 223 ? 14.833  -8.230  5.903   1.00 15.00 ?  265 MET A HE3  2  
ATOM   6612   N  N    . ALA A 1 224 ? 19.245  -4.916  2.847   1.00 15.00 ?  266 ALA A N    2  
ATOM   6613   C  CA   . ALA A 1 224 ? 19.603  -4.179  1.645   1.00 15.00 ?  266 ALA A CA   2  
ATOM   6614   C  C    . ALA A 1 224 ? 21.057  -3.714  1.679   1.00 15.00 ?  266 ALA A C    2  
ATOM   6615   O  O    . ALA A 1 224 ? 21.720  -3.663  0.644   1.00 15.00 ?  266 ALA A O    2  
ATOM   6616   C  CB   . ALA A 1 224 ? 18.672  -2.996  1.469   1.00 15.00 ?  266 ALA A CB   2  
ATOM   6617   H  H    . ALA A 1 224 ? 18.619  -4.510  3.490   1.00 15.00 ?  266 ALA A H    2  
ATOM   6618   H  HA   . ALA A 1 224 ? 19.470  -4.838  0.801   1.00 15.00 ?  266 ALA A HA   2  
ATOM   6619   H  HB1  . ALA A 1 224 ? 18.514  -2.520  2.424   1.00 15.00 ?  266 ALA A HB1  2  
ATOM   6620   H  HB2  . ALA A 1 224 ? 17.726  -3.337  1.076   1.00 15.00 ?  266 ALA A HB2  2  
ATOM   6621   H  HB3  . ALA A 1 224 ? 19.111  -2.287  0.785   1.00 15.00 ?  266 ALA A HB3  2  
ATOM   6622   N  N    . ASP A 1 225 ? 21.554  -3.396  2.870   1.00 15.00 ?  267 ASP A N    2  
ATOM   6623   C  CA   . ASP A 1 225 ? 22.933  -2.928  3.030   1.00 15.00 ?  267 ASP A CA   2  
ATOM   6624   C  C    . ASP A 1 225 ? 23.926  -4.077  2.864   1.00 15.00 ?  267 ASP A C    2  
ATOM   6625   O  O    . ASP A 1 225 ? 25.112  -3.855  2.616   1.00 15.00 ?  267 ASP A O    2  
ATOM   6626   C  CB   . ASP A 1 225 ? 23.124  -2.270  4.401   1.00 15.00 ?  267 ASP A CB   2  
ATOM   6627   C  CG   . ASP A 1 225 ? 24.098  -1.110  4.359   1.00 15.00 ?  267 ASP A CG   2  
ATOM   6628   O  OD1  . ASP A 1 225 ? 25.325  -1.354  4.313   1.00 15.00 ?  267 ASP A OD1  2  
ATOM   6629   O  OD2  . ASP A 1 225 ? 23.643  0.055   4.369   1.00 15.00 -1 267 ASP A OD2  2  
ATOM   6630   H  H    . ASP A 1 225 ? 20.978  -3.471  3.665   1.00 15.00 ?  267 ASP A H    2  
ATOM   6631   H  HA   . ASP A 1 225 ? 23.122  -2.192  2.262   1.00 15.00 ?  267 ASP A HA   2  
ATOM   6632   H  HB2  . ASP A 1 225 ? 22.172  -1.902  4.755   1.00 15.00 ?  267 ASP A HB2  2  
ATOM   6633   H  HB3  . ASP A 1 225 ? 23.503  -3.004  5.094   1.00 15.00 ?  267 ASP A HB3  2  
ATOM   6634   N  N    . LYS A 1 226 ? 23.441  -5.306  3.008   1.00 15.00 ?  268 LYS A N    2  
ATOM   6635   C  CA   . LYS A 1 226 ? 24.292  -6.487  2.863   1.00 15.00 ?  268 LYS A CA   2  
ATOM   6636   C  C    . LYS A 1 226 ? 24.138  -7.101  1.472   1.00 15.00 ?  268 LYS A C    2  
ATOM   6637   O  O    . LYS A 1 226 ? 24.752  -8.123  1.163   1.00 15.00 ?  268 LYS A O    2  
ATOM   6638   C  CB   . LYS A 1 226 ? 23.946  -7.546  3.918   1.00 15.00 ?  268 LYS A CB   2  
ATOM   6639   C  CG   . LYS A 1 226 ? 24.275  -7.137  5.349   1.00 15.00 ?  268 LYS A CG   2  
ATOM   6640   C  CD   . LYS A 1 226 ? 24.124  -8.305  6.314   1.00 15.00 ?  268 LYS A CD   2  
ATOM   6641   C  CE   . LYS A 1 226 ? 22.704  -8.846  6.314   1.00 15.00 ?  268 LYS A CE   2  
ATOM   6642   N  NZ   . LYS A 1 226 ? 22.582  -10.071 7.143   1.00 15.00 1  268 LYS A NZ   2  
ATOM   6643   H  H    . LYS A 1 226 ? 22.491  -5.421  3.227   1.00 15.00 ?  268 LYS A H    2  
ATOM   6644   H  HA   . LYS A 1 226 ? 25.317  -6.179  2.998   1.00 15.00 ?  268 LYS A HA   2  
ATOM   6645   H  HB2  . LYS A 1 226 ? 22.888  -7.754  3.860   1.00 15.00 ?  268 LYS A HB2  2  
ATOM   6646   H  HB3  . LYS A 1 226 ? 24.489  -8.452  3.691   1.00 15.00 ?  268 LYS A HB3  2  
ATOM   6647   H  HG2  . LYS A 1 226 ? 25.291  -6.782  5.386   1.00 15.00 ?  268 LYS A HG2  2  
ATOM   6648   H  HG3  . LYS A 1 226 ? 23.602  -6.348  5.647   1.00 15.00 ?  268 LYS A HG3  2  
ATOM   6649   H  HD2  . LYS A 1 226 ? 24.800  -9.095  6.020   1.00 15.00 ?  268 LYS A HD2  2  
ATOM   6650   H  HD3  . LYS A 1 226 ? 24.372  -7.970  7.312   1.00 15.00 ?  268 LYS A HD3  2  
ATOM   6651   H  HE2  . LYS A 1 226 ? 22.043  -8.089  6.707   1.00 15.00 ?  268 LYS A HE2  2  
ATOM   6652   H  HE3  . LYS A 1 226 ? 22.423  -9.079  5.297   1.00 15.00 ?  268 LYS A HE3  2  
ATOM   6653   H  HZ1  . LYS A 1 226 ? 21.623  -10.464 7.059   1.00 15.00 ?  268 LYS A HZ1  2  
ATOM   6654   H  HZ2  . LYS A 1 226 ? 22.771  -9.854  8.142   1.00 15.00 ?  268 LYS A HZ2  2  
ATOM   6655   H  HZ3  . LYS A 1 226 ? 23.263  -10.786 6.823   1.00 15.00 ?  268 LYS A HZ3  2  
ATOM   6656   N  N    . LEU A 1 227 ? 23.334  -6.466  0.635   1.00 15.00 ?  269 LEU A N    2  
ATOM   6657   C  CA   . LEU A 1 227 ? 23.081  -6.962  -0.712  1.00 15.00 ?  269 LEU A CA   2  
ATOM   6658   C  C    . LEU A 1 227 ? 23.883  -6.159  -1.726  1.00 15.00 ?  269 LEU A C    2  
ATOM   6659   O  O    . LEU A 1 227 ? 24.248  -6.721  -2.784  1.00 15.00 ?  269 LEU A O    2  
ATOM   6660   C  CB   . LEU A 1 227 ? 21.582  -6.889  -1.031  1.00 15.00 ?  269 LEU A CB   2  
ATOM   6661   C  CG   . LEU A 1 227 ? 21.110  -7.759  -2.200  1.00 15.00 ?  269 LEU A CG   2  
ATOM   6662   C  CD1  . LEU A 1 227 ? 21.385  -9.232  -1.924  1.00 15.00 ?  269 LEU A CD1  2  
ATOM   6663   C  CD2  . LEU A 1 227 ? 19.631  -7.528  -2.448  1.00 15.00 ?  269 LEU A CD2  2  
ATOM   6664   O  OXT  . LEU A 1 227 ? 24.170  -4.976  -1.446  1.00 15.00 -1 269 LEU A OXT  2  
ATOM   6665   H  H    . LEU A 1 227 ? 22.925  -5.622  0.915   1.00 15.00 ?  269 LEU A H    2  
ATOM   6666   H  HA   . LEU A 1 227 ? 23.400  -7.991  -0.755  1.00 15.00 ?  269 LEU A HA   2  
ATOM   6667   H  HB2  . LEU A 1 227 ? 21.035  -7.186  -0.148  1.00 15.00 ?  269 LEU A HB2  2  
ATOM   6668   H  HB3  . LEU A 1 227 ? 21.332  -5.862  -1.255  1.00 15.00 ?  269 LEU A HB3  2  
ATOM   6669   H  HG   . LEU A 1 227 ? 21.648  -7.478  -3.094  1.00 15.00 ?  269 LEU A HG   2  
ATOM   6670   H  HD11 . LEU A 1 227 ? 20.778  -9.564  -1.094  1.00 15.00 ?  269 LEU A HD11 2  
ATOM   6671   H  HD12 . LEU A 1 227 ? 22.427  -9.364  -1.681  1.00 15.00 ?  269 LEU A HD12 2  
ATOM   6672   H  HD13 . LEU A 1 227 ? 21.145  -9.813  -2.802  1.00 15.00 ?  269 LEU A HD13 2  
ATOM   6673   H  HD21 . LEU A 1 227 ? 19.304  -8.134  -3.278  1.00 15.00 ?  269 LEU A HD21 2  
ATOM   6674   H  HD22 . LEU A 1 227 ? 19.464  -6.482  -2.677  1.00 15.00 ?  269 LEU A HD22 2  
ATOM   6675   H  HD23 . LEU A 1 227 ? 19.074  -7.794  -1.564  1.00 15.00 ?  269 LEU A HD23 2  
HETATM 6676   ZN ZN   . ZN  B 2 .   ? 5.895   -3.678  -6.358  1.00 15.00 ?  301 ZN  A ZN   2  
HETATM 6677   ZN ZN   . ZN  C 2 .   ? 2.845   -7.555  -6.379  1.00 15.00 ?  302 ZN  A ZN   2  
HETATM 6678   O  OAB  . MRI D 3 .   ? 4.287   -8.585  -5.238  1.00 15.00 ?  303 MRI A OAB  2  
HETATM 6679   C  CAM  . MRI D 3 .   ? 4.951   -8.901  -6.381  1.00 15.00 ?  303 MRI A CAM  2  
HETATM 6680   C  CAN  . MRI D 3 .   ? 4.410   -8.562  -7.617  1.00 15.00 ?  303 MRI A CAN  2  
HETATM 6681   O  OAD  . MRI D 3 .   ? 3.309   -8.016  -7.682  1.00 15.00 ?  303 MRI A OAD  2  
HETATM 6682   C  CAI  . MRI D 3 .   ? 5.144   -8.863  -8.756  1.00 15.00 ?  303 MRI A CAI  2  
HETATM 6683   C  CAO  . MRI D 3 .   ? 4.798   -8.331  -9.991  1.00 15.00 ?  303 MRI A CAO  2  
HETATM 6684   O  OAC  . MRI D 3 .   ? 3.687   -7.560  -10.134 1.00 15.00 ?  303 MRI A OAC  2  
HETATM 6685   C  CAS  . MRI D 3 .   ? 5.595   -8.582  -11.103 1.00 15.00 ?  303 MRI A CAS  2  
HETATM 6686   C  CAR  . MRI D 3 .   ? 6.738   -9.359  -10.977 1.00 15.00 ?  303 MRI A CAR  2  
HETATM 6687   O  OAF  . MRI D 3 .   ? 7.523   -9.603  -12.063 1.00 15.00 ?  303 MRI A OAF  2  
HETATM 6688   C  CAP  . MRI D 3 .   ? 7.079   -9.896  -9.739  1.00 15.00 ?  303 MRI A CAP  2  
HETATM 6689   C  CAJ  . MRI D 3 .   ? 6.286   -9.648  -8.626  1.00 15.00 ?  303 MRI A CAJ  2  
HETATM 6690   O  OAA  . MRI D 3 .   ? 6.611   -10.238 -7.443  1.00 15.00 ?  303 MRI A OAA  2  
HETATM 6691   C  CAK  . MRI D 3 .   ? 6.174   -9.559  -6.347  1.00 15.00 ?  303 MRI A CAK  2  
HETATM 6692   C  CAL  . MRI D 3 .   ? 6.939   -9.563  -5.188  1.00 15.00 ?  303 MRI A CAL  2  
HETATM 6693   C  CAT  . MRI D 3 .   ? 7.753   -10.651 -4.900  1.00 15.00 ?  303 MRI A CAT  2  
HETATM 6694   C  CAV  . MRI D 3 .   ? 8.488   -10.683 -3.721  1.00 15.00 ?  303 MRI A CAV  2  
HETATM 6695   C  CAW  . MRI D 3 .   ? 8.410   -9.623  -2.830  1.00 15.00 ?  303 MRI A CAW  2  
HETATM 6696   O  OAG  . MRI D 3 .   ? 9.118   -9.655  -1.669  1.00 15.00 ?  303 MRI A OAG  2  
HETATM 6697   C  CAU  . MRI D 3 .   ? 7.603   -8.530  -3.119  1.00 15.00 ?  303 MRI A CAU  2  
HETATM 6698   C  CAQ  . MRI D 3 .   ? 6.869   -8.497  -4.297  1.00 15.00 ?  303 MRI A CAQ  2  
HETATM 6699   O  OAE  . MRI D 3 .   ? 6.104   -7.412  -4.588  1.00 15.00 ?  303 MRI A OAE  2  
HETATM 6700   H  H1   . MRI D 3 .   ? 4.798   -8.931  -4.450  1.00 15.00 ?  303 MRI A H1   2  
HETATM 6701   H  H2   . MRI D 3 .   ? 3.235   -7.445  -9.252  1.00 15.00 ?  303 MRI A H2   2  
HETATM 6702   H  H4   . MRI D 3 .   ? 7.139   -9.143  -12.864 1.00 15.00 ?  303 MRI A H4   2  
HETATM 6703   H  H8   . MRI D 3 .   ? 9.606   -10.529 -1.598  1.00 15.00 ?  303 MRI A H8   2  
HETATM 6704   H  H10  . MRI D 3 .   ? 6.180   -6.742  -3.848  1.00 15.00 ?  303 MRI A H10  2  
ATOM   6705   N  N    . ASP A 1 1   ? -9.254  -12.110 12.680  1.00 15.00 ?  43  ASP A N    3  
ATOM   6706   C  CA   . ASP A 1 1   ? -9.331  -11.946 11.233  1.00 15.00 ?  43  ASP A CA   3  
ATOM   6707   C  C    . ASP A 1 1   ? -10.701 -12.361 10.725  1.00 15.00 ?  43  ASP A C    3  
ATOM   6708   O  O    . ASP A 1 1   ? -11.134 -13.504 10.921  1.00 15.00 ?  43  ASP A O    3  
ATOM   6709   C  CB   . ASP A 1 1   ? -8.255  -12.778 10.533  1.00 15.00 ?  43  ASP A CB   3  
ATOM   6710   C  CG   . ASP A 1 1   ? -6.848  -12.287 10.815  1.00 15.00 ?  43  ASP A CG   3  
ATOM   6711   O  OD1  . ASP A 1 1   ? -6.580  -11.082 10.651  1.00 15.00 ?  43  ASP A OD1  3  
ATOM   6712   O  OD2  . ASP A 1 1   ? -5.992  -13.113 11.197  1.00 15.00 -1 43  ASP A OD2  3  
ATOM   6713   H  H1   . ASP A 1 1   ? -9.028  -12.989 13.042  1.00 15.00 ?  43  ASP A H1   3  
ATOM   6714   H  HA   . ASP A 1 1   ? -9.174  -10.902 11.001  1.00 15.00 ?  43  ASP A HA   3  
ATOM   6715   H  HB2  . ASP A 1 1   ? -8.331  -13.803 10.865  1.00 15.00 ?  43  ASP A HB2  3  
ATOM   6716   H  HB3  . ASP A 1 1   ? -8.423  -12.740 9.467   1.00 15.00 ?  43  ASP A HB3  3  
ATOM   6717   N  N    . GLN A 1 2   ? -11.379 -11.429 10.074  1.00 15.00 ?  44  GLN A N    3  
ATOM   6718   C  CA   . GLN A 1 2   ? -12.702 -11.675 9.529   1.00 15.00 ?  44  GLN A CA   3  
ATOM   6719   C  C    . GLN A 1 2   ? -12.605 -12.052 8.053   1.00 15.00 ?  44  GLN A C    3  
ATOM   6720   O  O    . GLN A 1 2   ? -12.205 -11.242 7.217   1.00 15.00 ?  44  GLN A O    3  
ATOM   6721   C  CB   . GLN A 1 2   ? -13.579 -10.429 9.707   1.00 15.00 ?  44  GLN A CB   3  
ATOM   6722   C  CG   . GLN A 1 2   ? -14.936 -10.527 9.031   1.00 15.00 ?  44  GLN A CG   3  
ATOM   6723   C  CD   . GLN A 1 2   ? -15.604 -9.171  8.888   1.00 15.00 ?  44  GLN A CD   3  
ATOM   6724   O  OE1  . GLN A 1 2   ? -14.935 -8.146  8.755   1.00 15.00 ?  44  GLN A OE1  3  
ATOM   6725   N  NE2  . GLN A 1 2   ? -16.926 -9.153  8.917   1.00 15.00 ?  44  GLN A NE2  3  
ATOM   6726   H  H    . GLN A 1 2   ? -10.972 -10.543 9.948   1.00 15.00 ?  44  GLN A H    3  
ATOM   6727   H  HA   . GLN A 1 2   ? -13.140 -12.496 10.073  1.00 15.00 ?  44  GLN A HA   3  
ATOM   6728   H  HB2  . GLN A 1 2   ? -13.742 -10.264 10.762  1.00 15.00 ?  44  GLN A HB2  3  
ATOM   6729   H  HB3  . GLN A 1 2   ? -13.058 -9.577  9.295   1.00 15.00 ?  44  GLN A HB3  3  
ATOM   6730   H  HG2  . GLN A 1 2   ? -14.807 -10.955 8.046   1.00 15.00 ?  44  GLN A HG2  3  
ATOM   6731   H  HG3  . GLN A 1 2   ? -15.576 -11.169 9.621   1.00 15.00 ?  44  GLN A HG3  3  
ATOM   6732   H  HE21 . GLN A 1 2   ? -17.401 -10.004 9.023   1.00 15.00 ?  44  GLN A HE21 3  
ATOM   6733   H  HE22 . GLN A 1 2   ? -17.379 -8.280  8.842   1.00 15.00 ?  44  GLN A HE22 3  
ATOM   6734   N  N    . ARG A 1 3   ? -12.952 -13.287 7.734   1.00 15.00 ?  45  ARG A N    3  
ATOM   6735   C  CA   . ARG A 1 3   ? -12.912 -13.752 6.357   1.00 15.00 ?  45  ARG A CA   3  
ATOM   6736   C  C    . ARG A 1 3   ? -14.171 -13.313 5.622   1.00 15.00 ?  45  ARG A C    3  
ATOM   6737   O  O    . ARG A 1 3   ? -15.287 -13.582 6.071   1.00 15.00 ?  45  ARG A O    3  
ATOM   6738   C  CB   . ARG A 1 3   ? -12.782 -15.273 6.307   1.00 15.00 ?  45  ARG A CB   3  
ATOM   6739   C  CG   . ARG A 1 3   ? -11.373 -15.775 6.579   1.00 15.00 ?  45  ARG A CG   3  
ATOM   6740   C  CD   . ARG A 1 3   ? -11.328 -17.288 6.632   1.00 15.00 ?  45  ARG A CD   3  
ATOM   6741   N  NE   . ARG A 1 3   ? -9.958  -17.803 6.611   1.00 15.00 ?  45  ARG A NE   3  
ATOM   6742   C  CZ   . ARG A 1 3   ? -9.557  -18.830 5.853   1.00 15.00 ?  45  ARG A CZ   3  
ATOM   6743   N  NH1  . ARG A 1 3   ? -10.425 -19.452 5.061   1.00 15.00 1  45  ARG A NH1  3  
ATOM   6744   N  NH2  . ARG A 1 3   ? -8.295  -19.247 5.901   1.00 15.00 ?  45  ARG A NH2  3  
ATOM   6745   H  H    . ARG A 1 3   ? -13.250 -13.901 8.439   1.00 15.00 ?  45  ARG A H    3  
ATOM   6746   H  HA   . ARG A 1 3   ? -12.051 -13.305 5.877   1.00 15.00 ?  45  ARG A HA   3  
ATOM   6747   H  HB2  . ARG A 1 3   ? -13.442 -15.703 7.043   1.00 15.00 ?  45  ARG A HB2  3  
ATOM   6748   H  HB3  . ARG A 1 3   ? -13.076 -15.612 5.328   1.00 15.00 ?  45  ARG A HB3  3  
ATOM   6749   H  HG2  . ARG A 1 3   ? -10.720 -15.435 5.792   1.00 15.00 ?  45  ARG A HG2  3  
ATOM   6750   H  HG3  . ARG A 1 3   ? -11.035 -15.382 7.526   1.00 15.00 ?  45  ARG A HG3  3  
ATOM   6751   H  HD2  . ARG A 1 3   ? -11.813 -17.615 7.541   1.00 15.00 ?  45  ARG A HD2  3  
ATOM   6752   H  HD3  . ARG A 1 3   ? -11.865 -17.677 5.780   1.00 15.00 ?  45  ARG A HD3  3  
ATOM   6753   H  HE   . ARG A 1 3   ? -9.300  -17.353 7.189   1.00 15.00 ?  45  ARG A HE   3  
ATOM   6754   H  HH11 . ARG A 1 3   ? -10.115 -20.251 4.465   1.00 15.00 ?  45  ARG A HH11 3  
ATOM   6755   H  HH12 . ARG A 1 3   ? -11.421 -19.145 5.030   1.00 15.00 ?  45  ARG A HH12 3  
ATOM   6756   H  HH21 . ARG A 1 3   ? -7.983  -20.051 5.309   1.00 15.00 ?  45  ARG A HH21 3  
ATOM   6757   H  HH22 . ARG A 1 3   ? -7.608  -18.773 6.528   1.00 15.00 ?  45  ARG A HH22 3  
ATOM   6758   N  N    . PHE A 1 4   ? -13.990 -12.639 4.499   1.00 15.00 ?  46  PHE A N    3  
ATOM   6759   C  CA   . PHE A 1 4   ? -15.106 -12.160 3.704   1.00 15.00 ?  46  PHE A CA   3  
ATOM   6760   C  C    . PHE A 1 4   ? -14.863 -12.485 2.236   1.00 15.00 ?  46  PHE A C    3  
ATOM   6761   O  O    . PHE A 1 4   ? -14.030 -11.859 1.576   1.00 15.00 ?  46  PHE A O    3  
ATOM   6762   C  CB   . PHE A 1 4   ? -15.286 -10.654 3.895   1.00 15.00 ?  46  PHE A CB   3  
ATOM   6763   C  CG   . PHE A 1 4   ? -16.551 -10.107 3.293   1.00 15.00 ?  46  PHE A CG   3  
ATOM   6764   C  CD1  . PHE A 1 4   ? -16.530 -9.478  2.059   1.00 15.00 ?  46  PHE A CD1  3  
ATOM   6765   C  CD2  . PHE A 1 4   ? -17.755 -10.218 3.966   1.00 15.00 ?  46  PHE A CD2  3  
ATOM   6766   C  CE1  . PHE A 1 4   ? -17.692 -8.970  1.502   1.00 15.00 ?  46  PHE A CE1  3  
ATOM   6767   C  CE2  . PHE A 1 4   ? -18.920 -9.715  3.417   1.00 15.00 ?  46  PHE A CE2  3  
ATOM   6768   C  CZ   . PHE A 1 4   ? -18.890 -9.089  2.184   1.00 15.00 ?  46  PHE A CZ   3  
ATOM   6769   H  H    . PHE A 1 4   ? -13.074 -12.469 4.185   1.00 15.00 ?  46  PHE A H    3  
ATOM   6770   H  HA   . PHE A 1 4   ? -15.997 -12.670 4.036   1.00 15.00 ?  46  PHE A HA   3  
ATOM   6771   H  HB2  . PHE A 1 4   ? -15.302 -10.436 4.951   1.00 15.00 ?  46  PHE A HB2  3  
ATOM   6772   H  HB3  . PHE A 1 4   ? -14.452 -10.141 3.441   1.00 15.00 ?  46  PHE A HB3  3  
ATOM   6773   H  HD1  . PHE A 1 4   ? -15.594 -9.387  1.528   1.00 15.00 ?  46  PHE A HD1  3  
ATOM   6774   H  HD2  . PHE A 1 4   ? -17.780 -10.705 4.927   1.00 15.00 ?  46  PHE A HD2  3  
ATOM   6775   H  HE1  . PHE A 1 4   ? -17.664 -8.479  0.539   1.00 15.00 ?  46  PHE A HE1  3  
ATOM   6776   H  HE2  . PHE A 1 4   ? -19.856 -9.810  3.950   1.00 15.00 ?  46  PHE A HE2  3  
ATOM   6777   H  HZ   . PHE A 1 4   ? -19.799 -8.694  1.754   1.00 15.00 ?  46  PHE A HZ   3  
ATOM   6778   N  N    . GLY A 1 5   ? -15.579 -13.482 1.741   1.00 15.00 ?  47  GLY A N    3  
ATOM   6779   C  CA   . GLY A 1 5   ? -15.430 -13.890 0.364   1.00 15.00 ?  47  GLY A CA   3  
ATOM   6780   C  C    . GLY A 1 5   ? -14.108 -14.580 0.112   1.00 15.00 ?  47  GLY A C    3  
ATOM   6781   O  O    . GLY A 1 5   ? -13.875 -15.683 0.603   1.00 15.00 ?  47  GLY A O    3  
ATOM   6782   H  H    . GLY A 1 5   ? -16.217 -13.948 2.318   1.00 15.00 ?  47  GLY A H    3  
ATOM   6783   H  HA2  . GLY A 1 5   ? -16.231 -14.569 0.116   1.00 15.00 ?  47  GLY A HA2  3  
ATOM   6784   H  HA3  . GLY A 1 5   ? -15.497 -13.019 -0.271  1.00 15.00 ?  47  GLY A HA3  3  
ATOM   6785   N  N    . ASP A 1 6   ? -13.244 -13.928 -0.652  1.00 15.00 ?  48  ASP A N    3  
ATOM   6786   C  CA   . ASP A 1 6   ? -11.933 -14.481 -0.969  1.00 15.00 ?  48  ASP A CA   3  
ATOM   6787   C  C    . ASP A 1 6   ? -10.838 -13.672 -0.290  1.00 15.00 ?  48  ASP A C    3  
ATOM   6788   O  O    . ASP A 1 6   ? -9.649  -13.910 -0.513  1.00 15.00 ?  48  ASP A O    3  
ATOM   6789   C  CB   . ASP A 1 6   ? -11.694 -14.485 -2.484  1.00 15.00 ?  48  ASP A CB   3  
ATOM   6790   C  CG   . ASP A 1 6   ? -12.716 -15.303 -3.244  1.00 15.00 ?  48  ASP A CG   3  
ATOM   6791   O  OD1  . ASP A 1 6   ? -12.685 -16.549 -3.146  1.00 15.00 ?  48  ASP A OD1  3  
ATOM   6792   O  OD2  . ASP A 1 6   ? -13.557 -14.704 -3.947  1.00 15.00 -1 48  ASP A OD2  3  
ATOM   6793   H  H    . ASP A 1 6   ? -13.499 -13.052 -1.021  1.00 15.00 ?  48  ASP A H    3  
ATOM   6794   H  HA   . ASP A 1 6   ? -11.901 -15.497 -0.603  1.00 15.00 ?  48  ASP A HA   3  
ATOM   6795   H  HB2  . ASP A 1 6   ? -11.732 -13.471 -2.849  1.00 15.00 ?  48  ASP A HB2  3  
ATOM   6796   H  HB3  . ASP A 1 6   ? -10.716 -14.897 -2.685  1.00 15.00 ?  48  ASP A HB3  3  
ATOM   6797   N  N    . LEU A 1 7   ? -11.242 -12.725 0.550   1.00 15.00 ?  49  LEU A N    3  
ATOM   6798   C  CA   . LEU A 1 7   ? -10.296 -11.862 1.243   1.00 15.00 ?  49  LEU A CA   3  
ATOM   6799   C  C    . LEU A 1 7   ? -10.461 -11.951 2.754   1.00 15.00 ?  49  LEU A C    3  
ATOM   6800   O  O    . LEU A 1 7   ? -11.463 -12.467 3.259   1.00 15.00 ?  49  LEU A O    3  
ATOM   6801   C  CB   . LEU A 1 7   ? -10.484 -10.405 0.806   1.00 15.00 ?  49  LEU A CB   3  
ATOM   6802   C  CG   . LEU A 1 7   ? -10.259 -10.127 -0.678  1.00 15.00 ?  49  LEU A CG   3  
ATOM   6803   C  CD1  . LEU A 1 7   ? -11.567 -10.235 -1.446  1.00 15.00 ?  49  LEU A CD1  3  
ATOM   6804   C  CD2  . LEU A 1 7   ? -9.633  -8.754  -0.862  1.00 15.00 ?  49  LEU A CD2  3  
ATOM   6805   H  H    . LEU A 1 7   ? -12.204 -12.609 0.715   1.00 15.00 ?  49  LEU A H    3  
ATOM   6806   H  HA   . LEU A 1 7   ? -9.300  -12.180 0.982   1.00 15.00 ?  49  LEU A HA   3  
ATOM   6807   H  HB2  . LEU A 1 7   ? -11.492 -10.104 1.056   1.00 15.00 ?  49  LEU A HB2  3  
ATOM   6808   H  HB3  . LEU A 1 7   ? -9.796  -9.793  1.370   1.00 15.00 ?  49  LEU A HB3  3  
ATOM   6809   H  HG   . LEU A 1 7   ? -9.575  -10.862 -1.078  1.00 15.00 ?  49  LEU A HG   3  
ATOM   6810   H  HD11 . LEU A 1 7   ? -12.224 -9.430  -1.156  1.00 15.00 ?  49  LEU A HD11 3  
ATOM   6811   H  HD12 . LEU A 1 7   ? -12.040 -11.180 -1.220  1.00 15.00 ?  49  LEU A HD12 3  
ATOM   6812   H  HD13 . LEU A 1 7   ? -11.371 -10.177 -2.507  1.00 15.00 ?  49  LEU A HD13 3  
ATOM   6813   H  HD21 . LEU A 1 7   ? -10.322 -7.993  -0.522  1.00 15.00 ?  49  LEU A HD21 3  
ATOM   6814   H  HD22 . LEU A 1 7   ? -9.407  -8.596  -1.905  1.00 15.00 ?  49  LEU A HD22 3  
ATOM   6815   H  HD23 . LEU A 1 7   ? -8.723  -8.698  -0.284  1.00 15.00 ?  49  LEU A HD23 3  
ATOM   6816   N  N    . VAL A 1 8   ? -9.461  -11.458 3.468   1.00 15.00 ?  50  VAL A N    3  
ATOM   6817   C  CA   . VAL A 1 8   ? -9.475  -11.439 4.920   1.00 15.00 ?  50  VAL A CA   3  
ATOM   6818   C  C    . VAL A 1 8   ? -9.367  -9.998  5.394   1.00 15.00 ?  50  VAL A C    3  
ATOM   6819   O  O    . VAL A 1 8   ? -8.521  -9.248  4.916   1.00 15.00 ?  50  VAL A O    3  
ATOM   6820   C  CB   . VAL A 1 8   ? -8.308  -12.254 5.517   1.00 15.00 ?  50  VAL A CB   3  
ATOM   6821   C  CG1  . VAL A 1 8   ? -8.507  -12.450 7.005   1.00 15.00 ?  50  VAL A CG1  3  
ATOM   6822   C  CG2  . VAL A 1 8   ? -8.160  -13.595 4.817   1.00 15.00 ?  50  VAL A CG2  3  
ATOM   6823   H  H    . VAL A 1 8   ? -8.677  -11.098 3.000   1.00 15.00 ?  50  VAL A H    3  
ATOM   6824   H  HA   . VAL A 1 8   ? -10.407 -11.862 5.263   1.00 15.00 ?  50  VAL A HA   3  
ATOM   6825   H  HB   . VAL A 1 8   ? -7.397  -11.694 5.371   1.00 15.00 ?  50  VAL A HB   3  
ATOM   6826   H  HG11 . VAL A 1 8   ? -9.366  -13.082 7.170   1.00 15.00 ?  50  VAL A HG11 3  
ATOM   6827   H  HG12 . VAL A 1 8   ? -8.670  -11.491 7.475   1.00 15.00 ?  50  VAL A HG12 3  
ATOM   6828   H  HG13 . VAL A 1 8   ? -7.628  -12.917 7.425   1.00 15.00 ?  50  VAL A HG13 3  
ATOM   6829   H  HG21 . VAL A 1 8   ? -7.459  -14.212 5.362   1.00 15.00 ?  50  VAL A HG21 3  
ATOM   6830   H  HG22 . VAL A 1 8   ? -7.794  -13.436 3.814   1.00 15.00 ?  50  VAL A HG22 3  
ATOM   6831   H  HG23 . VAL A 1 8   ? -9.119  -14.091 4.777   1.00 15.00 ?  50  VAL A HG23 3  
ATOM   6832   N  N    . PHE A 1 9   ? -10.226 -9.603  6.316   1.00 15.00 ?  51  PHE A N    3  
ATOM   6833   C  CA   . PHE A 1 9   ? -10.213 -8.245  6.823   1.00 15.00 ?  51  PHE A CA   3  
ATOM   6834   C  C    . PHE A 1 9   ? -9.918  -8.232  8.313   1.00 15.00 ?  51  PHE A C    3  
ATOM   6835   O  O    . PHE A 1 9   ? -10.466 -9.032  9.073   1.00 15.00 ?  51  PHE A O    3  
ATOM   6836   C  CB   . PHE A 1 9   ? -11.550 -7.563  6.530   1.00 15.00 ?  51  PHE A CB   3  
ATOM   6837   C  CG   . PHE A 1 9   ? -11.828 -7.413  5.058   1.00 15.00 ?  51  PHE A CG   3  
ATOM   6838   C  CD1  . PHE A 1 9   ? -12.446 -8.427  4.344   1.00 15.00 ?  51  PHE A CD1  3  
ATOM   6839   C  CD2  . PHE A 1 9   ? -11.460 -6.258  4.390   1.00 15.00 ?  51  PHE A CD2  3  
ATOM   6840   C  CE1  . PHE A 1 9   ? -12.693 -8.291  2.992   1.00 15.00 ?  51  PHE A CE1  3  
ATOM   6841   C  CE2  . PHE A 1 9   ? -11.706 -6.115  3.038   1.00 15.00 ?  51  PHE A CE2  3  
ATOM   6842   C  CZ   . PHE A 1 9   ? -12.323 -7.134  2.337   1.00 15.00 ?  51  PHE A CZ   3  
ATOM   6843   H  H    . PHE A 1 9   ? -10.886 -10.242 6.672   1.00 15.00 ?  51  PHE A H    3  
ATOM   6844   H  HA   . PHE A 1 9   ? -9.429  -7.707  6.308   1.00 15.00 ?  51  PHE A HA   3  
ATOM   6845   H  HB2  . PHE A 1 9   ? -12.348 -8.150  6.963   1.00 15.00 ?  51  PHE A HB2  3  
ATOM   6846   H  HB3  . PHE A 1 9   ? -11.551 -6.580  6.975   1.00 15.00 ?  51  PHE A HB3  3  
ATOM   6847   H  HD1  . PHE A 1 9   ? -12.736 -9.331  4.857   1.00 15.00 ?  51  PHE A HD1  3  
ATOM   6848   H  HD2  . PHE A 1 9   ? -10.976 -5.460  4.938   1.00 15.00 ?  51  PHE A HD2  3  
ATOM   6849   H  HE1  . PHE A 1 9   ? -13.174 -9.087  2.448   1.00 15.00 ?  51  PHE A HE1  3  
ATOM   6850   H  HE2  . PHE A 1 9   ? -11.412 -5.207  2.533   1.00 15.00 ?  51  PHE A HE2  3  
ATOM   6851   H  HZ   . PHE A 1 9   ? -12.515 -7.023  1.279   1.00 15.00 ?  51  PHE A HZ   3  
ATOM   6852   N  N    . ARG A 1 10  ? -9.035  -7.337  8.716   1.00 15.00 ?  52  ARG A N    3  
ATOM   6853   C  CA   . ARG A 1 10  ? -8.649  -7.217  10.113  1.00 15.00 ?  52  ARG A CA   3  
ATOM   6854   C  C    . ARG A 1 10  ? -8.645  -5.756  10.548  1.00 15.00 ?  52  ARG A C    3  
ATOM   6855   O  O    . ARG A 1 10  ? -8.126  -4.891  9.843   1.00 15.00 ?  52  ARG A O    3  
ATOM   6856   C  CB   . ARG A 1 10  ? -7.264  -7.829  10.328  1.00 15.00 ?  52  ARG A CB   3  
ATOM   6857   C  CG   . ARG A 1 10  ? -6.836  -7.878  11.786  1.00 15.00 ?  52  ARG A CG   3  
ATOM   6858   C  CD   . ARG A 1 10  ? -5.430  -8.435  11.934  1.00 15.00 ?  52  ARG A CD   3  
ATOM   6859   N  NE   . ARG A 1 10  ? -5.052  -8.617  13.332  1.00 15.00 ?  52  ARG A NE   3  
ATOM   6860   C  CZ   . ARG A 1 10  ? -5.109  -9.784  13.973  1.00 15.00 ?  52  ARG A CZ   3  
ATOM   6861   N  NH1  . ARG A 1 10  ? -5.527  -10.879 13.344  1.00 15.00 1  52  ARG A NH1  3  
ATOM   6862   N  NH2  . ARG A 1 10  ? -4.749  -9.855  15.244  1.00 15.00 ?  52  ARG A NH2  3  
ATOM   6863   H  H    . ARG A 1 10  ? -8.621  -6.741  8.051   1.00 15.00 ?  52  ARG A H    3  
ATOM   6864   H  HA   . ARG A 1 10  ? -9.371  -7.762  10.705  1.00 15.00 ?  52  ARG A HA   3  
ATOM   6865   H  HB2  . ARG A 1 10  ? -7.265  -8.839  9.939   1.00 15.00 ?  52  ARG A HB2  3  
ATOM   6866   H  HB3  . ARG A 1 10  ? -6.539  -7.244  9.781   1.00 15.00 ?  52  ARG A HB3  3  
ATOM   6867   H  HG2  . ARG A 1 10  ? -6.859  -6.877  12.192  1.00 15.00 ?  52  ARG A HG2  3  
ATOM   6868   H  HG3  . ARG A 1 10  ? -7.523  -8.509  12.332  1.00 15.00 ?  52  ARG A HG3  3  
ATOM   6869   H  HD2  . ARG A 1 10  ? -5.383  -9.391  11.433  1.00 15.00 ?  52  ARG A HD2  3  
ATOM   6870   H  HD3  . ARG A 1 10  ? -4.735  -7.749  11.466  1.00 15.00 ?  52  ARG A HD3  3  
ATOM   6871   H  HE   . ARG A 1 10  ? -4.732  -7.823  13.820  1.00 15.00 ?  52  ARG A HE   3  
ATOM   6872   H  HH11 . ARG A 1 10  ? -5.565  -11.792 13.849  1.00 15.00 ?  52  ARG A HH11 3  
ATOM   6873   H  HH12 . ARG A 1 10  ? -5.819  -10.834 12.336  1.00 15.00 ?  52  ARG A HH12 3  
ATOM   6874   H  HH21 . ARG A 1 10  ? -4.790  -10.767 15.750  1.00 15.00 ?  52  ARG A HH21 3  
ATOM   6875   H  HH22 . ARG A 1 10  ? -4.421  -9.002  15.745  1.00 15.00 ?  52  ARG A HH22 3  
ATOM   6876   N  N    . GLN A 1 11  ? -9.223  -5.484  11.706  1.00 15.00 ?  53  GLN A N    3  
ATOM   6877   C  CA   . GLN A 1 11  ? -9.271  -4.129  12.228  1.00 15.00 ?  53  GLN A CA   3  
ATOM   6878   C  C    . GLN A 1 11  ? -8.028  -3.847  13.061  1.00 15.00 ?  53  GLN A C    3  
ATOM   6879   O  O    . GLN A 1 11  ? -7.817  -4.462  14.108  1.00 15.00 ?  53  GLN A O    3  
ATOM   6880   C  CB   . GLN A 1 11  ? -10.532 -3.920  13.073  1.00 15.00 ?  53  GLN A CB   3  
ATOM   6881   C  CG   . GLN A 1 11  ? -10.748 -2.472  13.483  1.00 15.00 ?  53  GLN A CG   3  
ATOM   6882   C  CD   . GLN A 1 11  ? -12.042 -2.255  14.242  1.00 15.00 ?  53  GLN A CD   3  
ATOM   6883   O  OE1  . GLN A 1 11  ? -12.496 -3.124  14.987  1.00 15.00 ?  53  GLN A OE1  3  
ATOM   6884   N  NE2  . GLN A 1 11  ? -12.641 -1.091  14.055  1.00 15.00 ?  53  GLN A NE2  3  
ATOM   6885   H  H    . GLN A 1 11  ? -9.619  -6.210  12.227  1.00 15.00 ?  53  GLN A H    3  
ATOM   6886   H  HA   . GLN A 1 11  ? -9.291  -3.449  11.388  1.00 15.00 ?  53  GLN A HA   3  
ATOM   6887   H  HB2  . GLN A 1 11  ? -11.391 -4.244  12.505  1.00 15.00 ?  53  GLN A HB2  3  
ATOM   6888   H  HB3  . GLN A 1 11  ? -10.455 -4.518  13.968  1.00 15.00 ?  53  GLN A HB3  3  
ATOM   6889   H  HG2  . GLN A 1 11  ? -9.931  -2.163  14.113  1.00 15.00 ?  53  GLN A HG2  3  
ATOM   6890   H  HG3  . GLN A 1 11  ? -10.766 -1.858  12.593  1.00 15.00 ?  53  GLN A HG3  3  
ATOM   6891   H  HE21 . GLN A 1 11  ? -12.221 -0.448  13.447  1.00 15.00 ?  53  GLN A HE21 3  
ATOM   6892   H  HE22 . GLN A 1 11  ? -13.481 -0.918  14.535  1.00 15.00 ?  53  GLN A HE22 3  
ATOM   6893   N  N    . LEU A 1 12  ? -7.197  -2.935  12.581  1.00 15.00 ?  54  LEU A N    3  
ATOM   6894   C  CA   . LEU A 1 12  ? -5.976  -2.569  13.287  1.00 15.00 ?  54  LEU A CA   3  
ATOM   6895   C  C    . LEU A 1 12  ? -6.280  -1.508  14.331  1.00 15.00 ?  54  LEU A C    3  
ATOM   6896   O  O    . LEU A 1 12  ? -5.835  -1.595  15.476  1.00 15.00 ?  54  LEU A O    3  
ATOM   6897   C  CB   . LEU A 1 12  ? -4.925  -2.041  12.307  1.00 15.00 ?  54  LEU A CB   3  
ATOM   6898   C  CG   . LEU A 1 12  ? -4.427  -3.047  11.268  1.00 15.00 ?  54  LEU A CG   3  
ATOM   6899   C  CD1  . LEU A 1 12  ? -3.452  -2.383  10.309  1.00 15.00 ?  54  LEU A CD1  3  
ATOM   6900   C  CD2  . LEU A 1 12  ? -3.782  -4.245  11.949  1.00 15.00 ?  54  LEU A CD2  3  
ATOM   6901   H  H    . LEU A 1 12  ? -7.409  -2.491  11.732  1.00 15.00 ?  54  LEU A H    3  
ATOM   6902   H  HA   . LEU A 1 12  ? -5.593  -3.453  13.780  1.00 15.00 ?  54  LEU A HA   3  
ATOM   6903   H  HB2  . LEU A 1 12  ? -5.346  -1.196  11.785  1.00 15.00 ?  54  LEU A HB2  3  
ATOM   6904   H  HB3  . LEU A 1 12  ? -4.075  -1.702  12.880  1.00 15.00 ?  54  LEU A HB3  3  
ATOM   6905   H  HG   . LEU A 1 12  ? -5.266  -3.404  10.690  1.00 15.00 ?  54  LEU A HG   3  
ATOM   6906   H  HD11 . LEU A 1 12  ? -3.972  -1.629  9.738   1.00 15.00 ?  54  LEU A HD11 3  
ATOM   6907   H  HD12 . LEU A 1 12  ? -3.045  -3.123  9.636   1.00 15.00 ?  54  LEU A HD12 3  
ATOM   6908   H  HD13 . LEU A 1 12  ? -2.652  -1.921  10.866  1.00 15.00 ?  54  LEU A HD13 3  
ATOM   6909   H  HD21 . LEU A 1 12  ? -4.551  -4.912  12.308  1.00 15.00 ?  54  LEU A HD21 3  
ATOM   6910   H  HD22 . LEU A 1 12  ? -3.184  -3.906  12.781  1.00 15.00 ?  54  LEU A HD22 3  
ATOM   6911   H  HD23 . LEU A 1 12  ? -3.154  -4.765  11.243  1.00 15.00 ?  54  LEU A HD23 3  
ATOM   6912   N  N    . ALA A 1 13  ? -7.064  -0.521  13.922  1.00 15.00 ?  55  ALA A N    3  
ATOM   6913   C  CA   . ALA A 1 13  ? -7.448  0.576   14.786  1.00 15.00 ?  55  ALA A CA   3  
ATOM   6914   C  C    . ALA A 1 13  ? -8.923  0.899   14.574  1.00 15.00 ?  55  ALA A C    3  
ATOM   6915   O  O    . ALA A 1 13  ? -9.490  0.523   13.550  1.00 15.00 ?  55  ALA A O    3  
ATOM   6916   C  CB   . ALA A 1 13  ? -6.571  1.793   14.506  1.00 15.00 ?  55  ALA A CB   3  
ATOM   6917   H  H    . ALA A 1 13  ? -7.414  -0.544  13.003  1.00 15.00 ?  55  ALA A H    3  
ATOM   6918   H  HA   . ALA A 1 13  ? -7.293  0.271   15.810  1.00 15.00 ?  55  ALA A HA   3  
ATOM   6919   H  HB1  . ALA A 1 13  ? -7.175  2.685   14.530  1.00 15.00 ?  55  ALA A HB1  3  
ATOM   6920   H  HB2  . ALA A 1 13  ? -6.116  1.692   13.534  1.00 15.00 ?  55  ALA A HB2  3  
ATOM   6921   H  HB3  . ALA A 1 13  ? -5.800  1.863   15.257  1.00 15.00 ?  55  ALA A HB3  3  
ATOM   6922   N  N    . PRO A 1 14  ? -9.568  1.581   15.536  1.00 15.00 ?  56  PRO A N    3  
ATOM   6923   C  CA   . PRO A 1 14  ? -10.992 1.940   15.443  1.00 15.00 ?  56  PRO A CA   3  
ATOM   6924   C  C    . PRO A 1 14  ? -11.387 2.558   14.099  1.00 15.00 ?  56  PRO A C    3  
ATOM   6925   O  O    . PRO A 1 14  ? -12.489 2.315   13.598  1.00 15.00 ?  56  PRO A O    3  
ATOM   6926   C  CB   . PRO A 1 14  ? -11.162 2.962   16.564  1.00 15.00 ?  56  PRO A CB   3  
ATOM   6927   C  CG   . PRO A 1 14  ? -10.138 2.594   17.578  1.00 15.00 ?  56  PRO A CG   3  
ATOM   6928   C  CD   . PRO A 1 14  ? -8.971  2.029   16.814  1.00 15.00 ?  56  PRO A CD   3  
ATOM   6929   H  HA   . PRO A 1 14  ? -11.621 1.088   15.640  1.00 15.00 ?  56  PRO A HA   3  
ATOM   6930   H  HB2  . PRO A 1 14  ? -10.991 3.959   16.180  1.00 15.00 ?  56  PRO A HB2  3  
ATOM   6931   H  HB3  . PRO A 1 14  ? -12.150 2.886   16.988  1.00 15.00 ?  56  PRO A HB3  3  
ATOM   6932   H  HG2  . PRO A 1 14  ? -9.837  3.476   18.131  1.00 15.00 ?  56  PRO A HG2  3  
ATOM   6933   H  HG3  . PRO A 1 14  ? -10.532 1.847   18.246  1.00 15.00 ?  56  PRO A HG3  3  
ATOM   6934   H  HD2  . PRO A 1 14  ? -8.226  2.793   16.645  1.00 15.00 ?  56  PRO A HD2  3  
ATOM   6935   H  HD3  . PRO A 1 14  ? -8.540  1.196   17.351  1.00 15.00 ?  56  PRO A HD3  3  
ATOM   6936   N  N    . ASN A 1 15  ? -10.491 3.344   13.516  1.00 15.00 ?  57  ASN A N    3  
ATOM   6937   C  CA   . ASN A 1 15  ? -10.768 3.999   12.240  1.00 15.00 ?  57  ASN A CA   3  
ATOM   6938   C  C    . ASN A 1 15  ? -9.896  3.457   11.111  1.00 15.00 ?  57  ASN A C    3  
ATOM   6939   O  O    . ASN A 1 15  ? -9.888  4.022   10.014  1.00 15.00 ?  57  ASN A O    3  
ATOM   6940   C  CB   . ASN A 1 15  ? -10.543 5.511   12.356  1.00 15.00 ?  57  ASN A CB   3  
ATOM   6941   C  CG   . ASN A 1 15  ? -11.799 6.279   12.714  1.00 15.00 ?  57  ASN A CG   3  
ATOM   6942   O  OD1  . ASN A 1 15  ? -12.919 5.818   12.497  1.00 15.00 ?  57  ASN A OD1  3  
ATOM   6943   N  ND2  . ASN A 1 15  ? -11.617 7.475   13.253  1.00 15.00 ?  57  ASN A ND2  3  
ATOM   6944   H  H    . ASN A 1 15  ? -9.628  3.491   13.955  1.00 15.00 ?  57  ASN A H    3  
ATOM   6945   H  HA   . ASN A 1 15  ? -11.806 3.821   11.997  1.00 15.00 ?  57  ASN A HA   3  
ATOM   6946   H  HB2  . ASN A 1 15  ? -9.805  5.697   13.118  1.00 15.00 ?  57  ASN A HB2  3  
ATOM   6947   H  HB3  . ASN A 1 15  ? -10.176 5.882   11.410  1.00 15.00 ?  57  ASN A HB3  3  
ATOM   6948   H  HD21 . ASN A 1 15  ? -10.695 7.789   13.385  1.00 15.00 ?  57  ASN A HD21 3  
ATOM   6949   H  HD22 . ASN A 1 15  ? -12.407 8.004   13.491  1.00 15.00 ?  57  ASN A HD22 3  
ATOM   6950   N  N    . VAL A 1 16  ? -9.178  2.360   11.348  1.00 15.00 ?  58  VAL A N    3  
ATOM   6951   C  CA   . VAL A 1 16  ? -8.298  1.809   10.318  1.00 15.00 ?  58  VAL A CA   3  
ATOM   6952   C  C    . VAL A 1 16  ? -8.418  0.291   10.209  1.00 15.00 ?  58  VAL A C    3  
ATOM   6953   O  O    . VAL A 1 16  ? -8.208  -0.438  11.182  1.00 15.00 ?  58  VAL A O    3  
ATOM   6954   C  CB   . VAL A 1 16  ? -6.816  2.166   10.576  1.00 15.00 ?  58  VAL A CB   3  
ATOM   6955   C  CG1  . VAL A 1 16  ? -5.938  1.677   9.432   1.00 15.00 ?  58  VAL A CG1  3  
ATOM   6956   C  CG2  . VAL A 1 16  ? -6.642  3.664   10.778  1.00 15.00 ?  58  VAL A CG2  3  
ATOM   6957   H  H    . VAL A 1 16  ? -9.255  1.904   12.216  1.00 15.00 ?  58  VAL A H    3  
ATOM   6958   H  HA   . VAL A 1 16  ? -8.587  2.248   9.376   1.00 15.00 ?  58  VAL A HA   3  
ATOM   6959   H  HB   . VAL A 1 16  ? -6.502  1.663   11.477  1.00 15.00 ?  58  VAL A HB   3  
ATOM   6960   H  HG11 . VAL A 1 16  ? -6.278  2.117   8.505   1.00 15.00 ?  58  VAL A HG11 3  
ATOM   6961   H  HG12 . VAL A 1 16  ? -6.000  0.601   9.365   1.00 15.00 ?  58  VAL A HG12 3  
ATOM   6962   H  HG13 . VAL A 1 16  ? -4.916  1.968   9.615   1.00 15.00 ?  58  VAL A HG13 3  
ATOM   6963   H  HG21 . VAL A 1 16  ? -6.825  4.178   9.845   1.00 15.00 ?  58  VAL A HG21 3  
ATOM   6964   H  HG22 . VAL A 1 16  ? -5.634  3.866   11.109  1.00 15.00 ?  58  VAL A HG22 3  
ATOM   6965   H  HG23 . VAL A 1 16  ? -7.343  4.010   11.524  1.00 15.00 ?  58  VAL A HG23 3  
ATOM   6966   N  N    . TRP A 1 17  ? -8.736  -0.171  9.009   1.00 15.00 ?  59  TRP A N    3  
ATOM   6967   C  CA   . TRP A 1 17  ? -8.874  -1.591  8.731   1.00 15.00 ?  59  TRP A CA   3  
ATOM   6968   C  C    . TRP A 1 17  ? -7.819  -2.030  7.722   1.00 15.00 ?  59  TRP A C    3  
ATOM   6969   O  O    . TRP A 1 17  ? -7.337  -1.218  6.930   1.00 15.00 ?  59  TRP A O    3  
ATOM   6970   C  CB   . TRP A 1 17  ? -10.261 -1.897  8.165   1.00 15.00 ?  59  TRP A CB   3  
ATOM   6971   C  CG   . TRP A 1 17  ? -11.355 -1.882  9.185   1.00 15.00 ?  59  TRP A CG   3  
ATOM   6972   C  CD1  . TRP A 1 17  ? -11.815 -2.944  9.912   1.00 15.00 ?  59  TRP A CD1  3  
ATOM   6973   C  CD2  . TRP A 1 17  ? -12.145 -0.754  9.578   1.00 15.00 ?  59  TRP A CD2  3  
ATOM   6974   N  NE1  . TRP A 1 17  ? -12.846 -2.542  10.728  1.00 15.00 ?  59  TRP A NE1  3  
ATOM   6975   C  CE2  . TRP A 1 17  ? -13.062 -1.203  10.544  1.00 15.00 ?  59  TRP A CE2  3  
ATOM   6976   C  CE3  . TRP A 1 17  ? -12.165 0.595   9.206   1.00 15.00 ?  59  TRP A CE3  3  
ATOM   6977   C  CZ2  . TRP A 1 17  ? -13.990 -0.355  11.144  1.00 15.00 ?  59  TRP A CZ2  3  
ATOM   6978   C  CZ3  . TRP A 1 17  ? -13.086 1.435   9.801   1.00 15.00 ?  59  TRP A CZ3  3  
ATOM   6979   C  CH2  . TRP A 1 17  ? -13.988 0.957   10.762  1.00 15.00 ?  59  TRP A CH2  3  
ATOM   6980   H  H    . TRP A 1 17  ? -8.879  0.474   8.275   1.00 15.00 ?  59  TRP A H    3  
ATOM   6981   H  HA   . TRP A 1 17  ? -8.734  -2.135  9.653   1.00 15.00 ?  59  TRP A HA   3  
ATOM   6982   H  HB2  . TRP A 1 17  ? -10.501 -1.163  7.412   1.00 15.00 ?  59  TRP A HB2  3  
ATOM   6983   H  HB3  . TRP A 1 17  ? -10.245 -2.879  7.709   1.00 15.00 ?  59  TRP A HB3  3  
ATOM   6984   H  HD1  . TRP A 1 17  ? -11.425 -3.949  9.840   1.00 15.00 ?  59  TRP A HD1  3  
ATOM   6985   H  HE1  . TRP A 1 17  ? -13.345 -3.123  11.344  1.00 15.00 ?  59  TRP A HE1  3  
ATOM   6986   H  HE3  . TRP A 1 17  ? -11.476 0.982   8.470   1.00 15.00 ?  59  TRP A HE3  3  
ATOM   6987   H  HZ2  . TRP A 1 17  ? -14.690 -0.708  11.892  1.00 15.00 ?  59  TRP A HZ2  3  
ATOM   6988   H  HZ3  . TRP A 1 17  ? -13.119 2.480   9.525   1.00 15.00 ?  59  TRP A HZ3  3  
ATOM   6989   H  HH2  . TRP A 1 17  ? -14.691 1.648   11.199  1.00 15.00 ?  59  TRP A HH2  3  
ATOM   6990   N  N    . GLN A 1 18  ? -7.468  -3.302  7.752   1.00 15.00 ?  60  GLN A N    3  
ATOM   6991   C  CA   . GLN A 1 18  ? -6.487  -3.857  6.829   1.00 15.00 ?  60  GLN A CA   3  
ATOM   6992   C  C    . GLN A 1 18  ? -7.117  -4.988  6.033   1.00 15.00 ?  60  GLN A C    3  
ATOM   6993   O  O    . GLN A 1 18  ? -7.708  -5.902  6.613   1.00 15.00 ?  60  GLN A O    3  
ATOM   6994   C  CB   . GLN A 1 18  ? -5.261  -4.376  7.589   1.00 15.00 ?  60  GLN A CB   3  
ATOM   6995   C  CG   . GLN A 1 18  ? -4.210  -5.006  6.685   1.00 15.00 ?  60  GLN A CG   3  
ATOM   6996   C  CD   . GLN A 1 18  ? -3.341  -6.011  7.412   1.00 15.00 ?  60  GLN A CD   3  
ATOM   6997   O  OE1  . GLN A 1 18  ? -2.309  -5.659  7.978   1.00 15.00 ?  60  GLN A OE1  3  
ATOM   6998   N  NE2  . GLN A 1 18  ? -3.750  -7.270  7.388   1.00 15.00 ?  60  GLN A NE2  3  
ATOM   6999   H  H    . GLN A 1 18  ? -7.881  -3.895  8.419   1.00 15.00 ?  60  GLN A H    3  
ATOM   7000   H  HA   . GLN A 1 18  ? -6.183  -3.074  6.150   1.00 15.00 ?  60  GLN A HA   3  
ATOM   7001   H  HB2  . GLN A 1 18  ? -4.803  -3.554  8.117   1.00 15.00 ?  60  GLN A HB2  3  
ATOM   7002   H  HB3  . GLN A 1 18  ? -5.581  -5.120  8.305   1.00 15.00 ?  60  GLN A HB3  3  
ATOM   7003   H  HG2  . GLN A 1 18  ? -4.712  -5.513  5.871   1.00 15.00 ?  60  GLN A HG2  3  
ATOM   7004   H  HG3  . GLN A 1 18  ? -3.578  -4.224  6.292   1.00 15.00 ?  60  GLN A HG3  3  
ATOM   7005   H  HE21 . GLN A 1 18  ? -4.576  -7.478  6.904   1.00 15.00 ?  60  GLN A HE21 3  
ATOM   7006   H  HE22 . GLN A 1 18  ? -3.210  -7.939  7.858   1.00 15.00 ?  60  GLN A HE22 3  
ATOM   7007   N  N    . HIS A 1 19  ? -7.008  -4.921  4.713   1.00 15.00 ?  61  HIS A N    3  
ATOM   7008   C  CA   . HIS A 1 19  ? -7.562  -5.957  3.859   1.00 15.00 ?  61  HIS A CA   3  
ATOM   7009   C  C    . HIS A 1 19  ? -6.442  -6.843  3.329   1.00 15.00 ?  61  HIS A C    3  
ATOM   7010   O  O    . HIS A 1 19  ? -5.327  -6.373  3.093   1.00 15.00 ?  61  HIS A O    3  
ATOM   7011   C  CB   . HIS A 1 19  ? -8.397  -5.359  2.709   1.00 15.00 ?  61  HIS A CB   3  
ATOM   7012   C  CG   . HIS A 1 19  ? -7.618  -4.653  1.632   1.00 15.00 ?  61  HIS A CG   3  
ATOM   7013   N  ND1  . HIS A 1 19  ? -6.994  -5.345  0.619   1.00 15.00 ?  61  HIS A ND1  3  
ATOM   7014   C  CD2  . HIS A 1 19  ? -7.432  -3.324  1.436   1.00 15.00 ?  61  HIS A CD2  3  
ATOM   7015   C  CE1  . HIS A 1 19  ? -6.450  -4.432  -0.165  1.00 15.00 ?  61  HIS A CE1  3  
ATOM   7016   N  NE2  . HIS A 1 19  ? -6.691  -3.195  0.289   1.00 15.00 ?  61  HIS A NE2  3  
ATOM   7017   H  H    . HIS A 1 19  ? -6.529  -4.168  4.304   1.00 15.00 ?  61  HIS A H    3  
ATOM   7018   H  HA   . HIS A 1 19  ? -8.210  -6.563  4.476   1.00 15.00 ?  61  HIS A HA   3  
ATOM   7019   H  HB2  . HIS A 1 19  ? -8.949  -6.152  2.235   1.00 15.00 ?  61  HIS A HB2  3  
ATOM   7020   H  HB3  . HIS A 1 19  ? -9.096  -4.648  3.125   1.00 15.00 ?  61  HIS A HB3  3  
ATOM   7021   H  HD2  . HIS A 1 19  ? -7.798  -2.521  2.060   1.00 15.00 ?  61  HIS A HD2  3  
ATOM   7022   H  HE1  . HIS A 1 19  ? -5.882  -4.654  -1.055  1.00 15.00 ?  61  HIS A HE1  3  
ATOM   7023   H  HE2  . HIS A 1 19  ? -6.398  -2.351  -0.125  1.00 15.00 ?  61  HIS A HE2  3  
ATOM   7024   N  N    . THR A 1 20  ? -6.737  -8.121  3.174   1.00 15.00 ?  62  THR A N    3  
ATOM   7025   C  CA   . THR A 1 20  ? -5.763  -9.082  2.688   1.00 15.00 ?  62  THR A CA   3  
ATOM   7026   C  C    . THR A 1 20  ? -6.336  -9.928  1.550   1.00 15.00 ?  62  THR A C    3  
ATOM   7027   O  O    . THR A 1 20  ? -7.263  -10.715 1.752   1.00 15.00 ?  62  THR A O    3  
ATOM   7028   C  CB   . THR A 1 20  ? -5.298  -10.009 3.834   1.00 15.00 ?  62  THR A CB   3  
ATOM   7029   O  OG1  . THR A 1 20  ? -4.806  -9.226  4.932   1.00 15.00 ?  62  THR A OG1  3  
ATOM   7030   C  CG2  . THR A 1 20  ? -4.210  -10.962 3.357   1.00 15.00 ?  62  THR A CG2  3  
ATOM   7031   H  H    . THR A 1 20  ? -7.636  -8.433  3.411   1.00 15.00 ?  62  THR A H    3  
ATOM   7032   H  HA   . THR A 1 20  ? -4.906  -8.535  2.323   1.00 15.00 ?  62  THR A HA   3  
ATOM   7033   H  HB   . THR A 1 20  ? -6.143  -10.592 4.168   1.00 15.00 ?  62  THR A HB   3  
ATOM   7034   H  HG1  . THR A 1 20  ? -4.037  -8.716  4.635   1.00 15.00 ?  62  THR A HG1  3  
ATOM   7035   H  HG21 . THR A 1 20  ? -4.662  -11.804 2.855   1.00 15.00 ?  62  THR A HG21 3  
ATOM   7036   H  HG22 . THR A 1 20  ? -3.640  -11.309 4.204   1.00 15.00 ?  62  THR A HG22 3  
ATOM   7037   H  HG23 . THR A 1 20  ? -3.556  -10.443 2.673   1.00 15.00 ?  62  THR A HG23 3  
ATOM   7038   N  N    . SER A 1 21  ? -5.787  -9.749  0.356   1.00 15.00 ?  63  SER A N    3  
ATOM   7039   C  CA   . SER A 1 21  ? -6.215  -10.501 -0.813  1.00 15.00 ?  63  SER A CA   3  
ATOM   7040   C  C    . SER A 1 21  ? -5.251  -11.661 -1.048  1.00 15.00 ?  63  SER A C    3  
ATOM   7041   O  O    . SER A 1 21  ? -4.129  -11.639 -0.547  1.00 15.00 ?  63  SER A O    3  
ATOM   7042   C  CB   . SER A 1 21  ? -6.273  -9.585  -2.039  1.00 15.00 ?  63  SER A CB   3  
ATOM   7043   O  OG   . SER A 1 21  ? -5.187  -8.671  -2.049  1.00 15.00 ?  63  SER A OG   3  
ATOM   7044   H  H    . SER A 1 21  ? -5.060  -9.095  0.260   1.00 15.00 ?  63  SER A H    3  
ATOM   7045   H  HA   . SER A 1 21  ? -7.199  -10.900 -0.616  1.00 15.00 ?  63  SER A HA   3  
ATOM   7046   H  HB2  . SER A 1 21  ? -6.234  -10.183 -2.937  1.00 15.00 ?  63  SER A HB2  3  
ATOM   7047   H  HB3  . SER A 1 21  ? -7.197  -9.026  -2.022  1.00 15.00 ?  63  SER A HB3  3  
ATOM   7048   H  HG   . SER A 1 21  ? -5.372  -7.946  -1.446  1.00 15.00 ?  63  SER A HG   3  
ATOM   7049   N  N    . TYR A 1 22  ? -5.683  -12.670 -1.793  1.00 15.00 ?  64  TYR A N    3  
ATOM   7050   C  CA   . TYR A 1 22  ? -4.841  -13.833 -2.064  1.00 15.00 ?  64  TYR A CA   3  
ATOM   7051   C  C    . TYR A 1 22  ? -4.816  -14.151 -3.554  1.00 15.00 ?  64  TYR A C    3  
ATOM   7052   O  O    . TYR A 1 22  ? -5.827  -14.010 -4.235  1.00 15.00 ?  64  TYR A O    3  
ATOM   7053   C  CB   . TYR A 1 22  ? -5.351  -15.053 -1.288  1.00 15.00 ?  64  TYR A CB   3  
ATOM   7054   C  CG   . TYR A 1 22  ? -4.925  -15.086 0.166   1.00 15.00 ?  64  TYR A CG   3  
ATOM   7055   C  CD1  . TYR A 1 22  ? -5.679  -14.455 1.146   1.00 15.00 ?  64  TYR A CD1  3  
ATOM   7056   C  CD2  . TYR A 1 22  ? -3.775  -15.759 0.554   1.00 15.00 ?  64  TYR A CD2  3  
ATOM   7057   C  CE1  . TYR A 1 22  ? -5.293  -14.489 2.473   1.00 15.00 ?  64  TYR A CE1  3  
ATOM   7058   C  CE2  . TYR A 1 22  ? -3.383  -15.801 1.878   1.00 15.00 ?  64  TYR A CE2  3  
ATOM   7059   C  CZ   . TYR A 1 22  ? -4.147  -15.164 2.835   1.00 15.00 ?  64  TYR A CZ   3  
ATOM   7060   O  OH   . TYR A 1 22  ? -3.760  -15.195 4.157   1.00 15.00 ?  64  TYR A OH   3  
ATOM   7061   H  H    . TYR A 1 22  ? -6.584  -12.633 -2.182  1.00 15.00 ?  64  TYR A H    3  
ATOM   7062   H  HA   . TYR A 1 22  ? -3.839  -13.603 -1.740  1.00 15.00 ?  64  TYR A HA   3  
ATOM   7063   H  HB2  . TYR A 1 22  ? -6.430  -15.061 -1.315  1.00 15.00 ?  64  TYR A HB2  3  
ATOM   7064   H  HB3  . TYR A 1 22  ? -4.982  -15.951 -1.764  1.00 15.00 ?  64  TYR A HB3  3  
ATOM   7065   H  HD1  . TYR A 1 22  ? -6.577  -13.930 0.858   1.00 15.00 ?  64  TYR A HD1  3  
ATOM   7066   H  HD2  . TYR A 1 22  ? -3.180  -16.256 -0.200  1.00 15.00 ?  64  TYR A HD2  3  
ATOM   7067   H  HE1  . TYR A 1 22  ? -5.890  -13.990 3.218   1.00 15.00 ?  64  TYR A HE1  3  
ATOM   7068   H  HE2  . TYR A 1 22  ? -2.485  -16.333 2.157   1.00 15.00 ?  64  TYR A HE2  3  
ATOM   7069   H  HH   . TYR A 1 22  ? -2.842  -14.907 4.225   1.00 15.00 ?  64  TYR A HH   3  
ATOM   7070   N  N    . LEU A 1 23  ? -3.661  -14.565 -4.058  1.00 15.00 ?  65  LEU A N    3  
ATOM   7071   C  CA   . LEU A 1 23  ? -3.528  -14.914 -5.465  1.00 15.00 ?  65  LEU A CA   3  
ATOM   7072   C  C    . LEU A 1 23  ? -2.988  -16.327 -5.610  1.00 15.00 ?  65  LEU A C    3  
ATOM   7073   O  O    . LEU A 1 23  ? -1.914  -16.645 -5.096  1.00 15.00 ?  65  LEU A O    3  
ATOM   7074   C  CB   . LEU A 1 23  ? -2.604  -13.936 -6.194  1.00 15.00 ?  65  LEU A CB   3  
ATOM   7075   C  CG   . LEU A 1 23  ? -2.545  -14.123 -7.713  1.00 15.00 ?  65  LEU A CG   3  
ATOM   7076   C  CD1  . LEU A 1 23  ? -3.825  -13.621 -8.364  1.00 15.00 ?  65  LEU A CD1  3  
ATOM   7077   C  CD2  . LEU A 1 23  ? -1.331  -13.413 -8.294  1.00 15.00 ?  65  LEU A CD2  3  
ATOM   7078   H  H    . LEU A 1 23  ? -2.875  -14.634 -3.474  1.00 15.00 ?  65  LEU A H    3  
ATOM   7079   H  HA   . LEU A 1 23  ? -4.513  -14.868 -5.911  1.00 15.00 ?  65  LEU A HA   3  
ATOM   7080   H  HB2  . LEU A 1 23  ? -2.941  -12.930 -5.989  1.00 15.00 ?  65  LEU A HB2  3  
ATOM   7081   H  HB3  . LEU A 1 23  ? -1.604  -14.049 -5.800  1.00 15.00 ?  65  LEU A HB3  3  
ATOM   7082   H  HG   . LEU A 1 23  ? -2.452  -15.177 -7.936  1.00 15.00 ?  65  LEU A HG   3  
ATOM   7083   H  HD11 . LEU A 1 23  ? -3.928  -12.562 -8.179  1.00 15.00 ?  65  LEU A HD11 3  
ATOM   7084   H  HD12 . LEU A 1 23  ? -4.671  -14.141 -7.941  1.00 15.00 ?  65  LEU A HD12 3  
ATOM   7085   H  HD13 . LEU A 1 23  ? -3.785  -13.801 -9.428  1.00 15.00 ?  65  LEU A HD13 3  
ATOM   7086   H  HD21 . LEU A 1 23  ? -0.440  -13.971 -8.055  1.00 15.00 ?  65  LEU A HD21 3  
ATOM   7087   H  HD22 . LEU A 1 23  ? -1.258  -12.422 -7.870  1.00 15.00 ?  65  LEU A HD22 3  
ATOM   7088   H  HD23 . LEU A 1 23  ? -1.435  -13.338 -9.367  1.00 15.00 ?  65  LEU A HD23 3  
ATOM   7089   N  N    . ASP A 1 24  ? -3.739  -17.171 -6.301  1.00 15.00 ?  66  ASP A N    3  
ATOM   7090   C  CA   . ASP A 1 24  ? -3.338  -18.554 -6.519  1.00 15.00 ?  66  ASP A CA   3  
ATOM   7091   C  C    . ASP A 1 24  ? -2.259  -18.632 -7.593  1.00 15.00 ?  66  ASP A C    3  
ATOM   7092   O  O    . ASP A 1 24  ? -2.561  -18.642 -8.787  1.00 15.00 ?  66  ASP A O    3  
ATOM   7093   C  CB   . ASP A 1 24  ? -4.543  -19.396 -6.938  1.00 15.00 ?  66  ASP A CB   3  
ATOM   7094   C  CG   . ASP A 1 24  ? -4.371  -20.871 -6.617  1.00 15.00 ?  66  ASP A CG   3  
ATOM   7095   O  OD1  . ASP A 1 24  ? -3.577  -21.556 -7.299  1.00 15.00 ?  66  ASP A OD1  3  
ATOM   7096   O  OD2  . ASP A 1 24  ? -5.035  -21.358 -5.675  1.00 15.00 -1 66  ASP A OD2  3  
ATOM   7097   H  H    . ASP A 1 24  ? -4.590  -16.854 -6.674  1.00 15.00 ?  66  ASP A H    3  
ATOM   7098   H  HA   . ASP A 1 24  ? -2.943  -18.940 -5.593  1.00 15.00 ?  66  ASP A HA   3  
ATOM   7099   H  HB2  . ASP A 1 24  ? -5.420  -19.036 -6.421  1.00 15.00 ?  66  ASP A HB2  3  
ATOM   7100   H  HB3  . ASP A 1 24  ? -4.689  -19.294 -8.001  1.00 15.00 ?  66  ASP A HB3  3  
ATOM   7101   N  N    . MET A 1 25  ? -1.008  -18.666 -7.160  1.00 15.00 ?  67  MET A N    3  
ATOM   7102   C  CA   . MET A 1 25  ? 0.120   -18.740 -8.082  1.00 15.00 ?  67  MET A CA   3  
ATOM   7103   C  C    . MET A 1 25  ? 0.418   -20.198 -8.424  1.00 15.00 ?  67  MET A C    3  
ATOM   7104   O  O    . MET A 1 25  ? -0.003  -21.099 -7.698  1.00 15.00 ?  67  MET A O    3  
ATOM   7105   C  CB   . MET A 1 25  ? 1.350   -18.071 -7.467  1.00 15.00 ?  67  MET A CB   3  
ATOM   7106   C  CG   . MET A 1 25  ? 1.224   -16.559 -7.343  1.00 15.00 ?  67  MET A CG   3  
ATOM   7107   S  SD   . MET A 1 25  ? 2.820   -15.731 -7.173  1.00 15.00 ?  67  MET A SD   3  
ATOM   7108   C  CE   . MET A 1 25  ? 3.536   -16.042 -8.784  1.00 15.00 ?  67  MET A CE   3  
ATOM   7109   H  H    . MET A 1 25  ? -0.837  -18.651 -6.191  1.00 15.00 ?  67  MET A H    3  
ATOM   7110   H  HA   . MET A 1 25  ? -0.156  -18.217 -8.985  1.00 15.00 ?  67  MET A HA   3  
ATOM   7111   H  HB2  . MET A 1 25  ? 1.504   -18.477 -6.477  1.00 15.00 ?  67  MET A HB2  3  
ATOM   7112   H  HB3  . MET A 1 25  ? 2.212   -18.295 -8.076  1.00 15.00 ?  67  MET A HB3  3  
ATOM   7113   H  HG2  . MET A 1 25  ? 0.732   -16.177 -8.226  1.00 15.00 ?  67  MET A HG2  3  
ATOM   7114   H  HG3  . MET A 1 25  ? 0.625   -16.331 -6.474  1.00 15.00 ?  67  MET A HG3  3  
ATOM   7115   H  HE1  . MET A 1 25  ? 2.782   -15.904 -9.543  1.00 15.00 ?  67  MET A HE1  3  
ATOM   7116   H  HE2  . MET A 1 25  ? 3.905   -17.054 -8.824  1.00 15.00 ?  67  MET A HE2  3  
ATOM   7117   H  HE3  . MET A 1 25  ? 4.350   -15.354 -8.956  1.00 15.00 ?  67  MET A HE3  3  
ATOM   7118   N  N    . PRO A 1 26  ? 1.117   -20.456 -9.548  1.00 15.00 ?  68  PRO A N    3  
ATOM   7119   C  CA   . PRO A 1 26  ? 1.462   -21.818 -9.965  1.00 15.00 ?  68  PRO A CA   3  
ATOM   7120   C  C    . PRO A 1 26  ? 2.157   -22.600 -8.856  1.00 15.00 ?  68  PRO A C    3  
ATOM   7121   O  O    . PRO A 1 26  ? 3.234   -22.219 -8.387  1.00 15.00 ?  68  PRO A O    3  
ATOM   7122   C  CB   . PRO A 1 26  ? 2.407   -21.608 -11.148 1.00 15.00 ?  68  PRO A CB   3  
ATOM   7123   C  CG   . PRO A 1 26  ? 2.051   -20.270 -11.687 1.00 15.00 ?  68  PRO A CG   3  
