data_6TX0
# 
_entry.id   6TX0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6TX0         
WWPDB D_1292106127 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6TX0 
_pdbx_database_status.recvd_initial_deposition_date   2020-01-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Morris, E.R.'   1 0000-0003-1893-7515 
'Kunzelmann, S.' 2 0000-0002-2678-0549 
'Caswell, S.J.'  3 0000-0003-1590-2106 
'Arnold, L.H.'   4 0000-0001-6785-1035 
'Purkiss, A.G.'  5 0000-0002-5931-3509 
'Kelly, G.'      6 0000-0002-1149-0717 
'Taylor, I.A.'   7 0000-0002-6763-3852 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            11 
_citation.language                  ? 
_citation.page_first                3165 
_citation.page_last                 3165 
_citation.title                     
'Crystal structures of SAMHD1 inhibitor complexes reveal the mechanism of water-mediated dNTP hydrolysis.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-020-16983-2 
_citation.pdbx_database_id_PubMed   32576829 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Morris, E.R.'   1 ? 
primary 'Caswell, S.J.'  2 ? 
primary 'Kunzelmann, S.' 3 ? 
primary 'Arnold, L.H.'   4 ? 
primary 'Purkiss, A.G.'  5 ? 
primary 'Kelly, G.'      6 ? 
primary 'Taylor, I.A.'   7 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6TX0 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     105.924 
_cell.length_a_esd                 ? 
_cell.length_b                     105.924 
_cell.length_b_esd                 ? 
_cell.length_c                     198.073 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        16 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6TX0 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Deoxynucleoside triphosphate triphosphohydrolase SAMHD1' 60207.816 2   3.1.5.- D137N ? ? 
2 non-polymer syn 'FE (III) ION' 55.845    2   ?       ?     ? ? 
3 non-polymer syn 'MAGNESIUM ION' 24.305    6   ?       ?     ? ? 
4 non-polymer syn "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]adenosine" 490.197   4   ? ? ? 
? 
5 non-polymer syn 
;[[(2~{R},3~{S},4~{R},5~{R})-5-[2,6-bis(oxidanylidene)-3~{H}-purin-9-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate
;
524.165   2   ?       ?     ? ? 
6 water       nat water 18.015    128 ?       ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;dNTPase,Dendritic cell-derived IFNG-induced protein,DCIP,Monocyte protein 5,MOP-5,SAM domain and HD domain-containing protein 1,hSAMHD1
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSQIHVDTMKVINDPIHGHIELHPLLVRIINTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVHALGEKQ
PELQISERDVLCVQIAGLCHDLGHGPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGIKPVMEQYGLIPEEDIC
FIKEQIVGPLESPVEDSLWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKFARVCEVDNE
LRICARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGGKKYRISTAIDDMEAYTKLTDNI
FLEILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKREDYESLPKEVASAKPKVLLDVKLKAEDFIVDVINMD
YGMQEKNPIDHVSFYCKTAPNRAIRITKNQVSQLLPEKFAEQLIRVYCKKVDRKSLYAARQYFVQWCADRNFTKPQDGDV
IAPLITPQKKEWNDSTSVQNPTRLREASKSRVQLFKDDPM
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSQIHVDTMKVINDPIHGHIELHPLLVRIINTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVHALGEKQ
PELQISERDVLCVQIAGLCHDLGHGPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGIKPVMEQYGLIPEEDIC
FIKEQIVGPLESPVEDSLWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKFARVCEVDNE
LRICARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGGKKYRISTAIDDMEAYTKLTDNI
FLEILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKREDYESLPKEVASAKPKVLLDVKLKAEDFIVDVINMD
YGMQEKNPIDHVSFYCKTAPNRAIRITKNQVSQLLPEKFAEQLIRVYCKKVDRKSLYAARQYFVQWCADRNFTKPQDGDV
IAPLITPQKKEWNDSTSVQNPTRLREASKSRVQLFKDDPM
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   GLN n 
1 4   ILE n 
1 5   HIS n 
1 6   VAL n 
1 7   ASP n 
1 8   THR n 
1 9   MET n 
1 10  LYS n 
1 11  VAL n 
1 12  ILE n 
1 13  ASN n 
1 14  ASP n 
1 15  PRO n 
1 16  ILE n 
1 17  HIS n 
1 18  GLY n 
1 19  HIS n 
1 20  ILE n 
1 21  GLU n 
1 22  LEU n 
1 23  HIS n 
1 24  PRO n 
1 25  LEU n 
1 26  LEU n 
1 27  VAL n 
1 28  ARG n 
1 29  ILE n 
1 30  ILE n 
1 31  ASN n 
1 32  THR n 
1 33  PRO n 
1 34  GLN n 
1 35  PHE n 
1 36  GLN n 
1 37  ARG n 
1 38  LEU n 
1 39  ARG n 
1 40  TYR n 
1 41  ILE n 
1 42  LYS n 
1 43  GLN n 
1 44  LEU n 
1 45  GLY n 
1 46  GLY n 
1 47  GLY n 
1 48  TYR n 
1 49  TYR n 
1 50  VAL n 
1 51  PHE n 
1 52  PRO n 
1 53  GLY n 
1 54  ALA n 
1 55  SER n 
1 56  HIS n 
1 57  ASN n 
1 58  ARG n 
1 59  PHE n 
1 60  GLU n 
1 61  HIS n 
1 62  SER n 
1 63  LEU n 
1 64  GLY n 
1 65  VAL n 
1 66  GLY n 
1 67  TYR n 
1 68  LEU n 
1 69  ALA n 
1 70  GLY n 
1 71  CYS n 
1 72  LEU n 
1 73  VAL n 
1 74  HIS n 
1 75  ALA n 
1 76  LEU n 
1 77  GLY n 
1 78  GLU n 
1 79  LYS n 
1 80  GLN n 
1 81  PRO n 
1 82  GLU n 
1 83  LEU n 
1 84  GLN n 
1 85  ILE n 
1 86  SER n 
1 87  GLU n 
1 88  ARG n 
1 89  ASP n 
1 90  VAL n 
1 91  LEU n 
1 92  CYS n 
1 93  VAL n 
1 94  GLN n 
1 95  ILE n 
1 96  ALA n 
1 97  GLY n 
1 98  LEU n 
1 99  CYS n 
1 100 HIS n 
1 101 ASP n 
1 102 LEU n 
1 103 GLY n 
1 104 HIS n 
1 105 GLY n 
1 106 PRO n 
1 107 PHE n 
1 108 SER n 
1 109 HIS n 
1 110 MET n 
1 111 PHE n 
1 112 ASP n 
1 113 GLY n 
1 114 ARG n 
1 115 PHE n 
1 116 ILE n 
1 117 PRO n 
1 118 LEU n 
1 119 ALA n 
1 120 ARG n 
1 121 PRO n 
1 122 GLU n 
1 123 VAL n 
1 124 LYS n 
1 125 TRP n 
1 126 THR n 
1 127 HIS n 
1 128 GLU n 
1 129 GLN n 
1 130 GLY n 
1 131 SER n 
1 132 VAL n 
1 133 MET n 
1 134 MET n 
1 135 PHE n 
1 136 GLU n 
1 137 HIS n 
1 138 LEU n 
1 139 ILE n 
1 140 ASN n 
1 141 SER n 
1 142 ASN n 
1 143 GLY n 
1 144 ILE n 
1 145 LYS n 
1 146 PRO n 
1 147 VAL n 
1 148 MET n 
1 149 GLU n 
1 150 GLN n 
1 151 TYR n 
1 152 GLY n 
1 153 LEU n 
1 154 ILE n 
1 155 PRO n 
1 156 GLU n 
1 157 GLU n 
1 158 ASP n 
1 159 ILE n 
1 160 CYS n 
1 161 PHE n 
1 162 ILE n 
1 163 LYS n 
1 164 GLU n 
1 165 GLN n 
1 166 ILE n 
1 167 VAL n 
1 168 GLY n 
1 169 PRO n 
1 170 LEU n 
1 171 GLU n 
1 172 SER n 
1 173 PRO n 
1 174 VAL n 
1 175 GLU n 
1 176 ASP n 
1 177 SER n 
1 178 LEU n 
1 179 TRP n 
1 180 PRO n 
1 181 TYR n 
1 182 LYS n 
1 183 GLY n 
1 184 ARG n 
1 185 PRO n 
1 186 GLU n 
1 187 ASN n 
1 188 LYS n 
1 189 SER n 
1 190 PHE n 
1 191 LEU n 
1 192 TYR n 
1 193 GLU n 
1 194 ILE n 
1 195 VAL n 
1 196 SER n 
1 197 ASN n 
1 198 LYS n 
1 199 ARG n 
1 200 ASN n 
1 201 GLY n 
1 202 ILE n 
1 203 ASP n 
1 204 VAL n 
1 205 ASP n 
1 206 LYS n 
1 207 TRP n 
1 208 ASP n 
1 209 TYR n 
1 210 PHE n 
1 211 ALA n 
1 212 ARG n 
1 213 ASP n 
1 214 CYS n 
1 215 HIS n 
1 216 HIS n 
1 217 LEU n 
1 218 GLY n 
1 219 ILE n 
1 220 GLN n 
1 221 ASN n 
1 222 ASN n 
1 223 PHE n 
1 224 ASP n 
1 225 TYR n 
1 226 LYS n 
1 227 ARG n 
1 228 PHE n 
1 229 ILE n 
1 230 LYS n 
1 231 PHE n 
1 232 ALA n 
1 233 ARG n 
1 234 VAL n 
1 235 CYS n 
1 236 GLU n 
1 237 VAL n 
1 238 ASP n 
1 239 ASN n 
1 240 GLU n 
1 241 LEU n 
1 242 ARG n 
1 243 ILE n 
1 244 CYS n 
1 245 ALA n 
1 246 ARG n 
1 247 ASP n 
1 248 LYS n 
1 249 GLU n 
1 250 VAL n 
1 251 GLY n 
1 252 ASN n 
1 253 LEU n 
1 254 TYR n 
1 255 ASP n 
1 256 MET n 
1 257 PHE n 
1 258 HIS n 
1 259 THR n 
1 260 ARG n 
1 261 ASN n 
1 262 SER n 
1 263 LEU n 
1 264 HIS n 
1 265 ARG n 
1 266 ARG n 
1 267 ALA n 
1 268 TYR n 
1 269 GLN n 
1 270 HIS n 
1 271 LYS n 
1 272 VAL n 
1 273 GLY n 
1 274 ASN n 
1 275 ILE n 
1 276 ILE n 
1 277 ASP n 
1 278 THR n 
1 279 MET n 
1 280 ILE n 
1 281 THR n 
1 282 ASP n 
1 283 ALA n 
1 284 PHE n 
1 285 LEU n 
1 286 LYS n 
1 287 ALA n 
1 288 ASP n 
1 289 ASP n 
1 290 TYR n 
1 291 ILE n 
1 292 GLU n 
1 293 ILE n 
1 294 THR n 
1 295 GLY n 
1 296 ALA n 
1 297 GLY n 
1 298 GLY n 
1 299 LYS n 
1 300 LYS n 
1 301 TYR n 
1 302 ARG n 
1 303 ILE n 
1 304 SER n 
1 305 THR n 
1 306 ALA n 
1 307 ILE n 
1 308 ASP n 
1 309 ASP n 
1 310 MET n 
1 311 GLU n 
1 312 ALA n 
1 313 TYR n 
1 314 THR n 
1 315 LYS n 
1 316 LEU n 
1 317 THR n 
1 318 ASP n 
1 319 ASN n 
1 320 ILE n 
1 321 PHE n 
1 322 LEU n 
1 323 GLU n 
1 324 ILE n 
1 325 LEU n 
1 326 TYR n 
1 327 SER n 
1 328 THR n 
1 329 ASP n 
1 330 PRO n 
1 331 LYS n 
1 332 LEU n 
1 333 LYS n 
1 334 ASP n 
1 335 ALA n 
1 336 ARG n 
1 337 GLU n 
1 338 ILE n 
1 339 LEU n 
1 340 LYS n 
1 341 GLN n 
1 342 ILE n 
1 343 GLU n 
1 344 TYR n 
1 345 ARG n 
1 346 ASN n 
1 347 LEU n 
1 348 PHE n 
1 349 LYS n 
1 350 TYR n 
1 351 VAL n 
1 352 GLY n 
1 353 GLU n 
1 354 THR n 
1 355 GLN n 
1 356 PRO n 
1 357 THR n 
1 358 GLY n 
1 359 GLN n 
1 360 ILE n 
1 361 LYS n 
1 362 ILE n 
1 363 LYS n 
1 364 ARG n 
1 365 GLU n 
1 366 ASP n 
1 367 TYR n 
1 368 GLU n 
1 369 SER n 
1 370 LEU n 
1 371 PRO n 
1 372 LYS n 
1 373 GLU n 
1 374 VAL n 
1 375 ALA n 
1 376 SER n 
1 377 ALA n 
1 378 LYS n 
1 379 PRO n 
1 380 LYS n 
1 381 VAL n 
1 382 LEU n 
1 383 LEU n 
1 384 ASP n 
1 385 VAL n 
1 386 LYS n 
1 387 LEU n 
1 388 LYS n 
1 389 ALA n 
1 390 GLU n 
1 391 ASP n 
1 392 PHE n 
1 393 ILE n 
1 394 VAL n 
1 395 ASP n 
1 396 VAL n 
1 397 ILE n 
1 398 ASN n 
1 399 MET n 
1 400 ASP n 
1 401 TYR n 
1 402 GLY n 
1 403 MET n 
1 404 GLN n 
1 405 GLU n 
1 406 LYS n 
1 407 ASN n 
1 408 PRO n 
1 409 ILE n 
1 410 ASP n 
1 411 HIS n 
1 412 VAL n 
1 413 SER n 
1 414 PHE n 
1 415 TYR n 
1 416 CYS n 
1 417 LYS n 
1 418 THR n 
1 419 ALA n 
1 420 PRO n 
1 421 ASN n 
1 422 ARG n 
1 423 ALA n 
1 424 ILE n 
1 425 ARG n 
1 426 ILE n 
1 427 THR n 
1 428 LYS n 
1 429 ASN n 
1 430 GLN n 
1 431 VAL n 
1 432 SER n 
1 433 GLN n 
1 434 LEU n 
1 435 LEU n 
1 436 PRO n 
1 437 GLU n 
1 438 LYS n 
1 439 PHE n 
1 440 ALA n 
1 441 GLU n 
1 442 GLN n 
1 443 LEU n 
1 444 ILE n 
1 445 ARG n 
1 446 VAL n 
1 447 TYR n 
1 448 CYS n 
1 449 LYS n 
1 450 LYS n 
1 451 VAL n 
1 452 ASP n 
1 453 ARG n 
1 454 LYS n 
1 455 SER n 
1 456 LEU n 
1 457 TYR n 
1 458 ALA n 
1 459 ALA n 
1 460 ARG n 
1 461 GLN n 
1 462 TYR n 
1 463 PHE n 
1 464 VAL n 
1 465 GLN n 
1 466 TRP n 
1 467 CYS n 
1 468 ALA n 
1 469 ASP n 
1 470 ARG n 
1 471 ASN n 
1 472 PHE n 
1 473 THR n 
1 474 LYS n 
1 475 PRO n 
1 476 GLN n 
1 477 ASP n 
1 478 GLY n 
1 479 ASP n 
1 480 VAL n 
1 481 ILE n 
1 482 ALA n 
1 483 PRO n 
1 484 LEU n 
1 485 ILE n 
1 486 THR n 
1 487 PRO n 
1 488 GLN n 
1 489 LYS n 
1 490 LYS n 
1 491 GLU n 
1 492 TRP n 
1 493 ASN n 
1 494 ASP n 
1 495 SER n 
1 496 THR n 
1 497 SER n 
1 498 VAL n 
1 499 GLN n 
1 500 ASN n 
1 501 PRO n 
1 502 THR n 
1 503 ARG n 
1 504 LEU n 
1 505 ARG n 
1 506 GLU n 
1 507 ALA n 
1 508 SER n 
1 509 LYS n 
1 510 SER n 
1 511 ARG n 
1 512 VAL n 
1 513 GLN n 
1 514 LEU n 
1 515 PHE n 
1 516 LYS n 
1 517 ASP n 
1 518 ASP n 
1 519 PRO n 
1 520 MET n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   520 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'SAMHD1, MOP5' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              Rosetta2 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SAMH1_HUMAN 
_struct_ref.pdbx_db_accession          Q9Y3Z3 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;QIHVDTMKVINDPIHGHIELHPLLVRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVHALGEKQPE
LQISERDVLCVQIAGLCHDLGHGPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGIKPVMEQYGLIPEEDICFI
KEQIVGPLESPVEDSLWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKFARVCEVDNELR
ICARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGGKKYRISTAIDDMEAYTKLTDNIFL
EILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKREDYESLPKEVASAKPKVLLDVKLKAEDFIVDVINMDYG
MQEKNPIDHVSFYCKTAPNRAIRITKNQVSQLLPEKFAEQLIRVYCKKVDRKSLYAARQYFVQWCADRNFTKPQDGDVIA
PLITPQKKEWNDSTSVQNPTRLREASKSRVQLFKDDPM
;
_struct_ref.pdbx_align_begin           109 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6TX0 A 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
2 1 6TX0 B 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6TX0 GLY A 1  ? UNP Q9Y3Z3 ?   ?   'expression tag'      107 1 
1 6TX0 SER A 2  ? UNP Q9Y3Z3 ?   ?   'expression tag'      108 2 
1 6TX0 ASN A 31 ? UNP Q9Y3Z3 ASP 137 'engineered mutation' 137 3 
2 6TX0 GLY B 1  ? UNP Q9Y3Z3 ?   ?   'expression tag'      107 4 
2 6TX0 SER B 2  ? UNP Q9Y3Z3 ?   ?   'expression tag'      108 5 
2 6TX0 ASN B 31 ? UNP Q9Y3Z3 ASP 137 'engineered mutation' 137 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'      121.158 
CZF non-polymer         . 
;[[(2~{R},3~{S},4~{R},5~{R})-5-[2,6-bis(oxidanylidene)-3~{H}-purin-9-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate
;
? 'C10 H15 N4 O15 P3' 524.165 
DZ4 non-polymer         . "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]adenosine" ? 
'C10 H17 N6 O11 P3' 490.197 
FE  non-polymer         . 'FE (III) ION' ? 'Fe 3'              55.845  
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6TX0 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.31 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         46.80 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M Bistris methane-HCl pH 6, 16% (w/v) PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-01-16 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.92819 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I04-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.92819 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I04-1 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            36.1 
_reflns.entry_id                         6TX0 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.006 
_reflns.d_resolution_low                 72.342 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       45483 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             95.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  9.3 
_reflns.pdbx_Rmerge_I_obs                0.113 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            14.3 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.120 
_reflns.pdbx_Rpim_I_all                  0.039 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.999 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_CC_star 
_reflns_shell.pdbx_R_split 
2.006 2.256  ? 2.0  ? ? ? ? 2274 78.8  ? ? ? ? 1.190 ? ? ? ? ? ? ? ? 8.9 ? ? ? ? 1.264 0.421 ? 1 1 0.674 ? ? 
6.708 72.342 ? 46.7 ? ? ? ? 2274 100.0 ? ? ? ? 0.026 ? ? ? ? ? ? ? ? 8.3 ? ? ? ? 0.028 0.009 ? 2 1 1.000 ? ? 
# 
_refine.aniso_B[1][1]                            -0.3200 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            -0.3200 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            0.6400 
_refine.B_iso_max                                158.080 
_refine.B_iso_mean                               43.4430 
_refine.B_iso_min                                17.450 
_refine.correlation_coeff_Fo_to_Fc               0.9580 
_refine.correlation_coeff_Fo_to_Fc_free          0.9320 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : WITH TLS ADDED' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6TX0 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.010 
_refine.ls_d_res_low                             72.310 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     43168 
_refine.ls_number_reflns_R_free                  2306 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    60.1500 
_refine.ls_percent_reflns_R_free                 5.1000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1859 
_refine.ls_R_factor_R_free                       0.2281 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1836 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4bzc 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.3800 
_refine.pdbx_overall_ESU_R_Free                  0.2390 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             13.3970 
_refine.overall_SU_ML                            0.1610 
_refine.overall_SU_R_Cruickshank_DPI             0.3802 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.010 
_refine_hist.d_res_low                        72.310 
_refine_hist.number_atoms_solvent             128 
_refine_hist.number_atoms_total               8040 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       957 
_refine_hist.pdbx_B_iso_mean_ligand           28.85 
_refine_hist.pdbx_B_iso_mean_solvent          35.26 
_refine_hist.pdbx_number_atoms_protein        7720 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         192 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.020  0.019  8102  ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  7336  ? r_bond_other_d         ? ? 
'X-RAY DIFFRACTION' ? 2.024  1.952  11007 ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 1.119  2.988  17013 ? r_angle_other_deg      ? ? 
'X-RAY DIFFRACTION' ? 6.147  5.000  953   ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 38.705 23.878 392   ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 15.699 15.000 1369  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 19.214 15.000 53    ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.115  0.200  1188  ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.010  0.021  8886  ? r_gen_planes_refined   ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  1665  ? r_gen_planes_other     ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
_refine_ls_restr_ncs.pdbx_ens_id 
'X-RAY DIFFRACTION' 1 ? ? 0.070 ? 0.050 1 'interatomic distance' ? A 30790 ? ? 1 
'X-RAY DIFFRACTION' 2 ? ? 0.070 ? 0.050 2 'interatomic distance' ? B 30790 ? ? 1 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.0100 
_refine_ls_shell.d_res_low                        2.0620 
_refine_ls_shell.number_reflns_all                291 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             17 
_refine_ls_shell.number_reflns_R_work             274 
_refine_ls_shell.percent_reflns_obs               5.3300 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.3770 
_refine_ls_shell.R_factor_R_free_error            0.0000 
_refine_ls_shell.R_factor_R_work                  0.3280 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_R_complete                  ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 0 0 A 114 A 599 ? ? ? ? ? ? ? ? ? 
1 2 0 0 B 114 B 599 ? ? ? ? ? ? ? ? ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                     6TX0 
_struct.title                        
'Crystal structure of tetrameric human D137N-SAMHD1 (residues 109-626) with XTP, dAMPNPP and Mg' 
_struct.pdbx_descriptor              'Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 (E.C.3.1.5.-)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6TX0 
_struct_keywords.text            'triphosphohydrolase, metallo-enzyme, binuclear, HD, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 4 ? 
J N N 4 ? 
K N N 2 ? 
L N N 3 ? 
M N N 3 ? 
N N N 3 ? 
O N N 4 ? 
P N N 5 ? 
Q N N 6 ? 
R N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 HIS A 23  ? ASN A 31  ? HIS A 129 ASN A 137 1 ? 9  
HELX_P HELX_P2  AA2 THR A 32  ? ARG A 37  ? THR A 138 ARG A 143 1 ? 6  
HELX_P HELX_P3  AA3 LEU A 38  ? ILE A 41  ? LEU A 144 ILE A 147 5 ? 4  
HELX_P HELX_P4  AA4 LEU A 44  ? VAL A 50  ? LEU A 150 VAL A 156 5 ? 7  
HELX_P HELX_P5  AA5 ASN A 57  ? GLN A 80  ? ASN A 163 GLN A 186 1 ? 24 
HELX_P HELX_P6  AA6 PRO A 81  ? GLN A 84  ? PRO A 187 GLN A 190 5 ? 4  
HELX_P HELX_P7  AA7 SER A 86  ? HIS A 100 ? SER A 192 HIS A 206 1 ? 15 
HELX_P HELX_P8  AA8 SER A 108 ? ARG A 114 ? SER A 214 ARG A 220 1 ? 7  
HELX_P HELX_P9  AA9 ARG A 114 ? ARG A 120 ? ARG A 220 ARG A 226 1 ? 7  
HELX_P HELX_P10 AB1 THR A 126 ? ASN A 142 ? THR A 232 ASN A 248 1 ? 17 
HELX_P HELX_P11 AB2 GLY A 143 ? TYR A 151 ? GLY A 249 TYR A 257 1 ? 9  
HELX_P HELX_P12 AB3 ILE A 154 ? GLY A 168 ? ILE A 260 GLY A 274 1 ? 15 
HELX_P HELX_P13 AB4 PRO A 185 ? ILE A 194 ? PRO A 291 ILE A 300 5 ? 10 
HELX_P HELX_P14 AB5 ASP A 203 ? GLY A 218 ? ASP A 309 GLY A 324 1 ? 16 
HELX_P HELX_P15 AB6 ASP A 224 ? PHE A 231 ? ASP A 330 PHE A 337 1 ? 8  
HELX_P HELX_P16 AB7 GLU A 249 ? ALA A 267 ? GLU A 355 ALA A 373 1 ? 19 
HELX_P HELX_P17 AB8 HIS A 270 ? LYS A 286 ? HIS A 376 LYS A 392 1 ? 17 
HELX_P HELX_P18 AB9 ALA A 287 ? ILE A 291 ? ALA A 393 ILE A 397 5 ? 5  
HELX_P HELX_P19 AC1 ALA A 296 ? GLY A 298 ? ALA A 402 GLY A 404 5 ? 3  
HELX_P HELX_P20 AC2 THR A 305 ? ASP A 308 ? THR A 411 ASP A 414 5 ? 4  
HELX_P HELX_P21 AC3 ASP A 309 ? THR A 314 ? ASP A 415 THR A 420 1 ? 6  
HELX_P HELX_P22 AC4 LYS A 315 ? THR A 317 ? LYS A 421 THR A 423 5 ? 3  
HELX_P HELX_P23 AC5 ASP A 318 ? SER A 327 ? ASP A 424 SER A 433 1 ? 10 
HELX_P HELX_P24 AC6 ASP A 329 ? LYS A 331 ? ASP A 435 LYS A 437 5 ? 3  
HELX_P HELX_P25 AC7 LEU A 332 ? TYR A 344 ? LEU A 438 TYR A 450 1 ? 13 
HELX_P HELX_P26 AC8 LYS A 363 ? GLU A 368 ? LYS A 469 GLU A 474 5 ? 6  
HELX_P HELX_P27 AC9 SER A 369 ? SER A 376 ? SER A 475 SER A 482 1 ? 8  
HELX_P HELX_P28 AD1 LYS A 388 ? GLU A 390 ? LYS A 494 GLU A 496 5 ? 3  
HELX_P HELX_P29 AD2 ASN A 407 ? VAL A 412 ? ASN A 513 VAL A 518 5 ? 6  
HELX_P HELX_P30 AD3 THR A 427 ? VAL A 431 ? THR A 533 VAL A 537 5 ? 5  
HELX_P HELX_P31 AD4 ASP A 452 ? ARG A 470 ? ASP A 558 ARG A 576 1 ? 19 
HELX_P HELX_P32 AD5 ASP A 477 ? ALA A 482 ? ASP A 583 ALA A 588 1 ? 6  
HELX_P HELX_P33 AD6 ILE A 485 ? ASN A 493 ? ILE A 591 ASN A 599 5 ? 9  
HELX_P HELX_P34 AD7 HIS B 23  ? ASN B 31  ? HIS B 129 ASN B 137 1 ? 9  
HELX_P HELX_P35 AD8 THR B 32  ? ARG B 37  ? THR B 138 ARG B 143 1 ? 6  
HELX_P HELX_P36 AD9 LEU B 38  ? ILE B 41  ? LEU B 144 ILE B 147 5 ? 4  
HELX_P HELX_P37 AE1 LEU B 44  ? VAL B 50  ? LEU B 150 VAL B 156 5 ? 7  
HELX_P HELX_P38 AE2 ASN B 57  ? GLN B 80  ? ASN B 163 GLN B 186 1 ? 24 
HELX_P HELX_P39 AE3 PRO B 81  ? GLN B 84  ? PRO B 187 GLN B 190 5 ? 4  
HELX_P HELX_P40 AE4 SER B 86  ? HIS B 100 ? SER B 192 HIS B 206 1 ? 15 
HELX_P HELX_P41 AE5 SER B 108 ? ARG B 114 ? SER B 214 ARG B 220 1 ? 7  
HELX_P HELX_P42 AE6 ARG B 114 ? ARG B 120 ? ARG B 220 ARG B 226 1 ? 7  
HELX_P HELX_P43 AE7 THR B 126 ? ASN B 142 ? THR B 232 ASN B 248 1 ? 17 
HELX_P HELX_P44 AE8 GLY B 143 ? TYR B 151 ? GLY B 249 TYR B 257 1 ? 9  
HELX_P HELX_P45 AE9 ILE B 154 ? GLY B 168 ? ILE B 260 GLY B 274 1 ? 15 
HELX_P HELX_P46 AF1 PRO B 185 ? ILE B 194 ? PRO B 291 ILE B 300 5 ? 10 
HELX_P HELX_P47 AF2 ASP B 203 ? GLY B 218 ? ASP B 309 GLY B 324 1 ? 16 
HELX_P HELX_P48 AF3 ASP B 224 ? PHE B 231 ? ASP B 330 PHE B 337 1 ? 8  
HELX_P HELX_P49 AF4 GLU B 249 ? ALA B 267 ? GLU B 355 ALA B 373 1 ? 19 
HELX_P HELX_P50 AF5 HIS B 270 ? LYS B 286 ? HIS B 376 LYS B 392 1 ? 17 
HELX_P HELX_P51 AF6 ALA B 296 ? GLY B 298 ? ALA B 402 GLY B 404 5 ? 3  
HELX_P HELX_P52 AF7 THR B 305 ? ASP B 308 ? THR B 411 ASP B 414 5 ? 4  
HELX_P HELX_P53 AF8 ASP B 309 ? THR B 314 ? ASP B 415 THR B 420 1 ? 6  
HELX_P HELX_P54 AF9 LYS B 315 ? THR B 317 ? LYS B 421 THR B 423 5 ? 3  
HELX_P HELX_P55 AG1 ASP B 318 ? SER B 327 ? ASP B 424 SER B 433 1 ? 10 
HELX_P HELX_P56 AG2 ASP B 329 ? LYS B 331 ? ASP B 435 LYS B 437 5 ? 3  
HELX_P HELX_P57 AG3 LEU B 332 ? TYR B 344 ? LEU B 438 TYR B 450 1 ? 13 
HELX_P HELX_P58 AG4 LYS B 363 ? GLU B 368 ? LYS B 469 GLU B 474 5 ? 6  
HELX_P HELX_P59 AG5 SER B 369 ? SER B 376 ? SER B 475 SER B 482 1 ? 8  
HELX_P HELX_P60 AG6 LYS B 388 ? GLU B 390 ? LYS B 494 GLU B 496 5 ? 3  
HELX_P HELX_P61 AG7 ASN B 407 ? VAL B 412 ? ASN B 513 VAL B 518 5 ? 6  
HELX_P HELX_P62 AG8 THR B 427 ? VAL B 431 ? THR B 533 VAL B 537 5 ? 5  
HELX_P HELX_P63 AG9 ASP B 452 ? ARG B 470 ? ASP B 558 ARG B 576 1 ? 19 
HELX_P HELX_P64 AH1 ASP B 477 ? ALA B 482 ? ASP B 583 ALA B 588 1 ? 6  
HELX_P HELX_P65 AH2 ILE B 485 ? ASN B 493 ? ILE B 591 ASN B 599 5 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A HIS 61  NE2 ? ? ? 1_555 C FE  . FE  ? ? A HIS 167 A FE  701 1_555 ? ? ? ? ? ? ? 2.230 ? 
metalc2  metalc ? ? A HIS 100 NE2 ? ? ? 1_555 C FE  . FE  ? ? A HIS 206 A FE  701 1_555 ? ? ? ? ? ? ? 2.164 ? 
metalc3  metalc ? ? A ASP 101 OD1 ? ? ? 1_555 D MG  . MG  ? ? A ASP 207 A MG  702 1_555 ? ? ? ? ? ? ? 2.048 ? 
metalc4  metalc ? ? A ASP 101 OD2 ? ? ? 1_555 C FE  . FE  ? ? A ASP 207 A FE  701 1_555 ? ? ? ? ? ? ? 2.090 ? 
metalc5  metalc ? ? A ASP 205 OD1 ? ? ? 1_555 C FE  . FE  ? ? A ASP 311 A FE  701 1_555 ? ? ? ? ? ? ? 2.030 ? 
metalc6  metalc ? ? B HIS 61  NE2 ? ? ? 1_555 K FE  . FE  ? ? B HIS 167 B FE  702 1_555 ? ? ? ? ? ? ? 2.316 ? 
metalc7  metalc ? ? B HIS 100 NE2 ? ? ? 1_555 K FE  . FE  ? ? B HIS 206 B FE  702 1_555 ? ? ? ? ? ? ? 2.194 ? 
metalc8  metalc ? ? B ASP 101 OD1 ? ? ? 1_555 L MG  . MG  ? ? B ASP 207 B MG  703 1_555 ? ? ? ? ? ? ? 2.268 ? 
metalc9  metalc ? ? B ASP 101 OD2 ? ? ? 1_555 K FE  . FE  ? ? B ASP 207 B FE  702 1_555 ? ? ? ? ? ? ? 2.100 ? 
metalc10 metalc ? ? B ASP 205 OD1 ? ? ? 1_555 K FE  . FE  ? ? B ASP 311 B FE  702 1_555 ? ? ? ? ? ? ? 1.970 ? 
metalc11 metalc ? ? C FE  .   FE  ? ? ? 1_555 G DZ4 . O1A ? ? A FE  701 A DZ4 705 1_555 ? ? ? ? ? ? ? 2.109 ? 
metalc12 metalc ? ? C FE  .   FE  ? ? ? 1_555 Q HOH . O   ? ? A FE  701 A HOH 808 1_555 ? ? ? ? ? ? ? 2.119 ? 
metalc13 metalc ? ? D MG  .   MG  ? ? ? 1_555 G DZ4 . O2A ? ? A MG  702 A DZ4 705 1_555 ? ? ? ? ? ? ? 2.033 ? 
metalc14 metalc ? ? D MG  .   MG  ? ? ? 1_555 Q HOH . O   ? ? A MG  702 A HOH 817 1_555 ? ? ? ? ? ? ? 2.297 ? 
metalc15 metalc ? ? D MG  .   MG  ? ? ? 1_555 Q HOH . O   ? ? A MG  702 A HOH 808 1_555 ? ? ? ? ? ? ? 2.215 ? 
metalc16 metalc ? ? D MG  .   MG  ? ? ? 1_555 Q HOH . O   ? ? A MG  702 A HOH 836 1_555 ? ? ? ? ? ? ? 2.129 ? 
metalc17 metalc ? ? E MG  .   MG  ? ? ? 1_555 Q HOH . O   ? ? A MG  703 A HOH 811 1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc18 metalc ? ? E MG  .   MG  ? ? ? 1_555 G DZ4 . O1B ? ? A MG  703 A DZ4 705 1_555 ? ? ? ? ? ? ? 2.209 ? 
metalc19 metalc ? ? E MG  .   MG  ? ? ? 1_555 Q HOH . O   ? ? A MG  703 A HOH 827 1_555 ? ? ? ? ? ? ? 2.081 ? 
metalc20 metalc ? ? E MG  .   MG  ? ? ? 1_555 G DZ4 . O1G ? ? A MG  703 A DZ4 705 1_555 ? ? ? ? ? ? ? 1.968 ? 
metalc21 metalc ? ? E MG  .   MG  ? ? ? 1_555 Q HOH . O   ? ? A MG  703 A HOH 802 1_555 ? ? ? ? ? ? ? 1.945 ? 
metalc22 metalc ? ? E MG  .   MG  ? ? ? 1_555 Q HOH . O   ? ? A MG  703 A HOH 812 1_555 ? ? ? ? ? ? ? 1.797 ? 
metalc23 metalc ? ? F MG  .   MG  ? ? ? 1_555 H CZF . O12 ? ? A MG  704 A CZF 706 1_555 ? ? ? ? ? ? ? 2.089 ? 
metalc24 metalc ? ? F MG  .   MG  ? ? ? 1_555 H CZF . O14 ? ? A MG  704 A CZF 706 1_555 ? ? ? ? ? ? ? 2.213 ? 
metalc25 metalc ? ? F MG  .   MG  ? ? ? 1_555 J DZ4 . O1B ? ? A MG  704 B DZ4 701 1_555 ? ? ? ? ? ? ? 2.040 ? 
metalc26 metalc ? ? F MG  .   MG  ? ? ? 1_555 H CZF . O9  ? ? A MG  704 A CZF 706 1_555 ? ? ? ? ? ? ? 2.085 ? 
metalc27 metalc ? ? F MG  .   MG  ? ? ? 1_555 J DZ4 . O2G ? ? A MG  704 B DZ4 701 1_555 ? ? ? ? ? ? ? 2.069 ? 
metalc28 metalc ? ? F MG  .   MG  ? ? ? 1_555 R HOH . O   ? ? A MG  704 B HOH 823 1_555 ? ? ? ? ? ? ? 1.870 ? 
metalc29 metalc ? ? I DZ4 .   O1B ? ? ? 1_555 N MG  . MG  ? ? A DZ4 707 B MG  705 1_555 ? ? ? ? ? ? ? 2.087 ? 
metalc30 metalc ? ? I DZ4 .   O2G ? ? ? 1_555 N MG  . MG  ? ? A DZ4 707 B MG  705 1_555 ? ? ? ? ? ? ? 2.069 ? 
metalc31 metalc ? ? K FE  .   FE  ? ? ? 1_555 O DZ4 . O1A ? ? B FE  702 B DZ4 706 1_555 ? ? ? ? ? ? ? 2.135 ? 
metalc32 metalc ? ? K FE  .   FE  ? ? ? 1_555 R HOH . O   ? ? B FE  702 B HOH 812 1_555 ? ? ? ? ? ? ? 2.343 ? 
metalc33 metalc ? ? L MG  .   MG  ? ? ? 1_555 R HOH . O   ? ? B MG  703 B HOH 818 1_555 ? ? ? ? ? ? ? 2.254 ? 
metalc34 metalc ? ? L MG  .   MG  ? ? ? 1_555 O DZ4 . O2A ? ? B MG  703 B DZ4 706 1_555 ? ? ? ? ? ? ? 2.243 ? 
metalc35 metalc ? ? L MG  .   MG  ? ? ? 1_555 R HOH . O   ? ? B MG  703 B HOH 822 1_555 ? ? ? ? ? ? ? 2.185 ? 
metalc36 metalc ? ? L MG  .   MG  ? ? ? 1_555 R HOH . O   ? ? B MG  703 B HOH 812 1_555 ? ? ? ? ? ? ? 2.352 ? 
metalc37 metalc ? ? M MG  .   MG  ? ? ? 1_555 R HOH . O   ? ? B MG  704 B HOH 844 1_555 ? ? ? ? ? ? ? 2.089 ? 
metalc38 metalc ? ? M MG  .   MG  ? ? ? 1_555 R HOH . O   ? ? B MG  704 B HOH 847 1_555 ? ? ? ? ? ? ? 2.224 ? 
metalc39 metalc ? ? M MG  .   MG  ? ? ? 1_555 O DZ4 . O1B ? ? B MG  704 B DZ4 706 1_555 ? ? ? ? ? ? ? 1.880 ? 
metalc40 metalc ? ? M MG  .   MG  ? ? ? 1_555 R HOH . O   ? ? B MG  704 B HOH 820 1_555 ? ? ? ? ? ? ? 1.742 ? 
metalc41 metalc ? ? M MG  .   MG  ? ? ? 1_555 R HOH . O   ? ? B MG  704 B HOH 829 1_555 ? ? ? ? ? ? ? 2.064 ? 
metalc42 metalc ? ? M MG  .   MG  ? ? ? 1_555 O DZ4 . O1G ? ? B MG  704 B DZ4 706 1_555 ? ? ? ? ? ? ? 2.088 ? 
metalc43 metalc ? ? N MG  .   MG  ? ? ? 1_555 P CZF . O9  ? ? B MG  705 B CZF 707 1_555 ? ? ? ? ? ? ? 2.184 ? 
metalc44 metalc ? ? N MG  .   MG  ? ? ? 1_555 P CZF . O12 ? ? B MG  705 B CZF 707 1_555 ? ? ? ? ? ? ? 2.154 ? 
metalc45 metalc ? ? N MG  .   MG  ? ? ? 1_555 P CZF . O14 ? ? B MG  705 B CZF 707 1_555 ? ? ? ? ? ? ? 1.914 ? 
metalc46 metalc ? ? N MG  .   MG  ? ? ? 1_555 Q HOH . O   ? ? B MG  705 A HOH 845 1_555 ? ? ? ? ? ? ? 2.188 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 2 ? 
AA6 ? 4 ? 
AA7 ? 2 ? 
AA8 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? parallel      
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LYS A 10  ? ASP A 14  ? LYS A 116 ASP A 120 
AA1 2 GLY A 18  ? LEU A 22  ? GLY A 124 LEU A 128 
AA2 1 ALA A 232 ? VAL A 237 ? ALA A 338 VAL A 343 
AA2 2 GLU A 240 ? ARG A 246 ? GLU A 346 ARG A 352 
AA2 3 PHE A 414 ? CYS A 416 ? PHE A 520 CYS A 522 
AA2 4 ALA A 419 ? ILE A 424 ? ALA A 525 ILE A 530 
AA3 1 ILE A 293 ? THR A 294 ? ILE A 399 THR A 400 
AA3 2 LYS A 300 ? TYR A 301 ? LYS A 406 TYR A 407 
AA4 1 LYS A 349 ? THR A 354 ? LYS A 455 THR A 460 
AA4 2 ALA A 440 ? CYS A 448 ? ALA A 546 CYS A 554 
AA4 3 PHE A 392 ? ASP A 400 ? PHE A 498 ASP A 506 
AA5 1 LYS B 10  ? ASP B 14  ? LYS B 116 ASP B 120 
AA5 2 GLY B 18  ? LEU B 22  ? GLY B 124 LEU B 128 
AA6 1 ALA B 232 ? VAL B 237 ? ALA B 338 VAL B 343 
AA6 2 GLU B 240 ? ARG B 246 ? GLU B 346 ARG B 352 
AA6 3 PHE B 414 ? CYS B 416 ? PHE B 520 CYS B 522 
AA6 4 ALA B 419 ? ILE B 424 ? ALA B 525 ILE B 530 
AA7 1 ILE B 293 ? THR B 294 ? ILE B 399 THR B 400 
AA7 2 LYS B 300 ? TYR B 301 ? LYS B 406 TYR B 407 
AA8 1 LYS B 349 ? THR B 354 ? LYS B 455 THR B 460 
AA8 2 ALA B 440 ? CYS B 448 ? ALA B 546 CYS B 554 
AA8 3 PHE B 392 ? ASP B 400 ? PHE B 498 ASP B 506 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ILE A 12  ? N ILE A 118 O ILE A 20  ? O ILE A 126 
AA2 1 2 N ARG A 233 ? N ARG A 339 O CYS A 244 ? O CYS A 350 
AA2 2 3 N ALA A 245 ? N ALA A 351 O TYR A 415 ? O TYR A 521 
AA2 3 4 N PHE A 414 ? N PHE A 520 O ILE A 424 ? O ILE A 530 
AA3 1 2 N ILE A 293 ? N ILE A 399 O TYR A 301 ? O TYR A 407 
AA4 1 2 N VAL A 351 ? N VAL A 457 O VAL A 446 ? O VAL A 552 
AA4 2 3 O LEU A 443 ? O LEU A 549 N ILE A 397 ? N ILE A 503 
AA5 1 2 N ILE B 12  ? N ILE B 118 O ILE B 20  ? O ILE B 126 
AA6 1 2 N ARG B 233 ? N ARG B 339 O CYS B 244 ? O CYS B 350 
AA6 2 3 N ALA B 245 ? N ALA B 351 O TYR B 415 ? O TYR B 521 
AA6 3 4 N PHE B 414 ? N PHE B 520 O ILE B 424 ? O ILE B 530 
AA7 1 2 N ILE B 293 ? N ILE B 399 O TYR B 301 ? O TYR B 407 
AA8 1 2 N VAL B 351 ? N VAL B 457 O VAL B 446 ? O VAL B 552 
AA8 2 3 O LEU B 443 ? O LEU B 549 N ILE B 397 ? N ILE B 503 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A FE  701 ? 6  'binding site for residue FE A 701'  
AC2 Software A MG  702 ? 6  'binding site for residue MG A 702'  
AC3 Software A MG  703 ? 5  'binding site for residue MG A 703'  
AC4 Software A MG  704 ? 3  'binding site for residue MG A 704'  
AC5 Software A DZ4 705 ? 29 'binding site for residue DZ4 A 705' 
AC6 Software A CZF 706 ? 18 'binding site for residue CZF A 706' 
AC7 Software A DZ4 707 ? 17 'binding site for residue DZ4 A 707' 
AC8 Software B DZ4 701 ? 19 'binding site for residue DZ4 B 701' 
AC9 Software B FE  702 ? 6  'binding site for residue FE B 702'  
AD1 Software B MG  703 ? 6  'binding site for residue MG B 703'  
AD2 Software B MG  704 ? 5  'binding site for residue MG B 704'  
AD3 Software B MG  705 ? 3  'binding site for residue MG B 705'  
AD4 Software B DZ4 706 ? 26 'binding site for residue DZ4 B 706' 
AD5 Software B CZF 707 ? 17 'binding site for residue CZF B 707' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 6  HIS A 61  ? HIS A 167 . ? 1_555 ? 
2   AC1 6  HIS A 100 ? HIS A 206 . ? 1_555 ? 
3   AC1 6  ASP A 101 ? ASP A 207 . ? 1_555 ? 
4   AC1 6  ASP A 205 ? ASP A 311 . ? 1_555 ? 
5   AC1 6  DZ4 G .   ? DZ4 A 705 . ? 1_555 ? 
6   AC1 6  HOH Q .   ? HOH A 808 . ? 1_555 ? 
7   AC2 6  ASP A 101 ? ASP A 207 . ? 1_555 ? 
8   AC2 6  HIS A 127 ? HIS A 233 . ? 1_555 ? 
9   AC2 6  DZ4 G .   ? DZ4 A 705 . ? 1_555 ? 
10  AC2 6  HOH Q .   ? HOH A 808 . ? 1_555 ? 
11  AC2 6  HOH Q .   ? HOH A 817 . ? 1_555 ? 
12  AC2 6  HOH Q .   ? HOH A 836 . ? 1_555 ? 
13  AC3 5  DZ4 G .   ? DZ4 A 705 . ? 1_555 ? 
14  AC3 5  HOH Q .   ? HOH A 802 . ? 1_555 ? 
15  AC3 5  HOH Q .   ? HOH A 811 . ? 1_555 ? 
16  AC3 5  HOH Q .   ? HOH A 812 . ? 1_555 ? 
17  AC3 5  HOH Q .   ? HOH A 827 . ? 1_555 ? 
18  AC4 3  CZF H .   ? CZF A 706 . ? 1_555 ? 
19  AC4 3  DZ4 J .   ? DZ4 B 701 . ? 1_555 ? 
20  AC4 3  HOH R .   ? HOH B 823 . ? 1_555 ? 
21  AC5 29 GLN A 43  ? GLN A 149 . ? 1_555 ? 
22  AC5 29 LEU A 44  ? LEU A 150 . ? 1_555 ? 
23  AC5 29 ARG A 58  ? ARG A 164 . ? 1_555 ? 
24  AC5 29 HIS A 61  ? HIS A 167 . ? 1_555 ? 
25  AC5 29 ASP A 101 ? ASP A 207 . ? 1_555 ? 
26  AC5 29 HIS A 104 ? HIS A 210 . ? 1_555 ? 
27  AC5 29 HIS A 109 ? HIS A 215 . ? 1_555 ? 
28  AC5 29 HIS A 127 ? HIS A 233 . ? 1_555 ? 
29  AC5 29 ASP A 205 ? ASP A 311 . ? 1_555 ? 
30  AC5 29 LYS A 206 ? LYS A 312 . ? 1_555 ? 
31  AC5 29 TYR A 209 ? TYR A 315 . ? 1_555 ? 
32  AC5 29 ASP A 213 ? ASP A 319 . ? 1_555 ? 
33  AC5 29 ARG A 260 ? ARG A 366 . ? 1_555 ? 
34  AC5 29 TYR A 268 ? TYR A 374 . ? 1_555 ? 
35  AC5 29 GLN A 269 ? GLN A 375 . ? 1_555 ? 
36  AC5 29 FE  C .   ? FE  A 701 . ? 1_555 ? 
37  AC5 29 MG  D .   ? MG  A 702 . ? 1_555 ? 
38  AC5 29 MG  E .   ? MG  A 703 . ? 1_555 ? 
39  AC5 29 HOH Q .   ? HOH A 802 . ? 1_555 ? 
40  AC5 29 HOH Q .   ? HOH A 808 . ? 1_555 ? 
41  AC5 29 HOH Q .   ? HOH A 811 . ? 1_555 ? 
42  AC5 29 HOH Q .   ? HOH A 812 . ? 1_555 ? 
43  AC5 29 HOH Q .   ? HOH A 814 . ? 1_555 ? 
44  AC5 29 HOH Q .   ? HOH A 821 . ? 1_555 ? 
45  AC5 29 HOH Q .   ? HOH A 823 . ? 1_555 ? 
46  AC5 29 HOH Q .   ? HOH A 826 . ? 1_555 ? 
47  AC5 29 HOH Q .   ? HOH A 827 . ? 1_555 ? 
48  AC5 29 HOH Q .   ? HOH A 835 . ? 1_555 ? 
49  AC5 29 HOH Q .   ? HOH A 836 . ? 1_555 ? 
50  AC6 18 LYS A 10  ? LYS A 116 . ? 1_555 ? 
51  AC6 18 VAL A 11  ? VAL A 117 . ? 1_555 ? 
52  AC6 18 ILE A 12  ? ILE A 118 . ? 1_555 ? 
53  AC6 18 ASN A 31  ? ASN A 137 . ? 1_555 ? 
54  AC6 18 GLN A 36  ? GLN A 142 . ? 1_555 ? 
55  AC6 18 ARG A 39  ? ARG A 145 . ? 1_555 ? 
56  AC6 18 PHE A 59  ? PHE A 165 . ? 1_555 ? 
57  AC6 18 LYS A 417 ? LYS A 523 . ? 7_555 ? 
58  AC6 18 MG  F .   ? MG  A 704 . ? 1_555 ? 
59  AC6 18 HOH Q .   ? HOH A 803 . ? 1_555 ? 
60  AC6 18 HOH Q .   ? HOH A 838 . ? 1_555 ? 
61  AC6 18 TYR B 49  ? TYR B 155 . ? 1_555 ? 
62  AC6 18 VAL B 50  ? VAL B 156 . ? 1_555 ? 
63  AC6 18 VAL B 272 ? VAL B 378 . ? 1_555 ? 
64  AC6 18 ARG B 345 ? ARG B 451 . ? 1_555 ? 
65  AC6 18 LYS B 349 ? LYS B 455 . ? 1_555 ? 
66  AC6 18 DZ4 J .   ? DZ4 B 701 . ? 1_555 ? 
67  AC6 18 HOH R .   ? HOH B 823 . ? 1_555 ? 
68  AC7 17 VAL A 50  ? VAL A 156 . ? 1_555 ? 
69  AC7 17 PHE A 51  ? PHE A 157 . ? 1_555 ? 
70  AC7 17 ARG A 266 ? ARG A 372 . ? 1_555 ? 
71  AC7 17 HIS A 270 ? HIS A 376 . ? 1_555 ? 
72  AC7 17 LYS A 271 ? LYS A 377 . ? 1_555 ? 
73  AC7 17 HOH Q .   ? HOH A 815 . ? 1_555 ? 
74  AC7 17 HOH Q .   ? HOH A 845 . ? 1_555 ? 
75  AC7 17 VAL B 11  ? VAL B 117 . ? 1_555 ? 
76  AC7 17 ASN B 13  ? ASN B 119 . ? 1_555 ? 
77  AC7 17 HIS B 19  ? HIS B 125 . ? 1_555 ? 
78  AC7 17 ARG B 227 ? ARG B 333 . ? 7_555 ? 
79  AC7 17 ARG B 246 ? ARG B 352 . ? 7_555 ? 
80  AC7 17 LYS B 248 ? LYS B 354 . ? 7_555 ? 
81  AC7 17 ASN B 252 ? ASN B 358 . ? 7_555 ? 
82  AC7 17 LYS B 417 ? LYS B 523 . ? 7_555 ? 
83  AC7 17 MG  N .   ? MG  B 705 . ? 1_555 ? 
84  AC7 17 CZF P .   ? CZF B 707 . ? 1_555 ? 
85  AC8 19 VAL A 11  ? VAL A 117 . ? 1_555 ? 
86  AC8 19 ASN A 13  ? ASN A 119 . ? 1_555 ? 
87  AC8 19 ARG A 227 ? ARG A 333 . ? 7_555 ? 
88  AC8 19 ARG A 246 ? ARG A 352 . ? 7_555 ? 
89  AC8 19 LYS A 248 ? LYS A 354 . ? 7_555 ? 
90  AC8 19 ASN A 252 ? ASN A 358 . ? 7_555 ? 
91  AC8 19 LYS A 417 ? LYS A 523 . ? 7_555 ? 
92  AC8 19 MG  F .   ? MG  A 704 . ? 1_555 ? 
93  AC8 19 CZF H .   ? CZF A 706 . ? 1_555 ? 
94  AC8 19 VAL B 50  ? VAL B 156 . ? 1_555 ? 
95  AC8 19 PHE B 51  ? PHE B 157 . ? 1_555 ? 
96  AC8 19 ARG B 266 ? ARG B 372 . ? 1_555 ? 
97  AC8 19 HIS B 270 ? HIS B 376 . ? 1_555 ? 
98  AC8 19 LYS B 271 ? LYS B 377 . ? 1_555 ? 
99  AC8 19 HOH R .   ? HOH B 802 . ? 1_555 ? 
100 AC8 19 HOH R .   ? HOH B 804 . ? 1_555 ? 
101 AC8 19 HOH R .   ? HOH B 810 . ? 1_555 ? 
102 AC8 19 HOH R .   ? HOH B 815 . ? 1_555 ? 
103 AC8 19 HOH R .   ? HOH B 823 . ? 1_555 ? 
104 AC9 6  HIS B 61  ? HIS B 167 . ? 1_555 ? 
105 AC9 6  HIS B 100 ? HIS B 206 . ? 1_555 ? 
106 AC9 6  ASP B 101 ? ASP B 207 . ? 1_555 ? 
107 AC9 6  ASP B 205 ? ASP B 311 . ? 1_555 ? 
108 AC9 6  DZ4 O .   ? DZ4 B 706 . ? 1_555 ? 
109 AC9 6  HOH R .   ? HOH B 812 . ? 1_555 ? 
110 AD1 6  ASP B 101 ? ASP B 207 . ? 1_555 ? 
111 AD1 6  HIS B 127 ? HIS B 233 . ? 1_555 ? 
112 AD1 6  DZ4 O .   ? DZ4 B 706 . ? 1_555 ? 
113 AD1 6  HOH R .   ? HOH B 812 . ? 1_555 ? 
114 AD1 6  HOH R .   ? HOH B 818 . ? 1_555 ? 
115 AD1 6  HOH R .   ? HOH B 822 . ? 1_555 ? 
116 AD2 5  DZ4 O .   ? DZ4 B 706 . ? 1_555 ? 
117 AD2 5  HOH R .   ? HOH B 820 . ? 1_555 ? 
118 AD2 5  HOH R .   ? HOH B 829 . ? 1_555 ? 
119 AD2 5  HOH R .   ? HOH B 844 . ? 1_555 ? 
120 AD2 5  HOH R .   ? HOH B 847 . ? 1_555 ? 
121 AD3 3  DZ4 I .   ? DZ4 A 707 . ? 1_555 ? 
122 AD3 3  HOH Q .   ? HOH A 845 . ? 1_555 ? 
123 AD3 3  CZF P .   ? CZF B 707 . ? 1_555 ? 
124 AD4 26 GLN B 43  ? GLN B 149 . ? 1_555 ? 
125 AD4 26 LEU B 44  ? LEU B 150 . ? 1_555 ? 
126 AD4 26 ARG B 58  ? ARG B 164 . ? 1_555 ? 
127 AD4 26 HIS B 61  ? HIS B 167 . ? 1_555 ? 
128 AD4 26 ASP B 101 ? ASP B 207 . ? 1_555 ? 
129 AD4 26 HIS B 104 ? HIS B 210 . ? 1_555 ? 
130 AD4 26 HIS B 109 ? HIS B 215 . ? 1_555 ? 
131 AD4 26 HIS B 127 ? HIS B 233 . ? 1_555 ? 
132 AD4 26 ASP B 205 ? ASP B 311 . ? 1_555 ? 
133 AD4 26 LYS B 206 ? LYS B 312 . ? 1_555 ? 
134 AD4 26 TYR B 209 ? TYR B 315 . ? 1_555 ? 
135 AD4 26 ASP B 213 ? ASP B 319 . ? 1_555 ? 
136 AD4 26 ARG B 260 ? ARG B 366 . ? 1_555 ? 
137 AD4 26 TYR B 268 ? TYR B 374 . ? 1_555 ? 
138 AD4 26 GLN B 269 ? GLN B 375 . ? 1_555 ? 
139 AD4 26 FE  K .   ? FE  B 702 . ? 1_555 ? 
140 AD4 26 MG  L .   ? MG  B 703 . ? 1_555 ? 
141 AD4 26 MG  M .   ? MG  B 704 . ? 1_555 ? 
142 AD4 26 HOH R .   ? HOH B 812 . ? 1_555 ? 
143 AD4 26 HOH R .   ? HOH B 820 . ? 1_555 ? 
144 AD4 26 HOH R .   ? HOH B 822 . ? 1_555 ? 
145 AD4 26 HOH R .   ? HOH B 829 . ? 1_555 ? 
146 AD4 26 HOH R .   ? HOH B 844 . ? 1_555 ? 
147 AD4 26 HOH R .   ? HOH B 847 . ? 1_555 ? 
148 AD4 26 HOH R .   ? HOH B 853 . ? 1_555 ? 
149 AD4 26 HOH R .   ? HOH B 858 . ? 1_555 ? 
150 AD5 17 TYR A 49  ? TYR A 155 . ? 1_555 ? 
151 AD5 17 VAL A 50  ? VAL A 156 . ? 1_555 ? 
152 AD5 17 VAL A 272 ? VAL A 378 . ? 1_555 ? 
153 AD5 17 ARG A 345 ? ARG A 451 . ? 1_555 ? 
154 AD5 17 LYS A 349 ? LYS A 455 . ? 1_555 ? 
155 AD5 17 DZ4 I .   ? DZ4 A 707 . ? 1_555 ? 
156 AD5 17 HOH Q .   ? HOH A 845 . ? 1_555 ? 
157 AD5 17 LYS B 10  ? LYS B 116 . ? 1_555 ? 
158 AD5 17 VAL B 11  ? VAL B 117 . ? 1_555 ? 
159 AD5 17 ILE B 12  ? ILE B 118 . ? 1_555 ? 
160 AD5 17 ASN B 31  ? ASN B 137 . ? 1_555 ? 
161 AD5 17 GLN B 36  ? GLN B 142 . ? 1_555 ? 
162 AD5 17 ARG B 39  ? ARG B 145 . ? 1_555 ? 
163 AD5 17 PHE B 59  ? PHE B 165 . ? 1_555 ? 
164 AD5 17 LYS B 417 ? LYS B 523 . ? 7_555 ? 
165 AD5 17 MG  N .   ? MG  B 705 . ? 1_555 ? 
166 AD5 17 HOH R .   ? HOH B 834 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6TX0 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.009441 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009441 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005049 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
FE 
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . THR A 1 8   ? 19.704  17.573  -17.718 1.00 87.38  ? 114 THR A N     1 
ATOM   2    C  CA    . THR A 1 8   ? 18.840  17.554  -16.472 1.00 82.73  ? 114 THR A CA    1 
ATOM   3    C  C     . THR A 1 8   ? 18.437  16.101  -16.113 1.00 73.34  ? 114 THR A C     1 
ATOM   4    O  O     . THR A 1 8   ? 18.896  15.131  -16.756 1.00 67.22  ? 114 THR A O     1 
ATOM   5    C  CB    . THR A 1 8   ? 17.624  18.564  -16.568 1.00 87.54  ? 114 THR A CB    1 
ATOM   6    O  OG1   . THR A 1 8   ? 17.069  18.841  -15.262 1.00 90.32  ? 114 THR A OG1   1 
ATOM   7    C  CG2   . THR A 1 8   ? 16.498  18.081  -17.557 1.00 84.43  ? 114 THR A CG2   1 
ATOM   8    N  N     . MET A 1 9   ? 17.606  15.972  -15.067 1.00 70.01  ? 115 MET A N     1 
ATOM   9    C  CA    . MET A 1 9   ? 17.170  14.664  -14.554 1.00 62.92  ? 115 MET A CA    1 
ATOM   10   C  C     . MET A 1 9   ? 16.198  14.078  -15.536 1.00 54.79  ? 115 MET A C     1 
ATOM   11   O  O     . MET A 1 9   ? 15.659  14.755  -16.384 1.00 57.05  ? 115 MET A O     1 
ATOM   12   C  CB    . MET A 1 9   ? 16.525  14.782  -13.186 1.00 64.23  ? 115 MET A CB    1 
ATOM   13   C  CG    . MET A 1 9   ? 17.486  15.409  -12.138 1.00 69.10  ? 115 MET A CG    1 
ATOM   14   S  SD    . MET A 1 9   ? 19.110  14.617  -11.743 1.00 66.71  ? 115 MET A SD    1 
ATOM   15   C  CE    . MET A 1 9   ? 20.337  15.917  -11.991 1.00 68.21  ? 115 MET A CE    1 
ATOM   16   N  N     . LYS A 1 10  ? 16.038  12.790  -15.464 1.00 45.93  ? 116 LYS A N     1 
ATOM   17   C  CA    . LYS A 1 10  ? 14.995  12.107  -16.182 1.00 38.94  ? 116 LYS A CA    1 
ATOM   18   C  C     . LYS A 1 10  ? 14.203  11.386  -15.088 1.00 33.96  ? 116 LYS A C     1 
ATOM   19   O  O     . LYS A 1 10  ? 14.791  10.880  -14.197 1.00 30.55  ? 116 LYS A O     1 
ATOM   20   C  CB    . LYS A 1 10  ? 15.653  11.134  -17.162 1.00 38.29  ? 116 LYS A CB    1 
ATOM   21   C  CG    . LYS A 1 10  ? 14.699  10.632  -18.227 1.00 37.30  ? 116 LYS A CG    1 
ATOM   22   C  CD    . LYS A 1 10  ? 15.416  9.780   -19.270 1.00 35.91  ? 116 LYS A CD    1 
ATOM   23   C  CE    . LYS A 1 10  ? 14.428  9.452   -20.345 1.00 34.14  ? 116 LYS A CE    1 
ATOM   24   N  NZ    . LYS A 1 10  ? 15.003  8.683   -21.488 1.00 34.27  ? 116 LYS A NZ    1 
ATOM   25   N  N     . VAL A 1 11  ? 12.892  11.378  -15.170 1.00 31.83  ? 117 VAL A N     1 
ATOM   26   C  CA    . VAL A 1 11  ? 12.031  10.816  -14.153 1.00 30.10  ? 117 VAL A CA    1 
ATOM   27   C  C     . VAL A 1 11  ? 11.429  9.512   -14.651 1.00 28.74  ? 117 VAL A C     1 
ATOM   28   O  O     . VAL A 1 11  ? 10.813  9.460   -15.755 1.00 26.04  ? 117 VAL A O     1 
ATOM   29   C  CB    . VAL A 1 11  ? 10.885  11.809  -13.784 1.00 29.17  ? 117 VAL A CB    1 
ATOM   30   C  CG1   . VAL A 1 11  ? 9.950   11.236  -12.728 1.00 29.36  ? 117 VAL A CG1   1 
ATOM   31   C  CG2   . VAL A 1 11  ? 11.478  13.050  -13.182 1.00 28.72  ? 117 VAL A CG2   1 
ATOM   32   N  N     . ILE A 1 12  ? 11.581  8.488   -13.799 1.00 26.55  ? 118 ILE A N     1 
ATOM   33   C  CA    . ILE A 1 12  ? 10.999  7.173   -14.074 1.00 26.58  ? 118 ILE A CA    1 
ATOM   34   C  C     . ILE A 1 12  ? 10.088  6.738   -12.934 1.00 26.12  ? 118 ILE A C     1 
ATOM   35   O  O     . ILE A 1 12  ? 10.362  7.072   -11.783 1.00 25.49  ? 118 ILE A O     1 
ATOM   36   C  CB    . ILE A 1 12  ? 12.140  6.177   -14.452 1.00 26.36  ? 118 ILE A CB    1 
ATOM   37   C  CG1   . ILE A 1 12  ? 11.584  4.895   -15.044 1.00 26.84  ? 118 ILE A CG1   1 
ATOM   38   C  CG2   . ILE A 1 12  ? 13.054  5.945   -13.271 1.00 26.56  ? 118 ILE A CG2   1 
ATOM   39   C  CD1   . ILE A 1 12  ? 12.645  4.135   -15.814 1.00 29.06  ? 118 ILE A CD1   1 
ATOM   40   N  N     . ASN A 1 13  ? 8.986   6.056   -13.259 1.00 25.03  ? 119 ASN A N     1 
ATOM   41   C  CA    . ASN A 1 13  ? 8.002   5.676   -12.251 1.00 24.96  ? 119 ASN A CA    1 
ATOM   42   C  C     . ASN A 1 13  ? 8.123   4.195   -11.986 1.00 24.62  ? 119 ASN A C     1 
ATOM   43   O  O     . ASN A 1 13  ? 7.749   3.353   -12.862 1.00 24.28  ? 119 ASN A O     1 
ATOM   44   C  CB    . ASN A 1 13  ? 6.557   6.004   -12.728 1.00 25.16  ? 119 ASN A CB    1 
ATOM   45   C  CG    . ASN A 1 13  ? 5.485   5.663   -11.680 1.00 25.17  ? 119 ASN A CG    1 
ATOM   46   O  OD1   . ASN A 1 13  ? 5.765   5.083   -10.651 1.00 22.20  ? 119 ASN A OD1   1 
ATOM   47   N  ND2   . ASN A 1 13  ? 4.235   5.964   -12.003 1.00 26.25  ? 119 ASN A ND2   1 
ATOM   48   N  N     . ASP A 1 14  ? 8.548   3.889   -10.775 1.00 24.40  ? 120 ASP A N     1 
ATOM   49   C  CA    . ASP A 1 14  ? 8.764   2.537   -10.305 1.00 24.54  ? 120 ASP A CA    1 
ATOM   50   C  C     . ASP A 1 14  ? 7.671   2.286   -9.264  1.00 23.48  ? 120 ASP A C     1 
ATOM   51   O  O     . ASP A 1 14  ? 7.328   3.183   -8.447  1.00 24.00  ? 120 ASP A O     1 
ATOM   52   C  CB    . ASP A 1 14  ? 10.165  2.438   -9.691  1.00 27.17  ? 120 ASP A CB    1 
ATOM   53   C  CG    . ASP A 1 14  ? 10.334  1.163   -8.797  1.00 31.51  ? 120 ASP A CG    1 
ATOM   54   O  OD1   . ASP A 1 14  ? 9.815   0.115   -9.200  1.00 37.20  ? 120 ASP A OD1   1 
ATOM   55   O  OD2   . ASP A 1 14  ? 10.961  1.157   -7.720  1.00 28.70  ? 120 ASP A OD2   1 
ATOM   56   N  N     . PRO A 1 15  ? 7.072   1.092   -9.273  1.00 21.20  ? 121 PRO A N     1 
ATOM   57   C  CA    . PRO A 1 15  ? 5.982   0.898   -8.324  1.00 20.64  ? 121 PRO A CA    1 
ATOM   58   C  C     . PRO A 1 15  ? 6.435   0.770   -6.849  1.00 22.17  ? 121 PRO A C     1 
ATOM   59   O  O     . PRO A 1 15  ? 5.687   1.109   -6.002  1.00 24.10  ? 121 PRO A O     1 
ATOM   60   C  CB    . PRO A 1 15  ? 5.319   -0.393  -8.810  1.00 20.12  ? 121 PRO A CB    1 
ATOM   61   C  CG    . PRO A 1 15  ? 6.414   -1.121  -9.535  1.00 19.96  ? 121 PRO A CG    1 
ATOM   62   C  CD    . PRO A 1 15  ? 7.037   0.048   -10.307 1.00 20.45  ? 121 PRO A CD    1 
ATOM   63   N  N     . ILE A 1 16  ? 7.656   0.389   -6.540  1.00 22.36  ? 122 ILE A N     1 
ATOM   64   C  CA    . ILE A 1 16  ? 8.117   0.321   -5.144  1.00 21.61  ? 122 ILE A CA    1 
ATOM   65   C  C     . ILE A 1 16  ? 8.491   1.727   -4.686  1.00 22.42  ? 122 ILE A C     1 
ATOM   66   O  O     . ILE A 1 16  ? 8.052   2.136   -3.619  1.00 23.40  ? 122 ILE A O     1 
ATOM   67   C  CB    . ILE A 1 16  ? 9.352   -0.654  -4.977  1.00 20.53  ? 122 ILE A CB    1 
ATOM   68   C  CG1   . ILE A 1 16  ? 9.042   -2.018  -5.643  1.00 20.20  ? 122 ILE A CG1   1 
ATOM   69   C  CG2   . ILE A 1 16  ? 9.752   -0.845  -3.540  1.00 19.95  ? 122 ILE A CG2   1 
ATOM   70   C  CD1   . ILE A 1 16  ? 7.742   -2.662  -5.176  1.00 20.40  ? 122 ILE A CD1   1 
ATOM   71   N  N     . HIS A 1 17  ? 9.343   2.453   -5.444  1.00 21.02  ? 123 HIS A N     1 
ATOM   72   C  CA    . HIS A 1 17  ? 9.963   3.668   -4.936  1.00 20.69  ? 123 HIS A CA    1 
ATOM   73   C  C     . HIS A 1 17  ? 9.319   4.956   -5.467  1.00 21.94  ? 123 HIS A C     1 
ATOM   74   O  O     . HIS A 1 17  ? 9.677   6.054   -5.023  1.00 23.76  ? 123 HIS A O     1 
ATOM   75   C  CB    . HIS A 1 17  ? 11.429  3.682   -5.222  1.00 19.87  ? 123 HIS A CB    1 
ATOM   76   C  CG    . HIS A 1 17  ? 12.140  2.502   -4.671  1.00 19.69  ? 123 HIS A CG    1 
ATOM   77   N  ND1   . HIS A 1 17  ? 12.151  2.213   -3.334  1.00 20.56  ? 123 HIS A ND1   1 
ATOM   78   C  CD2   . HIS A 1 17  ? 12.878  1.519   -5.286  1.00 20.52  ? 123 HIS A CD2   1 
ATOM   79   C  CE1   . HIS A 1 17  ? 12.868  1.106   -3.138  1.00 21.43  ? 123 HIS A CE1   1 
ATOM   80   N  NE2   . HIS A 1 17  ? 13.331  0.667   -4.308  1.00 20.02  ? 123 HIS A NE2   1 
ATOM   81   N  N     . GLY A 1 18  ? 8.331   4.842   -6.344  1.00 22.91  ? 124 GLY A N     1 
ATOM   82   C  CA    . GLY A 1 18  ? 7.637   5.956   -6.935  1.00 23.72  ? 124 GLY A CA    1 
ATOM   83   C  C     . GLY A 1 18  ? 8.418   6.641   -8.079  1.00 24.35  ? 124 GLY A C     1 
ATOM   84   O  O     . GLY A 1 18  ? 9.276   5.994   -8.740  1.00 26.11  ? 124 GLY A O     1 
ATOM   85   N  N     . HIS A 1 19  ? 8.112   7.936   -8.292  1.00 24.74  ? 125 HIS A N     1 
ATOM   86   C  CA    . HIS A 1 19  ? 8.801   8.783   -9.297  1.00 25.70  ? 125 HIS A CA    1 
ATOM   87   C  C     . HIS A 1 19  ? 10.225  9.106   -8.841  1.00 26.49  ? 125 HIS A C     1 
ATOM   88   O  O     . HIS A 1 19  ? 10.406  9.799   -7.863  1.00 28.42  ? 125 HIS A O     1 
ATOM   89   C  CB    . HIS A 1 19  ? 7.997   10.067  -9.608  1.00 24.66  ? 125 HIS A CB    1 
ATOM   90   C  CG    . HIS A 1 19  ? 6.759   9.784   -10.384 1.00 24.70  ? 125 HIS A CG    1 
ATOM   91   N  ND1   . HIS A 1 19  ? 5.681   9.109   -9.844  1.00 24.21  ? 125 HIS A ND1   1 
ATOM   92   C  CD2   . HIS A 1 19  ? 6.464   9.968   -11.705 1.00 24.52  ? 125 HIS A CD2   1 
ATOM   93   C  CE1   . HIS A 1 19  ? 4.751   8.947   -10.770 1.00 24.10  ? 125 HIS A CE1   1 
ATOM   94   N  NE2   . HIS A 1 19  ? 5.206   9.438   -11.912 1.00 24.17  ? 125 HIS A NE2   1 
ATOM   95   N  N     . ILE A 1 20  ? 11.228  8.559   -9.520  1.00 27.18  ? 126 ILE A N     1 
ATOM   96   C  CA    . ILE A 1 20  ? 12.578  8.827   -9.160  1.00 29.98  ? 126 ILE A CA    1 
ATOM   97   C  C     . ILE A 1 20  ? 13.398  9.478   -10.261 1.00 29.49  ? 126 ILE A C     1 
ATOM   98   O  O     . ILE A 1 20  ? 13.103  9.301   -11.428 1.00 29.66  ? 126 ILE A O     1 
ATOM   99   C  CB    . ILE A 1 20  ? 13.258  7.571   -8.617  1.00 31.90  ? 126 ILE A CB    1 
ATOM   100  C  CG1   . ILE A 1 20  ? 13.466  6.518   -9.721  1.00 33.73  ? 126 ILE A CG1   1 
ATOM   101  C  CG2   . ILE A 1 20  ? 12.460  7.067   -7.485  1.00 32.80  ? 126 ILE A CG2   1 
ATOM   102  C  CD1   . ILE A 1 20  ? 13.904  5.168   -9.183  1.00 32.83  ? 126 ILE A CD1   1 
ATOM   103  N  N     . GLU A 1 21  ? 14.414  10.238  -9.840  1.00 30.59  ? 127 GLU A N     1 
ATOM   104  C  CA    . GLU A 1 21  ? 15.285  11.063  -10.736 1.00 32.85  ? 127 GLU A CA    1 
ATOM   105  C  C     . GLU A 1 21  ? 16.514  10.293  -11.135 1.00 31.92  ? 127 GLU A C     1 
ATOM   106  O  O     . GLU A 1 21  ? 17.109  9.679   -10.305 1.00 29.89  ? 127 GLU A O     1 
ATOM   107  C  CB    . GLU A 1 21  ? 15.661  12.373  -10.076 1.00 33.73  ? 127 GLU A CB    1 
ATOM   108  C  CG    . GLU A 1 21  ? 14.469  13.289  -10.106 1.00 37.46  ? 127 GLU A CG    1 
ATOM   109  C  CD    . GLU A 1 21  ? 14.673  14.643  -9.476  1.00 44.16  ? 127 GLU A CD    1 
ATOM   110  O  OE1   . GLU A 1 21  ? 15.764  14.958  -8.977  1.00 53.32  ? 127 GLU A OE1   1 
ATOM   111  O  OE2   . GLU A 1 21  ? 13.705  15.427  -9.448  1.00 51.55  ? 127 GLU A OE2   1 
ATOM   112  N  N     . LEU A 1 22  ? 16.816  10.261  -12.424 1.00 31.22  ? 128 LEU A N     1 
ATOM   113  C  CA    . LEU A 1 22  ? 18.042  9.617   -12.940 1.00 30.77  ? 128 LEU A CA    1 
ATOM   114  C  C     . LEU A 1 22  ? 19.017  10.669  -13.500 1.00 30.29  ? 128 LEU A C     1 
ATOM   115  O  O     . LEU A 1 22  ? 18.701  11.366  -14.523 1.00 29.64  ? 128 LEU A O     1 
ATOM   116  C  CB    . LEU A 1 22  ? 17.659  8.654   -14.038 1.00 31.23  ? 128 LEU A CB    1 
ATOM   117  C  CG    . LEU A 1 22  ? 16.820  7.449   -13.609 1.00 32.49  ? 128 LEU A CG    1 
ATOM   118  C  CD1   . LEU A 1 22  ? 16.335  6.741   -14.871 1.00 32.76  ? 128 LEU A CD1   1 
ATOM   119  C  CD2   . LEU A 1 22  ? 17.544  6.451   -12.700 1.00 31.22  ? 128 LEU A CD2   1 
ATOM   120  N  N     . HIS A 1 23  ? 20.166  10.779  -12.861 1.00 28.30  ? 129 HIS A N     1 
ATOM   121  C  CA    . HIS A 1 23  ? 21.234  11.652  -13.324 1.00 32.44  ? 129 HIS A CA    1 
ATOM   122  C  C     . HIS A 1 23  ? 21.666  11.237  -14.758 1.00 33.54  ? 129 HIS A C     1 
ATOM   123  O  O     . HIS A 1 23  ? 21.607  10.050  -15.096 1.00 33.26  ? 129 HIS A O     1 
ATOM   124  C  CB    . HIS A 1 23  ? 22.435  11.584  -12.367 1.00 33.19  ? 129 HIS A CB    1 
ATOM   125  C  CG    . HIS A 1 23  ? 23.560  12.547  -12.680 1.00 35.37  ? 129 HIS A CG    1 
ATOM   126  N  ND1   . HIS A 1 23  ? 24.529  12.298  -13.654 1.00 36.84  ? 129 HIS A ND1   1 
ATOM   127  C  CD2   . HIS A 1 23  ? 23.908  13.731  -12.095 1.00 34.03  ? 129 HIS A CD2   1 
ATOM   128  C  CE1   . HIS A 1 23  ? 25.406  13.298  -13.656 1.00 36.71  ? 129 HIS A CE1   1 
ATOM   129  N  NE2   . HIS A 1 23  ? 25.085  14.153  -12.686 1.00 35.12  ? 129 HIS A NE2   1 
ATOM   130  N  N     . PRO A 1 24  ? 22.060  12.209  -15.614 1.00 35.34  ? 130 PRO A N     1 
ATOM   131  C  CA    . PRO A 1 24  ? 22.259  11.847  -17.014 1.00 34.43  ? 130 PRO A CA    1 
ATOM   132  C  C     . PRO A 1 24  ? 23.387  10.856  -17.259 1.00 34.11  ? 130 PRO A C     1 
ATOM   133  O  O     . PRO A 1 24  ? 23.324  10.148  -18.196 1.00 34.03  ? 130 PRO A O     1 
ATOM   134  C  CB    . PRO A 1 24  ? 22.578  13.174  -17.699 1.00 35.34  ? 130 PRO A CB    1 
ATOM   135  C  CG    . PRO A 1 24  ? 22.395  14.221  -16.699 1.00 36.49  ? 130 PRO A CG    1 
ATOM   136  C  CD    . PRO A 1 24  ? 21.866  13.659  -15.455 1.00 36.92  ? 130 PRO A CD    1 
ATOM   137  N  N     . LEU A 1 25  ? 24.411  10.828  -16.427 1.00 35.41  ? 131 LEU A N     1 
ATOM   138  C  CA    . LEU A 1 25  ? 25.425  9.776   -16.506 1.00 34.95  ? 131 LEU A CA    1 
ATOM   139  C  C     . LEU A 1 25  ? 24.844  8.364   -16.229 1.00 33.71  ? 131 LEU A C     1 
ATOM   140  O  O     . LEU A 1 25  ? 25.241  7.389   -16.864 1.00 35.48  ? 131 LEU A O     1 
ATOM   141  C  CB    . LEU A 1 25  ? 26.571  10.099  -15.560 1.00 34.63  ? 131 LEU A CB    1 
ATOM   142  C  CG    . LEU A 1 25  ? 27.690  9.054   -15.492 1.00 35.68  ? 131 LEU A CG    1 
ATOM   143  C  CD1   . LEU A 1 25  ? 28.425  8.839   -16.809 1.00 37.54  ? 131 LEU A CD1   1 
ATOM   144  C  CD2   . LEU A 1 25  ? 28.671  9.545   -14.441 1.00 36.91  ? 131 LEU A CD2   1 
ATOM   145  N  N     . LEU A 1 26  ? 23.875  8.292   -15.333 1.00 31.29  ? 132 LEU A N     1 
ATOM   146  C  CA    . LEU A 1 26  ? 23.174  7.048   -15.108 1.00 31.87  ? 132 LEU A CA    1 
ATOM   147  C  C     . LEU A 1 26  ? 22.366  6.628   -16.316 1.00 30.27  ? 132 LEU A C     1 
ATOM   148  O  O     . LEU A 1 26  ? 22.414  5.463   -16.732 1.00 31.17  ? 132 LEU A O     1 
ATOM   149  C  CB    . LEU A 1 26  ? 22.316  7.132   -13.833 1.00 31.93  ? 132 LEU A CB    1 
ATOM   150  C  CG    . LEU A 1 26  ? 22.987  7.655   -12.522 1.00 34.23  ? 132 LEU A CG    1 
ATOM   151  C  CD1   . LEU A 1 26  ? 22.059  7.745   -11.311 1.00 35.49  ? 132 LEU A CD1   1 
ATOM   152  C  CD2   . LEU A 1 26  ? 24.153  6.758   -12.117 1.00 34.29  ? 132 LEU A CD2   1 
ATOM   153  N  N     . VAL A 1 27  ? 21.709  7.590   -16.942 1.00 30.34  ? 133 VAL A N     1 
ATOM   154  C  CA    . VAL A 1 27  ? 20.912  7.366   -18.146 1.00 30.60  ? 133 VAL A CA    1 
ATOM   155  C  C     . VAL A 1 27  ? 21.753  6.794   -19.311 1.00 32.36  ? 133 VAL A C     1 
ATOM   156  O  O     . VAL A 1 27  ? 21.350  5.823   -19.983 1.00 32.54  ? 133 VAL A O     1 
ATOM   157  C  CB    . VAL A 1 27  ? 20.154  8.630   -18.633 1.00 29.65  ? 133 VAL A CB    1 
ATOM   158  C  CG1   . VAL A 1 27  ? 19.292  8.313   -19.870 1.00 29.35  ? 133 VAL A CG1   1 
ATOM   159  C  CG2   . VAL A 1 27  ? 19.165  9.140   -17.622 1.00 29.24  ? 133 VAL A CG2   1 
ATOM   160  N  N     . ARG A 1 28  ? 22.915  7.398   -19.532 1.00 34.43  ? 134 ARG A N     1 
ATOM   161  C  CA    . ARG A 1 28  ? 23.910  6.873   -20.478 1.00 37.03  ? 134 ARG A CA    1 
ATOM   162  C  C     . ARG A 1 28  ? 24.283  5.449   -20.259 1.00 34.92  ? 134 ARG A C     1 
ATOM   163  O  O     . ARG A 1 28  ? 24.255  4.696   -21.180 1.00 37.49  ? 134 ARG A O     1 
ATOM   164  C  CB    . ARG A 1 28  ? 25.214  7.698   -20.482 1.00 41.30  ? 134 ARG A CB    1 
ATOM   165  C  CG    . ARG A 1 28  ? 25.059  9.104   -21.123 1.00 45.36  ? 134 ARG A CG    1 
ATOM   166  C  CD    . ARG A 1 28  ? 24.626  9.097   -22.596 1.00 45.30  ? 134 ARG A CD    1 
ATOM   167  N  NE    . ARG A 1 28  ? 25.582  8.318   -23.358 1.00 49.01  ? 134 ARG A NE    1 
ATOM   168  C  CZ    . ARG A 1 28  ? 26.664  8.793   -23.966 1.00 55.53  ? 134 ARG A CZ    1 
ATOM   169  N  NH1   . ARG A 1 28  ? 26.957  10.120  -23.920 1.00 54.80  ? 134 ARG A NH1   1 
ATOM   170  N  NH2   . ARG A 1 28  ? 27.466  7.906   -24.609 1.00 57.51  ? 134 ARG A NH2   1 
ATOM   171  N  N     . ILE A 1 29  ? 24.576  5.076   -19.033 1.00 33.18  ? 135 ILE A N     1 
ATOM   172  C  CA    . ILE A 1 29  ? 24.917  3.696   -18.684 1.00 33.14  ? 135 ILE A CA    1 
ATOM   173  C  C     . ILE A 1 29  ? 23.716  2.731   -18.868 1.00 34.27  ? 135 ILE A C     1 
ATOM   174  O  O     . ILE A 1 29  ? 23.891  1.584   -19.333 1.00 33.54  ? 135 ILE A O     1 
ATOM   175  C  CB    . ILE A 1 29  ? 25.464  3.654   -17.247 1.00 33.34  ? 135 ILE A CB    1 
ATOM   176  C  CG1   . ILE A 1 29  ? 26.848  4.339   -17.220 1.00 34.08  ? 135 ILE A CG1   1 
ATOM   177  C  CG2   . ILE A 1 29  ? 25.550  2.218   -16.716 1.00 31.83  ? 135 ILE A CG2   1 
ATOM   178  C  CD1   . ILE A 1 29  ? 27.427  4.547   -15.816 1.00 33.89  ? 135 ILE A CD1   1 
ATOM   179  N  N     . ILE A 1 30  ? 22.514  3.199   -18.513 1.00 32.73  ? 136 ILE A N     1 
ATOM   180  C  CA    . ILE A 1 30  ? 21.313  2.404   -18.656 1.00 31.62  ? 136 ILE A CA    1 
ATOM   181  C  C     . ILE A 1 30  ? 20.978  2.079   -20.089 1.00 31.47  ? 136 ILE A C     1 
ATOM   182  O  O     . ILE A 1 30  ? 20.472  0.974   -20.390 1.00 29.98  ? 136 ILE A O     1 
ATOM   183  C  CB    . ILE A 1 30  ? 20.074  3.136   -18.016 1.00 30.08  ? 136 ILE A CB    1 
ATOM   184  C  CG1   . ILE A 1 30  ? 20.184  3.049   -16.507 1.00 30.70  ? 136 ILE A CG1   1 
ATOM   185  C  CG2   . ILE A 1 30  ? 18.764  2.499   -18.475 1.00 29.03  ? 136 ILE A CG2   1 
ATOM   186  C  CD1   . ILE A 1 30  ? 19.279  3.911   -15.698 1.00 29.93  ? 136 ILE A CD1   1 
ATOM   187  N  N     . ASN A 1 31  ? 21.154  3.058   -20.965 1.00 32.51  ? 137 ASN A N     1 
ATOM   188  C  CA    . ASN A 1 31  ? 20.751  2.852   -22.374 1.00 34.17  ? 137 ASN A CA    1 
ATOM   189  C  C     . ASN A 1 31  ? 21.847  2.210   -23.233 1.00 35.28  ? 137 ASN A C     1 
ATOM   190  O  O     . ASN A 1 31  ? 22.204  2.712   -24.274 1.00 35.78  ? 137 ASN A O     1 
ATOM   191  C  CB    . ASN A 1 31  ? 20.170  4.138   -22.948 1.00 33.17  ? 137 ASN A CB    1 
ATOM   192  C  CG    . ASN A 1 31  ? 18.782  4.427   -22.369 1.00 33.75  ? 137 ASN A CG    1 
ATOM   193  O  OD1   . ASN A 1 31  ? 17.994  3.461   -22.124 1.00 33.38  ? 137 ASN A OD1   1 
ATOM   194  N  ND2   . ASN A 1 31  ? 18.455  5.707   -22.161 1.00 30.36  ? 137 ASN A ND2   1 
ATOM   195  N  N     . THR A 1 32  ? 22.340  1.067   -22.750 1.00 35.34  ? 138 THR A N     1 
ATOM   196  C  CA    . THR A 1 32  ? 23.315  0.213   -23.457 1.00 35.28  ? 138 THR A CA    1 
ATOM   197  C  C     . THR A 1 32  ? 22.753  -1.227  -23.553 1.00 36.73  ? 138 THR A C     1 
ATOM   198  O  O     . THR A 1 32  ? 21.916  -1.610  -22.749 1.00 33.38  ? 138 THR A O     1 
ATOM   199  C  CB    . THR A 1 32  ? 24.648  0.156   -22.706 1.00 35.33  ? 138 THR A CB    1 
ATOM   200  O  OG1   . THR A 1 32  ? 24.475  -0.389  -21.378 1.00 32.66  ? 138 THR A OG1   1 
ATOM   201  C  CG2   . THR A 1 32  ? 25.212  1.535   -22.589 1.00 36.49  ? 138 THR A CG2   1 
ATOM   202  N  N     . PRO A 1 33  ? 23.226  -2.020  -24.542 1.00 38.73  ? 139 PRO A N     1 
ATOM   203  C  CA    . PRO A 1 33  ? 22.813  -3.427  -24.581 1.00 36.92  ? 139 PRO A CA    1 
ATOM   204  C  C     . PRO A 1 33  ? 23.251  -4.210  -23.359 1.00 34.24  ? 139 PRO A C     1 
ATOM   205  O  O     . PRO A 1 33  ? 22.607  -5.190  -23.027 1.00 32.86  ? 139 PRO A O     1 
ATOM   206  C  CB    . PRO A 1 33  ? 23.499  -4.005  -25.850 1.00 37.10  ? 139 PRO A CB    1 
ATOM   207  C  CG    . PRO A 1 33  ? 24.008  -2.817  -26.579 1.00 38.83  ? 139 PRO A CG    1 
ATOM   208  C  CD    . PRO A 1 33  ? 24.264  -1.739  -25.562 1.00 39.20  ? 139 PRO A CD    1 
ATOM   209  N  N     . GLN A 1 34  ? 24.343  -3.812  -22.719 1.00 33.04  ? 140 GLN A N     1 
ATOM   210  C  CA    . GLN A 1 34  ? 24.860  -4.547  -21.562 1.00 34.19  ? 140 GLN A CA    1 
ATOM   211  C  C     . GLN A 1 34  ? 23.892  -4.426  -20.322 1.00 34.23  ? 140 GLN A C     1 
ATOM   212  O  O     . GLN A 1 34  ? 23.695  -5.398  -19.524 1.00 33.55  ? 140 GLN A O     1 
ATOM   213  C  CB    . GLN A 1 34  ? 26.264  -4.022  -21.199 1.00 34.97  ? 140 GLN A CB    1 
ATOM   214  C  CG    . GLN A 1 34  ? 27.347  -4.436  -22.225 1.00 36.76  ? 140 GLN A CG    1 
ATOM   215  C  CD    . GLN A 1 34  ? 27.290  -3.685  -23.522 1.00 37.63  ? 140 GLN A CD    1 
ATOM   216  O  OE1   . GLN A 1 34  ? 27.002  -2.467  -23.582 1.00 37.81  ? 140 GLN A OE1   1 
ATOM   217  N  NE2   . GLN A 1 34  ? 27.522  -4.416  -24.600 1.00 41.87  ? 140 GLN A NE2   1 
ATOM   218  N  N     . PHE A 1 35  ? 23.297  -3.218  -20.188 1.00 32.37  ? 141 PHE A N     1 
ATOM   219  C  CA    . PHE A 1 35  ? 22.389  -2.906  -19.107 1.00 30.53  ? 141 PHE A CA    1 
ATOM   220  C  C     . PHE A 1 35  ? 21.002  -3.412  -19.422 1.00 28.77  ? 141 PHE A C     1 
ATOM   221  O  O     . PHE A 1 35  ? 20.376  -4.070  -18.558 1.00 29.14  ? 141 PHE A O     1 
ATOM   222  C  CB    . PHE A 1 35  ? 22.342  -1.413  -18.700 1.00 30.12  ? 141 PHE A CB    1 
ATOM   223  C  CG    . PHE A 1 35  ? 21.665  -1.199  -17.365 1.00 29.17  ? 141 PHE A CG    1 
ATOM   224  C  CD1   . PHE A 1 35  ? 22.396  -1.311  -16.161 1.00 31.51  ? 141 PHE A CD1   1 
ATOM   225  C  CD2   . PHE A 1 35  ? 20.301  -1.032  -17.269 1.00 28.53  ? 141 PHE A CD2   1 
ATOM   226  C  CE1   . PHE A 1 35  ? 21.758  -1.212  -14.927 1.00 29.90  ? 141 PHE A CE1   1 
ATOM   227  C  CE2   . PHE A 1 35  ? 19.675  -0.939  -16.042 1.00 28.52  ? 141 PHE A CE2   1 
ATOM   228  C  CZ    . PHE A 1 35  ? 20.395  -1.031  -14.892 1.00 28.86  ? 141 PHE A CZ    1 
ATOM   229  N  N     . GLN A 1 36  ? 20.542  -3.156  -20.615 1.00 27.52  ? 142 GLN A N     1 
ATOM   230  C  CA    . GLN A 1 36  ? 19.204  -3.551  -21.032 1.00 27.19  ? 142 GLN A CA    1 
ATOM   231  C  C     . GLN A 1 36  ? 18.948  -5.069  -21.043 1.00 27.34  ? 142 GLN A C     1 
ATOM   232  O  O     . GLN A 1 36  ? 17.781  -5.535  -21.037 1.00 26.53  ? 142 GLN A O     1 
ATOM   233  C  CB    . GLN A 1 36  ? 18.858  -2.957  -22.416 1.00 26.19  ? 142 GLN A CB    1 
ATOM   234  C  CG    . GLN A 1 36  ? 18.762  -1.423  -22.497 1.00 25.94  ? 142 GLN A CG    1 
ATOM   235  C  CD    . GLN A 1 36  ? 17.580  -0.811  -21.776 1.00 25.05  ? 142 GLN A CD    1 
ATOM   236  O  OE1   . GLN A 1 36  ? 16.452  -1.248  -21.971 1.00 25.24  ? 142 GLN A OE1   1 
ATOM   237  N  NE2   . GLN A 1 36  ? 17.833  0.232   -20.983 1.00 22.04  ? 142 GLN A NE2   1 
ATOM   238  N  N     . ARG A 1 37  ? 20.027  -5.824  -21.106 1.00 27.35  ? 143 ARG A N     1 
ATOM   239  C  CA    . ARG A 1 37  ? 20.020  -7.311  -20.962 1.00 27.72  ? 143 ARG A CA    1 
ATOM   240  C  C     . ARG A 1 37  ? 19.264  -7.772  -19.751 1.00 26.60  ? 143 ARG A C     1 
ATOM   241  O  O     . ARG A 1 37  ? 18.617  -8.831  -19.751 1.00 26.14  ? 143 ARG A O     1 
ATOM   242  C  CB    . ARG A 1 37  ? 21.495  -7.730  -20.811 1.00 29.79  ? 143 ARG A CB    1 
ATOM   243  C  CG    . ARG A 1 37  ? 21.812  -9.078  -20.272 1.00 30.78  ? 143 ARG A CG    1 
ATOM   244  C  CD    . ARG A 1 37  ? 23.311  -9.329  -20.320 1.00 32.89  ? 143 ARG A CD    1 
ATOM   245  N  NE    . ARG A 1 37  ? 23.557  -10.714 -19.920 1.00 35.44  ? 143 ARG A NE    1 
ATOM   246  C  CZ    . ARG A 1 37  ? 23.742  -11.120 -18.671 1.00 35.94  ? 143 ARG A CZ    1 
ATOM   247  N  NH1   . ARG A 1 37  ? 23.809  -10.270 -17.624 1.00 37.65  ? 143 ARG A NH1   1 
ATOM   248  N  NH2   . ARG A 1 37  ? 23.838  -12.407 -18.467 1.00 37.23  ? 143 ARG A NH2   1 
ATOM   249  N  N     . LEU A 1 38  ? 19.358  -6.972  -18.695 1.00 25.32  ? 144 LEU A N     1 
ATOM   250  C  CA    . LEU A 1 38  ? 18.718  -7.334  -17.432 1.00 25.17  ? 144 LEU A CA    1 
ATOM   251  C  C     . LEU A 1 38  ? 17.210  -7.276  -17.506 1.00 24.64  ? 144 LEU A C     1 
ATOM   252  O  O     . LEU A 1 38  ? 16.571  -7.747  -16.591 1.00 23.91  ? 144 LEU A O     1 
ATOM   253  C  CB    . LEU A 1 38  ? 19.167  -6.436  -16.315 1.00 24.94  ? 144 LEU A CB    1 
ATOM   254  C  CG    . LEU A 1 38  ? 20.667  -6.564  -16.021 1.00 24.89  ? 144 LEU A CG    1 
ATOM   255  C  CD1   . LEU A 1 38  ? 21.013  -5.565  -14.915 1.00 24.08  ? 144 LEU A CD1   1 
ATOM   256  C  CD2   . LEU A 1 38  ? 21.155  -7.981  -15.684 1.00 24.60  ? 144 LEU A CD2   1 
ATOM   257  N  N     . ARG A 1 39  ? 16.629  -6.767  -18.596 1.00 24.00  ? 145 ARG A N     1 
ATOM   258  C  CA    . ARG A 1 39  ? 15.195  -6.956  -18.786 1.00 25.43  ? 145 ARG A CA    1 
ATOM   259  C  C     . ARG A 1 39  ? 14.790  -8.408  -18.985 1.00 25.93  ? 145 ARG A C     1 
ATOM   260  O  O     . ARG A 1 39  ? 13.613  -8.729  -18.937 1.00 24.98  ? 145 ARG A O     1 
ATOM   261  C  CB    . ARG A 1 39  ? 14.684  -6.110  -19.980 1.00 27.86  ? 145 ARG A CB    1 
ATOM   262  C  CG    . ARG A 1 39  ? 14.518  -4.596  -19.672 1.00 27.87  ? 145 ARG A CG    1 
ATOM   263  C  CD    . ARG A 1 39  ? 14.200  -3.822  -20.938 1.00 28.80  ? 145 ARG A CD    1 
ATOM   264  N  NE    . ARG A 1 39  ? 14.152  -2.359  -20.753 1.00 29.98  ? 145 ARG A NE    1 
ATOM   265  C  CZ    . ARG A 1 39  ? 13.120  -1.671  -20.225 1.00 28.01  ? 145 ARG A CZ    1 
ATOM   266  N  NH1   . ARG A 1 39  ? 12.030  -2.285  -19.768 1.00 29.16  ? 145 ARG A NH1   1 
ATOM   267  N  NH2   . ARG A 1 39  ? 13.187  -0.368  -20.143 1.00 26.39  ? 145 ARG A NH2   1 
ATOM   268  N  N     . TYR A 1 40  ? 15.764  -9.277  -19.263 1.00 27.31  ? 146 TYR A N     1 
ATOM   269  C  CA    . TYR A 1 40  ? 15.488  -10.622 -19.796 1.00 27.48  ? 146 TYR A CA    1 
ATOM   270  C  C     . TYR A 1 40  ? 16.015  -11.722 -18.874 1.00 27.83  ? 146 TYR A C     1 
ATOM   271  O  O     . TYR A 1 40  ? 16.217  -12.850 -19.276 1.00 26.16  ? 146 TYR A O     1 
ATOM   272  C  CB    . TYR A 1 40  ? 16.068  -10.745 -21.215 1.00 28.27  ? 146 TYR A CB    1 
ATOM   273  C  CG    . TYR A 1 40  ? 15.672  -9.568  -22.094 1.00 29.89  ? 146 TYR A CG    1 
ATOM   274  C  CD1   . TYR A 1 40  ? 14.357  -9.407  -22.504 1.00 28.80  ? 146 TYR A CD1   1 
ATOM   275  C  CD2   . TYR A 1 40  ? 16.634  -8.557  -22.492 1.00 32.05  ? 146 TYR A CD2   1 
ATOM   276  C  CE1   . TYR A 1 40  ? 13.977  -8.318  -23.295 1.00 29.18  ? 146 TYR A CE1   1 
ATOM   277  C  CE2   . TYR A 1 40  ? 16.245  -7.438  -23.265 1.00 30.58  ? 146 TYR A CE2   1 
ATOM   278  C  CZ    . TYR A 1 40  ? 14.894  -7.322  -23.648 1.00 30.58  ? 146 TYR A CZ    1 
ATOM   279  O  OH    . TYR A 1 40  ? 14.389  -6.226  -24.353 1.00 32.87  ? 146 TYR A OH    1 
ATOM   280  N  N     . ILE A 1 41  ? 16.235  -11.371 -17.592 1.00 27.82  ? 147 ILE A N     1 
ATOM   281  C  CA    . ILE A 1 41  ? 16.632  -12.298 -16.569 1.00 26.13  ? 147 ILE A CA    1 
ATOM   282  C  C     . ILE A 1 41  ? 15.743  -12.105 -15.293 1.00 26.13  ? 147 ILE A C     1 
ATOM   283  O  O     . ILE A 1 41  ? 15.823  -11.102 -14.614 1.00 22.71  ? 147 ILE A O     1 
ATOM   284  C  CB    . ILE A 1 41  ? 18.106  -12.069 -16.232 1.00 26.24  ? 147 ILE A CB    1 
ATOM   285  C  CG1   . ILE A 1 41  ? 18.966  -12.327 -17.477 1.00 26.03  ? 147 ILE A CG1   1 
ATOM   286  C  CG2   . ILE A 1 41  ? 18.528  -12.994 -15.101 1.00 25.18  ? 147 ILE A CG2   1 
ATOM   287  C  CD1   . ILE A 1 41  ? 20.443  -12.205 -17.237 1.00 26.99  ? 147 ILE A CD1   1 
ATOM   288  N  N     . LYS A 1 42  ? 14.905  -13.099 -15.006 1.00 27.58  ? 148 LYS A N     1 
ATOM   289  C  CA    . LYS A 1 42  ? 14.009  -13.050 -13.876 1.00 27.97  ? 148 LYS A CA    1 
ATOM   290  C  C     . LYS A 1 42  ? 14.759  -13.046 -12.559 1.00 27.34  ? 148 LYS A C     1 
ATOM   291  O  O     . LYS A 1 42  ? 15.711  -13.829 -12.352 1.00 28.31  ? 148 LYS A O     1 
ATOM   292  C  CB    . LYS A 1 42  ? 13.023  -14.197 -13.924 1.00 30.19  ? 148 LYS A CB    1 
ATOM   293  C  CG    . LYS A 1 42  ? 11.929  -13.854 -14.904 1.00 32.37  ? 148 LYS A CG    1 
ATOM   294  C  CD    . LYS A 1 42  ? 10.766  -14.814 -14.891 1.00 35.93  ? 148 LYS A CD    1 
ATOM   295  C  CE    . LYS A 1 42  ? 11.196  -16.276 -15.069 1.00 39.73  ? 148 LYS A CE    1 
ATOM   296  N  NZ    . LYS A 1 42  ? 12.069  -16.657 -16.259 1.00 42.45  ? 148 LYS A NZ    1 
ATOM   297  N  N     . GLN A 1 43  ? 14.354  -12.142 -11.670 1.00 25.73  ? 149 GLN A N     1 
ATOM   298  C  CA    . GLN A 1 43  ? 15.002  -12.046 -10.322 1.00 24.58  ? 149 GLN A CA    1 
ATOM   299  C  C     . GLN A 1 43  ? 15.052  -13.359 -9.551  1.00 24.96  ? 149 GLN A C     1 
ATOM   300  O  O     . GLN A 1 43  ? 16.083  -13.678 -8.913  1.00 24.50  ? 149 GLN A O     1 
ATOM   301  C  CB    . GLN A 1 43  ? 14.262  -10.963 -9.493  1.00 23.14  ? 149 GLN A CB    1 
ATOM   302  C  CG    . GLN A 1 43  ? 14.861  -10.598 -8.139  1.00 23.09  ? 149 GLN A CG    1 
ATOM   303  C  CD    . GLN A 1 43  ? 15.948  -9.538  -8.131  1.00 22.96  ? 149 GLN A CD    1 
ATOM   304  O  OE1   . GLN A 1 43  ? 16.354  -9.003  -9.208  1.00 24.28  ? 149 GLN A OE1   1 
ATOM   305  N  NE2   . GLN A 1 43  ? 16.452  -9.209  -6.903  1.00 23.42  ? 149 GLN A NE2   1 
ATOM   306  N  N     . LEU A 1 44  ? 13.902  -14.057 -9.562  1.00 24.20  ? 150 LEU A N     1 
ATOM   307  C  CA    . LEU A 1 44  ? 13.712  -15.272 -8.734  1.00 23.97  ? 150 LEU A CA    1 
ATOM   308  C  C     . LEU A 1 44  ? 13.859  -16.602 -9.491  1.00 24.13  ? 150 LEU A C     1 
ATOM   309  O  O     . LEU A 1 44  ? 13.502  -17.624 -8.977  1.00 22.64  ? 150 LEU A O     1 
ATOM   310  C  CB    . LEU A 1 44  ? 12.297  -15.187 -8.086  1.00 23.21  ? 150 LEU A CB    1 
ATOM   311  C  CG    . LEU A 1 44  ? 12.113  -13.996 -7.097  1.00 23.15  ? 150 LEU A CG    1 
ATOM   312  C  CD1   . LEU A 1 44  ? 10.885  -14.150 -6.175  1.00 22.54  ? 150 LEU A CD1   1 
ATOM   313  C  CD2   . LEU A 1 44  ? 13.336  -13.666 -6.201  1.00 23.35  ? 150 LEU A CD2   1 
ATOM   314  N  N     . GLY A 1 45  ? 14.291  -16.525 -10.743 1.00 25.10  ? 151 GLY A N     1 