ATOM   7124   C  CD   . PRO A 1 26  ? 1.615   -19.447 -10.505 1.00 15.00 ?  68  PRO A CD   3  
ATOM   7125   H  HA   . PRO A 1 26  ? 0.589   -22.362 -10.292 1.00 15.00 ?  68  PRO A HA   3  
ATOM   7126   H  HB2  . PRO A 1 26  ? 3.435   -21.632 -10.809 1.00 15.00 ?  68  PRO A HB2  3  
ATOM   7127   H  HB3  . PRO A 1 26  ? 2.242   -22.366 -11.895 1.00 15.00 ?  68  PRO A HB3  3  
ATOM   7128   H  HG2  . PRO A 1 26  ? 2.917   -19.824 -12.160 1.00 15.00 ?  68  PRO A HG2  3  
ATOM   7129   H  HG3  . PRO A 1 26  ? 1.239   -20.360 -12.392 1.00 15.00 ?  68  PRO A HG3  3  
ATOM   7130   H  HD2  . PRO A 1 26  ? 2.454   -18.904 -10.091 1.00 15.00 ?  68  PRO A HD2  3  
ATOM   7131   H  HD3  . PRO A 1 26  ? 0.828   -18.768 -10.789 1.00 15.00 ?  68  PRO A HD3  3  
ATOM   7132   N  N    . GLY A 1 27  ? 1.529   -23.687 -8.441  1.00 15.00 ?  69  GLY A N    3  
ATOM   7133   C  CA   . GLY A 1 27  ? 2.079   -24.500 -7.383  1.00 15.00 ?  69  GLY A CA   3  
ATOM   7134   C  C    . GLY A 1 27  ? 1.052   -24.762 -6.308  1.00 15.00 ?  69  GLY A C    3  
ATOM   7135   O  O    . GLY A 1 27  ? -0.072  -25.168 -6.610  1.00 15.00 ?  69  GLY A O    3  
ATOM   7136   H  H    . GLY A 1 27  ? 0.674   -23.936 -8.852  1.00 15.00 ?  69  GLY A H    3  
ATOM   7137   H  HA2  . GLY A 1 27  ? 2.410   -25.440 -7.796  1.00 15.00 ?  69  GLY A HA2  3  
ATOM   7138   H  HA3  . GLY A 1 27  ? 2.922   -23.986 -6.945  1.00 15.00 ?  69  GLY A HA3  3  
ATOM   7139   N  N    . PHE A 1 28  ? 1.424   -24.519 -5.056  1.00 15.00 ?  70  PHE A N    3  
ATOM   7140   C  CA   . PHE A 1 28  ? 0.519   -24.729 -3.933  1.00 15.00 ?  70  PHE A CA   3  
ATOM   7141   C  C    . PHE A 1 28  ? 0.685   -23.625 -2.893  1.00 15.00 ?  70  PHE A C    3  
ATOM   7142   O  O    . PHE A 1 28  ? 1.007   -23.892 -1.734  1.00 15.00 ?  70  PHE A O    3  
ATOM   7143   C  CB   . PHE A 1 28  ? 0.767   -26.094 -3.281  1.00 15.00 ?  70  PHE A CB   3  
ATOM   7144   C  CG   . PHE A 1 28  ? 0.203   -27.250 -4.052  1.00 15.00 ?  70  PHE A CG   3  
ATOM   7145   C  CD1  . PHE A 1 28  ? -1.134  -27.591 -3.934  1.00 15.00 ?  70  PHE A CD1  3  
ATOM   7146   C  CD2  . PHE A 1 28  ? 1.010   -27.998 -4.893  1.00 15.00 ?  70  PHE A CD2  3  
ATOM   7147   C  CE1  . PHE A 1 28  ? -1.657  -28.655 -4.642  1.00 15.00 ?  70  PHE A CE1  3  
ATOM   7148   C  CE2  . PHE A 1 28  ? 0.494   -29.062 -5.604  1.00 15.00 ?  70  PHE A CE2  3  
ATOM   7149   C  CZ   . PHE A 1 28  ? -0.841  -29.393 -5.480  1.00 15.00 ?  70  PHE A CZ   3  
ATOM   7150   H  H    . PHE A 1 28  ? 2.332   -24.191 -4.881  1.00 15.00 ?  70  PHE A H    3  
ATOM   7151   H  HA   . PHE A 1 28  ? -0.491  -24.700 -4.313  1.00 15.00 ?  70  PHE A HA   3  
ATOM   7152   H  HB2  . PHE A 1 28  ? 1.829   -26.251 -3.182  1.00 15.00 ?  70  PHE A HB2  3  
ATOM   7153   H  HB3  . PHE A 1 28  ? 0.314   -26.100 -2.300  1.00 15.00 ?  70  PHE A HB3  3  
ATOM   7154   H  HD1  . PHE A 1 28  ? -1.773  -27.011 -3.283  1.00 15.00 ?  70  PHE A HD1  3  
ATOM   7155   H  HD2  . PHE A 1 28  ? 2.056   -27.741 -4.987  1.00 15.00 ?  70  PHE A HD2  3  
ATOM   7156   H  HE1  . PHE A 1 28  ? -2.701  -28.911 -4.540  1.00 15.00 ?  70  PHE A HE1  3  
ATOM   7157   H  HE2  . PHE A 1 28  ? 1.135   -29.632 -6.259  1.00 15.00 ?  70  PHE A HE2  3  
ATOM   7158   H  HZ   . PHE A 1 28  ? -1.246  -30.223 -6.035  1.00 15.00 ?  70  PHE A HZ   3  
ATOM   7159   N  N    . GLY A 1 29  ? 0.463   -22.387 -3.307  1.00 15.00 ?  71  GLY A N    3  
ATOM   7160   C  CA   . GLY A 1 29  ? 0.600   -21.268 -2.402  1.00 15.00 ?  71  GLY A CA   3  
ATOM   7161   C  C    . GLY A 1 29  ? -0.097  -20.033 -2.916  1.00 15.00 ?  71  GLY A C    3  
ATOM   7162   O  O    . GLY A 1 29  ? 0.008   -19.699 -4.100  1.00 15.00 ?  71  GLY A O    3  
ATOM   7163   H  H    . GLY A 1 29  ? 0.188   -22.231 -4.236  1.00 15.00 ?  71  GLY A H    3  
ATOM   7164   H  HA2  . GLY A 1 29  ? 0.177   -21.538 -1.444  1.00 15.00 ?  71  GLY A HA2  3  
ATOM   7165   H  HA3  . GLY A 1 29  ? 1.649   -21.048 -2.269  1.00 15.00 ?  71  GLY A HA3  3  
ATOM   7166   N  N    . ALA A 1 30  ? -0.832  -19.372 -2.037  1.00 15.00 ?  72  ALA A N    3  
ATOM   7167   C  CA   . ALA A 1 30  ? -1.542  -18.158 -2.395  1.00 15.00 ?  72  ALA A CA   3  
ATOM   7168   C  C    . ALA A 1 30  ? -0.851  -16.949 -1.789  1.00 15.00 ?  72  ALA A C    3  
ATOM   7169   O  O    . ALA A 1 30  ? -0.851  -16.764 -0.570  1.00 15.00 ?  72  ALA A O    3  
ATOM   7170   C  CB   . ALA A 1 30  ? -2.986  -18.226 -1.932  1.00 15.00 ?  72  ALA A CB   3  
ATOM   7171   H  H    . ALA A 1 30  ? -0.902  -19.713 -1.120  1.00 15.00 ?  72  ALA A H    3  
ATOM   7172   H  HA   . ALA A 1 30  ? -1.531  -18.065 -3.471  1.00 15.00 ?  72  ALA A HA   3  
ATOM   7173   H  HB1  . ALA A 1 30  ? -3.470  -17.283 -2.121  1.00 15.00 ?  72  ALA A HB1  3  
ATOM   7174   H  HB2  . ALA A 1 30  ? -3.014  -18.440 -0.875  1.00 15.00 ?  72  ALA A HB2  3  
ATOM   7175   H  HB3  . ALA A 1 30  ? -3.500  -19.005 -2.471  1.00 15.00 ?  72  ALA A HB3  3  
ATOM   7176   N  N    . VAL A 1 31  ? -0.251  -16.136 -2.640  1.00 15.00 ?  73  VAL A N    3  
ATOM   7177   C  CA   . VAL A 1 31  ? 0.437   -14.945 -2.181  1.00 15.00 ?  73  VAL A CA   3  
ATOM   7178   C  C    . VAL A 1 31  ? -0.583  -13.888 -1.786  1.00 15.00 ?  73  VAL A C    3  
ATOM   7179   O  O    . VAL A 1 31  ? -1.483  -13.556 -2.556  1.00 15.00 ?  73  VAL A O    3  
ATOM   7180   C  CB   . VAL A 1 31  ? 1.397   -14.389 -3.252  1.00 15.00 ?  73  VAL A CB   3  
ATOM   7181   C  CG1  . VAL A 1 31  ? 2.175   -13.201 -2.711  1.00 15.00 ?  73  VAL A CG1  3  
ATOM   7182   C  CG2  . VAL A 1 31  ? 2.349   -15.473 -3.725  1.00 15.00 ?  73  VAL A CG2  3  
ATOM   7183   H  H    . VAL A 1 31  ? -0.284  -16.334 -3.599  1.00 15.00 ?  73  VAL A H    3  
ATOM   7184   H  HA   . VAL A 1 31  ? 1.014   -15.213 -1.308  1.00 15.00 ?  73  VAL A HA   3  
ATOM   7185   H  HB   . VAL A 1 31  ? 0.810   -14.060 -4.098  1.00 15.00 ?  73  VAL A HB   3  
ATOM   7186   H  HG11 . VAL A 1 31  ? 2.875   -12.861 -3.461  1.00 15.00 ?  73  VAL A HG11 3  
ATOM   7187   H  HG12 . VAL A 1 31  ? 2.714   -13.503 -1.824  1.00 15.00 ?  73  VAL A HG12 3  
ATOM   7188   H  HG13 . VAL A 1 31  ? 1.492   -12.401 -2.464  1.00 15.00 ?  73  VAL A HG13 3  
ATOM   7189   H  HG21 . VAL A 1 31  ? 3.137   -15.028 -4.315  1.00 15.00 ?  73  VAL A HG21 3  
ATOM   7190   H  HG22 . VAL A 1 31  ? 1.808   -16.187 -4.328  1.00 15.00 ?  73  VAL A HG22 3  
ATOM   7191   H  HG23 . VAL A 1 31  ? 2.778   -15.973 -2.870  1.00 15.00 ?  73  VAL A HG23 3  
ATOM   7192   N  N    . ALA A 1 32  ? -0.447  -13.384 -0.573  1.00 15.00 ?  74  ALA A N    3  
ATOM   7193   C  CA   . ALA A 1 32  ? -1.368  -12.398 -0.043  1.00 15.00 ?  74  ALA A CA   3  
ATOM   7194   C  C    . ALA A 1 32  ? -0.846  -10.977 -0.193  1.00 15.00 ?  74  ALA A C    3  
ATOM   7195   O  O    . ALA A 1 32  ? 0.365   -10.742 -0.216  1.00 15.00 ?  74  ALA A O    3  
ATOM   7196   C  CB   . ALA A 1 32  ? -1.657  -12.702 1.419   1.00 15.00 ?  74  ALA A CB   3  
ATOM   7197   H  H    . ALA A 1 32  ? 0.306   -13.681 -0.018  1.00 15.00 ?  74  ALA A H    3  
ATOM   7198   H  HA   . ALA A 1 32  ? -2.297  -12.485 -0.588  1.00 15.00 ?  74  ALA A HA   3  
ATOM   7199   H  HB1  . ALA A 1 32  ? -0.788  -12.465 2.016   1.00 15.00 ?  74  ALA A HB1  3  
ATOM   7200   H  HB2  . ALA A 1 32  ? -1.891  -13.752 1.526   1.00 15.00 ?  74  ALA A HB2  3  
ATOM   7201   H  HB3  . ALA A 1 32  ? -2.496  -12.111 1.754   1.00 15.00 ?  74  ALA A HB3  3  
ATOM   7202   N  N    . SER A 1 33  ? -1.777  -10.044 -0.306  1.00 15.00 ?  75  SER A N    3  
ATOM   7203   C  CA   . SER A 1 33  ? -1.459  -8.636  -0.432  1.00 15.00 ?  75  SER A CA   3  
ATOM   7204   C  C    . SER A 1 33  ? -2.335  -7.843  0.530   1.00 15.00 ?  75  SER A C    3  
ATOM   7205   O  O    . SER A 1 33  ? -3.560  -7.971  0.508   1.00 15.00 ?  75  SER A O    3  
ATOM   7206   C  CB   . SER A 1 33  ? -1.675  -8.144  -1.864  1.00 15.00 ?  75  SER A CB   3  
ATOM   7207   O  OG   . SER A 1 33  ? -1.093  -6.863  -2.041  1.00 15.00 ?  75  SER A OG   3  
ATOM   7208   H  H    . SER A 1 33  ? -2.723  -10.314 -0.292  1.00 15.00 ?  75  SER A H    3  
ATOM   7209   H  HA   . SER A 1 33  ? -0.422  -8.501  -0.160  1.00 15.00 ?  75  SER A HA   3  
ATOM   7210   H  HB2  . SER A 1 33  ? -1.220  -8.835  -2.557  1.00 15.00 ?  75  SER A HB2  3  
ATOM   7211   H  HB3  . SER A 1 33  ? -2.735  -8.075  -2.063  1.00 15.00 ?  75  SER A HB3  3  
ATOM   7212   H  HG   . SER A 1 33  ? -1.347  -6.510  -2.904  1.00 15.00 ?  75  SER A HG   3  
ATOM   7213   N  N    . ASN A 1 34  ? -1.706  -7.046  1.383   1.00 15.00 ?  76  ASN A N    3  
ATOM   7214   C  CA   . ASN A 1 34  ? -2.431  -6.249  2.367   1.00 15.00 ?  76  ASN A CA   3  
ATOM   7215   C  C    . ASN A 1 34  ? -2.602  -4.809  1.909   1.00 15.00 ?  76  ASN A C    3  
ATOM   7216   O  O    . ASN A 1 34  ? -1.762  -4.258  1.188   1.00 15.00 ?  76  ASN A O    3  
ATOM   7217   C  CB   . ASN A 1 34  ? -1.702  -6.245  3.717   1.00 15.00 ?  76  ASN A CB   3  
ATOM   7218   C  CG   . ASN A 1 34  ? -1.495  -7.631  4.295   1.00 15.00 ?  76  ASN A CG   3  
ATOM   7219   O  OD1  . ASN A 1 34  ? -2.294  -8.538  4.080   1.00 15.00 ?  76  ASN A OD1  3  
ATOM   7220   N  ND2  . ASN A 1 34  ? -0.418  -7.802  5.044   1.00 15.00 ?  76  ASN A ND2  3  
ATOM   7221   H  H    . ASN A 1 34  ? -0.728  -6.998  1.356   1.00 15.00 ?  76  ASN A H    3  
ATOM   7222   H  HA   . ASN A 1 34  ? -3.406  -6.690  2.502   1.00 15.00 ?  76  ASN A HA   3  
ATOM   7223   H  HB2  . ASN A 1 34  ? -0.738  -5.782  3.592   1.00 15.00 ?  76  ASN A HB2  3  
ATOM   7224   H  HB3  . ASN A 1 34  ? -2.280  -5.665  4.422   1.00 15.00 ?  76  ASN A HB3  3  
ATOM   7225   H  HD21 . ASN A 1 34  ? 0.178   -7.033  5.185   1.00 15.00 ?  76  ASN A HD21 3  
ATOM   7226   H  HD22 . ASN A 1 34  ? -0.256  -8.689  5.426   1.00 15.00 ?  76  ASN A HD22 3  
ATOM   7227   N  N    . GLY A 1 35  ? -3.700  -4.215  2.338   1.00 15.00 ?  77  GLY A N    3  
ATOM   7228   C  CA   . GLY A 1 35  ? -4.007  -2.837  2.024   1.00 15.00 ?  77  GLY A CA   3  
ATOM   7229   C  C    . GLY A 1 35  ? -4.634  -2.162  3.227   1.00 15.00 ?  77  GLY A C    3  
ATOM   7230   O  O    . GLY A 1 35  ? -4.962  -2.837  4.204   1.00 15.00 ?  77  GLY A O    3  
ATOM   7231   H  H    . GLY A 1 35  ? -4.334  -4.734  2.883   1.00 15.00 ?  77  GLY A H    3  
ATOM   7232   H  HA2  . GLY A 1 35  ? -3.097  -2.319  1.752   1.00 15.00 ?  77  GLY A HA2  3  
ATOM   7233   H  HA3  . GLY A 1 35  ? -4.701  -2.806  1.199   1.00 15.00 ?  77  GLY A HA3  3  
ATOM   7234   N  N    . LEU A 1 36  ? -4.826  -0.853  3.174   1.00 15.00 ?  78  LEU A N    3  
ATOM   7235   C  CA   . LEU A 1 36  ? -5.402  -0.144  4.309   1.00 15.00 ?  78  LEU A CA   3  
ATOM   7236   C  C    . LEU A 1 36  ? -6.684  0.590   3.948   1.00 15.00 ?  78  LEU A C    3  
ATOM   7237   O  O    . LEU A 1 36  ? -6.791  1.210   2.893   1.00 15.00 ?  78  LEU A O    3  
ATOM   7238   C  CB   . LEU A 1 36  ? -4.389  0.844   4.897   1.00 15.00 ?  78  LEU A CB   3  
ATOM   7239   C  CG   . LEU A 1 36  ? -3.346  0.231   5.837   1.00 15.00 ?  78  LEU A CG   3  
ATOM   7240   C  CD1  . LEU A 1 36  ? -2.466  1.317   6.433   1.00 15.00 ?  78  LEU A CD1  3  
ATOM   7241   C  CD2  . LEU A 1 36  ? -4.020  -0.558  6.947   1.00 15.00 ?  78  LEU A CD2  3  
ATOM   7242   H  H    . LEU A 1 36  ? -4.592  -0.357  2.358   1.00 15.00 ?  78  LEU A H    3  
ATOM   7243   H  HA   . LEU A 1 36  ? -5.637  -0.879  5.061   1.00 15.00 ?  78  LEU A HA   3  
ATOM   7244   H  HB2  . LEU A 1 36  ? -3.866  1.320   4.077   1.00 15.00 ?  78  LEU A HB2  3  
ATOM   7245   H  HB3  . LEU A 1 36  ? -4.931  1.600   5.443   1.00 15.00 ?  78  LEU A HB3  3  
ATOM   7246   H  HG   . LEU A 1 36  ? -2.716  -0.444  5.277   1.00 15.00 ?  78  LEU A HG   3  
ATOM   7247   H  HD11 . LEU A 1 36  ? -1.805  0.879   7.163   1.00 15.00 ?  78  LEU A HD11 3  
ATOM   7248   H  HD12 . LEU A 1 36  ? -3.087  2.061   6.909   1.00 15.00 ?  78  LEU A HD12 3  
ATOM   7249   H  HD13 . LEU A 1 36  ? -1.884  1.779   5.650   1.00 15.00 ?  78  LEU A HD13 3  
ATOM   7250   H  HD21 . LEU A 1 36  ? -3.302  -0.758  7.729   1.00 15.00 ?  78  LEU A HD21 3  
ATOM   7251   H  HD22 . LEU A 1 36  ? -4.392  -1.492  6.552   1.00 15.00 ?  78  LEU A HD22 3  
ATOM   7252   H  HD23 . LEU A 1 36  ? -4.842  0.015   7.351   1.00 15.00 ?  78  LEU A HD23 3  
ATOM   7253   N  N    . ILE A 1 37  ? -7.657  0.490   4.841   1.00 15.00 ?  79  ILE A N    3  
ATOM   7254   C  CA   . ILE A 1 37  ? -8.940  1.155   4.688   1.00 15.00 ?  79  ILE A CA   3  
ATOM   7255   C  C    . ILE A 1 37  ? -9.097  2.149   5.833   1.00 15.00 ?  79  ILE A C    3  
ATOM   7256   O  O    . ILE A 1 37  ? -9.269  1.757   6.988   1.00 15.00 ?  79  ILE A O    3  
ATOM   7257   C  CB   . ILE A 1 37  ? -10.113 0.147   4.696   1.00 15.00 ?  79  ILE A CB   3  
ATOM   7258   C  CG1  . ILE A 1 37  ? -9.928  -0.889  3.584   1.00 15.00 ?  79  ILE A CG1  3  
ATOM   7259   C  CG2  . ILE A 1 37  ? -11.447 0.869   4.543   1.00 15.00 ?  79  ILE A CG2  3  
ATOM   7260   C  CD1  . ILE A 1 37  ? -10.835 -2.088  3.718   1.00 15.00 ?  79  ILE A CD1  3  
ATOM   7261   H  H    . ILE A 1 37  ? -7.506  -0.060  5.645   1.00 15.00 ?  79  ILE A H    3  
ATOM   7262   H  HA   . ILE A 1 37  ? -8.941  1.691   3.748   1.00 15.00 ?  79  ILE A HA   3  
ATOM   7263   H  HB   . ILE A 1 37  ? -10.116 -0.357  5.649   1.00 15.00 ?  79  ILE A HB   3  
ATOM   7264   H  HG12 . ILE A 1 37  ? -10.132 -0.428  2.631   1.00 15.00 ?  79  ILE A HG12 3  
ATOM   7265   H  HG13 . ILE A 1 37  ? -8.907  -1.244  3.596   1.00 15.00 ?  79  ILE A HG13 3  
ATOM   7266   H  HG21 . ILE A 1 37  ? -11.555 1.593   5.338   1.00 15.00 ?  79  ILE A HG21 3  
ATOM   7267   H  HG22 . ILE A 1 37  ? -12.252 0.150   4.600   1.00 15.00 ?  79  ILE A HG22 3  
ATOM   7268   H  HG23 . ILE A 1 37  ? -11.483 1.373   3.589   1.00 15.00 ?  79  ILE A HG23 3  
ATOM   7269   H  HD11 . ILE A 1 37  ? -11.852 -1.792  3.510   1.00 15.00 ?  79  ILE A HD11 3  
ATOM   7270   H  HD12 . ILE A 1 37  ? -10.773 -2.477  4.722   1.00 15.00 ?  79  ILE A HD12 3  
ATOM   7271   H  HD13 . ILE A 1 37  ? -10.530 -2.847  3.018   1.00 15.00 ?  79  ILE A HD13 3  
ATOM   7272   N  N    . VAL A 1 38  ? -9.010  3.428   5.516   1.00 15.00 ?  80  VAL A N    3  
ATOM   7273   C  CA   . VAL A 1 38  ? -9.093  4.464   6.530   1.00 15.00 ?  80  VAL A CA   3  
ATOM   7274   C  C    . VAL A 1 38  ? -10.459 5.138   6.547   1.00 15.00 ?  80  VAL A C    3  
ATOM   7275   O  O    . VAL A 1 38  ? -10.969 5.576   5.517   1.00 15.00 ?  80  VAL A O    3  
ATOM   7276   C  CB   . VAL A 1 38  ? -8.007  5.537   6.315   1.00 15.00 ?  80  VAL A CB   3  
ATOM   7277   C  CG1  . VAL A 1 38  ? -7.981  6.531   7.467   1.00 15.00 ?  80  VAL A CG1  3  
ATOM   7278   C  CG2  . VAL A 1 38  ? -6.643  4.889   6.145   1.00 15.00 ?  80  VAL A CG2  3  
ATOM   7279   H  H    . VAL A 1 38  ? -8.895  3.686   4.572   1.00 15.00 ?  80  VAL A H    3  
ATOM   7280   H  HA   . VAL A 1 38  ? -8.921  4.001   7.490   1.00 15.00 ?  80  VAL A HA   3  
ATOM   7281   H  HB   . VAL A 1 38  ? -8.239  6.077   5.411   1.00 15.00 ?  80  VAL A HB   3  
ATOM   7282   H  HG11 . VAL A 1 38  ? -8.989  6.847   7.692   1.00 15.00 ?  80  VAL A HG11 3  
ATOM   7283   H  HG12 . VAL A 1 38  ? -7.389  7.389   7.185   1.00 15.00 ?  80  VAL A HG12 3  
ATOM   7284   H  HG13 . VAL A 1 38  ? -7.547  6.061   8.338   1.00 15.00 ?  80  VAL A HG13 3  
ATOM   7285   H  HG21 . VAL A 1 38  ? -5.893  5.659   6.035   1.00 15.00 ?  80  VAL A HG21 3  
ATOM   7286   H  HG22 . VAL A 1 38  ? -6.652  4.263   5.265   1.00 15.00 ?  80  VAL A HG22 3  
ATOM   7287   H  HG23 . VAL A 1 38  ? -6.420  4.287   7.014   1.00 15.00 ?  80  VAL A HG23 3  
ATOM   7288   N  N    . ARG A 1 39  ? -11.032 5.231   7.734   1.00 15.00 ?  81  ARG A N    3  
ATOM   7289   C  CA   . ARG A 1 39  ? -12.326 5.866   7.920   1.00 15.00 ?  81  ARG A CA   3  
ATOM   7290   C  C    . ARG A 1 39  ? -12.127 7.269   8.485   1.00 15.00 ?  81  ARG A C    3  
ATOM   7291   O  O    . ARG A 1 39  ? -11.747 7.429   9.646   1.00 15.00 ?  81  ARG A O    3  
ATOM   7292   C  CB   . ARG A 1 39  ? -13.187 5.020   8.865   1.00 15.00 ?  81  ARG A CB   3  
ATOM   7293   C  CG   . ARG A 1 39  ? -14.506 5.665   9.277   1.00 15.00 ?  81  ARG A CG   3  
ATOM   7294   C  CD   . ARG A 1 39  ? -15.433 4.639   9.907   1.00 15.00 ?  81  ARG A CD   3  
ATOM   7295   N  NE   . ARG A 1 39  ? -16.244 5.201   10.986  1.00 15.00 ?  81  ARG A NE   3  
ATOM   7296   C  CZ   . ARG A 1 39  ? -16.278 4.709   12.224  1.00 15.00 ?  81  ARG A CZ   3  
ATOM   7297   N  NH1  . ARG A 1 39  ? -15.548 3.645   12.551  1.00 15.00 1  81  ARG A NH1  3  
ATOM   7298   N  NH2  . ARG A 1 39  ? -17.058 5.279   13.139  1.00 15.00 ?  81  ARG A NH2  3  
ATOM   7299   H  H    . ARG A 1 39  ? -10.564 4.864   8.519   1.00 15.00 ?  81  ARG A H    3  
ATOM   7300   H  HA   . ARG A 1 39  ? -12.807 5.934   6.956   1.00 15.00 ?  81  ARG A HA   3  
ATOM   7301   H  HB2  . ARG A 1 39  ? -13.411 4.083   8.381   1.00 15.00 ?  81  ARG A HB2  3  
ATOM   7302   H  HB3  . ARG A 1 39  ? -12.616 4.822   9.760   1.00 15.00 ?  81  ARG A HB3  3  
ATOM   7303   H  HG2  . ARG A 1 39  ? -14.308 6.446   9.995   1.00 15.00 ?  81  ARG A HG2  3  
ATOM   7304   H  HG3  . ARG A 1 39  ? -14.985 6.086   8.404   1.00 15.00 ?  81  ARG A HG3  3  
ATOM   7305   H  HD2  . ARG A 1 39  ? -16.092 4.252   9.144   1.00 15.00 ?  81  ARG A HD2  3  
ATOM   7306   H  HD3  . ARG A 1 39  ? -14.835 3.835   10.301  1.00 15.00 ?  81  ARG A HD3  3  
ATOM   7307   H  HE   . ARG A 1 39  ? -16.798 5.984   10.773  1.00 15.00 ?  81  ARG A HE   3  
ATOM   7308   H  HH11 . ARG A 1 39  ? -15.584 3.259   13.517  1.00 15.00 ?  81  ARG A HH11 3  
ATOM   7309   H  HH12 . ARG A 1 39  ? -14.940 3.190   11.840  1.00 15.00 ?  81  ARG A HH12 3  
ATOM   7310   H  HH21 . ARG A 1 39  ? -17.089 4.903   14.113  1.00 15.00 ?  81  ARG A HH21 3  
ATOM   7311   H  HH22 . ARG A 1 39  ? -17.645 6.106   12.890  1.00 15.00 ?  81  ARG A HH22 3  
ATOM   7312   N  N    . ASP A 1 40  ? -12.355 8.276   7.658   1.00 15.00 ?  82  ASP A N    3  
ATOM   7313   C  CA   . ASP A 1 40  ? -12.188 9.663   8.071   1.00 15.00 ?  82  ASP A CA   3  
ATOM   7314   C  C    . ASP A 1 40  ? -13.528 10.380  8.099   1.00 15.00 ?  82  ASP A C    3  
ATOM   7315   O  O    . ASP A 1 40  ? -14.071 10.747  7.060   1.00 15.00 ?  82  ASP A O    3  
ATOM   7316   C  CB   . ASP A 1 40  ? -11.223 10.386  7.126   1.00 15.00 ?  82  ASP A CB   3  
ATOM   7317   C  CG   . ASP A 1 40  ? -11.074 11.858  7.462   1.00 15.00 ?  82  ASP A CG   3  
ATOM   7318   O  OD1  . ASP A 1 40  ? -10.630 12.176  8.585   1.00 15.00 ?  82  ASP A OD1  3  
ATOM   7319   O  OD2  . ASP A 1 40  ? -11.392 12.708  6.601   1.00 15.00 -1 82  ASP A OD2  3  
ATOM   7320   H  H    . ASP A 1 40  ? -12.652 8.086   6.738   1.00 15.00 ?  82  ASP A H    3  
ATOM   7321   H  HA   . ASP A 1 40  ? -11.772 9.665   9.068   1.00 15.00 ?  82  ASP A HA   3  
ATOM   7322   H  HB2  . ASP A 1 40  ? -10.250 9.920   7.191   1.00 15.00 ?  82  ASP A HB2  3  
ATOM   7323   H  HB3  . ASP A 1 40  ? -11.588 10.300  6.114   1.00 15.00 ?  82  ASP A HB3  3  
ATOM   7324   N  N    . GLY A 1 41  ? -14.065 10.567  9.294   1.00 15.00 ?  83  GLY A N    3  
ATOM   7325   C  CA   . GLY A 1 41  ? -15.341 11.239  9.434   1.00 15.00 ?  83  GLY A CA   3  
ATOM   7326   C  C    . GLY A 1 41  ? -16.473 10.467  8.791   1.00 15.00 ?  83  GLY A C    3  
ATOM   7327   O  O    . GLY A 1 41  ? -16.895 9.431   9.306   1.00 15.00 ?  83  GLY A O    3  
ATOM   7328   H  H    . GLY A 1 41  ? -13.592 10.238  10.091  1.00 15.00 ?  83  GLY A H    3  
ATOM   7329   H  HA2  . GLY A 1 41  ? -15.556 11.363  10.484  1.00 15.00 ?  83  GLY A HA2  3  
ATOM   7330   H  HA3  . GLY A 1 41  ? -15.273 12.213  8.973   1.00 15.00 ?  83  GLY A HA3  3  
ATOM   7331   N  N    . GLY A 1 42  ? -16.950 10.953  7.655   1.00 15.00 ?  84  GLY A N    3  
ATOM   7332   C  CA   . GLY A 1 42  ? -18.037 10.290  6.967   1.00 15.00 ?  84  GLY A CA   3  
ATOM   7333   C  C    . GLY A 1 42  ? -17.625 9.795   5.597   1.00 15.00 ?  84  GLY A C    3  
ATOM   7334   O  O    . GLY A 1 42  ? -18.471 9.481   4.757   1.00 15.00 ?  84  GLY A O    3  
ATOM   7335   H  H    . GLY A 1 42  ? -16.551 11.765  7.271   1.00 15.00 ?  84  GLY A H    3  
ATOM   7336   H  HA2  . GLY A 1 42  ? -18.363 9.449   7.561   1.00 15.00 ?  84  GLY A HA2  3  
ATOM   7337   H  HA3  . GLY A 1 42  ? -18.857 10.984  6.857   1.00 15.00 ?  84  GLY A HA3  3  
ATOM   7338   N  N    . ARG A 1 43  ? -16.323 9.726   5.370   1.00 15.00 ?  85  ARG A N    3  
ATOM   7339   C  CA   . ARG A 1 43  ? -15.795 9.270   4.095   1.00 15.00 ?  85  ARG A CA   3  
ATOM   7340   C  C    . ARG A 1 43  ? -14.763 8.165   4.308   1.00 15.00 ?  85  ARG A C    3  
ATOM   7341   O  O    . ARG A 1 43  ? -14.047 8.148   5.313   1.00 15.00 ?  85  ARG A O    3  
ATOM   7342   C  CB   . ARG A 1 43  ? -15.159 10.433  3.328   1.00 15.00 ?  85  ARG A CB   3  
ATOM   7343   C  CG   . ARG A 1 43  ? -13.908 10.977  3.992   1.00 15.00 ?  85  ARG A CG   3  
ATOM   7344   C  CD   . ARG A 1 43  ? -13.421 12.252  3.332   1.00 15.00 ?  85  ARG A CD   3  
ATOM   7345   N  NE   . ARG A 1 43  ? -12.231 12.769  4.004   1.00 15.00 ?  85  ARG A NE   3  
ATOM   7346   C  CZ   . ARG A 1 43  ? -11.203 13.336  3.386   1.00 15.00 ?  85  ARG A CZ   3  
ATOM   7347   N  NH1  . ARG A 1 43  ? -11.202 13.469  2.061   1.00 15.00 1  85  ARG A NH1  3  
ATOM   7348   N  NH2  . ARG A 1 43  ? -10.183 13.787  4.100   1.00 15.00 ?  85  ARG A NH2  3  
ATOM   7349   H  H    . ARG A 1 43  ? -15.696 9.983   6.085   1.00 15.00 ?  85  ARG A H    3  
ATOM   7350   H  HA   . ARG A 1 43  ? -16.618 8.876   3.519   1.00 15.00 ?  85  ARG A HA   3  
ATOM   7351   H  HB2  . ARG A 1 43  ? -14.894 10.089  2.341   1.00 15.00 ?  85  ARG A HB2  3  
ATOM   7352   H  HB3  . ARG A 1 43  ? -15.876 11.237  3.243   1.00 15.00 ?  85  ARG A HB3  3  
ATOM   7353   H  HG2  . ARG A 1 43  ? -14.124 11.184  5.030   1.00 15.00 ?  85  ARG A HG2  3  
ATOM   7354   H  HG3  . ARG A 1 43  ? -13.129 10.231  3.929   1.00 15.00 ?  85  ARG A HG3  3  
ATOM   7355   H  HD2  . ARG A 1 43  ? -13.185 12.042  2.299   1.00 15.00 ?  85  ARG A HD2  3  
ATOM   7356   H  HD3  . ARG A 1 43  ? -14.204 12.994  3.382   1.00 15.00 ?  85  ARG A HD3  3  
ATOM   7357   H  HE   . ARG A 1 43  ? -12.192 12.675  4.992   1.00 15.00 ?  85  ARG A HE   3  
ATOM   7358   H  HH11 . ARG A 1 43  ? -12.013 13.132  1.497   1.00 15.00 ?  85  ARG A HH11 3  
ATOM   7359   H  HH12 . ARG A 1 43  ? -10.385 13.909  1.580   1.00 15.00 ?  85  ARG A HH12 3  
ATOM   7360   H  HH21 . ARG A 1 43  ? -10.198 13.691  5.144   1.00 15.00 ?  85  ARG A HH21 3  
ATOM   7361   H  HH22 . ARG A 1 43  ? -9.368  14.238  3.632   1.00 15.00 ?  85  ARG A HH22 3  
ATOM   7362   N  N    . VAL A 1 44  ? -14.702 7.241   3.366   1.00 15.00 ?  86  VAL A N    3  
ATOM   7363   C  CA   . VAL A 1 44  ? -13.756 6.143   3.435   1.00 15.00 ?  86  VAL A CA   3  
ATOM   7364   C  C    . VAL A 1 44  ? -12.631 6.354   2.430   1.00 15.00 ?  86  VAL A C    3  
ATOM   7365   O  O    . VAL A 1 44  ? -12.874 6.681   1.267   1.00 15.00 ?  86  VAL A O    3  
ATOM   7366   C  CB   . VAL A 1 44  ? -14.447 4.786   3.170   1.00 15.00 ?  86  VAL A CB   3  
ATOM   7367   C  CG1  . VAL A 1 44  ? -13.429 3.661   3.040   1.00 15.00 ?  86  VAL A CG1  3  
ATOM   7368   C  CG2  . VAL A 1 44  ? -15.442 4.477   4.278   1.00 15.00 ?  86  VAL A CG2  3  
ATOM   7369   H  H    . VAL A 1 44  ? -15.313 7.296   2.597   1.00 15.00 ?  86  VAL A H    3  
ATOM   7370   H  HA   . VAL A 1 44  ? -13.337 6.124   4.431   1.00 15.00 ?  86  VAL A HA   3  
ATOM   7371   H  HB   . VAL A 1 44  ? -14.989 4.856   2.242   1.00 15.00 ?  86  VAL A HB   3  
ATOM   7372   H  HG11 . VAL A 1 44  ? -12.724 3.900   2.257   1.00 15.00 ?  86  VAL A HG11 3  
ATOM   7373   H  HG12 . VAL A 1 44  ? -13.942 2.741   2.792   1.00 15.00 ?  86  VAL A HG12 3  
ATOM   7374   H  HG13 . VAL A 1 44  ? -12.902 3.539   3.975   1.00 15.00 ?  86  VAL A HG13 3  
ATOM   7375   H  HG21 . VAL A 1 44  ? -15.948 3.546   4.060   1.00 15.00 ?  86  VAL A HG21 3  
ATOM   7376   H  HG22 . VAL A 1 44  ? -16.168 5.273   4.338   1.00 15.00 ?  86  VAL A HG22 3  
ATOM   7377   H  HG23 . VAL A 1 44  ? -14.922 4.392   5.222   1.00 15.00 ?  86  VAL A HG23 3  
ATOM   7378   N  N    . LEU A 1 45  ? -11.406 6.205   2.902   1.00 15.00 ?  87  LEU A N    3  
ATOM   7379   C  CA   . LEU A 1 45  ? -10.227 6.353   2.065   1.00 15.00 ?  87  LEU A CA   3  
ATOM   7380   C  C    . LEU A 1 45  ? -9.531  5.006   1.949   1.00 15.00 ?  87  LEU A C    3  
ATOM   7381   O  O    . LEU A 1 45  ? -9.212  4.375   2.957   1.00 15.00 ?  87  LEU A O    3  
ATOM   7382   C  CB   . LEU A 1 45  ? -9.273  7.394   2.659   1.00 15.00 ?  87  LEU A CB   3  
ATOM   7383   C  CG   . LEU A 1 45  ? -9.927  8.722   3.062   1.00 15.00 ?  87  LEU A CG   3  
ATOM   7384   C  CD1  . LEU A 1 45  ? -9.014  9.519   3.984   1.00 15.00 ?  87  LEU A CD1  3  
ATOM   7385   C  CD2  . LEU A 1 45  ? -10.286 9.545   1.831   1.00 15.00 ?  87  LEU A CD2  3  
ATOM   7386   H  H    . LEU A 1 45  ? -11.287 5.986   3.855   1.00 15.00 ?  87  LEU A H    3  
ATOM   7387   H  HA   . LEU A 1 45  ? -10.550 6.676   1.086   1.00 15.00 ?  87  LEU A HA   3  
ATOM   7388   H  HB2  . LEU A 1 45  ? -8.809  6.964   3.535   1.00 15.00 ?  87  LEU A HB2  3  
ATOM   7389   H  HB3  . LEU A 1 45  ? -8.504  7.604   1.932   1.00 15.00 ?  87  LEU A HB3  3  
ATOM   7390   H  HG   . LEU A 1 45  ? -10.839 8.512   3.599   1.00 15.00 ?  87  LEU A HG   3  
ATOM   7391   H  HD11 . LEU A 1 45  ? -9.569  10.340  4.414   1.00 15.00 ?  87  LEU A HD11 3  
ATOM   7392   H  HD12 . LEU A 1 45  ? -8.180  9.907   3.421   1.00 15.00 ?  87  LEU A HD12 3  
ATOM   7393   H  HD13 . LEU A 1 45  ? -8.649  8.879   4.773   1.00 15.00 ?  87  LEU A HD13 3  
ATOM   7394   H  HD21 . LEU A 1 45  ? -10.958 10.341  2.116   1.00 15.00 ?  87  LEU A HD21 3  
ATOM   7395   H  HD22 . LEU A 1 45  ? -10.768 8.912   1.103   1.00 15.00 ?  87  LEU A HD22 3  
ATOM   7396   H  HD23 . LEU A 1 45  ? -9.388  9.970   1.403   1.00 15.00 ?  87  LEU A HD23 3  
ATOM   7397   N  N    . VAL A 1 46  ? -9.303  4.561   0.727   1.00 15.00 ?  88  VAL A N    3  
ATOM   7398   C  CA   . VAL A 1 46  ? -8.674  3.270   0.507   1.00 15.00 ?  88  VAL A CA   3  
ATOM   7399   C  C    . VAL A 1 46  ? -7.255  3.412   -0.031  1.00 15.00 ?  88  VAL A C    3  
ATOM   7400   O  O    . VAL A 1 46  ? -6.993  4.182   -0.959  1.00 15.00 ?  88  VAL A O    3  
ATOM   7401   C  CB   . VAL A 1 46  ? -9.511  2.388   -0.458  1.00 15.00 ?  88  VAL A CB   3  
ATOM   7402   C  CG1  . VAL A 1 46  ? -8.833  1.043   -0.700  1.00 15.00 ?  88  VAL A CG1  3  
ATOM   7403   C  CG2  . VAL A 1 46  ? -10.922 2.188   0.082   1.00 15.00 ?  88  VAL A CG2  3  
ATOM   7404   H  H    . VAL A 1 46  ? -9.551  5.116   -0.044  1.00 15.00 ?  88  VAL A H    3  
ATOM   7405   H  HA   . VAL A 1 46  ? -8.628  2.765   1.462   1.00 15.00 ?  88  VAL A HA   3  
ATOM   7406   H  HB   . VAL A 1 46  ? -9.584  2.899   -1.407  1.00 15.00 ?  88  VAL A HB   3  
ATOM   7407   H  HG11 . VAL A 1 46  ? -9.530  0.369   -1.173  1.00 15.00 ?  88  VAL A HG11 3  
ATOM   7408   H  HG12 . VAL A 1 46  ? -8.510  0.627   0.243   1.00 15.00 ?  88  VAL A HG12 3  
ATOM   7409   H  HG13 . VAL A 1 46  ? -7.976  1.184   -1.346  1.00 15.00 ?  88  VAL A HG13 3  
ATOM   7410   H  HG21 . VAL A 1 46  ? -11.436 3.136   0.099   1.00 15.00 ?  88  VAL A HG21 3  
ATOM   7411   H  HG22 . VAL A 1 46  ? -10.872 1.791   1.087   1.00 15.00 ?  88  VAL A HG22 3  
ATOM   7412   H  HG23 . VAL A 1 46  ? -11.457 1.496   -0.553  1.00 15.00 ?  88  VAL A HG23 3  
ATOM   7413   N  N    . VAL A 1 47  ? -6.342  2.677   0.585   1.00 15.00 ?  89  VAL A N    3  
ATOM   7414   C  CA   . VAL A 1 47  ? -4.949  2.666   0.183   1.00 15.00 ?  89  VAL A CA   3  
ATOM   7415   C  C    . VAL A 1 47  ? -4.611  1.309   -0.419  1.00 15.00 ?  89  VAL A C    3  
ATOM   7416   O  O    . VAL A 1 47  ? -4.650  0.290   0.278   1.00 15.00 ?  89  VAL A O    3  
ATOM   7417   C  CB   . VAL A 1 47  ? -4.001  2.947   1.373   1.00 15.00 ?  89  VAL A CB   3  
ATOM   7418   C  CG1  . VAL A 1 47  ? -2.557  3.043   0.898   1.00 15.00 ?  89  VAL A CG1  3  
ATOM   7419   C  CG2  . VAL A 1 47  ? -4.407  4.216   2.113   1.00 15.00 ?  89  VAL A CG2  3  
ATOM   7420   H  H    . VAL A 1 47  ? -6.617  2.116   1.344   1.00 15.00 ?  89  VAL A H    3  
ATOM   7421   H  HA   . VAL A 1 47  ? -4.805  3.434   -0.565  1.00 15.00 ?  89  VAL A HA   3  
ATOM   7422   H  HB   . VAL A 1 47  ? -4.073  2.118   2.061   1.00 15.00 ?  89  VAL A HB   3  
ATOM   7423   H  HG11 . VAL A 1 47  ? -2.221  2.070   0.567   1.00 15.00 ?  89  VAL A HG11 3  
ATOM   7424   H  HG12 . VAL A 1 47  ? -1.932  3.383   1.712   1.00 15.00 ?  89  VAL A HG12 3  
ATOM   7425   H  HG13 . VAL A 1 47  ? -2.493  3.745   0.078   1.00 15.00 ?  89  VAL A HG13 3  
ATOM   7426   H  HG21 . VAL A 1 47  ? -3.768  4.352   2.971   1.00 15.00 ?  89  VAL A HG21 3  
ATOM   7427   H  HG22 . VAL A 1 47  ? -5.436  4.132   2.436   1.00 15.00 ?  89  VAL A HG22 3  
ATOM   7428   H  HG23 . VAL A 1 47  ? -4.306  5.066   1.455   1.00 15.00 ?  89  VAL A HG23 3  
ATOM   7429   N  N    . ASP A 1 48  ? -4.304  1.318   -1.717  1.00 15.00 ?  90  ASP A N    3  
ATOM   7430   C  CA   . ASP A 1 48  ? -3.955  0.112   -2.478  1.00 15.00 ?  90  ASP A CA   3  
ATOM   7431   C  C    . ASP A 1 48  ? -5.173  -0.769  -2.737  1.00 15.00 ?  90  ASP A C    3  
ATOM   7432   O  O    . ASP A 1 48  ? -6.130  -0.780  -1.960  1.00 15.00 ?  90  ASP A O    3  
ATOM   7433   C  CB   . ASP A 1 48  ? -2.873  -0.702  -1.769  1.00 15.00 ?  90  ASP A CB   3  
ATOM   7434   C  CG   . ASP A 1 48  ? -1.472  -0.252  -2.122  1.00 15.00 ?  90  ASP A CG   3  
ATOM   7435   O  OD1  . ASP A 1 48  ? -1.285  0.365   -3.187  1.00 15.00 ?  90  ASP A OD1  3  
ATOM   7436   O  OD2  . ASP A 1 48  ? -0.539  -0.546  -1.344  1.00 15.00 -1 90  ASP A OD2  3  
ATOM   7437   H  H    . ASP A 1 48  ? -4.300  2.184   -2.186  1.00 15.00 ?  90  ASP A H    3  
ATOM   7438   H  HA   . ASP A 1 48  ? -3.565  0.441   -3.430  1.00 15.00 ?  90  ASP A HA   3  
ATOM   7439   H  HB2  . ASP A 1 48  ? -3.003  -0.607  -0.700  1.00 15.00 ?  90  ASP A HB2  3  
ATOM   7440   H  HB3  . ASP A 1 48  ? -2.974  -1.741  -2.044  1.00 15.00 ?  90  ASP A HB3  3  
ATOM   7441   N  N    . THR A 1 49  ? -5.137  -1.509  -3.837  1.00 15.00 ?  91  THR A N    3  
ATOM   7442   C  CA   . THR A 1 49  ? -6.238  -2.396  -4.190  1.00 15.00 ?  91  THR A CA   3  
ATOM   7443   C  C    . THR A 1 49  ? -5.837  -3.857  -3.993  1.00 15.00 ?  91  THR A C    3  
ATOM   7444   O  O    . THR A 1 49  ? -4.857  -4.146  -3.309  1.00 15.00 ?  91  THR A O    3  
ATOM   7445   C  CB   . THR A 1 49  ? -6.708  -2.172  -5.646  1.00 15.00 ?  91  THR A CB   3  
ATOM   7446   O  OG1  . THR A 1 49  ? -5.624  -2.367  -6.561  1.00 15.00 ?  91  THR A OG1  3  
ATOM   7447   C  CG2  . THR A 1 49  ? -7.266  -0.771  -5.820  1.00 15.00 ?  91  THR A CG2  3  
ATOM   7448   H  H    . THR A 1 49  ? -4.347  -1.470  -4.420  1.00 15.00 ?  91  THR A H    3  
ATOM   7449   H  HA   . THR A 1 49  ? -7.064  -2.173  -3.529  1.00 15.00 ?  91  THR A HA   3  
ATOM   7450   H  HB   . THR A 1 49  ? -7.490  -2.882  -5.870  1.00 15.00 ?  91  THR A HB   3  
ATOM   7451   H  HG1  . THR A 1 49  ? -4.916  -1.741  -6.356  1.00 15.00 ?  91  THR A HG1  3  
ATOM   7452   H  HG21 . THR A 1 49  ? -6.457  -0.057  -5.790  1.00 15.00 ?  91  THR A HG21 3  
ATOM   7453   H  HG22 . THR A 1 49  ? -7.964  -0.558  -5.024  1.00 15.00 ?  91  THR A HG22 3  
ATOM   7454   H  HG23 . THR A 1 49  ? -7.774  -0.700  -6.774  1.00 15.00 ?  91  THR A HG23 3  
ATOM   7455   N  N    . ALA A 1 50  ? -6.599  -4.772  -4.574  1.00 15.00 ?  92  ALA A N    3  
ATOM   7456   C  CA   . ALA A 1 50  ? -6.310  -6.191  -4.452  1.00 15.00 ?  92  ALA A CA   3  
ATOM   7457   C  C    . ALA A 1 50  ? -5.616  -6.712  -5.705  1.00 15.00 ?  92  ALA A C    3  
ATOM   7458   O  O    . ALA A 1 50  ? -5.269  -5.935  -6.596  1.00 15.00 ?  92  ALA A O    3  
ATOM   7459   C  CB   . ALA A 1 50  ? -7.593  -6.956  -4.188  1.00 15.00 ?  92  ALA A CB   3  
ATOM   7460   H  H    . ALA A 1 50  ? -7.371  -4.487  -5.107  1.00 15.00 ?  92  ALA A H    3  
ATOM   7461   H  HA   . ALA A 1 50  ? -5.653  -6.328  -3.605  1.00 15.00 ?  92  ALA A HA   3  
ATOM   7462   H  HB1  . ALA A 1 50  ? -8.275  -6.812  -5.012  1.00 15.00 ?  92  ALA A HB1  3  
ATOM   7463   H  HB2  . ALA A 1 50  ? -8.045  -6.591  -3.280  1.00 15.00 ?  92  ALA A HB2  3  
ATOM   7464   H  HB3  . ALA A 1 50  ? -7.371  -8.008  -4.084  1.00 15.00 ?  92  ALA A HB3  3  
ATOM   7465   N  N    . TRP A 1 51  ? -5.422  -8.026  -5.768  1.00 15.00 ?  93  TRP A N    3  
ATOM   7466   C  CA   . TRP A 1 51  ? -4.769  -8.659  -6.907  1.00 15.00 ?  93  TRP A CA   3  
ATOM   7467   C  C    . TRP A 1 51  ? -5.609  -8.513  -8.170  1.00 15.00 ?  93  TRP A C    3  
ATOM   7468   O  O    . TRP A 1 51  ? -5.078  -8.316  -9.264  1.00 15.00 ?  93  TRP A O    3  
ATOM   7469   C  CB   . TRP A 1 51  ? -4.537  -10.146 -6.631  1.00 15.00 ?  93  TRP A CB   3  
ATOM   7470   C  CG   . TRP A 1 51  ? -3.419  -10.428 -5.677  1.00 15.00 ?  93  TRP A CG   3  
ATOM   7471   C  CD1  . TRP A 1 51  ? -3.531  -10.760 -4.358  1.00 15.00 ?  93  TRP A CD1  3  
ATOM   7472   C  CD2  . TRP A 1 51  ? -2.018  -10.415 -5.971  1.00 15.00 ?  93  TRP A CD2  3  
ATOM   7473   N  NE1  . TRP A 1 51  ? -2.288  -10.969 -3.820  1.00 15.00 ?  93  TRP A NE1  3  
ATOM   7474   C  CE2  . TRP A 1 51  ? -1.342  -10.757 -4.786  1.00 15.00 ?  93  TRP A CE2  3  
ATOM   7475   C  CE3  . TRP A 1 51  ? -1.269  -10.150 -7.123  1.00 15.00 ?  93  TRP A CE3  3  
ATOM   7476   C  CZ2  . TRP A 1 51  ? 0.045   -10.843 -4.716  1.00 15.00 ?  93  TRP A CZ2  3  
ATOM   7477   C  CZ3  . TRP A 1 51  ? 0.109   -10.233 -7.053  1.00 15.00 ?  93  TRP A CZ3  3  
ATOM   7478   C  CH2  . TRP A 1 51  ? 0.753   -10.578 -5.857  1.00 15.00 ?  93  TRP A CH2  3  
ATOM   7479   H  H    . TRP A 1 51  ? -5.728  -8.587  -5.026  1.00 15.00 ?  93  TRP A H    3  
ATOM   7480   H  HA   . TRP A 1 51  ? -3.818  -8.175  -7.062  1.00 15.00 ?  93  TRP A HA   3  
ATOM   7481   H  HB2  . TRP A 1 51  ? -5.438  -10.570 -6.215  1.00 15.00 ?  93  TRP A HB2  3  
ATOM   7482   H  HB3  . TRP A 1 51  ? -4.312  -10.644 -7.563  1.00 15.00 ?  93  TRP A HB3  3  
ATOM   7483   H  HD1  . TRP A 1 51  ? -4.467  -10.852 -3.830  1.00 15.00 ?  93  TRP A HD1  3  
ATOM   7484   H  HE1  . TRP A 1 51  ? -2.106  -11.226 -2.892  1.00 15.00 ?  93  TRP A HE1  3  
ATOM   7485   H  HE3  . TRP A 1 51  ? -1.749  -9.885  -8.055  1.00 15.00 ?  93  TRP A HE3  3  
ATOM   7486   H  HZ2  . TRP A 1 51  ? 0.556   -11.107 -3.802  1.00 15.00 ?  93  TRP A HZ2  3  
ATOM   7487   H  HZ3  . TRP A 1 51  ? 0.703   -10.029 -7.932  1.00 15.00 ?  93  TRP A HZ3  3  
ATOM   7488   H  HH2  . TRP A 1 51  ? 1.832   -10.627 -5.847  1.00 15.00 ?  93  TRP A HH2  3  
ATOM   7489   N  N    . THR A 1 52  ? -6.923  -8.631  -8.015  1.00 15.00 ?  94  THR A N    3  
ATOM   7490   C  CA   . THR A 1 52  ? -7.835  -8.527  -9.139  1.00 15.00 ?  94  THR A CA   3  
ATOM   7491   C  C    . THR A 1 52  ? -8.986  -7.572  -8.831  1.00 15.00 ?  94  THR A C    3  
ATOM   7492   O  O    . THR A 1 52  ? -9.224  -7.215  -7.670  1.00 15.00 ?  94  THR A O    3  
ATOM   7493   C  CB   . THR A 1 52  ? -8.411  -9.912  -9.504  1.00 15.00 ?  94  THR A CB   3  
ATOM   7494   O  OG1  . THR A 1 52  ? -8.933  -10.547 -8.326  1.00 15.00 ?  94  THR A OG1  3  
ATOM   7495   C  CG2  . THR A 1 52  ? -7.349  -10.803 -10.140 1.00 15.00 ?  94  THR A CG2  3  
ATOM   7496   H  H    . THR A 1 52  ? -7.287  -8.793  -7.121  1.00 15.00 ?  94  THR A H    3  
ATOM   7497   H  HA   . THR A 1 52  ? -7.283  -8.151  -9.987  1.00 15.00 ?  94  THR A HA   3  
ATOM   7498   H  HB   . THR A 1 52  ? -9.216  -9.774  -10.214 1.00 15.00 ?  94  THR A HB   3  
ATOM   7499   H  HG1  . THR A 1 52  ? -8.814  -11.503 -8.400  1.00 15.00 ?  94  THR A HG1  3  
ATOM   7500   H  HG21 . THR A 1 52  ? -6.473  -10.833 -9.506  1.00 15.00 ?  94  THR A HG21 3  
ATOM   7501   H  HG22 . THR A 1 52  ? -7.078  -10.409 -11.108 1.00 15.00 ?  94  THR A HG22 3  
ATOM   7502   H  HG23 . THR A 1 52  ? -7.737  -11.803 -10.258 1.00 15.00 ?  94  THR A HG23 3  
ATOM   7503   N  N    . ASP A 1 53  ? -9.702  -7.166  -9.871  1.00 15.00 ?  95  ASP A N    3  
ATOM   7504   C  CA   . ASP A 1 53  ? -10.838 -6.264  -9.717  1.00 15.00 ?  95  ASP A CA   3  
ATOM   7505   C  C    . ASP A 1 53  ? -11.953 -6.951  -8.944  1.00 15.00 ?  95  ASP A C    3  
ATOM   7506   O  O    . ASP A 1 53  ? -12.713 -6.303  -8.226  1.00 15.00 ?  95  ASP A O    3  
ATOM   7507   C  CB   . ASP A 1 53  ? -11.362 -5.800  -11.079 1.00 15.00 ?  95  ASP A CB   3  
ATOM   7508   C  CG   . ASP A 1 53  ? -10.491 -4.734  -11.715 1.00 15.00 ?  95  ASP A CG   3  
ATOM   7509   O  OD1  . ASP A 1 53  ? -10.530 -3.573  -11.260 1.00 15.00 ?  95  ASP A OD1  3  
ATOM   7510   O  OD2  . ASP A 1 53  ? -9.762  -5.056  -12.679 1.00 15.00 -1 95  ASP A OD2  3  
ATOM   7511   H  H    . ASP A 1 53  ? -9.453  -7.472  -10.770 1.00 15.00 ?  95  ASP A H    3  
ATOM   7512   H  HA   . ASP A 1 53  ? -10.505 -5.405  -9.157  1.00 15.00 ?  95  ASP A HA   3  
ATOM   7513   H  HB2  . ASP A 1 53  ? -11.406 -6.645  -11.748 1.00 15.00 ?  95  ASP A HB2  3  
ATOM   7514   H  HB3  . ASP A 1 53  ? -12.356 -5.395  -10.951 1.00 15.00 ?  95  ASP A HB3  3  
ATOM   7515   N  N    . ASP A 1 54  ? -12.038 -8.270  -9.091  1.00 15.00 ?  96  ASP A N    3  
ATOM   7516   C  CA   . ASP A 1 54  ? -13.054 -9.059  -8.396  1.00 15.00 ?  96  ASP A CA   3  
ATOM   7517   C  C    . ASP A 1 54  ? -12.899 -8.899  -6.893  1.00 15.00 ?  96  ASP A C    3  
ATOM   7518   O  O    . ASP A 1 54  ? -13.847 -8.539  -6.195  1.00 15.00 ?  96  ASP A O    3  
ATOM   7519   C  CB   . ASP A 1 54  ? -12.938 -10.539 -8.766  1.00 15.00 ?  96  ASP A CB   3  
ATOM   7520   C  CG   . ASP A 1 54  ? -14.108 -11.364 -8.255  1.00 15.00 ?  96  ASP A CG   3  
ATOM   7521   O  OD1  . ASP A 1 54  ? -14.985 -11.724 -9.073  1.00 15.00 ?  96  ASP A OD1  3  
ATOM   7522   O  OD2  . ASP A 1 54  ? -14.152 -11.674 -7.041  1.00 15.00 -1 96  ASP A OD2  3  
ATOM   7523   H  H    . ASP A 1 54  ? -11.403 -8.724  -9.684  1.00 15.00 ?  96  ASP A H    3  
ATOM   7524   H  HA   . ASP A 1 54  ? -14.025 -8.692  -8.692  1.00 15.00 ?  96  ASP A HA   3  
ATOM   7525   H  HB2  . ASP A 1 54  ? -12.901 -10.635 -9.840  1.00 15.00 ?  96  ASP A HB2  3  
ATOM   7526   H  HB3  . ASP A 1 54  ? -12.030 -10.936 -8.341  1.00 15.00 ?  96  ASP A HB3  3  
ATOM   7527   N  N    . GLN A 1 55  ? -11.684 -9.137  -6.408  1.00 15.00 ?  97  GLN A N    3  
ATOM   7528   C  CA   . GLN A 1 55  ? -11.387 -9.026  -4.989  1.00 15.00 ?  97  GLN A CA   3  
ATOM   7529   C  C    . GLN A 1 55  ? -11.567 -7.588  -4.519  1.00 15.00 ?  97  GLN A C    3  
ATOM   7530   O  O    . GLN A 1 55  ? -12.001 -7.340  -3.396  1.00 15.00 ?  97  GLN A O    3  
ATOM   7531   C  CB   . GLN A 1 55  ? -9.961  -9.496  -4.714  1.00 15.00 ?  97  GLN A CB   3  
ATOM   7532   C  CG   . GLN A 1 55  ? -9.675  -10.894 -5.224  1.00 15.00 ?  97  GLN A CG   3  
ATOM   7533   C  CD   . GLN A 1 55  ? -8.230  -11.303 -5.023  1.00 15.00 ?  97  GLN A CD   3  
ATOM   7534   O  OE1  . GLN A 1 55  ? -7.332  -10.462 -4.965  1.00 15.00 ?  97  GLN A OE1  3  
ATOM   7535   N  NE2  . GLN A 1 55  ? -8.000  -12.600 -4.927  1.00 15.00 ?  97  GLN A NE2  3  
ATOM   7536   H  H    . GLN A 1 55  ? -10.968 -9.398  -7.025  1.00 15.00 ?  97  GLN A H    3  
ATOM   7537   H  HA   . GLN A 1 55  ? -12.076 -9.660  -4.453  1.00 15.00 ?  97  GLN A HA   3  
ATOM   7538   H  HB2  . GLN A 1 55  ? -9.268  -8.815  -5.190  1.00 15.00 ?  97  GLN A HB2  3  
ATOM   7539   H  HB3  . GLN A 1 55  ? -9.791  -9.482  -3.647  1.00 15.00 ?  97  GLN A HB3  3  
ATOM   7540   H  HG2  . GLN A 1 55  ? -10.307 -11.594 -4.697  1.00 15.00 ?  97  GLN A HG2  3  
ATOM   7541   H  HG3  . GLN A 1 55  ? -9.902  -10.931 -6.281  1.00 15.00 ?  97  GLN A HG3  3  
ATOM   7542   H  HE21 . GLN A 1 55  ? -8.764  -13.212 -4.992  1.00 15.00 ?  97  GLN A HE21 3  
ATOM   7543   H  HE22 . GLN A 1 55  ? -7.069  -12.905 -4.800  1.00 15.00 ?  97  GLN A HE22 3  
ATOM   7544   N  N    . THR A 1 56  ? -11.242 -6.647  -5.395  1.00 15.00 ?  98  THR A N    3  
ATOM   7545   C  CA   . THR A 1 56  ? -11.381 -5.236  -5.083  1.00 15.00 ?  98  THR A CA   3  
ATOM   7546   C  C    . THR A 1 56  ? -12.858 -4.884  -4.896  1.00 15.00 ?  98  THR A C    3  
ATOM   7547   O  O    . THR A 1 56  ? -13.215 -4.108  -4.007  1.00 15.00 ?  98  THR A O    3  
ATOM   7548   C  CB   . THR A 1 56  ? -10.749 -4.372  -6.187  1.00 15.00 ?  98  THR A CB   3  
ATOM   7549   O  OG1  . THR A 1 56  ? -9.373  -4.744  -6.350  1.00 15.00 ?  98  THR A OG1  3  
ATOM   7550   C  CG2  . THR A 1 56  ? -10.843 -2.892  -5.847  1.00 15.00 ?  98  THR A CG2  3  
ATOM   7551   H  H    . THR A 1 56  ? -10.899 -6.910  -6.277  1.00 15.00 ?  98  THR A H    3  
ATOM   7552   H  HA   . THR A 1 56  ? -10.856 -5.045  -4.159  1.00 15.00 ?  98  THR A HA   3  
ATOM   7553   H  HB   . THR A 1 56  ? -11.273 -4.550  -7.112  1.00 15.00 ?  98  THR A HB   3  
ATOM   7554   H  HG1  . THR A 1 56  ? -9.312  -5.518  -6.929  1.00 15.00 ?  98  THR A HG1  3  
ATOM   7555   H  HG21 . THR A 1 56  ? -11.881 -2.597  -5.816  1.00 15.00 ?  98  THR A HG21 3  
ATOM   7556   H  HG22 . THR A 1 56  ? -10.324 -2.315  -6.600  1.00 15.00 ?  98  THR A HG22 3  
ATOM   7557   H  HG23 . THR A 1 56  ? -10.391 -2.715  -4.883  1.00 15.00 ?  98  THR A HG23 3  
ATOM   7558   N  N    . ALA A 1 57  ? -13.711 -5.483  -5.721  1.00 15.00 ?  99  ALA A N    3  
ATOM   7559   C  CA   . ALA A 1 57  ? -15.147 -5.254  -5.632  1.00 15.00 ?  99  ALA A CA   3  
ATOM   7560   C  C    . ALA A 1 57  ? -15.691 -5.832  -4.330  1.00 15.00 ?  99  ALA A C    3  
ATOM   7561   O  O    . ALA A 1 57  ? -16.596 -5.269  -3.714  1.00 15.00 ?  99  ALA A O    3  
ATOM   7562   C  CB   . ALA A 1 57  ? -15.866 -5.858  -6.834  1.00 15.00 ?  99  ALA A CB   3  
ATOM   7563   H  H    . ALA A 1 57  ? -13.363 -6.089  -6.412  1.00 15.00 ?  99  ALA A H    3  
ATOM   7564   H  HA   . ALA A 1 57  ? -15.312 -4.188  -5.636  1.00 15.00 ?  99  ALA A HA   3  
ATOM   7565   H  HB1  . ALA A 1 57  ? -15.584 -5.325  -7.730  1.00 15.00 ?  99  ALA A HB1  3  
ATOM   7566   H  HB2  . ALA A 1 57  ? -16.934 -5.783  -6.695  1.00 15.00 ?  99  ALA A HB2  3  
ATOM   7567   H  HB3  . ALA A 1 57  ? -15.589 -6.898  -6.931  1.00 15.00 ?  99  ALA A HB3  3  
ATOM   7568   N  N    . GLN A 1 58  ? -15.120 -6.959  -3.909  1.00 15.00 ?  100 GLN A N    3  
ATOM   7569   C  CA   . GLN A 1 58  ? -15.532 -7.599  -2.667  1.00 15.00 ?  100 GLN A CA   3  
ATOM   7570   C  C    . GLN A 1 58  ? -15.221 -6.674  -1.494  1.00 15.00 ?  100 GLN A C    3  
ATOM   7571   O  O    . GLN A 1 58  ? -15.969 -6.614  -0.518  1.00 15.00 ?  100 GLN A O    3  
ATOM   7572   C  CB   . GLN A 1 58  ? -14.836 -8.952  -2.491  1.00 15.00 ?  100 GLN A CB   3  
ATOM   7573   C  CG   . GLN A 1 58  ? -15.201 -9.973  -3.561  1.00 15.00 ?  100 GLN A CG   3  
ATOM   7574   C  CD   . GLN A 1 58  ? -14.676 -11.364 -3.252  1.00 15.00 ?  100 GLN A CD   3  
ATOM   7575   O  OE1  . GLN A 1 58  ? -14.574 -11.766 -2.091  1.00 15.00 ?  100 GLN A OE1  3  
ATOM   7576   N  NE2  . GLN A 1 58  ? -14.335 -12.114 -4.287  1.00 15.00 ?  100 GLN A NE2  3  
ATOM   7577   H  H    . GLN A 1 58  ? -14.406 -7.365  -4.445  1.00 15.00 ?  100 GLN A H    3  
ATOM   7578   H  HA   . GLN A 1 58  ? -16.600 -7.755  -2.715  1.00 15.00 ?  100 GLN A HA   3  
ATOM   7579   H  HB2  . GLN A 1 58  ? -13.769 -8.798  -2.524  1.00 15.00 ?  100 GLN A HB2  3  
ATOM   7580   H  HB3  . GLN A 1 58  ? -15.104 -9.361  -1.527  1.00 15.00 ?  100 GLN A HB3  3  
ATOM   7581   H  HG2  . GLN A 1 58  ? -16.276 -10.023 -3.643  1.00 15.00 ?  100 GLN A HG2  3  
ATOM   7582   H  HG3  . GLN A 1 58  ? -14.784 -9.649  -4.505  1.00 15.00 ?  100 GLN A HG3  3  
ATOM   7583   H  HE21 . GLN A 1 58  ? -14.439 -11.734 -5.194  1.00 15.00 ?  100 GLN A HE21 3  
ATOM   7584   H  HE22 . GLN A 1 58  ? -13.991 -13.023 -4.113  1.00 15.00 ?  100 GLN A HE22 3  
ATOM   7585   N  N    . ILE A 1 59  ? -14.119 -5.934  -1.616  1.00 15.00 ?  101 ILE A N    3  
ATOM   7586   C  CA   . ILE A 1 59  ? -13.712 -4.982  -0.591  1.00 15.00 ?  101 ILE A CA   3  
ATOM   7587   C  C    . ILE A 1 59  ? -14.736 -3.861  -0.494  1.00 15.00 ?  101 ILE A C    3  
ATOM   7588   O  O    . ILE A 1 59  ? -15.135 -3.461  0.596   1.00 15.00 ?  101 ILE A O    3  
ATOM   7589   C  CB   . ILE A 1 59  ? -12.323 -4.369  -0.894  1.00 15.00 ?  101 ILE A CB   3  
ATOM   7590   C  CG1  . ILE A 1 59  ? -11.257 -5.463  -0.943  1.00 15.00 ?  101 ILE A CG1  3  
ATOM   7591   C  CG2  . ILE A 1 59  ? -11.953 -3.314  0.144   1.00 15.00 ?  101 ILE A CG2  3  
ATOM   7592   C  CD1  . ILE A 1 59  ? -9.921  -4.995  -1.487  1.00 15.00 ?  101 ILE A CD1  3  
ATOM   7593   H  H    . ILE A 1 59  ? -13.564 -6.034  -2.419  1.00 15.00 ?  101 ILE A H    3  
ATOM   7594   H  HA   . ILE A 1 59  ? -13.662 -5.503  0.354   1.00 15.00 ?  101 ILE A HA   3  
ATOM   7595   H  HB   . ILE A 1 59  ? -12.374 -3.884  -1.858  1.00 15.00 ?  101 ILE A HB   3  
ATOM   7596   H  HG12 . ILE A 1 59  ? -11.093 -5.838  0.055   1.00 15.00 ?  101 ILE A HG12 3  
ATOM   7597   H  HG13 . ILE A 1 59  ? -11.606 -6.268  -1.571  1.00 15.00 ?  101 ILE A HG13 3  
ATOM   7598   H  HG21 . ILE A 1 59  ? -12.596 -2.455  0.030   1.00 15.00 ?  101 ILE A HG21 3  
ATOM   7599   H  HG22 . ILE A 1 59  ? -10.924 -3.017  0.001   1.00 15.00 ?  101 ILE A HG22 3  
ATOM   7600   H  HG23 . ILE A 1 59  ? -12.076 -3.725  1.132   1.00 15.00 ?  101 ILE A HG23 3  
ATOM   7601   H  HD11 . ILE A 1 59  ? -9.356  -5.845  -1.841  1.00 15.00 ?  101 ILE A HD11 3  
ATOM   7602   H  HD12 . ILE A 1 59  ? -9.367  -4.500  -0.704  1.00 15.00 ?  101 ILE A HD12 3  
ATOM   7603   H  HD13 . ILE A 1 59  ? -10.085 -4.304  -2.302  1.00 15.00 ?  101 ILE A HD13 3  
ATOM   7604   N  N    . LEU A 1 60  ? -15.165 -3.366  -1.653  1.00 15.00 ?  102 LEU A N    3  
ATOM   7605   C  CA   . LEU A 1 60  ? -16.156 -2.298  -1.715  1.00 15.00 ?  102 LEU A CA   3  
ATOM   7606   C  C    . LEU A 1 60  ? -17.452 -2.739  -1.043  1.00 15.00 ?  102 LEU A C    3  
ATOM   7607   O  O    . LEU A 1 60  ? -18.084 -1.968  -0.321  1.00 15.00 ?  102 LEU A O    3  
ATOM   7608   C  CB   . LEU A 1 60  ? -16.426 -1.900  -3.169  1.00 15.00 ?  102 LEU A CB   3  
ATOM   7609   C  CG   . LEU A 1 60  ? -15.205 -1.393  -3.943  1.00 15.00 ?  102 LEU A CG   3  
ATOM   7610   C  CD1  . LEU A 1 60  ? -15.565 -1.109  -5.391  1.00 15.00 ?  102 LEU A CD1  3  
ATOM   7611   C  CD2  . LEU A 1 60  ? -14.632 -0.146  -3.285  1.00 15.00 ?  102 LEU A CD2  3  
ATOM   7612   H  H    . LEU A 1 60  ? -14.797 -3.725  -2.490  1.00 15.00 ?  102 LEU A H    3  
ATOM   7613   H  HA   . LEU A 1 60  ? -15.760 -1.448  -1.183  1.00 15.00 ?  102 LEU A HA   3  
ATOM   7614   H  HB2  . LEU A 1 60  ? -16.823 -2.765  -3.687  1.00 15.00 ?  102 LEU A HB2  3  
ATOM   7615   H  HB3  . LEU A 1 60  ? -17.177 -1.124  -3.173  1.00 15.00 ?  102 LEU A HB3  3  
ATOM   7616   H  HG   . LEU A 1 60  ? -14.442 -2.158  -3.933  1.00 15.00 ?  102 LEU A HG   3  
ATOM   7617   H  HD11 . LEU A 1 60  ? -16.002 -1.991  -5.837  1.00 15.00 ?  102 LEU A HD11 3  
ATOM   7618   H  HD12 . LEU A 1 60  ? -14.673 -0.836  -5.934  1.00 15.00 ?  102 LEU A HD12 3  
ATOM   7619   H  HD13 . LEU A 1 60  ? -16.273 -0.295  -5.435  1.00 15.00 ?  102 LEU A HD13 3  
ATOM   7620   H  HD21 . LEU A 1 60  ? -13.796 0.212   -3.866  1.00 15.00 ?  102 LEU A HD21 3  
ATOM   7621   H  HD22 . LEU A 1 60  ? -14.301 -0.387  -2.287  1.00 15.00 ?  102 LEU A HD22 3  
ATOM   7622   H  HD23 . LEU A 1 60  ? -15.393 0.621   -3.236  1.00 15.00 ?  102 LEU A HD23 3  
ATOM   7623   N  N    . ASN A 1 61  ? -17.832 -3.989  -1.278  1.00 15.00 ?  103 ASN A N    3  
ATOM   7624   C  CA   . ASN A 1 61  ? -19.039 -4.548  -0.680  1.00 15.00 ?  103 ASN A CA   3  
ATOM   7625   C  C    . ASN A 1 61  ? -18.867 -4.665  0.826   1.00 15.00 ?  103 ASN A C    3  
ATOM   7626   O  O    . ASN A 1 61  ? -19.784 -4.374  1.593   1.00 15.00 ?  103 ASN A O    3  
ATOM   7627   C  CB   . ASN A 1 61  ? -19.351 -5.918  -1.284  1.00 15.00 ?  103 ASN A CB   3  
ATOM   7628   C  CG   . ASN A 1 61  ? -20.174 -5.815  -2.553  1.00 15.00 ?  103 ASN A CG   3  
ATOM   7629   O  OD1  . ASN A 1 61  ? -21.003 -4.914  -2.699  1.00 15.00 ?  103 ASN A OD1  3  
ATOM   7630   N  ND2  . ASN A 1 61  ? -19.946 -6.728  -3.485  1.00 15.00 ?  103 ASN A ND2  3  
ATOM   7631   H  H    . ASN A 1 61  ? -17.291 -4.548  -1.876  1.00 15.00 ?  103 ASN A H    3  
ATOM   7632   H  HA   . ASN A 1 61  ? -19.857 -3.874  -0.887  1.00 15.00 ?  103 ASN A HA   3  
ATOM   7633   H  HB2  . ASN A 1 61  ? -18.424 -6.420  -1.520  1.00 15.00 ?  103 ASN A HB2  3  
ATOM   7634   H  HB3  . ASN A 1 61  ? -19.901 -6.507  -0.564  1.00 15.00 ?  103 ASN A HB3  3  
ATOM   7635   H  HD21 . ASN A 1 61  ? -19.268 -7.414  -3.309  1.00 15.00 ?  103 ASN A HD21 3  
ATOM   7636   H  HD22 . ASN A 1 61  ? -20.463 -6.675  -4.317  1.00 15.00 ?  103 ASN A HD22 3  