ATOM   315  C  CA    . GLY A 1 45  ? 14.402  -17.673 -11.622 1.00 27.25  ? 151 GLY A CA    1 
ATOM   316  C  C     . GLY A 1 45  ? 13.198  -18.582 -11.637 1.00 27.39  ? 151 GLY A C     1 
ATOM   317  O  O     . GLY A 1 45  ? 12.107  -18.174 -11.964 1.00 27.51  ? 151 GLY A O     1 
ATOM   318  N  N     . GLY A 1 46  ? 13.374  -19.802 -11.168 1.00 27.81  ? 152 GLY A N     1 
ATOM   319  C  CA    . GLY A 1 46  ? 12.260  -20.757 -11.252 1.00 27.83  ? 152 GLY A CA    1 
ATOM   320  C  C     . GLY A 1 46  ? 11.134  -20.480 -10.317 1.00 26.01  ? 152 GLY A C     1 
ATOM   321  O  O     . GLY A 1 46  ? 10.099  -21.148 -10.442 1.00 26.24  ? 152 GLY A O     1 
ATOM   322  N  N     . GLY A 1 47  ? 11.331  -19.518 -9.388  1.00 24.51  ? 153 GLY A N     1 
ATOM   323  C  CA    . GLY A 1 47  ? 10.317  -19.054 -8.458  1.00 23.88  ? 153 GLY A CA    1 
ATOM   324  C  C     . GLY A 1 47  ? 9.016   -18.651 -9.133  1.00 24.26  ? 153 GLY A C     1 
ATOM   325  O  O     . GLY A 1 47  ? 7.935   -18.920 -8.535  1.00 23.79  ? 153 GLY A O     1 
ATOM   326  N  N     . TYR A 1 48  ? 9.090   -18.089 -10.369 1.00 23.53  ? 154 TYR A N     1 
ATOM   327  C  CA    . TYR A 1 48  ? 7.871   -17.784 -11.096 1.00 23.82  ? 154 TYR A CA    1 
ATOM   328  C  C     . TYR A 1 48  ? 6.961   -18.993 -11.358 1.00 23.98  ? 154 TYR A C     1 
ATOM   329  O  O     . TYR A 1 48  ? 5.751   -18.835 -11.504 1.00 23.49  ? 154 TYR A O     1 
ATOM   330  C  CB    . TYR A 1 48  ? 8.264   -17.192 -12.411 1.00 24.34  ? 154 TYR A CB    1 
ATOM   331  C  CG    . TYR A 1 48  ? 7.181   -16.756 -13.356 1.00 23.62  ? 154 TYR A CG    1 
ATOM   332  C  CD1   . TYR A 1 48  ? 6.065   -16.052 -12.915 1.00 24.34  ? 154 TYR A CD1   1 
ATOM   333  C  CD2   . TYR A 1 48  ? 7.352   -16.884 -14.722 1.00 23.60  ? 154 TYR A CD2   1 
ATOM   334  C  CE1   . TYR A 1 48  ? 5.073   -15.560 -13.814 1.00 24.11  ? 154 TYR A CE1   1 
ATOM   335  C  CE2   . TYR A 1 48  ? 6.371   -16.388 -15.621 1.00 24.14  ? 154 TYR A CE2   1 
ATOM   336  C  CZ    . TYR A 1 48  ? 5.221   -15.750 -15.159 1.00 24.83  ? 154 TYR A CZ    1 
ATOM   337  O  OH    . TYR A 1 48  ? 4.305   -15.231 -16.081 1.00 26.45  ? 154 TYR A OH    1 
ATOM   338  N  N     . TYR A 1 49  ? 7.543   -20.181 -11.415 1.00 24.51  ? 155 TYR A N     1 
ATOM   339  C  CA    . TYR A 1 49  ? 6.767   -21.375 -11.721 1.00 26.29  ? 155 TYR A CA    1 
ATOM   340  C  C     . TYR A 1 49  ? 6.052   -21.929 -10.457 1.00 27.22  ? 155 TYR A C     1 
ATOM   341  O  O     . TYR A 1 49  ? 5.337   -22.972 -10.536 1.00 26.19  ? 155 TYR A O     1 
ATOM   342  C  CB    . TYR A 1 49  ? 7.648   -22.452 -12.387 1.00 26.99  ? 155 TYR A CB    1 
ATOM   343  C  CG    . TYR A 1 49  ? 8.126   -22.053 -13.747 1.00 28.73  ? 155 TYR A CG    1 
ATOM   344  C  CD1   . TYR A 1 49  ? 9.292   -21.265 -13.916 1.00 29.78  ? 155 TYR A CD1   1 
ATOM   345  C  CD2   . TYR A 1 49  ? 7.344   -22.331 -14.937 1.00 28.84  ? 155 TYR A CD2   1 
ATOM   346  C  CE1   . TYR A 1 49  ? 9.701   -20.819 -15.183 1.00 30.21  ? 155 TYR A CE1   1 
ATOM   347  C  CE2   . TYR A 1 49  ? 7.726   -21.841 -16.178 1.00 29.46  ? 155 TYR A CE2   1 
ATOM   348  C  CZ    . TYR A 1 49  ? 8.910   -21.103 -16.309 1.00 30.31  ? 155 TYR A CZ    1 
ATOM   349  O  OH    . TYR A 1 49  ? 9.372   -20.683 -17.562 1.00 29.29  ? 155 TYR A OH    1 
ATOM   350  N  N     . VAL A 1 50  ? 6.253   -21.241 -9.310  1.00 26.75  ? 156 VAL A N     1 
ATOM   351  C  CA    . VAL A 1 50  ? 5.500   -21.495 -8.079  1.00 26.11  ? 156 VAL A CA    1 
ATOM   352  C  C     . VAL A 1 50  ? 4.677   -20.304 -7.641  1.00 25.71  ? 156 VAL A C     1 
ATOM   353  O  O     . VAL A 1 50  ? 3.509   -20.463 -7.223  1.00 23.24  ? 156 VAL A O     1 
ATOM   354  C  CB    . VAL A 1 50  ? 6.445   -21.964 -6.985  1.00 26.10  ? 156 VAL A CB    1 
ATOM   355  C  CG1   . VAL A 1 50  ? 5.712   -22.142 -5.663  1.00 26.93  ? 156 VAL A CG1   1 
ATOM   356  C  CG2   . VAL A 1 50  ? 7.036   -23.320 -7.410  1.00 26.75  ? 156 VAL A CG2   1 
ATOM   357  N  N     . PHE A 1 51  ? 5.313   -19.127 -7.683  1.00 26.10  ? 157 PHE A N     1 
ATOM   358  C  CA    . PHE A 1 51  ? 4.679   -17.834 -7.386  1.00 25.56  ? 157 PHE A CA    1 
ATOM   359  C  C     . PHE A 1 51  ? 4.435   -17.028 -8.691  1.00 26.01  ? 157 PHE A C     1 
ATOM   360  O  O     . PHE A 1 51  ? 5.361   -16.345 -9.188  1.00 25.42  ? 157 PHE A O     1 
ATOM   361  C  CB    . PHE A 1 51  ? 5.600   -17.013 -6.492  1.00 24.03  ? 157 PHE A CB    1 
ATOM   362  C  CG    . PHE A 1 51  ? 5.693   -17.525 -5.105  1.00 23.42  ? 157 PHE A CG    1 
ATOM   363  C  CD1   . PHE A 1 51  ? 6.695   -18.481 -4.762  1.00 22.97  ? 157 PHE A CD1   1 
ATOM   364  C  CD2   . PHE A 1 51  ? 4.819   -17.044 -4.086  1.00 22.38  ? 157 PHE A CD2   1 
ATOM   365  C  CE1   . PHE A 1 51  ? 6.766   -18.960 -3.448  1.00 22.19  ? 157 PHE A CE1   1 
ATOM   366  C  CE2   . PHE A 1 51  ? 4.868   -17.594 -2.777  1.00 22.18  ? 157 PHE A CE2   1 
ATOM   367  C  CZ    . PHE A 1 51  ? 5.870   -18.540 -2.475  1.00 22.04  ? 157 PHE A CZ    1 
ATOM   368  N  N     . PRO A 1 52  ? 3.220   -17.079 -9.213  1.00 26.71  ? 158 PRO A N     1 
ATOM   369  C  CA    . PRO A 1 52  ? 2.885   -16.513 -10.518 1.00 27.98  ? 158 PRO A CA    1 
ATOM   370  C  C     . PRO A 1 52  ? 2.892   -15.003 -10.601 1.00 27.23  ? 158 PRO A C     1 
ATOM   371  O  O     . PRO A 1 52  ? 2.899   -14.488 -11.720 1.00 28.80  ? 158 PRO A O     1 
ATOM   372  C  CB    . PRO A 1 52  ? 1.444   -17.026 -10.771 1.00 28.75  ? 158 PRO A CB    1 
ATOM   373  C  CG    . PRO A 1 52  ? 0.879   -17.076 -9.365  1.00 27.46  ? 158 PRO A CG    1 
ATOM   374  C  CD    . PRO A 1 52  ? 2.030   -17.672 -8.575  1.00 28.14  ? 158 PRO A CD    1 
ATOM   375  N  N     . GLY A 1 53  ? 2.966   -14.304 -9.489  1.00 25.31  ? 159 GLY A N     1 
ATOM   376  C  CA    . GLY A 1 53  ? 3.178   -12.879 -9.553  1.00 24.72  ? 159 GLY A CA    1 
ATOM   377  C  C     . GLY A 1 53  ? 4.644   -12.525 -9.783  1.00 25.36  ? 159 GLY A C     1 
ATOM   378  O  O     . GLY A 1 53  ? 4.938   -11.341 -10.023 1.00 25.79  ? 159 GLY A O     1 
ATOM   379  N  N     . ALA A 1 54  ? 5.575   -13.509 -9.650  1.00 24.70  ? 160 ALA A N     1 
ATOM   380  C  CA    . ALA A 1 54  ? 7.049   -13.271 -9.615  1.00 24.67  ? 160 ALA A CA    1 
ATOM   381  C  C     . ALA A 1 54  ? 7.747   -13.271 -10.951 1.00 25.12  ? 160 ALA A C     1 
ATOM   382  O  O     . ALA A 1 54  ? 8.808   -14.002 -11.131 1.00 22.60  ? 160 ALA A O     1 
ATOM   383  C  CB    . ALA A 1 54  ? 7.751   -14.272 -8.712  1.00 25.83  ? 160 ALA A CB    1 
ATOM   384  N  N     . SER A 1 55  ? 7.190   -12.419 -11.852 1.00 24.01  ? 161 SER A N     1 
ATOM   385  C  CA    . SER A 1 55  ? 7.760   -12.199 -13.156 1.00 25.69  ? 161 SER A CA    1 
ATOM   386  C  C     . SER A 1 55  ? 8.778   -10.990 -13.219 1.00 23.46  ? 161 SER A C     1 
ATOM   387  O  O     . SER A 1 55  ? 9.135   -10.496 -14.327 1.00 22.34  ? 161 SER A O     1 
ATOM   388  C  CB    . SER A 1 55  ? 6.586   -11.880 -14.104 1.00 28.00  ? 161 SER A CB    1 
ATOM   389  O  OG    . SER A 1 55  ? 5.871   -10.676 -13.587 1.00 31.39  ? 161 SER A OG    1 
ATOM   390  N  N     . HIS A 1 56  ? 9.134   -10.418 -12.097 1.00 21.49  ? 162 HIS A N     1 
ATOM   391  C  CA    . HIS A 1 56  ? 10.001  -9.243  -12.092 1.00 21.65  ? 162 HIS A CA    1 
ATOM   392  C  C     . HIS A 1 56  ? 11.442  -9.607  -12.479 1.00 23.23  ? 162 HIS A C     1 
ATOM   393  O  O     . HIS A 1 56  ? 11.947  -10.745 -12.199 1.00 22.22  ? 162 HIS A O     1 
ATOM   394  C  CB    . HIS A 1 56  ? 9.908   -8.492  -10.795 1.00 21.68  ? 162 HIS A CB    1 
ATOM   395  C  CG    . HIS A 1 56  ? 10.246  -9.309  -9.587  1.00 21.06  ? 162 HIS A CG    1 
ATOM   396  N  ND1   . HIS A 1 56  ? 9.540   -10.458 -9.241  1.00 20.55  ? 162 HIS A ND1   1 
ATOM   397  C  CD2   . HIS A 1 56  ? 11.166  -9.102  -8.598  1.00 20.49  ? 162 HIS A CD2   1 
ATOM   398  C  CE1   . HIS A 1 56  ? 9.998   -10.897 -8.080  1.00 20.04  ? 162 HIS A CE1   1 
ATOM   399  N  NE2   . HIS A 1 56  ? 10.973  -10.093 -7.655  1.00 19.63  ? 162 HIS A NE2   1 
ATOM   400  N  N     . ASN A 1 57  ? 12.053  -8.715  -13.283 1.00 24.16  ? 163 ASN A N     1 
ATOM   401  C  CA    . ASN A 1 57  ? 13.412  -8.981  -13.794 1.00 24.53  ? 163 ASN A CA    1 
ATOM   402  C  C     . ASN A 1 57  ? 14.433  -8.137  -13.035 1.00 23.91  ? 163 ASN A C     1 
ATOM   403  O  O     . ASN A 1 57  ? 14.067  -7.286  -12.240 1.00 24.67  ? 163 ASN A O     1 
ATOM   404  C  CB    . ASN A 1 57  ? 13.462  -8.700  -15.279 1.00 24.72  ? 163 ASN A CB    1 
ATOM   405  C  CG    . ASN A 1 57  ? 12.355  -9.399  -16.005 1.00 26.54  ? 163 ASN A CG    1 
ATOM   406  O  OD1   . ASN A 1 57  ? 12.329  -10.619 -16.044 1.00 28.97  ? 163 ASN A OD1   1 
ATOM   407  N  ND2   . ASN A 1 57  ? 11.427  -8.632  -16.596 1.00 25.20  ? 163 ASN A ND2   1 
ATOM   408  N  N     . ARG A 1 58  ? 15.704  -8.382  -13.317 1.00 23.84  ? 164 ARG A N     1 
ATOM   409  C  CA    . ARG A 1 58  ? 16.845  -7.729  -12.630 1.00 23.53  ? 164 ARG A CA    1 
ATOM   410  C  C     . ARG A 1 58  ? 16.979  -6.292  -12.984 1.00 22.47  ? 164 ARG A C     1 
ATOM   411  O  O     . ARG A 1 58  ? 17.569  -5.537  -12.213 1.00 22.57  ? 164 ARG A O     1 
ATOM   412  C  CB    . ARG A 1 58  ? 18.202  -8.437  -12.971 1.00 23.85  ? 164 ARG A CB    1 
ATOM   413  C  CG    . ARG A 1 58  ? 18.373  -9.868  -12.428 1.00 24.08  ? 164 ARG A CG    1 
ATOM   414  C  CD    . ARG A 1 58  ? 19.084  -9.898  -11.062 1.00 25.60  ? 164 ARG A CD    1 
ATOM   415  N  NE    . ARG A 1 58  ? 18.636  -10.998 -10.211 1.00 25.73  ? 164 ARG A NE    1 
ATOM   416  C  CZ    . ARG A 1 58  ? 18.850  -11.095 -8.895  1.00 25.36  ? 164 ARG A CZ    1 
ATOM   417  N  NH1   . ARG A 1 58  ? 18.236  -12.095 -8.253  1.00 25.55  ? 164 ARG A NH1   1 
ATOM   418  N  NH2   . ARG A 1 58  ? 19.543  -10.180 -8.218  1.00 24.33  ? 164 ARG A NH2   1 
ATOM   419  N  N     . PHE A 1 59  ? 16.438  -5.911  -14.116 1.00 22.37  ? 165 PHE A N     1 
ATOM   420  C  CA    . PHE A 1 59  ? 16.485  -4.485  -14.569 1.00 23.46  ? 165 PHE A CA    1 
ATOM   421  C  C     . PHE A 1 59  ? 15.893  -3.482  -13.482 1.00 23.41  ? 165 PHE A C     1 
ATOM   422  O  O     . PHE A 1 59  ? 16.589  -2.557  -12.946 1.00 21.80  ? 165 PHE A O     1 
ATOM   423  C  CB    . PHE A 1 59  ? 15.758  -4.402  -15.911 1.00 23.93  ? 165 PHE A CB    1 
ATOM   424  C  CG    . PHE A 1 59  ? 15.703  -2.989  -16.511 1.00 25.20  ? 165 PHE A CG    1 
ATOM   425  C  CD1   . PHE A 1 59  ? 16.766  -2.481  -17.269 1.00 23.63  ? 165 PHE A CD1   1 
ATOM   426  C  CD2   . PHE A 1 59  ? 14.550  -2.210  -16.364 1.00 24.68  ? 165 PHE A CD2   1 
ATOM   427  C  CE1   . PHE A 1 59  ? 16.682  -1.226  -17.779 1.00 24.94  ? 165 PHE A CE1   1 
ATOM   428  C  CE2   . PHE A 1 59  ? 14.486  -0.967  -16.913 1.00 24.68  ? 165 PHE A CE2   1 
ATOM   429  C  CZ    . PHE A 1 59  ? 15.541  -0.450  -17.584 1.00 25.44  ? 165 PHE A CZ    1 
ATOM   430  N  N     . GLU A 1 60  ? 14.643  -3.747  -13.114 1.00 22.13  ? 166 GLU A N     1 
ATOM   431  C  CA    . GLU A 1 60  ? 13.912  -2.916  -12.155 1.00 21.77  ? 166 GLU A CA    1 
ATOM   432  C  C     . GLU A 1 60  ? 14.617  -2.971  -10.774 1.00 21.15  ? 166 GLU A C     1 
ATOM   433  O  O     . GLU A 1 60  ? 14.804  -1.924  -10.107 1.00 20.53  ? 166 GLU A O     1 
ATOM   434  C  CB    . GLU A 1 60  ? 12.414  -3.230  -12.123 1.00 22.29  ? 166 GLU A CB    1 
ATOM   435  C  CG    . GLU A 1 60  ? 12.016  -4.706  -12.202 1.00 24.65  ? 166 GLU A CG    1 
ATOM   436  C  CD    . GLU A 1 60  ? 11.703  -5.255  -13.640 1.00 25.40  ? 166 GLU A CD    1 
ATOM   437  O  OE1   . GLU A 1 60  ? 10.739  -6.103  -13.716 1.00 24.28  ? 166 GLU A OE1   1 
ATOM   438  O  OE2   . GLU A 1 60  ? 12.374  -4.860  -14.660 1.00 25.35  ? 166 GLU A OE2   1 
ATOM   439  N  N     . HIS A 1 61  ? 15.104  -4.141  -10.375 1.00 20.28  ? 167 HIS A N     1 
ATOM   440  C  CA    . HIS A 1 61  ? 15.822  -4.243  -9.110  1.00 19.92  ? 167 HIS A CA    1 
ATOM   441  C  C     . HIS A 1 61  ? 17.058  -3.355  -9.095  1.00 19.83  ? 167 HIS A C     1 
ATOM   442  O  O     . HIS A 1 61  ? 17.295  -2.625  -8.111  1.00 20.34  ? 167 HIS A O     1 
ATOM   443  C  CB    . HIS A 1 61  ? 16.135  -5.702  -8.816  1.00 20.31  ? 167 HIS A CB    1 
ATOM   444  C  CG    . HIS A 1 61  ? 17.176  -5.934  -7.747  1.00 20.39  ? 167 HIS A CG    1 
ATOM   445  N  ND1   . HIS A 1 61  ? 16.968  -5.647  -6.395  1.00 19.28  ? 167 HIS A ND1   1 
ATOM   446  C  CD2   . HIS A 1 61  ? 18.422  -6.474  -7.844  1.00 20.55  ? 167 HIS A CD2   1 
ATOM   447  C  CE1   . HIS A 1 61  ? 18.068  -5.970  -5.735  1.00 20.04  ? 167 HIS A CE1   1 
ATOM   448  N  NE2   . HIS A 1 61  ? 18.961  -6.472  -6.575  1.00 20.22  ? 167 HIS A NE2   1 
ATOM   449  N  N     . SER A 1 62  ? 17.731  -3.291  -10.219 1.00 19.95  ? 168 SER A N     1 
ATOM   450  C  CA    . SER A 1 62  ? 18.999  -2.576  -10.342 1.00 20.43  ? 168 SER A CA    1 
ATOM   451  C  C     . SER A 1 62  ? 18.775  -1.114  -10.285 1.00 20.56  ? 168 SER A C     1 
ATOM   452  O  O     . SER A 1 62  ? 19.517  -0.425  -9.580  1.00 22.16  ? 168 SER A O     1 
ATOM   453  C  CB    . SER A 1 62  ? 19.760  -2.997  -11.613 1.00 20.62  ? 168 SER A CB    1 
ATOM   454  O  OG    . SER A 1 62  ? 20.030  -4.411  -11.649 1.00 20.72  ? 168 SER A OG    1 
ATOM   455  N  N     . LEU A 1 63  ? 17.715  -0.631  -10.920 1.00 20.51  ? 169 LEU A N     1 
ATOM   456  C  CA    . LEU A 1 63  ? 17.322  0.815   -10.751 1.00 20.81  ? 169 LEU A CA    1 
ATOM   457  C  C     . LEU A 1 63  ? 17.014  1.130   -9.314  1.00 21.16  ? 169 LEU A C     1 
ATOM   458  O  O     . LEU A 1 63  ? 17.346  2.189   -8.828  1.00 22.90  ? 169 LEU A O     1 
ATOM   459  C  CB    . LEU A 1 63  ? 16.067  1.186   -11.587 1.00 20.04  ? 169 LEU A CB    1 
ATOM   460  C  CG    . LEU A 1 63  ? 16.051  0.984   -13.118 1.00 20.11  ? 169 LEU A CG    1 
ATOM   461  C  CD1   . LEU A 1 63  ? 14.720  1.166   -13.800 1.00 20.07  ? 169 LEU A CD1   1 
ATOM   462  C  CD2   . LEU A 1 63  ? 16.895  2.028   -13.744 1.00 20.62  ? 169 LEU A CD2   1 
ATOM   463  N  N     . GLY A 1 64  ? 16.327  0.219   -8.598  1.00 22.26  ? 170 GLY A N     1 
ATOM   464  C  CA    . GLY A 1 64  ? 16.029  0.454   -7.149  1.00 21.52  ? 170 GLY A CA    1 
ATOM   465  C  C     . GLY A 1 64  ? 17.264  0.535   -6.288  1.00 21.93  ? 170 GLY A C     1 
ATOM   466  O  O     . GLY A 1 64  ? 17.369  1.406   -5.419  1.00 21.75  ? 170 GLY A O     1 
ATOM   467  N  N     . VAL A 1 65  ? 18.222  -0.368  -6.517  1.00 21.99  ? 171 VAL A N     1 
ATOM   468  C  CA    . VAL A 1 65  ? 19.382  -0.386  -5.685  1.00 21.44  ? 171 VAL A CA    1 
ATOM   469  C  C     . VAL A 1 65  ? 20.168  0.927   -5.896  1.00 22.25  ? 171 VAL A C     1 
ATOM   470  O  O     . VAL A 1 65  ? 20.648  1.541   -4.914  1.00 21.09  ? 171 VAL A O     1 
ATOM   471  C  CB    . VAL A 1 65  ? 20.221  -1.607  -5.935  1.00 21.76  ? 171 VAL A CB    1 
ATOM   472  C  CG1   . VAL A 1 65  ? 21.542  -1.560  -5.153  1.00 22.05  ? 171 VAL A CG1   1 
ATOM   473  C  CG2   . VAL A 1 65  ? 19.459  -2.866  -5.512  1.00 22.21  ? 171 VAL A CG2   1 
ATOM   474  N  N     . GLY A 1 66  ? 20.279  1.362   -7.153  1.00 22.99  ? 172 GLY A N     1 
ATOM   475  C  CA    . GLY A 1 66  ? 20.969  2.590   -7.469  1.00 23.19  ? 172 GLY A CA    1 
ATOM   476  C  C     . GLY A 1 66  ? 20.234  3.766   -6.806  1.00 23.52  ? 172 GLY A C     1 
ATOM   477  O  O     . GLY A 1 66  ? 20.876  4.712   -6.288  1.00 23.91  ? 172 GLY A O     1 
ATOM   478  N  N     . TYR A 1 67  ? 18.915  3.766   -6.813  1.00 23.42  ? 173 TYR A N     1 
ATOM   479  C  CA    . TYR A 1 67  ? 18.206  4.878   -6.187  1.00 23.14  ? 173 TYR A CA    1 
ATOM   480  C  C     . TYR A 1 67  ? 18.404  4.838   -4.662  1.00 24.76  ? 173 TYR A C     1 
ATOM   481  O  O     . TYR A 1 67  ? 18.732  5.847   -4.101  1.00 26.04  ? 173 TYR A O     1 
ATOM   482  C  CB    . TYR A 1 67  ? 16.743  4.854   -6.560  1.00 22.93  ? 173 TYR A CB    1 
ATOM   483  C  CG    . TYR A 1 67  ? 15.837  5.659   -5.637  1.00 23.17  ? 173 TYR A CG    1 
ATOM   484  C  CD1   . TYR A 1 67  ? 15.768  7.034   -5.724  1.00 22.75  ? 173 TYR A CD1   1 
ATOM   485  C  CD2   . TYR A 1 67  ? 15.046  5.013   -4.668  1.00 23.75  ? 173 TYR A CD2   1 
ATOM   486  C  CE1   . TYR A 1 67  ? 14.950  7.758   -4.880  1.00 22.87  ? 173 TYR A CE1   1 
ATOM   487  C  CE2   . TYR A 1 67  ? 14.191  5.736   -3.861  1.00 23.01  ? 173 TYR A CE2   1 
ATOM   488  C  CZ    . TYR A 1 67  ? 14.180  7.105   -3.954  1.00 22.95  ? 173 TYR A CZ    1 
ATOM   489  O  OH    . TYR A 1 67  ? 13.339  7.805   -3.102  1.00 22.53  ? 173 TYR A OH    1 
ATOM   490  N  N     . LEU A 1 68  ? 18.240  3.679   -4.003  1.00 25.16  ? 174 LEU A N     1 
ATOM   491  C  CA    . LEU A 1 68  ? 18.452  3.601   -2.533  1.00 24.40  ? 174 LEU A CA    1 
ATOM   492  C  C     . LEU A 1 68  ? 19.922  3.971   -2.173  1.00 25.44  ? 174 LEU A C     1 
ATOM   493  O  O     . LEU A 1 68  ? 20.148  4.614   -1.153  1.00 27.13  ? 174 LEU A O     1 
ATOM   494  C  CB    . LEU A 1 68  ? 18.060  2.270   -1.918  1.00 23.53  ? 174 LEU A CB    1 
ATOM   495  C  CG    . LEU A 1 68  ? 16.558  1.841   -2.033  1.00 24.47  ? 174 LEU A CG    1 
ATOM   496  C  CD1   . LEU A 1 68  ? 16.245  0.495   -1.360  1.00 23.92  ? 174 LEU A CD1   1 
ATOM   497  C  CD2   . LEU A 1 68  ? 15.525  2.822   -1.523  1.00 23.98  ? 174 LEU A CD2   1 
ATOM   498  N  N     . ALA A 1 69  ? 20.902  3.586   -2.978  1.00 25.19  ? 175 ALA A N     1 
ATOM   499  C  CA    . ALA A 1 69  ? 22.306  3.890   -2.630  1.00 26.23  ? 175 ALA A CA    1 
ATOM   500  C  C     . ALA A 1 69  ? 22.516  5.414   -2.511  1.00 26.99  ? 175 ALA A C     1 
ATOM   501  O  O     . ALA A 1 69  ? 23.135  5.887   -1.601  1.00 26.00  ? 175 ALA A O     1 
ATOM   502  C  CB    . ALA A 1 69  ? 23.228  3.325   -3.657  1.00 25.06  ? 175 ALA A CB    1 
ATOM   503  N  N     . GLY A 1 70  ? 21.904  6.146   -3.426  1.00 28.26  ? 176 GLY A N     1 
ATOM   504  C  CA    . GLY A 1 70  ? 21.888  7.606   -3.446  1.00 28.74  ? 176 GLY A CA    1 
ATOM   505  C  C     . GLY A 1 70  ? 21.149  8.161   -2.270  1.00 29.53  ? 176 GLY A C     1 
ATOM   506  O  O     . GLY A 1 70  ? 21.637  9.096   -1.615  1.00 29.94  ? 176 GLY A O     1 
ATOM   507  N  N     . CYS A 1 71  ? 19.984  7.591   -1.951  1.00 28.49  ? 177 CYS A N     1 
ATOM   508  C  CA    . CYS A 1 71  ? 19.281  8.074   -0.747  1.00 28.78  ? 177 CYS A CA    1 
ATOM   509  C  C     . CYS A 1 71  ? 20.227  8.001   0.534   1.00 27.44  ? 177 CYS A C     1 
ATOM   510  O  O     . CYS A 1 71  ? 20.367  8.989   1.288   1.00 26.06  ? 177 CYS A O     1 
ATOM   511  C  CB    . CYS A 1 71  ? 17.961  7.322   -0.501  1.00 28.96  ? 177 CYS A CB    1 
ATOM   512  S  SG    . CYS A 1 71  ? 16.728  7.609   -1.804  1.00 31.39  ? 177 CYS A SG    1 
ATOM   513  N  N     . LEU A 1 72  ? 20.892  6.870   0.731   1.00 26.32  ? 178 LEU A N     1 
ATOM   514  C  CA    . LEU A 1 72  ? 21.651  6.659   1.999   1.00 27.00  ? 178 LEU A CA    1 
ATOM   515  C  C     . LEU A 1 72  ? 22.846  7.622   2.075   1.00 27.75  ? 178 LEU A C     1 
ATOM   516  O  O     . LEU A 1 72  ? 23.017  8.283   3.083   1.00 26.85  ? 178 LEU A O     1 
ATOM   517  C  CB    . LEU A 1 72  ? 22.115  5.192   2.194   1.00 25.33  ? 178 LEU A CB    1 
ATOM   518  C  CG    . LEU A 1 72  ? 22.918  4.923   3.481   1.00 25.71  ? 178 LEU A CG    1 
ATOM   519  C  CD1   . LEU A 1 72  ? 22.284  5.358   4.787   1.00 25.31  ? 178 LEU A CD1   1 
ATOM   520  C  CD2   . LEU A 1 72  ? 23.092  3.436   3.574   1.00 25.63  ? 178 LEU A CD2   1 
ATOM   521  N  N     . VAL A 1 73  ? 23.614  7.704   0.985   1.00 29.48  ? 179 VAL A N     1 
ATOM   522  C  CA    . VAL A 1 73  ? 24.777  8.570   0.924   1.00 31.00  ? 179 VAL A CA    1 
ATOM   523  C  C     . VAL A 1 73  ? 24.402  10.027  1.054   1.00 32.21  ? 179 VAL A C     1 
ATOM   524  O  O     . VAL A 1 73  ? 25.108  10.702  1.828   1.00 30.51  ? 179 VAL A O     1 
ATOM   525  C  CB    . VAL A 1 73  ? 25.697  8.286   -0.305  1.00 33.41  ? 179 VAL A CB    1 
ATOM   526  C  CG1   . VAL A 1 73  ? 25.042  8.724   -1.614  1.00 34.53  ? 179 VAL A CG1   1 
ATOM   527  C  CG2   . VAL A 1 73  ? 27.073  8.943   -0.148  1.00 32.95  ? 179 VAL A CG2   1 
ATOM   528  N  N     . HIS A 1 74  ? 23.311  10.499  0.400   1.00 35.80  ? 180 HIS A N     1 
ATOM   529  C  CA    . HIS A 1 74  ? 22.864  11.924  0.510   1.00 39.11  ? 180 HIS A CA    1 
ATOM   530  C  C     . HIS A 1 74  ? 22.506  12.238  1.939   1.00 37.93  ? 180 HIS A C     1 
ATOM   531  O  O     . HIS A 1 74  ? 22.844  13.280  2.441   1.00 38.95  ? 180 HIS A O     1 
ATOM   532  C  CB    . HIS A 1 74  ? 21.672  12.345  -0.378  1.00 42.04  ? 180 HIS A CB    1 
ATOM   533  C  CG    . HIS A 1 74  ? 22.069  12.837  -1.749  1.00 53.08  ? 180 HIS A CG    1 
ATOM   534  N  ND1   . HIS A 1 74  ? 21.638  12.242  -2.936  1.00 56.74  ? 180 HIS A ND1   1 
ATOM   535  C  CD2   . HIS A 1 74  ? 22.894  13.855  -2.129  1.00 58.32  ? 180 HIS A CD2   1 
ATOM   536  C  CE1   . HIS A 1 74  ? 22.190  12.855  -3.969  1.00 55.98  ? 180 HIS A CE1   1 
ATOM   537  N  NE2   . HIS A 1 74  ? 22.963  13.830  -3.510  1.00 58.71  ? 180 HIS A NE2   1 
ATOM   538  N  N     . ALA A 1 75  ? 21.788  11.358  2.598   1.00 35.74  ? 181 ALA A N     1 
ATOM   539  C  CA    . ALA A 1 75  ? 21.342  11.627  3.944   1.00 34.97  ? 181 ALA A CA    1 
ATOM   540  C  C     . ALA A 1 75  ? 22.506  11.682  4.964   1.00 36.53  ? 181 ALA A C     1 
ATOM   541  O  O     . ALA A 1 75  ? 22.504  12.551  5.792   1.00 40.92  ? 181 ALA A O     1 
ATOM   542  C  CB    . ALA A 1 75  ? 20.361  10.586  4.358   1.00 34.67  ? 181 ALA A CB    1 
ATOM   543  N  N     . LEU A 1 76  ? 23.500  10.796  4.867   1.00 34.43  ? 182 LEU A N     1 
ATOM   544  C  CA    . LEU A 1 76  ? 24.704  10.948  5.659   1.00 32.75  ? 182 LEU A CA    1 
ATOM   545  C  C     . LEU A 1 76  ? 25.413  12.297  5.437   1.00 35.54  ? 182 LEU A C     1 
ATOM   546  O  O     . LEU A 1 76  ? 25.843  12.947  6.407   1.00 35.53  ? 182 LEU A O     1 
ATOM   547  C  CB    . LEU A 1 76  ? 25.681  9.808   5.362   1.00 31.06  ? 182 LEU A CB    1 
ATOM   548  C  CG    . LEU A 1 76  ? 25.185  8.437   5.726   1.00 29.75  ? 182 LEU A CG    1 
ATOM   549  C  CD1   . LEU A 1 76  ? 26.191  7.413   5.366   1.00 29.37  ? 182 LEU A CD1   1 
ATOM   550  C  CD2   . LEU A 1 76  ? 24.845  8.346   7.192   1.00 30.94  ? 182 LEU A CD2   1 
ATOM   551  N  N     . GLY A 1 77  ? 25.539  12.699  4.167   1.00 35.78  ? 183 GLY A N     1 
ATOM   552  C  CA    . GLY A 1 77  ? 26.051  14.001  3.773   1.00 37.05  ? 183 GLY A CA    1 
ATOM   553  C  C     . GLY A 1 77  ? 25.338  15.210  4.321   1.00 41.65  ? 183 GLY A C     1 
ATOM   554  O  O     . GLY A 1 77  ? 25.991  16.139  4.767   1.00 46.77  ? 183 GLY A O     1 
ATOM   555  N  N     . GLU A 1 78  ? 24.007  15.227  4.316   1.00 46.98  ? 184 GLU A N     1 
ATOM   556  C  CA    . GLU A 1 78  ? 23.248  16.419  4.775   1.00 51.78  ? 184 GLU A CA    1 
ATOM   557  C  C     . GLU A 1 78  ? 23.503  16.645  6.238   1.00 49.18  ? 184 GLU A C     1 
ATOM   558  O  O     . GLU A 1 78  ? 23.710  17.745  6.688   1.00 47.98  ? 184 GLU A O     1 
ATOM   559  C  CB    . GLU A 1 78  ? 21.712  16.326  4.602   1.00 61.18  ? 184 GLU A CB    1 
ATOM   560  C  CG    . GLU A 1 78  ? 21.151  16.063  3.213   1.00 76.67  ? 184 GLU A CG    1 
ATOM   561  C  CD    . GLU A 1 78  ? 21.665  17.009  2.102   1.00 94.78  ? 184 GLU A CD    1 
ATOM   562  O  OE1   . GLU A 1 78  ? 21.525  18.248  2.286   1.00 108.96 ? 184 GLU A OE1   1 
ATOM   563  O  OE2   . GLU A 1 78  ? 22.169  16.497  1.033   1.00 101.21 ? 184 GLU A OE2   1 
ATOM   564  N  N     . LYS A 1 79  ? 23.437  15.571  6.986   1.00 47.19  ? 185 LYS A N     1 
ATOM   565  C  CA    . LYS A 1 79  ? 23.495  15.669  8.392   1.00 47.60  ? 185 LYS A CA    1 
ATOM   566  C  C     . LYS A 1 79  ? 24.886  15.752  8.958   1.00 43.08  ? 185 LYS A C     1 
ATOM   567  O  O     . LYS A 1 79  ? 25.013  16.218  10.065  1.00 40.36  ? 185 LYS A O     1 
ATOM   568  C  CB    . LYS A 1 79  ? 22.752  14.503  9.002   1.00 51.91  ? 185 LYS A CB    1 
ATOM   569  C  CG    . LYS A 1 79  ? 21.228  14.641  8.856   1.00 59.28  ? 185 LYS A CG    1 
ATOM   570  C  CD    . LYS A 1 79  ? 20.566  13.270  9.049   1.00 67.33  ? 185 LYS A CD    1 
ATOM   571  C  CE    . LYS A 1 79  ? 21.177  12.505  10.258  1.00 67.89  ? 185 LYS A CE    1 
ATOM   572  N  NZ    . LYS A 1 79  ? 21.006  11.031  10.108  1.00 69.80  ? 185 LYS A NZ    1 
ATOM   573  N  N     . GLN A 1 80  ? 25.898  15.295  8.232   1.00 39.66  ? 186 GLN A N     1 
ATOM   574  C  CA    . GLN A 1 80  ? 27.287  15.355  8.679   1.00 40.31  ? 186 GLN A CA    1 
ATOM   575  C  C     . GLN A 1 80  ? 28.208  15.879  7.544   1.00 41.56  ? 186 GLN A C     1 
ATOM   576  O  O     . GLN A 1 80  ? 29.000  15.084  6.957   1.00 40.65  ? 186 GLN A O     1 
ATOM   577  C  CB    . GLN A 1 80  ? 27.774  13.983  9.163   1.00 39.72  ? 186 GLN A CB    1 
ATOM   578  C  CG    . GLN A 1 80  ? 27.040  13.463  10.380  1.00 41.29  ? 186 GLN A CG    1 
ATOM   579  C  CD    . GLN A 1 80  ? 27.545  12.076  10.829  1.00 42.48  ? 186 GLN A CD    1 
ATOM   580  O  OE1   . GLN A 1 80  ? 26.953  11.013  10.520  1.00 46.10  ? 186 GLN A OE1   1 
ATOM   581  N  NE2   . GLN A 1 80  ? 28.643  12.079  11.532  1.00 39.48  ? 186 GLN A NE2   1 
ATOM   582  N  N     . PRO A 1 81  ? 28.139  17.219  7.265   1.00 41.81  ? 187 PRO A N     1 
ATOM   583  C  CA    . PRO A 1 81  ? 29.031  17.955  6.327   1.00 41.03  ? 187 PRO A CA    1 
ATOM   584  C  C     . PRO A 1 81  ? 30.486  17.694  6.553   1.00 39.26  ? 187 PRO A C     1 
ATOM   585  O  O     . PRO A 1 81  ? 31.251  17.648  5.608   1.00 41.17  ? 187 PRO A O     1 
ATOM   586  C  CB    . PRO A 1 81  ? 28.730  19.438  6.616   1.00 42.52  ? 187 PRO A CB    1 
ATOM   587  C  CG    . PRO A 1 81  ? 27.324  19.470  7.235   1.00 42.45  ? 187 PRO A CG    1 
ATOM   588  C  CD    . PRO A 1 81  ? 27.113  18.128  7.871   1.00 42.62  ? 187 PRO A CD    1 
ATOM   589  N  N     . GLU A 1 82  ? 30.866  17.459  7.790   1.00 39.67  ? 188 GLU A N     1 
ATOM   590  C  CA    . GLU A 1 82  ? 32.256  17.121  8.148   1.00 41.96  ? 188 GLU A CA    1 
ATOM   591  C  C     . GLU A 1 82  ? 32.805  15.830  7.553   1.00 42.75  ? 188 GLU A C     1 
ATOM   592  O  O     . GLU A 1 82  ? 34.003  15.616  7.575   1.00 41.08  ? 188 GLU A O     1 
ATOM   593  C  CB    . GLU A 1 82  ? 32.459  17.114  9.684   1.00 44.47  ? 188 GLU A CB    1 
ATOM   594  C  CG    . GLU A 1 82  ? 31.978  15.867  10.462  1.00 45.10  ? 188 GLU A CG    1 
ATOM   595  C  CD    . GLU A 1 82  ? 30.507  15.887  10.842  1.00 46.61  ? 188 GLU A CD    1 
ATOM   596  O  OE1   . GLU A 1 82  ? 29.719  16.783  10.442  1.00 47.20  ? 188 GLU A OE1   1 
ATOM   597  O  OE2   . GLU A 1 82  ? 30.121  14.984  11.626  1.00 48.67  ? 188 GLU A OE2   1 
ATOM   598  N  N     . LEU A 1 83  ? 31.958  14.943  7.037   1.00 44.99  ? 189 LEU A N     1 
ATOM   599  C  CA    . LEU A 1 83  ? 32.484  13.754  6.346   1.00 45.70  ? 189 LEU A CA    1 
ATOM   600  C  C     . LEU A 1 83  ? 33.087  14.101  4.997   1.00 43.63  ? 189 LEU A C     1 
ATOM   601  O  O     . LEU A 1 83  ? 33.785  13.325  4.451   1.00 43.02  ? 189 LEU A O     1 
ATOM   602  C  CB    . LEU A 1 83  ? 31.393  12.709  6.186   1.00 45.91  ? 189 LEU A CB    1 
ATOM   603  C  CG    . LEU A 1 83  ? 30.834  12.228  7.518   1.00 46.72  ? 189 LEU A CG    1 
ATOM   604  C  CD1   . LEU A 1 83  ? 29.636  11.334  7.269   1.00 44.33  ? 189 LEU A CD1   1 
ATOM   605  C  CD2   . LEU A 1 83  ? 31.905  11.532  8.360   1.00 47.21  ? 189 LEU A CD2   1 
ATOM   606  N  N     . GLN A 1 84  ? 32.791  15.262  4.455   1.00 47.41  ? 190 GLN A N     1 
ATOM   607  C  CA    . GLN A 1 84  ? 33.342  15.673  3.166   1.00 52.16  ? 190 GLN A CA    1 
ATOM   608  C  C     . GLN A 1 84  ? 32.916  14.741  2.033   1.00 49.77  ? 190 GLN A C     1 
ATOM   609  O  O     . GLN A 1 84  ? 33.737  14.267  1.226   1.00 47.62  ? 190 GLN A O     1 
ATOM   610  C  CB    . GLN A 1 84  ? 34.884  15.739  3.275   1.00 60.42  ? 190 GLN A CB    1 
ATOM   611  C  CG    . GLN A 1 84  ? 35.437  16.515  4.477   1.00 63.95  ? 190 GLN A CG    1 
ATOM   612  C  CD    . GLN A 1 84  ? 35.439  18.025  4.231   1.00 67.22  ? 190 GLN A CD    1 
ATOM   613  O  OE1   . GLN A 1 84  ? 36.164  18.509  3.371   1.00 77.04  ? 190 GLN A OE1   1 
ATOM   614  N  NE2   . GLN A 1 84  ? 34.626  18.767  4.972   1.00 65.61  ? 190 GLN A NE2   1 
ATOM   615  N  N     . ILE A 1 85  ? 31.636  14.420  2.004   1.00 46.67  ? 191 ILE A N     1 
ATOM   616  C  CA    . ILE A 1 85  ? 31.082  13.605  0.939   1.00 43.16  ? 191 ILE A CA    1 
ATOM   617  C  C     . ILE A 1 85  ? 30.885  14.592  -0.229  1.00 40.85  ? 191 ILE A C     1 
ATOM   618  O  O     . ILE A 1 85  ? 30.199  15.614  -0.081  1.00 40.76  ? 191 ILE A O     1 
ATOM   619  C  CB    . ILE A 1 85  ? 29.776  12.942  1.411   1.00 40.68  ? 191 ILE A CB    1 
ATOM   620  C  CG1   . ILE A 1 85  ? 30.070  11.831  2.368   1.00 40.07  ? 191 ILE A CG1   1 
ATOM   621  C  CG2   . ILE A 1 85  ? 28.963  12.387  0.258   1.00 42.06  ? 191 ILE A CG2   1 
ATOM   622  C  CD1   . ILE A 1 85  ? 28.844  11.373  3.157   1.00 39.56  ? 191 ILE A CD1   1 
ATOM   623  N  N     . SER A 1 86  ? 31.533  14.307  -1.338  1.00 40.53  ? 192 SER A N     1 
ATOM   624  C  CA    . SER A 1 86  ? 31.432  15.150  -2.545  1.00 41.28  ? 192 SER A CA    1 
ATOM   625  C  C     . SER A 1 86  ? 30.391  14.574  -3.510  1.00 41.58  ? 192 SER A C     1 
ATOM   626  O  O     . SER A 1 86  ? 29.912  13.440  -3.316  1.00 37.43  ? 192 SER A O     1 
ATOM   627  C  CB    . SER A 1 86  ? 32.779  15.204  -3.282  1.00 40.37  ? 192 SER A CB    1 
ATOM   628  O  OG    . SER A 1 86  ? 33.119  13.958  -3.879  1.00 39.35  ? 192 SER A OG    1 
ATOM   629  N  N     . GLU A 1 87  ? 30.108  15.337  -4.578  1.00 43.94  ? 193 GLU A N     1 
ATOM   630  C  CA    . GLU A 1 87  ? 29.169  14.919  -5.632  1.00 45.84  ? 193 GLU A CA    1 
ATOM   631  C  C     . GLU A 1 87  ? 29.748  13.767  -6.425  1.00 42.25  ? 193 GLU A C     1 
ATOM   632  O  O     . GLU A 1 87  ? 29.034  12.884  -6.863  1.00 42.80  ? 193 GLU A O     1 
ATOM   633  C  CB    . GLU A 1 87  ? 28.804  16.062  -6.590  1.00 50.05  ? 193 GLU A CB    1 
ATOM   634  C  CG    . GLU A 1 87  ? 27.992  17.211  -5.967  1.00 57.37  ? 193 GLU A CG    1 
ATOM   635  C  CD    . GLU A 1 87  ? 26.732  16.799  -5.157  1.00 65.11  ? 193 GLU A CD    1 
ATOM   636  O  OE1   . GLU A 1 87  ? 26.056  15.760  -5.492  1.00 68.29  ? 193 GLU A OE1   1 
ATOM   637  O  OE2   . GLU A 1 87  ? 26.404  17.548  -4.174  1.00 66.42  ? 193 GLU A OE2   1 
ATOM   638  N  N     . ARG A 1 88  ? 31.051  13.798  -6.587  1.00 42.04  ? 194 ARG A N     1 
ATOM   639  C  CA    . ARG A 1 88  ? 31.827  12.686  -7.094  1.00 45.10  ? 194 ARG A CA    1 
ATOM   640  C  C     . ARG A 1 88  ? 31.538  11.359  -6.364  1.00 43.36  ? 194 ARG A C     1 
ATOM   641  O  O     . ARG A 1 88  ? 31.173  10.359  -7.004  1.00 39.25  ? 194 ARG A O     1 
ATOM   642  C  CB    . ARG A 1 88  ? 33.306  13.006  -6.952  1.00 47.81  ? 194 ARG A CB    1 
ATOM   643  C  CG    . ARG A 1 88  ? 34.196  12.319  -7.936  1.00 51.00  ? 194 ARG A CG    1 
ATOM   644  C  CD    . ARG A 1 88  ? 35.645  12.774  -7.740  1.00 51.75  ? 194 ARG A CD    1 
ATOM   645  N  NE    . ARG A 1 88  ? 36.540  11.642  -8.008  1.00 54.90  ? 194 ARG A NE    1 
ATOM   646  C  CZ    . ARG A 1 88  ? 37.730  11.431  -7.450  1.00 51.69  ? 194 ARG A CZ    1 
ATOM   647  N  NH1   . ARG A 1 88  ? 38.242  12.253  -6.606  1.00 53.18  ? 194 ARG A NH1   1 
ATOM   648  N  NH2   . ARG A 1 88  ? 38.442  10.371  -7.761  1.00 55.10  ? 194 ARG A NH2   1 
ATOM   649  N  N     . ASP A 1 89  ? 31.662  11.394  -5.044  1.00 41.86  ? 195 ASP A N     1 
ATOM   650  C  CA    . ASP A 1 89  ? 31.381  10.232  -4.188  1.00 42.35  ? 195 ASP A CA    1 
ATOM   651  C  C     . ASP A 1 89  ? 29.935  9.688   -4.377  1.00 39.14  ? 195 ASP A C     1 
ATOM   652  O  O     . ASP A 1 89  ? 29.700  8.488   -4.556  1.00 37.56  ? 195 ASP A O     1 
ATOM   653  C  CB    . ASP A 1 89  ? 31.611  10.600  -2.699  1.00 42.53  ? 195 ASP A CB    1 
ATOM   654  C  CG    . ASP A 1 89  ? 33.048  10.917  -2.367  1.00 45.42  ? 195 ASP A CG    1 
ATOM   655  O  OD1   . ASP A 1 89  ? 33.972  10.289  -2.933  1.00 46.75  ? 195 ASP A OD1   1 
ATOM   656  O  OD2   . ASP A 1 89  ? 33.270  11.768  -1.472  1.00 49.75  ? 195 ASP A OD2   1 
ATOM   657  N  N     . VAL A 1 90  ? 28.991  10.605  -4.330  1.00 35.54  ? 196 VAL A N     1 
ATOM   658  C  CA    . VAL A 1 90  ? 27.594  10.268  -4.468  1.00 35.52  ? 196 VAL A CA    1 
ATOM   659  C  C     . VAL A 1 90  ? 27.308  9.483   -5.794  1.00 36.76  ? 196 VAL A C     1 
ATOM   660  O  O     . VAL A 1 90  ? 26.670  8.376   -5.778  1.00 34.02  ? 196 VAL A O     1 
ATOM   661  C  CB    . VAL A 1 90  ? 26.739  11.577  -4.376  1.00 33.20  ? 196 VAL A CB    1 
ATOM   662  C  CG1   . VAL A 1 90  ? 25.301  11.414  -4.861  1.00 32.25  ? 196 VAL A CG1   1 
ATOM   663  C  CG2   . VAL A 1 90  ? 26.739  12.043  -2.945  1.00 34.57  ? 196 VAL A CG2   1 
ATOM   664  N  N     . LEU A 1 91  ? 27.733  10.092  -6.902  1.00 36.22  ? 197 LEU A N     1 
ATOM   665  C  CA    . LEU A 1 91  ? 27.662  9.439   -8.205  1.00 37.08  ? 197 LEU A CA    1 
ATOM   666  C  C     . LEU A 1 91  ? 28.382  8.071   -8.280  1.00 33.90  ? 197 LEU A C     1 
ATOM   667  O  O     . LEU A 1 91  ? 27.869  7.162   -8.901  1.00 34.03  ? 197 LEU A O     1 
ATOM   668  C  CB    . LEU A 1 91  ? 28.285  10.335  -9.303  1.00 38.79  ? 197 LEU A CB    1 
ATOM   669  C  CG    . LEU A 1 91  ? 27.397  11.324  -10.051 1.00 39.63  ? 197 LEU A CG    1 
ATOM   670  C  CD1   . LEU A 1 91  ? 28.235  12.053  -11.082 1.00 39.78  ? 197 LEU A CD1   1 
ATOM   671  C  CD2   . LEU A 1 91  ? 26.235  10.661  -10.781 1.00 39.27  ? 197 LEU A CD2   1 
ATOM   672  N  N     . CYS A 1 92  ? 29.567  7.936   -7.704  1.00 33.63  ? 198 CYS A N     1 
ATOM   673  C  CA    . CYS A 1 92  ? 30.244  6.620   -7.698  1.00 35.12  ? 198 CYS A CA    1 
ATOM   674  C  C     . CYS A 1 92  ? 29.416  5.557   -6.963  1.00 34.15  ? 198 CYS A C     1 
ATOM   675  O  O     . CYS A 1 92  ? 29.325  4.407   -7.419  1.00 33.65  ? 198 CYS A O     1 
ATOM   676  C  CB    . CYS A 1 92  ? 31.696  6.725   -7.156  1.00 38.10  ? 198 CYS A CB    1 
ATOM   677  S  SG    . CYS A 1 92  ? 32.807  7.721   -8.236  1.00 40.13  ? 198 CYS A SG    1 
ATOM   678  N  N     . VAL A 1 93  ? 28.773  5.963   -5.869  1.00 31.23  ? 199 VAL A N     1 
ATOM   679  C  CA    . VAL A 1 93  ? 27.946  5.052   -5.101  1.00 31.67  ? 199 VAL A CA    1 
ATOM   680  C  C     . VAL A 1 93  ? 26.673  4.677   -5.901  1.00 30.68  ? 199 VAL A C     1 
ATOM   681  O  O     . VAL A 1 93  ? 26.300  3.473   -6.025  1.00 30.78  ? 199 VAL A O     1 
ATOM   682  C  CB    . VAL A 1 93  ? 27.584  5.670   -3.701  1.00 31.57  ? 199 VAL A CB    1 
ATOM   683  C  CG1   . VAL A 1 93  ? 26.519  4.843   -3.006  1.00 31.56  ? 199 VAL A CG1   1 
ATOM   684  C  CG2   . VAL A 1 93  ? 28.825  5.822   -2.825  1.00 31.65  ? 199 VAL A CG2   1 
ATOM   685  N  N     . GLN A 1 94  ? 26.059  5.705   -6.478  1.00 28.65  ? 200 GLN A N     1 
ATOM   686  C  CA    . GLN A 1 94  ? 24.905  5.509   -7.351  1.00 29.75  ? 200 GLN A CA    1 
ATOM   687  C  C     . GLN A 1 94  ? 25.147  4.534   -8.536  1.00 29.44  ? 200 GLN A C     1 
ATOM   688  O  O     . GLN A 1 94  ? 24.381  3.614   -8.831  1.00 30.13  ? 200 GLN A O     1 
ATOM   689  C  CB    . GLN A 1 94  ? 24.408  6.854   -7.840  1.00 30.08  ? 200 GLN A CB    1 
ATOM   690  C  CG    . GLN A 1 94  ? 23.512  7.583   -6.872  1.00 30.75  ? 200 GLN A CG    1 
ATOM   691  C  CD    . GLN A 1 94  ? 23.027  8.930   -7.441  1.00 33.77  ? 200 GLN A CD    1 
ATOM   692  O  OE1   . GLN A 1 94  ? 23.841  9.781   -7.802  1.00 37.84  ? 200 GLN A OE1   1 
ATOM   693  N  NE2   . GLN A 1 94  ? 21.718  9.128   -7.502  1.00 32.67  ? 200 GLN A NE2   1 
ATOM   694  N  N     . ILE A 1 95  ? 26.268  4.696   -9.171  1.00 30.40  ? 201 ILE A N     1 
ATOM   695  C  CA    . ILE A 1 95  ? 26.662  3.815   -10.264 1.00 31.25  ? 201 ILE A CA    1 
ATOM   696  C  C     . ILE A 1 95  ? 26.910  2.385   -9.826  1.00 28.99  ? 201 ILE A C     1 
ATOM   697  O  O     . ILE A 1 95  ? 26.549  1.438   -10.586 1.00 28.85  ? 201 ILE A O     1 
ATOM   698  C  CB    . ILE A 1 95  ? 27.945  4.378   -10.980 1.00 32.88  ? 201 ILE A CB    1 
ATOM   699  C  CG1   . ILE A 1 95  ? 27.573  5.589   -11.833 1.00 34.70  ? 201 ILE A CG1   1 
ATOM   700  C  CG2   . ILE A 1 95  ? 28.580  3.375   -11.918 1.00 33.29  ? 201 ILE A CG2   1 
ATOM   701  C  CD1   . ILE A 1 95  ? 28.780  6.530   -12.089 1.00 36.84  ? 201 ILE A CD1   1 
ATOM   702  N  N     . ALA A 1 96  ? 27.563  2.217   -8.684  1.00 27.29  ? 202 ALA A N     1 
ATOM   703  C  CA    . ALA A 1 96  ? 27.832  0.878   -8.204  1.00 29.30  ? 202 ALA A CA    1 
ATOM   704  C  C     . ALA A 1 96  ? 26.483  0.159   -7.867  1.00 28.76  ? 202 ALA A C     1 
ATOM   705  O  O     . ALA A 1 96  ? 26.307  -1.029  -8.100  1.00 26.72  ? 202 ALA A O     1 
ATOM   706  C  CB    . ALA A 1 96  ? 28.733  0.954   -6.970  1.00 31.87  ? 202 ALA A CB    1 
ATOM   707  N  N     . GLY A 1 97  ? 25.538  0.919   -7.320  1.00 28.84  ? 203 GLY A N     1 
ATOM   708  C  CA    . GLY A 1 97  ? 24.231  0.398   -6.995  1.00 29.99  ? 203 GLY A CA    1 
ATOM   709  C  C     . GLY A 1 97  ? 23.516  -0.088  -8.218  1.00 28.37  ? 203 GLY A C     1 
ATOM   710  O  O     . GLY A 1 97  ? 22.954  -1.216  -8.262  1.00 28.31  ? 203 GLY A O     1 
ATOM   711  N  N     . LEU A 1 98  ? 23.573  0.774   -9.209  1.00 28.64  ? 204 LEU A N     1 
ATOM   712  C  CA    . LEU A 1 98  ? 22.939  0.504   -10.495 1.00 27.87  ? 204 LEU A CA    1 
ATOM   713  C  C     . LEU A 1 98  ? 23.519  -0.705  -11.214 1.00 26.37  ? 204 LEU A C     1 
ATOM   714  O  O     . LEU A 1 98  ? 22.748  -1.473  -11.788 1.00 24.81  ? 204 LEU A O     1 
ATOM   715  C  CB    . LEU A 1 98  ? 23.070  1.699   -11.300 1.00 29.00  ? 204 LEU A CB    1 
ATOM   716  C  CG    . LEU A 1 98  ? 22.346  1.656   -12.631 1.00 31.28  ? 204 LEU A CG    1 
ATOM   717  C  CD1   . LEU A 1 98  ? 20.863  1.842   -12.469 1.00 31.92  ? 204 LEU A CD1   1 
ATOM   718  C  CD2   . LEU A 1 98  ? 22.945  2.789   -13.469 1.00 33.63  ? 204 LEU A CD2   1 
ATOM   719  N  N     . CYS A 1 99  ? 24.840  -0.917  -11.085 1.00 26.80  ? 205 CYS A N     1 
ATOM   720  C  CA    . CYS A 1 99  ? 25.569  -1.944  -11.869 1.00 29.56  ? 205 CYS A CA    1 
ATOM   721  C  C     . CYS A 1 99  ? 25.972  -3.216  -11.082 1.00 29.99  ? 205 CYS A C     1 
ATOM   722  O  O     . CYS A 1 99  ? 26.642  -4.149  -11.610 1.00 29.86  ? 205 CYS A O     1 
ATOM   723  C  CB    . CYS A 1 99  ? 26.810  -1.294  -12.517 1.00 31.18  ? 205 CYS A CB    1 
ATOM   724  S  SG    . CYS A 1 99  ? 26.461  0.046   -13.734 1.00 32.38  ? 205 CYS A SG    1 
ATOM   725  N  N     . HIS A 1 100 ? 25.490  -3.297  -9.848  1.00 28.74  ? 206 HIS A N     1 
ATOM   726  C  CA    . HIS A 1 100 ? 25.945  -4.325  -8.940  1.00 28.70  ? 206 HIS A CA    1 
ATOM   727  C  C     . HIS A 1 100 ? 25.580  -5.748  -9.373  1.00 29.13  ? 206 HIS A C     1 
ATOM   728  O  O     . HIS A 1 100 ? 26.266  -6.705  -8.937  1.00 29.16  ? 206 HIS A O     1 
ATOM   729  C  CB    . HIS A 1 100 ? 25.425  -4.066  -7.515  1.00 27.26  ? 206 HIS A CB    1 
ATOM   730  C  CG    . HIS A 1 100 ? 24.054  -4.559  -7.289  1.00 25.91  ? 206 HIS A CG    1 
ATOM   731  N  ND1   . HIS A 1 100 ? 22.947  -3.897  -7.787  1.00 24.70  ? 206 HIS A ND1   1 
ATOM   732  C  CD2   . HIS A 1 100 ? 23.606  -5.665  -6.632  1.00 24.65  ? 206 HIS A CD2   1 
ATOM   733  C  CE1   . HIS A 1 100 ? 21.866  -4.585  -7.432  1.00 25.16  ? 206 HIS A CE1   1 
ATOM   734  N  NE2   . HIS A 1 100 ? 22.240  -5.655  -6.722  1.00 24.34  ? 206 HIS A NE2   1 
ATOM   735  N  N     . ASP A 1 101 ? 24.512  -5.906  -10.166 1.00 27.74  ? 207 ASP A N     1 
ATOM   736  C  CA    . ASP A 1 101 ? 24.024  -7.217  -10.532 1.00 26.56  ? 207 ASP A CA    1 
ATOM   737  C  C     . ASP A 1 101 ? 24.146  -7.384  -12.036 1.00 27.16  ? 207 ASP A C     1 
ATOM   738  O  O     . ASP A 1 101 ? 23.539  -8.299  -12.571 1.00 26.02  ? 207 ASP A O     1 
ATOM   739  C  CB    . ASP A 1 101 ? 22.575  -7.446  -10.081 1.00 26.66  ? 207 ASP A CB    1 
ATOM   740  C  CG    . ASP A 1 101 ? 22.417  -8.067  -8.636  1.00 27.46  ? 207 ASP A CG    1 
ATOM   741  O  OD1   . ASP A 1 101 ? 23.413  -8.716  -8.138  1.00 29.16  ? 207 ASP A OD1   1 
ATOM   742  O  OD2   . ASP A 1 101 ? 21.250  -7.934  -8.053  1.00 22.97  ? 207 ASP A OD2   1 
ATOM   743  N  N     . LEU A 1 102 ? 24.942  -6.568  -12.723 1.00 28.43  ? 208 LEU A N     1 
ATOM   744  C  CA    . LEU A 1 102 ? 25.174  -6.802  -14.182 1.00 31.22  ? 208 LEU A CA    1 
ATOM   745  C  C     . LEU A 1 102 ? 25.649  -8.230  -14.584 1.00 32.38  ? 208 LEU A C     1 
ATOM   746  O  O     . LEU A 1 102 ? 25.422  -8.655  -15.742 1.00 33.59  ? 208 LEU A O     1 
ATOM   747  C  CB    . LEU A 1 102 ? 26.218  -5.845  -14.736 1.00 31.80  ? 208 LEU A CB    1 
ATOM   748  C  CG    . LEU A 1 102 ? 25.793  -4.406  -14.996 1.00 31.72  ? 208 LEU A CG    1 
ATOM   749  C  CD1   . LEU A 1 102 ? 27.028  -3.593  -15.341 1.00 32.93  ? 208 LEU A CD1   1 
ATOM   750  C  CD2   . LEU A 1 102 ? 24.858  -4.325  -16.168 1.00 30.92  ? 208 LEU A CD2   1 
ATOM   751  N  N     . GLY A 1 103 ? 26.307  -8.930  -13.646 1.00 32.51  ? 209 GLY A N     1 
ATOM   752  C  CA    . GLY A 1 103 ? 26.793  -10.275 -13.903 1.00 33.54  ? 209 GLY A CA    1 
ATOM   753  C  C     . GLY A 1 103 ? 25.846  -11.443 -13.683 1.00 33.23  ? 209 GLY A C     1 
ATOM   754  O  O     . GLY A 1 103 ? 26.252  -12.592 -13.837 1.00 31.32  ? 209 GLY A O     1 
ATOM   755  N  N     . HIS A 1 104 ? 24.604  -11.206 -13.270 1.00 31.96  ? 210 HIS A N     1 
ATOM   756  C  CA    . HIS A 1 104 ? 23.716  -12.365 -13.142 1.00 31.31  ? 210 HIS A CA    1 
ATOM   757  C  C     . HIS A 1 104 ? 23.558  -13.005 -14.543 1.00 31.18  ? 210 HIS A C     1 
ATOM   758  O  O     . HIS A 1 104 ? 23.624  -12.329 -15.592 1.00 31.06  ? 210 HIS A O     1 
ATOM   759  C  CB    . HIS A 1 104 ? 22.350  -12.055 -12.493 1.00 31.30  ? 210 HIS A CB    1 
ATOM   760  C  CG    . HIS A 1 104 ? 22.334  -12.188 -10.989 1.00 32.81  ? 210 HIS A CG    1 
ATOM   761  N  ND1   . HIS A 1 104 ? 22.426  -13.401 -10.339 1.00 31.05  ? 210 HIS A ND1   1 
ATOM   762  C  CD2   . HIS A 1 104 ? 22.211  -11.243 -10.020 1.00 35.21  ? 210 HIS A CD2   1 
ATOM   763  C  CE1   . HIS A 1 104 ? 22.394  -13.196 -9.033  1.00 35.79  ? 210 HIS A CE1   1 
ATOM   764  N  NE2   . HIS A 1 104 ? 22.265  -11.893 -8.798  1.00 37.79  ? 210 HIS A NE2   1 
ATOM   765  N  N     . GLY A 1 105 ? 23.388  -14.331 -14.535 1.00 30.68  ? 211 GLY A N     1 
ATOM   766  C  CA    . GLY A 1 105 ? 23.126  -15.067 -15.755 1.00 29.00  ? 211 GLY A CA    1 
ATOM   767  C  C     . GLY A 1 105 ? 21.719  -15.555 -15.709 1.00 27.72  ? 211 GLY A C     1 
ATOM   768  O  O     . GLY A 1 105 ? 20.955  -15.167 -14.800 1.00 26.09  ? 211 GLY A O     1 
ATOM   769  N  N     . PRO A 1 106 ? 21.350  -16.414 -16.657 1.00 26.63  ? 212 PRO A N     1 
ATOM   770  C  CA    . PRO A 1 106 ? 19.975  -16.892 -16.796 1.00 27.50  ? 212 PRO A CA    1 
ATOM   771  C  C     . PRO A 1 106 ? 19.426  -17.460 -15.488 1.00 27.16  ? 212 PRO A C     1 
ATOM   772  O  O     . PRO A 1 106 ? 20.136  -18.265 -14.831 1.00 26.54  ? 212 PRO A O     1 
ATOM   773  C  CB    . PRO A 1 106 ? 20.075  -18.018 -17.824 1.00 27.79  ? 212 PRO A CB    1 
ATOM   774  C  CG    . PRO A 1 106 ? 21.371  -17.761 -18.572 1.00 28.07  ? 212 PRO A CG    1 
ATOM   775  C  CD    . PRO A 1 106 ? 22.196  -16.791 -17.804 1.00 28.36  ? 212 PRO A CD    1 
ATOM   776  N  N     . PHE A 1 107 ? 18.205  -17.046 -15.119 1.00 27.52  ? 213 PHE A N     1 
ATOM   777  C  CA    . PHE A 1 107 ? 17.526  -17.487 -13.861 1.00 30.40  ? 213 PHE A CA    1 
ATOM   778  C  C     . PHE A 1 107 ? 18.331  -17.101 -12.615 1.00 29.25  ? 213 PHE A C     1 
ATOM   779  O  O     . PHE A 1 107 ? 18.171  -17.697 -11.564 1.00 31.57  ? 213 PHE A O     1 
ATOM   780  C  CB    . PHE A 1 107 ? 17.132  -19.026 -13.926 1.00 31.97  ? 213 PHE A CB    1 
ATOM   781  C  CG    . PHE A 1 107 ? 16.230  -19.312 -15.114 1.00 33.26  ? 213 PHE A CG    1 
ATOM   782  C  CD1   . PHE A 1 107 ? 16.746  -19.411 -16.399 1.00 32.58  ? 213 PHE A CD1   1 
ATOM   783  C  CD2   . PHE A 1 107 ? 14.856  -19.351 -14.959 1.00 34.50  ? 213 PHE A CD2   1 
ATOM   784  C  CE1   . PHE A 1 107 ? 15.921  -19.585 -17.478 1.00 33.71  ? 213 PHE A CE1   1 
ATOM   785  C  CE2   . PHE A 1 107 ? 14.001  -19.522 -16.051 1.00 35.41  ? 213 PHE A CE2   1 
ATOM   786  C  CZ    . PHE A 1 107 ? 14.537  -19.624 -17.333 1.00 33.93  ? 213 PHE A CZ    1 
ATOM   787  N  N     . SER A 1 108 ? 19.191  -16.081 -12.748 1.00 27.73  ? 214 SER A N     1 
ATOM   788  C  CA    . SER A 1 108 ? 19.825  -15.467 -11.586 1.00 28.50  ? 214 SER A CA    1 
ATOM   789  C  C     . SER A 1 108 ? 20.579  -16.507 -10.746 1.00 28.86  ? 214 SER A C     1 
ATOM   790  O  O     . SER A 1 108 ? 21.466  -17.203 -11.294 1.00 28.75  ? 214 SER A O     1 
ATOM   791  C  CB    . SER A 1 108 ? 18.767  -14.658 -10.816 1.00 26.88  ? 214 SER A CB    1 
ATOM   792  O  OG    . SER A 1 108 ? 18.411  -13.459 -11.515 1.00 24.31  ? 214 SER A OG    1 
ATOM   793  N  N     . HIS A 1 109 ? 20.219  -16.693 -9.486  1.00 30.55  ? 215 HIS A N     1 
ATOM   794  C  CA    . HIS A 1 109 ? 21.027  -17.577 -8.610  1.00 33.13  ? 215 HIS A CA    1 
ATOM   795  C  C     . HIS A 1 109 ? 21.089  -19.088 -9.054  1.00 33.26  ? 215 HIS A C     1 
ATOM   796  O  O     . HIS A 1 109 ? 22.025  -19.761 -8.650  1.00 30.98  ? 215 HIS A O     1 
ATOM   797  C  CB    . HIS A 1 109 ? 20.681  -17.424 -7.098  1.00 32.97  ? 215 HIS A CB    1 
ATOM   798  C  CG    . HIS A 1 109 ? 21.308  -16.215 -6.446  1.00 34.07  ? 215 HIS A CG    1 
ATOM   799  N  ND1   . HIS A 1 109 ? 22.667  -16.094 -6.236  1.00 35.83  ? 215 HIS A ND1   1 
ATOM   800  C  CD2   . HIS A 1 109 ? 20.763  -15.057 -5.998  1.00 35.12  ? 215 HIS A CD2   1 
ATOM   801  C  CE1   . HIS A 1 109 ? 22.929  -14.916 -5.685  1.00 36.24  ? 215 HIS A CE1   1 
ATOM   802  N  NE2   . HIS A 1 109 ? 21.789  -14.272 -5.510  1.00 35.21  ? 215 HIS A NE2   1 
ATOM   803  N  N     . MET A 1 110 ? 20.147  -19.569 -9.901  1.00 32.53  ? 216 MET A N     1 
ATOM   804  C  CA    . MET A 1 110 ? 20.313  -20.900 -10.551 1.00 35.24  ? 216 MET A CA    1 
ATOM   805  C  C     . MET A 1 110 ? 21.671  -21.002 -11.307 1.00 35.53  ? 216 MET A C     1 
ATOM   806  O  O     . MET A 1 110 ? 22.327  -22.037 -11.246 1.00 35.07  ? 216 MET A O     1 
ATOM   807  C  CB    . MET A 1 110 ? 19.170  -21.188 -11.548 1.00 35.40  ? 216 MET A CB    1 
ATOM   808  C  CG    . MET A 1 110 ? 19.098  -22.623 -12.092 1.00 35.19  ? 216 MET A CG    1 
ATOM   809  S  SD    . MET A 1 110 ? 18.460  -22.758 -13.775 1.00 36.19  ? 216 MET A SD    1 
ATOM   810  C  CE    . MET A 1 110 ? 19.953  -22.121 -14.587 1.00 37.56  ? 216 MET A CE    1 
ATOM   811  N  N     . PHE A 1 111 ? 22.087  -19.903 -11.945 1.00 34.27  ? 217 PHE A N     1 
ATOM   812  C  CA    . PHE A 1 111 ? 23.227  -19.907 -12.833 1.00 34.66  ? 217 PHE A CA    1 
ATOM   813  C  C     . PHE A 1 111 ? 24.546  -20.077 -12.109 1.00 35.71  ? 217 PHE A C     1 
ATOM   814  O  O     . PHE A 1 111 ? 25.307  -20.961 -12.469 1.00 38.48  ? 217 PHE A O     1 
ATOM   815  C  CB    . PHE A 1 111 ? 23.252  -18.677 -13.779 1.00 34.13  ? 217 PHE A CB    1 
ATOM   816  C  CG    . PHE A 1 111 ? 24.052  -18.905 -15.038 1.00 32.42  ? 217 PHE A CG    1 
ATOM   817  C  CD1   . PHE A 1 111 ? 23.621  -19.839 -15.979 1.00 33.25  ? 217 PHE A CD1   1 
ATOM   818  C  CD2   . PHE A 1 111 ? 25.262  -18.276 -15.252 1.00 33.21  ? 217 PHE A CD2   1 
ATOM   819  C  CE1   . PHE A 1 111 ? 24.345  -20.096 -17.130 1.00 32.08  ? 217 PHE A CE1   1 
ATOM   820  C  CE2   . PHE A 1 111 ? 26.000  -18.507 -16.432 1.00 33.32  ? 217 PHE A CE2   1 
ATOM   821  C  CZ    . PHE A 1 111 ? 25.510  -19.400 -17.370 1.00 32.94  ? 217 PHE A CZ    1 
ATOM   822  N  N     . ASP A 1 112 ? 24.816  -19.254 -11.105 1.00 36.19  ? 218 ASP A N     1 
ATOM   823  C  CA    . ASP A 1 112 ? 26.053  -19.377 -10.294 1.00 36.18  ? 218 ASP A CA    1 
ATOM   824  C  C     . ASP A 1 112 ? 25.928  -20.349 -9.087  1.00 37.27  ? 218 ASP A C     1 
ATOM   825  O  O     . ASP A 1 112 ? 26.921  -20.859 -8.616  1.00 36.73  ? 218 ASP A O     1 
ATOM   826  C  CB    . ASP A 1 112 ? 26.661  -17.994 -9.820  1.00 36.72  ? 218 ASP A CB    1 
ATOM   827  C  CG    . ASP A 1 112 ? 25.744  -17.156 -8.952  1.00 36.99  ? 218 ASP A CG    1 
ATOM   828  O  OD1   . ASP A 1 112 ? 24.565  -17.538 -8.654  1.00 37.47  ? 218 ASP A OD1   1 
ATOM   829  O  OD2   . ASP A 1 112 ? 26.250  -16.079 -8.559  1.00 38.66  ? 218 ASP A OD2   1 
ATOM   830  N  N     . GLY A 1 113 ? 24.713  -20.618 -8.633  1.00 37.24  ? 219 GLY A N     1 
ATOM   831  C  CA    . GLY A 1 113 ? 24.454  -21.572 -7.539  1.00 35.04  ? 219 GLY A CA    1 
ATOM   832  C  C     . GLY A 1 113 ? 24.472  -23.015 -7.996  1.00 35.26  ? 219 GLY A C     1 
ATOM   833  O  O     . GLY A 1 113 ? 24.978  -23.860 -7.291  1.00 35.77  ? 219 GLY A O     1 
ATOM   834  N  N     . ARG A 1 114 ? 23.964  -23.326 -9.177  1.00 33.23  ? 220 ARG A N     1 
ATOM   835  C  CA    . ARG A 1 114 ? 23.869  -24.720 -9.618  1.00 33.98  ? 220 ARG A CA    1 
ATOM   836  C  C     . ARG A 1 114 ? 24.611  -25.013 -10.952 1.00 35.37  ? 220 ARG A C     1 
ATOM   837  O  O     . ARG A 1 114 ? 25.457  -25.909 -10.992 1.00 38.69  ? 220 ARG A O     1 
ATOM   838  C  CB    . ARG A 1 114 ? 22.432  -25.142 -9.739  1.00 34.17  ? 220 ARG A CB    1 
ATOM   839  C  CG    . ARG A 1 114 ? 21.622  -25.032 -8.477  1.00 36.69  ? 220 ARG A CG    1 
ATOM   840  C  CD    . ARG A 1 114 ? 20.147  -25.383 -8.720  1.00 37.28  ? 220 ARG A CD    1 
ATOM   841  N  NE    . ARG A 1 114 ? 19.289  -25.208 -7.542  1.00 38.80  ? 220 ARG A NE    1 
ATOM   842  C  CZ    . ARG A 1 114 ? 19.202  -26.089 -6.509  1.00 40.15  ? 220 ARG A CZ    1 
ATOM   843  N  NH1   . ARG A 1 114 ? 18.375  -25.888 -5.487  1.00 41.00  ? 220 ARG A NH1   1 
ATOM   844  N  NH2   . ARG A 1 114 ? 19.931  -27.191 -6.476  1.00 38.89  ? 220 ARG A NH2   1 
ATOM   845  N  N     . PHE A 1 115 ? 24.335  -24.261 -12.007 1.00 34.83  ? 221 PHE A N     1 
ATOM   846  C  CA    . PHE A 1 115 ? 24.854  -24.641 -13.306 1.00 36.70  ? 221 PHE A CA    1 
ATOM   847  C  C     . PHE A 1 115 ? 26.383  -24.585 -13.472 1.00 37.52  ? 221 PHE A C     1 
ATOM   848  O  O     . PHE A 1 115 ? 26.994  -25.571 -13.797 1.00 39.89  ? 221 PHE A O     1 
ATOM   849  C  CB    . PHE A 1 115 ? 24.190  -23.826 -14.374 1.00 37.46  ? 221 PHE A CB    1 
ATOM   850  C  CG    . PHE A 1 115 ? 24.678  -24.131 -15.754 1.00 36.73  ? 221 PHE A CG    1 
ATOM   851  C  CD1   . PHE A 1 115 ? 24.248  -25.272 -16.407 1.00 39.14  ? 221 PHE A CD1   1 
ATOM   852  C  CD2   . PHE A 1 115 ? 25.564  -23.284 -16.400 1.00 36.60  ? 221 PHE A CD2   1 
ATOM   853  C  CE1   . PHE A 1 115 ? 24.700  -25.564 -17.692 1.00 37.95  ? 221 PHE A CE1   1 
ATOM   854  C  CE2   . PHE A 1 115 ? 26.011  -23.552 -17.672 1.00 37.17  ? 221 PHE A CE2   1 
ATOM   855  C  CZ    . PHE A 1 115 ? 25.581  -24.700 -18.328 1.00 37.39  ? 221 PHE A CZ    1 
ATOM   856  N  N     . ILE A 1 116 ? 26.979  -23.435 -13.244 1.00 38.77  ? 222 ILE A N     1 
ATOM   857  C  CA    . ILE A 1 116 ? 28.397  -23.268 -13.462 1.00 41.32  ? 222 ILE A CA    1 
ATOM   858  C  C     . ILE A 1 116 ? 29.244  -24.193 -12.564 1.00 43.83  ? 222 ILE A C     1 
ATOM   859  O  O     . ILE A 1 116 ? 30.257  -24.713 -13.016 1.00 45.61  ? 222 ILE A O     1 
ATOM   860  C  CB    . ILE A 1 116 ? 28.823  -21.772 -13.341 1.00 42.45  ? 222 ILE A CB    1 
ATOM   861  C  CG1   . ILE A 1 116 ? 28.253  -20.936 -14.513 1.00 42.51  ? 222 ILE A CG1   1 
ATOM   862  C  CG2   . ILE A 1 116 ? 30.354  -21.590 -13.262 1.00 42.18  ? 222 ILE A CG2   1 
ATOM   863  C  CD1   . ILE A 1 116 ? 28.733  -21.271 -15.922 1.00 39.90  ? 222 ILE A CD1   1 
ATOM   864  N  N     . PRO A 1 117 ? 28.849  -24.406 -11.310 1.00 44.70  ? 223 PRO A N     1 
ATOM   865  C  CA    . PRO A 1 117 ? 29.545  -25.412 -10.514 1.00 47.65  ? 223 PRO A CA    1 
ATOM   866  C  C     . PRO A 1 117 ? 29.493  -26.850 -11.060 1.00 48.41  ? 223 PRO A C     1 
ATOM   867  O  O     . PRO A 1 117 ? 30.550  -27.517 -11.087 1.00 50.95  ? 223 PRO A O     1 
ATOM   868  C  CB    . PRO A 1 117 ? 28.836  -25.333 -9.175  1.00 47.93  ? 223 PRO A CB    1 
ATOM   869  C  CG    . PRO A 1 117 ? 28.465  -23.909 -9.064  1.00 47.17  ? 223 PRO A CG    1 
ATOM   870  C  CD    . PRO A 1 117 ? 28.049  -23.518 -10.458 1.00 46.42  ? 223 PRO A CD    1 
ATOM   871  N  N     . LEU A 1 118 ? 28.317  -27.294 -11.517 1.00 45.19  ? 224 LEU A N     1 
ATOM   872  C  CA    . LEU A 1 118 ? 28.250  -28.542 -12.220 1.00 45.32  ? 224 LEU A CA    1 
ATOM   873  C  C     . LEU A 1 118 ? 28.972  -28.546 -13.565 1.00 45.33  ? 224 LEU A C     1 
ATOM   874  O  O     . LEU A 1 118 ? 29.639  -29.495 -13.896 1.00 49.79  ? 224 LEU A O     1 
ATOM   875  C  CB    . LEU A 1 118 ? 26.812  -28.971 -12.444 1.00 46.60  ? 224 LEU A CB    1 
ATOM   876  C  CG    . LEU A 1 118 ? 26.015  -29.244 -11.183 1.00 46.76  ? 224 LEU A CG    1 
ATOM   877  C  CD1   . LEU A 1 118 ? 24.642  -29.716 -11.574 1.00 46.03  ? 224 LEU A CD1   1 
ATOM   878  C  CD2   . LEU A 1 118 ? 26.699  -30.256 -10.255 1.00 46.92  ? 224 LEU A CD2   1 
ATOM   879  N  N     . ALA A 1 119 ? 28.876  -27.497 -14.349 1.00 44.77  ? 225 ALA A N     1 
ATOM   880  C  CA    . ALA A 1 119 ? 29.377  -27.571 -15.718 1.00 40.71  ? 225 ALA A CA    1 
ATOM   881  C  C     . ALA A 1 119 ? 30.819  -27.204 -15.808 1.00 40.65  ? 225 ALA A C     1 
ATOM   882  O  O     . ALA A 1 119 ? 31.427  -27.496 -16.779 1.00 37.94  ? 225 ALA A O     1 
ATOM   883  C  CB    . ALA A 1 119 ? 28.562  -26.653 -16.598 1.00 40.34  ? 225 ALA A CB    1 
ATOM   884  N  N     . ARG A 1 120 ? 31.370  -26.515 -14.826 1.00 44.15  ? 226 ARG A N     1 
ATOM   885  C  CA    . ARG A 1 120 ? 32.759  -26.077 -14.916 1.00 48.22  ? 226 ARG A CA    1 
ATOM   886  C  C     . ARG A 1 120 ? 33.444  -26.084 -13.610 1.00 51.61  ? 226 ARG A C     1 
ATOM   887  O  O     . ARG A 1 120 ? 33.801  -25.017 -13.074 1.00 54.03  ? 226 ARG A O     1 
ATOM   888  C  CB    . ARG A 1 120 ? 32.866  -24.716 -15.617 1.00 48.06  ? 226 ARG A CB    1 
ATOM   889  C  CG    . ARG A 1 120 ? 32.852  -24.926 -17.098 1.00 46.78  ? 226 ARG A CG    1 
ATOM   890  C  CD    . ARG A 1 120 ? 33.139  -23.645 -17.748 1.00 46.21  ? 226 ARG A CD    1 
ATOM   891  N  NE    . ARG A 1 120 ? 34.517  -23.254 -17.709 1.00 44.44  ? 226 ARG A NE    1 
ATOM   892  C  CZ    . ARG A 1 120 ? 34.932  -22.061 -18.112 1.00 47.42  ? 226 ARG A CZ    1 
ATOM   893  N  NH1   . ARG A 1 120 ? 34.100  -21.063 -18.505 1.00 47.86  ? 226 ARG A NH1   1 
ATOM   894  N  NH2   . ARG A 1 120 ? 36.201  -21.800 -18.044 1.00 51.05  ? 226 ARG A NH2   1 
ATOM   895  N  N     . PRO A 1 121 ? 33.687  -27.313 -13.104 1.00 56.93  ? 227 PRO A N     1 
ATOM   896  C  CA    . PRO A 1 121 ? 34.280  -27.499 -11.762 1.00 56.64  ? 227 PRO A CA    1 
ATOM   897  C  C     . PRO A 1 121 ? 35.697  -26.959 -11.649 1.00 55.31  ? 227 PRO A C     1 
ATOM   898  O  O     . PRO A 1 121 ? 36.152  -26.674 -10.584 1.00 51.42  ? 227 PRO A O     1 
ATOM   899  C  CB    . PRO A 1 121 ? 34.251  -29.009 -11.567 1.00 58.19  ? 227 PRO A CB    1 
ATOM   900  C  CG    . PRO A 1 121 ? 33.520  -29.579 -12.737 1.00 57.79  ? 227 PRO A CG    1 
ATOM   901  C  CD    . PRO A 1 121 ? 33.588  -28.586 -13.834 1.00 55.80  ? 227 PRO A CD    1 
ATOM   902  N  N     . GLU A 1 122 ? 36.368  -26.801 -12.762 1.00 60.36  ? 228 GLU A N     1 
ATOM   903  C  CA    . GLU A 1 122 ? 37.661  -26.115 -12.805 1.00 65.83  ? 228 GLU A CA    1 
ATOM   904  C  C     . GLU A 1 122 ? 37.739  -24.602 -12.498 1.00 71.32  ? 228 GLU A C     1 
ATOM   905  O  O     . GLU A 1 122 ? 38.820  -24.135 -12.161 1.00 75.48  ? 228 GLU A O     1 
ATOM   906  C  CB    . GLU A 1 122 ? 38.302  -26.312 -14.172 1.00 66.54  ? 228 GLU A CB    1 
ATOM   907  C  CG    . GLU A 1 122 ? 37.779  -25.422 -15.271 1.00 69.24  ? 228 GLU A CG    1 
ATOM   908  C  CD    . GLU A 1 122 ? 36.725  -26.104 -16.110 1.00 77.53  ? 228 GLU A CD    1 
ATOM   909  O  OE1   . GLU A 1 122 ? 36.007  -27.065 -15.637 1.00 73.08  ? 228 GLU A OE1   1 
ATOM   910  O  OE2   . GLU A 1 122 ? 36.613  -25.652 -17.308 1.00 82.93  ? 228 GLU A OE2   1 
ATOM   911  N  N     . VAL A 1 123 ? 36.668  -23.817 -12.690 1.00 71.97  ? 229 VAL A N     1 
ATOM   912  C  CA    . VAL A 1 123 ? 36.709  -22.354 -12.351 1.00 70.10  ? 229 VAL A CA    1 
ATOM   913  C  C     . VAL A 1 123 ? 36.068  -22.148 -10.995 1.00 66.53  ? 229 VAL A C     1 
ATOM   914  O  O     . VAL A 1 123 ? 35.389  -23.044 -10.547 1.00 74.53  ? 229 VAL A O     1 
ATOM   915  C  CB    . VAL A 1 123 ? 36.060  -21.466 -13.429 1.00 71.54  ? 229 VAL A CB    1 
ATOM   916  C  CG1   . VAL A 1 123 ? 36.611  -21.842 -14.787 1.00 70.50  ? 229 VAL A CG1   1 
ATOM   917  C  CG2   . VAL A 1 123 ? 34.547  -21.579 -13.377 1.00 73.90  ? 229 VAL A CG2   1 
ATOM   918  N  N     . LYS A 1 124 ? 36.329  -21.019 -10.324 1.00 59.56  ? 230 LYS A N     1 
ATOM   919  C  CA    . LYS A 1 124 ? 35.507  -20.540 -9.166  1.00 55.74  ? 230 LYS A CA    1 
ATOM   920  C  C     . LYS A 1 124 ? 34.954  -19.174 -9.624  1.00 53.58  ? 230 LYS A C     1 
ATOM   921  O  O     . LYS A 1 124 ? 35.690  -18.201 -9.691  1.00 53.99  ? 230 LYS A O     1 
ATOM   922  C  CB    . LYS A 1 124 ? 36.252  -20.438 -7.804  1.00 51.53  ? 230 LYS A CB    1 
ATOM   923  N  N     . TRP A 1 125 ? 33.663  -19.136 -9.983  1.00 48.33  ? 231 TRP A N     1 
ATOM   924  C  CA    . TRP A 1 125 ? 32.961  -17.941 -10.456 1.00 46.63  ? 231 TRP A CA    1 
ATOM   925  C  C     . TRP A 1 125 ? 31.791  -17.487 -9.539  1.00 44.90  ? 231 TRP A C     1 
ATOM   926  O  O     . TRP A 1 125 ? 31.219  -18.297 -8.903  1.00 46.68  ? 231 TRP A O     1 
ATOM   927  C  CB    . TRP A 1 125 ? 32.387  -18.282 -11.818 1.00 46.15  ? 231 TRP A CB    1 
ATOM   928  C  CG    . TRP A 1 125 ? 31.879  -17.101 -12.582 1.00 47.95  ? 231 TRP A CG    1 
ATOM   929  C  CD1   . TRP A 1 125 ? 32.620  -16.096 -13.225 1.00 50.23  ? 231 TRP A CD1   1 
ATOM   930  C  CD2   . TRP A 1 125 ? 30.544  -16.820 -12.841 1.00 47.25  ? 231 TRP A CD2   1 
ATOM   931  N  NE1   . TRP A 1 125 ? 31.780  -15.217 -13.870 1.00 49.51  ? 231 TRP A NE1   1 
ATOM   932  C  CE2   . TRP A 1 125 ? 30.497  -15.634 -13.636 1.00 48.63  ? 231 TRP A CE2   1 
ATOM   933  C  CE3   . TRP A 1 125 ? 29.368  -17.432 -12.468 1.00 48.21  ? 231 TRP A CE3   1 
ATOM   934  C  CZ2   . TRP A 1 125 ? 29.329  -15.077 -14.040 1.00 49.25  ? 231 TRP A CZ2   1 
ATOM   935  C  CZ3   . TRP A 1 125 ? 28.189  -16.876 -12.877 1.00 52.20  ? 231 TRP A CZ3   1 
ATOM   936  C  CH2   . TRP A 1 125 ? 28.169  -15.710 -13.662 1.00 52.81  ? 231 TRP A CH2   1 
ATOM   937  N  N     . THR A 1 126 ? 31.458  -16.198 -9.516  1.00 43.30  ? 232 THR A N     1 
ATOM   938  C  CA    . THR A 1 126 ? 30.263  -15.632 -8.875  1.00 42.06  ? 232 THR A CA    1 
ATOM   939  C  C     . THR A 1 126 ? 29.659  -14.547 -9.747  1.00 39.26  ? 232 THR A C     1 
ATOM   940  O  O     . THR A 1 126 ? 30.407  -13.851 -10.511 1.00 39.43  ? 232 THR A O     1 
ATOM   941  C  CB    . THR A 1 126 ? 30.614  -14.886 -7.551  1.00 43.27  ? 232 THR A CB    1 
ATOM   942  O  OG1   . THR A 1 126 ? 31.703  -13.972 -7.787  1.00 44.07  ? 232 THR A OG1   1 
ATOM   943  C  CG2   . THR A 1 126 ? 30.977  -15.866 -6.395  1.00 43.55  ? 232 THR A CG2   1 
ATOM   944  N  N     . HIS A 1 127 ? 28.341  -14.321 -9.590  1.00 35.80  ? 233 HIS A N     1 
ATOM   945  C  CA    . HIS A 1 127 ? 27.684  -13.236 -10.376 1.00 35.04  ? 233 HIS A CA    1 
ATOM   946  C  C     . HIS A 1 127 ? 28.393  -11.887 -10.123 1.00 36.87  ? 233 HIS A C     1 
ATOM   947  O  O     . HIS A 1 127 ? 28.563  -11.099 -11.059 1.00 32.39  ? 233 HIS A O     1 
ATOM   948  C  CB    . HIS A 1 127 ? 26.156  -13.190 -10.269 1.00 33.70  ? 233 HIS A CB    1 
ATOM   949  C  CG    . HIS A 1 127 ? 25.656  -12.580 -9.013  1.00 34.93  ? 233 HIS A CG    1 
ATOM   950  N  ND1   . HIS A 1 127 ? 25.412  -13.321 -7.867  1.00 35.16  ? 233 HIS A ND1   1 
ATOM   951  C  CD2   . HIS A 1 127 ? 25.385  -11.295 -8.710  1.00 33.75  ? 233 HIS A CD2   1 
ATOM   952  C  CE1   . HIS A 1 127 ? 25.035  -12.497 -6.904  1.00 36.41  ? 233 HIS A CE1   1 
ATOM   953  N  NE2   . HIS A 1 127 ? 24.988  -11.268 -7.394  1.00 35.16  ? 233 HIS A NE2   1 
ATOM   954  N  N     . GLU A 1 128 ? 28.922  -11.687 -8.914  1.00 38.94  ? 234 GLU A N     1 
ATOM   955  C  CA    . GLU A 1 128 ? 29.647  -10.421 -8.589  1.00 40.38  ? 234 GLU A CA    1 
ATOM   956  C  C     . GLU A 1 128 ? 30.887  -10.207 -9.458  1.00 40.15  ? 234 GLU A C     1 
ATOM   957  O  O     . GLU A 1 128 ? 31.086  -9.106  -10.001 1.00 39.08  ? 234 GLU A O     1 
ATOM   958  C  CB    . GLU A 1 128 ? 30.017  -10.306 -7.079  1.00 39.52  ? 234 GLU A CB    1 
ATOM   959  C  CG    . GLU A 1 128 ? 28.807  -10.275 -6.139  1.00 38.85  ? 234 GLU A CG    1 
ATOM   960  C  CD    . GLU A 1 128 ? 28.307  -11.655 -5.694  1.00 39.30  ? 234 GLU A CD    1 
ATOM   961  O  OE1   . GLU A 1 128 ? 28.607  -12.682 -6.360  1.00 38.71  ? 234 GLU A OE1   1 
ATOM   962  O  OE2   . GLU A 1 128 ? 27.622  -11.721 -4.654  1.00 37.91  ? 234 GLU A OE2   1 
ATOM   963  N  N     . GLN A 1 129 ? 31.659  -11.276 -9.670  1.00 42.34  ? 235 GLN A N     1 
ATOM   964  C  CA    . GLN A 1 129 ? 32.819  -11.181 -10.611 1.00 43.56  ? 235 GLN A CA    1 
ATOM   965  C  C     . GLN A 1 129 ? 32.356  -10.902 -12.016 1.00 40.88  ? 235 GLN A C     1 
ATOM   966  O  O     . GLN A 1 129 ? 32.947  -10.079 -12.680 1.00 40.74  ? 235 GLN A O     1 
ATOM   967  C  CB    . GLN A 1 129 ? 33.676  -12.429 -10.613 1.00 46.82  ? 235 GLN A CB    1 
ATOM   968  C  CG    . GLN A 1 129 ? 34.300  -12.763 -9.252  1.00 50.86  ? 235 GLN A CG    1 
ATOM   969  C  CD    . GLN A 1 129 ? 34.708  -14.219 -9.181  1.00 53.92  ? 235 GLN A CD    1 
ATOM   970  O  OE1   . GLN A 1 129 ? 34.403  -14.950 -8.219  1.00 55.92  ? 235 GLN A OE1   1 
ATOM   971  N  NE2   . GLN A 1 129 ? 35.381  -14.657 -10.232 1.00 56.90  ? 235 GLN A NE2   1 
ATOM   972  N  N     . GLY A 1 130 ? 31.285  -11.564 -12.453 1.00 38.00  ? 236 GLY A N     1 
ATOM   973  C  CA    . GLY A 1 130 ? 30.622  -11.159 -13.686 1.00 36.89  ? 236 GLY A CA    1 
ATOM   974  C  C     . GLY A 1 130 ? 30.259  -9.685  -13.790 1.00 36.49  ? 236 GLY A C     1 
ATOM   975  O  O     . GLY A 1 130 ? 30.405  -9.075  -14.843 1.00 37.18  ? 236 GLY A O     1 
ATOM   976  N  N     . SER A 1 131 ? 29.793  -9.101  -12.700 1.00 35.09  ? 237 SER A N     1 
ATOM   977  C  CA    . SER A 1 131 ? 29.327  -7.718  -12.691 1.00 36.82  ? 237 SER A CA    1 
ATOM   978  C  C     . SER A 1 131 ? 30.536  -6.802  -12.939 1.00 38.16  ? 237 SER A C     1 
ATOM   979  O  O     . SER A 1 131 ? 30.425  -5.798  -13.650 1.00 37.90  ? 237 SER A O     1 
ATOM   980  C  CB    . SER A 1 131 ? 28.616  -7.315  -11.364 1.00 34.17  ? 237 SER A CB    1 
ATOM   981  O  OG    . SER A 1 131 ? 27.503  -8.153  -11.056 1.00 34.11  ? 237 SER A OG    1 
ATOM   982  N  N     . VAL A 1 132 ? 31.676  -7.137  -12.335 1.00 38.59  ? 238 VAL A N     1 
ATOM   983  C  CA    . VAL A 1 132 ? 32.877  -6.331  -12.508 1.00 38.69  ? 238 VAL A CA    1 
ATOM   984  C  C     . VAL A 1 132 ? 33.357  -6.352  -13.971 1.00 39.51  ? 238 VAL A C     1 
ATOM   985  O  O     . VAL A 1 132 ? 33.723  -5.320  -14.530 1.00 38.25  ? 238 VAL A O     1 
ATOM   986  C  CB    . VAL A 1 132 ? 33.984  -6.864  -11.582 1.00 39.29  ? 238 VAL A CB    1 
ATOM   987  C  CG1   . VAL A 1 132 ? 35.364  -6.336  -11.976 1.00 38.90  ? 238 VAL A CG1   1 
ATOM   988  C  CG2   . VAL A 1 132 ? 33.661  -6.507  -10.153 1.00 39.00  ? 238 VAL A CG2   1 
ATOM   989  N  N     . MET A 1 133 ? 33.309  -7.527  -14.598 1.00 41.43  ? 239 MET A N     1 
ATOM   990  C  CA    . MET A 1 133 ? 33.724  -7.667  -15.990 1.00 43.95  ? 239 MET A CA    1 
ATOM   991  C  C     . MET A 1 133 ? 32.773  -7.038  -16.995 1.00 39.71  ? 239 MET A C     1 
ATOM   992  O  O     . MET A 1 133 ? 33.167  -6.430  -17.971 1.00 38.87  ? 239 MET A O     1 
ATOM   993  C  CB    . MET A 1 133 ? 33.936  -9.147  -16.318 1.00 48.72  ? 239 MET A CB    1 
ATOM   994  C  CG    . MET A 1 133 ? 35.168  -9.740  -15.611 1.00 51.01  ? 239 MET A CG    1 
ATOM   995  S  SD    . MET A 1 133 ? 35.310  -11.533 -15.866 1.00 59.52  ? 239 MET A SD    1 
ATOM   996  C  CE    . MET A 1 133 ? 33.716  -12.379 -15.739 1.00 57.24  ? 239 MET A CE    1 
ATOM   997  N  N     . MET A 1 134 ? 31.508  -7.250  -16.773 1.00 36.86  ? 240 MET A N     1 
ATOM   998  C  CA    . MET A 1 134 ? 30.497  -6.684  -17.610 1.00 36.73  ? 240 MET A CA    1 
ATOM   999  C  C     . MET A 1 134 ? 30.451  -5.142  -17.472 1.00 34.87  ? 240 MET A C     1 
ATOM   1000 O  O     . MET A 1 134 ? 30.222  -4.455  -18.447 1.00 30.53  ? 240 MET A O     1 
ATOM   1001 C  CB    . MET A 1 134 ? 29.183  -7.340  -17.249 1.00 38.10  ? 240 MET A CB    1 
ATOM   1002 C  CG    . MET A 1 134 ? 28.045  -6.976  -18.152 1.00 40.60  ? 240 MET A CG    1 
ATOM   1003 S  SD    . MET A 1 134 ? 28.306  -7.428  -19.893 1.00 41.59  ? 240 MET A SD    1 
ATOM   1004 C  CE    . MET A 1 134 ? 27.297  -8.876  -19.947 1.00 40.29  ? 240 MET A CE    1 
ATOM   1005 N  N     . PHE A 1 135 ? 30.729  -4.623  -16.277 1.00 34.90  ? 241 PHE A N     1 
ATOM   1006 C  CA    . PHE A 1 135 ? 30.880  -3.171  -16.085 1.00 37.85  ? 241 PHE A CA    1 
ATOM   1007 C  C     . PHE A 1 135 ? 31.979  -2.589  -16.987 1.00 41.18  ? 241 PHE A C     1 
ATOM   1008 O  O     . PHE A 1 135 ? 31.761  -1.579  -17.656 1.00 37.77  ? 241 PHE A O     1 
ATOM   1009 C  CB    . PHE A 1 135 ? 31.222  -2.828  -14.638 1.00 36.75  ? 241 PHE A CB    1 
ATOM   1010 C  CG    . PHE A 1 135 ? 31.302  -1.322  -14.341 1.00 35.38  ? 241 PHE A CG    1 
ATOM   1011 C  CD1   . PHE A 1 135 ? 30.224  -0.473  -14.597 1.00 35.08  ? 241 PHE A CD1   1 
ATOM   1012 C  CD2   . PHE A 1 135 ? 32.431  -0.788  -13.740 1.00 35.06  ? 241 PHE A CD2   1 
ATOM   1013 C  CE1   . PHE A 1 135 ? 30.297  0.879   -14.310 1.00 36.02  ? 241 PHE A CE1   1 
ATOM   1014 C  CE2   . PHE A 1 135 ? 32.534  0.551   -13.442 1.00 36.75  ? 241 PHE A CE2   1 
ATOM   1015 C  CZ    . PHE A 1 135 ? 31.461  1.407   -13.732 1.00 38.04  ? 241 PHE A CZ    1 
ATOM   1016 N  N     . GLU A 1 136 ? 33.145  -3.249  -16.947 1.00 43.24  ? 242 GLU A N     1 
ATOM   1017 C  CA    . GLU A 1 136 ? 34.262  -2.950  -17.812 1.00 45.26  ? 242 GLU A CA    1 
ATOM   1018 C  C     . GLU A 1 136 ? 33.865  -2.950  -19.293 1.00 43.65  ? 242 GLU A C     1 
ATOM   1019 O  O     . GLU A 1 136 ? 34.087  -1.972  -20.008 1.00 49.36  ? 242 GLU A O     1 
ATOM   1020 C  CB    . GLU A 1 136 ? 35.417  -3.927  -17.515 1.00 48.25  ? 242 GLU A CB    1 
ATOM   1021 C  CG    . GLU A 1 136 ? 36.740  -3.672  -18.293 1.00 51.82  ? 242 GLU A CG    1 
ATOM   1022 C  CD    . GLU A 1 136 ? 37.441  -2.309  -17.985 1.00 54.17  ? 242 GLU A CD    1 
ATOM   1023 O  OE1   . GLU A 1 136 ? 37.264  -1.763  -16.870 1.00 52.26  ? 242 GLU A OE1   1 
ATOM   1024 O  OE2   . GLU A 1 136 ? 38.176  -1.776  -18.874 1.00 58.63  ? 242 GLU A OE2   1 
ATOM   1025 N  N     . HIS A 1 137 ? 33.258  -4.014  -19.751 1.00 40.91  ? 243 HIS A N     1 
ATOM   1026 C  CA    . HIS A 1 137 ? 32.910  -4.107  -21.146 1.00 40.74  ? 243 HIS A CA    1 
ATOM   1027 C  C     . HIS A 1 137 ? 31.948  -2.984  -21.550 1.00 40.28  ? 243 HIS A C     1 
ATOM   1028 O  O     . HIS A 1 137 ? 32.078  -2.372  -22.631 1.00 43.45  ? 243 HIS A O     1 
ATOM   1029 C  CB    . HIS A 1 137 ? 32.332  -5.500  -21.377 1.00 40.81  ? 243 HIS A CB    1 
ATOM   1030 C  CG    . HIS A 1 137 ? 31.764  -5.734  -22.748 1.00 40.86  ? 243 HIS A CG    1 
ATOM   1031 N  ND1   . HIS A 1 137 ? 32.511  -5.601  -23.900 1.00 44.99  ? 243 HIS A ND1   1 
ATOM   1032 C  CD2   . HIS A 1 137 ? 30.551  -6.193  -23.134 1.00 39.57  ? 243 HIS A CD2   1 
ATOM   1033 C  CE1   . HIS A 1 137 ? 31.774  -5.947  -24.932 1.00 42.43  ? 243 HIS A CE1   1 
ATOM   1034 N  NE2   . HIS A 1 137 ? 30.571  -6.290  -24.490 1.00 41.18  ? 243 HIS A NE2   1 
ATOM   1035 N  N     . LEU A 1 138 ? 30.991  -2.707  -20.661 1.00 38.87  ? 244 LEU A N     1 
ATOM   1036 C  CA    . LEU A 1 138 ? 29.995  -1.682  -20.907 1.00 38.72  ? 244 LEU A CA    1 
ATOM   1037 C  C     . LEU A 1 138 ? 30.643  -0.287  -21.058 1.00 38.31  ? 244 LEU A C     1 
ATOM   1038 O  O     . LEU A 1 138 ? 30.293  0.455   -21.994 1.00 36.14  ? 244 LEU A O     1 
ATOM   1039 C  CB    . LEU A 1 138 ? 28.919  -1.676  -19.803 1.00 38.68  ? 244 LEU A CB    1 
ATOM   1040 C  CG    . LEU A 1 138 ? 27.753  -0.628  -19.836 1.00 39.15  ? 244 LEU A CG    1 
ATOM   1041 C  CD1   . LEU A 1 138 ? 26.637  -0.982  -18.869 1.00 39.35  ? 244 LEU A CD1   1 
ATOM   1042 C  CD2   . LEU A 1 138 ? 28.188  0.807   -19.532 1.00 38.37  ? 244 LEU A CD2   1 
ATOM   1043 N  N     . ILE A 1 139 ? 31.546  0.056   -20.140 1.00 38.93  ? 245 ILE A N     1 
ATOM   1044 C  CA    . ILE A 1 139 ? 32.294  1.319   -20.194 1.00 42.83  ? 245 ILE A CA    1 
ATOM   1045 C  C     . ILE A 1 139 ? 33.075  1.439   -21.506 1.00 41.88  ? 245 ILE A C     1 
ATOM   1046 O  O     . ILE A 1 139 ? 32.872  2.406   -22.238 1.00 42.72  ? 245 ILE A O     1 
ATOM   1047 C  CB    . ILE A 1 139 ? 33.353  1.464   -19.082 1.00 45.57  ? 245 ILE A CB    1 
ATOM   1048 C  CG1   . ILE A 1 139 ? 32.790  1.451   -17.680 1.00 44.92  ? 245 ILE A CG1   1 
ATOM   1049 C  CG2   . ILE A 1 139 ? 34.087  2.787   -19.260 1.00 50.26  ? 245 ILE A CG2   1 
ATOM   1050 C  CD1   . ILE A 1 139 ? 31.559  2.311   -17.485 1.00 45.73  ? 245 ILE A CD1   1 
ATOM   1051 N  N     . ASN A 1 140 ? 33.922  0.440   -21.772 1.00 41.46  ? 246 ASN A N     1 
ATOM   1052 C  CA    . ASN A 1 140 ? 34.805  0.431   -22.951 1.00 42.11  ? 246 ASN A CA    1 
ATOM   1053 C  C     . ASN A 1 140 ? 34.043  0.387   -24.241 1.00 41.87  ? 246 ASN A C     1 
ATOM   1054 O  O     . ASN A 1 140 ? 34.383  1.088   -25.129 1.00 43.05  ? 246 ASN A O     1 
ATOM   1055 C  CB    . ASN A 1 140 ? 35.779  -0.752  -22.930 1.00 41.52  ? 246 ASN A CB    1 
ATOM   1056 C  CG    . ASN A 1 140 ? 36.711  -0.706  -21.754 1.00 45.05  ? 246 ASN A CG    1 
ATOM   1057 O  OD1   . ASN A 1 140 ? 37.074  0.365   -21.282 1.00 48.42  ? 246 ASN A OD1   1 
ATOM   1058 N  ND2   . ASN A 1 140 ? 37.112  -1.863  -21.266 1.00 47.15  ? 246 ASN A ND2   1 
ATOM   1059 N  N     . SER A 1 141 ? 32.995  -0.419  -24.363 1.00 43.88  ? 247 SER A N     1 
ATOM   1060 C  CA    . SER A 1 141 ? 32.333  -0.553  -25.645 1.00 41.11  ? 247 SER A CA    1 
ATOM   1061 C  C     . SER A 1 141 ? 31.273  0.538   -25.930 1.00 41.67  ? 247 SER A C     1 
ATOM   1062 O  O     . SER A 1 141 ? 30.696  0.573   -27.020 1.00 44.52  ? 247 SER A O     1 
ATOM   1063 C  CB    . SER A 1 141 ? 31.827  -1.979  -25.797 1.00 42.48  ? 247 SER A CB    1 
ATOM   1064 O  OG    . SER A 1 141 ? 30.591  -2.189  -25.161 1.00 46.31  ? 247 SER A OG    1 
ATOM   1065 N  N     . ASN A 1 142 ? 31.031  1.466   -25.012 1.00 40.98  ? 248 ASN A N     1 
ATOM   1066 C  CA    . ASN A 1 142 ? 30.011  2.519   -25.258 1.00 40.79  ? 248 ASN A CA    1 
ATOM   1067 C  C     . ASN A 1 142 ? 30.548  3.968   -25.033 1.00 42.89  ? 248 ASN A C     1 
ATOM   1068 O  O     . ASN A 1 142 ? 29.747  4.910   -24.904 1.00 44.09  ? 248 ASN A O     1 
ATOM   1069 C  CB    . ASN A 1 142 ? 28.768  2.267   -24.378 1.00 38.00  ? 248 ASN A CB    1 
ATOM   1070 C  CG    . ASN A 1 142 ? 28.079  0.967   -24.700 1.00 36.23  ? 248 ASN A CG    1 
ATOM   1071 O  OD1   . ASN A 1 142 ? 27.235  0.927   -25.572 1.00 35.67  ? 248 ASN A OD1   1 
ATOM   1072 N  ND2   . ASN A 1 142 ? 28.409  -0.095  -23.966 1.00 34.58  ? 248 ASN A ND2   1 
ATOM   1073 N  N     . GLY A 1 143 ? 31.862  4.173   -24.958 1.00 41.88  ? 249 GLY A N     1 
ATOM   1074 C  CA    . GLY A 1 143 ? 32.377  5.530   -24.749 1.00 42.90  ? 249 GLY A CA    1 
ATOM   1075 C  C     . GLY A 1 143 ? 32.031  6.238   -23.432 1.00 45.92  ? 249 GLY A C     1 
ATOM   1076 O  O     . GLY A 1 143 ? 32.047  7.472   -23.329 1.00 46.20  ? 249 GLY A O     1 
ATOM   1077 N  N     . ILE A 1 144 ? 31.786  5.480   -22.378 1.00 45.37  ? 250 ILE A N     1 
ATOM   1078 C  CA    . ILE A 1 144 ? 31.342  6.099   -21.134 1.00 46.37  ? 250 ILE A CA    1 
ATOM   1079 C  C     . ILE A 1 144 ? 32.429  6.980   -20.475 1.00 44.76  ? 250 ILE A C     1 
ATOM   1080 O  O     . ILE A 1 144 ? 32.105  7.999   -19.845 1.00 45.41  ? 250 ILE A O     1 
ATOM   1081 C  CB    . ILE A 1 144 ? 30.770  5.017   -20.160 1.00 46.61  ? 250 ILE A CB    1 
ATOM   1082 C  CG1   . ILE A 1 144 ? 29.610  4.246   -20.825 1.00 46.65  ? 250 ILE A CG1   1 
ATOM   1083 C  CG2   . ILE A 1 144 ? 30.376  5.581   -18.803 1.00 46.90  ? 250 ILE A CG2   1 
ATOM   1084 C  CD1   . ILE A 1 144 ? 28.531  5.127   -21.446 1.00 45.27  ? 250 ILE A CD1   1 
ATOM   1085 N  N     . LYS A 1 145 ? 33.695  6.612   -20.629 1.00 44.19  ? 251 LYS A N     1 
ATOM   1086 C  CA    . LYS A 1 145 ? 34.820  7.266   -19.906 1.00 45.24  ? 251 LYS A CA    1 
ATOM   1087 C  C     . LYS A 1 145 ? 34.902  8.795   -20.009 1.00 41.14  ? 251 LYS A C     1 
ATOM   1088 O  O     . LYS A 1 145 ? 35.133  9.477   -19.043 1.00 41.98  ? 251 LYS A O     1 
ATOM   1089 C  CB    . LYS A 1 145 ? 36.157  6.618   -20.305 1.00 48.81  ? 251 LYS A CB    1 
ATOM   1090 C  CG    . LYS A 1 145 ? 36.645  5.544   -19.363 1.00 50.51  ? 251 LYS A CG    1 
ATOM   1091 C  CD    . LYS A 1 145 ? 37.908  4.975   -19.929 1.00 53.42  ? 251 LYS A CD    1 
ATOM   1092 C  CE    . LYS A 1 145 ? 38.757  4.311   -18.887 1.00 58.83  ? 251 LYS A CE    1 
ATOM   1093 N  NZ    . LYS A 1 145 ? 39.260  3.019   -19.455 1.00 64.59  ? 251 LYS A NZ    1 
ATOM   1094 N  N     . PRO A 1 146 ? 34.665  9.351   -21.176 1.00 43.16  ? 252 PRO A N     1 
ATOM   1095 C  CA    . PRO A 1 146 ? 34.634  10.824  -21.272 1.00 42.10  ? 252 PRO A CA    1 
ATOM   1096 C  C     . PRO A 1 146 ? 33.501  11.514  -20.533 1.00 41.64  ? 252 PRO A C     1 
ATOM   1097 O  O     . PRO A 1 146 ? 33.657  12.629  -19.987 1.00 39.91  ? 252 PRO A O     1 
ATOM   1098 C  CB    . PRO A 1 146 ? 34.508  11.074  -22.796 1.00 43.04  ? 252 PRO A CB    1 
ATOM   1099 C  CG    . PRO A 1 146 ? 34.977  9.821   -23.470 1.00 43.31  ? 252 PRO A CG    1 
ATOM   1100 C  CD    . PRO A 1 146 ? 34.940  8.697   -22.477 1.00 43.94  ? 252 PRO A CD    1 
ATOM   1101 N  N     . VAL A 1 147 ? 32.349  10.856  -20.561 1.00 42.99  ? 253 VAL A N     1 
ATOM   1102 C  CA    . VAL A 1 147 ? 31.157  11.305  -19.844 1.00 42.98  ? 253 VAL A CA    1 
ATOM   1103 C  C     . VAL A 1 147 ? 31.408  11.324  -18.312 1.00 43.03  ? 253 VAL A C     1 
ATOM   1104 O  O     . VAL A 1 147 ? 30.978  12.220  -17.597 1.00 44.81  ? 253 VAL A O     1 
ATOM   1105 C  CB    . VAL A 1 147 ? 29.962  10.411  -20.194 1.00 41.36  ? 253 VAL A CB    1 
ATOM   1106 C  CG1   . VAL A 1 147 ? 28.702  11.065  -19.762 1.00 41.05  ? 253 VAL A CG1   1 
ATOM   1107 C  CG2   . VAL A 1 147 ? 29.850  10.151  -21.700 1.00 42.41  ? 253 VAL A CG2   1 
ATOM   1108 N  N     . MET A 1 148 ? 32.130  10.338  -17.822 1.00 44.76  ? 254 MET A N     1 
ATOM   1109 C  CA    . MET A 1 148 ? 32.505  10.315  -16.415 1.00 45.18  ? 254 MET A CA    1 
ATOM   1110 C  C     . MET A 1 148 ? 33.291  11.558  -16.065 1.00 44.67  ? 254 MET A C     1 
ATOM   1111 O  O     . MET A 1 148 ? 32.997  12.256  -15.086 1.00 42.94  ? 254 MET A O     1 
ATOM   1112 C  CB    . MET A 1 148 ? 33.292  9.047   -16.067 1.00 46.16  ? 254 MET A CB    1 
ATOM   1113 C  CG    . MET A 1 148 ? 32.437  7.784   -16.054 1.00 47.08  ? 254 MET A CG    1 
ATOM   1114 S  SD    . MET A 1 148 ? 33.345  6.225   -15.928 1.00 49.89  ? 254 MET A SD    1 
ATOM   1115 C  CE    . MET A 1 148 ? 33.234  5.790   -14.220 1.00 53.96  ? 254 MET A CE    1 
ATOM   1116 N  N     . GLU A 1 149 ? 34.246  11.877  -16.917 1.00 46.84  ? 255 GLU A N     1 
ATOM   1117 C  CA    . GLU A 1 149 ? 35.136  13.006  -16.658 1.00 47.58  ? 255 GLU A CA    1 
ATOM   1118 C  C     . GLU A 1 149 ? 34.377  14.263  -16.777 1.00 45.74  ? 255 GLU A C     1 
ATOM   1119 O  O     . GLU A 1 149 ? 34.599  15.201  -16.036 1.00 43.82  ? 255 GLU A O     1 
ATOM   1120 C  CB    . GLU A 1 149 ? 36.315  13.027  -17.632 1.00 53.65  ? 255 GLU A CB    1 
ATOM   1121 C  CG    . GLU A 1 149 ? 37.322  11.906  -17.370 1.00 56.73  ? 255 GLU A CG    1 
ATOM   1122 C  CD    . GLU A 1 149 ? 38.528  11.975  -18.264 1.00 60.81  ? 255 GLU A CD    1 
ATOM   1123 O  OE1   . GLU A 1 149 ? 38.339  12.345  -19.456 1.00 64.86  ? 255 GLU A OE1   1 
ATOM   1124 O  OE2   . GLU A 1 149 ? 39.640  11.657  -17.760 1.00 62.14  ? 255 GLU A OE2   1 
ATOM   1125 N  N     . GLN A 1 150 ? 33.451  14.272  -17.717 1.00 45.27  ? 256 GLN A N     1 
ATOM   1126 C  CA    . GLN A 1 150 ? 32.582  15.420  -17.931 1.00 47.23  ? 256 GLN A CA    1 
ATOM   1127 C  C     . GLN A 1 150 ? 31.760  15.771  -16.690 1.00 48.63  ? 256 GLN A C     1 
ATOM   1128 O  O     . GLN A 1 150 ? 31.373  16.912  -16.539 1.00 50.21  ? 256 GLN A O     1 
ATOM   1129 C  CB    . GLN A 1 150 ? 31.774  15.203  -19.219 1.00 49.38  ? 256 GLN A CB    1 
ATOM   1130 C  CG    . GLN A 1 150 ? 30.450  15.926  -19.376 1.00 52.76  ? 256 GLN A CG    1 
ATOM   1131 C  CD    . GLN A 1 150 ? 29.631  15.307  -20.533 1.00 53.37  ? 256 GLN A CD    1 
ATOM   1132 O  OE1   . GLN A 1 150 ? 30.086  14.388  -21.215 1.00 53.25  ? 256 GLN A OE1   1 
ATOM   1133 N  NE2   . GLN A 1 150 ? 28.423  15.811  -20.741 1.00 53.46  ? 256 GLN A NE2   1 
ATOM   1134 N  N     . TYR A 1 151 ? 31.519  14.830  -15.779 1.00 47.51  ? 257 TYR A N     1 
ATOM   1135 C  CA    . TYR A 1 151 ? 30.928  15.168  -14.473 1.00 47.90  ? 257 TYR A CA    1 
ATOM   1136 C  C     . TYR A 1 151 ? 31.902  15.144  -13.315 1.00 48.77  ? 257 TYR A C     1 
ATOM   1137 O  O     . TYR A 1 151 ? 31.463  15.032  -12.190 1.00 46.64  ? 257 TYR A O     1 
ATOM   1138 C  CB    . TYR A 1 151 ? 29.720  14.258  -14.173 1.00 45.06  ? 257 TYR A CB    1 
ATOM   1139 C  CG    . TYR A 1 151 ? 28.629  14.484  -15.180 1.00 42.75  ? 257 TYR A CG    1 
ATOM   1140 C  CD1   . TYR A 1 151 ? 27.793  15.573  -15.073 1.00 41.94  ? 257 TYR A CD1   1 
ATOM   1141 C  CD2   . TYR A 1 151 ? 28.472  13.653  -16.258 1.00 42.13  ? 257 TYR A CD2   1 
ATOM   1142 C  CE1   . TYR A 1 151 ? 26.825  15.820  -16.040 1.00 42.02  ? 257 TYR A CE1   1 
ATOM   1143 C  CE2   . TYR A 1 151 ? 27.494  13.897  -17.214 1.00 42.95  ? 257 TYR A CE2   1 
ATOM   1144 C  CZ    . TYR A 1 151 ? 26.679  14.979  -17.087 1.00 40.66  ? 257 TYR A CZ    1 
ATOM   1145 O  OH    . TYR A 1 151 ? 25.693  15.209  -18.021 1.00 46.19  ? 257 TYR A OH    1 
ATOM   1146 N  N     . GLY A 1 152 ? 33.201  15.286  -13.568 1.00 48.05  ? 258 GLY A N     1 
ATOM   1147 C  CA    . GLY A 1 152 ? 34.169  15.439  -12.502 1.00 46.22  ? 258 GLY A CA    1 
ATOM   1148 C  C     . GLY A 1 152 ? 34.678  14.144  -11.940 1.00 46.57  ? 258 GLY A C     1 
ATOM   1149 O  O     . GLY A 1 152 ? 35.369  14.161  -10.918 1.00 52.21  ? 258 GLY A O     1 
ATOM   1150 N  N     . LEU A 1 153 ? 34.380  13.019  -12.565 1.00 46.10  ? 259 LEU A N     1 
ATOM   1151 C  CA    . LEU A 1 153 ? 34.920  11.743  -12.071 1.00 49.22  ? 259 LEU A CA    1 
ATOM   1152 C  C     . LEU A 1 153 ? 36.298  11.524  -12.693 1.00 52.05  ? 259 LEU A C     1 
ATOM   1153 O  O     . LEU A 1 153 ? 36.555  11.965  -13.813 1.00 50.61  ? 259 LEU A O     1 
ATOM   1154 C  CB    . LEU A 1 153 ? 34.028  10.536  -12.429 1.00 49.38  ? 259 LEU A CB    1 
ATOM   1155 C  CG    . LEU A 1 153 ? 32.978  10.027  -11.456 1.00 51.17  ? 259 LEU A CG    1 
ATOM   1156 C  CD1   . LEU A 1 153 ? 32.013  11.129  -11.064 1.00 51.42  ? 259 LEU A CD1   1 
ATOM   1157 C  CD2   . LEU A 1 153 ? 32.253  8.794   -12.039 1.00 50.89  ? 259 LEU A CD2   1 
ATOM   1158 N  N     . ILE A 1 154 ? 37.138  10.782  -11.980 1.00 53.05  ? 260 ILE A N     1 
ATOM   1159 C  CA    . ILE A 1 154 ? 38.499  10.495  -12.397 1.00 51.94  ? 260 ILE A CA    1 
ATOM   1160 C  C     . ILE A 1 154 ? 38.646  9.015   -12.581 1.00 49.27  ? 260 ILE A C     1 
ATOM   1161 O  O     . ILE A 1 154 ? 38.864  8.314   -11.605 1.00 48.56  ? 260 ILE A O     1 
ATOM   1162 C  CB    . ILE A 1 154 ? 39.523  11.004  -11.358 1.00 52.76  ? 260 ILE A CB    1 
ATOM   1163 C  CG1   . ILE A 1 154 ? 39.365  12.527  -11.188 1.00 51.36  ? 260 ILE A CG1   1 
ATOM   1164 C  CG2   . ILE A 1 154 ? 40.957  10.686  -11.808 1.00 50.78  ? 260 ILE A CG2   1 
ATOM   1165 C  CD1   . ILE A 1 154 ? 39.724  12.983  -9.814  1.00 52.32  ? 260 ILE A CD1   1 
ATOM   1166 N  N     . PRO A 1 155 ? 38.565  8.532   -13.830 1.00 50.17  ? 261 PRO A N     1 
ATOM   1167 C  CA    . PRO A 1 155 ? 38.525  7.096   -14.088 1.00 50.05  ? 261 PRO A CA    1 
ATOM   1168 C  C     . PRO A 1 155 ? 39.594  6.172   -13.482 1.00 51.59  ? 261 PRO A C     1 
ATOM   1169 O  O     . PRO A 1 155 ? 39.177  5.121   -12.992 1.00 51.69  ? 261 PRO A O     1 
ATOM   1170 C  CB    . PRO A 1 155 ? 38.602  7.023   -15.588 1.00 50.70  ? 261 PRO A CB    1 
ATOM   1171 C  CG    . PRO A 1 155 ? 37.878  8.238   -16.033 1.00 51.25  ? 261 PRO A CG    1 
ATOM   1172 C  CD    . PRO A 1 155 ? 38.256  9.293   -15.050 1.00 49.92  ? 261 PRO A CD    1 
ATOM   1173 N  N     . GLU A 1 156 ? 40.912  6.481   -13.499 1.00 51.87  ? 262 GLU A N     1 
ATOM   1174 C  CA    . GLU A 1 156 ? 41.855  5.502   -12.912 1.00 53.89  ? 262 GLU A CA    1 
ATOM   1175 C  C     . GLU A 1 156 ? 41.323  5.120   -11.514 1.00 56.89  ? 262 GLU A C     1 
ATOM   1176 O  O     . GLU A 1 156 ? 41.000  3.955   -11.297 1.00 56.08  ? 262 GLU A O     1 
ATOM   1177 C  CB    . GLU A 1 156 ? 43.332  5.909   -12.899 1.00 57.01  ? 262 GLU A CB    1 
ATOM   1178 N  N     . GLU A 1 157 ? 41.090  6.109   -10.657 1.00 57.97  ? 263 GLU A N     1 
ATOM   1179 C  CA    . GLU A 1 157 ? 40.620  5.913   -9.264  1.00 59.15  ? 263 GLU A CA    1 
ATOM   1180 C  C     . GLU A 1 157 ? 39.172  5.440   -9.078  1.00 56.50  ? 263 GLU A C     1 
ATOM   1181 O  O     . GLU A 1 157 ? 38.898  4.528   -8.286  1.00 56.74  ? 263 GLU A O     1 
ATOM   1182 C  CB    . GLU A 1 157 ? 40.671  7.216   -8.489  1.00 62.04  ? 263 GLU A CB    1 
ATOM   1183 C  CG    . GLU A 1 157 ? 42.021  7.829   -8.317  1.00 67.05  ? 263 GLU A CG    1 
ATOM   1184 C  CD    . GLU A 1 157 ? 41.942  9.209   -7.669  1.00 71.30  ? 263 GLU A CD    1 
ATOM   1185 O  OE1   . GLU A 1 157 ? 42.777  10.055  -8.040  1.00 74.24  ? 263 GLU A OE1   1 
ATOM   1186 O  OE2   . GLU A 1 157 ? 41.085  9.465   -6.776  1.00 69.02  ? 263 GLU A OE2   1 
ATOM   1187 N  N     . ASP A 1 158 ? 38.251  6.103   -9.762  1.00 50.04  ? 264 ASP A N     1 
ATOM   1188 C  CA    . ASP A 1 158 ? 36.813  5.915   -9.536  1.00 47.15  ? 264 ASP A CA    1 
ATOM   1189 C  C     . ASP A 1 158 ? 36.210  4.566   -10.062 1.00 45.56  ? 264 ASP A C     1 
ATOM   1190 O  O     . ASP A 1 158 ? 35.326  3.982   -9.443  1.00 45.28  ? 264 ASP A O     1 
ATOM   1191 C  CB    . ASP A 1 158 ? 36.021  7.139   -10.085 1.00 43.09  ? 264 ASP A CB    1 
ATOM   1192 C  CG    . ASP A 1 158 ? 36.137  8.334   -9.231  1.00 40.18  ? 264 ASP A CG    1 
ATOM   1193 O  OD1   . ASP A 1 158 ? 36.526  8.249   -8.057  1.00 38.60  ? 264 ASP A OD1   1 
ATOM   1194 O  OD2   . ASP A 1 158 ? 35.822  9.410   -9.737  1.00 39.70  ? 264 ASP A OD2   1 
ATOM   1195 N  N     . ILE A 1 159 ? 36.712  4.077   -11.169 1.00 45.47  ? 265 ILE A N     1 
ATOM   1196 C  CA    . ILE A 1 159 ? 36.340  2.738   -11.673 1.00 45.63  ? 265 ILE A CA    1 
ATOM   1197 C  C     . ILE A 1 159 ? 36.781  1.637   -10.701 1.00 45.11  ? 265 ILE A C     1 
ATOM   1198 O  O     . ILE A 1 159 ? 36.046  0.660   -10.441 1.00 44.57  ? 265 ILE A O     1 
ATOM   1199 C  CB    . ILE A 1 159 ? 36.909  2.509   -13.082 1.00 44.58  ? 265 ILE A CB    1 
ATOM   1200 C  CG1   . ILE A 1 159 ? 36.127  3.422   -14.031 1.00 46.83  ? 265 ILE A CG1   1 
ATOM   1201 C  CG2   . ILE A 1 159 ? 36.834  1.055   -13.519 1.00 42.42  ? 265 ILE A CG2   1 
ATOM   1202 C  CD1   . ILE A 1 159 ? 36.746  3.592   -15.395 1.00 47.03  ? 265 ILE A CD1   1 
ATOM   1203 N  N     . CYS A 1 160 ? 37.957  1.817   -10.138 1.00 44.25  ? 266 CYS A N     1 
ATOM   1204 C  CA    . CYS A 1 160 ? 38.458  0.900   -9.129  1.00 47.13  ? 266 CYS A CA    1 
ATOM   1205 C  C     . CYS A 1 160 ? 37.558  0.945   -7.878  1.00 44.44  ? 266 CYS A C     1 
ATOM   1206 O  O     . CYS A 1 160 ? 37.272  -0.087  -7.305  1.00 44.50  ? 266 CYS A O     1 
ATOM   1207 C  CB    . CYS A 1 160 ? 39.928  1.231   -8.792  1.00 47.33  ? 266 CYS A CB    1 
ATOM   1208 S  SG    . CYS A 1 160 ? 40.549  0.558   -7.251  1.00 53.21  ? 266 CYS A SG    1 
ATOM   1209 N  N     . PHE A 1 161 ? 37.122  2.148   -7.486  1.00 43.22  ? 267 PHE A N     1 
ATOM   1210 C  CA    . PHE A 1 161 ? 36.193  2.337   -6.375  1.00 41.57  ? 267 PHE A CA    1 
ATOM   1211 C  C     . PHE A 1 161 ? 34.857  1.607   -6.597  1.00 40.48  ? 267 PHE A C     1 
ATOM   1212 O  O     . PHE A 1 161 ? 34.387  0.879   -5.738  1.00 40.53  ? 267 PHE A O     1 
ATOM   1213 C  CB    . PHE A 1 161 ? 35.994  3.852   -6.145  1.00 42.31  ? 267 PHE A CB    1 
ATOM   1214 C  CG    . PHE A 1 161 ? 35.033  4.218   -5.036  1.00 42.68  ? 267 PHE A CG    1 
ATOM   1215 C  CD1   . PHE A 1 161 ? 34.922  3.461   -3.876  1.00 42.36  ? 267 PHE A CD1   1 
ATOM   1216 C  CD2   . PHE A 1 161 ? 34.222  5.356   -5.174  1.00 43.37  ? 267 PHE A CD2   1 
ATOM   1217 C  CE1   . PHE A 1 161 ? 34.006  3.820   -2.896  1.00 42.91  ? 267 PHE A CE1   1 
ATOM   1218 C  CE2   . PHE A 1 161 ? 33.319  5.720   -4.195  1.00 42.93  ? 267 PHE A CE2   1 
ATOM   1219 C  CZ    . PHE A 1 161 ? 33.219  4.964   -3.051  1.00 43.78  ? 267 PHE A CZ    1 
ATOM   1220 N  N     . ILE A 1 162 ? 34.272  1.788   -7.767  1.00 39.40  ? 268 ILE A N     1 
ATOM   1221 C  CA    . ILE A 1 162 ? 33.015  1.141   -8.152  1.00 37.65  ? 268 ILE A CA    1 
ATOM   1222 C  C     . ILE A 1 162 ? 33.117  -0.366  -8.090  1.00 37.19  ? 268 ILE A C     1 
ATOM   1223 O  O     . ILE A 1 162 ? 32.221  -1.028  -7.609  1.00 33.91  ? 268 ILE A O     1 
ATOM   1224 C  CB    . ILE A 1 162 ? 32.538  1.658   -9.528  1.00 36.05  ? 268 ILE A CB    1 
ATOM   1225 C  CG1   . ILE A 1 162 ? 32.041  3.106   -9.380  1.00 36.90  ? 268 ILE A CG1   1 
ATOM   1226 C  CG2   . ILE A 1 162 ? 31.400  0.818   -10.097 1.00 36.26  ? 268 ILE A CG2   1 
ATOM   1227 C  CD1   . ILE A 1 162 ? 31.968  3.939   -10.684 1.00 37.41  ? 268 ILE A CD1   1 
ATOM   1228 N  N     . LYS A 1 163 ? 34.229  -0.900  -8.577  1.00 41.75  ? 269 LYS A N     1 
ATOM   1229 C  CA    . LYS A 1 163 ? 34.399  -2.351  -8.653  1.00 41.20  ? 269 LYS A CA    1 
ATOM   1230 C  C     . LYS A 1 163 ? 34.582  -2.925  -7.273  1.00 41.14  ? 269 LYS A C     1 
ATOM   1231 O  O     . LYS A 1 163 ? 33.986  -3.962  -6.960  1.00 42.52  ? 269 LYS A O     1 
ATOM   1232 C  CB    . LYS A 1 163 ? 35.582  -2.697  -9.497  1.00 42.92  ? 269 LYS A CB    1 
ATOM   1233 C  CG    . LYS A 1 163 ? 35.372  -2.467  -10.955 1.00 43.76  ? 269 LYS A CG    1 
ATOM   1234 C  CD    . LYS A 1 163 ? 36.708  -2.596  -11.735 1.00 43.38  ? 269 LYS A CD    1 
ATOM   1235 C  CE    . LYS A 1 163 ? 36.391  -2.667  -13.218 1.00 42.28  ? 269 LYS A CE    1 
ATOM   1236 N  NZ    . LYS A 1 163 ? 37.561  -2.477  -14.072 1.00 44.70  ? 269 LYS A NZ    1 
ATOM   1237 N  N     . GLU A 1 164 ? 35.345  -2.236  -6.429  1.00 39.59  ? 270 GLU A N     1 
ATOM   1238 C  CA    . GLU A 1 164 ? 35.534  -2.689  -5.061  1.00 40.69  ? 270 GLU A CA    1 
ATOM   1239 C  C     . GLU A 1 164 ? 34.226  -2.750  -4.207  1.00 38.60  ? 270 GLU A C     1 
ATOM   1240 O  O     . GLU A 1 164 ? 34.063  -3.652  -3.388  1.00 34.95  ? 270 GLU A O     1 
ATOM   1241 C  CB    . GLU A 1 164 ? 36.540  -1.794  -4.327  1.00 43.62  ? 270 GLU A CB    1 
ATOM   1242 C  CG    . GLU A 1 164 ? 37.993  -1.908  -4.765  1.00 44.02  ? 270 GLU A CG    1 
ATOM   1243 C  CD    . GLU A 1 164 ? 38.908  -0.755  -4.241  1.00 45.18  ? 270 GLU A CD    1 
ATOM   1244 O  OE1   . GLU A 1 164 ? 38.434  0.338   -3.864  1.00 45.03  ? 270 GLU A OE1   1 
ATOM   1245 O  OE2   . GLU A 1 164 ? 40.145  -0.927  -4.189  1.00 46.71  ? 270 GLU A OE2   1 
ATOM   1246 N  N     . GLN A 1 165 ? 33.352  -1.757  -4.409  1.00 36.99  ? 271 GLN A N     1 
ATOM   1247 C  CA    . GLN A 1 165 ? 32.033  -1.690  -3.785  1.00 35.06  ? 271 GLN A CA    1 
ATOM   1248 C  C     . GLN A 1 165 ? 31.211  -2.903  -4.177  1.00 36.52  ? 271 GLN A C     1 
ATOM   1249 O  O     . GLN A 1 165 ? 30.518  -3.479  -3.368  1.00 35.95  ? 271 GLN A O     1 
ATOM   1250 C  CB    . GLN A 1 165 ? 31.246  -0.448  -4.206  1.00 35.16  ? 271 GLN A CB    1 
ATOM   1251 C  CG    . GLN A 1 165 ? 31.700  0.912   -3.676  1.00 35.95  ? 271 GLN A CG    1 
ATOM   1252 C  CD    . GLN A 1 165 ? 30.830  2.096   -4.177  1.00 37.58  ? 271 GLN A CD    1 
ATOM   1253 O  OE1   . GLN A 1 165 ? 29.700  2.307   -3.689  1.00 37.19  ? 271 GLN A OE1   1 
ATOM   1254 N  NE2   . GLN A 1 165 ? 31.357  2.865   -5.144  1.00 35.05  ? 271 GLN A NE2   1 
ATOM   1255 N  N     . ILE A 1 166 ? 31.308  -3.325  -5.421  1.00 37.32  ? 272 ILE A N     1 
ATOM   1256 C  CA    . ILE A 1 166 ? 30.567  -4.482  -5.888  1.00 40.85  ? 272 ILE A CA    1 
ATOM   1257 C  C     . ILE A 1 166 ? 31.117  -5.836  -5.383  1.00 43.98  ? 272 ILE A C     1 
ATOM   1258 O  O     . ILE A 1 166 ? 30.379  -6.663  -4.839  1.00 49.08  ? 272 ILE A O     1 
ATOM   1259 C  CB    . ILE A 1 166 ? 30.519  -4.458  -7.434  1.00 39.47  ? 272 ILE A CB    1 
ATOM   1260 C  CG1   . ILE A 1 166 ? 29.687  -3.226  -7.881  1.00 36.92  ? 272 ILE A CG1   1 
ATOM   1261 C  CG2   . ILE A 1 166 ? 29.951  -5.768  -7.968  1.00 38.87  ? 272 ILE A CG2   1 
ATOM   1262 C  CD1   . ILE A 1 166 ? 29.547  -3.026  -9.382  1.00 38.31  ? 272 ILE A CD1   1 
ATOM   1263 N  N     . VAL A 1 167 ? 32.398  -6.062  -5.577  1.00 46.59  ? 273 VAL A N     1 
ATOM   1264 C  CA    . VAL A 1 167 ? 32.960  -7.398  -5.425  1.00 49.72  ? 273 VAL A CA    1 
ATOM   1265 C  C     . VAL A 1 167 ? 33.713  -7.573  -4.121  1.00 54.66  ? 273 VAL A C     1 
ATOM   1266 O  O     . VAL A 1 167 ? 33.845  -8.688  -3.680  1.00 61.44  ? 273 VAL A O     1 
ATOM   1267 C  CB    . VAL A 1 167 ? 33.864  -7.793  -6.660  1.00 47.77  ? 273 VAL A CB    1 
ATOM   1268 C  CG1   . VAL A 1 167 ? 35.251  -7.209  -6.559  1.00 45.71  ? 273 VAL A CG1   1 
ATOM   1269 C  CG2   . VAL A 1 167 ? 33.952  -9.301  -6.862  1.00 44.64  ? 273 VAL A CG2   1 
ATOM   1270 N  N     . GLY A 1 168 ? 34.182  -6.500  -3.496  1.00 58.90  ? 274 GLY A N     1 
ATOM   1271 C  CA    . GLY A 1 168 ? 35.218  -6.611  -2.447  1.00 60.22  ? 274 GLY A CA    1 
ATOM   1272 C  C     . GLY A 1 168 ? 36.583  -6.156  -2.961  1.00 60.04  ? 274 GLY A C     1 
ATOM   1273 O  O     . GLY A 1 168 ? 36.695  -5.787  -4.110  1.00 57.90  ? 274 GLY A O     1 
ATOM   1274 N  N     . PRO A 1 169 ? 37.621  -6.149  -2.107  1.00 66.80  ? 275 PRO A N     1 
ATOM   1275 C  CA    . PRO A 1 169 ? 38.975  -5.599  -2.443  1.00 67.10  ? 275 PRO A CA    1 
ATOM   1276 C  C     . PRO A 1 169 ? 39.729  -6.208  -3.603  1.00 63.62  ? 275 PRO A C     1 
ATOM   1277 O  O     . PRO A 1 169 ? 39.729  -7.411  -3.706  1.00 69.28  ? 275 PRO A O     1 
ATOM   1278 C  CB    . PRO A 1 169 ? 39.767  -5.786  -1.131  1.00 68.73  ? 275 PRO A CB    1 
ATOM   1279 C  CG    . PRO A 1 169 ? 38.762  -6.065  -0.069  1.00 68.44  ? 275 PRO A CG    1 
ATOM   1280 C  CD    . PRO A 1 169 ? 37.583  -6.700  -0.742  1.00 67.82  ? 275 PRO A CD    1 
ATOM   1281 N  N     . LEU A 1 178 ? 46.973  -3.867  7.168   1.00 75.06  ? 284 LEU A N     1 
ATOM   1282 C  CA    . LEU A 1 178 ? 46.204  -2.652  7.137   1.00 79.90  ? 284 LEU A CA    1 
ATOM   1283 C  C     . LEU A 1 178 ? 44.989  -2.581  6.151   1.00 78.72  ? 284 LEU A C     1 
ATOM   1284 O  O     . LEU A 1 178 ? 44.098  -3.426  6.213   1.00 74.22  ? 284 LEU A O     1 
ATOM   1285 C  CB    . LEU A 1 178 ? 47.163  -1.466  6.909   1.00 86.99  ? 284 LEU A CB    1 
ATOM   1286 C  CG    . LEU A 1 178 ? 48.109  -0.971  8.011   1.00 94.78  ? 284 LEU A CG    1 
ATOM   1287 C  CD1   . LEU A 1 178 ? 48.944  0.218   7.501   1.00 93.74  ? 284 LEU A CD1   1 
ATOM   1288 C  CD2   . LEU A 1 178 ? 47.336  -0.560  9.270   1.00 94.27  ? 284 LEU A CD2   1 
ATOM   1289 N  N     . TRP A 1 179 ? 44.959  -1.535  5.298   1.00 76.40  ? 285 TRP A N     1 
ATOM   1290 C  CA    . TRP A 1 179 ? 43.761  -1.061  4.564   1.00 70.63  ? 285 TRP A CA    1 
ATOM   1291 C  C     . TRP A 1 179 ? 43.788  -1.635  3.160   1.00 66.56  ? 285 TRP A C     1 
ATOM   1292 O  O     . TRP A 1 179 ? 44.651  -1.265  2.386   1.00 66.15  ? 285 TRP A O     1 
ATOM   1293 C  CB    . TRP A 1 179 ? 43.752  0.494   4.477   1.00 71.38  ? 285 TRP A CB    1 
ATOM   1294 C  CG    . TRP A 1 179 ? 42.608  1.183   3.655   1.00 71.93  ? 285 TRP A CG    1 
ATOM   1295 C  CD1   . TRP A 1 179 ? 42.742  1.988   2.533   1.00 71.20  ? 285 TRP A CD1   1 
ATOM   1296 C  CD2   . TRP A 1 179 ? 41.198  1.144   3.938   1.00 71.75  ? 285 TRP A CD2   1 
ATOM   1297 N  NE1   . TRP A 1 179 ? 41.507  2.425   2.110   1.00 71.07  ? 285 TRP A NE1   1 
ATOM   1298 C  CE2   . TRP A 1 179 ? 40.548  1.918   2.953   1.00 70.05  ? 285 TRP A CE2   1 
ATOM   1299 C  CE3   . TRP A 1 179 ? 40.422  0.517   4.928   1.00 69.08  ? 285 TRP A CE3   1 
ATOM   1300 C  CZ2   . TRP A 1 179 ? 39.183  2.064   2.929   1.00 65.81  ? 285 TRP A CZ2   1 
ATOM   1301 C  CZ3   . TRP A 1 179 ? 39.082  0.682   4.915   1.00 66.62  ? 285 TRP A CZ3   1 
ATOM   1302 C  CH2   . TRP A 1 179 ? 38.468  1.451   3.917   1.00 66.33  ? 285 TRP A CH2   1 
ATOM   1303 N  N     . PRO A 1 180 ? 42.826  -2.504  2.791   1.00 64.08  ? 286 PRO A N     1 
ATOM   1304 C  CA    . PRO A 1 180 ? 42.907  -3.182  1.490   1.00 61.83  ? 286 PRO A CA    1 
ATOM   1305 C  C     . PRO A 1 180 ? 42.422  -2.462  0.228   1.00 56.87  ? 286 PRO A C     1 
ATOM   1306 O  O     . PRO A 1 180 ? 42.451  -3.079  -0.799  1.00 50.71  ? 286 PRO A O     1 
ATOM   1307 C  CB    . PRO A 1 180 ? 42.083  -4.460  1.712   1.00 63.80  ? 286 PRO A CB    1 
ATOM   1308 C  CG    . PRO A 1 180 ? 41.091  -4.108  2.750   1.00 64.46  ? 286 PRO A CG    1 
ATOM   1309 C  CD    . PRO A 1 180 ? 41.689  -2.998  3.583   1.00 66.57  ? 286 PRO A CD    1 
ATOM   1310 N  N     . TYR A 1 181 ? 42.037  -1.189  0.295   1.00 55.56  ? 287 TYR A N     1 
ATOM   1311 C  CA    . TYR A 1 181 ? 41.350  -0.530  -0.804  1.00 55.61  ? 287 TYR A CA    1 
ATOM   1312 C  C     . TYR A 1 181 ? 42.218  0.527   -1.488  1.00 56.38  ? 287 TYR A C     1 
ATOM   1313 O  O     . TYR A 1 181 ? 42.828  1.392   -0.818  1.00 62.36  ? 287 TYR A O     1 
ATOM   1314 C  CB    . TYR A 1 181 ? 40.033  0.094   -0.309  1.00 56.85  ? 287 TYR A CB    1 
ATOM   1315 C  CG    . TYR A 1 181 ? 38.938  -0.897  0.122   1.00 55.69  ? 287 TYR A CG    1 
ATOM   1316 C  CD1   . TYR A 1 181 ? 38.230  -1.641  -0.831  1.00 56.64  ? 287 TYR A CD1   1 
ATOM   1317 C  CD2   . TYR A 1 181 ? 38.584  -1.069  1.473   1.00 57.26  ? 287 TYR A CD2   1 
ATOM   1318 C  CE1   . TYR A 1 181 ? 37.217  -2.509  -0.459  1.00 54.31  ? 287 TYR A CE1   1 
ATOM   1319 C  CE2   . TYR A 1 181 ? 37.559  -1.944  1.832   1.00 54.00  ? 287 TYR A CE2   1 
ATOM   1320 C  CZ    . TYR A 1 181 ? 36.888  -2.635  0.850   1.00 53.26  ? 287 TYR A CZ    1 
ATOM   1321 O  OH    . TYR A 1 181 ? 35.919  -3.531  1.144   1.00 53.25  ? 287 TYR A OH    1 
ATOM   1322 N  N     . LYS A 1 182 ? 42.239  0.446   -2.820  1.00 52.77  ? 288 LYS A N     1 
ATOM   1323 C  CA    . LYS A 1 182 ? 42.910  1.410   -3.657  1.00 52.81  ? 288 LYS A CA    1 
ATOM   1324 C  C     . LYS A 1 182 ? 41.977  2.577   -4.012  1.00 51.19  ? 288 LYS A C     1 
ATOM   1325 O  O     . LYS A 1 182 ? 42.454  3.635   -4.243  1.00 56.82  ? 288 LYS A O     1 
ATOM   1326 C  CB    . LYS A 1 182 ? 43.539  0.752   -4.932  1.00 49.23  ? 288 LYS A CB    1 
ATOM   1327 N  N     . GLY A 1 183 ? 40.664  2.434   -4.007  1.00 50.70  ? 289 GLY A N     1 
ATOM   1328 C  CA    . GLY A 1 183 ? 39.775  3.462   -4.607  1.00 50.69  ? 289 GLY A CA    1 
ATOM   1329 C  C     . GLY A 1 183 ? 39.373  4.652   -3.737  1.00 50.43  ? 289 GLY A C     1 
ATOM   1330 O  O     . GLY A 1 183 ? 38.958  5.700   -4.251  1.00 47.73  ? 289 GLY A O     1 
ATOM   1331 N  N     . ARG A 1 184 ? 39.427  4.449   -2.419  1.00 51.25  ? 290 ARG A N     1 
ATOM   1332 C  CA    . ARG A 1 184 ? 39.210  5.491   -1.410  1.00 52.95  ? 290 ARG A CA    1 
ATOM   1333 C  C     . ARG A 1 184 ? 40.013  5.097   -0.157  1.00 56.86  ? 290 ARG A C     1 
ATOM   1334 O  O     . ARG A 1 184 ? 40.308  3.907   0.030   1.00 59.26  ? 290 ARG A O     1 
ATOM   1335 C  CB    . ARG A 1 184 ? 37.723  5.603   -1.027  1.00 51.62  ? 290 ARG A CB    1 
ATOM   1336 C  CG    . ARG A 1 184 ? 36.758  6.207   -2.048  1.00 50.94  ? 290 ARG A CG    1 
ATOM   1337 C  CD    . ARG A 1 184 ? 37.036  7.684   -2.275  1.00 49.51  ? 290 ARG A CD    1 
ATOM   1338 N  NE    . ARG A 1 184 ? 36.129  8.372   -3.205  1.00 45.56  ? 290 ARG A NE    1 
ATOM   1339 C  CZ    . ARG A 1 184 ? 36.106  8.207   -4.515  1.00 44.05  ? 290 ARG A CZ    1 
ATOM   1340 N  NH1   . ARG A 1 184 ? 35.265  8.965   -5.234  1.00 44.11  ? 290 ARG A NH1   1 
ATOM   1341 N  NH2   . ARG A 1 184 ? 36.922  7.328   -5.118  1.00 43.17  ? 290 ARG A NH2   1 
ATOM   1342 N  N     . PRO A 1 185 ? 40.381  6.088   0.698   1.00 62.10  ? 291 PRO A N     1 
ATOM   1343 C  CA    . PRO A 1 185 ? 41.100  5.873   1.976   1.00 61.42  ? 291 PRO A CA    1 
ATOM   1344 C  C     . PRO A 1 185 ? 40.217  5.730   3.206   1.00 60.21  ? 291 PRO A C     1 
ATOM   1345 O  O     . PRO A 1 185 ? 39.044  6.015   3.150   1.00 65.47  ? 291 PRO A O     1 
ATOM   1346 C  CB    . PRO A 1 185 ? 41.933  7.153   2.102   1.00 60.72  ? 291 PRO A CB    1 
ATOM   1347 C  CG    . PRO A 1 185 ? 41.093  8.177   1.470   1.00 60.60  ? 291 PRO A CG    1 
ATOM   1348 C  CD    . PRO A 1 185 ? 40.499  7.502   0.278   1.00 60.95  ? 291 PRO A CD    1 
ATOM   1349 N  N     . GLU A 1 186 ? 40.825  5.388   4.330   1.00 60.11  ? 292 GLU A N     1 
ATOM   1350 C  CA    . GLU A 1 186 ? 40.127  5.017   5.588   1.00 60.38  ? 292 GLU A CA    1 
ATOM   1351 C  C     . GLU A 1 186 ? 39.108  5.989   6.153   1.00 59.26  ? 292 GLU A C     1 
ATOM   1352 O  O     . GLU A 1 186 ? 38.226  5.579   6.948   1.00 58.20  ? 292 GLU A O     1 
ATOM   1353 C  CB    . GLU A 1 186 ? 41.141  4.791   6.710   1.00 63.58  ? 292 GLU A CB    1 
ATOM   1354 C  CG    . GLU A 1 186 ? 42.258  3.811   6.414   1.00 64.68  ? 292 GLU A CG    1 
ATOM   1355 C  CD    . GLU A 1 186 ? 42.879  3.285   7.671   1.00 65.32  ? 292 GLU A CD    1 
ATOM   1356 O  OE1   . GLU A 1 186 ? 43.018  4.030   8.660   1.00 73.40  ? 292 GLU A OE1   1 
ATOM   1357 O  OE2   . GLU A 1 186 ? 43.226  2.106   7.681   1.00 66.79  ? 292 GLU A OE2   1 
ATOM   1358 N  N     . ASN A 1 187 ? 39.302  7.278   5.840   1.00 58.09  ? 293 ASN A N     1 
ATOM   1359 C  CA    . ASN A 1 187 ? 38.364  8.358   6.232   1.00 57.73  ? 293 ASN A CA    1 
ATOM   1360 C  C     . ASN A 1 187 ? 37.069  8.346   5.380   1.00 56.86  ? 293 ASN A C     1 
ATOM   1361 O  O     . ASN A 1 187 ? 36.101  9.082   5.693   1.00 52.69  ? 293 ASN A O     1 
ATOM   1362 C  CB    . ASN A 1 187 ? 39.039  9.759   6.242   1.00 58.27  ? 293 ASN A CB    1 
ATOM   1363 C  CG    . ASN A 1 187 ? 39.455  10.255  4.855   1.00 59.46  ? 293 ASN A CG    1 
ATOM   1364 O  OD1   . ASN A 1 187 ? 39.452  9.530   3.868   1.00 69.01  ? 293 ASN A OD1   1 
ATOM   1365 N  ND2   . ASN A 1 187 ? 39.802  11.500  4.788   1.00 60.21  ? 293 ASN A ND2   1 
ATOM   1366 N  N     . LYS A 1 188 ? 37.077  7.546   4.296   1.00 54.60  ? 294 LYS A N     1 
ATOM   1367 C  CA    . LYS A 1 188 ? 35.865  7.247   3.545   1.00 53.76  ? 294 LYS A CA    1 
ATOM   1368 C  C     . LYS A 1 188 ? 35.393  5.772   3.500   1.00 49.40  ? 294 LYS A C     1 
ATOM   1369 O  O     . LYS A 1 188 ? 34.707  5.390   2.588   1.00 44.32  ? 294 LYS A O     1 
ATOM   1370 C  CB    . LYS A 1 188 ? 36.031  7.911   2.182   1.00 54.21  ? 294 LYS A CB    1 
ATOM   1371 C  CG    . LYS A 1 188 ? 35.845  9.400   2.378   1.00 54.46  ? 294 LYS A CG    1 
ATOM   1372 C  CD    . LYS A 1 188 ? 35.982  10.159  1.120   1.00 56.31  ? 294 LYS A CD    1 
ATOM   1373 C  CE    . LYS A 1 188 ? 35.484  11.558  1.376   1.00 58.69  ? 294 LYS A CE    1 
ATOM   1374 N  NZ    . LYS A 1 188 ? 35.466  12.194  0.037   1.00 63.52  ? 294 LYS A NZ    1 
ATOM   1375 N  N     . SER A 1 189 ? 35.722  4.980   4.527   1.00 49.53  ? 295 SER A N     1 
ATOM   1376 C  CA    . SER A 1 189 ? 35.362  3.541   4.587   1.00 49.80  ? 295 SER A CA    1 
ATOM   1377 C  C     . SER A 1 189 ? 33.845  3.313   4.660   1.00 47.41  ? 295 SER A C     1 
ATOM   1378 O  O     . SER A 1 189 ? 33.360  2.327   4.165   1.00 49.61  ? 295 SER A O     1 
ATOM   1379 C  CB    . SER A 1 189 ? 36.008  2.853   5.803   1.00 48.63  ? 295 SER A CB    1 
ATOM   1380 O  OG    . SER A 1 189 ? 36.092  3.757   6.866   1.00 55.80  ? 295 SER A OG    1 
ATOM   1381 N  N     . PHE A 1 190 ? 33.111  4.213   5.296   1.00 43.84  ? 296 PHE A N     1 
ATOM   1382 C  CA    . PHE A 1 190 ? 31.673  4.094   5.356   1.00 44.22  ? 296 PHE A CA    1 
ATOM   1383 C  C     . PHE A 1 190 ? 31.011  3.927   3.995   1.00 43.57  ? 296 PHE A C     1 
ATOM   1384 O  O     . PHE A 1 190 ? 29.970  3.266   3.917   1.00 43.05  ? 296 PHE A O     1 
ATOM   1385 C  CB    . PHE A 1 190 ? 31.017  5.265   6.125   1.00 44.13  ? 296 PHE A CB    1 
ATOM   1386 C  CG    . PHE A 1 190 ? 31.360  6.634   5.600   1.00 42.05  ? 296 PHE A CG    1 
ATOM   1387 C  CD1   . PHE A 1 190 ? 32.496  7.299   6.017   1.00 40.59  ? 296 PHE A CD1   1 
ATOM   1388 C  CD2   . PHE A 1 190 ? 30.559  7.243   4.658   1.00 43.59  ? 296 PHE A CD2   1 
ATOM   1389 C  CE1   . PHE A 1 190 ? 32.823  8.528   5.545   1.00 39.14  ? 296 PHE A CE1   1 
ATOM   1390 C  CE2   . PHE A 1 190 ? 30.888  8.506   4.160   1.00 42.35  ? 296 PHE A CE2   1 
ATOM   1391 C  CZ    . PHE A 1 190 ? 32.016  9.152   4.638   1.00 42.21  ? 296 PHE A CZ    1 
ATOM   1392 N  N     . LEU A 1 191 ? 31.630  4.455   2.935   1.00 41.27  ? 297 LEU A N     1 
ATOM   1393 C  CA    . LEU A 1 191 ? 31.068  4.348   1.598   1.00 41.46  ? 297 LEU A CA    1 
ATOM   1394 C  C     . LEU A 1 191 ? 31.052  2.954   1.047   1.00 42.26  ? 297 LEU A C     1 
ATOM   1395 O  O     . LEU A 1 191 ? 30.204  2.618   0.226   1.00 44.19  ? 297 LEU A O     1 
ATOM   1396 C  CB    . LEU A 1 191 ? 31.814  5.267   0.622   1.00 42.30  ? 297 LEU A CB    1 
ATOM   1397 C  CG    . LEU A 1 191 ? 31.815  6.776   0.831   1.00 41.40  ? 297 LEU A CG    1 
ATOM   1398 C  CD1   . LEU A 1 191 ? 32.677  7.456   -0.194  1.00 42.07  ? 297 LEU A CD1   1 
ATOM   1399 C  CD2   . LEU A 1 191 ? 30.390  7.348   0.775   1.00 42.68  ? 297 LEU A CD2   1 
ATOM   1400 N  N     . TYR A 1 192 ? 31.968  2.112   1.494   1.00 42.28  ? 298 TYR A N     1 
ATOM   1401 C  CA    . TYR A 1 192 ? 31.910  0.697   1.085   1.00 41.52  ? 298 TYR A CA    1 
ATOM   1402 C  C     . TYR A 1 192 ? 30.785  -0.112  1.771   1.00 39.55  ? 298 TYR A C     1 
ATOM   1403 O  O     . TYR A 1 192 ? 30.587  -1.269  1.449   1.00 41.21  ? 298 TYR A O     1 
ATOM   1404 C  CB    . TYR A 1 192 ? 33.265  0.041   1.361   1.00 42.11  ? 298 TYR A CB    1 
ATOM   1405 C  CG    . TYR A 1 192 ? 34.384  0.527   0.484   1.00 43.20  ? 298 TYR A CG    1 
ATOM   1406 C  CD1   . TYR A 1 192 ? 34.542  0.025   -0.790  1.00 42.22  ? 298 TYR A CD1   1 
ATOM   1407 C  CD2   . TYR A 1 192 ? 35.280  1.516   0.918   1.00 44.49  ? 298 TYR A CD2   1 
ATOM   1408 C  CE1   . TYR A 1 192 ? 35.568  0.473   -1.607  1.00 43.93  ? 298 TYR A CE1   1 
ATOM   1409 C  CE2   . TYR A 1 192 ? 36.321  1.975   0.098   1.00 43.42  ? 298 TYR A CE2   1 
ATOM   1410 C  CZ    . TYR A 1 192 ? 36.468  1.437   -1.153  1.00 43.10  ? 298 TYR A CZ    1 
ATOM   1411 O  OH    . TYR A 1 192 ? 37.455  1.854   -1.978  1.00 40.70  ? 298 TYR A OH    1 
ATOM   1412 N  N     . GLU A 1 193 ? 30.132  0.473   2.768   1.00 39.84  ? 299 GLU A N     1 
ATOM   1413 C  CA    . GLU A 1 193 ? 29.076  -0.187  3.546   1.00 41.40  ? 299 GLU A CA    1 
ATOM   1414 C  C     . GLU A 1 193 ? 27.672  -0.007  2.944   1.00 39.68  ? 299 GLU A C     1 
ATOM   1415 O  O     . GLU A 1 193 ? 26.738  -0.581  3.476   1.00 37.40  ? 299 GLU A O     1 
ATOM   1416 C  CB    . GLU A 1 193 ? 29.108  0.251   5.039   1.00 44.68  ? 299 GLU A CB    1 
ATOM   1417 C  CG    . GLU A 1 193 ? 30.130  -0.521  5.877   1.00 48.52  ? 299 GLU A CG    1 
ATOM   1418 C  CD    . GLU A 1 193 ? 30.485  0.112   7.236   1.00 57.01  ? 299 GLU A CD    1 
ATOM   1419 O  OE1   . GLU A 1 193 ? 30.255  1.315   7.495   1.00 56.99  ? 299 GLU A OE1   1 
ATOM   1420 O  OE2   . GLU A 1 193 ? 31.046  -0.642  8.065   1.00 65.92  ? 299 GLU A OE2   1 
ATOM   1421 N  N     . ILE A 1 194 ? 27.545  0.693   1.802   1.00 35.56  ? 300 ILE A N     1 
ATOM   1422 C  CA    . ILE A 1 194 ? 26.221  1.003   1.223   1.00 31.56  ? 300 ILE A CA    1 
ATOM   1423 C  C     . ILE A 1 194 ? 25.625  -0.090  0.326   1.00 30.22  ? 300 ILE A C     1 
ATOM   1424 O  O     . ILE A 1 194 ? 24.516  -0.582  0.584   1.00 29.14  ? 300 ILE A O     1 
ATOM   1425 C  CB    . ILE A 1 194 ? 26.268  2.374   0.534   1.00 31.47  ? 300 ILE A CB    1 
ATOM   1426 C  CG1   . ILE A 1 194 ? 26.621  3.418   1.600   1.00 32.79  ? 300 ILE A CG1   1 
ATOM   1427 C  CG2   . ILE A 1 194 ? 24.960  2.726   -0.128  1.00 29.74  ? 300 ILE A CG2   1 
ATOM   1428 C  CD1   . ILE A 1 194 ? 26.824  4.803   1.062   1.00 33.92  ? 300 ILE A CD1   1 
ATOM   1429 N  N     . VAL A 1 195 ? 26.358  -0.504  -0.696  1.00 29.49  ? 301 VAL A N     1 
ATOM   1430 C  CA    . VAL A 1 195 ? 25.837  -1.338  -1.744  1.00 29.12  ? 301 VAL A CA    1 
ATOM   1431 C  C     . VAL A 1 195 ? 25.886  -2.817  -1.371  1.00 28.58  ? 301 VAL A C     1 
ATOM   1432 O  O     . VAL A 1 195 ? 24.894  -3.557  -1.571  1.00 28.77  ? 301 VAL A O     1 
ATOM   1433 C  CB    . VAL A 1 195 ? 26.617  -1.060  -3.070  1.00 29.43  ? 301 VAL A CB    1 
ATOM   1434 C  CG1   . VAL A 1 195 ? 26.281  -2.083  -4.101  1.00 29.43  ? 301 VAL A CG1   1 
ATOM   1435 C  CG2   . VAL A 1 195 ? 26.245  0.303   -3.626  1.00 29.41  ? 301 VAL A CG2   1 
ATOM   1436 N  N     . SER A 1 196 ? 27.053  -3.245  -0.895  1.00 27.39  ? 302 SER A N     1 
ATOM   1437 C  CA    . SER A 1 196 ? 27.286  -4.583  -0.414  1.00 26.93  ? 302 SER A CA    1 
ATOM   1438 C  C     . SER A 1 196 ? 28.204  -4.466  0.852   1.00 28.65  ? 302 SER A C     1 
ATOM   1439 O  O     . SER A 1 196 ? 29.432  -4.208  0.768   1.00 28.96  ? 302 SER A O     1 
ATOM   1440 C  CB    . SER A 1 196 ? 27.972  -5.359  -1.473  1.00 27.24  ? 302 SER A CB    1 
ATOM   1441 O  OG    . SER A 1 196 ? 28.317  -6.645  -0.963  1.00 27.88  ? 302 SER A OG    1 
ATOM   1442 N  N     . ASN A 1 197 ? 27.604  -4.721  2.013   1.00 30.27  ? 303 ASN A N     1 
ATOM   1443 C  CA    . ASN A 1 197 ? 28.248  -4.530  3.328   1.00 31.10  ? 303 ASN A CA    1 
ATOM   1444 C  C     . ASN A 1 197 ? 28.930  -5.863  3.776   1.00 32.13  ? 303 ASN A C     1 
ATOM   1445 O  O     . ASN A 1 197 ? 28.263  -6.799  4.194   1.00 31.57  ? 303 ASN A O     1 
ATOM   1446 C  CB    . ASN A 1 197 ? 27.171  -3.984  4.307   1.00 29.95  ? 303 ASN A CB    1 
ATOM   1447 C  CG    . ASN A 1 197 ? 27.721  -3.679  5.704   1.00 30.40  ? 303 ASN A CG    1 
ATOM   1448 O  OD1   . ASN A 1 197 ? 28.698  -4.346  6.196   1.00 28.22  ? 303 ASN A OD1   1 
ATOM   1449 N  ND2   . ASN A 1 197 ? 27.097  -2.703  6.366   1.00 26.63  ? 303 ASN A ND2   1 
ATOM   1450 N  N     . LYS A 1 198 ? 30.253  -5.924  3.668   1.00 36.53  ? 304 LYS A N     1 
ATOM   1451 C  CA    . LYS A 1 198 ? 31.045  -7.150  3.981   1.00 42.01  ? 304 LYS A CA    1 
ATOM   1452 C  C     . LYS A 1 198 ? 31.204  -7.349  5.494   1.00 41.37  ? 304 LYS A C     1 
ATOM   1453 O  O     . LYS A 1 198 ? 31.372  -8.453  5.944   1.00 43.36  ? 304 LYS A O     1 
ATOM   1454 C  CB    . LYS A 1 198 ? 32.465  -7.104  3.390   1.00 46.06  ? 304 LYS A CB    1 
ATOM   1455 C  CG    . LYS A 1 198 ? 32.608  -6.713  1.928   1.00 53.62  ? 304 LYS A CG    1 
ATOM   1456 C  CD    . LYS A 1 198 ? 31.984  -7.654  0.870   1.00 58.68  ? 304 LYS A CD    1 
ATOM   1457 C  CE    . LYS A 1 198 ? 31.703  -6.830  -0.423  1.00 66.07  ? 304 LYS A CE    1 
ATOM   1458 N  NZ    . LYS A 1 198 ? 30.978  -7.481  -1.590  1.00 68.18  ? 304 LYS A NZ    1 
ATOM   1459 N  N     . ARG A 1 199 ? 31.118  -6.273  6.247   1.00 40.19  ? 305 ARG A N     1 
ATOM   1460 C  CA    . ARG A 1 199 ? 31.267  -6.271  7.692   1.00 44.84  ? 305 ARG A CA    1 
ATOM   1461 C  C     . ARG A 1 199 ? 30.068  -6.966  8.399   1.00 41.17  ? 305 ARG A C     1 
ATOM   1462 O  O     . ARG A 1 199 ? 30.271  -7.879  9.231   1.00 43.37  ? 305 ARG A O     1 
ATOM   1463 C  CB    . ARG A 1 199 ? 31.489  -4.803  8.126   1.00 49.45  ? 305 ARG A CB    1 
ATOM   1464 C  CG    . ARG A 1 199 ? 31.928  -4.555  9.545   1.00 58.41  ? 305 ARG A CG    1 
ATOM   1465 C  CD    . ARG A 1 199 ? 31.696  -3.093  9.968   1.00 65.70  ? 305 ARG A CD    1 
ATOM   1466 N  NE    . ARG A 1 199 ? 31.622  -3.027  11.443  1.00 82.11  ? 305 ARG A NE    1 
ATOM   1467 C  CZ    . ARG A 1 199 ? 31.028  -2.077  12.202  1.00 88.76  ? 305 ARG A CZ    1 
ATOM   1468 N  NH1   . ARG A 1 199 ? 30.414  -1.029  11.643  1.00 93.92  ? 305 ARG A NH1   1 
ATOM   1469 N  NH2   . ARG A 1 199 ? 31.057  -2.179  13.545  1.00 79.65  ? 305 ARG A NH2   1 
ATOM   1470 N  N     . ASN A 1 200 ? 28.833  -6.567  8.061   1.00 36.58  ? 306 ASN A N     1 
ATOM   1471 C  CA    . ASN A 1 200 ? 27.623  -7.140  8.699   1.00 35.18  ? 306 ASN A CA    1 
ATOM   1472 C  C     . ASN A 1 200 ? 26.411  -7.491  7.813   1.00 32.15  ? 306 ASN A C     1 
ATOM   1473 O  O     . ASN A 1 200 ? 25.481  -8.110  8.257   1.00 31.24  ? 306 ASN A O     1 
ATOM   1474 C  CB    . ASN A 1 200 ? 27.227  -6.259  9.868   1.00 35.29  ? 306 ASN A CB    1 
ATOM   1475 C  CG    . ASN A 1 200 ? 26.925  -4.848  9.444   1.00 35.07  ? 306 ASN A CG    1 
ATOM   1476 O  OD1   . ASN A 1 200 ? 26.209  -4.644  8.466   1.00 33.99  ? 306 ASN A OD1   1 
ATOM   1477 N  ND2   . ASN A 1 200 ? 27.458  -3.854  10.187  1.00 32.61  ? 306 ASN A ND2   1 
ATOM   1478 N  N     . GLY A 1 201 ? 26.484  -7.169  6.534   1.00 31.01  ? 307 GLY A N     1 
ATOM   1479 C  CA    . GLY A 1 201 ? 25.468  -7.502  5.588   1.00 30.22  ? 307 GLY A CA    1 
ATOM   1480 C  C     . GLY A 1 201 ? 24.278  -6.522  5.524   1.00 30.19  ? 307 GLY A C     1 
ATOM   1481 O  O     . GLY A 1 201 ? 23.318  -6.785  4.748   1.00 29.50  ? 307 GLY A O     1 
ATOM   1482 N  N     . ILE A 1 202 ? 24.305  -5.407  6.279   1.00 27.49  ? 308 ILE A N     1 
ATOM   1483 C  CA    . ILE A 1 202 ? 23.176  -4.445  6.252   1.00 27.46  ? 308 ILE A CA    1 
ATOM   1484 C  C     . ILE A 1 202 ? 23.396  -3.510  5.081   1.00 27.68  ? 308 ILE A C     1 
ATOM   1485 O  O     . ILE A 1 202 ? 24.222  -2.633  5.157   1.00 30.36  ? 308 ILE A O     1 
ATOM   1486 C  CB    . ILE A 1 202 ? 23.091  -3.676  7.559   1.00 27.27  ? 308 ILE A CB    1 
ATOM   1487 C  CG1   . ILE A 1 202 ? 22.761  -4.675  8.694   1.00 27.73  ? 308 ILE A CG1   1 
ATOM   1488 C  CG2   . ILE A 1 202 ? 21.957  -2.652  7.531   1.00 27.44  ? 308 ILE A CG2   1 
ATOM   1489 C  CD1   . ILE A 1 202 ? 22.909  -4.054  10.078  1.00 26.69  ? 308 ILE A CD1   1 
ATOM   1490 N  N     . ASP A 1 203 ? 22.771  -3.792  3.937   1.00 26.49  ? 309 ASP A N     1 
ATOM   1491 C  CA    . ASP A 1 203 ? 23.007  -2.967  2.684   1.00 24.84  ? 309 ASP A CA    1 
ATOM   1492 C  C     . ASP A 1 203 ? 21.691  -2.676  1.941   1.00 23.54  ? 309 ASP A C     1 
ATOM   1493 O  O     . ASP A 1 203 ? 20.646  -3.320  2.171   1.00 22.20  ? 309 ASP A O     1 
ATOM   1494 C  CB    . ASP A 1 203 ? 24.097  -3.606  1.799   1.00 24.59  ? 309 ASP A CB    1 
ATOM   1495 C  CG    . ASP A 1 203 ? 23.883  -5.109  1.562   1.00 25.98  ? 309 ASP A CG    1 
ATOM   1496 O  OD1   . ASP A 1 203 ? 22.780  -5.517  1.136   1.00 23.89  ? 309 ASP A OD1   1 
ATOM   1497 O  OD2   . ASP A 1 203 ? 24.840  -5.910  1.825   1.00 29.37  ? 309 ASP A OD2   1 
ATOM   1498 N  N     . VAL A 1 204 ? 21.736  -1.717  1.025   1.00 24.36  ? 310 VAL A N     1 
ATOM   1499 C  CA    . VAL A 1 204 ? 20.515  -1.256  0.301   1.00 23.71  ? 310 VAL A CA    1 
ATOM   1500 C  C     . VAL A 1 204 ? 19.994  -2.258  -0.750  1.00 24.33  ? 310 VAL A C     1 
ATOM   1501 O  O     . VAL A 1 204 ? 18.797  -2.179  -1.148  1.00 23.20  ? 310 VAL A O     1 
ATOM   1502 C  CB    . VAL A 1 204 ? 20.732  0.125   -0.340  1.00 24.30  ? 310 VAL A CB    1 
ATOM   1503 C  CG1   . VAL A 1 204 ? 21.265  1.112   0.692   1.00 25.01  ? 310 VAL A CG1   1 
ATOM   1504 C  CG2   . VAL A 1 204 ? 21.701  0.108   -1.504  1.00 24.87  ? 310 VAL A CG2   1 
ATOM   1505 N  N     . ASP A 1 205 ? 20.878  -3.189  -1.192  1.00 23.66  ? 311 ASP A N     1 
ATOM   1506 C  CA    . ASP A 1 205 ? 20.503  -4.294  -2.055  1.00 24.48  ? 311 ASP A CA    1 
ATOM   1507 C  C     . ASP A 1 205 ? 19.385  -5.063  -1.403  1.00 24.32  ? 311 ASP A C     1 
ATOM   1508 O  O     . ASP A 1 205 ? 18.359  -5.340  -1.996  1.00 24.22  ? 311 ASP A O     1 
ATOM   1509 C  CB    . ASP A 1 205 ? 21.727  -5.171  -2.312  1.00 25.39  ? 311 ASP A CB    1 
ATOM   1510 C  CG    . ASP A 1 205 ? 21.429  -6.417  -3.104  1.00 29.34  ? 311 ASP A CG    1 
ATOM   1511 O  OD1   . ASP A 1 205 ? 20.874  -6.369  -4.277  1.00 28.93  ? 311 ASP A OD1   1 
ATOM   1512 O  OD2   . ASP A 1 205 ? 21.811  -7.510  -2.556  1.00 35.22  ? 311 ASP A OD2   1 
ATOM   1513 N  N     . LYS A 1 206 ? 19.587  -5.415  -0.144  1.00 24.27  ? 312 LYS A N     1 
ATOM   1514 C  CA    . LYS A 1 206 ? 18.568  -6.177  0.627   1.00 23.42  ? 312 LYS A CA    1 
ATOM   1515 C  C     . LYS A 1 206 ? 17.333  -5.354  0.793   1.00 21.95  ? 312 LYS A C     1 
ATOM   1516 O  O     . LYS A 1 206 ? 16.254  -5.881  0.727   1.00 20.99  ? 312 LYS A O     1 
ATOM   1517 C  CB    . LYS A 1 206 ? 19.071  -6.583  2.003   1.00 23.90  ? 312 LYS A CB    1 
ATOM   1518 C  CG    . LYS A 1 206 ? 20.124  -7.696  2.073   1.00 24.50  ? 312 LYS A CG    1 
ATOM   1519 C  CD    . LYS A 1 206 ? 20.500  -7.918  3.567   1.00 25.54  ? 312 LYS A CD    1 
ATOM   1520 C  CE    . LYS A 1 206 ? 21.399  -9.087  3.853   1.00 25.91  ? 312 LYS A CE    1 
ATOM   1521 N  NZ    . LYS A 1 206 ? 22.670  -8.760  3.142   1.00 27.84  ? 312 LYS A NZ    1 
ATOM   1522 N  N     . TRP A 1 207 ? 17.481  -4.068  1.033   1.00 21.35  ? 313 TRP A N     1 
ATOM   1523 C  CA    . TRP A 1 207 ? 16.300  -3.233  1.233   1.00 21.93  ? 313 TRP A CA    1 
ATOM   1524 C  C     . TRP A 1 207 ? 15.400  -3.246  0.033   1.00 21.42  ? 313 TRP A C     1 
ATOM   1525 O  O     . TRP A 1 207 ? 14.178  -3.385  0.164   1.00 22.10  ? 313 TRP A O     1 
ATOM   1526 C  CB    . TRP A 1 207 ? 16.680  -1.818  1.612   1.00 22.74  ? 313 TRP A CB    1 
ATOM   1527 C  CG    . TRP A 1 207 ? 17.579  -1.739  2.905   1.00 24.12  ? 313 TRP A CG    1 
ATOM   1528 C  CD1   . TRP A 1 207 ? 17.810  -2.727  3.791   1.00 24.85  ? 313 TRP A CD1   1 
ATOM   1529 C  CD2   . TRP A 1 207 ? 18.271  -0.564  3.422   1.00 24.72  ? 313 TRP A CD2   1 
ATOM   1530 N  NE1   . TRP A 1 207 ? 18.609  -2.271  4.826   1.00 25.65  ? 313 TRP A NE1   1 
ATOM   1531 C  CE2   . TRP A 1 207 ? 18.923  -0.952  4.605   1.00 25.76  ? 313 TRP A CE2   1 
ATOM   1532 C  CE3   . TRP A 1 207 ? 18.393  0.759   2.982   1.00 25.13  ? 313 TRP A CE3   1 
ATOM   1533 C  CZ2   . TRP A 1 207 ? 19.719  -0.052  5.383   1.00 26.03  ? 313 TRP A CZ2   1 
ATOM   1534 C  CZ3   . TRP A 1 207 ? 19.163  1.661   3.729   1.00 25.90  ? 313 TRP A CZ3   1 
ATOM   1535 C  CH2   . TRP A 1 207 ? 19.848  1.243   4.909   1.00 26.19  ? 313 TRP A CH2   1 
ATOM   1536 N  N     . ASP A 1 208 ? 15.975  -3.150  -1.163  1.00 21.72  ? 314 ASP A N     1 
ATOM   1537 C  CA    . ASP A 1 208 ? 15.176  -3.138  -2.392  1.00 20.38  ? 314 ASP A CA    1 
ATOM   1538 C  C     . ASP A 1 208 ? 14.516  -4.478  -2.627  1.00 20.77  ? 314 ASP A C     1 
ATOM   1539 O  O     . ASP A 1 208 ? 13.294  -4.545  -2.880  1.00 20.93  ? 314 ASP A O     1 
ATOM   1540 C  CB    . ASP A 1 208 ? 16.012  -2.783  -3.595  1.00 19.98  ? 314 ASP A CB    1 
ATOM   1541 C  CG    . ASP A 1 208 ? 15.158  -2.716  -4.897  1.00 19.69  ? 314 ASP A CG    1 
ATOM   1542 O  OD1   . ASP A 1 208 ? 14.956  -3.778  -5.535  1.00 19.49  ? 314 ASP A OD1   1 
ATOM   1543 O  OD2   . ASP A 1 208 ? 14.600  -1.630  -5.226  1.00 18.17  ? 314 ASP A OD2   1 
ATOM   1544 N  N     . TYR A 1 209 ? 15.286  -5.573  -2.571  1.00 20.87  ? 315 TYR A N     1 
ATOM   1545 C  CA    . TYR A 1 209 ? 14.669  -6.866  -2.895  1.00 20.91  ? 315 TYR A CA    1 
ATOM   1546 C  C     . TYR A 1 209 ? 13.638  -7.313  -1.877  1.00 21.42  ? 315 TYR A C     1 
ATOM   1547 O  O     . TYR A 1 209 ? 12.675  -7.934  -2.298  1.00 21.14  ? 315 TYR A O     1 
ATOM   1548 C  CB    . TYR A 1 209 ? 15.714  -7.993  -3.248  1.00 21.97  ? 315 TYR A CB    1 
ATOM   1549 C  CG    . TYR A 1 209 ? 16.393  -8.798  -2.136  1.00 21.92  ? 315 TYR A CG    1 
ATOM   1550 C  CD1   . TYR A 1 209 ? 15.675  -9.666  -1.355  1.00 22.16  ? 315 TYR A CD1   1 
ATOM   1551 C  CD2   . TYR A 1 209 ? 17.801  -8.731  -1.955  1.00 22.11  ? 315 TYR A CD2   1 
ATOM   1552 C  CE1   . TYR A 1 209 ? 16.298  -10.408 -0.332  1.00 22.39  ? 315 TYR A CE1   1 
ATOM   1553 C  CE2   . TYR A 1 209 ? 18.469  -9.502  -1.017  1.00 21.90  ? 315 TYR A CE2   1 
ATOM   1554 C  CZ    . TYR A 1 209 ? 17.715  -10.293 -0.175  1.00 22.64  ? 315 TYR A CZ    1 
ATOM   1555 O  OH    . TYR A 1 209 ? 18.337  -10.971 0.840   1.00 23.60  ? 315 TYR A OH    1 
ATOM   1556 N  N     . PHE A 1 210 ? 13.795  -7.005  -0.575  1.00 22.03  ? 316 PHE A N     1 
ATOM   1557 C  CA    . PHE A 1 210 ? 12.734  -7.264  0.366   1.00 22.96  ? 316 PHE A CA    1 
ATOM   1558 C  C     . PHE A 1 210 ? 11.423  -6.637  -0.081  1.00 22.76  ? 316 PHE A C     1 
ATOM   1559 O  O     . PHE A 1 210 ? 10.355  -7.335  -0.167  1.00 22.90  ? 316 PHE A O     1 
ATOM   1560 C  CB    . PHE A 1 210 ? 12.981  -6.718  1.790   1.00 25.18  ? 316 PHE A CB    1 
ATOM   1561 C  CG    . PHE A 1 210 ? 14.130  -7.364  2.585   1.00 25.73  ? 316 PHE A CG    1 
ATOM   1562 C  CD1   . PHE A 1 210 ? 14.769  -8.511  2.165   1.00 25.58  ? 316 PHE A CD1   1 
ATOM   1563 C  CD2   . PHE A 1 210 ? 14.553  -6.787  3.772   1.00 28.45  ? 316 PHE A CD2   1 
ATOM   1564 C  CE1   . PHE A 1 210 ? 15.782  -9.073  2.849   1.00 25.32  ? 316 PHE A CE1   1 
ATOM   1565 C  CE2   . PHE A 1 210 ? 15.611  -7.384  4.507   1.00 28.63  ? 316 PHE A CE2   1 
ATOM   1566 C  CZ    . PHE A 1 210 ? 16.243  -8.529  4.004   1.00 27.81  ? 316 PHE A CZ    1 
ATOM   1567 N  N     . ALA A 1 211 ? 11.469  -5.348  -0.369  1.00 21.54  ? 317 ALA A N     1 
ATOM   1568 C  CA    . ALA A 1 211 ? 10.210  -4.668  -0.758  1.00 20.39  ? 317 ALA A CA    1 
ATOM   1569 C  C     . ALA A 1 211 ? 9.690   -5.162  -2.125  1.00 20.01  ? 317 ALA A C     1 
ATOM   1570 O  O     . ALA A 1 211 ? 8.432   -5.330  -2.353  1.00 19.17  ? 317 ALA A O     1 
ATOM   1571 C  CB    . ALA A 1 211 ? 10.403  -3.169  -0.786  1.00 20.03  ? 317 ALA A CB    1 
ATOM   1572 N  N     . ARG A 1 212 ? 10.628  -5.431  -3.035  1.00 19.26  ? 318 ARG A N     1 
ATOM   1573 C  CA    . ARG A 1 212 ? 10.223  -5.669  -4.474  1.00 18.35  ? 318 ARG A CA    1 
ATOM   1574 C  C     . ARG A 1 212 ? 9.691   -7.109  -4.610  1.00 18.09  ? 318 ARG A C     1 
ATOM   1575 O  O     . ARG A 1 212 ? 8.617   -7.338  -5.184  1.00 18.95  ? 318 ARG A O     1 
ATOM   1576 C  CB    . ARG A 1 212 ? 11.382  -5.384  -5.394  1.00 18.38  ? 318 ARG A CB    1 
ATOM   1577 C  CG    . ARG A 1 212 ? 10.982  -5.425  -6.869  1.00 18.64  ? 318 ARG A CG    1 
ATOM   1578 C  CD    . ARG A 1 212 ? 12.161  -4.975  -7.800  1.00 19.58  ? 318 ARG A CD    1 
ATOM   1579 N  NE    . ARG A 1 212 ? 12.777  -3.683  -7.415  1.00 20.12  ? 318 ARG A NE    1 
ATOM   1580 C  CZ    . ARG A 1 212 ? 12.255  -2.489  -7.730  1.00 20.29  ? 318 ARG A CZ    1 
ATOM   1581 N  NH1   . ARG A 1 212 ? 12.773  -1.349  -7.264  1.00 20.40  ? 318 ARG A NH1   1 
ATOM   1582 N  NH2   . ARG A 1 212 ? 11.214  -2.425  -8.506  1.00 20.88  ? 318 ARG A NH2   1 
ATOM   1583 N  N     . ASP A 1 213 ? 10.421  -8.049  -4.042  1.00 17.58  ? 319 ASP A N     1 
ATOM   1584 C  CA    . ASP A 1 213 ? 9.982   -9.428  -3.995  1.00 17.77  ? 319 ASP A CA    1 
ATOM   1585 C  C     . ASP A 1 213 ? 8.657   -9.590  -3.272  1.00 18.06  ? 319 ASP A C     1 
ATOM   1586 O  O     . ASP A 1 213 ? 7.785   -10.254 -3.805  1.00 19.16  ? 319 ASP A O     1 
ATOM   1587 C  CB    . ASP A 1 213 ? 10.967  -10.409 -3.372  1.00 17.49  ? 319 ASP A CB    1 
ATOM   1588 C  CG    . ASP A 1 213 ? 12.325  -10.473 -4.084  1.00 17.45  ? 319 ASP A CG    1 
ATOM   1589 O  OD1   . ASP A 1 213 ? 12.388  -10.163 -5.271  1.00 19.18  ? 319 ASP A OD1   1 
ATOM   1590 O  OD2   . ASP A 1 213 ? 13.334  -10.903 -3.444  1.00 18.28  ? 319 ASP A OD2   1 
ATOM   1591 N  N     . CYS A 1 214 ? 8.453   -8.922  -2.142  1.00 19.20  ? 320 CYS A N     1 
ATOM   1592 C  CA    . CYS A 1 214 ? 7.160   -9.003  -1.400  1.00 19.06  ? 320 CYS A CA    1 
ATOM   1593 C  C     . CYS A 1 214 ? 5.978   -8.499  -2.233  1.00 19.05  ? 320 CYS A C     1 
ATOM   1594 O  O     . CYS A 1 214 ? 4.927   -9.206  -2.392  1.00 18.87  ? 320 CYS A O     1 
ATOM   1595 C  CB    . CYS A 1 214 ? 7.269   -8.288  -0.073  1.00 19.73  ? 320 CYS A CB    1 
ATOM   1596 S  SG    . CYS A 1 214 ? 8.115   -9.330  1.182   1.00 22.64  ? 320 CYS A SG    1 
ATOM   1597 N  N     . HIS A 1 215 ? 6.153   -7.345  -2.862  1.00 19.33  ? 321 HIS A N     1 
ATOM   1598 C  CA    . HIS A 1 215 ? 5.136   -6.804  -3.834  1.00 20.22  ? 321 HIS A CA    1 
ATOM   1599 C  C     . HIS A 1 215 ? 4.719   -7.841  -4.884  1.00 20.74  ? 321 HIS A C     1 
ATOM   1600 O  O     . HIS A 1 215 ? 3.522   -7.904  -5.231  1.00 19.59  ? 321 HIS A O     1 
ATOM   1601 C  CB    . HIS A 1 215 ? 5.702   -5.549  -4.555  1.00 21.10  ? 321 HIS A CB    1 
ATOM   1602 C  CG    . HIS A 1 215 ? 4.734   -4.797  -5.416  1.00 21.20  ? 321 HIS A CG    1 
ATOM   1603 N  ND1   . HIS A 1 215 ? 3.832   -3.878  -4.901  1.00 20.71  ? 321 HIS A ND1   1 
ATOM   1604 C  CD2   . HIS A 1 215 ? 4.610   -4.731  -6.772  1.00 21.96  ? 321 HIS A CD2   1 
ATOM   1605 C  CE1   . HIS A 1 215 ? 3.156   -3.320  -5.901  1.00 21.47  ? 321 HIS A CE1   1 
ATOM   1606 N  NE2   . HIS A 1 215 ? 3.592   -3.829  -7.048  1.00 21.35  ? 321 HIS A NE2   1 
ATOM   1607 N  N     . HIS A 1 216 ? 5.646   -8.649  -5.376  1.00 21.85  ? 322 HIS A N     1 
ATOM   1608 C  CA    . HIS A 1 216 ? 5.328   -9.584  -6.506  1.00 24.32  ? 322 HIS A CA    1 
ATOM   1609 C  C     . HIS A 1 216 ? 4.905   -10.985 -6.043  1.00 26.00  ? 322 HIS A C     1 
ATOM   1610 O  O     . HIS A 1 216 ? 4.109   -11.672 -6.718  1.00 25.57  ? 322 HIS A O     1 
ATOM   1611 C  CB    . HIS A 1 216 ? 6.510   -9.690  -7.484  1.00 24.83  ? 322 HIS A CB    1 
ATOM   1612 C  CG    . HIS A 1 216 ? 6.690   -8.461  -8.321  1.00 26.95  ? 322 HIS A CG    1 
ATOM   1613 N  ND1   . HIS A 1 216 ? 7.443   -7.375  -7.909  1.00 28.33  ? 322 HIS A ND1   1 
ATOM   1614 C  CD2   . HIS A 1 216 ? 6.175   -8.123  -9.523  1.00 27.34  ? 322 HIS A CD2   1 
ATOM   1615 C  CE1   . HIS A 1 216 ? 7.345   -6.417  -8.812  1.00 28.20  ? 322 HIS A CE1   1 
ATOM   1616 N  NE2   . HIS A 1 216 ? 6.571   -6.835  -9.786  1.00 29.12  ? 322 HIS A NE2   1 
ATOM   1617 N  N     . LEU A 1 217 ? 5.480   -11.429 -4.916  1.00 26.84  ? 323 LEU A N     1 
ATOM   1618 C  CA    . LEU A 1 217 ? 5.191   -12.719 -4.376  1.00 26.74  ? 323 LEU A CA    1 
ATOM   1619 C  C     . LEU A 1 217 ? 3.804   -12.800 -3.798  1.00 26.95  ? 323 LEU A C     1 
ATOM   1620 O  O     . LEU A 1 217 ? 3.222   -13.892 -3.789  1.00 30.10  ? 323 LEU A O     1 
ATOM   1621 C  CB    . LEU A 1 217 ? 6.163   -13.067 -3.268  1.00 26.97  ? 323 LEU A CB    1 
ATOM   1622 C  CG    . LEU A 1 217 ? 7.570   -13.404 -3.675  1.00 27.08  ? 323 LEU A CG    1 
ATOM   1623 C  CD1   . LEU A 1 217 ? 8.491   -13.301 -2.413  1.00 26.14  ? 323 LEU A CD1   1 
ATOM   1624 C  CD2   . LEU A 1 217 ? 7.633   -14.745 -4.420  1.00 26.96  ? 323 LEU A CD2   1 
ATOM   1625 N  N     . GLY A 1 218 ? 3.300   -11.713 -3.246  1.00 27.21  ? 324 GLY A N     1 
ATOM   1626 C  CA    . GLY A 1 218 ? 2.047   -11.794 -2.475  1.00 27.74  ? 324 GLY A CA    1 
ATOM   1627 C  C     . GLY A 1 218 ? 2.210   -12.096 -0.992  1.00 28.85  ? 324 GLY A C     1 
ATOM   1628 O  O     . GLY A 1 218 ? 1.307   -12.611 -0.405  1.00 28.88  ? 324 GLY A O     1 
ATOM   1629 N  N     . ILE A 1 219 ? 3.346   -11.734 -0.411  1.00 29.19  ? 325 ILE A N     1 
ATOM   1630 C  CA    . ILE A 1 219 ? 3.688   -11.913 0.964   1.00 28.88  ? 325 ILE A CA    1 
ATOM   1631 C  C     . ILE A 1 219 ? 4.167   -10.540 1.328   1.00 31.44  ? 325 ILE A C     1 
ATOM   1632 O  O     . ILE A 1 219 ? 4.889   -9.911  0.560   1.00 29.71  ? 325 ILE A O     1 
ATOM   1633 C  CB    . ILE A 1 219 ? 4.933   -12.745 1.132   1.00 30.02  ? 325 ILE A CB    1 
ATOM   1634 C  CG1   . ILE A 1 219 ? 4.678   -14.215 0.808   1.00 30.16  ? 325 ILE A CG1   1 
ATOM   1635 C  CG2   . ILE A 1 219 ? 5.547   -12.561 2.549   1.00 32.56  ? 325 ILE A CG2   1 
ATOM   1636 C  CD1   . ILE A 1 219 ? 6.004   -14.986 0.686   1.00 29.85  ? 325 ILE A CD1   1 
ATOM   1637 N  N     . GLN A 1 220 ? 3.835   -10.111 2.541   1.00 36.22  ? 326 GLN A N     1 
ATOM   1638 C  CA    . GLN A 1 220 ? 3.977   -8.760  2.923   1.00 38.32  ? 326 GLN A CA    1 
ATOM   1639 C  C     . GLN A 1 220 ? 5.249   -8.499  3.748   1.00 37.39  ? 326 GLN A C     1 
ATOM   1640 O  O     . GLN A 1 220 ? 5.767   -9.344  4.561   1.00 31.38  ? 326 GLN A O     1 
ATOM   1641 C  CB    . GLN A 1 220 ? 2.759   -8.411  3.636   1.00 45.44  ? 326 GLN A CB    1 
ATOM   1642 C  CG    . GLN A 1 220 ? 2.594   -6.962  3.973   1.00 53.98  ? 326 GLN A CG    1 
ATOM   1643 C  CD    . GLN A 1 220 ? 1.141   -6.515  4.232   1.00 63.28  ? 326 GLN A CD    1 
ATOM   1644 O  OE1   . GLN A 1 220 ? 0.852   -6.020  5.325   1.00 73.99  ? 326 GLN A OE1   1 
ATOM   1645 N  NE2   . GLN A 1 220 ? 0.227   -6.644  3.224   1.00 64.32  ? 326 GLN A NE2   1 
ATOM   1646 N  N     . ASN A 1 221 ? 5.817   -7.320  3.437   1.00 36.83  ? 327 ASN A N     1 
ATOM   1647 C  CA    . ASN A 1 221 ? 7.123   -6.962  4.030   1.00 38.16  ? 327 ASN A CA    1 
ATOM   1648 C  C     . ASN A 1 221 ? 7.004   -6.373  5.443   1.00 35.68  ? 327 ASN A C     1 
ATOM   1649 O  O     . ASN A 1 221 ? 6.186   -5.540  5.644   1.00 32.81  ? 327 ASN A O     1 
ATOM   1650 C  CB    . ASN A 1 221 ? 7.873   -5.957  3.101   1.00 36.57  ? 327 ASN A CB    1 
ATOM   1651 C  CG    . ASN A 1 221 ? 9.355   -5.711  3.568   1.00 35.29  ? 327 ASN A CG    1 
ATOM   1652 O  OD1   . ASN A 1 221 ? 9.900   -6.536  4.464   1.00 31.22  ? 327 ASN A OD1   1 
ATOM   1653 N  ND2   . ASN A 1 221 ? 9.993   -4.577  3.047   1.00 26.33  ? 327 ASN A ND2   1 
ATOM   1654 N  N     . ASN A 1 222 ? 7.827   -6.749  6.406   1.00 39.82  ? 328 ASN A N     1 
ATOM   1655 C  CA    . ASN A 1 222 ? 7.719   -6.155  7.732   1.00 36.95  ? 328 ASN A CA    1 
ATOM   1656 C  C     . ASN A 1 222 ? 8.968   -5.347  8.207   1.00 31.79  ? 328 ASN A C     1 
ATOM   1657 O  O     . ASN A 1 222 ? 9.064   -4.977  9.364   1.00 34.66  ? 328 ASN A O     1 
ATOM   1658 C  CB    . ASN A 1 222 ? 7.275   -7.264  8.655   1.00 45.13  ? 328 ASN A CB    1 
ATOM   1659 C  CG    . ASN A 1 222 ? 8.432   -8.188  9.023   1.00 53.73  ? 328 ASN A CG    1 
ATOM   1660 O  OD1   . ASN A 1 222 ? 9.112   -7.858  10.045  1.00 59.91  ? 328 ASN A OD1   1 
ATOM   1661 N  ND2   . ASN A 1 222 ? 8.723   -9.296  8.182   1.00 42.11  ? 328 ASN A ND2   1 
ATOM   1662 N  N     . PHE A 1 223 ? 9.856   -4.970  7.320   1.00 28.15  ? 329 PHE A N     1 
ATOM   1663 C  CA    . PHE A 1 223 ? 11.052  -4.193  7.623   1.00 26.90  ? 329 PHE A CA    1 
ATOM   1664 C  C     . PHE A 1 223 ? 10.893  -2.769  7.108   1.00 26.02  ? 329 PHE A C     1 
ATOM   1665 O  O     . PHE A 1 223 ? 10.389  -2.565  5.986   1.00 27.01  ? 329 PHE A O     1 
ATOM   1666 C  CB    . PHE A 1 223 ? 12.282  -4.825  6.965   1.00 26.82  ? 329 PHE A CB    1 
ATOM   1667 C  CG    . PHE A 1 223 ? 13.517  -4.016  7.175   1.00 27.53  ? 329 PHE A CG    1 
ATOM   1668 C  CD1   . PHE A 1 223 ? 14.047  -3.860  8.457   1.00 28.04  ? 329 PHE A CD1   1 
ATOM   1669 C  CD2   . PHE A 1 223 ? 14.097  -3.331  6.138   1.00 27.15  ? 329 PHE A CD2   1 
ATOM   1670 C  CE1   . PHE A 1 223 ? 15.171  -3.062  8.675   1.00 26.63  ? 329 PHE A CE1   1 
ATOM   1671 C  CE2   . PHE A 1 223 ? 15.207  -2.496  6.373   1.00 26.24  ? 329 PHE A CE2   1 
ATOM   1672 C  CZ    . PHE A 1 223 ? 15.746  -2.399  7.637   1.00 26.20  ? 329 PHE A CZ    1 
ATOM   1673 N  N     . ASP A 1 224 ? 11.335  -1.762  7.844   1.00 24.22  ? 330 ASP A N     1 
ATOM   1674 C  CA    . ASP A 1 224 ? 11.155  -0.373  7.398   1.00 24.40  ? 330 ASP A CA    1 
ATOM   1675 C  C     . ASP A 1 224 ? 12.479  0.354   7.110   1.00 24.41  ? 330 ASP A C     1 
ATOM   1676 O  O     . ASP A 1 224 ? 13.069  0.896   8.005   1.00 24.35  ? 330 ASP A O     1 
ATOM   1677 C  CB    . ASP A 1 224 ? 10.294  0.368   8.413   1.00 23.90  ? 330 ASP A CB    1 
ATOM   1678 C  CG    . ASP A 1 224 ? 9.931   1.818   7.988   1.00 24.40  ? 330 ASP A CG    1 
ATOM   1679 O  OD1   . ASP A 1 224 ? 10.604  2.445   7.147   1.00 24.09  ? 330 ASP A OD1   1 
ATOM   1680 O  OD2   . ASP A 1 224 ? 8.979   2.353   8.592   1.00 26.25  ? 330 ASP A OD2   1 
ATOM   1681 N  N     . TYR A 1 225 ? 12.923  0.375   5.858   1.00 25.18  ? 331 TYR A N     1 
ATOM   1682 C  CA    . TYR A 1 225 ? 14.262  0.889   5.537   1.00 26.21  ? 331 TYR A CA    1 
ATOM   1683 C  C     . TYR A 1 225 ? 14.367  2.389   5.811   1.00 26.41  ? 331 TYR A C     1 
ATOM   1684 O  O     . TYR A 1 225 ? 15.382  2.891   6.211   1.00 28.06  ? 331 TYR A O     1 
ATOM   1685 C  CB    . TYR A 1 225 ? 14.667  0.490   4.094   1.00 27.53  ? 331 TYR A CB    1 
ATOM   1686 C  CG    . TYR A 1 225 ? 14.261  1.455   3.012   1.00 27.97  ? 331 TYR A CG    1 
ATOM   1687 C  CD1   . TYR A 1 225 ? 14.984  2.691   2.812   1.00 28.49  ? 331 TYR A CD1   1 
ATOM   1688 C  CD2   . TYR A 1 225 ? 13.136  1.193   2.211   1.00 27.92  ? 331 TYR A CD2   1 
ATOM   1689 C  CE1   . TYR A 1 225 ? 14.579  3.618   1.850   1.00 28.24  ? 331 TYR A CE1   1 
ATOM   1690 C  CE2   . TYR A 1 225 ? 12.695  2.101   1.245   1.00 26.83  ? 331 TYR A CE2   1 
ATOM   1691 C  CZ    . TYR A 1 225 ? 13.419  3.294   1.052   1.00 29.01  ? 331 TYR A CZ    1 
ATOM   1692 O  OH    . TYR A 1 225 ? 12.991  4.198   0.128   1.00 27.98  ? 331 TYR A OH    1 
ATOM   1693 N  N     . LYS A 1 226 ? 13.300  3.113   5.582   1.00 27.64  ? 332 LYS A N     1 
ATOM   1694 C  CA    . LYS A 1 226 ? 13.307  4.578   5.739   1.00 26.36  ? 332 LYS A CA    1 
ATOM   1695 C  C     . LYS A 1 226 ? 13.550  4.990   7.159   1.00 26.89  ? 332 LYS A C     1 
ATOM   1696 O  O     . LYS A 1 226 ? 14.244  6.021   7.427   1.00 26.62  ? 332 LYS A O     1 
ATOM   1697 C  CB    . LYS A 1 226 ? 11.991  5.201   5.308   1.00 25.84  ? 332 LYS A CB    1 
ATOM   1698 C  CG    . LYS A 1 226 ? 11.840  5.164   3.834   1.00 28.59  ? 332 LYS A CG    1 
ATOM   1699 C  CD    . LYS A 1 226 ? 10.674  5.977   3.391   1.00 30.15  ? 332 LYS A CD    1 
ATOM   1700 C  CE    . LYS A 1 226 ? 10.386  5.579   1.985   1.00 31.70  ? 332 LYS A CE    1 
ATOM   1701 N  NZ    . LYS A 1 226 ? 9.400   6.547   1.418   1.00 35.18  ? 332 LYS A NZ    1 
ATOM   1702 N  N     . ARG A 1 227 ? 12.980  4.211   8.065   1.00 26.57  ? 333 ARG A N     1 
ATOM   1703 C  CA    . ARG A 1 227 ? 13.297  4.416   9.465   1.00 27.49  ? 333 ARG A CA    1 
ATOM   1704 C  C     . ARG A 1 227 ? 14.829  4.280   9.735   1.00 28.54  ? 333 ARG A C     1 
ATOM   1705 O  O     . ARG A 1 227 ? 15.477  5.154   10.458  1.00 26.44  ? 333 ARG A O     1 
ATOM   1706 C  CB    . ARG A 1 227 ? 12.446  3.453   10.322  1.00 27.76  ? 333 ARG A CB    1 
ATOM   1707 C  CG    . ARG A 1 227 ? 12.633  3.651   11.808  1.00 26.72  ? 333 ARG A CG    1 
ATOM   1708 C  CD    . ARG A 1 227 ? 11.844  2.629   12.674  1.00 26.41  ? 333 ARG A CD    1 
ATOM   1709 N  NE    . ARG A 1 227 ? 12.261  2.847   14.083  1.00 26.44  ? 333 ARG A NE    1 
ATOM   1710 C  CZ    . ARG A 1 227 ? 11.799  3.781   14.893  1.00 26.25  ? 333 ARG A CZ    1 
ATOM   1711 N  NH1   . ARG A 1 227 ? 10.775  4.561   14.553  1.00 27.86  ? 333 ARG A NH1   1 
ATOM   1712 N  NH2   . ARG A 1 227 ? 12.346  3.939   16.080  1.00 27.00  ? 333 ARG A NH2   1 
ATOM   1713 N  N     . PHE A 1 228 ? 15.429  3.211   9.172   1.00 28.17  ? 334 PHE A N     1 
ATOM   1714 C  CA    . PHE A 1 228 ? 16.846  2.915   9.475   1.00 27.43  ? 334 PHE A CA    1 
ATOM   1715 C  C     . PHE A 1 228 ? 17.663  4.101   8.998   1.00 27.62  ? 334 PHE A C     1 
ATOM   1716 O  O     . PHE A 1 228 ? 18.582  4.579   9.676   1.00 25.96  ? 334 PHE A O     1 
ATOM   1717 C  CB    . PHE A 1 228 ? 17.273  1.618   8.862   1.00 30.01  ? 334 PHE A CB    1 
ATOM   1718 C  CG    . PHE A 1 228 ? 18.730  1.357   8.984   1.00 32.15  ? 334 PHE A CG    1 
ATOM   1719 C  CD1   . PHE A 1 228 ? 19.646  2.010   8.188   1.00 31.62  ? 334 PHE A CD1   1 
ATOM   1720 C  CD2   . PHE A 1 228 ? 19.204  0.521   9.974   1.00 35.28  ? 334 PHE A CD2   1 
ATOM   1721 C  CE1   . PHE A 1 228 ? 21.009  1.844   8.363   1.00 33.45  ? 334 PHE A CE1   1 
ATOM   1722 C  CE2   . PHE A 1 228 ? 20.591  0.280   10.109  1.00 34.14  ? 334 PHE A CE2   1 
ATOM   1723 C  CZ    . PHE A 1 228 ? 21.492  0.957   9.300   1.00 34.06  ? 334 PHE A CZ    1 
ATOM   1724 N  N     . ILE A 1 229 ? 17.285  4.669   7.861   1.00 30.39  ? 335 ILE A N     1 
ATOM   1725 C  CA    . ILE A 1 229 ? 18.073  5.816   7.292   1.00 31.22  ? 335 ILE A CA    1 
ATOM   1726 C  C     . ILE A 1 229 ? 17.928  7.037   8.193   1.00 31.80  ? 335 ILE A C     1 
ATOM   1727 O  O     . ILE A 1 229 ? 18.869  7.757   8.361   1.00 34.43  ? 335 ILE A O     1 
ATOM   1728 C  CB    . ILE A 1 229 ? 17.626  6.206   5.894   1.00 29.08  ? 335 ILE A CB    1 
ATOM   1729 C  CG1   . ILE A 1 229 ? 18.013  5.138   4.946   1.00 29.60  ? 335 ILE A CG1   1 
ATOM   1730 C  CG2   . ILE A 1 229 ? 18.302  7.489   5.489   1.00 29.77  ? 335 ILE A CG2   1 
ATOM   1731 C  CD1   . ILE A 1 229 ? 17.658  5.368   3.490   1.00 30.16  ? 335 ILE A CD1   1 
ATOM   1732 N  N     . LYS A 1 230 ? 16.765  7.281   8.764   1.00 32.54  ? 336 LYS A N     1 
ATOM   1733 C  CA    . LYS A 1 230 ? 16.669  8.455   9.645   1.00 32.78  ? 336 LYS A CA    1 
ATOM   1734 C  C     . LYS A 1 230 ? 17.610  8.382   10.874  1.00 33.10  ? 336 LYS A C     1 
ATOM   1735 O  O     . LYS A 1 230 ? 18.030  9.435   11.368  1.00 31.73  ? 336 LYS A O     1 
ATOM   1736 C  CB    . LYS A 1 230 ? 15.263  8.645   10.161  1.00 32.79  ? 336 LYS A CB    1 
ATOM   1737 C  CG    . LYS A 1 230 ? 14.251  8.988   9.119   1.00 35.86  ? 336 LYS A CG    1 
ATOM   1738 C  CD    . LYS A 1 230 ? 14.363  10.376  8.565   1.00 38.57  ? 336 LYS A CD    1 
ATOM   1739 C  CE    . LYS A 1 230 ? 13.283  10.541  7.524   1.00 42.05  ? 336 LYS A CE    1 
ATOM   1740 N  NZ    . LYS A 1 230 ? 13.690  11.763  6.766   1.00 43.99  ? 336 LYS A NZ    1 
ATOM   1741 N  N     . PHE A 1 231 ? 17.892  7.166   11.383  1.00 31.45  ? 337 PHE A N     1 
ATOM   1742 C  CA    . PHE A 1 231 ? 18.620  7.037   12.623  1.00 30.69  ? 337 PHE A CA    1 
ATOM   1743 C  C     . PHE A 1 231 ? 20.032  6.434   12.362  1.00 33.20  ? 337 PHE A C     1 
ATOM   1744 O  O     . PHE A 1 231 ? 20.617  5.807   13.279  1.00 37.21  ? 337 PHE A O     1 
ATOM   1745 C  CB    . PHE A 1 231 ? 17.812  6.179   13.573  1.00 29.59  ? 337 PHE A CB    1 
ATOM   1746 C  CG    . PHE A 1 231 ? 16.420  6.725   13.893  1.00 31.37  ? 337 PHE A CG    1 
ATOM   1747 C  CD1   . PHE A 1 231 ? 16.238  8.028   14.431  1.00 33.65  ? 337 PHE A CD1   1 
ATOM   1748 C  CD2   . PHE A 1 231 ? 15.282  5.939   13.750  1.00 31.34  ? 337 PHE A CD2   1 
ATOM   1749 C  CE1   . PHE A 1 231 ? 14.948  8.513   14.779  1.00 32.23  ? 337 PHE A CE1   1 
ATOM   1750 C  CE2   . PHE A 1 231 ? 14.004  6.436   14.079  1.00 32.40  ? 337 PHE A CE2   1 
ATOM   1751 C  CZ    . PHE A 1 231 ? 13.842  7.724   14.585  1.00 32.44  ? 337 PHE A CZ    1 
ATOM   1752 N  N     . ALA A 1 232 ? 20.578  6.607   11.149  1.00 30.21  ? 338 ALA A N     1 
ATOM   1753 C  CA    . ALA A 1 232 ? 21.939  6.148   10.842  1.00 31.44  ? 338 ALA A CA    1 
ATOM   1754 C  C     . ALA A 1 232 ? 22.928  7.261   11.020  1.00 32.80  ? 338 ALA A C     1 
ATOM   1755 O  O     . ALA A 1 232 ? 22.614  8.378   10.786  1.00 32.37  ? 338 ALA A O     1 
ATOM   1756 C  CB    . ALA A 1 232 ? 22.047  5.646   9.401   1.00 30.31  ? 338 ALA A CB    1 
ATOM   1757 N  N     . ARG A 1 233 ? 24.159  6.939   11.365  1.00 35.23  ? 339 ARG A N     1 
ATOM   1758 C  CA    . ARG A 1 233 ? 25.158  7.954   11.596  1.00 36.05  ? 339 ARG A CA    1 
ATOM   1759 C  C     . ARG A 1 233 ? 26.547  7.386   11.483  1.00 36.98  ? 339 ARG A C     1 
ATOM   1760 O  O     . ARG A 1 233 ? 26.760  6.182   11.658  1.00 36.36  ? 339 ARG A O     1 
ATOM   1761 C  CB    . ARG A 1 233 ? 24.947  8.414   12.979  1.00 39.54  ? 339 ARG A CB    1 
ATOM   1762 C  CG    . ARG A 1 233 ? 25.350  9.811   13.186  1.00 42.03  ? 339 ARG A CG    1 
ATOM   1763 C  CD    . ARG A 1 233 ? 25.092  10.188  14.612  1.00 43.56  ? 339 ARG A CD    1 
ATOM   1764 N  NE    . ARG A 1 233 ? 26.118  11.106  15.033  1.00 44.12  ? 339 ARG A NE    1 
ATOM   1765 C  CZ    . ARG A 1 233 ? 26.190  12.367  14.659  1.00 42.48  ? 339 ARG A CZ    1 
ATOM   1766 N  NH1   . ARG A 1 233 ? 27.163  13.112  15.130  1.00 44.59  ? 339 ARG A NH1   1 
ATOM   1767 N  NH2   . ARG A 1 233 ? 25.237  12.921  13.942  1.00 43.31  ? 339 ARG A NH2   1 
ATOM   1768 N  N     . VAL A 1 234 ? 27.485  8.220   11.066  1.00 39.16  ? 340 VAL A N     1 
ATOM   1769 C  CA    . VAL A 1 234 ? 28.874  7.779   10.942  1.00 40.40  ? 340 VAL A CA    1 
ATOM   1770 C  C     . VAL A 1 234 ? 29.580  8.108   12.245  1.00 38.69  ? 340 VAL A C     1 
ATOM   1771 O  O     . VAL A 1 234 ? 29.546  9.260   12.662  1.00 33.04  ? 340 VAL A O     1 
ATOM   1772 C  CB    . VAL A 1 234 ? 29.606  8.411   9.748   1.00 43.72  ? 340 VAL A CB    1 
ATOM   1773 C  CG1   . VAL A 1 234 ? 31.071  7.977   9.713   1.00 42.68  ? 340 VAL A CG1   1 
ATOM   1774 C  CG2   . VAL A 1 234 ? 28.929  7.952   8.451   1.00 43.08  ? 340 VAL A CG2   1 
ATOM   1775 N  N     . CYS A 1 235 ? 30.198  7.087   12.858  1.00 39.66  ? 341 CYS A N     1 
ATOM   1776 C  CA    . CYS A 1 235 ? 31.102  7.242   14.024  1.00 45.49  ? 341 CYS A CA    1 
ATOM   1777 C  C     . CYS A 1 235 ? 32.475  6.578   13.833  1.00 47.05  ? 341 CYS A C     1 
ATOM   1778 O  O     . CYS A 1 235 ? 32.629  5.644   13.037  1.00 46.71  ? 341 CYS A O     1 
ATOM   1779 C  CB    . CYS A 1 235 ? 30.464  6.665   15.303  1.00 44.50  ? 341 CYS A CB    1 
ATOM   1780 S  SG    . CYS A 1 235 ? 28.855  7.347   15.715  1.00 43.75  ? 341 CYS A SG    1 
ATOM   1781 N  N     . GLU A 1 236 ? 33.463  7.050   14.604  1.00 51.20  ? 342 GLU A N     1 
ATOM   1782 C  CA    . GLU A 1 236 ? 34.775  6.383   14.674  1.00 53.04  ? 342 GLU A CA    1 
ATOM   1783 C  C     . GLU A 1 236 ? 34.649  5.077   15.425  1.00 48.04  ? 342 GLU A C     1 
ATOM   1784 O  O     . GLU A 1 236 ? 34.118  5.060   16.506  1.00 52.16  ? 342 GLU A O     1 