ATOM   7637   N  N    . TRP A 1 62  ? -17.673 -5.078  1.240   1.00 15.00 ?  104 TRP A N    3  
ATOM   7638   C  CA   . TRP A 1 62  ? -17.353 -5.215  2.651   1.00 15.00 ?  104 TRP A CA   3  
ATOM   7639   C  C    . TRP A 1 62  ? -17.475 -3.862  3.339   1.00 15.00 ?  104 TRP A C    3  
ATOM   7640   O  O    . TRP A 1 62  ? -18.055 -3.752  4.416   1.00 15.00 ?  104 TRP A O    3  
ATOM   7641   C  CB   . TRP A 1 62  ? -15.937 -5.774  2.819   1.00 15.00 ?  104 TRP A CB   3  
ATOM   7642   C  CG   . TRP A 1 62  ? -15.487 -5.873  4.249   1.00 15.00 ?  104 TRP A CG   3  
ATOM   7643   C  CD1  . TRP A 1 62  ? -15.661 -6.932  5.090   1.00 15.00 ?  104 TRP A CD1  3  
ATOM   7644   C  CD2  . TRP A 1 62  ? -14.789 -4.877  5.001   1.00 15.00 ?  104 TRP A CD2  3  
ATOM   7645   N  NE1  . TRP A 1 62  ? -15.117 -6.653  6.320   1.00 15.00 ?  104 TRP A NE1  3  
ATOM   7646   C  CE2  . TRP A 1 62  ? -14.576 -5.398  6.291   1.00 15.00 ?  104 TRP A CE2  3  
ATOM   7647   C  CE3  . TRP A 1 62  ? -14.325 -3.595  4.707   1.00 15.00 ?  104 TRP A CE3  3  
ATOM   7648   C  CZ2  . TRP A 1 62  ? -13.918 -4.677  7.283   1.00 15.00 ?  104 TRP A CZ2  3  
ATOM   7649   C  CZ3  . TRP A 1 62  ? -13.674 -2.881  5.690   1.00 15.00 ?  104 TRP A CZ3  3  
ATOM   7650   C  CH2  . TRP A 1 62  ? -13.476 -3.422  6.965   1.00 15.00 ?  104 TRP A CH2  3  
ATOM   7651   H  H    . TRP A 1 62  ? -16.988 -5.307  0.569   1.00 15.00 ?  104 TRP A H    3  
ATOM   7652   H  HA   . TRP A 1 62  ? -18.061 -5.901  3.090   1.00 15.00 ?  104 TRP A HA   3  
ATOM   7653   H  HB2  . TRP A 1 62  ? -15.900 -6.763  2.390   1.00 15.00 ?  104 TRP A HB2  3  
ATOM   7654   H  HB3  . TRP A 1 62  ? -15.244 -5.135  2.291   1.00 15.00 ?  104 TRP A HB3  3  
ATOM   7655   H  HD1  . TRP A 1 62  ? -16.156 -7.850  4.815   1.00 15.00 ?  104 TRP A HD1  3  
ATOM   7656   H  HE1  . TRP A 1 62  ? -15.117 -7.260  7.098   1.00 15.00 ?  104 TRP A HE1  3  
ATOM   7657   H  HE3  . TRP A 1 62  ? -14.469 -3.159  3.728   1.00 15.00 ?  104 TRP A HE3  3  
ATOM   7658   H  HZ2  . TRP A 1 62  ? -13.758 -5.081  8.271   1.00 15.00 ?  104 TRP A HZ2  3  
ATOM   7659   H  HZ3  . TRP A 1 62  ? -13.310 -1.885  5.479   1.00 15.00 ?  104 TRP A HZ3  3  
ATOM   7660   H  HH2  . TRP A 1 62  ? -12.960 -2.826  7.706   1.00 15.00 ?  104 TRP A HH2  3  
ATOM   7661   N  N    . ILE A 1 63  ? -16.932 -2.834  2.697   1.00 15.00 ?  105 ILE A N    3  
ATOM   7662   C  CA   . ILE A 1 63  ? -16.979 -1.485  3.236   1.00 15.00 ?  105 ILE A CA   3  
ATOM   7663   C  C    . ILE A 1 63  ? -18.423 -1.021  3.393   1.00 15.00 ?  105 ILE A C    3  
ATOM   7664   O  O    . ILE A 1 63  ? -18.778 -0.397  4.387   1.00 15.00 ?  105 ILE A O    3  
ATOM   7665   C  CB   . ILE A 1 63  ? -16.211 -0.494  2.332   1.00 15.00 ?  105 ILE A CB   3  
ATOM   7666   C  CG1  . ILE A 1 63  ? -14.719 -0.840  2.320   1.00 15.00 ?  105 ILE A CG1  3  
ATOM   7667   C  CG2  . ILE A 1 63  ? -16.421 0.945   2.795   1.00 15.00 ?  105 ILE A CG2  3  
ATOM   7668   C  CD1  . ILE A 1 63  ? -13.906 -0.047  1.315   1.00 15.00 ?  105 ILE A CD1  3  
ATOM   7669   H  H    . ILE A 1 63  ? -16.479 -2.991  1.835   1.00 15.00 ?  105 ILE A H    3  
ATOM   7670   H  HA   . ILE A 1 63  ? -16.507 -1.495  4.209   1.00 15.00 ?  105 ILE A HA   3  
ATOM   7671   H  HB   . ILE A 1 63  ? -16.600 -0.582  1.331   1.00 15.00 ?  105 ILE A HB   3  
ATOM   7672   H  HG12 . ILE A 1 63  ? -14.305 -0.651  3.301   1.00 15.00 ?  105 ILE A HG12 3  
ATOM   7673   H  HG13 . ILE A 1 63  ? -14.603 -1.886  2.086   1.00 15.00 ?  105 ILE A HG13 3  
ATOM   7674   H  HG21 . ILE A 1 63  ? -15.829 1.612   2.183   1.00 15.00 ?  105 ILE A HG21 3  
ATOM   7675   H  HG22 . ILE A 1 63  ? -16.122 1.038   3.826   1.00 15.00 ?  105 ILE A HG22 3  
ATOM   7676   H  HG23 . ILE A 1 63  ? -17.466 1.202   2.701   1.00 15.00 ?  105 ILE A HG23 3  
ATOM   7677   H  HD11 . ILE A 1 63  ? -12.855 -0.262  1.453   1.00 15.00 ?  105 ILE A HD11 3  
ATOM   7678   H  HD12 . ILE A 1 63  ? -14.078 1.009   1.461   1.00 15.00 ?  105 ILE A HD12 3  
ATOM   7679   H  HD13 . ILE A 1 63  ? -14.199 -0.325  0.313   1.00 15.00 ?  105 ILE A HD13 3  
ATOM   7680   N  N    . LYS A 1 64  ? -19.258 -1.355  2.423   1.00 15.00 ?  106 LYS A N    3  
ATOM   7681   C  CA   . LYS A 1 64  ? -20.664 -0.971  2.449   1.00 15.00 ?  106 LYS A CA   3  
ATOM   7682   C  C    . LYS A 1 64  ? -21.427 -1.711  3.555   1.00 15.00 ?  106 LYS A C    3  
ATOM   7683   O  O    . LYS A 1 64  ? -22.358 -1.170  4.147   1.00 15.00 ?  106 LYS A O    3  
ATOM   7684   C  CB   . LYS A 1 64  ? -21.303 -1.257  1.082   1.00 15.00 ?  106 LYS A CB   3  
ATOM   7685   C  CG   . LYS A 1 64  ? -22.820 -1.102  1.048   1.00 15.00 ?  106 LYS A CG   3  
ATOM   7686   C  CD   . LYS A 1 64  ? -23.255 0.318   1.374   1.00 15.00 ?  106 LYS A CD   3  
ATOM   7687   C  CE   . LYS A 1 64  ? -24.768 0.452   1.358   1.00 15.00 ?  106 LYS A CE   3  
ATOM   7688   N  NZ   . LYS A 1 64  ? -25.197 1.822   1.728   1.00 15.00 1  106 LYS A NZ   3  
ATOM   7689   H  H    . LYS A 1 64  ? -18.922 -1.881  1.664   1.00 15.00 ?  106 LYS A H    3  
ATOM   7690   H  HA   . LYS A 1 64  ? -20.714 0.089   2.643   1.00 15.00 ?  106 LYS A HA   3  
ATOM   7691   H  HB2  . LYS A 1 64  ? -20.881 -0.579  0.354   1.00 15.00 ?  106 LYS A HB2  3  
ATOM   7692   H  HB3  . LYS A 1 64  ? -21.061 -2.271  0.795   1.00 15.00 ?  106 LYS A HB3  3  
ATOM   7693   H  HG2  . LYS A 1 64  ? -23.174 -1.356  0.061   1.00 15.00 ?  106 LYS A HG2  3  
ATOM   7694   H  HG3  . LYS A 1 64  ? -23.255 -1.778  1.770   1.00 15.00 ?  106 LYS A HG3  3  
ATOM   7695   H  HD2  . LYS A 1 64  ? -22.895 0.578   2.356   1.00 15.00 ?  106 LYS A HD2  3  
ATOM   7696   H  HD3  . LYS A 1 64  ? -22.835 0.992   0.642   1.00 15.00 ?  106 LYS A HD3  3  
ATOM   7697   H  HE2  . LYS A 1 64  ? -25.127 0.228   0.366   1.00 15.00 ?  106 LYS A HE2  3  
ATOM   7698   H  HE3  . LYS A 1 64  ? -25.192 -0.252  2.063   1.00 15.00 ?  106 LYS A HE3  3  
ATOM   7699   H  HZ1  . LYS A 1 64  ? -24.739 2.521   1.102   1.00 15.00 ?  106 LYS A HZ1  3  
ATOM   7700   H  HZ2  . LYS A 1 64  ? -24.932 2.024   2.715   1.00 15.00 ?  106 LYS A HZ2  3  
ATOM   7701   H  HZ3  . LYS A 1 64  ? -26.225 1.914   1.636   1.00 15.00 ?  106 LYS A HZ3  3  
ATOM   7702   N  N    . GLN A 1 65  ? -21.014 -2.933  3.843   1.00 15.00 ?  107 GLN A N    3  
ATOM   7703   C  CA   . GLN A 1 65  ? -21.685 -3.745  4.855   1.00 15.00 ?  107 GLN A CA   3  
ATOM   7704   C  C    . GLN A 1 65  ? -21.192 -3.447  6.277   1.00 15.00 ?  107 GLN A C    3  
ATOM   7705   O  O    . GLN A 1 65  ? -21.996 -3.253  7.186   1.00 15.00 ?  107 GLN A O    3  
ATOM   7706   C  CB   . GLN A 1 65  ? -21.485 -5.232  4.549   1.00 15.00 ?  107 GLN A CB   3  
ATOM   7707   C  CG   . GLN A 1 65  ? -22.280 -6.160  5.458   1.00 15.00 ?  107 GLN A CG   3  
ATOM   7708   C  CD   . GLN A 1 65  ? -21.786 -7.589  5.392   1.00 15.00 ?  107 GLN A CD   3  
ATOM   7709   O  OE1  . GLN A 1 65  ? -22.207 -8.365  4.533   1.00 15.00 ?  107 GLN A OE1  3  
ATOM   7710   N  NE2  . GLN A 1 65  ? -20.894 -7.949  6.301   1.00 15.00 ?  107 GLN A NE2  3  
ATOM   7711   H  H    . GLN A 1 65  ? -20.245 -3.305  3.361   1.00 15.00 ?  107 GLN A H    3  
ATOM   7712   H  HA   . GLN A 1 65  ? -22.739 -3.524  4.805   1.00 15.00 ?  107 GLN A HA   3  
ATOM   7713   H  HB2  . GLN A 1 65  ? -21.783 -5.420  3.530   1.00 15.00 ?  107 GLN A HB2  3  
ATOM   7714   H  HB3  . GLN A 1 65  ? -20.436 -5.472  4.658   1.00 15.00 ?  107 GLN A HB3  3  
ATOM   7715   H  HG2  . GLN A 1 65  ? -22.194 -5.812  6.475   1.00 15.00 ?  107 GLN A HG2  3  
ATOM   7716   H  HG3  . GLN A 1 65  ? -23.317 -6.139  5.160   1.00 15.00 ?  107 GLN A HG3  3  
ATOM   7717   H  HE21 . GLN A 1 65  ? -20.603 -7.273  6.966   1.00 15.00 ?  107 GLN A HE21 3  
ATOM   7718   H  HE22 . GLN A 1 65  ? -20.561 -8.867  6.284   1.00 15.00 ?  107 GLN A HE22 3  
ATOM   7719   N  N    . GLU A 1 66  ? -19.880 -3.411  6.464   1.00 15.00 ?  108 GLU A N    3  
ATOM   7720   C  CA   . GLU A 1 66  ? -19.298 -3.185  7.788   1.00 15.00 ?  108 GLU A CA   3  
ATOM   7721   C  C    . GLU A 1 66  ? -19.215 -1.701  8.160   1.00 15.00 ?  108 GLU A C    3  
ATOM   7722   O  O    . GLU A 1 66  ? -19.440 -1.335  9.314   1.00 15.00 ?  108 GLU A O    3  
ATOM   7723   C  CB   . GLU A 1 66  ? -17.905 -3.821  7.849   1.00 15.00 ?  108 GLU A CB   3  
ATOM   7724   C  CG   . GLU A 1 66  ? -17.890 -5.297  7.469   1.00 15.00 ?  108 GLU A CG   3  
ATOM   7725   C  CD   . GLU A 1 66  ? -18.637 -6.172  8.453   1.00 15.00 ?  108 GLU A CD   3  
ATOM   7726   O  OE1  . GLU A 1 66  ? -18.014 -6.664  9.414   1.00 15.00 ?  108 GLU A OE1  3  
ATOM   7727   O  OE2  . GLU A 1 66  ? -19.855 -6.380  8.270   1.00 15.00 -1 108 GLU A OE2  3  
ATOM   7728   H  H    . GLU A 1 66  ? -19.280 -3.550  5.695   1.00 15.00 ?  108 GLU A H    3  
ATOM   7729   H  HA   . GLU A 1 66  ? -19.931 -3.680  8.508   1.00 15.00 ?  108 GLU A HA   3  
ATOM   7730   H  HB2  . GLU A 1 66  ? -17.251 -3.287  7.176   1.00 15.00 ?  108 GLU A HB2  3  
ATOM   7731   H  HB3  . GLU A 1 66  ? -17.522 -3.728  8.855   1.00 15.00 ?  108 GLU A HB3  3  
ATOM   7732   H  HG2  . GLU A 1 66  ? -18.344 -5.410  6.495   1.00 15.00 ?  108 GLU A HG2  3  
ATOM   7733   H  HG3  . GLU A 1 66  ? -16.863 -5.632  7.422   1.00 15.00 ?  108 GLU A HG3  3  
ATOM   7734   N  N    . ILE A 1 67  ? -18.907 -0.849  7.197   1.00 15.00 ?  109 ILE A N    3  
ATOM   7735   C  CA   . ILE A 1 67  ? -18.782 0.578   7.472   1.00 15.00 ?  109 ILE A CA   3  
ATOM   7736   C  C    . ILE A 1 67  ? -20.016 1.348   7.010   1.00 15.00 ?  109 ILE A C    3  
ATOM   7737   O  O    . ILE A 1 67  ? -20.508 2.222   7.722   1.00 15.00 ?  109 ILE A O    3  
ATOM   7738   C  CB   . ILE A 1 67  ? -17.518 1.161   6.803   1.00 15.00 ?  109 ILE A CB   3  
ATOM   7739   C  CG1  . ILE A 1 67  ? -16.289 0.312   7.150   1.00 15.00 ?  109 ILE A CG1  3  
ATOM   7740   C  CG2  . ILE A 1 67  ? -17.308 2.601   7.243   1.00 15.00 ?  109 ILE A CG2  3  
ATOM   7741   C  CD1  . ILE A 1 67  ? -15.038 0.705   6.394   1.00 15.00 ?  109 ILE A CD1  3  
ATOM   7742   H  H    . ILE A 1 67  ? -18.774 -1.179  6.282   1.00 15.00 ?  109 ILE A H    3  
ATOM   7743   H  HA   . ILE A 1 67  ? -18.683 0.699   8.540   1.00 15.00 ?  109 ILE A HA   3  
ATOM   7744   H  HB   . ILE A 1 67  ? -17.667 1.151   5.735   1.00 15.00 ?  109 ILE A HB   3  
ATOM   7745   H  HG12 . ILE A 1 67  ? -16.080 0.407   8.203   1.00 15.00 ?  109 ILE A HG12 3  
ATOM   7746   H  HG13 . ILE A 1 67  ? -16.502 -0.723  6.923   1.00 15.00 ?  109 ILE A HG13 3  
ATOM   7747   H  HG21 . ILE A 1 67  ? -18.168 3.188   6.962   1.00 15.00 ?  109 ILE A HG21 3  
ATOM   7748   H  HG22 . ILE A 1 67  ? -16.427 3.001   6.767   1.00 15.00 ?  109 ILE A HG22 3  
ATOM   7749   H  HG23 . ILE A 1 67  ? -17.186 2.633   8.316   1.00 15.00 ?  109 ILE A HG23 3  
ATOM   7750   H  HD11 . ILE A 1 67  ? -15.025 1.777   6.253   1.00 15.00 ?  109 ILE A HD11 3  
ATOM   7751   H  HD12 . ILE A 1 67  ? -15.027 0.213   5.434   1.00 15.00 ?  109 ILE A HD12 3  
ATOM   7752   H  HD13 . ILE A 1 67  ? -14.169 0.407   6.962   1.00 15.00 ?  109 ILE A HD13 3  
ATOM   7753   N  N    . ASN A 1 68  ? -20.493 1.021   5.810   1.00 15.00 ?  110 ASN A N    3  
ATOM   7754   C  CA   . ASN A 1 68  ? -21.679 1.652   5.215   1.00 15.00 ?  110 ASN A CA   3  
ATOM   7755   C  C    . ASN A 1 68  ? -21.375 3.080   4.758   1.00 15.00 ?  110 ASN A C    3  
ATOM   7756   O  O    . ASN A 1 68  ? -22.274 3.830   4.369   1.00 15.00 ?  110 ASN A O    3  
ATOM   7757   C  CB   . ASN A 1 68  ? -22.872 1.630   6.190   1.00 15.00 ?  110 ASN A CB   3  
ATOM   7758   C  CG   . ASN A 1 68  ? -24.194 1.964   5.523   1.00 15.00 ?  110 ASN A CG   3  
ATOM   7759   O  OD1  . ASN A 1 68  ? -24.396 1.695   4.339   1.00 15.00 ?  110 ASN A OD1  3  
ATOM   7760   N  ND2  . ASN A 1 68  ? -25.103 2.548   6.286   1.00 15.00 ?  110 ASN A ND2  3  
ATOM   7761   H  H    . ASN A 1 68  ? -20.019 0.335   5.292   1.00 15.00 ?  110 ASN A H    3  
ATOM   7762   H  HA   . ASN A 1 68  ? -21.941 1.074   4.342   1.00 15.00 ?  110 ASN A HA   3  
ATOM   7763   H  HB2  . ASN A 1 68  ? -22.955 0.644   6.625   1.00 15.00 ?  110 ASN A HB2  3  
ATOM   7764   H  HB3  . ASN A 1 68  ? -22.696 2.350   6.976   1.00 15.00 ?  110 ASN A HB3  3  
ATOM   7765   H  HD21 . ASN A 1 68  ? -24.871 2.728   7.224   1.00 15.00 ?  110 ASN A HD21 3  
ATOM   7766   H  HD22 . ASN A 1 68  ? -25.970 2.772   5.889   1.00 15.00 ?  110 ASN A HD22 3  
ATOM   7767   N  N    . LEU A 1 69  ? -20.105 3.455   4.778   1.00 15.00 ?  111 LEU A N    3  
ATOM   7768   C  CA   . LEU A 1 69  ? -19.715 4.794   4.362   1.00 15.00 ?  111 LEU A CA   3  
ATOM   7769   C  C    . LEU A 1 69  ? -19.169 4.773   2.941   1.00 15.00 ?  111 LEU A C    3  
ATOM   7770   O  O    . LEU A 1 69  ? -18.526 3.805   2.531   1.00 15.00 ?  111 LEU A O    3  
ATOM   7771   C  CB   . LEU A 1 69  ? -18.677 5.382   5.316   1.00 15.00 ?  111 LEU A CB   3  
ATOM   7772   C  CG   . LEU A 1 69  ? -19.191 5.759   6.708   1.00 15.00 ?  111 LEU A CG   3  
ATOM   7773   C  CD1  . LEU A 1 69  ? -18.065 6.355   7.537   1.00 15.00 ?  111 LEU A CD1  3  
ATOM   7774   C  CD2  . LEU A 1 69  ? -20.354 6.739   6.610   1.00 15.00 ?  111 LEU A CD2  3  
ATOM   7775   H  H    . LEU A 1 69  ? -19.414 2.820   5.061   1.00 15.00 ?  111 LEU A H    3  
ATOM   7776   H  HA   . LEU A 1 69  ? -20.598 5.411   4.380   1.00 15.00 ?  111 LEU A HA   3  
ATOM   7777   H  HB2  . LEU A 1 69  ? -17.885 4.660   5.435   1.00 15.00 ?  111 LEU A HB2  3  
ATOM   7778   H  HB3  . LEU A 1 69  ? -18.264 6.269   4.861   1.00 15.00 ?  111 LEU A HB3  3  
ATOM   7779   H  HG   . LEU A 1 69  ? -19.542 4.869   7.207   1.00 15.00 ?  111 LEU A HG   3  
ATOM   7780   H  HD11 . LEU A 1 69  ? -18.483 6.884   8.379   1.00 15.00 ?  111 LEU A HD11 3  
ATOM   7781   H  HD12 . LEU A 1 69  ? -17.497 7.041   6.927   1.00 15.00 ?  111 LEU A HD12 3  
ATOM   7782   H  HD13 . LEU A 1 69  ? -17.419 5.566   7.894   1.00 15.00 ?  111 LEU A HD13 3  
ATOM   7783   H  HD21 . LEU A 1 69  ? -20.584 7.124   7.591   1.00 15.00 ?  111 LEU A HD21 3  
ATOM   7784   H  HD22 . LEU A 1 69  ? -21.218 6.230   6.214   1.00 15.00 ?  111 LEU A HD22 3  
ATOM   7785   H  HD23 . LEU A 1 69  ? -20.085 7.556   5.956   1.00 15.00 ?  111 LEU A HD23 3  
ATOM   7786   N  N    . PRO A 1 70  ? -19.445 5.835   2.165   1.00 15.00 ?  112 PRO A N    3  
ATOM   7787   C  CA   . PRO A 1 70  ? -18.979 5.944   0.779   1.00 15.00 ?  112 PRO A CA   3  
ATOM   7788   C  C    . PRO A 1 70  ? -17.479 6.214   0.679   1.00 15.00 ?  112 PRO A C    3  
ATOM   7789   O  O    . PRO A 1 70  ? -16.890 6.888   1.529   1.00 15.00 ?  112 PRO A O    3  
ATOM   7790   C  CB   . PRO A 1 70  ? -19.773 7.133   0.231   1.00 15.00 ?  112 PRO A CB   3  
ATOM   7791   C  CG   . PRO A 1 70  ? -20.108 7.961   1.420   1.00 15.00 ?  112 PRO A CG   3  
ATOM   7792   C  CD   . PRO A 1 70  ? -20.254 7.004   2.571   1.00 15.00 ?  112 PRO A CD   3  
ATOM   7793   H  HA   . PRO A 1 70  ? -19.218 5.056   0.211   1.00 15.00 ?  112 PRO A HA   3  
ATOM   7794   H  HB2  . PRO A 1 70  ? -19.165 7.690   -0.471  1.00 15.00 ?  112 PRO A HB2  3  
ATOM   7795   H  HB3  . PRO A 1 70  ? -20.675 6.788   -0.247  1.00 15.00 ?  112 PRO A HB3  3  
ATOM   7796   H  HG2  . PRO A 1 70  ? -19.310 8.667   1.608   1.00 15.00 ?  112 PRO A HG2  3  
ATOM   7797   H  HG3  . PRO A 1 70  ? -21.038 8.479   1.254   1.00 15.00 ?  112 PRO A HG3  3  
ATOM   7798   H  HD2  . PRO A 1 70  ? -19.867 7.442   3.481   1.00 15.00 ?  112 PRO A HD2  3  
ATOM   7799   H  HD3  . PRO A 1 70  ? -21.290 6.727   2.698   1.00 15.00 ?  112 PRO A HD3  3  
ATOM   7800   N  N    . VAL A 1 71  ? -16.870 5.684   -0.371  1.00 15.00 ?  113 VAL A N    3  
ATOM   7801   C  CA   . VAL A 1 71  ? -15.444 5.860   -0.605  1.00 15.00 ?  113 VAL A CA   3  
ATOM   7802   C  C    . VAL A 1 71  ? -15.187 7.203   -1.288  1.00 15.00 ?  113 VAL A C    3  
ATOM   7803   O  O    . VAL A 1 71  ? -15.782 7.501   -2.324  1.00 15.00 ?  113 VAL A O    3  
ATOM   7804   C  CB   . VAL A 1 71  ? -14.876 4.721   -1.479  1.00 15.00 ?  113 VAL A CB   3  
ATOM   7805   C  CG1  . VAL A 1 71  ? -13.356 4.802   -1.557  1.00 15.00 ?  113 VAL A CG1  3  
ATOM   7806   C  CG2  . VAL A 1 71  ? -15.316 3.363   -0.946  1.00 15.00 ?  113 VAL A CG2  3  
ATOM   7807   H  H    . VAL A 1 71  ? -17.397 5.163   -1.010  1.00 15.00 ?  113 VAL A H    3  
ATOM   7808   H  HA   . VAL A 1 71  ? -14.941 5.845   0.352   1.00 15.00 ?  113 VAL A HA   3  
ATOM   7809   H  HB   . VAL A 1 71  ? -15.270 4.836   -2.479  1.00 15.00 ?  113 VAL A HB   3  
ATOM   7810   H  HG11 . VAL A 1 71  ? -13.068 5.766   -1.951  1.00 15.00 ?  113 VAL A HG11 3  
ATOM   7811   H  HG12 . VAL A 1 71  ? -12.986 4.021   -2.207  1.00 15.00 ?  113 VAL A HG12 3  
ATOM   7812   H  HG13 . VAL A 1 71  ? -12.937 4.677   -0.570  1.00 15.00 ?  113 VAL A HG13 3  
ATOM   7813   H  HG21 . VAL A 1 71  ? -16.378 3.381   -0.747  1.00 15.00 ?  113 VAL A HG21 3  
ATOM   7814   H  HG22 . VAL A 1 71  ? -14.780 3.143   -0.032  1.00 15.00 ?  113 VAL A HG22 3  
ATOM   7815   H  HG23 . VAL A 1 71  ? -15.102 2.601   -1.681  1.00 15.00 ?  113 VAL A HG23 3  
ATOM   7816   N  N    . ALA A 1 72  ? -14.309 8.010   -0.709  1.00 15.00 ?  114 ALA A N    3  
ATOM   7817   C  CA   . ALA A 1 72  ? -14.000 9.321   -1.265  1.00 15.00 ?  114 ALA A CA   3  
ATOM   7818   C  C    . ALA A 1 72  ? -12.941 9.231   -2.356  1.00 15.00 ?  114 ALA A C    3  
ATOM   7819   O  O    . ALA A 1 72  ? -13.169 9.655   -3.488  1.00 15.00 ?  114 ALA A O    3  
ATOM   7820   C  CB   . ALA A 1 72  ? -13.551 10.269  -0.166  1.00 15.00 ?  114 ALA A CB   3  
ATOM   7821   H  H    . ALA A 1 72  ? -13.848 7.710   0.109   1.00 15.00 ?  114 ALA A H    3  
ATOM   7822   H  HA   . ALA A 1 72  ? -14.909 9.716   -1.695  1.00 15.00 ?  114 ALA A HA   3  
ATOM   7823   H  HB1  . ALA A 1 72  ? -13.298 11.228  -0.596  1.00 15.00 ?  114 ALA A HB1  3  
ATOM   7824   H  HB2  . ALA A 1 72  ? -12.687 9.860   0.334   1.00 15.00 ?  114 ALA A HB2  3  
ATOM   7825   H  HB3  . ALA A 1 72  ? -14.353 10.395  0.546   1.00 15.00 ?  114 ALA A HB3  3  
ATOM   7826   N  N    . LEU A 1 73  ? -11.786 8.683   -2.013  1.00 15.00 ?  115 LEU A N    3  
ATOM   7827   C  CA   . LEU A 1 73  ? -10.693 8.543   -2.962  1.00 15.00 ?  115 LEU A CA   3  
ATOM   7828   C  C    . LEU A 1 73  ? -9.851  7.319   -2.630  1.00 15.00 ?  115 LEU A C    3  
ATOM   7829   O  O    . LEU A 1 73  ? -9.926  6.782   -1.516  1.00 15.00 ?  115 LEU A O    3  
ATOM   7830   C  CB   . LEU A 1 73  ? -9.817  9.805   -2.967  1.00 15.00 ?  115 LEU A CB   3  
ATOM   7831   C  CG   . LEU A 1 73  ? -9.079  10.104  -1.657  1.00 15.00 ?  115 LEU A CG   3  
ATOM   7832   C  CD1  . LEU A 1 73  ? -7.594  9.816   -1.800  1.00 15.00 ?  115 LEU A CD1  3  
ATOM   7833   C  CD2  . LEU A 1 73  ? -9.300  11.549  -1.239  1.00 15.00 ?  115 LEU A CD2  3  
ATOM   7834   H  H    . LEU A 1 73  ? -11.662 8.359   -1.098  1.00 15.00 ?  115 LEU A H    3  
ATOM   7835   H  HA   . LEU A 1 73  ? -11.118 8.409   -3.946  1.00 15.00 ?  115 LEU A HA   3  
ATOM   7836   H  HB2  . LEU A 1 73  ? -9.082  9.706   -3.753  1.00 15.00 ?  115 LEU A HB2  3  
ATOM   7837   H  HB3  . LEU A 1 73  ? -10.448 10.649  -3.195  1.00 15.00 ?  115 LEU A HB3  3  
ATOM   7838   H  HG   . LEU A 1 73  ? -9.468  9.466   -0.876  1.00 15.00 ?  115 LEU A HG   3  
ATOM   7839   H  HD11 . LEU A 1 73  ? -7.215  10.328  -2.671  1.00 15.00 ?  115 LEU A HD11 3  
ATOM   7840   H  HD12 . LEU A 1 73  ? -7.443  8.753   -1.912  1.00 15.00 ?  115 LEU A HD12 3  
ATOM   7841   H  HD13 . LEU A 1 73  ? -7.073  10.163  -0.920  1.00 15.00 ?  115 LEU A HD13 3  
ATOM   7842   H  HD21 . LEU A 1 73  ? -10.335 11.689  -0.966  1.00 15.00 ?  115 LEU A HD21 3  
ATOM   7843   H  HD22 . LEU A 1 73  ? -9.053  12.202  -2.063  1.00 15.00 ?  115 LEU A HD22 3  
ATOM   7844   H  HD23 . LEU A 1 73  ? -8.668  11.780  -0.393  1.00 15.00 ?  115 LEU A HD23 3  
ATOM   7845   N  N    . ALA A 1 74  ? -9.064  6.878   -3.596  1.00 15.00 ?  116 ALA A N    3  
ATOM   7846   C  CA   . ALA A 1 74  ? -8.200  5.728   -3.416  1.00 15.00 ?  116 ALA A CA   3  
ATOM   7847   C  C    . ALA A 1 74  ? -6.793  6.029   -3.924  1.00 15.00 ?  116 ALA A C    3  
ATOM   7848   O  O    . ALA A 1 74  ? -6.615  6.539   -5.029  1.00 15.00 ?  116 ALA A O    3  
ATOM   7849   C  CB   . ALA A 1 74  ? -8.783  4.518   -4.128  1.00 15.00 ?  116 ALA A CB   3  
ATOM   7850   H  H    . ALA A 1 74  ? -9.065  7.342   -4.465  1.00 15.00 ?  116 ALA A H    3  
ATOM   7851   H  HA   . ALA A 1 74  ? -8.154  5.506   -2.361  1.00 15.00 ?  116 ALA A HA   3  
ATOM   7852   H  HB1  . ALA A 1 74  ? -8.203  3.641   -3.885  1.00 15.00 ?  116 ALA A HB1  3  
ATOM   7853   H  HB2  . ALA A 1 74  ? -8.757  4.683   -5.193  1.00 15.00 ?  116 ALA A HB2  3  
ATOM   7854   H  HB3  . ALA A 1 74  ? -9.806  4.372   -3.813  1.00 15.00 ?  116 ALA A HB3  3  
ATOM   7855   N  N    . VAL A 1 75  ? -5.801  5.731   -3.107  1.00 15.00 ?  117 VAL A N    3  
ATOM   7856   C  CA   . VAL A 1 75  ? -4.416  5.971   -3.476  1.00 15.00 ?  117 VAL A CA   3  
ATOM   7857   C  C    . VAL A 1 75  ? -3.630  4.662   -3.468  1.00 15.00 ?  117 VAL A C    3  
ATOM   7858   O  O    . VAL A 1 75  ? -3.819  3.828   -2.586  1.00 15.00 ?  117 VAL A O    3  
ATOM   7859   C  CB   . VAL A 1 75  ? -3.762  7.009   -2.532  1.00 15.00 ?  117 VAL A CB   3  
ATOM   7860   C  CG1  . VAL A 1 75  ? -3.755  6.524   -1.086  1.00 15.00 ?  117 VAL A CG1  3  
ATOM   7861   C  CG2  . VAL A 1 75  ? -2.355  7.350   -2.992  1.00 15.00 ?  117 VAL A CG2  3  
ATOM   7862   H  H    . VAL A 1 75  ? -6.001  5.331   -2.228  1.00 15.00 ?  117 VAL A H    3  
ATOM   7863   H  HA   . VAL A 1 75  ? -4.408  6.376   -4.479  1.00 15.00 ?  117 VAL A HA   3  
ATOM   7864   H  HB   . VAL A 1 75  ? -4.351  7.915   -2.574  1.00 15.00 ?  117 VAL A HB   3  
ATOM   7865   H  HG11 . VAL A 1 75  ? -4.760  6.268   -0.785  1.00 15.00 ?  117 VAL A HG11 3  
ATOM   7866   H  HG12 . VAL A 1 75  ? -3.378  7.310   -0.449  1.00 15.00 ?  117 VAL A HG12 3  
ATOM   7867   H  HG13 . VAL A 1 75  ? -3.121  5.654   -1.000  1.00 15.00 ?  117 VAL A HG13 3  
ATOM   7868   H  HG21 . VAL A 1 75  ? -2.395  7.782   -3.981  1.00 15.00 ?  117 VAL A HG21 3  
ATOM   7869   H  HG22 . VAL A 1 75  ? -1.757  6.454   -3.015  1.00 15.00 ?  117 VAL A HG22 3  
ATOM   7870   H  HG23 . VAL A 1 75  ? -1.914  8.060   -2.308  1.00 15.00 ?  117 VAL A HG23 3  
ATOM   7871   N  N    . VAL A 1 76  ? -2.776  4.466   -4.465  1.00 15.00 ?  118 VAL A N    3  
ATOM   7872   C  CA   . VAL A 1 76  ? -1.979  3.246   -4.547  1.00 15.00 ?  118 VAL A CA   3  
ATOM   7873   C  C    . VAL A 1 76  ? -0.514  3.543   -4.246  1.00 15.00 ?  118 VAL A C    3  
ATOM   7874   O  O    . VAL A 1 76  ? -0.083  4.694   -4.330  1.00 15.00 ?  118 VAL A O    3  
ATOM   7875   C  CB   . VAL A 1 76  ? -2.111  2.564   -5.926  1.00 15.00 ?  118 VAL A CB   3  
ATOM   7876   C  CG1  . VAL A 1 76  ? -3.525  2.030   -6.120  1.00 15.00 ?  118 VAL A CG1  3  
ATOM   7877   C  CG2  . VAL A 1 76  ? -1.740  3.535   -7.036  1.00 15.00 ?  118 VAL A CG2  3  
ATOM   7878   H  H    . VAL A 1 76  ? -2.671  5.159   -5.153  1.00 15.00 ?  118 VAL A H    3  
ATOM   7879   H  HA   . VAL A 1 76  ? -2.352  2.564   -3.799  1.00 15.00 ?  118 VAL A HA   3  
ATOM   7880   H  HB   . VAL A 1 76  ? -1.428  1.728   -5.961  1.00 15.00 ?  118 VAL A HB   3  
ATOM   7881   H  HG11 . VAL A 1 76  ? -4.229  2.844   -6.046  1.00 15.00 ?  118 VAL A HG11 3  
ATOM   7882   H  HG12 . VAL A 1 76  ? -3.740  1.296   -5.358  1.00 15.00 ?  118 VAL A HG12 3  
ATOM   7883   H  HG13 . VAL A 1 76  ? -3.609  1.570   -7.095  1.00 15.00 ?  118 VAL A HG13 3  
ATOM   7884   H  HG21 . VAL A 1 76  ? -2.366  4.411   -6.967  1.00 15.00 ?  118 VAL A HG21 3  
ATOM   7885   H  HG22 . VAL A 1 76  ? -1.885  3.060   -7.995  1.00 15.00 ?  118 VAL A HG22 3  
ATOM   7886   H  HG23 . VAL A 1 76  ? -0.707  3.825   -6.927  1.00 15.00 ?  118 VAL A HG23 3  
ATOM   7887   N  N    . THR A 1 77  ? 0.241   2.511   -3.887  1.00 15.00 ?  119 THR A N    3  
ATOM   7888   C  CA   . THR A 1 77  ? 1.652   2.677   -3.548  1.00 15.00 ?  119 THR A CA   3  
ATOM   7889   C  C    . THR A 1 77  ? 2.579   2.612   -4.762  1.00 15.00 ?  119 THR A C    3  
ATOM   7890   O  O    . THR A 1 77  ? 3.549   3.370   -4.835  1.00 15.00 ?  119 THR A O    3  
ATOM   7891   C  CB   . THR A 1 77  ? 2.101   1.631   -2.513  1.00 15.00 ?  119 THR A CB   3  
ATOM   7892   O  OG1  . THR A 1 77  ? 1.639   0.328   -2.892  1.00 15.00 ?  119 THR A OG1  3  
ATOM   7893   C  CG2  . THR A 1 77  ? 1.574   1.982   -1.129  1.00 15.00 ?  119 THR A CG2  3  
ATOM   7894   H  H    . THR A 1 77  ? -0.170  1.616   -3.816  1.00 15.00 ?  119 THR A H    3  
ATOM   7895   H  HA   . THR A 1 77  ? 1.761   3.651   -3.091  1.00 15.00 ?  119 THR A HA   3  
ATOM   7896   H  HB   . THR A 1 77  ? 3.180   1.622   -2.476  1.00 15.00 ?  119 THR A HB   3  
ATOM   7897   H  HG1  . THR A 1 77  ? 0.736   0.194   -2.546  1.00 15.00 ?  119 THR A HG1  3  
ATOM   7898   H  HG21 . THR A 1 77  ? 1.921   2.965   -0.850  1.00 15.00 ?  119 THR A HG21 3  
ATOM   7899   H  HG22 . THR A 1 77  ? 1.933   1.258   -0.415  1.00 15.00 ?  119 THR A HG22 3  
ATOM   7900   H  HG23 . THR A 1 77  ? 0.493   1.974   -1.143  1.00 15.00 ?  119 THR A HG23 3  
ATOM   7901   N  N    . HIS A 1 78  ? 2.318   1.702   -5.700  1.00 15.00 ?  120 HIS A N    3  
ATOM   7902   C  CA   . HIS A 1 78  ? 3.168   1.586   -6.883  1.00 15.00 ?  120 HIS A CA   3  
ATOM   7903   C  C    . HIS A 1 78  ? 2.494   0.792   -7.992  1.00 15.00 ?  120 HIS A C    3  
ATOM   7904   O  O    . HIS A 1 78  ? 1.491   0.111   -7.768  1.00 15.00 ?  120 HIS A O    3  
ATOM   7905   C  CB   . HIS A 1 78  ? 4.531   0.973   -6.533  1.00 15.00 ?  120 HIS A CB   3  
ATOM   7906   C  CG   . HIS A 1 78  ? 4.498   -0.442  -6.041  1.00 15.00 ?  120 HIS A CG   3  
ATOM   7907   N  ND1  . HIS A 1 78  ? 3.911   -0.834  -4.859  1.00 15.00 ?  120 HIS A ND1  3  
ATOM   7908   C  CD2  . HIS A 1 78  ? 5.032   -1.564  -6.584  1.00 15.00 ?  120 HIS A CD2  3  
ATOM   7909   C  CE1  . HIS A 1 78  ? 4.108   -2.149  -4.718  1.00 15.00 ?  120 HIS A CE1  3  
ATOM   7910   N  NE2  . HIS A 1 78  ? 4.786   -2.642  -5.739  1.00 15.00 ?  120 HIS A NE2  3  
ATOM   7911   H  H    . HIS A 1 78  ? 1.542   1.108   -5.603  1.00 15.00 ?  120 HIS A H    3  
ATOM   7912   H  HA   . HIS A 1 78  ? 3.334   2.586   -7.248  1.00 15.00 ?  120 HIS A HA   3  
ATOM   7913   H  HB2  . HIS A 1 78  ? 5.156   0.993   -7.414  1.00 15.00 ?  120 HIS A HB2  3  
ATOM   7914   H  HB3  . HIS A 1 78  ? 4.990   1.573   -5.766  1.00 15.00 ?  120 HIS A HB3  3  
ATOM   7915   H  HD1  . HIS A 1 78  ? 3.419   -0.253  -4.236  1.00 15.00 ?  120 HIS A HD1  3  
ATOM   7916   H  HD2  . HIS A 1 78  ? 5.567   -1.622  -7.518  1.00 15.00 ?  120 HIS A HD2  3  
ATOM   7917   H  HE1  . HIS A 1 78  ? 3.754   -2.733  -3.884  1.00 15.00 ?  120 HIS A HE1  3  
ATOM   7918   N  N    . ALA A 1 79  ? 3.070   0.879   -9.184  1.00 15.00 ?  121 ALA A N    3  
ATOM   7919   C  CA   . ALA A 1 79  ? 2.536   0.205   -10.358 1.00 15.00 ?  121 ALA A CA   3  
ATOM   7920   C  C    . ALA A 1 79  ? 2.900   -1.278  -10.411 1.00 15.00 ?  121 ALA A C    3  
ATOM   7921   O  O    . ALA A 1 79  ? 3.895   -1.668  -11.018 1.00 15.00 ?  121 ALA A O    3  
ATOM   7922   C  CB   . ALA A 1 79  ? 3.008   0.910   -11.624 1.00 15.00 ?  121 ALA A CB   3  
ATOM   7923   H  H    . ALA A 1 79  ? 3.886   1.432   -9.277  1.00 15.00 ?  121 ALA A H    3  
ATOM   7924   H  HA   . ALA A 1 79  ? 1.459   0.292   -10.321 1.00 15.00 ?  121 ALA A HA   3  
ATOM   7925   H  HB1  . ALA A 1 79  ? 2.586   1.902   -11.661 1.00 15.00 ?  121 ALA A HB1  3  
ATOM   7926   H  HB2  . ALA A 1 79  ? 2.687   0.349   -12.489 1.00 15.00 ?  121 ALA A HB2  3  
ATOM   7927   H  HB3  . ALA A 1 79  ? 4.086   0.976   -11.618 1.00 15.00 ?  121 ALA A HB3  3  
ATOM   7928   N  N    . HIS A 1 80  ? 2.087   -2.095  -9.756  1.00 15.00 ?  122 HIS A N    3  
ATOM   7929   C  CA   . HIS A 1 80  ? 2.267   -3.545  -9.742  1.00 15.00 ?  122 HIS A CA   3  
ATOM   7930   C  C    . HIS A 1 80  ? 0.892   -4.199  -9.590  1.00 15.00 ?  122 HIS A C    3  
ATOM   7931   O  O    . HIS A 1 80  ? -0.049  -3.543  -9.143  1.00 15.00 ?  122 HIS A O    3  
ATOM   7932   C  CB   . HIS A 1 80  ? 3.228   -3.989  -8.630  1.00 15.00 ?  122 HIS A CB   3  
ATOM   7933   C  CG   . HIS A 1 80  ? 4.626   -4.293  -9.111  1.00 15.00 ?  122 HIS A CG   3  
ATOM   7934   N  ND1  . HIS A 1 80  ? 5.674   -4.444  -8.227  1.00 15.00 ?  122 HIS A ND1  3  
ATOM   7935   C  CD2  . HIS A 1 80  ? 5.089   -4.483  -10.374 1.00 15.00 ?  122 HIS A CD2  3  
ATOM   7936   C  CE1  . HIS A 1 80  ? 6.736   -4.723  -8.965  1.00 15.00 ?  122 HIS A CE1  3  
ATOM   7937   N  NE2  . HIS A 1 80  ? 6.431   -4.758  -10.266 1.00 15.00 ?  122 HIS A NE2  3  
ATOM   7938   H  H    . HIS A 1 80  ? 1.335   -1.708  -9.257  1.00 15.00 ?  122 HIS A H    3  
ATOM   7939   H  HA   . HIS A 1 80  ? 2.675   -3.830  -10.702 1.00 15.00 ?  122 HIS A HA   3  
ATOM   7940   H  HB2  . HIS A 1 80  ? 3.297   -3.206  -7.888  1.00 15.00 ?  122 HIS A HB2  3  
ATOM   7941   H  HB3  . HIS A 1 80  ? 2.836   -4.885  -8.163  1.00 15.00 ?  122 HIS A HB3  3  
ATOM   7942   H  HD2  . HIS A 1 80  ? 4.520   -4.431  -11.289 1.00 15.00 ?  122 HIS A HD2  3  
ATOM   7943   H  HE1  . HIS A 1 80  ? 7.726   -4.903  -8.566  1.00 15.00 ?  122 HIS A HE1  3  
ATOM   7944   H  HE2  . HIS A 1 80  ? 7.055   -4.937  -11.009 1.00 15.00 ?  122 HIS A HE2  3  
ATOM   7945   N  N    . GLN A 1 81  ? 0.770   -5.474  -9.943  1.00 15.00 ?  123 GLN A N    3  
ATOM   7946   C  CA   . GLN A 1 81  ? -0.519  -6.167  -9.893  1.00 15.00 ?  123 GLN A CA   3  
ATOM   7947   C  C    . GLN A 1 81  ? -1.084  -6.292  -8.482  1.00 15.00 ?  123 GLN A C    3  
ATOM   7948   O  O    . GLN A 1 81  ? -2.293  -6.204  -8.287  1.00 15.00 ?  123 GLN A O    3  
ATOM   7949   C  CB   . GLN A 1 81  ? -0.403  -7.565  -10.502 1.00 15.00 ?  123 GLN A CB   3  
ATOM   7950   C  CG   . GLN A 1 81  ? -1.744  -8.213  -10.800 1.00 15.00 ?  123 GLN A CG   3  
ATOM   7951   C  CD   . GLN A 1 81  ? -1.674  -9.727  -10.809 1.00 15.00 ?  123 GLN A CD   3  
ATOM   7952   O  OE1  . GLN A 1 81  ? -0.635  -10.317 -11.110 1.00 15.00 ?  123 GLN A OE1  3  
ATOM   7953   N  NE2  . GLN A 1 81  ? -2.779  -10.367 -10.470 1.00 15.00 ?  123 GLN A NE2  3  
ATOM   7954   H  H    . GLN A 1 81  ? 1.568   -5.971  -10.234 1.00 15.00 ?  123 GLN A H    3  
ATOM   7955   H  HA   . GLN A 1 81  ? -1.213  -5.596  -10.489 1.00 15.00 ?  123 GLN A HA   3  
ATOM   7956   H  HB2  . GLN A 1 81  ? 0.154   -7.500  -11.423 1.00 15.00 ?  123 GLN A HB2  3  
ATOM   7957   H  HB3  . GLN A 1 81  ? 0.131   -8.201  -9.811  1.00 15.00 ?  123 GLN A HB3  3  
ATOM   7958   H  HG2  . GLN A 1 81  ? -2.448  -7.906  -10.042 1.00 15.00 ?  123 GLN A HG2  3  
ATOM   7959   H  HG3  . GLN A 1 81  ? -2.088  -7.879  -11.769 1.00 15.00 ?  123 GLN A HG3  3  
ATOM   7960   H  HE21 . GLN A 1 81  ? -3.571  -9.831  -10.234 1.00 15.00 ?  123 GLN A HE21 3  
ATOM   7961   H  HE22 . GLN A 1 81  ? -2.766  -11.348 -10.472 1.00 15.00 ?  123 GLN A HE22 3  
ATOM   7962   N  N    . ASP A 1 82  ? -0.221  -6.479  -7.499  1.00 15.00 ?  124 ASP A N    3  
ATOM   7963   C  CA   . ASP A 1 82  ? -0.680  -6.660  -6.120  1.00 15.00 ?  124 ASP A CA   3  
ATOM   7964   C  C    . ASP A 1 82  ? -1.171  -5.361  -5.490  1.00 15.00 ?  124 ASP A C    3  
ATOM   7965   O  O    . ASP A 1 82  ? -1.711  -5.377  -4.386  1.00 15.00 ?  124 ASP A O    3  
ATOM   7966   C  CB   . ASP A 1 82  ? 0.423   -7.274  -5.253  1.00 15.00 ?  124 ASP A CB   3  
ATOM   7967   C  CG   . ASP A 1 82  ? 1.461   -6.266  -4.801  1.00 15.00 ?  124 ASP A CG   3  
ATOM   7968   O  OD1  . ASP A 1 82  ? 2.059   -5.596  -5.660  1.00 15.00 ?  124 ASP A OD1  3  
ATOM   7969   O  OD2  . ASP A 1 82  ? 1.703   -6.161  -3.575  1.00 15.00 -1 124 ASP A OD2  3  
ATOM   7970   H  H    . ASP A 1 82  ? 0.740   -6.496  -7.696  1.00 15.00 ?  124 ASP A H    3  
ATOM   7971   H  HA   . ASP A 1 82  ? -1.508  -7.352  -6.152  1.00 15.00 ?  124 ASP A HA   3  
ATOM   7972   H  HB2  . ASP A 1 82  ? -0.027  -7.711  -4.375  1.00 15.00 ?  124 ASP A HB2  3  
ATOM   7973   H  HB3  . ASP A 1 82  ? 0.919   -8.050  -5.818  1.00 15.00 ?  124 ASP A HB3  3  
ATOM   7974   N  N    . LYS A 1 83  ? -0.994  -4.244  -6.186  1.00 15.00 ?  125 LYS A N    3  
ATOM   7975   C  CA   . LYS A 1 83  ? -1.418  -2.952  -5.655  1.00 15.00 ?  125 LYS A CA   3  
ATOM   7976   C  C    . LYS A 1 83  ? -2.342  -2.214  -6.622  1.00 15.00 ?  125 LYS A C    3  
ATOM   7977   O  O    . LYS A 1 83  ? -3.193  -1.430  -6.196  1.00 15.00 ?  125 LYS A O    3  
ATOM   7978   C  CB   . LYS A 1 83  ? -0.199  -2.080  -5.342  1.00 15.00 ?  125 LYS A CB   3  
ATOM   7979   C  CG   . LYS A 1 83  ? 0.923   -2.816  -4.625  1.00 15.00 ?  125 LYS A CG   3  
ATOM   7980   C  CD   . LYS A 1 83  ? 0.838   -2.671  -3.110  1.00 15.00 ?  125 LYS A CD   3  
ATOM   7981   C  CE   . LYS A 1 83  ? -0.212  -3.585  -2.498  1.00 15.00 ?  125 LYS A CE   3  
ATOM   7982   N  NZ   . LYS A 1 83  ? -0.549  -3.186  -1.106  1.00 15.00 1  125 LYS A NZ   3  
ATOM   7983   H  H    . LYS A 1 83  ? -0.569  -4.292  -7.067  1.00 15.00 ?  125 LYS A H    3  
ATOM   7984   H  HA   . LYS A 1 83  ? -1.961  -3.135  -4.739  1.00 15.00 ?  125 LYS A HA   3  
ATOM   7985   H  HB2  . LYS A 1 83  ? 0.197   -1.684  -6.267  1.00 15.00 ?  125 LYS A HB2  3  
ATOM   7986   H  HB3  . LYS A 1 83  ? -0.512  -1.256  -4.718  1.00 15.00 ?  125 LYS A HB3  3  
ATOM   7987   H  HG2  . LYS A 1 83  ? 0.870   -3.864  -4.878  1.00 15.00 ?  125 LYS A HG2  3  
ATOM   7988   H  HG3  . LYS A 1 83  ? 1.866   -2.414  -4.962  1.00 15.00 ?  125 LYS A HG3  3  
ATOM   7989   H  HD2  . LYS A 1 83  ? 1.799   -2.912  -2.681  1.00 15.00 ?  125 LYS A HD2  3  
ATOM   7990   H  HD3  . LYS A 1 83  ? 0.587   -1.648  -2.876  1.00 15.00 ?  125 LYS A HD3  3  
ATOM   7991   H  HE2  . LYS A 1 83  ? -1.104  -3.540  -3.100  1.00 15.00 ?  125 LYS A HE2  3  
ATOM   7992   H  HE3  . LYS A 1 83  ? 0.169   -4.596  -2.493  1.00 15.00 ?  125 LYS A HE3  3  
ATOM   7993   H  HZ1  . LYS A 1 83  ? -0.712  -2.152  -1.061  1.00 15.00 ?  125 LYS A HZ1  3  
ATOM   7994   H  HZ2  . LYS A 1 83  ? 0.231   -3.429  -0.464  1.00 15.00 ?  125 LYS A HZ2  3  
ATOM   7995   H  HZ3  . LYS A 1 83  ? -1.411  -3.675  -0.787  1.00 15.00 ?  125 LYS A HZ3  3  
ATOM   7996   N  N    . MET A 1 84  ? -2.173  -2.458  -7.914  1.00 15.00 ?  126 MET A N    3  
ATOM   7997   C  CA   . MET A 1 84  ? -2.992  -1.814  -8.939  1.00 15.00 ?  126 MET A CA   3  
ATOM   7998   C  C    . MET A 1 84  ? -3.763  -2.850  -9.748  1.00 15.00 ?  126 MET A C    3  
ATOM   7999   O  O    . MET A 1 84  ? -3.973  -2.681  -10.951 1.00 15.00 ?  126 MET A O    3  
ATOM   8000   C  CB   . MET A 1 84  ? -2.117  -0.985  -9.881  1.00 15.00 ?  126 MET A CB   3  
ATOM   8001   C  CG   . MET A 1 84  ? -1.704  0.364   -9.317  1.00 15.00 ?  126 MET A CG   3  
ATOM   8002   S  SD   . MET A 1 84  ? -0.607  1.266   -10.430 1.00 15.00 ?  126 MET A SD   3  
ATOM   8003   C  CE   . MET A 1 84  ? -1.781  2.192   -11.417 1.00 15.00 ?  126 MET A CE   3  
ATOM   8004   H  H    . MET A 1 84  ? -1.469  -3.088  -8.196  1.00 15.00 ?  126 MET A H    3  
ATOM   8005   H  HA   . MET A 1 84  ? -3.696  -1.160  -8.445  1.00 15.00 ?  126 MET A HA   3  
ATOM   8006   H  HB2  . MET A 1 84  ? -1.221  -1.543  -10.104 1.00 15.00 ?  126 MET A HB2  3  
ATOM   8007   H  HB3  . MET A 1 84  ? -2.659  -0.817  -10.798 1.00 15.00 ?  126 MET A HB3  3  
ATOM   8008   H  HG2  . MET A 1 84  ? -2.591  0.957   -9.147  1.00 15.00 ?  126 MET A HG2  3  
ATOM   8009   H  HG3  . MET A 1 84  ? -1.194  0.202   -8.381  1.00 15.00 ?  126 MET A HG3  3  
ATOM   8010   H  HE1  . MET A 1 84  ? -2.070  3.086   -10.885 1.00 15.00 ?  126 MET A HE1  3  
ATOM   8011   H  HE2  . MET A 1 84  ? -2.656  1.587   -11.604 1.00 15.00 ?  126 MET A HE2  3  
ATOM   8012   H  HE3  . MET A 1 84  ? -1.325  2.464   -12.358 1.00 15.00 ?  126 MET A HE3  3  
ATOM   8013   N  N    . GLY A 1 85  ? -4.184  -3.919  -9.085  1.00 15.00 ?  127 GLY A N    3  
ATOM   8014   C  CA   . GLY A 1 85  ? -4.920  -4.971  -9.761  1.00 15.00 ?  127 GLY A CA   3  
ATOM   8015   C  C    . GLY A 1 85  ? -6.397  -4.668  -9.868  1.00 15.00 ?  127 GLY A C    3  
ATOM   8016   O  O    . GLY A 1 85  ? -7.094  -5.244  -10.707 1.00 15.00 ?  127 GLY A O    3  
ATOM   8017   H  H    . GLY A 1 85  ? -3.992  -3.996  -8.126  1.00 15.00 ?  127 GLY A H    3  
ATOM   8018   H  HA2  . GLY A 1 85  ? -4.520  -5.097  -10.757 1.00 15.00 ?  127 GLY A HA2  3  
ATOM   8019   H  HA3  . GLY A 1 85  ? -4.793  -5.890  -9.214  1.00 15.00 ?  127 GLY A HA3  3  
ATOM   8020   N  N    . GLY A 1 86  ? -6.876  -3.763  -9.022  1.00 15.00 ?  128 GLY A N    3  
ATOM   8021   C  CA   . GLY A 1 86  ? -8.279  -3.403  -9.041  1.00 15.00 ?  128 GLY A CA   3  
ATOM   8022   C  C    . GLY A 1 86  ? -8.490  -1.916  -9.242  1.00 15.00 ?  128 GLY A C    3  
ATOM   8023   O  O    . GLY A 1 86  ? -9.216  -1.275  -8.481  1.00 15.00 ?  128 GLY A O    3  
ATOM   8024   H  H    . GLY A 1 86  ? -6.271  -3.341  -8.371  1.00 15.00 ?  128 GLY A H    3  
ATOM   8025   H  HA2  . GLY A 1 86  ? -8.767  -3.937  -9.842  1.00 15.00 ?  128 GLY A HA2  3  
ATOM   8026   H  HA3  . GLY A 1 86  ? -8.728  -3.693  -8.101  1.00 15.00 ?  128 GLY A HA3  3  
ATOM   8027   N  N    . MET A 1 87  ? -7.869  -1.373  -10.277 1.00 15.00 ?  129 MET A N    3  
ATOM   8028   C  CA   . MET A 1 87  ? -7.981  0.049   -10.574 1.00 15.00 ?  129 MET A CA   3  
ATOM   8029   C  C    . MET A 1 87  ? -9.276  0.353   -11.316 1.00 15.00 ?  129 MET A C    3  
ATOM   8030   O  O    . MET A 1 87  ? -9.910  1.386   -11.094 1.00 15.00 ?  129 MET A O    3  
ATOM   8031   C  CB   . MET A 1 87  ? -6.794  0.513   -11.419 1.00 15.00 ?  129 MET A CB   3  
ATOM   8032   C  CG   . MET A 1 87  ? -5.460  0.415   -10.705 1.00 15.00 ?  129 MET A CG   3  
ATOM   8033   S  SD   . MET A 1 87  ? -5.321  1.558   -9.319  1.00 15.00 ?  129 MET A SD   3  
ATOM   8034   C  CE   . MET A 1 87  ? -5.298  3.132   -10.173 1.00 15.00 ?  129 MET A CE   3  
ATOM   8035   H  H    . MET A 1 87  ? -7.338  -1.948  -10.871 1.00 15.00 ?  129 MET A H    3  
ATOM   8036   H  HA   . MET A 1 87  ? -7.980  0.587   -9.641  1.00 15.00 ?  129 MET A HA   3  
ATOM   8037   H  HB2  . MET A 1 87  ? -6.747  -0.092  -12.312 1.00 15.00 ?  129 MET A HB2  3  
ATOM   8038   H  HB3  . MET A 1 87  ? -6.951  1.543   -11.703 1.00 15.00 ?  129 MET A HB3  3  
ATOM   8039   H  HG2  . MET A 1 87  ? -5.339  -0.595  -10.337 1.00 15.00 ?  129 MET A HG2  3  
ATOM   8040   H  HG3  . MET A 1 87  ? -4.674  0.633   -11.414 1.00 15.00 ?  129 MET A HG3  3  
ATOM   8041   H  HE1  . MET A 1 87  ? -4.499  3.135   -10.900 1.00 15.00 ?  129 MET A HE1  3  
ATOM   8042   H  HE2  . MET A 1 87  ? -5.136  3.927   -9.460  1.00 15.00 ?  129 MET A HE2  3  
ATOM   8043   H  HE3  . MET A 1 87  ? -6.242  3.284   -10.675 1.00 15.00 ?  129 MET A HE3  3  
ATOM   8044   N  N    . ASP A 1 88  ? -9.657  -0.561  -12.200 1.00 15.00 ?  130 ASP A N    3  
ATOM   8045   C  CA   . ASP A 1 88  ? -10.869 -0.408  -12.998 1.00 15.00 ?  130 ASP A CA   3  
ATOM   8046   C  C    . ASP A 1 88  ? -12.106 -0.416  -12.107 1.00 15.00 ?  130 ASP A C    3  
ATOM   8047   O  O    . ASP A 1 88  ? -13.010 0.405   -12.277 1.00 15.00 ?  130 ASP A O    3  
ATOM   8048   C  CB   . ASP A 1 88  ? -10.961 -1.522  -14.047 1.00 15.00 ?  130 ASP A CB   3  
ATOM   8049   C  CG   . ASP A 1 88  ? -12.065 -1.282  -15.059 1.00 15.00 ?  130 ASP A CG   3  
ATOM   8050   O  OD1  . ASP A 1 88  ? -12.018 -0.253  -15.770 1.00 15.00 ?  130 ASP A OD1  3  
ATOM   8051   O  OD2  . ASP A 1 88  ? -12.978 -2.128  -15.163 1.00 15.00 -1 130 ASP A OD2  3  
ATOM   8052   H  H    . ASP A 1 88  ? -9.112  -1.370  -12.313 1.00 15.00 ?  130 ASP A H    3  
ATOM   8053   H  HA   . ASP A 1 88  ? -10.812 0.543   -13.502 1.00 15.00 ?  130 ASP A HA   3  
ATOM   8054   H  HB2  . ASP A 1 88  ? -10.022 -1.588  -14.576 1.00 15.00 ?  130 ASP A HB2  3  
ATOM   8055   H  HB3  . ASP A 1 88  ? -11.154 -2.461  -13.548 1.00 15.00 ?  130 ASP A HB3  3  
ATOM   8056   N  N    . ALA A 1 89  ? -12.129 -1.336  -11.149 1.00 15.00 ?  131 ALA A N    3  
ATOM   8057   C  CA   . ALA A 1 89  ? -13.245 -1.452  -10.217 1.00 15.00 ?  131 ALA A CA   3  
ATOM   8058   C  C    . ALA A 1 89  ? -13.493 -0.133  -9.492  1.00 15.00 ?  131 ALA A C    3  
ATOM   8059   O  O    . ALA A 1 89  ? -14.639 0.231   -9.231  1.00 15.00 ?  131 ALA A O    3  
ATOM   8060   C  CB   . ALA A 1 89  ? -12.983 -2.566  -9.215  1.00 15.00 ?  131 ALA A CB   3  
ATOM   8061   H  H    . ALA A 1 89  ? -11.376 -1.971  -11.078 1.00 15.00 ?  131 ALA A H    3  
ATOM   8062   H  HA   . ALA A 1 89  ? -14.129 -1.710  -10.783 1.00 15.00 ?  131 ALA A HA   3  
ATOM   8063   H  HB1  . ALA A 1 89  ? -12.720 -3.466  -9.745  1.00 15.00 ?  131 ALA A HB1  3  
ATOM   8064   H  HB2  . ALA A 1 89  ? -13.873 -2.739  -8.628  1.00 15.00 ?  131 ALA A HB2  3  
ATOM   8065   H  HB3  . ALA A 1 89  ? -12.172 -2.281  -8.565  1.00 15.00 ?  131 ALA A HB3  3  
ATOM   8066   N  N    . LEU A 1 90  ? -12.414 0.580   -9.182  1.00 15.00 ?  132 LEU A N    3  
ATOM   8067   C  CA   . LEU A 1 90  ? -12.511 1.860   -8.497  1.00 15.00 ?  132 LEU A CA   3  
ATOM   8068   C  C    . LEU A 1 90  ? -13.168 2.898   -9.395  1.00 15.00 ?  132 LEU A C    3  
ATOM   8069   O  O    . LEU A 1 90  ? -14.099 3.590   -8.985  1.00 15.00 ?  132 LEU A O    3  
ATOM   8070   C  CB   . LEU A 1 90  ? -11.126 2.360   -8.082  1.00 15.00 ?  132 LEU A CB   3  
ATOM   8071   C  CG   . LEU A 1 90  ? -10.378 1.486   -7.074  1.00 15.00 ?  132 LEU A CG   3  
ATOM   8072   C  CD1  . LEU A 1 90  ? -8.979  2.036   -6.840  1.00 15.00 ?  132 LEU A CD1  3  
ATOM   8073   C  CD2  . LEU A 1 90  ? -11.157 1.387   -5.767  1.00 15.00 ?  132 LEU A CD2  3  
ATOM   8074   H  H    . LEU A 1 90  ? -11.529 0.234   -9.423  1.00 15.00 ?  132 LEU A H    3  
ATOM   8075   H  HA   . LEU A 1 90  ? -13.118 1.723   -7.614  1.00 15.00 ?  132 LEU A HA   3  
ATOM   8076   H  HB2  . LEU A 1 90  ? -10.517 2.443   -8.971  1.00 15.00 ?  132 LEU A HB2  3  
ATOM   8077   H  HB3  . LEU A 1 90  ? -11.240 3.345   -7.654  1.00 15.00 ?  132 LEU A HB3  3  
ATOM   8078   H  HG   . LEU A 1 90  ? -10.280 0.492   -7.481  1.00 15.00 ?  132 LEU A HG   3  
ATOM   8079   H  HD11 . LEU A 1 90  ? -9.028  3.110   -6.726  1.00 15.00 ?  132 LEU A HD11 3  
ATOM   8080   H  HD12 . LEU A 1 90  ? -8.352  1.794   -7.685  1.00 15.00 ?  132 LEU A HD12 3  
ATOM   8081   H  HD13 . LEU A 1 90  ? -8.561  1.599   -5.945  1.00 15.00 ?  132 LEU A HD13 3  
ATOM   8082   H  HD21 . LEU A 1 90  ? -11.547 2.361   -5.502  1.00 15.00 ?  132 LEU A HD21 3  
ATOM   8083   H  HD22 . LEU A 1 90  ? -10.504 1.036   -4.981  1.00 15.00 ?  132 LEU A HD22 3  
ATOM   8084   H  HD23 . LEU A 1 90  ? -11.974 0.693   -5.889  1.00 15.00 ?  132 LEU A HD23 3  
ATOM   8085   N  N    . HIS A 1 91  ? -12.686 2.991   -10.624 1.00 15.00 ?  133 HIS A N    3  
ATOM   8086   C  CA   . HIS A 1 91  ? -13.223 3.951   -11.581 1.00 15.00 ?  133 HIS A CA   3  
ATOM   8087   C  C    . HIS A 1 91  ? -14.686 3.647   -11.886 1.00 15.00 ?  133 HIS A C    3  
ATOM   8088   O  O    . HIS A 1 91  ? -15.498 4.559   -12.040 1.00 15.00 ?  133 HIS A O    3  
ATOM   8089   C  CB   . HIS A 1 91  ? -12.409 3.941   -12.872 1.00 15.00 ?  133 HIS A CB   3  
ATOM   8090   C  CG   . HIS A 1 91  ? -10.963 4.293   -12.688 1.00 15.00 ?  133 HIS A CG   3  
ATOM   8091   N  ND1  . HIS A 1 91  ? -9.929  3.625   -13.303 1.00 15.00 ?  133 HIS A ND1  3  
ATOM   8092   C  CD2  . HIS A 1 91  ? -10.386 5.261   -11.935 1.00 15.00 ?  133 HIS A CD2  3  
ATOM   8093   C  CE1  . HIS A 1 91  ? -8.781  4.189   -12.913 1.00 15.00 ?  133 HIS A CE1  3  
ATOM   8094   N  NE2  . HIS A 1 91  ? -9.004  5.189   -12.083 1.00 15.00 ?  133 HIS A NE2  3  
ATOM   8095   H  H    . HIS A 1 91  ? -11.947 2.399   -10.898 1.00 15.00 ?  133 HIS A H    3  
ATOM   8096   H  HA   . HIS A 1 91  ? -13.158 4.930   -11.133 1.00 15.00 ?  133 HIS A HA   3  
ATOM   8097   H  HB2  . HIS A 1 91  ? -12.458 2.953   -13.308 1.00 15.00 ?  133 HIS A HB2  3  
ATOM   8098   H  HB3  . HIS A 1 91  ? -12.842 4.653   -13.562 1.00 15.00 ?  133 HIS A HB3  3  
ATOM   8099   H  HD1  . HIS A 1 91  ? -10.020 2.866   -13.921 1.00 15.00 ?  133 HIS A HD1  3  
ATOM   8100   H  HD2  . HIS A 1 91  ? -10.902 5.977   -11.318 1.00 15.00 ?  133 HIS A HD2  3  
ATOM   8101   H  HE1  . HIS A 1 91  ? -7.798  3.865   -13.230 1.00 15.00 ?  133 HIS A HE1  3  
ATOM   8102   N  N    . ALA A 1 92  ? -15.021 2.358   -11.949 1.00 15.00 ?  134 ALA A N    3  
ATOM   8103   C  CA   . ALA A 1 92  ? -16.387 1.924   -12.222 1.00 15.00 ?  134 ALA A CA   3  
ATOM   8104   C  C    . ALA A 1 92  ? -17.301 2.247   -11.046 1.00 15.00 ?  134 ALA A C    3  
ATOM   8105   O  O    . ALA A 1 92  ? -18.525 2.199   -11.160 1.00 15.00 ?  134 ALA A O    3  
ATOM   8106   C  CB   . ALA A 1 92  ? -16.410 0.431   -12.524 1.00 15.00 ?  134 ALA A CB   3  
ATOM   8107   H  H    . ALA A 1 92  ? -14.323 1.675   -11.816 1.00 15.00 ?  134 ALA A H    3  
ATOM   8108   H  HA   . ALA A 1 92  ? -16.740 2.450   -13.094 1.00 15.00 ?  134 ALA A HA   3  
ATOM   8109   H  HB1  . ALA A 1 92  ? -17.431 0.088   -12.585 1.00 15.00 ?  134 ALA A HB1  3  
ATOM   8110   H  HB2  . ALA A 1 92  ? -15.898 -0.104  -11.738 1.00 15.00 ?  134 ALA A HB2  3  
ATOM   8111   H  HB3  . ALA A 1 92  ? -15.914 0.249   -13.464 1.00 15.00 ?  134 ALA A HB3  3  
ATOM   8112   N  N    . ALA A 1 93  ? -16.700 2.573   -9.913  1.00 15.00 ?  135 ALA A N    3  
ATOM   8113   C  CA   . ALA A 1 93  ? -17.454 2.913   -8.721  1.00 15.00 ?  135 ALA A CA   3  
ATOM   8114   C  C    . ALA A 1 93  ? -17.406 4.417   -8.467  1.00 15.00 ?  135 ALA A C    3  
ATOM   8115   O  O    . ALA A 1 93  ? -17.857 4.899   -7.425  1.00 15.00 ?  135 ALA A O    3  
ATOM   8116   C  CB   . ALA A 1 93  ? -16.916 2.152   -7.523  1.00 15.00 ?  135 ALA A CB   3  
ATOM   8117   H  H    . ALA A 1 93  ? -15.721 2.587   -9.878  1.00 15.00 ?  135 ALA A H    3  
ATOM   8118   H  HA   . ALA A 1 93  ? -18.482 2.616   -8.880  1.00 15.00 ?  135 ALA A HA   3  
ATOM   8119   H  HB1  . ALA A 1 93  ? -15.908 2.478   -7.311  1.00 15.00 ?  135 ALA A HB1  3  
ATOM   8120   H  HB2  . ALA A 1 93  ? -16.910 1.093   -7.743  1.00 15.00 ?  135 ALA A HB2  3  
ATOM   8121   H  HB3  . ALA A 1 93  ? -17.544 2.343   -6.668  1.00 15.00 ?  135 ALA A HB3  3  
ATOM   8122   N  N    . GLY A 1 94  ? -16.847 5.148   -9.430  1.00 15.00 ?  136 GLY A N    3  
ATOM   8123   C  CA   . GLY A 1 94  ? -16.744 6.592   -9.318  1.00 15.00 ?  136 GLY A CA   3  
ATOM   8124   C  C    . GLY A 1 94  ? -15.792 7.031   -8.225  1.00 15.00 ?  136 GLY A C    3  
ATOM   8125   O  O    . GLY A 1 94  ? -16.039 8.020   -7.536  1.00 15.00 ?  136 GLY A O    3  
ATOM   8126   H  H    . GLY A 1 94  ? -16.501 4.700   -10.232 1.00 15.00 ?  136 GLY A H    3  
ATOM   8127   H  HA2  . GLY A 1 94  ? -16.398 6.990   -10.260 1.00 15.00 ?  136 GLY A HA2  3  
ATOM   8128   H  HA3  . GLY A 1 94  ? -17.723 6.997   -9.111  1.00 15.00 ?  136 GLY A HA3  3  
ATOM   8129   N  N    . ILE A 1 95  ? -14.703 6.298   -8.058  1.00 15.00 ?  137 ILE A N    3  
ATOM   8130   C  CA   . ILE A 1 95  ? -13.718 6.625   -7.036  1.00 15.00 ?  137 ILE A CA   3  
ATOM   8131   C  C    . ILE A 1 95  ? -12.487 7.268   -7.661  1.00 15.00 ?  137 ILE A C    3  
ATOM   8132   O  O    . ILE A 1 95  ? -11.892 6.714   -8.588  1.00 15.00 ?  137 ILE A O    3  
ATOM   8133   C  CB   . ILE A 1 95  ? -13.298 5.371   -6.236  1.00 15.00 ?  137 ILE A CB   3  
ATOM   8134   C  CG1  . ILE A 1 95  ? -14.531 4.664   -5.673  1.00 15.00 ?  137 ILE A CG1  3  
ATOM   8135   C  CG2  . ILE A 1 95  ? -12.345 5.752   -5.110  1.00 15.00 ?  137 ILE A CG2  3  
ATOM   8136   C  CD1  . ILE A 1 95  ? -14.241 3.311   -5.057  1.00 15.00 ?  137 ILE A CD1  3  
ATOM   8137   H  H    . ILE A 1 95  ? -14.555 5.519   -8.635  1.00 15.00 ?  137 ILE A H    3  
ATOM   8138   H  HA   . ILE A 1 95  ? -14.171 7.328   -6.352  1.00 15.00 ?  137 ILE A HA   3  
ATOM   8139   H  HB   . ILE A 1 95  ? -12.779 4.702   -6.904  1.00 15.00 ?  137 ILE A HB   3  
ATOM   8140   H  HG12 . ILE A 1 95  ? -14.975 5.285   -4.909  1.00 15.00 ?  137 ILE A HG12 3  
ATOM   8141   H  HG13 . ILE A 1 95  ? -15.247 4.519   -6.469  1.00 15.00 ?  137 ILE A HG13 3  
ATOM   8142   H  HG21 . ILE A 1 95  ? -11.411 6.096   -5.528  1.00 15.00 ?  137 ILE A HG21 3  
ATOM   8143   H  HG22 . ILE A 1 95  ? -12.165 4.890   -4.485  1.00 15.00 ?  137 ILE A HG22 3  
ATOM   8144   H  HG23 . ILE A 1 95  ? -12.786 6.539   -4.518  1.00 15.00 ?  137 ILE A HG23 3  
ATOM   8145   H  HD11 . ILE A 1 95  ? -13.442 3.404   -4.339  1.00 15.00 ?  137 ILE A HD11 3  
ATOM   8146   H  HD12 . ILE A 1 95  ? -13.949 2.616   -5.832  1.00 15.00 ?  137 ILE A HD12 3  
ATOM   8147   H  HD13 . ILE A 1 95  ? -15.130 2.944   -4.562  1.00 15.00 ?  137 ILE A HD13 3  
ATOM   8148   N  N    . ALA A 1 96  ? -12.123 8.443   -7.157  1.00 15.00 ?  138 ALA A N    3  
ATOM   8149   C  CA   . ALA A 1 96  ? -10.960 9.164   -7.655  1.00 15.00 ?  138 ALA A CA   3  
ATOM   8150   C  C    . ALA A 1 96  ? -9.681  8.442   -7.246  1.00 15.00 ?  138 ALA A C    3  
ATOM   8151   O  O    . ALA A 1 96  ? -9.474  8.148   -6.065  1.00 15.00 ?  138 ALA A O    3  
ATOM   8152   C  CB   . ALA A 1 96  ? -10.958 10.596  -7.140  1.00 15.00 ?  138 ALA A CB   3  
ATOM   8153   H  H    . ALA A 1 96  ? -12.648 8.831   -6.426  1.00 15.00 ?  138 ALA A H    3  
ATOM   8154   H  HA   . ALA A 1 96  ? -11.018 9.189   -8.733  1.00 15.00 ?  138 ALA A HA   3  
ATOM   8155   H  HB1  . ALA A 1 96  ? -10.844 10.591  -6.066  1.00 15.00 ?  138 ALA A HB1  3  
ATOM   8156   H  HB2  . ALA A 1 96  ? -11.890 11.074  -7.404  1.00 15.00 ?  138 ALA A HB2  3  
ATOM   8157   H  HB3  . ALA A 1 96  ? -10.135 11.137  -7.587  1.00 15.00 ?  138 ALA A HB3  3  
ATOM   8158   N  N    . THR A 1 97  ? -8.827  8.159   -8.216  1.00 15.00 ?  139 THR A N    3  
ATOM   8159   C  CA   . THR A 1 97  ? -7.592  7.446   -7.951  1.00 15.00 ?  139 THR A CA   3  
ATOM   8160   C  C    . THR A 1 97  ? -6.376  8.366   -7.991  1.00 15.00 ?  139 THR A C    3  
ATOM   8161   O  O    . THR A 1 97  ? -6.266  9.241   -8.854  1.00 15.00 ?  139 THR A O    3  
ATOM   8162   C  CB   . THR A 1 97  ? -7.395  6.316   -8.969  1.00 15.00 ?  139 THR A CB   3  
ATOM   8163   O  OG1  . THR A 1 97  ? -7.685  6.808   -10.285 1.00 15.00 ?  139 THR A OG1  3  
ATOM   8164   C  CG2  . THR A 1 97  ? -8.295  5.132   -8.649  1.00 15.00 ?  139 THR A CG2  3  
ATOM   8165   H  H    . THR A 1 97  ? -9.029  8.439   -9.133  1.00 15.00 ?  139 THR A H    3  
ATOM   8166   H  HA   . THR A 1 97  ? -7.665  7.004   -6.968  1.00 15.00 ?  139 THR A HA   3  
ATOM   8167   H  HB   . THR A 1 97  ? -6.365  5.989   -8.928  1.00 15.00 ?  139 THR A HB   3  
ATOM   8168   H  HG1  . THR A 1 97  ? -8.256  6.179   -10.747 1.00 15.00 ?  139 THR A HG1  3  
ATOM   8169   H  HG21 . THR A 1 97  ? -8.066  4.313   -9.315  1.00 15.00 ?  139 THR A HG21 3  
ATOM   8170   H  HG22 . THR A 1 97  ? -9.328  5.422   -8.775  1.00 15.00 ?  139 THR A HG22 3  
ATOM   8171   H  HG23 . THR A 1 97  ? -8.128  4.820   -7.627  1.00 15.00 ?  139 THR A HG23 3  
ATOM   8172   N  N    . TYR A 1 98  ? -5.473  8.158   -7.043  1.00 15.00 ?  140 TYR A N    3  
ATOM   8173   C  CA   . TYR A 1 98  ? -4.244  8.934   -6.952  1.00 15.00 ?  140 TYR A CA   3  
ATOM   8174   C  C    . TYR A 1 98  ? -3.047  7.995   -6.963  1.00 15.00 ?  140 TYR A C    3  
ATOM   8175   O  O    . TYR A 1 98  ? -3.064  6.955   -6.301  1.00 15.00 ?  140 TYR A O    3  
ATOM   8176   C  CB   . TYR A 1 98  ? -4.220  9.770   -5.668  1.00 15.00 ?  140 TYR A CB   3  
ATOM   8177   C  CG   . TYR A 1 98  ? -5.193  10.928  -5.657  1.00 15.00 ?  140 TYR A CG   3  
ATOM   8178   C  CD1  . TYR A 1 98  ? -6.484  10.770  -5.169  1.00 15.00 ?  140 TYR A CD1  3  
ATOM   8179   C  CD2  . TYR A 1 98  ? -4.817  12.180  -6.124  1.00 15.00 ?  140 TYR A CD2  3  
ATOM   8180   C  CE1  . TYR A 1 98  ? -7.370  11.828  -5.144  1.00 15.00 ?  140 TYR A CE1  3  
ATOM   8181   C  CE2  . TYR A 1 98  ? -5.700  13.242  -6.105  1.00 15.00 ?  140 TYR A CE2  3  
ATOM   8182   C  CZ   . TYR A 1 98  ? -6.974  13.060  -5.614  1.00 15.00 ?  140 TYR A CZ   3  
ATOM   8183   O  OH   . TYR A 1 98  ? -7.856  14.114  -5.586  1.00 15.00 ?  140 TYR A OH   3  
ATOM   8184   H  H    . TYR A 1 98  ? -5.636  7.449   -6.379  1.00 15.00 ?  140 TYR A H    3  
ATOM   8185   H  HA   . TYR A 1 98  ? -4.191  9.589   -7.808  1.00 15.00 ?  140 TYR A HA   3  
ATOM   8186   H  HB2  . TYR A 1 98  ? -4.458  9.132   -4.828  1.00 15.00 ?  140 TYR A HB2  3  
ATOM   8187   H  HB3  . TYR A 1 98  ? -3.227  10.172  -5.533  1.00 15.00 ?  140 TYR A HB3  3  
ATOM   8188   H  HD1  . TYR A 1 98  ? -6.792  9.803   -4.801  1.00 15.00 ?  140 TYR A HD1  3  
ATOM   8189   H  HD2  . TYR A 1 98  ? -3.819  12.320  -6.506  1.00 15.00 ?  140 TYR A HD2  3  
ATOM   8190   H  HE1  . TYR A 1 98  ? -8.370  11.685  -4.762  1.00 15.00 ?  140 TYR A HE1  3  
ATOM   8191   H  HE2  . TYR A 1 98  ? -5.390  14.209  -6.475  1.00 15.00 ?  140 TYR A HE2  3  
ATOM   8192   H  HH   . TYR A 1 98  ? -8.139  14.270  -4.679  1.00 15.00 ?  140 TYR A HH   3  
ATOM   8193   N  N    . ALA A 1 99  ? -2.019  8.347   -7.721  1.00 15.00 ?  141 ALA A N    3  
ATOM   8194   C  CA   . ALA A 1 99  ? -0.817  7.527   -7.798  1.00 15.00 ?  141 ALA A CA   3  
ATOM   8195   C  C    . ALA A 1 99  ? 0.393   8.379   -8.129  1.00 15.00 ?  141 ALA A C    3  
ATOM   8196   O  O    . ALA A 1 99  ? 0.255   9.538   -8.512  1.00 15.00 ?  141 ALA A O    3  
ATOM   8197   C  CB   . ALA A 1 99  ? -0.984  6.446   -8.851  1.00 15.00 ?  141 ALA A CB   3  
ATOM   8198   H  H    . ALA A 1 99  ? -2.067  9.174   -8.248  1.00 15.00 ?  141 ALA A H    3  
ATOM   8199   H  HA   . ALA A 1 99  ? -0.668  7.052   -6.838  1.00 15.00 ?  141 ALA A HA   3  
ATOM   8200   H  HB1  . ALA A 1 99  ? -0.905  6.889   -9.831  1.00 15.00 ?  141 ALA A HB1  3  
ATOM   8201   H  HB2  . ALA A 1 99  ? -1.952  5.985   -8.742  1.00 15.00 ?  141 ALA A HB2  3  
ATOM   8202   H  HB3  . ALA A 1 99  ? -0.213  5.701   -8.729  1.00 15.00 ?  141 ALA A HB3  3  
ATOM   8203   N  N    . ASN A 1 100 ? 1.580   7.806   -7.984  1.00 15.00 ?  142 ASN A N    3  
ATOM   8204   C  CA   . ASN A 1 100 ? 2.811   8.518   -8.293  1.00 15.00 ?  142 ASN A CA   3  
ATOM   8205   C  C    . ASN A 1 100 ? 2.858   8.804   -9.792  1.00 15.00 ?  142 ASN A C    3  
ATOM   8206   O  O    . ASN A 1 100 ? 2.399   7.988   -10.597 1.00 15.00 ?  142 ASN A O    3  
ATOM   8207   C  CB   . ASN A 1 100 ? 4.030   7.684   -7.871  1.00 15.00 ?  142 ASN A CB   3  
ATOM   8208   C  CG   . ASN A 1 100 ? 5.337   8.464   -7.856  1.00 15.00 ?  142 ASN A CG   3  
ATOM   8209   O  OD1  . ASN A 1 100 ? 5.460   9.532   -8.455  1.00 15.00 ?  142 ASN A OD1  3  
ATOM   8210   N  ND2  . ASN A 1 100 ? 6.335   7.917   -7.180  1.00 15.00 ?  142 ASN A ND2  3  
ATOM   8211   H  H    . ASN A 1 100 ? 1.629   6.876   -7.676  1.00 15.00 ?  142 ASN A H    3  
ATOM   8212   H  HA   . ASN A 1 100 ? 2.807   9.453   -7.752  1.00 15.00 ?  142 ASN A HA   3  
ATOM   8213   H  HB2  . ASN A 1 100 ? 3.862   7.298   -6.878  1.00 15.00 ?  142 ASN A HB2  3  
ATOM   8214   H  HB3  . ASN A 1 100 ? 4.140   6.855   -8.556  1.00 15.00 ?  142 ASN A HB3  3  
ATOM   8215   H  HD21 . ASN A 1 100 ? 6.175   7.053   -6.736  1.00 15.00 ?  142 ASN A HD21 3  
ATOM   8216   H  HD22 . ASN A 1 100 ? 7.190   8.391   -7.153  1.00 15.00 ?  142 ASN A HD22 3  
ATOM   8217   N  N    . ALA A 1 101 ? 3.402   9.954   -10.165 1.00 15.00 ?  143 ALA A N    3  
ATOM   8218   C  CA   . ALA A 1 101 ? 3.497   10.339  -11.566 1.00 15.00 ?  143 ALA A CA   3  
ATOM   8219   C  C    . ALA A 1 101 ? 4.237   9.281   -12.382 1.00 15.00 ?  143 ALA A C    3  
ATOM   8220   O  O    . ALA A 1 101 ? 3.909   9.042   -13.545 1.00 15.00 ?  143 ALA A O    3  
ATOM   8221   C  CB   . ALA A 1 101 ? 4.182   11.690  -11.696 1.00 15.00 ?  143 ALA A CB   3  
ATOM   8222   H  H    . ALA A 1 101 ? 3.757   10.562  -9.477  1.00 15.00 ?  143 ALA A H    3  
ATOM   8223   H  HA   . ALA A 1 101 ? 2.493   10.435  -11.952 1.00 15.00 ?  143 ALA A HA   3  
ATOM   8224   H  HB1  . ALA A 1 101 ? 3.735   12.391  -11.005 1.00 15.00 ?  143 ALA A HB1  3  
ATOM   8225   H  HB2  . ALA A 1 101 ? 4.066   12.057  -12.705 1.00 15.00 ?  143 ALA A HB2  3  
ATOM   8226   H  HB3  . ALA A 1 101 ? 5.231   11.584  -11.471 1.00 15.00 ?  143 ALA A HB3  3  
ATOM   8227   N  N    . LEU A 1 102 ? 5.226   8.643   -11.769 1.00 15.00 ?  144 LEU A N    3  
ATOM   8228   C  CA   . LEU A 1 102 ? 5.996   7.609   -12.450 1.00 15.00 ?  144 LEU A CA   3  
ATOM   8229   C  C    . LEU A 1 102 ? 5.182   6.321   -12.578 1.00 15.00 ?  144 LEU A C    3  
ATOM   8230   O  O    . LEU A 1 102 ? 5.264   5.621   -13.591 1.00 15.00 ?  144 LEU A O    3  
ATOM   8231   C  CB   . LEU A 1 102 ? 7.312   7.344   -11.712 1.00 15.00 ?  144 LEU A CB   3  
ATOM   8232   C  CG   . LEU A 1 102 ? 8.267   6.363   -12.400 1.00 15.00 ?  144 LEU A CG   3  
ATOM   8233   C  CD1  . LEU A 1 102 ? 8.544   6.793   -13.836 1.00 15.00 ?  144 LEU A CD1  3  
ATOM   8234   C  CD2  . LEU A 1 102 ? 9.570   6.258   -11.623 1.00 15.00 ?  144 LEU A CD2  3  
ATOM   8235   H  H    . LEU A 1 102 ? 5.450   8.880   -10.843 1.00 15.00 ?  144 LEU A H    3  
ATOM   8236   H  HA   . LEU A 1 102 ? 6.219   7.970   -13.442 1.00 15.00 ?  144 LEU A HA   3  
ATOM   8237   H  HB2  . LEU A 1 102 ? 7.827   8.286   -11.594 1.00 15.00 ?  144 LEU A HB2  3  
ATOM   8238   H  HB3  . LEU A 1 102 ? 7.079   6.956   -10.732 1.00 15.00 ?  144 LEU A HB3  3  
ATOM   8239   H  HG   . LEU A 1 102 ? 7.812   5.383   -12.426 1.00 15.00 ?  144 LEU A HG   3  
ATOM   8240   H  HD11 . LEU A 1 102 ? 8.920   7.805   -13.843 1.00 15.00 ?  144 LEU A HD11 3  
ATOM   8241   H  HD12 . LEU A 1 102 ? 7.629   6.743   -14.410 1.00 15.00 ?  144 LEU A HD12 3  
ATOM   8242   H  HD13 . LEU A 1 102 ? 9.278   6.135   -14.271 1.00 15.00 ?  144 LEU A HD13 3  
ATOM   8243   H  HD21 . LEU A 1 102 ? 9.965   7.248   -11.452 1.00 15.00 ?  144 LEU A HD21 3  
ATOM   8244   H  HD22 . LEU A 1 102 ? 10.282  5.681   -12.192 1.00 15.00 ?  144 LEU A HD22 3  
ATOM   8245   H  HD23 . LEU A 1 102 ? 9.387   5.774   -10.673 1.00 15.00 ?  144 LEU A HD23 3  
ATOM   8246   N  N    . SER A 1 103 ? 4.385   6.019   -11.556 1.00 15.00 ?  145 SER A N    3  
ATOM   8247   C  CA   . SER A 1 103 ? 3.550   4.826   -11.563 1.00 15.00 ?  145 SER A CA   3  
ATOM   8248   C  C    . SER A 1 103 ? 2.544   4.884   -12.706 1.00 15.00 ?  145 SER A C    3  
ATOM   8249   O  O    . SER A 1 103 ? 2.339   3.906   -13.420 1.00 15.00 ?  145 SER A O    3  
ATOM   8250   C  CB   . SER A 1 103 ? 2.812   4.692   -10.233 1.00 15.00 ?  145 SER A CB   3  
ATOM   8251   O  OG   . SER A 1 103 ? 3.692   4.911   -9.145  1.00 15.00 ?  145 SER A OG   3  
ATOM   8252   H  H    . SER A 1 103 ? 4.361   6.609   -10.776 1.00 15.00 ?  145 SER A H    3  
ATOM   8253   H  HA   . SER A 1 103 ? 4.193   3.969   -11.702 1.00 15.00 ?  145 SER A HA   3  
ATOM   8254   H  HB2  . SER A 1 103 ? 2.017   5.423   -10.189 1.00 15.00 ?  145 SER A HB2  3  
ATOM   8255   H  HB3  . SER A 1 103 ? 2.397   3.698   -10.152 1.00 15.00 ?  145 SER A HB3  3  
ATOM   8256   H  HG   . SER A 1 103 ? 4.196   4.094   -8.980  1.00 15.00 ?  145 SER A HG   3  
ATOM   8257   N  N    . ASN A 1 104 ? 1.946   6.054   -12.896 1.00 15.00 ?  146 ASN A N    3  
ATOM   8258   C  CA   . ASN A 1 104 ? 0.955   6.251   -13.951 1.00 15.00 ?  146 ASN A CA   3  
ATOM   8259   C  C    . ASN A 1 104 ? 1.598   6.236   -15.335 1.00 15.00 ?  146 ASN A C    3  
ATOM   8260   O  O    . ASN A 1 104 ? 0.912   6.096   -16.347 1.00 15.00 ?  146 ASN A O    3  
ATOM   8261   C  CB   . ASN A 1 104 ? 0.202   7.567   -13.734 1.00 15.00 ?  146 ASN A CB   3  
ATOM   8262   C  CG   . ASN A 1 104 ? -0.831  7.465   -12.627 1.00 15.00 ?  146 ASN A CG   3  
ATOM   8263   O  OD1  . ASN A 1 104 ? -1.321  6.378   -12.320 1.00 15.00 ?  146 ASN A OD1  3  
ATOM   8264   N  ND2  . ASN A 1 104 ? -1.178  8.593   -12.027 1.00 15.00 ?  146 ASN A ND2  3  
ATOM   8265   H  H    . ASN A 1 104 ? 2.172   6.806   -12.308 1.00 15.00 ?  146 ASN A H    3  
ATOM   8266   H  HA   . ASN A 1 104 ? 0.250   5.438   -13.893 1.00 15.00 ?  146 ASN A HA   3  
ATOM   8267   H  HB2  . ASN A 1 104 ? 0.909   8.340   -13.472 1.00 15.00 ?  146 ASN A HB2  3  
ATOM   8268   H  HB3  . ASN A 1 104 ? -0.300  7.841   -14.649 1.00 15.00 ?  146 ASN A HB3  3  
ATOM   8269   H  HD21 . ASN A 1 104 ? -0.753  9.434   -12.326 1.00 15.00 ?  146 ASN A HD21 3  
ATOM   8270   H  HD22 . ASN A 1 104 ? -1.847  8.552   -11.314 1.00 15.00 ?  146 ASN A HD22 3  
ATOM   8271   N  N    . GLN A 1 105 ? 2.914   6.372   -15.376 1.00 15.00 ?  147 GLN A N    3  
ATOM   8272   C  CA   . GLN A 1 105 ? 3.645   6.365   -16.633 1.00 15.00 ?  147 GLN A CA   3  
ATOM   8273   C  C    . GLN A 1 105 ? 4.015   4.938   -17.027 1.00 15.00 ?  147 GLN A C    3  
ATOM   8274   O  O    . GLN A 1 105 ? 3.859   4.535   -18.181 1.00 15.00 ?  147 GLN A O    3  
ATOM   8275   C  CB   . GLN A 1 105 ? 4.907   7.218   -16.507 1.00 15.00 ?  147 GLN A CB   3  
ATOM   8276   C  CG   . GLN A 1 105 ? 5.646   7.433   -17.819 1.00 15.00 ?  147 GLN A CG   3  
ATOM   8277   C  CD   . GLN A 1 105 ? 7.029   8.010   -17.614 1.00 15.00 ?  147 GLN A CD   3  
ATOM   8278   O  OE1  . GLN A 1 105 ? 7.286   8.697   -16.625 1.00 15.00 ?  147 GLN A OE1  3  
ATOM   8279   N  NE2  . GLN A 1 105 ? 7.926   7.743   -18.548 1.00 15.00 ?  147 GLN A NE2  3  
ATOM   8280   H  H    . GLN A 1 105 ? 3.411   6.478   -14.536 1.00 15.00 ?  147 GLN A H    3  
ATOM   8281   H  HA   . GLN A 1 105 ? 3.004   6.788   -17.393 1.00 15.00 ?  147 GLN A HA   3  
ATOM   8282   H  HB2  . GLN A 1 105 ? 4.632   8.184   -16.115 1.00 15.00 ?  147 GLN A HB2  3  
ATOM   8283   H  HB3  . GLN A 1 105 ? 5.581   6.736   -15.813 1.00 15.00 ?  147 GLN A HB3  3  
ATOM   8284   H  HG2  . GLN A 1 105 ? 5.741   6.483   -18.325 1.00 15.00 ?  147 GLN A HG2  3  
ATOM   8285   H  HG3  . GLN A 1 105 ? 5.075   8.113   -18.434 1.00 15.00 ?  147 GLN A HG3  3  
ATOM   8286   H  HE21 . GLN A 1 105 ? 7.649   7.194   -19.316 1.00 15.00 ?  147 GLN A HE21 3  
ATOM   8287   H  HE22 . GLN A 1 105 ? 8.833   8.100   -18.434 1.00 15.00 ?  147 GLN A HE22 3  
ATOM   8288   N  N    . LEU A 1 106 ? 4.483   4.167   -16.052 1.00 15.00 ?  148 LEU A N    3  
ATOM   8289   C  CA   . LEU A 1 106 ? 4.890   2.785   -16.290 1.00 15.00 ?  148 LEU A CA   3  
ATOM   8290   C  C    . LEU A 1 106 ? 3.703   1.827   -16.213 1.00 15.00 ?  148 LEU A C    3  
ATOM   8291   O  O    . LEU A 1 106 ? 3.836   0.645   -16.534 1.00 15.00 ?  148 LEU A O    3  
ATOM   8292   C  CB   . LEU A 1 106 ? 5.956   2.361   -15.278 1.00 15.00 ?  148 LEU A CB   3  
ATOM   8293   C  CG   . LEU A 1 106 ? 7.203   3.252   -15.224 1.00 15.00 ?  148 LEU A CG   3  
ATOM   8294   C  CD1  . LEU A 1 106 ? 8.142   2.782   -14.122 1.00 15.00 ?  148 LEU A CD1  3  
ATOM   8295   C  CD2  . LEU A 1 106 ? 7.917   3.258   -16.568 1.00 15.00 ?  148 LEU A CD2  3  
ATOM   8296   H  H    . LEU A 1 106 ? 4.570   4.542   -15.148 1.00 15.00 ?  148 LEU A H    3  
ATOM   8297   H  HA   . LEU A 1 106 ? 5.313   2.729   -17.283 1.00 15.00 ?  148 LEU A HA   3  
ATOM   8298   H  HB2  . LEU A 1 106 ? 5.505   2.350   -14.295 1.00 15.00 ?  148 LEU A HB2  3  
ATOM   8299   H  HB3  . LEU A 1 106 ? 6.270   1.356   -15.521 1.00 15.00 ?  148 LEU A HB3  3  
ATOM   8300   H  HG   . LEU A 1 106 ? 6.905   4.264   -14.997 1.00 15.00 ?  148 LEU A HG   3  
ATOM   8301   H  HD11 . LEU A 1 106 ? 8.413   1.751   -14.294 1.00 15.00 ?  148 LEU A HD11 3  
ATOM   8302   H  HD12 . LEU A 1 106 ? 7.653   2.871   -13.163 1.00 15.00 ?  148 LEU A HD12 3  
ATOM   8303   H  HD13 . LEU A 1 106 ? 9.036   3.392   -14.128 1.00 15.00 ?  148 LEU A HD13 3  
ATOM   8304   H  HD21 . LEU A 1 106 ? 8.162   2.244   -16.852 1.00 15.00 ?  148 LEU A HD21 3  
ATOM   8305   H  HD22 . LEU A 1 106 ? 8.826   3.836   -16.491 1.00 15.00 ?  148 LEU A HD22 3  
ATOM   8306   H  HD23 . LEU A 1 106 ? 7.274   3.698   -17.315 1.00 15.00 ?  148 LEU A HD23 3  
ATOM   8307   N  N    . ALA A 1 107 ? 2.553   2.341   -15.796 1.00 15.00 ?  149 ALA A N    3  
ATOM   8308   C  CA   . ALA A 1 107 ? 1.344   1.532   -15.662 1.00 15.00 ?  149 ALA A CA   3  
ATOM   8309   C  C    . ALA A 1 107 ? 1.039   0.710   -16.920 1.00 15.00 ?  149 ALA A C    3  
ATOM   8310   O  O    . ALA A 1 107 ? 0.958   -0.515  -16.837 1.00 15.00 ?  149 ALA A O    3  
ATOM   8311   C  CB   . ALA A 1 107 ? 0.156   2.407   -15.282 1.00 15.00 ?  149 ALA A CB   3  
ATOM   8312   H  H    . ALA A 1 107 ? 2.518   3.291   -15.560 1.00 15.00 ?  149 ALA A H    3  
ATOM   8313   H  HA   . ALA A 1 107 ? 1.510   0.845   -14.846 1.00 15.00 ?  149 ALA A HA   3  
ATOM   8314   H  HB1  . ALA A 1 107 ? -0.610  2.323   -16.037 1.00 15.00 ?  149 ALA A HB1  3  
ATOM   8315   H  HB2  . ALA A 1 107 ? 0.476   3.434   -15.207 1.00 15.00 ?  149 ALA A HB2  3  
ATOM   8316   H  HB3  . ALA A 1 107 ? -0.240  2.084   -14.331 1.00 15.00 ?  149 ALA A HB3  3  
ATOM   8317   N  N    . PRO A 1 108 ? 0.896   1.337   -18.107 1.00 15.00 ?  150 PRO A N    3  
ATOM   8318   C  CA   . PRO A 1 108 ? 0.592   0.599   -19.342 1.00 15.00 ?  150 PRO A CA   3  
ATOM   8319   C  C    . PRO A 1 108 ? 1.681   -0.403  -19.718 1.00 15.00 ?  150 PRO A C    3  
ATOM   8320   O  O    . PRO A 1 108 ? 1.408   -1.414  -20.361 1.00 15.00 ?  150 PRO A O    3  
ATOM   8321   C  CB   . PRO A 1 108 ? 0.496   1.694   -20.407 1.00 15.00 ?  150 PRO A CB   3  
ATOM   8322   C  CG   . PRO A 1 108 ? 0.273   2.955   -19.656 1.00 15.00 ?  150 PRO A CG   3  
ATOM   8323   C  CD   . PRO A 1 108 ? 1.007   2.787   -18.361 1.00 15.00 ?  150 PRO A CD   3  
ATOM   8324   H  HA   . PRO A 1 108 ? -0.355  0.084   -19.267 1.00 15.00 ?  150 PRO A HA   3  
ATOM   8325   H  HB2  . PRO A 1 108 ? 1.421   1.738   -20.969 1.00 15.00 ?  150 PRO A HB2  3  
ATOM   8326   H  HB3  . PRO A 1 108 ? -0.333  1.503   -21.065 1.00 15.00 ?  150 PRO A HB3  3  
ATOM   8327   H  HG2  . PRO A 1 108 ? 0.671   3.791   -20.215 1.00 15.00 ?  150 PRO A HG2  3  
ATOM   8328   H  HG3  . PRO A 1 108 ? -0.780  3.089   -19.467 1.00 15.00 ?  150 PRO A HG3  3  
ATOM   8329   H  HD2  . PRO A 1 108 ? 2.041   3.081   -18.472 1.00 15.00 ?  150 PRO A HD2  3  
ATOM   8330   H  HD3  . PRO A 1 108 ? 0.532   3.356   -17.576 1.00 15.00 ?  150 PRO A HD3  3  
ATOM   8331   N  N    . GLN A 1 109 ? 2.910   -0.130  -19.295 1.00 15.00 ?  151 GLN A N    3  
ATOM   8332   C  CA   . GLN A 1 109 ? 4.031   -1.010  -19.603 1.00 15.00 ?  151 GLN A CA   3  
ATOM   8333   C  C    . GLN A 1 109 ? 3.954   -2.293  -18.787 1.00 15.00 ?  151 GLN A C    3  
ATOM   8334   O  O    . GLN A 1 109 ? 4.289   -3.372  -19.273 1.00 15.00 ?  151 GLN A O    3  
ATOM   8335   C  CB   . GLN A 1 109 ? 5.355   -0.304  -19.336 1.00 15.00 ?  151 GLN A CB   3  
ATOM   8336   C  CG   . GLN A 1 109 ? 5.601   0.903   -20.226 1.00 15.00 ?  151 GLN A CG   3  
ATOM   8337   C  CD   . GLN A 1 109 ? 7.026   1.408   -20.113 1.00 15.00 ?  151 GLN A CD   3  
ATOM   8338   O  OE1  . GLN A 1 109 ? 7.951   0.630   -19.874 1.00 15.00 ?  151 GLN A OE1  3  
ATOM   8339   N  NE2  . GLN A 1 109 ? 7.218   2.705   -20.282 1.00 15.00 ?  151 GLN A NE2  3  
ATOM   8340   H  H    . GLN A 1 109 ? 3.065   0.672   -18.758 1.00 15.00 ?  151 GLN A H    3  
ATOM   8341   H  HA   . GLN A 1 109 ? 3.973   -1.262  -20.649 1.00 15.00 ?  151 GLN A HA   3  
ATOM   8342   H  HB2  . GLN A 1 109 ? 5.371   0.029   -18.309 1.00 15.00 ?  151 GLN A HB2  3  
ATOM   8343   H  HB3  . GLN A 1 109 ? 6.161   -1.006  -19.488 1.00 15.00 ?  151 GLN A HB3  3  
ATOM   8344   H  HG2  . GLN A 1 109 ? 5.410   0.627   -21.253 1.00 15.00 ?  151 GLN A HG2  3  
ATOM   8345   H  HG3  . GLN A 1 109 ? 4.926   1.696   -19.935 1.00 15.00 ?  151 GLN A HG3  3  
ATOM   8346   H  HE21 . GLN A 1 109 ? 6.434   3.271   -20.475 1.00 15.00 ?  151 GLN A HE21 3  
ATOM   8347   H  HE22 . GLN A 1 109 ? 8.134   3.052   -20.204 1.00 15.00 ?  151 GLN A HE22 3  
ATOM   8348   N  N    . GLU A 1 110 ? 3.520   -2.173  -17.543 1.00 15.00 ?  152 GLU A N    3  
ATOM   8349   C  CA   . GLU A 1 110 ? 3.401   -3.335  -16.675 1.00 15.00 ?  152 GLU A CA   3  
ATOM   8350   C  C    . GLU A 1 110 ? 2.046   -4.013  -16.860 1.00 15.00 ?  152 GLU A C    3  
ATOM   8351   O  O    . GLU A 1 110 ? 1.855   -5.162  -16.458 1.00 15.00 ?  152 GLU A O    3  
ATOM   8352   C  CB   . GLU A 1 110 ? 3.605   -2.939  -15.211 1.00 15.00 ?  152 GLU A CB   3  
ATOM   8353   C  CG   . GLU A 1 110 ? 4.958   -2.287  -14.938 1.00 15.00 ?  152 GLU A CG   3  
ATOM   8354   C  CD   . GLU A 1 110 ? 6.115   -2.997  -15.619 1.00 15.00 ?  152 GLU A CD   3  
ATOM   8355   O  OE1  . GLU A 1 110 ? 6.266   -4.227  -15.440 1.00 15.00 ?  152 GLU A OE1  3  
ATOM   8356   O  OE2  . GLU A 1 110 ? 6.879   -2.323  -16.340 1.00 15.00 -1 152 GLU A OE2  3  
ATOM   8357   H  H    . GLU A 1 110 ? 3.288   -1.282  -17.196 1.00 15.00 ?  152 GLU A H    3  
ATOM   8358   H  HA   . GLU A 1 110 ? 4.173   -4.034  -16.956 1.00 15.00 ?  152 GLU A HA   3  
ATOM   8359   H  HB2  . GLU A 1 110 ? 2.830   -2.241  -14.931 1.00 15.00 ?  152 GLU A HB2  3  
ATOM   8360   H  HB3  . GLU A 1 110 ? 3.522   -3.822  -14.595 1.00 15.00 ?  152 GLU A HB3  3  
ATOM   8361   H  HG2  . GLU A 1 110 ? 4.927   -1.268  -15.294 1.00 15.00 ?  152 GLU A HG2  3  
ATOM   8362   H  HG3  . GLU A 1 110 ? 5.134   -2.285  -13.871 1.00 15.00 ?  152 GLU A HG3  3  
ATOM   8363   N  N    . GLY A 1 111 ? 1.113   -3.293  -17.473 1.00 15.00 ?  153 GLY A N    3  
ATOM   8364   C  CA   . GLY A 1 111 ? -0.209  -3.836  -17.710 1.00 15.00 ?  153 GLY A CA   3  
ATOM   8365   C  C    . GLY A 1 111 ? -1.207  -3.432  -16.643 1.00 15.00 ?  153 GLY A C    3  
ATOM   8366   O  O    . GLY A 1 111 ? -2.061  -4.229  -16.255 1.00 15.00 ?  153 GLY A O    3  
ATOM   8367   H  H    . GLY A 1 111 ? 1.328   -2.385  -17.767 1.00 15.00 ?  153 GLY A H    3  
ATOM   8368   H  HA2  . GLY A 1 111 ? -0.561  -3.484  -18.667 1.00 15.00 ?  153 GLY A HA2  3  
ATOM   8369   H  HA3  . GLY A 1 111 ? -0.141  -4.914  -17.735 1.00 15.00 ?  153 GLY A HA3  3  
ATOM   8370   N  N    . MET A 1 112 ? -1.100  -2.201  -16.165 1.00 15.00 ?  154 MET A N    3  
ATOM   8371   C  CA   . MET A 1 112 ? -2.001  -1.705  -15.134 1.00 15.00 ?  154 MET A CA   3  
ATOM   8372   C  C    . MET A 1 112 ? -2.720  -0.452  -15.613 1.00 15.00 ?  154 MET A C    3  
ATOM   8373   O  O    . MET A 1 112 ? -2.167  0.331   -16.381 1.00 15.00 ?  154 MET A O    3  
ATOM   8374   C  CB   . MET A 1 112 ? -1.220  -1.390  -13.854 1.00 15.00 ?  154 MET A CB   3  
ATOM   8375   C  CG   . MET A 1 112 ? -0.335  -2.531  -13.381 1.00 15.00 ?  154 MET A CG   3  
ATOM   8376   S  SD   . MET A 1 112 ? -1.269  -4.029  -13.017 1.00 15.00 ?  154 MET A SD   3  
ATOM   8377   C  CE   . MET A 1 112 ? -0.033  -5.278  -13.368 1.00 15.00 ?  154 MET A CE   3  
ATOM   8378   H  H    . MET A 1 112 ? -0.400  -1.605  -16.514 1.00 15.00 ?  154 MET A H    3  
ATOM   8379   H  HA   . MET A 1 112 ? -2.730  -2.472  -14.926 1.00 15.00 ?  154 MET A HA   3  
ATOM   8380   H  HB2  . MET A 1 112 ? -0.596  -0.526  -14.032 1.00 15.00 ?  154 MET A HB2  3  
ATOM   8381   H  HB3  . MET A 1 112 ? -1.922  -1.157  -13.069 1.00 15.00 ?  154 MET A HB3  3  
ATOM   8382   H  HG2  . MET A 1 112 ? 0.388   -2.753  -14.154 1.00 15.00 ?  154 MET A HG2  3  
ATOM   8383   H  HG3  . MET A 1 112 ? 0.183   -2.220  -12.487 1.00 15.00 ?  154 MET A HG3  3  
ATOM   8384   H  HE1  . MET A 1 112 ? 0.373   -5.116  -14.356 1.00 15.00 ?  154 MET A HE1  3  
ATOM   8385   H  HE2  . MET A 1 112 ? -0.487  -6.258  -13.323 1.00 15.00 ?  154 MET A HE2  3  
ATOM   8386   H  HE3  . MET A 1 112 ? 0.760   -5.216  -12.640 1.00 15.00 ?  154 MET A HE3  3  
ATOM   8387   N  N    . VAL A 1 113 ? -3.955  -0.270  -15.168 1.00 15.00 ?  155 VAL A N    3  
ATOM   8388   C  CA   . VAL A 1 113 ? -4.729  0.904   -15.542 1.00 15.00 ?  155 VAL A CA   3  
ATOM   8389   C  C    . VAL A 1 113 ? -4.251  2.111   -14.741 1.00 15.00 ?  155 VAL A C    3  
ATOM   8390   O  O    . VAL A 1 113 ? -4.319  2.110   -13.510 1.00 15.00 ?  155 VAL A O    3  
ATOM   8391   C  CB   . VAL A 1 113 ? -6.242  0.698   -15.302 1.00 15.00 ?  155 VAL A CB   3  
ATOM   8392   C  CG1  . VAL A 1 113 ? -7.035  1.878   -15.836 1.00 15.00 ?  155 VAL A CG1  3  
ATOM   8393   C  CG2  . VAL A 1 113 ? -6.721  -0.601  -15.938 1.00 15.00 ?  155 VAL A CG2  3  
ATOM   8394   H  H    . VAL A 1 113 ? -4.357  -0.942  -14.576 1.00 15.00 ?  155 VAL A H    3  
ATOM   8395   H  HA   . VAL A 1 113 ? -4.571  1.091   -16.595 1.00 15.00 ?  155 VAL A HA   3  
ATOM   8396   H  HB   . VAL A 1 113 ? -6.409  0.633   -14.237 1.00 15.00 ?  155 VAL A HB   3  
ATOM   8397   H  HG11 . VAL A 1 113 ? -8.061  1.799   -15.510 1.00 15.00 ?  155 VAL A HG11 3  
ATOM   8398   H  HG12 . VAL A 1 113 ? -6.997  1.876   -16.913 1.00 15.00 ?  155 VAL A HG12 3  
ATOM   8399   H  HG13 . VAL A 1 113 ? -6.604  2.798   -15.463 1.00 15.00 ?  155 VAL A HG13 3  
ATOM   8400   H  HG21 . VAL A 1 113 ? -7.797  -0.673  -15.842 1.00 15.00 ?  155 VAL A HG21 3  
ATOM   8401   H  HG22 . VAL A 1 113 ? -6.256  -1.436  -15.438 1.00 15.00 ?  155 VAL A HG22 3  
ATOM   8402   H  HG23 . VAL A 1 113 ? -6.453  -0.609  -16.985 1.00 15.00 ?  155 VAL A HG23 3  
ATOM   8403   N  N    . ALA A 1 114 ? -3.755  3.124   -15.443 1.00 15.00 ?  156 ALA A N    3  
ATOM   8404   C  CA   . ALA A 1 114 ? -3.251  4.335   -14.803 1.00 15.00 ?  156 ALA A CA   3  
ATOM   8405   C  C    . ALA A 1 114 ? -4.347  5.057   -14.025 1.00 15.00 ?  156 ALA A C    3  
ATOM   8406   O  O    . ALA A 1 114 ? -5.523  5.010   -14.394 1.00 15.00 ?  156 ALA A O    3  
ATOM   8407   C  CB   . ALA A 1 114 ? -2.632  5.265   -15.840 1.00 15.00 ?  156 ALA A CB   3  
ATOM   8408   H  H    . ALA A 1 114 ? -3.730  3.057   -16.420 1.00 15.00 ?  156 ALA A H    3  
ATOM   8409   H  HA   . ALA A 1 114 ? -2.473  4.043   -14.113 1.00 15.00 ?  156 ALA A HA   3  
ATOM   8410   H  HB1  . ALA A 1 114 ? -1.925  4.713   -16.441 1.00 15.00 ?  156 ALA A HB1  3  
ATOM   8411   H  HB2  . ALA A 1 114 ? -2.123  6.075   -15.337 1.00 15.00 ?  156 ALA A HB2  3  
ATOM   8412   H  HB3  . ALA A 1 114 ? -3.408  5.666   -16.475 1.00 15.00 ?  156 ALA A HB3  3  
ATOM   8413   N  N    . ALA A 1 115 ? -3.947  5.730   -12.952 1.00 15.00 ?  157 ALA A N    3  
ATOM   8414   C  CA   . ALA A 1 115 ? -4.875  6.460   -12.106 1.00 15.00 ?  157 ALA A CA   3  
ATOM   8415   C  C    . ALA A 1 115 ? -5.334  7.743   -12.790 1.00 15.00 ?  157 ALA A C    3  
ATOM   8416   O  O    . ALA A 1 115 ? -4.769  8.160   -13.805 1.00 15.00 ?  157 ALA A O    3  
ATOM   8417   C  CB   . ALA A 1 115 ? -4.222  6.781   -10.771 1.00 15.00 ?  157 ALA A CB   3  
ATOM   8418   H  H    . ALA A 1 115 ? -2.990  5.747   -12.728 1.00 15.00 ?  157 ALA A H    3  
ATOM   8419   H  HA   . ALA A 1 115 ? -5.737  5.827   -11.919 1.00 15.00 ?  157 ALA A HA   3  
ATOM   8420   H  HB1  . ALA A 1 115 ? -3.313  7.335   -10.945 1.00 15.00 ?  157 ALA A HB1  3  
ATOM   8421   H  HB2  . ALA A 1 115 ? -3.991  5.864   -10.251 1.00 15.00 ?  157 ALA A HB2  3  
ATOM   8422   H  HB3  . ALA A 1 115 ? -4.896  7.374   -10.172 1.00 15.00 ?  157 ALA A HB3  3  
ATOM   8423   N  N    . GLN A 1 116 ? -6.355  8.364   -12.226 1.00 15.00 ?  158 GLN A N    3  
ATOM   8424   C  CA   . GLN A 1 116 ? -6.908  9.593   -12.773 1.00 15.00 ?  158 GLN A CA   3  
ATOM   8425   C  C    . GLN A 1 116 ? -5.968  10.770  -12.548 1.00 15.00 ?  158 GLN A C    3  
ATOM   8426   O  O    . GLN A 1 116 ? -5.732  11.565  -13.457 1.00 15.00 ?  158 GLN A O    3  
ATOM   8427   C  CB   . GLN A 1 116 ? -8.272  9.885   -12.149 1.00 15.00 ?  158 GLN A CB   3  
ATOM   8428   C  CG   . GLN A 1 116 ? -9.327  8.843   -12.485 1.00 15.00 ?  158 GLN A CG   3  
ATOM   8429   C  CD   . GLN A 1 116 ? -10.644 9.097   -11.784 1.00 15.00 ?  158 GLN A CD   3  
ATOM   8430   O  OE1  . GLN A 1 116 ? -10.681 9.701   -10.713 1.00 15.00 ?  158 GLN A OE1  3  
ATOM   8431   N  NE2  . GLN A 1 116 ? -11.731 8.638   -12.380 1.00 15.00 ?  158 GLN A NE2  3  
ATOM   8432   H  H    . GLN A 1 116 ? -6.751  7.983   -11.406 1.00 15.00 ?  158 GLN A H    3  
ATOM   8433   H  HA   . GLN A 1 116 ? -7.036  9.450   -13.836 1.00 15.00 ?  158 GLN A HA   3  
ATOM   8434   H  HB2  . GLN A 1 116 ? -8.161  9.920   -11.076 1.00 15.00 ?  158 GLN A HB2  3  
ATOM   8435   H  HB3  . GLN A 1 116 ? -8.618  10.847  -12.499 1.00 15.00 ?  158 GLN A HB3  3  
ATOM   8436   H  HG2  . GLN A 1 116 ? -9.498  8.855   -13.550 1.00 15.00 ?  158 GLN A HG2  3  
ATOM   8437   H  HG3  . GLN A 1 116 ? -8.959  7.871   -12.193 1.00 15.00 ?  158 GLN A HG3  3  
ATOM   8438   H  HE21 . GLN A 1 116 ? -11.629 8.167   -13.235 1.00 15.00 ?  158 GLN A HE21 3  
ATOM   8439   H  HE22 . GLN A 1 116 ? -12.597 8.784   -11.942 1.00 15.00 ?  158 GLN A HE22 3  
ATOM   8440   N  N    . HIS A 1 117 ? -5.430  10.881  -11.340 1.00 15.00 ?  159 HIS A N    3  
ATOM   8441   C  CA   . HIS A 1 117 ? -4.522  11.976  -11.017 1.00 15.00 ?  159 HIS A CA   3  
ATOM   8442   C  C    . HIS A 1 117 ? -3.153  11.451  -10.594 1.00 15.00 ?  159 HIS A C    3  
ATOM   8443   O  O    . HIS A 1 117 ? -3.018  10.305  -10.157 1.00 15.00 ?  159 HIS A O    3  
ATOM   8444   C  CB   . HIS A 1 117 ? -5.110  12.864  -9.911  1.00 15.00 ?  159 HIS A CB   3  
ATOM   8445   C  CG   . HIS A 1 117 ? -6.383  13.556  -10.302 1.00 15.00 ?  159 HIS A CG   3  
ATOM   8446   N  ND1  . HIS A 1 117 ? -6.394  14.877  -10.692 1.00 15.00 ?  159 HIS A ND1  3  
ATOM   8447   C  CD2  . HIS A 1 117 ? -7.650  13.069  -10.350 1.00 15.00 ?  159 HIS A CD2  3  
ATOM   8448   C  CE1  . HIS A 1 117 ? -7.659  15.162  -10.967 1.00 15.00 ?  159 HIS A CE1  3  
ATOM   8449   N  NE2  . HIS A 1 117 ? -8.451  14.097  -10.773 1.00 15.00 ?  159 HIS A NE2  3  
ATOM   8450   H  H    . HIS A 1 117 ? -5.645  10.214  -10.650 1.00 15.00 ?  159 HIS A H    3  
ATOM   8451   H  HA   . HIS A 1 117 ? -4.400  12.571  -11.909 1.00 15.00 ?  159 HIS A HA   3  
ATOM   8452   H  HB2  . HIS A 1 117 ? -5.318  12.259  -9.040  1.00 15.00 ?  159 HIS A HB2  3  
ATOM   8453   H  HB3  . HIS A 1 117 ? -4.386  13.622  -9.650  1.00 15.00 ?  159 HIS A HB3  3  
ATOM   8454   H  HD2  . HIS A 1 117 ? -7.966  12.069  -10.105 1.00 15.00 ?  159 HIS A HD2  3  
ATOM   8455   H  HE1  . HIS A 1 117 ? -8.007  16.127  -11.305 1.00 15.00 ?  159 HIS A HE1  3  
ATOM   8456   H  HE2  . HIS A 1 117 ? -9.421  14.056  -10.917 1.00 15.00 ?  159 HIS A HE2  3  
ATOM   8457   N  N    . SER A 1 118 ? -2.140  12.297  -10.719 1.00 15.00 ?  160 SER A N    3  
ATOM   8458   C  CA   . SER A 1 118 ? -0.782  11.927  -10.357 1.00 15.00 ?  160 SER A CA   3  
ATOM   8459   C  C    . SER A 1 118 ? -0.267  12.816  -9.232  1.00 15.00 ?  160 SER A C    3  
ATOM   8460   O  O    . SER A 1 118 ? -0.587  14.004  -9.167  1.00 15.00 ?  160 SER A O    3  
ATOM   8461   C  CB   . SER A 1 118 ? 0.137   12.034  -11.577 1.00 15.00 ?  160 SER A CB   3  
ATOM   8462   O  OG   . SER A 1 118 ? -0.249  11.116  -12.589 1.00 15.00 ?  160 SER A OG   3  
ATOM   8463   H  H    . SER A 1 118 ? -2.310  13.198  -11.065 1.00 15.00 ?  160 SER A H    3  
ATOM   8464   H  HA   . SER A 1 118 ? -0.796  10.901  -10.014 1.00 15.00 ?  160 SER A HA   3  
ATOM   8465   H  HB2  . SER A 1 118 ? 0.087   13.036  -11.978 1.00 15.00 ?  160 SER A HB2  3  
ATOM   8466   H  HB3  . SER A 1 118 ? 1.152   11.819  -11.280 1.00 15.00 ?  160 SER A HB3  3  
ATOM   8467   H  HG   . SER A 1 118 ? 0.035   11.454  -13.448 1.00 15.00 ?  160 SER A HG   3  
ATOM   8468   N  N    . LEU A 1 119 ? 0.516   12.223  -8.342  1.00 15.00 ?  161 LEU A N    3  
ATOM   8469   C  CA   . LEU A 1 119 ? 1.086   12.943  -7.214  1.00 15.00 ?  161 LEU A CA   3  
ATOM   8470   C  C    . LEU A 1 119 ? 2.532   13.325  -7.488  1.00 15.00 ?  161 LEU A C    3  
ATOM   8471   O  O    . LEU A 1 119 ? 3.330   12.494  -7.928  1.00 15.00 ?  161 LEU A O    3  
ATOM   8472   C  CB   . LEU A 1 119 ? 1.037   12.080  -5.950  1.00 15.00 ?  161 LEU A CB   3  
ATOM   8473   C  CG   . LEU A 1 119 ? -0.327  11.489  -5.607  1.00 15.00 ?  161 LEU A CG   3  
ATOM   8474   C  CD1  . LEU A 1 119 ? -0.174  10.329  -4.637  1.00 15.00 ?  161 LEU A CD1  3  
ATOM   8475   C  CD2  . LEU A 1 119 ? -1.230  12.553  -5.013  1.00 15.00 ?  161 LEU A CD2  3  
ATOM   8476   H  H    . LEU A 1 119 ? 0.705   11.262  -8.441  1.00 15.00 ?  161 LEU A H    3  
ATOM   8477   H  HA   . LEU A 1 119 ? 0.507   13.837  -7.056  1.00 15.00 ?  161 LEU A HA   3  
ATOM   8478   H  HB2  . LEU A 1 119 ? 1.737   11.268  -6.072  1.00 15.00 ?  161 LEU A HB2  3  
ATOM   8479   H  HB3  . LEU A 1 119 ? 1.359   12.685  -5.117  1.00 15.00 ?  161 LEU A HB3  3  
ATOM   8480   H  HG   . LEU A 1 119 ? -0.790  11.116  -6.508  1.00 15.00 ?  161 LEU A HG   3  
ATOM   8481   H  HD11 . LEU A 1 119 ? 0.446   9.566   -5.084  1.00 15.00 ?  161 LEU A HD11 3  
ATOM   8482   H  HD12 . LEU A 1 119 ? -1.146  9.919   -4.412  1.00 15.00 ?  161 LEU A HD12 3  
ATOM   8483   H  HD13 . LEU A 1 119 ? 0.289   10.684  -3.727  1.00 15.00 ?  161 LEU A HD13 3  
ATOM   8484   H  HD21 . LEU A 1 119 ? -2.184  12.114  -4.757  1.00 15.00 ?  161 LEU A HD21 3  
ATOM   8485   H  HD22 . LEU A 1 119 ? -1.379  13.345  -5.733  1.00 15.00 ?  161 LEU A HD22 3  
ATOM   8486   H  HD23 . LEU A 1 119 ? -0.770  12.955  -4.125  1.00 15.00 ?  161 LEU A HD23 3  
ATOM   8487   N  N    . THR A 1 120 ? 2.868   14.581  -7.243  1.00 15.00 ?  162 THR A N    3  
ATOM   8488   C  CA   . THR A 1 120 ? 4.229   15.041  -7.435  1.00 15.00 ?  162 THR A CA   3  
ATOM   8489   C  C    . THR A 1 120 ? 4.912   15.178  -6.077  1.00 15.00 ?  162 THR A C    3  
ATOM   8490   O  O    . THR A 1 120 ? 4.283   15.595  -5.099  1.00 15.00 ?  162 THR A O    3  
ATOM   8491   C  CB   . THR A 1 120 ? 4.283   16.375  -8.198  1.00 15.00 ?  162 THR A CB   3  
ATOM   8492   O  OG1  . THR A 1 120 ? 3.267   17.262  -7.712  1.00 15.00 ?  162 THR A OG1  3  
ATOM   8493   C  CG2  . THR A 1 120 ? 4.089   16.145  -9.690  1.00 15.00 ?  162 THR A CG2  3  
ATOM   8494   H  H    . THR A 1 120 ? 2.184   15.212  -6.926  1.00 15.00 ?  162 THR A H    3  
ATOM   8495   H  HA   . THR A 1 120 ? 4.752   14.294  -8.013  1.00 15.00 ?  162 THR A HA   3  
ATOM   8496   H  HB   . THR A 1 120 ? 5.251   16.823  -8.039  1.00 15.00 ?  162 THR A HB   3  
ATOM   8497   H  HG1  . THR A 1 120 ? 3.051   17.031  -6.799  1.00 15.00 ?  162 THR A HG1  3  
ATOM   8498   H  HG21 . THR A 1 120 ? 4.776   15.384  -10.028 1.00 15.00 ?  162 THR A HG21 3  
ATOM   8499   H  HG22 . THR A 1 120 ? 4.279   17.062  -10.223 1.00 15.00 ?  162 THR A HG22 3  
ATOM   8500   H  HG23 . THR A 1 120 ? 3.075   15.824  -9.874  1.00 15.00 ?  162 THR A HG23 3  
ATOM   8501   N  N    . PHE A 1 121 ? 6.182   14.819  -6.011  1.00 15.00 ?  163 PHE A N    3  
ATOM   8502   C  CA   . PHE A 1 121 ? 6.918   14.872  -4.755  1.00 15.00 ?  163 PHE A CA   3  
ATOM   8503   C  C    . PHE A 1 121 ? 8.045   15.892  -4.807  1.00 15.00 ?  163 PHE A C    3  
ATOM   8504   O  O    . PHE A 1 121 ? 8.623   16.148  -5.863  1.00 15.00 ?  163 PHE A O    3  
ATOM   8505   C  CB   . PHE A 1 121 ? 7.469   13.483  -4.421  1.00 15.00 ?  163 PHE A CB   3  
ATOM   8506   C  CG   . PHE A 1 121 ? 6.388   12.473  -4.156  1.00 15.00 ?  163 PHE A CG   3  
ATOM   8507   C  CD1  . PHE A 1 121 ? 5.880   12.309  -2.880  1.00 15.00 ?  163 PHE A CD1  3  
ATOM   8508   C  CD2  . PHE A 1 121 ? 5.878   11.692  -5.182  1.00 15.00 ?  163 PHE A CD2  3  
ATOM   8509   C  CE1  . PHE A 1 121 ? 4.887   11.385  -2.629  1.00 15.00 ?  163 PHE A CE1  3  
ATOM   8510   C  CE2  . PHE A 1 121 ? 4.883   10.767  -4.937  1.00 15.00 ?  163 PHE A CE2  3  
ATOM   8511   C  CZ   . PHE A 1 121 ? 4.385   10.614  -3.658  1.00 15.00 ?  163 PHE A CZ   3  
ATOM   8512   H  H    . PHE A 1 121 ? 6.641   14.520  -6.824  1.00 15.00 ?  163 PHE A H    3  
ATOM   8513   H  HA   . PHE A 1 121 ? 6.226   15.162  -3.982  1.00 15.00 ?  163 PHE A HA   3  
ATOM   8514   H  HB2  . PHE A 1 121 ? 8.062   13.125  -5.252  1.00 15.00 ?  163 PHE A HB2  3  
ATOM   8515   H  HB3  . PHE A 1 121 ? 8.092   13.549  -3.541  1.00 15.00 ?  163 PHE A HB3  3  
ATOM   8516   H  HD1  . PHE A 1 121 ? 6.269   12.912  -2.075  1.00 15.00 ?  163 PHE A HD1  3  
ATOM   8517   H  HD2  . PHE A 1 121 ? 6.267   11.811  -6.181  1.00 15.00 ?  163 PHE A HD2  3  
ATOM   8518   H  HE1  . PHE A 1 121 ? 4.503   11.265  -1.627  1.00 15.00 ?  163 PHE A HE1  3  
ATOM   8519   H  HE2  . PHE A 1 121 ? 4.492   10.165  -5.745  1.00 15.00 ?  163 PHE A HE2  3  
ATOM   8520   H  HZ   . PHE A 1 121 ? 3.608   9.889   -3.463  1.00 15.00 ?  163 PHE A HZ   3  
ATOM   8521   N  N    . ALA A 1 122 ? 8.332   16.485  -3.657  1.00 15.00 ?  164 ALA A N    3  
ATOM   8522   C  CA   . ALA A 1 122 ? 9.386   17.475  -3.548  1.00 15.00 ?  164 ALA A CA   3  
ATOM   8523   C  C    . ALA A 1 122 ? 10.741  16.798  -3.388  1.00 15.00 ?  164 ALA A C    3  
ATOM   8524   O  O    . ALA A 1 122 ? 10.819  15.571  -3.305  1.00 15.00 ?  164 ALA A O    3  
ATOM   8525   C  CB   . ALA A 1 122 ? 9.104   18.399  -2.376  1.00 15.00 ?  164 ALA A CB   3  
ATOM   8526   H  H    . ALA A 1 122 ? 7.812   16.248  -2.855  1.00 15.00 ?  164 ALA A H    3  
ATOM   8527   H  HA   . ALA A 1 122 ? 9.391   18.069  -4.451  1.00 15.00 ?  164 ALA A HA   3  
ATOM   8528   H  HB1  . ALA A 1 122 ? 9.139   17.833  -1.457  1.00 15.00 ?  164 ALA A HB1  3  
ATOM   8529   H  HB2  . ALA A 1 122 ? 8.122   18.838  -2.491  1.00 15.00 ?  164 ALA A HB2  3  
ATOM   8530   H  HB3  . ALA A 1 122 ? 9.848   19.177  -2.348  1.00 15.00 ?  164 ALA A HB3  3  
ATOM   8531   N  N    . ALA A 1 123 ? 11.797  17.596  -3.310  1.00 15.00 ?  165 ALA A N    3  
ATOM   8532   C  CA   . ALA A 1 123 ? 13.157  17.071  -3.174  1.00 15.00 ?  165 ALA A CA   3  
ATOM   8533   C  C    . ALA A 1 123 ? 13.342  16.328  -1.853  1.00 15.00 ?  165 ALA A C    3  
ATOM   8534   O  O    . ALA A 1 123 ? 14.168  15.419  -1.751  1.00 15.00 ?  165 ALA A O    3  
ATOM   8535   C  CB   . ALA A 1 123 ? 14.170  18.200  -3.279  1.00 15.00 ?  165 ALA A CB   3  
ATOM   8536   H  H    . ALA A 1 123 ? 11.663  18.570  -3.343  1.00 15.00 ?  165 ALA A H    3  
ATOM   8537   H  HA   . ALA A 1 123 ? 13.332  16.386  -3.992  1.00 15.00 ?  165 ALA A HA   3  
ATOM   8538   H  HB1  . ALA A 1 123 ? 13.860  18.894  -4.047  1.00 15.00 ?  165 ALA A HB1  3  
ATOM   8539   H  HB2  . ALA A 1 123 ? 15.138  17.794  -3.531  1.00 15.00 ?  165 ALA A HB2  3  
ATOM   8540   H  HB3  . ALA A 1 123 ? 14.232  18.714  -2.331  1.00 15.00 ?  165 ALA A HB3  3  
ATOM   8541   N  N    . ASN A 1 124 ? 12.563  16.711  -0.847  1.00 15.00 ?  166 ASN A N    3  
ATOM   8542   C  CA   . ASN A 1 124 ? 12.645  16.082  0.473   1.00 15.00 ?  166 ASN A CA   3  
ATOM   8543   C  C    . ASN A 1 124 ? 11.854  14.771  0.514   1.00 15.00 ?  166 ASN A C    3  
ATOM   8544   O  O    . ASN A 1 124 ? 11.842  14.073  1.529   1.00 15.00 ?  166 ASN A O    3  
ATOM   8545   C  CB   . ASN A 1 124 ? 12.150  17.039  1.574   1.00 15.00 ?  166 ASN A CB   3  
ATOM   8546   C  CG   . ASN A 1 124 ? 10.794  17.650  1.269   1.00 15.00 ?  166 ASN A CG   3  
ATOM   8547   O  OD1  . ASN A 1 124 ? 9.968   17.047  0.587   1.00 15.00 ?  166 ASN A OD1  3  
ATOM   8548   N  ND2  . ASN A 1 124 ? 10.553  18.853  1.767   1.00 15.00 ?  166 ASN A ND2  3  
ATOM   8549   H  H    . ASN A 1 124 ? 11.916  17.428  -0.994  1.00 15.00 ?  166 ASN A H    3  
ATOM   8550   H  HA   . ASN A 1 124 ? 13.687  15.857  0.655   1.00 15.00 ?  166 ASN A HA   3  
ATOM   8551   H  HB2  . ASN A 1 124 ? 12.073  16.494  2.503   1.00 15.00 ?  166 ASN A HB2  3  
ATOM   8552   H  HB3  . ASN A 1 124 ? 12.867  17.840  1.695   1.00 15.00 ?  166 ASN A HB3  3  
ATOM   8553   H  HD21 . ASN A 1 124 ? 11.258  19.285  2.303   1.00 15.00 ?  166 ASN A HD21 3  
ATOM   8554   H  HD22 . ASN A 1 124 ? 9.676   19.261  1.592   1.00 15.00 ?  166 ASN A HD22 3  
ATOM   8555   N  N    . GLY A 1 125 ? 11.178  14.459  -0.584  1.00 15.00 ?  167 GLY A N    3  
ATOM   8556   C  CA   . GLY A 1 125 ? 10.413  13.227  -0.666  1.00 15.00 ?  167 GLY A CA   3  
ATOM   8557   C  C    . GLY A 1 125 ? 8.950   13.395  -0.297  1.00 15.00 ?  167 GLY A C    3  
ATOM   8558   O  O    . GLY A 1 125 ? 8.130   12.524  -0.578  1.00 15.00 ?  167 GLY A O    3  
ATOM   8559   H  H    . GLY A 1 125 ? 11.195  15.073  -1.348  1.00 15.00 ?  167 GLY A H    3  
ATOM   8560   H  HA2  . GLY A 1 125 ? 10.472  12.851  -1.676  1.00 15.00 ?  167 GLY A HA2  3  
ATOM   8561   H  HA3  . GLY A 1 125 ? 10.857  12.497  -0.000  1.00 15.00 ?  167 GLY A HA3  3  
ATOM   8562   N  N    . TRP A 1 126 ? 8.609   14.512  0.330   1.00 15.00 ?  168 TRP A N    3  
ATOM   8563   C  CA   . TRP A 1 126 ? 7.232   14.758  0.733   1.00 15.00 ?  168 TRP A CA   3  
ATOM   8564   C  C    . TRP A 1 126 ? 6.374   15.134  -0.469  1.00 15.00 ?  168 TRP A C    3  
ATOM   8565   O  O    . TRP A 1 126 ? 6.842   15.789  -1.403  1.00 15.00 ?  168 TRP A O    3  
ATOM   8566   C  CB   . TRP A 1 126 ? 7.169   15.847  1.808   1.00 15.00 ?  168 TRP A CB   3  
ATOM   8567   C  CG   . TRP A 1 126 ? 7.605   15.363  3.157   1.00 15.00 ?  168 TRP A CG   3  
ATOM   8568   C  CD1  . TRP A 1 126 ? 8.813   15.576  3.751   1.00 15.00 ?  168 TRP A CD1  3  
ATOM   8569   C  CD2  . TRP A 1 126 ? 6.841   14.566  4.073   1.00 15.00 ?  168 TRP A CD2  3  
ATOM   8570   N  NE1  . TRP A 1 126 ? 8.847   14.970  4.985   1.00 15.00 ?  168 TRP A NE1  3  
ATOM   8571   C  CE2  . TRP A 1 126 ? 7.648   14.344  5.202   1.00 15.00 ?  168 TRP A CE2  3  
ATOM   8572   C  CE3  . TRP A 1 126 ? 5.551   14.025  4.047   1.00 15.00 ?  168 TRP A CE3  3  
ATOM   8573   C  CZ2  . TRP A 1 126 ? 7.211   13.602  6.296   1.00 15.00 ?  168 TRP A CZ2  3  
ATOM   8574   C  CZ3  . TRP A 1 126 ? 5.119   13.287  5.133   1.00 15.00 ?  168 TRP A CZ3  3  
ATOM   8575   C  CH2  . TRP A 1 126 ? 5.944   13.083  6.245   1.00 15.00 ?  168 TRP A CH2  3  
ATOM   8576   H  H    . TRP A 1 126 ? 9.294   15.188  0.516   1.00 15.00 ?  168 TRP A H    3  
ATOM   8577   H  HA   . TRP A 1 126 ? 6.850   13.838  1.148   1.00 15.00 ?  168 TRP A HA   3  
ATOM   8578   H  HB2  . TRP A 1 126 ? 7.812   16.664  1.520   1.00 15.00 ?  168 TRP A HB2  3  
ATOM   8579   H  HB3  . TRP A 1 126 ? 6.152   16.205  1.891   1.00 15.00 ?  168 TRP A HB3  3  
ATOM   8580   H  HD1  . TRP A 1 126 ? 9.617   16.147  3.307   1.00 15.00 ?  168 TRP A HD1  3  
ATOM   8581   H  HE1  . TRP A 1 126 ? 9.608   14.981  5.606   1.00 15.00 ?  168 TRP A HE1  3  
ATOM   8582   H  HE3  . TRP A 1 126 ? 4.898   14.172  3.198   1.00 15.00 ?  168 TRP A HE3  3  
ATOM   8583   H  HZ2  . TRP A 1 126 ? 7.834   13.439  7.159   1.00 15.00 ?  168 TRP A HZ2  3  
ATOM   8584   H  HZ3  . TRP A 1 126 ? 4.129   12.860  5.130   1.00 15.00 ?  168 TRP A HZ3  3  
ATOM   8585   H  HH2  . TRP A 1 126 ? 5.564   12.502  7.073   1.00 15.00 ?  168 TRP A HH2  3  
ATOM   8586   N  N    . VAL A 1 127 ? 5.118   14.709  -0.438  1.00 15.00 ?  169 VAL A N    3  
ATOM   8587   C  CA   . VAL A 1 127 ? 4.191   14.981  -1.524  1.00 15.00 ?  169 VAL A CA   3  
ATOM   8588   C  C    . VAL A 1 127 ? 3.783   16.451  -1.560  1.00 15.00 ?  169 VAL A C    3  
ATOM   8589   O  O    . VAL A 1 127 ? 3.617   17.091  -0.517  1.00 15.00 ?  169 VAL A O    3  
ATOM   8590   C  CB   . VAL A 1 127 ? 2.927   14.086  -1.420  1.00 15.00 ?  169 VAL A CB   3  
ATOM   8591   C  CG1  . VAL A 1 127 ? 2.069   14.473  -0.226  1.00 15.00 ?  169 VAL A CG1  3  
ATOM   8592   C  CG2  . VAL A 1 127 ? 2.114   14.148  -2.704  1.00 15.00 ?  169 VAL A CG2  3  
ATOM   8593   H  H    . VAL A 1 127 ? 4.806   14.195  0.339   1.00 15.00 ?  169 VAL A H    3  
ATOM   8594   H  HA   . VAL A 1 127 ? 4.694   14.743  -2.447  1.00 15.00 ?  169 VAL A HA   3  
ATOM   8595   H  HB   . VAL A 1 127 ? 3.251   13.064  -1.280  1.00 15.00 ?  169 VAL A HB   3  
ATOM   8596   H  HG11 . VAL A 1 127 ? 2.666   14.444  0.673   1.00 15.00 ?  169 VAL A HG11 3  
ATOM   8597   H  HG12 . VAL A 1 127 ? 1.244   13.781  -0.134  1.00 15.00 ?  169 VAL A HG12 3  
ATOM   8598   H  HG13 . VAL A 1 127 ? 1.687   15.472  -0.370  1.00 15.00 ?  169 VAL A HG13 3  
ATOM   8599   H  HG21 . VAL A 1 127 ? 2.735   13.853  -3.537  1.00 15.00 ?  169 VAL A HG21 3  
ATOM   8600   H  HG22 . VAL A 1 127 ? 1.759   15.158  -2.858  1.00 15.00 ?  169 VAL A HG22 3  
ATOM   8601   H  HG23 . VAL A 1 127 ? 1.268   13.478  -2.629  1.00 15.00 ?  169 VAL A HG23 3  
ATOM   8602   N  N    . GLU A 1 128 ? 3.652   16.982  -2.765  1.00 15.00 ?  170 GLU A N    3  
ATOM   8603   C  CA   . GLU A 1 128 ? 3.239   18.360  -2.948  1.00 15.00 ?  170 GLU A CA   3  
ATOM   8604   C  C    . GLU A 1 128 ? 1.738   18.474  -2.703  1.00 15.00 ?  170 GLU A C    3  
ATOM   8605   O  O    . GLU A 1 128 ? 0.950   17.828  -3.400  1.00 15.00 ?  170 GLU A O    3  
ATOM   8606   C  CB   . GLU A 1 128 ? 3.579   18.833  -4.364  1.00 15.00 ?  170 GLU A CB   3  
ATOM   8607   C  CG   . GLU A 1 128 ? 5.062   19.095  -4.581  1.00 15.00 ?  170 GLU A CG   3  
ATOM   8608   C  CD   . GLU A 1 128 ? 5.459   20.520  -4.239  1.00 15.00 ?  170 GLU A CD   3  
ATOM   8609   O  OE1  . GLU A 1 128 ? 4.903   21.081  -3.270  1.00 15.00 ?  170 GLU A OE1  3  
ATOM   8610   O  OE2  . GLU A 1 128 ? 6.326   21.089  -4.942  1.00 15.00 -1 170 GLU A OE2  3  
ATOM   8611   H  H    . GLU A 1 128 ? 3.839   16.426  -3.557  1.00 15.00 ?  170 GLU A H    3  
ATOM   8612   H  HA   . GLU A 1 128 ? 3.766   18.969  -2.230  1.00 15.00 ?  170 GLU A HA   3  
ATOM   8613   H  HB2  . GLU A 1 128 ? 3.262   18.079  -5.070  1.00 15.00 ?  170 GLU A HB2  3  
ATOM   8614   H  HB3  . GLU A 1 128 ? 3.044   19.746  -4.564  1.00 15.00 ?  170 GLU A HB3  3  
ATOM   8615   H  HG2  . GLU A 1 128 ? 5.627   18.420  -3.957  1.00 15.00 ?  170 GLU A HG2  3  
ATOM   8616   H  HG3  . GLU A 1 128 ? 5.300   18.909  -5.617  1.00 15.00 ?  170 GLU A HG3  3  
ATOM   8617   N  N    . PRO A 1 129 ? 1.326   19.262  -1.693  1.00 15.00 ?  171 PRO A N    3  
ATOM   8618   C  CA   . PRO A 1 129 ? -0.092  19.455  -1.357  1.00 15.00 ?  171 PRO A CA   3  
ATOM   8619   C  C    . PRO A 1 129 ? -0.940  19.860  -2.564  1.00 15.00 ?  171 PRO A C    3  
ATOM   8620   O  O    . PRO A 1 129 ? -2.136  19.571  -2.614  1.00 15.00 ?  171 PRO A O    3  
ATOM   8621   C  CB   . PRO A 1 129 ? -0.059  20.580  -0.325  1.00 15.00 ?  171 PRO A CB   3  
ATOM   8622   C  CG   . PRO A 1 129 ? 1.287   20.482  0.302   1.00 15.00 ?  171 PRO A CG   3  
ATOM   8623   C  CD   . PRO A 1 129 ? 2.216   20.010  -0.781  1.00 15.00 ?  171 PRO A CD   3  
ATOM   8624   H  HA   . PRO A 1 129 ? -0.515  18.567  -0.910  1.00 15.00 ?  171 PRO A HA   3  
ATOM   8625   H  HB2  . PRO A 1 129 ? -0.191  21.537  -0.816  1.00 15.00 ?  171 PRO A HB2  3  
ATOM   8626   H  HB3  . PRO A 1 129 ? -0.824  20.426  0.417   1.00 15.00 ?  171 PRO A HB3  3  
ATOM   8627   H  HG2  . PRO A 1 129 ? 1.592   21.452  0.666   1.00 15.00 ?  171 PRO A HG2  3  
ATOM   8628   H  HG3  . PRO A 1 129 ? 1.270   19.766  1.105   1.00 15.00 ?  171 PRO A HG3  3  
ATOM   8629   H  HD2  . PRO A 1 129 ? 2.667   20.851  -1.284  1.00 15.00 ?  171 PRO A HD2  3  
ATOM   8630   H  HD3  . PRO A 1 129 ? 2.975   19.363  -0.370  1.00 15.00 ?  171 PRO A HD3  3  
ATOM   8631   N  N    . ALA A 1 130 ? -0.311  20.517  -3.542  1.00 15.00 ?  172 ALA A N    3  
ATOM   8632   C  CA   . ALA A 1 130 ? -1.007  20.950  -4.754  1.00 15.00 ?  172 ALA A CA   3  
ATOM   8633   C  C    . ALA A 1 130 ? -1.528  19.753  -5.548  1.00 15.00 ?  172 ALA A C    3  
ATOM   8634   O  O    . ALA A 1 130 ? -2.489  19.868  -6.310  1.00 15.00 ?  172 ALA A O    3  
ATOM   8635   C  CB   . ALA A 1 130 ? -0.084  21.795  -5.623  1.00 15.00 ?  172 ALA A CB   3  
ATOM   8636   H  H    . ALA A 1 130 ? 0.643   20.726  -3.440  1.00 15.00 ?  172 ALA A H    3  
ATOM   8637   H  HA   . ALA A 1 130 ? -1.844  21.567  -4.456  1.00 15.00 ?  172 ALA A HA   3  
ATOM   8638   H  HB1  . ALA A 1 130 ? 0.660   21.158  -6.079  1.00 15.00 ?  172 ALA A HB1  3  
ATOM   8639   H  HB2  . ALA A 1 130 ? 0.403   22.541  -5.015  1.00 15.00 ?  172 ALA A HB2  3  
ATOM   8640   H  HB3  . ALA A 1 130 ? -0.662  22.280  -6.396  1.00 15.00 ?  172 ALA A HB3  3  
ATOM   8641   N  N    . THR A 1 131 ? -0.891  18.603  -5.370  1.00 15.00 ?  173 THR A N    3  
ATOM   8642   C  CA   . THR A 1 131 ? -1.296  17.392  -6.068  1.00 15.00 ?  173 THR A CA   3  
ATOM   8643   C  C    . THR A 1 131 ? -2.011  16.426  -5.133  1.00 15.00 ?  173 THR A C    3  
ATOM   8644   O  O    . THR A 1 131 ? -2.484  15.373  -5.560  1.00 15.00 ?  173 THR A O    3  
ATOM   8645   C  CB   . THR A 1 131 ? -0.090  16.677  -6.705  1.00 15.00 ?  173 THR A CB   3  
ATOM   8646   O  OG1  . THR A 1 131 ? 1.097   16.891  -5.922  1.00 15.00 ?  173 THR A OG1  3  
ATOM   8647   C  CG2  . THR A 1 131 ? 0.135   17.168  -8.126  1.00 15.00 ?  173 THR A CG2  3  
ATOM   8648   H  H    . THR A 1 131 ? -0.126  18.569  -4.757  1.00 15.00 ?  173 THR A H    3  
ATOM   8649   H  HA   . THR A 1 131 ? -1.975  17.677  -6.861  1.00 15.00 ?  173 THR A HA   3  
ATOM   8650   H  HB   . THR A 1 131 ? -0.300  15.617  -6.740  1.00 15.00 ?  173 THR A HB   3  
ATOM   8651   H  HG1  . THR A 1 131 ? 0.860   16.973  -4.988  1.00 15.00 ?  173 THR A HG1  3  
ATOM   8652   H  HG21 . THR A 1 131 ? 0.148   18.248  -8.135  1.00 15.00 ?  173 THR A HG21 3  
ATOM   8653   H  HG22 . THR A 1 131 ? -0.661  16.811  -8.762  1.00 15.00 ?  173 THR A HG22 3  
ATOM   8654   H  HG23 . THR A 1 131 ? 1.082   16.793  -8.491  1.00 15.00 ?  173 THR A HG23 3  
ATOM   8655   N  N    . ALA A 1 132 ? -2.095  16.795  -3.862  1.00 15.00 ?  174 ALA A N    3  
ATOM   8656   C  CA   . ALA A 1 132 ? -2.746  15.958  -2.866  1.00 15.00 ?  174 ALA A CA   3  
ATOM   8657   C  C    . ALA A 1 132 ? -3.804  16.744  -2.100  1.00 15.00 ?  174 ALA A C    3  
ATOM   8658   O  O    . ALA A 1 132 ? -3.577  17.166  -0.964  1.00 15.00 ?  174 ALA A O    3  
ATOM   8659   C  CB   . ALA A 1 132 ? -1.712  15.381  -1.912  1.00 15.00 ?  174 ALA A CB   3  
ATOM   8660   H  H    . ALA A 1 132 ? -1.723  17.661  -3.589  1.00 15.00 ?  174 ALA A H    3  
ATOM   8661   H  HA   . ALA A 1 132 ? -3.224  15.138  -3.382  1.00 15.00 ?  174 ALA A HA   3  
ATOM   8662   H  HB1  . ALA A 1 132 ? -0.968  14.837  -2.475  1.00 15.00 ?  174 ALA A HB1  3  