ATOM   1785 C  CB    . GLU A 1 236 ? 35.849  7.282   15.336  1.00 58.56  ? 342 GLU A CB    1 
ATOM   1786 C  CG    . GLU A 1 236 ? 37.241  6.701   15.077  1.00 68.83  ? 342 GLU A CG    1 
ATOM   1787 C  CD    . GLU A 1 236 ? 38.387  7.461   15.665  1.00 75.88  ? 342 GLU A CD    1 
ATOM   1788 O  OE1   . GLU A 1 236 ? 38.236  8.185   16.676  1.00 85.26  ? 342 GLU A OE1   1 
ATOM   1789 O  OE2   . GLU A 1 236 ? 39.479  7.259   15.097  1.00 84.34  ? 342 GLU A OE2   1 
ATOM   1790 N  N     . VAL A 1 237 ? 35.134  4.001   14.848  1.00 47.51  ? 343 VAL A N     1 
ATOM   1791 C  CA    . VAL A 1 237 ? 35.202  2.672   15.480  1.00 50.61  ? 343 VAL A CA    1 
ATOM   1792 C  C     . VAL A 1 237 ? 36.522  2.045   15.010  1.00 53.94  ? 343 VAL A C     1 
ATOM   1793 O  O     . VAL A 1 237 ? 36.733  1.904   13.801  1.00 52.54  ? 343 VAL A O     1 
ATOM   1794 C  CB    . VAL A 1 237 ? 33.984  1.756   15.061  1.00 52.46  ? 343 VAL A CB    1 
ATOM   1795 C  CG1   . VAL A 1 237 ? 34.017  0.400   15.747  1.00 53.41  ? 343 VAL A CG1   1 
ATOM   1796 C  CG2   . VAL A 1 237 ? 32.618  2.403   15.365  1.00 51.15  ? 343 VAL A CG2   1 
ATOM   1797 N  N     . ASP A 1 238 ? 37.410  1.693   15.957  1.00 61.79  ? 344 ASP A N     1 
ATOM   1798 C  CA    . ASP A 1 238 ? 38.793  1.176   15.701  1.00 63.04  ? 344 ASP A CA    1 
ATOM   1799 C  C     . ASP A 1 238 ? 39.508  1.969   14.632  1.00 66.76  ? 344 ASP A C     1 
ATOM   1800 O  O     . ASP A 1 238 ? 39.961  1.359   13.660  1.00 69.45  ? 344 ASP A O     1 
ATOM   1801 C  CB    . ASP A 1 238 ? 38.804  -0.310  15.259  1.00 65.55  ? 344 ASP A CB    1 
ATOM   1802 C  CG    . ASP A 1 238 ? 37.967  -1.211  16.128  1.00 70.67  ? 344 ASP A CG    1 
ATOM   1803 O  OD1   . ASP A 1 238 ? 38.149  -1.173  17.352  1.00 70.40  ? 344 ASP A OD1   1 
ATOM   1804 O  OD2   . ASP A 1 238 ? 37.117  -1.957  15.568  1.00 75.81  ? 344 ASP A OD2   1 
ATOM   1805 N  N     . ASN A 1 239 ? 39.548  3.297   14.769  1.00 71.99  ? 345 ASN A N     1 
ATOM   1806 C  CA    . ASN A 1 239 ? 40.233  4.203   13.794  1.00 76.79  ? 345 ASN A CA    1 
ATOM   1807 C  C     . ASN A 1 239 ? 39.770  4.154   12.332  1.00 72.34  ? 345 ASN A C     1 
ATOM   1808 O  O     . ASN A 1 239 ? 40.506  4.466   11.395  1.00 74.00  ? 345 ASN A O     1 
ATOM   1809 C  CB    . ASN A 1 239 ? 41.754  4.005   13.892  1.00 82.34  ? 345 ASN A CB    1 
ATOM   1810 C  CG    . ASN A 1 239 ? 42.248  4.397   15.256  1.00 89.68  ? 345 ASN A CG    1 
ATOM   1811 O  OD1   . ASN A 1 239 ? 42.249  5.585   15.610  1.00 92.54  ? 345 ASN A OD1   1 
ATOM   1812 N  ND2   . ASN A 1 239 ? 42.642  3.400   16.053  1.00 87.28  ? 345 ASN A ND2   1 
ATOM   1813 N  N     . GLU A 1 240 ? 38.502  3.823   12.175  1.00 67.78  ? 346 GLU A N     1 
ATOM   1814 C  CA    . GLU A 1 240 ? 37.871  3.751   10.879  1.00 62.99  ? 346 GLU A CA    1 
ATOM   1815 C  C     . GLU A 1 240 ? 36.475  4.372   10.991  1.00 57.07  ? 346 GLU A C     1 
ATOM   1816 O  O     . GLU A 1 240 ? 35.764  4.129   11.963  1.00 53.02  ? 346 GLU A O     1 
ATOM   1817 C  CB    . GLU A 1 240 ? 37.802  2.285   10.533  1.00 61.39  ? 346 GLU A CB    1 
ATOM   1818 C  CG    . GLU A 1 240 ? 37.327  1.992   9.138   1.00 62.68  ? 346 GLU A CG    1 
ATOM   1819 C  CD    . GLU A 1 240 ? 37.546  0.556   8.760   1.00 61.23  ? 346 GLU A CD    1 
ATOM   1820 O  OE1   . GLU A 1 240 ? 38.669  0.107   8.950   1.00 64.72  ? 346 GLU A OE1   1 
ATOM   1821 O  OE2   . GLU A 1 240 ? 36.636  -0.115  8.271   1.00 60.75  ? 346 GLU A OE2   1 
ATOM   1822 N  N     . LEU A 1 241 ? 36.088  5.188   10.030  1.00 51.81  ? 347 LEU A N     1 
ATOM   1823 C  CA    . LEU A 1 241 ? 34.732  5.772   10.031  1.00 51.34  ? 347 LEU A CA    1 
ATOM   1824 C  C     . LEU A 1 241 ? 33.702  4.799   9.463   1.00 50.56  ? 347 LEU A C     1 
ATOM   1825 O  O     . LEU A 1 241 ? 33.857  4.322   8.350   1.00 56.19  ? 347 LEU A O     1 
ATOM   1826 C  CB    . LEU A 1 241 ? 34.688  7.078   9.286   1.00 50.35  ? 347 LEU A CB    1 
ATOM   1827 C  CG    . LEU A 1 241 ? 35.641  8.134   9.869   1.00 52.45  ? 347 LEU A CG    1 
ATOM   1828 C  CD1   . LEU A 1 241 ? 35.494  9.416   9.084   1.00 55.43  ? 347 LEU A CD1   1 
ATOM   1829 C  CD2   . LEU A 1 241 ? 35.487  8.455   11.359  1.00 53.71  ? 347 LEU A CD2   1 
ATOM   1830 N  N     . ARG A 1 242 ? 32.658  4.510   10.251  1.00 48.28  ? 348 ARG A N     1 
ATOM   1831 C  CA    . ARG A 1 242 ? 31.679  3.454   9.996   1.00 44.53  ? 348 ARG A CA    1 
ATOM   1832 C  C     . ARG A 1 242 ? 30.215  3.876   10.222  1.00 40.35  ? 348 ARG A C     1 
ATOM   1833 O  O     . ARG A 1 242 ? 29.911  4.780   10.999  1.00 37.29  ? 348 ARG A O     1 
ATOM   1834 C  CB    . ARG A 1 242 ? 31.973  2.320   10.937  1.00 49.71  ? 348 ARG A CB    1 
ATOM   1835 C  CG    . ARG A 1 242 ? 33.327  1.709   10.760  1.00 54.96  ? 348 ARG A CG    1 
ATOM   1836 C  CD    . ARG A 1 242 ? 33.232  0.220   11.041  1.00 60.51  ? 348 ARG A CD    1 
ATOM   1837 N  NE    . ARG A 1 242 ? 34.507  -0.449  10.754  1.00 69.59  ? 348 ARG A NE    1 
ATOM   1838 C  CZ    . ARG A 1 242 ? 35.276  -1.116  11.634  1.00 68.68  ? 348 ARG A CZ    1 
ATOM   1839 N  NH1   . ARG A 1 242 ? 34.920  -1.305  12.904  1.00 65.19  ? 348 ARG A NH1   1 
ATOM   1840 N  NH2   . ARG A 1 242 ? 36.398  -1.682  11.214  1.00 70.59  ? 348 ARG A NH2   1 
ATOM   1841 N  N     . ILE A 1 243 ? 29.297  3.153   9.580   1.00 38.16  ? 349 ILE A N     1 
ATOM   1842 C  CA    . ILE A 1 243 ? 27.881  3.469   9.692   1.00 35.64  ? 349 ILE A CA    1 
ATOM   1843 C  C     . ILE A 1 243 ? 27.401  2.793   10.962  1.00 35.62  ? 349 ILE A C     1 
ATOM   1844 O  O     . ILE A 1 243 ? 27.647  1.634   11.153  1.00 37.61  ? 349 ILE A O     1 
ATOM   1845 C  CB    . ILE A 1 243 ? 27.048  3.009   8.497   1.00 35.32  ? 349 ILE A CB    1 
ATOM   1846 C  CG1   . ILE A 1 243 ? 27.634  3.567   7.190   1.00 36.05  ? 349 ILE A CG1   1 
ATOM   1847 C  CG2   . ILE A 1 243 ? 25.617  3.535   8.632   1.00 36.85  ? 349 ILE A CG2   1 
ATOM   1848 C  CD1   . ILE A 1 243 ? 26.765  3.493   5.925   1.00 35.44  ? 349 ILE A CD1   1 
ATOM   1849 N  N     . CYS A 1 244 ? 26.722  3.551   11.807  1.00 34.08  ? 350 CYS A N     1 
ATOM   1850 C  CA    . CYS A 1 244 ? 26.221  3.101   13.091  1.00 34.74  ? 350 CYS A CA    1 
ATOM   1851 C  C     . CYS A 1 244 ? 24.756  3.461   13.157  1.00 33.92  ? 350 CYS A C     1 
ATOM   1852 O  O     . CYS A 1 244 ? 24.280  4.348   12.434  1.00 34.41  ? 350 CYS A O     1 
ATOM   1853 C  CB    . CYS A 1 244 ? 26.954  3.862   14.212  1.00 37.60  ? 350 CYS A CB    1 
ATOM   1854 S  SG    . CYS A 1 244 ? 28.767  3.618   14.337  1.00 43.71  ? 350 CYS A SG    1 
ATOM   1855 N  N     . ALA A 1 245 ? 24.044  2.808   14.042  1.00 33.22  ? 351 ALA A N     1 
ATOM   1856 C  CA    . ALA A 1 245 ? 22.616  2.986   14.209  1.00 32.66  ? 351 ALA A CA    1 
ATOM   1857 C  C     . ALA A 1 245 ? 22.275  3.422   15.648  1.00 33.15  ? 351 ALA A C     1 
ATOM   1858 O  O     . ALA A 1 245 ? 23.008  3.094   16.585  1.00 32.90  ? 351 ALA A O     1 
ATOM   1859 C  CB    . ALA A 1 245 ? 22.021  1.619   13.956  1.00 32.54  ? 351 ALA A CB    1 
ATOM   1860 N  N     . ARG A 1 246 ? 21.139  4.077   15.832  1.00 31.11  ? 352 ARG A N     1 
ATOM   1861 C  CA    . ARG A 1 246 ? 20.686  4.362   17.166  1.00 30.19  ? 352 ARG A CA    1 
ATOM   1862 C  C     . ARG A 1 246 ? 20.520  3.041   17.931  1.00 29.40  ? 352 ARG A C     1 
ATOM   1863 O  O     . ARG A 1 246 ? 20.009  2.088   17.377  1.00 27.06  ? 352 ARG A O     1 
ATOM   1864 C  CB    . ARG A 1 246 ? 19.340  5.108   17.245  1.00 30.61  ? 352 ARG A CB    1 
ATOM   1865 C  CG    . ARG A 1 246 ? 19.414  6.623   17.404  1.00 31.99  ? 352 ARG A CG    1 
ATOM   1866 C  CD    . ARG A 1 246 ? 19.937  7.129   18.771  1.00 33.37  ? 352 ARG A CD    1 
ATOM   1867 N  NE    . ARG A 1 246 ? 19.154  6.675   19.938  1.00 31.76  ? 352 ARG A NE    1 
ATOM   1868 C  CZ    . ARG A 1 246 ? 18.008  7.183   20.331  1.00 30.40  ? 352 ARG A CZ    1 
ATOM   1869 N  NH1   . ARG A 1 246 ? 17.504  8.236   19.741  1.00 29.63  ? 352 ARG A NH1   1 
ATOM   1870 N  NH2   . ARG A 1 246 ? 17.409  6.702   21.420  1.00 33.32  ? 352 ARG A NH2   1 
ATOM   1871 N  N     . ASP A 1 247 ? 20.949  3.055   19.196  1.00 29.53  ? 353 ASP A N     1 
ATOM   1872 C  CA    . ASP A 1 247 ? 20.708  1.995   20.189  1.00 29.09  ? 353 ASP A CA    1 
ATOM   1873 C  C     . ASP A 1 247 ? 19.311  1.346   20.132  1.00 26.36  ? 353 ASP A C     1 
ATOM   1874 O  O     . ASP A 1 247 ? 19.199  0.132   20.080  1.00 24.12  ? 353 ASP A O     1 
ATOM   1875 C  CB    . ASP A 1 247 ? 21.047  2.514   21.639  1.00 30.77  ? 353 ASP A CB    1 
ATOM   1876 C  CG    . ASP A 1 247 ? 20.330  3.828   22.047  1.00 31.78  ? 353 ASP A CG    1 
ATOM   1877 O  OD1   . ASP A 1 247 ? 19.591  4.476   21.299  1.00 32.43  ? 353 ASP A OD1   1 
ATOM   1878 O  OD2   . ASP A 1 247 ? 20.568  4.282   23.168  1.00 38.15  ? 353 ASP A OD2   1 
ATOM   1879 N  N     . LYS A 1 248 ? 18.269  2.170   20.093  1.00 25.97  ? 354 LYS A N     1 
ATOM   1880 C  CA    . LYS A 1 248 ? 16.883  1.692   20.074  1.00 27.84  ? 354 LYS A CA    1 
ATOM   1881 C  C     . LYS A 1 248 ? 16.499  0.876   18.820  1.00 29.21  ? 354 LYS A C     1 
ATOM   1882 O  O     . LYS A 1 248 ? 15.444  0.211   18.862  1.00 31.04  ? 354 LYS A O     1 
ATOM   1883 C  CB    . LYS A 1 248 ? 15.871  2.867   20.213  1.00 28.37  ? 354 LYS A CB    1 
ATOM   1884 C  CG    . LYS A 1 248 ? 15.925  3.846   19.047  1.00 28.88  ? 354 LYS A CG    1 
ATOM   1885 C  CD    . LYS A 1 248 ? 14.980  5.015   19.171  1.00 29.17  ? 354 LYS A CD    1 
ATOM   1886 C  CE    . LYS A 1 248 ? 15.273  5.957   18.013  1.00 30.10  ? 354 LYS A CE    1 
ATOM   1887 N  NZ    . LYS A 1 248 ? 14.289  7.064   17.846  1.00 30.96  ? 354 LYS A NZ    1 
ATOM   1888 N  N     . GLU A 1 249 ? 17.281  0.929   17.743  1.00 27.79  ? 355 GLU A N     1 
ATOM   1889 C  CA    . GLU A 1 249 ? 17.051  0.096   16.569  1.00 30.39  ? 355 GLU A CA    1 
ATOM   1890 C  C     . GLU A 1 249 ? 17.521  -1.378  16.648  1.00 30.36  ? 355 GLU A C     1 
ATOM   1891 O  O     . GLU A 1 249 ? 17.328  -2.168  15.691  1.00 30.33  ? 355 GLU A O     1 
ATOM   1892 C  CB    . GLU A 1 249 ? 17.815  0.719   15.351  1.00 34.77  ? 355 GLU A CB    1 
ATOM   1893 C  CG    . GLU A 1 249 ? 17.296  2.104   14.946  1.00 39.24  ? 355 GLU A CG    1 
ATOM   1894 C  CD    . GLU A 1 249 ? 15.753  2.049   14.652  1.00 43.89  ? 355 GLU A CD    1 
ATOM   1895 O  OE1   . GLU A 1 249 ? 15.316  1.483   13.573  1.00 50.86  ? 355 GLU A OE1   1 
ATOM   1896 O  OE2   . GLU A 1 249 ? 15.008  2.475   15.561  1.00 45.35  ? 355 GLU A OE2   1 
ATOM   1897 N  N     . VAL A 1 250 ? 18.124  -1.781  17.757  1.00 28.13  ? 356 VAL A N     1 
ATOM   1898 C  CA    . VAL A 1 250 ? 18.665  -3.098  17.813  1.00 26.76  ? 356 VAL A CA    1 
ATOM   1899 C  C     . VAL A 1 250 ? 17.658  -4.218  17.569  1.00 25.39  ? 356 VAL A C     1 
ATOM   1900 O  O     . VAL A 1 250 ? 17.944  -5.160  16.804  1.00 27.81  ? 356 VAL A O     1 
ATOM   1901 C  CB    . VAL A 1 250 ? 19.480  -3.320  19.112  1.00 27.86  ? 356 VAL A CB    1 
ATOM   1902 C  CG1   . VAL A 1 250 ? 18.599  -3.216  20.398  1.00 26.46  ? 356 VAL A CG1   1 
ATOM   1903 C  CG2   . VAL A 1 250 ? 20.234  -4.676  18.986  1.00 28.13  ? 356 VAL A CG2   1 
ATOM   1904 N  N     . GLY A 1 251 ? 16.494  -4.131  18.175  1.00 24.36  ? 357 GLY A N     1 
ATOM   1905 C  CA    . GLY A 1 251 ? 15.389  -5.061  17.932  1.00 24.39  ? 357 GLY A CA    1 
ATOM   1906 C  C     . GLY A 1 251 ? 15.035  -5.049  16.424  1.00 24.92  ? 357 GLY A C     1 
ATOM   1907 O  O     . GLY A 1 251 ? 14.786  -6.098  15.854  1.00 25.30  ? 357 GLY A O     1 
ATOM   1908 N  N     . ASN A 1 252 ? 15.053  -3.896  15.768  1.00 24.56  ? 358 ASN A N     1 
ATOM   1909 C  CA    . ASN A 1 252 ? 14.644  -3.863  14.352  1.00 25.74  ? 358 ASN A CA    1 
ATOM   1910 C  C     . ASN A 1 252 ? 15.671  -4.582  13.476  1.00 25.80  ? 358 ASN A C     1 
ATOM   1911 O  O     . ASN A 1 252 ? 15.286  -5.167  12.481  1.00 26.81  ? 358 ASN A O     1 
ATOM   1912 C  CB    . ASN A 1 252 ? 14.314  -2.444  13.779  1.00 24.85  ? 358 ASN A CB    1 
ATOM   1913 C  CG    . ASN A 1 252 ? 13.183  -1.716  14.557  1.00 24.71  ? 358 ASN A CG    1 
ATOM   1914 O  OD1   . ASN A 1 252 ? 12.181  -2.313  14.956  1.00 23.50  ? 358 ASN A OD1   1 
ATOM   1915 N  ND2   . ASN A 1 252 ? 13.358  -0.378  14.758  1.00 25.28  ? 358 ASN A ND2   1 
ATOM   1916 N  N     . LEU A 1 253 ? 16.939  -4.571  13.847  1.00 25.24  ? 359 LEU A N     1 
ATOM   1917 C  CA    . LEU A 1 253 ? 17.952  -5.282  13.067  1.00 26.26  ? 359 LEU A CA    1 
ATOM   1918 C  C     . LEU A 1 253 ? 17.918  -6.784  13.257  1.00 25.55  ? 359 LEU A C     1 
ATOM   1919 O  O     . LEU A 1 253 ? 18.022  -7.511  12.304  1.00 24.62  ? 359 LEU A O     1 
ATOM   1920 C  CB    . LEU A 1 253 ? 19.343  -4.746  13.360  1.00 28.21  ? 359 LEU A CB    1 
ATOM   1921 C  CG    . LEU A 1 253 ? 19.451  -3.211  13.028  1.00 29.11  ? 359 LEU A CG    1 
ATOM   1922 C  CD1   . LEU A 1 253 ? 20.869  -2.684  13.268  1.00 29.72  ? 359 LEU A CD1   1 
ATOM   1923 C  CD2   . LEU A 1 253 ? 19.055  -2.907  11.566  1.00 30.13  ? 359 LEU A CD2   1 
ATOM   1924 N  N     . TYR A 1 254 ? 17.675  -7.258  14.460  1.00 25.88  ? 360 TYR A N     1 
ATOM   1925 C  CA    . TYR A 1 254 ? 17.408  -8.682  14.608  1.00 27.25  ? 360 TYR A CA    1 
ATOM   1926 C  C     . TYR A 1 254 ? 16.202  -9.097  13.701  1.00 27.26  ? 360 TYR A C     1 
ATOM   1927 O  O     . TYR A 1 254 ? 16.259  -10.111 13.012  1.00 25.73  ? 360 TYR A O     1 
ATOM   1928 C  CB    . TYR A 1 254 ? 17.164  -9.098  16.084  1.00 28.06  ? 360 TYR A CB    1 
ATOM   1929 C  CG    . TYR A 1 254 ? 18.452  -9.381  16.856  1.00 28.89  ? 360 TYR A CG    1 
ATOM   1930 C  CD1   . TYR A 1 254 ? 19.150  -10.593 16.717  1.00 28.70  ? 360 TYR A CD1   1 
ATOM   1931 C  CD2   . TYR A 1 254 ? 19.010  -8.398  17.707  1.00 29.64  ? 360 TYR A CD2   1 
ATOM   1932 C  CE1   . TYR A 1 254 ? 20.348  -10.824 17.394  1.00 30.49  ? 360 TYR A CE1   1 
ATOM   1933 C  CE2   . TYR A 1 254 ? 20.219  -8.634  18.394  1.00 31.51  ? 360 TYR A CE2   1 
ATOM   1934 C  CZ    . TYR A 1 254 ? 20.893  -9.850  18.238  1.00 31.77  ? 360 TYR A CZ    1 
ATOM   1935 O  OH    . TYR A 1 254 ? 22.084  -10.102 18.916  1.00 33.36  ? 360 TYR A OH    1 
ATOM   1936 N  N     . ASP A 1 255 ? 15.135  -8.268  13.705  1.00 26.96  ? 361 ASP A N     1 
ATOM   1937 C  CA    . ASP A 1 255 ? 13.960  -8.553  12.911  1.00 25.91  ? 361 ASP A CA    1 
ATOM   1938 C  C     . ASP A 1 255 ? 14.224  -8.506  11.382  1.00 24.66  ? 361 ASP A C     1 
ATOM   1939 O  O     . ASP A 1 255 ? 13.641  -9.269  10.622  1.00 20.53  ? 361 ASP A O     1 
ATOM   1940 C  CB    . ASP A 1 255 ? 12.879  -7.589  13.258  1.00 26.48  ? 361 ASP A CB    1 
ATOM   1941 C  CG    . ASP A 1 255 ? 12.059  -8.032  14.462  1.00 29.03  ? 361 ASP A CG    1 
ATOM   1942 O  OD1   . ASP A 1 255 ? 12.155  -9.193  14.949  1.00 31.39  ? 361 ASP A OD1   1 
ATOM   1943 O  OD2   . ASP A 1 255 ? 11.222  -7.215  14.914  1.00 31.11  ? 361 ASP A OD2   1 
ATOM   1944 N  N     . MET A 1 256 ? 15.146  -7.641  10.960  1.00 26.02  ? 362 MET A N     1 
ATOM   1945 C  CA    . MET A 1 256 ? 15.541  -7.567  9.547   1.00 27.43  ? 362 MET A CA    1 
ATOM   1946 C  C     . MET A 1 256 ? 16.113  -8.880  9.080   1.00 27.41  ? 362 MET A C     1 
ATOM   1947 O  O     . MET A 1 256 ? 15.777  -9.325  7.983   1.00 29.36  ? 362 MET A O     1 
ATOM   1948 C  CB    . MET A 1 256 ? 16.624  -6.478  9.314   1.00 28.82  ? 362 MET A CB    1 
ATOM   1949 C  CG    . MET A 1 256 ? 16.755  -6.150  7.815   1.00 28.17  ? 362 MET A CG    1 
ATOM   1950 S  SD    . MET A 1 256 ? 18.248  -5.301  7.382   1.00 29.56  ? 362 MET A SD    1 
ATOM   1951 C  CE    . MET A 1 256 ? 19.416  -6.703  7.343   1.00 29.39  ? 362 MET A CE    1 
ATOM   1952 N  N     . PHE A 1 257 ? 16.957  -9.505  9.918   1.00 26.24  ? 363 PHE A N     1 
ATOM   1953 C  CA    . PHE A 1 257 ? 17.572  -10.796 9.549   1.00 25.97  ? 363 PHE A CA    1 
ATOM   1954 C  C     . PHE A 1 257 ? 16.559  -11.955 9.626   1.00 26.42  ? 363 PHE A C     1 
ATOM   1955 O  O     . PHE A 1 257 ? 16.670  -12.955 8.869   1.00 25.73  ? 363 PHE A O     1 
ATOM   1956 C  CB    . PHE A 1 257 ? 18.907  -11.072 10.286  1.00 24.21  ? 363 PHE A CB    1 
ATOM   1957 C  CG    . PHE A 1 257 ? 20.038  -10.260 9.762   1.00 24.66  ? 363 PHE A CG    1 
ATOM   1958 C  CD1   . PHE A 1 257 ? 20.695  -10.612 8.601   1.00 24.73  ? 363 PHE A CD1   1 
ATOM   1959 C  CD2   . PHE A 1 257 ? 20.440  -9.090  10.414  1.00 25.15  ? 363 PHE A CD2   1 
ATOM   1960 C  CE1   . PHE A 1 257 ? 21.743  -9.817  8.092   1.00 24.98  ? 363 PHE A CE1   1 
ATOM   1961 C  CE2   . PHE A 1 257 ? 21.449  -8.298  9.895   1.00 25.25  ? 363 PHE A CE2   1 
ATOM   1962 C  CZ    . PHE A 1 257 ? 22.111  -8.669  8.723   1.00 25.04  ? 363 PHE A CZ    1 
ATOM   1963 N  N     . HIS A 1 258 ? 15.602  -11.820 10.555  1.00 26.70  ? 364 HIS A N     1 
ATOM   1964 C  CA    . HIS A 1 258 ? 14.506  -12.783 10.666  1.00 27.06  ? 364 HIS A CA    1 
ATOM   1965 C  C     . HIS A 1 258 ? 13.676  -12.737 9.401   1.00 25.97  ? 364 HIS A C     1 
ATOM   1966 O  O     . HIS A 1 258 ? 13.329  -13.757 8.895   1.00 26.62  ? 364 HIS A O     1 
ATOM   1967 C  CB    . HIS A 1 258 ? 13.655  -12.529 11.910  1.00 26.49  ? 364 HIS A CB    1 
ATOM   1968 C  CG    . HIS A 1 258 ? 12.473  -13.430 12.023  1.00 26.67  ? 364 HIS A CG    1 
ATOM   1969 N  ND1   . HIS A 1 258 ? 12.427  -14.432 12.933  1.00 28.76  ? 364 HIS A ND1   1 
ATOM   1970 C  CD2   . HIS A 1 258 ? 11.280  -13.464 11.391  1.00 27.18  ? 364 HIS A CD2   1 
ATOM   1971 C  CE1   . HIS A 1 258 ? 11.278  -15.086 12.841  1.00 28.75  ? 364 HIS A CE1   1 
ATOM   1972 N  NE2   . HIS A 1 258 ? 10.575  -14.537 11.884  1.00 25.94  ? 364 HIS A NE2   1 
ATOM   1973 N  N     . THR A 1 259 ? 13.390  -11.545 8.891   1.00 25.73  ? 365 THR A N     1 
ATOM   1974 C  CA    . THR A 1 259 ? 12.641  -11.361 7.618   1.00 25.79  ? 365 THR A CA    1 
ATOM   1975 C  C     . THR A 1 259 ? 13.360  -12.062 6.476   1.00 25.72  ? 365 THR A C     1 
ATOM   1976 O  O     . THR A 1 259 ? 12.761  -12.839 5.712   1.00 28.16  ? 365 THR A O     1 
ATOM   1977 C  CB    . THR A 1 259 ? 12.505  -9.838  7.322   1.00 25.14  ? 365 THR A CB    1 
ATOM   1978 O  OG1   . THR A 1 259 ? 11.642  -9.234  8.286   1.00 24.10  ? 365 THR A OG1   1 
ATOM   1979 C  CG2   . THR A 1 259 ? 11.905  -9.525  5.975   1.00 25.28  ? 365 THR A CG2   1 
ATOM   1980 N  N     . ARG A 1 260 ? 14.647  -11.788 6.349   1.00 24.62  ? 366 ARG A N     1 
ATOM   1981 C  CA    . ARG A 1 260 ? 15.447  -12.428 5.309   1.00 24.68  ? 366 ARG A CA    1 
ATOM   1982 C  C     . ARG A 1 260 ? 15.333  -13.967 5.376   1.00 25.36  ? 366 ARG A C     1 
ATOM   1983 O  O     . ARG A 1 260 ? 15.101  -14.593 4.415   1.00 24.06  ? 366 ARG A O     1 
ATOM   1984 C  CB    . ARG A 1 260 ? 16.889  -11.967 5.413   1.00 23.34  ? 366 ARG A CB    1 
ATOM   1985 C  CG    . ARG A 1 260 ? 17.842  -12.650 4.468   1.00 23.04  ? 366 ARG A CG    1 
ATOM   1986 C  CD    . ARG A 1 260 ? 19.187  -11.969 4.421   1.00 23.22  ? 366 ARG A CD    1 
ATOM   1987 N  NE    . ARG A 1 260 ? 20.186  -12.660 3.619   1.00 23.28  ? 366 ARG A NE    1 
ATOM   1988 C  CZ    . ARG A 1 260 ? 20.752  -13.849 3.872   1.00 25.33  ? 366 ARG A CZ    1 
ATOM   1989 N  NH1   . ARG A 1 260 ? 20.564  -14.549 4.979   1.00 27.85  ? 366 ARG A NH1   1 
ATOM   1990 N  NH2   . ARG A 1 260 ? 21.549  -14.375 2.981   1.00 26.16  ? 366 ARG A NH2   1 
ATOM   1991 N  N     . ASN A 1 261 ? 15.440  -14.538 6.545   1.00 26.78  ? 367 ASN A N     1 
ATOM   1992 C  CA    . ASN A 1 261 ? 15.323  -15.982 6.681   1.00 29.08  ? 367 ASN A CA    1 
ATOM   1993 C  C     . ASN A 1 261 ? 13.919  -16.525 6.338   1.00 28.17  ? 367 ASN A C     1 
ATOM   1994 O  O     . ASN A 1 261 ? 13.760  -17.565 5.675   1.00 30.09  ? 367 ASN A O     1 
ATOM   1995 C  CB    . ASN A 1 261 ? 15.706  -16.392 8.101   1.00 29.91  ? 367 ASN A CB    1 
ATOM   1996 C  CG    . ASN A 1 261 ? 15.779  -17.912 8.266   1.00 32.32  ? 367 ASN A CG    1 
ATOM   1997 O  OD1   . ASN A 1 261 ? 16.706  -18.578 7.757   1.00 35.91  ? 367 ASN A OD1   1 
ATOM   1998 N  ND2   . ASN A 1 261 ? 14.798  -18.479 8.995   1.00 32.21  ? 367 ASN A ND2   1 
ATOM   1999 N  N     . SER A 1 262 ? 12.915  -15.836 6.818   1.00 26.74  ? 368 SER A N     1 
ATOM   2000 C  CA    . SER A 1 262 ? 11.513  -16.078 6.415   1.00 27.70  ? 368 SER A CA    1 
ATOM   2001 C  C     . SER A 1 262 ? 11.244  -16.087 4.895   1.00 25.95  ? 368 SER A C     1 
ATOM   2002 O  O     . SER A 1 262 ? 10.475  -16.882 4.363   1.00 25.32  ? 368 SER A O     1 
ATOM   2003 C  CB    . SER A 1 262 ? 10.681  -14.919 6.900   1.00 27.94  ? 368 SER A CB    1 
ATOM   2004 O  OG    . SER A 1 262 ? 9.656   -15.447 7.605   1.00 34.03  ? 368 SER A OG    1 
ATOM   2005 N  N     . LEU A 1 263 ? 11.816  -15.111 4.201   1.00 26.02  ? 369 LEU A N     1 
ATOM   2006 C  CA    . LEU A 1 263 ? 11.652  -15.050 2.755   1.00 25.19  ? 369 LEU A CA    1 
ATOM   2007 C  C     . LEU A 1 263 ? 12.401  -16.257 2.063   1.00 25.09  ? 369 LEU A C     1 
ATOM   2008 O  O     . LEU A 1 263 ? 11.912  -16.829 1.089   1.00 23.64  ? 369 LEU A O     1 
ATOM   2009 C  CB    . LEU A 1 263 ? 12.092  -13.741 2.231   1.00 25.42  ? 369 LEU A CB    1 
ATOM   2010 C  CG    . LEU A 1 263 ? 11.276  -12.491 2.564   1.00 26.03  ? 369 LEU A CG    1 
ATOM   2011 C  CD1   . LEU A 1 263 ? 12.031  -11.165 2.300   1.00 25.87  ? 369 LEU A CD1   1 
ATOM   2012 C  CD2   . LEU A 1 263 ? 10.012  -12.481 1.766   1.00 27.67  ? 369 LEU A CD2   1 
ATOM   2013 N  N     . HIS A 1 264 ? 13.530  -16.674 2.580   1.00 24.34  ? 370 HIS A N     1 
ATOM   2014 C  CA    . HIS A 1 264 ? 14.141  -17.907 2.019   1.00 25.91  ? 370 HIS A CA    1 
ATOM   2015 C  C     . HIS A 1 264 ? 13.262  -19.129 2.289   1.00 26.18  ? 370 HIS A C     1 
ATOM   2016 O  O     . HIS A 1 264 ? 13.099  -19.999 1.404   1.00 23.53  ? 370 HIS A O     1 
ATOM   2017 C  CB    . HIS A 1 264 ? 15.586  -18.114 2.560   1.00 26.04  ? 370 HIS A CB    1 
ATOM   2018 C  CG    . HIS A 1 264 ? 16.614  -17.308 1.834   1.00 26.27  ? 370 HIS A CG    1 
ATOM   2019 N  ND1   . HIS A 1 264 ? 17.308  -17.807 0.721   1.00 25.34  ? 370 HIS A ND1   1 
ATOM   2020 C  CD2   . HIS A 1 264 ? 17.018  -16.029 1.996   1.00 25.32  ? 370 HIS A CD2   1 
ATOM   2021 C  CE1   . HIS A 1 264 ? 18.153  -16.894 0.286   1.00 24.90  ? 370 HIS A CE1   1 
ATOM   2022 N  NE2   . HIS A 1 264 ? 18.018  -15.820 1.058   1.00 27.21  ? 370 HIS A NE2   1 
ATOM   2023 N  N     . ARG A 1 265 ? 12.700  -19.221 3.502   1.00 26.35  ? 371 ARG A N     1 
ATOM   2024 C  CA    . ARG A 1 265 ? 11.855  -20.387 3.838   1.00 28.44  ? 371 ARG A CA    1 
ATOM   2025 C  C     . ARG A 1 265 ? 10.608  -20.458 3.023   1.00 28.29  ? 371 ARG A C     1 
ATOM   2026 O  O     . ARG A 1 265 ? 10.274  -21.480 2.525   1.00 27.27  ? 371 ARG A O     1 
ATOM   2027 C  CB    . ARG A 1 265 ? 11.393  -20.359 5.287   1.00 31.92  ? 371 ARG A CB    1 
ATOM   2028 C  CG    . ARG A 1 265 ? 12.479  -20.727 6.298   1.00 35.88  ? 371 ARG A CG    1 
ATOM   2029 C  CD    . ARG A 1 265 ? 12.834  -22.216 6.240   1.00 38.27  ? 371 ARG A CD    1 
ATOM   2030 N  NE    . ARG A 1 265 ? 13.678  -22.727 7.342   1.00 39.93  ? 371 ARG A NE    1 
ATOM   2031 C  CZ    . ARG A 1 265 ? 13.537  -23.927 7.906   1.00 41.88  ? 371 ARG A CZ    1 
ATOM   2032 N  NH1   . ARG A 1 265 ? 12.496  -24.721 7.585   1.00 41.70  ? 371 ARG A NH1   1 
ATOM   2033 N  NH2   . ARG A 1 265 ? 14.395  -24.314 8.864   1.00 43.88  ? 371 ARG A NH2   1 
ATOM   2034 N  N     . ARG A 1 266 ? 9.903   -19.351 2.908   1.00 30.07  ? 372 ARG A N     1 
ATOM   2035 C  CA    . ARG A 1 266 ? 8.616   -19.384 2.215   1.00 30.82  ? 372 ARG A CA    1 
ATOM   2036 C  C     . ARG A 1 266 ? 8.741   -19.338 0.699   1.00 28.21  ? 372 ARG A C     1 
ATOM   2037 O  O     . ARG A 1 266 ? 7.955   -19.976 0.009   1.00 26.45  ? 372 ARG A O     1 
ATOM   2038 C  CB    . ARG A 1 266 ? 7.780   -18.173 2.607   1.00 34.04  ? 372 ARG A CB    1 
ATOM   2039 C  CG    . ARG A 1 266 ? 7.477   -18.081 4.066   1.00 35.49  ? 372 ARG A CG    1 
ATOM   2040 C  CD    . ARG A 1 266 ? 6.758   -16.778 4.279   1.00 39.02  ? 372 ARG A CD    1 
ATOM   2041 N  NE    . ARG A 1 266 ? 6.373   -16.654 5.654   1.00 43.25  ? 372 ARG A NE    1 
ATOM   2042 C  CZ    . ARG A 1 266 ? 5.645   -15.668 6.185   1.00 48.67  ? 372 ARG A CZ    1 
ATOM   2043 N  NH1   . ARG A 1 266 ? 5.253   -14.625 5.415   1.00 52.18  ? 372 ARG A NH1   1 
ATOM   2044 N  NH2   . ARG A 1 266 ? 5.372   -15.673 7.530   1.00 46.10  ? 372 ARG A NH2   1 
ATOM   2045 N  N     . ALA A 1 267 ? 9.711   -18.550 0.197   1.00 27.18  ? 373 ALA A N     1 
ATOM   2046 C  CA    . ALA A 1 267 ? 9.876   -18.317 -1.201  1.00 26.89  ? 373 ALA A CA    1 
ATOM   2047 C  C     . ALA A 1 267 ? 11.133  -18.921 -1.907  1.00 25.87  ? 373 ALA A C     1 
ATOM   2048 O  O     . ALA A 1 267 ? 11.048  -19.863 -2.673  1.00 23.07  ? 373 ALA A O     1 
ATOM   2049 C  CB    . ALA A 1 267 ? 9.729   -16.813 -1.498  1.00 26.91  ? 373 ALA A CB    1 
ATOM   2050 N  N     . TYR A 1 268 ? 12.283  -18.342 -1.651  1.00 24.96  ? 374 TYR A N     1 
ATOM   2051 C  CA    . TYR A 1 268 ? 13.432  -18.594 -2.478  1.00 25.02  ? 374 TYR A CA    1 
ATOM   2052 C  C     . TYR A 1 268 ? 13.937  -20.066 -2.387  1.00 26.47  ? 374 TYR A C     1 
ATOM   2053 O  O     . TYR A 1 268 ? 14.604  -20.523 -3.282  1.00 24.34  ? 374 TYR A O     1 
ATOM   2054 C  CB    . TYR A 1 268 ? 14.589  -17.648 -2.037  1.00 23.74  ? 374 TYR A CB    1 
ATOM   2055 C  CG    . TYR A 1 268 ? 14.233  -16.182 -1.806  1.00 22.20  ? 374 TYR A CG    1 
ATOM   2056 C  CD1   . TYR A 1 268 ? 13.378  -15.520 -2.655  1.00 22.04  ? 374 TYR A CD1   1 
ATOM   2057 C  CD2   . TYR A 1 268 ? 14.781  -15.457 -0.720  1.00 21.04  ? 374 TYR A CD2   1 
ATOM   2058 C  CE1   . TYR A 1 268 ? 12.985  -14.186 -2.397  1.00 22.19  ? 374 TYR A CE1   1 
ATOM   2059 C  CE2   . TYR A 1 268 ? 14.454  -14.116 -0.501  1.00 20.71  ? 374 TYR A CE2   1 
ATOM   2060 C  CZ    . TYR A 1 268 ? 13.541  -13.487 -1.311  1.00 20.80  ? 374 TYR A CZ    1 
ATOM   2061 O  OH    . TYR A 1 268 ? 13.222  -12.178 -1.174  1.00 20.16  ? 374 TYR A OH    1 
ATOM   2062 N  N     . GLN A 1 269 ? 13.688  -20.753 -1.266  1.00 27.13  ? 375 GLN A N     1 
ATOM   2063 C  CA    . GLN A 1 269 ? 13.993  -22.191 -1.156  1.00 27.99  ? 375 GLN A CA    1 
ATOM   2064 C  C     . GLN A 1 269 ? 12.762  -23.063 -1.141  1.00 28.51  ? 375 GLN A C     1 
ATOM   2065 O  O     . GLN A 1 269 ? 12.838  -24.168 -0.631  1.00 29.38  ? 375 GLN A O     1 
ATOM   2066 C  CB    . GLN A 1 269 ? 14.812  -22.489 0.122   1.00 29.07  ? 375 GLN A CB    1 
ATOM   2067 C  CG    . GLN A 1 269 ? 16.018  -21.558 0.354   1.00 29.71  ? 375 GLN A CG    1 
ATOM   2068 C  CD    . GLN A 1 269 ? 17.065  -21.704 -0.697  1.00 30.37  ? 375 GLN A CD    1 
ATOM   2069 O  OE1   . GLN A 1 269 ? 17.849  -20.791 -0.881  1.00 32.26  ? 375 GLN A OE1   1 
ATOM   2070 N  NE2   . GLN A 1 269 ? 17.093  -22.838 -1.391  1.00 31.71  ? 375 GLN A NE2   1 
ATOM   2071 N  N     . HIS A 1 270 ? 11.627  -22.613 -1.694  1.00 28.72  ? 376 HIS A N     1 
ATOM   2072 C  CA    . HIS A 1 270 ? 10.437  -23.470 -1.761  1.00 27.32  ? 376 HIS A CA    1 
ATOM   2073 C  C     . HIS A 1 270 ? 10.884  -24.733 -2.458  1.00 28.43  ? 376 HIS A C     1 
ATOM   2074 O  O     . HIS A 1 270 ? 11.516  -24.683 -3.559  1.00 30.30  ? 376 HIS A O     1 
ATOM   2075 C  CB    . HIS A 1 270 ? 9.318   -22.784 -2.546  1.00 26.84  ? 376 HIS A CB    1 
ATOM   2076 C  CG    . HIS A 1 270 ? 8.001   -23.503 -2.540  1.00 26.14  ? 376 HIS A CG    1 
ATOM   2077 N  ND1   . HIS A 1 270 ? 7.711   -24.546 -3.390  1.00 26.46  ? 376 HIS A ND1   1 
ATOM   2078 C  CD2   . HIS A 1 270 ? 6.879   -23.307 -1.804  1.00 25.43  ? 376 HIS A CD2   1 
ATOM   2079 C  CE1   . HIS A 1 270 ? 6.454   -24.932 -3.217  1.00 25.59  ? 376 HIS A CE1   1 
ATOM   2080 N  NE2   . HIS A 1 270 ? 5.934   -24.199 -2.245  1.00 26.40  ? 376 HIS A NE2   1 
ATOM   2081 N  N     . LYS A 1 271 ? 10.577  -25.869 -1.864  1.00 28.45  ? 377 LYS A N     1 
ATOM   2082 C  CA    . LYS A 1 271 ? 11.021  -27.194 -2.370  1.00 29.60  ? 377 LYS A CA    1 
ATOM   2083 C  C     . LYS A 1 271 ? 10.681  -27.400 -3.879  1.00 28.39  ? 377 LYS A C     1 
ATOM   2084 O  O     . LYS A 1 271 ? 11.436  -28.066 -4.644  1.00 28.37  ? 377 LYS A O     1 
ATOM   2085 C  CB    . LYS A 1 271 ? 10.359  -28.335 -1.554  1.00 31.53  ? 377 LYS A CB    1 
ATOM   2086 C  CG    . LYS A 1 271 ? 8.834   -28.241 -1.763  1.00 33.59  ? 377 LYS A CG    1 
ATOM   2087 C  CD    . LYS A 1 271 ? 8.002   -28.808 -0.664  1.00 36.28  ? 377 LYS A CD    1 
ATOM   2088 C  CE    . LYS A 1 271 ? 6.506   -28.898 -0.970  1.00 37.39  ? 377 LYS A CE    1 
ATOM   2089 N  NZ    . LYS A 1 271 ? 5.896   -27.622 -0.655  1.00 38.57  ? 377 LYS A NZ    1 
ATOM   2090 N  N     . VAL A 1 272 ? 9.563   -26.847 -4.340  1.00 27.56  ? 378 VAL A N     1 
ATOM   2091 C  CA    . VAL A 1 272 ? 9.206   -27.037 -5.774  1.00 27.27  ? 378 VAL A CA    1 
ATOM   2092 C  C     . VAL A 1 272 ? 9.937   -26.012 -6.658  1.00 27.73  ? 378 VAL A C     1 
ATOM   2093 O  O     . VAL A 1 272 ? 10.395  -26.303 -7.788  1.00 26.68  ? 378 VAL A O     1 
ATOM   2094 C  CB    . VAL A 1 272 ? 7.696   -27.018 -6.011  1.00 27.46  ? 378 VAL A CB    1 
ATOM   2095 C  CG1   . VAL A 1 272 ? 7.409   -27.253 -7.467  1.00 27.39  ? 378 VAL A CG1   1 
ATOM   2096 C  CG2   . VAL A 1 272 ? 6.964   -28.127 -5.241  1.00 27.48  ? 378 VAL A CG2   1 
ATOM   2097 N  N     . GLY A 1 273 ? 10.070  -24.799 -6.146  1.00 27.46  ? 379 GLY A N     1 
ATOM   2098 C  CA    . GLY A 1 273 ? 10.943  -23.807 -6.744  1.00 27.49  ? 379 GLY A CA    1 
ATOM   2099 C  C     . GLY A 1 273 ? 12.329  -24.336 -7.033  1.00 28.62  ? 379 GLY A C     1 
ATOM   2100 O  O     . GLY A 1 273 ? 12.856  -24.150 -8.171  1.00 25.45  ? 379 GLY A O     1 
ATOM   2101 N  N     . ASN A 1 274 ? 12.916  -25.000 -6.030  1.00 29.34  ? 380 ASN A N     1 
ATOM   2102 C  CA    . ASN A 1 274 ? 14.298  -25.523 -6.160  1.00 30.83  ? 380 ASN A CA    1 
ATOM   2103 C  C     . ASN A 1 274 ? 14.371  -26.683 -7.189  1.00 31.36  ? 380 ASN A C     1 
ATOM   2104 O  O     . ASN A 1 274 ? 15.347  -26.780 -7.926  1.00 32.05  ? 380 ASN A O     1 
ATOM   2105 C  CB    . ASN A 1 274 ? 14.887  -25.944 -4.775  1.00 31.05  ? 380 ASN A CB    1 
ATOM   2106 C  CG    . ASN A 1 274 ? 15.372  -24.780 -3.937  1.00 31.50  ? 380 ASN A CG    1 
ATOM   2107 O  OD1   . ASN A 1 274 ? 15.796  -24.979 -2.767  1.00 37.90  ? 380 ASN A OD1   1 
ATOM   2108 N  ND2   . ASN A 1 274 ? 15.328  -23.583 -4.471  1.00 28.93  ? 380 ASN A ND2   1 
ATOM   2109 N  N     . ILE A 1 275 ? 13.354  -27.536 -7.235  1.00 32.30  ? 381 ILE A N     1 
ATOM   2110 C  CA    . ILE A 1 275 ? 13.368  -28.640 -8.149  1.00 34.31  ? 381 ILE A CA    1 
ATOM   2111 C  C     . ILE A 1 275 ? 13.194  -28.192 -9.638  1.00 37.64  ? 381 ILE A C     1 
ATOM   2112 O  O     . ILE A 1 275 ? 13.801  -28.758 -10.565 1.00 39.77  ? 381 ILE A O     1 
ATOM   2113 C  CB    . ILE A 1 275 ? 12.384  -29.776 -7.720  1.00 34.67  ? 381 ILE A CB    1 
ATOM   2114 C  CG1   . ILE A 1 275 ? 12.825  -31.165 -8.268  1.00 35.59  ? 381 ILE A CG1   1 
ATOM   2115 C  CG2   . ILE A 1 275 ? 10.957  -29.562 -8.147  1.00 33.69  ? 381 ILE A CG2   1 
ATOM   2116 C  CD1   . ILE A 1 275 ? 14.225  -31.588 -7.829  1.00 34.42  ? 381 ILE A CD1   1 
ATOM   2117 N  N     . ILE A 1 276 ? 12.422  -27.159 -9.857  1.00 38.35  ? 382 ILE A N     1 
ATOM   2118 C  CA    . ILE A 1 276 ? 12.364  -26.581 -11.165 1.00 38.33  ? 382 ILE A CA    1 
ATOM   2119 C  C     . ILE A 1 276 ? 13.718  -25.989 -11.573 1.00 37.35  ? 382 ILE A C     1 
ATOM   2120 O  O     . ILE A 1 276 ? 14.120  -26.148 -12.728 1.00 35.59  ? 382 ILE A O     1 
ATOM   2121 C  CB    . ILE A 1 276 ? 11.186  -25.586 -11.263 1.00 41.26  ? 382 ILE A CB    1 
ATOM   2122 C  CG1   . ILE A 1 276 ? 9.901   -26.393 -11.293 1.00 42.78  ? 382 ILE A CG1   1 
ATOM   2123 C  CG2   . ILE A 1 276 ? 11.245  -24.777 -12.537 1.00 41.97  ? 382 ILE A CG2   1 
ATOM   2124 C  CD1   . ILE A 1 276 ? 8.667   -25.565 -11.372 1.00 43.33  ? 382 ILE A CD1   1 
ATOM   2125 N  N     . ASP A 1 277 ? 14.436  -25.350 -10.660 1.00 34.46  ? 383 ASP A N     1 
ATOM   2126 C  CA    . ASP A 1 277 ? 15.749  -24.832 -10.997 1.00 35.88  ? 383 ASP A CA    1 
ATOM   2127 C  C     . ASP A 1 277 ? 16.721  -25.997 -11.304 1.00 36.83  ? 383 ASP A C     1 
ATOM   2128 O  O     . ASP A 1 277 ? 17.658  -25.860 -12.123 1.00 31.84  ? 383 ASP A O     1 
ATOM   2129 C  CB    . ASP A 1 277 ? 16.331  -23.989 -9.860  1.00 37.53  ? 383 ASP A CB    1 
ATOM   2130 C  CG    . ASP A 1 277 ? 15.814  -22.531 -9.832  1.00 38.85  ? 383 ASP A CG    1 
ATOM   2131 O  OD1   . ASP A 1 277 ? 15.159  -22.028 -10.786 1.00 37.31  ? 383 ASP A OD1   1 
ATOM   2132 O  OD2   . ASP A 1 277 ? 16.109  -21.870 -8.804  1.00 38.69  ? 383 ASP A OD2   1 
ATOM   2133 N  N     . THR A 1 278 ? 16.492  -27.127 -10.619 1.00 36.74  ? 384 THR A N     1 
ATOM   2134 C  CA    . THR A 1 278 ? 17.326  -28.309 -10.808 1.00 37.32  ? 384 THR A CA    1 
ATOM   2135 C  C     . THR A 1 278 ? 17.128  -28.899 -12.205 1.00 36.15  ? 384 THR A C     1 
ATOM   2136 O  O     . THR A 1 278 ? 18.084  -29.251 -12.869 1.00 33.34  ? 384 THR A O     1 
ATOM   2137 C  CB    . THR A 1 278 ? 17.041  -29.359 -9.710  1.00 38.39  ? 384 THR A CB    1 
ATOM   2138 O  OG1   . THR A 1 278 ? 17.372  -28.785 -8.445  1.00 37.18  ? 384 THR A OG1   1 
ATOM   2139 C  CG2   . THR A 1 278 ? 17.853  -30.643 -9.932  1.00 37.46  ? 384 THR A CG2   1 
ATOM   2140 N  N     . MET A 1 279 ? 15.876  -28.970 -12.627 1.00 37.02  ? 385 MET A N     1 
ATOM   2141 C  CA    . MET A 1 279 ? 15.509  -29.513 -13.934 1.00 37.00  ? 385 MET A CA    1 
ATOM   2142 C  C     . MET A 1 279 ? 15.958  -28.615 -15.052 1.00 36.75  ? 385 MET A C     1 
ATOM   2143 O  O     . MET A 1 279 ? 16.441  -29.078 -16.084 1.00 35.88  ? 385 MET A O     1 
ATOM   2144 C  CB    . MET A 1 279 ? 13.977  -29.781 -14.011 1.00 38.68  ? 385 MET A CB    1 
ATOM   2145 C  CG    . MET A 1 279 ? 13.505  -30.904 -13.115 1.00 38.46  ? 385 MET A CG    1 
ATOM   2146 S  SD    . MET A 1 279 ? 11.740  -31.206 -12.993 1.00 42.44  ? 385 MET A SD    1 
ATOM   2147 C  CE    . MET A 1 279 ? 11.290  -31.950 -14.545 1.00 39.86  ? 385 MET A CE    1 
ATOM   2148 N  N     . ILE A 1 280 ? 15.827  -27.312 -14.854 1.00 36.21  ? 386 ILE A N     1 
ATOM   2149 C  CA    . ILE A 1 280 ? 16.352  -26.381 -15.822 1.00 35.15  ? 386 ILE A CA    1 
ATOM   2150 C  C     . ILE A 1 280 ? 17.886  -26.512 -15.940 1.00 34.47  ? 386 ILE A C     1 
ATOM   2151 O  O     . ILE A 1 280 ? 18.420  -26.450 -17.026 1.00 33.16  ? 386 ILE A O     1 
ATOM   2152 C  CB    . ILE A 1 280 ? 15.941  -24.970 -15.504 1.00 34.26  ? 386 ILE A CB    1 
ATOM   2153 C  CG1   . ILE A 1 280 ? 14.454  -24.846 -15.702 1.00 36.20  ? 386 ILE A CG1   1 
ATOM   2154 C  CG2   . ILE A 1 280 ? 16.614  -24.004 -16.466 1.00 33.40  ? 386 ILE A CG2   1 
ATOM   2155 C  CD1   . ILE A 1 280 ? 13.877  -23.510 -15.181 1.00 36.87  ? 386 ILE A CD1   1 
ATOM   2156 N  N     . THR A 1 281 ? 18.567  -26.691 -14.836 1.00 34.45  ? 387 THR A N     1 
ATOM   2157 C  CA    . THR A 1 281 ? 20.032  -26.857 -14.836 1.00 39.24  ? 387 THR A CA    1 
ATOM   2158 C  C     . THR A 1 281 ? 20.459  -28.116 -15.631 1.00 40.27  ? 387 THR A C     1 
ATOM   2159 O  O     . THR A 1 281 ? 21.337  -28.071 -16.491 1.00 39.17  ? 387 THR A O     1 
ATOM   2160 C  CB    . THR A 1 281 ? 20.561  -26.832 -13.361 1.00 39.31  ? 387 THR A CB    1 
ATOM   2161 O  OG1   . THR A 1 281 ? 20.496  -25.488 -12.919 1.00 40.63  ? 387 THR A OG1   1 
ATOM   2162 C  CG2   . THR A 1 281 ? 21.993  -27.334 -13.223 1.00 39.74  ? 387 THR A CG2   1 
ATOM   2163 N  N     . ASP A 1 282 ? 19.779  -29.203 -15.336 1.00 42.00  ? 388 ASP A N     1 
ATOM   2164 C  CA    . ASP A 1 282 ? 19.778  -30.405 -16.163 1.00 44.33  ? 388 ASP A CA    1 
ATOM   2165 C  C     . ASP A 1 282 ? 19.613  -30.257 -17.666 1.00 40.42  ? 388 ASP A C     1 
ATOM   2166 O  O     . ASP A 1 282 ? 20.382  -30.782 -18.458 1.00 41.41  ? 388 ASP A O     1 
ATOM   2167 C  CB    . ASP A 1 282 ? 18.674  -31.329 -15.666 1.00 47.12  ? 388 ASP A CB    1 
ATOM   2168 C  CG    . ASP A 1 282 ? 19.257  -32.476 -14.961 1.00 51.63  ? 388 ASP A CG    1 
ATOM   2169 O  OD1   . ASP A 1 282 ? 19.823  -33.338 -15.700 1.00 56.82  ? 388 ASP A OD1   1 
ATOM   2170 O  OD2   . ASP A 1 282 ? 19.238  -32.448 -13.688 1.00 54.03  ? 388 ASP A OD2   1 
ATOM   2171 N  N     . ALA A 1 283 ? 18.566  -29.561 -18.041 1.00 37.95  ? 389 ALA A N     1 
ATOM   2172 C  CA    . ALA A 1 283 ? 18.341  -29.265 -19.418 1.00 37.43  ? 389 ALA A CA    1 
ATOM   2173 C  C     . ALA A 1 283 ? 19.527  -28.482 -20.019 1.00 38.23  ? 389 ALA A C     1 
ATOM   2174 O  O     . ALA A 1 283 ? 20.017  -28.811 -21.091 1.00 36.15  ? 389 ALA A O     1 
ATOM   2175 C  CB    . ALA A 1 283 ? 17.041  -28.537 -19.585 1.00 36.98  ? 389 ALA A CB    1 
ATOM   2176 N  N     . PHE A 1 284 ? 20.054  -27.513 -19.283 1.00 40.94  ? 390 PHE A N     1 
ATOM   2177 C  CA    . PHE A 1 284 ? 21.175  -26.733 -19.795 1.00 41.02  ? 390 PHE A CA    1 
ATOM   2178 C  C     . PHE A 1 284 ? 22.397  -27.607 -19.938 1.00 39.17  ? 390 PHE A C     1 
ATOM   2179 O  O     . PHE A 1 284 ? 23.156  -27.419 -20.854 1.00 33.07  ? 390 PHE A O     1 
ATOM   2180 C  CB    . PHE A 1 284 ? 21.551  -25.545 -18.878 1.00 42.81  ? 390 PHE A CB    1 
ATOM   2181 C  CG    . PHE A 1 284 ? 20.646  -24.342 -18.961 1.00 42.24  ? 390 PHE A CG    1 
ATOM   2182 C  CD1   . PHE A 1 284 ? 19.362  -24.395 -19.516 1.00 41.47  ? 390 PHE A CD1   1 
ATOM   2183 C  CD2   . PHE A 1 284 ? 21.077  -23.149 -18.394 1.00 44.59  ? 390 PHE A CD2   1 
ATOM   2184 C  CE1   . PHE A 1 284 ? 18.553  -23.273 -19.572 1.00 42.13  ? 390 PHE A CE1   1 
ATOM   2185 C  CE2   . PHE A 1 284 ? 20.261  -22.018 -18.427 1.00 47.41  ? 390 PHE A CE2   1 
ATOM   2186 C  CZ    . PHE A 1 284 ? 18.993  -22.090 -19.007 1.00 44.99  ? 390 PHE A CZ    1 
ATOM   2187 N  N     . LEU A 1 285 ? 22.614  -28.516 -18.993 1.00 40.74  ? 391 LEU A N     1 
ATOM   2188 C  CA    . LEU A 1 285 ? 23.771  -29.441 -19.084 1.00 41.34  ? 391 LEU A CA    1 
ATOM   2189 C  C     . LEU A 1 285 ? 23.732  -30.304 -20.350 1.00 41.10  ? 391 LEU A C     1 
ATOM   2190 O  O     . LEU A 1 285 ? 24.728  -30.438 -21.001 1.00 40.37  ? 391 LEU A O     1 
ATOM   2191 C  CB    . LEU A 1 285 ? 23.889  -30.282 -17.830 1.00 40.58  ? 391 LEU A CB    1 
ATOM   2192 C  CG    . LEU A 1 285 ? 24.440  -29.525 -16.603 1.00 41.15  ? 391 LEU A CG    1 
ATOM   2193 C  CD1   . LEU A 1 285 ? 24.219  -30.356 -15.367 1.00 41.46  ? 391 LEU A CD1   1 
ATOM   2194 C  CD2   . LEU A 1 285 ? 25.909  -29.168 -16.673 1.00 41.03  ? 391 LEU A CD2   1 
ATOM   2195 N  N     . LYS A 1 286 ? 22.559  -30.773 -20.731 1.00 40.22  ? 392 LYS A N     1 
ATOM   2196 C  CA    . LYS A 1 286 ? 22.386  -31.553 -21.937 1.00 42.50  ? 392 LYS A CA    1 
ATOM   2197 C  C     . LYS A 1 286 ? 22.307  -30.787 -23.244 1.00 44.01  ? 392 LYS A C     1 
ATOM   2198 O  O     . LYS A 1 286 ? 22.097  -31.362 -24.336 1.00 45.37  ? 392 LYS A O     1 
ATOM   2199 C  CB    . LYS A 1 286 ? 21.113  -32.384 -21.775 1.00 44.60  ? 392 LYS A CB    1 
ATOM   2200 C  CG    . LYS A 1 286 ? 21.307  -33.353 -20.670 1.00 44.75  ? 392 LYS A CG    1 
ATOM   2201 C  CD    . LYS A 1 286 ? 20.086  -34.174 -20.454 1.00 49.76  ? 392 LYS A CD    1 
ATOM   2202 C  CE    . LYS A 1 286 ? 20.271  -35.137 -19.290 1.00 53.62  ? 392 LYS A CE    1 
ATOM   2203 N  NZ    . LYS A 1 286 ? 21.583  -35.834 -19.505 1.00 57.56  ? 392 LYS A NZ    1 
ATOM   2204 N  N     . ALA A 1 287 ? 22.399  -29.473 -23.162 1.00 45.33  ? 393 ALA A N     1 
ATOM   2205 C  CA    . ALA A 1 287 ? 22.453  -28.659 -24.367 1.00 41.19  ? 393 ALA A CA    1 
ATOM   2206 C  C     . ALA A 1 287 ? 23.786  -27.972 -24.469 1.00 38.64  ? 393 ALA A C     1 
ATOM   2207 O  O     . ALA A 1 287 ? 24.050  -27.352 -25.460 1.00 35.83  ? 393 ALA A O     1 
ATOM   2208 C  CB    . ALA A 1 287 ? 21.329  -27.646 -24.319 1.00 40.82  ? 393 ALA A CB    1 
ATOM   2209 N  N     . ASP A 1 288 ? 24.619  -28.041 -23.444 1.00 40.02  ? 394 ASP A N     1 
ATOM   2210 C  CA    . ASP A 1 288 ? 25.794  -27.181 -23.411 1.00 43.52  ? 394 ASP A CA    1 
ATOM   2211 C  C     . ASP A 1 288 ? 26.747  -27.393 -24.607 1.00 47.03  ? 394 ASP A C     1 
ATOM   2212 O  O     . ASP A 1 288 ? 27.262  -26.403 -25.172 1.00 51.90  ? 394 ASP A O     1 
ATOM   2213 C  CB    . ASP A 1 288 ? 26.558  -27.364 -22.098 1.00 43.20  ? 394 ASP A CB    1 
ATOM   2214 C  CG    . ASP A 1 288 ? 27.543  -26.240 -21.855 1.00 43.57  ? 394 ASP A CG    1 
ATOM   2215 O  OD1   . ASP A 1 288 ? 27.175  -25.062 -22.103 1.00 44.71  ? 394 ASP A OD1   1 
ATOM   2216 O  OD2   . ASP A 1 288 ? 28.698  -26.518 -21.464 1.00 42.51  ? 394 ASP A OD2   1 
ATOM   2217 N  N     . ASP A 1 289 ? 26.942  -28.678 -24.963 1.00 49.26  ? 395 ASP A N     1 
ATOM   2218 C  CA    . ASP A 1 289 ? 27.749  -29.089 -26.120 1.00 53.61  ? 395 ASP A CA    1 
ATOM   2219 C  C     . ASP A 1 289 ? 27.276  -28.519 -27.428 1.00 53.56  ? 395 ASP A C     1 
ATOM   2220 O  O     . ASP A 1 289 ? 28.083  -28.268 -28.262 1.00 56.80  ? 395 ASP A O     1 
ATOM   2221 C  CB    . ASP A 1 289 ? 27.827  -30.621 -26.275 1.00 54.76  ? 395 ASP A CB    1 
ATOM   2222 C  CG    . ASP A 1 289 ? 28.767  -31.309 -25.244 1.00 60.48  ? 395 ASP A CG    1 
ATOM   2223 O  OD1   . ASP A 1 289 ? 29.713  -30.683 -24.716 1.00 59.27  ? 395 ASP A OD1   1 
ATOM   2224 O  OD2   . ASP A 1 289 ? 28.568  -32.533 -24.995 1.00 68.88  ? 395 ASP A OD2   1 
ATOM   2225 N  N     . TYR A 1 290 ? 25.972  -28.343 -27.584 1.00 53.10  ? 396 TYR A N     1 
ATOM   2226 C  CA    . TYR A 1 290 ? 25.344  -28.115 -28.878 1.00 51.81  ? 396 TYR A CA    1 
ATOM   2227 C  C     . TYR A 1 290 ? 24.867  -26.697 -29.156 1.00 51.02  ? 396 TYR A C     1 
ATOM   2228 O  O     . TYR A 1 290 ? 24.369  -26.469 -30.230 1.00 46.65  ? 396 TYR A O     1 
ATOM   2229 C  CB    . TYR A 1 290 ? 24.144  -29.084 -29.036 1.00 52.85  ? 396 TYR A CB    1 
ATOM   2230 C  CG    . TYR A 1 290 ? 24.541  -30.481 -28.648 1.00 59.52  ? 396 TYR A CG    1 
ATOM   2231 C  CD1   . TYR A 1 290 ? 25.634  -31.106 -29.273 1.00 62.67  ? 396 TYR A CD1   1 
ATOM   2232 C  CD2   . TYR A 1 290 ? 23.852  -31.190 -27.647 1.00 62.62  ? 396 TYR A CD2   1 
ATOM   2233 C  CE1   . TYR A 1 290 ? 26.039  -32.371 -28.909 1.00 62.48  ? 396 TYR A CE1   1 
ATOM   2234 C  CE2   . TYR A 1 290 ? 24.255  -32.457 -27.262 1.00 62.13  ? 396 TYR A CE2   1 
ATOM   2235 C  CZ    . TYR A 1 290 ? 25.346  -33.031 -27.907 1.00 64.70  ? 396 TYR A CZ    1 
ATOM   2236 O  OH    . TYR A 1 290 ? 25.813  -34.238 -27.542 1.00 67.31  ? 396 TYR A OH    1 
ATOM   2237 N  N     . ILE A 1 291 ? 24.960  -25.747 -28.223 1.00 49.80  ? 397 ILE A N     1 
ATOM   2238 C  CA    . ILE A 1 291 ? 24.544  -24.370 -28.506 1.00 52.75  ? 397 ILE A CA    1 
ATOM   2239 C  C     . ILE A 1 291 ? 25.781  -23.491 -28.608 1.00 51.10  ? 397 ILE A C     1 
ATOM   2240 O  O     . ILE A 1 291 ? 26.701  -23.625 -27.793 1.00 55.44  ? 397 ILE A O     1 
ATOM   2241 C  CB    . ILE A 1 291 ? 23.563  -23.893 -27.410 1.00 55.79  ? 397 ILE A CB    1 
ATOM   2242 C  CG1   . ILE A 1 291 ? 22.168  -24.393 -27.759 1.00 53.55  ? 397 ILE A CG1   1 
ATOM   2243 C  CG2   . ILE A 1 291 ? 23.547  -22.363 -27.286 1.00 54.13  ? 397 ILE A CG2   1 
ATOM   2244 C  CD1   . ILE A 1 291 ? 21.225  -24.412 -26.611 1.00 50.91  ? 397 ILE A CD1   1 
ATOM   2245 N  N     . GLU A 1 292 ? 25.772  -22.596 -29.581 1.00 50.48  ? 398 GLU A N     1 
ATOM   2246 C  CA    . GLU A 1 292 ? 26.903  -21.688 -29.849 1.00 53.06  ? 398 GLU A CA    1 
ATOM   2247 C  C     . GLU A 1 292 ? 26.527  -20.221 -29.797 1.00 48.28  ? 398 GLU A C     1 
ATOM   2248 O  O     . GLU A 1 292 ? 25.629  -19.815 -30.466 1.00 44.67  ? 398 GLU A O     1 
ATOM   2249 C  CB    . GLU A 1 292 ? 27.488  -21.931 -31.228 1.00 59.76  ? 398 GLU A CB    1 
ATOM   2250 C  CG    . GLU A 1 292 ? 28.544  -23.032 -31.243 1.00 71.80  ? 398 GLU A CG    1 
ATOM   2251 C  CD    . GLU A 1 292 ? 28.690  -23.688 -32.640 1.00 80.06  ? 398 GLU A CD    1 
ATOM   2252 O  OE1   . GLU A 1 292 ? 28.534  -22.942 -33.666 1.00 83.77  ? 398 GLU A OE1   1 
ATOM   2253 O  OE2   . GLU A 1 292 ? 28.983  -24.926 -32.704 1.00 78.61  ? 398 GLU A OE2   1 
ATOM   2254 N  N     . ILE A 1 293 ? 27.285  -19.430 -29.050 1.00 46.44  ? 399 ILE A N     1 
ATOM   2255 C  CA    . ILE A 1 293 ? 26.998  -18.026 -28.913 1.00 49.28  ? 399 ILE A CA    1 
ATOM   2256 C  C     . ILE A 1 293 ? 28.202  -17.311 -29.491 1.00 47.13  ? 399 ILE A C     1 
ATOM   2257 O  O     . ILE A 1 293 ? 29.315  -17.549 -29.073 1.00 45.45  ? 399 ILE A O     1 
ATOM   2258 C  CB    . ILE A 1 293 ? 26.721  -17.646 -27.416 1.00 52.64  ? 399 ILE A CB    1 
ATOM   2259 C  CG1   . ILE A 1 293 ? 25.477  -18.346 -26.884 1.00 51.18  ? 399 ILE A CG1   1 
ATOM   2260 C  CG2   . ILE A 1 293 ? 26.513  -16.155 -27.199 1.00 53.93  ? 399 ILE A CG2   1 
ATOM   2261 C  CD1   . ILE A 1 293 ? 25.624  -18.719 -25.419 1.00 53.33  ? 399 ILE A CD1   1 
ATOM   2262 N  N     . THR A 1 294 ? 27.969  -16.407 -30.429 1.00 48.02  ? 400 THR A N     1 
ATOM   2263 C  CA    . THR A 1 294 ? 29.072  -15.706 -31.034 1.00 48.86  ? 400 THR A CA    1 
ATOM   2264 C  C     . THR A 1 294 ? 29.563  -14.602 -30.140 1.00 45.43  ? 400 THR A C     1 
ATOM   2265 O  O     . THR A 1 294 ? 28.789  -13.773 -29.711 1.00 46.02  ? 400 THR A O     1 
ATOM   2266 C  CB    . THR A 1 294 ? 28.693  -15.106 -32.380 1.00 53.44  ? 400 THR A CB    1 
ATOM   2267 O  OG1   . THR A 1 294 ? 27.977  -16.062 -33.159 1.00 53.68  ? 400 THR A OG1   1 
ATOM   2268 C  CG2   . THR A 1 294 ? 29.954  -14.692 -33.128 1.00 57.03  ? 400 THR A CG2   1 
ATOM   2269 N  N     . GLY A 1 295 ? 30.856  -14.573 -29.907 1.00 43.89  ? 401 GLY A N     1 
ATOM   2270 C  CA    . GLY A 1 295 ? 31.473  -13.603 -29.054 1.00 47.77  ? 401 GLY A CA    1 
ATOM   2271 C  C     . GLY A 1 295 ? 32.412  -12.737 -29.836 1.00 51.38  ? 401 GLY A C     1 
ATOM   2272 O  O     . GLY A 1 295 ? 32.224  -12.581 -31.033 1.00 63.68  ? 401 GLY A O     1 
ATOM   2273 N  N     . ALA A 1 296 ? 33.410  -12.176 -29.164 1.00 55.47  ? 402 ALA A N     1 
ATOM   2274 C  CA    . ALA A 1 296 ? 34.299  -11.158 -29.746 1.00 58.44  ? 402 ALA A CA    1 
ATOM   2275 C  C     . ALA A 1 296 ? 35.281  -11.790 -30.729 1.00 60.44  ? 402 ALA A C     1 
ATOM   2276 O  O     . ALA A 1 296 ? 35.861  -12.836 -30.430 1.00 61.93  ? 402 ALA A O     1 
ATOM   2277 C  CB    . ALA A 1 296 ? 35.073  -10.430 -28.648 1.00 58.37  ? 402 ALA A CB    1 
ATOM   2278 N  N     . GLY A 1 297 ? 35.460  -11.118 -31.871 1.00 62.28  ? 403 GLY A N     1 
ATOM   2279 C  CA    . GLY A 1 297 ? 36.283  -11.573 -32.982 1.00 60.47  ? 403 GLY A CA    1 
ATOM   2280 C  C     . GLY A 1 297 ? 35.729  -12.833 -33.593 1.00 63.10  ? 403 GLY A C     1 
ATOM   2281 O  O     . GLY A 1 297 ? 36.494  -13.767 -33.824 1.00 64.22  ? 403 GLY A O     1 
ATOM   2282 N  N     . GLY A 1 298 ? 34.396  -12.887 -33.790 1.00 67.15  ? 404 GLY A N     1 
ATOM   2283 C  CA    . GLY A 1 298 ? 33.670  -14.061 -34.358 1.00 64.82  ? 404 GLY A CA    1 
ATOM   2284 C  C     . GLY A 1 298 ? 33.724  -15.439 -33.656 1.00 64.24  ? 404 GLY A C     1 
ATOM   2285 O  O     . GLY A 1 298 ? 33.080  -16.370 -34.128 1.00 64.90  ? 404 GLY A O     1 
ATOM   2286 N  N     . LYS A 1 299 ? 34.459  -15.580 -32.539 1.00 60.61  ? 405 LYS A N     1 
ATOM   2287 C  CA    . LYS A 1 299 ? 34.592  -16.868 -31.819 1.00 60.59  ? 405 LYS A CA    1 
ATOM   2288 C  C     . LYS A 1 299 ? 33.346  -17.384 -31.187 1.00 61.25  ? 405 LYS A C     1 
ATOM   2289 O  O     . LYS A 1 299 ? 32.477  -16.634 -30.813 1.00 65.48  ? 405 LYS A O     1 
ATOM   2290 C  CB    . LYS A 1 299 ? 35.534  -16.779 -30.661 1.00 61.35  ? 405 LYS A CB    1 
ATOM   2291 C  CG    . LYS A 1 299 ? 36.864  -16.346 -31.158 1.00 64.92  ? 405 LYS A CG    1 
ATOM   2292 C  CD    . LYS A 1 299 ? 37.853  -16.112 -30.050 1.00 68.25  ? 405 LYS A CD    1 
ATOM   2293 C  CE    . LYS A 1 299 ? 38.804  -15.008 -30.511 1.00 74.35  ? 405 LYS A CE    1 
ATOM   2294 N  NZ    . LYS A 1 299 ? 40.079  -15.082 -29.771 1.00 77.49  ? 405 LYS A NZ    1 
ATOM   2295 N  N     . LYS A 1 300 ? 33.317  -18.684 -30.974 1.00 61.38  ? 406 LYS A N     1 
ATOM   2296 C  CA    . LYS A 1 300 ? 32.110  -19.359 -30.572 1.00 59.46  ? 406 LYS A CA    1 
ATOM   2297 C  C     . LYS A 1 300 ? 32.239  -19.848 -29.184 1.00 51.56  ? 406 LYS A C     1 
ATOM   2298 O  O     . LYS A 1 300 ? 33.267  -20.441 -28.857 1.00 48.15  ? 406 LYS A O     1 
ATOM   2299 C  CB    . LYS A 1 300 ? 31.853  -20.487 -31.509 1.00 66.97  ? 406 LYS A CB    1 
ATOM   2300 C  CG    . LYS A 1 300 ? 31.486  -19.901 -32.859 1.00 76.73  ? 406 LYS A CG    1 
ATOM   2301 C  CD    . LYS A 1 300 ? 31.014  -20.986 -33.766 1.00 85.90  ? 406 LYS A CD    1 
ATOM   2302 C  CE    . LYS A 1 300 ? 32.136  -22.008 -34.008 1.00 92.79  ? 406 LYS A CE    1 
ATOM   2303 N  NZ    . LYS A 1 300 ? 31.771  -22.877 -35.159 1.00 96.01  ? 406 LYS A NZ    1 
ATOM   2304 N  N     . TYR A 1 301 ? 31.217  -19.555 -28.367 1.00 45.51  ? 407 TYR A N     1 
ATOM   2305 C  CA    . TYR A 1 301 ? 31.182  -19.982 -26.976 1.00 42.03  ? 407 TYR A CA    1 
ATOM   2306 C  C     . TYR A 1 301 ? 29.962  -20.807 -26.672 1.00 41.15  ? 407 TYR A C     1 
ATOM   2307 O  O     . TYR A 1 301 ? 28.990  -20.868 -27.424 1.00 39.43  ? 407 TYR A O     1 
ATOM   2308 C  CB    . TYR A 1 301 ? 31.212  -18.791 -26.068 1.00 42.02  ? 407 TYR A CB    1 
ATOM   2309 C  CG    . TYR A 1 301 ? 32.462  -18.001 -26.195 1.00 41.74  ? 407 TYR A CG    1 
ATOM   2310 C  CD1   . TYR A 1 301 ? 32.626  -17.087 -27.244 1.00 41.81  ? 407 TYR A CD1   1 
ATOM   2311 C  CD2   . TYR A 1 301 ? 33.530  -18.200 -25.311 1.00 42.25  ? 407 TYR A CD2   1 
ATOM   2312 C  CE1   . TYR A 1 301 ? 33.816  -16.400 -27.416 1.00 42.35  ? 407 TYR A CE1   1 
ATOM   2313 C  CE2   . TYR A 1 301 ? 34.725  -17.472 -25.451 1.00 41.33  ? 407 TYR A CE2   1 
ATOM   2314 C  CZ    . TYR A 1 301 ? 34.856  -16.593 -26.499 1.00 42.82  ? 407 TYR A CZ    1 
ATOM   2315 O  OH    . TYR A 1 301 ? 36.009  -15.873 -26.579 1.00 45.53  ? 407 TYR A OH    1 
ATOM   2316 N  N     . ARG A 1 302 ? 30.036  -21.518 -25.569 1.00 45.44  ? 408 ARG A N     1 
ATOM   2317 C  CA    . ARG A 1 302 ? 28.911  -22.298 -25.113 1.00 50.21  ? 408 ARG A CA    1 
ATOM   2318 C  C     . ARG A 1 302 ? 28.279  -21.617 -23.897 1.00 47.99  ? 408 ARG A C     1 
ATOM   2319 O  O     . ARG A 1 302 ? 28.846  -20.651 -23.318 1.00 41.13  ? 408 ARG A O     1 
ATOM   2320 C  CB    . ARG A 1 302 ? 29.382  -23.703 -24.855 1.00 57.14  ? 408 ARG A CB    1 
ATOM   2321 C  CG    . ARG A 1 302 ? 29.630  -24.380 -26.234 1.00 68.32  ? 408 ARG A CG    1 
ATOM   2322 C  CD    . ARG A 1 302 ? 30.790  -25.341 -26.240 1.00 78.36  ? 408 ARG A CD    1 
ATOM   2323 N  NE    . ARG A 1 302 ? 30.446  -26.494 -25.395 1.00 88.60  ? 408 ARG A NE    1 
ATOM   2324 C  CZ    . ARG A 1 302 ? 31.255  -27.157 -24.548 1.00 89.37  ? 408 ARG A CZ    1 
ATOM   2325 N  NH1   . ARG A 1 302 ? 30.775  -28.197 -23.846 1.00 87.47  ? 408 ARG A NH1   1 
ATOM   2326 N  NH2   . ARG A 1 302 ? 32.528  -26.792 -24.388 1.00 88.67  ? 408 ARG A NH2   1 
ATOM   2327 N  N     . ILE A 1 303 ? 27.102  -22.105 -23.533 1.00 46.68  ? 409 ILE A N     1 
ATOM   2328 C  CA    . ILE A 1 303 ? 26.436  -21.640 -22.316 1.00 43.55  ? 409 ILE A CA    1 
ATOM   2329 C  C     . ILE A 1 303 ? 27.431  -21.571 -21.124 1.00 43.24  ? 409 ILE A C     1 
ATOM   2330 O  O     . ILE A 1 303 ? 27.487  -20.534 -20.443 1.00 43.58  ? 409 ILE A O     1 
ATOM   2331 C  CB    . ILE A 1 303 ? 25.211  -22.508 -21.967 1.00 43.26  ? 409 ILE A CB    1 
ATOM   2332 C  CG1   . ILE A 1 303 ? 24.168  -22.528 -23.103 1.00 42.14  ? 409 ILE A CG1   1 
ATOM   2333 C  CG2   . ILE A 1 303 ? 24.561  -22.011 -20.691 1.00 43.62  ? 409 ILE A CG2   1 
ATOM   2334 C  CD1   . ILE A 1 303 ? 23.218  -23.720 -23.004 1.00 41.11  ? 409 ILE A CD1   1 
ATOM   2335 N  N     . SER A 1 304 ? 28.253  -22.626 -20.909 1.00 40.96  ? 410 SER A N     1 
ATOM   2336 C  CA    . SER A 1 304 ? 29.203  -22.673 -19.787 1.00 39.46  ? 410 SER A CA    1 
ATOM   2337 C  C     . SER A 1 304 ? 30.480  -21.871 -20.002 1.00 40.01  ? 410 SER A C     1 
ATOM   2338 O  O     . SER A 1 304 ? 31.167  -21.582 -19.030 1.00 41.49  ? 410 SER A O     1 
ATOM   2339 C  CB    . SER A 1 304 ? 29.584  -24.099 -19.402 1.00 40.12  ? 410 SER A CB    1 
ATOM   2340 O  OG    . SER A 1 304 ? 30.054  -24.817 -20.505 1.00 45.41  ? 410 SER A OG    1 
ATOM   2341 N  N     . THR A 1 305 ? 30.820  -21.494 -21.223 1.00 37.29  ? 411 THR A N     1 
ATOM   2342 C  CA    . THR A 1 305 ? 32.031  -20.671 -21.442 1.00 38.42  ? 411 THR A CA    1 
ATOM   2343 C  C     . THR A 1 305 ? 31.747  -19.219 -21.732 1.00 39.13  ? 411 THR A C     1 
ATOM   2344 O  O     . THR A 1 305 ? 32.687  -18.409 -21.703 1.00 42.14  ? 411 THR A O     1 
ATOM   2345 C  CB    . THR A 1 305 ? 32.919  -21.193 -22.603 1.00 38.68  ? 411 THR A CB    1 
ATOM   2346 O  OG1   . THR A 1 305 ? 32.108  -21.476 -23.767 1.00 39.70  ? 411 THR A OG1   1 
ATOM   2347 C  CG2   . THR A 1 305 ? 33.676  -22.446 -22.145 1.00 37.79  ? 411 THR A CG2   1 
ATOM   2348 N  N     . ALA A 1 306 ? 30.489  -18.870 -22.003 1.00 37.37  ? 412 ALA A N     1 
ATOM   2349 C  CA    . ALA A 1 306 ? 30.155  -17.504 -22.358 1.00 39.16  ? 412 ALA A CA    1 
ATOM   2350 C  C     . ALA A 1 306 ? 30.554  -16.525 -21.277 1.00 42.65  ? 412 ALA A C     1 
ATOM   2351 O  O     . ALA A 1 306 ? 30.733  -15.341 -21.562 1.00 41.04  ? 412 ALA A O     1 
ATOM   2352 C  CB    . ALA A 1 306 ? 28.672  -17.385 -22.633 1.00 39.76  ? 412 ALA A CB    1 
ATOM   2353 N  N     . ILE A 1 307 ? 30.678  -17.017 -20.035 1.00 42.02  ? 413 ILE A N     1 
ATOM   2354 C  CA    . ILE A 1 307 ? 31.182  -16.195 -18.938 1.00 44.81  ? 413 ILE A CA    1 
ATOM   2355 C  C     . ILE A 1 307 ? 32.590  -15.668 -19.081 1.00 46.56  ? 413 ILE A C     1 
ATOM   2356 O  O     . ILE A 1 307 ? 32.955  -14.751 -18.352 1.00 46.46  ? 413 ILE A O     1 
ATOM   2357 C  CB    . ILE A 1 307 ? 31.127  -16.921 -17.602 1.00 47.37  ? 413 ILE A CB    1 
ATOM   2358 C  CG1   . ILE A 1 307 ? 31.910  -18.233 -17.603 1.00 49.91  ? 413 ILE A CG1   1 
ATOM   2359 C  CG2   . ILE A 1 307 ? 29.688  -17.164 -17.194 1.00 48.85  ? 413 ILE A CG2   1 
ATOM   2360 C  CD1   . ILE A 1 307 ? 32.120  -18.749 -16.195 1.00 53.57  ? 413 ILE A CD1   1 
ATOM   2361 N  N     . ASP A 1 308 ? 33.375  -16.255 -19.984 1.00 47.77  ? 414 ASP A N     1 
ATOM   2362 C  CA    . ASP A 1 308 ? 34.735  -15.811 -20.281 1.00 49.71  ? 414 ASP A CA    1 
ATOM   2363 C  C     . ASP A 1 308 ? 34.834  -14.729 -21.370 1.00 48.02  ? 414 ASP A C     1 
ATOM   2364 O  O     . ASP A 1 308 ? 35.912  -14.243 -21.622 1.00 49.72  ? 414 ASP A O     1 
ATOM   2365 C  CB    . ASP A 1 308 ? 35.625  -17.014 -20.693 1.00 52.72  ? 414 ASP A CB    1 
ATOM   2366 C  CG    . ASP A 1 308 ? 35.741  -18.057 -19.609 1.00 52.87  ? 414 ASP A CG    1 
ATOM   2367 O  OD1   . ASP A 1 308 ? 35.914  -17.713 -18.423 1.00 54.38  ? 414 ASP A OD1   1 
ATOM   2368 O  OD2   . ASP A 1 308 ? 35.677  -19.238 -19.962 1.00 56.68  ? 414 ASP A OD2   1 
ATOM   2369 N  N     . ASP A 1 309 ? 33.741  -14.371 -22.017 1.00 44.92  ? 415 ASP A N     1 
ATOM   2370 C  CA    . ASP A 1 309 ? 33.746  -13.344 -23.069 1.00 45.80  ? 415 ASP A CA    1 
ATOM   2371 C  C     . ASP A 1 309 ? 32.502  -12.452 -22.989 1.00 42.21  ? 415 ASP A C     1 
ATOM   2372 O  O     . ASP A 1 309 ? 31.388  -12.889 -23.361 1.00 40.61  ? 415 ASP A O     1 
ATOM   2373 C  CB    . ASP A 1 309 ? 33.833  -13.984 -24.480 1.00 46.40  ? 415 ASP A CB    1 
ATOM   2374 C  CG    . ASP A 1 309 ? 33.905  -12.958 -25.552 1.00 45.84  ? 415 ASP A CG    1 
ATOM   2375 O  OD1   . ASP A 1 309 ? 34.931  -12.287 -25.615 1.00 47.16  ? 415 ASP A OD1   1 
ATOM   2376 O  OD2   . ASP A 1 309 ? 32.934  -12.798 -26.295 1.00 47.52  ? 415 ASP A OD2   1 
ATOM   2377 N  N     . MET A 1 310 ? 32.677  -11.206 -22.545 1.00 42.24  ? 416 MET A N     1 
ATOM   2378 C  CA    . MET A 1 310 ? 31.504  -10.363 -22.222 1.00 41.84  ? 416 MET A CA    1 
ATOM   2379 C  C     . MET A 1 310 ? 30.627  -10.023 -23.406 1.00 41.96  ? 416 MET A C     1 
ATOM   2380 O  O     . MET A 1 310 ? 29.451  -9.772  -23.235 1.00 38.75  ? 416 MET A O     1 
ATOM   2381 C  CB    . MET A 1 310 ? 31.903  -9.127  -21.467 1.00 39.72  ? 416 MET A CB    1 
ATOM   2382 C  CG    . MET A 1 310 ? 32.420  -9.412  -20.078 1.00 41.39  ? 416 MET A CG    1 
ATOM   2383 S  SD    . MET A 1 310 ? 31.229  -10.170 -19.012 1.00 42.29  ? 416 MET A SD    1 
ATOM   2384 C  CE    . MET A 1 310 ? 31.667  -11.923 -19.077 1.00 46.15  ? 416 MET A CE    1 
ATOM   2385 N  N     . GLU A 1 311 ? 31.184  -10.031 -24.613 1.00 44.80  ? 417 GLU A N     1 
ATOM   2386 C  CA    . GLU A 1 311 ? 30.357  -9.808  -25.807 1.00 42.17  ? 417 GLU A CA    1 
ATOM   2387 C  C     . GLU A 1 311 ? 29.400  -11.006 -26.072 1.00 39.16  ? 417 GLU A C     1 
ATOM   2388 O  O     . GLU A 1 311 ? 28.264  -10.836 -26.527 1.00 37.19  ? 417 GLU A O     1 
ATOM   2389 C  CB    . GLU A 1 311 ? 31.264  -9.530  -26.990 1.00 45.42  ? 417 GLU A CB    1 
ATOM   2390 C  CG    . GLU A 1 311 ? 30.506  -9.136  -28.238 1.00 47.01  ? 417 GLU A CG    1 
ATOM   2391 C  CD    . GLU A 1 311 ? 31.396  -8.714  -29.411 1.00 50.90  ? 417 GLU A CD    1 
ATOM   2392 O  OE1   . GLU A 1 311 ? 32.503  -8.092  -29.225 1.00 52.42  ? 417 GLU A OE1   1 
ATOM   2393 O  OE2   . GLU A 1 311 ? 30.906  -8.991  -30.523 1.00 51.05  ? 417 GLU A OE2   1 
ATOM   2394 N  N     . ALA A 1 312 ? 29.857  -12.214 -25.784 1.00 36.34  ? 418 ALA A N     1 
ATOM   2395 C  CA    . ALA A 1 312 ? 28.963  -13.352 -25.856 1.00 37.73  ? 418 ALA A CA    1 
ATOM   2396 C  C     . ALA A 1 312 ? 27.952  -13.406 -24.682 1.00 36.49  ? 418 ALA A C     1 
ATOM   2397 O  O     . ALA A 1 312 ? 26.797  -13.850 -24.879 1.00 33.12  ? 418 ALA A O     1 
ATOM   2398 C  CB    . ALA A 1 312 ? 29.776  -14.660 -25.857 1.00 37.69  ? 418 ALA A CB    1 
ATOM   2399 N  N     . TYR A 1 313 ? 28.453  -13.070 -23.487 1.00 36.09  ? 419 TYR A N     1 
ATOM   2400 C  CA    . TYR A 1 313 ? 27.669  -13.148 -22.261 1.00 37.00  ? 419 TYR A CA    1 
ATOM   2401 C  C     . TYR A 1 313 ? 26.462  -12.185 -22.349 1.00 35.96  ? 419 TYR A C     1 
ATOM   2402 O  O     . TYR A 1 313 ? 25.352  -12.547 -21.884 1.00 36.74  ? 419 TYR A O     1 
ATOM   2403 C  CB    . TYR A 1 313 ? 28.500  -12.852 -21.001 1.00 37.39  ? 419 TYR A CB    1 
ATOM   2404 C  CG    . TYR A 1 313 ? 27.853  -13.289 -19.668 1.00 38.18  ? 419 TYR A CG    1 
ATOM   2405 C  CD1   . TYR A 1 313 ? 27.254  -14.558 -19.513 1.00 40.41  ? 419 TYR A CD1   1 
ATOM   2406 C  CD2   . TYR A 1 313 ? 27.865  -12.460 -18.544 1.00 38.57  ? 419 TYR A CD2   1 
ATOM   2407 C  CE1   . TYR A 1 313 ? 26.679  -14.960 -18.293 1.00 39.28  ? 419 TYR A CE1   1 
ATOM   2408 C  CE2   . TYR A 1 313 ? 27.309  -12.849 -17.315 1.00 37.59  ? 419 TYR A CE2   1 
ATOM   2409 C  CZ    . TYR A 1 313 ? 26.715  -14.111 -17.195 1.00 39.36  ? 419 TYR A CZ    1 
ATOM   2410 O  OH    . TYR A 1 313 ? 26.133  -14.562 -16.005 1.00 40.53  ? 419 TYR A OH    1 
ATOM   2411 N  N     . THR A 1 314 ? 26.685  -11.031 -23.019 1.00 33.48  ? 420 THR A N     1 
ATOM   2412 C  CA    . THR A 1 314 ? 25.669  -10.020 -23.297 1.00 32.65  ? 420 THR A CA    1 
ATOM   2413 C  C     . THR A 1 314 ? 24.426  -10.660 -23.900 1.00 32.41  ? 420 THR A C     1 
ATOM   2414 O  O     . THR A 1 314 ? 23.322  -10.257 -23.565 1.00 31.15  ? 420 THR A O     1 
ATOM   2415 C  CB    . THR A 1 314 ? 26.222  -8.882  -24.214 1.00 33.94  ? 420 THR A CB    1 
ATOM   2416 O  OG1   . THR A 1 314 ? 27.231  -8.149  -23.486 1.00 34.93  ? 420 THR A OG1   1 
ATOM   2417 C  CG2   . THR A 1 314 ? 25.142  -7.863  -24.657 1.00 33.34  ? 420 THR A CG2   1 
ATOM   2418 N  N     . LYS A 1 315 ? 24.581  -11.695 -24.714 1.00 32.66  ? 421 LYS A N     1 
ATOM   2419 C  CA    . LYS A 1 315 ? 23.455  -12.277 -25.426 1.00 34.95  ? 421 LYS A CA    1 
ATOM   2420 C  C     . LYS A 1 315 ? 22.929  -13.534 -24.748 1.00 35.40  ? 421 LYS A C     1 
ATOM   2421 O  O     . LYS A 1 315 ? 22.123  -14.301 -25.342 1.00 32.66  ? 421 LYS A O     1 
ATOM   2422 C  CB    . LYS A 1 315 ? 23.831  -12.580 -26.891 1.00 37.89  ? 421 LYS A CB    1 
ATOM   2423 C  CG    . LYS A 1 315 ? 24.470  -11.390 -27.610 1.00 40.98  ? 421 LYS A CG    1 
ATOM   2424 C  CD    . LYS A 1 315 ? 24.573  -11.538 -29.142 1.00 43.25  ? 421 LYS A CD    1 
ATOM   2425 C  CE    . LYS A 1 315 ? 25.681  -12.484 -29.539 1.00 46.50  ? 421 LYS A CE    1 
ATOM   2426 N  NZ    . LYS A 1 315 ? 26.218  -12.197 -30.893 1.00 49.53  ? 421 LYS A NZ    1 
ATOM   2427 N  N     . LEU A 1 316 ? 23.322  -13.740 -23.485 1.00 35.51  ? 422 LEU A N     1 
ATOM   2428 C  CA    . LEU A 1 316 ? 22.986  -14.981 -22.790 1.00 33.98  ? 422 LEU A CA    1 
ATOM   2429 C  C     . LEU A 1 316 ? 22.005  -14.666 -21.672 1.00 32.15  ? 422 LEU A C     1 
ATOM   2430 O  O     . LEU A 1 316 ? 22.355  -14.070 -20.672 1.00 29.73  ? 422 LEU A O     1 
ATOM   2431 C  CB    . LEU A 1 316 ? 24.248  -15.671 -22.270 1.00 35.60  ? 422 LEU A CB    1 
ATOM   2432 C  CG    . LEU A 1 316 ? 23.951  -16.955 -21.424 1.00 36.94  ? 422 LEU A CG    1 
ATOM   2433 C  CD1   . LEU A 1 316 ? 23.261  -18.044 -22.230 1.00 36.84  ? 422 LEU A CD1   1 
ATOM   2434 C  CD2   . LEU A 1 316 ? 25.184  -17.506 -20.739 1.00 36.59  ? 422 LEU A CD2   1 
ATOM   2435 N  N     . THR A 1 317 ? 20.751  -15.037 -21.856 1.00 32.02  ? 423 THR A N     1 
ATOM   2436 C  CA    . THR A 1 317 ? 19.699  -14.594 -20.928 1.00 31.55  ? 423 THR A CA    1 
ATOM   2437 C  C     . THR A 1 317 ? 18.680  -15.710 -20.738 1.00 30.80  ? 423 THR A C     1 
ATOM   2438 O  O     . THR A 1 317 ? 18.899  -16.819 -21.247 1.00 34.10  ? 423 THR A O     1 
ATOM   2439 C  CB    . THR A 1 317 ? 19.002  -13.312 -21.464 1.00 32.82  ? 423 THR A CB    1 
ATOM   2440 O  OG1   . THR A 1 317 ? 18.261  -13.600 -22.673 1.00 32.63  ? 423 THR A OG1   1 
ATOM   2441 C  CG2   . THR A 1 317 ? 19.973  -12.147 -21.690 1.00 32.42  ? 423 THR A CG2   1 
ATOM   2442 N  N     . ASP A 1 318 ? 17.554  -15.419 -20.082 1.00 27.95  ? 424 ASP A N     1 
ATOM   2443 C  CA    . ASP A 1 318 ? 16.488  -16.428 -19.913 1.00 29.82  ? 424 ASP A CA    1 
ATOM   2444 C  C     . ASP A 1 318 ? 15.932  -17.007 -21.218 1.00 32.18  ? 424 ASP A C     1 
ATOM   2445 O  O     . ASP A 1 318 ? 15.252  -18.058 -21.221 1.00 34.37  ? 424 ASP A O     1 
ATOM   2446 C  CB    . ASP A 1 318 ? 15.296  -15.859 -19.141 1.00 27.67  ? 424 ASP A CB    1 
ATOM   2447 C  CG    . ASP A 1 318 ? 15.562  -15.654 -17.652 1.00 28.59  ? 424 ASP A CG    1 
ATOM   2448 O  OD1   . ASP A 1 318 ? 16.742  -15.812 -17.179 1.00 26.83  ? 424 ASP A OD1   1 
ATOM   2449 O  OD2   . ASP A 1 318 ? 14.546  -15.257 -16.950 1.00 26.18  ? 424 ASP A OD2   1 
ATOM   2450 N  N     . ASN A 1 319 ? 16.113  -16.254 -22.297 1.00 35.14  ? 425 ASN A N     1 
ATOM   2451 C  CA    . ASN A 1 319 ? 15.772  -16.657 -23.654 1.00 37.16  ? 425 ASN A CA    1 
ATOM   2452 C  C     . ASN A 1 319 ? 16.271  -18.033 -24.048 1.00 36.19  ? 425 ASN A C     1 
ATOM   2453 O  O     . ASN A 1 319 ? 15.580  -18.736 -24.799 1.00 35.28  ? 425 ASN A O     1 
ATOM   2454 C  CB    . ASN A 1 319 ? 16.418  -15.683 -24.624 1.00 39.31  ? 425 ASN A CB    1 
ATOM   2455 C  CG    . ASN A 1 319 ? 16.020  -15.978 -26.060 1.00 45.12  ? 425 ASN A CG    1 
ATOM   2456 O  OD1   . ASN A 1 319 ? 14.801  -15.919 -26.402 1.00 45.55  ? 425 ASN A OD1   1 
ATOM   2457 N  ND2   . ASN A 1 319 ? 17.024  -16.356 -26.903 1.00 42.65  ? 425 ASN A ND2   1 
ATOM   2458 N  N     . ILE A 1 320 ? 17.459  -18.391 -23.548 1.00 34.87  ? 426 ILE A N     1 
ATOM   2459 C  CA    . ILE A 1 320 ? 18.026  -19.697 -23.773 1.00 35.85  ? 426 ILE A CA    1 
ATOM   2460 C  C     . ILE A 1 320 ? 17.059  -20.869 -23.455 1.00 33.98  ? 426 ILE A C     1 
ATOM   2461 O  O     . ILE A 1 320 ? 17.104  -21.868 -24.137 1.00 32.79  ? 426 ILE A O     1 
ATOM   2462 C  CB    . ILE A 1 320 ? 19.362  -19.794 -22.987 1.00 40.04  ? 426 ILE A CB    1 
ATOM   2463 C  CG1   . ILE A 1 320 ? 20.342  -20.705 -23.636 1.00 42.92  ? 426 ILE A CG1   1 
ATOM   2464 C  CG2   . ILE A 1 320 ? 19.182  -20.250 -21.553 1.00 41.53  ? 426 ILE A CG2   1 
ATOM   2465 C  CD1   . ILE A 1 320 ? 20.987  -20.027 -24.828 1.00 45.26  ? 426 ILE A CD1   1 
ATOM   2466 N  N     . PHE A 1 321 ? 16.178  -20.716 -22.452 1.00 30.29  ? 427 PHE A N     1 
ATOM   2467 C  CA    . PHE A 1 321 ? 15.135  -21.686 -22.127 1.00 30.22  ? 427 PHE A CA    1 
ATOM   2468 C  C     . PHE A 1 321 ? 14.247  -21.932 -23.331 1.00 31.66  ? 427 PHE A C     1 
ATOM   2469 O  O     . PHE A 1 321 ? 13.972  -23.048 -23.701 1.00 31.31  ? 427 PHE A O     1 
ATOM   2470 C  CB    . PHE A 1 321 ? 14.265  -21.151 -20.922 1.00 28.68  ? 427 PHE A CB    1 
ATOM   2471 C  CG    . PHE A 1 321 ? 13.095  -22.040 -20.485 1.00 27.88  ? 427 PHE A CG    1 
ATOM   2472 C  CD1   . PHE A 1 321 ? 11.873  -21.931 -21.046 1.00 27.25  ? 427 PHE A CD1   1 
ATOM   2473 C  CD2   . PHE A 1 321 ? 13.196  -22.875 -19.350 1.00 29.58  ? 427 PHE A CD2   1 
ATOM   2474 C  CE1   . PHE A 1 321 ? 10.762  -22.660 -20.608 1.00 27.03  ? 427 PHE A CE1   1 
ATOM   2475 C  CE2   . PHE A 1 321 ? 12.115  -23.640 -18.915 1.00 27.58  ? 427 PHE A CE2   1 
ATOM   2476 C  CZ    . PHE A 1 321 ? 10.883  -23.523 -19.534 1.00 27.02  ? 427 PHE A CZ    1 
ATOM   2477 N  N     . LEU A 1 322 ? 13.746  -20.860 -23.904 1.00 33.43  ? 428 LEU A N     1 
ATOM   2478 C  CA    . LEU A 1 322 ? 12.831  -20.970 -25.068 1.00 32.91  ? 428 LEU A CA    1 
ATOM   2479 C  C     . LEU A 1 322 ? 13.555  -21.392 -26.356 1.00 33.20  ? 428 LEU A C     1 
ATOM   2480 O  O     . LEU A 1 322 ? 13.004  -22.175 -27.164 1.00 28.94  ? 428 LEU A O     1 
ATOM   2481 C  CB    . LEU A 1 322 ? 12.119  -19.637 -25.268 1.00 32.69  ? 428 LEU A CB    1 
ATOM   2482 C  CG    . LEU A 1 322 ? 11.176  -19.235 -24.107 1.00 33.73  ? 428 LEU A CG    1 
ATOM   2483 C  CD1   . LEU A 1 322 ? 10.615  -17.844 -24.236 1.00 32.09  ? 428 LEU A CD1   1 
ATOM   2484 C  CD2   . LEU A 1 322 ? 9.990   -20.205 -23.910 1.00 34.48  ? 428 LEU A CD2   1 
ATOM   2485 N  N     . GLU A 1 323 ? 14.772  -20.881 -26.566 1.00 36.08  ? 429 GLU A N     1 
ATOM   2486 C  CA    . GLU A 1 323 ? 15.645  -21.424 -27.632 1.00 37.97  ? 429 GLU A CA    1 
ATOM   2487 C  C     . GLU A 1 323 ? 15.646  -22.994 -27.579 1.00 37.35  ? 429 GLU A C     1 
ATOM   2488 O  O     . GLU A 1 323 ? 15.332  -23.629 -28.570 1.00 33.02  ? 429 GLU A O     1 
ATOM   2489 C  CB    . GLU A 1 323 ? 17.053  -20.884 -27.566 1.00 41.71  ? 429 GLU A CB    1 
ATOM   2490 C  CG    . GLU A 1 323 ? 17.801  -20.980 -28.900 1.00 47.73  ? 429 GLU A CG    1 
ATOM   2491 C  CD    . GLU A 1 323 ? 19.295  -20.486 -28.864 1.00 51.50  ? 429 GLU A CD    1 
ATOM   2492 O  OE1   . GLU A 1 323 ? 19.653  -19.435 -28.216 1.00 54.86  ? 429 GLU A OE1   1 
ATOM   2493 O  OE2   . GLU A 1 323 ? 20.154  -21.125 -29.545 1.00 55.38  ? 429 GLU A OE2   1 
ATOM   2494 N  N     . ILE A 1 324 ? 15.856  -23.578 -26.394 1.00 35.48  ? 430 ILE A N     1 
ATOM   2495 C  CA    . ILE A 1 324 ? 15.859  -25.033 -26.289 1.00 36.54  ? 430 ILE A CA    1 
ATOM   2496 C  C     . ILE A 1 324 ? 14.458  -25.635 -26.499 1.00 38.32  ? 430 ILE A C     1 
ATOM   2497 O  O     . ILE A 1 324 ? 14.248  -26.564 -27.296 1.00 41.13  ? 430 ILE A O     1 
ATOM   2498 C  CB    . ILE A 1 324 ? 16.426  -25.448 -24.940 1.00 37.08  ? 430 ILE A CB    1 
ATOM   2499 C  CG1   . ILE A 1 324 ? 17.893  -25.078 -24.882 1.00 36.07  ? 430 ILE A CG1   1 
ATOM   2500 C  CG2   . ILE A 1 324 ? 16.199  -26.921 -24.684 1.00 37.55  ? 430 ILE A CG2   1 
ATOM   2501 C  CD1   . ILE A 1 324 ? 18.486  -25.195 -23.523 1.00 37.07  ? 430 ILE A CD1   1 
ATOM   2502 N  N     . LEU A 1 325 ? 13.496  -25.074 -25.792 1.00 37.62  ? 431 LEU A N     1 
ATOM   2503 C  CA    . LEU A 1 325 ? 12.114  -25.560 -25.867 1.00 36.64  ? 431 LEU A CA    1 
ATOM   2504 C  C     . LEU A 1 325 ? 11.531  -25.496 -27.267 1.00 35.97  ? 431 LEU A C     1 
ATOM   2505 O  O     . LEU A 1 325 ? 10.687  -26.314 -27.602 1.00 34.01  ? 431 LEU A O     1 
ATOM   2506 C  CB    . LEU A 1 325 ? 11.212  -24.759 -24.917 1.00 36.16  ? 431 LEU A CB    1 
ATOM   2507 C  CG    . LEU A 1 325 ? 9.734   -25.158 -24.827 1.00 36.93  ? 431 LEU A CG    1 
ATOM   2508 C  CD1   . LEU A 1 325 ? 9.624   -26.434 -24.035 1.00 38.14  ? 431 LEU A CD1   1 
ATOM   2509 C  CD2   . LEU A 1 325 ? 8.807   -24.105 -24.219 1.00 37.50  ? 431 LEU A CD2   1 
ATOM   2510 N  N     . TYR A 1 326 ? 11.917  -24.495 -28.048 1.00 36.68  ? 432 TYR A N     1 
ATOM   2511 C  CA    . TYR A 1 326 ? 11.324  -24.326 -29.387 1.00 40.07  ? 432 TYR A CA    1 
ATOM   2512 C  C     . TYR A 1 326 ? 12.146  -25.014 -30.499 1.00 41.06  ? 432 TYR A C     1 
ATOM   2513 O  O     . TYR A 1 326 ? 11.672  -25.098 -31.618 1.00 46.11  ? 432 TYR A O     1 
ATOM   2514 C  CB    . TYR A 1 326 ? 11.134  -22.819 -29.758 1.00 38.84  ? 432 TYR A CB    1 
ATOM   2515 C  CG    . TYR A 1 326 ? 10.142  -21.993 -28.904 1.00 38.28  ? 432 TYR A CG    1 
ATOM   2516 C  CD1   . TYR A 1 326 ? 9.020   -22.597 -28.271 1.00 38.63  ? 432 TYR A CD1   1 
ATOM   2517 C  CD2   . TYR A 1 326 ? 10.283  -20.581 -28.795 1.00 36.07  ? 432 TYR A CD2   1 
ATOM   2518 C  CE1   . TYR A 1 326 ? 8.119   -21.846 -27.517 1.00 36.91  ? 432 TYR A CE1   1 
ATOM   2519 C  CE2   . TYR A 1 326 ? 9.358   -19.829 -28.064 1.00 35.31  ? 432 TYR A CE2   1 