ATOM   8663   H  HB2  . ALA A 1 132 ? -2.199  14.713  -1.218  1.00 15.00 ?  174 ALA A HB2  3  
ATOM   8664   H  HB3  . ALA A 1 132 ? -1.238  16.186  -1.368  1.00 15.00 ?  174 ALA A HB3  3  
ATOM   8665   N  N    . PRO A 1 133 ? -4.971  16.961  -2.716  1.00 15.00 ?  175 PRO A N    3  
ATOM   8666   C  CA   . PRO A 1 133 ? -6.060  17.700  -2.111  1.00 15.00 ?  175 PRO A CA   3  
ATOM   8667   C  C    . PRO A 1 133 ? -7.065  16.804  -1.390  1.00 15.00 ?  175 PRO A C    3  
ATOM   8668   O  O    . PRO A 1 133 ? -7.447  15.745  -1.892  1.00 15.00 ?  175 PRO A O    3  
ATOM   8669   C  CB   . PRO A 1 133 ? -6.712  18.369  -3.321  1.00 15.00 ?  175 PRO A CB   3  
ATOM   8670   C  CG   . PRO A 1 133 ? -6.368  17.519  -4.510  1.00 15.00 ?  175 PRO A CG   3  
ATOM   8671   C  CD   . PRO A 1 133 ? -5.329  16.513  -4.069  1.00 15.00 ?  175 PRO A CD   3  
ATOM   8672   H  HA   . PRO A 1 133 ? -5.700  18.454  -1.430  1.00 15.00 ?  175 PRO A HA   3  
ATOM   8673   H  HB2  . PRO A 1 133 ? -7.785  18.415  -3.178  1.00 15.00 ?  175 PRO A HB2  3  
ATOM   8674   H  HB3  . PRO A 1 133 ? -6.313  19.361  -3.451  1.00 15.00 ?  175 PRO A HB3  3  
ATOM   8675   H  HG2  . PRO A 1 133 ? -7.256  17.009  -4.858  1.00 15.00 ?  175 PRO A HG2  3  
ATOM   8676   H  HG3  . PRO A 1 133 ? -5.965  18.137  -5.293  1.00 15.00 ?  175 PRO A HG3  3  
ATOM   8677   H  HD2  . PRO A 1 133 ? -5.749  15.519  -4.050  1.00 15.00 ?  175 PRO A HD2  3  
ATOM   8678   H  HD3  . PRO A 1 133 ? -4.470  16.548  -4.726  1.00 15.00 ?  175 PRO A HD3  3  
ATOM   8679   N  N    . ASN A 1 134 ? -7.470  17.249  -0.200  1.00 15.00 ?  176 ASN A N    3  
ATOM   8680   C  CA   . ASN A 1 134 ? -8.451  16.542  0.626   1.00 15.00 ?  176 ASN A CA   3  
ATOM   8681   C  C    . ASN A 1 134 ? -7.992  15.133  0.994   1.00 15.00 ?  176 ASN A C    3  
ATOM   8682   O  O    . ASN A 1 134 ? -8.799  14.205  1.042   1.00 15.00 ?  176 ASN A O    3  
ATOM   8683   C  CB   . ASN A 1 134 ? -9.807  16.469  -0.085  1.00 15.00 ?  176 ASN A CB   3  
ATOM   8684   C  CG   . ASN A 1 134 ? -10.465 17.825  -0.273  1.00 15.00 ?  176 ASN A CG   3  
ATOM   8685   O  OD1  . ASN A 1 134 ? -11.123 18.067  -1.284  1.00 15.00 ?  176 ASN A OD1  3  
ATOM   8686   N  ND2  . ASN A 1 134 ? -10.308 18.713  0.699   1.00 15.00 ?  176 ASN A ND2  3  
ATOM   8687   H  H    . ASN A 1 134 ? -7.083  18.086  0.142   1.00 15.00 ?  176 ASN A H    3  
ATOM   8688   H  HA   . ASN A 1 134 ? -8.570  17.108  1.537   1.00 15.00 ?  176 ASN A HA   3  
ATOM   8689   H  HB2  . ASN A 1 134 ? -9.667  16.026  -1.061  1.00 15.00 ?  176 ASN A HB2  3  
ATOM   8690   H  HB3  . ASN A 1 134 ? -10.471 15.844  0.491   1.00 15.00 ?  176 ASN A HB3  3  
ATOM   8691   H  HD21 . ASN A 1 134 ? -9.781  18.458  1.487   1.00 15.00 ?  176 ASN A HD21 3  
ATOM   8692   H  HD22 . ASN A 1 134 ? -10.735 19.593  0.592   1.00 15.00 ?  176 ASN A HD22 3  
ATOM   8693   N  N    . PHE A 1 135 ? -6.708  14.979  1.286   1.00 15.00 ?  177 PHE A N    3  
ATOM   8694   C  CA   . PHE A 1 135 ? -6.171  13.673  1.647   1.00 15.00 ?  177 PHE A CA   3  
ATOM   8695   C  C    . PHE A 1 135 ? -6.451  13.358  3.114   1.00 15.00 ?  177 PHE A C    3  
ATOM   8696   O  O    . PHE A 1 135 ? -6.436  12.199  3.528   1.00 15.00 ?  177 PHE A O    3  
ATOM   8697   C  CB   . PHE A 1 135 ? -4.673  13.611  1.358   1.00 15.00 ?  177 PHE A CB   3  
ATOM   8698   C  CG   . PHE A 1 135 ? -4.348  12.895  0.078   1.00 15.00 ?  177 PHE A CG   3  
ATOM   8699   C  CD1  . PHE A 1 135 ? -4.724  13.427  -1.144  1.00 15.00 ?  177 PHE A CD1  3  
ATOM   8700   C  CD2  . PHE A 1 135 ? -3.671  11.688  0.100   1.00 15.00 ?  177 PHE A CD2  3  
ATOM   8701   C  CE1  . PHE A 1 135 ? -4.432  12.768  -2.324  1.00 15.00 ?  177 PHE A CE1  3  
ATOM   8702   C  CE2  . PHE A 1 135 ? -3.374  11.023  -1.075  1.00 15.00 ?  177 PHE A CE2  3  
ATOM   8703   C  CZ   . PHE A 1 135 ? -3.754  11.564  -2.288  1.00 15.00 ?  177 PHE A CZ   3  
ATOM   8704   H  H    . PHE A 1 135 ? -6.111  15.759  1.257   1.00 15.00 ?  177 PHE A H    3  
ATOM   8705   H  HA   . PHE A 1 135 ? -6.675  12.938  1.036   1.00 15.00 ?  177 PHE A HA   3  
ATOM   8706   H  HB2  . PHE A 1 135 ? -4.283  14.615  1.286   1.00 15.00 ?  177 PHE A HB2  3  
ATOM   8707   H  HB3  . PHE A 1 135 ? -4.178  13.093  2.165   1.00 15.00 ?  177 PHE A HB3  3  
ATOM   8708   H  HD1  . PHE A 1 135 ? -5.251  14.366  -1.170  1.00 15.00 ?  177 PHE A HD1  3  
ATOM   8709   H  HD2  . PHE A 1 135 ? -3.374  11.264  1.049   1.00 15.00 ?  177 PHE A HD2  3  
ATOM   8710   H  HE1  . PHE A 1 135 ? -4.728  13.195  -3.271  1.00 15.00 ?  177 PHE A HE1  3  
ATOM   8711   H  HE2  . PHE A 1 135 ? -2.843  10.079  -1.045  1.00 15.00 ?  177 PHE A HE2  3  
ATOM   8712   H  HZ   . PHE A 1 135 ? -3.525  11.045  -3.209  1.00 15.00 ?  177 PHE A HZ   3  
ATOM   8713   N  N    . GLY A 1 136 ? -6.723  14.401  3.887   1.00 15.00 ?  178 GLY A N    3  
ATOM   8714   C  CA   . GLY A 1 136 ? -7.027  14.237  5.294   1.00 15.00 ?  178 GLY A CA   3  
ATOM   8715   C  C    . GLY A 1 136 ? -5.845  13.737  6.102   1.00 15.00 ?  178 GLY A C    3  
ATOM   8716   O  O    . GLY A 1 136 ? -4.781  14.357  6.096   1.00 15.00 ?  178 GLY A O    3  
ATOM   8717   H  H    . GLY A 1 136 ? -6.707  15.299  3.496   1.00 15.00 ?  178 GLY A H    3  
ATOM   8718   H  HA2  . GLY A 1 136 ? -7.343  15.188  5.693   1.00 15.00 ?  178 GLY A HA2  3  
ATOM   8719   H  HA3  . GLY A 1 136 ? -7.839  13.534  5.390   1.00 15.00 ?  178 GLY A HA3  3  
ATOM   8720   N  N    . PRO A 1 137 ? -5.998  12.605  6.807   1.00 15.00 ?  179 PRO A N    3  
ATOM   8721   C  CA   . PRO A 1 137 ? -4.932  12.038  7.620   1.00 15.00 ?  179 PRO A CA   3  
ATOM   8722   C  C    . PRO A 1 137 ? -3.899  11.284  6.787   1.00 15.00 ?  179 PRO A C    3  
ATOM   8723   O  O    . PRO A 1 137 ? -2.851  10.891  7.298   1.00 15.00 ?  179 PRO A O    3  
ATOM   8724   C  CB   . PRO A 1 137 ? -5.656  11.064  8.561   1.00 15.00 ?  179 PRO A CB   3  
ATOM   8725   C  CG   . PRO A 1 137 ? -7.106  11.106  8.204   1.00 15.00 ?  179 PRO A CG   3  
ATOM   8726   C  CD   . PRO A 1 137 ? -7.218  11.786  6.871   1.00 15.00 ?  179 PRO A CD   3  
ATOM   8727   H  HA   . PRO A 1 137 ? -4.434  12.800  8.203   1.00 15.00 ?  179 PRO A HA   3  
ATOM   8728   H  HB2  . PRO A 1 137 ? -5.259  10.067  8.422   1.00 15.00 ?  179 PRO A HB2  3  
ATOM   8729   H  HB3  . PRO A 1 137 ? -5.520  11.375  9.585   1.00 15.00 ?  179 PRO A HB3  3  
ATOM   8730   H  HG2  . PRO A 1 137 ? -7.489  10.097  8.143   1.00 15.00 ?  179 PRO A HG2  3  
ATOM   8731   H  HG3  . PRO A 1 137 ? -7.647  11.666  8.949   1.00 15.00 ?  179 PRO A HG3  3  
ATOM   8732   H  HD2  . PRO A 1 137 ? -7.234  11.056  6.076   1.00 15.00 ?  179 PRO A HD2  3  
ATOM   8733   H  HD3  . PRO A 1 137 ? -8.104  12.401  6.840   1.00 15.00 ?  179 PRO A HD3  3  
ATOM   8734   N  N    . LEU A 1 138 ? -4.188  11.097  5.505   1.00 15.00 ?  180 LEU A N    3  
ATOM   8735   C  CA   . LEU A 1 138 ? -3.283  10.377  4.620   1.00 15.00 ?  180 LEU A CA   3  
ATOM   8736   C  C    . LEU A 1 138 ? -2.105  11.249  4.205   1.00 15.00 ?  180 LEU A C    3  
ATOM   8737   O  O    . LEU A 1 138 ? -2.263  12.219  3.465   1.00 15.00 ?  180 LEU A O    3  
ATOM   8738   C  CB   . LEU A 1 138 ? -4.020  9.888   3.373   1.00 15.00 ?  180 LEU A CB   3  
ATOM   8739   C  CG   . LEU A 1 138 ? -5.132  8.867   3.622   1.00 15.00 ?  180 LEU A CG   3  
ATOM   8740   C  CD1  . LEU A 1 138 ? -5.597  8.259   2.310   1.00 15.00 ?  180 LEU A CD1  3  
ATOM   8741   C  CD2  . LEU A 1 138 ? -4.665  7.783   4.580   1.00 15.00 ?  180 LEU A CD2  3  
ATOM   8742   H  H    . LEU A 1 138 ? -5.024  11.465  5.142   1.00 15.00 ?  180 LEU A H    3  
ATOM   8743   H  HA   . LEU A 1 138 ? -2.905  9.519   5.160   1.00 15.00 ?  180 LEU A HA   3  
ATOM   8744   H  HB2  . LEU A 1 138 ? -4.452  10.747  2.881   1.00 15.00 ?  180 LEU A HB2  3  
ATOM   8745   H  HB3  . LEU A 1 138 ? -3.296  9.443   2.704   1.00 15.00 ?  180 LEU A HB3  3  
ATOM   8746   H  HG   . LEU A 1 138 ? -5.974  9.370   4.072   1.00 15.00 ?  180 LEU A HG   3  
ATOM   8747   H  HD11 . LEU A 1 138 ? -5.998  9.037   1.676   1.00 15.00 ?  180 LEU A HD11 3  
ATOM   8748   H  HD12 . LEU A 1 138 ? -6.363  7.523   2.506   1.00 15.00 ?  180 LEU A HD12 3  
ATOM   8749   H  HD13 . LEU A 1 138 ? -4.760  7.783   1.813   1.00 15.00 ?  180 LEU A HD13 3  
ATOM   8750   H  HD21 . LEU A 1 138 ? -3.711  7.397   4.249   1.00 15.00 ?  180 LEU A HD21 3  
ATOM   8751   H  HD22 . LEU A 1 138 ? -5.390  6.985   4.599   1.00 15.00 ?  180 LEU A HD22 3  
ATOM   8752   H  HD23 . LEU A 1 138 ? -4.560  8.200   5.572   1.00 15.00 ?  180 LEU A HD23 3  
ATOM   8753   N  N    . LYS A 1 139 ? -0.927  10.909  4.705   1.00 15.00 ?  181 LYS A N    3  
ATOM   8754   C  CA   . LYS A 1 139 ? 0.288   11.639  4.380   1.00 15.00 ?  181 LYS A CA   3  
ATOM   8755   C  C    . LYS A 1 139 ? 1.158   10.795  3.460   1.00 15.00 ?  181 LYS A C    3  
ATOM   8756   O  O    . LYS A 1 139 ? 1.684   9.757   3.867   1.00 15.00 ?  181 LYS A O    3  
ATOM   8757   C  CB   . LYS A 1 139 ? 1.054   12.002  5.657   1.00 15.00 ?  181 LYS A CB   3  
ATOM   8758   C  CG   . LYS A 1 139 ? 0.196   12.702  6.703   1.00 15.00 ?  181 LYS A CG   3  
ATOM   8759   C  CD   . LYS A 1 139 ? -0.385  14.000  6.174   1.00 15.00 ?  181 LYS A CD   3  
ATOM   8760   C  CE   . LYS A 1 139 ? -1.440  14.559  7.109   1.00 15.00 ?  181 LYS A CE   3  
ATOM   8761   N  NZ   . LYS A 1 139 ? -2.034  15.815  6.579   1.00 15.00 1  181 LYS A NZ   3  
ATOM   8762   H  H    . LYS A 1 139 ? -0.873  10.145  5.323   1.00 15.00 ?  181 LYS A H    3  
ATOM   8763   H  HA   . LYS A 1 139 ? 0.009   12.544  3.861   1.00 15.00 ?  181 LYS A HA   3  
ATOM   8764   H  HB2  . LYS A 1 139 ? 1.449   11.098  6.095   1.00 15.00 ?  181 LYS A HB2  3  
ATOM   8765   H  HB3  . LYS A 1 139 ? 1.875   12.653  5.400   1.00 15.00 ?  181 LYS A HB3  3  
ATOM   8766   H  HG2  . LYS A 1 139 ? -0.614  12.049  6.984   1.00 15.00 ?  181 LYS A HG2  3  
ATOM   8767   H  HG3  . LYS A 1 139 ? 0.805   12.918  7.571   1.00 15.00 ?  181 LYS A HG3  3  
ATOM   8768   H  HD2  . LYS A 1 139 ? 0.409   14.724  6.071   1.00 15.00 ?  181 LYS A HD2  3  
ATOM   8769   H  HD3  . LYS A 1 139 ? -0.834  13.814  5.212   1.00 15.00 ?  181 LYS A HD3  3  
ATOM   8770   H  HE2  . LYS A 1 139 ? -2.221  13.821  7.229   1.00 15.00 ?  181 LYS A HE2  3  
ATOM   8771   H  HE3  . LYS A 1 139 ? -0.986  14.761  8.069   1.00 15.00 ?  181 LYS A HE3  3  
ATOM   8772   H  HZ1  . LYS A 1 139 ? -1.286  16.510  6.377   1.00 15.00 ?  181 LYS A HZ1  3  
ATOM   8773   H  HZ2  . LYS A 1 139 ? -2.692  16.222  7.273   1.00 15.00 ?  181 LYS A HZ2  3  
ATOM   8774   H  HZ3  . LYS A 1 139 ? -2.558  15.616  5.698   1.00 15.00 ?  181 LYS A HZ3  3  
ATOM   8775   N  N    . VAL A 1 140 ? 1.293   11.233  2.217   1.00 15.00 ?  182 VAL A N    3  
ATOM   8776   C  CA   . VAL A 1 140 ? 2.083   10.509  1.234   1.00 15.00 ?  182 VAL A CA   3  
ATOM   8777   C  C    . VAL A 1 140 ? 3.532   10.984  1.233   1.00 15.00 ?  182 VAL A C    3  
ATOM   8778   O  O    . VAL A 1 140 ? 3.802   12.184  1.301   1.00 15.00 ?  182 VAL A O    3  
ATOM   8779   C  CB   . VAL A 1 140 ? 1.494   10.664  -0.181  1.00 15.00 ?  182 VAL A CB   3  
ATOM   8780   C  CG1  . VAL A 1 140 ? 2.111   9.657   -1.135  1.00 15.00 ?  182 VAL A CG1  3  
ATOM   8781   C  CG2  . VAL A 1 140 ? -0.016  10.505  -0.152  1.00 15.00 ?  182 VAL A CG2  3  
ATOM   8782   H  H    . VAL A 1 140 ? 0.854   12.066  1.954   1.00 15.00 ?  182 VAL A H    3  
ATOM   8783   H  HA   . VAL A 1 140 ? 2.057   9.460   1.497   1.00 15.00 ?  182 VAL A HA   3  
ATOM   8784   H  HB   . VAL A 1 140 ? 1.723   11.656  -0.542  1.00 15.00 ?  182 VAL A HB   3  
ATOM   8785   H  HG11 . VAL A 1 140 ? 3.185   9.703   -1.060  1.00 15.00 ?  182 VAL A HG11 3  
ATOM   8786   H  HG12 . VAL A 1 140 ? 1.808   9.885   -2.148  1.00 15.00 ?  182 VAL A HG12 3  
ATOM   8787   H  HG13 . VAL A 1 140 ? 1.775   8.665   -0.873  1.00 15.00 ?  182 VAL A HG13 3  
ATOM   8788   H  HG21 . VAL A 1 140 ? -0.432  10.848  -1.087  1.00 15.00 ?  182 VAL A HG21 3  
ATOM   8789   H  HG22 . VAL A 1 140 ? -0.423  11.090  0.660   1.00 15.00 ?  182 VAL A HG22 3  
ATOM   8790   H  HG23 . VAL A 1 140 ? -0.267  9.465   -0.007  1.00 15.00 ?  182 VAL A HG23 3  
ATOM   8791   N  N    . PHE A 1 141 ? 4.453   10.037  1.162   1.00 15.00 ?  183 PHE A N    3  
ATOM   8792   C  CA   . PHE A 1 141 ? 5.875   10.341  1.154   1.00 15.00 ?  183 PHE A CA   3  
ATOM   8793   C  C    . PHE A 1 141 ? 6.617   9.391   0.214   1.00 15.00 ?  183 PHE A C    3  
ATOM   8794   O  O    . PHE A 1 141 ? 6.366   8.187   0.212   1.00 15.00 ?  183 PHE A O    3  
ATOM   8795   C  CB   . PHE A 1 141 ? 6.430   10.237  2.583   1.00 15.00 ?  183 PHE A CB   3  
ATOM   8796   C  CG   . PHE A 1 141 ? 7.924   10.368  2.683   1.00 15.00 ?  183 PHE A CG   3  
ATOM   8797   C  CD1  . PHE A 1 141 ? 8.527   11.614  2.690   1.00 15.00 ?  183 PHE A CD1  3  
ATOM   8798   C  CD2  . PHE A 1 141 ? 8.724   9.240   2.780   1.00 15.00 ?  183 PHE A CD2  3  
ATOM   8799   C  CE1  . PHE A 1 141 ? 9.899   11.735  2.787   1.00 15.00 ?  183 PHE A CE1  3  
ATOM   8800   C  CE2  . PHE A 1 141 ? 10.096  9.355   2.877   1.00 15.00 ?  183 PHE A CE2  3  
ATOM   8801   C  CZ   . PHE A 1 141 ? 10.686  10.604  2.881   1.00 15.00 ?  183 PHE A CZ   3  
ATOM   8802   H  H    . PHE A 1 141 ? 4.166   9.095   1.120   1.00 15.00 ?  183 PHE A H    3  
ATOM   8803   H  HA   . PHE A 1 141 ? 6.000   11.353  0.799   1.00 15.00 ?  183 PHE A HA   3  
ATOM   8804   H  HB2  . PHE A 1 141 ? 5.993   11.019  3.183   1.00 15.00 ?  183 PHE A HB2  3  
ATOM   8805   H  HB3  . PHE A 1 141 ? 6.152   9.278   2.998   1.00 15.00 ?  183 PHE A HB3  3  
ATOM   8806   H  HD1  . PHE A 1 141 ? 7.913   12.499  2.616   1.00 15.00 ?  183 PHE A HD1  3  
ATOM   8807   H  HD2  . PHE A 1 141 ? 8.263   8.262   2.778   1.00 15.00 ?  183 PHE A HD2  3  
ATOM   8808   H  HE1  . PHE A 1 141 ? 10.356  12.711  2.791   1.00 15.00 ?  183 PHE A HE1  3  
ATOM   8809   H  HE2  . PHE A 1 141 ? 10.709  8.468   2.951   1.00 15.00 ?  183 PHE A HE2  3  
ATOM   8810   H  HZ   . PHE A 1 141 ? 11.760  10.696  2.957   1.00 15.00 ?  183 PHE A HZ   3  
ATOM   8811   N  N    . TYR A 1 142 ? 7.506   9.945   -0.600  1.00 15.00 ?  184 TYR A N    3  
ATOM   8812   C  CA   . TYR A 1 142 ? 8.301   9.161   -1.535  1.00 15.00 ?  184 TYR A CA   3  
ATOM   8813   C  C    . TYR A 1 142 ? 9.732   9.041   -1.012  1.00 15.00 ?  184 TYR A C    3  
ATOM   8814   O  O    . TYR A 1 142 ? 10.525  9.979   -1.112  1.00 15.00 ?  184 TYR A O    3  
ATOM   8815   C  CB   . TYR A 1 142 ? 8.284   9.808   -2.926  1.00 15.00 ?  184 TYR A CB   3  
ATOM   8816   C  CG   . TYR A 1 142 ? 9.182   9.131   -3.944  1.00 15.00 ?  184 TYR A CG   3  
ATOM   8817   C  CD1  . TYR A 1 142 ? 8.875   7.873   -4.444  1.00 15.00 ?  184 TYR A CD1  3  
ATOM   8818   C  CD2  . TYR A 1 142 ? 10.331  9.760   -4.406  1.00 15.00 ?  184 TYR A CD2  3  
ATOM   8819   C  CE1  . TYR A 1 142 ? 9.692   7.257   -5.375  1.00 15.00 ?  184 TYR A CE1  3  
ATOM   8820   C  CE2  . TYR A 1 142 ? 11.154  9.152   -5.337  1.00 15.00 ?  184 TYR A CE2  3  
ATOM   8821   C  CZ   . TYR A 1 142 ? 10.829  7.898   -5.819  1.00 15.00 ?  184 TYR A CZ   3  
ATOM   8822   O  OH   . TYR A 1 142 ? 11.644  7.285   -6.747  1.00 15.00 ?  184 TYR A OH   3  
ATOM   8823   H  H    . TYR A 1 142 ? 7.638   10.922  -0.570  1.00 15.00 ?  184 TYR A H    3  
ATOM   8824   H  HA   . TYR A 1 142 ? 7.865   8.175   -1.595  1.00 15.00 ?  184 TYR A HA   3  
ATOM   8825   H  HB2  . TYR A 1 142 ? 7.276   9.781   -3.310  1.00 15.00 ?  184 TYR A HB2  3  
ATOM   8826   H  HB3  . TYR A 1 142 ? 8.600   10.838  -2.841  1.00 15.00 ?  184 TYR A HB3  3  
ATOM   8827   H  HD1  . TYR A 1 142 ? 7.983   7.372   -4.094  1.00 15.00 ?  184 TYR A HD1  3  
ATOM   8828   H  HD2  . TYR A 1 142 ? 10.582  10.740  -4.025  1.00 15.00 ?  184 TYR A HD2  3  
ATOM   8829   H  HE1  . TYR A 1 142 ? 9.434   6.276   -5.751  1.00 15.00 ?  184 TYR A HE1  3  
ATOM   8830   H  HE2  . TYR A 1 142 ? 12.043  9.658   -5.681  1.00 15.00 ?  184 TYR A HE2  3  
ATOM   8831   H  HH   . TYR A 1 142 ? 11.099  6.762   -7.356  1.00 15.00 ?  184 TYR A HH   3  
ATOM   8832   N  N    . PRO A 1 143 ? 10.078  7.880   -0.447  1.00 15.00 ?  185 PRO A N    3  
ATOM   8833   C  CA   . PRO A 1 143 ? 11.409  7.645   0.115   1.00 15.00 ?  185 PRO A CA   3  
ATOM   8834   C  C    . PRO A 1 143 ? 12.491  7.504   -0.953  1.00 15.00 ?  185 PRO A C    3  
ATOM   8835   O  O    . PRO A 1 143 ? 13.658  7.817   -0.711  1.00 15.00 ?  185 PRO A O    3  
ATOM   8836   C  CB   . PRO A 1 143 ? 11.240  6.337   0.885   1.00 15.00 ?  185 PRO A CB   3  
ATOM   8837   C  CG   . PRO A 1 143 ? 10.107  5.632   0.226   1.00 15.00 ?  185 PRO A CG   3  
ATOM   8838   C  CD   . PRO A 1 143 ? 9.201   6.700   -0.319  1.00 15.00 ?  185 PRO A CD   3  
ATOM   8839   H  HA   . PRO A 1 143 ? 11.690  8.432   0.802   1.00 15.00 ?  185 PRO A HA   3  
ATOM   8840   H  HB2  . PRO A 1 143 ? 12.148  5.754   0.817   1.00 15.00 ?  185 PRO A HB2  3  
ATOM   8841   H  HB3  . PRO A 1 143 ? 11.001  6.537   1.917   1.00 15.00 ?  185 PRO A HB3  3  
ATOM   8842   H  HG2  . PRO A 1 143 ? 10.482  5.012   -0.575  1.00 15.00 ?  185 PRO A HG2  3  
ATOM   8843   H  HG3  . PRO A 1 143 ? 9.575   5.033   0.949   1.00 15.00 ?  185 PRO A HG3  3  
ATOM   8844   H  HD2  . PRO A 1 143 ? 8.819   6.406   -1.284  1.00 15.00 ?  185 PRO A HD2  3  
ATOM   8845   H  HD3  . PRO A 1 143 ? 8.389   6.896   0.366   1.00 15.00 ?  185 PRO A HD3  3  
ATOM   8846   N  N    . GLY A 1 144 ? 12.102  7.034   -2.128  1.00 15.00 ?  186 GLY A N    3  
ATOM   8847   C  CA   . GLY A 1 144 ? 13.052  6.854   -3.203  1.00 15.00 ?  186 GLY A CA   3  
ATOM   8848   C  C    . GLY A 1 144 ? 12.959  5.467   -3.796  1.00 15.00 ?  186 GLY A C    3  
ATOM   8849   O  O    . GLY A 1 144 ? 12.118  4.675   -3.373  1.00 15.00 ?  186 GLY A O    3  
ATOM   8850   H  H    . GLY A 1 144 ? 11.162  6.798   -2.263  1.00 15.00 ?  186 GLY A H    3  
ATOM   8851   H  HA2  . GLY A 1 144 ? 12.852  7.582   -3.976  1.00 15.00 ?  186 GLY A HA2  3  
ATOM   8852   H  HA3  . GLY A 1 144 ? 14.052  7.008   -2.824  1.00 15.00 ?  186 GLY A HA3  3  
ATOM   8853   N  N    . PRO A 1 145 ? 13.800  5.144   -4.781  1.00 15.00 ?  187 PRO A N    3  
ATOM   8854   C  CA   . PRO A 1 145 ? 13.789  3.826   -5.416  1.00 15.00 ?  187 PRO A CA   3  
ATOM   8855   C  C    . PRO A 1 145 ? 14.213  2.713   -4.455  1.00 15.00 ?  187 PRO A C    3  
ATOM   8856   O  O    . PRO A 1 145 ? 15.293  2.756   -3.865  1.00 15.00 ?  187 PRO A O    3  
ATOM   8857   C  CB   . PRO A 1 145 ? 14.790  3.965   -6.569  1.00 15.00 ?  187 PRO A CB   3  
ATOM   8858   C  CG   . PRO A 1 145 ? 15.644  5.139   -6.231  1.00 15.00 ?  187 PRO A CG   3  
ATOM   8859   C  CD   . PRO A 1 145 ? 14.822  6.041   -5.352  1.00 15.00 ?  187 PRO A CD   3  
ATOM   8860   H  HA   . PRO A 1 145 ? 12.811  3.596   -5.816  1.00 15.00 ?  187 PRO A HA   3  
ATOM   8861   H  HB2  . PRO A 1 145 ? 15.385  3.064   -6.649  1.00 15.00 ?  187 PRO A HB2  3  
ATOM   8862   H  HB3  . PRO A 1 145 ? 14.265  4.148   -7.493  1.00 15.00 ?  187 PRO A HB3  3  
ATOM   8863   H  HG2  . PRO A 1 145 ? 16.528  4.807   -5.704  1.00 15.00 ?  187 PRO A HG2  3  
ATOM   8864   H  HG3  . PRO A 1 145 ? 15.922  5.662   -7.132  1.00 15.00 ?  187 PRO A HG3  3  
ATOM   8865   H  HD2  . PRO A 1 145 ? 15.435  6.467   -4.573  1.00 15.00 ?  187 PRO A HD2  3  
ATOM   8866   H  HD3  . PRO A 1 145 ? 14.364  6.822   -5.940  1.00 15.00 ?  187 PRO A HD3  3  
ATOM   8867   N  N    . GLY A 1 146 ? 13.335  1.736   -4.290  1.00 15.00 ?  188 GLY A N    3  
ATOM   8868   C  CA   . GLY A 1 146 ? 13.606  0.612   -3.421  1.00 15.00 ?  188 GLY A CA   3  
ATOM   8869   C  C    . GLY A 1 146 ? 13.094  -0.666  -4.040  1.00 15.00 ?  188 GLY A C    3  
ATOM   8870   O  O    . GLY A 1 146 ? 13.803  -1.309  -4.812  1.00 15.00 ?  188 GLY A O    3  
ATOM   8871   H  H    . GLY A 1 146 ? 12.485  1.773   -4.779  1.00 15.00 ?  188 GLY A H    3  
ATOM   8872   H  HA2  . GLY A 1 146 ? 14.673  0.532   -3.268  1.00 15.00 ?  188 GLY A HA2  3  
ATOM   8873   H  HA3  . GLY A 1 146 ? 13.118  0.766   -2.472  1.00 15.00 ?  188 GLY A HA3  3  
ATOM   8874   N  N    . HIS A 1 147 ? 11.859  -1.035  -3.713  1.00 15.00 ?  189 HIS A N    3  
ATOM   8875   C  CA   . HIS A 1 147 ? 11.244  -2.226  -4.290  1.00 15.00 ?  189 HIS A CA   3  
ATOM   8876   C  C    . HIS A 1 147 ? 10.954  -1.932  -5.756  1.00 15.00 ?  189 HIS A C    3  
ATOM   8877   O  O    . HIS A 1 147 ? 10.969  -2.814  -6.613  1.00 15.00 ?  189 HIS A O    3  
ATOM   8878   C  CB   . HIS A 1 147 ? 9.953   -2.600  -3.540  1.00 15.00 ?  189 HIS A CB   3  
ATOM   8879   C  CG   . HIS A 1 147 ? 9.054   -3.538  -4.292  1.00 15.00 ?  189 HIS A CG   3  
ATOM   8880   N  ND1  . HIS A 1 147 ? 9.410   -4.812  -4.675  1.00 15.00 ?  189 HIS A ND1  3  
ATOM   8881   C  CD2  . HIS A 1 147 ? 7.786   -3.353  -4.741  1.00 15.00 ?  189 HIS A CD2  3  
ATOM   8882   C  CE1  . HIS A 1 147 ? 8.379   -5.348  -5.337  1.00 15.00 ?  189 HIS A CE1  3  
ATOM   8883   N  NE2  . HIS A 1 147 ? 7.360   -4.500  -5.405  1.00 15.00 ?  189 HIS A NE2  3  
ATOM   8884   H  H    . HIS A 1 147 ? 11.348  -0.488  -3.080  1.00 15.00 ?  189 HIS A H    3  
ATOM   8885   H  HA   . HIS A 1 147 ? 11.955  -3.038  -4.225  1.00 15.00 ?  189 HIS A HA   3  
ATOM   8886   H  HB2  . HIS A 1 147 ? 10.215  -3.076  -2.607  1.00 15.00 ?  189 HIS A HB2  3  
ATOM   8887   H  HB3  . HIS A 1 147 ? 9.395   -1.700  -3.332  1.00 15.00 ?  189 HIS A HB3  3  
ATOM   8888   H  HD1  . HIS A 1 147 ? 10.273  -5.250  -4.500  1.00 15.00 ?  189 HIS A HD1  3  
ATOM   8889   H  HD2  . HIS A 1 147 ? 7.192   -2.461  -4.609  1.00 15.00 ?  189 HIS A HD2  3  
ATOM   8890   H  HE1  . HIS A 1 147 ? 8.375   -6.341  -5.759  1.00 15.00 ?  189 HIS A HE1  3  
ATOM   8891   N  N    . THR A 1 148 ? 10.670  -0.667  -6.004  1.00 15.00 ?  190 THR A N    3  
ATOM   8892   C  CA   . THR A 1 148 ? 10.417  -0.156  -7.330  1.00 15.00 ?  190 THR A CA   3  
ATOM   8893   C  C    . THR A 1 148 ? 10.951  1.269   -7.388  1.00 15.00 ?  190 THR A C    3  
ATOM   8894   O  O    . THR A 1 148 ? 11.460  1.782   -6.390  1.00 15.00 ?  190 THR A O    3  
ATOM   8895   C  CB   . THR A 1 148 ? 8.914   -0.179  -7.696  1.00 15.00 ?  190 THR A CB   3  
ATOM   8896   O  OG1  . THR A 1 148 ? 8.119   0.181   -6.559  1.00 15.00 ?  190 THR A OG1  3  
ATOM   8897   C  CG2  . THR A 1 148 ? 8.490   -1.551  -8.199  1.00 15.00 ?  190 THR A CG2  3  
ATOM   8898   H  H    . THR A 1 148 ? 10.621  -0.041  -5.248  1.00 15.00 ?  190 THR A H    3  
ATOM   8899   H  HA   . THR A 1 148 ? 10.959  -0.767  -8.041  1.00 15.00 ?  190 THR A HA   3  
ATOM   8900   H  HB   . THR A 1 148 ? 8.741   0.541   -8.484  1.00 15.00 ?  190 THR A HB   3  
ATOM   8901   H  HG1  . THR A 1 148 ? 7.348   0.676   -6.859  1.00 15.00 ?  190 THR A HG1  3  
ATOM   8902   H  HG21 . THR A 1 148 ? 7.628   -1.451  -8.841  1.00 15.00 ?  190 THR A HG21 3  
ATOM   8903   H  HG22 . THR A 1 148 ? 8.239   -2.181  -7.357  1.00 15.00 ?  190 THR A HG22 3  
ATOM   8904   H  HG23 . THR A 1 148 ? 9.302   -1.998  -8.751  1.00 15.00 ?  190 THR A HG23 3  
ATOM   8905   N  N    . SER A 1 149 ? 10.850  1.911   -8.532  1.00 15.00 ?  191 SER A N    3  
ATOM   8906   C  CA   . SER A 1 149 ? 11.344  3.270   -8.673  1.00 15.00 ?  191 SER A CA   3  
ATOM   8907   C  C    . SER A 1 149 ? 10.216  4.278   -8.468  1.00 15.00 ?  191 SER A C    3  
ATOM   8908   O  O    . SER A 1 149 ? 10.443  5.487   -8.400  1.00 15.00 ?  191 SER A O    3  
ATOM   8909   C  CB   . SER A 1 149 ? 11.979  3.438   -10.053 1.00 15.00 ?  191 SER A CB   3  
ATOM   8910   O  OG   . SER A 1 149 ? 12.820  2.333   -10.350 1.00 15.00 ?  191 SER A OG   3  
ATOM   8911   H  H    . SER A 1 149 ? 10.439  1.465   -9.304  1.00 15.00 ?  191 SER A H    3  
ATOM   8912   H  HA   . SER A 1 149 ? 12.096  3.431   -7.917  1.00 15.00 ?  191 SER A HA   3  
ATOM   8913   H  HB2  . SER A 1 149 ? 11.201  3.499   -10.803 1.00 15.00 ?  191 SER A HB2  3  
ATOM   8914   H  HB3  . SER A 1 149 ? 12.573  4.341   -10.072 1.00 15.00 ?  191 SER A HB3  3  
ATOM   8915   H  HG   . SER A 1 149 ? 12.396  1.521   -10.050 1.00 15.00 ?  191 SER A HG   3  
ATOM   8916   N  N    . ASP A 1 150 ? 9.005   3.765   -8.333  1.00 15.00 ?  192 ASP A N    3  
ATOM   8917   C  CA   . ASP A 1 150 ? 7.827   4.601   -8.165  1.00 15.00 ?  192 ASP A CA   3  
ATOM   8918   C  C    . ASP A 1 150 ? 7.126   4.349   -6.830  1.00 15.00 ?  192 ASP A C    3  
ATOM   8919   O  O    . ASP A 1 150 ? 6.098   4.962   -6.548  1.00 15.00 ?  192 ASP A O    3  
ATOM   8920   C  CB   . ASP A 1 150 ? 6.849   4.304   -9.303  1.00 15.00 ?  192 ASP A CB   3  
ATOM   8921   C  CG   . ASP A 1 150 ? 6.313   2.883   -9.230  1.00 15.00 ?  192 ASP A CG   3  
ATOM   8922   O  OD1  . ASP A 1 150 ? 7.132   1.936   -9.190  1.00 15.00 ?  192 ASP A OD1  3  
ATOM   8923   O  OD2  . ASP A 1 150 ? 5.079   2.709   -9.200  1.00 15.00 -1 192 ASP A OD2  3  
ATOM   8924   H  H    . ASP A 1 150 ? 8.892   2.792   -8.365  1.00 15.00 ?  192 ASP A H    3  
ATOM   8925   H  HA   . ASP A 1 150 ? 8.132   5.634   -8.224  1.00 15.00 ?  192 ASP A HA   3  
ATOM   8926   H  HB2  . ASP A 1 150 ? 6.017   4.991   -9.247  1.00 15.00 ?  192 ASP A HB2  3  
ATOM   8927   H  HB3  . ASP A 1 150 ? 7.355   4.431   -10.250 1.00 15.00 ?  192 ASP A HB3  3  
ATOM   8928   N  N    . ASN A 1 151 ? 7.690   3.473   -6.004  1.00 15.00 ?  193 ASN A N    3  
ATOM   8929   C  CA   . ASN A 1 151 ? 7.072   3.136   -4.718  1.00 15.00 ?  193 ASN A CA   3  
ATOM   8930   C  C    . ASN A 1 151 ? 6.945   4.334   -3.784  1.00 15.00 ?  193 ASN A C    3  
ATOM   8931   O  O    . ASN A 1 151 ? 7.881   5.113   -3.603  1.00 15.00 ?  193 ASN A O    3  
ATOM   8932   C  CB   . ASN A 1 151 ? 7.811   1.985   -4.008  1.00 15.00 ?  193 ASN A CB   3  
ATOM   8933   C  CG   . ASN A 1 151 ? 9.324   2.153   -3.911  1.00 15.00 ?  193 ASN A CG   3  
ATOM   8934   O  OD1  . ASN A 1 151 ? 10.060  1.166   -3.875  1.00 15.00 ?  193 ASN A OD1  3  
ATOM   8935   N  ND2  . ASN A 1 151 ? 9.803   3.384   -3.854  1.00 15.00 ?  193 ASN A ND2  3  
ATOM   8936   H  H    . ASN A 1 151 ? 8.536   3.053   -6.257  1.00 15.00 ?  193 ASN A H    3  
ATOM   8937   H  HA   . ASN A 1 151 ? 6.073   2.799   -4.939  1.00 15.00 ?  193 ASN A HA   3  
ATOM   8938   H  HB2  . ASN A 1 151 ? 7.427   1.895   -3.003  1.00 15.00 ?  193 ASN A HB2  3  
ATOM   8939   H  HB3  . ASN A 1 151 ? 7.608   1.066   -4.538  1.00 15.00 ?  193 ASN A HB3  3  
ATOM   8940   H  HD21 . ASN A 1 151 ? 9.164   4.134   -3.879  1.00 15.00 ?  193 ASN A HD21 3  
ATOM   8941   H  HD22 . ASN A 1 151 ? 10.775  3.505   -3.775  1.00 15.00 ?  193 ASN A HD22 3  
ATOM   8942   N  N    . ILE A 1 152 ? 5.764   4.481   -3.211  1.00 15.00 ?  194 ILE A N    3  
ATOM   8943   C  CA   . ILE A 1 152 ? 5.497   5.558   -2.274  1.00 15.00 ?  194 ILE A CA   3  
ATOM   8944   C  C    . ILE A 1 152 ? 4.950   4.988   -0.971  1.00 15.00 ?  194 ILE A C    3  
ATOM   8945   O  O    . ILE A 1 152 ? 4.381   3.893   -0.954  1.00 15.00 ?  194 ILE A O    3  
ATOM   8946   C  CB   . ILE A 1 152 ? 4.495   6.588   -2.842  1.00 15.00 ?  194 ILE A CB   3  
ATOM   8947   C  CG1  . ILE A 1 152 ? 3.139   5.929   -3.116  1.00 15.00 ?  194 ILE A CG1  3  
ATOM   8948   C  CG2  . ILE A 1 152 ? 5.050   7.221   -4.110  1.00 15.00 ?  194 ILE A CG2  3  
ATOM   8949   C  CD1  . ILE A 1 152 ? 2.049   6.912   -3.495  1.00 15.00 ?  194 ILE A CD1  3  
ATOM   8950   H  H    . ILE A 1 152 ? 5.040   3.854   -3.434  1.00 15.00 ?  194 ILE A H    3  
ATOM   8951   H  HA   . ILE A 1 152 ? 6.430   6.063   -2.075  1.00 15.00 ?  194 ILE A HA   3  
ATOM   8952   H  HB   . ILE A 1 152 ? 4.366   7.368   -2.108  1.00 15.00 ?  194 ILE A HB   3  
ATOM   8953   H  HG12 . ILE A 1 152 ? 3.247   5.226   -3.931  1.00 15.00 ?  194 ILE A HG12 3  
ATOM   8954   H  HG13 . ILE A 1 152 ? 2.817   5.400   -2.229  1.00 15.00 ?  194 ILE A HG13 3  
ATOM   8955   H  HG21 . ILE A 1 152 ? 4.272   7.783   -4.604  1.00 15.00 ?  194 ILE A HG21 3  
ATOM   8956   H  HG22 . ILE A 1 152 ? 5.411   6.448   -4.772  1.00 15.00 ?  194 ILE A HG22 3  
ATOM   8957   H  HG23 . ILE A 1 152 ? 5.864   7.885   -3.855  1.00 15.00 ?  194 ILE A HG23 3  
ATOM   8958   H  HD11 . ILE A 1 152 ? 2.335   7.440   -4.393  1.00 15.00 ?  194 ILE A HD11 3  
ATOM   8959   H  HD12 . ILE A 1 152 ? 1.904   7.618   -2.690  1.00 15.00 ?  194 ILE A HD12 3  
ATOM   8960   H  HD13 . ILE A 1 152 ? 1.125   6.377   -3.672  1.00 15.00 ?  194 ILE A HD13 3  
ATOM   8961   N  N    . THR A 1 153 ? 5.135   5.718   0.117   1.00 15.00 ?  195 THR A N    3  
ATOM   8962   C  CA   . THR A 1 153 ? 4.654   5.283   1.415   1.00 15.00 ?  195 THR A CA   3  
ATOM   8963   C  C    . THR A 1 153 ? 3.606   6.258   1.941   1.00 15.00 ?  195 THR A C    3  
ATOM   8964   O  O    . THR A 1 153 ? 3.676   7.456   1.665   1.00 15.00 ?  195 THR A O    3  
ATOM   8965   C  CB   . THR A 1 153 ? 5.819   5.153   2.419   1.00 15.00 ?  195 THR A CB   3  
ATOM   8966   O  OG1  . THR A 1 153 ? 6.756   6.217   2.219   1.00 15.00 ?  195 THR A OG1  3  
ATOM   8967   C  CG2  . THR A 1 153 ? 6.531   3.817   2.243   1.00 15.00 ?  195 THR A CG2  3  
ATOM   8968   H  H    . THR A 1 153 ? 5.608   6.576   0.046   1.00 15.00 ?  195 THR A H    3  
ATOM   8969   H  HA   . THR A 1 153 ? 4.196   4.312   1.294   1.00 15.00 ?  195 THR A HA   3  
ATOM   8970   H  HB   . THR A 1 153 ? 5.422   5.208   3.423   1.00 15.00 ?  195 THR A HB   3  
ATOM   8971   H  HG1  . THR A 1 153 ? 6.314   6.949   1.776   1.00 15.00 ?  195 THR A HG1  3  
ATOM   8972   H  HG21 . THR A 1 153 ? 5.803   3.028   2.132   1.00 15.00 ?  195 THR A HG21 3  
ATOM   8973   H  HG22 . THR A 1 153 ? 7.142   3.620   3.110   1.00 15.00 ?  195 THR A HG22 3  
ATOM   8974   H  HG23 . THR A 1 153 ? 7.157   3.857   1.365   1.00 15.00 ?  195 THR A HG23 3  
ATOM   8975   N  N    . VAL A 1 154 ? 2.631   5.744   2.682   1.00 15.00 ?  196 VAL A N    3  
ATOM   8976   C  CA   . VAL A 1 154 ? 1.562   6.572   3.218   1.00 15.00 ?  196 VAL A CA   3  
ATOM   8977   C  C    . VAL A 1 154 ? 1.423   6.381   4.726   1.00 15.00 ?  196 VAL A C    3  
ATOM   8978   O  O    . VAL A 1 154 ? 1.407   5.252   5.225   1.00 15.00 ?  196 VAL A O    3  
ATOM   8979   C  CB   . VAL A 1 154 ? 0.204   6.255   2.541   1.00 15.00 ?  196 VAL A CB   3  
ATOM   8980   C  CG1  . VAL A 1 154 ? -0.864  7.239   2.997   1.00 15.00 ?  196 VAL A CG1  3  
ATOM   8981   C  CG2  . VAL A 1 154 ? 0.337   6.268   1.022   1.00 15.00 ?  196 VAL A CG2  3  
ATOM   8982   H  H    . VAL A 1 154 ? 2.640   4.785   2.889   1.00 15.00 ?  196 VAL A H    3  
ATOM   8983   H  HA   . VAL A 1 154 ? 1.808   7.603   3.019   1.00 15.00 ?  196 VAL A HA   3  
ATOM   8984   H  HB   . VAL A 1 154 ? -0.102  5.262   2.846   1.00 15.00 ?  196 VAL A HB   3  
ATOM   8985   H  HG11 . VAL A 1 154 ? -0.499  8.247   2.868   1.00 15.00 ?  196 VAL A HG11 3  
ATOM   8986   H  HG12 . VAL A 1 154 ? -1.087  7.072   4.042   1.00 15.00 ?  196 VAL A HG12 3  
ATOM   8987   H  HG13 . VAL A 1 154 ? -1.759  7.103   2.409   1.00 15.00 ?  196 VAL A HG13 3  
ATOM   8988   H  HG21 . VAL A 1 154 ? 1.234   5.739   0.735   1.00 15.00 ?  196 VAL A HG21 3  
ATOM   8989   H  HG22 . VAL A 1 154 ? 0.394   7.288   0.673   1.00 15.00 ?  196 VAL A HG22 3  
ATOM   8990   H  HG23 . VAL A 1 154 ? -0.522  5.784   0.581   1.00 15.00 ?  196 VAL A HG23 3  
ATOM   8991   N  N    . GLY A 1 155 ? 1.343   7.483   5.445   1.00 15.00 ?  197 GLY A N    3  
ATOM   8992   C  CA   . GLY A 1 155 ? 1.184   7.424   6.880   1.00 15.00 ?  197 GLY A CA   3  
ATOM   8993   C  C    . GLY A 1 155 ? -0.118  8.060   7.309   1.00 15.00 ?  197 GLY A C    3  
ATOM   8994   O  O    . GLY A 1 155 ? -0.586  9.002   6.671   1.00 15.00 ?  197 GLY A O    3  
ATOM   8995   H  H    . GLY A 1 155 ? 1.392   8.356   4.993   1.00 15.00 ?  197 GLY A H    3  
ATOM   8996   H  HA2  . GLY A 1 155 ? 1.189   6.389   7.192   1.00 15.00 ?  197 GLY A HA2  3  
ATOM   8997   H  HA3  . GLY A 1 155 ? 2.005   7.942   7.354   1.00 15.00 ?  197 GLY A HA3  3  
ATOM   8998   N  N    . ILE A 1 156 ? -0.712  7.548   8.376   1.00 15.00 ?  198 ILE A N    3  
ATOM   8999   C  CA   . ILE A 1 156 ? -1.976  8.078   8.863   1.00 15.00 ?  198 ILE A CA   3  
ATOM   9000   C  C    . ILE A 1 156 ? -1.741  8.997   10.055  1.00 15.00 ?  198 ILE A C    3  
ATOM   9001   O  O    . ILE A 1 156 ? -1.540  8.530   11.179  1.00 15.00 ?  198 ILE A O    3  
ATOM   9002   C  CB   . ILE A 1 156 ? -2.947  6.951   9.277   1.00 15.00 ?  198 ILE A CB   3  
ATOM   9003   C  CG1  . ILE A 1 156 ? -2.854  5.776   8.300   1.00 15.00 ?  198 ILE A CG1  3  
ATOM   9004   C  CG2  . ILE A 1 156 ? -4.375  7.478   9.335   1.00 15.00 ?  198 ILE A CG2  3  
ATOM   9005   C  CD1  . ILE A 1 156 ? -3.434  4.487   8.841   1.00 15.00 ?  198 ILE A CD1  3  
ATOM   9006   H  H    . ILE A 1 156 ? -0.289  6.803   8.854   1.00 15.00 ?  198 ILE A H    3  
ATOM   9007   H  HA   . ILE A 1 156 ? -2.433  8.645   8.064   1.00 15.00 ?  198 ILE A HA   3  
ATOM   9008   H  HB   . ILE A 1 156 ? -2.673  6.614   10.266  1.00 15.00 ?  198 ILE A HB   3  
ATOM   9009   H  HG12 . ILE A 1 156 ? -3.389  6.025   7.397   1.00 15.00 ?  198 ILE A HG12 3  
ATOM   9010   H  HG13 . ILE A 1 156 ? -1.816  5.599   8.058   1.00 15.00 ?  198 ILE A HG13 3  
ATOM   9011   H  HG21 . ILE A 1 156 ? -4.427  8.310   10.023  1.00 15.00 ?  198 ILE A HG21 3  
ATOM   9012   H  HG22 . ILE A 1 156 ? -5.035  6.693   9.673   1.00 15.00 ?  198 ILE A HG22 3  
ATOM   9013   H  HG23 . ILE A 1 156 ? -4.682  7.805   8.352   1.00 15.00 ?  198 ILE A HG23 3  
ATOM   9014   H  HD11 . ILE A 1 156 ? -4.333  4.703   9.398   1.00 15.00 ?  198 ILE A HD11 3  
ATOM   9015   H  HD12 . ILE A 1 156 ? -2.715  4.011   9.490   1.00 15.00 ?  198 ILE A HD12 3  
ATOM   9016   H  HD13 . ILE A 1 156 ? -3.672  3.826   8.022   1.00 15.00 ?  198 ILE A HD13 3  
ATOM   9017   N  N    . ASP A 1 157 ? -1.757  10.302  9.802   1.00 15.00 ?  199 ASP A N    3  
ATOM   9018   C  CA   . ASP A 1 157 ? -1.544  11.292  10.854  1.00 15.00 ?  199 ASP A CA   3  
ATOM   9019   C  C    . ASP A 1 157 ? -2.635  11.191  11.909  1.00 15.00 ?  199 ASP A C    3  
ATOM   9020   O  O    . ASP A 1 157 ? -3.824  11.158  11.582  1.00 15.00 ?  199 ASP A O    3  
ATOM   9021   C  CB   . ASP A 1 157 ? -1.510  12.705  10.273  1.00 15.00 ?  199 ASP A CB   3  
ATOM   9022   C  CG   . ASP A 1 157 ? -1.015  13.729  11.278  1.00 15.00 ?  199 ASP A CG   3  
ATOM   9023   O  OD1  . ASP A 1 157 ? 0.188   14.069  11.246  1.00 15.00 ?  199 ASP A OD1  3  
ATOM   9024   O  OD2  . ASP A 1 157 ? -1.822  14.203  12.107  1.00 15.00 -1 199 ASP A OD2  3  
ATOM   9025   H  H    . ASP A 1 157 ? -1.926  10.606  8.882   1.00 15.00 ?  199 ASP A H    3  
ATOM   9026   H  HA   . ASP A 1 157 ? -0.591  11.080  11.319  1.00 15.00 ?  199 ASP A HA   3  
ATOM   9027   H  HB2  . ASP A 1 157 ? -0.850  12.718  9.419   1.00 15.00 ?  199 ASP A HB2  3  
ATOM   9028   H  HB3  . ASP A 1 157 ? -2.505  12.985  9.958   1.00 15.00 ?  199 ASP A HB3  3  
ATOM   9029   N  N    . GLY A 1 158 ? -2.224  11.156  13.167  1.00 15.00 ?  200 GLY A N    3  
ATOM   9030   C  CA   . GLY A 1 158 ? -3.168  11.021  14.260  1.00 15.00 ?  200 GLY A CA   3  
ATOM   9031   C  C    . GLY A 1 158 ? -3.161  9.606   14.790  1.00 15.00 ?  200 GLY A C    3  
ATOM   9032   O  O    . GLY A 1 158 ? -3.829  9.282   15.775  1.00 15.00 ?  200 GLY A O    3  
ATOM   9033   H  H    . GLY A 1 158 ? -1.265  11.239  13.359  1.00 15.00 ?  200 GLY A H    3  
ATOM   9034   H  HA2  . GLY A 1 158 ? -2.896  11.703  15.054  1.00 15.00 ?  200 GLY A HA2  3  
ATOM   9035   H  HA3  . GLY A 1 158 ? -4.160  11.261  13.908  1.00 15.00 ?  200 GLY A HA3  3  
ATOM   9036   N  N    . THR A 1 159 ? -2.390  8.763   14.122  1.00 15.00 ?  201 THR A N    3  
ATOM   9037   C  CA   . THR A 1 159 ? -2.256  7.369   14.488  1.00 15.00 ?  201 THR A CA   3  
ATOM   9038   C  C    . THR A 1 159 ? -0.794  6.947   14.392  1.00 15.00 ?  201 THR A C    3  
ATOM   9039   O  O    . THR A 1 159 ? -0.018  7.549   13.646  1.00 15.00 ?  201 THR A O    3  
ATOM   9040   C  CB   . THR A 1 159 ? -3.109  6.477   13.564  1.00 15.00 ?  201 THR A CB   3  
ATOM   9041   O  OG1  . THR A 1 159 ? -3.647  7.262   12.489  1.00 15.00 ?  201 THR A OG1  3  
ATOM   9042   C  CG2  . THR A 1 159 ? -4.244  5.821   14.335  1.00 15.00 ?  201 THR A CG2  3  
ATOM   9043   H  H    . THR A 1 159 ? -1.888  9.096   13.349  1.00 15.00 ?  201 THR A H    3  
ATOM   9044   H  HA   . THR A 1 159 ? -2.598  7.245   15.504  1.00 15.00 ?  201 THR A HA   3  
ATOM   9045   H  HB   . THR A 1 159 ? -2.477  5.704   13.152  1.00 15.00 ?  201 THR A HB   3  
ATOM   9046   H  HG1  . THR A 1 159 ? -2.931  7.757   12.064  1.00 15.00 ?  201 THR A HG1  3  
ATOM   9047   H  HG21 . THR A 1 159 ? -4.762  6.565   14.919  1.00 15.00 ?  201 THR A HG21 3  
ATOM   9048   H  HG22 . THR A 1 159 ? -3.842  5.063   14.992  1.00 15.00 ?  201 THR A HG22 3  
ATOM   9049   H  HG23 . THR A 1 159 ? -4.933  5.365   13.644  1.00 15.00 ?  201 THR A HG23 3  
ATOM   9050   N  N    . ASP A 1 160 ? -0.416  5.919   15.138  1.00 15.00 ?  202 ASP A N    3  
ATOM   9051   C  CA   . ASP A 1 160 ? 0.956   5.422   15.121  1.00 15.00 ?  202 ASP A CA   3  
ATOM   9052   C  C    . ASP A 1 160 ? 1.119   4.340   14.059  1.00 15.00 ?  202 ASP A C    3  
ATOM   9053   O  O    . ASP A 1 160 ? 1.991   3.478   14.160  1.00 15.00 ?  202 ASP A O    3  
ATOM   9054   C  CB   . ASP A 1 160 ? 1.340   4.866   16.494  1.00 15.00 ?  202 ASP A CB   3  
ATOM   9055   C  CG   . ASP A 1 160 ? 0.599   3.585   16.844  1.00 15.00 ?  202 ASP A CG   3  
ATOM   9056   O  OD1  . ASP A 1 160 ? -0.653  3.593   16.834  1.00 15.00 ?  202 ASP A OD1  3  
ATOM   9057   O  OD2  . ASP A 1 160 ? 1.266   2.567   17.137  1.00 15.00 -1 202 ASP A OD2  3  
ATOM   9058   H  H    . ASP A 1 160 ? -1.073  5.480   15.721  1.00 15.00 ?  202 ASP A H    3  
ATOM   9059   H  HA   . ASP A 1 160 ? 1.605   6.249   14.879  1.00 15.00 ?  202 ASP A HA   3  
ATOM   9060   H  HB2  . ASP A 1 160 ? 2.400   4.657   16.503  1.00 15.00 ?  202 ASP A HB2  3  
ATOM   9061   H  HB3  . ASP A 1 160 ? 1.119   5.606   17.248  1.00 15.00 ?  202 ASP A HB3  3  
ATOM   9062   N  N    . ILE A 1 161 ? 0.289   4.416   13.032  1.00 15.00 ?  203 ILE A N    3  
ATOM   9063   C  CA   . ILE A 1 161 ? 0.305   3.445   11.951  1.00 15.00 ?  203 ILE A CA   3  
ATOM   9064   C  C    . ILE A 1 161 ? 0.845   4.058   10.661  1.00 15.00 ?  203 ILE A C    3  
ATOM   9065   O  O    . ILE A 1 161 ? 0.523   5.201   10.313  1.00 15.00 ?  203 ILE A O    3  
ATOM   9066   C  CB   . ILE A 1 161 ? -1.111  2.886   11.697  1.00 15.00 ?  203 ILE A CB   3  
ATOM   9067   C  CG1  . ILE A 1 161 ? -1.755  2.455   13.019  1.00 15.00 ?  203 ILE A CG1  3  
ATOM   9068   C  CG2  . ILE A 1 161 ? -1.060  1.719   10.721  1.00 15.00 ?  203 ILE A CG2  3  
ATOM   9069   C  CD1  . ILE A 1 161 ? -3.222  2.109   12.899  1.00 15.00 ?  203 ILE A CD1  3  
ATOM   9070   H  H    . ILE A 1 161 ? -0.346  5.159   12.993  1.00 15.00 ?  203 ILE A H    3  
ATOM   9071   H  HA   . ILE A 1 161 ? 0.948   2.628   12.245  1.00 15.00 ?  203 ILE A HA   3  
ATOM   9072   H  HB   . ILE A 1 161 ? -1.707  3.671   11.255  1.00 15.00 ?  203 ILE A HB   3  
ATOM   9073   H  HG12 . ILE A 1 161 ? -1.242  1.583   13.394  1.00 15.00 ?  203 ILE A HG12 3  
ATOM   9074   H  HG13 . ILE A 1 161 ? -1.660  3.258   13.737  1.00 15.00 ?  203 ILE A HG13 3  
ATOM   9075   H  HG21 . ILE A 1 161 ? -0.814  2.085   9.736   1.00 15.00 ?  203 ILE A HG21 3  
ATOM   9076   H  HG22 . ILE A 1 161 ? -2.020  1.227   10.695  1.00 15.00 ?  203 ILE A HG22 3  
ATOM   9077   H  HG23 . ILE A 1 161 ? -0.304  1.017   11.041  1.00 15.00 ?  203 ILE A HG23 3  
ATOM   9078   H  HD11 . ILE A 1 161 ? -3.351  1.324   12.168  1.00 15.00 ?  203 ILE A HD11 3  
ATOM   9079   H  HD12 . ILE A 1 161 ? -3.775  2.985   12.589  1.00 15.00 ?  203 ILE A HD12 3  
ATOM   9080   H  HD13 . ILE A 1 161 ? -3.591  1.773   13.855  1.00 15.00 ?  203 ILE A HD13 3  
ATOM   9081   N  N    . ALA A 1 162 ? 1.681   3.296   9.971   1.00 15.00 ?  204 ALA A N    3  
ATOM   9082   C  CA   . ALA A 1 162 ? 2.269   3.727   8.713   1.00 15.00 ?  204 ALA A CA   3  
ATOM   9083   C  C    . ALA A 1 162 ? 2.283   2.565   7.725   1.00 15.00 ?  204 ALA A C    3  
ATOM   9084   O  O    . ALA A 1 162 ? 2.424   1.408   8.122   1.00 15.00 ?  204 ALA A O    3  
ATOM   9085   C  CB   . ALA A 1 162 ? 3.674   4.260   8.938   1.00 15.00 ?  204 ALA A CB   3  
ATOM   9086   H  H    . ALA A 1 162 ? 1.914   2.408   10.323  1.00 15.00 ?  204 ALA A H    3  
ATOM   9087   H  HA   . ALA A 1 162 ? 1.659   4.524   8.313   1.00 15.00 ?  204 ALA A HA   3  
ATOM   9088   H  HB1  . ALA A 1 162 ? 3.640   5.071   9.651   1.00 15.00 ?  204 ALA A HB1  3  
ATOM   9089   H  HB2  . ALA A 1 162 ? 4.075   4.621   8.002   1.00 15.00 ?  204 ALA A HB2  3  
ATOM   9090   H  HB3  . ALA A 1 162 ? 4.303   3.471   9.323   1.00 15.00 ?  204 ALA A HB3  3  
ATOM   9091   N  N    . PHE A 1 163 ? 2.123   2.872   6.448   1.00 15.00 ?  205 PHE A N    3  
ATOM   9092   C  CA   . PHE A 1 163 ? 2.110   1.853   5.412   1.00 15.00 ?  205 PHE A CA   3  
ATOM   9093   C  C    . PHE A 1 163 ? 3.421   1.865   4.636   1.00 15.00 ?  205 PHE A C    3  
ATOM   9094   O  O    . PHE A 1 163 ? 3.786   2.874   4.031   1.00 15.00 ?  205 PHE A O    3  
ATOM   9095   C  CB   . PHE A 1 163 ? 0.935   2.100   4.463   1.00 15.00 ?  205 PHE A CB   3  
ATOM   9096   C  CG   . PHE A 1 163 ? 0.527   0.894   3.666   1.00 15.00 ?  205 PHE A CG   3  
ATOM   9097   C  CD1  . PHE A 1 163 ? -0.128  -0.165  4.275   1.00 15.00 ?  205 PHE A CD1  3  
ATOM   9098   C  CD2  . PHE A 1 163 ? 0.794   0.821   2.310   1.00 15.00 ?  205 PHE A CD2  3  
ATOM   9099   C  CE1  . PHE A 1 163 ? -0.509  -1.276  3.547   1.00 15.00 ?  205 PHE A CE1  3  
ATOM   9100   C  CE2  . PHE A 1 163 ? 0.415   -0.288  1.575   1.00 15.00 ?  205 PHE A CE2  3  
ATOM   9101   C  CZ   . PHE A 1 163 ? -0.238  -1.337  2.196   1.00 15.00 ?  205 PHE A CZ   3  
ATOM   9102   H  H    . PHE A 1 163 ? 2.013   3.815   6.187   1.00 15.00 ?  205 PHE A H    3  
ATOM   9103   H  HA   . PHE A 1 163 ? 1.990   0.892   5.887   1.00 15.00 ?  205 PHE A HA   3  
ATOM   9104   H  HB2  . PHE A 1 163 ? 0.080   2.422   5.038   1.00 15.00 ?  205 PHE A HB2  3  
ATOM   9105   H  HB3  . PHE A 1 163 ? 1.207   2.881   3.768   1.00 15.00 ?  205 PHE A HB3  3  
ATOM   9106   H  HD1  . PHE A 1 163 ? -0.344  -0.118  5.332   1.00 15.00 ?  205 PHE A HD1  3  
ATOM   9107   H  HD2  . PHE A 1 163 ? 1.305   1.642   1.826   1.00 15.00 ?  205 PHE A HD2  3  
ATOM   9108   H  HE1  . PHE A 1 163 ? -1.017  -2.095  4.036   1.00 15.00 ?  205 PHE A HE1  3  
ATOM   9109   H  HE2  . PHE A 1 163 ? 0.628   -0.334  0.517   1.00 15.00 ?  205 PHE A HE2  3  
ATOM   9110   H  HZ   . PHE A 1 163 ? -0.533  -2.206  1.626   1.00 15.00 ?  205 PHE A HZ   3  
ATOM   9111   N  N    . GLY A 1 164 ? 4.129   0.742   4.670   1.00 15.00 ?  206 GLY A N    3  
ATOM   9112   C  CA   . GLY A 1 164 ? 5.395   0.631   3.967   1.00 15.00 ?  206 GLY A CA   3  
ATOM   9113   C  C    . GLY A 1 164 ? 5.257   -0.073  2.632   1.00 15.00 ?  206 GLY A C    3  
ATOM   9114   O  O    . GLY A 1 164 ? 6.244   -0.283  1.921   1.00 15.00 ?  206 GLY A O    3  
ATOM   9115   H  H    . GLY A 1 164 ? 3.791   -0.021  5.192   1.00 15.00 ?  206 GLY A H    3  
ATOM   9116   H  HA2  . GLY A 1 164 ? 5.792   1.621   3.801   1.00 15.00 ?  206 GLY A HA2  3  
ATOM   9117   H  HA3  . GLY A 1 164 ? 6.087   0.078   4.583   1.00 15.00 ?  206 GLY A HA3  3  
ATOM   9118   N  N    . GLY A 1 165 ? 4.027   -0.445  2.300   1.00 15.00 ?  207 GLY A N    3  
ATOM   9119   C  CA   . GLY A 1 165 ? 3.758   -1.129  1.049   1.00 15.00 ?  207 GLY A CA   3  
ATOM   9120   C  C    . GLY A 1 165 ? 4.533   -2.424  0.915   1.00 15.00 ?  207 GLY A C    3  
ATOM   9121   O  O    . GLY A 1 165 ? 4.457   -3.300  1.777   1.00 15.00 ?  207 GLY A O    3  
ATOM   9122   H  H    . GLY A 1 165 ? 3.292   -0.248  2.913   1.00 15.00 ?  207 GLY A H    3  
ATOM   9123   H  HA2  . GLY A 1 165 ? 2.702   -1.346  0.993   1.00 15.00 ?  207 GLY A HA2  3  
ATOM   9124   H  HA3  . GLY A 1 165 ? 4.024   -0.475  0.230   1.00 15.00 ?  207 GLY A HA3  3  
ATOM   9125   N  N    . CYS A 1 166 ? 5.269   -2.553  -0.176  1.00 15.00 ?  208 CYS A N    3  
ATOM   9126   C  CA   . CYS A 1 166 ? 6.065   -3.745  -0.422  1.00 15.00 ?  208 CYS A CA   3  
ATOM   9127   C  C    . CYS A 1 166 ? 7.548   -3.422  -0.304  1.00 15.00 ?  208 CYS A C    3  
ATOM   9128   O  O    . CYS A 1 166 ? 8.404   -4.264  -0.581  1.00 15.00 ?  208 CYS A O    3  
ATOM   9129   C  CB   . CYS A 1 166 ? 5.761   -4.311  -1.807  1.00 15.00 ?  208 CYS A CB   3  
ATOM   9130   S  SG   . CYS A 1 166 ? 4.023   -4.753  -2.062  1.00 15.00 ?  208 CYS A SG   3  
ATOM   9131   H  H    . CYS A 1 166 ? 5.280   -1.826  -0.835  1.00 15.00 ?  208 CYS A H    3  
ATOM   9132   H  HA   . CYS A 1 166 ? 5.805   -4.480  0.326   1.00 15.00 ?  208 CYS A HA   3  
ATOM   9133   H  HB2  . CYS A 1 166 ? 6.025   -3.575  -2.553  1.00 15.00 ?  208 CYS A HB2  3  
ATOM   9134   H  HB3  . CYS A 1 166 ? 6.357   -5.202  -1.961  1.00 15.00 ?  208 CYS A HB3  3  
ATOM   9135   H  HG   . CYS A 1 166 ? 3.273   -3.784  -1.545  1.00 15.00 ?  208 CYS A HG   3  
ATOM   9136   N  N    . LEU A 1 167 ? 7.838   -2.196  0.111   1.00 15.00 ?  209 LEU A N    3  
ATOM   9137   C  CA   . LEU A 1 167 ? 9.211   -1.741  0.272   1.00 15.00 ?  209 LEU A CA   3  
ATOM   9138   C  C    . LEU A 1 167 ? 9.800   -2.292  1.564   1.00 15.00 ?  209 LEU A C    3  
ATOM   9139   O  O    . LEU A 1 167 ? 10.896  -2.856  1.565   1.00 15.00 ?  209 LEU A O    3  
ATOM   9140   C  CB   . LEU A 1 167 ? 9.261   -0.209  0.279   1.00 15.00 ?  209 LEU A CB   3  
ATOM   9141   C  CG   . LEU A 1 167 ? 10.611  0.402   0.663   1.00 15.00 ?  209 LEU A CG   3  
ATOM   9142   C  CD1  . LEU A 1 167 ? 11.606  0.264   -0.478  1.00 15.00 ?  209 LEU A CD1  3  
ATOM   9143   C  CD2  . LEU A 1 167 ? 10.441  1.864   1.040   1.00 15.00 ?  209 LEU A CD2  3  
ATOM   9144   H  H    . LEU A 1 167 ? 7.108   -1.586  0.338   1.00 15.00 ?  209 LEU A H    3  
ATOM   9145   H  HA   . LEU A 1 167 ? 9.788   -2.110  -0.565  1.00 15.00 ?  209 LEU A HA   3  
ATOM   9146   H  HB2  . LEU A 1 167 ? 9.002   0.142   -0.711  1.00 15.00 ?  209 LEU A HB2  3  
ATOM   9147   H  HB3  . LEU A 1 167 ? 8.518   0.152   0.974   1.00 15.00 ?  209 LEU A HB3  3  
ATOM   9148   H  HG   . LEU A 1 167 ? 11.008  -0.123  1.518   1.00 15.00 ?  209 LEU A HG   3  
ATOM   9149   H  HD11 . LEU A 1 167 ? 11.352  0.961   -1.264  1.00 15.00 ?  209 LEU A HD11 3  
ATOM   9150   H  HD12 . LEU A 1 167 ? 11.568  -0.741  -0.866  1.00 15.00 ?  209 LEU A HD12 3  
ATOM   9151   H  HD13 . LEU A 1 167 ? 12.604  0.472   -0.116  1.00 15.00 ?  209 LEU A HD13 3  
ATOM   9152   H  HD21 . LEU A 1 167 ? 11.391  2.266   1.364   1.00 15.00 ?  209 LEU A HD21 3  
ATOM   9153   H  HD22 . LEU A 1 167 ? 9.723   1.947   1.843   1.00 15.00 ?  209 LEU A HD22 3  
ATOM   9154   H  HD23 . LEU A 1 167 ? 10.088  2.418   0.182   1.00 15.00 ?  209 LEU A HD23 3  
ATOM   9155   N  N    . ILE A 1 168 ? 9.053   -2.141  2.648   1.00 15.00 ?  210 ILE A N    3  
ATOM   9156   C  CA   . ILE A 1 168 ? 9.487   -2.605  3.957   1.00 15.00 ?  210 ILE A CA   3  
ATOM   9157   C  C    . ILE A 1 168 ? 9.029   -4.040  4.206   1.00 15.00 ?  210 ILE A C    3  
ATOM   9158   O  O    . ILE A 1 168 ? 7.900   -4.410  3.868   1.00 15.00 ?  210 ILE A O    3  
ATOM   9159   C  CB   . ILE A 1 168 ? 8.944   -1.679  5.075   1.00 15.00 ?  210 ILE A CB   3  
ATOM   9160   C  CG1  . ILE A 1 168 ? 9.413   -0.233  4.851   1.00 15.00 ?  210 ILE A CG1  3  
ATOM   9161   C  CG2  . ILE A 1 168 ? 9.369   -2.173  6.454   1.00 15.00 ?  210 ILE A CG2  3  
ATOM   9162   C  CD1  . ILE A 1 168 ? 10.914  -0.061  4.908   1.00 15.00 ?  210 ILE A CD1  3  
ATOM   9163   H  H    . ILE A 1 168 ? 8.176   -1.714  2.564   1.00 15.00 ?  210 ILE A H    3  
ATOM   9164   H  HA   . ILE A 1 168 ? 10.564  -2.572  3.986   1.00 15.00 ?  210 ILE A HA   3  
ATOM   9165   H  HB   . ILE A 1 168 ? 7.864   -1.704  5.031   1.00 15.00 ?  210 ILE A HB   3  
ATOM   9166   H  HG12 . ILE A 1 168 ? 9.081   0.103   3.879   1.00 15.00 ?  210 ILE A HG12 3  
ATOM   9167   H  HG13 . ILE A 1 168 ? 8.977   0.402   5.610   1.00 15.00 ?  210 ILE A HG13 3  
ATOM   9168   H  HG21 . ILE A 1 168 ? 10.441  -2.300  6.476   1.00 15.00 ?  210 ILE A HG21 3  
ATOM   9169   H  HG22 . ILE A 1 168 ? 8.890   -3.117  6.665   1.00 15.00 ?  210 ILE A HG22 3  
ATOM   9170   H  HG23 . ILE A 1 168 ? 9.078   -1.449  7.199   1.00 15.00 ?  210 ILE A HG23 3  
ATOM   9171   H  HD11 . ILE A 1 168 ? 11.160  0.981   4.784   1.00 15.00 ?  210 ILE A HD11 3  
ATOM   9172   H  HD12 . ILE A 1 168 ? 11.373  -0.634  4.116   1.00 15.00 ?  210 ILE A HD12 3  
ATOM   9173   H  HD13 . ILE A 1 168 ? 11.281  -0.405  5.862   1.00 15.00 ?  210 ILE A HD13 3  
ATOM   9174   N  N    . LYS A 1 169 ? 9.920   -4.844  4.768   1.00 15.00 ?  211 LYS A N    3  
ATOM   9175   C  CA   . LYS A 1 169 ? 9.630   -6.236  5.083   1.00 15.00 ?  211 LYS A CA   3  