ATOM   2520 C  CZ    . TYR A 1 326 ? 8.290   -20.457 -27.408 1.00 35.36  ? 432 TYR A CZ    1 
ATOM   2521 O  OH    . TYR A 1 326 ? 7.349   -19.764 -26.634 1.00 33.45  ? 432 TYR A OH    1 
ATOM   2522 N  N     . SER A 1 327 ? 13.357  -25.467 -30.206 1.00 40.72  ? 433 SER A N     1 
ATOM   2523 C  CA    . SER A 1 327 ? 14.188  -26.108 -31.195 1.00 40.91  ? 433 SER A CA    1 
ATOM   2524 C  C     . SER A 1 327 ? 13.568  -27.390 -31.854 1.00 44.16  ? 433 SER A C     1 
ATOM   2525 O  O     . SER A 1 327 ? 12.605  -28.033 -31.337 1.00 42.85  ? 433 SER A O     1 
ATOM   2526 C  CB    . SER A 1 327 ? 15.583  -26.433 -30.619 1.00 39.70  ? 433 SER A CB    1 
ATOM   2527 O  OG    . SER A 1 327 ? 15.472  -27.321 -29.538 1.00 41.56  ? 433 SER A OG    1 
ATOM   2528 N  N     . THR A 1 328 ? 14.146  -27.695 -33.025 1.00 46.00  ? 434 THR A N     1 
ATOM   2529 C  CA    . THR A 1 328 ? 13.924  -28.980 -33.775 1.00 48.47  ? 434 THR A CA    1 
ATOM   2530 C  C     . THR A 1 328 ? 15.221  -29.799 -34.018 1.00 48.91  ? 434 THR A C     1 
ATOM   2531 O  O     . THR A 1 328 ? 15.143  -30.992 -34.289 1.00 50.41  ? 434 THR A O     1 
ATOM   2532 C  CB    . THR A 1 328 ? 13.248  -28.724 -35.129 1.00 46.49  ? 434 THR A CB    1 
ATOM   2533 O  OG1   . THR A 1 328 ? 13.902  -27.613 -35.771 1.00 45.53  ? 434 THR A OG1   1 
ATOM   2534 C  CG2   . THR A 1 328 ? 11.785  -28.385 -34.925 1.00 46.05  ? 434 THR A CG2   1 
ATOM   2535 N  N     . ASP A 1 329 ? 16.389  -29.163 -33.895 1.00 48.00  ? 435 ASP A N     1 
ATOM   2536 C  CA    . ASP A 1 329 ? 17.637  -29.882 -33.906 1.00 47.50  ? 435 ASP A CA    1 
ATOM   2537 C  C     . ASP A 1 329 ? 17.535  -31.156 -33.083 1.00 45.89  ? 435 ASP A C     1 
ATOM   2538 O  O     . ASP A 1 329 ? 17.151  -31.089 -31.919 1.00 47.83  ? 435 ASP A O     1 
ATOM   2539 C  CB    . ASP A 1 329 ? 18.757  -29.018 -33.385 1.00 49.01  ? 435 ASP A CB    1 
ATOM   2540 C  CG    . ASP A 1 329 ? 20.119  -29.673 -33.533 1.00 52.65  ? 435 ASP A CG    1 
ATOM   2541 O  OD1   . ASP A 1 329 ? 20.264  -30.910 -33.705 1.00 52.31  ? 435 ASP A OD1   1 
ATOM   2542 O  OD2   . ASP A 1 329 ? 21.087  -28.904 -33.448 1.00 59.17  ? 435 ASP A OD2   1 
ATOM   2543 N  N     . PRO A 1 330 ? 17.871  -32.332 -33.686 1.00 46.04  ? 436 PRO A N     1 
ATOM   2544 C  CA    . PRO A 1 330 ? 17.831  -33.574 -32.936 1.00 43.15  ? 436 PRO A CA    1 
ATOM   2545 C  C     . PRO A 1 330 ? 18.859  -33.665 -31.809 1.00 43.21  ? 436 PRO A C     1 
ATOM   2546 O  O     . PRO A 1 330 ? 18.613  -34.368 -30.838 1.00 38.64  ? 436 PRO A O     1 
ATOM   2547 C  CB    . PRO A 1 330 ? 18.101  -34.637 -34.015 1.00 45.57  ? 436 PRO A CB    1 
ATOM   2548 C  CG    . PRO A 1 330 ? 17.719  -34.037 -35.311 1.00 45.34  ? 436 PRO A CG    1 
ATOM   2549 C  CD    . PRO A 1 330 ? 18.163  -32.606 -35.126 1.00 46.46  ? 436 PRO A CD    1 
ATOM   2550 N  N     . LYS A 1 331 ? 19.958  -32.937 -31.897 1.00 44.50  ? 437 LYS A N     1 
ATOM   2551 C  CA    . LYS A 1 331 ? 20.953  -32.919 -30.803 1.00 48.42  ? 437 LYS A CA    1 
ATOM   2552 C  C     . LYS A 1 331 ? 20.480  -32.320 -29.482 1.00 46.43  ? 437 LYS A C     1 
ATOM   2553 O  O     . LYS A 1 331 ? 21.096  -32.557 -28.466 1.00 45.81  ? 437 LYS A O     1 
ATOM   2554 C  CB    . LYS A 1 331 ? 22.196  -32.151 -31.224 1.00 54.54  ? 437 LYS A CB    1 
ATOM   2555 C  CG    . LYS A 1 331 ? 22.772  -32.593 -32.562 1.00 59.25  ? 437 LYS A CG    1 
ATOM   2556 C  CD    . LYS A 1 331 ? 24.287  -32.457 -32.643 1.00 63.76  ? 437 LYS A CD    1 
ATOM   2557 C  CE    . LYS A 1 331 ? 24.965  -33.631 -33.359 1.00 64.94  ? 437 LYS A CE    1 
ATOM   2558 N  NZ    . LYS A 1 331 ? 25.847  -33.098 -34.427 1.00 68.66  ? 437 LYS A NZ    1 
ATOM   2559 N  N     . LEU A 1 332 ? 19.382  -31.553 -29.523 1.00 46.73  ? 438 LEU A N     1 
ATOM   2560 C  CA    . LEU A 1 332 ? 18.738  -30.942 -28.351 1.00 44.16  ? 438 LEU A CA    1 
ATOM   2561 C  C     . LEU A 1 332 ? 17.511  -31.685 -27.901 1.00 45.03  ? 438 LEU A C     1 
ATOM   2562 O  O     . LEU A 1 332 ? 16.887  -31.254 -26.958 1.00 47.76  ? 438 LEU A O     1 
ATOM   2563 C  CB    . LEU A 1 332 ? 18.332  -29.488 -28.632 1.00 41.23  ? 438 LEU A CB    1 
ATOM   2564 C  CG    . LEU A 1 332 ? 19.503  -28.540 -28.938 1.00 41.69  ? 438 LEU A CG    1 
ATOM   2565 C  CD1   . LEU A 1 332 ? 19.025  -27.213 -29.477 1.00 41.22  ? 438 LEU A CD1   1 
ATOM   2566 C  CD2   . LEU A 1 332 ? 20.389  -28.327 -27.700 1.00 42.62  ? 438 LEU A CD2   1 
ATOM   2567 N  N     . LYS A 1 333 ? 17.152  -32.803 -28.496 1.00 44.37  ? 439 LYS A N     1 
ATOM   2568 C  CA    . LYS A 1 333 ? 15.964  -33.515 -28.009 1.00 46.89  ? 439 LYS A CA    1 
ATOM   2569 C  C     . LYS A 1 333 ? 16.004  -33.812 -26.503 1.00 43.40  ? 439 LYS A C     1 
ATOM   2570 O  O     . LYS A 1 333 ? 14.991  -33.672 -25.819 1.00 40.24  ? 439 LYS A O     1 
ATOM   2571 C  CB    . LYS A 1 333 ? 15.706  -34.808 -28.786 1.00 50.43  ? 439 LYS A CB    1 
ATOM   2572 C  CG    . LYS A 1 333 ? 14.333  -35.385 -28.516 1.00 56.25  ? 439 LYS A CG    1 
ATOM   2573 C  CD    . LYS A 1 333 ? 14.109  -36.753 -29.122 1.00 61.92  ? 439 LYS A CD    1 
ATOM   2574 C  CE    . LYS A 1 333 ? 12.803  -37.369 -28.610 1.00 63.39  ? 439 LYS A CE    1 
ATOM   2575 N  NZ    . LYS A 1 333 ? 12.106  -38.091 -29.723 1.00 64.09  ? 439 LYS A NZ    1 
ATOM   2576 N  N     . ASP A 1 334 ? 17.158  -34.198 -25.992 1.00 42.05  ? 440 ASP A N     1 
ATOM   2577 C  CA    . ASP A 1 334 ? 17.245  -34.607 -24.590 1.00 44.47  ? 440 ASP A CA    1 
ATOM   2578 C  C     . ASP A 1 334 ? 16.903  -33.423 -23.660 1.00 41.15  ? 440 ASP A C     1 
ATOM   2579 O  O     . ASP A 1 334 ? 16.093  -33.566 -22.773 1.00 37.90  ? 440 ASP A O     1 
ATOM   2580 C  CB    . ASP A 1 334 ? 18.675  -35.065 -24.236 1.00 49.05  ? 440 ASP A CB    1 
ATOM   2581 C  CG    . ASP A 1 334 ? 18.946  -36.492 -24.499 1.00 53.28  ? 440 ASP A CG    1 
ATOM   2582 O  OD1   . ASP A 1 334 ? 18.279  -37.120 -25.330 1.00 57.87  ? 440 ASP A OD1   1 
ATOM   2583 O  OD2   . ASP A 1 334 ? 19.878  -36.984 -23.834 1.00 61.43  ? 440 ASP A OD2   1 
ATOM   2584 N  N     . ALA A 1 335 ? 17.588  -32.292 -23.881 1.00 38.92  ? 441 ALA A N     1 
ATOM   2585 C  CA    . ALA A 1 335 ? 17.339  -31.045 -23.187 1.00 38.73  ? 441 ALA A CA    1 
ATOM   2586 C  C     . ALA A 1 335 ? 15.892  -30.583 -23.315 1.00 39.30  ? 441 ALA A C     1 
ATOM   2587 O  O     . ALA A 1 335 ? 15.293  -30.241 -22.340 1.00 40.81  ? 441 ALA A O     1 
ATOM   2588 C  CB    . ALA A 1 335 ? 18.294  -29.974 -23.693 1.00 38.97  ? 441 ALA A CB    1 
ATOM   2589 N  N     . ARG A 1 336 ? 15.350  -30.593 -24.521 1.00 37.97  ? 442 ARG A N     1 
ATOM   2590 C  CA    . ARG A 1 336 ? 13.976  -30.283 -24.814 1.00 40.15  ? 442 ARG A CA    1 
ATOM   2591 C  C     . ARG A 1 336 ? 12.979  -31.140 -24.041 1.00 39.01  ? 442 ARG A C     1 
ATOM   2592 O  O     . ARG A 1 336 ? 11.999  -30.636 -23.485 1.00 36.26  ? 442 ARG A O     1 
ATOM   2593 C  CB    . ARG A 1 336 ? 13.754  -30.428 -26.328 1.00 43.49  ? 442 ARG A CB    1 
ATOM   2594 C  CG    . ARG A 1 336 ? 12.502  -29.792 -26.920 1.00 46.34  ? 442 ARG A CG    1 
ATOM   2595 C  CD    . ARG A 1 336 ? 12.661  -29.538 -28.432 1.00 50.20  ? 442 ARG A CD    1 
ATOM   2596 N  NE    . ARG A 1 336 ? 13.033  -30.759 -29.189 1.00 52.87  ? 442 ARG A NE    1 
ATOM   2597 C  CZ    . ARG A 1 336 ? 14.095  -30.899 -30.012 1.00 55.56  ? 442 ARG A CZ    1 
ATOM   2598 N  NH1   . ARG A 1 336 ? 14.966  -29.927 -30.301 1.00 52.63  ? 442 ARG A NH1   1 
ATOM   2599 N  NH2   . ARG A 1 336 ? 14.291  -32.061 -30.589 1.00 59.79  ? 442 ARG A NH2   1 
ATOM   2600 N  N     . GLU A 1 337 ? 13.207  -32.429 -23.976 1.00 40.50  ? 443 GLU A N     1 
ATOM   2601 C  CA    . GLU A 1 337 ? 12.256  -33.309 -23.290 1.00 41.69  ? 443 GLU A CA    1 
ATOM   2602 C  C     . GLU A 1 337 ? 12.175  -32.988 -21.789 1.00 41.76  ? 443 GLU A C     1 
ATOM   2603 O  O     . GLU A 1 337 ? 11.119  -33.137 -21.164 1.00 41.97  ? 443 GLU A O     1 
ATOM   2604 C  CB    . GLU A 1 337 ? 12.606  -34.808 -23.522 1.00 45.21  ? 443 GLU A CB    1 
ATOM   2605 C  CG    . GLU A 1 337 ? 12.235  -35.329 -24.952 1.00 48.66  ? 443 GLU A CG    1 
ATOM   2606 C  CD    . GLU A 1 337 ? 10.753  -35.188 -25.285 1.00 48.91  ? 443 GLU A CD    1 
ATOM   2607 O  OE1   . GLU A 1 337 ? 9.970   -35.515 -24.374 1.00 55.34  ? 443 GLU A OE1   1 
ATOM   2608 O  OE2   . GLU A 1 337 ? 10.374  -34.723 -26.397 1.00 50.60  ? 443 GLU A OE2   1 
ATOM   2609 N  N     . ILE A 1 338 ? 13.273  -32.567 -21.190 1.00 39.36  ? 444 ILE A N     1 
ATOM   2610 C  CA    . ILE A 1 338 ? 13.223  -32.107 -19.801 1.00 39.38  ? 444 ILE A CA    1 
ATOM   2611 C  C     . ILE A 1 338 ? 12.333  -30.852 -19.632 1.00 35.74  ? 444 ILE A C     1 
ATOM   2612 O  O     . ILE A 1 338 ? 11.443  -30.851 -18.795 1.00 32.71  ? 444 ILE A O     1 
ATOM   2613 C  CB    . ILE A 1 338 ? 14.641  -31.916 -19.217 1.00 41.50  ? 444 ILE A CB    1 
ATOM   2614 C  CG1   . ILE A 1 338 ? 15.319  -33.290 -19.090 1.00 40.82  ? 444 ILE A CG1   1 
ATOM   2615 C  CG2   . ILE A 1 338 ? 14.605  -31.302 -17.812 1.00 41.80  ? 444 ILE A CG2   1 
ATOM   2616 C  CD1   . ILE A 1 338 ? 16.804  -33.219 -18.855 1.00 40.52  ? 444 ILE A CD1   1 
ATOM   2617 N  N     . LEU A 1 339 ? 12.534  -29.851 -20.483 1.00 33.83  ? 445 LEU A N     1 
ATOM   2618 C  CA    . LEU A 1 339 ? 11.702  -28.673 -20.466 1.00 34.29  ? 445 LEU A CA    1 
ATOM   2619 C  C     . LEU A 1 339 ? 10.237  -28.995 -20.733 1.00 34.72  ? 445 LEU A C     1 
ATOM   2620 O  O     . LEU A 1 339 ? 9.371   -28.463 -20.079 1.00 33.26  ? 445 LEU A O     1 
ATOM   2621 C  CB    . LEU A 1 339 ? 12.257  -27.559 -21.348 1.00 34.38  ? 445 LEU A CB    1 
ATOM   2622 C  CG    . LEU A 1 339 ? 13.722  -27.102 -21.090 1.00 36.14  ? 445 LEU A CG    1 
ATOM   2623 C  CD1   . LEU A 1 339 ? 14.094  -25.844 -21.873 1.00 35.51  ? 445 LEU A CD1   1 
ATOM   2624 C  CD2   . LEU A 1 339 ? 14.080  -26.883 -19.629 1.00 35.48  ? 445 LEU A CD2   1 
ATOM   2625 N  N     . LYS A 1 340 ? 9.946   -29.937 -21.597 1.00 39.59  ? 446 LYS A N     1 
ATOM   2626 C  CA    . LYS A 1 340 ? 8.558   -30.336 -21.811 1.00 44.32  ? 446 LYS A CA    1 
ATOM   2627 C  C     . LYS A 1 340 ? 7.979   -30.990 -20.566 1.00 42.46  ? 446 LYS A C     1 
ATOM   2628 O  O     . LYS A 1 340 ? 6.809   -30.746 -20.253 1.00 42.83  ? 446 LYS A O     1 
ATOM   2629 C  CB    . LYS A 1 340 ? 8.393   -31.216 -23.060 1.00 51.19  ? 446 LYS A CB    1 
ATOM   2630 C  CG    . LYS A 1 340 ? 8.213   -30.343 -24.287 1.00 59.16  ? 446 LYS A CG    1 
ATOM   2631 C  CD    . LYS A 1 340 ? 8.242   -31.148 -25.590 1.00 68.99  ? 446 LYS A CD    1 
ATOM   2632 C  CE    . LYS A 1 340 ? 8.582   -30.229 -26.775 1.00 76.83  ? 446 LYS A CE    1 
ATOM   2633 N  NZ    . LYS A 1 340 ? 8.918   -30.939 -28.037 1.00 79.62  ? 446 LYS A NZ    1 
ATOM   2634 N  N     . GLN A 1 341 ? 8.768   -31.779 -19.826 1.00 39.39  ? 447 GLN A N     1 
ATOM   2635 C  CA    . GLN A 1 341 ? 8.238   -32.349 -18.594 1.00 40.41  ? 447 GLN A CA    1 
ATOM   2636 C  C     . GLN A 1 341 ? 7.805   -31.249 -17.556 1.00 37.73  ? 447 GLN A C     1 
ATOM   2637 O  O     . GLN A 1 341 ? 6.774   -31.367 -16.917 1.00 35.45  ? 447 GLN A O     1 
ATOM   2638 C  CB    . GLN A 1 341 ? 9.165   -33.463 -18.020 1.00 43.63  ? 447 GLN A CB    1 
ATOM   2639 C  CG    . GLN A 1 341 ? 9.099   -34.796 -18.823 1.00 48.98  ? 447 GLN A CG    1 
ATOM   2640 C  CD    . GLN A 1 341 ? 7.796   -35.035 -19.702 1.00 53.14  ? 447 GLN A CD    1 
ATOM   2641 O  OE1   . GLN A 1 341 ? 6.720   -35.406 -19.199 1.00 55.88  ? 447 GLN A OE1   1 
ATOM   2642 N  NE2   . GLN A 1 341 ? 7.913   -34.810 -21.030 1.00 56.74  ? 447 GLN A NE2   1 
ATOM   2643 N  N     . ILE A 1 342 ? 8.556   -30.144 -17.501 1.00 34.38  ? 448 ILE A N     1 
ATOM   2644 C  CA    . ILE A 1 342 ? 8.163   -28.969 -16.745 1.00 33.32  ? 448 ILE A CA    1 
ATOM   2645 C  C     . ILE A 1 342 ? 6.782   -28.412 -17.173 1.00 32.43  ? 448 ILE A C     1 
ATOM   2646 O  O     . ILE A 1 342 ? 5.953   -28.191 -16.328 1.00 27.44  ? 448 ILE A O     1 
ATOM   2647 C  CB    . ILE A 1 342 ? 9.217   -27.877 -16.823 1.00 31.93  ? 448 ILE A CB    1 
ATOM   2648 C  CG1   . ILE A 1 342 ? 10.544  -28.380 -16.220 1.00 31.88  ? 448 ILE A CG1   1 
ATOM   2649 C  CG2   . ILE A 1 342 ? 8.672   -26.644 -16.123 1.00 32.28  ? 448 ILE A CG2   1 
ATOM   2650 C  CD1   . ILE A 1 342 ? 11.744  -27.393 -16.233 1.00 32.62  ? 448 ILE A CD1   1 
ATOM   2651 N  N     . GLU A 1 343 ? 6.549   -28.200 -18.472 1.00 34.54  ? 449 GLU A N     1 
ATOM   2652 C  CA    . GLU A 1 343 ? 5.288   -27.598 -18.973 1.00 35.80  ? 449 GLU A CA    1 
ATOM   2653 C  C     . GLU A 1 343 ? 4.077   -28.454 -18.659 1.00 36.81  ? 449 GLU A C     1 
ATOM   2654 O  O     . GLU A 1 343 ? 3.005   -27.903 -18.439 1.00 38.44  ? 449 GLU A O     1 
ATOM   2655 C  CB    . GLU A 1 343 ? 5.272   -27.460 -20.494 1.00 35.87  ? 449 GLU A CB    1 
ATOM   2656 C  CG    . GLU A 1 343 ? 6.234   -26.468 -21.036 1.00 39.17  ? 449 GLU A CG    1 
ATOM   2657 C  CD    . GLU A 1 343 ? 5.786   -25.895 -22.389 1.00 41.47  ? 449 GLU A CD    1 
ATOM   2658 O  OE1   . GLU A 1 343 ? 5.776   -26.681 -23.368 1.00 41.01  ? 449 GLU A OE1   1 
ATOM   2659 O  OE2   . GLU A 1 343 ? 5.457   -24.653 -22.450 1.00 42.68  ? 449 GLU A OE2   1 
ATOM   2660 N  N     . TYR A 1 344 ? 4.224   -29.779 -18.743 1.00 36.31  ? 450 TYR A N     1 
ATOM   2661 C  CA    . TYR A 1 344 ? 3.133   -30.693 -18.426 1.00 37.52  ? 450 TYR A CA    1 
ATOM   2662 C  C     . TYR A 1 344 ? 3.028   -30.897 -16.936 1.00 37.71  ? 450 TYR A C     1 
ATOM   2663 O  O     . TYR A 1 344 ? 2.132   -31.602 -16.480 1.00 37.11  ? 450 TYR A O     1 
ATOM   2664 C  CB    . TYR A 1 344 ? 3.296   -32.103 -19.138 1.00 40.26  ? 450 TYR A CB    1 
ATOM   2665 C  CG    . TYR A 1 344 ? 3.104   -32.110 -20.637 1.00 40.05  ? 450 TYR A CG    1 
ATOM   2666 C  CD1   . TYR A 1 344 ? 1.844   -31.960 -21.216 1.00 41.16  ? 450 TYR A CD1   1 
ATOM   2667 C  CD2   . TYR A 1 344 ? 4.216   -32.228 -21.505 1.00 42.67  ? 450 TYR A CD2   1 
ATOM   2668 C  CE1   . TYR A 1 344 ? 1.701   -31.921 -22.637 1.00 41.15  ? 450 TYR A CE1   1 
ATOM   2669 C  CE2   . TYR A 1 344 ? 4.076   -32.205 -22.914 1.00 41.15  ? 450 TYR A CE2   1 
ATOM   2670 C  CZ    . TYR A 1 344 ? 2.820   -32.061 -23.443 1.00 40.50  ? 450 TYR A CZ    1 
ATOM   2671 O  OH    . TYR A 1 344 ? 2.664   -32.072 -24.778 1.00 45.20  ? 450 TYR A OH    1 
ATOM   2672 N  N     . ARG A 1 345 ? 3.945   -30.301 -16.169 1.00 36.41  ? 451 ARG A N     1 
ATOM   2673 C  CA    . ARG A 1 345 ? 3.959   -30.434 -14.727 1.00 36.70  ? 451 ARG A CA    1 
ATOM   2674 C  C     . ARG A 1 345 ? 4.223   -31.886 -14.280 1.00 37.12  ? 451 ARG A C     1 
ATOM   2675 O  O     . ARG A 1 345 ? 3.626   -32.329 -13.286 1.00 35.08  ? 451 ARG A O     1 
ATOM   2676 C  CB    . ARG A 1 345 ? 2.647   -29.786 -14.102 1.00 36.39  ? 451 ARG A CB    1 
ATOM   2677 C  CG    . ARG A 1 345 ? 2.739   -29.176 -12.671 1.00 35.96  ? 451 ARG A CG    1 
ATOM   2678 C  CD    . ARG A 1 345 ? 3.541   -27.884 -12.671 1.00 35.62  ? 451 ARG A CD    1 
ATOM   2679 N  NE    . ARG A 1 345 ? 3.772   -27.305 -11.318 1.00 34.29  ? 451 ARG A NE    1 
ATOM   2680 C  CZ    . ARG A 1 345 ? 4.358   -26.120 -11.135 1.00 32.45  ? 451 ARG A CZ    1 
ATOM   2681 N  NH1   . ARG A 1 345 ? 4.816   -25.391 -12.199 1.00 30.54  ? 451 ARG A NH1   1 
ATOM   2682 N  NH2   . ARG A 1 345 ? 4.481   -25.624 -9.918  1.00 30.44  ? 451 ARG A NH2   1 
ATOM   2683 N  N     . ASN A 1 346 ? 5.125   -32.616 -14.977 1.00 38.57  ? 452 ASN A N     1 
ATOM   2684 C  CA    . ASN A 1 346 ? 5.626   -33.926 -14.530 1.00 42.28  ? 452 ASN A CA    1 
ATOM   2685 C  C     . ASN A 1 346 ? 7.015   -33.753 -13.908 1.00 41.05  ? 452 ASN A C     1 
ATOM   2686 O  O     . ASN A 1 346 ? 8.061   -34.088 -14.535 1.00 41.54  ? 452 ASN A O     1 
ATOM   2687 C  CB    . ASN A 1 346 ? 5.709   -34.967 -15.649 1.00 45.91  ? 452 ASN A CB    1 
ATOM   2688 C  CG    . ASN A 1 346 ? 4.357   -35.257 -16.288 1.00 52.25  ? 452 ASN A CG    1 
ATOM   2689 O  OD1   . ASN A 1 346 ? 3.277   -35.331 -15.630 1.00 58.39  ? 452 ASN A OD1   1 
ATOM   2690 N  ND2   . ASN A 1 346 ? 4.400   -35.444 -17.588 1.00 56.64  ? 452 ASN A ND2   1 
ATOM   2691 N  N     . LEU A 1 347 ? 6.997   -33.277 -12.676 1.00 40.81  ? 453 LEU A N     1 
ATOM   2692 C  CA    . LEU A 1 347 ? 8.188   -32.882 -11.928 1.00 41.58  ? 453 LEU A CA    1 
ATOM   2693 C  C     . LEU A 1 347 ? 8.664   -34.038 -11.100 1.00 41.57  ? 453 LEU A C     1 
ATOM   2694 O  O     . LEU A 1 347 ? 7.840   -34.856 -10.676 1.00 42.20  ? 453 LEU A O     1 
ATOM   2695 C  CB    . LEU A 1 347 ? 7.900   -31.651 -11.030 1.00 38.68  ? 453 LEU A CB    1 
ATOM   2696 C  CG    . LEU A 1 347 ? 7.144   -30.460 -11.645 1.00 39.28  ? 453 LEU A CG    1 
ATOM   2697 C  CD1   . LEU A 1 347 ? 6.976   -29.342 -10.608 1.00 39.51  ? 453 LEU A CD1   1 
ATOM   2698 C  CD2   . LEU A 1 347 ? 7.848   -29.903 -12.889 1.00 39.80  ? 453 LEU A CD2   1 
ATOM   2699 N  N     . PHE A 1 348 ? 9.970   -34.085 -10.861 1.00 42.16  ? 454 PHE A N     1 
ATOM   2700 C  CA    . PHE A 1 348 ? 10.514  -35.008 -9.865  1.00 45.34  ? 454 PHE A CA    1 
ATOM   2701 C  C     . PHE A 1 348 ? 9.733   -34.774 -8.560  1.00 46.01  ? 454 PHE A C     1 
ATOM   2702 O  O     . PHE A 1 348 ? 9.237   -33.661 -8.307  1.00 48.55  ? 454 PHE A O     1 
ATOM   2703 C  CB    . PHE A 1 348 ? 12.016  -34.790 -9.606  1.00 45.05  ? 454 PHE A CB    1 
ATOM   2704 C  CG    . PHE A 1 348 ? 12.891  -34.778 -10.870 1.00 45.78  ? 454 PHE A CG    1 
ATOM   2705 C  CD1   . PHE A 1 348 ? 12.530  -35.483 -12.022 1.00 46.17  ? 454 PHE A CD1   1 
ATOM   2706 C  CD2   . PHE A 1 348 ? 14.119  -34.092 -10.880 1.00 45.17  ? 454 PHE A CD2   1 
ATOM   2707 C  CE1   . PHE A 1 348 ? 13.360  -35.499 -13.149 1.00 45.93  ? 454 PHE A CE1   1 
ATOM   2708 C  CE2   . PHE A 1 348 ? 14.929  -34.062 -12.012 1.00 46.63  ? 454 PHE A CE2   1 
ATOM   2709 C  CZ    . PHE A 1 348 ? 14.557  -34.778 -13.144 1.00 46.51  ? 454 PHE A CZ    1 
ATOM   2710 N  N     . LYS A 1 349 ? 9.533   -35.855 -7.808  1.00 45.37  ? 455 LYS A N     1 
ATOM   2711 C  CA    . LYS A 1 349 ? 8.616   -35.880 -6.679  1.00 46.93  ? 455 LYS A CA    1 
ATOM   2712 C  C     . LYS A 1 349 ? 9.411   -35.665 -5.370  1.00 46.31  ? 455 LYS A C     1 
ATOM   2713 O  O     . LYS A 1 349 ? 10.467  -36.257 -5.151  1.00 46.22  ? 455 LYS A O     1 
ATOM   2714 C  CB    . LYS A 1 349 ? 7.872   -37.201 -6.619  1.00 48.77  ? 455 LYS A CB    1 
ATOM   2715 C  CG    . LYS A 1 349 ? 7.085   -37.556 -7.884  1.00 51.28  ? 455 LYS A CG    1 
ATOM   2716 C  CD    . LYS A 1 349 ? 6.034   -36.533 -8.279  1.00 51.69  ? 455 LYS A CD    1 
ATOM   2717 C  CE    . LYS A 1 349 ? 4.938   -36.414 -7.242  1.00 53.40  ? 455 LYS A CE    1 
ATOM   2718 N  NZ    . LYS A 1 349 ? 4.409   -35.038 -7.058  1.00 53.28  ? 455 LYS A NZ    1 
ATOM   2719 N  N     . TYR A 1 350 ? 8.866   -34.793 -4.532  1.00 45.71  ? 456 TYR A N     1 
ATOM   2720 C  CA    . TYR A 1 350 ? 9.437   -34.422 -3.255  1.00 46.98  ? 456 TYR A CA    1 
ATOM   2721 C  C     . TYR A 1 350 ? 9.161   -35.546 -2.274  1.00 48.74  ? 456 TYR A C     1 
ATOM   2722 O  O     . TYR A 1 350 ? 8.027   -35.923 -2.091  1.00 50.50  ? 456 TYR A O     1 
ATOM   2723 C  CB    . TYR A 1 350 ? 8.804   -33.119 -2.736  1.00 46.54  ? 456 TYR A CB    1 
ATOM   2724 C  CG    . TYR A 1 350 ? 9.227   -32.641 -1.349  1.00 44.30  ? 456 TYR A CG    1 
ATOM   2725 C  CD1   . TYR A 1 350 ? 10.561  -32.289 -1.074  1.00 43.70  ? 456 TYR A CD1   1 
ATOM   2726 C  CD2   . TYR A 1 350 ? 8.267   -32.485 -0.338  1.00 43.59  ? 456 TYR A CD2   1 
ATOM   2727 C  CE1   . TYR A 1 350 ? 10.936  -31.830 0.196   1.00 45.23  ? 456 TYR A CE1   1 
ATOM   2728 C  CE2   . TYR A 1 350 ? 8.603   -32.035 0.930   1.00 46.62  ? 456 TYR A CE2   1 
ATOM   2729 C  CZ    . TYR A 1 350 ? 9.936   -31.710 1.220   1.00 46.71  ? 456 TYR A CZ    1 
ATOM   2730 O  OH    . TYR A 1 350 ? 10.189  -31.272 2.506   1.00 42.61  ? 456 TYR A OH    1 
ATOM   2731 N  N     . VAL A 1 351 ? 10.201  -36.066 -1.640  1.00 48.28  ? 457 VAL A N     1 
ATOM   2732 C  CA    . VAL A 1 351 ? 10.047  -37.198 -0.758  1.00 47.97  ? 457 VAL A CA    1 
ATOM   2733 C  C     . VAL A 1 351 ? 9.968   -36.725 0.705   1.00 46.85  ? 457 VAL A C     1 
ATOM   2734 O  O     . VAL A 1 351 ? 9.205   -37.250 1.485   1.00 43.70  ? 457 VAL A O     1 
ATOM   2735 C  CB    . VAL A 1 351 ? 11.198  -38.187 -0.935  1.00 49.24  ? 457 VAL A CB    1 
ATOM   2736 C  CG1   . VAL A 1 351 ? 10.922  -39.424 -0.079  1.00 50.09  ? 457 VAL A CG1   1 
ATOM   2737 C  CG2   . VAL A 1 351 ? 11.325  -38.603 -2.371  1.00 49.06  ? 457 VAL A CG2   1 
ATOM   2738 N  N     . GLY A 1 352 ? 10.784  -35.748 1.056   1.00 47.61  ? 458 GLY A N     1 
ATOM   2739 C  CA    . GLY A 1 352 ? 10.785  -35.184 2.394   1.00 48.42  ? 458 GLY A CA    1 
ATOM   2740 C  C     . GLY A 1 352 ? 12.025  -34.375 2.665   1.00 45.67  ? 458 GLY A C     1 
ATOM   2741 O  O     . GLY A 1 352 ? 12.899  -34.198 1.774   1.00 44.87  ? 458 GLY A O     1 
ATOM   2742 N  N     . GLU A 1 353 ? 12.055  -33.881 3.899   1.00 44.57  ? 459 GLU A N     1 
ATOM   2743 C  CA    . GLU A 1 353 ? 13.117  -33.061 4.428   1.00 43.44  ? 459 GLU A CA    1 
ATOM   2744 C  C     . GLU A 1 353 ? 13.570  -33.638 5.770   1.00 43.21  ? 459 GLU A C     1 
ATOM   2745 O  O     . GLU A 1 353 ? 12.782  -34.200 6.535   1.00 44.28  ? 459 GLU A O     1 
ATOM   2746 C  CB    . GLU A 1 353 ? 12.607  -31.608 4.638   1.00 43.77  ? 459 GLU A CB    1 
ATOM   2747 C  CG    . GLU A 1 353 ? 13.705  -30.548 4.940   1.00 46.96  ? 459 GLU A CG    1 
ATOM   2748 C  CD    . GLU A 1 353 ? 13.124  -29.149 5.152   1.00 49.31  ? 459 GLU A CD    1 
ATOM   2749 O  OE1   . GLU A 1 353 ? 12.271  -29.007 6.030   1.00 51.52  ? 459 GLU A OE1   1 
ATOM   2750 O  OE2   . GLU A 1 353 ? 13.464  -28.180 4.438   1.00 52.51  ? 459 GLU A OE2   1 
ATOM   2751 N  N     . THR A 1 354 ? 14.838  -33.431 6.066   1.00 42.40  ? 460 THR A N     1 
ATOM   2752 C  CA    . THR A 1 354 ? 15.417  -33.776 7.334   1.00 42.80  ? 460 THR A CA    1 
ATOM   2753 C  C     . THR A 1 354 ? 16.589  -32.856 7.580   1.00 43.22  ? 460 THR A C     1 
ATOM   2754 O  O     . THR A 1 354 ? 17.062  -32.178 6.650   1.00 47.75  ? 460 THR A O     1 
ATOM   2755 C  CB    . THR A 1 354 ? 15.887  -35.266 7.387   1.00 44.19  ? 460 THR A CB    1 
ATOM   2756 O  OG1   . THR A 1 354 ? 16.257  -35.589 8.725   1.00 49.94  ? 460 THR A OG1   1 
ATOM   2757 C  CG2   . THR A 1 354 ? 17.076  -35.550 6.489   1.00 44.02  ? 460 THR A CG2   1 
ATOM   2758 N  N     . GLN A 1 355 ? 17.039  -32.837 8.824   1.00 43.74  ? 461 GLN A N     1 
ATOM   2759 C  CA    . GLN A 1 355 ? 18.176  -32.074 9.261   1.00 46.34  ? 461 GLN A CA    1 
ATOM   2760 C  C     . GLN A 1 355 ? 19.150  -32.955 10.077  1.00 49.03  ? 461 GLN A C     1 
ATOM   2761 O  O     . GLN A 1 355 ? 18.714  -33.909 10.776  1.00 45.76  ? 461 GLN A O     1 
ATOM   2762 C  CB    . GLN A 1 355 ? 17.729  -30.947 10.186  1.00 47.41  ? 461 GLN A CB    1 
ATOM   2763 C  CG    . GLN A 1 355 ? 16.854  -29.893 9.566   1.00 47.87  ? 461 GLN A CG    1 
ATOM   2764 C  CD    . GLN A 1 355 ? 16.605  -28.794 10.560  1.00 49.22  ? 461 GLN A CD    1 
ATOM   2765 O  OE1   . GLN A 1 355 ? 15.541  -28.756 11.187  1.00 52.32  ? 461 GLN A OE1   1 
ATOM   2766 N  NE2   . GLN A 1 355 ? 17.618  -27.932 10.775  1.00 45.47  ? 461 GLN A NE2   1 
ATOM   2767 N  N     . PRO A 1 356 ? 20.450  -32.557 10.077  1.00 52.53  ? 462 PRO A N     1 
ATOM   2768 C  CA    . PRO A 1 356 ? 21.379  -33.147 10.986  1.00 59.33  ? 462 PRO A CA    1 
ATOM   2769 C  C     . PRO A 1 356 ? 21.058  -32.885 12.478  1.00 66.56  ? 462 PRO A C     1 
ATOM   2770 O  O     . PRO A 1 356 ? 20.012  -32.368 12.840  1.00 67.93  ? 462 PRO A O     1 
ATOM   2771 C  CB    . PRO A 1 356 ? 22.721  -32.496 10.612  1.00 57.50  ? 462 PRO A CB    1 
ATOM   2772 C  CG    . PRO A 1 356 ? 22.511  -31.810 9.345   1.00 55.76  ? 462 PRO A CG    1 
ATOM   2773 C  CD    . PRO A 1 356 ? 21.085  -31.432 9.373   1.00 54.11  ? 462 PRO A CD    1 
ATOM   2774 N  N     . THR A 1 357 ? 21.960  -33.337 13.329  1.00 75.40  ? 463 THR A N     1 
ATOM   2775 C  CA    . THR A 1 357 ? 21.696  -33.448 14.746  1.00 77.35  ? 463 THR A CA    1 
ATOM   2776 C  C     . THR A 1 357 ? 22.986  -33.477 15.575  1.00 80.05  ? 463 THR A C     1 
ATOM   2777 O  O     . THR A 1 357 ? 24.084  -33.699 15.056  1.00 78.49  ? 463 THR A O     1 
ATOM   2778 C  CB    . THR A 1 357 ? 20.924  -34.728 14.989  1.00 77.82  ? 463 THR A CB    1 
ATOM   2779 O  OG1   . THR A 1 357 ? 20.556  -34.762 16.356  1.00 85.41  ? 463 THR A OG1   1 
ATOM   2780 C  CG2   . THR A 1 357 ? 21.801  -35.972 14.679  1.00 78.81  ? 463 THR A CG2   1 
ATOM   2781 N  N     . GLY A 1 358 ? 22.865  -33.264 16.881  1.00 90.13  ? 464 GLY A N     1 
ATOM   2782 C  CA    . GLY A 1 358 ? 24.033  -32.949 17.709  1.00 97.01  ? 464 GLY A CA    1 
ATOM   2783 C  C     . GLY A 1 358 ? 24.455  -31.561 17.244  1.00 100.40 ? 464 GLY A C     1 
ATOM   2784 O  O     . GLY A 1 358 ? 23.595  -30.674 17.128  1.00 105.86 ? 464 GLY A O     1 
ATOM   2785 N  N     . GLN A 1 359 ? 25.738  -31.356 16.944  1.00 97.57  ? 465 GLN A N     1 
ATOM   2786 C  CA    . GLN A 1 359 ? 26.138  -30.133 16.252  1.00 86.93  ? 465 GLN A CA    1 
ATOM   2787 C  C     . GLN A 1 359 ? 26.851  -30.514 14.932  1.00 82.84  ? 465 GLN A C     1 
ATOM   2788 O  O     . GLN A 1 359 ? 27.617  -29.693 14.402  1.00 74.93  ? 465 GLN A O     1 
ATOM   2789 C  CB    . GLN A 1 359 ? 26.942  -29.204 17.211  1.00 84.15  ? 465 GLN A CB    1 
ATOM   2790 C  CG    . GLN A 1 359 ? 26.556  -29.285 18.719  1.00 79.88  ? 465 GLN A CG    1 
ATOM   2791 C  CD    . GLN A 1 359 ? 25.191  -28.674 19.118  1.00 80.88  ? 465 GLN A CD    1 
ATOM   2792 O  OE1   . GLN A 1 359 ? 24.921  -27.492 18.844  1.00 76.88  ? 465 GLN A OE1   1 
ATOM   2793 N  NE2   . GLN A 1 359 ? 24.332  -29.478 19.798  1.00 76.17  ? 465 GLN A NE2   1 
ATOM   2794 N  N     . ILE A 1 360 ? 26.515  -31.702 14.361  1.00 81.23  ? 466 ILE A N     1 
ATOM   2795 C  CA    . ILE A 1 360 ? 27.251  -32.293 13.192  1.00 82.82  ? 466 ILE A CA    1 
ATOM   2796 C  C     . ILE A 1 360 ? 27.051  -31.389 11.954  1.00 88.61  ? 466 ILE A C     1 
ATOM   2797 O  O     . ILE A 1 360 ? 26.058  -30.655 11.923  1.00 102.59 ? 466 ILE A O     1 
ATOM   2798 C  CB    . ILE A 1 360 ? 26.803  -33.733 12.739  1.00 83.07  ? 466 ILE A CB    1 
ATOM   2799 C  CG1   . ILE A 1 360 ? 26.411  -34.734 13.840  1.00 83.74  ? 466 ILE A CG1   1 
ATOM   2800 C  CG2   . ILE A 1 360 ? 27.950  -34.428 12.000  1.00 81.73  ? 466 ILE A CG2   1 
ATOM   2801 C  CD1   . ILE A 1 360 ? 25.382  -35.773 13.374  1.00 81.36  ? 466 ILE A CD1   1 
ATOM   2802 N  N     . LYS A 1 361 ? 27.943  -31.419 10.950  1.00 80.06  ? 467 LYS A N     1 
ATOM   2803 C  CA    . LYS A 1 361 ? 27.670  -30.741 9.670   1.00 75.52  ? 467 LYS A CA    1 
ATOM   2804 C  C     . LYS A 1 361 ? 27.850  -31.713 8.551   1.00 68.20  ? 467 LYS A C     1 
ATOM   2805 O  O     . LYS A 1 361 ? 28.426  -32.729 8.784   1.00 66.08  ? 467 LYS A O     1 
ATOM   2806 C  CB    . LYS A 1 361 ? 28.599  -29.588 9.483   1.00 78.18  ? 467 LYS A CB    1 
ATOM   2807 C  CG    . LYS A 1 361 ? 28.187  -28.431 10.348  1.00 85.64  ? 467 LYS A CG    1 
ATOM   2808 C  CD    . LYS A 1 361 ? 28.891  -27.206 9.848   1.00 91.25  ? 467 LYS A CD    1 
ATOM   2809 C  CE    . LYS A 1 361 ? 29.060  -26.168 10.964  1.00 97.16  ? 467 LYS A CE    1 
ATOM   2810 N  NZ    . LYS A 1 361 ? 30.423  -25.585 10.850  1.00 101.00 ? 467 LYS A NZ    1 
ATOM   2811 N  N     . ILE A 1 362 ? 27.355  -31.383 7.359   1.00 59.17  ? 468 ILE A N     1 
ATOM   2812 C  CA    . ILE A 1 362 ? 27.648  -32.137 6.175   1.00 58.28  ? 468 ILE A CA    1 
ATOM   2813 C  C     . ILE A 1 362 ? 28.547  -31.319 5.296   1.00 62.78  ? 468 ILE A C     1 
ATOM   2814 O  O     . ILE A 1 362 ? 28.129  -30.248 4.824   1.00 65.47  ? 468 ILE A O     1 
ATOM   2815 C  CB    . ILE A 1 362 ? 26.388  -32.509 5.401   1.00 57.06  ? 468 ILE A CB    1 
ATOM   2816 C  CG1   . ILE A 1 362 ? 25.612  -33.515 6.228   1.00 60.00  ? 468 ILE A CG1   1 
ATOM   2817 C  CG2   . ILE A 1 362 ? 26.715  -33.092 4.010   1.00 56.59  ? 468 ILE A CG2   1 
ATOM   2818 C  CD1   . ILE A 1 362 ? 24.594  -34.326 5.453   1.00 62.08  ? 468 ILE A CD1   1 
ATOM   2819 N  N     . LYS A 1 363 ? 29.714  -31.888 4.983   1.00 66.18  ? 469 LYS A N     1 
ATOM   2820 C  CA    . LYS A 1 363 ? 30.756  -31.204 4.244   1.00 70.87  ? 469 LYS A CA    1 
ATOM   2821 C  C     . LYS A 1 363 ? 30.405  -31.292 2.773   1.00 69.69  ? 469 LYS A C     1 
ATOM   2822 O  O     . LYS A 1 363 ? 29.900  -32.336 2.323   1.00 67.91  ? 469 LYS A O     1 
ATOM   2823 C  CB    . LYS A 1 363 ? 32.119  -31.868 4.432   1.00 77.31  ? 469 LYS A CB    1 
ATOM   2824 C  CG    . LYS A 1 363 ? 32.513  -32.140 5.865   1.00 83.95  ? 469 LYS A CG    1 
ATOM   2825 C  CD    . LYS A 1 363 ? 33.614  -33.183 5.963   1.00 90.36  ? 469 LYS A CD    1 
ATOM   2826 C  CE    . LYS A 1 363 ? 33.655  -33.746 7.384   1.00 94.33  ? 469 LYS A CE    1 
ATOM   2827 N  NZ    . LYS A 1 363 ? 34.989  -33.506 7.949   1.00 100.48 ? 469 LYS A NZ    1 
ATOM   2828 N  N     . ARG A 1 364 ? 30.718  -30.210 2.050   1.00 65.63  ? 470 ARG A N     1 
ATOM   2829 C  CA    . ARG A 1 364 ? 30.483  -30.117 0.643   1.00 70.68  ? 470 ARG A CA    1 
ATOM   2830 C  C     . ARG A 1 364 ? 31.121  -31.272 -0.171  1.00 72.07  ? 470 ARG A C     1 
ATOM   2831 O  O     . ARG A 1 364 ? 30.548  -31.631 -1.205  1.00 78.83  ? 470 ARG A O     1 
ATOM   2832 C  CB    . ARG A 1 364 ? 30.965  -28.747 0.095   1.00 72.77  ? 470 ARG A CB    1 
ATOM   2833 C  CG    . ARG A 1 364 ? 30.759  -28.621 -1.432  1.00 80.28  ? 470 ARG A CG    1 
ATOM   2834 C  CD    . ARG A 1 364 ? 31.066  -27.244 -1.992  1.00 83.76  ? 470 ARG A CD    1 
ATOM   2835 N  NE    . ARG A 1 364 ? 30.543  -26.248 -1.071  1.00 92.66  ? 470 ARG A NE    1 
ATOM   2836 C  CZ    . ARG A 1 364 ? 29.252  -25.933 -0.922  1.00 100.35 ? 470 ARG A CZ    1 
ATOM   2837 N  NH1   . ARG A 1 364 ? 28.317  -26.512 -1.682  1.00 109.42 ? 470 ARG A NH1   1 
ATOM   2838 N  NH2   . ARG A 1 364 ? 28.889  -25.023 -0.004  1.00 91.83  ? 470 ARG A NH2   1 
ATOM   2839 N  N     . GLU A 1 365 ? 32.264  -31.854 0.266   1.00 71.00  ? 471 GLU A N     1 
ATOM   2840 C  CA    . GLU A 1 365 ? 32.931  -32.954 -0.491  1.00 71.58  ? 471 GLU A CA    1 
ATOM   2841 C  C     . GLU A 1 365 ? 31.928  -34.080 -0.711  1.00 74.33  ? 471 GLU A C     1 
ATOM   2842 O  O     . GLU A 1 365 ? 31.664  -34.542 -1.851  1.00 83.68  ? 471 GLU A O     1 
ATOM   2843 C  CB    . GLU A 1 365 ? 34.146  -33.507 0.259   1.00 65.10  ? 471 GLU A CB    1 
ATOM   2844 N  N     . ASP A 1 366 ? 31.288  -34.429 0.399   1.00 70.58  ? 472 ASP A N     1 
ATOM   2845 C  CA    . ASP A 1 366 ? 30.384  -35.560 0.461   1.00 71.60  ? 472 ASP A CA    1 
ATOM   2846 C  C     . ASP A 1 366 ? 29.034  -35.405 -0.205  1.00 69.57  ? 472 ASP A C     1 
ATOM   2847 O  O     . ASP A 1 366 ? 28.287  -36.381 -0.248  1.00 72.38  ? 472 ASP A O     1 
ATOM   2848 C  CB    . ASP A 1 366 ? 30.218  -35.954 1.923   1.00 71.57  ? 472 ASP A CB    1 
ATOM   2849 C  CG    . ASP A 1 366 ? 31.554  -36.204 2.570   1.00 70.37  ? 472 ASP A CG    1 
ATOM   2850 O  OD1   . ASP A 1 366 ? 32.450  -35.478 2.166   1.00 72.84  ? 472 ASP A OD1   1 
ATOM   2851 O  OD2   . ASP A 1 366 ? 31.755  -37.079 3.425   1.00 74.21  ? 472 ASP A OD2   1 
ATOM   2852 N  N     . TYR A 1 367 ? 28.697  -34.225 -0.742  1.00 67.18  ? 473 TYR A N     1 
ATOM   2853 C  CA    . TYR A 1 367 ? 27.364  -34.044 -1.369  1.00 64.77  ? 473 TYR A CA    1 
ATOM   2854 C  C     . TYR A 1 367 ? 27.141  -35.141 -2.389  1.00 62.31  ? 473 TYR A C     1 
ATOM   2855 O  O     . TYR A 1 367 ? 26.107  -35.817 -2.362  1.00 61.92  ? 473 TYR A O     1 
ATOM   2856 C  CB    . TYR A 1 367 ? 27.148  -32.638 -2.002  1.00 64.12  ? 473 TYR A CB    1 
ATOM   2857 C  CG    . TYR A 1 367 ? 26.942  -31.446 -1.036  1.00 61.30  ? 473 TYR A CG    1 
ATOM   2858 C  CD1   . TYR A 1 367 ? 27.015  -31.610 0.365   1.00 63.48  ? 473 TYR A CD1   1 
ATOM   2859 C  CD2   . TYR A 1 367 ? 26.725  -30.131 -1.531  1.00 58.07  ? 473 TYR A CD2   1 
ATOM   2860 C  CE1   . TYR A 1 367 ? 26.849  -30.529 1.238   1.00 62.44  ? 473 TYR A CE1   1 
ATOM   2861 C  CE2   . TYR A 1 367 ? 26.553  -29.048 -0.665  1.00 57.51  ? 473 TYR A CE2   1 
ATOM   2862 C  CZ    . TYR A 1 367 ? 26.616  -29.255 0.714   1.00 61.12  ? 473 TYR A CZ    1 
ATOM   2863 O  OH    . TYR A 1 367 ? 26.452  -28.244 1.625   1.00 63.16  ? 473 TYR A OH    1 
ATOM   2864 N  N     . GLU A 1 368 ? 28.140  -35.399 -3.213  1.00 66.95  ? 474 GLU A N     1 
ATOM   2865 C  CA    . GLU A 1 368 ? 27.953  -36.342 -4.327  1.00 68.47  ? 474 GLU A CA    1 
ATOM   2866 C  C     . GLU A 1 368 ? 27.692  -37.799 -3.939  1.00 67.14  ? 474 GLU A C     1 
ATOM   2867 O  O     . GLU A 1 368 ? 27.068  -38.508 -4.706  1.00 70.47  ? 474 GLU A O     1 
ATOM   2868 C  CB    . GLU A 1 368 ? 29.086  -36.174 -5.315  1.00 71.40  ? 474 GLU A CB    1 
ATOM   2869 C  CG    . GLU A 1 368 ? 29.091  -34.746 -5.864  1.00 77.17  ? 474 GLU A CG    1 
ATOM   2870 C  CD    . GLU A 1 368 ? 30.475  -34.176 -6.044  1.00 87.37  ? 474 GLU A CD    1 
ATOM   2871 O  OE1   . GLU A 1 368 ? 31.132  -34.696 -6.958  1.00 103.27 ? 474 GLU A OE1   1 
ATOM   2872 O  OE2   . GLU A 1 368 ? 30.908  -33.233 -5.315  1.00 86.41  ? 474 GLU A OE2   1 
ATOM   2873 N  N     . SER A 1 369 ? 28.094  -38.207 -2.733  1.00 65.80  ? 475 SER A N     1 
ATOM   2874 C  CA    . SER A 1 369 ? 27.814  -39.567 -2.187  1.00 66.30  ? 475 SER A CA    1 
ATOM   2875 C  C     . SER A 1 369 ? 26.413  -39.903 -1.580  1.00 67.05  ? 475 SER A C     1 
ATOM   2876 O  O     . SER A 1 369 ? 26.107  -41.089 -1.212  1.00 64.54  ? 475 SER A O     1 
ATOM   2877 C  CB    . SER A 1 369 ? 28.815  -39.834 -1.082  1.00 69.87  ? 475 SER A CB    1 
ATOM   2878 O  OG    . SER A 1 369 ? 28.490  -39.109 0.092   1.00 73.22  ? 475 SER A OG    1 
ATOM   2879 N  N     . LEU A 1 370 ? 25.603  -38.858 -1.418  1.00 66.23  ? 476 LEU A N     1 
ATOM   2880 C  CA    . LEU A 1 370 ? 24.375  -38.991 -0.640  1.00 66.88  ? 476 LEU A CA    1 
ATOM   2881 C  C     . LEU A 1 370 ? 23.306  -39.846 -1.352  1.00 59.31  ? 476 LEU A C     1 
ATOM   2882 O  O     . LEU A 1 370 ? 22.616  -40.641 -0.700  1.00 55.79  ? 476 LEU A O     1 
ATOM   2883 C  CB    . LEU A 1 370 ? 23.841  -37.605 -0.167  1.00 67.82  ? 476 LEU A CB    1 
ATOM   2884 C  CG    . LEU A 1 370 ? 24.743  -36.789 0.801   1.00 70.57  ? 476 LEU A CG    1 
ATOM   2885 C  CD1   . LEU A 1 370 ? 24.063  -35.508 1.336   1.00 72.49  ? 476 LEU A CD1   1 
ATOM   2886 C  CD2   . LEU A 1 370 ? 25.242  -37.630 1.965   1.00 69.83  ? 476 LEU A CD2   1 
ATOM   2887 N  N     . PRO A 1 371 ? 23.177  -39.689 -2.678  1.00 58.22  ? 477 PRO A N     1 
ATOM   2888 C  CA    . PRO A 1 371 ? 22.122  -40.479 -3.315  1.00 60.83  ? 477 PRO A CA    1 
ATOM   2889 C  C     . PRO A 1 371 ? 22.397  -41.999 -3.187  1.00 61.11  ? 477 PRO A C     1 
ATOM   2890 O  O     . PRO A 1 371 ? 21.464  -42.776 -2.923  1.00 60.08  ? 477 PRO A O     1 
ATOM   2891 C  CB    . PRO A 1 371 ? 22.128  -39.981 -4.780  1.00 59.97  ? 477 PRO A CB    1 
ATOM   2892 C  CG    . PRO A 1 371 ? 22.843  -38.672 -4.777  1.00 58.03  ? 477 PRO A CG    1 
ATOM   2893 C  CD    . PRO A 1 371 ? 23.828  -38.754 -3.635  1.00 58.28  ? 477 PRO A CD    1 
ATOM   2894 N  N     . LYS A 1 372 ? 23.665  -42.392 -3.299  1.00 63.41  ? 478 LYS A N     1 
ATOM   2895 C  CA    . LYS A 1 372 ? 24.041  -43.805 -3.098  1.00 65.55  ? 478 LYS A CA    1 
ATOM   2896 C  C     . LYS A 1 372 ? 23.604  -44.207 -1.727  1.00 60.43  ? 478 LYS A C     1 
ATOM   2897 O  O     . LYS A 1 372 ? 22.920  -45.190 -1.595  1.00 56.11  ? 478 LYS A O     1 
ATOM   2898 C  CB    . LYS A 1 372 ? 25.554  -44.048 -3.149  1.00 70.79  ? 478 LYS A CB    1 
ATOM   2899 C  CG    . LYS A 1 372 ? 26.282  -43.587 -4.405  1.00 75.71  ? 478 LYS A CG    1 
ATOM   2900 C  CD    . LYS A 1 372 ? 27.746  -43.216 -4.118  1.00 77.85  ? 478 LYS A CD    1 
ATOM   2901 C  CE    . LYS A 1 372 ? 28.137  -41.877 -4.740  1.00 77.06  ? 478 LYS A CE    1 
ATOM   2902 N  NZ    . LYS A 1 372 ? 28.417  -42.012 -6.179  1.00 78.29  ? 478 LYS A NZ    1 
ATOM   2903 N  N     . GLU A 1 373 ? 23.976  -43.425 -0.711  1.00 56.43  ? 479 GLU A N     1 
ATOM   2904 C  CA    . GLU A 1 373 ? 23.609  -43.803 0.645   1.00 59.00  ? 479 GLU A CA    1 
ATOM   2905 C  C     . GLU A 1 373 ? 22.080  -44.060 0.794   1.00 60.94  ? 479 GLU A C     1 
ATOM   2906 O  O     . GLU A 1 373 ? 21.672  -45.014 1.483   1.00 60.37  ? 479 GLU A O     1 
ATOM   2907 C  CB    . GLU A 1 373 ? 24.036  -42.777 1.693   1.00 57.88  ? 479 GLU A CB    1 
ATOM   2908 C  CG    . GLU A 1 373 ? 25.495  -42.366 1.774   1.00 58.65  ? 479 GLU A CG    1 
ATOM   2909 C  CD    . GLU A 1 373 ? 25.741  -41.481 3.033   1.00 63.09  ? 479 GLU A CD    1 
ATOM   2910 O  OE1   . GLU A 1 373 ? 24.788  -41.208 3.814   1.00 61.28  ? 479 GLU A OE1   1 
ATOM   2911 O  OE2   . GLU A 1 373 ? 26.884  -41.029 3.271   1.00 62.38  ? 479 GLU A OE2   1 
ATOM   2912 N  N     . VAL A 1 374 ? 21.242  -43.231 0.149   1.00 60.94  ? 480 VAL A N     1 
ATOM   2913 C  CA    . VAL A 1 374 ? 19.776  -43.397 0.272   1.00 61.84  ? 480 VAL A CA    1 
ATOM   2914 C  C     . VAL A 1 374 ? 19.318  -44.697 -0.395  1.00 62.27  ? 480 VAL A C     1 
ATOM   2915 O  O     . VAL A 1 374 ? 18.495  -45.451 0.174   1.00 60.21  ? 480 VAL A O     1 
ATOM   2916 C  CB    . VAL A 1 374 ? 18.948  -42.190 -0.299  1.00 61.78  ? 480 VAL A CB    1 
ATOM   2917 C  CG1   . VAL A 1 374 ? 17.440  -42.422 -0.123  1.00 60.97  ? 480 VAL A CG1   1 
ATOM   2918 C  CG2   . VAL A 1 374 ? 19.323  -40.883 0.392   1.00 61.45  ? 480 VAL A CG2   1 
ATOM   2919 N  N     . ALA A 1 375 ? 19.820  -44.889 -1.614  1.00 64.08  ? 481 ALA A N     1 
ATOM   2920 C  CA    . ALA A 1 375 ? 19.627  -46.106 -2.416  1.00 67.25  ? 481 ALA A CA    1 
ATOM   2921 C  C     . ALA A 1 375 ? 20.016  -47.415 -1.667  1.00 68.20  ? 481 ALA A C     1 
ATOM   2922 O  O     . ALA A 1 375 ? 19.295  -48.425 -1.764  1.00 66.87  ? 481 ALA A O     1 
ATOM   2923 C  CB    . ALA A 1 375 ? 20.412  -45.982 -3.734  1.00 66.72  ? 481 ALA A CB    1 
ATOM   2924 N  N     . SER A 1 376 ? 21.121  -47.357 -0.914  1.00 67.46  ? 482 SER A N     1 
ATOM   2925 C  CA    . SER A 1 376 ? 21.588  -48.458 -0.049  1.00 66.35  ? 482 SER A CA    1 
ATOM   2926 C  C     . SER A 1 376 ? 20.832  -48.660 1.256   1.00 67.74  ? 482 SER A C     1 
ATOM   2927 O  O     . SER A 1 376 ? 21.105  -49.621 1.915   1.00 72.73  ? 482 SER A O     1 
ATOM   2928 C  CB    . SER A 1 376 ? 23.063  -48.258 0.349   1.00 64.10  ? 482 SER A CB    1 
ATOM   2929 O  OG    . SER A 1 376 ? 23.820  -47.729 -0.716  1.00 62.34  ? 482 SER A OG    1 
ATOM   2930 N  N     . ALA A 1 377 ? 19.924  -47.798 1.681   1.00 72.07  ? 483 ALA A N     1 
ATOM   2931 C  CA    . ALA A 1 377 ? 19.224  -48.114 2.933   1.00 77.70  ? 483 ALA A CA    1 
ATOM   2932 C  C     . ALA A 1 377 ? 18.434  -49.436 2.730   1.00 82.58  ? 483 ALA A C     1 
ATOM   2933 O  O     . ALA A 1 377 ? 17.809  -49.633 1.692   1.00 85.71  ? 483 ALA A O     1 
ATOM   2934 C  CB    . ALA A 1 377 ? 18.347  -46.957 3.375   1.00 75.32  ? 483 ALA A CB    1 
ATOM   2935 N  N     . LYS A 1 378 ? 18.541  -50.368 3.666   1.00 89.73  ? 484 LYS A N     1 
ATOM   2936 C  CA    . LYS A 1 378 ? 17.832  -51.671 3.528   1.00 95.31  ? 484 LYS A CA    1 
ATOM   2937 C  C     . LYS A 1 378 ? 16.570  -51.590 4.374   1.00 100.00 ? 484 LYS A C     1 
ATOM   2938 O  O     . LYS A 1 378 ? 16.598  -51.981 5.543   1.00 102.41 ? 484 LYS A O     1 
ATOM   2939 C  CB    . LYS A 1 378 ? 18.709  -52.881 3.956   1.00 85.45  ? 484 LYS A CB    1 
ATOM   2940 N  N     . PRO A 1 379 ? 15.456  -51.065 3.818   1.00 102.81 ? 485 PRO A N     1 
ATOM   2941 C  CA    . PRO A 1 379 ? 14.207  -50.988 4.620   1.00 102.75 ? 485 PRO A CA    1 
ATOM   2942 C  C     . PRO A 1 379 ? 13.647  -52.420 4.822   1.00 105.17 ? 485 PRO A C     1 
ATOM   2943 O  O     . PRO A 1 379 ? 13.934  -53.289 3.981   1.00 108.74 ? 485 PRO A O     1 
ATOM   2944 C  CB    . PRO A 1 379 ? 13.311  -50.124 3.738   1.00 101.59 ? 485 PRO A CB    1 
ATOM   2945 C  CG    . PRO A 1 379 ? 13.732  -50.535 2.362   1.00 103.08 ? 485 PRO A CG    1 
ATOM   2946 C  CD    . PRO A 1 379 ? 15.216  -50.696 2.411   1.00 100.32 ? 485 PRO A CD    1 
ATOM   2947 N  N     . LYS A 1 380 ? 12.860  -52.674 5.883   1.00 104.89 ? 486 LYS A N     1 
ATOM   2948 C  CA    . LYS A 1 380 ? 12.260  -54.030 6.112   1.00 102.94 ? 486 LYS A CA    1 
ATOM   2949 C  C     . LYS A 1 380 ? 11.309  -54.375 4.943   1.00 104.44 ? 486 LYS A C     1 
ATOM   2950 O  O     . LYS A 1 380 ? 10.113  -54.033 4.976   1.00 97.69  ? 486 LYS A O     1 
ATOM   2951 C  CB    . LYS A 1 380 ? 11.549  -54.176 7.476   1.00 94.43  ? 486 LYS A CB    1 
ATOM   2952 N  N     . VAL A 1 381 ? 11.892  -55.084 3.948   1.00 118.30 ? 487 VAL A N     1 
ATOM   2953 C  CA    . VAL A 1 381 ? 11.441  -55.147 2.499   1.00 127.09 ? 487 VAL A CA    1 
ATOM   2954 C  C     . VAL A 1 381 ? 9.958   -55.569 2.240   1.00 140.42 ? 487 VAL A C     1 
ATOM   2955 O  O     . VAL A 1 381 ? 9.522   -56.701 2.513   1.00 158.08 ? 487 VAL A O     1 
ATOM   2956 C  CB    . VAL A 1 381 ? 12.481  -55.923 1.573   1.00 120.67 ? 487 VAL A CB    1 
ATOM   2957 C  CG1   . VAL A 1 381 ? 12.075  -55.964 0.089   1.00 115.03 ? 487 VAL A CG1   1 
ATOM   2958 C  CG2   . VAL A 1 381 ? 13.859  -55.278 1.671   1.00 117.96 ? 487 VAL A CG2   1 
ATOM   2959 N  N     . LEU A 1 382 ? 9.225   -54.642 1.619   1.00 139.72 ? 488 LEU A N     1 
ATOM   2960 C  CA    . LEU A 1 382 ? 7.934   -54.921 0.974   1.00 130.88 ? 488 LEU A CA    1 
ATOM   2961 C  C     . LEU A 1 382 ? 7.879   -54.105 -0.350  1.00 127.82 ? 488 LEU A C     1 
ATOM   2962 O  O     . LEU A 1 382 ? 7.063   -53.195 -0.484  1.00 129.49 ? 488 LEU A O     1 
ATOM   2963 C  CB    . LEU A 1 382 ? 6.779   -54.531 1.936   1.00 126.94 ? 488 LEU A CB    1 
ATOM   2964 C  CG    . LEU A 1 382 ? 6.586   -55.177 3.341   1.00 120.28 ? 488 LEU A CG    1 
ATOM   2965 C  CD1   . LEU A 1 382 ? 7.301   -54.463 4.489   1.00 112.92 ? 488 LEU A CD1   1 
ATOM   2966 C  CD2   . LEU A 1 382 ? 5.098   -55.272 3.699   1.00 115.04 ? 488 LEU A CD2   1 
ATOM   2967 N  N     . LEU A 1 383 ? 8.710   -54.464 -1.337  1.00 122.50 ? 489 LEU A N     1 
ATOM   2968 C  CA    . LEU A 1 383 ? 9.071   -53.519 -2.420  1.00 119.10 ? 489 LEU A CA    1 
ATOM   2969 C  C     . LEU A 1 383 ? 9.071   -54.152 -3.825  1.00 117.68 ? 489 LEU A C     1 
ATOM   2970 O  O     . LEU A 1 383 ? 9.833   -55.106 -4.079  1.00 109.64 ? 489 LEU A O     1 
ATOM   2971 C  CB    . LEU A 1 383 ? 10.455  -52.895 -2.191  1.00 114.84 ? 489 LEU A CB    1 
ATOM   2972 C  CG    . LEU A 1 383 ? 10.773  -52.209 -0.876  1.00 110.50 ? 489 LEU A CG    1 
ATOM   2973 C  CD1   . LEU A 1 383 ? 12.224  -51.749 -0.914  1.00 109.44 ? 489 LEU A CD1   1 
ATOM   2974 C  CD2   . LEU A 1 383 ? 9.839   -51.041 -0.582  1.00 106.40 ? 489 LEU A CD2   1 
ATOM   2975 N  N     . ASP A 1 384 ? 8.243   -53.564 -4.719  1.00 119.64 ? 490 ASP A N     1 
ATOM   2976 C  CA    . ASP A 1 384 ? 8.036   -54.002 -6.120  1.00 119.69 ? 490 ASP A CA    1 
ATOM   2977 C  C     . ASP A 1 384 ? 9.045   -53.466 -7.112  1.00 117.27 ? 490 ASP A C     1 
ATOM   2978 O  O     . ASP A 1 384 ? 9.108   -53.961 -8.248  1.00 118.56 ? 490 ASP A O     1 
ATOM   2979 C  CB    . ASP A 1 384 ? 6.692   -53.518 -6.666  1.00 118.95 ? 490 ASP A CB    1 
ATOM   2980 C  CG    . ASP A 1 384 ? 5.552   -53.805 -5.735  1.00 122.83 ? 490 ASP A CG    1 
ATOM   2981 O  OD1   . ASP A 1 384 ? 5.416   -54.937 -5.239  1.00 123.75 ? 490 ASP A OD1   1 
ATOM   2982 O  OD2   . ASP A 1 384 ? 4.759   -52.886 -5.496  1.00 128.22 ? 490 ASP A OD2   1 
ATOM   2983 N  N     . VAL A 1 385 ? 9.756   -52.404 -6.723  1.00 113.71 ? 491 VAL A N     1 
ATOM   2984 C  CA    . VAL A 1 385 ? 10.917  -51.907 -7.488  1.00 111.49 ? 491 VAL A CA    1 
ATOM   2985 C  C     . VAL A 1 385 ? 12.063  -51.660 -6.483  1.00 104.59 ? 491 VAL A C     1 
ATOM   2986 O  O     . VAL A 1 385 ? 11.812  -51.248 -5.360  1.00 102.18 ? 491 VAL A O     1 
ATOM   2987 C  CB    . VAL A 1 385 ? 10.533  -50.688 -8.403  1.00 108.70 ? 491 VAL A CB    1 
ATOM   2988 C  CG1   . VAL A 1 385 ? 11.751  -50.153 -9.141  1.00 107.02 ? 491 VAL A CG1   1 
ATOM   2989 C  CG2   . VAL A 1 385 ? 9.454   -51.063 -9.422  1.00 103.87 ? 491 VAL A CG2   1 
ATOM   2990 N  N     . LYS A 1 386 ? 13.287  -52.058 -6.840  1.00 98.86  ? 492 LYS A N     1 
ATOM   2991 C  CA    . LYS A 1 386 ? 14.514  -51.630 -6.121  1.00 90.09  ? 492 LYS A CA    1 
ATOM   2992 C  C     . LYS A 1 386 ? 14.936  -50.372 -6.895  1.00 87.48  ? 492 LYS A C     1 
ATOM   2993 O  O     . LYS A 1 386 ? 14.608  -50.225 -8.110  1.00 86.43  ? 492 LYS A O     1 
ATOM   2994 C  CB    . LYS A 1 386 ? 15.619  -52.718 -6.106  1.00 79.10  ? 492 LYS A CB    1 
ATOM   2995 N  N     . LEU A 1 387 ? 15.570  -49.423 -6.211  1.00 80.76  ? 493 LEU A N     1 
ATOM   2996 C  CA    . LEU A 1 387 ? 15.884  -48.112 -6.828  1.00 76.14  ? 493 LEU A CA    1 
ATOM   2997 C  C     . LEU A 1 387 ? 17.413  -47.888 -6.851  1.00 69.34  ? 493 LEU A C     1 
ATOM   2998 O  O     . LEU A 1 387 ? 18.073  -48.339 -5.956  1.00 73.15  ? 493 LEU A O     1 
ATOM   2999 C  CB    . LEU A 1 387 ? 15.127  -47.001 -6.098  1.00 78.34  ? 493 LEU A CB    1 
ATOM   3000 C  CG    . LEU A 1 387 ? 13.574  -46.948 -6.203  1.00 80.30  ? 493 LEU A CG    1 
ATOM   3001 C  CD1   . LEU A 1 387 ? 12.905  -46.059 -5.128  1.00 80.19  ? 493 LEU A CD1   1 
ATOM   3002 C  CD2   . LEU A 1 387 ? 13.109  -46.494 -7.586  1.00 79.21  ? 493 LEU A CD2   1 
ATOM   3003 N  N     . LYS A 1 388 ? 17.967  -47.299 -7.906  1.00 63.67  ? 494 LYS A N     1 
ATOM   3004 C  CA    . LYS A 1 388 ? 19.420  -47.065 -8.006  1.00 63.10  ? 494 LYS A CA    1 
ATOM   3005 C  C     . LYS A 1 388 ? 19.701  -45.622 -7.552  1.00 65.92  ? 494 LYS A C     1 
ATOM   3006 O  O     . LYS A 1 388 ? 18.770  -44.812 -7.284  1.00 65.41  ? 494 LYS A O     1 
ATOM   3007 C  CB    . LYS A 1 388 ? 19.960  -47.316 -9.431  1.00 60.87  ? 494 LYS A CB    1 
ATOM   3008 N  N     . ALA A 1 389 ? 20.987  -45.286 -7.445  1.00 64.99  ? 495 ALA A N     1 
ATOM   3009 C  CA    . ALA A 1 389 ? 21.374  -43.957 -6.975  1.00 64.37  ? 495 ALA A CA    1 
ATOM   3010 C  C     . ALA A 1 389 ? 21.002  -42.882 -7.972  1.00 67.61  ? 495 ALA A C     1 
ATOM   3011 O  O     . ALA A 1 389 ? 20.572  -41.804 -7.538  1.00 72.76  ? 495 ALA A O     1 
ATOM   3012 C  CB    . ALA A 1 389 ? 22.859  -43.891 -6.631  1.00 61.48  ? 495 ALA A CB    1 
ATOM   3013 N  N     . GLU A 1 390 ? 21.103  -43.178 -9.286  1.00 64.58  ? 496 GLU A N     1 
ATOM   3014 C  CA    . GLU A 1 390 ? 20.761  -42.208 -10.319 1.00 59.49  ? 496 GLU A CA    1 
ATOM   3015 C  C     . GLU A 1 390 ? 19.325  -41.677 -10.148 1.00 57.63  ? 496 GLU A C     1 
ATOM   3016 O  O     . GLU A 1 390 ? 19.007  -40.635 -10.734 1.00 58.85  ? 496 GLU A O     1 
ATOM   3017 C  CB    . GLU A 1 390 ? 20.946  -42.806 -11.714 1.00 60.30  ? 496 GLU A CB    1 
ATOM   3018 N  N     . ASP A 1 391 ? 18.482  -42.354 -9.356  1.00 55.13  ? 497 ASP A N     1 
ATOM   3019 C  CA    . ASP A 1 391 ? 17.031  -42.026 -9.233  1.00 57.88  ? 497 ASP A CA    1 
ATOM   3020 C  C     . ASP A 1 391 ? 16.650  -40.973 -8.155  1.00 60.80  ? 497 ASP A C     1 
ATOM   3021 O  O     . ASP A 1 391 ? 15.500  -40.541 -8.086  1.00 63.29  ? 497 ASP A O     1 
ATOM   3022 C  CB    . ASP A 1 391 ? 16.225  -43.279 -8.825  1.00 61.09  ? 497 ASP A CB    1 
ATOM   3023 C  CG    . ASP A 1 391 ? 16.279  -44.432 -9.834  1.00 64.53  ? 497 ASP A CG    1 
ATOM   3024 O  OD1   . ASP A 1 391 ? 16.547  -44.229 -11.019 1.00 61.17  ? 497 ASP A OD1   1 
ATOM   3025 O  OD2   . ASP A 1 391 ? 15.972  -45.576 -9.424  1.00 65.23  ? 497 ASP A OD2   1 
ATOM   3026 N  N     . PHE A 1 392 ? 17.613  -40.646 -7.292  1.00 58.21  ? 498 PHE A N     1 
ATOM   3027 C  CA    . PHE A 1 392 ? 17.411  -39.808 -6.132  1.00 55.55  ? 498 PHE A CA    1 
ATOM   3028 C  C     . PHE A 1 392 ? 18.192  -38.518 -6.348  1.00 53.73  ? 498 PHE A C     1 
ATOM   3029 O  O     . PHE A 1 392 ? 19.244  -38.525 -6.997  1.00 52.81  ? 498 PHE A O     1 
ATOM   3030 C  CB    . PHE A 1 392 ? 17.950  -40.499 -4.852  1.00 54.62  ? 498 PHE A CB    1 
ATOM   3031 C  CG    . PHE A 1 392 ? 17.076  -41.632 -4.365  1.00 52.68  ? 498 PHE A CG    1 
ATOM   3032 C  CD1   . PHE A 1 392 ? 15.875  -41.370 -3.703  1.00 50.52  ? 498 PHE A CD1   1 
ATOM   3033 C  CD2   . PHE A 1 392 ? 17.432  -42.949 -4.598  1.00 50.99  ? 498 PHE A CD2   1 
ATOM   3034 C  CE1   . PHE A 1 392 ? 15.074  -42.393 -3.272  1.00 49.38  ? 498 PHE A CE1   1 
ATOM   3035 C  CE2   . PHE A 1 392 ? 16.616  -43.980 -4.175  1.00 50.35  ? 498 PHE A CE2   1 
ATOM   3036 C  CZ    . PHE A 1 392 ? 15.432  -43.701 -3.504  1.00 49.63  ? 498 PHE A CZ    1 
ATOM   3037 N  N     . ILE A 1 393 ? 17.645  -37.416 -5.840  1.00 52.08  ? 499 ILE A N     1 
ATOM   3038 C  CA    . ILE A 1 393 ? 18.384  -36.158 -5.688  1.00 50.09  ? 499 ILE A CA    1 
ATOM   3039 C  C     . ILE A 1 393 ? 18.392  -35.759 -4.210  1.00 47.65  ? 499 ILE A C     1 
ATOM   3040 O  O     . ILE A 1 393 ? 17.362  -35.868 -3.536  1.00 44.50  ? 499 ILE A O     1 
ATOM   3041 C  CB    . ILE A 1 393 ? 17.725  -35.041 -6.499  1.00 48.81  ? 499 ILE A CB    1 
ATOM   3042 C  CG1   . ILE A 1 393 ? 17.844  -35.357 -7.969  1.00 50.14  ? 499 ILE A CG1   1 
ATOM   3043 C  CG2   . ILE A 1 393 ? 18.371  -33.708 -6.197  1.00 46.15  ? 499 ILE A CG2   1 
ATOM   3044 C  CD1   . ILE A 1 393 ? 16.750  -34.696 -8.748  1.00 52.28  ? 499 ILE A CD1   1 
ATOM   3045 N  N     . VAL A 1 394 ? 19.547  -35.274 -3.748  1.00 43.77  ? 500 VAL A N     1 
ATOM   3046 C  CA    . VAL A 1 394 ? 19.633  -34.834 -2.387  1.00 47.74  ? 500 VAL A CA    1 
ATOM   3047 C  C     . VAL A 1 394 ? 20.157  -33.412 -2.456  1.00 46.66  ? 500 VAL A C     1 
ATOM   3048 O  O     . VAL A 1 394 ? 21.246  -33.219 -2.963  1.00 48.13  ? 500 VAL A O     1 
ATOM   3049 C  CB    . VAL A 1 394 ? 20.562  -35.759 -1.556  1.00 49.95  ? 500 VAL A CB    1 
ATOM   3050 C  CG1   . VAL A 1 394 ? 20.621  -35.343 -0.095  1.00 49.59  ? 500 VAL A CG1   1 
ATOM   3051 C  CG2   . VAL A 1 394 ? 20.099  -37.224 -1.636  1.00 50.98  ? 500 VAL A CG2   1 
ATOM   3052 N  N     . ASP A 1 395 ? 19.368  -32.421 -1.978  1.00 42.29  ? 501 ASP A N     1 
ATOM   3053 C  CA    . ASP A 1 395 ? 19.659  -31.003 -2.185  1.00 39.67  ? 501 ASP A CA    1 
ATOM   3054 C  C     . ASP A 1 395 ? 19.987  -30.501 -0.758  1.00 39.19  ? 501 ASP A C     1 
ATOM   3055 O  O     . ASP A 1 395 ? 19.148  -30.568 0.124   1.00 39.97  ? 501 ASP A O     1 
ATOM   3056 C  CB    . ASP A 1 395 ? 18.403  -30.372 -2.788  1.00 41.53  ? 501 ASP A CB    1 
ATOM   3057 C  CG    . ASP A 1 395 ? 18.596  -28.930 -3.334  1.00 44.03  ? 501 ASP A CG    1 
ATOM   3058 O  OD1   . ASP A 1 395 ? 19.733  -28.553 -3.760  1.00 42.86  ? 501 ASP A OD1   1 
ATOM   3059 O  OD2   . ASP A 1 395 ? 17.571  -28.148 -3.263  1.00 42.15  ? 501 ASP A OD2   1 
ATOM   3060 N  N     . VAL A 1 396 ? 21.228  -30.093 -0.527  1.00 35.77  ? 502 VAL A N     1 
ATOM   3061 C  CA    . VAL A 1 396 ? 21.663  -29.606 0.759   1.00 39.53  ? 502 VAL A CA    1 
ATOM   3062 C  C     . VAL A 1 396 ? 21.624  -28.093 0.812   1.00 36.12  ? 502 VAL A C     1 
ATOM   3063 O  O     . VAL A 1 396 ? 22.295  -27.487 0.028   1.00 36.51  ? 502 VAL A O     1 
ATOM   3064 C  CB    . VAL A 1 396 ? 23.106  -30.123 1.100   1.00 41.72  ? 502 VAL A CB    1 
ATOM   3065 C  CG1   . VAL A 1 396 ? 23.518  -29.709 2.494   1.00 42.81  ? 502 VAL A CG1   1 
ATOM   3066 C  CG2   . VAL A 1 396 ? 23.142  -31.645 1.015   1.00 41.86  ? 502 VAL A CG2   1 
ATOM   3067 N  N     . ILE A 1 397 ? 20.872  -27.499 1.726   1.00 35.34  ? 503 ILE A N     1 
ATOM   3068 C  CA    . ILE A 1 397 ? 20.703  -26.059 1.760   1.00 36.74  ? 503 ILE A CA    1 
ATOM   3069 C  C     . ILE A 1 397 ? 21.211  -25.438 3.077   1.00 38.88  ? 503 ILE A C     1 
ATOM   3070 O  O     . ILE A 1 397 ? 20.708  -25.774 4.140   1.00 39.97  ? 503 ILE A O     1 
ATOM   3071 C  CB    . ILE A 1 397 ? 19.242  -25.683 1.554   1.00 37.25  ? 503 ILE A CB    1 
ATOM   3072 C  CG1   . ILE A 1 397 ? 18.765  -26.066 0.161   1.00 39.60  ? 503 ILE A CG1   1 
ATOM   3073 C  CG2   . ILE A 1 397 ? 19.013  -24.163 1.671   1.00 37.90  ? 503 ILE A CG2   1 
ATOM   3074 C  CD1   . ILE A 1 397 ? 17.321  -26.502 0.261   1.00 43.76  ? 503 ILE A CD1   1 
ATOM   3075 N  N     . ASN A 1 398 ? 22.169  -24.513 2.957   1.00 38.56  ? 504 ASN A N     1 
ATOM   3076 C  CA    . ASN A 1 398 ? 22.782  -23.839 4.075   1.00 41.05  ? 504 ASN A CA    1 
ATOM   3077 C  C     . ASN A 1 398 ? 22.001  -22.556 4.316   1.00 44.31  ? 504 ASN A C     1 
ATOM   3078 O  O     . ASN A 1 398 ? 22.010  -21.697 3.471   1.00 49.08  ? 504 ASN A O     1 
ATOM   3079 C  CB    . ASN A 1 398 ? 24.236  -23.497 3.774   1.00 41.85  ? 504 ASN A CB    1 
ATOM   3080 C  CG    . ASN A 1 398 ? 25.212  -24.720 3.921   1.00 46.06  ? 504 ASN A CG    1 
ATOM   3081 O  OD1   . ASN A 1 398 ? 24.865  -25.917 4.111   1.00 46.40  ? 504 ASN A OD1   1 
ATOM   3082 N  ND2   . ASN A 1 398 ? 26.491  -24.386 3.853   1.00 48.50  ? 504 ASN A ND2   1 
ATOM   3083 N  N     . MET A 1 399 ? 21.287  -22.465 5.453   1.00 43.21  ? 505 MET A N     1 
ATOM   3084 C  CA    . MET A 1 399 ? 20.470  -21.325 5.868   1.00 40.99  ? 505 MET A CA    1 
ATOM   3085 C  C     . MET A 1 399 ? 21.199  -20.594 7.008   1.00 39.78  ? 505 MET A C     1 
ATOM   3086 O  O     . MET A 1 399 ? 21.534  -21.214 8.013   1.00 40.82  ? 505 MET A O     1 
ATOM   3087 C  CB    . MET A 1 399 ? 19.092  -21.764 6.373   1.00 40.07  ? 505 MET A CB    1 
ATOM   3088 C  CG    . MET A 1 399 ? 18.250  -22.617 5.429   1.00 41.80  ? 505 MET A CG    1 
ATOM   3089 S  SD    . MET A 1 399 ? 17.447  -21.660 4.105   1.00 42.71  ? 505 MET A SD    1 
ATOM   3090 C  CE    . MET A 1 399 ? 16.006  -20.999 4.909   1.00 43.42  ? 505 MET A CE    1 
ATOM   3091 N  N     . ASP A 1 400 ? 21.416  -19.289 6.876   1.00 38.25  ? 506 ASP A N     1 
ATOM   3092 C  CA    . ASP A 1 400 ? 22.140  -18.560 7.876   1.00 37.69  ? 506 ASP A CA    1 
ATOM   3093 C  C     . ASP A 1 400 ? 21.749  -17.071 7.871   1.00 36.27  ? 506 ASP A C     1 
ATOM   3094 O  O     . ASP A 1 400 ? 20.942  -16.686 7.052   1.00 33.49  ? 506 ASP A O     1 
ATOM   3095 C  CB    . ASP A 1 400 ? 23.645  -18.800 7.686   1.00 38.01  ? 506 ASP A CB    1 
ATOM   3096 C  CG    . ASP A 1 400 ? 24.187  -18.216 6.400   1.00 38.65  ? 506 ASP A CG    1 
ATOM   3097 O  OD1   . ASP A 1 400 ? 23.633  -17.241 5.882   1.00 40.38  ? 506 ASP A OD1   1 
ATOM   3098 O  OD2   . ASP A 1 400 ? 25.202  -18.698 5.915   1.00 43.16  ? 506 ASP A OD2   1 
ATOM   3099 N  N     . TYR A 1 401 ? 22.354  -16.281 8.776   1.00 33.61  ? 507 TYR A N     1 
ATOM   3100 C  CA    . TYR A 1 401 ? 22.155  -14.830 8.868   1.00 33.15  ? 507 TYR A CA    1 
ATOM   3101 C  C     . TYR A 1 401 ? 23.178  -14.036 8.040   1.00 33.15  ? 507 TYR A C     1 
ATOM   3102 O  O     . TYR A 1 401 ? 23.466  -12.859 8.299   1.00 31.80  ? 507 TYR A O     1 
ATOM   3103 C  CB    . TYR A 1 401 ? 22.122  -14.395 10.370  1.00 32.54  ? 507 TYR A CB    1 
ATOM   3104 C  CG    . TYR A 1 401 ? 20.744  -14.468 11.040  1.00 31.90  ? 507 TYR A CG    1 
ATOM   3105 C  CD1   . TYR A 1 401 ? 19.774  -15.394 10.611  1.00 32.88  ? 507 TYR A CD1   1 
ATOM   3106 C  CD2   . TYR A 1 401 ? 20.382  -13.582 12.080  1.00 32.33  ? 507 TYR A CD2   1 
ATOM   3107 C  CE1   . TYR A 1 401 ? 18.512  -15.420 11.198  1.00 32.18  ? 507 TYR A CE1   1 
ATOM   3108 C  CE2   . TYR A 1 401 ? 19.090  -13.597 12.642  1.00 30.96  ? 507 TYR A CE2   1 
ATOM   3109 C  CZ    . TYR A 1 401 ? 18.180  -14.524 12.214  1.00 31.17  ? 507 TYR A CZ    1 
ATOM   3110 O  OH    . TYR A 1 401 ? 16.933  -14.571 12.753  1.00 30.49  ? 507 TYR A OH    1 
ATOM   3111 N  N     . GLY A 1 402 ? 23.707  -14.694 7.004   1.00 34.19  ? 508 GLY A N     1 
ATOM   3112 C  CA    . GLY A 1 402 ? 24.664  -14.091 6.030   1.00 36.06  ? 508 GLY A CA    1 
ATOM   3113 C  C     . GLY A 1 402 ? 26.103  -13.992 6.434   1.00 38.07  ? 508 GLY A C     1 
ATOM   3114 O  O     . GLY A 1 402 ? 26.875  -13.306 5.771   1.00 40.40  ? 508 GLY A O     1 
ATOM   3115 N  N     . MET A 1 403 ? 26.474  -14.642 7.531   1.00 41.33  ? 509 MET A N     1 
ATOM   3116 C  CA    . MET A 1 403 ? 27.865  -14.606 8.044   1.00 43.14  ? 509 MET A CA    1 
ATOM   3117 C  C     . MET A 1 403 ? 28.182  -15.966 8.691   1.00 42.34  ? 509 MET A C     1 
ATOM   3118 O  O     . MET A 1 403 ? 28.678  -16.045 9.807   1.00 37.39  ? 509 MET A O     1 
ATOM   3119 C  CB    . MET A 1 403 ? 28.042  -13.447 9.044   1.00 44.86  ? 509 MET A CB    1 
ATOM   3120 C  CG    . MET A 1 403 ? 28.204  -12.082 8.438   1.00 47.39  ? 509 MET A CG    1 
ATOM   3121 S  SD    . MET A 1 403 ? 28.558  -10.886 9.746   1.00 56.20  ? 509 MET A SD    1 
ATOM   3122 C  CE    . MET A 1 403 ? 30.370  -10.983 9.801   1.00 59.48  ? 509 MET A CE    1 
ATOM   3123 N  N     . GLN A 1 404 ? 27.845  -17.028 7.964   1.00 46.23  ? 510 GLN A N     1 
ATOM   3124 C  CA    . GLN A 1 404 ? 28.074  -18.432 8.345   1.00 46.43  ? 510 GLN A CA    1 
ATOM   3125 C  C     . GLN A 1 404 ? 27.485  -18.584 9.704   1.00 45.33  ? 510 GLN A C     1 
ATOM   3126 O  O     . GLN A 1 404 ? 26.300  -18.390 9.828   1.00 46.73  ? 510 GLN A O     1 
ATOM   3127 C  CB    . GLN A 1 404 ? 29.553  -18.855 8.193   1.00 48.66  ? 510 GLN A CB    1 
ATOM   3128 C  CG    . GLN A 1 404 ? 30.163  -18.534 6.816   1.00 50.17  ? 510 GLN A CG    1 
ATOM   3129 C  CD    . GLN A 1 404 ? 30.590  -17.028 6.636   1.00 58.96  ? 510 GLN A CD    1 
ATOM   3130 O  OE1   . GLN A 1 404 ? 31.369  -16.470 7.449   1.00 62.84  ? 510 GLN A OE1   1 
ATOM   3131 N  NE2   . GLN A 1 404 ? 30.071  -16.355 5.564   1.00 62.07  ? 510 GLN A NE2   1 
ATOM   3132 N  N     . GLU A 1 405 ? 28.241  -18.854 10.743  1.00 46.84  ? 511 GLU A N     1 
ATOM   3133 C  CA    . GLU A 1 405 ? 27.545  -19.014 12.013  1.00 49.64  ? 511 GLU A CA    1 
ATOM   3134 C  C     . GLU A 1 405 ? 27.701  -17.918 12.985  1.00 44.77  ? 511 GLU A C     1 
ATOM   3135 O  O     . GLU A 1 405 ? 27.238  -18.025 14.120  1.00 40.78  ? 511 GLU A O     1 
ATOM   3136 C  CB    . GLU A 1 405 ? 27.796  -20.356 12.665  1.00 55.86  ? 511 GLU A CB    1 
ATOM   3137 C  CG    . GLU A 1 405 ? 29.213  -20.661 12.977  1.00 61.65  ? 511 GLU A CG    1 
ATOM   3138 C  CD    . GLU A 1 405 ? 29.405  -22.179 12.916  1.00 73.11  ? 511 GLU A CD    1 
ATOM   3139 O  OE1   . GLU A 1 405 ? 28.612  -22.868 12.195  1.00 77.70  ? 511 GLU A OE1   1 
ATOM   3140 O  OE2   . GLU A 1 405 ? 30.349  -22.695 13.570  1.00 81.35  ? 511 GLU A OE2   1 
ATOM   3141 N  N     . LYS A 1 406 ? 28.202  -16.799 12.516  1.00 40.99  ? 512 LYS A N     1 
ATOM   3142 C  CA    . LYS A 1 406 ? 28.233  -15.619 13.361  1.00 41.54  ? 512 LYS A CA    1 
ATOM   3143 C  C     . LYS A 1 406 ? 26.885  -14.875 13.448  1.00 37.87  ? 512 LYS A C     1 
ATOM   3144 O  O     . LYS A 1 406 ? 26.039  -14.909 12.557  1.00 40.40  ? 512 LYS A O     1 
ATOM   3145 C  CB    . LYS A 1 406 ? 29.274  -14.679 12.826  1.00 44.83  ? 512 LYS A CB    1 
ATOM   3146 C  CG    . LYS A 1 406 ? 30.673  -15.293 12.781  1.00 48.54  ? 512 LYS A CG    1 
ATOM   3147 C  CD    . LYS A 1 406 ? 31.635  -14.440 12.005  1.00 50.19  ? 512 LYS A CD    1 
ATOM   3148 C  CE    . LYS A 1 406 ? 32.997  -15.064 12.145  1.00 53.85  ? 512 LYS A CE    1 
ATOM   3149 N  NZ    . LYS A 1 406 ? 33.784  -14.627 10.997  1.00 57.09  ? 512 LYS A NZ    1 
ATOM   3150 N  N     . ASN A 1 407 ? 26.755  -14.146 14.514  1.00 35.03  ? 513 ASN A N     1 
ATOM   3151 C  CA    . ASN A 1 407 ? 25.686  -13.240 14.725  1.00 34.24  ? 513 ASN A CA    1 
ATOM   3152 C  C     . ASN A 1 407 ? 26.155  -11.905 14.102  1.00 34.33  ? 513 ASN A C     1 
ATOM   3153 O  O     . ASN A 1 407 ? 27.127  -11.292 14.583  1.00 33.58  ? 513 ASN A O     1 
ATOM   3154 C  CB    . ASN A 1 407 ? 25.391  -13.101 16.223  1.00 33.43  ? 513 ASN A CB    1 
ATOM   3155 C  CG    . ASN A 1 407 ? 24.252  -12.128 16.513  1.00 33.26  ? 513 ASN A CG    1 
ATOM   3156 O  OD1   . ASN A 1 407 ? 23.750  -11.443 15.595  1.00 32.74  ? 513 ASN A OD1   1 
ATOM   3157 N  ND2   . ASN A 1 407 ? 23.871  -12.011 17.782  1.00 31.47  ? 513 ASN A ND2   1 
ATOM   3158 N  N     . PRO A 1 408 ? 25.460  -11.435 13.032  1.00 33.21  ? 514 PRO A N     1 
ATOM   3159 C  CA    . PRO A 1 408 ? 25.836  -10.157 12.420  1.00 32.70  ? 514 PRO A CA    1 
ATOM   3160 C  C     . PRO A 1 408 ? 25.612  -8.960  13.308  1.00 34.13  ? 514 PRO A C     1 
ATOM   3161 O  O     . PRO A 1 408 ? 26.305  -7.930  13.143  1.00 36.33  ? 514 PRO A O     1 
ATOM   3162 C  CB    . PRO A 1 408 ? 24.955  -10.062 11.164  1.00 33.04  ? 514 PRO A CB    1 
ATOM   3163 C  CG    . PRO A 1 408 ? 23.806  -10.958 11.423  1.00 33.94  ? 514 PRO A CG    1 
ATOM   3164 C  CD    . PRO A 1 408 ? 24.243  -12.002 12.421  1.00 33.87  ? 514 PRO A CD    1 
ATOM   3165 N  N     . ILE A 1 409 ? 24.697  -9.061  14.271  1.00 33.68  ? 515 ILE A N     1 
ATOM   3166 C  CA    . ILE A 1 409 ? 24.475  -7.925  15.151  1.00 34.21  ? 515 ILE A CA    1 
ATOM   3167 C  C     . ILE A 1 409 ? 25.688  -7.743  16.100  1.00 35.38  ? 515 ILE A C     1 
ATOM   3168 O  O     . ILE A 1 409 ? 25.846  -6.652  16.611  1.00 34.14  ? 515 ILE A O     1 
ATOM   3169 C  CB    . ILE A 1 409 ? 23.157  -7.996  15.947  1.00 34.10  ? 515 ILE A CB    1 
ATOM   3170 C  CG1   . ILE A 1 409 ? 21.936  -8.335  15.095  1.00 32.36  ? 515 ILE A CG1   1 
ATOM   3171 C  CG2   . ILE A 1 409 ? 22.909  -6.692  16.668  1.00 35.65  ? 515 ILE A CG2   1 
ATOM   3172 C  CD1   . ILE A 1 409 ? 21.860  -7.568  13.810  1.00 33.70  ? 515 ILE A CD1   1 
ATOM   3173 N  N     . ASP A 1 410 ? 26.562  -8.755  16.248  1.00 35.52  ? 516 ASP A N     1 
ATOM   3174 C  CA    . ASP A 1 410 ? 27.866  -8.583  16.935  1.00 37.62  ? 516 ASP A CA    1 
ATOM   3175 C  C     . ASP A 1 410 ? 28.843  -7.701  16.144  1.00 39.17  ? 516 ASP A C     1 
ATOM   3176 O  O     . ASP A 1 410 ? 29.832  -7.226  16.684  1.00 38.72  ? 516 ASP A O     1 
ATOM   3177 C  CB    . ASP A 1 410 ? 28.535  -9.934  17.309  1.00 37.31  ? 516 ASP A CB    1 
ATOM   3178 C  CG    . ASP A 1 410 ? 27.766  -10.692 18.411  1.00 37.40  ? 516 ASP A CG    1 
ATOM   3179 O  OD1   . ASP A 1 410 ? 27.037  -10.096 19.184  1.00 37.40  ? 516 ASP A OD1   1 
ATOM   3180 O  OD2   . ASP A 1 410 ? 27.866  -11.908 18.556  1.00 42.23  ? 516 ASP A OD2   1 
ATOM   3181 N  N     . HIS A 1 411 ? 28.544  -7.456  14.873  1.00 39.35  ? 517 HIS A N     1 
ATOM   3182 C  CA    . HIS A 1 411 ? 29.402  -6.695  14.004  1.00 36.66  ? 517 HIS A CA    1 
ATOM   3183 C  C     . HIS A 1 411 ? 28.709  -5.420  13.565  1.00 34.69  ? 517 HIS A C     1 
ATOM   3184 O  O     . HIS A 1 411 ? 29.099  -4.831  12.573  1.00 36.92  ? 517 HIS A O     1 
ATOM   3185 C  CB    . HIS A 1 411 ? 29.832  -7.583  12.856  1.00 37.99  ? 517 HIS A CB    1 
ATOM   3186 C  CG    . HIS A 1 411 ? 30.581  -8.825  13.293  1.00 40.89  ? 517 HIS A CG    1 
ATOM   3187 N  ND1   . HIS A 1 411 ? 31.963  -8.918  13.305  1.00 40.23  ? 517 HIS A ND1   1 
ATOM   3188 C  CD2   . HIS A 1 411 ? 30.126  -10.013 13.782  1.00 43.03  ? 517 HIS A CD2   1 
ATOM   3189 C  CE1   . HIS A 1 411 ? 32.312  -10.122 13.736  1.00 40.87  ? 517 HIS A CE1   1 
ATOM   3190 N  NE2   . HIS A 1 411 ? 31.225  -10.811 14.025  1.00 40.15  ? 517 HIS A NE2   1 
ATOM   3191 N  N     . VAL A 1 412 ? 27.729  -4.957  14.354  1.00 33.82  ? 518 VAL A N     1 
ATOM   3192 C  CA    . VAL A 1 412 ? 27.135  -3.603  14.248  1.00 32.07  ? 518 VAL A CA    1 
ATOM   3193 C  C     . VAL A 1 412 ? 27.580  -2.702  15.423  1.00 33.52  ? 518 VAL A C     1 
ATOM   3194 O  O     . VAL A 1 412 ? 27.713  -3.159  16.563  1.00 32.74  ? 518 VAL A O     1 
ATOM   3195 C  CB    . VAL A 1 412 ? 25.587  -3.712  14.309  1.00 32.29  ? 518 VAL A CB    1 
ATOM   3196 C  CG1   . VAL A 1 412 ? 24.862  -2.367  14.350  1.00 31.55  ? 518 VAL A CG1   1 
ATOM   3197 C  CG2   . VAL A 1 412 ? 25.074  -4.517  13.158  1.00 32.02  ? 518 VAL A CG2   1 
ATOM   3198 N  N     . SER A 1 413 ? 27.754  -1.419  15.154  1.00 32.57  ? 519 SER A N     1 
ATOM   3199 C  CA    . SER A 1 413 ? 27.978  -0.452  16.183  1.00 34.92  ? 519 SER A CA    1 
ATOM   3200 C  C     . SER A 1 413 ? 26.756  0.468   16.341  1.00 32.88  ? 519 SER A C     1 
ATOM   3201 O  O     . SER A 1 413 ? 26.175  0.864   15.338  1.00 33.34  ? 519 SER A O     1 
ATOM   3202 C  CB    . SER A 1 413 ? 29.201  0.412   15.850  1.00 38.12  ? 519 SER A CB    1 
ATOM   3203 O  OG    . SER A 1 413 ? 30.339  -0.357  16.086  1.00 43.91  ? 519 SER A OG    1 
ATOM   3204 N  N     . PHE A 1 414 ? 26.488  0.880   17.580  1.00 30.34  ? 520 PHE A N     1 
ATOM   3205 C  CA    . PHE A 1 414 ? 25.380  1.730   17.954  1.00 30.08  ? 520 PHE A CA    1 
ATOM   3206 C  C     . PHE A 1 414 ? 25.804  3.092   18.607  1.00 30.29  ? 520 PHE A C     1 
ATOM   3207 O  O     . PHE A 1 414 ? 26.959  3.265   19.001  1.00 32.50  ? 520 PHE A O     1 
ATOM   3208 C  CB    . PHE A 1 414 ? 24.465  0.910   18.914  1.00 30.55  ? 520 PHE A CB    1 
ATOM   3209 C  CG    . PHE A 1 414 ? 23.844  -0.358  18.287  1.00 30.65  ? 520 PHE A CG    1 
ATOM   3210 C  CD1   . PHE A 1 414 ? 22.598  -0.300  17.622  1.00 30.19  ? 520 PHE A CD1   1 
ATOM   3211 C  CD2   . PHE A 1 414 ? 24.503  -1.572  18.317  1.00 30.56  ? 520 PHE A CD2   1 
ATOM   3212 C  CE1   . PHE A 1 414 ? 22.033  -1.422  17.055  1.00 30.50  ? 520 PHE A CE1   1 
ATOM   3213 C  CE2   . PHE A 1 414 ? 23.931  -2.736  17.739  1.00 32.27  ? 520 PHE A CE2   1 
ATOM   3214 C  CZ    . PHE A 1 414 ? 22.676  -2.677  17.137  1.00 32.05  ? 520 PHE A CZ    1 
ATOM   3215 N  N     . TYR A 1 415 ? 24.882  4.038   18.715  1.00 29.22  ? 521 TYR A N     1 
ATOM   3216 C  CA    . TYR A 1 415 ? 25.105  5.242   19.432  1.00 31.92  ? 521 TYR A CA    1 
ATOM   3217 C  C     . TYR A 1 415 ? 23.834  5.627   20.265  1.00 36.13  ? 521 TYR A C     1 
ATOM   3218 O  O     . TYR A 1 415 ? 22.695  5.239   19.903  1.00 34.37  ? 521 TYR A O     1 
ATOM   3219 C  CB    . TYR A 1 415 ? 25.591  6.388   18.572  1.00 32.88  ? 521 TYR A CB    1 
ATOM   3220 C  CG    . TYR A 1 415 ? 24.517  6.914   17.603  1.00 34.47  ? 521 TYR A CG    1 
ATOM   3221 C  CD1   . TYR A 1 415 ? 24.358  6.352   16.357  1.00 33.56  ? 521 TYR A CD1   1 
ATOM   3222 C  CD2   . TYR A 1 415 ? 23.681  7.959   17.962  1.00 35.33  ? 521 TYR A CD2   1 
ATOM   3223 C  CE1   . TYR A 1 415 ? 23.411  6.805   15.465  1.00 34.87  ? 521 TYR A CE1   1 
ATOM   3224 C  CE2   . TYR A 1 415 ? 22.703  8.420   17.088  1.00 34.93  ? 521 TYR A CE2   1 
ATOM   3225 C  CZ    . TYR A 1 415 ? 22.588  7.835   15.838  1.00 35.63  ? 521 TYR A CZ    1 
ATOM   3226 O  OH    . TYR A 1 415 ? 21.609  8.260   15.010  1.00 35.85  ? 521 TYR A OH    1 
ATOM   3227 N  N     . CYS A 1 416 ? 24.066  6.385   21.351  1.00 34.17  ? 522 CYS A N     1 
ATOM   3228 C  CA    . CYS A 1 416 ? 23.039  6.831   22.287  1.00 40.23  ? 522 CYS A CA    1 
ATOM   3229 C  C     . CYS A 1 416 ? 22.745  8.281   22.092  1.00 39.65  ? 522 CYS A C     1 
ATOM   3230 O  O     . CYS A 1 416 ? 23.618  9.059   21.670  1.00 38.98  ? 522 CYS A O     1 
ATOM   3231 C  CB    . CYS A 1 416 ? 23.483  6.627   23.741  1.00 44.37  ? 522 CYS A CB    1 
ATOM   3232 S  SG    . CYS A 1 416 ? 24.000  4.911   23.942  1.00 60.49  ? 522 CYS A SG    1 
ATOM   3233 N  N     . LYS A 1 417 ? 21.511  8.641   22.418  1.00 42.02  ? 523 LYS A N     1 
ATOM   3234 C  CA    . LYS A 1 417 ? 21.050  10.019  22.269  1.00 45.51  ? 523 LYS A CA    1 
ATOM   3235 C  C     . LYS A 1 417 ? 21.966  10.993  23.042  1.00 46.84  ? 523 LYS A C     1 
ATOM   3236 O  O     . LYS A 1 417 ? 22.319  12.058  22.517  1.00 47.87  ? 523 LYS A O     1 
ATOM   3237 C  CB    . LYS A 1 417 ? 19.570  10.132  22.703  1.00 45.90  ? 523 LYS A CB    1 
ATOM   3238 C  CG    . LYS A 1 417 ? 18.945  11.461  22.306  1.00 46.59  ? 523 LYS A CG    1 
ATOM   3239 C  CD    . LYS A 1 417 ? 17.405  11.518  22.377  1.00 49.95  ? 523 LYS A CD    1 
ATOM   3240 C  CE    . LYS A 1 417 ? 16.739  10.865  23.611  1.00 47.82  ? 523 LYS A CE    1 
ATOM   3241 N  NZ    . LYS A 1 417 ? 15.413  11.518  23.900  1.00 45.87  ? 523 LYS A NZ    1 
ATOM   3242 N  N     . THR A 1 418 ? 22.397  10.569  24.231  1.00 48.36  ? 524 THR A N     1 
ATOM   3243 C  CA    . THR A 1 418 ? 23.273  11.345  25.136  1.00 52.30  ? 524 THR A CA    1 
ATOM   3244 C  C     . THR A 1 418 ? 24.735  11.569  24.638  1.00 52.89  ? 524 THR A C     1 
ATOM   3245 O  O     . THR A 1 418 ? 25.349  12.522  25.039  1.00 57.15  ? 524 THR A O     1 
ATOM   3246 C  CB    . THR A 1 418 ? 23.305  10.679  26.554  1.00 53.60  ? 524 THR A CB    1 
ATOM   3247 O  OG1   . THR A 1 418 ? 23.652  9.296   26.453  1.00 62.17  ? 524 THR A OG1   1 
ATOM   3248 C  CG2   . THR A 1 418 ? 21.937  10.697  27.219  1.00 52.49  ? 524 THR A CG2   1 
ATOM   3249 N  N     . ALA A 1 419 ? 25.257  10.712  23.756  1.00 53.62  ? 525 ALA A N     1 
ATOM   3250 C  CA    . ALA A 1 419 ? 26.676  10.735  23.265  1.00 50.95  ? 525 ALA A CA    1 
ATOM   3251 C  C     . ALA A 1 419 ? 26.720  10.241  21.812  1.00 46.17  ? 525 ALA A C     1 
ATOM   3252 O  O     . ALA A 1 419 ? 27.160  9.096   21.531  1.00 41.76  ? 525 ALA A O     1 
ATOM   3253 C  CB    . ALA A 1 419 ? 27.608  9.876   24.144  1.00 52.00  ? 525 ALA A CB    1 
ATOM   3254 N  N     . PRO A 1 420 ? 26.267  11.112  20.903  1.00 43.26  ? 526 PRO A N     1 
ATOM   3255 C  CA    . PRO A 1 420 ? 26.033  10.765  19.525  1.00 44.10  ? 526 PRO A CA    1 
ATOM   3256 C  C     . PRO A 1 420 ? 27.248  10.401  18.717  1.00 43.50  ? 526 PRO A C     1 
ATOM   3257 O  O     . PRO A 1 420 ? 27.087  9.797   17.662  1.00 46.62  ? 526 PRO A O     1 
ATOM   3258 C  CB    . PRO A 1 420 ? 25.382  12.008  18.924  1.00 42.29  ? 526 PRO A CB    1 
ATOM   3259 C  CG    . PRO A 1 420 ? 24.849  12.743  20.056  1.00 42.82  ? 526 PRO A CG    1 
ATOM   3260 C  CD    . PRO A 1 420 ? 25.765  12.468  21.209  1.00 44.49  ? 526 PRO A CD    1 
ATOM   3261 N  N     . ASN A 1 421 ? 28.431  10.778  19.168  1.00 41.37  ? 527 ASN A N     1 
ATOM   3262 C  CA    . ASN A 1 421 ? 29.662  10.475  18.415  1.00 41.01  ? 527 ASN A CA    1 
ATOM   3263 C  C     . ASN A 1 421 ? 30.417  9.299   18.925  1.00 41.26  ? 527 ASN A C     1 
ATOM   3264 O  O     . ASN A 1 421 ? 31.469  9.045   18.416  1.00 42.66  ? 527 ASN A O     1 
ATOM   3265 C  CB    . ASN A 1 421 ? 30.572  11.685  18.361  1.00 39.23  ? 527 ASN A CB    1 
ATOM   3266 C  CG    . ASN A 1 421 ? 30.019  12.730  17.473  1.00 41.13  ? 527 ASN A CG    1 
ATOM   3267 O  OD1   . ASN A 1 421 ? 29.745  12.446  16.345  1.00 46.05  ? 527 ASN A OD1   1 
ATOM   3268 N  ND2   . ASN A 1 421 ? 29.798  13.908  17.964  1.00 42.49  ? 527 ASN A ND2   1 
ATOM   3269 N  N     . ARG A 1 422 ? 29.841  8.535   19.840  1.00 40.10  ? 528 ARG A N     1 
ATOM   3270 C  CA    . ARG A 1 422 ? 30.521  7.488   20.497  1.00 40.21  ? 528 ARG A CA    1 
ATOM   3271 C  C     . ARG A 1 422 ? 29.874  6.144   20.242  1.00 37.52  ? 528 ARG A C     1 
ATOM   3272 O  O     . ARG A 1 422 ? 28.797  5.884   20.689  1.00 35.37  ? 528 ARG A O     1 
ATOM   3273 C  CB    . ARG A 1 422 ? 30.470  7.798   21.962  1.00 43.84  ? 528 ARG A CB    1 
ATOM   3274 C  CG    . ARG A 1 422 ? 31.108  6.723   22.755  1.00 49.89  ? 528 ARG A CG    1 
ATOM   3275 C  CD    . ARG A 1 422 ? 31.231  7.147   24.189  1.00 55.37  ? 528 ARG A CD    1 
ATOM   3276 N  NE    . ARG A 1 422 ? 31.562  5.968   24.968  1.00 61.15  ? 528 ARG A NE    1 
ATOM   3277 C  CZ    . ARG A 1 422 ? 31.645  5.931   26.298  1.00 66.01  ? 528 ARG A CZ    1 
ATOM   3278 N  NH1   . ARG A 1 422 ? 31.404  7.013   27.062  1.00 68.53  ? 528 ARG A NH1   1 
ATOM   3279 N  NH2   . ARG A 1 422 ? 31.973  4.783   26.874  1.00 66.69  ? 528 ARG A NH2   1 
ATOM   3280 N  N     . ALA A 1 423 ? 30.592  5.266   19.576  1.00 38.21  ? 529 ALA A N     1 
ATOM   3281 C  CA    . ALA A 1 423 ? 30.110  3.919   19.287  1.00 39.00  ? 529 ALA A CA    1 
ATOM   3282 C  C     . ALA A 1 423 ? 30.120  2.972   20.494  1.00 42.00  ? 529 ALA A C     1 
ATOM   3283 O  O     . ALA A 1 423 ? 30.905  3.126   21.393  1.00 44.80  ? 529 ALA A O     1 
ATOM   3284 C  CB    . ALA A 1 423 ? 30.963  3.309   18.247  1.00 38.89  ? 529 ALA A CB    1 
ATOM   3285 N  N     . ILE A 1 424 ? 29.250  1.975   20.497  1.00 44.15  ? 530 ILE A N     1 
ATOM   3286 C  CA    . ILE A 1 424 ? 29.188  1.001   21.573  1.00 43.46  ? 530 ILE A CA    1 
ATOM   3287 C  C     . ILE A 1 424 ? 28.757  -0.280  20.933  1.00 43.23  ? 530 ILE A C     1 
ATOM   3288 O  O     . ILE A 1 424 ? 28.355  -0.269  19.792  1.00 39.19  ? 530 ILE A O     1 
ATOM   3289 C  CB    . ILE A 1 424 ? 28.198  1.359   22.690  1.00 43.83  ? 530 ILE A CB    1 
ATOM   3290 C  CG1   . ILE A 1 424 ? 26.758  1.341   22.190  1.00 45.28  ? 530 ILE A CG1   1 
ATOM   3291 C  CG2   . ILE A 1 424 ? 28.577  2.700   23.336  1.00 46.03  ? 530 ILE A CG2   1 
ATOM   3292 C  CD1   . ILE A 1 424 ? 25.698  1.967   23.103  1.00 47.21  ? 530 ILE A CD1   1 
ATOM   3293 N  N     . ARG A 1 425 ? 28.808  -1.355  21.690  1.00 41.98  ? 531 ARG A N     1 
ATOM   3294 C  CA    . ARG A 1 425 ? 28.297  -2.625  21.209  1.00 45.93  ? 531 ARG A CA    1 
ATOM   3295 C  C     . ARG A 1 425 ? 27.131  -3.068  22.094  1.00 42.26  ? 531 ARG A C     1 
ATOM   3296 O  O     . ARG A 1 425 ? 26.972  -2.601  23.207  1.00 40.36  ? 531 ARG A O     1 
ATOM   3297 C  CB    . ARG A 1 425 ? 29.388  -3.691  21.155  1.00 50.83  ? 531 ARG A CB    1 
ATOM   3298 C  CG    . ARG A 1 425 ? 30.453  -3.429  20.117  1.00 56.45  ? 531 ARG A CG    1 
ATOM   3299 C  CD    . ARG A 1 425 ? 30.746  -4.697  19.340  1.00 66.59  ? 531 ARG A CD    1 
ATOM   3300 N  NE    . ARG A 1 425 ? 31.753  -4.575  18.256  1.00 74.16  ? 531 ARG A NE    1 
ATOM   3301 C  CZ    . ARG A 1 425 ? 31.652  -3.844  17.138  1.00 77.27  ? 531 ARG A CZ    1 
ATOM   3302 N  NH1   . ARG A 1 425 ? 30.604  -3.048  16.902  1.00 82.27  ? 531 ARG A NH1   1 
ATOM   3303 N  NH2   . ARG A 1 425 ? 32.620  -3.918  16.231  1.00 79.40  ? 531 ARG A NH2   1 
ATOM   3304 N  N     . ILE A 1 426 ? 26.256  -3.897  21.543  1.00 39.96  ? 532 ILE A N     1 
ATOM   3305 C  CA    . ILE A 1 426 ? 25.128  -4.376  22.300  1.00 37.46  ? 532 ILE A CA    1 
ATOM   3306 C  C     . ILE A 1 426 ? 25.092  -5.849  22.055  1.00 36.72  ? 532 ILE A C     1 
ATOM   3307 O  O     . ILE A 1 426 ? 25.095  -6.263  20.947  1.00 34.45  ? 532 ILE A O     1 
ATOM   3308 C  CB    . ILE A 1 426 ? 23.819  -3.688  21.886  1.00 36.34  ? 532 ILE A CB    1 
ATOM   3309 C  CG1   . ILE A 1 426 ? 23.924  -2.181  22.105  1.00 35.77  ? 532 ILE A CG1   1 
ATOM   3310 C  CG2   . ILE A 1 426 ? 22.642  -4.192  22.729  1.00 36.36  ? 532 ILE A CG2   1 
ATOM   3311 C  CD1   . ILE A 1 426 ? 22.695  -1.390  21.674  1.00 37.27  ? 532 ILE A CD1   1 
ATOM   3312 N  N     . THR A 1 427 ? 25.104  -6.636  23.121  1.00 36.83  ? 533 THR A N     1 
ATOM   3313 C  CA    . THR A 1 427 ? 25.139  -8.092  22.974  1.00 35.63  ? 533 THR A CA    1 
ATOM   3314 C  C     . THR A 1 427 ? 23.736  -8.592  22.991  1.00 34.68  ? 533 THR A C     1 
ATOM   3315 O  O     . THR A 1 427 ? 22.778  -7.903  23.432  1.00 32.54  ? 533 THR A O     1 
ATOM   3316 C  CB    . THR A 1 427 ? 25.914  -8.758  24.127  1.00 38.69  ? 533 THR A CB    1 
ATOM   3317 O  OG1   . THR A 1 427 ? 25.143  -8.670  25.336  1.00 40.89  ? 533 THR A OG1   1 
ATOM   3318 C  CG2   . THR A 1 427 ? 27.304  -8.061  24.365  1.00 38.29  ? 533 THR A CG2   1 
ATOM   3319 N  N     . LYS A 1 428 ? 23.622  -9.820  22.542  1.00 38.62  ? 534 LYS A N     1 
ATOM   3320 C  CA    . LYS A 1 428 ? 22.323  -10.530 22.451  1.00 42.55  ? 534 LYS A CA    1 
ATOM   3321 C  C     . LYS A 1 428 ? 21.547  -10.570 23.776  1.00 43.92  ? 534 LYS A C     1 
ATOM   3322 O  O     . LYS A 1 428 ? 20.338  -10.262 23.800  1.00 42.89  ? 534 LYS A O     1 
ATOM   3323 C  CB    . LYS A 1 428 ? 22.646  -11.920 21.984  1.00 42.72  ? 534 LYS A CB    1 
ATOM   3324 C  CG    . LYS A 1 428 ? 21.544  -12.816 21.489  1.00 45.12  ? 534 LYS A CG    1 
ATOM   3325 C  CD    . LYS A 1 428 ? 22.252  -14.153 21.503  1.00 47.91  ? 534 LYS A CD    1 
ATOM   3326 C  CE    . LYS A 1 428 ? 21.502  -15.265 20.925  1.00 51.52  ? 534 LYS A CE    1 
ATOM   3327 N  NZ    . LYS A 1 428 ? 20.516  -15.799 21.908  1.00 55.89  ? 534 LYS A NZ    1 
ATOM   3328 N  N     . ASN A 1 429 ? 22.273  -10.906 24.855  1.00 45.71  ? 535 ASN A N     1 
ATOM   3329 C  CA    . ASN A 1 429 ? 21.779  -10.835 26.265  1.00 49.46  ? 535 ASN A CA    1 
ATOM   3330 C  C     . ASN A 1 429 ? 21.099  -9.579  26.785  1.00 44.47  ? 535 ASN A C     1 
ATOM   3331 O  O     . ASN A 1 429 ? 20.165  -9.613  27.619  1.00 46.60  ? 535 ASN A O     1 
ATOM   3332 C  CB    . ASN A 1 429 ? 22.977  -10.982 27.230  1.00 55.38  ? 535 ASN A CB    1 
ATOM   3333 C  CG    . ASN A 1 429 ? 23.457  -12.391 27.338  1.00 61.46  ? 535 ASN A CG    1 
ATOM   3334 O  OD1   . ASN A 1 429 ? 22.717  -13.370 27.029  1.00 64.32  ? 535 ASN A OD1   1 
ATOM   3335 N  ND2   . ASN A 1 429 ? 24.719  -12.529 27.772  1.00 65.63  ? 535 ASN A ND2   1 
ATOM   3336 N  N     . GLN A 1 430 ? 21.667  -8.475  26.340  1.00 42.55  ? 536 GLN A N     1 
ATOM   3337 C  CA    . GLN A 1 430 ? 21.144  -7.154  26.597  1.00 40.89  ? 536 GLN A CA    1 
ATOM   3338 C  C     . GLN A 1 430 ? 19.836  -6.903  25.843  1.00 40.45  ? 536 GLN A C     1 
ATOM   3339 O  O     . GLN A 1 430 ? 19.236  -5.856  26.059  1.00 41.61  ? 536 GLN A O     1 
ATOM   3340 C  CB    . GLN A 1 430 ? 22.192  -6.053  26.212  1.00 41.65  ? 536 GLN A CB    1 
ATOM   3341 C  CG    . GLN A 1 430 ? 23.502  -6.065  27.030  1.00 40.67  ? 536 GLN A CG    1 
ATOM   3342 C  CD    . GLN A 1 430 ? 24.514  -4.976  26.681  1.00 39.83  ? 536 GLN A CD    1 
ATOM   3343 O  OE1   . GLN A 1 430 ? 25.180  -5.079  25.688  1.00 39.54  ? 536 GLN A OE1   1 
ATOM   3344 N  NE2   . GLN A 1 430 ? 24.698  -4.003  27.542  1.00 40.29  ? 536 GLN A NE2   1 
ATOM   3345 N  N     . VAL A 1 431 ? 19.399  -7.814  24.954  1.00 37.99  ? 537 VAL A N     1 
ATOM   3346 C  CA    . VAL A 1 431 ? 18.241  -7.525  24.146  1.00 38.29  ? 537 VAL A CA    1 
ATOM   3347 C  C     . VAL A 1 431 ? 17.052  -8.362  24.536  1.00 37.61  ? 537 VAL A C     1 
ATOM   3348 O  O     . VAL A 1 431 ? 15.960  -7.810  24.793  1.00 37.15  ? 537 VAL A O     1 
ATOM   3349 C  CB    . VAL A 1 431 ? 18.484  -7.625  22.566  1.00 39.57  ? 537 VAL A CB    1 
ATOM   3350 C  CG1   . VAL A 1 431 ? 17.215  -7.204  21.789  1.00 39.09  ? 537 VAL A CG1   1 
ATOM   3351 C  CG2   . VAL A 1 431 ? 19.618  -6.712  22.115  1.00 37.75  ? 537 VAL A CG2   1 
ATOM   3352 N  N     . SER A 1 432 ? 17.210  -9.682  24.504  1.00 36.66  ? 538 SER A N     1 
ATOM   3353 C  CA    . SER A 1 432 ? 16.053  -10.549 24.677  1.00 36.32  ? 538 SER A CA    1 
ATOM   3354 C  C     . SER A 1 432 ? 16.506  -11.983 24.777  1.00 37.47  ? 538 SER A C     1 
ATOM   3355 O  O     . SER A 1 432 ? 17.411  -12.368 24.103  1.00 37.61  ? 538 SER A O     1 
ATOM   3356 C  CB    . SER A 1 432 ? 15.057  -10.401 23.462  1.00 36.91  ? 538 SER A CB    1 
ATOM   3357 O  OG    . SER A 1 432 ? 13.914  -11.268 23.526  1.00 38.14  ? 538 SER A OG    1 
ATOM   3358 N  N     . GLN A 1 433 ? 15.832  -12.757 25.608  1.00 39.34  ? 539 GLN A N     1 
ATOM   3359 C  CA    . GLN A 1 433 ? 15.998  -14.189 25.684  1.00 42.84  ? 539 GLN A CA    1 
ATOM   3360 C  C     . GLN A 1 433 ? 15.155  -14.920 24.657  1.00 40.80  ? 539 GLN A C     1 
ATOM   3361 O  O     . GLN A 1 433 ? 15.255  -16.125 24.584  1.00 40.36  ? 539 GLN A O     1 
ATOM   3362 C  CB    . GLN A 1 433 ? 15.592  -14.762 27.089  1.00 53.05  ? 539 GLN A CB    1 
ATOM   3363 C  CG    . GLN A 1 433 ? 15.960  -13.962 28.367  1.00 58.27  ? 539 GLN A CG    1 
ATOM   3364 C  CD    . GLN A 1 433 ? 17.436  -13.775 28.448  1.00 64.38  ? 539 GLN A CD    1 
ATOM   3365 O  OE1   . GLN A 1 433 ? 18.200  -14.772 28.557  1.00 70.25  ? 539 GLN A OE1   1 
ATOM   3366 N  NE2   . GLN A 1 433 ? 17.876  -12.491 28.326  1.00 67.66  ? 539 GLN A NE2   1 
ATOM   3367 N  N     . LEU A 1 434 ? 14.306  -14.253 23.881  1.00 41.40  ? 540 LEU A N     1 
ATOM   3368 C  CA    . LEU A 1 434 ? 13.533  -14.964 22.813  1.00 41.85  ? 540 LEU A CA    1 
ATOM   3369 C  C     . LEU A 1 434 ? 14.208  -14.981 21.385  1.00 38.80  ? 540 LEU A C     1 
ATOM   3370 O  O     . LEU A 1 434 ? 13.702  -15.550 20.460  1.00 37.31  ? 540 LEU A O     1 
ATOM   3371 C  CB    . LEU A 1 434 ? 12.105  -14.409 22.765  1.00 42.34  ? 540 LEU A CB    1 
ATOM   3372 C  CG    . LEU A 1 434 ? 11.369  -14.240 24.078  1.00 44.93  ? 540 LEU A CG    1 
ATOM   3373 C  CD1   . LEU A 1 434 ? 9.950   -13.661 23.931  1.00 44.13  ? 540 LEU A CD1   1 
ATOM   3374 C  CD2   . LEU A 1 434 ? 11.210  -15.599 24.759  1.00 48.28  ? 540 LEU A CD2   1 
ATOM   3375 N  N     . LEU A 1 435 ? 15.386  -14.411 21.263  1.00 37.11  ? 541 LEU A N     1 
ATOM   3376 C  CA    . LEU A 1 435 ? 16.173  -14.462 20.073  1.00 35.57  ? 541 LEU A CA    1 
ATOM   3377 C  C     . LEU A 1 435 ? 16.740  -15.878 19.788  1.00 38.14  ? 541 LEU A C     1 
ATOM   3378 O  O     . LEU A 1 435 ? 16.800  -16.722 20.662  1.00 36.40  ? 541 LEU A O     1 
ATOM   3379 C  CB    . LEU A 1 435 ? 17.334  -13.466 20.191  1.00 33.70  ? 541 LEU A CB    1 
ATOM   3380 C  CG    . LEU A 1 435 ? 16.873  -12.049 20.402  1.00 32.36  ? 541 LEU A CG    1 
ATOM   3381 C  CD1   . LEU A 1 435 ? 18.069  -11.150 20.716  1.00 32.27  ? 541 LEU A CD1   1 
ATOM   3382 C  CD2   . LEU A 1 435 ? 16.096  -11.580 19.190  1.00 34.17  ? 541 LEU A CD2   1 
ATOM   3383 N  N     . PRO A 1 436 ? 17.168  -16.135 18.517  1.00 40.48  ? 542 PRO A N     1 
ATOM   3384 C  CA    . PRO A 1 436 ? 17.765  -17.458 18.204  1.00 42.19  ? 542 PRO A CA    1 
ATOM   3385 C  C     . PRO A 1 436 ? 19.022  -17.772 19.040  1.00 46.69  ? 542 PRO A C     1 
ATOM   3386 O  O     . PRO A 1 436 ? 19.801  -16.880 19.353  1.00 44.90  ? 542 PRO A O     1 
ATOM   3387 C  CB    . PRO A 1 436 ? 18.151  -17.322 16.750  1.00 40.26  ? 542 PRO A CB    1 
ATOM   3388 C  CG    . PRO A 1 436 ? 17.341  -16.188 16.239  1.00 38.45  ? 542 PRO A CG    1 
ATOM   3389 C  CD    . PRO A 1 436 ? 17.227  -15.222 17.376  1.00 36.43  ? 542 PRO A CD    1 
ATOM   3390 N  N     . GLU A 1 437 ? 19.222  -19.026 19.372  1.00 53.38  ? 543 GLU A N     1 
ATOM   3391 C  CA    . GLU A 1 437 ? 20.459  -19.453 20.058  1.00 59.62  ? 543 GLU A CA    1 
ATOM   3392 C  C     . GLU A 1 437 ? 21.564  -19.776 19.012  1.00 54.64  ? 543 GLU A C     1 
ATOM   3393 O  O     . GLU A 1 437 ? 22.723  -19.577 19.280  1.00 53.80  ? 543 GLU A O     1 
ATOM   3394 C  CB    . GLU A 1 437 ? 20.174  -20.630 21.022  1.00 70.81  ? 543 GLU A CB    1 
ATOM   3395 C  CG    . GLU A 1 437 ? 21.060  -20.697 22.278  1.00 85.06  ? 543 GLU A CG    1 
ATOM   3396 C  CD    . GLU A 1 437 ? 21.556  -22.135 22.541  1.00 103.27 ? 543 GLU A CD    1 
ATOM   3397 O  OE1   . GLU A 1 437 ? 20.696  -23.050 22.750  1.00 114.59 ? 543 GLU A OE1   1 
ATOM   3398 O  OE2   . GLU A 1 437 ? 22.796  -22.356 22.516  1.00 111.52 ? 543 GLU A OE2   1 
ATOM   3399 N  N     . LYS A 1 438 ? 21.177  -20.223 17.809  1.00 51.99  ? 544 LYS A N     1 
ATOM   3400 C  CA    . LYS A 1 438 ? 22.074  -20.475 16.645  1.00 49.92  ? 544 LYS A CA    1 
ATOM   3401 C  C     . LYS A 1 438 ? 21.744  -19.542 15.463  1.00 44.37  ? 544 LYS A C     1 
ATOM   3402 O  O     . LYS A 1 438 ? 20.680  -18.961 15.447  1.00 42.31  ? 544 LYS A O     1 
ATOM   3403 C  CB    . LYS A 1 438 ? 21.930  -21.900 16.142  1.00 50.92  ? 544 LYS A CB    1 
ATOM   3404 C  CG    . LYS A 1 438 ? 22.859  -22.875 16.770  1.00 55.68  ? 544 LYS A CG    1 
ATOM   3405 C  CD    . LYS A 1 438 ? 22.564  -24.236 16.173  1.00 61.49  ? 544 LYS A CD    1 
ATOM   3406 C  CE    . LYS A 1 438 ? 23.467  -25.303 16.769  1.00 68.12  ? 544 LYS A CE    1 
ATOM   3407 N  NZ    . LYS A 1 438 ? 22.645  -26.440 17.290  1.00 72.23  ? 544 LYS A NZ    1 
ATOM   3408 N  N     . PHE A 1 439 ? 22.690  -19.406 14.532  1.00 39.17  ? 545 PHE A N     1 
ATOM   3409 C  CA    . PHE A 1 439 ? 22.599  -18.518 13.363  1.00 37.79  ? 545 PHE A CA    1 
ATOM   3410 C  C     . PHE A 1 439 ? 22.932  -19.225 12.029  1.00 37.18  ? 545 PHE A C     1 
ATOM   3411 O  O     . PHE A 1 439 ? 23.050  -18.562 11.006  1.00 38.86  ? 545 PHE A O     1 
ATOM   3412 C  CB    . PHE A 1 439 ? 23.513  -17.296 13.584  1.00 38.13  ? 545 PHE A CB    1 
ATOM   3413 C  CG    . PHE A 1 439 ? 23.072  -16.425 14.783  1.00 40.90  ? 545 PHE A CG    1 
ATOM   3414 C  CD1   . PHE A 1 439 ? 22.083  -15.454 14.644  1.00 40.10  ? 545 PHE A CD1   1 
ATOM   3415 C  CD2   . PHE A 1 439 ? 23.574  -16.650 16.059  1.00 43.47  ? 545 PHE A CD2   1 
ATOM   3416 C  CE1   . PHE A 1 439 ? 21.633  -14.683 15.702  1.00 41.40  ? 545 PHE A CE1   1 
ATOM   3417 C  CE2   . PHE A 1 439 ? 23.138  -15.875 17.145  1.00 42.90  ? 545 PHE A CE2   1 
ATOM   3418 C  CZ    . PHE A 1 439 ? 22.159  -14.873 16.959  1.00 42.95  ? 545 PHE A CZ    1 
ATOM   3419 N  N     . ALA A 1 440 ? 23.092  -20.545 12.012  1.00 34.88  ? 546 ALA A N     1 
ATOM   3420 C  CA    . ALA A 1 440 ? 23.235  -21.338 10.784  1.00 34.34  ? 546 ALA A CA    1 
ATOM   3421 C  C     . ALA A 1 440 ? 22.728  -22.775 11.008  1.00 35.25  ? 546 ALA A C     1 
ATOM   3422 O  O     . ALA A 1 440 ? 22.793  -23.308 12.090  1.00 36.91  ? 546 ALA A O     1 
ATOM   3423 C  CB    . ALA A 1 440 ? 24.665  -21.324 10.271  1.00 32.77  ? 546 ALA A CB    1 
ATOM   3424 N  N     . GLU A 1 441 ? 22.150  -23.356 9.979   1.00 36.09  ? 547 GLU A N     1 
ATOM   3425 C  CA    . GLU A 1 441 ? 21.632  -24.723 10.012  1.00 36.76  ? 547 GLU A CA    1 
ATOM   3426 C  C     . GLU A 1 441 ? 21.620  -25.287 8.577   1.00 38.19  ? 547 GLU A C     1 
ATOM   3427 O  O     . GLU A 1 441 ? 21.810  -24.524 7.663   1.00 40.31  ? 547 GLU A O     1 
ATOM   3428 C  CB    . GLU A 1 441 ? 20.264  -24.782 10.666  1.00 35.67  ? 547 GLU A CB    1 
ATOM   3429 C  CG    . GLU A 1 441 ? 19.175  -24.028 9.960   1.00 39.45  ? 547 GLU A CG    1 
ATOM   3430 C  CD    . GLU A 1 441 ? 17.773  -24.286 10.529  1.00 42.20  ? 547 GLU A CD    1 
ATOM   3431 O  OE1   . GLU A 1 441 ? 17.646  -25.307 11.296  1.00 48.28  ? 547 GLU A OE1   1 
ATOM   3432 O  OE2   . GLU A 1 441 ? 16.817  -23.529 10.172  1.00 39.49  ? 547 GLU A OE2   1 
ATOM   3433 N  N     . GLN A 1 442 ? 21.423  -26.585 8.377   1.00 38.66  ? 548 GLN A N     1 
ATOM   3434 C  CA    . GLN A 1 442 ? 21.332  -27.154 7.042   1.00 39.51  ? 548 GLN A CA    1 
ATOM   3435 C  C     . GLN A 1 442 ? 20.039  -27.915 6.962   1.00 39.07  ? 548 GLN A C     1 
ATOM   3436 O  O     . GLN A 1 442 ? 19.646  -28.594 7.928   1.00 36.07  ? 548 GLN A O     1 
ATOM   3437 C  CB    . GLN A 1 442 ? 22.458  -28.141 6.726   1.00 42.72  ? 548 GLN A CB    1 
ATOM   3438 C  CG    . GLN A 1 442 ? 23.893  -27.638 6.812   1.00 45.11  ? 548 GLN A CG    1 
ATOM   3439 C  CD    . GLN A 1 442 ? 24.896  -28.807 6.542   1.00 47.84  ? 548 GLN A CD    1 
ATOM   3440 O  OE1   . GLN A 1 442 ? 25.100  -29.684 7.405   1.00 54.88  ? 548 GLN A OE1   1 
ATOM   3441 N  NE2   . GLN A 1 442 ? 25.502  -28.834 5.352   1.00 45.01  ? 548 GLN A NE2   1 
ATOM   3442 N  N     . LEU A 1 443 ? 19.385  -27.785 5.810   1.00 38.58  ? 549 LEU A N     1 
ATOM   3443 C  CA    . LEU A 1 443 ? 18.193  -28.571 5.463   1.00 41.84  ? 549 LEU A CA    1 
ATOM   3444 C  C     . LEU A 1 443 ? 18.540  -29.523 4.347   1.00 41.86  ? 549 LEU A C     1 
ATOM   3445 O  O     . LEU A 1 443 ? 19.260  -29.148 3.423   1.00 43.68  ? 549 LEU A O     1 
ATOM   3446 C  CB    . LEU A 1 443 ? 17.067  -27.660 4.954   1.00 42.97  ? 549 LEU A CB    1 
ATOM   3447 C  CG    . LEU A 1 443 ? 16.701  -26.469 5.831   1.00 45.86  ? 549 LEU A CG    1 
ATOM   3448 C  CD1   . LEU A 1 443 ? 15.616  -25.657 5.178   1.00 44.97  ? 549 LEU A CD1   1 
ATOM   3449 C  CD2   . LEU A 1 443 ? 16.218  -26.942 7.208   1.00 45.98  ? 549 LEU A CD2   1 
ATOM   3450 N  N     . ILE A 1 444 ? 18.034  -30.744 4.429   1.00 42.43  ? 550 ILE A N     1 
ATOM   3451 C  CA    . ILE A 1 444 ? 18.301  -31.724 3.418   1.00 43.69  ? 550 ILE A CA    1 
ATOM   3452 C  C     . ILE A 1 444 ? 16.982  -32.101 2.807   1.00 41.44  ? 550 ILE A C     1 
ATOM   3453 O  O     . ILE A 1 444 ? 16.100  -32.575 3.515   1.00 42.35  ? 550 ILE A O     1 
ATOM   3454 C  CB    . ILE A 1 444 ? 18.989  -32.984 4.032   1.00 45.66  ? 550 ILE A CB    1 
ATOM   3455 C  CG1   . ILE A 1 444 ? 20.343  -32.601 4.653   1.00 48.50  ? 550 ILE A CG1   1 
ATOM   3456 C  CG2   . ILE A 1 444 ? 19.214  -34.099 2.999   1.00 44.31  ? 550 ILE A CG2   1 
ATOM   3457 C  CD1   . ILE A 1 444 ? 20.858  -33.592 5.718   1.00 49.44  ? 550 ILE A CD1   1 
ATOM   3458 N  N     . ARG A 1 445 ? 16.851  -31.908 1.496   1.00 38.65  ? 551 ARG A N     1 
ATOM   3459 C  CA    . ARG A 1 445 ? 15.669  -32.389 0.765   1.00 39.11  ? 551 ARG A CA    1 
ATOM   3460 C  C     . ARG A 1 445 ? 16.016  -33.556 -0.116  1.00 36.92  ? 551 ARG A C     1 
ATOM   3461 O  O     . ARG A 1 445 ? 17.029  -33.542 -0.773  1.00 36.39  ? 551 ARG A O     1 
ATOM   3462 C  CB    . ARG A 1 445 ? 14.994  -31.295 -0.146  1.00 38.56  ? 551 ARG A CB    1 
ATOM   3463 C  CG    . ARG A 1 445 ? 14.217  -30.242 0.663   1.00 37.79  ? 551 ARG A CG    1 
ATOM   3464 C  CD    . ARG A 1 445 ? 15.143  -29.189 1.196   1.00 38.79  ? 551 ARG A CD    1 
ATOM   3465 N  NE    . ARG A 1 445 ? 14.441  -28.098 1.850   1.00 40.67  ? 551 ARG A NE    1 
ATOM   3466 C  CZ    . ARG A 1 445 ? 14.004  -26.965 1.279   1.00 39.18  ? 551 ARG A CZ    1 
ATOM   3467 N  NH1   . ARG A 1 445 ? 14.151  -26.751 -0.019  1.00 39.58  ? 551 ARG A NH1   1 
ATOM   3468 N  NH2   . ARG A 1 445 ? 13.425  -26.030 2.042   1.00 37.10  ? 551 ARG A NH2   1 
ATOM   3469 N  N     . VAL A 1 446 ? 15.088  -34.504 -0.196  1.00 39.79  ? 552 VAL A N     1 
ATOM   3470 C  CA    . VAL A 1 446 ? 15.221  -35.642 -1.092  1.00 42.07  ? 552 VAL A CA    1 
ATOM   3471 C  C     . VAL A 1 446 ? 14.064  -35.667 -2.047  1.00 40.52  ? 552 VAL A C     1 
ATOM   3472 O  O     . VAL A 1 446 ? 12.909  -35.526 -1.642  1.00 36.40  ? 552 VAL A O     1 
ATOM   3473 C  CB    . VAL A 1 446 ? 15.259  -36.951 -0.284  1.00 44.72  ? 552 VAL A CB    1 
ATOM   3474 C  CG1   . VAL A 1 446 ? 15.413  -38.180 -1.185  1.00 44.40  ? 552 VAL A CG1   1 
ATOM   3475 C  CG2   . VAL A 1 446 ? 16.436  -36.862 0.641   1.00 46.91  ? 552 VAL A CG2   1 
ATOM   3476 N  N     . TYR A 1 447 ? 14.396  -35.887 -3.311  1.00 41.94  ? 553 TYR A N     1 
ATOM   3477 C  CA    . TYR A 1 447 ? 13.400  -36.103 -4.326  1.00 41.47  ? 553 TYR A CA    1 
ATOM   3478 C  C     . TYR A 1 447 ? 13.688  -37.408 -5.090  1.00 46.07  ? 553 TYR A C     1 
ATOM   3479 O  O     . TYR A 1 447 ? 14.827  -37.919 -5.105  1.00 48.99  ? 553 TYR A O     1 
ATOM   3480 C  CB    . TYR A 1 447 ? 13.433  -34.961 -5.333  1.00 39.63  ? 553 TYR A CB    1 
ATOM   3481 C  CG    . TYR A 1 447 ? 13.414  -33.529 -4.831  1.00 36.97  ? 553 TYR A CG    1 
ATOM   3482 C  CD1   . TYR A 1 447 ? 14.550  -32.963 -4.292  1.00 37.22  ? 553 TYR A CD1   1 
ATOM   3483 C  CD2   . TYR A 1 447 ? 12.269  -32.740 -4.947  1.00 35.85  ? 553 TYR A CD2   1 
ATOM   3484 C  CE1   . TYR A 1 447 ? 14.557  -31.649 -3.853  1.00 36.66  ? 553 TYR A CE1   1 
ATOM   3485 C  CE2   . TYR A 1 447 ? 12.242  -31.433 -4.478  1.00 35.28  ? 553 TYR A CE2   1 
ATOM   3486 C  CZ    . TYR A 1 447 ? 13.385  -30.863 -3.955  1.00 36.11  ? 553 TYR A CZ    1 
ATOM   3487 O  OH    . TYR A 1 447 ? 13.387  -29.539 -3.462  1.00 34.91  ? 553 TYR A OH    1 
ATOM   3488 N  N     . CYS A 1 448 ? 12.666  -37.901 -5.775  1.00 47.87  ? 554 CYS A N     1 
ATOM   3489 C  CA    . CYS A 1 448 ? 12.788  -39.050 -6.703  1.00 50.36  ? 554 CYS A CA    1 
ATOM   3490 C  C     . CYS A 1 448 ? 12.360  -38.735 -8.159  1.00 48.84  ? 554 CYS A C     1 
ATOM   3491 O  O     . CYS A 1 448 ? 11.305  -38.173 -8.359  1.00 42.17  ? 554 CYS A O     1 
ATOM   3492 C  CB    . CYS A 1 448 ? 11.925  -40.253 -6.205  1.00 54.27  ? 554 CYS A CB    1 
ATOM   3493 S  SG    . CYS A 1 448 ? 12.179  -41.832 -7.100  1.00 57.60  ? 554 CYS A SG    1 
ATOM   3494 N  N     . LYS A 1 449 ? 13.141  -39.196 -9.138  1.00 52.72  ? 555 LYS A N     1 
ATOM   3495 C  CA    . LYS A 1 449 ? 12.843  -38.969 -10.524 1.00 55.51  ? 555 LYS A CA    1 
ATOM   3496 C  C     . LYS A 1 449 ? 11.860  -39.953 -11.090 1.00 61.99  ? 555 LYS A C     1 
ATOM   3497 O  O     . LYS A 1 449 ? 11.379  -39.706 -12.187 1.00 62.23  ? 555 LYS A O     1 
ATOM   3498 C  CB    . LYS A 1 449 ? 14.059  -39.062 -11.418 1.00 52.78  ? 555 LYS A CB    1 
ATOM   3499 C  CG    . LYS A 1 449 ? 15.248  -38.343 -10.863 1.00 54.35  ? 555 LYS A CG    1 
ATOM   3500 C  CD    . LYS A 1 449 ? 16.177  -38.012 -12.021 1.00 53.09  ? 555 LYS A CD    1 
ATOM   3501 C  CE    . LYS A 1 449 ? 17.466  -37.481 -11.485 1.00 52.92  ? 555 LYS A CE    1 
ATOM   3502 N  NZ    . LYS A 1 449 ? 18.546  -37.516 -12.496 1.00 53.51  ? 555 LYS A NZ    1 
ATOM   3503 N  N     . LYS A 1 450 ? 11.626  -41.085 -10.419 1.00 60.63  ? 556 LYS A N     1 
ATOM   3504 C  CA    . LYS A 1 450 ? 10.595  -41.975 -10.869 1.00 63.52  ? 556 LYS A CA    1 
ATOM   3505 C  C     . LYS A 1 450 ? 9.302   -41.574 -10.206 1.00 65.11  ? 556 LYS A C     1 
ATOM   3506 O  O     . LYS A 1 450 ? 9.203   -41.534 -8.963  1.00 72.90  ? 556 LYS A O     1 
ATOM   3507 C  CB    . LYS A 1 450 ? 10.950  -43.434 -10.604 1.00 67.83  ? 556 LYS A CB    1 
ATOM   3508 C  CG    . LYS A 1 450 ? 12.180  -43.931 -11.383 1.00 71.97  ? 556 LYS A CG    1 
ATOM   3509 C  CD    . LYS A 1 450 ? 12.315  -45.445 -11.236 1.00 78.67  ? 556 LYS A CD    1 
ATOM   3510 C  CE    . LYS A 1 450 ? 13.581  -46.043 -11.852 1.00 81.83  ? 556 LYS A CE    1 
ATOM   3511 N  NZ    . LYS A 1 450 ? 13.710  -45.871 -13.314 1.00 84.03  ? 556 LYS A NZ    1 
ATOM   3512 N  N     . VAL A 1 451 ? 8.306   -41.301 -11.029 1.00 66.10  ? 557 VAL A N     1 
ATOM   3513 C  CA    . VAL A 1 451 ? 7.106   -40.584 -10.590 1.00 68.18  ? 557 VAL A CA    1 
ATOM   3514 C  C     . VAL A 1 451 ? 5.834   -41.403 -10.428 1.00 69.15  ? 557 VAL A C     1 
ATOM   3515 O  O     . VAL A 1 451 ? 4.849   -40.850 -9.984  1.00 71.68  ? 557 VAL A O     1 
ATOM   3516 C  CB    . VAL A 1 451 ? 6.801   -39.397 -11.520 1.00 68.57  ? 557 VAL A CB    1 
ATOM   3517 C  CG1   . VAL A 1 451 ? 8.031   -38.484 -11.575 1.00 69.69  ? 557 VAL A CG1   1 
ATOM   3518 C  CG2   . VAL A 1 451 ? 6.365   -39.868 -12.929 1.00 66.74  ? 557 VAL A CG2   1 
ATOM   3519 N  N     . ASP A 1 452 ? 5.819   -42.682 -10.799 1.00 67.94  ? 558 ASP A N     1 
ATOM   3520 C  CA    . ASP A 1 452 ? 4.651   -43.557 -10.531 1.00 69.09  ? 558 ASP A CA    1 
ATOM   3521 C  C     . ASP A 1 452 ? 4.532   -43.890 -9.045  1.00 74.48  ? 558 ASP A C     1 
ATOM   3522 O  O     . ASP A 1 452 ? 5.527   -43.786 -8.295  1.00 79.02  ? 558 ASP A O     1 
ATOM   3523 C  CB    . ASP A 1 452 ? 4.765   -44.869 -11.289 1.00 68.85  ? 558 ASP A CB    1 
ATOM   3524 C  CG    . ASP A 1 452 ? 6.022   -45.629 -10.930 1.00 68.77  ? 558 ASP A CG    1 
ATOM   3525 O  OD1   . ASP A 1 452 ? 7.092   -45.198 -11.393 1.00 69.70  ? 558 ASP A OD1   1 
ATOM   3526 O  OD2   . ASP A 1 452 ? 5.949   -46.608 -10.146 1.00 75.17  ? 558 ASP A OD2   1 
ATOM   3527 N  N     . ARG A 1 453 ? 3.337   -44.347 -8.650  1.00 78.08  ? 559 ARG A N     1 
ATOM   3528 C  CA    . ARG A 1 453 ? 2.975   -44.588 -7.233  1.00 76.54  ? 559 ARG A CA    1 
ATOM   3529 C  C     . ARG A 1 453 ? 3.811   -45.657 -6.577  1.00 75.84  ? 559 ARG A C     1 
ATOM   3530 O  O     . ARG A 1 453 ? 4.211   -45.510 -5.423  1.00 77.33  ? 559 ARG A O     1 
ATOM   3531 C  CB    . ARG A 1 453 ? 1.494   -44.932 -7.101  1.00 81.13  ? 559 ARG A CB    1 
ATOM   3532 C  CG    . ARG A 1 453 ? 0.612   -43.723 -7.423  1.00 89.19  ? 559 ARG A CG    1 
ATOM   3533 C  CD    . ARG A 1 453 ? -0.823  -44.088 -7.782  1.00 95.55  ? 559 ARG A CD    1 
ATOM   3534 N  NE    . ARG A 1 453 ? -1.480  -44.756 -6.665  1.00 103.17 ? 559 ARG A NE    1 
ATOM   3535 C  CZ    . ARG A 1 453 ? -2.726  -45.248 -6.677  1.00 104.68 ? 559 ARG A CZ    1 
ATOM   3536 N  NH1   . ARG A 1 453 ? -3.500  -45.181 -7.769  1.00 104.06 ? 559 ARG A NH1   1 
ATOM   3537 N  NH2   . ARG A 1 453 ? -3.197  -45.827 -5.573  1.00 105.12 ? 559 ARG A NH2   1 
ATOM   3538 N  N     . LYS A 1 454 ? 4.077   -46.728 -7.304  1.00 71.82  ? 560 LYS A N     1 
ATOM   3539 C  CA    . LYS A 1 454 ? 5.001   -47.734 -6.820  1.00 72.16  ? 560 LYS A CA    1 
ATOM   3540 C  C     . LYS A 1 454 ? 6.377   -47.186 -6.489  1.00 72.28  ? 560 LYS A C     1 
ATOM   3541 O  O     . LYS A 1 454 ? 6.792   -47.254 -5.339  1.00 75.47  ? 560 LYS A O     1 
ATOM   3542 C  CB    . LYS A 1 454 ? 5.115   -48.883 -7.802  1.00 75.70  ? 560 LYS A CB    1 
ATOM   3543 C  CG    . LYS A 1 454 ? 4.203   -50.010 -7.376  1.00 79.09  ? 560 LYS A CG    1 
ATOM   3544 C  CD    . LYS A 1 454 ? 3.804   -50.930 -8.506  1.00 81.46  ? 560 LYS A CD    1 
ATOM   3545 C  CE    . LYS A 1 454 ? 2.552   -51.652 -8.067  1.00 82.49  ? 560 LYS A CE    1 
ATOM   3546 N  NZ    . LYS A 1 454 ? 1.960   -52.451 -9.181  1.00 85.47  ? 560 LYS A NZ    1 
ATOM   3547 N  N     . SER A 1 455 ? 7.077   -46.624 -7.464  1.00 69.78  ? 561 SER A N     1 
ATOM   3548 C  CA    . SER A 1 455 ? 8.414   -46.062 -7.207  1.00 73.87  ? 561 SER A CA    1 
ATOM   3549 C  C     . SER A 1 455 ? 8.452   -45.048 -6.045  1.00 74.95  ? 561 SER A C     1 
ATOM   3550 O  O     . SER A 1 455 ? 9.442   -44.995 -5.306  1.00 67.67  ? 561 SER A O     1 
ATOM   3551 C  CB    . SER A 1 455 ? 8.972   -45.344 -8.431  1.00 75.52  ? 561 SER A CB    1 
ATOM   3552 O  OG    . SER A 1 455 ? 8.853   -46.106 -9.606  1.00 77.15  ? 561 SER A OG    1 
ATOM   3553 N  N     . LEU A 1 456 ? 7.394   -44.234 -5.931  1.00 74.07  ? 562 LEU A N     1 
ATOM   3554 C  CA    . LEU A 1 456 ? 7.342   -43.164 -4.942  1.00 73.64  ? 562 LEU A CA    1 
ATOM   3555 C  C     . LEU A 1 456 ? 7.189   -43.771 -3.519  1.00 72.79  ? 562 LEU A C     1 
ATOM   3556 O  O     . LEU A 1 456 ? 7.925   -43.393 -2.585  1.00 73.64  ? 562 LEU A O     1 
ATOM   3557 C  CB    . LEU A 1 456 ? 6.229   -42.124 -5.292  1.00 73.10  ? 562 LEU A CB    1 
ATOM   3558 C  CG    . LEU A 1 456 ? 5.871   -41.031 -4.245  1.00 73.51  ? 562 LEU A CG    1 
ATOM   3559 C  CD1   . LEU A 1 456 ? 7.130   -40.217 -4.029  1.00 75.31  ? 562 LEU A CD1   1 
ATOM   3560 C  CD2   . LEU A 1 456 ? 4.681   -40.114 -4.545  1.00 68.53  ? 562 LEU A CD2   1 
ATOM   3561 N  N     . TYR A 1 457 ? 6.249   -44.704 -3.368  1.00 70.91  ? 563 TYR A N     1 
ATOM   3562 C  CA    . TYR A 1 457 ? 6.063   -45.409 -2.119  1.00 71.41  ? 563 TYR A CA    1 
ATOM   3563 C  C     . TYR A 1 457 ? 7.395   -46.009 -1.592  1.00 71.32  ? 563 TYR A C     1 
ATOM   3564 O  O     . TYR A 1 457 ? 7.776   -45.866 -0.403  1.00 65.77  ? 563 TYR A O     1 
ATOM   3565 C  CB    . TYR A 1 457 ? 5.018   -46.516 -2.281  1.00 73.71  ? 563 TYR A CB    1 
ATOM   3566 C  CG    . TYR A 1 457 ? 4.880   -47.331 -1.019  1.00 76.18  ? 563 TYR A CG    1 
ATOM   3567 C  CD1   . TYR A 1 457 ? 4.250   -46.805 0.120   1.00 74.45  ? 563 TYR A CD1   1 
ATOM   3568 C  CD2   . TYR A 1 457 ? 5.438   -48.601 -0.934  1.00 79.86  ? 563 TYR A CD2   1 
ATOM   3569 C  CE1   . TYR A 1 457 ? 4.157   -47.530 1.302   1.00 77.46  ? 563 TYR A CE1   1 
ATOM   3570 C  CE2   . TYR A 1 457 ? 5.313   -49.369 0.234   1.00 82.10  ? 563 TYR A CE2   1 
ATOM   3571 C  CZ    . TYR A 1 457 ? 4.687   -48.821 1.360   1.00 79.97  ? 563 TYR A CZ    1 
ATOM   3572 O  OH    . TYR A 1 457 ? 4.594   -49.562 2.525   1.00 76.22  ? 563 TYR A OH    1 
ATOM   3573 N  N     . ALA A 1 458 ? 8.107   -46.653 -2.496  1.00 66.12  ? 564 ALA A N     1 
ATOM   3574 C  CA    . ALA A 1 458 ? 9.400   -47.211 -2.145  1.00 65.38  ? 564 ALA A CA    1 
ATOM   3575 C  C     . ALA A 1 458 ? 10.392  -46.129 -1.701  1.00 62.22  ? 564 ALA A C     1 
ATOM   3576 O  O     . ALA A 1 458 ? 11.095  -46.287 -0.706  1.00 59.27  ? 564 ALA A O     1 
ATOM   3577 C  CB    . ALA A 1 458 ? 9.965   -47.976 -3.320  1.00 64.54  ? 564 ALA A CB    1 
ATOM   3578 N  N     . ALA A 1 459 ? 10.452  -45.034 -2.452  1.00 58.73  ? 565 ALA A N     1 
ATOM   3579 C  CA    . ALA A 1 459 ? 11.414  -43.972 -2.156  1.00 57.03  ? 565 ALA A CA    1 
ATOM   3580 C  C     . ALA A 1 459 ? 11.200  -43.391 -0.760  1.00 55.90  ? 565 ALA A C     1 
ATOM   3581 O  O     . ALA A 1 459 ? 12.174  -42.992 -0.117  1.00 53.94  ? 565 ALA A O     1 
ATOM   3582 C  CB    . ALA A 1 459 ? 11.342  -42.865 -3.182  1.00 57.17  ? 565 ALA A CB    1 
ATOM   3583 N  N     . ARG A 1 460 ? 9.944   -43.351 -0.312  1.00 52.71  ? 566 ARG A N     1 
ATOM   3584 C  CA    . ARG A 1 460 ? 9.624   -42.908 1.006   1.00 57.88  ? 566 ARG A CA    1 
ATOM   3585 C  C     . ARG A 1 460 ? 10.209  -43.801 2.082   1.00 62.01  ? 566 ARG A C     1 
ATOM   3586 O  O     . ARG A 1 460 ? 10.634  -43.282 3.116   1.00 59.63  ? 566 ARG A O     1 
ATOM   3587 C  CB    . ARG A 1 460 ? 8.128   -42.780 1.216   1.00 62.56  ? 566 ARG A CB    1 
ATOM   3588 C  CG    . ARG A 1 460 ? 7.557   -41.506 0.649   1.00 65.55  ? 566 ARG A CG    1 
ATOM   3589 C  CD    . ARG A 1 460 ? 6.091   -41.657 0.304   1.00 69.44  ? 566 ARG A CD    1 
ATOM   3590 N  NE    . ARG A 1 460 ? 5.508   -40.340 0.001   1.00 75.86  ? 566 ARG A NE    1 
ATOM   3591 C  CZ    . ARG A 1 460 ? 4.284   -40.110 -0.478  1.00 75.95  ? 566 ARG A CZ    1 
ATOM   3592 N  NH1   . ARG A 1 460 ? 3.410   -41.088 -0.664  1.00 80.99  ? 566 ARG A NH1   1 
ATOM   3593 N  NH2   . ARG A 1 460 ? 3.916   -38.869 -0.735  1.00 72.58  ? 566 ARG A NH2   1 
ATOM   3594 N  N     . GLN A 1 461 ? 10.239  -45.121 1.823   1.00 61.14  ? 567 GLN A N     1 
ATOM   3595 C  CA    . GLN A 1 461 ? 10.807  -46.110 2.750   1.00 58.43  ? 567 GLN A CA    1 
ATOM   3596 C  C     . GLN A 1 461 ? 12.349  -45.971 2.804   1.00 58.61  ? 567 GLN A C     1 
ATOM   3597 O  O     . GLN A 1 461 ? 12.899  -45.841 3.889   1.00 60.46  ? 567 GLN A O     1 
ATOM   3598 C  CB    . GLN A 1 461 ? 10.414  -47.571 2.400   1.00 57.26  ? 567 GLN A CB    1 
ATOM   3599 C  CG    . GLN A 1 461 ? 8.967   -47.812 1.946   1.00 57.87  ? 567 GLN A CG    1 
ATOM   3600 C  CD    . GLN A 1 461 ? 7.900   -47.148 2.842   1.00 59.12  ? 567 GLN A CD    1 
ATOM   3601 O  OE1   . GLN A 1 461 ? 7.923   -47.326 4.041   1.00 61.56  ? 567 GLN A OE1   1 
ATOM   3602 N  NE2   . GLN A 1 461 ? 7.012   -46.366 2.272   1.00 61.34  ? 567 GLN A NE2   1 
ATOM   3603 N  N     . TYR A 1 462 ? 13.034  -46.027 1.666   1.00 55.86  ? 568 TYR A N     1 
ATOM   3604 C  CA    . TYR A 1 462 ? 14.465  -45.774 1.646   1.00 60.40  ? 568 TYR A CA    1 
ATOM   3605 C  C     . TYR A 1 462 ? 14.825  -44.502 2.456   1.00 60.96  ? 568 TYR A C     1 
ATOM   3606 O  O     . TYR A 1 462 ? 15.689  -44.520 3.358   1.00 59.47  ? 568 TYR A O     1 
ATOM   3607 C  CB    . TYR A 1 462 ? 14.978  -45.621 0.194   1.00 63.83  ? 568 TYR A CB    1 
ATOM   3608 C  CG    . TYR A 1 462 ? 15.030  -46.914 -0.637  1.00 70.75  ? 568 TYR A CG    1 
ATOM   3609 C  CD1   . TYR A 1 462 ? 16.074  -47.817 -0.503  1.00 74.55  ? 568 TYR A CD1   1 
ATOM   3610 C  CD2   . TYR A 1 462 ? 14.042  -47.232 -1.568  1.00 73.26  ? 568 TYR A CD2   1 
ATOM   3611 C  CE1   . TYR A 1 462 ? 16.134  -49.000 -1.249  1.00 72.18  ? 568 TYR A CE1   1 
ATOM   3612 C  CE2   . TYR A 1 462 ? 14.098  -48.398 -2.322  1.00 71.13  ? 568 TYR A CE2   1 
ATOM   3613 C  CZ    . TYR A 1 462 ? 15.141  -49.279 -2.142  1.00 72.95  ? 568 TYR A CZ    1 
ATOM   3614 O  OH    . TYR A 1 462 ? 15.190  -50.408 -2.910  1.00 76.55  ? 568 TYR A OH    1 
ATOM   3615 N  N     . PHE A 1 463 ? 14.126  -43.399 2.156   1.00 62.02  ? 569 PHE A N     1 
ATOM   3616 C  CA    . PHE A 1 463 ? 14.440  -42.096 2.764   1.00 57.96  ? 569 PHE A CA    1 
ATOM   3617 C  C     . PHE A 1 463 ? 14.293  -42.093 4.308   1.00 57.60  ? 569 PHE A C     1 
ATOM   3618 O  O     . PHE A 1 463 ? 15.195  -41.624 5.011   1.00 56.09  ? 569 PHE A O     1 
ATOM   3619 C  CB    . PHE A 1 463 ? 13.573  -40.993 2.145   1.00 56.92  ? 569 PHE A CB    1 
ATOM   3620 C  CG    . PHE A 1 463 ? 13.656  -39.677 2.878   1.00 51.97  ? 569 PHE A CG    1 
ATOM   3621 C  CD1   . PHE A 1 463 ? 14.868  -38.981 2.932   1.00 49.75  ? 569 PHE A CD1   1 
ATOM   3622 C  CD2   . PHE A 1 463 ? 12.540  -39.155 3.535   1.00 50.38  ? 569 PHE A CD2   1 
ATOM   3623 C  CE1   . PHE A 1 463 ? 14.953  -37.784 3.620   1.00 49.85  ? 569 PHE A CE1   1 
ATOM   3624 C  CE2   . PHE A 1 463 ? 12.643  -37.955 4.236   1.00 51.77  ? 569 PHE A CE2   1 
ATOM   3625 C  CZ    . PHE A 1 463 ? 13.835  -37.257 4.271   1.00 49.00  ? 569 PHE A CZ    1 
ATOM   3626 N  N     . VAL A 1 464 ? 13.168  -42.600 4.830   1.00 56.72  ? 570 VAL A N     1 
ATOM   3627 C  CA    . VAL A 1 464 ? 12.927  -42.666 6.285   1.00 58.35  ? 570 VAL A CA    1 
ATOM   3628 C  C     . VAL A 1 464 ? 13.902  -43.655 6.971   1.00 57.79  ? 570 VAL A C     1 
ATOM   3629 O  O     . VAL A 1 464 ? 14.377  -43.388 8.102   1.00 61.87  ? 570 VAL A O     1 
ATOM   3630 C  CB    . VAL A 1 464 ? 11.428  -42.922 6.620   1.00 59.85  ? 570 VAL A CB    1 
ATOM   3631 C  CG1   . VAL A 1 464 ? 11.195  -43.037 8.114   1.00 63.04  ? 570 VAL A CG1   1 
ATOM   3632 C  CG2   . VAL A 1 464 ? 10.548  -41.776 6.106   1.00 59.04  ? 570 VAL A CG2   1 
ATOM   3633 N  N     . GLN A 1 465 ? 14.249  -44.751 6.289   1.00 58.23  ? 571 GLN A N     1 
ATOM   3634 C  CA    . GLN A 1 465 ? 15.297  -45.629 6.803   1.00 59.12  ? 571 GLN A CA    1 
ATOM   3635 C  C     . GLN A 1 465 ? 16.612  -44.839 6.868   1.00 57.38  ? 571 GLN A C     1 
ATOM   3636 O  O     . GLN A 1 465 ? 17.267  -44.868 7.898   1.00 56.23  ? 571 GLN A O     1 
ATOM   3637 C  CB    . GLN A 1 465 ? 15.442  -46.939 5.992   1.00 61.52  ? 571 GLN A CB    1 
ATOM   3638 C  CG    . GLN A 1 465 ? 16.244  -48.095 6.678   1.00 62.10  ? 571 GLN A CG    1 
ATOM   3639 C  CD    . GLN A 1 465 ? 15.739  -48.486 8.077   1.00 60.82  ? 571 GLN A CD    1 
ATOM   3640 O  OE1   . GLN A 1 465 ? 14.605  -48.913 8.257   1.00 62.08  ? 571 GLN A OE1   1 
ATOM   3641 N  NE2   . GLN A 1 465 ? 16.581  -48.303 9.070   1.00 57.17  ? 571 GLN A NE2   1 
ATOM   3642 N  N     . TRP A 1 466 ? 16.959  -44.095 5.815   1.00 53.54  ? 572 TRP A N     1 
ATOM   3643 C  CA    . TRP A 1 466 ? 18.224  -43.355 5.813   1.00 52.71  ? 572 TRP A CA    1 
ATOM   3644 C  C     . TRP A 1 466 ? 18.339  -42.345 7.001   1.00 59.42  ? 572 TRP A C     1 
ATOM   3645 O  O     . TRP A 1 466 ? 19.404  -42.212 7.648   1.00 60.93  ? 572 TRP A O     1 
ATOM   3646 C  CB    . TRP A 1 466 ? 18.391  -42.646 4.489   1.00 51.31  ? 572 TRP A CB    1 
ATOM   3647 C  CG    . TRP A 1 466 ? 19.642  -41.853 4.308   1.00 50.34  ? 572 TRP A CG    1 
ATOM   3648 C  CD1   . TRP A 1 466 ? 20.904  -42.344 4.185   1.00 51.60  ? 572 TRP A CD1   1 
ATOM   3649 C  CD2   . TRP A 1 466 ? 19.750  -40.441 4.125   1.00 49.27  ? 572 TRP A CD2   1 
ATOM   3650 N  NE1   . TRP A 1 466 ? 21.811  -41.327 3.966   1.00 51.36  ? 572 TRP A NE1   1 
ATOM   3651 C  CE2   . TRP A 1 466 ? 21.132  -40.148 3.915   1.00 50.40  ? 572 TRP A CE2   1 
ATOM   3652 C  CE3   . TRP A 1 466 ? 18.821  -39.392 4.098   1.00 49.37  ? 572 TRP A CE3   1 
ATOM   3653 C  CZ2   . TRP A 1 466 ? 21.614  -38.845 3.706   1.00 49.99  ? 572 TRP A CZ2   1 
ATOM   3654 C  CZ3   . TRP A 1 466 ? 19.289  -38.094 3.891   1.00 49.05  ? 572 TRP A CZ3   1 
ATOM   3655 C  CH2   . TRP A 1 466 ? 20.685  -37.835 3.700   1.00 50.38  ? 572 TRP A CH2   1 
ATOM   3656 N  N     . CYS A 1 467 ? 17.242  -41.657 7.288   1.00 60.25  ? 573 CYS A N     1 
ATOM   3657 C  CA    . CYS A 1 467 ? 17.164  -40.703 8.405   1.00 62.10  ? 573 CYS A CA    1 
ATOM   3658 C  C     . CYS A 1 467 ? 17.363  -41.424 9.742   1.00 65.30  ? 573 CYS A C     1 
ATOM   3659 O  O     . CYS A 1 467 ? 18.114  -40.943 10.593  1.00 64.55  ? 573 CYS A O     1 
ATOM   3660 C  CB    . CYS A 1 467 ? 15.795  -39.991 8.457   1.00 59.75  ? 573 CYS A CB    1 
ATOM   3661 S  SG    . CYS A 1 467 ? 15.492  -38.879 7.073   1.00 56.79  ? 573 CYS A SG    1 
ATOM   3662 N  N     . ALA A 1 468 ? 16.638  -42.535 9.913   1.00 67.50  ? 574 ALA A N     1 
ATOM   3663 C  CA    . ALA A 1 468 ? 16.857  -43.489 11.031  1.00 65.60  ? 574 ALA A CA    1 
ATOM   3664 C  C     . ALA A 1 468 ? 18.346  -43.945 11.144  1.00 62.60  ? 574 ALA A C     1 
ATOM   3665 O  O     . ALA A 1 468 ? 18.907  -43.842 12.219  1.00 57.82  ? 574 ALA A O     1 
ATOM   3666 C  CB    . ALA A 1 468 ? 15.891  -44.686 10.933  1.00 63.84  ? 574 ALA A CB    1 
ATOM   3667 N  N     . ASP A 1 469 ? 18.970  -44.341 10.030  1.00 61.46  ? 575 ASP A N     1 
ATOM   3668 C  CA    . ASP A 1 469 ? 20.378  -44.767 9.989   1.00 59.31  ? 575 ASP A CA    1 
ATOM   3669 C  C     . ASP A 1 469 ? 21.380  -43.665 10.365  1.00 59.43  ? 575 ASP A C     1 
ATOM   3670 O  O     . ASP A 1 469 ? 22.304  -43.938 11.069  1.00 63.24  ? 575 ASP A O     1 
ATOM   3671 C  CB    . ASP A 1 469 ? 20.786  -45.286 8.591   1.00 59.27  ? 575 ASP A CB    1 
ATOM   3672 C  CG    . ASP A 1 469 ? 20.006  -46.560 8.125   1.00 59.88  ? 575 ASP A CG    1 
ATOM   3673 O  OD1   . ASP A 1 469 ? 19.194  -47.126 8.876   1.00 56.76  ? 575 ASP A OD1   1 
ATOM   3674 O  OD2   . ASP A 1 469 ? 20.204  -47.006 6.969   1.00 58.91  ? 575 ASP A OD2   1 
ATOM   3675 N  N     . ARG A 1 470 ? 21.233  -42.433 9.895   1.00 60.58  ? 576 ARG A N     1 
ATOM   3676 C  CA    . ARG A 1 470 ? 22.279  -41.380 10.111  1.00 62.28  ? 576 ARG A CA    1 
ATOM   3677 C  C     . ARG A 1 470 ? 22.065  -40.562 11.387  1.00 60.60  ? 576 ARG A C     1 
ATOM   3678 O  O     . ARG A 1 470 ? 22.793  -39.594 11.691  1.00 54.61  ? 576 ARG A O     1 
ATOM   3679 C  CB    . ARG A 1 470 ? 22.275  -40.415 8.928   1.00 62.78  ? 576 ARG A CB    1 
ATOM   3680 C  CG    . ARG A 1 470 ? 22.524  -41.097 7.608   1.00 60.17  ? 576 ARG A CG    1 
ATOM   3681 C  CD    . ARG A 1 470 ? 24.003  -41.107 7.278   1.00 58.65  ? 576 ARG A CD    1 
ATOM   3682 N  NE    . ARG A 1 470 ? 24.745  -39.901 7.666   1.00 54.05  ? 576 ARG A NE    1 
ATOM   3683 C  CZ    . ARG A 1 470 ? 25.369  -39.077 6.815   1.00 50.91  ? 576 ARG A CZ    1 
ATOM   3684 N  NH1   . ARG A 1 470 ? 25.363  -39.242 5.510   1.00 50.60  ? 576 ARG A NH1   1 
ATOM   3685 N  NH2   . ARG A 1 470 ? 26.037  -38.066 7.293   1.00 48.94  ? 576 ARG A NH2   1 
ATOM   3686 N  N     . ASN A 1 471 ? 21.043  -40.978 12.117  1.00 63.77  ? 577 ASN A N     1 
ATOM   3687 C  CA    . ASN A 1 471 ? 20.438  -40.231 13.230  1.00 70.68  ? 577 ASN A CA    1 
ATOM   3688 C  C     . ASN A 1 471 ? 20.048  -38.741 12.946  1.00 67.73  ? 577 ASN A C     1 
ATOM   3689 O  O     . ASN A 1 471 ? 20.342  -37.814 13.709  1.00 62.88  ? 577 ASN A O     1 
ATOM   3690 C  CB    . ASN A 1 471 ? 21.253  -40.432 14.509  1.00 79.67  ? 577 ASN A CB    1 
ATOM   3691 C  CG    . ASN A 1 471 ? 20.380  -40.347 15.748  1.00 84.55  ? 577 ASN A CG    1 
ATOM   3692 O  OD1   . ASN A 1 471 ? 19.346  -41.029 15.845  1.00 80.21  ? 577 ASN A OD1   1 
ATOM   3693 N  ND2   . ASN A 1 471 ? 20.762  -39.465 16.685  1.00 92.24  ? 577 ASN A ND2   1 
ATOM   3694 N  N     . PHE A 1 472 ? 19.327  -38.558 11.833  1.00 63.38  ? 578 PHE A N     1 
ATOM   3695 C  CA    . PHE A 1 472 ? 18.805  -37.259 11.430  1.00 58.41  ? 578 PHE A CA    1 
ATOM   3696 C  C     . PHE A 1 472 ? 17.429  -37.047 12.010  1.00 52.37  ? 578 PHE A C     1 
ATOM   3697 O  O     . PHE A 1 472 ? 16.832  -38.000 12.491  1.00 52.95  ? 578 PHE A O     1 
ATOM   3698 C  CB    . PHE A 1 472 ? 18.743  -37.236 9.913   1.00 60.68  ? 578 PHE A CB    1 
ATOM   3699 C  CG    . PHE A 1 472 ? 20.088  -37.153 9.216   1.00 59.64  ? 578 PHE A CG    1 
ATOM   3700 C  CD1   . PHE A 1 472 ? 21.290  -36.826 9.894   1.00 58.26  ? 578 PHE A CD1   1 
ATOM   3701 C  CD2   . PHE A 1 472 ? 20.126  -37.317 7.823   1.00 57.23  ? 578 PHE A CD2   1 
ATOM   3702 C  CE1   . PHE A 1 472 ? 22.469  -36.734 9.184   1.00 57.36  ? 578 PHE A CE1   1 
ATOM   3703 C  CE2   . PHE A 1 472 ? 21.308  -37.201 7.120   1.00 54.44  ? 578 PHE A CE2   1 
ATOM   3704 C  CZ    . PHE A 1 472 ? 22.481  -36.909 7.793   1.00 54.05  ? 578 PHE A CZ    1 
ATOM   3705 N  N     . THR A 1 473 ? 16.888  -35.828 11.953  1.00 49.07  ? 579 THR A N     1 
ATOM   3706 C  CA    . THR A 1 473 ? 15.545  -35.598 12.516  1.00 48.73  ? 579 THR A CA    1 
ATOM   3707 C  C     . THR A 1 473 ? 14.473  -36.446 11.843  1.00 49.95  ? 579 THR A C     1 
ATOM   3708 O  O     . THR A 1 473 ? 14.620  -36.947 10.709  1.00 47.20  ? 579 THR A O     1 
ATOM   3709 C  CB    . THR A 1 473 ? 15.093  -34.135 12.460  1.00 49.58  ? 579 THR A CB    1 
ATOM   3710 O  OG1   . THR A 1 473 ? 15.184  -33.654 11.118  1.00 55.17  ? 579 THR A OG1   1 
ATOM   3711 C  CG2   . THR A 1 473 ? 15.970  -33.297 13.260  1.00 49.35  ? 579 THR A CG2   1 
ATOM   3712 N  N     . LYS A 1 474 ? 13.379  -36.623 12.560  1.00 49.86  ? 580 LYS A N     1 
ATOM   3713 C  CA    . LYS A 1 474 ? 12.317  -37.465 12.090  1.00 50.56  ? 580 LYS A CA    1 
ATOM   3714 C  C     . LYS A 1 474 ? 11.446  -36.666 11.102  1.00 52.70  ? 580 LYS A C     1 
ATOM   3715 O  O     . LYS A 1 474 ? 10.838  -35.632 11.486  1.00 52.36  ? 580 LYS A O     1 
ATOM   3716 C  CB    . LYS A 1 474 ? 11.418  -37.850 13.248  1.00 52.39  ? 580 LYS A CB    1 
ATOM   3717 C  CG    . LYS A 1 474 ? 10.203  -38.709 12.880  1.00 54.54  ? 580 LYS A CG    1 
ATOM   3718 C  CD    . LYS A 1 474 ? 9.098   -38.467 13.882  1.00 55.80  ? 580 LYS A CD    1 
ATOM   3719 C  CE    . LYS A 1 474 ? 7.871   -39.246 13.521  1.00 57.32  ? 580 LYS A CE    1 
ATOM   3720 N  NZ    . LYS A 1 474 ? 6.866   -38.881 14.543  1.00 57.32  ? 580 LYS A NZ    1 
ATOM   3721 N  N     . PRO A 1 475 ? 11.309  -37.172 9.845   1.00 53.54  ? 581 PRO A N     1 
ATOM   3722 C  CA    . PRO A 1 475 ? 10.482  -36.417 8.941   1.00 49.90  ? 581 PRO A CA    1 
ATOM   3723 C  C     . PRO A 1 475 ? 9.038   -36.228 9.493   1.00 48.01  ? 581 PRO A C     1 
ATOM   3724 O  O     . PRO A 1 475 ? 8.476   -37.135 10.092  1.00 46.68  ? 581 PRO A O     1 
ATOM   3725 C  CB    . PRO A 1 475 ? 10.521  -37.264 7.695   1.00 52.01  ? 581 PRO A CB    1 
ATOM   3726 C  CG    . PRO A 1 475 ? 11.853  -37.918 7.744   1.00 53.34  ? 581 PRO A CG    1 
ATOM   3727 C  CD    . PRO A 1 475 ? 11.949  -38.324 9.177   1.00 52.92  ? 581 PRO A CD    1 
ATOM   3728 N  N     . GLN A 1 476 ? 8.502   -35.024 9.304   1.00 48.09  ? 582 GLN A N     1 
ATOM   3729 C  CA    . GLN A 1 476 ? 7.233   -34.540 9.884   1.00 52.38  ? 582 GLN A CA    1 
ATOM   3730 C  C     . GLN A 1 476 ? 6.048   -35.460 9.662   1.00 54.30  ? 582 GLN A C     1 
ATOM   3731 O  O     . GLN A 1 476 ? 5.303   -35.776 10.601  1.00 50.58  ? 582 GLN A O     1 
ATOM   3732 C  CB    . GLN A 1 476 ? 6.874   -33.155 9.314   1.00 52.72  ? 582 GLN A CB    1 
ATOM   3733 C  CG    . GLN A 1 476 ? 7.700   -32.043 9.941   1.00 53.61  ? 582 GLN A CG    1 
ATOM   3734 C  CD    . GLN A 1 476 ? 7.562   -30.648 9.304   1.00 51.42  ? 582 GLN A CD    1 
ATOM   3735 O  OE1   . GLN A 1 476 ? 6.552   -30.303 8.656   1.00 51.84  ? 582 GLN A OE1   1 
ATOM   3736 N  NE2   . GLN A 1 476 ? 8.585   -29.814 9.555   1.00 51.12  ? 582 GLN A NE2   1 
ATOM   3737 N  N     . ASP A 1 477 ? 5.910   -35.891 8.404   1.00 58.70  ? 583 ASP A N     1 
ATOM   3738 C  CA    . ASP A 1 477 ? 4.875   -36.893 7.999   1.00 62.51  ? 583 ASP A CA    1 
ATOM   3739 C  C     . ASP A 1 477 ? 5.343   -38.380 8.069   1.00 59.17  ? 583 ASP A C     1 
ATOM   3740 O  O     . ASP A 1 477 ? 4.634   -39.275 7.581   1.00 52.89  ? 583 ASP A O     1 
ATOM   3741 C  CB    . ASP A 1 477 ? 4.292   -36.551 6.580   1.00 63.81  ? 583 ASP A CB    1 
ATOM   3742 C  CG    . ASP A 1 477 ? 5.337   -36.623 5.408   1.00 65.09  ? 583 ASP A CG    1 
ATOM   3743 O  OD1   . ASP A 1 477 ? 6.567   -36.767 5.639   1.00 64.72  ? 583 ASP A OD1   1 
ATOM   3744 O  OD2   . ASP A 1 477 ? 4.854   -36.522 4.220   1.00 68.99  ? 583 ASP A OD2   1 
ATOM   3745 N  N     . GLY A 1 478 ? 6.525   -38.624 8.664   1.00 59.27  ? 584 GLY A N     1 
ATOM   3746 C  CA    . GLY A 1 478 ? 7.086   -39.982 8.869   1.00 58.05  ? 584 GLY A CA    1 
ATOM   3747 C  C     . GLY A 1 478 ? 6.124   -41.122 9.200   1.00 55.69  ? 584 GLY A C     1 
ATOM   3748 O  O     . GLY A 1 478 ? 6.184   -42.175 8.575   1.00 55.33  ? 584 GLY A O     1 
ATOM   3749 N  N     . ASP A 1 479 ? 5.230   -40.906 10.161  1.00 57.78  ? 585 ASP A N     1 
ATOM   3750 C  CA    . ASP A 1 479 ? 4.284   -41.952 10.621  1.00 61.39  ? 585 ASP A CA    1 
ATOM   3751 C  C     . ASP A 1 479 ? 3.254   -42.299 9.555   1.00 63.77  ? 585 ASP A C     1 
ATOM   3752 O  O     . ASP A 1 479 ? 2.792   -43.457 9.472   1.00 63.41  ? 585 ASP A O     1 
ATOM   3753 C  CB    . ASP A 1 479 ? 3.515   -41.515 11.867  1.00 61.11  ? 585 ASP A CB    1 
ATOM   3754 C  CG    . ASP A 1 479 ? 4.413   -41.232 13.064  1.00 62.50  ? 585 ASP A CG    1 
ATOM   3755 O  OD1   . ASP A 1 479 ? 5.460   -41.923 13.257  1.00 63.59  ? 585 ASP A OD1   1 
ATOM   3756 O  OD2   . ASP A 1 479 ? 4.038   -40.297 13.815  1.00 60.96  ? 585 ASP A OD2   1 
ATOM   3757 N  N     . VAL A 1 480 ? 2.913   -41.279 8.767   1.00 63.18  ? 586 VAL A N     1 
ATOM   3758 C  CA    . VAL A 1 480 ? 1.993   -41.407 7.672   1.00 60.89  ? 586 VAL A CA    1 
ATOM   3759 C  C     . VAL A 1 480 ? 2.679   -42.051 6.446   1.00 60.42  ? 586 VAL A C     1 
ATOM   3760 O  O     . VAL A 1 480 ? 2.139   -42.977 5.894   1.00 56.82  ? 586 VAL A O     1 
ATOM   3761 C  CB    . VAL A 1 480 ? 1.345   -40.039 7.350   1.00 59.21  ? 586 VAL A CB    1 
ATOM   3762 C  CG1   . VAL A 1 480 ? 0.515   -40.139 6.083   1.00 61.69  ? 586 VAL A CG1   1 
ATOM   3763 C  CG2   . VAL A 1 480 ? 0.491   -39.560 8.527   1.00 57.79  ? 586 VAL A CG2   1 
ATOM   3764 N  N     . ILE A 1 481 ? 3.847   -41.566 6.028   1.00 61.91  ? 587 ILE A N     1 
ATOM   3765 C  CA    . ILE A 1 481 ? 4.484   -42.085 4.805   1.00 61.56  ? 587 ILE A CA    1 
ATOM   3766 C  C     . ILE A 1 481 ? 5.213   -43.424 4.996   1.00 66.93  ? 587 ILE A C     1 
ATOM   3767 O  O     . ILE A 1 481 ? 5.389   -44.168 4.025   1.00 72.65  ? 587 ILE A O     1 
ATOM   3768 C  CB    . ILE A 1 481 ? 5.441   -41.075 4.114   1.00 58.46  ? 587 ILE A CB    1 
ATOM   3769 C  CG1   . ILE A 1 481 ? 6.698   -40.797 4.969   1.00 57.47  ? 587 ILE A CG1   1 
ATOM   3770 C  CG2   . ILE A 1 481 ? 4.650   -39.832 3.729   1.00 56.69  ? 587 ILE A CG2   1 
ATOM   3771 C  CD1   . ILE A 1 481 ? 7.683   -39.837 4.362   1.00 57.74  ? 587 ILE A CD1   1 
ATOM   3772 N  N     . ALA A 1 482 ? 5.645   -43.737 6.216   1.00 63.85  ? 588 ALA A N     1 
ATOM   3773 C  CA    . ALA A 1 482 ? 6.406   -44.960 6.445   1.00 67.36  ? 588 ALA A CA    1 
ATOM   3774 C  C     . ALA A 1 482 ? 6.035   -45.548 7.805   1.00 69.77  ? 588 ALA A C     1 
ATOM   3775 O  O     . ALA A 1 482 ? 6.879   -45.609 8.678   1.00 66.44  ? 588 ALA A O     1 
ATOM   3776 C  CB    . ALA A 1 482 ? 7.918   -44.704 6.329   1.00 63.37  ? 588 ALA A CB    1 
ATOM   3777 N  N     . PRO A 1 483 ? 4.762   -45.990 7.973   1.00 76.04  ? 589 PRO A N     1 
ATOM   3778 C  CA    . PRO A 1 483 ? 4.280   -46.501 9.274   1.00 75.81  ? 589 PRO A CA    1 
ATOM   3779 C  C     . PRO A 1 483 ? 5.047   -47.723 9.796   1.00 74.08  ? 589 PRO A C     1 
ATOM   3780 O  O     . PRO A 1 483 ? 5.150   -47.921 11.022  1.00 69.30  ? 589 PRO A O     1 
ATOM   3781 C  CB    . PRO A 1 483 ? 2.805   -46.829 9.011   1.00 75.62  ? 589 PRO A CB    1 
ATOM   3782 C  CG    . PRO A 1 483 ? 2.689   -46.996 7.543   1.00 75.36  ? 589 PRO A CG    1 
ATOM   3783 C  CD    . PRO A 1 483 ? 3.751   -46.168 6.908   1.00 75.96  ? 589 PRO A CD    1 
ATOM   3784 N  N     . LEU A 1 484 ? 5.609   -48.495 8.865   1.00 74.83  ? 590 LEU A N     1 
ATOM   3785 C  CA    . LEU A 1 484 ? 6.464   -49.648 9.198   1.00 77.03  ? 590 LEU A CA    1 
ATOM   3786 C  C     . LEU A 1 484 ? 7.851   -49.299 9.737   1.00 76.50  ? 590 LEU A C     1 
ATOM   3787 O  O     . LEU A 1 484 ? 8.493   -50.165 10.293  1.00 86.22  ? 590 LEU A O     1 
ATOM   3788 C  CB    . LEU A 1 484 ? 6.619   -50.594 7.993   1.00 76.66  ? 590 LEU A CB    1 
ATOM   3789 C  CG    . LEU A 1 484 ? 5.301   -51.200 7.434   1.00 74.23  ? 590 LEU A CG    1 
ATOM   3790 C  CD1   . LEU A 1 484 ? 5.550   -51.953 6.125   1.00 73.70  ? 590 LEU A CD1   1 
ATOM   3791 C  CD2   . LEU A 1 484 ? 4.581   -52.065 8.475   1.00 71.49  ? 590 LEU A CD2   1 
ATOM   3792 N  N     . ILE A 1 485 ? 8.328   -48.064 9.574   1.00 73.16  ? 591 ILE A N     1 
ATOM   3793 C  CA    . ILE A 1 485 ? 9.754   -47.738 9.815   1.00 72.34  ? 591 ILE A CA    1 
ATOM   3794 C  C     . ILE A 1 485 ? 10.010  -46.849 11.022  1.00 73.81  ? 591 ILE A C     1 
ATOM   3795 O  O     . ILE A 1 485 ? 10.979  -47.055 11.735  1.00 71.72  ? 591 ILE A O     1 
ATOM   3796 C  CB    . ILE A 1 485 ? 10.410  -47.131 8.551   1.00 68.00  ? 591 ILE A CB    1 
ATOM   3797 C  CG1   . ILE A 1 485 ? 10.065  -48.033 7.338   1.00 66.37  ? 591 ILE A CG1   1 
ATOM   3798 C  CG2   . ILE A 1 485 ? 11.909  -46.924 8.764   1.00 69.63  ? 591 ILE A CG2   1 
ATOM   3799 C  CD1   . ILE A 1 485 ? 11.047  -48.119 6.184   1.00 66.81  ? 591 ILE A CD1   1 
ATOM   3800 N  N     . THR A 1 486 ? 9.142   -45.865 11.255  1.00 78.01  ? 592 THR A N     1 
ATOM   3801 C  CA    . THR A 1 486 ? 9.271   -44.909 12.370  1.00 78.25  ? 592 THR A CA    1 
ATOM   3802 C  C     . THR A 1 486 ? 9.275   -45.528 13.791  1.00 83.22  ? 592 THR A C     1 
ATOM   3803 O  O     . THR A 1 486 ? 9.914   -44.959 14.698  1.00 84.45  ? 592 THR A O     1 
ATOM   3804 C  CB    . THR A 1 486 ? 8.234   -43.741 12.268  1.00 77.17  ? 592 THR A CB    1 
ATOM   3805 O  OG1   . THR A 1 486 ? 6.899   -44.222 12.115  1.00 72.68  ? 592 THR A OG1   1 
ATOM   3806 C  CG2   . THR A 1 486 ? 8.548   -42.871 11.061  1.00 76.62  ? 592 THR A CG2   1 
ATOM   3807 N  N     . PRO A 1 487 ? 8.549   -46.669 13.999  1.00 85.41  ? 593 PRO A N     1 
ATOM   3808 C  CA    . PRO A 1 487 ? 8.742   -47.529 15.190  1.00 82.80  ? 593 PRO A CA    1 
ATOM   3809 C  C     . PRO A 1 487 ? 10.155  -48.080 15.461  1.00 81.68  ? 593 PRO A C     1 
ATOM   3810 O  O     . PRO A 1 487 ? 10.471  -48.244 16.613  1.00 79.37  ? 593 PRO A O     1 
ATOM   3811 C  CB    . PRO A 1 487 ? 7.756   -48.695 14.963  1.00 83.83  ? 593 PRO A CB    1 
ATOM   3812 C  CG    . PRO A 1 487 ? 6.982   -48.375 13.729  1.00 84.00  ? 593 PRO A CG    1 
ATOM   3813 C  CD    . PRO A 1 487 ? 7.221   -46.933 13.402  1.00 85.23  ? 593 PRO A CD    1 
ATOM   3814 N  N     . GLN A 1 488 ? 11.004  -48.319 14.443  1.00 83.72  ? 594 GLN A N     1 
ATOM   3815 C  CA    . GLN A 1 488 ? 12.459  -48.666 14.637  1.00 79.39  ? 594 GLN A CA    1 
ATOM   3816 C  C     . GLN A 1 488 ? 13.277  -47.680 15.468  1.00 80.15  ? 594 GLN A C     1 
ATOM   3817 O  O     . GLN A 1 488 ? 14.430  -47.986 15.722  1.00 81.64  ? 594 GLN A O     1 
ATOM   3818 C  CB    . GLN A 1 488 ? 13.231  -48.824 13.299  1.00 71.28  ? 594 GLN A CB    1 
ATOM   3819 N  N     . LYS A 1 489 ? 12.734  -46.497 15.822  1.00 81.01  ? 595 LYS A N     1 
ATOM   3820 C  CA    . LYS A 1 489 ? 13.322  -45.608 16.841  1.00 81.60  ? 595 LYS A CA    1 
ATOM   3821 C  C     . LYS A 1 489 ? 12.360  -45.262 18.006  1.00 82.35  ? 595 LYS A C     1 
ATOM   3822 O  O     . LYS A 1 489 ? 11.361  -44.516 17.828  1.00 78.50  ? 595 LYS A O     1 
ATOM   3823 C  CB    . LYS A 1 489 ? 13.902  -44.325 16.212  1.00 81.46  ? 595 LYS A CB    1 
ATOM   3824 C  CG    . LYS A 1 489 ? 15.265  -44.543 15.566  1.00 79.43  ? 595 LYS A CG    1 
ATOM   3825 C  CD    . LYS A 1 489 ? 16.133  -43.320 15.816  1.00 79.88  ? 595 LYS A CD    1 
ATOM   3826 C  CE    . LYS A 1 489 ? 17.416  -43.309 15.000  1.00 79.94  ? 595 LYS A CE    1 
ATOM   3827 N  NZ    . LYS A 1 489 ? 18.711  -43.337 15.737  1.00 77.97  ? 595 LYS A NZ    1 
ATOM   3828 N  N     . LYS A 1 490 ? 12.746  -45.740 19.214  1.00 78.56  ? 596 LYS A N     1 
ATOM   3829 C  CA    . LYS A 1 490 ? 12.240  -45.297 20.516  1.00 77.78  ? 596 LYS A CA    1 
ATOM   3830 C  C     . LYS A 1 490 ? 12.173  -43.762 20.568  1.00 74.79  ? 596 LYS A C     1 
ATOM   3831 O  O     . LYS A 1 490 ? 11.090  -43.197 20.806  1.00 74.06  ? 596 LYS A O     1 
ATOM   3832 C  CB    . LYS A 1 490 ? 13.160  -45.859 21.650  1.00 77.80  ? 596 LYS A CB    1 
ATOM   3833 N  N     . GLU A 1 491 ? 13.325  -43.128 20.261  1.00 71.50  ? 597 GLU A N     1 
ATOM   3834 C  CA    . GLU A 1 491 ? 13.545  -41.653 20.264  1.00 70.68  ? 597 GLU A CA    1 
ATOM   3835 C  C     . GLU A 1 491 ? 12.482  -40.814 19.442  1.00 78.01  ? 597 GLU A C     1 
ATOM   3836 O  O     . GLU A 1 491 ? 12.441  -39.585 19.599  1.00 75.29  ? 597 GLU A O     1 
ATOM   3837 C  CB    . GLU A 1 491 ? 15.024  -41.314 19.839  1.00 59.27  ? 597 GLU A CB    1 
ATOM   3838 N  N     . TRP A 1 492 ? 11.611  -41.456 18.622  1.00 84.41  ? 598 TRP A N     1 
ATOM   3839 C  CA    . TRP A 1 492 ? 10.630  -40.758 17.757  1.00 86.24  ? 598 TRP A CA    1 
ATOM   3840 C  C     . TRP A 1 492 ? 9.101   -40.782 18.150  1.00 86.31  ? 598 TRP A C     1 
ATOM   3841 O  O     . TRP A 1 492 ? 8.322   -40.030 17.552  1.00 77.74  ? 598 TRP A O     1 
ATOM   3842 C  CB    . TRP A 1 492 ? 10.810  -41.253 16.309  1.00 88.77  ? 598 TRP A CB    1 
ATOM   3843 C  CG    . TRP A 1 492 ? 12.120  -40.803 15.535  1.00 84.35  ? 598 TRP A CG    1 
ATOM   3844 C  CD1   . TRP A 1 492 ? 13.110  -39.927 15.954  1.00 79.52  ? 598 TRP A CD1   1 
ATOM   3845 C  CD2   . TRP A 1 492 ? 12.484  -41.212 14.182  1.00 78.31  ? 598 TRP A CD2   1 
ATOM   3846 N  NE1   . TRP A 1 492 ? 14.053  -39.772 14.924  1.00 77.78  ? 598 TRP A NE1   1 
ATOM   3847 C  CE2   . TRP A 1 492 ? 13.692  -40.546 13.841  1.00 75.21  ? 598 TRP A CE2   1 
ATOM   3848 C  CE3   . TRP A 1 492 ? 11.883  -42.071 13.233  1.00 76.73  ? 598 TRP A CE3   1 
ATOM   3849 C  CZ2   . TRP A 1 492 ? 14.322  -40.739 12.597  1.00 76.88  ? 598 TRP A CZ2   1 
ATOM   3850 C  CZ3   . TRP A 1 492 ? 12.479  -42.265 12.018  1.00 78.09  ? 598 TRP A CZ3   1 
ATOM   3851 C  CH2   . TRP A 1 492 ? 13.691  -41.588 11.692  1.00 80.96  ? 598 TRP A CH2   1 
ATOM   3852 N  N     . ASN A 1 493 ? 8.690   -41.612 19.109  1.00 88.66  ? 599 ASN A N     1 
ATOM   3853 C  CA    . ASN A 1 493 ? 7.309   -41.518 19.709  1.00 95.68  ? 599 ASN A CA    1 
ATOM   3854 C  C     . ASN A 1 493 ? 6.819   -40.094 20.095  1.00 97.68  ? 599 ASN A C     1 
ATOM   3855 O  O     . ASN A 1 493 ? 5.810   -39.908 20.802  1.00 99.91  ? 599 ASN A O     1 
ATOM   3856 C  CB    . ASN A 1 493 ? 7.249   -42.402 20.936  1.00 94.96  ? 599 ASN A CB    1 
ATOM   3857 C  CG    . ASN A 1 493 ? 7.632   -43.847 20.637  1.00 95.40  ? 599 ASN A CG    1 
ATOM   3858 O  OD1   . ASN A 1 493 ? 7.323   -44.410 19.568  1.00 83.42  ? 599 ASN A OD1   1 
ATOM   3859 N  ND2   . ASN A 1 493 ? 8.336   -44.458 21.591  1.00 99.45  ? 599 ASN A ND2   1 
ATOM   3860 N  N     . THR B 1 8   ? -8.317  -33.420 -5.614  1.00 94.65  ? 114 THR B N     1 
ATOM   3861 C  CA    . THR B 1 8   ? -8.773  -32.272 -4.734  1.00 95.40  ? 114 THR B CA    1 
ATOM   3862 C  C     . THR B 1 8   ? -8.360  -30.920 -5.367  1.00 85.95  ? 114 THR B C     1 
ATOM   3863 O  O     . THR B 1 8   ? -7.810  -30.887 -6.492  1.00 76.10  ? 114 THR B O     1 
ATOM   3864 C  CB    . THR B 1 8   ? -8.310  -32.447 -3.215  1.00 104.34 ? 114 THR B CB    1 
ATOM   3865 O  OG1   . THR B 1 8   ? -9.014  -31.550 -2.331  1.00 100.29 ? 114 THR B OG1   1 
ATOM   3866 C  CG2   . THR B 1 8   ? -6.771  -32.275 -3.008  1.00 104.96 ? 114 THR B CG2   1 
ATOM   3867 N  N     . MET B 1 9   ? -8.619  -29.828 -4.635  1.00 78.38  ? 115 MET B N     1 
ATOM   3868 C  CA    . MET B 1 9   ? -8.281  -28.475 -5.064  1.00 68.91  ? 115 MET B CA    1 
ATOM   3869 C  C     . MET B 1 9   ? -6.787  -28.332 -5.008  1.00 59.80  ? 115 MET B C     1 
ATOM   3870 O  O     . MET B 1 9   ? -6.076  -29.091 -4.388  1.00 63.65  ? 115 MET B O     1 
ATOM   3871 C  CB    . MET B 1 9   ? -8.930  -27.405 -4.176  1.00 71.32  ? 115 MET B CB    1 
ATOM   3872 C  CG    . MET B 1 9   ? -10.452 -27.542 -4.105  1.00 77.30  ? 115 MET B CG    1 
ATOM   3873 S  SD    . MET B 1 9   ? -11.367 -27.155 -5.636  1.00 87.05  ? 115 MET B SD    1 
ATOM   3874 C  CE    . MET B 1 9   ? -12.628 -28.441 -5.776  1.00 80.43  ? 115 MET B CE    1 
ATOM   3875 N  N     . LYS B 1 10  ? -6.314  -27.353 -5.722  1.00 48.86  ? 116 LYS B N     1 
ATOM   3876 C  CA    . LYS B 1 10  ? -4.932  -26.958 -5.680  1.00 41.61  ? 116 LYS B CA    1 
ATOM   3877 C  C     . LYS B 1 10  ? -5.019  -25.480 -5.370  1.00 37.96  ? 116 LYS B C     1 
ATOM   3878 O  O     . LYS B 1 10  ? -5.847  -24.829 -5.870  1.00 38.52  ? 116 LYS B O     1 
ATOM   3879 C  CB    . LYS B 1 10  ? -4.312  -27.227 -7.045  1.00 38.91  ? 116 LYS B CB    1 
ATOM   3880 C  CG    . LYS B 1 10  ? -2.822  -27.270 -7.057  1.00 37.77  ? 116 LYS B CG    1 
ATOM   3881 C  CD    . LYS B 1 10  ? -2.266  -28.088 -8.236  1.00 34.59  ? 116 LYS B CD    1 
ATOM   3882 C  CE    . LYS B 1 10  ? -0.852  -27.712 -8.487  1.00 33.41  ? 116 LYS B CE    1 
ATOM   3883 N  NZ    . LYS B 1 10  ? 0.024   -28.696 -9.143  1.00 32.21  ? 116 LYS B NZ    1 
ATOM   3884 N  N     . VAL B 1 11  ? -4.181  -24.979 -4.482  1.00 36.32  ? 117 VAL B N     1 
ATOM   3885 C  CA    . VAL B 1 11  ? -4.184  -23.593 -4.045  1.00 34.84  ? 117 VAL B CA    1 
ATOM   3886 C  C     . VAL B 1 11  ? -2.963  -22.907 -4.647  1.00 33.27  ? 117 VAL B C     1 
ATOM   3887 O  O     . VAL B 1 11  ? -1.824  -23.394 -4.508  1.00 34.45  ? 117 VAL B O     1 
ATOM   3888 C  CB    . VAL B 1 11  ? -4.169  -23.481 -2.515  1.00 35.73  ? 117 VAL B CB    1 
ATOM   3889 C  CG1   . VAL B 1 11  ? -4.102  -22.038 -2.063  1.00 36.52  ? 117 VAL B CG1   1 
ATOM   3890 C  CG2   . VAL B 1 11  ? -5.476  -24.060 -1.970  1.00 37.15  ? 117 VAL B CG2   1 
ATOM   3891 N  N     . ILE B 1 12  ? -3.217  -21.772 -5.292  1.00 30.10  ? 118 ILE B N     1 
ATOM   3892 C  CA    . ILE B 1 12  ? -2.152  -20.925 -5.827  1.00 28.86  ? 118 ILE B CA    1 
ATOM   3893 C  C     . ILE B 1 12  ? -2.257  -19.513 -5.218  1.00 28.17  ? 118 ILE B C     1 
ATOM   3894 O  O     . ILE B 1 12  ? -3.374  -19.031 -4.950  1.00 29.40  ? 118 ILE B O     1 
ATOM   3895 C  CB    . ILE B 1 12  ? -2.177  -20.993 -7.370  1.00 28.48  ? 118 ILE B CB    1 
ATOM   3896 C  CG1   . ILE B 1 12  ? -0.952  -20.390 -7.981  1.00 29.17  ? 118 ILE B CG1   1 
ATOM   3897 C  CG2   . ILE B 1 12  ? -3.428  -20.381 -7.937  1.00 28.63  ? 118 ILE B CG2   1 
ATOM   3898 C  CD1   . ILE B 1 12  ? -0.650  -20.895 -9.402  1.00 30.13  ? 118 ILE B CD1   1 
ATOM   3899 N  N     . ASN B 1 13  ? -1.118  -18.881 -4.938  1.00 26.08  ? 119 ASN B N     1 
ATOM   3900 C  CA    . ASN B 1 13  ? -1.080  -17.583 -4.336  1.00 26.80  ? 119 ASN B CA    1 
ATOM   3901 C  C     . ASN B 1 13  ? -0.752  -16.528 -5.387  1.00 28.41  ? 119 ASN B C     1 
ATOM   3902 O  O     . ASN B 1 13  ? 0.371   -16.442 -5.895  1.00 29.20  ? 119 ASN B O     1 
ATOM   3903 C  CB    . ASN B 1 13  ? 0.013   -17.538 -3.241  1.00 29.40  ? 119 ASN B CB    1 
ATOM   3904 C  CG    . ASN B 1 13  ? 0.090   -16.185 -2.498  1.00 29.06  ? 119 ASN B CG    1 
ATOM   3905 O  OD1   . ASN B 1 13  ? -0.639  -15.192 -2.839  1.00 27.75  ? 119 ASN B OD1   1 
ATOM   3906 N  ND2   . ASN B 1 13  ? 0.933   -16.155 -1.467  1.00 27.83  ? 119 ASN B ND2   1 
ATOM   3907 N  N     . ASP B 1 14  ? -1.759  -15.698 -5.653  1.00 27.97  ? 120 ASP B N     1 
ATOM   3908 C  CA    . ASP B 1 14  ? -1.705  -14.636 -6.612  1.00 27.33  ? 120 ASP B CA    1 
ATOM   3909 C  C     . ASP B 1 14  ? -1.593  -13.316 -5.799  1.00 24.81  ? 120 ASP B C     1 
ATOM   3910 O  O     . ASP B 1 14  ? -2.279  -13.157 -4.768  1.00 25.41  ? 120 ASP B O     1 
ATOM   3911 C  CB    . ASP B 1 14  ? -2.969  -14.668 -7.484  1.00 28.45  ? 120 ASP B CB    1 
ATOM   3912 C  CG    . ASP B 1 14  ? -3.166  -13.378 -8.298  1.00 30.43  ? 120 ASP B CG    1 
ATOM   3913 O  OD1   . ASP B 1 14  ? -2.158  -12.843 -8.760  1.00 32.82  ? 120 ASP B OD1   1 
ATOM   3914 O  OD2   . ASP B 1 14  ? -4.281  -12.849 -8.493  1.00 32.04  ? 120 ASP B OD2   1 
ATOM   3915 N  N     . PRO B 1 15  ? -0.762  -12.382 -6.236  1.00 22.56  ? 121 PRO B N     1 
ATOM   3916 C  CA    . PRO B 1 15  ? -0.652  -11.182 -5.425  1.00 23.27  ? 121 PRO B CA    1 
ATOM   3917 C  C     . PRO B 1 15  ? -1.863  -10.257 -5.487  1.00 23.03  ? 121 PRO B C     1 
ATOM   3918 O  O     . PRO B 1 15  ? -2.081  -9.536  -4.546  1.00 22.60  ? 121 PRO B O     1 
ATOM   3919 C  CB    . PRO B 1 15  ? 0.576   -10.449 -5.978  1.00 23.45  ? 121 PRO B CB    1 
ATOM   3920 C  CG    . PRO B 1 15  ? 0.708   -11.032 -7.372  1.00 24.74  ? 121 PRO B CG    1 
ATOM   3921 C  CD    . PRO B 1 15  ? 0.355   -12.492 -7.178  1.00 24.24  ? 121 PRO B CD    1 
ATOM   3922 N  N     . ILE B 1 16  ? -2.697  -10.298 -6.512  1.00 20.92  ? 122 ILE B N     1 
ATOM   3923 C  CA    . ILE B 1 16  ? -3.880  -9.427  -6.525  1.00 20.46  ? 122 ILE B CA    1 
ATOM   3924 C  C     . ILE B 1 16  ? -4.977  -10.101 -5.746  1.00 21.19  ? 122 ILE B C     1 
ATOM   3925 O  O     . ILE B 1 16  ? -5.558  -9.447  -4.928  1.00 21.27  ? 122 ILE B O     1 
ATOM   3926 C  CB    . ILE B 1 16  ? -4.344  -9.172  -8.036  1.00 20.81  ? 122 ILE B CB    1 
ATOM   3927 C  CG1   . ILE B 1 16  ? -3.203  -8.705  -8.891  1.00 19.63  ? 122 ILE B CG1   1 
ATOM   3928 C  CG2   . ILE B 1 16  ? -5.573  -8.277  -8.199  1.00 20.79  ? 122 ILE B CG2   1 
ATOM   3929 C  CD1   . ILE B 1 16  ? -2.518  -7.535  -8.393  1.00 19.74  ? 122 ILE B CD1   1 
ATOM   3930 N  N     . HIS B 1 17  ? -5.273  -11.388 -5.976  1.00 21.72  ? 123 HIS B N     1 
ATOM   3931 C  CA    . HIS B 1 17  ? -6.488  -12.000 -5.441  1.00 22.10  ? 123 HIS B CA    1 
ATOM   3932 C  C     . HIS B 1 17  ? -6.232  -12.890 -4.236  1.00 23.38  ? 123 HIS B C     1 
ATOM   3933 O  O     . HIS B 1 17  ? -7.137  -13.265 -3.592  1.00 21.98  ? 123 HIS B O     1 
ATOM   3934 C  CB    . HIS B 1 17  ? -7.232  -12.794 -6.520  1.00 23.68  ? 123 HIS B CB    1 
ATOM   3935 C  CG    . HIS B 1 17  ? -7.594  -11.995 -7.716  1.00 24.10  ? 123 HIS B CG    1 
ATOM   3936 N  ND1   . HIS B 1 17  ? -8.447  -10.918 -7.637  1.00 25.05  ? 123 HIS B ND1   1 
ATOM   3937 C  CD2   . HIS B 1 17  ? -7.222  -12.088 -9.025  1.00 25.80  ? 123 HIS B CD2   1 
ATOM   3938 C  CE1   . HIS B 1 17  ? -8.601  -10.387 -8.831  1.00 24.63  ? 123 HIS B CE1   1 
ATOM   3939 N  NE2   . HIS B 1 17  ? -7.873  -11.093 -9.706  1.00 25.26  ? 123 HIS B NE2   1 
ATOM   3940 N  N     . GLY B 1 18  ? -4.977  -13.106 -3.874  1.00 25.00  ? 124 GLY B N     1 
ATOM   3941 C  CA    . GLY B 1 18  ? -4.572  -13.955 -2.759  1.00 26.10  ? 124 GLY B CA    1 
ATOM   3942 C  C     . GLY B 1 18  ? -4.636  -15.461 -3.117  1.00 27.46  ? 124 GLY B C     1 
ATOM   3943 O  O     . GLY B 1 18  ? -4.420  -15.840 -4.312  1.00 25.73  ? 124 GLY B O     1 
ATOM   3944 N  N     . HIS B 1 19  ? -4.872  -16.279 -2.081  1.00 26.41  ? 125 HIS B N     1 
ATOM   3945 C  CA    . HIS B 1 19  ? -4.905  -17.746 -2.197  1.00 29.26  ? 125 HIS B CA    1 
ATOM   3946 C  C     . HIS B 1 19  ? -6.177  -18.227 -2.880  1.00 32.67  ? 125 HIS B C     1 
ATOM   3947 O  O     . HIS B 1 19  ? -7.260  -18.027 -2.353  1.00 32.52  ? 125 HIS B O     1 
ATOM   3948 C  CB    . HIS B 1 19  ? -4.698  -18.415 -0.837  1.00 26.44  ? 125 HIS B CB    1 
ATOM   3949 C  CG    . HIS B 1 19  ? -3.290  -18.289 -0.349  1.00 24.91  ? 125 HIS B CG    1 
ATOM   3950 N  ND1   . HIS B 1 19  ? -2.753  -17.087 0.063   1.00 25.51  ? 125 HIS B ND1   1 
ATOM   3951 C  CD2   . HIS B 1 19  ? -2.287  -19.194 -0.277  1.00 24.49  ? 125 HIS B CD2   1 
ATOM   3952 C  CE1   . HIS B 1 19  ? -1.490  -17.271 0.424   1.00 24.99  ? 125 HIS B CE1   1 
ATOM   3953 N  NE2   . HIS B 1 19  ? -1.179  -18.540 0.206   1.00 24.76  ? 125 HIS B NE2   1 
ATOM   3954 N  N     . ILE B 1 20  ? -6.040  -18.832 -4.075  1.00 34.87  ? 126 ILE B N     1 
ATOM   3955 C  CA    . ILE B 1 20  ? -7.209  -19.285 -4.787  1.00 36.01  ? 126 ILE B CA    1 
ATOM   3956 C  C     . ILE B 1 20  ? -7.170  -20.723 -5.139  1.00 34.77  ? 126 ILE B C     1 
ATOM   3957 O  O     . ILE B 1 20  ? -6.114  -21.273 -5.364  1.00 31.55  ? 126 ILE B O     1 
ATOM   3958 C  CB    . ILE B 1 20  ? -7.476  -18.437 -6.032  1.00 39.46  ? 126 ILE B CB    1 
ATOM   3959 C  CG1   . ILE B 1 20  ? -6.420  -18.614 -7.113  1.00 39.90  ? 126 ILE B CG1   1 
ATOM   3960 C  CG2   . ILE B 1 20  ? -7.519  -16.993 -5.598  1.00 42.08  ? 126 ILE B CG2   1 
ATOM   3961 C  CD1   . ILE B 1 20  ? -6.551  -17.665 -8.255  1.00 40.91  ? 126 ILE B CD1   1 
ATOM   3962 N  N     . GLU B 1 21  ? -8.374  -21.300 -5.200  1.00 37.39  ? 127 GLU B N     1 
ATOM   3963 C  CA    . GLU B 1 21  ? -8.593  -22.759 -5.367  1.00 39.24  ? 127 GLU B CA    1 
ATOM   3964 C  C     . GLU B 1 21  ? -8.828  -23.087 -6.793  1.00 36.88  ? 127 GLU B C     1 
ATOM   3965 O  O     . GLU B 1 21  ? -9.573  -22.394 -7.440  1.00 37.90  ? 127 GLU B O     1 
ATOM   3966 C  CB    . GLU B 1 21  ? -9.782  -23.217 -4.597  1.00 41.71  ? 127 GLU B CB    1 
ATOM   3967 C  CG    . GLU B 1 21  ? -9.577  -23.145 -3.121  1.00 45.29  ? 127 GLU B CG    1 
ATOM   3968 C  CD    . GLU B 1 21  ? -10.808 -23.562 -2.384  1.00 48.31  ? 127 GLU B CD    1 
ATOM   3969 O  OE1   . GLU B 1 21  ? -11.528 -24.332 -3.018  1.00 56.17  ? 127 GLU B OE1   1 
ATOM   3970 O  OE2   . GLU B 1 21  ? -11.048 -23.117 -1.223  1.00 49.07  ? 127 GLU B OE2   1 
ATOM   3971 N  N     . LEU B 1 22  ? -8.102  -24.077 -7.309  1.00 36.87  ? 128 LEU B N     1 
ATOM   3972 C  CA    . LEU B 1 22  ? -8.200  -24.487 -8.685  1.00 38.02  ? 128 LEU B CA    1 
ATOM   3973 C  C     . LEU B 1 22  ? -8.731  -25.918 -8.755  1.00 37.82  ? 128 LEU B C     1 
ATOM   3974 O  O     . LEU B 1 22  ? -8.072  -26.889 -8.314  1.00 42.66  ? 128 LEU B O     1 
ATOM   3975 C  CB    . LEU B 1 22  ? -6.821  -24.416 -9.325  1.00 38.70  ? 128 LEU B CB    1 
ATOM   3976 C  CG    . LEU B 1 22  ? -6.178  -23.026 -9.461  1.00 36.91  ? 128 LEU B CG    1 
ATOM   3977 C  CD1   . LEU B 1 22  ? -4.755  -23.248 -9.923  1.00 36.89  ? 128 LEU B CD1   1 
ATOM   3978 C  CD2   . LEU B 1 22  ? -6.848  -22.110 -10.459 1.00 36.82  ? 128 LEU B CD2   1 
ATOM   3979 N  N     . HIS B 1 23  ? -9.908  -26.059 -9.339  1.00 37.65  ? 129 HIS B N     1 
ATOM   3980 C  CA    . HIS B 1 23  ? -10.538 -27.373 -9.575  1.00 38.11  ? 129 HIS B CA    1 
ATOM   3981 C  C     . HIS B 1 23  ? -9.615  -28.250 -10.431 1.00 38.92  ? 129 HIS B C     1 
ATOM   3982 O  O     . HIS B 1 23  ? -8.853  -27.716 -11.272 1.00 40.56  ? 129 HIS B O     1 
ATOM   3983 C  CB    . HIS B 1 23  ? -11.875 -27.169 -10.264 1.00 38.25  ? 129 HIS B CB    1 
ATOM   3984 C  CG    . HIS B 1 23  ? -12.698 -28.413 -10.423 1.00 40.76  ? 129 HIS B CG    1 
ATOM   3985 N  ND1   . HIS B 1 23  ? -12.520 -29.281 -11.479 1.00 41.31  ? 129 HIS B ND1   1 
ATOM   3986 C  CD2   . HIS B 1 23  ? -13.772 -28.880 -9.742  1.00 39.01  ? 129 HIS B CD2   1 
ATOM   3987 C  CE1   . HIS B 1 23  ? -13.404 -30.262 -11.402 1.00 40.21  ? 129 HIS B CE1   1 
ATOM   3988 N  NE2   . HIS B 1 23  ? -14.172 -30.048 -10.359 1.00 39.10  ? 129 HIS B NE2   1 
ATOM   3989 N  N     . PRO B 1 24  ? -9.623  -29.574 -10.214 1.00 40.31  ? 130 PRO B N     1 
ATOM   3990 C  CA    . PRO B 1 24  ? -8.628  -30.391 -10.920 1.00 40.46  ? 130 PRO B CA    1 