ATOM   9176   C  C    . LYS A 1 169 ? 9.557   -6.399  6.590   1.00 15.00 ?  211 LYS A C    3  
ATOM   9177   O  O    . LYS A 1 169 ? 9.908   -5.483  7.331   1.00 15.00 ?  211 LYS A O    3  
ATOM   9178   C  CB   . LYS A 1 169 ? 10.722  -7.161  4.532   1.00 15.00 ?  211 LYS A CB   3  
ATOM   9179   C  CG   . LYS A 1 169 ? 11.258  -6.757  3.171   1.00 15.00 ?  211 LYS A CG   3  
ATOM   9180   C  CD   . LYS A 1 169 ? 10.212  -6.930  2.088   1.00 15.00 ?  211 LYS A CD   3  
ATOM   9181   C  CE   . LYS A 1 169 ? 10.771  -6.561  0.726   1.00 15.00 ?  211 LYS A CE   3  
ATOM   9182   N  NZ   . LYS A 1 169 ? 9.743   -6.638  -0.345  1.00 15.00 1  211 LYS A NZ   3  
ATOM   9183   H  H    . LYS A 1 169 ? 10.807  -4.487  4.999   1.00 15.00 ?  211 LYS A H    3  
ATOM   9184   H  HA   . LYS A 1 169 ? 8.676   -6.498  4.645   1.00 15.00 ?  211 LYS A HA   3  
ATOM   9185   H  HB2  . LYS A 1 169 ? 11.549  -7.176  5.226   1.00 15.00 ?  211 LYS A HB2  3  
ATOM   9186   H  HB3  . LYS A 1 169 ? 10.318  -8.159  4.449   1.00 15.00 ?  211 LYS A HB3  3  
ATOM   9187   H  HG2  . LYS A 1 169 ? 11.557  -5.723  3.203   1.00 15.00 ?  211 LYS A HG2  3  
ATOM   9188   H  HG3  . LYS A 1 169 ? 12.111  -7.374  2.934   1.00 15.00 ?  211 LYS A HG3  3  
ATOM   9189   H  HD2  . LYS A 1 169 ? 9.897   -7.964  2.073   1.00 15.00 ?  211 LYS A HD2  3  
ATOM   9190   H  HD3  . LYS A 1 169 ? 9.368   -6.296  2.312   1.00 15.00 ?  211 LYS A HD3  3  
ATOM   9191   H  HE2  . LYS A 1 169 ? 11.151  -5.553  0.769   1.00 15.00 ?  211 LYS A HE2  3  
ATOM   9192   H  HE3  . LYS A 1 169 ? 11.578  -7.239  0.488   1.00 15.00 ?  211 LYS A HE3  3  
ATOM   9193   H  HZ1  . LYS A 1 169 ? 9.324   -5.699  -0.510  1.00 15.00 ?  211 LYS A HZ1  3  
ATOM   9194   H  HZ2  . LYS A 1 169 ? 8.987   -7.295  -0.069  1.00 15.00 ?  211 LYS A HZ2  3  
ATOM   9195   H  HZ3  . LYS A 1 169 ? 10.176  -6.974  -1.231  1.00 15.00 ?  211 LYS A HZ3  3  
ATOM   9196   N  N    . ASP A 1 170 ? 9.110   -7.559  7.040   1.00 15.00 ?  212 ASP A N    3  
ATOM   9197   C  CA   . ASP A 1 170 ? 9.001   -7.834  8.467   1.00 15.00 ?  212 ASP A CA   3  
ATOM   9198   C  C    . ASP A 1 170 ? 10.375  -8.123  9.063   1.00 15.00 ?  212 ASP A C    3  
ATOM   9199   O  O    . ASP A 1 170 ? 11.334  -8.385  8.336   1.00 15.00 ?  212 ASP A O    3  
ATOM   9200   C  CB   . ASP A 1 170 ? 8.058   -9.011  8.709   1.00 15.00 ?  212 ASP A CB   3  
ATOM   9201   C  CG   . ASP A 1 170 ? 8.448   -10.246 7.922   1.00 15.00 ?  212 ASP A CG   3  
ATOM   9202   O  OD1  . ASP A 1 170 ? 8.942   -11.214 8.535   1.00 15.00 ?  212 ASP A OD1  3  
ATOM   9203   O  OD2  . ASP A 1 170 ? 8.252   -10.257 6.686   1.00 15.00 -1 212 ASP A OD2  3  
ATOM   9204   H  H    . ASP A 1 170 ? 8.845   -8.253  6.401   1.00 15.00 ?  212 ASP A H    3  
ATOM   9205   H  HA   . ASP A 1 170 ? 8.594   -6.955  8.942   1.00 15.00 ?  212 ASP A HA   3  
ATOM   9206   H  HB2  . ASP A 1 170 ? 8.066   -9.260  9.760   1.00 15.00 ?  212 ASP A HB2  3  
ATOM   9207   H  HB3  . ASP A 1 170 ? 7.057   -8.723  8.421   1.00 15.00 ?  212 ASP A HB3  3  
ATOM   9208   N  N    . SER A 1 171 ? 10.467  -8.094  10.389  1.00 15.00 ?  213 SER A N    3  
ATOM   9209   C  CA   . SER A 1 171 ? 11.735  -8.335  11.081  1.00 15.00 ?  213 SER A CA   3  
ATOM   9210   C  C    . SER A 1 171 ? 12.152  -9.811  11.043  1.00 15.00 ?  213 SER A C    3  
ATOM   9211   O  O    . SER A 1 171 ? 13.155  -10.197 11.652  1.00 15.00 ?  213 SER A O    3  
ATOM   9212   C  CB   . SER A 1 171 ? 11.640  -7.848  12.530  1.00 15.00 ?  213 SER A CB   3  
ATOM   9213   O  OG   . SER A 1 171 ? 10.479  -8.352  13.174  1.00 15.00 ?  213 SER A OG   3  
ATOM   9214   H  H    . SER A 1 171 ? 9.658   -7.895  10.920  1.00 15.00 ?  213 SER A H    3  
ATOM   9215   H  HA   . SER A 1 171 ? 12.494  -7.761  10.576  1.00 15.00 ?  213 SER A HA   3  
ATOM   9216   H  HB2  . SER A 1 171 ? 12.511  -8.182  13.078  1.00 15.00 ?  213 SER A HB2  3  
ATOM   9217   H  HB3  . SER A 1 171 ? 11.600  -6.769  12.541  1.00 15.00 ?  213 SER A HB3  3  
ATOM   9218   H  HG   . SER A 1 171 ? 9.683   -7.943  12.779  1.00 15.00 ?  213 SER A HG   3  
ATOM   9219   N  N    . LYS A 1 172 ? 11.391  -10.634 10.332  1.00 15.00 ?  214 LYS A N    3  
ATOM   9220   C  CA   . LYS A 1 172 ? 11.705  -12.053 10.226  1.00 15.00 ?  214 LYS A CA   3  
ATOM   9221   C  C    . LYS A 1 172 ? 11.913  -12.448 8.771   1.00 15.00 ?  214 LYS A C    3  
ATOM   9222   O  O    . LYS A 1 172 ? 11.981  -13.634 8.445   1.00 15.00 ?  214 LYS A O    3  
ATOM   9223   C  CB   . LYS A 1 172 ? 10.591  -12.913 10.834  1.00 15.00 ?  214 LYS A CB   3  
ATOM   9224   C  CG   . LYS A 1 172 ? 10.365  -12.674 12.317  1.00 15.00 ?  214 LYS A CG   3  
ATOM   9225   C  CD   . LYS A 1 172 ? 11.562  -13.109 13.155  1.00 15.00 ?  214 LYS A CD   3  
ATOM   9226   C  CE   . LYS A 1 172 ? 11.233  -13.107 14.641  1.00 15.00 ?  214 LYS A CE   3  
ATOM   9227   N  NZ   . LYS A 1 172 ? 10.723  -11.785 15.097  1.00 15.00 1  214 LYS A NZ   3  
ATOM   9228   H  H    . LYS A 1 172 ? 10.608  -10.279 9.859   1.00 15.00 ?  214 LYS A H    3  
ATOM   9229   H  HA   . LYS A 1 172 ? 12.620  -12.230 10.769  1.00 15.00 ?  214 LYS A HA   3  
ATOM   9230   H  HB2  . LYS A 1 172 ? 9.668   -12.703 10.313  1.00 15.00 ?  214 LYS A HB2  3  
ATOM   9231   H  HB3  . LYS A 1 172 ? 10.842  -13.954 10.694  1.00 15.00 ?  214 LYS A HB3  3  
ATOM   9232   H  HG2  . LYS A 1 172 ? 10.191  -11.620 12.477  1.00 15.00 ?  214 LYS A HG2  3  
ATOM   9233   H  HG3  . LYS A 1 172 ? 9.496   -13.232 12.631  1.00 15.00 ?  214 LYS A HG3  3  
ATOM   9234   H  HD2  . LYS A 1 172 ? 11.850  -14.108 12.862  1.00 15.00 ?  214 LYS A HD2  3  
ATOM   9235   H  HD3  . LYS A 1 172 ? 12.382  -12.432 12.976  1.00 15.00 ?  214 LYS A HD3  3  
ATOM   9236   H  HE2  . LYS A 1 172 ? 10.481  -13.859 14.833  1.00 15.00 ?  214 LYS A HE2  3  
ATOM   9237   H  HE3  . LYS A 1 172 ? 12.131  -13.345 15.194  1.00 15.00 ?  214 LYS A HE3  3  
ATOM   9238   H  HZ1  . LYS A 1 172 ? 10.465  -11.832 16.104  1.00 15.00 ?  214 LYS A HZ1  3  
ATOM   9239   H  HZ2  . LYS A 1 172 ? 9.879   -11.513 14.549  1.00 15.00 ?  214 LYS A HZ2  3  
ATOM   9240   H  HZ3  . LYS A 1 172 ? 11.451  -11.056 14.974  1.00 15.00 ?  214 LYS A HZ3  3  
ATOM   9241   N  N    . ALA A 1 173 ? 12.022  -11.452 7.904   1.00 15.00 ?  215 ALA A N    3  
ATOM   9242   C  CA   . ALA A 1 173 ? 12.214  -11.695 6.481   1.00 15.00 ?  215 ALA A CA   3  
ATOM   9243   C  C    . ALA A 1 173 ? 13.606  -12.255 6.200   1.00 15.00 ?  215 ALA A C    3  
ATOM   9244   O  O    . ALA A 1 173 ? 14.610  -11.751 6.712   1.00 15.00 ?  215 ALA A O    3  
ATOM   9245   C  CB   . ALA A 1 173 ? 11.982  -10.415 5.692   1.00 15.00 ?  215 ALA A CB   3  
ATOM   9246   H  H    . ALA A 1 173 ? 11.972  -10.528 8.228   1.00 15.00 ?  215 ALA A H    3  
ATOM   9247   H  HA   . ALA A 1 173 ? 11.477  -12.419 6.166   1.00 15.00 ?  215 ALA A HA   3  
ATOM   9248   H  HB1  . ALA A 1 173 ? 12.446  -10.503 4.722   1.00 15.00 ?  215 ALA A HB1  3  
ATOM   9249   H  HB2  . ALA A 1 173 ? 12.412  -9.579  6.224   1.00 15.00 ?  215 ALA A HB2  3  
ATOM   9250   H  HB3  . ALA A 1 173 ? 10.922  -10.256 5.569   1.00 15.00 ?  215 ALA A HB3  3  
ATOM   9251   N  N    . LYS A 1 174 ? 13.656  -13.312 5.405   1.00 15.00 ?  216 LYS A N    3  
ATOM   9252   C  CA   . LYS A 1 174 ? 14.919  -13.936 5.045   1.00 15.00 ?  216 LYS A CA   3  
ATOM   9253   C  C    . LYS A 1 174 ? 15.555  -13.218 3.864   1.00 15.00 ?  216 LYS A C    3  
ATOM   9254   O  O    . LYS A 1 174 ? 16.780  -13.164 3.745   1.00 15.00 ?  216 LYS A O    3  
ATOM   9255   C  CB   . LYS A 1 174 ? 14.704  -15.410 4.706   1.00 15.00 ?  216 LYS A CB   3  
ATOM   9256   C  CG   . LYS A 1 174 ? 14.646  -16.309 5.927   1.00 15.00 ?  216 LYS A CG   3  
ATOM   9257   C  CD   . LYS A 1 174 ? 14.169  -17.706 5.571   1.00 15.00 ?  216 LYS A CD   3  
ATOM   9258   C  CE   . LYS A 1 174 ? 14.269  -18.637 6.765   1.00 15.00 ?  216 LYS A CE   3  
ATOM   9259   N  NZ   . LYS A 1 174 ? 13.538  -19.911 6.546   1.00 15.00 1  216 LYS A NZ   3  
ATOM   9260   H  H    . LYS A 1 174 ? 12.818  -13.691 5.061   1.00 15.00 ?  216 LYS A H    3  
ATOM   9261   H  HA   . LYS A 1 174 ? 15.580  -13.861 5.895   1.00 15.00 ?  216 LYS A HA   3  
ATOM   9262   H  HB2  . LYS A 1 174 ? 13.776  -15.511 4.168   1.00 15.00 ?  216 LYS A HB2  3  
ATOM   9263   H  HB3  . LYS A 1 174 ? 15.515  -15.744 4.076   1.00 15.00 ?  216 LYS A HB3  3  
ATOM   9264   H  HG2  . LYS A 1 174 ? 15.632  -16.375 6.363   1.00 15.00 ?  216 LYS A HG2  3  
ATOM   9265   H  HG3  . LYS A 1 174 ? 13.963  -15.879 6.644   1.00 15.00 ?  216 LYS A HG3  3  
ATOM   9266   H  HD2  . LYS A 1 174 ? 13.141  -17.655 5.250   1.00 15.00 ?  216 LYS A HD2  3  
ATOM   9267   H  HD3  . LYS A 1 174 ? 14.781  -18.095 4.772   1.00 15.00 ?  216 LYS A HD3  3  
ATOM   9268   H  HE2  . LYS A 1 174 ? 15.309  -18.857 6.948   1.00 15.00 ?  216 LYS A HE2  3  
ATOM   9269   H  HE3  . LYS A 1 174 ? 13.851  -18.139 7.624   1.00 15.00 ?  216 LYS A HE3  3  
ATOM   9270   H  HZ1  . LYS A 1 174 ? 13.662  -20.536 7.367   1.00 15.00 ?  216 LYS A HZ1  3  
ATOM   9271   H  HZ2  . LYS A 1 174 ? 13.895  -20.393 5.697   1.00 15.00 ?  216 LYS A HZ2  3  
ATOM   9272   H  HZ3  . LYS A 1 174 ? 12.521  -19.723 6.419   1.00 15.00 ?  216 LYS A HZ3  3  
ATOM   9273   N  N    . SER A 1 175 ? 14.722  -12.656 3.001   1.00 15.00 ?  217 SER A N    3  
ATOM   9274   C  CA   . SER A 1 175 ? 15.200  -11.946 1.826   1.00 15.00 ?  217 SER A CA   3  
ATOM   9275   C  C    . SER A 1 175 ? 14.293  -10.760 1.510   1.00 15.00 ?  217 SER A C    3  
ATOM   9276   O  O    . SER A 1 175 ? 13.336  -10.489 2.238   1.00 15.00 ?  217 SER A O    3  
ATOM   9277   C  CB   . SER A 1 175 ? 15.247  -12.899 0.632   1.00 15.00 ?  217 SER A CB   3  
ATOM   9278   O  OG   . SER A 1 175 ? 13.998  -13.546 0.464   1.00 15.00 ?  217 SER A OG   3  
ATOM   9279   H  H    . SER A 1 175 ? 13.758  -12.713 3.162   1.00 15.00 ?  217 SER A H    3  
ATOM   9280   H  HA   . SER A 1 175 ? 16.195  -11.585 2.035   1.00 15.00 ?  217 SER A HA   3  
ATOM   9281   H  HB2  . SER A 1 175 ? 15.472  -12.338 -0.262  1.00 15.00 ?  217 SER A HB2  3  
ATOM   9282   H  HB3  . SER A 1 175 ? 16.008  -13.644 0.796   1.00 15.00 ?  217 SER A HB3  3  
ATOM   9283   H  HG   . SER A 1 175 ? 14.140  -14.424 0.092   1.00 15.00 ?  217 SER A HG   3  
ATOM   9284   N  N    . LEU A 1 176 ? 14.589  -10.060 0.422   1.00 15.00 ?  218 LEU A N    3  
ATOM   9285   C  CA   . LEU A 1 176 ? 13.791  -8.917  0.013   1.00 15.00 ?  218 LEU A CA   3  
ATOM   9286   C  C    . LEU A 1 176 ? 12.728  -9.342  -0.999  1.00 15.00 ?  218 LEU A C    3  
ATOM   9287   O  O    . LEU A 1 176 ? 11.896  -8.537  -1.417  1.00 15.00 ?  218 LEU A O    3  
ATOM   9288   C  CB   . LEU A 1 176 ? 14.690  -7.833  -0.586  1.00 15.00 ?  218 LEU A CB   3  
ATOM   9289   C  CG   . LEU A 1 176 ? 15.672  -7.186  0.390   1.00 15.00 ?  218 LEU A CG   3  
ATOM   9290   C  CD1  . LEU A 1 176 ? 16.740  -6.405  -0.364  1.00 15.00 ?  218 LEU A CD1  3  
ATOM   9291   C  CD2  . LEU A 1 176 ? 14.941  -6.274  1.363   1.00 15.00 ?  218 LEU A CD2  3  
ATOM   9292   H  H    . LEU A 1 176 ? 15.363  -10.319 -0.121  1.00 15.00 ?  218 LEU A H    3  
ATOM   9293   H  HA   . LEU A 1 176 ? 13.298  -8.521  0.889   1.00 15.00 ?  218 LEU A HA   3  
ATOM   9294   H  HB2  . LEU A 1 176 ? 15.257  -8.275  -1.392  1.00 15.00 ?  218 LEU A HB2  3  
ATOM   9295   H  HB3  . LEU A 1 176 ? 14.062  -7.057  -0.994  1.00 15.00 ?  218 LEU A HB3  3  
ATOM   9296   H  HG   . LEU A 1 176 ? 16.164  -7.961  0.958   1.00 15.00 ?  218 LEU A HG   3  
ATOM   9297   H  HD11 . LEU A 1 176 ? 16.272  -5.772  -1.104  1.00 15.00 ?  218 LEU A HD11 3  
ATOM   9298   H  HD12 . LEU A 1 176 ? 17.410  -7.097  -0.852  1.00 15.00 ?  218 LEU A HD12 3  
ATOM   9299   H  HD13 . LEU A 1 176 ? 17.298  -5.792  0.330   1.00 15.00 ?  218 LEU A HD13 3  
ATOM   9300   H  HD21 . LEU A 1 176 ? 15.623  -5.954  2.135   1.00 15.00 ?  218 LEU A HD21 3  
ATOM   9301   H  HD22 . LEU A 1 176 ? 14.116  -6.808  1.811   1.00 15.00 ?  218 LEU A HD22 3  
ATOM   9302   H  HD23 . LEU A 1 176 ? 14.564  -5.408  0.836   1.00 15.00 ?  218 LEU A HD23 3  
ATOM   9303   N  N    . GLY A 1 177 ? 12.757  -10.616 -1.381  1.00 15.00 ?  219 GLY A N    3  
ATOM   9304   C  CA   . GLY A 1 177 ? 11.794  -11.130 -2.339  1.00 15.00 ?  219 GLY A CA   3  
ATOM   9305   C  C    . GLY A 1 177 ? 12.115  -10.703 -3.759  1.00 15.00 ?  219 GLY A C    3  
ATOM   9306   O  O    . GLY A 1 177 ? 13.285  -10.643 -4.138  1.00 15.00 ?  219 GLY A O    3  
ATOM   9307   H  H    . GLY A 1 177 ? 13.437  -11.215 -1.009  1.00 15.00 ?  219 GLY A H    3  
ATOM   9308   H  HA2  . GLY A 1 177 ? 11.787  -12.209 -2.286  1.00 15.00 ?  219 GLY A HA2  3  
ATOM   9309   H  HA3  . GLY A 1 177 ? 10.814  -10.761 -2.074  1.00 15.00 ?  219 GLY A HA3  3  
ATOM   9310   N  N    . ASN A 1 178 ? 11.078  -10.409 -4.541  1.00 15.00 ?  220 ASN A N    3  
ATOM   9311   C  CA   . ASN A 1 178 ? 11.251  -9.975  -5.925  1.00 15.00 ?  220 ASN A CA   3  
ATOM   9312   C  C    . ASN A 1 178 ? 12.107  -8.720  -5.994  1.00 15.00 ?  220 ASN A C    3  
ATOM   9313   O  O    . ASN A 1 178 ? 11.756  -7.683  -5.423  1.00 15.00 ?  220 ASN A O    3  
ATOM   9314   C  CB   . ASN A 1 178 ? 9.891   -9.718  -6.583  1.00 15.00 ?  220 ASN A CB   3  
ATOM   9315   C  CG   . ASN A 1 178 ? 10.015  -9.097  -7.966  1.00 15.00 ?  220 ASN A CG   3  
ATOM   9316   O  OD1  . ASN A 1 178 ? 10.081  -7.876  -8.110  1.00 15.00 ?  220 ASN A OD1  3  
ATOM   9317   N  ND2  . ASN A 1 178 ? 10.036  -9.931  -8.992  1.00 15.00 ?  220 ASN A ND2  3  
ATOM   9318   H  H    . ASN A 1 178 ? 10.172  -10.497 -4.182  1.00 15.00 ?  220 ASN A H    3  
ATOM   9319   H  HA   . ASN A 1 178 ? 11.750  -10.769 -6.461  1.00 15.00 ?  220 ASN A HA   3  
ATOM   9320   H  HB2  . ASN A 1 178 ? 9.366   -10.656 -6.678  1.00 15.00 ?  220 ASN A HB2  3  
ATOM   9321   H  HB3  . ASN A 1 178 ? 9.317   -9.051  -5.957  1.00 15.00 ?  220 ASN A HB3  3  
ATOM   9322   H  HD21 . ASN A 1 178 ? 9.974   -10.895 -8.808  1.00 15.00 ?  220 ASN A HD21 3  
ATOM   9323   H  HD22 . ASN A 1 178 ? 10.108  -9.554  -9.897  1.00 15.00 ?  220 ASN A HD22 3  
ATOM   9324   N  N    . LEU A 1 179 ? 13.235  -8.830  -6.676  1.00 15.00 ?  221 LEU A N    3  
ATOM   9325   C  CA   . LEU A 1 179 ? 14.155  -7.713  -6.827  1.00 15.00 ?  221 LEU A CA   3  
ATOM   9326   C  C    . LEU A 1 179 ? 14.380  -7.409  -8.305  1.00 15.00 ?  221 LEU A C    3  
ATOM   9327   O  O    . LEU A 1 179 ? 15.383  -6.799  -8.679  1.00 15.00 ?  221 LEU A O    3  
ATOM   9328   C  CB   . LEU A 1 179 ? 15.491  -8.040  -6.152  1.00 15.00 ?  221 LEU A CB   3  
ATOM   9329   C  CG   . LEU A 1 179 ? 15.479  -8.039  -4.618  1.00 15.00 ?  221 LEU A CG   3  
ATOM   9330   C  CD1  . LEU A 1 179 ? 16.751  -8.676  -4.080  1.00 15.00 ?  221 LEU A CD1  3  
ATOM   9331   C  CD2  . LEU A 1 179 ? 15.321  -6.620  -4.084  1.00 15.00 ?  221 LEU A CD2  3  
ATOM   9332   H  H    . LEU A 1 179 ? 13.465  -9.695  -7.083  1.00 15.00 ?  221 LEU A H    3  
ATOM   9333   H  HA   . LEU A 1 179 ? 13.717  -6.851  -6.348  1.00 15.00 ?  221 LEU A HA   3  
ATOM   9334   H  HB2  . LEU A 1 179 ? 15.804  -9.017  -6.484  1.00 15.00 ?  221 LEU A HB2  3  
ATOM   9335   H  HB3  . LEU A 1 179 ? 16.221  -7.319  -6.481  1.00 15.00 ?  221 LEU A HB3  3  
ATOM   9336   H  HG   . LEU A 1 179 ? 14.639  -8.626  -4.270  1.00 15.00 ?  221 LEU A HG   3  
ATOM   9337   H  HD11 . LEU A 1 179 ? 17.590  -8.380  -4.694  1.00 15.00 ?  221 LEU A HD11 3  
ATOM   9338   H  HD12 . LEU A 1 179 ? 16.652  -9.751  -4.101  1.00 15.00 ?  221 LEU A HD12 3  
ATOM   9339   H  HD13 . LEU A 1 179 ? 16.916  -8.349  -3.064  1.00 15.00 ?  221 LEU A HD13 3  
ATOM   9340   H  HD21 . LEU A 1 179 ? 15.552  -6.602  -3.029  1.00 15.00 ?  221 LEU A HD21 3  
ATOM   9341   H  HD22 . LEU A 1 179 ? 14.303  -6.295  -4.235  1.00 15.00 ?  221 LEU A HD22 3  
ATOM   9342   H  HD23 . LEU A 1 179 ? 15.991  -5.956  -4.612  1.00 15.00 ?  221 LEU A HD23 3  
ATOM   9343   N  N    . GLY A 1 180 ? 13.437  -7.830  -9.140  1.00 15.00 ?  222 GLY A N    3  
ATOM   9344   C  CA   . GLY A 1 180 ? 13.555  -7.606  -10.570 1.00 15.00 ?  222 GLY A CA   3  
ATOM   9345   C  C    . GLY A 1 180 ? 13.355  -6.154  -10.944 1.00 15.00 ?  222 GLY A C    3  
ATOM   9346   O  O    . GLY A 1 180 ? 14.146  -5.581  -11.694 1.00 15.00 ?  222 GLY A O    3  
ATOM   9347   H  H    . GLY A 1 180 ? 12.649  -8.288  -8.782  1.00 15.00 ?  222 GLY A H    3  
ATOM   9348   H  HA2  . GLY A 1 180 ? 14.537  -7.916  -10.893 1.00 15.00 ?  222 GLY A HA2  3  
ATOM   9349   H  HA3  . GLY A 1 180 ? 12.814  -8.206  -11.082 1.00 15.00 ?  222 GLY A HA3  3  
ATOM   9350   N  N    . ASP A 1 181 ? 12.302  -5.559  -10.412 1.00 15.00 ?  223 ASP A N    3  
ATOM   9351   C  CA   . ASP A 1 181 ? 11.991  -4.162  -10.691 1.00 15.00 ?  223 ASP A CA   3  
ATOM   9352   C  C    . ASP A 1 181 ? 12.454  -3.281  -9.541  1.00 15.00 ?  223 ASP A C    3  
ATOM   9353   O  O    . ASP A 1 181 ? 12.023  -2.135  -9.412  1.00 15.00 ?  223 ASP A O    3  
ATOM   9354   C  CB   . ASP A 1 181 ? 10.482  -3.977  -10.907 1.00 15.00 ?  223 ASP A CB   3  
ATOM   9355   C  CG   . ASP A 1 181 ? 9.944   -4.798  -12.058 1.00 15.00 ?  223 ASP A CG   3  
ATOM   9356   O  OD1  . ASP A 1 181 ? 10.510  -4.716  -13.170 1.00 15.00 ?  223 ASP A OD1  3  
ATOM   9357   O  OD2  . ASP A 1 181 ? 8.947   -5.528  -11.860 1.00 15.00 -1 223 ASP A OD2  3  
ATOM   9358   H  H    . ASP A 1 181 ? 11.716  -6.073  -9.816  1.00 15.00 ?  223 ASP A H    3  
ATOM   9359   H  HA   . ASP A 1 181 ? 12.518  -3.875  -11.588 1.00 15.00 ?  223 ASP A HA   3  
ATOM   9360   H  HB2  . ASP A 1 181 ? 9.961   -4.272  -10.010 1.00 15.00 ?  223 ASP A HB2  3  
ATOM   9361   H  HB3  . ASP A 1 181 ? 10.279  -2.934  -11.107 1.00 15.00 ?  223 ASP A HB3  3  
ATOM   9362   N  N    . ALA A 1 182 ? 13.350  -3.817  -8.725  1.00 15.00 ?  224 ALA A N    3  
ATOM   9363   C  CA   . ALA A 1 182 ? 13.857  -3.101  -7.565  1.00 15.00 ?  224 ALA A CA   3  
ATOM   9364   C  C    . ALA A 1 182 ? 15.174  -2.388  -7.860  1.00 15.00 ?  224 ALA A C    3  
ATOM   9365   O  O    . ALA A 1 182 ? 15.835  -2.665  -8.861  1.00 15.00 ?  224 ALA A O    3  
ATOM   9366   C  CB   . ALA A 1 182 ? 14.031  -4.071  -6.405  1.00 15.00 ?  224 ALA A CB   3  
ATOM   9367   H  H    . ALA A 1 182 ? 13.685  -4.719  -8.913  1.00 15.00 ?  224 ALA A H    3  
ATOM   9368   H  HA   . ALA A 1 182 ? 13.117  -2.368  -7.279  1.00 15.00 ?  224 ALA A HA   3  
ATOM   9369   H  HB1  . ALA A 1 182 ? 14.460  -3.550  -5.564  1.00 15.00 ?  224 ALA A HB1  3  
ATOM   9370   H  HB2  . ALA A 1 182 ? 14.687  -4.877  -6.704  1.00 15.00 ?  224 ALA A HB2  3  
ATOM   9371   H  HB3  . ALA A 1 182 ? 13.073  -4.476  -6.127  1.00 15.00 ?  224 ALA A HB3  3  
ATOM   9372   N  N    . ASP A 1 183 ? 15.536  -1.469  -6.973  1.00 15.00 ?  225 ASP A N    3  
ATOM   9373   C  CA   . ASP A 1 183 ? 16.771  -0.709  -7.092  1.00 15.00 ?  225 ASP A CA   3  
ATOM   9374   C  C    . ASP A 1 183 ? 17.738  -1.161  -6.001  1.00 15.00 ?  225 ASP A C    3  
ATOM   9375   O  O    . ASP A 1 183 ? 17.566  -0.831  -4.826  1.00 15.00 ?  225 ASP A O    3  
ATOM   9376   C  CB   . ASP A 1 183 ? 16.484  0.793   -6.970  1.00 15.00 ?  225 ASP A CB   3  
ATOM   9377   C  CG   . ASP A 1 183 ? 17.731  1.645   -7.117  1.00 15.00 ?  225 ASP A CG   3  
ATOM   9378   O  OD1  . ASP A 1 183 ? 18.466  1.805   -6.124  1.00 15.00 ?  225 ASP A OD1  3  
ATOM   9379   O  OD2  . ASP A 1 183 ? 17.977  2.166   -8.228  1.00 15.00 -1 225 ASP A OD2  3  
ATOM   9380   H  H    . ASP A 1 183 ? 14.955  -1.308  -6.195  1.00 15.00 ?  225 ASP A H    3  
ATOM   9381   H  HA   . ASP A 1 183 ? 17.206  -0.914  -8.059  1.00 15.00 ?  225 ASP A HA   3  
ATOM   9382   H  HB2  . ASP A 1 183 ? 15.782  1.079   -7.739  1.00 15.00 ?  225 ASP A HB2  3  
ATOM   9383   H  HB3  . ASP A 1 183 ? 16.049  0.987   -6.001  1.00 15.00 ?  225 ASP A HB3  3  
ATOM   9384   N  N    . THR A 1 184 ? 18.747  -1.924  -6.391  1.00 15.00 ?  226 THR A N    3  
ATOM   9385   C  CA   . THR A 1 184 ? 19.727  -2.443  -5.451  1.00 15.00 ?  226 THR A CA   3  
ATOM   9386   C  C    . THR A 1 184 ? 20.817  -1.417  -5.121  1.00 15.00 ?  226 THR A C    3  
ATOM   9387   O  O    . THR A 1 184 ? 22.002  -1.748  -5.068  1.00 15.00 ?  226 THR A O    3  
ATOM   9388   C  CB   . THR A 1 184 ? 20.372  -3.725  -6.012  1.00 15.00 ?  226 THR A CB   3  
ATOM   9389   O  OG1  . THR A 1 184 ? 20.044  -3.858  -7.409  1.00 15.00 ?  226 THR A OG1  3  
ATOM   9390   C  CG2  . THR A 1 184 ? 19.884  -4.950  -5.252  1.00 15.00 ?  226 THR A CG2  3  
ATOM   9391   H  H    . THR A 1 184 ? 18.838  -2.151  -7.343  1.00 15.00 ?  226 THR A H    3  
ATOM   9392   H  HA   . THR A 1 184 ? 19.210  -2.701  -4.540  1.00 15.00 ?  226 THR A HA   3  
ATOM   9393   H  HB   . THR A 1 184 ? 21.446  -3.650  -5.904  1.00 15.00 ?  226 THR A HB   3  
ATOM   9394   H  HG1  . THR A 1 184 ? 20.598  -3.256  -7.923  1.00 15.00 ?  226 THR A HG1  3  
ATOM   9395   H  HG21 . THR A 1 184 ? 19.690  -4.684  -4.224  1.00 15.00 ?  226 THR A HG21 3  
ATOM   9396   H  HG22 . THR A 1 184 ? 20.644  -5.718  -5.286  1.00 15.00 ?  226 THR A HG22 3  
ATOM   9397   H  HG23 . THR A 1 184 ? 18.975  -5.322  -5.705  1.00 15.00 ?  226 THR A HG23 3  
ATOM   9398   N  N    . GLU A 1 185 ? 20.416  -0.170  -4.898  1.00 15.00 ?  227 GLU A N    3  
ATOM   9399   C  CA   . GLU A 1 185 ? 21.370  0.877   -4.563  1.00 15.00 ?  227 GLU A CA   3  
ATOM   9400   C  C    . GLU A 1 185 ? 20.789  1.846   -3.536  1.00 15.00 ?  227 GLU A C    3  
ATOM   9401   O  O    . GLU A 1 185 ? 21.459  2.229   -2.580  1.00 15.00 ?  227 GLU A O    3  
ATOM   9402   C  CB   . GLU A 1 185 ? 21.814  1.642   -5.817  1.00 15.00 ?  227 GLU A CB   3  
ATOM   9403   C  CG   . GLU A 1 185 ? 23.058  2.482   -5.588  1.00 15.00 ?  227 GLU A CG   3  
ATOM   9404   C  CD   . GLU A 1 185 ? 24.180  1.672   -4.977  1.00 15.00 ?  227 GLU A CD   3  
ATOM   9405   O  OE1  . GLU A 1 185 ? 24.928  1.018   -5.731  1.00 15.00 ?  227 GLU A OE1  3  
ATOM   9406   O  OE2  . GLU A 1 185 ? 24.313  1.672   -3.739  1.00 15.00 -1 227 GLU A OE2  3  
ATOM   9407   H  H    . GLU A 1 185 ? 19.461  0.052   -4.969  1.00 15.00 ?  227 GLU A H    3  
ATOM   9408   H  HA   . GLU A 1 185 ? 22.232  0.396   -4.130  1.00 15.00 ?  227 GLU A HA   3  
ATOM   9409   H  HB2  . GLU A 1 185 ? 22.025  0.933   -6.605  1.00 15.00 ?  227 GLU A HB2  3  
ATOM   9410   H  HB3  . GLU A 1 185 ? 21.018  2.298   -6.136  1.00 15.00 ?  227 GLU A HB3  3  
ATOM   9411   H  HG2  . GLU A 1 185 ? 23.394  2.877   -6.533  1.00 15.00 ?  227 GLU A HG2  3  
ATOM   9412   H  HG3  . GLU A 1 185 ? 22.813  3.296   -4.919  1.00 15.00 ?  227 GLU A HG3  3  
ATOM   9413   N  N    . HIS A 1 186 ? 19.545  2.240   -3.735  1.00 15.00 ?  228 HIS A N    3  
ATOM   9414   C  CA   . HIS A 1 186 ? 18.889  3.177   -2.829  1.00 15.00 ?  228 HIS A CA   3  
ATOM   9415   C  C    . HIS A 1 186 ? 17.844  2.474   -1.972  1.00 15.00 ?  228 HIS A C    3  
ATOM   9416   O  O    . HIS A 1 186 ? 17.117  3.120   -1.220  1.00 15.00 ?  228 HIS A O    3  
ATOM   9417   C  CB   . HIS A 1 186 ? 18.232  4.312   -3.625  1.00 15.00 ?  228 HIS A CB   3  
ATOM   9418   C  CG   . HIS A 1 186 ? 19.147  4.982   -4.601  1.00 15.00 ?  228 HIS A CG   3  
ATOM   9419   N  ND1  . HIS A 1 186 ? 19.425  4.484   -5.854  1.00 15.00 ?  228 HIS A ND1  3  
ATOM   9420   C  CD2  . HIS A 1 186 ? 19.854  6.133   -4.487  1.00 15.00 ?  228 HIS A CD2  3  
ATOM   9421   C  CE1  . HIS A 1 186 ? 20.276  5.326   -6.450  1.00 15.00 ?  228 HIS A CE1  3  
ATOM   9422   N  NE2  . HIS A 1 186 ? 20.568  6.346   -5.663  1.00 15.00 ?  228 HIS A NE2  3  
ATOM   9423   H  H    . HIS A 1 186 ? 19.053  1.913   -4.530  1.00 15.00 ?  228 HIS A H    3  
ATOM   9424   H  HA   . HIS A 1 186 ? 19.643  3.596   -2.179  1.00 15.00 ?  228 HIS A HA   3  
ATOM   9425   H  HB2  . HIS A 1 186 ? 17.399  3.915   -4.182  1.00 15.00 ?  228 HIS A HB2  3  
ATOM   9426   H  HB3  . HIS A 1 186 ? 17.871  5.064   -2.939  1.00 15.00 ?  228 HIS A HB3  3  
ATOM   9427   H  HD1  . HIS A 1 186 ? 19.060  3.648   -6.241  1.00 15.00 ?  228 HIS A HD1  3  
ATOM   9428   H  HD2  . HIS A 1 186 ? 19.864  6.790   -3.626  1.00 15.00 ?  228 HIS A HD2  3  
ATOM   9429   H  HE1  . HIS A 1 186 ? 20.675  5.188   -7.444  1.00 15.00 ?  228 HIS A HE1  3  
ATOM   9430   N  N    . TYR A 1 187 ? 17.787  1.148   -2.067  1.00 15.00 ?  229 TYR A N    3  
ATOM   9431   C  CA   . TYR A 1 187 ? 16.811  0.366   -1.312  1.00 15.00 ?  229 TYR A CA   3  
ATOM   9432   C  C    . TYR A 1 187 ? 16.909  0.650   0.190   1.00 15.00 ?  229 TYR A C    3  
ATOM   9433   O  O    . TYR A 1 187 ? 15.930  1.077   0.810   1.00 15.00 ?  229 TYR A O    3  
ATOM   9434   C  CB   . TYR A 1 187 ? 16.996  -1.132  -1.585  1.00 15.00 ?  229 TYR A CB   3  
ATOM   9435   C  CG   . TYR A 1 187 ? 15.764  -1.962  -1.273  1.00 15.00 ?  229 TYR A CG   3  
ATOM   9436   C  CD1  . TYR A 1 187 ? 15.189  -1.949  -0.008  1.00 15.00 ?  229 TYR A CD1  3  
ATOM   9437   C  CD2  . TYR A 1 187 ? 15.175  -2.753  -2.247  1.00 15.00 ?  229 TYR A CD2  3  
ATOM   9438   C  CE1  . TYR A 1 187 ? 14.065  -2.695  0.275   1.00 15.00 ?  229 TYR A CE1  3  
ATOM   9439   C  CE2  . TYR A 1 187 ? 14.047  -3.505  -1.969  1.00 15.00 ?  229 TYR A CE2  3  
ATOM   9440   C  CZ   . TYR A 1 187 ? 13.497  -3.471  -0.706  1.00 15.00 ?  229 TYR A CZ   3  
ATOM   9441   O  OH   . TYR A 1 187 ? 12.372  -4.209  -0.426  1.00 15.00 ?  229 TYR A OH   3  
ATOM   9442   H  H    . TYR A 1 187 ? 18.415  0.685   -2.660  1.00 15.00 ?  229 TYR A H    3  
ATOM   9443   H  HA   . TYR A 1 187 ? 15.829  0.658   -1.650  1.00 15.00 ?  229 TYR A HA   3  
ATOM   9444   H  HB2  . TYR A 1 187 ? 17.236  -1.273  -2.630  1.00 15.00 ?  229 TYR A HB2  3  
ATOM   9445   H  HB3  . TYR A 1 187 ? 17.811  -1.504  -0.984  1.00 15.00 ?  229 TYR A HB3  3  
ATOM   9446   H  HD1  . TYR A 1 187 ? 15.633  -1.338  0.765   1.00 15.00 ?  229 TYR A HD1  3  
ATOM   9447   H  HD2  . TYR A 1 187 ? 15.612  -2.777  -3.236  1.00 15.00 ?  229 TYR A HD2  3  
ATOM   9448   H  HE1  . TYR A 1 187 ? 13.637  -2.672  1.264   1.00 15.00 ?  229 TYR A HE1  3  
ATOM   9449   H  HE2  . TYR A 1 187 ? 13.602  -4.113  -2.740  1.00 15.00 ?  229 TYR A HE2  3  
ATOM   9450   H  HH   . TYR A 1 187 ? 11.833  -3.734  0.221   1.00 15.00 ?  229 TYR A HH   3  
ATOM   9451   N  N    . ALA A 1 188 ? 18.089  0.436   0.763   1.00 15.00 ?  230 ALA A N    3  
ATOM   9452   C  CA   . ALA A 1 188 ? 18.293  0.662   2.191   1.00 15.00 ?  230 ALA A CA   3  
ATOM   9453   C  C    . ALA A 1 188 ? 18.033  2.123   2.555   1.00 15.00 ?  230 ALA A C    3  
ATOM   9454   O  O    . ALA A 1 188 ? 17.471  2.421   3.611   1.00 15.00 ?  230 ALA A O    3  
ATOM   9455   C  CB   . ALA A 1 188 ? 19.699  0.250   2.602   1.00 15.00 ?  230 ALA A CB   3  
ATOM   9456   H  H    . ALA A 1 188 ? 18.842  0.134   0.213   1.00 15.00 ?  230 ALA A H    3  
ATOM   9457   H  HA   . ALA A 1 188 ? 17.591  0.038   2.731   1.00 15.00 ?  230 ALA A HA   3  
ATOM   9458   H  HB1  . ALA A 1 188 ? 20.392  1.047   2.372   1.00 15.00 ?  230 ALA A HB1  3  
ATOM   9459   H  HB2  . ALA A 1 188 ? 19.983  -0.642  2.060   1.00 15.00 ?  230 ALA A HB2  3  
ATOM   9460   H  HB3  . ALA A 1 188 ? 19.721  0.049   3.662   1.00 15.00 ?  230 ALA A HB3  3  
ATOM   9461   N  N    . ALA A 1 189 ? 18.428  3.027   1.661   1.00 15.00 ?  231 ALA A N    3  
ATOM   9462   C  CA   . ALA A 1 189 ? 18.242  4.456   1.873   1.00 15.00 ?  231 ALA A CA   3  
ATOM   9463   C  C    . ALA A 1 189 ? 16.759  4.794   1.959   1.00 15.00 ?  231 ALA A C    3  
ATOM   9464   O  O    . ALA A 1 189 ? 16.334  5.522   2.859   1.00 15.00 ?  231 ALA A O    3  
ATOM   9465   C  CB   . ALA A 1 189 ? 18.909  5.250   0.758   1.00 15.00 ?  231 ALA A CB   3  
ATOM   9466   H  H    . ALA A 1 189 ? 18.850  2.718   0.832   1.00 15.00 ?  231 ALA A H    3  
ATOM   9467   H  HA   . ALA A 1 189 ? 18.714  4.718   2.808   1.00 15.00 ?  231 ALA A HA   3  
ATOM   9468   H  HB1  . ALA A 1 189 ? 18.498  4.948   -0.192  1.00 15.00 ?  231 ALA A HB1  3  
ATOM   9469   H  HB2  . ALA A 1 189 ? 19.972  5.062   0.768   1.00 15.00 ?  231 ALA A HB2  3  
ATOM   9470   H  HB3  . ALA A 1 189 ? 18.725  6.304   0.909   1.00 15.00 ?  231 ALA A HB3  3  
ATOM   9471   N  N    . SER A 1 190 ? 15.978  4.253   1.024   1.00 15.00 ?  232 SER A N    3  
ATOM   9472   C  CA   . SER A 1 190 ? 14.537  4.477   1.000   1.00 15.00 ?  232 SER A CA   3  
ATOM   9473   C  C    . SER A 1 190 ? 13.886  3.918   2.263   1.00 15.00 ?  232 SER A C    3  
ATOM   9474   O  O    . SER A 1 190 ? 12.963  4.520   2.814   1.00 15.00 ?  232 SER A O    3  
ATOM   9475   C  CB   . SER A 1 190 ? 13.924  3.840   -0.253  1.00 15.00 ?  232 SER A CB   3  
ATOM   9476   O  OG   . SER A 1 190 ? 14.596  4.285   -1.420  1.00 15.00 ?  232 SER A OG   3  
ATOM   9477   H  H    . SER A 1 190 ? 16.386  3.698   0.322   1.00 15.00 ?  232 SER A H    3  
ATOM   9478   H  HA   . SER A 1 190 ? 14.372  5.542   0.966   1.00 15.00 ?  232 SER A HA   3  
ATOM   9479   H  HB2  . SER A 1 190 ? 14.008  2.766   -0.190  1.00 15.00 ?  232 SER A HB2  3  
ATOM   9480   H  HB3  . SER A 1 190 ? 12.880  4.115   -0.325  1.00 15.00 ?  232 SER A HB3  3  
ATOM   9481   H  HG   . SER A 1 190 ? 14.945  3.524   -1.905  1.00 15.00 ?  232 SER A HG   3  
ATOM   9482   N  N    . ALA A 1 191 ? 14.385  2.776   2.725   1.00 15.00 ?  233 ALA A N    3  
ATOM   9483   C  CA   . ALA A 1 191 ? 13.864  2.150   3.931   1.00 15.00 ?  233 ALA A CA   3  
ATOM   9484   C  C    . ALA A 1 191 ? 14.068  3.070   5.135   1.00 15.00 ?  233 ALA A C    3  
ATOM   9485   O  O    . ALA A 1 191 ? 13.150  3.290   5.927   1.00 15.00 ?  233 ALA A O    3  
ATOM   9486   C  CB   . ALA A 1 191 ? 14.529  0.798   4.152   1.00 15.00 ?  233 ALA A CB   3  
ATOM   9487   H  H    . ALA A 1 191 ? 15.118  2.343   2.237   1.00 15.00 ?  233 ALA A H    3  
ATOM   9488   H  HA   . ALA A 1 191 ? 12.806  1.987   3.792   1.00 15.00 ?  233 ALA A HA   3  
ATOM   9489   H  HB1  . ALA A 1 191 ? 14.060  0.294   4.983   1.00 15.00 ?  233 ALA A HB1  3  
ATOM   9490   H  HB2  . ALA A 1 191 ? 15.576  0.944   4.366   1.00 15.00 ?  233 ALA A HB2  3  
ATOM   9491   H  HB3  . ALA A 1 191 ? 14.426  0.197   3.262   1.00 15.00 ?  233 ALA A HB3  3  
ATOM   9492   N  N    . ARG A 1 192 ? 15.274  3.629   5.248   1.00 15.00 ?  234 ARG A N    3  
ATOM   9493   C  CA   . ARG A 1 192 ? 15.598  4.535   6.347   1.00 15.00 ?  234 ARG A CA   3  
ATOM   9494   C  C    . ARG A 1 192 ? 14.815  5.836   6.212   1.00 15.00 ?  234 ARG A C    3  
ATOM   9495   O  O    . ARG A 1 192 ? 14.384  6.416   7.210   1.00 15.00 ?  234 ARG A O    3  
ATOM   9496   C  CB   . ARG A 1 192 ? 17.101  4.834   6.390   1.00 15.00 ?  234 ARG A CB   3  
ATOM   9497   C  CG   . ARG A 1 192 ? 17.974  3.597   6.518   1.00 15.00 ?  234 ARG A CG   3  
ATOM   9498   C  CD   . ARG A 1 192 ? 19.445  3.973   6.628   1.00 15.00 ?  234 ARG A CD   3  
ATOM   9499   N  NE   . ARG A 1 192 ? 20.305  3.090   5.833   1.00 15.00 ?  234 ARG A NE   3  
ATOM   9500   C  CZ   . ARG A 1 192 ? 20.993  3.481   4.761   1.00 15.00 ?  234 ARG A CZ   3  
ATOM   9501   N  NH1  . ARG A 1 192 ? 20.928  4.741   4.341   1.00 15.00 1  234 ARG A NH1  3  
ATOM   9502   N  NH2  . ARG A 1 192 ? 21.770  2.614   4.121   1.00 15.00 ?  234 ARG A NH2  3  
ATOM   9503   H  H    . ARG A 1 192 ? 15.964  3.416   4.580   1.00 15.00 ?  234 ARG A H    3  
ATOM   9504   H  HA   . ARG A 1 192 ? 15.313  4.053   7.268   1.00 15.00 ?  234 ARG A HA   3  
ATOM   9505   H  HB2  . ARG A 1 192 ? 17.382  5.352   5.484   1.00 15.00 ?  234 ARG A HB2  3  
ATOM   9506   H  HB3  . ARG A 1 192 ? 17.304  5.479   7.233   1.00 15.00 ?  234 ARG A HB3  3  
ATOM   9507   H  HG2  . ARG A 1 192 ? 17.687  3.049   7.403   1.00 15.00 ?  234 ARG A HG2  3  
ATOM   9508   H  HG3  . ARG A 1 192 ? 17.833  2.975   5.647   1.00 15.00 ?  234 ARG A HG3  3  
ATOM   9509   H  HD2  . ARG A 1 192 ? 19.575  4.989   6.288   1.00 15.00 ?  234 ARG A HD2  3  
ATOM   9510   H  HD3  . ARG A 1 192 ? 19.740  3.908   7.667   1.00 15.00 ?  234 ARG A HD3  3  
ATOM   9511   H  HE   . ARG A 1 192 ? 20.377  2.152   6.123   1.00 15.00 ?  234 ARG A HE   3  
ATOM   9512   H  HH11 . ARG A 1 192 ? 21.471  5.044   3.505   1.00 15.00 ?  234 ARG A HH11 3  
ATOM   9513   H  HH12 . ARG A 1 192 ? 20.339  5.438   4.844   1.00 15.00 ?  234 ARG A HH12 3  
ATOM   9514   H  HH21 . ARG A 1 192 ? 21.848  1.626   4.457   1.00 15.00 ?  234 ARG A HH21 3  
ATOM   9515   H  HH22 . ARG A 1 192 ? 22.314  2.913   3.284   1.00 15.00 ?  234 ARG A HH22 3  
ATOM   9516   N  N    . ALA A 1 193 ? 14.626  6.284   4.974   1.00 15.00 ?  235 ALA A N    3  
ATOM   9517   C  CA   . ALA A 1 193 ? 13.889  7.510   4.709   1.00 15.00 ?  235 ALA A CA   3  
ATOM   9518   C  C    . ALA A 1 193 ? 12.448  7.401   5.193   1.00 15.00 ?  235 ALA A C    3  
ATOM   9519   O  O    . ALA A 1 193 ? 11.902  8.355   5.743   1.00 15.00 ?  235 ALA A O    3  
ATOM   9520   C  CB   . ALA A 1 193 ? 13.925  7.837   3.228   1.00 15.00 ?  235 ALA A CB   3  
ATOM   9521   H  H    . ALA A 1 193 ? 14.999  5.775   4.218   1.00 15.00 ?  235 ALA A H    3  
ATOM   9522   H  HA   . ALA A 1 193 ? 14.377  8.314   5.240   1.00 15.00 ?  235 ALA A HA   3  
ATOM   9523   H  HB1  . ALA A 1 193 ? 13.436  7.052   2.672   1.00 15.00 ?  235 ALA A HB1  3  
ATOM   9524   H  HB2  . ALA A 1 193 ? 14.951  7.920   2.904   1.00 15.00 ?  235 ALA A HB2  3  
ATOM   9525   H  HB3  . ALA A 1 193 ? 13.416  8.773   3.058   1.00 15.00 ?  235 ALA A HB3  3  
ATOM   9526   N  N    . PHE A 1 194 ? 11.842  6.237   4.986   1.00 15.00 ?  236 PHE A N    3  
ATOM   9527   C  CA   . PHE A 1 194 ? 10.470  5.999   5.414   1.00 15.00 ?  236 PHE A CA   3  
ATOM   9528   C  C    . PHE A 1 194 ? 10.361  6.097   6.930   1.00 15.00 ?  236 PHE A C    3  
ATOM   9529   O  O    . PHE A 1 194 ? 9.472   6.767   7.461   1.00 15.00 ?  236 PHE A O    3  
ATOM   9530   C  CB   . PHE A 1 194 ? 10.005  4.626   4.925   1.00 15.00 ?  236 PHE A CB   3  
ATOM   9531   C  CG   . PHE A 1 194 ? 8.760   4.123   5.597   1.00 15.00 ?  236 PHE A CG   3  
ATOM   9532   C  CD1  . PHE A 1 194 ? 7.570   4.827   5.500   1.00 15.00 ?  236 PHE A CD1  3  
ATOM   9533   C  CD2  . PHE A 1 194 ? 8.782   2.945   6.322   1.00 15.00 ?  236 PHE A CD2  3  
ATOM   9534   C  CE1  . PHE A 1 194 ? 6.426   4.362   6.116   1.00 15.00 ?  236 PHE A CE1  3  
ATOM   9535   C  CE2  . PHE A 1 194 ? 7.641   2.475   6.941   1.00 15.00 ?  236 PHE A CE2  3  
ATOM   9536   C  CZ   . PHE A 1 194 ? 6.461   3.186   6.837   1.00 15.00 ?  236 PHE A CZ   3  
ATOM   9537   H  H    . PHE A 1 194 ? 12.328  5.518   4.525   1.00 15.00 ?  236 PHE A H    3  
ATOM   9538   H  HA   . PHE A 1 194 ? 9.848   6.758   4.970   1.00 15.00 ?  236 PHE A HA   3  
ATOM   9539   H  HB2  . PHE A 1 194 ? 9.806   4.680   3.867   1.00 15.00 ?  236 PHE A HB2  3  
ATOM   9540   H  HB3  . PHE A 1 194 ? 10.793  3.905   5.100   1.00 15.00 ?  236 PHE A HB3  3  
ATOM   9541   H  HD1  . PHE A 1 194 ? 7.542   5.748   4.939   1.00 15.00 ?  236 PHE A HD1  3  
ATOM   9542   H  HD2  . PHE A 1 194 ? 9.705   2.390   6.403   1.00 15.00 ?  236 PHE A HD2  3  
ATOM   9543   H  HE1  . PHE A 1 194 ? 5.503   4.917   6.032   1.00 15.00 ?  236 PHE A HE1  3  
ATOM   9544   H  HE2  . PHE A 1 194 ? 7.672   1.554   7.505   1.00 15.00 ?  236 PHE A HE2  3  
ATOM   9545   H  HZ   . PHE A 1 194 ? 5.567   2.820   7.319   1.00 15.00 ?  236 PHE A HZ   3  
ATOM   9546   N  N    . GLY A 1 195 ? 11.289  5.447   7.619   1.00 15.00 ?  237 GLY A N    3  
ATOM   9547   C  CA   . GLY A 1 195 ? 11.289  5.468   9.065   1.00 15.00 ?  237 GLY A CA   3  
ATOM   9548   C  C    . GLY A 1 195 ? 11.541  6.853   9.616   1.00 15.00 ?  237 GLY A C    3  
ATOM   9549   O  O    . GLY A 1 195 ? 10.979  7.224   10.646  1.00 15.00 ?  237 GLY A O    3  
ATOM   9550   H  H    . GLY A 1 195 ? 11.981  4.947   7.140   1.00 15.00 ?  237 GLY A H    3  
ATOM   9551   H  HA2  . GLY A 1 195 ? 10.329  5.120   9.419   1.00 15.00 ?  237 GLY A HA2  3  
ATOM   9552   H  HA3  . GLY A 1 195 ? 12.059  4.803   9.425   1.00 15.00 ?  237 GLY A HA3  3  
ATOM   9553   N  N    . ALA A 1 196 ? 12.371  7.623   8.915   1.00 15.00 ?  238 ALA A N    3  
ATOM   9554   C  CA   . ALA A 1 196 ? 12.705  8.980   9.331   1.00 15.00 ?  238 ALA A CA   3  
ATOM   9555   C  C    . ALA A 1 196 ? 11.552  9.938   9.058   1.00 15.00 ?  238 ALA A C    3  
ATOM   9556   O  O    . ALA A 1 196 ? 11.438  10.986  9.699   1.00 15.00 ?  238 ALA A O    3  
ATOM   9557   C  CB   . ALA A 1 196 ? 13.969  9.458   8.627   1.00 15.00 ?  238 ALA A CB   3  
ATOM   9558   H  H    . ALA A 1 196 ? 12.777  7.264   8.093   1.00 15.00 ?  238 ALA A H    3  
ATOM   9559   H  HA   . ALA A 1 196 ? 12.900  8.961   10.395  1.00 15.00 ?  238 ALA A HA   3  
ATOM   9560   H  HB1  . ALA A 1 196 ? 13.811  9.449   7.560   1.00 15.00 ?  238 ALA A HB1  3  
ATOM   9561   H  HB2  . ALA A 1 196 ? 14.789  8.801   8.875   1.00 15.00 ?  238 ALA A HB2  3  
ATOM   9562   H  HB3  . ALA A 1 196 ? 14.205  10.463  8.948   1.00 15.00 ?  238 ALA A HB3  3  
ATOM   9563   N  N    . ALA A 1 197 ? 10.699  9.577   8.110   1.00 15.00 ?  239 ALA A N    3  
ATOM   9564   C  CA   . ALA A 1 197 ? 9.551   10.399  7.760   1.00 15.00 ?  239 ALA A CA   3  
ATOM   9565   C  C    . ALA A 1 197 ? 8.478   10.309  8.837   1.00 15.00 ?  239 ALA A C    3  
ATOM   9566   O  O    . ALA A 1 197 ? 7.883   11.318  9.226   1.00 15.00 ?  239 ALA A O    3  
ATOM   9567   C  CB   . ALA A 1 197 ? 8.987   9.981   6.411   1.00 15.00 ?  239 ALA A CB   3  
ATOM   9568   H  H    . ALA A 1 197 ? 10.848  8.733   7.627   1.00 15.00 ?  239 ALA A H    3  
ATOM   9569   H  HA   . ALA A 1 197 ? 9.886   11.423  7.682   1.00 15.00 ?  239 ALA A HA   3  
ATOM   9570   H  HB1  . ALA A 1 197 ? 8.276   10.721  6.071   1.00 15.00 ?  239 ALA A HB1  3  
ATOM   9571   H  HB2  . ALA A 1 197 ? 8.490   9.028   6.509   1.00 15.00 ?  239 ALA A HB2  3  
ATOM   9572   H  HB3  . ALA A 1 197 ? 9.793   9.898   5.693   1.00 15.00 ?  239 ALA A HB3  3  
ATOM   9573   N  N    . PHE A 1 198 ? 8.239   9.095   9.319   1.00 15.00 ?  240 PHE A N    3  
ATOM   9574   C  CA   . PHE A 1 198 ? 7.251   8.859   10.365  1.00 15.00 ?  240 PHE A CA   3  
ATOM   9575   C  C    . PHE A 1 198 ? 7.922   8.216   11.573  1.00 15.00 ?  240 PHE A C    3  
ATOM   9576   O  O    . PHE A 1 198 ? 7.884   6.995   11.736  1.00 15.00 ?  240 PHE A O    3  
ATOM   9577   C  CB   . PHE A 1 198 ? 6.118   7.962   9.854   1.00 15.00 ?  240 PHE A CB   3  
ATOM   9578   C  CG   . PHE A 1 198 ? 5.403   8.515   8.654   1.00 15.00 ?  240 PHE A CG   3  
ATOM   9579   C  CD1  . PHE A 1 198 ? 4.504   9.560   8.788   1.00 15.00 ?  240 PHE A CD1  3  
ATOM   9580   C  CD2  . PHE A 1 198 ? 5.633   7.991   7.392   1.00 15.00 ?  240 PHE A CD2  3  
ATOM   9581   C  CE1  . PHE A 1 198 ? 3.852   10.075  7.685   1.00 15.00 ?  240 PHE A CE1  3  
ATOM   9582   C  CE2  . PHE A 1 198 ? 4.984   8.500   6.286   1.00 15.00 ?  240 PHE A CE2  3  
ATOM   9583   C  CZ   . PHE A 1 198 ? 4.093   9.544   6.433   1.00 15.00 ?  240 PHE A CZ   3  
ATOM   9584   H  H    . PHE A 1 198 ? 8.748   8.334   8.965   1.00 15.00 ?  240 PHE A H    3  
ATOM   9585   H  HA   . PHE A 1 198 ? 6.844   9.817   10.658  1.00 15.00 ?  240 PHE A HA   3  
ATOM   9586   H  HB2  . PHE A 1 198 ? 6.527   7.000   9.585   1.00 15.00 ?  240 PHE A HB2  3  
ATOM   9587   H  HB3  . PHE A 1 198 ? 5.393   7.830   10.643  1.00 15.00 ?  240 PHE A HB3  3  
ATOM   9588   H  HD1  . PHE A 1 198 ? 4.319   9.977   9.766   1.00 15.00 ?  240 PHE A HD1  3  
ATOM   9589   H  HD2  . PHE A 1 198 ? 6.330   7.174   7.276   1.00 15.00 ?  240 PHE A HD2  3  
ATOM   9590   H  HE1  . PHE A 1 198 ? 3.153   10.888  7.802   1.00 15.00 ?  240 PHE A HE1  3  
ATOM   9591   H  HE2  . PHE A 1 198 ? 5.175   8.082   5.306   1.00 15.00 ?  240 PHE A HE2  3  
ATOM   9592   H  HZ   . PHE A 1 198 ? 3.585   9.943   5.568   1.00 15.00 ?  240 PHE A HZ   3  
ATOM   9593   N  N    . PRO A 1 199 ? 8.549   9.028   12.436  1.00 15.00 ?  241 PRO A N    3  
ATOM   9594   C  CA   . PRO A 1 199 ? 9.257   8.544   13.630  1.00 15.00 ?  241 PRO A CA   3  
ATOM   9595   C  C    . PRO A 1 199 ? 8.321   8.125   14.765  1.00 15.00 ?  241 PRO A C    3  
ATOM   9596   O  O    . PRO A 1 199 ? 8.727   7.406   15.680  1.00 15.00 ?  241 PRO A O    3  
ATOM   9597   C  CB   . PRO A 1 199 ? 10.095  9.758   14.069  1.00 15.00 ?  241 PRO A CB   3  
ATOM   9598   C  CG   . PRO A 1 199 ? 9.938   10.787  12.996  1.00 15.00 ?  241 PRO A CG   3  
ATOM   9599   C  CD   . PRO A 1 199 ? 8.636   10.488  12.323  1.00 15.00 ?  241 PRO A CD   3  
ATOM   9600   H  HA   . PRO A 1 199 ? 9.913   7.719   13.391  1.00 15.00 ?  241 PRO A HA   3  
ATOM   9601   H  HB2  . PRO A 1 199 ? 9.721   10.132  15.014  1.00 15.00 ?  241 PRO A HB2  3  
ATOM   9602   H  HB3  . PRO A 1 199 ? 11.131  9.478   14.164  1.00 15.00 ?  241 PRO A HB3  3  
ATOM   9603   H  HG2  . PRO A 1 199 ? 9.921   11.778  13.435  1.00 15.00 ?  241 PRO A HG2  3  
ATOM   9604   H  HG3  . PRO A 1 199 ? 10.746  10.703  12.285  1.00 15.00 ?  241 PRO A HG3  3  
ATOM   9605   H  HD2  . PRO A 1 199 ? 7.817   10.966  12.841  1.00 15.00 ?  241 PRO A HD2  3  
ATOM   9606   H  HD3  . PRO A 1 199 ? 8.665   10.795  11.287  1.00 15.00 ?  241 PRO A HD3  3  
ATOM   9607   N  N    . LYS A 1 200 ? 7.069   8.565   14.713  1.00 15.00 ?  242 LYS A N    3  
ATOM   9608   C  CA   . LYS A 1 200 ? 6.113   8.228   15.763  1.00 15.00 ?  242 LYS A CA   3  
ATOM   9609   C  C    . LYS A 1 200 ? 5.365   6.941   15.439  1.00 15.00 ?  242 LYS A C    3  
ATOM   9610   O  O    . LYS A 1 200 ? 4.774   6.315   16.319  1.00 15.00 ?  242 LYS A O    3  
ATOM   9611   C  CB   . LYS A 1 200 ? 5.123   9.378   15.980  1.00 15.00 ?  242 LYS A CB   3  
ATOM   9612   C  CG   . LYS A 1 200 ? 5.757   10.625  16.579  1.00 15.00 ?  242 LYS A CG   3  
ATOM   9613   C  CD   . LYS A 1 200 ? 6.062   10.449  18.058  1.00 15.00 ?  242 LYS A CD   3  
ATOM   9614   C  CE   . LYS A 1 200 ? 6.808   11.647  18.628  1.00 15.00 ?  242 LYS A CE   3  
ATOM   9615   N  NZ   . LYS A 1 200 ? 8.277   11.536  18.429  1.00 15.00 1  242 LYS A NZ   3  
ATOM   9616   H  H    . LYS A 1 200 ? 6.780   9.115   13.957  1.00 15.00 ?  242 LYS A H    3  
ATOM   9617   H  HA   . LYS A 1 200 ? 6.672   8.076   16.674  1.00 15.00 ?  242 LYS A HA   3  
ATOM   9618   H  HB2  . LYS A 1 200 ? 4.685   9.647   15.032  1.00 15.00 ?  242 LYS A HB2  3  
ATOM   9619   H  HB3  . LYS A 1 200 ? 4.337   9.047   16.645  1.00 15.00 ?  242 LYS A HB3  3  
ATOM   9620   H  HG2  . LYS A 1 200 ? 6.675   10.833  16.054  1.00 15.00 ?  242 LYS A HG2  3  
ATOM   9621   H  HG3  . LYS A 1 200 ? 5.074   11.452  16.459  1.00 15.00 ?  242 LYS A HG3  3  
ATOM   9622   H  HD2  . LYS A 1 200 ? 5.133   10.326  18.595  1.00 15.00 ?  242 LYS A HD2  3  
ATOM   9623   H  HD3  . LYS A 1 200 ? 6.670   9.565   18.185  1.00 15.00 ?  242 LYS A HD3  3  
ATOM   9624   H  HE2  . LYS A 1 200 ? 6.456   12.541  18.136  1.00 15.00 ?  242 LYS A HE2  3  
ATOM   9625   H  HE3  . LYS A 1 200 ? 6.602   11.715  19.687  1.00 15.00 ?  242 LYS A HE3  3  
ATOM   9626   H  HZ1  . LYS A 1 200 ? 8.528   11.766  17.445  1.00 15.00 ?  242 LYS A HZ1  3  
ATOM   9627   H  HZ2  . LYS A 1 200 ? 8.598   10.569  18.641  1.00 15.00 ?  242 LYS A HZ2  3  
ATOM   9628   H  HZ3  . LYS A 1 200 ? 8.772   12.195  19.063  1.00 15.00 ?  242 LYS A HZ3  3  
ATOM   9629   N  N    . ALA A 1 201 ? 5.395   6.548   14.175  1.00 15.00 ?  243 ALA A N    3  
ATOM   9630   C  CA   . ALA A 1 201 ? 4.727   5.335   13.738  1.00 15.00 ?  243 ALA A CA   3  
ATOM   9631   C  C    . ALA A 1 201 ? 5.369   4.109   14.371  1.00 15.00 ?  243 ALA A C    3  
ATOM   9632   O  O    . ALA A 1 201 ? 6.570   3.877   14.228  1.00 15.00 ?  243 ALA A O    3  
ATOM   9633   C  CB   . ALA A 1 201 ? 4.759   5.228   12.224  1.00 15.00 ?  243 ALA A CB   3  
ATOM   9634   H  H    . ALA A 1 201 ? 5.880   7.090   13.520  1.00 15.00 ?  243 ALA A H    3  
ATOM   9635   H  HA   . ALA A 1 201 ? 3.693   5.391   14.051  1.00 15.00 ?  243 ALA A HA   3  
ATOM   9636   H  HB1  . ALA A 1 201 ? 4.090   4.442   11.905  1.00 15.00 ?  243 ALA A HB1  3  
ATOM   9637   H  HB2  . ALA A 1 201 ? 5.765   4.997   11.901  1.00 15.00 ?  243 ALA A HB2  3  
ATOM   9638   H  HB3  . ALA A 1 201 ? 4.446   6.165   11.793  1.00 15.00 ?  243 ALA A HB3  3  
ATOM   9639   N  N    . SER A 1 202 ? 4.567   3.339   15.085  1.00 15.00 ?  244 SER A N    3  
ATOM   9640   C  CA   . SER A 1 202 ? 5.044   2.136   15.739  1.00 15.00 ?  244 SER A CA   3  
ATOM   9641   C  C    . SER A 1 202 ? 4.550   0.905   14.988  1.00 15.00 ?  244 SER A C    3  
ATOM   9642   O  O    . SER A 1 202 ? 5.236   -0.116  14.919  1.00 15.00 ?  244 SER A O    3  
ATOM   9643   C  CB   . SER A 1 202 ? 4.565   2.114   17.188  1.00 15.00 ?  244 SER A CB   3  
ATOM   9644   O  OG   . SER A 1 202 ? 4.683   3.404   17.765  1.00 15.00 ?  244 SER A OG   3  
ATOM   9645   H  H    . SER A 1 202 ? 3.619   3.582   15.167  1.00 15.00 ?  244 SER A H    3  
ATOM   9646   H  HA   . SER A 1 202 ? 6.121   2.149   15.720  1.00 15.00 ?  244 SER A HA   3  
ATOM   9647   H  HB2  . SER A 1 202 ? 3.528   1.813   17.216  1.00 15.00 ?  244 SER A HB2  3  
ATOM   9648   H  HB3  . SER A 1 202 ? 5.163   1.418   17.758  1.00 15.00 ?  244 SER A HB3  3  
ATOM   9649   H  HG   . SER A 1 202 ? 4.993   4.024   17.093  1.00 15.00 ?  244 SER A HG   3  
ATOM   9650   N  N    . MET A 1 203 ? 3.359   1.012   14.422  1.00 15.00 ?  245 MET A N    3  
ATOM   9651   C  CA   . MET A 1 203 ? 2.777   -0.082  13.664  1.00 15.00 ?  245 MET A CA   3  
ATOM   9652   C  C    . MET A 1 203 ? 3.086   0.090   12.181  1.00 15.00 ?  245 MET A C    3  
ATOM   9653   O  O    . MET A 1 203 ? 2.521   0.956   11.514  1.00 15.00 ?  245 MET A O    3  
ATOM   9654   C  CB   . MET A 1 203 ? 1.262   -0.142  13.873  1.00 15.00 ?  245 MET A CB   3  
ATOM   9655   C  CG   . MET A 1 203 ? 0.613   -1.367  13.244  1.00 15.00 ?  245 MET A CG   3  
ATOM   9656   S  SD   . MET A 1 203 ? -1.180  -1.224  13.095  1.00 15.00 ?  245 MET A SD   3  
ATOM   9657   C  CE   . MET A 1 203 ? -1.657  -0.989  14.805  1.00 15.00 ?  245 MET A CE   3  
ATOM   9658   H  H    . MET A 1 203 ? 2.856   1.854   14.512  1.00 15.00 ?  245 MET A H    3  
ATOM   9659   H  HA   . MET A 1 203 ? 3.220   -1.004  14.012  1.00 15.00 ?  245 MET A HA   3  
ATOM   9660   H  HB2  . MET A 1 203 ? 1.058   -0.157  14.932  1.00 15.00 ?  245 MET A HB2  3  
ATOM   9661   H  HB3  . MET A 1 203 ? 0.817   0.738   13.440  1.00 15.00 ?  245 MET A HB3  3  
ATOM   9662   H  HG2  . MET A 1 203 ? 1.029   -1.513  12.258  1.00 15.00 ?  245 MET A HG2  3  
ATOM   9663   H  HG3  . MET A 1 203 ? 0.840   -2.227  13.855  1.00 15.00 ?  245 MET A HG3  3  
ATOM   9664   H  HE1  . MET A 1 203 ? -1.280  -1.807  15.397  1.00 15.00 ?  245 MET A HE1  3  
ATOM   9665   H  HE2  . MET A 1 203 ? -2.737  -0.960  14.877  1.00 15.00 ?  245 MET A HE2  3  
ATOM   9666   H  HE3  . MET A 1 203 ? -1.244  -0.060  15.167  1.00 15.00 ?  245 MET A HE3  3  
ATOM   9667   N  N    . ILE A 1 204 ? 3.995   -0.725  11.677  1.00 15.00 ?  246 ILE A N    3  
ATOM   9668   C  CA   . ILE A 1 204 ? 4.379   -0.672  10.279  1.00 15.00 ?  246 ILE A CA   3  
ATOM   9669   C  C    . ILE A 1 204 ? 3.629   -1.738  9.488   1.00 15.00 ?  246 ILE A C    3  
ATOM   9670   O  O    . ILE A 1 204 ? 3.904   -2.933  9.611   1.00 15.00 ?  246 ILE A O    3  
ATOM   9671   C  CB   . ILE A 1 204 ? 5.899   -0.869  10.114  1.00 15.00 ?  246 ILE A CB   3  
ATOM   9672   C  CG1  . ILE A 1 204 ? 6.668   0.146   10.971  1.00 15.00 ?  246 ILE A CG1  3  
ATOM   9673   C  CG2  . ILE A 1 204 ? 6.301   -0.748  8.651   1.00 15.00 ?  246 ILE A CG2  3  
ATOM   9674   C  CD1  . ILE A 1 204 ? 6.342   1.591   10.658  1.00 15.00 ?  246 ILE A CD1  3  
ATOM   9675   H  H    . ILE A 1 204 ? 4.420   -1.394  12.262  1.00 15.00 ?  246 ILE A H    3  
ATOM   9676   H  HA   . ILE A 1 204 ? 4.114   0.302   9.892   1.00 15.00 ?  246 ILE A HA   3  
ATOM   9677   H  HB   . ILE A 1 204 ? 6.146   -1.867  10.445  1.00 15.00 ?  246 ILE A HB   3  
ATOM   9678   H  HG12 . ILE A 1 204 ? 6.442   -0.024  12.013  1.00 15.00 ?  246 ILE A HG12 3  
ATOM   9679   H  HG13 . ILE A 1 204 ? 7.725   0.007   10.811  1.00 15.00 ?  246 ILE A HG13 3  
ATOM   9680   H  HG21 . ILE A 1 204 ? 5.754   -1.474  8.065   1.00 15.00 ?  246 ILE A HG21 3  
ATOM   9681   H  HG22 . ILE A 1 204 ? 7.362   -0.930  8.553   1.00 15.00 ?  246 ILE A HG22 3  
ATOM   9682   H  HG23 . ILE A 1 204 ? 6.071   0.246   8.296   1.00 15.00 ?  246 ILE A HG23 3  
ATOM   9683   H  HD11 . ILE A 1 204 ? 5.296   1.774   10.852  1.00 15.00 ?  246 ILE A HD11 3  
ATOM   9684   H  HD12 . ILE A 1 204 ? 6.559   1.791   9.617   1.00 15.00 ?  246 ILE A HD12 3  
ATOM   9685   H  HD13 . ILE A 1 204 ? 6.943   2.236   11.282  1.00 15.00 ?  246 ILE A HD13 3  
ATOM   9686   N  N    . VAL A 1 205 ? 2.673   -1.295  8.688   1.00 15.00 ?  247 VAL A N    3  
ATOM   9687   C  CA   . VAL A 1 205 ? 1.872   -2.193  7.882   1.00 15.00 ?  247 VAL A CA   3  
ATOM   9688   C  C    . VAL A 1 205 ? 2.534   -2.446  6.535   1.00 15.00 ?  247 VAL A C    3  