ATOM   3991 C  C     . PRO B 1 24  ? -8.739  -30.382 -12.450 1.00 37.37  ? 130 PRO B C     1 
ATOM   3992 O  O     . PRO B 1 24  ? -7.758  -30.558 -13.106 1.00 37.14  ? 130 PRO B O     1 
ATOM   3993 C  CB    . PRO B 1 24  ? -8.871  -31.807 -10.388 1.00 40.83  ? 130 PRO B CB    1 
ATOM   3994 C  CG    . PRO B 1 24  ? -9.926  -31.725 -9.350  1.00 41.42  ? 130 PRO B CG    1 
ATOM   3995 C  CD    . PRO B 1 24  ? -10.194 -30.290 -9.063  1.00 41.88  ? 130 PRO B CD    1 
ATOM   3996 N  N     . LEU B 1 25  ? -9.928  -30.214 -12.988 1.00 35.92  ? 131 LEU B N     1 
ATOM   3997 C  CA    . LEU B 1 25  ? -10.096 -29.989 -14.424 1.00 37.47  ? 131 LEU B CA    1 
ATOM   3998 C  C     . LEU B 1 25  ? -9.386  -28.709 -14.925 1.00 36.20  ? 131 LEU B C     1 
ATOM   3999 O  O     . LEU B 1 25  ? -8.836  -28.683 -16.029 1.00 35.06  ? 131 LEU B O     1 
ATOM   4000 C  CB    . LEU B 1 25  ? -11.577 -29.958 -14.790 1.00 37.02  ? 131 LEU B CB    1 
ATOM   4001 C  CG    . LEU B 1 25  ? -11.932 -29.695 -16.237 1.00 38.17  ? 131 LEU B CG    1 
ATOM   4002 C  CD1   . LEU B 1 25  ? -11.390 -30.761 -17.177 1.00 37.96  ? 131 LEU B CD1   1 
ATOM   4003 C  CD2   . LEU B 1 25  ? -13.437 -29.604 -16.362 1.00 38.54  ? 131 LEU B CD2   1 
ATOM   4004 N  N     . LEU B 1 26  ? -9.392  -27.674 -14.093 1.00 34.37  ? 132 LEU B N     1 
ATOM   4005 C  CA    . LEU B 1 26  ? -8.693  -26.445 -14.418 1.00 32.25  ? 132 LEU B CA    1 
ATOM   4006 C  C     . LEU B 1 26  ? -7.213  -26.647 -14.428 1.00 32.15  ? 132 LEU B C     1 
ATOM   4007 O  O     . LEU B 1 26  ? -6.520  -26.197 -15.373 1.00 32.79  ? 132 LEU B O     1 
ATOM   4008 C  CB    . LEU B 1 26  ? -9.132  -25.321 -13.519 1.00 31.69  ? 132 LEU B CB    1 
ATOM   4009 C  CG    . LEU B 1 26  ? -10.627 -25.058 -13.246 1.00 32.64  ? 132 LEU B CG    1 
ATOM   4010 C  CD1   . LEU B 1 26  ? -10.871 -23.841 -12.323 1.00 34.07  ? 132 LEU B CD1   1 
ATOM   4011 C  CD2   . LEU B 1 26  ? -11.455 -24.906 -14.493 1.00 32.32  ? 132 LEU B CD2   1 
ATOM   4012 N  N     . VAL B 1 27  ? -6.730  -27.416 -13.459 1.00 34.44  ? 133 VAL B N     1 
ATOM   4013 C  CA    . VAL B 1 27  ? -5.303  -27.789 -13.380 1.00 35.80  ? 133 VAL B CA    1 
ATOM   4014 C  C     . VAL B 1 27  ? -4.826  -28.510 -14.660 1.00 36.64  ? 133 VAL B C     1 
ATOM   4015 O  O     . VAL B 1 27  ? -3.763  -28.185 -15.205 1.00 34.70  ? 133 VAL B O     1 
ATOM   4016 C  CB    . VAL B 1 27  ? -4.974  -28.647 -12.122 1.00 34.98  ? 133 VAL B CB    1 
ATOM   4017 C  CG1   . VAL B 1 27  ? -3.498  -29.091 -12.111 1.00 35.46  ? 133 VAL B CG1   1 
ATOM   4018 C  CG2   . VAL B 1 27  ? -5.299  -27.897 -10.818 1.00 34.22  ? 133 VAL B CG2   1 
ATOM   4019 N  N     . ARG B 1 28  ? -5.604  -29.491 -15.088 1.00 39.28  ? 134 ARG B N     1 
ATOM   4020 C  CA    . ARG B 1 28  ? -5.327  -30.242 -16.333 1.00 41.72  ? 134 ARG B CA    1 
ATOM   4021 C  C     . ARG B 1 28  ? -5.208  -29.323 -17.550 1.00 38.55  ? 134 ARG B C     1 
ATOM   4022 O  O     . ARG B 1 28  ? -4.287  -29.493 -18.285 1.00 36.21  ? 134 ARG B O     1 
ATOM   4023 C  CB    . ARG B 1 28  ? -6.422  -31.296 -16.661 1.00 46.00  ? 134 ARG B CB    1 
ATOM   4024 C  CG    . ARG B 1 28  ? -6.614  -32.386 -15.638 1.00 50.35  ? 134 ARG B CG    1 
ATOM   4025 C  CD    . ARG B 1 28  ? -5.352  -33.233 -15.419 1.00 54.55  ? 134 ARG B CD    1 
ATOM   4026 N  NE    . ARG B 1 28  ? -5.111  -33.973 -16.637 1.00 53.89  ? 134 ARG B NE    1 
ATOM   4027 C  CZ    . ARG B 1 28  ? -5.491  -35.232 -16.812 1.00 56.23  ? 134 ARG B CZ    1 
ATOM   4028 N  NH1   . ARG B 1 28  ? -5.233  -35.836 -17.944 1.00 56.25  ? 134 ARG B NH1   1 
ATOM   4029 N  NH2   . ARG B 1 28  ? -6.109  -35.921 -15.853 1.00 60.15  ? 134 ARG B NH2   1 
ATOM   4030 N  N     . ILE B 1 29  ? -6.120  -28.365 -17.708 1.00 36.35  ? 135 ILE B N     1 
ATOM   4031 C  CA    . ILE B 1 29  ? -6.055  -27.399 -18.776 1.00 35.54  ? 135 ILE B CA    1 
ATOM   4032 C  C     . ILE B 1 29  ? -4.834  -26.453 -18.683 1.00 35.11  ? 135 ILE B C     1 
ATOM   4033 O  O     . ILE B 1 29  ? -4.196  -26.127 -19.706 1.00 37.42  ? 135 ILE B O     1 
ATOM   4034 C  CB    . ILE B 1 29  ? -7.385  -26.586 -18.819 1.00 36.75  ? 135 ILE B CB    1 
ATOM   4035 C  CG1   . ILE B 1 29  ? -8.534  -27.522 -19.273 1.00 37.45  ? 135 ILE B CG1   1 
ATOM   4036 C  CG2   . ILE B 1 29  ? -7.281  -25.360 -19.759 1.00 37.77  ? 135 ILE B CG2   1 
ATOM   4037 C  CD1   . ILE B 1 29  ? -9.911  -26.945 -19.217 1.00 35.88  ? 135 ILE B CD1   1 
ATOM   4038 N  N     . ILE B 1 30  ? -4.510  -26.013 -17.467 1.00 32.65  ? 136 ILE B N     1 
ATOM   4039 C  CA    . ILE B 1 30  ? -3.405  -25.127 -17.226 1.00 31.46  ? 136 ILE B CA    1 
ATOM   4040 C  C     . ILE B 1 30  ? -2.081  -25.770 -17.530 1.00 31.94  ? 136 ILE B C     1 
ATOM   4041 O  O     . ILE B 1 30  ? -1.124  -25.082 -18.016 1.00 32.74  ? 136 ILE B O     1 
ATOM   4042 C  CB    . ILE B 1 30  ? -3.362  -24.666 -15.722 1.00 31.96  ? 136 ILE B CB    1 
ATOM   4043 C  CG1   . ILE B 1 30  ? -4.434  -23.614 -15.505 1.00 31.75  ? 136 ILE B CG1   1 
ATOM   4044 C  CG2   . ILE B 1 30  ? -2.026  -24.086 -15.346 1.00 31.35  ? 136 ILE B CG2   1 
ATOM   4045 C  CD1   . ILE B 1 30  ? -4.787  -23.351 -14.052 1.00 33.36  ? 136 ILE B CD1   1 
ATOM   4046 N  N     . ASN B 1 31  ? -1.952  -27.047 -17.209 1.00 32.95  ? 137 ASN B N     1 
ATOM   4047 C  CA    . ASN B 1 31  ? -0.641  -27.722 -17.408 1.00 34.82  ? 137 ASN B CA    1 
ATOM   4048 C  C     . ASN B 1 31  ? -0.467  -28.334 -18.788 1.00 35.35  ? 137 ASN B C     1 
ATOM   4049 O  O     . ASN B 1 31  ? -0.152  -29.521 -18.952 1.00 34.99  ? 137 ASN B O     1 
ATOM   4050 C  CB    . ASN B 1 31  ? -0.361  -28.680 -16.257 1.00 33.87  ? 137 ASN B CB    1 
ATOM   4051 C  CG    . ASN B 1 31  ? -0.011  -27.923 -14.980 1.00 34.32  ? 137 ASN B CG    1 
ATOM   4052 O  OD1   . ASN B 1 31  ? 0.624   -26.836 -15.027 1.00 32.16  ? 137 ASN B OD1   1 
ATOM   4053 N  ND2   . ASN B 1 31  ? -0.391  -28.487 -13.864 1.00 32.20  ? 137 ASN B ND2   1 
ATOM   4054 N  N     . THR B 1 32  ? -0.659  -27.461 -19.775 1.00 36.85  ? 138 THR B N     1 
ATOM   4055 C  CA    . THR B 1 32  ? -0.447  -27.767 -21.207 1.00 38.39  ? 138 THR B CA    1 
ATOM   4056 C  C     . THR B 1 32  ? 0.506   -26.757 -21.826 1.00 38.94  ? 138 THR B C     1 
ATOM   4057 O  O     . THR B 1 32  ? 0.589   -25.647 -21.341 1.00 37.99  ? 138 THR B O     1 
ATOM   4058 C  CB    . THR B 1 32  ? -1.762  -27.754 -22.000 1.00 35.28  ? 138 THR B CB    1 
ATOM   4059 O  OG1   . THR B 1 32  ? -2.361  -26.476 -21.930 1.00 32.57  ? 138 THR B OG1   1 
ATOM   4060 C  CG2   . THR B 1 32  ? -2.704  -28.773 -21.390 1.00 34.87  ? 138 THR B CG2   1 
ATOM   4061 N  N     . PRO B 1 33  ? 1.214   -27.140 -22.918 1.00 41.39  ? 139 PRO B N     1 
ATOM   4062 C  CA    . PRO B 1 33  ? 2.057   -26.121 -23.580 1.00 39.46  ? 139 PRO B CA    1 
ATOM   4063 C  C     . PRO B 1 33  ? 1.225   -24.977 -24.155 1.00 36.72  ? 139 PRO B C     1 
ATOM   4064 O  O     . PRO B 1 33  ? 1.731   -23.903 -24.297 1.00 34.94  ? 139 PRO B O     1 
ATOM   4065 C  CB    . PRO B 1 33  ? 2.803   -26.902 -24.683 1.00 42.70  ? 139 PRO B CB    1 
ATOM   4066 C  CG    . PRO B 1 33  ? 2.444   -28.341 -24.508 1.00 44.32  ? 139 PRO B CG    1 
ATOM   4067 C  CD    . PRO B 1 33  ? 1.198   -28.418 -23.647 1.00 42.45  ? 139 PRO B CD    1 
ATOM   4068 N  N     . GLN B 1 34  ? -0.021  -25.207 -24.504 1.00 37.92  ? 140 GLN B N     1 
ATOM   4069 C  CA    . GLN B 1 34  ? -0.884  -24.161 -25.101 1.00 38.92  ? 140 GLN B CA    1 
ATOM   4070 C  C     . GLN B 1 34  ? -1.230  -23.049 -24.076 1.00 38.25  ? 140 GLN B C     1 
ATOM   4071 O  O     . GLN B 1 34  ? -1.299  -21.854 -24.423 1.00 39.16  ? 140 GLN B O     1 
ATOM   4072 C  CB    . GLN B 1 34  ? -2.173  -24.785 -25.661 1.00 39.48  ? 140 GLN B CB    1 
ATOM   4073 C  CG    . GLN B 1 34  ? -1.950  -25.662 -26.916 1.00 42.43  ? 140 GLN B CG    1 
ATOM   4074 C  CD    . GLN B 1 34  ? -1.303  -27.008 -26.640 1.00 40.37  ? 140 GLN B CD    1 
ATOM   4075 O  OE1   . GLN B 1 34  ? -1.550  -27.684 -25.643 1.00 43.72  ? 140 GLN B OE1   1 
ATOM   4076 N  NE2   . GLN B 1 34  ? -0.470  -27.379 -27.505 1.00 41.35  ? 140 GLN B NE2   1 
ATOM   4077 N  N     . PHE B 1 35  ? -1.442  -23.476 -22.810 1.00 38.74  ? 141 PHE B N     1 
ATOM   4078 C  CA    . PHE B 1 35  ? -1.748  -22.561 -21.702 1.00 34.85  ? 141 PHE B CA    1 
ATOM   4079 C  C     . PHE B 1 35  ? -0.482  -21.900 -21.189 1.00 33.44  ? 141 PHE B C     1 
ATOM   4080 O  O     . PHE B 1 35  ? -0.445  -20.681 -21.024 1.00 34.22  ? 141 PHE B O     1 
ATOM   4081 C  CB    . PHE B 1 35  ? -2.552  -23.207 -20.562 1.00 34.74  ? 141 PHE B CB    1 
ATOM   4082 C  CG    . PHE B 1 35  ? -3.150  -22.167 -19.646 1.00 35.29  ? 141 PHE B CG    1 
ATOM   4083 C  CD1   . PHE B 1 35  ? -4.383  -21.602 -19.933 1.00 34.56  ? 141 PHE B CD1   1 
ATOM   4084 C  CD2   . PHE B 1 35  ? -2.419  -21.646 -18.560 1.00 35.12  ? 141 PHE B CD2   1 
ATOM   4085 C  CE1   . PHE B 1 35  ? -4.891  -20.586 -19.143 1.00 34.39  ? 141 PHE B CE1   1 
ATOM   4086 C  CE2   . PHE B 1 35  ? -2.927  -20.631 -17.793 1.00 35.18  ? 141 PHE B CE2   1 
ATOM   4087 C  CZ    . PHE B 1 35  ? -4.152  -20.096 -18.099 1.00 33.88  ? 141 PHE B CZ    1 
ATOM   4088 N  N     . GLN B 1 36  ? 0.545   -22.702 -20.948 1.00 31.72  ? 142 GLN B N     1 
ATOM   4089 C  CA    . GLN B 1 36  ? 1.792   -22.210 -20.390 1.00 31.50  ? 142 GLN B CA    1 
ATOM   4090 C  C     . GLN B 1 36  ? 2.533   -21.161 -21.269 1.00 32.37  ? 142 GLN B C     1 
ATOM   4091 O  O     . GLN B 1 36  ? 3.414   -20.429 -20.814 1.00 30.74  ? 142 GLN B O     1 
ATOM   4092 C  CB    . GLN B 1 36  ? 2.726   -23.390 -20.073 1.00 32.92  ? 142 GLN B CB    1 
ATOM   4093 C  CG    . GLN B 1 36  ? 2.274   -24.352 -18.966 1.00 33.10  ? 142 GLN B CG    1 
ATOM   4094 C  CD    . GLN B 1 36  ? 2.269   -23.753 -17.554 1.00 33.64  ? 142 GLN B CD    1 
ATOM   4095 O  OE1   . GLN B 1 36  ? 3.290   -23.220 -17.114 1.00 31.86  ? 142 GLN B OE1   1 
ATOM   4096 N  NE2   . GLN B 1 36  ? 1.136   -23.934 -16.802 1.00 34.29  ? 142 GLN B NE2   1 
ATOM   4097 N  N     . ARG B 1 37  ? 2.215   -21.166 -22.555 1.00 31.03  ? 143 ARG B N     1 
ATOM   4098 C  CA    . ARG B 1 37  ? 2.673   -20.171 -23.546 1.00 32.03  ? 143 ARG B CA    1 
ATOM   4099 C  C     . ARG B 1 37  ? 2.485   -18.754 -23.063 1.00 31.05  ? 143 ARG B C     1 
ATOM   4100 O  O     . ARG B 1 37  ? 3.296   -17.847 -23.340 1.00 30.53  ? 143 ARG B O     1 
ATOM   4101 C  CB    . ARG B 1 37  ? 1.820   -20.391 -24.804 1.00 32.07  ? 143 ARG B CB    1 
ATOM   4102 C  CG    . ARG B 1 37  ? 1.790   -19.291 -25.836 1.00 34.02  ? 143 ARG B CG    1 
ATOM   4103 C  CD    . ARG B 1 37  ? 1.013   -19.716 -27.082 1.00 32.95  ? 143 ARG B CD    1 
ATOM   4104 N  NE    . ARG B 1 37  ? 1.156   -18.666 -28.096 1.00 33.10  ? 143 ARG B NE    1 
ATOM   4105 C  CZ    . ARG B 1 37  ? 0.340   -17.626 -28.234 1.00 33.26  ? 143 ARG B CZ    1 
ATOM   4106 N  NH1   . ARG B 1 37  ? -0.752  -17.469 -27.467 1.00 35.92  ? 143 ARG B NH1   1 
ATOM   4107 N  NH2   . ARG B 1 37  ? 0.623   -16.718 -29.117 1.00 32.28  ? 143 ARG B NH2   1 
ATOM   4108 N  N     . LEU B 1 38  ? 1.386   -18.567 -22.350 1.00 30.72  ? 144 LEU B N     1 
ATOM   4109 C  CA    . LEU B 1 38  ? 1.045   -17.245 -21.880 1.00 30.89  ? 144 LEU B CA    1 
ATOM   4110 C  C     . LEU B 1 38  ? 2.002   -16.695 -20.828 1.00 29.31  ? 144 LEU B C     1 
ATOM   4111 O  O     . LEU B 1 38  ? 1.935   -15.535 -20.504 1.00 27.75  ? 144 LEU B O     1 
ATOM   4112 C  CB    . LEU B 1 38  ? -0.361  -17.209 -21.346 1.00 30.71  ? 144 LEU B CB    1 
ATOM   4113 C  CG    . LEU B 1 38  ? -1.430  -17.605 -22.322 1.00 30.52  ? 144 LEU B CG    1 
ATOM   4114 C  CD1   . LEU B 1 38  ? -2.738  -17.469 -21.587 1.00 32.33  ? 144 LEU B CD1   1 
ATOM   4115 C  CD2   . LEU B 1 38  ? -1.468  -16.807 -23.594 1.00 32.25  ? 144 LEU B CD2   1 
ATOM   4116 N  N     . ARG B 1 39  ? 2.904   -17.514 -20.315 1.00 29.32  ? 145 ARG B N     1 
ATOM   4117 C  CA    . ARG B 1 39  ? 3.966   -17.007 -19.473 1.00 28.70  ? 145 ARG B CA    1 
ATOM   4118 C  C     . ARG B 1 39  ? 4.933   -16.104 -20.219 1.00 29.69  ? 145 ARG B C     1 
ATOM   4119 O  O     . ARG B 1 39  ? 5.740   -15.413 -19.600 1.00 28.48  ? 145 ARG B O     1 
ATOM   4120 C  CB    . ARG B 1 39  ? 4.720   -18.161 -18.821 1.00 29.18  ? 145 ARG B CB    1 
ATOM   4121 C  CG    . ARG B 1 39  ? 4.071   -18.795 -17.590 1.00 29.00  ? 145 ARG B CG    1 
ATOM   4122 C  CD    . ARG B 1 39  ? 4.869   -20.016 -17.117 1.00 29.97  ? 145 ARG B CD    1 
ATOM   4123 N  NE    . ARG B 1 39  ? 4.241   -20.784 -16.022 1.00 30.73  ? 145 ARG B NE    1 
ATOM   4124 C  CZ    . ARG B 1 39  ? 4.245   -20.438 -14.721 1.00 30.07  ? 145 ARG B CZ    1 
ATOM   4125 N  NH1   . ARG B 1 39  ? 4.837   -19.331 -14.293 1.00 28.60  ? 145 ARG B NH1   1 
ATOM   4126 N  NH2   . ARG B 1 39  ? 3.643   -21.216 -13.845 1.00 30.69  ? 145 ARG B NH2   1 
ATOM   4127 N  N     . TYR B 1 40  ? 4.883   -16.117 -21.551 1.00 30.28  ? 146 TYR B N     1 
ATOM   4128 C  CA    . TYR B 1 40  ? 5.945   -15.559 -22.387 1.00 31.58  ? 146 TYR B CA    1 
ATOM   4129 C  C     . TYR B 1 40  ? 5.425   -14.423 -23.300 1.00 31.32  ? 146 TYR B C     1 
ATOM   4130 O  O     . TYR B 1 40  ? 6.068   -14.039 -24.290 1.00 31.06  ? 146 TYR B O     1 
ATOM   4131 C  CB    . TYR B 1 40  ? 6.609   -16.711 -23.201 1.00 33.17  ? 146 TYR B CB    1 
ATOM   4132 C  CG    . TYR B 1 40  ? 6.975   -17.877 -22.322 1.00 33.71  ? 146 TYR B CG    1 
ATOM   4133 C  CD1   . TYR B 1 40  ? 7.981   -17.772 -21.367 1.00 34.69  ? 146 TYR B CD1   1 
ATOM   4134 C  CD2   . TYR B 1 40  ? 6.274   -19.113 -22.403 1.00 37.09  ? 146 TYR B CD2   1 
ATOM   4135 C  CE1   . TYR B 1 40  ? 8.299   -18.840 -20.492 1.00 35.59  ? 146 TYR B CE1   1 
ATOM   4136 C  CE2   . TYR B 1 40  ? 6.589   -20.205 -21.545 1.00 37.98  ? 146 TYR B CE2   1 
ATOM   4137 C  CZ    . TYR B 1 40  ? 7.599   -20.064 -20.566 1.00 38.03  ? 146 TYR B CZ    1 
ATOM   4138 O  OH    . TYR B 1 40  ? 7.923   -21.143 -19.733 1.00 37.51  ? 146 TYR B OH    1 
ATOM   4139 N  N     . ILE B 1 41  ? 4.278   -13.861 -22.930 1.00 31.35  ? 147 ILE B N     1 
ATOM   4140 C  CA    . ILE B 1 41  ? 3.724   -12.718 -23.627 1.00 31.73  ? 147 ILE B CA    1 
ATOM   4141 C  C     . ILE B 1 41  ? 3.314   -11.580 -22.608 1.00 29.52  ? 147 ILE B C     1 
ATOM   4142 O  O     . ILE B 1 41  ? 2.337   -11.766 -21.836 1.00 27.28  ? 147 ILE B O     1 
ATOM   4143 C  CB    . ILE B 1 41  ? 2.482   -13.167 -24.418 1.00 31.57  ? 147 ILE B CB    1 
ATOM   4144 C  CG1   . ILE B 1 41  ? 2.861   -14.183 -25.427 1.00 33.56  ? 147 ILE B CG1   1 
ATOM   4145 C  CG2   . ILE B 1 41  ? 1.777   -11.962 -25.055 1.00 31.29  ? 147 ILE B CG2   1 
ATOM   4146 C  CD1   . ILE B 1 41  ? 1.646   -14.662 -26.244 1.00 33.50  ? 147 ILE B CD1   1 
ATOM   4147 N  N     . LYS B 1 42  ? 4.019   -10.451 -22.654 1.00 26.66  ? 148 LYS B N     1 
ATOM   4148 C  CA    . LYS B 1 42  ? 3.728   -9.358  -21.779 1.00 26.65  ? 148 LYS B CA    1 
ATOM   4149 C  C     . LYS B 1 42  ? 2.345   -8.746  -21.946 1.00 24.84  ? 148 LYS B C     1 
ATOM   4150 O  O     . LYS B 1 42  ? 1.904   -8.510  -23.017 1.00 24.74  ? 148 LYS B O     1 
ATOM   4151 C  CB    . LYS B 1 42  ? 4.818   -8.325  -21.887 1.00 27.60  ? 148 LYS B CB    1 
ATOM   4152 C  CG    . LYS B 1 42  ? 6.045   -8.779  -21.151 1.00 31.07  ? 148 LYS B CG    1 
ATOM   4153 C  CD    . LYS B 1 42  ? 7.047   -7.675  -20.974 1.00 34.30  ? 148 LYS B CD    1 
ATOM   4154 C  CE    . LYS B 1 42  ? 7.545   -7.103  -22.333 1.00 39.55  ? 148 LYS B CE    1 
ATOM   4155 N  NZ    . LYS B 1 42  ? 7.969   -8.025  -23.486 1.00 44.30  ? 148 LYS B NZ    1 
ATOM   4156 N  N     . GLN B 1 43  ? 1.639   -8.534  -20.849 1.00 24.39  ? 149 GLN B N     1 
ATOM   4157 C  CA    . GLN B 1 43  ? 0.245   -8.020  -20.886 1.00 24.04  ? 149 GLN B CA    1 
ATOM   4158 C  C     . GLN B 1 43  ? 0.172   -6.644  -21.667 1.00 22.45  ? 149 GLN B C     1 
ATOM   4159 O  O     . GLN B 1 43  ? -0.783  -6.421  -22.422 1.00 20.25  ? 149 GLN B O     1 
ATOM   4160 C  CB    . GLN B 1 43  ? -0.300  -7.835  -19.452 1.00 23.03  ? 149 GLN B CB    1 
ATOM   4161 C  CG    . GLN B 1 43  ? -1.755  -7.349  -19.341 1.00 23.02  ? 149 GLN B CG    1 
ATOM   4162 C  CD    . GLN B 1 43  ? -2.858  -8.430  -19.321 1.00 23.19  ? 149 GLN B CD    1 
ATOM   4163 O  OE1   . GLN B 1 43  ? -2.571  -9.627  -19.458 1.00 25.35  ? 149 GLN B OE1   1 
ATOM   4164 N  NE2   . GLN B 1 43  ? -4.121  -8.005  -19.145 1.00 21.02  ? 149 GLN B NE2   1 
ATOM   4165 N  N     . LEU B 1 44  ? 1.134   -5.763  -21.345 1.00 21.64  ? 150 LEU B N     1 
ATOM   4166 C  CA    . LEU B 1 44  ? 1.205   -4.418  -21.835 1.00 22.54  ? 150 LEU B CA    1 
ATOM   4167 C  C     . LEU B 1 44  ? 2.173   -4.142  -22.989 1.00 24.78  ? 150 LEU B C     1 
ATOM   4168 O  O     . LEU B 1 44  ? 2.370   -2.956  -23.417 1.00 24.35  ? 150 LEU B O     1 
ATOM   4169 C  CB    . LEU B 1 44  ? 1.517   -3.441  -20.678 1.00 22.55  ? 150 LEU B CB    1 
ATOM   4170 C  CG    . LEU B 1 44  ? 0.469   -3.484  -19.480 1.00 21.90  ? 150 LEU B CG    1 
ATOM   4171 C  CD1   . LEU B 1 44  ? 0.612   -2.325  -18.547 1.00 21.56  ? 150 LEU B CD1   1 
ATOM   4172 C  CD2   . LEU B 1 44  ? -1.022  -3.539  -19.930 1.00 21.81  ? 150 LEU B CD2   1 
ATOM   4173 N  N     . GLY B 1 45  ? 2.744   -5.208  -23.553 1.00 25.37  ? 151 GLY B N     1 
ATOM   4174 C  CA    . GLY B 1 45  ? 3.657   -5.097  -24.672 1.00 26.16  ? 151 GLY B CA    1 
ATOM   4175 C  C     . GLY B 1 45  ? 4.765   -4.105  -24.493 1.00 26.85  ? 151 GLY B C     1 
ATOM   4176 O  O     . GLY B 1 45  ? 5.557   -4.149  -23.527 1.00 30.26  ? 151 GLY B O     1 
ATOM   4177 N  N     . GLY B 1 46  ? 4.808   -3.114  -25.341 1.00 26.59  ? 152 GLY B N     1 
ATOM   4178 C  CA    . GLY B 1 46  ? 5.900   -2.120  -25.257 1.00 26.19  ? 152 GLY B CA    1 
ATOM   4179 C  C     . GLY B 1 46  ? 5.841   -1.227  -24.023 1.00 26.96  ? 152 GLY B C     1 
ATOM   4180 O  O     . GLY B 1 46  ? 6.802   -0.487  -23.801 1.00 28.07  ? 152 GLY B O     1 
ATOM   4181 N  N     . GLY B 1 47  ? 4.709   -1.279  -23.271 1.00 25.07  ? 153 GLY B N     1 
ATOM   4182 C  CA    . GLY B 1 47  ? 4.510   -0.538  -22.048 1.00 25.15  ? 153 GLY B CA    1 
ATOM   4183 C  C     . GLY B 1 47  ? 5.583   -0.759  -21.008 1.00 24.76  ? 153 GLY B C     1 
ATOM   4184 O  O     . GLY B 1 47  ? 5.938   0.190   -20.289 1.00 25.88  ? 153 GLY B O     1 
ATOM   4185 N  N     . TYR B 1 48  ? 6.136   -1.978  -20.928 1.00 24.32  ? 154 TYR B N     1 
ATOM   4186 C  CA    . TYR B 1 48  ? 7.292   -2.254  -20.050 1.00 24.22  ? 154 TYR B CA    1 
ATOM   4187 C  C     . TYR B 1 48  ? 8.499   -1.369  -20.327 1.00 24.38  ? 154 TYR B C     1 
ATOM   4188 O  O     . TYR B 1 48  ? 9.288   -1.116  -19.423 1.00 25.75  ? 154 TYR B O     1 
ATOM   4189 C  CB    . TYR B 1 48  ? 7.684   -3.699  -20.161 1.00 23.42  ? 154 TYR B CB    1 
ATOM   4190 C  CG    . TYR B 1 48  ? 8.855   -4.191  -19.365 1.00 22.39  ? 154 TYR B CG    1 
ATOM   4191 C  CD1   . TYR B 1 48  ? 8.996   -3.909  -18.033 1.00 22.30  ? 154 TYR B CD1   1 
ATOM   4192 C  CD2   . TYR B 1 48  ? 9.754   -5.123  -19.913 1.00 22.07  ? 154 TYR B CD2   1 
ATOM   4193 C  CE1   . TYR B 1 48  ? 10.066  -4.424  -17.266 1.00 21.92  ? 154 TYR B CE1   1 
ATOM   4194 C  CE2   . TYR B 1 48  ? 10.788  -5.678  -19.131 1.00 22.15  ? 154 TYR B CE2   1 
ATOM   4195 C  CZ    . TYR B 1 48  ? 10.977  -5.301  -17.844 1.00 21.60  ? 154 TYR B CZ    1 
ATOM   4196 O  OH    . TYR B 1 48  ? 12.026  -5.838  -17.061 1.00 22.96  ? 154 TYR B OH    1 
ATOM   4197 N  N     . TYR B 1 49  ? 8.627   -0.882  -21.543 1.00 23.75  ? 155 TYR B N     1 
ATOM   4198 C  CA    . TYR B 1 49  ? 9.777   -0.042  -21.886 1.00 25.48  ? 155 TYR B CA    1 
ATOM   4199 C  C     . TYR B 1 49  ? 9.584   1.427   -21.450 1.00 25.02  ? 155 TYR B C     1 
ATOM   4200 O  O     . TYR B 1 49  ? 10.462  2.300   -21.738 1.00 25.51  ? 155 TYR B O     1 
ATOM   4201 C  CB    . TYR B 1 49  ? 10.090  -0.136  -23.409 1.00 25.07  ? 155 TYR B CB    1 
ATOM   4202 C  CG    . TYR B 1 49  ? 10.596  -1.522  -23.778 1.00 26.51  ? 155 TYR B CG    1 
ATOM   4203 C  CD1   . TYR B 1 49  ? 9.712   -2.584  -24.075 1.00 26.95  ? 155 TYR B CD1   1 
ATOM   4204 C  CD2   . TYR B 1 49  ? 11.964  -1.789  -23.812 1.00 26.28  ? 155 TYR B CD2   1 
ATOM   4205 C  CE1   . TYR B 1 49  ? 10.191  -3.857  -24.412 1.00 25.89  ? 155 TYR B CE1   1 
ATOM   4206 C  CE2   . TYR B 1 49  ? 12.424  -3.047  -24.154 1.00 26.86  ? 155 TYR B CE2   1 
ATOM   4207 C  CZ    . TYR B 1 49  ? 11.535  -4.081  -24.411 1.00 26.64  ? 155 TYR B CZ    1 
ATOM   4208 O  OH    . TYR B 1 49  ? 12.119  -5.332  -24.640 1.00 28.19  ? 155 TYR B OH    1 
ATOM   4209 N  N     . VAL B 1 50  ? 8.406   1.715   -20.864 1.00 23.27  ? 156 VAL B N     1 
ATOM   4210 C  CA    . VAL B 1 50  ? 8.118   3.036   -20.285 1.00 22.34  ? 156 VAL B CA    1 
ATOM   4211 C  C     . VAL B 1 50  ? 7.871   2.895   -18.780 1.00 22.01  ? 156 VAL B C     1 
ATOM   4212 O  O     . VAL B 1 50  ? 8.425   3.693   -18.005 1.00 20.41  ? 156 VAL B O     1 
ATOM   4213 C  CB    . VAL B 1 50  ? 6.958   3.688   -21.010 1.00 22.07  ? 156 VAL B CB    1 
ATOM   4214 C  CG1   . VAL B 1 50  ? 6.505   5.010   -20.386 1.00 21.73  ? 156 VAL B CG1   1 
ATOM   4215 C  CG2   . VAL B 1 50  ? 7.369   3.892   -22.489 1.00 22.19  ? 156 VAL B CG2   1 
ATOM   4216 N  N     . PHE B 1 51  ? 7.056   1.885   -18.405 1.00 21.35  ? 157 PHE B N     1 
ATOM   4217 C  CA    . PHE B 1 51  ? 6.774   1.552   -17.026 1.00 21.58  ? 157 PHE B CA    1 
ATOM   4218 C  C     . PHE B 1 51  ? 7.498   0.245   -16.625 1.00 22.35  ? 157 PHE B C     1 
ATOM   4219 O  O     . PHE B 1 51  ? 6.981   -0.906  -16.908 1.00 23.65  ? 157 PHE B O     1 
ATOM   4220 C  CB    . PHE B 1 51  ? 5.273   1.301   -16.820 1.00 22.28  ? 157 PHE B CB    1 
ATOM   4221 C  CG    . PHE B 1 51  ? 4.421   2.529   -16.973 1.00 23.56  ? 157 PHE B CG    1 
ATOM   4222 C  CD1   . PHE B 1 51  ? 3.973   2.966   -18.248 1.00 24.16  ? 157 PHE B CD1   1 
ATOM   4223 C  CD2   . PHE B 1 51  ? 4.021   3.247   -15.854 1.00 24.20  ? 157 PHE B CD2   1 
ATOM   4224 C  CE1   . PHE B 1 51  ? 3.158   4.123   -18.365 1.00 24.48  ? 157 PHE B CE1   1 
ATOM   4225 C  CE2   . PHE B 1 51  ? 3.211   4.434   -16.014 1.00 24.44  ? 157 PHE B CE2   1 
ATOM   4226 C  CZ    . PHE B 1 51  ? 2.832   4.869   -17.274 1.00 23.34  ? 157 PHE B CZ    1 
ATOM   4227 N  N     . PRO B 1 52  ? 8.636   0.369   -15.924 1.00 21.33  ? 158 PRO B N     1 
ATOM   4228 C  CA    . PRO B 1 52  ? 9.469   -0.777  -15.577 1.00 21.45  ? 158 PRO B CA    1 
ATOM   4229 C  C     . PRO B 1 52  ? 8.900   -1.731  -14.553 1.00 22.01  ? 158 PRO B C     1 
ATOM   4230 O  O     . PRO B 1 52  ? 9.471   -2.796  -14.292 1.00 21.96  ? 158 PRO B O     1 
ATOM   4231 C  CB    . PRO B 1 52  ? 10.738  -0.127  -14.961 1.00 21.59  ? 158 PRO B CB    1 
ATOM   4232 C  CG    . PRO B 1 52  ? 10.176  1.148   -14.382 1.00 21.81  ? 158 PRO B CG    1 
ATOM   4233 C  CD    . PRO B 1 52  ? 9.131   1.633   -15.347 1.00 21.33  ? 158 PRO B CD    1 
ATOM   4234 N  N     . GLY B 1 53  ? 7.806   -1.377  -13.894 1.00 22.54  ? 159 GLY B N     1 
ATOM   4235 C  CA    . GLY B 1 53  ? 7.145   -2.360  -13.039 1.00 23.17  ? 159 GLY B CA    1 
ATOM   4236 C  C     . GLY B 1 53  ? 6.258   -3.320  -13.868 1.00 23.81  ? 159 GLY B C     1 
ATOM   4237 O  O     . GLY B 1 53  ? 5.782   -4.349  -13.290 1.00 24.17  ? 159 GLY B O     1 
ATOM   4238 N  N     . ALA B 1 54  ? 6.012   -2.991  -15.161 1.00 21.99  ? 160 ALA B N     1 
ATOM   4239 C  CA    . ALA B 1 54  ? 4.987   -3.701  -16.012 1.00 22.38  ? 160 ALA B CA    1 
ATOM   4240 C  C     . ALA B 1 54  ? 5.530   -4.884  -16.797 1.00 22.99  ? 160 ALA B C     1 
ATOM   4241 O  O     . ALA B 1 54  ? 5.307   -5.004  -18.035 1.00 20.24  ? 160 ALA B O     1 
ATOM   4242 C  CB    . ALA B 1 54  ? 4.326   -2.754  -17.007 1.00 22.13  ? 160 ALA B CB    1 
ATOM   4243 N  N     . SER B 1 55  ? 6.148   -5.800  -16.040 1.00 23.92  ? 161 SER B N     1 
ATOM   4244 C  CA    . SER B 1 55  ? 6.653   -7.055  -16.591 1.00 26.31  ? 161 SER B CA    1 
ATOM   4245 C  C     . SER B 1 55  ? 5.622   -8.210  -16.479 1.00 26.31  ? 161 SER B C     1 
ATOM   4246 O  O     . SER B 1 55  ? 5.970   -9.363  -16.724 1.00 26.53  ? 161 SER B O     1 
ATOM   4247 C  CB    . SER B 1 55  ? 7.914   -7.437  -15.787 1.00 27.60  ? 161 SER B CB    1 
ATOM   4248 O  OG    . SER B 1 55  ? 7.589   -7.470  -14.325 1.00 32.22  ? 161 SER B OG    1 
ATOM   4249 N  N     . HIS B 1 56  ? 4.410   -7.945  -15.977 1.00 25.21  ? 162 HIS B N     1 
ATOM   4250 C  CA    . HIS B 1 56  ? 3.415   -9.019  -15.878 1.00 24.95  ? 162 HIS B CA    1 
ATOM   4251 C  C     . HIS B 1 56  ? 2.959   -9.585  -17.302 1.00 24.44  ? 162 HIS B C     1 
ATOM   4252 O  O     . HIS B 1 56  ? 2.911   -8.880  -18.317 1.00 24.84  ? 162 HIS B O     1 
ATOM   4253 C  CB    . HIS B 1 56  ? 2.264   -8.594  -15.040 1.00 23.04  ? 162 HIS B CB    1 
ATOM   4254 C  CG    . HIS B 1 56  ? 1.544   -7.377  -15.568 1.00 24.62  ? 162 HIS B CG    1 
ATOM   4255 N  ND1   . HIS B 1 56  ? 2.159   -6.154  -15.741 1.00 22.64  ? 162 HIS B ND1   1 
ATOM   4256 C  CD2   . HIS B 1 56  ? 0.221   -7.199  -15.861 1.00 24.10  ? 162 HIS B CD2   1 
ATOM   4257 C  CE1   . HIS B 1 56  ? 1.232   -5.282  -16.089 1.00 24.94  ? 162 HIS B CE1   1 
ATOM   4258 N  NE2   . HIS B 1 56  ? 0.042   -5.888  -16.129 1.00 24.08  ? 162 HIS B NE2   1 
ATOM   4259 N  N     . ASN B 1 57  ? 2.786   -10.889 -17.350 1.00 23.85  ? 163 ASN B N     1 
ATOM   4260 C  CA    . ASN B 1 57  ? 2.414   -11.582 -18.569 1.00 24.65  ? 163 ASN B CA    1 
ATOM   4261 C  C     . ASN B 1 57  ? 0.947   -12.020 -18.528 1.00 25.47  ? 163 ASN B C     1 
ATOM   4262 O  O     . ASN B 1 57  ? 0.279   -11.880 -17.498 1.00 26.38  ? 163 ASN B O     1 
ATOM   4263 C  CB    . ASN B 1 57  ? 3.327   -12.800 -18.769 1.00 25.22  ? 163 ASN B CB    1 
ATOM   4264 C  CG    . ASN B 1 57  ? 4.777   -12.454 -18.614 1.00 24.37  ? 163 ASN B CG    1 
ATOM   4265 O  OD1   . ASN B 1 57  ? 5.336   -11.705 -19.419 1.00 25.04  ? 163 ASN B OD1   1 
ATOM   4266 N  ND2   . ASN B 1 57  ? 5.384   -12.970 -17.587 1.00 22.42  ? 163 ASN B ND2   1 
ATOM   4267 N  N     . ARG B 1 58  ? 0.451   -12.568 -19.638 1.00 24.92  ? 164 ARG B N     1 
ATOM   4268 C  CA    . ARG B 1 58  ? -0.958  -12.933 -19.791 1.00 24.54  ? 164 ARG B CA    1 
ATOM   4269 C  C     . ARG B 1 58  ? -1.364  -14.123 -18.990 1.00 24.25  ? 164 ARG B C     1 
ATOM   4270 O  O     . ARG B 1 58  ? -2.565  -14.263 -18.686 1.00 23.82  ? 164 ARG B O     1 
ATOM   4271 C  CB    . ARG B 1 58  ? -1.260  -13.224 -21.263 1.00 25.43  ? 164 ARG B CB    1 
ATOM   4272 C  CG    . ARG B 1 58  ? -1.241  -12.019 -22.209 1.00 24.87  ? 164 ARG B CG    1 
ATOM   4273 C  CD    . ARG B 1 58  ? -2.634  -11.360 -22.357 1.00 25.26  ? 164 ARG B CD    1 
ATOM   4274 N  NE    . ARG B 1 58  ? -2.538  -9.945  -22.657 1.00 25.40  ? 164 ARG B NE    1 
ATOM   4275 C  CZ    . ARG B 1 58  ? -3.543  -9.084  -22.569 1.00 25.34  ? 164 ARG B CZ    1 
ATOM   4276 N  NH1   . ARG B 1 58  ? -4.770  -9.533  -22.297 1.00 25.56  ? 164 ARG B NH1   1 
ATOM   4277 N  NH2   . ARG B 1 58  ? -3.311  -7.757  -22.837 1.00 24.87  ? 164 ARG B NH2   1 
ATOM   4278 N  N     . PHE B 1 59  ? -0.390  -14.962 -18.624 1.00 24.13  ? 165 PHE B N     1 
ATOM   4279 C  CA    . PHE B 1 59  ? -0.682  -16.144 -17.773 1.00 24.78  ? 165 PHE B CA    1 
ATOM   4280 C  C     . PHE B 1 59  ? -1.436  -15.771 -16.434 1.00 24.92  ? 165 PHE B C     1 
ATOM   4281 O  O     . PHE B 1 59  ? -2.583  -16.258 -16.147 1.00 25.41  ? 165 PHE B O     1 
ATOM   4282 C  CB    . PHE B 1 59  ? 0.642   -16.878 -17.510 1.00 25.57  ? 165 PHE B CB    1 
ATOM   4283 C  CG    . PHE B 1 59  ? 0.566   -18.079 -16.551 1.00 27.09  ? 165 PHE B CG    1 
ATOM   4284 C  CD1   . PHE B 1 59  ? 0.235   -19.319 -17.027 1.00 28.64  ? 165 PHE B CD1   1 
ATOM   4285 C  CD2   . PHE B 1 59  ? 0.913   -17.961 -15.229 1.00 27.23  ? 165 PHE B CD2   1 
ATOM   4286 C  CE1   . PHE B 1 59  ? 0.194   -20.422 -16.205 1.00 29.43  ? 165 PHE B CE1   1 
ATOM   4287 C  CE2   . PHE B 1 59  ? 0.882   -19.048 -14.373 1.00 28.00  ? 165 PHE B CE2   1 
ATOM   4288 C  CZ    . PHE B 1 59  ? 0.486   -20.286 -14.848 1.00 29.46  ? 165 PHE B CZ    1 
ATOM   4289 N  N     . GLU B 1 60  ? -0.802  -14.887 -15.644 1.00 24.25  ? 166 GLU B N     1 
ATOM   4290 C  CA    . GLU B 1 60  ? -1.328  -14.467 -14.352 1.00 24.52  ? 166 GLU B CA    1 
ATOM   4291 C  C     . GLU B 1 60  ? -2.693  -13.775 -14.540 1.00 24.70  ? 166 GLU B C     1 
ATOM   4292 O  O     . GLU B 1 60  ? -3.650  -14.034 -13.776 1.00 25.25  ? 166 GLU B O     1 
ATOM   4293 C  CB    . GLU B 1 60  ? -0.311  -13.558 -13.535 1.00 24.89  ? 166 GLU B CB    1 
ATOM   4294 C  CG    . GLU B 1 60  ? 0.536   -12.555 -14.291 1.00 25.99  ? 166 GLU B CG    1 
ATOM   4295 C  CD    . GLU B 1 60  ? 1.923   -13.148 -14.813 1.00 27.02  ? 166 GLU B CD    1 
ATOM   4296 O  OE1   . GLU B 1 60  ? 1.942   -14.359 -15.285 1.00 25.30  ? 166 GLU B OE1   1 
ATOM   4297 O  OE2   . GLU B 1 60  ? 2.964   -12.385 -14.756 1.00 25.11  ? 166 GLU B OE2   1 
ATOM   4298 N  N     . HIS B 1 61  ? -2.836  -12.954 -15.594 1.00 25.48  ? 167 HIS B N     1 
ATOM   4299 C  CA    . HIS B 1 61  ? -4.132  -12.311 -15.854 1.00 24.93  ? 167 HIS B CA    1 
ATOM   4300 C  C     . HIS B 1 61  ? -5.236  -13.339 -16.074 1.00 25.53  ? 167 HIS B C     1 
ATOM   4301 O  O     . HIS B 1 61  ? -6.313  -13.204 -15.493 1.00 27.89  ? 167 HIS B O     1 
ATOM   4302 C  CB    . HIS B 1 61  ? -3.988  -11.366 -17.000 1.00 24.16  ? 167 HIS B CB    1 
ATOM   4303 C  CG    . HIS B 1 61  ? -5.271  -10.912 -17.646 1.00 24.55  ? 167 HIS B CG    1 
ATOM   4304 N  ND1   . HIS B 1 61  ? -6.195  -10.100 -17.019 1.00 23.26  ? 167 HIS B ND1   1 
ATOM   4305 C  CD2   . HIS B 1 61  ? -5.733  -11.123 -18.920 1.00 23.00  ? 167 HIS B CD2   1 
ATOM   4306 C  CE1   . HIS B 1 61  ? -7.163  -9.823  -17.883 1.00 23.70  ? 167 HIS B CE1   1 
ATOM   4307 N  NE2   . HIS B 1 61  ? -6.919  -10.451 -19.028 1.00 23.25  ? 167 HIS B NE2   1 
ATOM   4308 N  N     . SER B 1 62  ? -4.905  -14.408 -16.759 1.00 25.44  ? 168 SER B N     1 
ATOM   4309 C  CA    . SER B 1 62  ? -5.862  -15.423 -17.186 1.00 25.58  ? 168 SER B CA    1 
ATOM   4310 C  C     . SER B 1 62  ? -6.314  -16.206 -15.985 1.00 26.36  ? 168 SER B C     1 
ATOM   4311 O  O     . SER B 1 62  ? -7.505  -16.425 -15.845 1.00 27.13  ? 168 SER B O     1 
ATOM   4312 C  CB    . SER B 1 62  ? -5.237  -16.346 -18.249 1.00 25.35  ? 168 SER B CB    1 
ATOM   4313 O  OG    . SER B 1 62  ? -4.868  -15.603 -19.423 1.00 24.42  ? 168 SER B OG    1 
ATOM   4314 N  N     . LEU B 1 63  ? -5.400  -16.520 -15.073 1.00 26.06  ? 169 LEU B N     1 
ATOM   4315 C  CA    . LEU B 1 63  ? -5.813  -17.107 -13.748 1.00 25.12  ? 169 LEU B CA    1 
ATOM   4316 C  C     . LEU B 1 63  ? -6.735  -16.190 -12.984 1.00 24.26  ? 169 LEU B C     1 
ATOM   4317 O  O     . LEU B 1 63  ? -7.682  -16.617 -12.378 1.00 24.10  ? 169 LEU B O     1 
ATOM   4318 C  CB    . LEU B 1 63  ? -4.657  -17.473 -12.840 1.00 25.00  ? 169 LEU B CB    1 
ATOM   4319 C  CG    . LEU B 1 63  ? -3.570  -18.452 -13.336 1.00 27.21  ? 169 LEU B CG    1 
ATOM   4320 C  CD1   . LEU B 1 63  ? -2.451  -18.681 -12.348 1.00 26.07  ? 169 LEU B CD1   1 
ATOM   4321 C  CD2   . LEU B 1 63  ? -4.094  -19.838 -13.660 1.00 29.16  ? 169 LEU B CD2   1 
ATOM   4322 N  N     . GLY B 1 64  ? -6.475  -14.911 -13.004 1.00 24.82  ? 170 GLY B N     1 
ATOM   4323 C  CA    . GLY B 1 64  ? -7.389  -13.938 -12.334 1.00 25.27  ? 170 GLY B CA    1 
ATOM   4324 C  C     . GLY B 1 64  ? -8.785  -13.861 -12.911 1.00 25.91  ? 170 GLY B C     1 
ATOM   4325 O  O     . GLY B 1 64  ? -9.762  -13.884 -12.145 1.00 26.13  ? 170 GLY B O     1 
ATOM   4326 N  N     . VAL B 1 65  ? -8.858  -13.808 -14.243 1.00 25.44  ? 171 VAL B N     1 
ATOM   4327 C  CA    . VAL B 1 65  ? -10.126 -13.720 -14.874 1.00 26.45  ? 171 VAL B CA    1 
ATOM   4328 C  C     . VAL B 1 65  ? -10.965 -15.001 -14.570 1.00 26.65  ? 171 VAL B C     1 
ATOM   4329 O  O     . VAL B 1 65  ? -12.161 -14.915 -14.274 1.00 25.90  ? 171 VAL B O     1 
ATOM   4330 C  CB    . VAL B 1 65  ? -9.988  -13.464 -16.353 1.00 27.12  ? 171 VAL B CB    1 
ATOM   4331 C  CG1   . VAL B 1 65  ? -11.337 -13.479 -17.058 1.00 27.34  ? 171 VAL B CG1   1 
ATOM   4332 C  CG2   . VAL B 1 65  ? -9.343  -12.105 -16.606 1.00 27.41  ? 171 VAL B CG2   1 
ATOM   4333 N  N     . GLY B 1 66  ? -10.310 -16.162 -14.611 1.00 25.62  ? 172 GLY B N     1 
ATOM   4334 C  CA    . GLY B 1 66  ? -10.962 -17.404 -14.318 1.00 25.13  ? 172 GLY B CA    1 
ATOM   4335 C  C     . GLY B 1 66  ? -11.443 -17.401 -12.858 1.00 26.70  ? 172 GLY B C     1 
ATOM   4336 O  O     . GLY B 1 66  ? -12.554 -17.901 -12.537 1.00 26.71  ? 172 GLY B O     1 
ATOM   4337 N  N     . TYR B 1 67  ? -10.626 -16.886 -11.927 1.00 26.78  ? 173 TYR B N     1 
ATOM   4338 C  CA    . TYR B 1 67  ? -11.062 -16.909 -10.542 1.00 25.57  ? 173 TYR B CA    1 
ATOM   4339 C  C     . TYR B 1 67  ? -12.238 -15.923 -10.372 1.00 27.20  ? 173 TYR B C     1 
ATOM   4340 O  O     . TYR B 1 67  ? -13.236 -16.295 -9.776  1.00 27.75  ? 173 TYR B O     1 
ATOM   4341 C  CB    . TYR B 1 67  ? -9.939  -16.583 -9.637  1.00 26.12  ? 173 TYR B CB    1 
ATOM   4342 C  CG    . TYR B 1 67  ? -10.340 -16.101 -8.211  1.00 25.87  ? 173 TYR B CG    1 
ATOM   4343 C  CD1   . TYR B 1 67  ? -10.802 -16.973 -7.279  1.00 25.54  ? 173 TYR B CD1   1 
ATOM   4344 C  CD2   . TYR B 1 67  ? -10.272 -14.760 -7.899  1.00 25.66  ? 173 TYR B CD2   1 
ATOM   4345 C  CE1   . TYR B 1 67  ? -11.133 -16.561 -5.982  1.00 26.03  ? 173 TYR B CE1   1 
ATOM   4346 C  CE2   . TYR B 1 67  ? -10.602 -14.300 -6.661  1.00 28.35  ? 173 TYR B CE2   1 
ATOM   4347 C  CZ    . TYR B 1 67  ? -11.027 -15.219 -5.672  1.00 26.98  ? 173 TYR B CZ    1 
ATOM   4348 O  OH    . TYR B 1 67  ? -11.315 -14.695 -4.467  1.00 29.35  ? 173 TYR B OH    1 
ATOM   4349 N  N     . LEU B 1 68  ? -12.148 -14.684 -10.906 1.00 27.93  ? 174 LEU B N     1 
ATOM   4350 C  CA    . LEU B 1 68  ? -13.271 -13.734 -10.795 1.00 27.35  ? 174 LEU B CA    1 
ATOM   4351 C  C     . LEU B 1 68  ? -14.551 -14.270 -11.446 1.00 27.57  ? 174 LEU B C     1 
ATOM   4352 O  O     . LEU B 1 68  ? -15.617 -14.059 -10.935 1.00 27.55  ? 174 LEU B O     1 
ATOM   4353 C  CB    . LEU B 1 68  ? -12.931 -12.330 -11.343 1.00 26.62  ? 174 LEU B CB    1 
ATOM   4354 C  CG    . LEU B 1 68  ? -11.822 -11.547 -10.612 1.00 27.10  ? 174 LEU B CG    1 
ATOM   4355 C  CD1   . LEU B 1 68  ? -11.616 -10.155 -11.196 1.00 26.75  ? 174 LEU B CD1   1 
ATOM   4356 C  CD2   . LEU B 1 68  ? -11.984 -11.403 -9.026  1.00 27.67  ? 174 LEU B CD2   1 
ATOM   4357 N  N     . ALA B 1 69  ? -14.446 -14.961 -12.568 1.00 30.00  ? 175 ALA B N     1 
ATOM   4358 C  CA    . ALA B 1 69  ? -15.651 -15.465 -13.256 1.00 29.63  ? 175 ALA B CA    1 
ATOM   4359 C  C     . ALA B 1 69  ? -16.438 -16.375 -12.334 1.00 31.41  ? 175 ALA B C     1 
ATOM   4360 O  O     . ALA B 1 69  ? -17.647 -16.240 -12.219 1.00 31.90  ? 175 ALA B O     1 
ATOM   4361 C  CB    . ALA B 1 69  ? -15.261 -16.192 -14.478 1.00 29.85  ? 175 ALA B CB    1 
ATOM   4362 N  N     . GLY B 1 70  ? -15.717 -17.260 -11.631 1.00 32.79  ? 176 GLY B N     1 
ATOM   4363 C  CA    . GLY B 1 70  ? -16.302 -18.161 -10.638 1.00 33.52  ? 176 GLY B CA    1 
ATOM   4364 C  C     . GLY B 1 70  ? -16.852 -17.410 -9.455  1.00 34.04  ? 176 GLY B C     1 
ATOM   4365 O  O     . GLY B 1 70  ? -17.943 -17.738 -9.014  1.00 32.28  ? 176 GLY B O     1 
ATOM   4366 N  N     . CYS B 1 71  ? -16.129 -16.379 -8.957  1.00 33.77  ? 177 CYS B N     1 
ATOM   4367 C  CA    . CYS B 1 71  ? -16.704 -15.581 -7.874  1.00 34.70  ? 177 CYS B CA    1 
ATOM   4368 C  C     . CYS B 1 71  ? -18.110 -15.049 -8.238  1.00 36.25  ? 177 CYS B C     1 
ATOM   4369 O  O     . CYS B 1 71  ? -19.089 -15.202 -7.462  1.00 34.11  ? 177 CYS B O     1 
ATOM   4370 C  CB    . CYS B 1 71  ? -15.765 -14.390 -7.433  1.00 34.66  ? 177 CYS B CB    1 
ATOM   4371 S  SG    . CYS B 1 71  ? -14.265 -14.985 -6.610  1.00 34.40  ? 177 CYS B SG    1 
ATOM   4372 N  N     . LEU B 1 72  ? -18.229 -14.436 -9.434  1.00 35.60  ? 178 LEU B N     1 
ATOM   4373 C  CA    . LEU B 1 72  ? -19.493 -13.719 -9.790  1.00 35.36  ? 178 LEU B CA    1 
ATOM   4374 C  C     . LEU B 1 72  ? -20.639 -14.719 -9.940  1.00 38.03  ? 178 LEU B C     1 
ATOM   4375 O  O     . LEU B 1 72  ? -21.699 -14.505 -9.384  1.00 39.03  ? 178 LEU B O     1 
ATOM   4376 C  CB    . LEU B 1 72  ? -19.332 -12.841 -11.012 1.00 33.79  ? 178 LEU B CB    1 
ATOM   4377 C  CG    . LEU B 1 72  ? -20.606 -12.129 -11.508 1.00 33.91  ? 178 LEU B CG    1 
ATOM   4378 C  CD1   . LEU B 1 72  ? -21.398 -11.296 -10.507 1.00 31.73  ? 178 LEU B CD1   1 
ATOM   4379 C  CD2   . LEU B 1 72  ? -20.171 -11.253 -12.636 1.00 33.85  ? 178 LEU B CD2   1 
ATOM   4380 N  N     . VAL B 1 73  ? -20.395 -15.809 -10.660 1.00 39.69  ? 179 VAL B N     1 
ATOM   4381 C  CA    . VAL B 1 73  ? -21.411 -16.822 -10.890 1.00 42.41  ? 179 VAL B CA    1 
ATOM   4382 C  C     . VAL B 1 73  ? -21.838 -17.492 -9.596  1.00 43.61  ? 179 VAL B C     1 
ATOM   4383 O  O     . VAL B 1 73  ? -23.049 -17.649 -9.446  1.00 44.49  ? 179 VAL B O     1 
ATOM   4384 C  CB    . VAL B 1 73  ? -21.020 -17.840 -12.030 1.00 42.86  ? 179 VAL B CB    1 
ATOM   4385 C  CG1   . VAL B 1 73  ? -19.918 -18.796 -11.599 1.00 42.79  ? 179 VAL B CG1   1 
ATOM   4386 C  CG2   . VAL B 1 73  ? -22.224 -18.639 -12.488 1.00 44.17  ? 179 VAL B CG2   1 
ATOM   4387 N  N     . HIS B 1 74  ? -20.898 -17.843 -8.670  1.00 44.42  ? 180 HIS B N     1 
ATOM   4388 C  CA    . HIS B 1 74  ? -21.258 -18.465 -7.363  1.00 43.79  ? 180 HIS B CA    1 
ATOM   4389 C  C     . HIS B 1 74  ? -22.122 -17.524 -6.559  1.00 41.87  ? 180 HIS B C     1 
ATOM   4390 O  O     . HIS B 1 74  ? -23.022 -17.934 -5.908  1.00 47.13  ? 180 HIS B O     1 
ATOM   4391 C  CB    . HIS B 1 74  ? -20.061 -18.773 -6.444  1.00 49.90  ? 180 HIS B CB    1 
ATOM   4392 C  CG    . HIS B 1 74  ? -19.498 -20.147 -6.569  1.00 58.26  ? 180 HIS B CG    1 
ATOM   4393 N  ND1   . HIS B 1 74  ? -18.156 -20.376 -6.838  1.00 62.33  ? 180 HIS B ND1   1 
ATOM   4394 C  CD2   . HIS B 1 74  ? -20.075 -21.367 -6.467  1.00 64.37  ? 180 HIS B CD2   1 
ATOM   4395 C  CE1   . HIS B 1 74  ? -17.930 -21.680 -6.906  1.00 63.62  ? 180 HIS B CE1   1 
ATOM   4396 N  NE2   . HIS B 1 74  ? -19.081 -22.305 -6.700  1.00 68.70  ? 180 HIS B NE2   1 
ATOM   4397 N  N     . ALA B 1 75  ? -21.798 -16.258 -6.526  1.00 39.56  ? 181 ALA B N     1 
ATOM   4398 C  CA    . ALA B 1 75  ? -22.574 -15.293 -5.764  1.00 38.27  ? 181 ALA B CA    1 
ATOM   4399 C  C     . ALA B 1 75  ? -24.005 -15.102 -6.270  1.00 37.47  ? 181 ALA B C     1 
ATOM   4400 O  O     . ALA B 1 75  ? -24.905 -15.021 -5.488  1.00 33.37  ? 181 ALA B O     1 
ATOM   4401 C  CB    . ALA B 1 75  ? -21.861 -13.965 -5.770  1.00 38.08  ? 181 ALA B CB    1 
ATOM   4402 N  N     . LEU B 1 76  ? -24.208 -15.064 -7.578  1.00 38.95  ? 182 LEU B N     1 
ATOM   4403 C  CA    . LEU B 1 76  ? -25.567 -15.094 -8.147  1.00 41.40  ? 182 LEU B CA    1 
ATOM   4404 C  C     . LEU B 1 76  ? -26.340 -16.355 -7.699  1.00 42.87  ? 182 LEU B C     1 
ATOM   4405 O  O     . LEU B 1 76  ? -27.530 -16.245 -7.294  1.00 44.98  ? 182 LEU B O     1 
ATOM   4406 C  CB    . LEU B 1 76  ? -25.520 -14.980 -9.665  1.00 39.67  ? 182 LEU B CB    1 
ATOM   4407 C  CG    . LEU B 1 76  ? -24.922 -13.626 -10.097 1.00 39.74  ? 182 LEU B CG    1 
ATOM   4408 C  CD1   . LEU B 1 76  ? -24.821 -13.585 -11.595 1.00 40.36  ? 182 LEU B CD1   1 
ATOM   4409 C  CD2   . LEU B 1 76  ? -25.662 -12.382 -9.581  1.00 39.11  ? 182 LEU B CD2   1 
ATOM   4410 N  N     . GLY B 1 77  ? -25.662 -17.504 -7.774  1.00 41.76  ? 183 GLY B N     1 
ATOM   4411 C  CA    . GLY B 1 77  ? -26.155 -18.775 -7.248  1.00 45.30  ? 183 GLY B CA    1 
ATOM   4412 C  C     . GLY B 1 77  ? -26.605 -18.803 -5.780  1.00 49.71  ? 183 GLY B C     1 
ATOM   4413 O  O     . GLY B 1 77  ? -27.699 -19.324 -5.467  1.00 50.23  ? 183 GLY B O     1 
ATOM   4414 N  N     . GLU B 1 78  ? -25.790 -18.248 -4.877  1.00 51.51  ? 184 GLU B N     1 
ATOM   4415 C  CA    . GLU B 1 78  ? -26.093 -18.297 -3.429  1.00 54.27  ? 184 GLU B CA    1 
ATOM   4416 C  C     . GLU B 1 78  ? -27.331 -17.526 -3.118  1.00 51.65  ? 184 GLU B C     1 
ATOM   4417 O  O     . GLU B 1 78  ? -28.185 -17.975 -2.378  1.00 53.51  ? 184 GLU B O     1 
ATOM   4418 C  CB    . GLU B 1 78  ? -24.970 -17.736 -2.508  1.00 59.66  ? 184 GLU B CB    1 
ATOM   4419 C  CG    . GLU B 1 78  ? -23.594 -18.408 -2.622  1.00 68.51  ? 184 GLU B CG    1 
ATOM   4420 C  CD    . GLU B 1 78  ? -23.609 -19.941 -2.419  1.00 75.42  ? 184 GLU B CD    1 
ATOM   4421 O  OE1   . GLU B 1 78  ? -24.096 -20.384 -1.358  1.00 80.08  ? 184 GLU B OE1   1 
ATOM   4422 O  OE2   . GLU B 1 78  ? -23.106 -20.718 -3.284  1.00 83.79  ? 184 GLU B OE2   1 
ATOM   4423 N  N     . LYS B 1 79  ? -27.423 -16.357 -3.683  1.00 49.89  ? 185 LYS B N     1 
ATOM   4424 C  CA    . LYS B 1 79  ? -28.514 -15.494 -3.355  1.00 52.59  ? 185 LYS B CA    1 
ATOM   4425 C  C     . LYS B 1 79  ? -29.801 -15.781 -4.103  1.00 51.10  ? 185 LYS B C     1 
ATOM   4426 O  O     . LYS B 1 79  ? -30.832 -15.374 -3.629  1.00 50.17  ? 185 LYS B O     1 
ATOM   4427 C  CB    . LYS B 1 79  ? -28.118 -14.058 -3.569  1.00 54.95  ? 185 LYS B CB    1 
ATOM   4428 C  CG    . LYS B 1 79  ? -27.135 -13.535 -2.537  1.00 59.76  ? 185 LYS B CG    1 
ATOM   4429 C  CD    . LYS B 1 79  ? -26.941 -12.028 -2.692  1.00 66.04  ? 185 LYS B CD    1 
ATOM   4430 C  CE    . LYS B 1 79  ? -27.973 -11.288 -3.596  1.00 70.56  ? 185 LYS B CE    1 
ATOM   4431 N  NZ    . LYS B 1 79  ? -27.621 -9.861  -3.774  1.00 72.25  ? 185 LYS B NZ    1 
ATOM   4432 N  N     . GLN B 1 80  ? -29.725 -16.423 -5.274  1.00 49.82  ? 186 GLN B N     1 
ATOM   4433 C  CA    . GLN B 1 80  ? -30.917 -16.718 -6.089  1.00 48.11  ? 186 GLN B CA    1 
ATOM   4434 C  C     . GLN B 1 80  ? -30.904 -18.184 -6.576  1.00 48.30  ? 186 GLN B C     1 
ATOM   4435 O  O     . GLN B 1 80  ? -30.661 -18.441 -7.778  1.00 46.52  ? 186 GLN B O     1 
ATOM   4436 C  CB    . GLN B 1 80  ? -31.029 -15.751 -7.267  1.00 45.79  ? 186 GLN B CB    1 
ATOM   4437 C  CG    . GLN B 1 80  ? -31.192 -14.301 -6.869  1.00 45.94  ? 186 GLN B CG    1 
ATOM   4438 C  CD    . GLN B 1 80  ? -31.306 -13.366 -8.071  1.00 47.42  ? 186 GLN B CD    1 
ATOM   4439 O  OE1   . GLN B 1 80  ? -30.374 -12.644 -8.425  1.00 50.20  ? 186 GLN B OE1   1 
ATOM   4440 N  NE2   . GLN B 1 80  ? -32.439 -13.371 -8.698  1.00 43.77  ? 186 GLN B NE2   1 
ATOM   4441 N  N     . PRO B 1 81  ? -31.203 -19.141 -5.637  1.00 52.43  ? 187 PRO B N     1 
ATOM   4442 C  CA    . PRO B 1 81  ? -31.306 -20.609 -5.924  1.00 50.85  ? 187 PRO B CA    1 
ATOM   4443 C  C     . PRO B 1 81  ? -32.294 -20.910 -7.029  1.00 50.95  ? 187 PRO B C     1 
ATOM   4444 O  O     . PRO B 1 81  ? -32.069 -21.873 -7.779  1.00 47.08  ? 187 PRO B O     1 
ATOM   4445 C  CB    . PRO B 1 81  ? -31.744 -21.230 -4.610  1.00 52.06  ? 187 PRO B CB    1 
ATOM   4446 C  CG    . PRO B 1 81  ? -31.413 -20.235 -3.525  1.00 54.15  ? 187 PRO B CG    1 
ATOM   4447 C  CD    . PRO B 1 81  ? -31.315 -18.865 -4.175  1.00 54.51  ? 187 PRO B CD    1 
ATOM   4448 N  N     . GLU B 1 82  ? -33.312 -20.057 -7.176  1.00 51.85  ? 188 GLU B N     1 
ATOM   4449 C  CA    . GLU B 1 82  ? -34.245 -20.178 -8.317  1.00 56.90  ? 188 GLU B CA    1 
ATOM   4450 C  C     . GLU B 1 82  ? -33.648 -20.096 -9.724  1.00 57.72  ? 188 GLU B C     1 
ATOM   4451 O  O     . GLU B 1 82  ? -34.291 -20.496 -10.651 1.00 59.60  ? 188 GLU B O     1 
ATOM   4452 C  CB    . GLU B 1 82  ? -35.437 -19.198 -8.214  1.00 57.66  ? 188 GLU B CB    1 
ATOM   4453 C  CG    . GLU B 1 82  ? -35.209 -17.742 -8.615  1.00 57.63  ? 188 GLU B CG    1 
ATOM   4454 C  CD    . GLU B 1 82  ? -34.577 -16.905 -7.501  1.00 58.42  ? 188 GLU B CD    1 
ATOM   4455 O  OE1   . GLU B 1 82  ? -34.622 -15.674 -7.650  1.00 60.33  ? 188 GLU B OE1   1 
ATOM   4456 O  OE2   . GLU B 1 82  ? -34.041 -17.504 -6.517  1.00 54.05  ? 188 GLU B OE2   1 
ATOM   4457 N  N     . LEU B 1 83  ? -32.436 -19.560 -9.885  1.00 60.53  ? 189 LEU B N     1 
ATOM   4458 C  CA    . LEU B 1 83  ? -31.814 -19.540 -11.201 1.00 55.74  ? 189 LEU B CA    1 
ATOM   4459 C  C     . LEU B 1 83  ? -31.346 -20.923 -11.627 1.00 53.72  ? 189 LEU B C     1 
ATOM   4460 O  O     . LEU B 1 83  ? -31.091 -21.119 -12.791 1.00 47.79  ? 189 LEU B O     1 
ATOM   4461 C  CB    . LEU B 1 83  ? -30.650 -18.567 -11.237 1.00 55.44  ? 189 LEU B CB    1 
ATOM   4462 C  CG    . LEU B 1 83  ? -31.081 -17.132 -10.944 1.00 55.81  ? 189 LEU B CG    1 
ATOM   4463 C  CD1   . LEU B 1 83  ? -29.843 -16.261 -10.773 1.00 56.02  ? 189 LEU B CD1   1 
ATOM   4464 C  CD2   . LEU B 1 83  ? -31.949 -16.576 -12.048 1.00 52.49  ? 189 LEU B CD2   1 
ATOM   4465 N  N     . GLN B 1 84  ? -31.202 -21.876 -10.711 1.00 55.34  ? 190 GLN B N     1 
ATOM   4466 C  CA    . GLN B 1 84  ? -30.776 -23.225 -11.108 1.00 57.90  ? 190 GLN B CA    1 
ATOM   4467 C  C     . GLN B 1 84  ? -29.387 -23.221 -11.790 1.00 55.25  ? 190 GLN B C     1 
ATOM   4468 O  O     . GLN B 1 84  ? -29.171 -23.780 -12.885 1.00 54.66  ? 190 GLN B O     1 
ATOM   4469 C  CB    . GLN B 1 84  ? -31.808 -23.830 -12.064 1.00 63.04  ? 190 GLN B CB    1 
ATOM   4470 C  CG    . GLN B 1 84  ? -33.274 -23.725 -11.618 1.00 68.28  ? 190 GLN B CG    1 
ATOM   4471 C  CD    . GLN B 1 84  ? -33.661 -24.817 -10.643 1.00 69.73  ? 190 GLN B CD    1 
ATOM   4472 O  OE1   . GLN B 1 84  ? -33.705 -25.986 -11.009 1.00 76.56  ? 190 GLN B OE1   1 
ATOM   4473 N  NE2   . GLN B 1 84  ? -33.946 -24.448 -9.406  1.00 68.54  ? 190 GLN B NE2   1 
ATOM   4474 N  N     . ILE B 1 85  ? -28.458 -22.541 -11.139 1.00 51.68  ? 191 ILE B N     1 
ATOM   4475 C  CA    . ILE B 1 85  ? -27.093 -22.541 -11.607 1.00 52.53  ? 191 ILE B CA    1 
ATOM   4476 C  C     . ILE B 1 85  ? -26.510 -23.843 -11.079 1.00 49.77  ? 191 ILE B C     1 
ATOM   4477 O  O     . ILE B 1 85  ? -26.573 -24.098 -9.872  1.00 46.30  ? 191 ILE B O     1 
ATOM   4478 C  CB    . ILE B 1 85  ? -26.342 -21.272 -11.121 1.00 53.11  ? 191 ILE B CB    1 
ATOM   4479 C  CG1   . ILE B 1 85  ? -26.827 -20.035 -11.904 1.00 52.89  ? 191 ILE B CG1   1 
ATOM   4480 C  CG2   . ILE B 1 85  ? -24.836 -21.387 -11.277 1.00 51.88  ? 191 ILE B CG2   1 
ATOM   4481 C  CD1   . ILE B 1 85  ? -26.473 -18.759 -11.177 1.00 52.79  ? 191 ILE B CD1   1 
ATOM   4482 N  N     . SER B 1 86  ? -26.019 -24.683 -11.988 1.00 48.79  ? 192 SER B N     1 
ATOM   4483 C  CA    . SER B 1 86  ? -25.410 -25.954 -11.614 1.00 50.89  ? 192 SER B CA    1 
ATOM   4484 C  C     . SER B 1 86  ? -23.896 -25.839 -11.476 1.00 53.36  ? 192 SER B C     1 
ATOM   4485 O  O     . SER B 1 86  ? -23.311 -24.836 -11.885 1.00 57.36  ? 192 SER B O     1 
ATOM   4486 C  CB    . SER B 1 86  ? -25.733 -27.034 -12.647 1.00 47.58  ? 192 SER B CB    1 
ATOM   4487 O  OG    . SER B 1 86  ? -25.069 -26.819 -13.846 1.00 46.43  ? 192 SER B OG    1 
ATOM   4488 N  N     . GLU B 1 87  ? -23.268 -26.896 -10.958 1.00 55.77  ? 193 GLU B N     1 
ATOM   4489 C  CA    . GLU B 1 87  ? -21.805 -26.976 -10.854 1.00 58.82  ? 193 GLU B CA    1 
ATOM   4490 C  C     . GLU B 1 87  ? -21.162 -27.091 -12.196 1.00 56.74  ? 193 GLU B C     1 
ATOM   4491 O  O     . GLU B 1 87  ? -20.084 -26.560 -12.414 1.00 60.09  ? 193 GLU B O     1 
ATOM   4492 C  CB    . GLU B 1 87  ? -21.360 -28.113 -9.912  1.00 63.69  ? 193 GLU B CB    1 
ATOM   4493 C  CG    . GLU B 1 87  ? -21.648 -27.832 -8.412  1.00 67.19  ? 193 GLU B CG    1 
ATOM   4494 C  CD    . GLU B 1 87  ? -21.141 -26.440 -7.891  1.00 74.81  ? 193 GLU B CD    1 
ATOM   4495 O  OE1   . GLU B 1 87  ? -20.042 -25.980 -8.332  1.00 74.79  ? 193 GLU B OE1   1 
ATOM   4496 O  OE2   . GLU B 1 87  ? -21.833 -25.770 -7.041  1.00 79.10  ? 193 GLU B OE2   1 
ATOM   4497 N  N     . ARG B 1 88  ? -21.850 -27.772 -13.093 1.00 54.36  ? 194 ARG B N     1 
ATOM   4498 C  CA    . ARG B 1 88  ? -21.541 -27.733 -14.518 1.00 53.12  ? 194 ARG B CA    1 
ATOM   4499 C  C     . ARG B 1 88  ? -21.396 -26.306 -15.091 1.00 49.15  ? 194 ARG B C     1 
ATOM   4500 O  O     . ARG B 1 88  ? -20.369 -25.988 -15.676 1.00 48.12  ? 194 ARG B O     1 
ATOM   4501 C  CB    . ARG B 1 88  ? -22.652 -28.443 -15.272 1.00 54.20  ? 194 ARG B CB    1 
ATOM   4502 C  CG    . ARG B 1 88  ? -22.175 -29.069 -16.554 1.00 56.56  ? 194 ARG B CG    1 
ATOM   4503 C  CD    . ARG B 1 88  ? -23.313 -29.828 -17.192 1.00 56.83  ? 194 ARG B CD    1 
ATOM   4504 N  NE    . ARG B 1 88  ? -23.270 -29.651 -18.637 1.00 59.43  ? 194 ARG B NE    1 
ATOM   4505 C  CZ    . ARG B 1 88  ? -24.336 -29.622 -19.441 1.00 57.73  ? 194 ARG B CZ    1 
ATOM   4506 N  NH1   . ARG B 1 88  ? -25.545 -29.786 -18.956 1.00 55.43  ? 194 ARG B NH1   1 
ATOM   4507 N  NH2   . ARG B 1 88  ? -24.195 -29.438 -20.753 1.00 58.73  ? 194 ARG B NH2   1 
ATOM   4508 N  N     . ASP B 1 89  ? -22.425 -25.475 -14.887 1.00 48.24  ? 195 ASP B N     1 
ATOM   4509 C  CA    . ASP B 1 89  ? -22.412 -24.057 -15.309 1.00 48.31  ? 195 ASP B CA    1 
ATOM   4510 C  C     . ASP B 1 89  ? -21.185 -23.272 -14.740 1.00 45.74  ? 195 ASP B C     1 
ATOM   4511 O  O     . ASP B 1 89  ? -20.468 -22.561 -15.448 1.00 41.85  ? 195 ASP B O     1 
ATOM   4512 C  CB    . ASP B 1 89  ? -23.712 -23.352 -14.885 1.00 48.98  ? 195 ASP B CB    1 
ATOM   4513 C  CG    . ASP B 1 89  ? -24.974 -23.903 -15.584 1.00 49.28  ? 195 ASP B CG    1 
ATOM   4514 O  OD1   . ASP B 1 89  ? -24.929 -24.273 -16.759 1.00 55.61  ? 195 ASP B OD1   1 
ATOM   4515 O  OD2   . ASP B 1 89  ? -26.060 -23.905 -14.983 1.00 49.10  ? 195 ASP B OD2   1 
ATOM   4516 N  N     . VAL B 1 90  ? -20.951 -23.444 -13.447 1.00 44.54  ? 196 VAL B N     1 
ATOM   4517 C  CA    . VAL B 1 90  ? -19.865 -22.772 -12.777 1.00 43.38  ? 196 VAL B CA    1 
ATOM   4518 C  C     . VAL B 1 90  ? -18.498 -23.088 -13.423 1.00 43.85  ? 196 VAL B C     1 
ATOM   4519 O  O     . VAL B 1 90  ? -17.692 -22.166 -13.756 1.00 43.79  ? 196 VAL B O     1 
ATOM   4520 C  CB    . VAL B 1 90  ? -19.901 -23.134 -11.259 1.00 44.23  ? 196 VAL B CB    1 
ATOM   4521 C  CG1   . VAL B 1 90  ? -18.578 -22.811 -10.504 1.00 41.91  ? 196 VAL B CG1   1 
ATOM   4522 C  CG2   . VAL B 1 90  ? -21.101 -22.440 -10.623 1.00 43.90  ? 196 VAL B CG2   1 
ATOM   4523 N  N     . LEU B 1 91  ? -18.224 -24.375 -13.547 1.00 42.33  ? 197 LEU B N     1 
ATOM   4524 C  CA    . LEU B 1 91  ? -17.025 -24.840 -14.242 1.00 44.54  ? 197 LEU B CA    1 
ATOM   4525 C  C     . LEU B 1 91  ? -16.896 -24.352 -15.694 1.00 43.10  ? 197 LEU B C     1 
ATOM   4526 O  O     . LEU B 1 91  ? -15.788 -24.026 -16.132 1.00 42.79  ? 197 LEU B O     1 
ATOM   4527 C  CB    . LEU B 1 91  ? -16.965 -26.370 -14.270 1.00 47.62  ? 197 LEU B CB    1 
ATOM   4528 C  CG    . LEU B 1 91  ? -16.313 -27.123 -13.134 1.00 50.48  ? 197 LEU B CG    1 
ATOM   4529 C  CD1   . LEU B 1 91  ? -16.587 -28.618 -13.233 1.00 51.19  ? 197 LEU B CD1   1 
ATOM   4530 C  CD2   . LEU B 1 91  ? -14.816 -26.859 -13.128 1.00 52.66  ? 197 LEU B CD2   1 
ATOM   4531 N  N     . CYS B 1 92  ? -17.981 -24.334 -16.454 1.00 41.79  ? 198 CYS B N     1 
ATOM   4532 C  CA    . CYS B 1 92  ? -17.910 -23.797 -17.837 1.00 42.47  ? 198 CYS B CA    1 
ATOM   4533 C  C     . CYS B 1 92  ? -17.507 -22.331 -17.843 1.00 41.49  ? 198 CYS B C     1 
ATOM   4534 O  O     . CYS B 1 92  ? -16.703 -21.896 -18.686 1.00 41.75  ? 198 CYS B O     1 
ATOM   4535 C  CB    . CYS B 1 92  ? -19.217 -24.052 -18.613 1.00 43.24  ? 198 CYS B CB    1 
ATOM   4536 S  SG    . CYS B 1 92  ? -19.389 -25.823 -19.027 1.00 45.85  ? 198 CYS B SG    1 
ATOM   4537 N  N     . VAL B 1 93  ? -18.026 -21.576 -16.865 1.00 39.71  ? 199 VAL B N     1 
ATOM   4538 C  CA    . VAL B 1 93  ? -17.725 -20.158 -16.759 1.00 40.59  ? 199 VAL B CA    1 
ATOM   4539 C  C     . VAL B 1 93  ? -16.247 -19.969 -16.369 1.00 39.15  ? 199 VAL B C     1 
ATOM   4540 O  O     . VAL B 1 93  ? -15.498 -19.138 -16.996 1.00 34.56  ? 199 VAL B O     1 
ATOM   4541 C  CB    . VAL B 1 93  ? -18.686 -19.464 -15.768 1.00 42.17  ? 199 VAL B CB    1 
ATOM   4542 C  CG1   . VAL B 1 93  ? -18.225 -18.050 -15.460 1.00 40.78  ? 199 VAL B CG1   1 
ATOM   4543 C  CG2   . VAL B 1 93  ? -20.119 -19.443 -16.334 1.00 42.64  ? 199 VAL B CG2   1 
ATOM   4544 N  N     . GLN B 1 94  ? -15.828 -20.764 -15.386 1.00 38.10  ? 200 GLN B N     1 
ATOM   4545 C  CA    . GLN B 1 94  ? -14.429 -20.770 -14.948 1.00 40.02  ? 200 GLN B CA    1 
ATOM   4546 C  C     . GLN B 1 94  ? -13.416 -21.048 -16.054 1.00 38.33  ? 200 GLN B C     1 
ATOM   4547 O  O     . GLN B 1 94  ? -12.429 -20.322 -16.262 1.00 35.68  ? 200 GLN B O     1 
ATOM   4548 C  CB    . GLN B 1 94  ? -14.262 -21.736 -13.779 1.00 46.69  ? 200 GLN B CB    1 
ATOM   4549 C  CG    . GLN B 1 94  ? -14.725 -21.174 -12.406 1.00 47.46  ? 200 GLN B CG    1 
ATOM   4550 C  CD    . GLN B 1 94  ? -14.542 -22.202 -11.291 1.00 46.67  ? 200 GLN B CD    1 
ATOM   4551 O  OE1   . GLN B 1 94  ? -15.060 -23.282 -11.367 1.00 48.83  ? 200 GLN B OE1   1 
ATOM   4552 N  NE2   . GLN B 1 94  ? -13.803 -21.853 -10.268 1.00 45.36  ? 200 GLN B NE2   1 
ATOM   4553 N  N     . ILE B 1 95  ? -13.718 -22.046 -16.843 1.00 39.57  ? 201 ILE B N     1 
ATOM   4554 C  CA    . ILE B 1 95  ? -12.883 -22.389 -18.014 1.00 37.53  ? 201 ILE B CA    1 
ATOM   4555 C  C     . ILE B 1 95  ? -12.826 -21.281 -19.080 1.00 36.74  ? 201 ILE B C     1 
ATOM   4556 O  O     . ILE B 1 95  ? -11.757 -21.023 -19.681 1.00 38.47  ? 201 ILE B O     1 
ATOM   4557 C  CB    . ILE B 1 95  ? -13.376 -23.712 -18.651 1.00 36.24  ? 201 ILE B CB    1 
ATOM   4558 C  CG1   . ILE B 1 95  ? -13.096 -24.885 -17.703 1.00 36.64  ? 201 ILE B CG1   1 
ATOM   4559 C  CG2   . ILE B 1 95  ? -12.693 -23.994 -19.971 1.00 35.26  ? 201 ILE B CG2   1 
ATOM   4560 C  CD1   . ILE B 1 95  ? -13.897 -26.140 -17.959 1.00 38.50  ? 201 ILE B CD1   1 
ATOM   4561 N  N     . ALA B 1 96  ? -13.963 -20.658 -19.364 1.00 34.64  ? 202 ALA B N     1 
ATOM   4562 C  CA    . ALA B 1 96  ? -13.971 -19.582 -20.338 1.00 31.85  ? 202 ALA B CA    1 
ATOM   4563 C  C     . ALA B 1 96  ? -13.119 -18.366 -19.848 1.00 31.20  ? 202 ALA B C     1 
ATOM   4564 O  O     . ALA B 1 96  ? -12.390 -17.737 -20.604 1.00 32.81  ? 202 ALA B O     1 
ATOM   4565 C  CB    . ALA B 1 96  ? -15.382 -19.176 -20.589 1.00 31.35  ? 202 ALA B CB    1 
ATOM   4566 N  N     . GLY B 1 97  ? -13.204 -18.077 -18.544 1.00 32.09  ? 203 GLY B N     1 
ATOM   4567 C  CA    . GLY B 1 97  ? -12.453 -17.002 -17.933 1.00 30.05  ? 203 GLY B CA    1 
ATOM   4568 C  C     . GLY B 1 97  ? -10.988 -17.267 -18.074 1.00 30.60  ? 203 GLY B C     1 
ATOM   4569 O  O     . GLY B 1 97  ? -10.201 -16.366 -18.484 1.00 32.92  ? 203 GLY B O     1 
ATOM   4570 N  N     . LEU B 1 98  ? -10.633 -18.503 -17.755 1.00 29.81  ? 204 LEU B N     1 
ATOM   4571 C  CA    . LEU B 1 98  ? -9.267  -18.940 -17.820 1.00 31.26  ? 204 LEU B CA    1 
ATOM   4572 C  C     . LEU B 1 98  ? -8.669  -18.933 -19.207 1.00 33.73  ? 204 LEU B C     1 
ATOM   4573 O  O     . LEU B 1 98  ? -7.509  -18.598 -19.348 1.00 34.99  ? 204 LEU B O     1 
ATOM   4574 C  CB    . LEU B 1 98  ? -9.230  -20.309 -17.270 1.00 32.46  ? 204 LEU B CB    1 
ATOM   4575 C  CG    . LEU B 1 98  ? -7.911  -20.940 -17.058 1.00 35.31  ? 204 LEU B CG    1 
ATOM   4576 C  CD1   . LEU B 1 98  ? -7.217  -20.314 -15.858 1.00 34.88  ? 204 LEU B CD1   1 
ATOM   4577 C  CD2   . LEU B 1 98  ? -8.191  -22.399 -16.696 1.00 38.26  ? 204 LEU B CD2   1 
ATOM   4578 N  N     . CYS B 1 99  ? -9.477  -19.243 -20.224 1.00 33.85  ? 205 CYS B N     1 
ATOM   4579 C  CA    . CYS B 1 99  ? -8.987  -19.430 -21.633 1.00 35.56  ? 205 CYS B CA    1 
ATOM   4580 C  C     . CYS B 1 99  ? -9.287  -18.269 -22.581 1.00 34.33  ? 205 CYS B C     1 
ATOM   4581 O  O     . CYS B 1 99  ? -8.949  -18.307 -23.772 1.00 33.85  ? 205 CYS B O     1 
ATOM   4582 C  CB    . CYS B 1 99  ? -9.573  -20.762 -22.196 1.00 37.74  ? 205 CYS B CB    1 
ATOM   4583 S  SG    . CYS B 1 99  ? -9.098  -22.299 -21.322 1.00 37.11  ? 205 CYS B SG    1 
ATOM   4584 N  N     . HIS B 1 100 ? -9.848  -17.195 -22.037 1.00 35.30  ? 206 HIS B N     1 
ATOM   4585 C  CA    . HIS B 1 100 ? -10.350 -16.100 -22.843 1.00 34.25  ? 206 HIS B CA    1 
ATOM   4586 C  C     . HIS B 1 100 ? -9.294  -15.377 -23.670 1.00 33.65  ? 206 HIS B C     1 
ATOM   4587 O  O     . HIS B 1 100 ? -9.633  -14.770 -24.698 1.00 30.26  ? 206 HIS B O     1 
ATOM   4588 C  CB    . HIS B 1 100 ? -11.145 -15.119 -22.003 1.00 34.66  ? 206 HIS B CB    1 
ATOM   4589 C  CG    . HIS B 1 100 ? -10.294 -14.105 -21.337 1.00 34.98  ? 206 HIS B CG    1 
ATOM   4590 N  ND1   . HIS B 1 100 ? -9.514  -14.405 -20.231 1.00 33.41  ? 206 HIS B ND1   1 
ATOM   4591 C  CD2   . HIS B 1 100 ? -10.074 -12.802 -21.632 1.00 34.94  ? 206 HIS B CD2   1 
ATOM   4592 C  CE1   . HIS B 1 100 ? -8.856  -13.321 -19.873 1.00 33.44  ? 206 HIS B CE1   1 
ATOM   4593 N  NE2   . HIS B 1 100 ? -9.189  -12.330 -20.686 1.00 35.77  ? 206 HIS B NE2   1 
ATOM   4594 N  N     . ASP B 1 101 ? -8.041  -15.395 -23.218 1.00 32.32  ? 207 ASP B N     1 
ATOM   4595 C  CA    . ASP B 1 101 ? -6.977  -14.633 -23.878 1.00 30.79  ? 207 ASP B CA    1 
ATOM   4596 C  C     . ASP B 1 101 ? -5.924  -15.603 -24.417 1.00 29.91  ? 207 ASP B C     1 
ATOM   4597 O  O     . ASP B 1 101 ? -4.818  -15.162 -24.742 1.00 26.81  ? 207 ASP B O     1 
ATOM   4598 C  CB    . ASP B 1 101 ? -6.343  -13.622 -22.871 1.00 29.80  ? 207 ASP B CB    1 
ATOM   4599 C  CG    . ASP B 1 101 ? -7.013  -12.216 -22.882 1.00 30.23  ? 207 ASP B CG    1 
ATOM   4600 O  OD1   . ASP B 1 101 ? -7.698  -11.843 -23.891 1.00 33.45  ? 207 ASP B OD1   1 
ATOM   4601 O  OD2   . ASP B 1 101 ? -6.817  -11.463 -21.909 1.00 27.81  ? 207 ASP B OD2   1 
ATOM   4602 N  N     . LEU B 1 102 ? -6.232  -16.899 -24.545 1.00 29.37  ? 208 LEU B N     1 
ATOM   4603 C  CA    . LEU B 1 102 ? -5.249  -17.837 -25.171 1.00 32.58  ? 208 LEU B CA    1 
ATOM   4604 C  C     . LEU B 1 102 ? -4.712  -17.445 -26.577 1.00 33.62  ? 208 LEU B C     1 
ATOM   4605 O  O     . LEU B 1 102 ? -3.595  -17.844 -26.952 1.00 33.27  ? 208 LEU B O     1 
ATOM   4606 C  CB    . LEU B 1 102 ? -5.858  -19.221 -25.343 1.00 34.89  ? 208 LEU B CB    1 
ATOM   4607 C  CG    . LEU B 1 102 ? -6.012  -20.121 -24.139 1.00 35.79  ? 208 LEU B CG    1 
ATOM   4608 C  CD1   . LEU B 1 102 ? -6.837  -21.328 -24.538 1.00 38.23  ? 208 LEU B CD1   1 
ATOM   4609 C  CD2   . LEU B 1 102 ? -4.657  -20.590 -23.690 1.00 35.40  ? 208 LEU B CD2   1 
ATOM   4610 N  N     . GLY B 1 103 ? -5.506  -16.674 -27.336 1.00 34.64  ? 209 GLY B N     1 
ATOM   4611 C  CA    . GLY B 1 103 ? -5.100  -16.226 -28.671 1.00 32.99  ? 209 GLY B CA    1 
ATOM   4612 C  C     . GLY B 1 103 ? -4.280  -14.948 -28.756 1.00 32.41  ? 209 GLY B C     1 
ATOM   4613 O  O     . GLY B 1 103 ? -4.011  -14.484 -29.876 1.00 33.85  ? 209 GLY B O     1 
ATOM   4614 N  N     . HIS B 1 104 ? -3.919  -14.303 -27.663 1.00 28.26  ? 210 HIS B N     1 
ATOM   4615 C  CA    . HIS B 1 104 ? -3.038  -13.152 -27.822 1.00 28.68  ? 210 HIS B CA    1 
ATOM   4616 C  C     . HIS B 1 104 ? -1.733  -13.613 -28.459 1.00 28.56  ? 210 HIS B C     1 
ATOM   4617 O  O     . HIS B 1 104 ? -1.295  -14.775 -28.254 1.00 28.11  ? 210 HIS B O     1 
ATOM   4618 C  CB    . HIS B 1 104 ? -2.749  -12.382 -26.483 1.00 30.09  ? 210 HIS B CB    1 
ATOM   4619 C  CG    . HIS B 1 104 ? -3.726  -11.280 -26.194 1.00 29.35  ? 210 HIS B CG    1 
ATOM   4620 N  ND1   . HIS B 1 104 ? -3.758  -10.129 -26.942 1.00 28.82  ? 210 HIS B ND1   1 
ATOM   4621 C  CD2   . HIS B 1 104 ? -4.698  -11.162 -25.258 1.00 29.71  ? 210 HIS B CD2   1 
ATOM   4622 C  CE1   . HIS B 1 104 ? -4.719  -9.347  -26.479 1.00 30.92  ? 210 HIS B CE1   1 
ATOM   4623 N  NE2   . HIS B 1 104 ? -5.320  -9.959  -25.470 1.00 30.31  ? 210 HIS B NE2   1 
ATOM   4624 N  N     . GLY B 1 105 ? -1.116  -12.731 -29.215 1.00 28.65  ? 211 GLY B N     1 
ATOM   4625 C  CA    . GLY B 1 105 ? 0.162   -13.003 -29.839 1.00 30.24  ? 211 GLY B CA    1 
ATOM   4626 C  C     . GLY B 1 105 ? 1.181   -12.125 -29.172 1.00 31.96  ? 211 GLY B C     1 
ATOM   4627 O  O     . GLY B 1 105 ? 0.864   -11.445 -28.181 1.00 31.96  ? 211 GLY B O     1 
ATOM   4628 N  N     . PRO B 1 106 ? 2.411   -12.091 -29.721 1.00 32.27  ? 212 PRO B N     1 
ATOM   4629 C  CA    . PRO B 1 106 ? 3.513   -11.356 -29.118 1.00 30.87  ? 212 PRO B CA    1 
ATOM   4630 C  C     . PRO B 1 106 ? 3.144   -9.905  -28.829 1.00 30.34  ? 212 PRO B C     1 
ATOM   4631 O  O     . PRO B 1 106 ? 2.548   -9.242  -29.712 1.00 30.13  ? 212 PRO B O     1 
ATOM   4632 C  CB    . PRO B 1 106 ? 4.595   -11.426 -30.171 1.00 33.04  ? 212 PRO B CB    1 
ATOM   4633 C  CG    . PRO B 1 106 ? 4.238   -12.536 -31.084 1.00 32.75  ? 212 PRO B CG    1 
ATOM   4634 C  CD    . PRO B 1 106 ? 2.829   -12.918 -30.860 1.00 33.00  ? 212 PRO B CD    1 
ATOM   4635 N  N     . PHE B 1 107 ? 3.489   -9.421  -27.617 1.00 27.22  ? 213 PHE B N     1 
ATOM   4636 C  CA    . PHE B 1 107 ? 3.217   -8.044  -27.148 1.00 25.86  ? 213 PHE B CA    1 
ATOM   4637 C  C     . PHE B 1 107 ? 1.698   -7.749  -27.126 1.00 25.13  ? 213 PHE B C     1 
ATOM   4638 O  O     . PHE B 1 107 ? 1.280   -6.573  -27.183 1.00 24.24  ? 213 PHE B O     1 
ATOM   4639 C  CB    . PHE B 1 107 ? 4.081   -6.997  -27.903 1.00 27.82  ? 213 PHE B CB    1 
ATOM   4640 C  CG    . PHE B 1 107 ? 5.538   -7.253  -27.813 1.00 29.89  ? 213 PHE B CG    1 
ATOM   4641 C  CD1   . PHE B 1 107 ? 6.149   -8.240  -28.575 1.00 32.42  ? 213 PHE B CD1   1 
ATOM   4642 C  CD2   . PHE B 1 107 ? 6.322   -6.568  -26.909 1.00 33.02  ? 213 PHE B CD2   1 
ATOM   4643 C  CE1   . PHE B 1 107 ? 7.501   -8.555  -28.406 1.00 33.40  ? 213 PHE B CE1   1 
ATOM   4644 C  CE2   . PHE B 1 107 ? 7.687   -6.878  -26.725 1.00 32.70  ? 213 PHE B CE2   1 
ATOM   4645 C  CZ    . PHE B 1 107 ? 8.273   -7.871  -27.480 1.00 33.51  ? 213 PHE B CZ    1 
ATOM   4646 N  N     . SER B 1 108 ? 0.868   -8.790  -27.090 1.00 25.02  ? 214 SER B N     1 
ATOM   4647 C  CA    . SER B 1 108 ? -0.554  -8.636  -26.846 1.00 26.05  ? 214 SER B CA    1 
ATOM   4648 C  C     . SER B 1 108 ? -1.176  -7.725  -27.893 1.00 28.18  ? 214 SER B C     1 
ATOM   4649 O  O     . SER B 1 108 ? -1.071  -8.044  -29.125 1.00 28.65  ? 214 SER B O     1 
ATOM   4650 C  CB    . SER B 1 108 ? -0.788  -8.171  -25.379 1.00 28.01  ? 214 SER B CB    1 
ATOM   4651 O  OG    . SER B 1 108 ? -0.523  -9.233  -24.470 1.00 28.34  ? 214 SER B OG    1 
ATOM   4652 N  N     . HIS B 1 109 ? -1.772  -6.594  -27.506 1.00 28.35  ? 215 HIS B N     1 
ATOM   4653 C  CA    . HIS B 1 109 ? -2.547  -5.797  -28.478 1.00 31.17  ? 215 HIS B CA    1 
ATOM   4654 C  C     . HIS B 1 109 ? -1.704  -5.215  -29.662 1.00 31.47  ? 215 HIS B C     1 
ATOM   4655 O  O     . HIS B 1 109 ? -2.292  -4.862  -30.678 1.00 29.85  ? 215 HIS B O     1 
ATOM   4656 C  CB    . HIS B 1 109 ? -3.450  -4.709  -27.813 1.00 31.96  ? 215 HIS B CB    1 
ATOM   4657 C  CG    . HIS B 1 109 ? -4.709  -5.267  -27.211 1.00 35.83  ? 215 HIS B CG    1 
ATOM   4658 N  ND1   . HIS B 1 109 ? -5.761  -5.728  -27.987 1.00 35.37  ? 215 HIS B ND1   1 
ATOM   4659 C  CD2   . HIS B 1 109 ? -5.077  -5.482  -25.909 1.00 34.31  ? 215 HIS B CD2   1 
ATOM   4660 C  CE1   . HIS B 1 109 ? -6.716  -6.198  -27.195 1.00 35.71  ? 215 HIS B CE1   1 
ATOM   4661 N  NE2   . HIS B 1 109 ? -6.337  -6.060  -25.938 1.00 34.00  ? 215 HIS B NE2   1 
ATOM   4662 N  N     . MET B 1 110 ? -0.364  -5.129  -29.535 1.00 32.94  ? 216 MET B N     1 
ATOM   4663 C  CA    . MET B 1 110 ? 0.503   -4.777  -30.699 1.00 35.21  ? 216 MET B CA    1 
ATOM   4664 C  C     . MET B 1 110 ? 0.260   -5.743  -31.880 1.00 36.74  ? 216 MET B C     1 
ATOM   4665 O  O     . MET B 1 110 ? 0.235   -5.316  -33.033 1.00 41.05  ? 216 MET B O     1 
ATOM   4666 C  CB    . MET B 1 110 ? 1.996   -4.824  -30.307 1.00 35.68  ? 216 MET B CB    1 
ATOM   4667 C  CG    . MET B 1 110 ? 2.960   -4.268  -31.352 1.00 35.66  ? 216 MET B CG    1 
ATOM   4668 S  SD    . MET B 1 110 ? 4.536   -5.122  -31.346 1.00 37.13  ? 216 MET B SD    1 
ATOM   4669 C  CE    . MET B 1 110 ? 4.014   -6.686  -32.140 1.00 34.87  ? 216 MET B CE    1 
ATOM   4670 N  N     . PHE B 1 111 ? 0.029   -7.026  -31.573 1.00 36.78  ? 217 PHE B N     1 
ATOM   4671 C  CA    . PHE B 1 111 ? -0.021  -8.068  -32.551 1.00 36.91  ? 217 PHE B CA    1 
ATOM   4672 C  C     . PHE B 1 111 ? -1.271  -7.967  -33.412 1.00 37.89  ? 217 PHE B C     1 
ATOM   4673 O  O     . PHE B 1 111 ? -1.126  -7.965  -34.638 1.00 33.61  ? 217 PHE B O     1 
ATOM   4674 C  CB    . PHE B 1 111 ? 0.147   -9.478  -31.967 1.00 35.40  ? 217 PHE B CB    1 
ATOM   4675 C  CG    . PHE B 1 111 ? 0.623   -10.496 -32.983 1.00 36.91  ? 217 PHE B CG    1 
ATOM   4676 C  CD1   . PHE B 1 111 ? 1.896   -10.398 -33.538 1.00 37.05  ? 217 PHE B CD1   1 
ATOM   4677 C  CD2   . PHE B 1 111 ? -0.239  -11.518 -33.449 1.00 37.57  ? 217 PHE B CD2   1 
ATOM   4678 C  CE1   . PHE B 1 111 ? 2.324   -11.339 -34.486 1.00 37.18  ? 217 PHE B CE1   1 
ATOM   4679 C  CE2   . PHE B 1 111 ? 0.183   -12.463 -34.388 1.00 36.11  ? 217 PHE B CE2   1 
ATOM   4680 C  CZ    . PHE B 1 111 ? 1.465   -12.385 -34.888 1.00 36.53  ? 217 PHE B CZ    1 
ATOM   4681 N  N     . ASP B 1 112 ? -2.461  -7.918  -32.786 1.00 37.88  ? 218 ASP B N     1 
ATOM   4682 C  CA    . ASP B 1 112 ? -3.728  -7.742  -33.544 1.00 38.27  ? 218 ASP B CA    1 
ATOM   4683 C  C     . ASP B 1 112 ? -4.113  -6.288  -33.877 1.00 36.58  ? 218 ASP B C     1 
ATOM   4684 O  O     . ASP B 1 112 ? -4.836  -6.032  -34.818 1.00 37.31  ? 218 ASP B O     1 
ATOM   4685 C  CB    . ASP B 1 112 ? -4.938  -8.532  -32.935 1.00 39.36  ? 218 ASP B CB    1 
ATOM   4686 C  CG    . ASP B 1 112 ? -5.387  -8.054  -31.550 1.00 37.35  ? 218 ASP B CG    1 
ATOM   4687 O  OD1   . ASP B 1 112 ? -4.699  -7.189  -30.917 1.00 36.40  ? 218 ASP B OD1   1 
ATOM   4688 O  OD2   . ASP B 1 112 ? -6.439  -8.637  -31.093 1.00 37.01  ? 218 ASP B OD2   1 
ATOM   4689 N  N     . GLY B 1 113 ? -3.595  -5.344  -33.114 1.00 37.01  ? 219 GLY B N     1 
ATOM   4690 C  CA    . GLY B 1 113 ? -3.802  -3.911  -33.343 1.00 36.81  ? 219 GLY B CA    1 
ATOM   4691 C  C     . GLY B 1 113 ? -2.951  -3.346  -34.472 1.00 36.18  ? 219 GLY B C     1 
ATOM   4692 O  O     . GLY B 1 113 ? -3.410  -2.517  -35.185 1.00 35.98  ? 219 GLY B O     1 
ATOM   4693 N  N     . ARG B 1 114 ? -1.724  -3.791  -34.627 1.00 36.56  ? 220 ARG B N     1 
ATOM   4694 C  CA    . ARG B 1 114 ? -0.810  -3.174  -35.602 1.00 37.78  ? 220 ARG B CA    1 
ATOM   4695 C  C     . ARG B 1 114 ? -0.214  -4.174  -36.605 1.00 39.73  ? 220 ARG B C     1 
ATOM   4696 O  O     . ARG B 1 114 ? -0.311  -3.959  -37.820 1.00 42.37  ? 220 ARG B O     1 
ATOM   4697 C  CB    . ARG B 1 114 ? 0.336   -2.438  -34.883 1.00 36.84  ? 220 ARG B CB    1 
ATOM   4698 C  CG    . ARG B 1 114 ? -0.111  -1.459  -33.815 1.00 34.88  ? 220 ARG B CG    1 
ATOM   4699 C  CD    . ARG B 1 114 ? 1.069   -0.805  -33.135 1.00 37.56  ? 220 ARG B CD    1 
ATOM   4700 N  NE    . ARG B 1 114 ? 0.637   0.260   -32.205 1.00 38.86  ? 220 ARG B NE    1 
ATOM   4701 C  CZ    . ARG B 1 114 ? 0.408   1.526   -32.523 1.00 39.18  ? 220 ARG B CZ    1 
ATOM   4702 N  NH1   . ARG B 1 114 ? 0.567   1.945   -33.760 1.00 39.82  ? 220 ARG B NH1   1 
ATOM   4703 N  NH2   . ARG B 1 114 ? -0.026  2.371   -31.596 1.00 37.19  ? 220 ARG B NH2   1 
ATOM   4704 N  N     . PHE B 1 115 ? 0.386   -5.272  -36.137 1.00 39.41  ? 221 PHE B N     1 
ATOM   4705 C  CA    . PHE B 1 115 ? 1.139   -6.113  -37.066 1.00 40.36  ? 221 PHE B CA    1 
ATOM   4706 C  C     . PHE B 1 115 ? 0.280   -6.851  -38.115 1.00 40.40  ? 221 PHE B C     1 
ATOM   4707 O  O     . PHE B 1 115 ? 0.506   -6.701  -39.298 1.00 38.83  ? 221 PHE B O     1 
ATOM   4708 C  CB    . PHE B 1 115 ? 1.970   -7.083  -36.313 1.00 42.23  ? 221 PHE B CB    1 
ATOM   4709 C  CG    . PHE B 1 115 ? 2.729   -8.019  -37.177 1.00 42.72  ? 221 PHE B CG    1 
ATOM   4710 C  CD1   . PHE B 1 115 ? 3.893   -7.595  -37.830 1.00 43.65  ? 221 PHE B CD1   1 
ATOM   4711 C  CD2   . PHE B 1 115 ? 2.290   -9.347  -37.351 1.00 43.07  ? 221 PHE B CD2   1 
ATOM   4712 C  CE1   . PHE B 1 115 ? 4.623   -8.489  -38.616 1.00 42.66  ? 221 PHE B CE1   1 
ATOM   4713 C  CE2   . PHE B 1 115 ? 2.999   -10.216 -38.170 1.00 41.37  ? 221 PHE B CE2   1 
ATOM   4714 C  CZ    . PHE B 1 115 ? 4.154   -9.773  -38.799 1.00 42.46  ? 221 PHE B CZ    1 
ATOM   4715 N  N     . ILE B 1 116 ? -0.688  -7.622  -37.675 1.00 37.62  ? 222 ILE B N     1 
ATOM   4716 C  CA    . ILE B 1 116 ? -1.502  -8.394  -38.568 1.00 41.44  ? 222 ILE B CA    1 
ATOM   4717 C  C     . ILE B 1 116 ? -2.259  -7.540  -39.590 1.00 44.07  ? 222 ILE B C     1 
ATOM   4718 O  O     . ILE B 1 116 ? -2.367  -7.927  -40.733 1.00 42.80  ? 222 ILE B O     1 
ATOM   4719 C  CB    . ILE B 1 116 ? -2.436  -9.394  -37.802 1.00 40.74  ? 222 ILE B CB    1 
ATOM   4720 C  CG1   . ILE B 1 116 ? -1.584  -10.513 -37.144 1.00 39.42  ? 222 ILE B CG1   1 
ATOM   4721 C  CG2   . ILE B 1 116 ? -3.518  -10.032 -38.711 1.00 40.54  ? 222 ILE B CG2   1 
ATOM   4722 C  CD1   . ILE B 1 116 ? -0.781  -11.450 -38.068 1.00 41.23  ? 222 ILE B CD1   1 
ATOM   4723 N  N     . PRO B 1 117 ? -2.780  -6.382  -39.180 1.00 47.18  ? 223 PRO B N     1 
ATOM   4724 C  CA    . PRO B 1 117 ? -3.367  -5.466  -40.188 1.00 45.55  ? 223 PRO B CA    1 
ATOM   4725 C  C     . PRO B 1 117 ? -2.414  -4.949  -41.236 1.00 45.97  ? 223 PRO B C     1 