ATOM   9689   O  O    . VAL A 1 205 ? 2.905   -1.509  5.821   1.00 15.00 ?  247 VAL A O    3  
ATOM   9690   C  CB   . VAL A 1 205 ? 0.453   -1.633  7.664   1.00 15.00 ?  247 VAL A CB   3  
ATOM   9691   C  CG1  . VAL A 1 205 ? -0.421  -2.652  6.953   1.00 15.00 ?  247 VAL A CG1  3  
ATOM   9692   C  CG2  . VAL A 1 205 ? -0.168  -1.230  8.992   1.00 15.00 ?  247 VAL A CG2  3  
ATOM   9693   H  H    . VAL A 1 205 ? 2.509   -0.326  8.631   1.00 15.00 ?  247 VAL A H    3  
ATOM   9694   H  HA   . VAL A 1 205 ? 1.786   -3.131  8.409   1.00 15.00 ?  247 VAL A HA   3  
ATOM   9695   H  HB   . VAL A 1 205 ? 0.524   -0.754  7.042   1.00 15.00 ?  247 VAL A HB   3  
ATOM   9696   H  HG11 . VAL A 1 205 ? 0.059   -2.955  6.035   1.00 15.00 ?  247 VAL A HG11 3  
ATOM   9697   H  HG12 . VAL A 1 205 ? -1.381  -2.211  6.729   1.00 15.00 ?  247 VAL A HG12 3  
ATOM   9698   H  HG13 . VAL A 1 205 ? -0.558  -3.513  7.589   1.00 15.00 ?  247 VAL A HG13 3  
ATOM   9699   H  HG21 . VAL A 1 205 ? -0.027  -2.023  9.712   1.00 15.00 ?  247 VAL A HG21 3  
ATOM   9700   H  HG22 . VAL A 1 205 ? -1.227  -1.050  8.857   1.00 15.00 ?  247 VAL A HG22 3  
ATOM   9701   H  HG23 . VAL A 1 205 ? 0.305   -0.329  9.352   1.00 15.00 ?  247 VAL A HG23 3  
ATOM   9702   N  N    . MET A 1 206 ? 2.689   -3.715  6.199   1.00 15.00 ?  248 MET A N    3  
ATOM   9703   C  CA   . MET A 1 206 ? 3.299   -4.109  4.942   1.00 15.00 ?  248 MET A CA   3  
ATOM   9704   C  C    . MET A 1 206 ? 2.291   -4.884  4.103   1.00 15.00 ?  248 MET A C    3  
ATOM   9705   O  O    . MET A 1 206 ? 1.283   -5.356  4.623   1.00 15.00 ?  248 MET A O    3  
ATOM   9706   C  CB   . MET A 1 206 ? 4.558   -4.938  5.194   1.00 15.00 ?  248 MET A CB   3  
ATOM   9707   C  CG   . MET A 1 206 ? 4.447   -5.869  6.391   1.00 15.00 ?  248 MET A CG   3  
ATOM   9708   S  SD   . MET A 1 206 ? 6.047   -6.281  7.102   1.00 15.00 ?  248 MET A SD   3  
ATOM   9709   C  CE   . MET A 1 206 ? 6.552   -4.683  7.732   1.00 15.00 ?  248 MET A CE   3  
ATOM   9710   H  H    . MET A 1 206 ? 2.378   -4.410  6.814   1.00 15.00 ?  248 MET A H    3  
ATOM   9711   H  HA   . MET A 1 206 ? 3.572   -3.207  4.413   1.00 15.00 ?  248 MET A HA   3  
ATOM   9712   H  HB2  . MET A 1 206 ? 4.757   -5.536  4.320   1.00 15.00 ?  248 MET A HB2  3  
ATOM   9713   H  HB3  . MET A 1 206 ? 5.390   -4.270  5.358   1.00 15.00 ?  248 MET A HB3  3  
ATOM   9714   H  HG2  . MET A 1 206 ? 3.849   -5.387  7.150   1.00 15.00 ?  248 MET A HG2  3  
ATOM   9715   H  HG3  . MET A 1 206 ? 3.962   -6.781  6.078   1.00 15.00 ?  248 MET A HG3  3  
ATOM   9716   H  HE1  . MET A 1 206 ? 7.434   -4.802  8.346   1.00 15.00 ?  248 MET A HE1  3  
ATOM   9717   H  HE2  . MET A 1 206 ? 5.753   -4.260  8.323   1.00 15.00 ?  248 MET A HE2  3  
ATOM   9718   H  HE3  . MET A 1 206 ? 6.778   -4.026  6.903   1.00 15.00 ?  248 MET A HE3  3  
ATOM   9719   N  N    . SER A 1 207 ? 2.569   -5.039  2.819   1.00 15.00 ?  249 SER A N    3  
ATOM   9720   C  CA   . SER A 1 207 ? 1.640   -5.719  1.927   1.00 15.00 ?  249 SER A CA   3  
ATOM   9721   C  C    . SER A 1 207 ? 1.843   -7.233  1.847   1.00 15.00 ?  249 SER A C    3  
ATOM   9722   O  O    . SER A 1 207 ? 0.921   -7.946  1.475   1.00 15.00 ?  249 SER A O    3  
ATOM   9723   C  CB   . SER A 1 207 ? 1.735   -5.113  0.531   1.00 15.00 ?  249 SER A CB   3  
ATOM   9724   O  OG   . SER A 1 207 ? 1.605   -3.704  0.593   1.00 15.00 ?  249 SER A OG   3  
ATOM   9725   H  H    . SER A 1 207 ? 3.415   -4.681  2.460   1.00 15.00 ?  249 SER A H    3  
ATOM   9726   H  HA   . SER A 1 207 ? 0.649   -5.535  2.301   1.00 15.00 ?  249 SER A HA   3  
ATOM   9727   H  HB2  . SER A 1 207 ? 2.693   -5.357  0.092   1.00 15.00 ?  249 SER A HB2  3  
ATOM   9728   H  HB3  . SER A 1 207 ? 0.942   -5.508  -0.088  1.00 15.00 ?  249 SER A HB3  3  
ATOM   9729   H  HG   . SER A 1 207 ? 1.483   -3.436  1.511   1.00 15.00 ?  249 SER A HG   3  
ATOM   9730   N  N    . HIS A 1 208 ? 3.019   -7.739  2.199   1.00 15.00 ?  250 HIS A N    3  
ATOM   9731   C  CA   . HIS A 1 208 ? 3.249   -9.182  2.082   1.00 15.00 ?  250 HIS A CA   3  
ATOM   9732   C  C    . HIS A 1 208 ? 3.516   -9.860  3.420   1.00 15.00 ?  250 HIS A C    3  
ATOM   9733   O  O    . HIS A 1 208 ? 3.820   -11.055 3.471   1.00 15.00 ?  250 HIS A O    3  
ATOM   9734   C  CB   . HIS A 1 208 ? 4.393   -9.458  1.112   1.00 15.00 ?  250 HIS A CB   3  
ATOM   9735   C  CG   . HIS A 1 208 ? 4.031   -9.171  -0.314  1.00 15.00 ?  250 HIS A CG   3  
ATOM   9736   N  ND1  . HIS A 1 208 ? 3.322   -10.038 -1.112  1.00 15.00 ?  250 HIS A ND1  3  
ATOM   9737   C  CD2  . HIS A 1 208 ? 4.267   -8.072  -1.073  1.00 15.00 ?  250 HIS A CD2  3  
ATOM   9738   C  CE1  . HIS A 1 208 ? 3.151   -9.458  -2.304  1.00 15.00 ?  250 HIS A CE1  3  
ATOM   9739   N  NE2  . HIS A 1 208 ? 3.707   -8.259  -2.334  1.00 15.00 ?  250 HIS A NE2  3  
ATOM   9740   H  H    . HIS A 1 208 ? 3.728   -7.152  2.540   1.00 15.00 ?  250 HIS A H    3  
ATOM   9741   H  HA   . HIS A 1 208 ? 2.348   -9.609  1.669   1.00 15.00 ?  250 HIS A HA   3  
ATOM   9742   H  HB2  . HIS A 1 208 ? 5.237   -8.840  1.375   1.00 15.00 ?  250 HIS A HB2  3  
ATOM   9743   H  HB3  . HIS A 1 208 ? 4.672   -10.498 1.182   1.00 15.00 ?  250 HIS A HB3  3  
ATOM   9744   H  HD1  . HIS A 1 208 ? 2.989   -10.923 -0.851  1.00 15.00 ?  250 HIS A HD1  3  
ATOM   9745   H  HD2  . HIS A 1 208 ? 4.807   -7.192  -0.761  1.00 15.00 ?  250 HIS A HD2  3  
ATOM   9746   H  HE1  . HIS A 1 208 ? 2.625   -9.910  -3.129  1.00 15.00 ?  250 HIS A HE1  3  
ATOM   9747   N  N    . SER A 1 209 ? 3.398   -9.105  4.493   1.00 15.00 ?  251 SER A N    3  
ATOM   9748   C  CA   . SER A 1 209 ? 3.612   -9.640  5.827   1.00 15.00 ?  251 SER A CA   3  
ATOM   9749   C  C    . SER A 1 209 ? 2.667   -8.965  6.810   1.00 15.00 ?  251 SER A C    3  
ATOM   9750   O  O    . SER A 1 209 ? 2.078   -7.928  6.494   1.00 15.00 ?  251 SER A O    3  
ATOM   9751   C  CB   . SER A 1 209 ? 5.061   -9.426  6.267   1.00 15.00 ?  251 SER A CB   3  
ATOM   9752   O  OG   . SER A 1 209 ? 5.972   -10.085 5.400   1.00 15.00 ?  251 SER A OG   3  
ATOM   9753   H  H    . SER A 1 209 ? 3.159   -8.164  4.392   1.00 15.00 ?  251 SER A H    3  
ATOM   9754   H  HA   . SER A 1 209 ? 3.397   -10.699 5.801   1.00 15.00 ?  251 SER A HA   3  
ATOM   9755   H  HB2  . SER A 1 209 ? 5.279   -8.368  6.260   1.00 15.00 ?  251 SER A HB2  3  
ATOM   9756   H  HB3  . SER A 1 209 ? 5.191   -9.810  7.268   1.00 15.00 ?  251 SER A HB3  3  
ATOM   9757   H  HG   . SER A 1 209 ? 6.838   -10.158 5.845   1.00 15.00 ?  251 SER A HG   3  
ATOM   9758   N  N    . ALA A 1 210 ? 2.517   -9.552  7.986   1.00 15.00 ?  252 ALA A N    3  
ATOM   9759   C  CA   . ALA A 1 210 ? 1.654   -8.992  9.011   1.00 15.00 ?  252 ALA A CA   3  
ATOM   9760   C  C    . ALA A 1 210 ? 2.259   -7.699  9.554   1.00 15.00 ?  252 ALA A C    3  
ATOM   9761   O  O    . ALA A 1 210 ? 3.472   -7.511  9.485   1.00 15.00 ?  252 ALA A O    3  
ATOM   9762   C  CB   . ALA A 1 210 ? 1.448   -10.008 10.122  1.00 15.00 ?  252 ALA A CB   3  
ATOM   9763   H  H    . ALA A 1 210 ? 3.001   -10.387 8.172   1.00 15.00 ?  252 ALA A H    3  
ATOM   9764   H  HA   . ALA A 1 210 ? 0.694   -8.778  8.560   1.00 15.00 ?  252 ALA A HA   3  
ATOM   9765   H  HB1  . ALA A 1 210 ? 0.857   -9.567  10.911  1.00 15.00 ?  252 ALA A HB1  3  
ATOM   9766   H  HB2  . ALA A 1 210 ? 2.406   -10.308 10.515  1.00 15.00 ?  252 ALA A HB2  3  
ATOM   9767   H  HB3  . ALA A 1 210 ? 0.938   -10.873 9.725   1.00 15.00 ?  252 ALA A HB3  3  
ATOM   9768   N  N    . PRO A 1 211 ? 1.426   -6.780  10.077  1.00 15.00 ?  253 PRO A N    3  
ATOM   9769   C  CA   . PRO A 1 211 ? 1.905   -5.510  10.628  1.00 15.00 ?  253 PRO A CA   3  
ATOM   9770   C  C    . PRO A 1 211 ? 2.952   -5.729  11.713  1.00 15.00 ?  253 PRO A C    3  
ATOM   9771   O  O    . PRO A 1 211 ? 2.664   -6.311  12.763  1.00 15.00 ?  253 PRO A O    3  
ATOM   9772   C  CB   . PRO A 1 211 ? 0.652   -4.868  11.224  1.00 15.00 ?  253 PRO A CB   3  
ATOM   9773   C  CG   . PRO A 1 211 ? -0.497  -5.528  10.547  1.00 15.00 ?  253 PRO A CG   3  
ATOM   9774   C  CD   . PRO A 1 211 ? -0.038  -6.911  10.173  1.00 15.00 ?  253 PRO A CD   3  
ATOM   9775   H  HA   . PRO A 1 211 ? 2.313   -4.872  9.857   1.00 15.00 ?  253 PRO A HA   3  
ATOM   9776   H  HB2  . PRO A 1 211 ? 0.628   -5.044  12.293  1.00 15.00 ?  253 PRO A HB2  3  
ATOM   9777   H  HB3  . PRO A 1 211 ? 0.645   -3.809  11.021  1.00 15.00 ?  253 PRO A HB3  3  
ATOM   9778   H  HG2  . PRO A 1 211 ? -1.340  -5.581  11.224  1.00 15.00 ?  253 PRO A HG2  3  
ATOM   9779   H  HG3  . PRO A 1 211 ? -0.764  -4.978  9.658   1.00 15.00 ?  253 PRO A HG3  3  
ATOM   9780   H  HD2  . PRO A 1 211 ? -0.310  -7.617  10.942  1.00 15.00 ?  253 PRO A HD2  3  
ATOM   9781   H  HD3  . PRO A 1 211 ? -0.459  -7.207  9.222   1.00 15.00 ?  253 PRO A HD3  3  
ATOM   9782   N  N    . ASP A 1 212 ? 4.160   -5.258  11.459  1.00 15.00 ?  254 ASP A N    3  
ATOM   9783   C  CA   . ASP A 1 212 ? 5.256   -5.411  12.403  1.00 15.00 ?  254 ASP A CA   3  
ATOM   9784   C  C    . ASP A 1 212 ? 5.572   -4.077  13.069  1.00 15.00 ?  254 ASP A C    3  
ATOM   9785   O  O    . ASP A 1 212 ? 4.884   -3.082  12.838  1.00 15.00 ?  254 ASP A O    3  
ATOM   9786   C  CB   . ASP A 1 212 ? 6.493   -5.952  11.677  1.00 15.00 ?  254 ASP A CB   3  
ATOM   9787   C  CG   . ASP A 1 212 ? 7.437   -6.705  12.594  1.00 15.00 ?  254 ASP A CG   3  
ATOM   9788   O  OD1  . ASP A 1 212 ? 7.189   -6.734  13.822  1.00 15.00 ?  254 ASP A OD1  3  
ATOM   9789   O  OD2  . ASP A 1 212 ? 8.433   -7.271  12.092  1.00 15.00 -1 254 ASP A OD2  3  
ATOM   9790   H  H    . ASP A 1 212 ? 4.321   -4.784  10.611  1.00 15.00 ?  254 ASP A H    3  
ATOM   9791   H  HA   . ASP A 1 212 ? 4.952   -6.119  13.159  1.00 15.00 ?  254 ASP A HA   3  
ATOM   9792   H  HB2  . ASP A 1 212 ? 6.174   -6.624  10.896  1.00 15.00 ?  254 ASP A HB2  3  
ATOM   9793   H  HB3  . ASP A 1 212 ? 7.033   -5.128  11.236  1.00 15.00 ?  254 ASP A HB3  3  
ATOM   9794   N  N    . SER A 1 213 ? 6.583   -4.066  13.923  1.00 15.00 ?  255 SER A N    3  
ATOM   9795   C  CA   . SER A 1 213 ? 6.997   -2.853  14.610  1.00 15.00 ?  255 SER A CA   3  
ATOM   9796   C  C    . SER A 1 213 ? 8.064   -2.126  13.789  1.00 15.00 ?  255 SER A C    3  
ATOM   9797   O  O    . SER A 1 213 ? 8.286   -2.456  12.621  1.00 15.00 ?  255 SER A O    3  
ATOM   9798   C  CB   . SER A 1 213 ? 7.530   -3.200  16.000  1.00 15.00 ?  255 SER A CB   3  
ATOM   9799   O  OG   . SER A 1 213 ? 6.630   -4.054  16.688  1.00 15.00 ?  255 SER A OG   3  
ATOM   9800   H  H    . SER A 1 213 ? 7.071   -4.907  14.094  1.00 15.00 ?  255 SER A H    3  
ATOM   9801   H  HA   . SER A 1 213 ? 6.135   -2.212  14.708  1.00 15.00 ?  255 SER A HA   3  
ATOM   9802   H  HB2  . SER A 1 213 ? 8.481   -3.701  15.905  1.00 15.00 ?  255 SER A HB2  3  
ATOM   9803   H  HB3  . SER A 1 213 ? 7.655   -2.293  16.573  1.00 15.00 ?  255 SER A HB3  3  
ATOM   9804   H  HG   . SER A 1 213 ? 5.834   -4.173  16.158  1.00 15.00 ?  255 SER A HG   3  
ATOM   9805   N  N    . ARG A 1 214 ? 8.741   -1.157  14.398  1.00 15.00 ?  256 ARG A N    3  
ATOM   9806   C  CA   . ARG A 1 214 ? 9.774   -0.400  13.697  1.00 15.00 ?  256 ARG A CA   3  
ATOM   9807   C  C    . ARG A 1 214 ? 10.997  -1.265  13.435  1.00 15.00 ?  256 ARG A C    3  
ATOM   9808   O  O    . ARG A 1 214 ? 11.841  -0.919  12.611  1.00 15.00 ?  256 ARG A O    3  
ATOM   9809   C  CB   . ARG A 1 214 ? 10.170  0.845   14.486  1.00 15.00 ?  256 ARG A CB   3  
ATOM   9810   C  CG   . ARG A 1 214 ? 9.069   1.883   14.566  1.00 15.00 ?  256 ARG A CG   3  
ATOM   9811   C  CD   . ARG A 1 214 ? 9.553   3.163   15.234  1.00 15.00 ?  256 ARG A CD   3  
ATOM   9812   N  NE   . ARG A 1 214 ? 10.486  3.915   14.392  1.00 15.00 ?  256 ARG A NE   3  
ATOM   9813   C  CZ   . ARG A 1 214 ? 10.114  4.781   13.451  1.00 15.00 ?  256 ARG A CZ   3  
ATOM   9814   N  NH1  . ARG A 1 214 ? 8.827   5.004   13.219  1.00 15.00 1  256 ARG A NH1  3  
ATOM   9815   N  NH2  . ARG A 1 214 ? 11.036  5.431   12.743  1.00 15.00 ?  256 ARG A NH2  3  
ATOM   9816   H  H    . ARG A 1 214 ? 8.547   -0.951  15.340  1.00 15.00 ?  256 ARG A H    3  
ATOM   9817   H  HA   . ARG A 1 214 ? 9.362   -0.090  12.747  1.00 15.00 ?  256 ARG A HA   3  
ATOM   9818   H  HB2  . ARG A 1 214 ? 10.435  0.555   15.490  1.00 15.00 ?  256 ARG A HB2  3  
ATOM   9819   H  HB3  . ARG A 1 214 ? 11.028  1.299   14.013  1.00 15.00 ?  256 ARG A HB3  3  
ATOM   9820   H  HG2  . ARG A 1 214 ? 8.734   2.113   13.567  1.00 15.00 ?  256 ARG A HG2  3  
ATOM   9821   H  HG3  . ARG A 1 214 ? 8.243   1.477   15.137  1.00 15.00 ?  256 ARG A HG3  3  
ATOM   9822   H  HD2  . ARG A 1 214 ? 8.699   3.787   15.446  1.00 15.00 ?  256 ARG A HD2  3  
ATOM   9823   H  HD3  . ARG A 1 214 ? 10.049  2.904   16.159  1.00 15.00 ?  256 ARG A HD3  3  
ATOM   9824   H  HE   . ARG A 1 214 ? 11.447  3.765   14.542  1.00 15.00 ?  256 ARG A HE   3  
ATOM   9825   H  HH11 . ARG A 1 214 ? 8.532   5.686   12.482  1.00 15.00 ?  256 ARG A HH11 3  
ATOM   9826   H  HH12 . ARG A 1 214 ? 8.095   4.496   13.773  1.00 15.00 ?  256 ARG A HH12 3  
ATOM   9827   H  HH21 . ARG A 1 214 ? 10.750  6.116   12.004  1.00 15.00 ?  256 ARG A HH21 3  
ATOM   9828   H  HH22 . ARG A 1 214 ? 12.051  5.264   12.923  1.00 15.00 ?  256 ARG A HH22 3  
ATOM   9829   N  N    . ALA A 1 215 ? 11.076  -2.398  14.127  1.00 15.00 ?  257 ALA A N    3  
ATOM   9830   C  CA   . ALA A 1 215 ? 12.191  -3.326  13.958  1.00 15.00 ?  257 ALA A CA   3  
ATOM   9831   C  C    . ALA A 1 215 ? 12.235  -3.851  12.526  1.00 15.00 ?  257 ALA A C    3  
ATOM   9832   O  O    . ALA A 1 215 ? 13.296  -4.217  12.014  1.00 15.00 ?  257 ALA A O    3  
ATOM   9833   C  CB   . ALA A 1 215 ? 12.080  -4.479  14.943  1.00 15.00 ?  257 ALA A CB   3  
ATOM   9834   H  H    . ALA A 1 215 ? 10.373  -2.610  14.773  1.00 15.00 ?  257 ALA A H    3  
ATOM   9835   H  HA   . ALA A 1 215 ? 13.104  -2.789  14.166  1.00 15.00 ?  257 ALA A HA   3  
ATOM   9836   H  HB1  . ALA A 1 215 ? 12.987  -5.062  14.914  1.00 15.00 ?  257 ALA A HB1  3  
ATOM   9837   H  HB2  . ALA A 1 215 ? 11.242  -5.103  14.676  1.00 15.00 ?  257 ALA A HB2  3  
ATOM   9838   H  HB3  . ALA A 1 215 ? 11.935  -4.089  15.939  1.00 15.00 ?  257 ALA A HB3  3  
ATOM   9839   N  N    . ALA A 1 216 ? 11.072  -3.883  11.893  1.00 15.00 ?  258 ALA A N    3  
ATOM   9840   C  CA   . ALA A 1 216 ? 10.947  -4.338  10.518  1.00 15.00 ?  258 ALA A CA   3  
ATOM   9841   C  C    . ALA A 1 216 ? 11.682  -3.397  9.571   1.00 15.00 ?  258 ALA A C    3  
ATOM   9842   O  O    . ALA A 1 216 ? 12.352  -3.837  8.636   1.00 15.00 ?  258 ALA A O    3  
ATOM   9843   C  CB   . ALA A 1 216 ? 9.480   -4.423  10.145  1.00 15.00 ?  258 ALA A CB   3  
ATOM   9844   H  H    . ALA A 1 216 ? 10.263  -3.591  12.369  1.00 15.00 ?  258 ALA A H    3  
ATOM   9845   H  HA   . ALA A 1 216 ? 11.377  -5.329  10.443  1.00 15.00 ?  258 ALA A HA   3  
ATOM   9846   H  HB1  . ALA A 1 216 ? 9.010   -3.465  10.319  1.00 15.00 ?  258 ALA A HB1  3  
ATOM   9847   H  HB2  . ALA A 1 216 ? 8.998   -5.177  10.751  1.00 15.00 ?  258 ALA A HB2  3  
ATOM   9848   H  HB3  . ALA A 1 216 ? 9.388   -4.685  9.100   1.00 15.00 ?  258 ALA A HB3  3  
ATOM   9849   N  N    . ILE A 1 217 ? 11.572  -2.097  9.839   1.00 15.00 ?  259 ILE A N    3  
ATOM   9850   C  CA   . ILE A 1 217 ? 12.225  -1.086  9.014   1.00 15.00 ?  259 ILE A CA   3  
ATOM   9851   C  C    . ILE A 1 217 ? 13.739  -1.264  9.066   1.00 15.00 ?  259 ILE A C    3  
ATOM   9852   O  O    . ILE A 1 217 ? 14.412  -1.299  8.035   1.00 15.00 ?  259 ILE A O    3  
ATOM   9853   C  CB   . ILE A 1 217 ? 11.871  0.345   9.474   1.00 15.00 ?  259 ILE A CB   3  
ATOM   9854   C  CG1  . ILE A 1 217 ? 10.352  0.546   9.487   1.00 15.00 ?  259 ILE A CG1  3  
ATOM   9855   C  CG2  . ILE A 1 217 ? 12.539  1.381   8.580   1.00 15.00 ?  259 ILE A CG2  3  
ATOM   9856   C  CD1  . ILE A 1 217 ? 9.931   1.901   10.007  1.00 15.00 ?  259 ILE A CD1  3  
ATOM   9857   H  H    . ILE A 1 217 ? 11.045  -1.813  10.618  1.00 15.00 ?  259 ILE A H    3  
ATOM   9858   H  HA   . ILE A 1 217 ? 11.887  -1.213  7.999   1.00 15.00 ?  259 ILE A HA   3  
ATOM   9859   H  HB   . ILE A 1 217 ? 12.249  0.477   10.478  1.00 15.00 ?  259 ILE A HB   3  
ATOM   9860   H  HG12 . ILE A 1 217 ? 9.972   0.445   8.481   1.00 15.00 ?  259 ILE A HG12 3  
ATOM   9861   H  HG13 . ILE A 1 217 ? 9.900   -0.208  10.114  1.00 15.00 ?  259 ILE A HG13 3  
ATOM   9862   H  HG21 . ILE A 1 217 ? 13.612  1.263   8.634   1.00 15.00 ?  259 ILE A HG21 3  
ATOM   9863   H  HG22 . ILE A 1 217 ? 12.268  2.373   8.911   1.00 15.00 ?  259 ILE A HG22 3  
ATOM   9864   H  HG23 . ILE A 1 217 ? 12.212  1.241   7.559   1.00 15.00 ?  259 ILE A HG23 3  
ATOM   9865   H  HD11 . ILE A 1 217 ? 8.855   1.933   10.094  1.00 15.00 ?  259 ILE A HD11 3  
ATOM   9866   H  HD12 . ILE A 1 217 ? 10.261  2.669   9.322   1.00 15.00 ?  259 ILE A HD12 3  
ATOM   9867   H  HD13 . ILE A 1 217 ? 10.377  2.069   10.975  1.00 15.00 ?  259 ILE A HD13 3  
ATOM   9868   N  N    . THR A 1 218 ? 14.261  -1.405  10.278  1.00 15.00 ?  260 THR A N    3  
ATOM   9869   C  CA   . THR A 1 218 ? 15.687  -1.588  10.486  1.00 15.00 ?  260 THR A CA   3  
ATOM   9870   C  C    . THR A 1 218 ? 16.171  -2.876  9.828   1.00 15.00 ?  260 THR A C    3  
ATOM   9871   O  O    . THR A 1 218 ? 17.236  -2.904  9.209   1.00 15.00 ?  260 THR A O    3  
ATOM   9872   C  CB   . THR A 1 218 ? 16.023  -1.613  11.987  1.00 15.00 ?  260 THR A CB   3  
ATOM   9873   O  OG1  . THR A 1 218 ? 14.818  -1.494  12.755  1.00 15.00 ?  260 THR A OG1  3  
ATOM   9874   C  CG2  . THR A 1 218 ? 16.967  -0.478  12.345  1.00 15.00 ?  260 THR A CG2  3  
ATOM   9875   H  H    . THR A 1 218 ? 13.669  -1.384  11.062  1.00 15.00 ?  260 THR A H    3  
ATOM   9876   H  HA   . THR A 1 218 ? 16.201  -0.751  10.034  1.00 15.00 ?  260 THR A HA   3  
ATOM   9877   H  HB   . THR A 1 218 ? 16.500  -2.551  12.219  1.00 15.00 ?  260 THR A HB   3  
ATOM   9878   H  HG1  . THR A 1 218 ? 14.765  -2.218  13.386  1.00 15.00 ?  260 THR A HG1  3  
ATOM   9879   H  HG21 . THR A 1 218 ? 17.918  -0.636  11.861  1.00 15.00 ?  260 THR A HG21 3  
ATOM   9880   H  HG22 . THR A 1 218 ? 17.106  -0.449  13.416  1.00 15.00 ?  260 THR A HG22 3  
ATOM   9881   H  HG23 . THR A 1 218 ? 16.548  0.458   12.008  1.00 15.00 ?  260 THR A HG23 3  
ATOM   9882   N  N    . HIS A 1 219 ? 15.381  -3.939  9.956   1.00 15.00 ?  261 HIS A N    3  
ATOM   9883   C  CA   . HIS A 1 219 ? 15.727  -5.226  9.364   1.00 15.00 ?  261 HIS A CA   3  
ATOM   9884   C  C    . HIS A 1 219 ? 15.801  -5.107  7.841   1.00 15.00 ?  261 HIS A C    3  
ATOM   9885   O  O    . HIS A 1 219 ? 16.746  -5.590  7.215   1.00 15.00 ?  261 HIS A O    3  
ATOM   9886   C  CB   . HIS A 1 219 ? 14.705  -6.290  9.774   1.00 15.00 ?  261 HIS A CB   3  
ATOM   9887   C  CG   . HIS A 1 219 ? 15.060  -7.673  9.323   1.00 15.00 ?  261 HIS A CG   3  
ATOM   9888   N  ND1  . HIS A 1 219 ? 16.134  -8.352  9.854   1.00 15.00 ?  261 HIS A ND1  3  
ATOM   9889   C  CD2  . HIS A 1 219 ? 14.462  -8.452  8.391   1.00 15.00 ?  261 HIS A CD2  3  
ATOM   9890   C  CE1  . HIS A 1 219 ? 16.165  -9.521  9.233   1.00 15.00 ?  261 HIS A CE1  3  
ATOM   9891   N  NE2  . HIS A 1 219 ? 15.174  -9.622  8.340   1.00 15.00 ?  261 HIS A NE2  3  
ATOM   9892   H  H    . HIS A 1 219 ? 14.552  -3.859  10.473  1.00 15.00 ?  261 HIS A H    3  
ATOM   9893   H  HA   . HIS A 1 219 ? 16.699  -5.512  9.738   1.00 15.00 ?  261 HIS A HA   3  
ATOM   9894   H  HB2  . HIS A 1 219 ? 14.624  -6.303  10.850  1.00 15.00 ?  261 HIS A HB2  3  
ATOM   9895   H  HB3  . HIS A 1 219 ? 13.745  -6.038  9.347   1.00 15.00 ?  261 HIS A HB3  3  
ATOM   9896   H  HD2  . HIS A 1 219 ? 13.590  -8.204  7.804   1.00 15.00 ?  261 HIS A HD2  3  
ATOM   9897   H  HE1  . HIS A 1 219 ? 16.898  -10.292 9.417   1.00 15.00 ?  261 HIS A HE1  3  
ATOM   9898   H  HE2  . HIS A 1 219 ? 14.995  -10.388 7.747   1.00 15.00 ?  261 HIS A HE2  3  
ATOM   9899   N  N    . THR A 1 220 ? 14.814  -4.436  7.259   1.00 15.00 ?  262 THR A N    3  
ATOM   9900   C  CA   . THR A 1 220 ? 14.770  -4.243  5.819   1.00 15.00 ?  262 THR A CA   3  
ATOM   9901   C  C    . THR A 1 220 ? 15.967  -3.415  5.351   1.00 15.00 ?  262 THR A C    3  
ATOM   9902   O  O    . THR A 1 220 ? 16.633  -3.759  4.368   1.00 15.00 ?  262 THR A O    3  
ATOM   9903   C  CB   . THR A 1 220 ? 13.467  -3.540  5.390   1.00 15.00 ?  262 THR A CB   3  
ATOM   9904   O  OG1  . THR A 1 220 ? 12.333  -4.247  5.913   1.00 15.00 ?  262 THR A OG1  3  
ATOM   9905   C  CG2  . THR A 1 220 ? 13.367  -3.462  3.875   1.00 15.00 ?  262 THR A CG2  3  
ATOM   9906   H  H    . THR A 1 220 ? 14.095  -4.062  7.814   1.00 15.00 ?  262 THR A H    3  
ATOM   9907   H  HA   . THR A 1 220 ? 14.806  -5.215  5.347   1.00 15.00 ?  262 THR A HA   3  
ATOM   9908   H  HB   . THR A 1 220 ? 13.474  -2.534  5.789   1.00 15.00 ?  262 THR A HB   3  
ATOM   9909   H  HG1  . THR A 1 220 ? 12.311  -4.161  6.878   1.00 15.00 ?  262 THR A HG1  3  
ATOM   9910   H  HG21 . THR A 1 220 ? 12.524  -2.848  3.601   1.00 15.00 ?  262 THR A HG21 3  
ATOM   9911   H  HG22 . THR A 1 220 ? 13.237  -4.452  3.471   1.00 15.00 ?  262 THR A HG22 3  
ATOM   9912   H  HG23 . THR A 1 220 ? 14.272  -3.032  3.476   1.00 15.00 ?  262 THR A HG23 3  
ATOM   9913   N  N    . ALA A 1 221 ? 16.248  -2.336  6.080   1.00 15.00 ?  263 ALA A N    3  
ATOM   9914   C  CA   . ALA A 1 221 ? 17.360  -1.453  5.755   1.00 15.00 ?  263 ALA A CA   3  
ATOM   9915   C  C    . ALA A 1 221 ? 18.694  -2.185  5.854   1.00 15.00 ?  263 ALA A C    3  
ATOM   9916   O  O    . ALA A 1 221 ? 19.614  -1.921  5.082   1.00 15.00 ?  263 ALA A O    3  
ATOM   9917   C  CB   . ALA A 1 221 ? 17.345  -0.231  6.665   1.00 15.00 ?  263 ALA A CB   3  
ATOM   9918   H  H    . ALA A 1 221 ? 15.685  -2.128  6.860   1.00 15.00 ?  263 ALA A H    3  
ATOM   9919   H  HA   . ALA A 1 221 ? 17.226  -1.114  4.738   1.00 15.00 ?  263 ALA A HA   3  
ATOM   9920   H  HB1  . ALA A 1 221 ? 18.187  0.404   6.436   1.00 15.00 ?  263 ALA A HB1  3  
ATOM   9921   H  HB2  . ALA A 1 221 ? 17.401  -0.549  7.696   1.00 15.00 ?  263 ALA A HB2  3  
ATOM   9922   H  HB3  . ALA A 1 221 ? 16.428  0.320   6.509   1.00 15.00 ?  263 ALA A HB3  3  
ATOM   9923   N  N    . ARG A 1 222 ? 18.789  -3.109  6.804   1.00 15.00 ?  264 ARG A N    3  
ATOM   9924   C  CA   . ARG A 1 222 ? 20.010  -3.883  6.999   1.00 15.00 ?  264 ARG A CA   3  
ATOM   9925   C  C    . ARG A 1 222 ? 20.171  -4.917  5.888   1.00 15.00 ?  264 ARG A C    3  
ATOM   9926   O  O    . ARG A 1 222 ? 21.266  -5.108  5.364   1.00 15.00 ?  264 ARG A O    3  
ATOM   9927   C  CB   . ARG A 1 222 ? 19.998  -4.568  8.371   1.00 15.00 ?  264 ARG A CB   3  
ATOM   9928   C  CG   . ARG A 1 222 ? 20.282  -3.625  9.524   1.00 15.00 ?  264 ARG A CG   3  
ATOM   9929   C  CD   . ARG A 1 222 ? 20.134  -4.334  10.854  1.00 15.00 ?  264 ARG A CD   3  
ATOM   9930   N  NE   . ARG A 1 222 ? 19.987  -3.387  11.961  1.00 15.00 ?  264 ARG A NE   3  
ATOM   9931   C  CZ   . ARG A 1 222 ? 19.353  -3.661  13.102  1.00 15.00 ?  264 ARG A CZ   3  
ATOM   9932   N  NH1  . ARG A 1 222 ? 18.815  -4.859  13.286  1.00 15.00 1  264 ARG A NH1  3  
ATOM   9933   N  NH2  . ARG A 1 222 ? 19.246  -2.730  14.049  1.00 15.00 ?  264 ARG A NH2  3  
ATOM   9934   H  H    . ARG A 1 222 ? 18.020  -3.276  7.391   1.00 15.00 ?  264 ARG A H    3  
ATOM   9935   H  HA   . ARG A 1 222 ? 20.843  -3.201  6.957   1.00 15.00 ?  264 ARG A HA   3  
ATOM   9936   H  HB2  . ARG A 1 222 ? 19.025  -5.005  8.534   1.00 15.00 ?  264 ARG A HB2  3  
ATOM   9937   H  HB3  . ARG A 1 222 ? 20.745  -5.351  8.382   1.00 15.00 ?  264 ARG A HB3  3  
ATOM   9938   H  HG2  . ARG A 1 222 ? 21.290  -3.248  9.438   1.00 15.00 ?  264 ARG A HG2  3  
ATOM   9939   H  HG3  . ARG A 1 222 ? 19.582  -2.803  9.487   1.00 15.00 ?  264 ARG A HG3  3  
ATOM   9940   H  HD2  . ARG A 1 222 ? 19.259  -4.966  10.812  1.00 15.00 ?  264 ARG A HD2  3  
ATOM   9941   H  HD3  . ARG A 1 222 ? 21.007  -4.944  11.025  1.00 15.00 ?  264 ARG A HD3  3  
ATOM   9942   H  HE   . ARG A 1 222 ? 20.392  -2.497  11.844  1.00 15.00 ?  264 ARG A HE   3  
ATOM   9943   H  HH11 . ARG A 1 222 ? 18.316  -5.086  14.171  1.00 15.00 ?  264 ARG A HH11 3  
ATOM   9944   H  HH12 . ARG A 1 222 ? 18.892  -5.585  12.539  1.00 15.00 ?  264 ARG A HH12 3  
ATOM   9945   H  HH21 . ARG A 1 222 ? 19.656  -1.782  13.900  1.00 15.00 ?  264 ARG A HH21 3  
ATOM   9946   H  HH22 . ARG A 1 222 ? 18.753  -2.941  14.947  1.00 15.00 ?  264 ARG A HH22 3  
ATOM   9947   N  N    . MET A 1 223 ? 19.069  -5.559  5.513   1.00 15.00 ?  265 MET A N    3  
ATOM   9948   C  CA   . MET A 1 223 ? 19.089  -6.566  4.457   1.00 15.00 ?  265 MET A CA   3  
ATOM   9949   C  C    . MET A 1 223 ? 19.577  -5.963  3.151   1.00 15.00 ?  265 MET A C    3  
ATOM   9950   O  O    . MET A 1 223 ? 20.502  -6.478  2.526   1.00 15.00 ?  265 MET A O    3  
ATOM   9951   C  CB   . MET A 1 223 ? 17.697  -7.174  4.255   1.00 15.00 ?  265 MET A CB   3  
ATOM   9952   C  CG   . MET A 1 223 ? 17.350  -8.259  5.266   1.00 15.00 ?  265 MET A CG   3  
ATOM   9953   S  SD   . MET A 1 223 ? 16.008  -9.330  4.714   1.00 15.00 ?  265 MET A SD   3  
ATOM   9954   C  CE   . MET A 1 223 ? 14.658  -8.164  4.682   1.00 15.00 ?  265 MET A CE   3  
ATOM   9955   H  H    . MET A 1 223 ? 18.219  -5.348  5.958   1.00 15.00 ?  265 MET A H    3  
ATOM   9956   H  HA   . MET A 1 223 ? 19.773  -7.344  4.753   1.00 15.00 ?  265 MET A HA   3  
ATOM   9957   H  HB2  . MET A 1 223 ? 16.959  -6.388  4.337   1.00 15.00 ?  265 MET A HB2  3  
ATOM   9958   H  HB3  . MET A 1 223 ? 17.645  -7.599  3.265   1.00 15.00 ?  265 MET A HB3  3  
ATOM   9959   H  HG2  . MET A 1 223 ? 18.225  -8.866  5.440   1.00 15.00 ?  265 MET A HG2  3  
ATOM   9960   H  HG3  . MET A 1 223 ? 17.054  -7.785  6.191   1.00 15.00 ?  265 MET A HG3  3  
ATOM   9961   H  HE1  . MET A 1 223 ? 14.377  -7.919  5.694   1.00 15.00 ?  265 MET A HE1  3  
ATOM   9962   H  HE2  . MET A 1 223 ? 13.814  -8.599  4.167   1.00 15.00 ?  265 MET A HE2  3  
ATOM   9963   H  HE3  . MET A 1 223 ? 14.970  -7.269  4.169   1.00 15.00 ?  265 MET A HE3  3  
ATOM   9964   N  N    . ALA A 1 224 ? 18.974  -4.846  2.765   1.00 15.00 ?  266 ALA A N    3  
ATOM   9965   C  CA   . ALA A 1 224 ? 19.334  -4.169  1.530   1.00 15.00 ?  266 ALA A CA   3  
ATOM   9966   C  C    . ALA A 1 224 ? 20.758  -3.625  1.570   1.00 15.00 ?  266 ALA A C    3  
ATOM   9967   O  O    . ALA A 1 224 ? 21.382  -3.414  0.530   1.00 15.00 ?  266 ALA A O    3  
ATOM   9968   C  CB   . ALA A 1 224 ? 18.347  -3.054  1.253   1.00 15.00 ?  266 ALA A CB   3  
ATOM   9969   H  H    . ALA A 1 224 ? 18.265  -4.465  3.331   1.00 15.00 ?  266 ALA A H    3  
ATOM   9970   H  HA   . ALA A 1 224 ? 19.258  -4.885  0.726   1.00 15.00 ?  266 ALA A HA   3  
ATOM   9971   H  HB1  . ALA A 1 224 ? 18.328  -2.371  2.090   1.00 15.00 ?  266 ALA A HB1  3  
ATOM   9972   H  HB2  . ALA A 1 224 ? 17.364  -3.474  1.103   1.00 15.00 ?  266 ALA A HB2  3  
ATOM   9973   H  HB3  . ALA A 1 224 ? 18.651  -2.524  0.366   1.00 15.00 ?  266 ALA A HB3  3  
ATOM   9974   N  N    . ASP A 1 225 ? 21.272  -3.409  2.770   1.00 15.00 ?  267 ASP A N    3  
ATOM   9975   C  CA   . ASP A 1 225 ? 22.620  -2.887  2.940   1.00 15.00 ?  267 ASP A CA   3  
ATOM   9976   C  C    . ASP A 1 225 ? 23.655  -3.994  2.744   1.00 15.00 ?  267 ASP A C    3  
ATOM   9977   O  O    . ASP A 1 225 ? 24.804  -3.729  2.399   1.00 15.00 ?  267 ASP A O    3  
ATOM   9978   C  CB   . ASP A 1 225 ? 22.775  -2.260  4.329   1.00 15.00 ?  267 ASP A CB   3  
ATOM   9979   C  CG   . ASP A 1 225 ? 23.631  -1.012  4.317   1.00 15.00 ?  267 ASP A CG   3  
ATOM   9980   O  OD1  . ASP A 1 225 ? 24.870  -1.128  4.184   1.00 15.00 ?  267 ASP A OD1  3  
ATOM   9981   O  OD2  . ASP A 1 225 ? 23.072  0.097   4.464   1.00 15.00 -1 267 ASP A OD2  3  
ATOM   9982   H  H    . ASP A 1 225 ? 20.729  -3.608  3.565   1.00 15.00 ?  267 ASP A H    3  
ATOM   9983   H  HA   . ASP A 1 225 ? 22.779  -2.130  2.188   1.00 15.00 ?  267 ASP A HA   3  
ATOM   9984   H  HB2  . ASP A 1 225 ? 21.798  -1.996  4.707   1.00 15.00 ?  267 ASP A HB2  3  
ATOM   9985   H  HB3  . ASP A 1 225 ? 23.228  -2.981  4.995   1.00 15.00 ?  267 ASP A HB3  3  
ATOM   9986   N  N    . LYS A 1 226 ? 23.229  -5.240  2.943   1.00 15.00 ?  268 LYS A N    3  
ATOM   9987   C  CA   . LYS A 1 226 ? 24.118  -6.389  2.803   1.00 15.00 ?  268 LYS A CA   3  
ATOM   9988   C  C    . LYS A 1 226 ? 24.194  -6.880  1.363   1.00 15.00 ?  268 LYS A C    3  
ATOM   9989   O  O    . LYS A 1 226 ? 25.030  -7.721  1.036   1.00 15.00 ?  268 LYS A O    3  
ATOM   9990   C  CB   . LYS A 1 226 ? 23.650  -7.532  3.699   1.00 15.00 ?  268 LYS A CB   3  
ATOM   9991   C  CG   . LYS A 1 226 ? 23.821  -7.264  5.184   1.00 15.00 ?  268 LYS A CG   3  
ATOM   9992   C  CD   . LYS A 1 226 ? 23.278  -8.416  6.013   1.00 15.00 ?  268 LYS A CD   3  
ATOM   9993   C  CE   . LYS A 1 226 ? 21.777  -8.577  5.834   1.00 15.00 ?  268 LYS A CE   3  
ATOM   9994   N  NZ   . LYS A 1 226 ? 21.197  -9.521  6.824   1.00 15.00 1  268 LYS A NZ   3  
ATOM   9995   H  H    . LYS A 1 226 ? 22.294  -5.390  3.196   1.00 15.00 ?  268 LYS A H    3  
ATOM   9996   H  HA   . LYS A 1 226 ? 25.103  -6.083  3.118   1.00 15.00 ?  268 LYS A HA   3  
ATOM   9997   H  HB2  . LYS A 1 226 ? 22.602  -7.711  3.508   1.00 15.00 ?  268 LYS A HB2  3  
ATOM   9998   H  HB3  . LYS A 1 226 ? 24.209  -8.421  3.451   1.00 15.00 ?  268 LYS A HB3  3  
ATOM   9999   H  HG2  . LYS A 1 226 ? 24.872  -7.139  5.404   1.00 15.00 ?  268 LYS A HG2  3  
ATOM   10000  H  HG3  . LYS A 1 226 ? 23.286  -6.362  5.445   1.00 15.00 ?  268 LYS A HG3  3  
ATOM   10001  H  HD2  . LYS A 1 226 ? 23.765  -9.326  5.704   1.00 15.00 ?  268 LYS A HD2  3  
ATOM   10002  H  HD3  . LYS A 1 226 ? 23.492  -8.232  7.054   1.00 15.00 ?  268 LYS A HD3  3  
ATOM   10003  H  HE2  . LYS A 1 226 ? 21.308  -7.611  5.955   1.00 15.00 ?  268 LYS A HE2  3  
ATOM   10004  H  HE3  . LYS A 1 226 ? 21.584  -8.947  4.837   1.00 15.00 ?  268 LYS A HE3  3  
ATOM   10005  H  HZ1  . LYS A 1 226 ? 20.185  -9.673  6.628   1.00 15.00 ?  268 LYS A HZ1  3  
ATOM   10006  H  HZ2  . LYS A 1 226 ? 21.297  -9.135  7.785   1.00 15.00 ?  268 LYS A HZ2  3  
ATOM   10007  H  HZ3  . LYS A 1 226 ? 21.687  -10.433 6.780   1.00 15.00 ?  268 LYS A HZ3  3  
ATOM   10008  N  N    . LEU A 1 227 ? 23.318  -6.380  0.509   1.00 15.00 ?  269 LEU A N    3  
ATOM   10009  C  CA   . LEU A 1 227 ? 23.320  -6.787  -0.887  1.00 15.00 ?  269 LEU A CA   3  
ATOM   10010  C  C    . LEU A 1 227 ? 24.380  -6.009  -1.656  1.00 15.00 ?  269 LEU A C    3  
ATOM   10011  O  O    . LEU A 1 227 ? 25.527  -6.501  -1.756  1.00 15.00 ?  269 LEU A O    3  
ATOM   10012  C  CB   . LEU A 1 227 ? 21.939  -6.586  -1.516  1.00 15.00 ?  269 LEU A CB   3  
ATOM   10013  C  CG   . LEU A 1 227 ? 21.043  -7.830  -1.524  1.00 15.00 ?  269 LEU A CG   3  
ATOM   10014  C  CD1  . LEU A 1 227 ? 20.561  -8.170  -0.123  1.00 15.00 ?  269 LEU A CD1  3  
ATOM   10015  C  CD2  . LEU A 1 227 ? 19.858  -7.620  -2.447  1.00 15.00 ?  269 LEU A CD2  3  
ATOM   10016  O  OXT  . LEU A 1 227 ? 24.075  -4.901  -2.137  1.00 15.00 -1 269 LEU A OXT  3  
ATOM   10017  H  H    . LEU A 1 227 ? 22.663  -5.718  0.819   1.00 15.00 ?  269 LEU A H    3  
ATOM   10018  H  HA   . LEU A 1 227 ? 23.570  -7.838  -0.922  1.00 15.00 ?  269 LEU A HA   3  
ATOM   10019  H  HB2  . LEU A 1 227 ? 21.431  -5.803  -0.971  1.00 15.00 ?  269 LEU A HB2  3  
ATOM   10020  H  HB3  . LEU A 1 227 ? 22.074  -6.260  -2.537  1.00 15.00 ?  269 LEU A HB3  3  
ATOM   10021  H  HG   . LEU A 1 227 ? 21.608  -8.671  -1.895  1.00 15.00 ?  269 LEU A HG   3  
ATOM   10022  H  HD11 . LEU A 1 227 ? 21.412  -8.273  0.535   1.00 15.00 ?  269 LEU A HD11 3  
ATOM   10023  H  HD12 . LEU A 1 227 ? 20.007  -9.100  -0.148  1.00 15.00 ?  269 LEU A HD12 3  
ATOM   10024  H  HD13 . LEU A 1 227 ? 19.920  -7.378  0.237   1.00 15.00 ?  269 LEU A HD13 3  
ATOM   10025  H  HD21 . LEU A 1 227 ? 19.312  -6.743  -2.136  1.00 15.00 ?  269 LEU A HD21 3  
ATOM   10026  H  HD22 . LEU A 1 227 ? 19.211  -8.483  -2.399  1.00 15.00 ?  269 LEU A HD22 3  
ATOM   10027  H  HD23 . LEU A 1 227 ? 20.207  -7.486  -3.460  1.00 15.00 ?  269 LEU A HD23 3  
HETATM 10028  ZN ZN   . ZN  B 2 .   ? 5.830   -3.958  -6.509  1.00 15.00 ?  301 ZN  A ZN   3  
HETATM 10029  ZN ZN   . ZN  C 2 .   ? 3.062   -6.578  -2.805  1.00 15.00 ?  302 ZN  A ZN   3  
HETATM 10030  O  OAB  . MRI D 3 .   ? 2.912   -7.566  -7.626  1.00 15.00 ?  303 MRI A OAB  3  
HETATM 10031  C  CAM  . MRI D 3 .   ? 3.896   -7.837  -8.524  1.00 15.00 ?  303 MRI A CAM  3  
HETATM 10032  C  CAN  . MRI D 3 .   ? 3.658   -7.696  -9.887  1.00 15.00 ?  303 MRI A CAN  3  
HETATM 10033  O  OAD  . MRI D 3 .   ? 2.527   -7.429  -10.298 1.00 15.00 ?  303 MRI A OAD  3  
HETATM 10034  C  CAI  . MRI D 3 .   ? 4.720   -7.890  -10.758 1.00 15.00 ?  303 MRI A CAI  3  
HETATM 10035  C  CAO  . MRI D 3 .   ? 4.632   -7.488  -12.089 1.00 15.00 ?  303 MRI A CAO  3  
HETATM 10036  O  OAC  . MRI D 3 .   ? 3.488   -6.952  -12.584 1.00 15.00 ?  303 MRI A OAC  3  
HETATM 10037  C  CAS  . MRI D 3 .   ? 5.733   -7.632  -12.922 1.00 15.00 ?  303 MRI A CAS  3  
HETATM 10038  C  CAR  . MRI D 3 .   ? 6.916   -8.169  -12.433 1.00 15.00 ?  303 MRI A CAR  3  
HETATM 10039  O  OAF  . MRI D 3 .   ? 7.992   -8.299  -13.254 1.00 15.00 ?  303 MRI A OAF  3  
HETATM 10040  C  CAP  . MRI D 3 .   ? 6.994   -8.566  -11.106 1.00 15.00 ?  303 MRI A CAP  3  
HETATM 10041  C  CAJ  . MRI D 3 .   ? 5.896   -8.432  -10.266 1.00 15.00 ?  303 MRI A CAJ  3  
HETATM 10042  O  OAA  . MRI D 3 .   ? 5.986   -8.887  -8.985  1.00 15.00 ?  303 MRI A OAA  3  
HETATM 10043  C  CAK  . MRI D 3 .   ? 5.155   -8.257  -8.111  1.00 15.00 ?  303 MRI A CAK  3  
HETATM 10044  C  CAL  . MRI D 3 .   ? 5.561   -8.071  -6.795  1.00 15.00 ?  303 MRI A CAL  3  
HETATM 10045  C  CAT  . MRI D 3 .   ? 6.405   -8.995  -6.194  1.00 15.00 ?  303 MRI A CAT  3  
HETATM 10046  C  CAV  . MRI D 3 .   ? 6.780   -8.839  -4.864  1.00 15.00 ?  303 MRI A CAV  3  
HETATM 10047  C  CAW  . MRI D 3 .   ? 6.309   -7.753  -4.133  1.00 15.00 ?  303 MRI A CAW  3  
HETATM 10048  O  OAG  . MRI D 3 .   ? 6.678   -7.591  -2.835  1.00 15.00 ?  303 MRI A OAG  3  
HETATM 10049  C  CAU  . MRI D 3 .   ? 5.470   -6.822  -4.737  1.00 15.00 ?  303 MRI A CAU  3  
HETATM 10050  C  CAQ  . MRI D 3 .   ? 5.098   -6.982  -6.067  1.00 15.00 ?  303 MRI A CAQ  3  
HETATM 10051  O  OAE  . MRI D 3 .   ? 4.309   -6.049  -6.658  1.00 15.00 ?  303 MRI A OAE  3  
HETATM 10052  H  H1   . MRI D 3 .   ? 3.238   -7.747  -6.700  1.00 15.00 ?  303 MRI A H1   3  
HETATM 10053  H  H2   . MRI D 3 .   ? 2.797   -6.892  -11.864 1.00 15.00 ?  303 MRI A H2   3  
HETATM 10054  H  H4   . MRI D 3 .   ? 7.762   -7.961  -14.165 1.00 15.00 ?  303 MRI A H4   3  
HETATM 10055  H  H8   . MRI D 3 .   ? 7.290   -8.336  -2.566  1.00 15.00 ?  303 MRI A H8   3  
HETATM 10056  H  H10  . MRI D 3 .   ? 4.083   -5.332  -6.002  1.00 15.00 ?  303 MRI A H10  3  
ATOM   10057  N  N    . ASP A 1 1   ? -9.774  -12.853 12.429  1.00 15.00 ?  43  ASP A N    4  
ATOM   10058  C  CA   . ASP A 1 1   ? -9.806  -12.392 11.048  1.00 15.00 ?  43  ASP A CA   4  
ATOM   10059  C  C    . ASP A 1 1   ? -11.184 -12.635 10.446  1.00 15.00 ?  43  ASP A C    4  
ATOM   10060  O  O    . ASP A 1 1   ? -11.842 -13.633 10.758  1.00 15.00 ?  43  ASP A O    4  
ATOM   10061  C  CB   . ASP A 1 1   ? -8.728  -13.094 10.215  1.00 15.00 ?  43  ASP A CB   4  
ATOM   10062  C  CG   . ASP A 1 1   ? -7.318  -12.782 10.685  1.00 15.00 ?  43  ASP A CG   4  
ATOM   10063  O  OD1  . ASP A 1 1   ? -6.916  -11.598 10.679  1.00 15.00 ?  43  ASP A OD1  4  
ATOM   10064  O  OD2  . ASP A 1 1   ? -6.593  -13.728 11.067  1.00 15.00 -1 43  ASP A OD2  4  
ATOM   10065  H  H1   . ASP A 1 1   ? -9.660  -13.811 12.608  1.00 15.00 ?  43  ASP A H1   4  
ATOM   10066  H  HA   . ASP A 1 1   ? -9.612  -11.332 11.050  1.00 15.00 ?  43  ASP A HA   4  
ATOM   10067  H  HB2  . ASP A 1 1   ? -8.876  -14.161 10.280  1.00 15.00 ?  43  ASP A HB2  4  
ATOM   10068  H  HB3  . ASP A 1 1   ? -8.822  -12.786 9.185   1.00 15.00 ?  43  ASP A HB3  4  
ATOM   10069  N  N    . GLN A 1 2   ? -11.621 -11.729 9.586   1.00 15.00 ?  44  GLN A N    4  
ATOM   10070  C  CA   . GLN A 1 2   ? -12.932 -11.830 8.959   1.00 15.00 ?  44  GLN A CA   4  
ATOM   10071  C  C    . GLN A 1 2   ? -12.818 -12.266 7.502   1.00 15.00 ?  44  GLN A C    4  
ATOM   10072  O  O    . GLN A 1 2   ? -12.220 -11.573 6.684   1.00 15.00 ?  44  GLN A O    4  
ATOM   10073  C  CB   . GLN A 1 2   ? -13.651 -10.480 9.049   1.00 15.00 ?  44  GLN A CB   4  
ATOM   10074  C  CG   . GLN A 1 2   ? -15.121 -10.522 8.663   1.00 15.00 ?  44  GLN A CG   4  
ATOM   10075  C  CD   . GLN A 1 2   ? -15.818 -9.192  8.887   1.00 15.00 ?  44  GLN A CD   4  
ATOM   10076  O  OE1  . GLN A 1 2   ? -15.418 -8.402  9.743   1.00 15.00 ?  44  GLN A OE1  4  
ATOM   10077  N  NE2  . GLN A 1 2   ? -16.865 -8.935  8.122   1.00 15.00 ?  44  GLN A NE2  4  
ATOM   10078  H  H    . GLN A 1 2   ? -11.043 -10.963 9.360   1.00 15.00 ?  44  GLN A H    4  
ATOM   10079  H  HA   . GLN A 1 2   ? -13.501 -12.569 9.499   1.00 15.00 ?  44  GLN A HA   4  
ATOM   10080  H  HB2  . GLN A 1 2   ? -13.580 -10.118 10.063  1.00 15.00 ?  44  GLN A HB2  4  
ATOM   10081  H  HB3  . GLN A 1 2   ? -13.154 -9.781  8.395   1.00 15.00 ?  44  GLN A HB3  4  
ATOM   10082  H  HG2  . GLN A 1 2   ? -15.200 -10.781 7.618   1.00 15.00 ?  44  GLN A HG2  4  
ATOM   10083  H  HG3  . GLN A 1 2   ? -15.616 -11.274 9.258   1.00 15.00 ?  44  GLN A HG3  4  
ATOM   10084  H  HE21 . GLN A 1 2   ? -17.134 -9.612  7.459   1.00 15.00 ?  44  GLN A HE21 4  
ATOM   10085  H  HE22 . GLN A 1 2   ? -17.340 -8.084  8.254   1.00 15.00 ?  44  GLN A HE22 4  
ATOM   10086  N  N    . ARG A 1 3   ? -13.395 -13.419 7.188   1.00 15.00 ?  45  ARG A N    4  
ATOM   10087  C  CA   . ARG A 1 3   ? -13.368 -13.944 5.830   1.00 15.00 ?  45  ARG A CA   4  
ATOM   10088  C  C    . ARG A 1 3   ? -14.547 -13.408 5.033   1.00 15.00 ?  45  ARG A C    4  
ATOM   10089  O  O    . ARG A 1 3   ? -15.690 -13.816 5.248   1.00 15.00 ?  45  ARG A O    4  
ATOM   10090  C  CB   . ARG A 1 3   ? -13.402 -15.476 5.824   1.00 15.00 ?  45  ARG A CB   4  
ATOM   10091  C  CG   . ARG A 1 3   ? -12.132 -16.127 6.341   1.00 15.00 ?  45  ARG A CG   4  
ATOM   10092  C  CD   . ARG A 1 3   ? -12.119 -17.620 6.052   1.00 15.00 ?  45  ARG A CD   4  
ATOM   10093  N  NE   . ARG A 1 3   ? -10.787 -18.194 6.195   1.00 15.00 ?  45  ARG A NE   4  
ATOM   10094  C  CZ   . ARG A 1 3   ? -10.364 -19.260 5.522   1.00 15.00 ?  45  ARG A CZ   4  
ATOM   10095  N  NH1  . ARG A 1 3   ? -11.164 -19.873 4.656   1.00 15.00 1  45  ARG A NH1  4  
ATOM   10096  N  NH2  . ARG A 1 3   ? -9.137  -19.715 5.712   1.00 15.00 ?  45  ARG A NH2  4  
ATOM   10097  H  H    . ARG A 1 3   ? -13.860 -13.929 7.888   1.00 15.00 ?  45  ARG A H    4  
ATOM   10098  H  HA   . ARG A 1 3   ? -12.454 -13.612 5.363   1.00 15.00 ?  45  ARG A HA   4  
ATOM   10099  H  HB2  . ARG A 1 3   ? -14.227 -15.809 6.436   1.00 15.00 ?  45  ARG A HB2  4  
ATOM   10100  H  HB3  . ARG A 1 3   ? -13.564 -15.815 4.810   1.00 15.00 ?  45  ARG A HB3  4  
ATOM   10101  H  HG2  . ARG A 1 3   ? -11.283 -15.669 5.858   1.00 15.00 ?  45  ARG A HG2  4  
ATOM   10102  H  HG3  . ARG A 1 3   ? -12.069 -15.973 7.409   1.00 15.00 ?  45  ARG A HG3  4  
ATOM   10103  H  HD2  . ARG A 1 3   ? -12.789 -18.114 6.739   1.00 15.00 ?  45  ARG A HD2  4  
ATOM   10104  H  HD3  . ARG A 1 3   ? -12.462 -17.781 5.040   1.00 15.00 ?  45  ARG A HD3  4  
ATOM   10105  H  HE   . ARG A 1 3   ? -10.172 -17.755 6.826   1.00 15.00 ?  45  ARG A HE   4  
ATOM   10106  H  HH11 . ARG A 1 3   ? -10.821 -20.709 4.132   1.00 15.00 ?  45  ARG A HH11 4  
ATOM   10107  H  HH12 . ARG A 1 3   ? -12.135 -19.528 4.496   1.00 15.00 ?  45  ARG A HH12 4  
ATOM   10108  H  HH21 . ARG A 1 3   ? -8.803  -20.552 5.184   1.00 15.00 ?  45  ARG A HH21 4  
ATOM   10109  H  HH22 . ARG A 1 3   ? -8.498  -19.240 6.385   1.00 15.00 ?  45  ARG A HH22 4  
ATOM   10110  N  N    . PHE A 1 4   ? -14.270 -12.483 4.131   1.00 15.00 ?  46  PHE A N    4  
ATOM   10111  C  CA   . PHE A 1 4   ? -15.302 -11.904 3.292   1.00 15.00 ?  46  PHE A CA   4  
ATOM   10112  C  C    . PHE A 1 4   ? -15.135 -12.389 1.858   1.00 15.00 ?  46  PHE A C    4  
ATOM   10113  O  O    . PHE A 1 4   ? -14.421 -11.781 1.055   1.00 15.00 ?  46  PHE A O    4  
ATOM   10114  C  CB   . PHE A 1 4   ? -15.258 -10.375 3.354   1.00 15.00 ?  46  PHE A CB   4  
ATOM   10115  C  CG   . PHE A 1 4   ? -16.471 -9.717  2.763   1.00 15.00 ?  46  PHE A CG   4  
ATOM   10116  C  CD1  . PHE A 1 4   ? -16.418 -9.149  1.502   1.00 15.00 ?  46  PHE A CD1  4  
ATOM   10117  C  CD2  . PHE A 1 4   ? -17.661 -9.666  3.472   1.00 15.00 ?  46  PHE A CD2  4  
ATOM   10118  C  CE1  . PHE A 1 4   ? -17.532 -8.543  0.953   1.00 15.00 ?  46  PHE A CE1  4  
ATOM   10119  C  CE2  . PHE A 1 4   ? -18.780 -9.060  2.929   1.00 15.00 ?  46  PHE A CE2  4  
ATOM   10120  C  CZ   . PHE A 1 4   ? -18.715 -8.498  1.667   1.00 15.00 ?  46  PHE A CZ   4  
ATOM   10121  H  H    . PHE A 1 4   ? -13.338 -12.184 4.019   1.00 15.00 ?  46  PHE A H    4  
ATOM   10122  H  HA   . PHE A 1 4   ? -16.259 -12.246 3.661   1.00 15.00 ?  46  PHE A HA   4  
ATOM   10123  H  HB2  . PHE A 1 4   ? -15.182 -10.066 4.387   1.00 15.00 ?  46  PHE A HB2  4  
ATOM   10124  H  HB3  . PHE A 1 4   ? -14.391 -10.024 2.814   1.00 15.00 ?  46  PHE A HB3  4  
ATOM   10125  H  HD1  . PHE A 1 4   ? -15.491 -9.186  0.944   1.00 15.00 ?  46  PHE A HD1  4  
ATOM   10126  H  HD2  . PHE A 1 4   ? -17.713 -10.105 4.458   1.00 15.00 ?  46  PHE A HD2  4  
ATOM   10127  H  HE1  . PHE A 1 4   ? -17.476 -8.105  -0.032  1.00 15.00 ?  46  PHE A HE1  4  
ATOM   10128  H  HE2  . PHE A 1 4   ? -19.702 -9.028  3.490   1.00 15.00 ?  46  PHE A HE2  4  
ATOM   10129  H  HZ   . PHE A 1 4   ? -19.590 -8.027  1.240   1.00 15.00 ?  46  PHE A HZ   4  
ATOM   10130  N  N    . GLY A 1 5   ? -15.767 -13.513 1.558   1.00 15.00 ?  47  GLY A N    4  
ATOM   10131  C  CA   . GLY A 1 5   ? -15.696 -14.078 0.228   1.00 15.00 ?  47  GLY A CA   4  
ATOM   10132  C  C    . GLY A 1 5   ? -14.338 -14.677 -0.069  1.00 15.00 ?  47  GLY A C    4  
ATOM   10133  O  O    . GLY A 1 5   ? -14.080 -15.840 0.243   1.00 15.00 ?  47  GLY A O    4  
ATOM   10134  H  H    . GLY A 1 5   ? -16.290 -13.966 2.251   1.00 15.00 ?  47  GLY A H    4  
ATOM   10135  H  HA2  . GLY A 1 5   ? -16.448 -14.848 0.136   1.00 15.00 ?  47  GLY A HA2  4  
ATOM   10136  H  HA3  . GLY A 1 5   ? -15.901 -13.303 -0.497  1.00 15.00 ?  47  GLY A HA3  4  
ATOM   10137  N  N    . ASP A 1 6   ? -13.460 -13.878 -0.654  1.00 15.00 ?  48  ASP A N    4  
ATOM   10138  C  CA   . ASP A 1 6   ? -12.118 -14.336 -1.002  1.00 15.00 ?  48  ASP A CA   4  
ATOM   10139  C  C    . ASP A 1 6   ? -11.054 -13.539 -0.264  1.00 15.00 ?  48  ASP A C    4  
ATOM   10140  O  O    . ASP A 1 6   ? -9.876  -13.901 -0.276  1.00 15.00 ?  48  ASP A O    4  
ATOM   10141  C  CB   . ASP A 1 6   ? -11.874 -14.210 -2.515  1.00 15.00 ?  48  ASP A CB   4  
ATOM   10142  C  CG   . ASP A 1 6   ? -12.831 -15.039 -3.346  1.00 15.00 ?  48  ASP A CG   4  
ATOM   10143  O  OD1  . ASP A 1 6   ? -12.596 -16.257 -3.500  1.00 15.00 ?  48  ASP A OD1  4  
ATOM   10144  O  OD2  . ASP A 1 6   ? -13.819 -14.471 -3.860  1.00 15.00 -1 48  ASP A OD2  4  
ATOM   10145  H  H    . ASP A 1 6   ? -13.719 -12.953 -0.855  1.00 15.00 ?  48  ASP A H    4  
ATOM   10146  H  HA   . ASP A 1 6   ? -12.034 -15.373 -0.719  1.00 15.00 ?  48  ASP A HA   4  
ATOM   10147  H  HB2  . ASP A 1 6   ? -11.983 -13.177 -2.806  1.00 15.00 ?  48  ASP A HB2  4  
ATOM   10148  H  HB3  . ASP A 1 6   ? -10.867 -14.532 -2.737  1.00 15.00 ?  48  ASP A HB3  4  
ATOM   10149  N  N    . LEU A 1 7   ? -11.465 -12.465 0.392   1.00 15.00 ?  49  LEU A N    4  
ATOM   10150  C  CA   . LEU A 1 7   ? -10.521 -11.614 1.102   1.00 15.00 ?  49  LEU A CA   4  
ATOM   10151  C  C    . LEU A 1 7   ? -10.696 -11.714 2.605   1.00 15.00 ?  49  LEU A C    4  
ATOM   10152  O  O    . LEU A 1 7   ? -11.780 -12.012 3.105   1.00 15.00 ?  49  LEU A O    4  
ATOM   10153  C  CB   . LEU A 1 7   ? -10.678 -10.158 0.665   1.00 15.00 ?  49  LEU A CB   4  
ATOM   10154  C  CG   . LEU A 1 7   ? -10.384 -9.888  -0.808  1.00 15.00 ?  49  LEU A CG   4  
ATOM   10155  C  CD1  . LEU A 1 7   ? -11.651 -10.021 -1.639  1.00 15.00 ?  49  LEU A CD1  4  
ATOM   10156  C  CD2  . LEU A 1 7   ? -9.769  -8.509  -0.974  1.00 15.00 ?  49  LEU A CD2  4  
ATOM   10157  H  H    . LEU A 1 7   ? -12.422 -12.246 0.416   1.00 15.00 ?  49  LEU A H    4  
ATOM   10158  H  HA   . LEU A 1 7   ? -9.523  -11.943 0.849   1.00 15.00 ?  49  LEU A HA   4  
ATOM   10159  H  HB2  . LEU A 1 7   ? -11.694 -9.855  0.869   1.00 15.00 ?  49  LEU A HB2  4  
ATOM   10160  H  HB3  . LEU A 1 7   ? -10.012 -9.549  1.259   1.00 15.00 ?  49  LEU A HB3  4  
ATOM   10161  H  HG   . LEU A 1 7   ? -9.671  -10.618 -1.164  1.00 15.00 ?  49  LEU A HG   4  
ATOM   10162  H  HD11 . LEU A 1 7   ? -12.236 -9.118  -1.547  1.00 15.00 ?  49  LEU A HD11 4  
ATOM   10163  H  HD12 . LEU A 1 7   ? -12.228 -10.861 -1.282  1.00 15.00 ?  49  LEU A HD12 4  
ATOM   10164  H  HD13 . LEU A 1 7   ? -11.391 -10.176 -2.675  1.00 15.00 ?  49  LEU A HD13 4  
ATOM   10165  H  HD21 . LEU A 1 7   ? -10.413 -7.772  -0.516  1.00 15.00 ?  49  LEU A HD21 4  
ATOM   10166  H  HD22 . LEU A 1 7   ? -9.659  -8.288  -2.023  1.00 15.00 ?  49  LEU A HD22 4  
ATOM   10167  H  HD23 . LEU A 1 7   ? -8.802  -8.487  -0.498  1.00 15.00 ?  49  LEU A HD23 4  
ATOM   10168  N  N    . VAL A 1 8   ? -9.613  -11.468 3.316   1.00 15.00 ?  50  VAL A N    4  
ATOM   10169  C  CA   . VAL A 1 8   ? -9.626  -11.503 4.765   1.00 15.00 ?  50  VAL A CA   4  
ATOM   10170  C  C    . VAL A 1 8   ? -9.463  -10.091 5.306   1.00 15.00 ?  50  VAL A C    4  
ATOM   10171  O  O    . VAL A 1 8   ? -8.561  -9.366  4.899   1.00 15.00 ?  50  VAL A O    4  
ATOM   10172  C  CB   . VAL A 1 8   ? -8.507  -12.415 5.321   1.00 15.00 ?  50  VAL A CB   4  
ATOM   10173  C  CG1  . VAL A 1 8   ? -8.529  -12.439 6.843   1.00 15.00 ?  50  VAL A CG1  4  
ATOM   10174  C  CG2  . VAL A 1 8   ? -8.636  -13.824 4.756   1.00 15.00 ?  50  VAL A CG2  4  
ATOM   10175  H  H    . VAL A 1 8   ? -8.775  -11.247 2.850   1.00 15.00 ?  50  VAL A H    4  
ATOM   10176  H  HA   . VAL A 1 8   ? -10.582 -11.895 5.081   1.00 15.00 ?  50  VAL A HA   4  
ATOM   10177  H  HB   . VAL A 1 8   ? -7.557  -12.013 5.007   1.00 15.00 ?  50  VAL A HB   4  
ATOM   10178  H  HG11 . VAL A 1 8   ? -9.504  -12.755 7.187   1.00 15.00 ?  50  VAL A HG11 4  
ATOM   10179  H  HG12 . VAL A 1 8   ? -8.317  -11.451 7.222   1.00 15.00 ?  50  VAL A HG12 4  
ATOM   10180  H  HG13 . VAL A 1 8   ? -7.779  -13.127 7.203   1.00 15.00 ?  50  VAL A HG13 4  
ATOM   10181  H  HG21 . VAL A 1 8   ? -7.832  -14.440 5.136   1.00 15.00 ?  50  VAL A HG21 4  
ATOM   10182  H  HG22 . VAL A 1 8   ? -8.582  -13.786 3.678   1.00 15.00 ?  50  VAL A HG22 4  
ATOM   10183  H  HG23 . VAL A 1 8   ? -9.583  -14.243 5.050   1.00 15.00 ?  50  VAL A HG23 4  
ATOM   10184  N  N    . PHE A 1 9   ? -10.352 -9.696  6.193   1.00 15.00 ?  51  PHE A N    4  
ATOM   10185  C  CA   . PHE A 1 9   ? -10.311 -8.367  6.779   1.00 15.00 ?  51  PHE A CA   4  
ATOM   10186  C  C    . PHE A 1 9   ? -10.028 -8.450  8.270   1.00 15.00 ?  51  PHE A C    4  
ATOM   10187  O  O    . PHE A 1 9   ? -10.507 -9.353  8.954   1.00 15.00 ?  51  PHE A O    4  
ATOM   10188  C  CB   . PHE A 1 9   ? -11.635 -7.638  6.541   1.00 15.00 ?  51  PHE A CB   4  
ATOM   10189  C  CG   . PHE A 1 9   ? -11.878 -7.270  5.103   1.00 15.00 ?  51  PHE A CG   4  
ATOM   10190  C  CD1  . PHE A 1 9   ? -12.346 -8.215  4.200   1.00 15.00 ?  51  PHE A CD1  4  
ATOM   10191  C  CD2  . PHE A 1 9   ? -11.633 -5.981  4.653   1.00 15.00 ?  51  PHE A CD2  4  
ATOM   10192  C  CE1  . PHE A 1 9   ? -12.565 -7.882  2.878   1.00 15.00 ?  51  PHE A CE1  4  
ATOM   10193  C  CE2  . PHE A 1 9   ? -11.853 -5.644  3.331   1.00 15.00 ?  51  PHE A CE2  4  
ATOM   10194  C  CZ   . PHE A 1 9   ? -12.319 -6.595  2.442   1.00 15.00 ?  51  PHE A CZ   4  
ATOM   10195  H  H    . PHE A 1 9   ? -11.063 -10.321 6.469   1.00 15.00 ?  51  PHE A H    4  
ATOM   10196  H  HA   . PHE A 1 9   ? -9.516  -7.817  6.301   1.00 15.00 ?  51  PHE A HA   4  
ATOM   10197  H  HB2  . PHE A 1 9   ? -12.448 -8.267  6.863   1.00 15.00 ?  51  PHE A HB2  4  
ATOM   10198  H  HB3  . PHE A 1 9   ? -11.640 -6.727  7.120   1.00 15.00 ?  51  PHE A HB3  4  
ATOM   10199  H  HD1  . PHE A 1 9   ? -12.541 -9.220  4.541   1.00 15.00 ?  51  PHE A HD1  4  
ATOM   10200  H  HD2  . PHE A 1 9   ? -11.268 -5.235  5.349   1.00 15.00 ?  51  PHE A HD2  4  
ATOM   10201  H  HE1  . PHE A 1 9   ? -12.930 -8.627  2.188   1.00 15.00 ?  51  PHE A HE1  4  
ATOM   10202  H  HE2  . PHE A 1 9   ? -11.659 -4.638  2.991   1.00 15.00 ?  51  PHE A HE2  4  
ATOM   10203  H  HZ   . PHE A 1 9   ? -12.495 -6.334  1.410   1.00 15.00 ?  51  PHE A HZ   4  
ATOM   10204  N  N    . ARG A 1 10  ? -9.240  -7.517  8.770   1.00 15.00 ?  52  ARG A N    4  
ATOM   10205  C  CA   . ARG A 1 10  ? -8.910  -7.483  10.182  1.00 15.00 ?  52  ARG A CA   4  
ATOM   10206  C  C    . ARG A 1 10  ? -8.871  -6.046  10.682  1.00 15.00 ?  52  ARG A C    4  
ATOM   10207  O  O    . ARG A 1 10  ? -8.380  -5.151  9.994   1.00 15.00 ?  52  ARG A O    4  
ATOM   10208  C  CB   . ARG A 1 10  ? -7.564  -8.160  10.432  1.00 15.00 ?  52  ARG A CB   4  
ATOM   10209  C  CG   . ARG A 1 10  ? -7.256  -8.363  11.903  1.00 15.00 ?  52  ARG A CG   4  
ATOM   10210  C  CD   . ARG A 1 10  ? -5.857  -8.913  12.105  1.00 15.00 ?  52  ARG A CD   4  
ATOM   10211  N  NE   . ARG A 1 10  ? -5.581  -9.203  13.511  1.00 15.00 ?  52  ARG A NE   4  
ATOM   10212  C  CZ   . ARG A 1 10  ? -5.573  -10.431 14.031  1.00 15.00 ?  52  ARG A CZ   4  
ATOM   10213  N  NH1  . ARG A 1 10  ? -5.836  -11.488 13.268  1.00 15.00 1  52  ARG A NH1  4  
ATOM   10214  N  NH2  . ARG A 1 10  ? -5.283  -10.606 15.313  1.00 15.00 ?  52  ARG A NH2  4  
ATOM   10215  H  H    . ARG A 1 10  ? -8.859  -6.836  8.169   1.00 15.00 ?  52  ARG A H    4  
ATOM   10216  H  HA   . ARG A 1 10  ? -9.682  -8.019  10.715  1.00 15.00 ?  52  ARG A HA   4  
ATOM   10217  H  HB2  . ARG A 1 10  ? -7.565  -9.125  9.949   1.00 15.00 ?  52  ARG A HB2  4  
ATOM   10218  H  HB3  . ARG A 1 10  ? -6.782  -7.553  10.001  1.00 15.00 ?  52  ARG A HB3  4  
ATOM   10219  H  HG2  . ARG A 1 10  ? -7.334  -7.415  12.413  1.00 15.00 ?  52  ARG A HG2  4  
ATOM   10220  H  HG3  . ARG A 1 10  ? -7.972  -9.056  12.321  1.00 15.00 ?  52  ARG A HG3  4  
ATOM   10221  H  HD2  . ARG A 1 10  ? -5.753  -9.823  11.532  1.00 15.00 ?  52  ARG A HD2  4  
ATOM   10222  H  HD3  . ARG A 1 10  ? -5.145  -8.183  11.748  1.00 15.00 ?  52  ARG A HD3  4  
ATOM   10223  H  HE   . ARG A 1 10  ? -5.403  -8.437  14.104  1.00 15.00 ?  52  ARG A HE   4  
ATOM   10224  H  HH11 . ARG A 1 10  ? -5.823  -12.448 13.683  1.00 15.00 ?  52  ARG A HH11 4  
ATOM   10225  H  HH12 . ARG A 1 10  ? -6.061  -11.368 12.249  1.00 15.00 ?  52  ARG A HH12 4  
ATOM   10226  H  HH21 . ARG A 1 10  ? -5.277  -11.566 15.723  1.00 15.00 ?  52  ARG A HH21 4  
ATOM   10227  H  HH22 . ARG A 1 10  ? -5.060  -9.785  15.919  1.00 15.00 ?  52  ARG A HH22 4  
ATOM   10228  N  N    . GLN A 1 11  ? -9.394  -5.827  11.878  1.00 15.00 ?  53  GLN A N    4  
ATOM   10229  C  CA   . GLN A 1 11  ? -9.420  -4.499  12.463  1.00 15.00 ?  53  GLN A CA   4  
ATOM   10230  C  C    . GLN A 1 11  ? -8.173  -4.254  13.305  1.00 15.00 ?  53  GLN A C    4  
ATOM   10231  O  O    . GLN A 1 11  ? -7.984  -4.883  14.346  1.00 15.00 ?  53  GLN A O    4  
ATOM   10232  C  CB   . GLN A 1 11  ? -10.678 -4.329  13.318  1.00 15.00 ?  53  GLN A CB   4  
ATOM   10233  C  CG   . GLN A 1 11  ? -10.732 -3.008  14.064  1.00 15.00 ?  53  GLN A CG   4  
ATOM   10234  C  CD   . GLN A 1 11  ? -12.081 -2.755  14.704  1.00 15.00 ?  53  GLN A CD   4  
ATOM   10235  O  OE1  . GLN A 1 11  ? -12.788 -3.689  15.085  1.00 15.00 ?  53  GLN A OE1  4  
ATOM   10236  N  NE2  . GLN A 1 11  ? -12.445 -1.489  14.821  1.00 15.00 ?  53  GLN A NE2  4  
ATOM   10237  H  H    . GLN A 1 11  ? -9.765  -6.582  12.385  1.00 15.00 ?  53  GLN A H    4  
ATOM   10238  H  HA   . GLN A 1 11  ? -9.445  -3.780  11.657  1.00 15.00 ?  53  GLN A HA   4  
ATOM   10239  H  HB2  . GLN A 1 11  ? -11.544 -4.392  12.676  1.00 15.00 ?  53  GLN A HB2  4  
ATOM   10240  H  HB3  . GLN A 1 11  ? -10.718 -5.130  14.043  1.00 15.00 ?  53  GLN A HB3  4  
ATOM   10241  H  HG2  . GLN A 1 11  ? -9.980  -3.015  14.839  1.00 15.00 ?  53  GLN A HG2  4  
ATOM   10242  H  HG3  . GLN A 1 11  ? -10.524 -2.208  13.369  1.00 15.00 ?  53  GLN A HG3  4  
ATOM   10243  H  HE21 . GLN A 1 11  ? -11.832 -0.798  14.489  1.00 15.00 ?  53  GLN A HE21 4  
ATOM   10244  H  HE22 . GLN A 1 11  ? -13.311 -1.292  15.239  1.00 15.00 ?  53  GLN A HE22 4  
ATOM   10245  N  N    . LEU A 1 12  ? -7.315  -3.354  12.843  1.00 15.00 ?  54  LEU A N    4  
ATOM   10246  C  CA   . LEU A 1 12  ? -6.095  -3.024  13.571  1.00 15.00 ?  54  LEU A CA   4  
ATOM   10247  C  C    . LEU A 1 12  ? -6.352  -1.869  14.526  1.00 15.00 ?  54  LEU A C    4  
ATOM   10248  O  O    . LEU A 1 12  ? -5.790  -1.808  15.619  1.00 15.00 ?  54  LEU A O    4  
ATOM   10249  C  CB   . LEU A 1 12  ? -4.973  -2.647  12.602  1.00 15.00 ?  54  LEU A CB   4  
ATOM   10250  C  CG   . LEU A 1 12  ? -4.571  -3.733  11.600  1.00 15.00 ?  54  LEU A CG   4  
ATOM   10251  C  CD1  . LEU A 1 12  ? -3.516  -3.206  10.645  1.00 15.00 ?  54  LEU A CD1  4  
ATOM   10252  C  CD2  . LEU A 1 12  ? -4.059  -4.971  12.322  1.00 15.00 ?  54  LEU A CD2  4  
ATOM   10253  H  H    . LEU A 1 12  ? -7.506  -2.898  11.996  1.00 15.00 ?  54  LEU A H    4  
ATOM   10254  H  HA   . LEU A 1 12  ? -5.798  -3.892  14.142  1.00 15.00 ?  54  LEU A HA   4  
ATOM   10255  H  HB2  . LEU A 1 12  ? -5.289  -1.775  12.049  1.00 15.00 ?  54  LEU A HB2  4  
ATOM   10256  H  HB3  . LEU A 1 12  ? -4.101  -2.385  13.183  1.00 15.00 ?  54  LEU A HB3  4  
ATOM   10257  H  HG   . LEU A 1 12  ? -5.437  -4.016  11.017  1.00 15.00 ?  54  LEU A HG   4  
ATOM   10258  H  HD11 . LEU A 1 12  ? -3.926  -2.391  10.068  1.00 15.00 ?  54  LEU A HD11 4  
ATOM   10259  H  HD12 . LEU A 1 12  ? -3.205  -4.000  9.979   1.00 15.00 ?  54  LEU A HD12 4  
ATOM   10260  H  HD13 . LEU A 1 12  ? -2.663  -2.854  11.209  1.00 15.00 ?  54  LEU A HD13 4  
ATOM   10261  H  HD21 . LEU A 1 12  ? -4.888  -5.492  12.779  1.00 15.00 ?  54  LEU A HD21 4  
ATOM   10262  H  HD22 . LEU A 1 12  ? -3.355  -4.676  13.085  1.00 15.00 ?  54  LEU A HD22 4  
ATOM   10263  H  HD23 . LEU A 1 12  ? -3.569  -5.624  11.614  1.00 15.00 ?  54  LEU A HD23 4  
ATOM   10264  N  N    . ALA A 1 13  ? -7.207  -0.955  14.101  1.00 15.00 ?  55  ALA A N    4  
ATOM   10265  C  CA   . ALA A 1 13  ? -7.559  0.202   14.905  1.00 15.00 ?  55  ALA A CA   4  
ATOM   10266  C  C    . ALA A 1 13  ? -9.041  0.524   14.731  1.00 15.00 ?  55  ALA A C    4  
ATOM   10267  O  O    . ALA A 1 13  ? -9.654  0.069   13.765  1.00 15.00 ?  55  ALA A O    4  
ATOM   10268  C  CB   . ALA A 1 13  ? -6.701  1.394   14.510  1.00 15.00 ?  55  ALA A CB   4  
ATOM   10269  H  H    . ALA A 1 13  ? -7.618  -1.058  13.214  1.00 15.00 ?  55  ALA A H    4  
ATOM   10270  H  HA   . ALA A 1 13  ? -7.361  -0.035  15.942  1.00 15.00 ?  55  ALA A HA   4  
ATOM   10271  H  HB1  . ALA A 1 13  ? -6.525  2.010   15.377  1.00 15.00 ?  55  ALA A HB1  4  
ATOM   10272  H  HB2  . ALA A 1 13  ? -7.214  1.972   13.757  1.00 15.00 ?  55  ALA A HB2  4  
ATOM   10273  H  HB3  . ALA A 1 13  ? -5.758  1.045   14.117  1.00 15.00 ?  55  ALA A HB3  4  
ATOM   10274  N  N    . PRO A 1 14  ? -9.636  1.304   15.659  1.00 15.00 ?  56  PRO A N    4  
ATOM   10275  C  CA   . PRO A 1 14  ? -11.058 1.682   15.612  1.00 15.00 ?  56  PRO A CA   4  
ATOM   10276  C  C    . PRO A 1 14  ? -11.538 2.126   14.227  1.00 15.00 ?  56  PRO A C    4  
ATOM   10277  O  O    . PRO A 1 14  ? -12.638 1.765   13.803  1.00 15.00 ?  56  PRO A O    4  
ATOM   10278  C  CB   . PRO A 1 14  ? -11.134 2.852   16.596  1.00 15.00 ?  56  PRO A CB   4  
ATOM   10279  C  CG   . PRO A 1 14  ? -10.071 2.575   17.594  1.00 15.00 ?  56  PRO A CG   4  
ATOM   10280  C  CD   . PRO A 1 14  ? -8.967  1.867   16.851  1.00 15.00 ?  56  PRO A CD   4  
ATOM   10281  H  HA   . PRO A 1 14  ? -11.689 0.880   15.962  1.00 15.00 ?  56  PRO A HA   4  
ATOM   10282  H  HB2  . PRO A 1 14  ? -10.954 3.786   16.079  1.00 15.00 ?  56  PRO A HB2  4  
ATOM   10283  H  HB3  . PRO A 1 14  ? -12.096 2.872   17.081  1.00 15.00 ?  56  PRO A HB3  4  
ATOM   10284  H  HG2  . PRO A 1 14  ? -9.711  3.506   18.013  1.00 15.00 ?  56  PRO A HG2  4  
ATOM   10285  H  HG3  . PRO A 1 14  ? -10.458 1.936   18.373  1.00 15.00 ?  56  PRO A HG3  4  
ATOM   10286  H  HD2  . PRO A 1 14  ? -8.194  2.567   16.565  1.00 15.00 ?  56  PRO A HD2  4  
ATOM   10287  H  HD3  . PRO A 1 14  ? -8.553  1.081   17.463  1.00 15.00 ?  56  PRO A HD3  4  
ATOM   10288  N  N    . ASN A 1 15  ? -10.713 2.898   13.523  1.00 15.00 ?  57  ASN A N    4  
ATOM   10289  C  CA   . ASN A 1 15  ? -11.085 3.396   12.201  1.00 15.00 ?  57  ASN A CA   4  
ATOM   10290  C  C    . ASN A 1 15  ? -10.089 2.964   11.132  1.00 15.00 ?  57  ASN A C    4  
ATOM   10291  O  O    . ASN A 1 15  ? -10.040 3.556   10.049  1.00 15.00 ?  57  ASN A O    4  
ATOM   10292  C  CB   . ASN A 1 15  ? -11.176 4.926   12.208  1.00 15.00 ?  57  ASN A CB   4  
ATOM   10293  C  CG   . ASN A 1 15  ? -12.262 5.449   13.125  1.00 15.00 ?  57  ASN A CG   4  
ATOM   10294  O  OD1  . ASN A 1 15  ? -13.432 5.525   12.745  1.00 15.00 ?  57  ASN A OD1  4  
ATOM   10295  N  ND2  . ASN A 1 15  ? -11.881 5.821   14.338  1.00 15.00 ?  57  ASN A ND2  4  
ATOM   10296  H  H    . ASN A 1 15  ? -9.838  3.139   13.902  1.00 15.00 ?  57  ASN A H    4  
ATOM   10297  H  HA   . ASN A 1 15  ? -12.053 2.989   11.954  1.00 15.00 ?  57  ASN A HA   4  
ATOM   10298  H  HB2  . ASN A 1 15  ? -10.233 5.335   12.532  1.00 15.00 ?  57  ASN A HB2  4  
ATOM   10299  H  HB3  . ASN A 1 15  ? -11.384 5.268   11.204  1.00 15.00 ?  57  ASN A HB3  4  
ATOM   10300  H  HD21 . ASN A 1 15  ? -10.931 5.739   14.575  1.00 15.00 ?  57  ASN A HD21 4  
ATOM   10301  H  HD22 . ASN A 1 15  ? -12.560 6.169   14.953  1.00 15.00 ?  57  ASN A HD22 4  
ATOM   10302  N  N    . VAL A 1 16  ? -9.307  1.930   11.423  1.00 15.00 ?  58  VAL A N    4  
ATOM   10303  C  CA   . VAL A 1 16  ? -8.313  1.436   10.474  1.00 15.00 ?  58  VAL A CA   4  
ATOM   10304  C  C    . VAL A 1 16  ? -8.406  -0.081  10.329  1.00 15.00 ?  58  VAL A C    4  
ATOM   10305  O  O    . VAL A 1 16  ? -8.141  -0.829  11.276  1.00 15.00 ?  58  VAL A O    4  
ATOM   10306  C  CB   . VAL A 1 16  ? -6.870  1.817   10.889  1.00 15.00 ?  58  VAL A CB   4  
ATOM   10307  C  CG1  . VAL A 1 16  ? -5.866  1.279   9.879   1.00 15.00 ?  58  VAL A CG1  4  
ATOM   10308  C  CG2  . VAL A 1 16  ? -6.717  3.328   11.029  1.00 15.00 ?  58  VAL A CG2  4  
ATOM   10309  H  H    . VAL A 1 16  ? -9.412  1.475   12.287  1.00 15.00 ?  58  VAL A H    4  
ATOM   10310  H  HA   . VAL A 1 16  ? -8.518  1.890   9.515   1.00 15.00 ?  58  VAL A HA   4  
ATOM   10311  H  HB   . VAL A 1 16  ? -6.659  1.364   11.846  1.00 15.00 ?  58  VAL A HB   4  
ATOM   10312  H  HG11 . VAL A 1 16  ? -6.022  1.763   8.927   1.00 15.00 ?  58  VAL A HG11 4  
ATOM   10313  H  HG12 . VAL A 1 16  ? -6.003  0.214   9.768   1.00 15.00 ?  58  VAL A HG12 4  
ATOM   10314  H  HG13 . VAL A 1 16  ? -4.863  1.478   10.224  1.00 15.00 ?  58  VAL A HG13 4  
ATOM   10315  H  HG21 . VAL A 1 16  ? -6.857  3.794   10.064  1.00 15.00 ?  58  VAL A HG21 4  
ATOM   10316  H  HG22 . VAL A 1 16  ? -5.727  3.558   11.401  1.00 15.00 ?  58  VAL A HG22 4  
ATOM   10317  H  HG23 . VAL A 1 16  ? -7.455  3.702   11.722  1.00 15.00 ?  58  VAL A HG23 4  
ATOM   10318  N  N    . TRP A 1 17  ? -8.797  -0.525  9.148   1.00 15.00 ?  59  TRP A N    4  
ATOM   10319  C  CA   . TRP A 1 17  ? -8.921  -1.943  8.868   1.00 15.00 ?  59  TRP A CA   4  
ATOM   10320  C  C    . TRP A 1 17  ? -7.898  -2.360  7.819   1.00 15.00 ?  59  TRP A C    4  
ATOM   10321  O  O    . TRP A 1 17  ? -7.492  -1.552  6.984   1.00 15.00 ?  59  TRP A O    4  
ATOM   10322  C  CB   . TRP A 1 17  ? -10.338 -2.274  8.381   1.00 15.00 ?  59  TRP A CB   4  
ATOM   10323  C  CG   . TRP A 1 17  ? -11.411 -1.917  9.361   1.00 15.00 ?  59  TRP A CG   4  
ATOM   10324  C  CD1  . TRP A 1 17  ? -11.967 -2.730  10.303  1.00 15.00 ?  59  TRP A CD1  4  
ATOM   10325  C  CD2  . TRP A 1 17  ? -12.070 -0.651  9.485   1.00 15.00 ?  59  TRP A CD2  4  
ATOM   10326  N  NE1  . TRP A 1 17  ? -12.916 -2.044  11.018  1.00 15.00 ?  59  TRP A NE1  4  
ATOM   10327  C  CE2  . TRP A 1 17  ? -13.000 -0.765  10.533  1.00 15.00 ?  59  TRP A CE2  4  
ATOM   10328  C  CE3  . TRP A 1 17  ? -11.954 0.567   8.814   1.00 15.00 ?  59  TRP A CE3  4  
ATOM   10329  C  CZ2  . TRP A 1 17  ? -13.813 0.294   10.924  1.00 15.00 ?  59  TRP A CZ2  4  
ATOM   10330  C  CZ3  . TRP A 1 17  ? -12.763 1.618   9.200   1.00 15.00 ?  59  TRP A CZ3  4  
ATOM   10331  C  CH2  . TRP A 1 17  ? -13.681 1.476   10.247  1.00 15.00 ?  59  TRP A CH2  4  
ATOM   10332  H  H    . TRP A 1 17  ? -9.008  0.123   8.438   1.00 15.00 ?  59  TRP A H    4  
ATOM   10333  H  HA   . TRP A 1 17  ? -8.726  -2.483  9.782   1.00 15.00 ?  59  TRP A HA   4  
ATOM   10334  H  HB2  . TRP A 1 17  ? -10.532 -1.733  7.469   1.00 15.00 ?  59  TRP A HB2  4  
ATOM   10335  H  HB3  . TRP A 1 17  ? -10.406 -3.334  8.185   1.00 15.00 ?  59  TRP A HB3  4  
ATOM   10336  H  HD1  . TRP A 1 17  ? -11.686 -3.762  10.456  1.00 15.00 ?  59  TRP A HD1  4  
ATOM   10337  H  HE1  . TRP A 1 17  ? -13.449 -2.411  11.756  1.00 15.00 ?  59  TRP A HE1  4  
ATOM   10338  H  HE3  . TRP A 1 17  ? -11.251 0.692   8.005   1.00 15.00 ?  59  TRP A HE3  4  
ATOM   10339  H  HZ2  . TRP A 1 17  ? -14.524 0.202   11.730  1.00 15.00 ?  59  TRP A HZ2  4  
ATOM   10340  H  HZ3  . TRP A 1 17  ? -12.687 2.567   8.693   1.00 15.00 ?  59  TRP A HZ3  4  
ATOM   10341  H  HH2  . TRP A 1 17  ? -14.296 2.323   10.511  1.00 15.00 ?  59  TRP A HH2  4  
ATOM   10342  N  N    . GLN A 1 18  ? -7.483  -3.615  7.870   1.00 15.00 ?  60  GLN A N    4  
ATOM   10343  C  CA   . GLN A 1 18  ? -6.508  -4.140  6.927   1.00 15.00 ?  60  GLN A CA   4  
ATOM   10344  C  C    . GLN A 1 18  ? -7.123  -5.258  6.101   1.00 15.00 ?  60  GLN A C    4  
ATOM   10345  O  O    . GLN A 1 18  ? -7.670  -6.213  6.653   1.00 15.00 ?  60  GLN A O    4  
ATOM   10346  C  CB   . GLN A 1 18  ? -5.276  -4.659  7.673   1.00 15.00 ?  60  GLN A CB   4  
ATOM   10347  C  CG   . GLN A 1 18  ? -4.241  -5.319  6.772   1.00 15.00 ?  60  GLN A CG   4  
ATOM   10348  C  CD   . GLN A 1 18  ? -3.615  -6.539  7.415   1.00 15.00 ?  60  GLN A CD   4  
ATOM   10349  O  OE1  . GLN A 1 18  ? -2.615  -6.441  8.123   1.00 15.00 ?  60  GLN A OE1  4  
ATOM   10350  N  NE2  . GLN A 1 18  ? -4.202  -7.699  7.174   1.00 15.00 ?  60  GLN A NE2  4  
ATOM   10351  H  H    . GLN A 1 18  ? -7.846  -4.211  8.564   1.00 15.00 ?  60  GLN A H    4  
ATOM   10352  H  HA   . GLN A 1 18  ? -6.209  -3.337  6.268   1.00 15.00 ?  60  GLN A HA   4  
ATOM   10353  H  HB2  . GLN A 1 18  ? -4.800  -3.833  8.181   1.00 15.00 ?  60  GLN A HB2  4  
ATOM   10354  H  HB3  . GLN A 1 18  ? -5.595  -5.384  8.407   1.00 15.00 ?  60  GLN A HB3  4  
ATOM   10355  H  HG2  . GLN A 1 18  ? -4.719  -5.622  5.853   1.00 15.00 ?  60  GLN A HG2  4  
ATOM   10356  H  HG3  . GLN A 1 18  ? -3.460  -4.603  6.555   1.00 15.00 ?  60  GLN A HG3  4  
ATOM   10357  H  HE21 . GLN A 1 18  ? -5.002  -7.706  6.602   1.00 15.00 ?  60  GLN A HE21 4  
ATOM   10358  H  HE22 . GLN A 1 18  ? -3.811  -8.505  7.565   1.00 15.00 ?  60  GLN A HE22 4  
ATOM   10359  N  N    . HIS A 1 19  ? -7.053  -5.131  4.780   1.00 15.00 ?  61  HIS A N    4  
ATOM   10360  C  CA   . HIS A 1 19  ? -7.593  -6.152  3.895   1.00 15.00 ?  61  HIS A CA   4  
ATOM   10361  C  C    . HIS A 1 19  ? -6.468  -7.059  3.401   1.00 15.00 ?  61  HIS A C    4  
ATOM   10362  O  O    . HIS A 1 19  ? -5.312  -6.637  3.306   1.00 15.00 ?  61  HIS A O    4  
ATOM   10363  C  CB   . HIS A 1 19  ? -8.375  -5.538  2.716   1.00 15.00 ?  61  HIS A CB   4  
ATOM   10364  C  CG   . HIS A 1 19  ? -7.557  -4.761  1.720   1.00 15.00 ?  61  HIS A CG   4  
ATOM   10365  N  ND1  . HIS A 1 19  ? -6.800  -5.396  0.762   1.00 15.00 ?  61  HIS A ND1  4  
ATOM   10366  C  CD2  . HIS A 1 19  ? -7.449  -3.419  1.548   1.00 15.00 ?  61  HIS A CD2  4  
ATOM   10367  C  CE1  . HIS A 1 19  ? -6.255  -4.439  0.033   1.00 15.00 ?  61  HIS A CE1  4  
ATOM   10368  N  NE2  . HIS A 1 19  ? -6.621  -3.227  0.470   1.00 15.00 ?  61  HIS A NE2  4  
ATOM   10369  H  H    . HIS A 1 19  ? -6.616  -4.342  4.395   1.00 15.00 ?  61  HIS A H    4  
ATOM   10370  H  HA   . HIS A 1 19  ? -8.273  -6.752  4.484   1.00 15.00 ?  61  HIS A HA   4  
ATOM   10371  H  HB2  . HIS A 1 19  ? -8.861  -6.333  2.179   1.00 15.00 ?  61  HIS A HB2  4  
ATOM   10372  H  HB3  . HIS A 1 19  ? -9.129  -4.873  3.113   1.00 15.00 ?  61  HIS A HB3  4  
ATOM   10373  H  HD2  . HIS A 1 19  ? -7.920  -2.650  2.143   1.00 15.00 ?  61  HIS A HD2  4  
ATOM   10374  H  HE1  . HIS A 1 19  ? -5.591  -4.610  -0.799  1.00 15.00 ?  61  HIS A HE1  4  
ATOM   10375  H  HE2  . HIS A 1 19  ? -6.356  -2.362  0.081   1.00 15.00 ?  61  HIS A HE2  4  
ATOM   10376  N  N    . THR A 1 20  ? -6.799  -8.309  3.128   1.00 15.00 ?  62  THR A N    4  
ATOM   10377  C  CA   . THR A 1 20  ? -5.822  -9.268  2.657   1.00 15.00 ?  62  THR A CA   4  
ATOM   10378  C  C    . THR A 1 20  ? -6.365  -10.060 1.473   1.00 15.00 ?  62  THR A C    4  
ATOM   10379  O  O    . THR A 1 20  ? -7.283  -10.868 1.622   1.00 15.00 ?  62  THR A O    4  
ATOM   10380  C  CB   . THR A 1 20  ? -5.427  -10.246 3.785   1.00 15.00 ?  62  THR A CB   4  
ATOM   10381  O  OG1  . THR A 1 20  ? -4.991  -9.511  4.936   1.00 15.00 ?  62  THR A OG1  4  
ATOM   10382  C  CG2  . THR A 1 20  ? -4.321  -11.191 3.331   1.00 15.00 ?  62  THR A CG2  4  
ATOM   10383  H  H    . THR A 1 20  ? -7.722  -8.601  3.270   1.00 15.00 ?  62  THR A H    4  
ATOM   10384  H  HA   . THR A 1 20  ? -4.938  -8.727  2.350   1.00 15.00 ?  62  THR A HA   4  
ATOM   10385  H  HB   . THR A 1 20  ? -6.293  -10.828 4.050   1.00 15.00 ?  62  THR A HB   4  
ATOM   10386  H  HG1  . THR A 1 20  ? -4.362  -8.832  4.656   1.00 15.00 ?  62  THR A HG1  4  
ATOM   10387  H  HG21 . THR A 1 20  ? -4.647  -11.731 2.454   1.00 15.00 ?  62  THR A HG21 4  
ATOM   10388  H  HG22 . THR A 1 20  ? -4.099  -11.892 4.124   1.00 15.00 ?  62  THR A HG22 4  
ATOM   10389  H  HG23 . THR A 1 20  ? -3.434  -10.621 3.093   1.00 15.00 ?  62  THR A HG23 4  
ATOM   10390  N  N    . SER A 1 21  ? -5.809  -9.812  0.301   1.00 15.00 ?  63  SER A N    4  
ATOM   10391  C  CA   . SER A 1 21  ? -6.215  -10.513 -0.901  1.00 15.00 ?  63  SER A CA   4  
ATOM   10392  C  C    . SER A 1 21  ? -5.193  -11.596 -1.229  1.00 15.00 ?  63  SER A C    4  
ATOM   10393  O  O    . SER A 1 21  ? -4.009  -11.449 -0.917  1.00 15.00 ?  63  SER A O    4  
ATOM   10394  C  CB   . SER A 1 21  ? -6.349  -9.523  -2.055  1.00 15.00 ?  63  SER A CB   4  
ATOM   10395  O  OG   . SER A 1 21  ? -5.480  -8.416  -1.879  1.00 15.00 ?  63  SER A OG   4  
ATOM   10396  H  H    . SER A 1 21  ? -5.092  -9.139  0.241   1.00 15.00 ?  63  SER A H    4  
ATOM   10397  H  HA   . SER A 1 21  ? -7.172  -10.975 -0.713  1.00 15.00 ?  63  SER A HA   4  
ATOM   10398  H  HB2  . SER A 1 21  ? -6.099  -10.015 -2.979  1.00 15.00 ?  63  SER A HB2  4  
ATOM   10399  H  HB3  . SER A 1 21  ? -7.364  -9.164  -2.103  1.00 15.00 ?  63  SER A HB3  4  
ATOM   10400  H  HG   . SER A 1 21  ? -5.845  -7.828  -1.212  1.00 15.00 ?  63  SER A HG   4  
ATOM   10401  N  N    . TYR A 1 22  ? -5.634  -12.680 -1.851  1.00 15.00 ?  64  TYR A N    4  
ATOM   10402  C  CA   . TYR A 1 22  ? -4.731  -13.772 -2.180  1.00 15.00 ?  64  TYR A CA   4  
ATOM   10403  C  C    . TYR A 1 22  ? -4.667  -14.026 -3.677  1.00 15.00 ?  64  TYR A C    4  
ATOM   10404  O  O    . TYR A 1 22  ? -5.631  -13.777 -4.406  1.00 15.00 ?  64  TYR A O    4  
ATOM   10405  C  CB   . TYR A 1 22  ? -5.167  -15.053 -1.469  1.00 15.00 ?  64  TYR A CB   4  
ATOM   10406  C  CG   . TYR A 1 22  ? -4.988  -15.014 0.033   1.00 15.00 ?  64  TYR A CG   4  
ATOM   10407  C  CD1  . TYR A 1 22  ? -6.044  -14.673 0.868   1.00 15.00 ?  64  TYR A CD1  4  
ATOM   10408  C  CD2  . TYR A 1 22  ? -3.766  -15.324 0.614   1.00 15.00 ?  64  TYR A CD2  4  
ATOM   10409  C  CE1  . TYR A 1 22  ? -5.887  -14.640 2.239   1.00 15.00 ?  64  TYR A CE1  4  
ATOM   10410  C  CE2  . TYR A 1 22  ? -3.601  -15.293 1.984   1.00 15.00 ?  64  TYR A CE2  4  
ATOM   10411  C  CZ   . TYR A 1 22  ? -4.664  -14.954 2.791   1.00 15.00 ?  64  TYR A CZ   4  
ATOM   10412  O  OH   . TYR A 1 22  ? -4.501  -14.927 4.158   1.00 15.00 ?  64  TYR A OH   4  
ATOM   10413  H  H    . TYR A 1 22  ? -6.578  -12.750 -2.098  1.00 15.00 ?  64  TYR A H    4  
ATOM   10414  H  HA   . TYR A 1 22  ? -3.748  -13.499 -1.832  1.00 15.00 ?  64  TYR A HA   4  
ATOM   10415  H  HB2  . TYR A 1 22  ? -6.214  -15.230 -1.670  1.00 15.00 ?  64  TYR A HB2  4  
ATOM   10416  H  HB3  . TYR A 1 22  ? -4.589  -15.883 -1.851  1.00 15.00 ?  64  TYR A HB3  4  
ATOM   10417  H  HD1  . TYR A 1 22  ? -7.001  -14.435 0.432   1.00 15.00 ?  64  TYR A HD1  4  
ATOM   10418  H  HD2  . TYR A 1 22  ? -2.937  -15.591 -0.020  1.00 15.00 ?  64  TYR A HD2  4  
ATOM   10419  H  HE1  . TYR A 1 22  ? -6.719  -14.371 2.874   1.00 15.00 ?  64  TYR A HE1  4  
ATOM   10420  H  HE2  . TYR A 1 22  ? -2.643  -15.538 2.421   1.00 15.00 ?  64  TYR A HE2  4  
ATOM   10421  H  HH   . TYR A 1 22  ? -3.738  -14.369 4.386   1.00 15.00 ?  64  TYR A HH   4  
ATOM   10422  N  N    . LEU A 1 23  ? -3.512  -14.512 -4.113  1.00 15.00 ?  65  LEU A N    4  
ATOM   10423  C  CA   . LEU A 1 23  ? -3.274  -14.848 -5.507  1.00 15.00 ?  65  LEU A CA   4  
ATOM   10424  C  C    . LEU A 1 23  ? -2.539  -16.176 -5.597  1.00 15.00 ?  65  LEU A C    4  
ATOM   10425  O  O    . LEU A 1 23  ? -1.482  -16.355 -4.986  1.00 15.00 ?  65  LEU A O    4  
ATOM   10426  C  CB   . LEU A 1 23  ? -2.448  -13.762 -6.201  1.00 15.00 ?  65  LEU A CB   4  
ATOM   10427  C  CG   . LEU A 1 23  ? -2.156  -14.020 -7.683  1.00 15.00 ?  65  LEU A CG   4  
ATOM   10428  C  CD1  . LEU A 1 23  ? -3.193  -13.340 -8.561  1.00 15.00 ?  65  LEU A CD1  4  
ATOM   10429  C  CD2  . LEU A 1 23  ? -0.756  -13.544 -8.042  1.00 15.00 ?  65  LEU A CD2  4  
ATOM   10430  H  H    . LEU A 1 23  ? -2.784  -14.641 -3.466  1.00 15.00 ?  65  LEU A H    4  
ATOM   10431  H  HA   . LEU A 1 23  ? -4.230  -14.943 -6.001  1.00 15.00 ?  65  LEU A HA   4  
ATOM   10432  H  HB2  . LEU A 1 23  ? -2.980  -12.825 -6.117  1.00 15.00 ?  65  LEU A HB2  4  
ATOM   10433  H  HB3  . LEU A 1 23  ? -1.505  -13.667 -5.684  1.00 15.00 ?  65  LEU A HB3  4  
ATOM   10434  H  HG   . LEU A 1 23  ? -2.206  -15.082 -7.870  1.00 15.00 ?  65  LEU A HG   4  
ATOM   10435  H  HD11 . LEU A 1 23  ? -3.165  -12.272 -8.390  1.00 15.00 ?  65  LEU A HD11 4  
ATOM   10436  H  HD12 . LEU A 1 23  ? -4.177  -13.717 -8.318  1.00 15.00 ?  65  LEU A HD12 4  
ATOM   10437  H  HD13 . LEU A 1 23  ? -2.977  -13.544 -9.598  1.00 15.00 ?  65  LEU A HD13 4  
ATOM   10438  H  HD21 . LEU A 1 23  ? -0.038  -14.014 -7.387  1.00 15.00 ?  65  LEU A HD21 4  
ATOM   10439  H  HD22 . LEU A 1 23  ? -0.697  -12.473 -7.927  1.00 15.00 ?  65  LEU A HD22 4  
ATOM   10440  H  HD23 . LEU A 1 23  ? -0.537  -13.809 -9.066  1.00 15.00 ?  65  LEU A HD23 4  
ATOM   10441  N  N    . ASP A 1 24  ? -3.098  -17.103 -6.347  1.00 15.00 ?  66  ASP A N    4  
ATOM   10442  C  CA   . ASP A 1 24  ? -2.485  -18.412 -6.506  1.00 15.00 ?  66  ASP A CA   4  
ATOM   10443  C  C    . ASP A 1 24  ? -1.399  -18.371 -7.570  1.00 15.00 ?  66  ASP A C    4  
ATOM   10444  O  O    . ASP A 1 24  ? -1.682  -18.206 -8.756  1.00 15.00 ?  66  ASP A O    4  
ATOM   10445  C  CB   . ASP A 1 24  ? -3.526  -19.467 -6.875  1.00 15.00 ?  66  ASP A CB   4  
ATOM   10446  C  CG   . ASP A 1 24  ? -4.251  -20.025 -5.668  1.00 15.00 ?  66  ASP A CG   4  
ATOM   10447  O  OD1  . ASP A 1 24  ? -3.942  -21.163 -5.254  1.00 15.00 ?  66  ASP A OD1  4  
ATOM   10448  O  OD2  . ASP A 1 24  ? -5.142  -19.333 -5.131  1.00 15.00 -1 66  ASP A OD2  4  
ATOM   10449  H  H    . ASP A 1 24  ? -3.942  -16.906 -6.807  1.00 15.00 ?  66  ASP A H    4  
ATOM   10450  H  HA   . ASP A 1 24  ? -2.034  -18.680 -5.565  1.00 15.00 ?  66  ASP A HA   4  
ATOM   10451  H  HB2  . ASP A 1 24  ? -4.256  -19.026 -7.538  1.00 15.00 ?  66  ASP A HB2  4  
ATOM   10452  H  HB3  . ASP A 1 24  ? -3.032  -20.282 -7.384  1.00 15.00 ?  66  ASP A HB3  4  
ATOM   10453  N  N    . MET A 1 25  ? -0.155  -18.492 -7.137  1.00 15.00 ?  67  MET A N    4  
ATOM   10454  C  CA   . MET A 1 25  ? 0.972   -18.489 -8.053  1.00 15.00 ?  67  MET A CA   4  
ATOM   10455  C  C    . MET A 1 25  ? 1.383   -19.926 -8.347  1.00 15.00 ?  67  MET A C    4  
ATOM   10456  O  O    . MET A 1 25  ? 1.088   -20.815 -7.548  1.00 15.00 ?  67  MET A O    4  
ATOM   10457  C  CB   . MET A 1 25  ? 2.152   -17.698 -7.468  1.00 15.00 ?  67  MET A CB   4  
ATOM   10458  C  CG   . MET A 1 25  ? 2.050   -16.195 -7.688  1.00 15.00 ?  67  MET A CG   4  
ATOM   10459  S  SD   . MET A 1 25  ? 3.555   -15.308 -7.225  1.00 15.00 ?  67  MET A SD   4  
ATOM   10460  C  CE   . MET A 1 25  ? 4.723   -15.981 -8.405  1.00 15.00 ?  67  MET A CE   4  
ATOM   10461  H  H    . MET A 1 25  ? 0.009   -18.603 -6.177  1.00 15.00 ?  67  MET A H    4  
ATOM   10462  H  HA   . MET A 1 25  ? 0.652   -18.022 -8.974  1.00 15.00 ?  67  MET A HA   4  
ATOM   10463  H  HB2  . MET A 1 25  ? 2.203   -17.884 -6.404  1.00 15.00 ?  67  MET A HB2  4  
ATOM   10464  H  HB3  . MET A 1 25  ? 3.066   -18.048 -7.929  1.00 15.00 ?  67  MET A HB3  4  
ATOM   10465  H  HG2  . MET A 1 25  ? 1.854   -16.011 -8.735  1.00 15.00 ?  67  MET A HG2  4  
ATOM   10466  H  HG3  . MET A 1 25  ? 1.229   -15.816 -7.098  1.00 15.00 ?  67  MET A HG3  4  
ATOM   10467  H  HE1  . MET A 1 25  ? 4.229   -16.131 -9.353  1.00 15.00 ?  67  MET A HE1  4  
ATOM   10468  H  HE2  . MET A 1 25  ? 5.099   -16.925 -8.040  1.00 15.00 ?  67  MET A HE2  4  
ATOM   10469  H  HE3  . MET A 1 25  ? 5.545   -15.291 -8.534  1.00 15.00 ?  67  MET A HE3  4  
ATOM   10470  N  N    . PRO A 1 26  ? 2.039   -20.165 -9.505  1.00 15.00 ?  68  PRO A N    4  
ATOM   10471  C  CA   . PRO A 1 26  ? 2.494   -21.498 -9.925  1.00 15.00 ?  68  PRO A CA   4  
ATOM   10472  C  C    . PRO A 1 26  ? 3.031   -22.343 -8.765  1.00 15.00 ?  68  PRO A C    4  
ATOM   10473  O  O    . PRO A 1 26  ? 4.144   -22.126 -8.282  1.00 15.00 ?  68  PRO A O    4  
ATOM   10474  C  CB   . PRO A 1 26  ? 3.609   -21.175 -10.917 1.00 15.00 ?  68  PRO A CB   4  
ATOM   10475  C  CG   . PRO A 1 26  ? 3.233   -19.867 -11.524 1.00 15.00 ?  68  PRO A CG   4  
ATOM   10476  C  CD   . PRO A 1 26  ? 2.380   -19.139 -10.513 1.00 15.00 ?  68  PRO A CD   4  
ATOM   10477  H  HA   . PRO A 1 26  ? 1.710   -22.043 -10.428 1.00 15.00 ?  68  PRO A HA   4  
ATOM   10478  H  HB2  . PRO A 1 26  ? 4.555   -21.102 -10.397 1.00 15.00 ?  68  PRO A HB2  4  
ATOM   10479  H  HB3  . PRO A 1 26  ? 3.660   -21.933 -11.681 1.00 15.00 ?  68  PRO A HB3  4  
ATOM   10480  H  HG2  . PRO A 1 26  ? 4.129   -19.296 -11.741 1.00 15.00 ?  68  PRO A HG2  4  
ATOM   10481  H  HG3  . PRO A 1 26  ? 2.671   -20.032 -12.430 1.00 15.00 ?  68  PRO A HG3  4  
ATOM   10482  H  HD2  . PRO A 1 26  ? 2.942   -18.337 -10.060 1.00 15.00 ?  68  PRO A HD2  4  
ATOM   10483  H  HD3  . PRO A 1 26  ? 1.488   -18.754 -10.983 1.00 15.00 ?  68  PRO A HD3  4  
ATOM   10484  N  N    . GLY A 1 27  ? 2.218   -23.294 -8.323  1.00 15.00 ?  69  GLY A N    4  
ATOM   10485  C  CA   . GLY A 1 27  ? 2.588   -24.148 -7.219  1.00 15.00 ?  69  GLY A CA   4  
ATOM   10486  C  C    . GLY A 1 27  ? 1.442   -24.299 -6.244  1.00 15.00 ?  69  GLY A C    4  
ATOM   10487  O  O    . GLY A 1 27  ? 0.286   -24.411 -6.658  1.00 15.00 ?  69  GLY A O    4  
ATOM   10488  H  H    . GLY A 1 27  ? 1.344   -23.411 -8.748  1.00 15.00 ?  69  GLY A H    4  
ATOM   10489  H  HA2  . GLY A 1 27  ? 2.856   -25.121 -7.602  1.00 15.00 ?  69  GLY A HA2  4  
ATOM   10490  H  HA3  . GLY A 1 27  ? 3.437   -23.721 -6.707  1.00 15.00 ?  69  GLY A HA3  4  
ATOM   10491  N  N    . PHE A 1 28  ? 1.746   -24.308 -4.955  1.00 15.00 ?  70  PHE A N    4  
ATOM   10492  C  CA   . PHE A 1 28  ? 0.716   -24.434 -3.931  1.00 15.00 ?  70  PHE A CA   4  
ATOM   10493  C  C    . PHE A 1 28  ? 0.892   -23.343 -2.888  1.00 15.00 ?  70  PHE A C    4  
ATOM   10494  O  O    . PHE A 1 28  ? 0.641   -23.552 -1.701  1.00 15.00 ?  70  PHE A O    4  
ATOM   10495  C  CB   . PHE A 1 28  ? 0.773   -25.815 -3.263  1.00 15.00 ?  70  PHE A CB   4  
ATOM   10496  C  CG   . PHE A 1 28  ? 0.649   -26.955 -4.226  1.00 15.00 ?  70  PHE A CG   4  
ATOM   10497  C  CD1  . PHE A 1 28  ? -0.567  -27.243 -4.824  1.00 15.00 ?  70  PHE A CD1  4  
ATOM   10498  C  CD2  . PHE A 1 28  ? 1.748   -27.734 -4.540  1.00 15.00 ?  70  PHE A CD2  4  
ATOM   10499  C  CE1  . PHE A 1 28  ? -0.684  -28.287 -5.717  1.00 15.00 ?  70  PHE A CE1  4  
ATOM   10500  C  CE2  . PHE A 1 28  ? 1.639   -28.780 -5.432  1.00 15.00 ?  70  PHE A CE2  4  
ATOM   10501  C  CZ   . PHE A 1 28  ? 0.421   -29.057 -6.023  1.00 15.00 ?  70  PHE A CZ   4  
ATOM   10502  H  H    . PHE A 1 28  ? 2.688   -24.236 -4.679  1.00 15.00 ?  70  PHE A H    4  
ATOM   10503  H  HA   . PHE A 1 28  ? -0.245  -24.310 -4.412  1.00 15.00 ?  70  PHE A HA   4  
ATOM   10504  H  HB2  . PHE A 1 28  ? 1.715   -25.919 -2.748  1.00 15.00 ?  70  PHE A HB2  4  
ATOM   10505  H  HB3  . PHE A 1 28  ? -0.034  -25.898 -2.546  1.00 15.00 ?  70  PHE A HB3  4  
ATOM   10506  H  HD1  . PHE A 1 28  ? -1.431  -26.639 -4.586  1.00 15.00 ?  70  PHE A HD1  4  
ATOM   10507  H  HD2  . PHE A 1 28  ? 2.699   -27.521 -4.079  1.00 15.00 ?  70  PHE A HD2  4  
ATOM   10508  H  HE1  . PHE A 1 28  ? -1.639  -28.503 -6.174  1.00 15.00 ?  70  PHE A HE1  4  
ATOM   10509  H  HE2  . PHE A 1 28  ? 2.507   -29.383 -5.667  1.00 15.00 ?  70  PHE A HE2  4  
ATOM   10510  H  HZ   . PHE A 1 28  ? 0.332   -29.873 -6.722  1.00 15.00 ?  70  PHE A HZ   4  
ATOM   10511  N  N    . GLY A 1 29  ? 1.329   -22.176 -3.340  1.00 15.00 ?  71  GLY A N    4  
ATOM   10512  C  CA   . GLY A 1 29  ? 1.547   -21.064 -2.441  1.00 15.00 ?  71  GLY A CA   4  
ATOM   10513  C  C    . GLY A 1 29  ? 0.809   -19.818 -2.885  1.00 15.00 ?  71  GLY A C    4  
ATOM   10514  O  O    . GLY A 1 29  ? 1.144   -19.222 -3.910  1.00 15.00 ?  71  GLY A O    4  
ATOM   10515  H  H    . GLY A 1 29  ? 1.495   -22.064 -4.299  1.00 15.00 ?  71  GLY A H    4  
ATOM   10516  H  HA2  . GLY A 1 29  ? 1.209   -21.340 -1.449  1.00 15.00 ?  71  GLY A HA2  4  
ATOM   10517  H  HA3  . GLY A 1 29  ? 2.606   -20.849 -2.403  1.00 15.00 ?  71  GLY A HA3  4  
ATOM   10518  N  N    . ALA A 1 30  ? -0.203  -19.433 -2.123  1.00 15.00 ?  72  ALA A N    4  
ATOM   10519  C  CA   . ALA A 1 30  ? -0.988  -18.247 -2.432  1.00 15.00 ?  72  ALA A CA   4  
ATOM   10520  C  C    . ALA A 1 30  ? -0.352  -17.024 -1.789  1.00 15.00 ?  72  ALA A C    4  
ATOM   10521  O  O    . ALA A 1 30  ? -0.096  -17.009 -0.582  1.00 15.00 ?  72  ALA A O    4  
ATOM   10522  C  CB   . ALA A 1 30  ? -2.427  -18.422 -1.959  1.00 15.00 ?  72  ALA A CB   4  
ATOM   10523  H  H    . ALA A 1 30  ? -0.424  -19.954 -1.320  1.00 15.00 ?  72  ALA A H    4  
ATOM   10524  H  HA   . ALA A 1 30  ? -0.998  -18.115 -3.507  1.00 15.00 ?  72  ALA A HA   4  
ATOM   10525  H  HB1  . ALA A 1 30  ? -2.995  -17.535 -2.197  1.00 15.00 ?  72  ALA A HB1  4  
ATOM   10526  H  HB2  . ALA A 1 30  ? -2.440  -18.582 -0.892  1.00 15.00 ?  72  ALA A HB2  4  
ATOM   10527  H  HB3  . ALA A 1 30  ? -2.866  -19.278 -2.455  1.00 15.00 ?  72  ALA A HB3  4  
ATOM   10528  N  N    . VAL A 1 31  ? -0.070  -16.019 -2.602  1.00 15.00 ?  73  VAL A N    4  
ATOM   10529  C  CA   . VAL A 1 31  ? 0.541   -14.793 -2.113  1.00 15.00 ?  73  VAL A CA   4  
ATOM   10530  C  C    . VAL A 1 31  ? -0.522  -13.878 -1.525  1.00 15.00 ?  73  VAL A C    4  
ATOM   10531  O  O    . VAL A 1 31  ? -1.639  -13.805 -2.042  1.00 15.00 ?  73  VAL A O    4  
ATOM   10532  C  CB   . VAL A 1 31  ? 1.299   -14.046 -3.231  1.00 15.00 ?  73  VAL A CB   4  
ATOM   10533  C  CG1  . VAL A 1 31  ? 2.275   -13.036 -2.639  1.00 15.00 ?  73  VAL A CG1  4  
ATOM   10534  C  CG2  . VAL A 1 31  ? 2.025   -15.025 -4.137  1.00 15.00 ?  73  VAL A CG2  4  
ATOM   10535  H  H    . VAL A 1 31  ? -0.292  -16.099 -3.556  1.00 15.00 ?  73  VAL A H    4  
ATOM   10536  H  HA   . VAL A 1 31  ? 1.248   -15.058 -1.338  1.00 15.00 ?  73  VAL A HA   4  
ATOM   10537  H  HB   . VAL A 1 31  ? 0.579   -13.505 -3.824  1.00 15.00 ?  73  VAL A HB   4  
ATOM   10538  H  HG11 . VAL A 1 31  ? 2.760   -12.493 -3.439  1.00 15.00 ?  73  VAL A HG11 4  
ATOM   10539  H  HG12 . VAL A 1 31  ? 3.020   -13.554 -2.053  1.00 15.00 ?  73  VAL A HG12 4  
ATOM   10540  H  HG13 . VAL A 1 31  ? 1.740   -12.342 -2.008  1.00 15.00 ?  73  VAL A HG13 4  
ATOM   10541  H  HG21 . VAL A 1 31  ? 2.328   -14.521 -5.043  1.00 15.00 ?  73  VAL A HG21 4  
ATOM   10542  H  HG22 . VAL A 1 31  ? 1.367   -15.845 -4.382  1.00 15.00 ?  73  VAL A HG22 4  
ATOM   10543  H  HG23 . VAL A 1 31  ? 2.899   -15.406 -3.628  1.00 15.00 ?  73  VAL A HG23 4  
ATOM   10544  N  N    . ALA A 1 32  ? -0.182  -13.189 -0.452  1.00 15.00 ?  74  ALA A N    4  
ATOM   10545  C  CA   . ALA A 1 32  ? -1.118  -12.295 0.198   1.00 15.00 ?  74  ALA A CA   4  
ATOM   10546  C  C    . ALA A 1 32  ? -0.727  -10.837 -0.006  1.00 15.00 ?  74  ALA A C    4  
ATOM   10547  O  O    . ALA A 1 32  ? 0.459   -10.500 -0.025  1.00 15.00 ?  74  ALA A O    4  
ATOM   10548  C  CB   . ALA A 1 32  ? -1.187  -12.616 1.678   1.00 15.00 ?  74  ALA A CB   4  
ATOM   10549  H  H    . ALA A 1 32  ? 0.726   -13.282 -0.086  1.00 15.00 ?  74  ALA A H    4  
ATOM   10550  H  HA   . ALA A 1 32  ? -2.095  -12.463 -0.229  1.00 15.00 ?  74  ALA A HA   4  
ATOM   10551  H  HB1  . ALA A 1 32  ? -0.240  -12.380 2.138   1.00 15.00 ?  74  ALA A HB1  4  
ATOM   10552  H  HB2  . ALA A 1 32  ? -1.396  -13.668 1.806   1.00 15.00 ?  74  ALA A HB2  4  
ATOM   10553  H  HB3  . ALA A 1 32  ? -1.971  -12.035 2.140   1.00 15.00 ?  74  ALA A HB3  4  
ATOM   10554  N  N    . SER A 1 33  ? -1.729  -9.991  -0.186  1.00 15.00 ?  75  SER A N    4  
ATOM   10555  C  CA   . SER A 1 33  ? -1.518  -8.566  -0.360  1.00 15.00 ?  75  SER A CA   4  
ATOM   10556  C  C    . SER A 1 33  ? -2.385  -7.810  0.636   1.00 15.00 ?  75  SER A C    4  
ATOM   10557  O  O    . SER A 1 33  ? -3.613  -7.915  0.611   1.00 15.00 ?  75  SER A O    4  
ATOM   10558  C  CB   . SER A 1 33  ? -1.845  -8.129  -1.790  1.00 15.00 ?  75  SER A CB   4  
ATOM   10559  O  OG   . SER A 1 33  ? -0.854  -7.249  -2.292  1.00 15.00 ?  75  SER A OG   4  
ATOM   10560  H  H    . SER A 1 33  ? -2.647  -10.340 -0.205  1.00 15.00 ?  75  SER A H    4  
ATOM   10561  H  HA   . SER A 1 33  ? -0.478  -8.352  -0.149  1.00 15.00 ?  75  SER A HA   4  
ATOM   10562  H  HB2  . SER A 1 33  ? -1.897  -8.998  -2.430  1.00 15.00 ?  75  SER A HB2  4  
ATOM   10563  H  HB3  . SER A 1 33  ? -2.798  -7.618  -1.797  1.00 15.00 ?  75  SER A HB3  4  
ATOM   10564  H  HG   . SER A 1 33  ? -1.175  -6.823  -3.101  1.00 15.00 ?  75  SER A HG   4  
ATOM   10565  N  N    . ASN A 1 34  ? -1.738  -7.075  1.525   1.00 15.00 ?  76  ASN A N    4  
ATOM   10566  C  CA   . ASN A 1 34  ? -2.435  -6.312  2.551   1.00 15.00 ?  76  ASN A CA   4  
ATOM   10567  C  C    . ASN A 1 34  ? -2.600  -4.854  2.144   1.00 15.00 ?  76  ASN A C    4  
ATOM   10568  O  O    . ASN A 1 34  ? -1.749  -4.284  1.458   1.00 15.00 ?  76  ASN A O    4  
ATOM   10569  C  CB   . ASN A 1 34  ? -1.682  -6.376  3.885   1.00 15.00 ?  76  ASN A CB   4  
ATOM   10570  C  CG   . ASN A 1 34  ? -1.612  -7.776  4.464   1.00 15.00 ?  76  ASN A CG   4  
ATOM   10571  O  OD1  . ASN A 1 34  ? -2.507  -8.593  4.260   1.00 15.00 ?  76  ASN A OD1  4  
ATOM   10572  N  ND2  . ASN A 1 34  ? -0.548  -8.063  5.200   1.00 15.00 ?  76  ASN A ND2  4  
ATOM   10573  H  H    . ASN A 1 34  ? -0.758  -7.049  1.493   1.00 15.00 ?  76  ASN A H    4  
ATOM   10574  H  HA   . ASN A 1 34  ? -3.413  -6.751  2.680   1.00 15.00 ?  76  ASN A HA   4  
ATOM   10575  H  HB2  . ASN A 1 34  ? -0.674  -6.019  3.739   1.00 15.00 ?  76  ASN A HB2  4  
ATOM   10576  H  HB3  . ASN A 1 34  ? -2.180  -5.739  4.600   1.00 15.00 ?  76  ASN A HB3  4  
ATOM   10577  H  HD21 . ASN A 1 34  ? 0.130   -7.363  5.331   1.00 15.00 ?  76  ASN A HD21 4  
ATOM   10578  H  HD22 . ASN A 1 34  ? -0.481  -8.960  5.584   1.00 15.00 ?  76  ASN A HD22 4  
ATOM   10579  N  N    . GLY A 1 35  ? -3.700  -4.266  2.576   1.00 15.00 ?  77  GLY A N    4  
ATOM   10580  C  CA   . GLY A 1 35  ? -3.983  -2.874  2.296   1.00 15.00 ?  77  GLY A CA   4  
ATOM   10581  C  C    . GLY A 1 35  ? -4.643  -2.232  3.494   1.00 15.00 ?  77  GLY A C    4  
ATOM   10582  O  O    . GLY A 1 35  ? -4.947  -2.927  4.465   1.00 15.00 ?  77  GLY A O    4  
ATOM   10583  H  H    . GLY A 1 35  ? -4.342  -4.790  3.107   1.00 15.00 ?  77  GLY A H    4  
ATOM   10584  H  HA2  . GLY A 1 35  ? -3.058  -2.362  2.075   1.00 15.00 ?  77  GLY A HA2  4  
ATOM   10585  H  HA3  . GLY A 1 35  ? -4.645  -2.805  1.445   1.00 15.00 ?  77  GLY A HA3  4  
ATOM   10586  N  N    . LEU A 1 36  ? -4.894  -0.931  3.442   1.00 15.00 ?  78  LEU A N    4  
ATOM   10587  C  CA   . LEU A 1 36  ? -5.507  -0.248  4.575   1.00 15.00 ?  78  LEU A CA   4  
ATOM   10588  C  C    . LEU A 1 36  ? -6.790  0.475   4.190   1.00 15.00 ?  78  LEU A C    4  
ATOM   10589  O  O    . LEU A 1 36  ? -6.909  1.042   3.102   1.00 15.00 ?  78  LEU A O    4  
ATOM   10590  C  CB   . LEU A 1 36  ? -4.526  0.748   5.204   1.00 15.00 ?  78  LEU A CB   4  
ATOM   10591  C  CG   . LEU A 1 36  ? -3.399  0.128   6.039   1.00 15.00 ?  78  LEU A CG   4  
ATOM   10592  C  CD1  . LEU A 1 36  ? -2.444  1.207   6.528   1.00 15.00 ?  78  LEU A CD1  4  
ATOM   10593  C  CD2  . LEU A 1 36  ? -3.973  -0.645  7.221   1.00 15.00 ?  78  LEU A CD2  4  
ATOM   10594  H  H    . LEU A 1 36  ? -4.680  -0.424  2.628   1.00 15.00 ?  78  LEU A H    4  
ATOM   10595  H  HA   . LEU A 1 36  ? -5.754  -0.997  5.311   1.00 15.00 ?  78  LEU A HA   4  
ATOM   10596  H  HB2  . LEU A 1 36  ? -4.080  1.326   4.410   1.00 15.00 ?  78  LEU A HB2  4  
ATOM   10597  H  HB3  . LEU A 1 36  ? -5.087  1.414   5.841   1.00 15.00 ?  78  LEU A HB3  4  
ATOM   10598  H  HG   . LEU A 1 36  ? -2.837  -0.564  5.423   1.00 15.00 ?  78  LEU A HG   4  
ATOM   10599  H  HD11 . LEU A 1 36  ? -2.942  1.823   7.261   1.00 15.00 ?  78  LEU A HD11 4  
ATOM   10600  H  HD12 . LEU A 1 36  ? -2.137  1.819   5.692   1.00 15.00 ?  78  LEU A HD12 4  
ATOM   10601  H  HD13 . LEU A 1 36  ? -1.575  0.747   6.975   1.00 15.00 ?  78  LEU A HD13 4  
ATOM   10602  H  HD21 . LEU A 1 36  ? -3.169  -1.080  7.795   1.00 15.00 ?  78  LEU A HD21 4  
ATOM   10603  H  HD22 . LEU A 1 36  ? -4.622  -1.427  6.860   1.00 15.00 ?  78  LEU A HD22 4  
ATOM   10604  H  HD23 . LEU A 1 36  ? -4.536  0.029   7.849   1.00 15.00 ?  78  LEU A HD23 4  
ATOM   10605  N  N    . ILE A 1 37  ? -7.743  0.429   5.103   1.00 15.00 ?  79  ILE A N    4  
ATOM   10606  C  CA   . ILE A 1 37  ? -9.027  1.086   4.937   1.00 15.00 ?  79  ILE A CA   4  
ATOM   10607  C  C    . ILE A 1 37  ? -9.216  2.079   6.076   1.00 15.00 ?  79  ILE A C    4  
ATOM   10608  O  O    . ILE A 1 37  ? -9.308  1.683   7.242   1.00 15.00 ?  79  ILE A O    4  
ATOM   10609  C  CB   . ILE A 1 37  ? -10.195 0.074   4.944   1.00 15.00 ?  79  ILE A CB   4  
ATOM   10610  C  CG1  . ILE A 1 37  ? -9.994  -0.984  3.854   1.00 15.00 ?  79  ILE A CG1  4  
ATOM   10611  C  CG2  . ILE A 1 37  ? -11.524 0.794   4.751   1.00 15.00 ?  79  ILE A CG2  4  
ATOM   10612  C  CD1  . ILE A 1 37  ? -10.900 -2.193  3.985   1.00 15.00 ?  79  ILE A CD1  4  
ATOM   10613  H  H    . ILE A 1 37  ? -7.580  -0.084  5.930   1.00 15.00 ?  79  ILE A H    4  
ATOM   10614  H  HA   . ILE A 1 37  ? -9.018  1.610   3.995   1.00 15.00 ?  79  ILE A HA   4  
ATOM   10615  H  HB   . ILE A 1 37  ? -10.212 -0.413  5.908   1.00 15.00 ?  79  ILE A HB   4  
ATOM   10616  H  HG12 . ILE A 1 37  ? -10.186 -0.536  2.892   1.00 15.00 ?  79  ILE A HG12 4  
ATOM   10617  H  HG13 . ILE A 1 37  ? -8.969  -1.330  3.887   1.00 15.00 ?  79  ILE A HG13 4  
ATOM   10618  H  HG21 . ILE A 1 37  ? -11.654 1.528   5.532   1.00 15.00 ?  79  ILE A HG21 4  
ATOM   10619  H  HG22 . ILE A 1 37  ? -12.329 0.079   4.794   1.00 15.00 ?  79  ILE A HG22 4  
ATOM   10620  H  HG23 . ILE A 1 37  ? -11.531 1.286   3.789   1.00 15.00 ?  79  ILE A HG23 4  
ATOM   10621  H  HD11 . ILE A 1 37  ? -11.925 -1.897  3.814   1.00 15.00 ?  79  ILE A HD11 4  
ATOM   10622  H  HD12 . ILE A 1 37  ? -10.805 -2.607  4.977   1.00 15.00 ?  79  ILE A HD12 4  
ATOM   10623  H  HD13 . ILE A 1 37  ? -10.613 -2.937  3.255   1.00 15.00 ?  79  ILE A HD13 4  
ATOM   10624  N  N    . VAL A 1 38  ? -9.249  3.359   5.752   1.00 15.00 ?  80  VAL A N    4  
ATOM   10625  C  CA   . VAL A 1 38  ? -9.391  4.384   6.774   1.00 15.00 ?  80  VAL A CA   4  
ATOM   10626  C  C    . VAL A 1 38  ? -10.733 5.099   6.675   1.00 15.00 ?  80  VAL A C    4  
ATOM   10627  O  O    . VAL A 1 38  ? -11.161 5.502   5.596   1.00 15.00 ?  80  VAL A O    4  
ATOM   10628  C  CB   . VAL A 1 38  ? -8.246  5.422   6.679   1.00 15.00 ?  80  VAL A CB   4  
ATOM   10629  C  CG1  . VAL A 1 38  ? -8.319  6.439   7.811   1.00 15.00 ?  80  VAL A CG1  4  
ATOM   10630  C  CG2  . VAL A 1 38  ? -6.892  4.727   6.671   1.00 15.00 ?  80  VAL A CG2  4  
ATOM   10631  H  H    . VAL A 1 38  ? -9.190  3.625   4.804   1.00 15.00 ?  80  VAL A H    4  
ATOM   10632  H  HA   . VAL A 1 38  ? -9.329  3.899   7.736   1.00 15.00 ?  80  VAL A HA   4  
ATOM   10633  H  HB   . VAL A 1 38  ? -8.352  5.956   5.748   1.00 15.00 ?  80  VAL A HB   4  
ATOM   10634  H  HG11 . VAL A 1 38  ? -9.295  6.903   7.820   1.00 15.00 ?  80  VAL A HG11 4  
ATOM   10635  H  HG12 . VAL A 1 38  ? -7.564  7.198   7.662   1.00 15.00 ?  80  VAL A HG12 4  
ATOM   10636  H  HG13 . VAL A 1 38  ? -8.145  5.943   8.756   1.00 15.00 ?  80  VAL A HG13 4  
ATOM   10637  H  HG21 . VAL A 1 38  ? -6.116  5.454   6.467   1.00 15.00 ?  80  VAL A HG21 4  
ATOM   10638  H  HG22 . VAL A 1 38  ? -6.885  3.965   5.903   1.00 15.00 ?  80  VAL A HG22 4  
ATOM   10639  H  HG23 . VAL A 1 38  ? -6.714  4.273   7.633   1.00 15.00 ?  80  VAL A HG23 4  
ATOM   10640  N  N    . ARG A 1 39  ? -11.394 5.248   7.814   1.00 15.00 ?  81  ARG A N    4  
ATOM   10641  C  CA   . ARG A 1 39  ? -12.675 5.929   7.880   1.00 15.00 ?  81  ARG A CA   4  
ATOM   10642  C  C    . ARG A 1 39  ? -12.470 7.323   8.471   1.00 15.00 ?  81  ARG A C    4  
ATOM   10643  O  O    . ARG A 1 39  ? -12.364 7.481   9.687   1.00 15.00 ?  81  ARG A O    4  
ATOM   10644  C  CB   . ARG A 1 39  ? -13.657 5.114   8.733   1.00 15.00 ?  81  ARG A CB   4  
ATOM   10645  C  CG   . ARG A 1 39  ? -14.954 5.832   9.073   1.00 15.00 ?  81  ARG A CG   4  
ATOM   10646  C  CD   . ARG A 1 39  ? -15.783 5.029   10.064  1.00 15.00 ?  81  ARG A CD   4  
ATOM   10647  N  NE   . ARG A 1 39  ? -16.788 5.851   10.737  1.00 15.00 ?  81  ARG A NE   4  
ATOM   10648  C  CZ   . ARG A 1 39  ? -17.033 5.806   12.045  1.00 15.00 ?  81  ARG A CZ   4  
ATOM   10649  N  NH1  . ARG A 1 39  ? -16.343 4.987   12.832  1.00 15.00 1  81  ARG A NH1  4  
ATOM   10650  N  NH2  . ARG A 1 39  ? -17.983 6.566   12.564  1.00 15.00 ?  81  ARG A NH2  4  
ATOM   10651  H  H    . ARG A 1 39  ? -11.002 4.889   8.641   1.00 15.00 ?  81  ARG A H    4  
ATOM   10652  H  HA   . ARG A 1 39  ? -13.060 6.022   6.874   1.00 15.00 ?  81  ARG A HA   4  
ATOM   10653  H  HB2  . ARG A 1 39  ? -13.911 4.211   8.199   1.00 15.00 ?  81  ARG A HB2  4  
ATOM   10654  H  HB3  . ARG A 1 39  ? -13.170 4.845   9.659   1.00 15.00 ?  81  ARG A HB3  4  
ATOM   10655  H  HG2  . ARG A 1 39  ? -14.718 6.793   9.508   1.00 15.00 ?  81  ARG A HG2  4  
ATOM   10656  H  HG3  . ARG A 1 39  ? -15.526 5.975   8.166   1.00 15.00 ?  81  ARG A HG3  4  
ATOM   10657  H  HD2  . ARG A 1 39  ? -16.284 4.232   9.535   1.00 15.00 ?  81  ARG A HD2  4  
ATOM   10658  H  HD3  . ARG A 1 39  ? -15.121 4.605   10.807  1.00 15.00 ?  81  ARG A HD3  4  
ATOM   10659  H  HE   . ARG A 1 39  ? -17.307 6.475   10.181  1.00 15.00 ?  81  ARG A HE   4  
ATOM   10660  H  HH11 . ARG A 1 39  ? -16.540 4.960   13.851  1.00 15.00 ?  81  ARG A HH11 4  
ATOM   10661  H  HH12 . ARG A 1 39  ? -15.604 4.372   12.434  1.00 15.00 ?  81  ARG A HH12 4  
ATOM   10662  H  HH21 . ARG A 1 39  ? -18.179 6.536   13.589  1.00 15.00 ?  81  ARG A HH21 4  
ATOM   10663  H  HH22 . ARG A 1 39  ? -18.541 7.202   11.947  1.00 15.00 ?  81  ARG A HH22 4  
ATOM   10664  N  N    . ASP A 1 40  ? -12.383 8.321   7.610   1.00 15.00 ?  82  ASP A N    4  
ATOM   10665  C  CA   . ASP A 1 40  ? -12.177 9.696   8.050   1.00 15.00 ?  82  ASP A CA   4  
ATOM   10666  C  C    . ASP A 1 40  ? -13.492 10.462  8.036   1.00 15.00 ?  82  ASP A C    4  
ATOM   10667  O  O    . ASP A 1 40  ? -14.001 10.816  6.973   1.00 15.00 ?  82  ASP A O    4  
ATOM   10668  C  CB   . ASP A 1 40  ? -11.145 10.389  7.155   1.00 15.00 ?  82  ASP A CB   4  
ATOM   10669  C  CG   . ASP A 1 40  ? -10.944 11.848  7.519   1.00 15.00 ?  82  ASP A CG   4  
ATOM   10670  O  OD1  . ASP A 1 40  ? -10.826 12.157  8.725   1.00 15.00 ?  82  ASP A OD1  4  
ATOM   10671  O  OD2  . ASP A 1 40  ? -10.883 12.693  6.597   1.00 15.00 -1 82  ASP A OD2  4  
ATOM   10672  H  H    . ASP A 1 40  ? -12.471 8.134   6.650   1.00 15.00 ?  82  ASP A H    4  
ATOM   10673  H  HA   . ASP A 1 40  ? -11.801 9.667   9.060   1.00 15.00 ?  82  ASP A HA   4  
ATOM   10674  H  HB2  . ASP A 1 40  ? -10.199 9.878   7.252   1.00 15.00 ?  82  ASP A HB2  4  
ATOM   10675  H  HB3  . ASP A 1 40  ? -11.475 10.334  6.127   1.00 15.00 ?  82  ASP A HB3  4  
ATOM   10676  N  N    . GLY A 1 41  ? -14.049 10.699  9.216   1.00 15.00 ?  83  GLY A N    4  
ATOM   10677  C  CA   . GLY A 1 41  ? -15.305 11.417  9.311   1.00 15.00 ?  83  GLY A CA   4  
ATOM   10678  C  C    . GLY A 1 41  ? -16.457 10.632  8.726   1.00 15.00 ?  83  GLY A C    4  
ATOM   10679  O  O    . GLY A 1 41  ? -16.814 9.566   9.230   1.00 15.00 ?  83  GLY A O    4  
ATOM   10680  H  H    . GLY A 1 41  ? -13.605 10.382  10.030  1.00 15.00 ?  83  GLY A H    4  
ATOM   10681  H  HA2  . GLY A 1 41  ? -15.515 11.627  10.349  1.00 15.00 ?  83  GLY A HA2  4  
ATOM   10682  H  HA3  . GLY A 1 41  ? -15.212 12.353  8.778   1.00 15.00 ?  83  GLY A HA3  4  
ATOM   10683  N  N    . GLY A 1 42  ? -17.033 11.151  7.653   1.00 15.00 ?  84  GLY A N    4  
ATOM   10684  C  CA   . GLY A 1 42  ? -18.143 10.479  7.005   1.00 15.00 ?  84  GLY A CA   4  
ATOM   10685  C  C    . GLY A 1 42  ? -17.782 10.002  5.617   1.00 15.00 ?  84  GLY A C    4  
ATOM   10686  O  O    . GLY A 1 42  ? -18.649 9.856   4.753   1.00 15.00 ?  84  GLY A O    4  
ATOM   10687  H  H    . GLY A 1 42  ? -16.704 12.000  7.293   1.00 15.00 ?  84  GLY A H    4  
ATOM   10688  H  HA2  . GLY A 1 42  ? -18.435 9.629   7.601   1.00 15.00 ?  84  GLY A HA2  4  
ATOM   10689  H  HA3  . GLY A 1 42  ? -18.977 11.163  6.935   1.00 15.00 ?  84  GLY A HA3  4  
ATOM   10690  N  N    . ARG A 1 43  ? -16.499 9.756   5.404   1.00 15.00 ?  85  ARG A N    4  
ATOM   10691  C  CA   . ARG A 1 43  ? -16.005 9.297   4.116   1.00 15.00 ?  85  ARG A CA   4  
ATOM   10692  C  C    . ARG A 1 43  ? -14.991 8.179   4.321   1.00 15.00 ?  85  ARG A C    4  
ATOM   10693  O  O    . ARG A 1 43  ? -14.388 8.063   5.391   1.00 15.00 ?  85  ARG A O    4  
ATOM   10694  C  CB   . ARG A 1 43  ? -15.361 10.457  3.350   1.00 15.00 ?  85  ARG A CB   4  
ATOM   10695  C  CG   . ARG A 1 43  ? -14.046 10.913  3.960   1.00 15.00 ?  85  ARG A CG   4  
ATOM   10696  C  CD   . ARG A 1 43  ? -13.578 12.239  3.398   1.00 15.00 ?  85  ARG A CD   4  
ATOM   10697  N  NE   . ARG A 1 43  ? -12.356 12.688  4.062   1.00 15.00 ?  85  ARG A NE   4  
ATOM   10698  C  CZ   . ARG A 1 43  ? -11.297 13.181  3.428   1.00 15.00 ?  85  ARG A CZ   4  
ATOM   10699  N  NH1  . ARG A 1 43  ? -11.298 13.297  2.105   1.00 15.00 1  85  ARG A NH1  4  
ATOM   10700  N  NH2  . ARG A 1 43  ? -10.230 13.541  4.129   1.00 15.00 ?  85  ARG A NH2  4  
ATOM   10701  H  H    . ARG A 1 43  ? -15.861 9.880   6.142   1.00 15.00 ?  85  ARG A H    4  
ATOM   10702  H  HA   . ARG A 1 43  ? -16.841 8.917   3.550   1.00 15.00 ?  85  ARG A HA   4  
ATOM   10703  H  HB2  . ARG A 1 43  ? -15.179 10.149  2.330   1.00 15.00 ?  85  ARG A HB2  4  
ATOM   10704  H  HB3  . ARG A 1 43  ? -16.043 11.296  3.347   1.00 15.00 ?  85  ARG A HB3  4  
ATOM   10705  H  HG2  . ARG A 1 43  ? -14.176 11.016  5.028   1.00 15.00 ?  85  ARG A HG2  4  
ATOM   10706  H  HG3  . ARG A 1 43  ? -13.292 10.165  3.762   1.00 15.00 ?  85  ARG A HG3  4  
ATOM   10707  H  HD2  . ARG A 1 43  ? -13.384 12.118  2.342   1.00 15.00 ?  85  ARG A HD2  4  
ATOM   10708  H  HD3  . ARG A 1 43  ? -14.353 12.975  3.546   1.00 15.00 ?  85  ARG A HD3  4  
ATOM   10709  H  HE   . ARG A 1 43  ? -12.321 12.614  5.047   1.00 15.00 ?  85  ARG A HE   4  
ATOM   10710  H  HH11 . ARG A 1 43  ? -12.132 13.013  1.553   1.00 15.00 ?  85  ARG A HH11 4  
ATOM   10711  H  HH12 . ARG A 1 43  ? -10.457 13.679  1.609   1.00 15.00 ?  85  ARG A HH12 4  
ATOM   10712  H  HH21 . ARG A 1 43  ? -10.233 13.432  5.177   1.00 15.00 ?  85  ARG A HH21 4  
ATOM   10713  H  HH22 . ARG A 1 43  ? -9.389  13.929  3.652   1.00 15.00 ?  85  ARG A HH22 4  
ATOM   10714  N  N    . VAL A 1 44  ? -14.809 7.355   3.304   1.00 15.00 ?  86  VAL A N    4