ATOM   4726 O  O     . PRO B 1 117 ? -2.774  -4.911  -42.386 1.00 46.74  ? 223 PRO B O     1 
ATOM   4727 C  CB    . PRO B 1 117 ? -3.893  -4.337  -39.328 1.00 46.76  ? 223 PRO B CB    1 
ATOM   4728 C  CG    . PRO B 1 117 ? -4.286  -5.021  -38.045 1.00 45.07  ? 223 PRO B CG    1 
ATOM   4729 C  CD    . PRO B 1 117 ? -3.238  -6.047  -37.823 1.00 46.35  ? 223 PRO B CD    1 
ATOM   4730 N  N     . LEU B 1 118 ? -1.206  -4.560  -40.853 1.00 45.58  ? 224 LEU B N     1 
ATOM   4731 C  CA    . LEU B 1 118 ? -0.185  -4.261  -41.830 1.00 43.42  ? 224 LEU B CA    1 
ATOM   4732 C  C     . LEU B 1 118 ? 0.238   -5.476  -42.652 1.00 45.46  ? 224 LEU B C     1 
ATOM   4733 O  O     . LEU B 1 118 ? 0.416   -5.371  -43.853 1.00 45.75  ? 224 LEU B O     1 
ATOM   4734 C  CB    . LEU B 1 118 ? 1.041   -3.625  -41.202 1.00 41.11  ? 224 LEU B CB    1 
ATOM   4735 C  CG    . LEU B 1 118 ? 0.767   -2.283  -40.547 1.00 41.93  ? 224 LEU B CG    1 
ATOM   4736 C  CD1   . LEU B 1 118 ? 2.060   -1.714  -39.985 1.00 42.47  ? 224 LEU B CD1   1 
ATOM   4737 C  CD2   . LEU B 1 118 ? 0.183   -1.264  -41.487 1.00 43.19  ? 224 LEU B CD2   1 
ATOM   4738 N  N     . ALA B 1 119 ? 0.440   -6.626  -42.044 1.00 45.45  ? 225 ALA B N     1 
ATOM   4739 C  CA    . ALA B 1 119 ? 1.075   -7.707  -42.765 1.00 44.22  ? 225 ALA B CA    1 
ATOM   4740 C  C     . ALA B 1 119 ? 0.066   -8.531  -43.571 1.00 47.16  ? 225 ALA B C     1 
ATOM   4741 O  O     . ALA B 1 119 ? 0.438   -9.252  -44.488 1.00 45.17  ? 225 ALA B O     1 
ATOM   4742 C  CB    . ALA B 1 119 ? 1.795   -8.590  -41.796 1.00 41.94  ? 225 ALA B CB    1 
ATOM   4743 N  N     . ARG B 1 120 ? -1.206  -8.480  -43.206 1.00 48.71  ? 226 ARG B N     1 
ATOM   4744 C  CA    . ARG B 1 120 ? -2.185  -9.314  -43.859 1.00 49.89  ? 226 ARG B CA    1 
ATOM   4745 C  C     . ARG B 1 120 ? -3.505  -8.606  -43.966 1.00 47.65  ? 226 ARG B C     1 
ATOM   4746 O  O     . ARG B 1 120 ? -4.503  -9.032  -43.360 1.00 45.05  ? 226 ARG B O     1 
ATOM   4747 C  CB    . ARG B 1 120 ? -2.269  -10.690 -43.193 1.00 54.03  ? 226 ARG B CB    1 
ATOM   4748 C  CG    . ARG B 1 120 ? -1.145  -11.560 -43.810 1.00 54.09  ? 226 ARG B CG    1 
ATOM   4749 C  CD    . ARG B 1 120 ? -1.101  -12.970 -43.341 1.00 54.64  ? 226 ARG B CD    1 
ATOM   4750 N  NE    . ARG B 1 120 ? -2.226  -13.686 -43.882 1.00 53.86  ? 226 ARG B NE    1 
ATOM   4751 C  CZ    . ARG B 1 120 ? -2.716  -14.824 -43.364 1.00 56.84  ? 226 ARG B CZ    1 
ATOM   4752 N  NH1   . ARG B 1 120 ? -2.196  -15.396 -42.234 1.00 55.18  ? 226 ARG B NH1   1 
ATOM   4753 N  NH2   . ARG B 1 120 ? -3.767  -15.372 -43.972 1.00 52.07  ? 226 ARG B NH2   1 
ATOM   4754 N  N     . PRO B 1 121 ? -3.524  -7.563  -44.827 1.00 49.39  ? 227 PRO B N     1 
ATOM   4755 C  CA    . PRO B 1 121 ? -4.701  -6.692  -45.001 1.00 47.61  ? 227 PRO B CA    1 
ATOM   4756 C  C     . PRO B 1 121 ? -5.914  -7.408  -45.522 1.00 46.13  ? 227 PRO B C     1 
ATOM   4757 O  O     . PRO B 1 121 ? -7.010  -6.948  -45.303 1.00 48.84  ? 227 PRO B O     1 
ATOM   4758 C  CB    . PRO B 1 121 ? -4.247  -5.637  -45.998 1.00 46.99  ? 227 PRO B CB    1 
ATOM   4759 C  CG    . PRO B 1 121 ? -2.802  -5.882  -46.238 1.00 49.77  ? 227 PRO B CG    1 
ATOM   4760 C  CD    . PRO B 1 121 ? -2.504  -7.291  -45.867 1.00 49.19  ? 227 PRO B CD    1 
ATOM   4761 N  N     . GLU B 1 122 ? -5.704  -8.525  -46.199 1.00 46.13  ? 228 GLU B N     1 
ATOM   4762 C  CA    . GLU B 1 122 ? -6.784  -9.353  -46.678 1.00 49.86  ? 228 GLU B CA    1 
ATOM   4763 C  C     . GLU B 1 122 ? -7.632  -10.127 -45.622 1.00 54.00  ? 228 GLU B C     1 
ATOM   4764 O  O     . GLU B 1 122 ? -8.736  -10.502 -45.962 1.00 58.73  ? 228 GLU B O     1 
ATOM   4765 C  CB    . GLU B 1 122 ? -6.230  -10.366 -47.683 1.00 49.53  ? 228 GLU B CB    1 
ATOM   4766 C  CG    . GLU B 1 122 ? -5.582  -11.604 -47.063 1.00 51.89  ? 228 GLU B CG    1 
ATOM   4767 C  CD    . GLU B 1 122 ? -4.062  -11.494 -46.835 1.00 50.23  ? 228 GLU B CD    1 
ATOM   4768 O  OE1   . GLU B 1 122 ? -3.509  -10.357 -46.879 1.00 45.22  ? 228 GLU B OE1   1 
ATOM   4769 O  OE2   . GLU B 1 122 ? -3.495  -12.583 -46.624 1.00 49.63  ? 228 GLU B OE2   1 
ATOM   4770 N  N     . VAL B 1 123 ? -7.112  -10.427 -44.409 1.00 54.85  ? 229 VAL B N     1 
ATOM   4771 C  CA    . VAL B 1 123 ? -7.876  -11.184 -43.396 1.00 50.89  ? 229 VAL B CA    1 
ATOM   4772 C  C     . VAL B 1 123 ? -8.512  -10.170 -42.440 1.00 51.53  ? 229 VAL B C     1 
ATOM   4773 O  O     . VAL B 1 123 ? -8.049  -9.014  -42.405 1.00 50.52  ? 229 VAL B O     1 
ATOM   4774 C  CB    . VAL B 1 123 ? -7.002  -12.202 -42.648 1.00 49.69  ? 229 VAL B CB    1 
ATOM   4775 C  CG1   . VAL B 1 123 ? -5.976  -12.902 -43.547 1.00 49.52  ? 229 VAL B CG1   1 
ATOM   4776 C  CG2   . VAL B 1 123 ? -6.180  -11.560 -41.551 1.00 50.95  ? 229 VAL B CG2   1 
ATOM   4777 N  N     . LYS B 1 124 ? -9.596  -10.562 -41.735 1.00 52.10  ? 230 LYS B N     1 
ATOM   4778 C  CA    . LYS B 1 124 ? -10.116 -9.817  -40.569 1.00 53.39  ? 230 LYS B CA    1 
ATOM   4779 C  C     . LYS B 1 124 ? -9.944  -10.772 -39.325 1.00 53.53  ? 230 LYS B C     1 
ATOM   4780 O  O     . LYS B 1 124 ? -10.700 -11.716 -39.175 1.00 56.08  ? 230 LYS B O     1 
ATOM   4781 C  CB    . LYS B 1 124 ? -11.564 -9.329  -40.761 1.00 51.06  ? 230 LYS B CB    1 
ATOM   4782 N  N     . TRP B 1 125 ? -8.919  -10.535 -38.510 1.00 48.98  ? 231 TRP B N     1 
ATOM   4783 C  CA    . TRP B 1 125 ? -8.489  -11.410 -37.391 1.00 48.24  ? 231 TRP B CA    1 
ATOM   4784 C  C     . TRP B 1 125 ? -8.493  -10.627 -36.059 1.00 44.91  ? 231 TRP B C     1 
ATOM   4785 O  O     . TRP B 1 125 ? -8.158  -9.454  -36.042 1.00 37.14  ? 231 TRP B O     1 
ATOM   4786 C  CB    . TRP B 1 125 ? -7.058  -11.924 -37.619 1.00 50.65  ? 231 TRP B CB    1 
ATOM   4787 C  CG    . TRP B 1 125 ? -6.625  -12.988 -36.638 1.00 52.48  ? 231 TRP B CG    1 
ATOM   4788 C  CD1   . TRP B 1 125 ? -7.004  -14.312 -36.612 1.00 54.07  ? 231 TRP B CD1   1 
ATOM   4789 C  CD2   . TRP B 1 125 ? -5.720  -12.817 -35.586 1.00 52.96  ? 231 TRP B CD2   1 
ATOM   4790 N  NE1   . TRP B 1 125 ? -6.402  -14.973 -35.571 1.00 56.32  ? 231 TRP B NE1   1 
ATOM   4791 C  CE2   . TRP B 1 125 ? -5.601  -14.071 -34.924 1.00 56.72  ? 231 TRP B CE2   1 
ATOM   4792 C  CE3   . TRP B 1 125 ? -5.009  -11.731 -35.121 1.00 52.60  ? 231 TRP B CE3   1 
ATOM   4793 C  CZ2   . TRP B 1 125 ? -4.798  -14.251 -33.817 1.00 58.68  ? 231 TRP B CZ2   1 
ATOM   4794 C  CZ3   . TRP B 1 125 ? -4.209  -11.886 -34.043 1.00 58.82  ? 231 TRP B CZ3   1 
ATOM   4795 C  CH2   . TRP B 1 125 ? -4.102  -13.146 -33.373 1.00 63.04  ? 231 TRP B CH2   1 
ATOM   4796 N  N     . THR B 1 126 ? -8.801  -11.320 -34.948 1.00 44.14  ? 232 THR B N     1 
ATOM   4797 C  CA    . THR B 1 126 ? -8.729  -10.768 -33.596 1.00 42.61  ? 232 THR B CA    1 
ATOM   4798 C  C     . THR B 1 126 ? -8.152  -11.808 -32.640 1.00 40.33  ? 232 THR B C     1 
ATOM   4799 O  O     . THR B 1 126 ? -8.374  -13.039 -32.854 1.00 36.79  ? 232 THR B O     1 
ATOM   4800 C  CB    . THR B 1 126 ? -10.124 -10.452 -33.013 1.00 42.81  ? 232 THR B CB    1 
ATOM   4801 O  OG1   . THR B 1 126 ? -10.961 -11.602 -33.177 1.00 46.80  ? 232 THR B OG1   1 
ATOM   4802 C  CG2   . THR B 1 126 ? -10.794 -9.243  -33.688 1.00 42.90  ? 232 THR B CG2   1 
ATOM   4803 N  N     . HIS B 1 127 ? -7.509  -11.317 -31.546 1.00 36.85  ? 233 HIS B N     1 
ATOM   4804 C  CA    . HIS B 1 127 ? -6.989  -12.246 -30.536 1.00 35.92  ? 233 HIS B CA    1 
ATOM   4805 C  C     . HIS B 1 127 ? -8.117  -13.189 -30.023 1.00 33.00  ? 233 HIS B C     1 
ATOM   4806 O  O     . HIS B 1 127 ? -7.866  -14.396 -29.796 1.00 30.91  ? 233 HIS B O     1 
ATOM   4807 C  CB    . HIS B 1 127 ? -6.127  -11.587 -29.438 1.00 35.16  ? 233 HIS B CB    1 
ATOM   4808 C  CG    . HIS B 1 127 ? -6.929  -10.954 -28.368 1.00 37.51  ? 233 HIS B CG    1 
ATOM   4809 N  ND1   . HIS B 1 127 ? -7.293  -9.625  -28.418 1.00 40.67  ? 233 HIS B ND1   1 
ATOM   4810 C  CD2   . HIS B 1 127 ? -7.486  -11.463 -27.239 1.00 37.90  ? 233 HIS B CD2   1 
ATOM   4811 C  CE1   . HIS B 1 127 ? -8.038  -9.344  -27.360 1.00 40.61  ? 233 HIS B CE1   1 
ATOM   4812 N  NE2   . HIS B 1 127 ? -8.157  -10.437 -26.625 1.00 41.58  ? 233 HIS B NE2   1 
ATOM   4813 N  N     . GLU B 1 128 ? -9.358  -12.685 -29.960 1.00 32.36  ? 234 GLU B N     1 
ATOM   4814 C  CA    . GLU B 1 128 ? -10.490 -13.517 -29.487 1.00 35.11  ? 234 GLU B CA    1 
ATOM   4815 C  C     . GLU B 1 128 ? -10.723 -14.746 -30.379 1.00 38.44  ? 234 GLU B C     1 
ATOM   4816 O  O     . GLU B 1 128 ? -10.894 -15.892 -29.883 1.00 36.67  ? 234 GLU B O     1 
ATOM   4817 C  CB    . GLU B 1 128 ? -11.789 -12.711 -29.345 1.00 36.02  ? 234 GLU B CB    1 
ATOM   4818 C  CG    . GLU B 1 128 ? -11.760 -11.597 -28.309 1.00 40.01  ? 234 GLU B CG    1 
ATOM   4819 C  CD    . GLU B 1 128 ? -11.209 -10.242 -28.777 1.00 42.69  ? 234 GLU B CD    1 
ATOM   4820 O  OE1   . GLU B 1 128 ? -10.530 -10.203 -29.832 1.00 44.29  ? 234 GLU B OE1   1 
ATOM   4821 O  OE2   . GLU B 1 128 ? -11.466 -9.203  -28.049 1.00 43.13  ? 234 GLU B OE2   1 
ATOM   4822 N  N     . GLN B 1 129 ? -10.674 -14.538 -31.699 1.00 39.59  ? 235 GLN B N     1 
ATOM   4823 C  CA    . GLN B 1 129 ? -10.814 -15.688 -32.606 1.00 43.74  ? 235 GLN B CA    1 
ATOM   4824 C  C     . GLN B 1 129 ? -9.646  -16.634 -32.468 1.00 39.96  ? 235 GLN B C     1 
ATOM   4825 O  O     . GLN B 1 129 ? -9.833  -17.835 -32.478 1.00 40.27  ? 235 GLN B O     1 
ATOM   4826 C  CB    . GLN B 1 129 ? -10.922 -15.274 -34.070 1.00 49.14  ? 235 GLN B CB    1 
ATOM   4827 C  CG    . GLN B 1 129 ? -12.086 -14.363 -34.407 1.00 54.10  ? 235 GLN B CG    1 
ATOM   4828 C  CD    . GLN B 1 129 ? -11.807 -13.596 -35.707 1.00 62.67  ? 235 GLN B CD    1 
ATOM   4829 O  OE1   . GLN B 1 129 ? -11.994 -12.380 -35.771 1.00 68.82  ? 235 GLN B OE1   1 
ATOM   4830 N  NE2   . GLN B 1 129 ? -11.298 -14.311 -36.740 1.00 62.17  ? 235 GLN B NE2   1 
ATOM   4831 N  N     . GLY B 1 130 ? -8.434  -16.102 -32.330 1.00 38.23  ? 236 GLY B N     1 
ATOM   4832 C  CA    . GLY B 1 130 ? -7.293  -16.937 -31.880 1.00 37.56  ? 236 GLY B CA    1 
ATOM   4833 C  C     . GLY B 1 130 ? -7.564  -17.797 -30.639 1.00 35.71  ? 236 GLY B C     1 
ATOM   4834 O  O     . GLY B 1 130 ? -7.176  -18.945 -30.611 1.00 32.56  ? 236 GLY B O     1 
ATOM   4835 N  N     . SER B 1 131 ? -8.255  -17.230 -29.651 1.00 36.06  ? 237 SER B N     1 
ATOM   4836 C  CA    . SER B 1 131 ? -8.492  -17.910 -28.381 1.00 39.91  ? 237 SER B CA    1 
ATOM   4837 C  C     . SER B 1 131 ? -9.399  -19.097 -28.637 1.00 42.20  ? 237 SER B C     1 
ATOM   4838 O  O     . SER B 1 131 ? -9.222  -20.163 -28.028 1.00 44.12  ? 237 SER B O     1 
ATOM   4839 C  CB    . SER B 1 131 ? -9.125  -16.962 -27.282 1.00 38.00  ? 237 SER B CB    1 
ATOM   4840 O  OG    . SER B 1 131 ? -8.315  -15.795 -27.045 1.00 37.11  ? 237 SER B OG    1 
ATOM   4841 N  N     . VAL B 1 132 ? -10.392 -18.917 -29.501 1.00 42.13  ? 238 VAL B N     1 
ATOM   4842 C  CA    . VAL B 1 132 ? -11.324 -20.021 -29.829 1.00 42.16  ? 238 VAL B CA    1 
ATOM   4843 C  C     . VAL B 1 132 ? -10.592 -21.200 -30.495 1.00 41.47  ? 238 VAL B C     1 
ATOM   4844 O  O     . VAL B 1 132 ? -10.808 -22.362 -30.148 1.00 38.65  ? 238 VAL B O     1 
ATOM   4845 C  CB    . VAL B 1 132 ? -12.452 -19.496 -30.708 1.00 43.15  ? 238 VAL B CB    1 
ATOM   4846 C  CG1   . VAL B 1 132 ? -13.250 -20.621 -31.232 1.00 44.96  ? 238 VAL B CG1   1 
ATOM   4847 C  CG2   . VAL B 1 132 ? -13.387 -18.666 -29.847 1.00 44.21  ? 238 VAL B CG2   1 
ATOM   4848 N  N     . MET B 1 133 ? -9.710  -20.886 -31.437 1.00 44.11  ? 239 MET B N     1 
ATOM   4849 C  CA    . MET B 1 133 ? -8.939  -21.913 -32.131 1.00 46.30  ? 239 MET B CA    1 
ATOM   4850 C  C     . MET B 1 133 ? -7.877  -22.615 -31.265 1.00 46.68  ? 239 MET B C     1 
ATOM   4851 O  O     . MET B 1 133 ? -7.686  -23.824 -31.329 1.00 43.06  ? 239 MET B O     1 
ATOM   4852 C  CB    . MET B 1 133 ? -8.280  -21.304 -33.359 1.00 50.24  ? 239 MET B CB    1 
ATOM   4853 C  CG    . MET B 1 133 ? -9.272  -20.961 -34.471 1.00 52.09  ? 239 MET B CG    1 
ATOM   4854 S  SD    . MET B 1 133 ? -8.444  -20.135 -35.863 1.00 61.00  ? 239 MET B SD    1 
ATOM   4855 C  CE    . MET B 1 133 ? -7.310  -18.800 -35.316 1.00 54.21  ? 239 MET B CE    1 
ATOM   4856 N  N     . MET B 1 134 ? -7.170  -21.821 -30.489 1.00 46.04  ? 240 MET B N     1 
ATOM   4857 C  CA    . MET B 1 134 ? -6.181  -22.329 -29.585 1.00 43.80  ? 240 MET B CA    1 
ATOM   4858 C  C     . MET B 1 134 ? -6.833  -23.171 -28.459 1.00 39.59  ? 240 MET B C     1 
ATOM   4859 O  O     . MET B 1 134 ? -6.273  -24.144 -28.043 1.00 37.48  ? 240 MET B O     1 
ATOM   4860 C  CB    . MET B 1 134 ? -5.408  -21.131 -29.036 1.00 46.44  ? 240 MET B CB    1 
ATOM   4861 C  CG    . MET B 1 134 ? -4.227  -21.522 -28.192 1.00 48.36  ? 240 MET B CG    1 
ATOM   4862 S  SD    . MET B 1 134 ? -2.988  -22.536 -29.037 1.00 51.45  ? 240 MET B SD    1 
ATOM   4863 C  CE    . MET B 1 134 ? -1.842  -21.261 -29.529 1.00 50.21  ? 240 MET B CE    1 
ATOM   4864 N  N     . PHE B 1 135 ? -8.026  -22.805 -28.015 1.00 38.39  ? 241 PHE B N     1 
ATOM   4865 C  CA    . PHE B 1 135 ? -8.799  -23.625 -27.068 1.00 40.36  ? 241 PHE B CA    1 
ATOM   4866 C  C     . PHE B 1 135 ? -9.061  -25.012 -27.602 1.00 41.52  ? 241 PHE B C     1 
ATOM   4867 O  O     . PHE B 1 135 ? -8.852  -26.001 -26.888 1.00 39.54  ? 241 PHE B O     1 
ATOM   4868 C  CB    . PHE B 1 135 ? -10.153 -22.960 -26.715 1.00 40.27  ? 241 PHE B CB    1 
ATOM   4869 C  CG    . PHE B 1 135 ? -11.002 -23.727 -25.694 1.00 39.20  ? 241 PHE B CG    1 
ATOM   4870 C  CD1   . PHE B 1 135 ? -10.517 -24.032 -24.436 1.00 41.31  ? 241 PHE B CD1   1 
ATOM   4871 C  CD2   . PHE B 1 135 ? -12.305 -24.090 -25.979 1.00 38.51  ? 241 PHE B CD2   1 
ATOM   4872 C  CE1   . PHE B 1 135 ? -11.304 -24.744 -23.500 1.00 39.10  ? 241 PHE B CE1   1 
ATOM   4873 C  CE2   . PHE B 1 135 ? -13.080 -24.777 -25.071 1.00 39.20  ? 241 PHE B CE2   1 
ATOM   4874 C  CZ    . PHE B 1 135 ? -12.578 -25.112 -23.816 1.00 38.14  ? 241 PHE B CZ    1 
ATOM   4875 N  N     . GLU B 1 136 ? -9.562  -25.051 -28.833 1.00 41.94  ? 242 GLU B N     1 
ATOM   4876 C  CA    . GLU B 1 136 ? -9.763  -26.273 -29.575 1.00 44.91  ? 242 GLU B CA    1 
ATOM   4877 C  C     . GLU B 1 136 ? -8.471  -27.113 -29.660 1.00 39.43  ? 242 GLU B C     1 
ATOM   4878 O  O     . GLU B 1 136 ? -8.465  -28.264 -29.352 1.00 40.62  ? 242 GLU B O     1 
ATOM   4879 C  CB    . GLU B 1 136 ? -10.295 -25.896 -31.004 1.00 54.04  ? 242 GLU B CB    1 
ATOM   4880 C  CG    . GLU B 1 136 ? -10.652 -27.061 -31.933 1.00 61.30  ? 242 GLU B CG    1 
ATOM   4881 C  CD    . GLU B 1 136 ? -11.847 -27.920 -31.413 1.00 69.69  ? 242 GLU B CD    1 
ATOM   4882 O  OE1   . GLU B 1 136 ? -12.766 -27.313 -30.779 1.00 69.14  ? 242 GLU B OE1   1 
ATOM   4883 O  OE2   . GLU B 1 136 ? -11.931 -29.186 -31.671 1.00 74.21  ? 242 GLU B OE2   1 
ATOM   4884 N  N     . HIS B 1 137 ? -7.375  -26.524 -30.073 1.00 35.92  ? 243 HIS B N     1 
ATOM   4885 C  CA    . HIS B 1 137 ? -6.155  -27.253 -30.235 1.00 36.95  ? 243 HIS B CA    1 
ATOM   4886 C  C     . HIS B 1 137 ? -5.713  -27.853 -28.894 1.00 37.90  ? 243 HIS B C     1 
ATOM   4887 O  O     . HIS B 1 137 ? -5.266  -29.017 -28.807 1.00 36.08  ? 243 HIS B O     1 
ATOM   4888 C  CB    . HIS B 1 137 ? -5.129  -26.322 -30.880 1.00 37.16  ? 243 HIS B CB    1 
ATOM   4889 C  CG    . HIS B 1 137 ? -3.746  -26.876 -30.962 1.00 40.98  ? 243 HIS B CG    1 
ATOM   4890 N  ND1   . HIS B 1 137 ? -3.425  -28.048 -31.599 1.00 43.24  ? 243 HIS B ND1   1 
ATOM   4891 C  CD2   . HIS B 1 137 ? -2.561  -26.365 -30.536 1.00 44.05  ? 243 HIS B CD2   1 
ATOM   4892 C  CE1   . HIS B 1 137 ? -2.113  -28.245 -31.540 1.00 43.46  ? 243 HIS B CE1   1 
ATOM   4893 N  NE2   . HIS B 1 137 ? -1.562  -27.241 -30.889 1.00 40.82  ? 243 HIS B NE2   1 
ATOM   4894 N  N     . LEU B 1 138 ? -5.870  -27.061 -27.849 1.00 38.81  ? 244 LEU B N     1 
ATOM   4895 C  CA    . LEU B 1 138 ? -5.500  -27.479 -26.505 1.00 41.58  ? 244 LEU B CA    1 
ATOM   4896 C  C     . LEU B 1 138 ? -6.323  -28.704 -26.038 1.00 41.58  ? 244 LEU B C     1 
ATOM   4897 O  O     . LEU B 1 138 ? -5.754  -29.645 -25.520 1.00 39.54  ? 244 LEU B O     1 
ATOM   4898 C  CB    . LEU B 1 138 ? -5.635  -26.289 -25.526 1.00 41.49  ? 244 LEU B CB    1 
ATOM   4899 C  CG    . LEU B 1 138 ? -5.321  -26.498 -24.004 1.00 42.81  ? 244 LEU B CG    1 
ATOM   4900 C  CD1   . LEU B 1 138 ? -5.183  -25.161 -23.245 1.00 41.10  ? 244 LEU B CD1   1 
ATOM   4901 C  CD2   . LEU B 1 138 ? -6.292  -27.412 -23.242 1.00 43.11  ? 244 LEU B CD2   1 
ATOM   4902 N  N     . ILE B 1 139 ? -7.649  -28.638 -26.209 1.00 43.19  ? 245 ILE B N     1 
ATOM   4903 C  CA    . ILE B 1 139 ? -8.550  -29.746 -25.899 1.00 46.90  ? 245 ILE B CA    1 
ATOM   4904 C  C     . ILE B 1 139 ? -8.138  -31.011 -26.663 1.00 49.19  ? 245 ILE B C     1 
ATOM   4905 O  O     . ILE B 1 139 ? -7.893  -32.029 -26.057 1.00 46.62  ? 245 ILE B O     1 
ATOM   4906 C  CB    . ILE B 1 139 ? -10.023 -29.492 -26.342 1.00 49.60  ? 245 ILE B CB    1 
ATOM   4907 C  CG1   . ILE B 1 139 ? -10.642 -28.310 -25.624 1.00 51.36  ? 245 ILE B CG1   1 
ATOM   4908 C  CG2   . ILE B 1 139 ? -10.873 -30.749 -26.076 1.00 51.21  ? 245 ILE B CG2   1 
ATOM   4909 C  CD1   . ILE B 1 139 ? -10.445 -28.318 -24.126 1.00 51.17  ? 245 ILE B CD1   1 
ATOM   4910 N  N     . ASN B 1 140 ? -8.072  -30.901 -28.005 1.00 49.37  ? 246 ASN B N     1 
ATOM   4911 C  CA    . ASN B 1 140 ? -7.804  -32.027 -28.877 1.00 50.02  ? 246 ASN B CA    1 
ATOM   4912 C  C     . ASN B 1 140 ? -6.433  -32.579 -28.690 1.00 51.87  ? 246 ASN B C     1 
ATOM   4913 O  O     . ASN B 1 140 ? -6.298  -33.754 -28.651 1.00 58.40  ? 246 ASN B O     1 
ATOM   4914 C  CB    . ASN B 1 140 ? -7.990  -31.653 -30.341 1.00 50.97  ? 246 ASN B CB    1 
ATOM   4915 C  CG    . ASN B 1 140 ? -9.446  -31.250 -30.666 1.00 50.63  ? 246 ASN B CG    1 
ATOM   4916 O  OD1   . ASN B 1 140 ? -10.396 -31.719 -30.058 1.00 51.31  ? 246 ASN B OD1   1 
ATOM   4917 N  ND2   . ASN B 1 140 ? -9.609  -30.361 -31.622 1.00 53.54  ? 246 ASN B ND2   1 
ATOM   4918 N  N     . SER B 1 141 ? -5.398  -31.762 -28.530 1.00 52.13  ? 247 SER B N     1 
ATOM   4919 C  CA    . SER B 1 141 ? -4.047  -32.314 -28.452 1.00 48.53  ? 247 SER B CA    1 
ATOM   4920 C  C     . SER B 1 141 ? -3.633  -32.788 -27.017 1.00 49.88  ? 247 SER B C     1 
ATOM   4921 O  O     . SER B 1 141 ? -2.550  -33.353 -26.825 1.00 52.52  ? 247 SER B O     1 
ATOM   4922 C  CB    . SER B 1 141 ? -3.075  -31.358 -29.103 1.00 48.30  ? 247 SER B CB    1 
ATOM   4923 O  OG    . SER B 1 141 ? -2.732  -30.340 -28.246 1.00 53.49  ? 247 SER B OG    1 
ATOM   4924 N  N     . ASN B 1 142 ? -4.486  -32.627 -26.019 1.00 44.20  ? 248 ASN B N     1 
ATOM   4925 C  CA    . ASN B 1 142 ? -4.123  -33.058 -24.655 1.00 43.42  ? 248 ASN B CA    1 
ATOM   4926 C  C     . ASN B 1 142 ? -5.159  -34.023 -24.005 1.00 43.53  ? 248 ASN B C     1 
ATOM   4927 O  O     . ASN B 1 142 ? -5.124  -34.229 -22.804 1.00 41.33  ? 248 ASN B O     1 
ATOM   4928 C  CB    . ASN B 1 142 ? -3.880  -31.821 -23.747 1.00 40.11  ? 248 ASN B CB    1 
ATOM   4929 C  CG    . ASN B 1 142 ? -2.730  -30.968 -24.213 1.00 39.68  ? 248 ASN B CG    1 
ATOM   4930 O  OD1   . ASN B 1 142 ? -1.599  -31.225 -23.858 1.00 39.24  ? 248 ASN B OD1   1 
ATOM   4931 N  ND2   . ASN B 1 142 ? -3.008  -29.949 -25.019 1.00 42.22  ? 248 ASN B ND2   1 
ATOM   4932 N  N     . GLY B 1 143 ? -6.073  -34.603 -24.779 1.00 42.38  ? 249 GLY B N     1 
ATOM   4933 C  CA    . GLY B 1 143 ? -7.081  -35.492 -24.203 1.00 45.19  ? 249 GLY B CA    1 
ATOM   4934 C  C     . GLY B 1 143 ? -8.067  -34.933 -23.180 1.00 46.24  ? 249 GLY B C     1 
ATOM   4935 O  O     . GLY B 1 143 ? -8.603  -35.657 -22.355 1.00 52.12  ? 249 GLY B O     1 
ATOM   4936 N  N     . ILE B 1 144 ? -8.359  -33.662 -23.239 1.00 47.30  ? 250 ILE B N     1 
ATOM   4937 C  CA    . ILE B 1 144 ? -9.167  -33.040 -22.171 1.00 47.33  ? 250 ILE B CA    1 
ATOM   4938 C  C     . ILE B 1 144 ? -10.628 -33.545 -22.159 1.00 47.78  ? 250 ILE B C     1 
ATOM   4939 O  O     . ILE B 1 144 ? -11.216 -33.647 -21.098 1.00 44.26  ? 250 ILE B O     1 
ATOM   4940 C  CB    . ILE B 1 144 ? -9.088  -31.467 -22.301 1.00 48.11  ? 250 ILE B CB    1 
ATOM   4941 C  CG1   . ILE B 1 144 ? -7.627  -30.989 -22.244 1.00 48.14  ? 250 ILE B CG1   1 
ATOM   4942 C  CG2   . ILE B 1 144 ? -9.984  -30.747 -21.273 1.00 47.96  ? 250 ILE B CG2   1 
ATOM   4943 C  CD1   . ILE B 1 144 ? -6.848  -31.527 -21.053 1.00 49.02  ? 250 ILE B CD1   1 
ATOM   4944 N  N     . LYS B 1 145 ? -11.208 -33.858 -23.327 1.00 50.74  ? 251 LYS B N     1 
ATOM   4945 C  CA    . LYS B 1 145 ? -12.670 -34.208 -23.439 1.00 49.93  ? 251 LYS B CA    1 
ATOM   4946 C  C     . LYS B 1 145 ? -13.171 -35.305 -22.446 1.00 50.15  ? 251 LYS B C     1 
ATOM   4947 O  O     . LYS B 1 145 ? -14.213 -35.193 -21.861 1.00 48.64  ? 251 LYS B O     1 
ATOM   4948 C  CB    . LYS B 1 145 ? -13.004 -34.545 -24.904 1.00 47.50  ? 251 LYS B CB    1 
ATOM   4949 N  N     . PRO B 1 146 ? -12.397 -36.358 -22.238 1.00 50.26  ? 252 PRO B N     1 
ATOM   4950 C  CA    . PRO B 1 146 ? -12.751 -37.357 -21.238 1.00 52.66  ? 252 PRO B CA    1 
ATOM   4951 C  C     . PRO B 1 146 ? -12.819 -36.882 -19.781 1.00 56.09  ? 252 PRO B C     1 
ATOM   4952 O  O     . PRO B 1 146 ? -13.692 -37.301 -18.963 1.00 56.10  ? 252 PRO B O     1 
ATOM   4953 C  CB    . PRO B 1 146 ? -11.589 -38.367 -21.343 1.00 52.63  ? 252 PRO B CB    1 
ATOM   4954 C  CG    . PRO B 1 146 ? -11.179 -38.305 -22.749 1.00 51.81  ? 252 PRO B CG    1 
ATOM   4955 C  CD    . PRO B 1 146 ? -11.474 -36.904 -23.243 1.00 52.05  ? 252 PRO B CD    1 
ATOM   4956 N  N     . VAL B 1 147 ? -11.852 -36.030 -19.465 1.00 56.25  ? 253 VAL B N     1 
ATOM   4957 C  CA    . VAL B 1 147 ? -11.747 -35.416 -18.166 1.00 54.28  ? 253 VAL B CA    1 
ATOM   4958 C  C     . VAL B 1 147 ? -12.965 -34.509 -17.899 1.00 53.32  ? 253 VAL B C     1 
ATOM   4959 O  O     . VAL B 1 147 ? -13.479 -34.448 -16.771 1.00 57.27  ? 253 VAL B O     1 
ATOM   4960 C  CB    . VAL B 1 147 ? -10.435 -34.591 -18.072 1.00 56.34  ? 253 VAL B CB    1 
ATOM   4961 C  CG1   . VAL B 1 147 ? -10.156 -34.234 -16.653 1.00 56.92  ? 253 VAL B CG1   1 
ATOM   4962 C  CG2   . VAL B 1 147 ? -9.218  -35.336 -18.603 1.00 55.40  ? 253 VAL B CG2   1 
ATOM   4963 N  N     . MET B 1 148 ? -13.424 -33.798 -18.927 1.00 49.50  ? 254 MET B N     1 
ATOM   4964 C  CA    . MET B 1 148 ? -14.599 -32.979 -18.805 1.00 49.59  ? 254 MET B CA    1 
ATOM   4965 C  C     . MET B 1 148 ? -15.759 -33.837 -18.373 1.00 50.17  ? 254 MET B C     1 
ATOM   4966 O  O     . MET B 1 148 ? -16.477 -33.497 -17.446 1.00 50.44  ? 254 MET B O     1 
ATOM   4967 C  CB    . MET B 1 148 ? -14.909 -32.282 -20.145 1.00 49.63  ? 254 MET B CB    1 
ATOM   4968 C  CG    . MET B 1 148 ? -13.989 -31.128 -20.486 1.00 49.09  ? 254 MET B CG    1 
ATOM   4969 S  SD    . MET B 1 148 ? -14.115 -30.427 -22.157 1.00 50.29  ? 254 MET B SD    1 
ATOM   4970 C  CE    . MET B 1 148 ? -15.321 -29.125 -21.976 1.00 51.41  ? 254 MET B CE    1 
ATOM   4971 N  N     . GLU B 1 149 ? -15.917 -34.974 -19.031 1.00 53.38  ? 255 GLU B N     1 
ATOM   4972 C  CA    . GLU B 1 149 ? -17.057 -35.845 -18.775 1.00 55.57  ? 255 GLU B CA    1 
ATOM   4973 C  C     . GLU B 1 149 ? -16.927 -36.434 -17.431 1.00 53.37  ? 255 GLU B C     1 
ATOM   4974 O  O     . GLU B 1 149 ? -17.913 -36.556 -16.724 1.00 54.03  ? 255 GLU B O     1 
ATOM   4975 C  CB    . GLU B 1 149 ? -17.146 -36.968 -19.795 1.00 57.92  ? 255 GLU B CB    1 
ATOM   4976 C  CG    . GLU B 1 149 ? -17.549 -36.518 -21.188 1.00 62.55  ? 255 GLU B CG    1 
ATOM   4977 C  CD    . GLU B 1 149 ? -17.387 -37.641 -22.203 1.00 66.00  ? 255 GLU B CD    1 
ATOM   4978 O  OE1   . GLU B 1 149 ? -17.558 -37.414 -23.426 1.00 68.19  ? 255 GLU B OE1   1 
ATOM   4979 O  OE2   . GLU B 1 149 ? -17.082 -38.762 -21.759 1.00 65.27  ? 255 GLU B OE2   1 
ATOM   4980 N  N     . GLN B 1 150 ? -15.699 -36.754 -17.070 1.00 51.80  ? 256 GLN B N     1 
ATOM   4981 C  CA    . GLN B 1 150 ? -15.408 -37.280 -15.748 1.00 54.28  ? 256 GLN B CA    1 
ATOM   4982 C  C     . GLN B 1 150 ? -15.873 -36.343 -14.620 1.00 52.22  ? 256 GLN B C     1 
ATOM   4983 O  O     . GLN B 1 150 ? -16.169 -36.815 -13.562 1.00 58.41  ? 256 GLN B O     1 
ATOM   4984 C  CB    . GLN B 1 150 ? -13.908 -37.668 -15.664 1.00 55.23  ? 256 GLN B CB    1 
ATOM   4985 C  CG    . GLN B 1 150 ? -13.362 -37.871 -14.271 1.00 57.54  ? 256 GLN B CG    1 
ATOM   4986 C  CD    . GLN B 1 150 ? -11.892 -38.194 -14.233 1.00 61.12  ? 256 GLN B CD    1 
ATOM   4987 O  OE1   . GLN B 1 150 ? -11.272 -38.429 -15.275 1.00 69.65  ? 256 GLN B OE1   1 
ATOM   4988 N  NE2   . GLN B 1 150 ? -11.324 -38.217 -13.026 1.00 58.27  ? 256 GLN B NE2   1 
ATOM   4989 N  N     . TYR B 1 151 ? -15.963 -35.035 -14.848 1.00 51.75  ? 257 TYR B N     1 
ATOM   4990 C  CA    . TYR B 1 151 ? -16.588 -34.123 -13.873 1.00 48.88  ? 257 TYR B CA    1 
ATOM   4991 C  C     . TYR B 1 151 ? -17.983 -33.633 -14.251 1.00 51.04  ? 257 TYR B C     1 
ATOM   4992 O  O     . TYR B 1 151 ? -18.385 -32.568 -13.797 1.00 47.52  ? 257 TYR B O     1 
ATOM   4993 C  CB    . TYR B 1 151 ? -15.663 -32.927 -13.605 1.00 48.33  ? 257 TYR B CB    1 
ATOM   4994 C  CG    . TYR B 1 151 ? -14.382 -33.389 -12.963 1.00 46.49  ? 257 TYR B CG    1 
ATOM   4995 C  CD1   . TYR B 1 151 ? -14.346 -33.706 -11.619 1.00 46.04  ? 257 TYR B CD1   1 
ATOM   4996 C  CD2   . TYR B 1 151 ? -13.226 -33.560 -13.712 1.00 45.64  ? 257 TYR B CD2   1 
ATOM   4997 C  CE1   . TYR B 1 151 ? -13.175 -34.193 -11.027 1.00 47.51  ? 257 TYR B CE1   1 
ATOM   4998 C  CE2   . TYR B 1 151 ? -12.066 -34.034 -13.151 1.00 45.08  ? 257 TYR B CE2   1 
ATOM   4999 C  CZ    . TYR B 1 151 ? -12.039 -34.351 -11.800 1.00 47.81  ? 257 TYR B CZ    1 
ATOM   5000 O  OH    . TYR B 1 151 ? -10.916 -34.809 -11.187 1.00 47.70  ? 257 TYR B OH    1 
ATOM   5001 N  N     . GLY B 1 152 ? -18.705 -34.376 -15.105 1.00 52.66  ? 258 GLY B N     1 
ATOM   5002 C  CA    . GLY B 1 152 ? -20.098 -34.068 -15.378 1.00 51.11  ? 258 GLY B CA    1 
ATOM   5003 C  C     . GLY B 1 152 ? -20.356 -33.071 -16.460 1.00 54.04  ? 258 GLY B C     1 
ATOM   5004 O  O     . GLY B 1 152 ? -21.480 -32.667 -16.642 1.00 56.28  ? 258 GLY B O     1 
ATOM   5005 N  N     . LEU B 1 153 ? -19.337 -32.691 -17.218 1.00 53.86  ? 259 LEU B N     1 
ATOM   5006 C  CA    . LEU B 1 153 ? -19.567 -31.803 -18.353 1.00 57.69  ? 259 LEU B CA    1 
ATOM   5007 C  C     . LEU B 1 153 ? -19.944 -32.638 -19.575 1.00 57.95  ? 259 LEU B C     1 
ATOM   5008 O  O     . LEU B 1 153 ? -19.507 -33.779 -19.701 1.00 55.65  ? 259 LEU B O     1 
ATOM   5009 C  CB    . LEU B 1 153 ? -18.310 -30.944 -18.682 1.00 57.81  ? 259 LEU B CB    1 
ATOM   5010 C  CG    . LEU B 1 153 ? -18.190 -29.525 -18.115 1.00 56.71  ? 259 LEU B CG    1 
ATOM   5011 C  CD1   . LEU B 1 153 ? -18.208 -29.594 -16.618 1.00 56.65  ? 259 LEU B CD1   1 
ATOM   5012 C  CD2   . LEU B 1 153 ? -16.920 -28.869 -18.541 1.00 55.38  ? 259 LEU B CD2   1 
ATOM   5013 N  N     . ILE B 1 154 ? -20.669 -32.021 -20.510 1.00 57.68  ? 260 ILE B N     1 
ATOM   5014 C  CA    . ILE B 1 154 ? -21.079 -32.658 -21.762 1.00 53.59  ? 260 ILE B CA    1 
ATOM   5015 C  C     . ILE B 1 154 ? -20.457 -31.910 -22.891 1.00 51.56  ? 260 ILE B C     1 
ATOM   5016 O  O     . ILE B 1 154 ? -21.004 -30.892 -23.302 1.00 54.21  ? 260 ILE B O     1 
ATOM   5017 C  CB    . ILE B 1 154 ? -22.606 -32.653 -21.915 1.00 55.51  ? 260 ILE B CB    1 
ATOM   5018 C  CG1   . ILE B 1 154 ? -23.230 -33.458 -20.771 1.00 57.26  ? 260 ILE B CG1   1 
ATOM   5019 C  CG2   . ILE B 1 154 ? -23.032 -33.289 -23.240 1.00 53.85  ? 260 ILE B CG2   1 
ATOM   5020 C  CD1   . ILE B 1 154 ? -24.574 -32.944 -20.354 1.00 57.21  ? 260 ILE B CD1   1 
ATOM   5021 N  N     . PRO B 1 155 ? -19.351 -32.434 -23.449 1.00 48.47  ? 261 PRO B N     1 
ATOM   5022 C  CA    . PRO B 1 155 ? -18.628 -31.688 -24.456 1.00 48.64  ? 261 PRO B CA    1 
ATOM   5023 C  C     . PRO B 1 155 ? -19.351 -31.191 -25.731 1.00 53.52  ? 261 PRO B C     1 
ATOM   5024 O  O     . PRO B 1 155 ? -19.059 -30.067 -26.108 1.00 58.02  ? 261 PRO B O     1 
ATOM   5025 C  CB    . PRO B 1 155 ? -17.457 -32.569 -24.761 1.00 46.65  ? 261 PRO B CB    1 
ATOM   5026 C  CG    . PRO B 1 155 ? -17.228 -33.337 -23.559 1.00 46.13  ? 261 PRO B CG    1 
ATOM   5027 C  CD    . PRO B 1 155 ? -18.584 -33.584 -22.984 1.00 47.12  ? 261 PRO B CD    1 
ATOM   5028 N  N     . GLU B 1 156 ? -20.241 -31.946 -26.395 1.00 55.89  ? 262 GLU B N     1 
ATOM   5029 C  CA    . GLU B 1 156 ? -20.922 -31.376 -27.578 1.00 57.46  ? 262 GLU B CA    1 
ATOM   5030 C  C     . GLU B 1 156 ? -21.417 -29.967 -27.190 1.00 58.34  ? 262 GLU B C     1 
ATOM   5031 O  O     . GLU B 1 156 ? -20.967 -28.986 -27.793 1.00 67.73  ? 262 GLU B O     1 
ATOM   5032 C  CB    . GLU B 1 156 ? -22.045 -32.251 -28.192 1.00 53.88  ? 262 GLU B CB    1 
ATOM   5033 N  N     . GLU B 1 157 ? -22.222 -29.862 -26.125 1.00 54.96  ? 263 GLU B N     1 
ATOM   5034 C  CA    . GLU B 1 157 ? -22.818 -28.592 -25.667 1.00 53.39  ? 263 GLU B CA    1 
ATOM   5035 C  C     . GLU B 1 157 ? -21.887 -27.570 -25.033 1.00 51.26  ? 263 GLU B C     1 
ATOM   5036 O  O     . GLU B 1 157 ? -21.946 -26.373 -25.344 1.00 48.46  ? 263 GLU B O     1 
ATOM   5037 C  CB    . GLU B 1 157 ? -23.888 -28.867 -24.631 1.00 54.25  ? 263 GLU B CB    1 
ATOM   5038 C  CG    . GLU B 1 157 ? -25.186 -29.297 -25.265 1.00 58.33  ? 263 GLU B CG    1 
ATOM   5039 C  CD    . GLU B 1 157 ? -26.170 -29.971 -24.310 1.00 62.41  ? 263 GLU B CD    1 
ATOM   5040 O  OE1   . GLU B 1 157 ? -26.175 -29.735 -23.082 1.00 64.13  ? 263 GLU B OE1   1 
ATOM   5041 O  OE2   . GLU B 1 157 ? -26.991 -30.748 -24.831 1.00 64.49  ? 263 GLU B OE2   1 
ATOM   5042 N  N     . ASP B 1 158 ? -21.081 -28.058 -24.090 1.00 49.55  ? 264 ASP B N     1 
ATOM   5043 C  CA    . ASP B 1 158 ? -20.273 -27.210 -23.199 1.00 47.24  ? 264 ASP B CA    1 
ATOM   5044 C  C     . ASP B 1 158 ? -19.071 -26.506 -23.886 1.00 51.04  ? 264 ASP B C     1 
ATOM   5045 O  O     . ASP B 1 158 ? -18.752 -25.356 -23.567 1.00 50.61  ? 264 ASP B O     1 
ATOM   5046 C  CB    . ASP B 1 158 ? -19.839 -28.001 -21.959 1.00 44.69  ? 264 ASP B CB    1 
ATOM   5047 C  CG    . ASP B 1 158 ? -20.992 -28.246 -20.988 1.00 42.24  ? 264 ASP B CG    1 
ATOM   5048 O  OD1   . ASP B 1 158 ? -22.036 -27.558 -21.043 1.00 41.41  ? 264 ASP B OD1   1 
ATOM   5049 O  OD2   . ASP B 1 158 ? -20.837 -29.116 -20.120 1.00 43.29  ? 264 ASP B OD2   1 
ATOM   5050 N  N     . ILE B 1 159 ? -18.448 -27.150 -24.865 1.00 53.23  ? 265 ILE B N     1 
ATOM   5051 C  CA    . ILE B 1 159 ? -17.394 -26.516 -25.656 1.00 50.10  ? 265 ILE B CA    1 
ATOM   5052 C  C     . ILE B 1 159 ? -17.923 -25.348 -26.460 1.00 50.37  ? 265 ILE B C     1 
ATOM   5053 O  O     . ILE B 1 159 ? -17.286 -24.292 -26.565 1.00 50.43  ? 265 ILE B O     1 
ATOM   5054 C  CB    . ILE B 1 159 ? -16.670 -27.559 -26.530 1.00 50.00  ? 265 ILE B CB    1 
ATOM   5055 C  CG1   . ILE B 1 159 ? -15.842 -28.430 -25.620 1.00 49.72  ? 265 ILE B CG1   1 
ATOM   5056 C  CG2   . ILE B 1 159 ? -15.742 -26.892 -27.554 1.00 50.27  ? 265 ILE B CG2   1 
ATOM   5057 C  CD1   . ILE B 1 159 ? -15.315 -29.681 -26.228 1.00 52.39  ? 265 ILE B CD1   1 
ATOM   5058 N  N     . CYS B 1 160 ? -19.094 -25.544 -27.024 1.00 51.92  ? 266 CYS B N     1 
ATOM   5059 C  CA    . CYS B 1 160 ? -19.767 -24.486 -27.769 1.00 48.62  ? 266 CYS B CA    1 
ATOM   5060 C  C     . CYS B 1 160 ? -20.115 -23.311 -26.812 1.00 45.78  ? 266 CYS B C     1 
ATOM   5061 O  O     . CYS B 1 160 ? -19.961 -22.162 -27.181 1.00 42.97  ? 266 CYS B O     1 
ATOM   5062 C  CB    . CYS B 1 160 ? -21.041 -25.049 -28.463 1.00 48.79  ? 266 CYS B CB    1 
ATOM   5063 S  SG    . CYS B 1 160 ? -22.148 -23.735 -29.090 1.00 52.62  ? 266 CYS B SG    1 
ATOM   5064 N  N     . PHE B 1 161 ? -20.558 -23.632 -25.596 1.00 42.57  ? 267 PHE B N     1 
ATOM   5065 C  CA    . PHE B 1 161 ? -20.835 -22.625 -24.570 1.00 44.67  ? 267 PHE B CA    1 
ATOM   5066 C  C     . PHE B 1 161 ? -19.586 -21.783 -24.210 1.00 44.60  ? 267 PHE B C     1 
ATOM   5067 O  O     . PHE B 1 161 ? -19.638 -20.567 -24.202 1.00 45.89  ? 267 PHE B O     1 
ATOM   5068 C  CB    . PHE B 1 161 ? -21.422 -23.325 -23.323 1.00 43.66  ? 267 PHE B CB    1 
ATOM   5069 C  CG    . PHE B 1 161 ? -21.737 -22.414 -22.162 1.00 43.65  ? 267 PHE B CG    1 
ATOM   5070 C  CD1   . PHE B 1 161 ? -22.198 -21.105 -22.343 1.00 43.52  ? 267 PHE B CD1   1 
ATOM   5071 C  CD2   . PHE B 1 161 ? -21.597 -22.881 -20.861 1.00 42.30  ? 267 PHE B CD2   1 
ATOM   5072 C  CE1   . PHE B 1 161 ? -22.467 -20.286 -21.240 1.00 41.61  ? 267 PHE B CE1   1 
ATOM   5073 C  CE2   . PHE B 1 161 ? -21.872 -22.068 -19.761 1.00 41.97  ? 267 PHE B CE2   1 
ATOM   5074 C  CZ    . PHE B 1 161 ? -22.329 -20.775 -19.954 1.00 41.33  ? 267 PHE B CZ    1 
ATOM   5075 N  N     . ILE B 1 162 ? -18.471 -22.456 -23.966 1.00 45.32  ? 268 ILE B N     1 
ATOM   5076 C  CA    . ILE B 1 162 ? -17.213 -21.819 -23.645 1.00 44.19  ? 268 ILE B CA    1 
ATOM   5077 C  C     . ILE B 1 162 ? -16.760 -20.893 -24.754 1.00 44.37  ? 268 ILE B C     1 
ATOM   5078 O  O     . ILE B 1 162 ? -16.295 -19.760 -24.484 1.00 44.54  ? 268 ILE B O     1 
ATOM   5079 C  CB    . ILE B 1 162 ? -16.134 -22.870 -23.285 1.00 44.33  ? 268 ILE B CB    1 
ATOM   5080 C  CG1   . ILE B 1 162 ? -16.447 -23.477 -21.915 1.00 42.93  ? 268 ILE B CG1   1 
ATOM   5081 C  CG2   . ILE B 1 162 ? -14.732 -22.263 -23.222 1.00 43.90  ? 268 ILE B CG2   1 
ATOM   5082 C  CD1   . ILE B 1 162 ? -15.840 -24.852 -21.624 1.00 42.25  ? 268 ILE B CD1   1 
ATOM   5083 N  N     . LYS B 1 163 ? -16.905 -21.334 -26.001 1.00 44.33  ? 269 LYS B N     1 
ATOM   5084 C  CA    . LYS B 1 163 ? -16.423 -20.565 -27.114 1.00 41.73  ? 269 LYS B CA    1 
ATOM   5085 C  C     . LYS B 1 163 ? -17.259 -19.318 -27.310 1.00 40.14  ? 269 LYS B C     1 
ATOM   5086 O  O     . LYS B 1 163 ? -16.713 -18.210 -27.536 1.00 39.33  ? 269 LYS B O     1 
ATOM   5087 C  CB    . LYS B 1 163 ? -16.465 -21.397 -28.358 1.00 46.33  ? 269 LYS B CB    1 
ATOM   5088 C  CG    . LYS B 1 163 ? -15.411 -22.467 -28.402 1.00 47.41  ? 269 LYS B CG    1 
ATOM   5089 C  CD    . LYS B 1 163 ? -15.661 -23.383 -29.599 1.00 48.61  ? 269 LYS B CD    1 
ATOM   5090 C  CE    . LYS B 1 163 ? -14.397 -24.208 -29.855 1.00 51.12  ? 269 LYS B CE    1 
ATOM   5091 N  NZ    . LYS B 1 163 ? -14.468 -25.026 -31.087 1.00 53.97  ? 269 LYS B NZ    1 
ATOM   5092 N  N     . GLU B 1 164 ? -18.564 -19.465 -27.155 1.00 38.43  ? 270 GLU B N     1 
ATOM   5093 C  CA    . GLU B 1 164 ? -19.465 -18.323 -27.295 1.00 40.16  ? 270 GLU B CA    1 
ATOM   5094 C  C     . GLU B 1 164 ? -19.240 -17.209 -26.255 1.00 40.51  ? 270 GLU B C     1 
ATOM   5095 O  O     . GLU B 1 164 ? -19.382 -16.021 -26.568 1.00 40.42  ? 270 GLU B O     1 
ATOM   5096 C  CB    . GLU B 1 164 ? -20.917 -18.790 -27.187 1.00 41.95  ? 270 GLU B CB    1 
ATOM   5097 C  CG    . GLU B 1 164 ? -21.450 -19.590 -28.389 1.00 45.53  ? 270 GLU B CG    1 
ATOM   5098 C  CD    . GLU B 1 164 ? -22.802 -20.261 -28.123 1.00 49.03  ? 270 GLU B CD    1 
ATOM   5099 O  OE1   . GLU B 1 164 ? -23.181 -20.506 -26.936 1.00 46.80  ? 270 GLU B OE1   1 
ATOM   5100 O  OE2   . GLU B 1 164 ? -23.515 -20.573 -29.132 1.00 57.61  ? 270 GLU B OE2   1 
ATOM   5101 N  N     . GLN B 1 165 ? -18.949 -17.617 -25.019 1.00 38.27  ? 271 GLN B N     1 
ATOM   5102 C  CA    . GLN B 1 165 ? -18.618 -16.701 -23.926 1.00 39.22  ? 271 GLN B CA    1 
ATOM   5103 C  C     . GLN B 1 165 ? -17.398 -15.879 -24.280 1.00 40.77  ? 271 GLN B C     1 
ATOM   5104 O  O     . GLN B 1 165 ? -17.345 -14.746 -23.996 1.00 44.27  ? 271 GLN B O     1 
ATOM   5105 C  CB    . GLN B 1 165 ? -18.322 -17.463 -22.632 1.00 38.24  ? 271 GLN B CB    1 
ATOM   5106 C  CG    . GLN B 1 165 ? -19.452 -18.122 -21.866 1.00 37.39  ? 271 GLN B CG    1 
ATOM   5107 C  CD    . GLN B 1 165 ? -18.986 -18.829 -20.585 1.00 39.27  ? 271 GLN B CD    1 
ATOM   5108 O  OE1   . GLN B 1 165 ? -18.731 -18.170 -19.550 1.00 39.65  ? 271 GLN B OE1   1 
ATOM   5109 N  NE2   . GLN B 1 165 ? -18.925 -20.170 -20.619 1.00 39.79  ? 271 GLN B NE2   1 
ATOM   5110 N  N     . ILE B 1 166 ? -16.415 -16.471 -24.929 1.00 45.16  ? 272 ILE B N     1 
ATOM   5111 C  CA    . ILE B 1 166 ? -15.206 -15.762 -25.312 1.00 44.54  ? 272 ILE B CA    1 
ATOM   5112 C  C     . ILE B 1 166 ? -15.408 -14.802 -26.507 1.00 47.46  ? 272 ILE B C     1 
ATOM   5113 O  O     . ILE B 1 166 ? -15.056 -13.626 -26.455 1.00 47.87  ? 272 ILE B O     1 
ATOM   5114 C  CB    . ILE B 1 166 ? -14.103 -16.797 -25.645 1.00 46.09  ? 272 ILE B CB    1 
ATOM   5115 C  CG1   . ILE B 1 166 ? -13.750 -17.569 -24.377 1.00 45.50  ? 272 ILE B CG1   1 
ATOM   5116 C  CG2   . ILE B 1 166 ? -12.899 -16.120 -26.310 1.00 45.26  ? 272 ILE B CG2   1 
ATOM   5117 C  CD1   . ILE B 1 166 ? -12.694 -18.646 -24.543 1.00 47.42  ? 272 ILE B CD1   1 
ATOM   5118 N  N     . VAL B 1 167 ? -15.962 -15.328 -27.596 1.00 48.58  ? 273 VAL B N     1 
ATOM   5119 C  CA    . VAL B 1 167 ? -15.905 -14.646 -28.874 1.00 46.97  ? 273 VAL B CA    1 
ATOM   5120 C  C     . VAL B 1 167 ? -17.220 -13.956 -29.222 1.00 48.12  ? 273 VAL B C     1 
ATOM   5121 O  O     . VAL B 1 167 ? -17.182 -13.018 -30.000 1.00 47.98  ? 273 VAL B O     1 
ATOM   5122 C  CB    . VAL B 1 167 ? -15.466 -15.596 -30.017 1.00 46.40  ? 273 VAL B CB    1 
ATOM   5123 C  CG1   . VAL B 1 167 ? -16.659 -16.441 -30.555 1.00 45.90  ? 273 VAL B CG1   1 
ATOM   5124 C  CG2   . VAL B 1 167 ? -14.732 -14.843 -31.110 1.00 45.25  ? 273 VAL B CG2   1 
ATOM   5125 N  N     . GLY B 1 168 ? -18.339 -14.355 -28.629 1.00 47.56  ? 274 GLY B N     1 
ATOM   5126 C  CA    . GLY B 1 168 ? -19.638 -13.925 -29.108 1.00 50.50  ? 274 GLY B CA    1 
ATOM   5127 C  C     . GLY B 1 168 ? -20.369 -15.035 -29.840 1.00 52.11  ? 274 GLY B C     1 
ATOM   5128 O  O     . GLY B 1 168 ? -19.830 -16.140 -29.972 1.00 47.76  ? 274 GLY B O     1 
ATOM   5129 N  N     . PRO B 1 169 ? -21.576 -14.725 -30.387 1.00 57.72  ? 275 PRO B N     1 
ATOM   5130 C  CA    . PRO B 1 169 ? -22.349 -15.726 -31.182 1.00 59.89  ? 275 PRO B CA    1 
ATOM   5131 C  C     . PRO B 1 169 ? -21.639 -16.184 -32.495 1.00 62.25  ? 275 PRO B C     1 
ATOM   5132 O  O     . PRO B 1 169 ? -21.002 -15.381 -33.165 1.00 59.54  ? 275 PRO B O     1 
ATOM   5133 C  CB    . PRO B 1 169 ? -23.668 -15.016 -31.493 1.00 58.35  ? 275 PRO B CB    1 
ATOM   5134 C  CG    . PRO B 1 169 ? -23.644 -13.725 -30.688 1.00 59.71  ? 275 PRO B CG    1 
ATOM   5135 C  CD    . PRO B 1 169 ? -22.203 -13.382 -30.427 1.00 57.76  ? 275 PRO B CD    1 
ATOM   5136 N  N     . LEU B 1 170 ? -21.785 -17.479 -32.795 1.00 68.42  ? 276 LEU B N     1 
ATOM   5137 C  CA    . LEU B 1 170 ? -21.098 -18.213 -33.875 1.00 71.13  ? 276 LEU B CA    1 
ATOM   5138 C  C     . LEU B 1 170 ? -21.987 -18.430 -35.122 1.00 64.10  ? 276 LEU B C     1 
ATOM   5139 O  O     . LEU B 1 170 ? -22.017 -17.624 -36.043 1.00 62.68  ? 276 LEU B O     1 
ATOM   5140 C  CB    . LEU B 1 170 ? -20.694 -19.599 -33.309 1.00 73.16  ? 276 LEU B CB    1 
ATOM   5141 C  CG    . LEU B 1 170 ? -20.059 -19.676 -31.887 1.00 75.19  ? 276 LEU B CG    1 
ATOM   5142 C  CD1   . LEU B 1 170 ? -19.975 -21.083 -31.268 1.00 74.47  ? 276 LEU B CD1   1 
ATOM   5143 C  CD2   . LEU B 1 170 ? -18.678 -19.047 -31.932 1.00 73.24  ? 276 LEU B CD2   1 
ATOM   5144 N  N     . LEU B 1 178 ? -34.342 -13.253 -32.838 1.00 68.58  ? 284 LEU B N     1 
ATOM   5145 C  CA    . LEU B 1 178 ? -34.517 -14.500 -32.060 1.00 72.57  ? 284 LEU B CA    1 
ATOM   5146 C  C     . LEU B 1 178 ? -33.134 -14.799 -31.442 1.00 73.04  ? 284 LEU B C     1 
ATOM   5147 O  O     . LEU B 1 178 ? -32.220 -14.039 -31.694 1.00 78.92  ? 284 LEU B O     1 
ATOM   5148 C  CB    . LEU B 1 178 ? -35.042 -15.687 -32.922 1.00 75.91  ? 284 LEU B CB    1 
ATOM   5149 C  CG    . LEU B 1 178 ? -36.285 -15.514 -33.831 1.00 80.88  ? 284 LEU B CG    1 
ATOM   5150 C  CD1   . LEU B 1 178 ? -36.521 -16.751 -34.686 1.00 79.36  ? 284 LEU B CD1   1 
ATOM   5151 C  CD2   . LEU B 1 178 ? -37.546 -15.136 -33.054 1.00 80.85  ? 284 LEU B CD2   1 
ATOM   5152 N  N     . TRP B 1 179 ? -32.959 -15.906 -30.697 1.00 71.95  ? 285 TRP B N     1 
ATOM   5153 C  CA    . TRP B 1 179 ? -31.843 -16.167 -29.728 1.00 66.27  ? 285 TRP B CA    1 
ATOM   5154 C  C     . TRP B 1 179 ? -30.634 -16.788 -30.429 1.00 63.59  ? 285 TRP B C     1 
ATOM   5155 O  O     . TRP B 1 179 ? -30.730 -17.894 -30.898 1.00 69.74  ? 285 TRP B O     1 
ATOM   5156 C  CB    . TRP B 1 179 ? -32.346 -17.133 -28.627 1.00 66.81  ? 285 TRP B CB    1 
ATOM   5157 C  CG    . TRP B 1 179 ? -31.323 -17.655 -27.545 1.00 68.48  ? 285 TRP B CG    1 
ATOM   5158 C  CD1   . TRP B 1 179 ? -30.922 -18.967 -27.306 1.00 68.94  ? 285 TRP B CD1   1 
ATOM   5159 C  CD2   . TRP B 1 179 ? -30.649 -16.862 -26.562 1.00 67.59  ? 285 TRP B CD2   1 
ATOM   5160 N  NE1   . TRP B 1 179 ? -30.040 -19.007 -26.266 1.00 66.72  ? 285 TRP B NE1   1 
ATOM   5161 C  CE2   . TRP B 1 179 ? -29.859 -17.731 -25.793 1.00 66.91  ? 285 TRP B CE2   1 
ATOM   5162 C  CE3   . TRP B 1 179 ? -30.628 -15.487 -26.270 1.00 64.39  ? 285 TRP B CE3   1 
ATOM   5163 C  CZ2   . TRP B 1 179 ? -29.075 -17.271 -24.757 1.00 69.48  ? 285 TRP B CZ2   1 
ATOM   5164 C  CZ3   . TRP B 1 179 ? -29.853 -15.043 -25.244 1.00 64.57  ? 285 TRP B CZ3   1 
ATOM   5165 C  CH2   . TRP B 1 179 ? -29.084 -15.916 -24.504 1.00 67.09  ? 285 TRP B CH2   1 
ATOM   5166 N  N     . PRO B 1 180 ? -29.479 -16.094 -30.470 1.00 59.68  ? 286 PRO B N     1 
ATOM   5167 C  CA    . PRO B 1 180 ? -28.353 -16.580 -31.277 1.00 58.28  ? 286 PRO B CA    1 
ATOM   5168 C  C     . PRO B 1 180 ? -27.409 -17.622 -30.671 1.00 57.10  ? 286 PRO B C     1 
ATOM   5169 O  O     . PRO B 1 180 ? -26.405 -17.918 -31.317 1.00 54.16  ? 286 PRO B O     1 
ATOM   5170 C  CB    . PRO B 1 180 ? -27.563 -15.299 -31.596 1.00 56.34  ? 286 PRO B CB    1 
ATOM   5171 C  CG    . PRO B 1 180 ? -27.877 -14.367 -30.500 1.00 56.55  ? 286 PRO B CG    1 
ATOM   5172 C  CD    . PRO B 1 180 ? -29.205 -14.754 -29.908 1.00 58.50  ? 286 PRO B CD    1 
ATOM   5173 N  N     . TYR B 1 181 ? -27.715 -18.189 -29.498 1.00 58.23  ? 287 TYR B N     1 
ATOM   5174 C  CA    . TYR B 1 181 ? -26.777 -19.076 -28.819 1.00 55.85  ? 287 TYR B CA    1 
ATOM   5175 C  C     . TYR B 1 181 ? -27.208 -20.536 -28.850 1.00 55.13  ? 287 TYR B C     1 
ATOM   5176 O  O     . TYR B 1 181 ? -28.360 -20.877 -28.538 1.00 57.14  ? 287 TYR B O     1 
ATOM   5177 C  CB    . TYR B 1 181 ? -26.555 -18.606 -27.363 1.00 55.30  ? 287 TYR B CB    1 
ATOM   5178 C  CG    . TYR B 1 181 ? -25.810 -17.270 -27.202 1.00 54.43  ? 287 TYR B CG    1 
ATOM   5179 C  CD1   . TYR B 1 181 ? -24.430 -17.176 -27.460 1.00 51.25  ? 287 TYR B CD1   1 
ATOM   5180 C  CD2   . TYR B 1 181 ? -26.470 -16.089 -26.793 1.00 53.21  ? 287 TYR B CD2   1 
ATOM   5181 C  CE1   . TYR B 1 181 ? -23.736 -16.005 -27.300 1.00 47.06  ? 287 TYR B CE1   1 
ATOM   5182 C  CE2   . TYR B 1 181 ? -25.764 -14.889 -26.669 1.00 48.94  ? 287 TYR B CE2   1 
ATOM   5183 C  CZ    . TYR B 1 181 ? -24.392 -14.893 -26.900 1.00 46.08  ? 287 TYR B CZ    1 
ATOM   5184 O  OH    . TYR B 1 181 ? -23.653 -13.783 -26.766 1.00 46.36  ? 287 TYR B OH    1 
ATOM   5185 N  N     . LYS B 1 182 ? -26.249 -21.381 -29.207 1.00 54.10  ? 288 LYS B N     1 
ATOM   5186 C  CA    . LYS B 1 182 ? -26.412 -22.814 -29.222 1.00 56.66  ? 288 LYS B CA    1 
ATOM   5187 C  C     . LYS B 1 182 ? -26.012 -23.425 -27.899 1.00 56.17  ? 288 LYS B C     1 
ATOM   5188 O  O     . LYS B 1 182 ? -26.526 -24.452 -27.562 1.00 63.45  ? 288 LYS B O     1 
ATOM   5189 C  CB    . LYS B 1 182 ? -25.690 -23.480 -30.449 1.00 57.53  ? 288 LYS B CB    1 
ATOM   5190 N  N     . GLY B 1 183 ? -25.169 -22.811 -27.081 1.00 56.55  ? 289 GLY B N     1 
ATOM   5191 C  CA    . GLY B 1 183 ? -24.613 -23.510 -25.898 1.00 52.71  ? 289 GLY B CA    1 
ATOM   5192 C  C     . GLY B 1 183 ? -25.439 -23.498 -24.592 1.00 51.19  ? 289 GLY B C     1 
ATOM   5193 O  O     . GLY B 1 183 ? -25.219 -24.330 -23.698 1.00 46.61  ? 289 GLY B O     1 
ATOM   5194 N  N     . ARG B 1 184 ? -26.343 -22.531 -24.475 1.00 51.23  ? 290 ARG B N     1 
ATOM   5195 C  CA    . ARG B 1 184 ? -27.302 -22.406 -23.375 1.00 52.05  ? 290 ARG B CA    1 
ATOM   5196 C  C     . ARG B 1 184 ? -28.526 -21.611 -23.906 1.00 54.64  ? 290 ARG B C     1 
ATOM   5197 O  O     . ARG B 1 184 ? -28.376 -20.822 -24.866 1.00 56.63  ? 290 ARG B O     1 
ATOM   5198 C  CB    . ARG B 1 184 ? -26.691 -21.607 -22.189 1.00 50.19  ? 290 ARG B CB    1 
ATOM   5199 C  CG    . ARG B 1 184 ? -25.633 -22.310 -21.341 1.00 48.56  ? 290 ARG B CG    1 
ATOM   5200 C  CD    . ARG B 1 184 ? -26.227 -23.457 -20.542 1.00 47.02  ? 290 ARG B CD    1 
ATOM   5201 N  NE    . ARG B 1 184 ? -25.290 -24.162 -19.665 1.00 46.36  ? 290 ARG B NE    1 
ATOM   5202 C  CZ    . ARG B 1 184 ? -24.279 -24.947 -20.062 1.00 45.25  ? 290 ARG B CZ    1 
ATOM   5203 N  NH1   . ARG B 1 184 ? -23.964 -25.079 -21.346 1.00 46.09  ? 290 ARG B NH1   1 
ATOM   5204 N  NH2   . ARG B 1 184 ? -23.523 -25.568 -19.167 1.00 44.66  ? 290 ARG B NH2   1 
ATOM   5205 N  N     . PRO B 1 185 ? -29.715 -21.783 -23.286 1.00 58.73  ? 291 PRO B N     1 
ATOM   5206 C  CA    . PRO B 1 185 ? -30.971 -21.083 -23.660 1.00 62.56  ? 291 PRO B CA    1 
ATOM   5207 C  C     . PRO B 1 185 ? -31.264 -19.807 -22.886 1.00 65.65  ? 291 PRO B C     1 
ATOM   5208 O  O     . PRO B 1 185 ? -30.597 -19.533 -21.894 1.00 73.06  ? 291 PRO B O     1 
ATOM   5209 C  CB    . PRO B 1 185 ? -32.039 -22.113 -23.315 1.00 61.10  ? 291 PRO B CB    1 
ATOM   5210 C  CG    . PRO B 1 185 ? -31.457 -22.812 -22.121 1.00 59.55  ? 291 PRO B CG    1 
ATOM   5211 C  CD    . PRO B 1 185 ? -30.007 -22.964 -22.452 1.00 59.67  ? 291 PRO B CD    1 
ATOM   5212 N  N     . GLU B 1 186 ? -32.309 -19.086 -23.292 1.00 67.43  ? 292 GLU B N     1 
ATOM   5213 C  CA    . GLU B 1 186 ? -32.639 -17.737 -22.767 1.00 70.16  ? 292 GLU B CA    1 
ATOM   5214 C  C     . GLU B 1 186 ? -32.781 -17.565 -21.250 1.00 66.82  ? 292 GLU B C     1 
ATOM   5215 O  O     . GLU B 1 186 ? -32.663 -16.407 -20.725 1.00 66.16  ? 292 GLU B O     1 
ATOM   5216 C  CB    . GLU B 1 186 ? -33.970 -17.254 -23.350 1.00 75.45  ? 292 GLU B CB    1 
ATOM   5217 C  CG    . GLU B 1 186 ? -34.012 -17.196 -24.866 1.00 83.49  ? 292 GLU B CG    1 
ATOM   5218 C  CD    . GLU B 1 186 ? -34.895 -16.068 -25.381 1.00 88.09  ? 292 GLU B CD    1 
ATOM   5219 O  OE1   . GLU B 1 186 ? -35.989 -15.923 -24.822 1.00 96.87  ? 292 GLU B OE1   1 
ATOM   5220 O  OE2   . GLU B 1 186 ? -34.497 -15.322 -26.306 1.00 91.09  ? 292 GLU B OE2   1 
ATOM   5221 N  N     . ASN B 1 187 ? -33.139 -18.682 -20.582 1.00 60.45  ? 293 ASN B N     1 
ATOM   5222 C  CA    . ASN B 1 187 ? -33.232 -18.738 -19.120 1.00 59.39  ? 293 ASN B CA    1 
ATOM   5223 C  C     . ASN B 1 187 ? -31.835 -18.740 -18.427 1.00 56.82  ? 293 ASN B C     1 
ATOM   5224 O  O     . ASN B 1 187 ? -31.741 -18.557 -17.199 1.00 54.77  ? 293 ASN B O     1 
ATOM   5225 C  CB    . ASN B 1 187 ? -34.125 -19.905 -18.619 1.00 57.83  ? 293 ASN B CB    1 
ATOM   5226 C  CG    . ASN B 1 187 ? -33.536 -21.292 -18.888 1.00 57.68  ? 293 ASN B CG    1 
ATOM   5227 O  OD1   . ASN B 1 187 ? -32.565 -21.467 -19.569 1.00 61.21  ? 293 ASN B OD1   1 
ATOM   5228 N  ND2   . ASN B 1 187 ? -34.162 -22.276 -18.358 1.00 58.60  ? 293 ASN B ND2   1 
ATOM   5229 N  N     . LYS B 1 188 ? -30.778 -18.949 -19.223 1.00 53.85  ? 294 LYS B N     1 
ATOM   5230 C  CA    . LYS B 1 188 ? -29.418 -18.763 -18.769 1.00 54.73  ? 294 LYS B CA    1 
ATOM   5231 C  C     . LYS B 1 188 ? -28.563 -17.682 -19.487 1.00 50.22  ? 294 LYS B C     1 
ATOM   5232 O  O     . LYS B 1 188 ? -27.348 -17.784 -19.540 1.00 47.58  ? 294 LYS B O     1 
ATOM   5233 C  CB    . LYS B 1 188 ? -28.785 -20.154 -18.711 1.00 56.23  ? 294 LYS B CB    1 
ATOM   5234 C  CG    . LYS B 1 188 ? -29.325 -20.806 -17.451 1.00 57.47  ? 294 LYS B CG    1 
ATOM   5235 C  CD    . LYS B 1 188 ? -28.965 -22.238 -17.294 1.00 57.76  ? 294 LYS B CD    1 
ATOM   5236 C  CE    . LYS B 1 188 ? -29.367 -22.716 -15.932 1.00 53.92  ? 294 LYS B CE    1 
ATOM   5237 N  NZ    . LYS B 1 188 ? -28.619 -23.972 -15.791 1.00 57.16  ? 294 LYS B NZ    1 
ATOM   5238 N  N     . SER B 1 189 ? -29.209 -16.621 -19.976 1.00 51.16  ? 295 SER B N     1 
ATOM   5239 C  CA    . SER B 1 189 ? -28.507 -15.550 -20.739 1.00 50.20  ? 295 SER B CA    1 
ATOM   5240 C  C     . SER B 1 189 ? -27.536 -14.743 -19.854 1.00 48.67  ? 295 SER B C     1 
ATOM   5241 O  O     . SER B 1 189 ? -26.512 -14.277 -20.326 1.00 44.87  ? 295 SER B O     1 
ATOM   5242 C  CB    . SER B 1 189 ? -29.494 -14.602 -21.373 1.00 48.96  ? 295 SER B CB    1 
ATOM   5243 O  OG    . SER B 1 189 ? -30.636 -14.474 -20.551 1.00 53.49  ? 295 SER B OG    1 
ATOM   5244 N  N     . PHE B 1 190 ? -27.872 -14.588 -18.571 1.00 46.20  ? 296 PHE B N     1 
ATOM   5245 C  CA    . PHE B 1 190 ? -26.986 -13.870 -17.667 1.00 46.01  ? 296 PHE B CA    1 
ATOM   5246 C  C     . PHE B 1 190 ? -25.569 -14.428 -17.652 1.00 46.59  ? 296 PHE B C     1 
ATOM   5247 O  O     . PHE B 1 190 ? -24.625 -13.666 -17.436 1.00 48.50  ? 296 PHE B O     1 
ATOM   5248 C  CB    . PHE B 1 190 ? -27.546 -13.759 -16.254 1.00 46.04  ? 296 PHE B CB    1 
ATOM   5249 C  CG    . PHE B 1 190 ? -27.961 -15.069 -15.641 1.00 46.44  ? 296 PHE B CG    1 
ATOM   5250 C  CD1   . PHE B 1 190 ? -27.083 -15.816 -14.925 1.00 45.92  ? 296 PHE B CD1   1 
ATOM   5251 C  CD2   . PHE B 1 190 ? -29.267 -15.524 -15.744 1.00 46.42  ? 296 PHE B CD2   1 
ATOM   5252 C  CE1   . PHE B 1 190 ? -27.456 -17.041 -14.380 1.00 45.92  ? 296 PHE B CE1   1 
ATOM   5253 C  CE2   . PHE B 1 190 ? -29.638 -16.735 -15.195 1.00 44.85  ? 296 PHE B CE2   1 
ATOM   5254 C  CZ    . PHE B 1 190 ? -28.732 -17.500 -14.517 1.00 44.86  ? 296 PHE B CZ    1 
ATOM   5255 N  N     . LEU B 1 191 ? -25.412 -15.726 -17.941 1.00 43.23  ? 297 LEU B N     1 
ATOM   5256 C  CA    . LEU B 1 191 ? -24.092 -16.348 -17.913 1.00 42.60  ? 297 LEU B CA    1 
ATOM   5257 C  C     . LEU B 1 191 ? -23.151 -15.852 -18.999 1.00 44.09  ? 297 LEU B C     1 
ATOM   5258 O  O     . LEU B 1 191 ? -21.944 -15.899 -18.863 1.00 51.02  ? 297 LEU B O     1 
ATOM   5259 C  CB    . LEU B 1 191 ? -24.198 -17.861 -17.990 1.00 41.27  ? 297 LEU B CB    1 
ATOM   5260 C  CG    . LEU B 1 191 ? -24.968 -18.653 -16.931 1.00 42.23  ? 297 LEU B CG    1 
ATOM   5261 C  CD1   . LEU B 1 191 ? -24.954 -20.137 -17.210 1.00 43.30  ? 297 LEU B CD1   1 
ATOM   5262 C  CD2   . LEU B 1 191 ? -24.425 -18.496 -15.535 1.00 42.27  ? 297 LEU B CD2   1 
ATOM   5263 N  N     . TYR B 1 192 ? -23.688 -15.386 -20.106 1.00 43.98  ? 298 TYR B N     1 
ATOM   5264 C  CA    . TYR B 1 192 ? -22.834 -14.774 -21.135 1.00 40.86  ? 298 TYR B CA    1 
ATOM   5265 C  C     . TYR B 1 192 ? -22.317 -13.374 -20.819 1.00 39.47  ? 298 TYR B C     1 
ATOM   5266 O  O     . TYR B 1 192 ? -21.432 -12.870 -21.554 1.00 36.75  ? 298 TYR B O     1 
ATOM   5267 C  CB    . TYR B 1 192 ? -23.584 -14.727 -22.471 1.00 41.68  ? 298 TYR B CB    1 
ATOM   5268 C  CG    . TYR B 1 192 ? -23.839 -16.101 -23.079 1.00 39.50  ? 298 TYR B CG    1 
ATOM   5269 C  CD1   . TYR B 1 192 ? -22.843 -16.734 -23.770 1.00 37.86  ? 298 TYR B CD1   1 
ATOM   5270 C  CD2   . TYR B 1 192 ? -25.072 -16.765 -22.897 1.00 37.61  ? 298 TYR B CD2   1 
ATOM   5271 C  CE1   . TYR B 1 192 ? -23.065 -17.977 -24.320 1.00 40.52  ? 298 TYR B CE1   1 
ATOM   5272 C  CE2   . TYR B 1 192 ? -25.300 -18.012 -23.441 1.00 38.75  ? 298 TYR B CE2   1 
ATOM   5273 C  CZ    . TYR B 1 192 ? -24.302 -18.605 -24.183 1.00 38.99  ? 298 TYR B CZ    1 
ATOM   5274 O  OH    . TYR B 1 192 ? -24.454 -19.818 -24.762 1.00 37.61  ? 298 TYR B OH    1 
ATOM   5275 N  N     . GLU B 1 193 ? -22.884 -12.754 -19.783 1.00 41.04  ? 299 GLU B N     1 
ATOM   5276 C  CA    . GLU B 1 193 ? -22.515 -11.424 -19.322 1.00 43.81  ? 299 GLU B CA    1 
ATOM   5277 C  C     . GLU B 1 193 ? -21.316 -11.386 -18.338 1.00 41.82  ? 299 GLU B C     1 
ATOM   5278 O  O     . GLU B 1 193 ? -20.879 -10.298 -17.994 1.00 39.90  ? 299 GLU B O     1 
ATOM   5279 C  CB    . GLU B 1 193 ? -23.722 -10.697 -18.695 1.00 48.15  ? 299 GLU B CB    1 
ATOM   5280 C  CG    . GLU B 1 193 ? -24.662 -10.052 -19.728 1.00 51.57  ? 299 GLU B CG    1 
ATOM   5281 C  CD    . GLU B 1 193 ? -26.028 -9.632  -19.182 1.00 54.35  ? 299 GLU B CD    1 
ATOM   5282 O  OE1   . GLU B 1 193 ? -26.513 -10.150 -18.148 1.00 55.73  ? 299 GLU B OE1   1 
ATOM   5283 O  OE2   . GLU B 1 193 ? -26.624 -8.751  -19.810 1.00 61.70  ? 299 GLU B OE2   1 
ATOM   5284 N  N     . ILE B 1 194 ? -20.736 -12.545 -17.992 1.00 38.00  ? 300 ILE B N     1 
ATOM   5285 C  CA    . ILE B 1 194 ? -19.642 -12.612 -17.030 1.00 34.96  ? 300 ILE B CA    1 
ATOM   5286 C  C     . ILE B 1 194 ? -18.223 -12.345 -17.567 1.00 33.92  ? 300 ILE B C     1 
ATOM   5287 O  O     . ILE B 1 194 ? -17.565 -11.416 -17.119 1.00 29.75  ? 300 ILE B O     1 
ATOM   5288 C  CB    . ILE B 1 194 ? -19.731 -13.950 -16.261 1.00 35.41  ? 300 ILE B CB    1 
ATOM   5289 C  CG1   . ILE B 1 194 ? -21.057 -13.939 -15.498 1.00 34.72  ? 300 ILE B CG1   1 
ATOM   5290 C  CG2   . ILE B 1 194 ? -18.578 -14.135 -15.273 1.00 34.47  ? 300 ILE B CG2   1 
ATOM   5291 C  CD1   . ILE B 1 194 ? -21.377 -15.263 -14.913 1.00 36.63  ? 300 ILE B CD1   1 
ATOM   5292 N  N     . VAL B 1 195 ? -17.812 -13.116 -18.587 1.00 33.61  ? 301 VAL B N     1 
ATOM   5293 C  CA    . VAL B 1 195 ? -16.462 -13.103 -19.073 1.00 32.58  ? 301 VAL B CA    1 
ATOM   5294 C  C     . VAL B 1 195 ? -16.173 -11.942 -20.034 1.00 35.00  ? 301 VAL B C     1 
ATOM   5295 O  O     . VAL B 1 195 ? -15.148 -11.194 -19.890 1.00 38.01  ? 301 VAL B O     1 
ATOM   5296 C  CB    . VAL B 1 195 ? -16.109 -14.465 -19.668 1.00 31.18  ? 301 VAL B CB    1 
ATOM   5297 C  CG1   . VAL B 1 195 ? -14.794 -14.410 -20.399 1.00 31.64  ? 301 VAL B CG1   1 
ATOM   5298 C  CG2   . VAL B 1 195 ? -15.984 -15.506 -18.560 1.00 32.20  ? 301 VAL B CG2   1 
ATOM   5299 N  N     . SER B 1 196 ? -17.053 -11.803 -21.008 1.00 34.90  ? 302 SER B N     1 
ATOM   5300 C  CA    . SER B 1 196 ? -17.001 -10.748 -22.006 1.00 36.37  ? 302 SER B CA    1 
ATOM   5301 C  C     . SER B 1 196 ? -18.441 -10.297 -22.329 1.00 35.11  ? 302 SER B C     1 
ATOM   5302 O  O     . SER B 1 196 ? -19.167 -10.987 -22.979 1.00 35.27  ? 302 SER B O     1 
ATOM   5303 C  CB    . SER B 1 196 ? -16.321 -11.325 -23.257 1.00 36.65  ? 302 SER B CB    1 
ATOM   5304 O  OG    . SER B 1 196 ? -16.332 -10.425 -24.336 1.00 34.47  ? 302 SER B OG    1 
ATOM   5305 N  N     . ASN B 1 197 ? -18.830 -9.146  -21.819 1.00 35.74  ? 303 ASN B N     1 
ATOM   5306 C  CA    . ASN B 1 197 ? -20.223 -8.645  -21.789 1.00 35.98  ? 303 ASN B CA    1 
ATOM   5307 C  C     . ASN B 1 197 ? -20.458 -7.775  -23.085 1.00 37.12  ? 303 ASN B C     1 
ATOM   5308 O  O     . ASN B 1 197 ? -20.000 -6.627  -23.177 1.00 34.67  ? 303 ASN B O     1 
ATOM   5309 C  CB    . ASN B 1 197 ? -20.451 -7.836  -20.475 1.00 35.59  ? 303 ASN B CB    1 
ATOM   5310 C  CG    . ASN B 1 197 ? -21.860 -7.294  -20.324 1.00 35.30  ? 303 ASN B CG    1 
ATOM   5311 O  OD1   . ASN B 1 197 ? -22.544 -6.935  -21.315 1.00 35.10  ? 303 ASN B OD1   1 
ATOM   5312 N  ND2   . ASN B 1 197 ? -22.284 -7.177  -19.084 1.00 31.72  ? 303 ASN B ND2   1 
ATOM   5313 N  N     . LYS B 1 198 ? -21.174 -8.360  -24.065 1.00 40.15  ? 304 LYS B N     1 
ATOM   5314 C  CA    . LYS B 1 198 ? -21.421 -7.684  -25.361 1.00 43.74  ? 304 LYS B CA    1 
ATOM   5315 C  C     . LYS B 1 198 ? -22.483 -6.600  -25.276 1.00 42.48  ? 304 LYS B C     1 
ATOM   5316 O  O     . LYS B 1 198 ? -22.487 -5.687  -26.065 1.00 44.44  ? 304 LYS B O     1 
ATOM   5317 C  CB    . LYS B 1 198 ? -21.841 -8.637  -26.478 1.00 47.92  ? 304 LYS B CB    1 
ATOM   5318 C  CG    . LYS B 1 198 ? -20.989 -9.876  -26.694 1.00 53.47  ? 304 LYS B CG    1 
ATOM   5319 C  CD    . LYS B 1 198 ? -19.512 -9.703  -27.101 1.00 57.61  ? 304 LYS B CD    1 
ATOM   5320 C  CE    . LYS B 1 198 ? -18.767 -10.989 -26.612 1.00 63.59  ? 304 LYS B CE    1 
ATOM   5321 N  NZ    . LYS B 1 198 ? -17.285 -11.127 -26.819 1.00 67.67  ? 304 LYS B NZ    1 
ATOM   5322 N  N     . ARG B 1 199 ? -23.375 -6.729  -24.313 1.00 43.46  ? 305 ARG B N     1 
ATOM   5323 C  CA    . ARG B 1 199 ? -24.465 -5.803  -24.088 1.00 43.83  ? 305 ARG B CA    1 
ATOM   5324 C  C     . ARG B 1 199 ? -23.954 -4.381  -23.597 1.00 42.90  ? 305 ARG B C     1 
ATOM   5325 O  O     . ARG B 1 199 ? -24.315 -3.326  -24.187 1.00 40.17  ? 305 ARG B O     1 
ATOM   5326 C  CB    . ARG B 1 199 ? -25.439 -6.500  -23.132 1.00 45.89  ? 305 ARG B CB    1 
ATOM   5327 C  CG    . ARG B 1 199 ? -26.768 -5.857  -22.918 1.00 53.76  ? 305 ARG B CG    1 
ATOM   5328 C  CD    . ARG B 1 199 ? -27.486 -6.327  -21.643 1.00 60.87  ? 305 ARG B CD    1 
ATOM   5329 N  NE    . ARG B 1 199 ? -28.516 -5.328  -21.274 1.00 69.91  ? 305 ARG B NE    1 
ATOM   5330 C  CZ    . ARG B 1 199 ? -29.058 -5.122  -20.052 1.00 80.57  ? 305 ARG B CZ    1 
ATOM   5331 N  NH1   . ARG B 1 199 ? -28.685 -5.867  -18.975 1.00 88.97  ? 305 ARG B NH1   1 
ATOM   5332 N  NH2   . ARG B 1 199 ? -29.998 -4.147  -19.890 1.00 74.65  ? 305 ARG B NH2   1 
ATOM   5333 N  N     . ASN B 1 200 ? -23.102 -4.353  -22.552 1.00 40.87  ? 306 ASN B N     1 
ATOM   5334 C  CA    . ASN B 1 200 ? -22.590 -3.068  -22.002 1.00 37.24  ? 306 ASN B CA    1 
ATOM   5335 C  C     . ASN B 1 200 ? -21.099 -2.980  -21.617 1.00 35.33  ? 306 ASN B C     1 
ATOM   5336 O  O     . ASN B 1 200 ? -20.603 -1.904  -21.288 1.00 35.68  ? 306 ASN B O     1 
ATOM   5337 C  CB    . ASN B 1 200 ? -23.492 -2.651  -20.837 1.00 38.54  ? 306 ASN B CB    1 
ATOM   5338 C  CG    . ASN B 1 200 ? -23.525 -3.684  -19.740 1.00 38.18  ? 306 ASN B CG    1 
ATOM   5339 O  OD1   . ASN B 1 200 ? -22.487 -4.193  -19.321 1.00 40.87  ? 306 ASN B OD1   1 
ATOM   5340 N  ND2   . ASN B 1 200 ? -24.708 -3.977  -19.255 1.00 38.62  ? 306 ASN B ND2   1 
ATOM   5341 N  N     . GLY B 1 201 ? -20.382 -4.092  -21.706 1.00 34.07  ? 307 GLY B N     1 
ATOM   5342 C  CA    . GLY B 1 201 ? -18.967 -4.097  -21.462 1.00 33.90  ? 307 GLY B CA    1 
ATOM   5343 C  C     . GLY B 1 201 ? -18.552 -4.265  -19.977 1.00 32.39  ? 307 GLY B C     1 
ATOM   5344 O  O     . GLY B 1 201 ? -17.344 -4.242  -19.684 1.00 32.47  ? 307 GLY B O     1 
ATOM   5345 N  N     . ILE B 1 202 ? -19.496 -4.449  -19.063 1.00 30.74  ? 308 ILE B N     1 
ATOM   5346 C  CA    . ILE B 1 202 ? -19.159 -4.611  -17.597 1.00 30.00  ? 308 ILE B CA    1 
ATOM   5347 C  C     . ILE B 1 202 ? -18.878 -6.078  -17.364 1.00 31.14  ? 308 ILE B C     1 
ATOM   5348 O  O     . ILE B 1 202 ? -19.789 -6.873  -17.323 1.00 31.94  ? 308 ILE B O     1 
ATOM   5349 C  CB    . ILE B 1 202 ? -20.295 -4.118  -16.739 1.00 29.70  ? 308 ILE B CB    1 
ATOM   5350 C  CG1   . ILE B 1 202 ? -20.508 -2.619  -17.026 1.00 29.93  ? 308 ILE B CG1   1 
ATOM   5351 C  CG2   . ILE B 1 202 ? -20.012 -4.332  -15.264 1.00 30.42  ? 308 ILE B CG2   1 
ATOM   5352 C  CD1   . ILE B 1 202 ? -21.712 -1.967  -16.429 1.00 30.52  ? 308 ILE B CD1   1 
ATOM   5353 N  N     . ASP B 1 203 ? -17.619 -6.478  -17.367 1.00 32.59  ? 309 ASP B N     1 
ATOM   5354 C  CA    . ASP B 1 203 ? -17.229 -7.913  -17.253 1.00 32.83  ? 309 ASP B CA    1 
ATOM   5355 C  C     . ASP B 1 203 ? -15.985 -8.078  -16.322 1.00 31.46  ? 309 ASP B C     1 
ATOM   5356 O  O     . ASP B 1 203 ? -15.255 -7.101  -16.019 1.00 32.16  ? 309 ASP B O     1 
ATOM   5357 C  CB    . ASP B 1 203 ? -17.020 -8.561  -18.647 1.00 33.74  ? 309 ASP B CB    1 
ATOM   5358 C  CG    . ASP B 1 203 ? -16.140 -7.690  -19.599 1.00 36.04  ? 309 ASP B CG    1 
ATOM   5359 O  OD1   . ASP B 1 203 ? -15.012 -7.279  -19.206 1.00 33.75  ? 309 ASP B OD1   1 
ATOM   5360 O  OD2   . ASP B 1 203 ? -16.592 -7.392  -20.735 1.00 37.76  ? 309 ASP B OD2   1 
ATOM   5361 N  N     . VAL B 1 204 ? -15.734 -9.314  -15.901 1.00 29.39  ? 310 VAL B N     1 
ATOM   5362 C  CA    . VAL B 1 204 ? -14.665 -9.607  -14.955 1.00 29.11  ? 310 VAL B CA    1 
ATOM   5363 C  C     . VAL B 1 204 ? -13.218 -9.468  -15.525 1.00 29.88  ? 310 VAL B C     1 
ATOM   5364 O  O     . VAL B 1 204 ? -12.262 -9.294  -14.747 1.00 30.81  ? 310 VAL B O     1 
ATOM   5365 C  CB    . VAL B 1 204 ? -14.848 -10.971 -14.292 1.00 29.01  ? 310 VAL B CB    1 
ATOM   5366 C  CG1   . VAL B 1 204 ? -16.218 -11.120 -13.716 1.00 30.11  ? 310 VAL B CG1   1 
ATOM   5367 C  CG2   . VAL B 1 204 ? -14.602 -12.135 -15.203 1.00 29.56  ? 310 VAL B CG2   1 
ATOM   5368 N  N     . ASP B 1 205 ? -13.088 -9.533  -16.842 1.00 28.58  ? 311 ASP B N     1 
ATOM   5369 C  CA    . ASP B 1 205 ? -11.833 -9.269  -17.555 1.00 28.85  ? 311 ASP B CA    1 
ATOM   5370 C  C     . ASP B 1 205 ? -11.328 -7.898  -17.169 1.00 27.78  ? 311 ASP B C     1 
ATOM   5371 O  O     . ASP B 1 205 ? -10.180 -7.736  -16.771 1.00 27.26  ? 311 ASP B O     1 
ATOM   5372 C  CB    . ASP B 1 205 ? -12.059 -9.364  -19.089 1.00 28.27  ? 311 ASP B CB    1 
ATOM   5373 C  CG    . ASP B 1 205 ? -10.802 -9.021  -19.900 1.00 28.98  ? 311 ASP B CG    1 
ATOM   5374 O  OD1   . ASP B 1 205 ? -9.716  -9.659  -19.738 1.00 30.11  ? 311 ASP B OD1   1 
ATOM   5375 O  OD2   . ASP B 1 205 ? -10.866 -8.170  -20.791 1.00 27.12  ? 311 ASP B OD2   1 
ATOM   5376 N  N     . LYS B 1 206 ? -12.198 -6.921  -17.284 1.00 27.63  ? 312 LYS B N     1 
ATOM   5377 C  CA    . LYS B 1 206 ? -11.843 -5.544  -16.919 1.00 28.67  ? 312 LYS B CA    1 
ATOM   5378 C  C     . LYS B 1 206 ? -11.520 -5.446  -15.429 1.00 26.89  ? 312 LYS B C     1 
ATOM   5379 O  O     . LYS B 1 206 ? -10.603 -4.746  -15.064 1.00 26.50  ? 312 LYS B O     1 
ATOM   5380 C  CB    . LYS B 1 206 ? -12.986 -4.531  -17.183 1.00 29.18  ? 312 LYS B CB    1 
ATOM   5381 C  CG    . LYS B 1 206 ? -13.206 -4.190  -18.657 1.00 29.22  ? 312 LYS B CG    1 
ATOM   5382 C  CD    . LYS B 1 206 ? -14.256 -3.077  -18.750 1.00 29.67  ? 312 LYS B CD    1 
ATOM   5383 C  CE    . LYS B 1 206 ? -14.672 -2.668  -20.139 1.00 29.46  ? 312 LYS B CE    1 
ATOM   5384 N  NZ    . LYS B 1 206 ? -15.084 -3.868  -20.928 1.00 29.90  ? 312 LYS B NZ    1 
ATOM   5385 N  N     . TRP B 1 207 ? -12.278 -6.141  -14.606 1.00 26.23  ? 313 TRP B N     1 
ATOM   5386 C  CA    . TRP B 1 207 ? -12.017 -6.067  -13.157 1.00 25.34  ? 313 TRP B CA    1 
ATOM   5387 C  C     . TRP B 1 207 ? -10.618 -6.547  -12.789 1.00 24.73  ? 313 TRP B C     1 
ATOM   5388 O  O     . TRP B 1 207 ? -9.909  -5.913  -12.012 1.00 23.29  ? 313 TRP B O     1 
ATOM   5389 C  CB    . TRP B 1 207 ? -13.047 -6.862  -12.393 1.00 26.60  ? 313 TRP B CB    1 
ATOM   5390 C  CG    . TRP B 1 207 ? -14.513 -6.360  -12.643 1.00 28.14  ? 313 TRP B CG    1 
ATOM   5391 C  CD1   . TRP B 1 207 ? -14.909 -5.189  -13.310 1.00 27.11  ? 313 TRP B CD1   1 
ATOM   5392 C  CD2   . TRP B 1 207 ? -15.743 -7.003  -12.214 1.00 27.45  ? 313 TRP B CD2   1 
ATOM   5393 N  NE1   . TRP B 1 207 ? -16.278 -5.090  -13.286 1.00 26.70  ? 313 TRP B NE1   1 
ATOM   5394 C  CE2   . TRP B 1 207 ? -16.810 -6.164  -12.606 1.00 27.52  ? 313 TRP B CE2   1 
ATOM   5395 C  CE3   . TRP B 1 207 ? -16.021 -8.175  -11.510 1.00 28.24  ? 313 TRP B CE3   1 
ATOM   5396 C  CZ2   . TRP B 1 207 ? -18.154 -6.497  -12.372 1.00 28.36  ? 313 TRP B CZ2   1 
ATOM   5397 C  CZ3   . TRP B 1 207 ? -17.349 -8.511  -11.245 1.00 29.31  ? 313 TRP B CZ3   1 
ATOM   5398 C  CH2   . TRP B 1 207 ? -18.408 -7.666  -11.686 1.00 29.86  ? 313 TRP B CH2   1 
ATOM   5399 N  N     . ASP B 1 208 ? -10.167 -7.626  -13.407 1.00 25.72  ? 314 ASP B N     1 
ATOM   5400 C  CA    . ASP B 1 208 ? -8.832  -8.153  -13.109 1.00 25.28  ? 314 ASP B CA    1 
ATOM   5401 C  C     . ASP B 1 208 ? -7.764  -7.213  -13.633 1.00 25.76  ? 314 ASP B C     1 
ATOM   5402 O  O     . ASP B 1 208 ? -6.782  -6.887  -12.908 1.00 25.95  ? 314 ASP B O     1 
ATOM   5403 C  CB    . ASP B 1 208 ? -8.621  -9.506  -13.746 1.00 25.95  ? 314 ASP B CB    1 
ATOM   5404 C  CG    . ASP B 1 208 ? -7.220  -10.084 -13.434 1.00 26.68  ? 314 ASP B CG    1 
ATOM   5405 O  OD1   . ASP B 1 208 ? -6.978  -10.707 -12.383 1.00 26.33  ? 314 ASP B OD1   1 
ATOM   5406 O  OD2   . ASP B 1 208 ? -6.348  -9.917  -14.310 1.00 28.93  ? 314 ASP B OD2   1 
ATOM   5407 N  N     . TYR B 1 209 ? -7.886  -6.767  -14.879 1.00 24.33  ? 315 TYR B N     1 
ATOM   5408 C  CA    . TYR B 1 209 ? -6.759  -5.977  -15.425 1.00 24.87  ? 315 TYR B CA    1 
ATOM   5409 C  C     . TYR B 1 209 ? -6.652  -4.591  -14.811 1.00 23.78  ? 315 TYR B C     1 
ATOM   5410 O  O     . TYR B 1 209 ? -5.539  -4.060  -14.707 1.00 21.82  ? 315 TYR B O     1 
ATOM   5411 C  CB    . TYR B 1 209 ? -6.661  -5.958  -17.015 1.00 24.72  ? 315 TYR B CB    1 
ATOM   5412 C  CG    . TYR B 1 209 ? -7.568  -4.961  -17.790 1.00 25.98  ? 315 TYR B CG    1 
ATOM   5413 C  CD1   . TYR B 1 209 ? -7.390  -3.607  -17.702 1.00 24.64  ? 315 TYR B CD1   1 
ATOM   5414 C  CD2   . TYR B 1 209 ? -8.548  -5.431  -18.705 1.00 26.49  ? 315 TYR B CD2   1 
ATOM   5415 C  CE1   . TYR B 1 209 ? -8.189  -2.761  -18.389 1.00 24.99  ? 315 TYR B CE1   1 
ATOM   5416 C  CE2   . TYR B 1 209 ? -9.312  -4.561  -19.467 1.00 25.62  ? 315 TYR B CE2   1 
ATOM   5417 C  CZ    . TYR B 1 209 ? -9.126  -3.233  -19.288 1.00 25.73  ? 315 TYR B CZ    1 
ATOM   5418 O  OH    . TYR B 1 209 ? -9.896  -2.326  -19.987 1.00 25.24  ? 315 TYR B OH    1 
ATOM   5419 N  N     . PHE B 1 210 ? -7.767  -3.991  -14.397 1.00 24.15  ? 316 PHE B N     1 
ATOM   5420 C  CA    . PHE B 1 210 ? -7.664  -2.744  -13.647 1.00 23.77  ? 316 PHE B CA    1 
ATOM   5421 C  C     . PHE B 1 210 ? -6.775  -2.937  -12.415 1.00 22.65  ? 316 PHE B C     1 
ATOM   5422 O  O     . PHE B 1 210 ? -5.847  -2.150  -12.168 1.00 20.58  ? 316 PHE B O     1 
ATOM   5423 C  CB    . PHE B 1 210 ? -9.024  -2.255  -13.121 1.00 26.30  ? 316 PHE B CB    1 
ATOM   5424 C  CG    . PHE B 1 210 ? -10.005 -1.750  -14.187 1.00 28.22  ? 316 PHE B CG    1 
ATOM   5425 C  CD1   . PHE B 1 210 ? -9.676  -1.635  -15.491 1.00 28.06  ? 316 PHE B CD1   1 
ATOM   5426 C  CD2   . PHE B 1 210 ? -11.274 -1.345  -13.811 1.00 30.08  ? 316 PHE B CD2   1 
ATOM   5427 C  CE1   . PHE B 1 210 ? -10.562 -1.173  -16.434 1.00 29.84  ? 316 PHE B CE1   1 
ATOM   5428 C  CE2   . PHE B 1 210 ? -12.162 -0.851  -14.754 1.00 32.91  ? 316 PHE B CE2   1 
ATOM   5429 C  CZ    . PHE B 1 210 ? -11.823 -0.817  -16.069 1.00 30.01  ? 316 PHE B CZ    1 
ATOM   5430 N  N     . ALA B 1 211 ? -7.095  -3.954  -11.626 1.00 20.72  ? 317 ALA B N     1 
ATOM   5431 C  CA    . ALA B 1 211 ? -6.382  -4.119  -10.363 1.00 20.11  ? 317 ALA B CA    1 
ATOM   5432 C  C     . ALA B 1 211 ? -4.937  -4.573  -10.651 1.00 20.55  ? 317 ALA B C     1 
ATOM   5433 O  O     . ALA B 1 211 ? -3.975  -4.134  -9.956  1.00 20.52  ? 317 ALA B O     1 
ATOM   5434 C  CB    . ALA B 1 211 ? -7.116  -5.107  -9.471  1.00 19.42  ? 317 ALA B CB    1 
ATOM   5435 N  N     . ARG B 1 212 ? -4.751  -5.378  -11.714 1.00 20.94  ? 318 ARG B N     1 
ATOM   5436 C  CA    . ARG B 1 212 ? -3.430  -6.046  -11.920 1.00 20.41  ? 318 ARG B CA    1 
ATOM   5437 C  C     . ARG B 1 212 ? -2.472  -5.058  -12.533 1.00 20.17  ? 318 ARG B C     1 
ATOM   5438 O  O     . ARG B 1 212 ? -1.322  -4.926  -12.099 1.00 20.70  ? 318 ARG B O     1 
ATOM   5439 C  CB    . ARG B 1 212 ? -3.595  -7.331  -12.714 1.00 20.48  ? 318 ARG B CB    1 
ATOM   5440 C  CG    . ARG B 1 212 ? -2.305  -8.159  -12.823 1.00 20.58  ? 318 ARG B CG    1 
ATOM   5441 C  CD    . ARG B 1 212 ? -2.526  -9.517  -13.552 1.00 21.46  ? 318 ARG B CD    1 
ATOM   5442 N  NE    . ARG B 1 212 ? -3.652  -10.293 -13.000 1.00 21.80  ? 318 ARG B NE    1 
ATOM   5443 C  CZ    . ARG B 1 212 ? -3.595  -11.072 -11.901 1.00 22.19  ? 318 ARG B CZ    1 
ATOM   5444 N  NH1   . ARG B 1 212 ? -4.677  -11.633 -11.375 1.00 22.44  ? 318 ARG B NH1   1 
ATOM   5445 N  NH2   . ARG B 1 212 ? -2.467  -11.224 -11.249 1.00 23.08  ? 318 ARG B NH2   1 
ATOM   5446 N  N     . ASP B 1 213 ? -2.934  -4.353  -13.548 1.00 20.26  ? 319 ASP B N     1 
ATOM   5447 C  CA    . ASP B 1 213 ? -2.156  -3.343  -14.223 1.00 20.78  ? 319 ASP B CA    1 
ATOM   5448 C  C     . ASP B 1 213 ? -1.762  -2.258  -13.210 1.00 21.36  ? 319 ASP B C     1 
ATOM   5449 O  O     . ASP B 1 213 ? -0.604  -1.878  -13.172 1.00 21.16  ? 319 ASP B O     1 
ATOM   5450 C  CB    . ASP B 1 213 ? -2.889  -2.721  -15.397 1.00 19.96  ? 319 ASP B CB    1 
ATOM   5451 C  CG    . ASP B 1 213 ? -3.097  -3.705  -16.582 1.00 20.50  ? 319 ASP B CG    1 
ATOM   5452 O  OD1   . ASP B 1 213 ? -2.443  -4.810  -16.680 1.00 20.69  ? 319 ASP B OD1   1 
ATOM   5453 O  OD2   . ASP B 1 213 ? -3.973  -3.376  -17.429 1.00 18.66  ? 319 ASP B OD2   1 
ATOM   5454 N  N     . CYS B 1 214 ? -2.712  -1.772  -12.403 1.00 22.16  ? 320 CYS B N     1 
ATOM   5455 C  CA    . CYS B 1 214 ? -2.407  -0.740  -11.395 1.00 22.58  ? 320 CYS B CA    1 
ATOM   5456 C  C     . CYS B 1 214 ? -1.302  -1.166  -10.365 1.00 21.24  ? 320 CYS B C     1 
ATOM   5457 O  O     . CYS B 1 214 ? -0.300  -0.454  -10.147 1.00 18.77  ? 320 CYS B O     1 
ATOM   5458 C  CB    . CYS B 1 214 ? -3.675  -0.293  -10.678 1.00 23.79  ? 320 CYS B CB    1 
ATOM   5459 S  SG    . CYS B 1 214 ? -4.631  0.844   -11.762 1.00 25.99  ? 320 CYS B SG    1 
ATOM   5460 N  N     . HIS B 1 215 ? -1.435  -2.371  -9.857  1.00 20.94  ? 321 HIS B N     1 
ATOM   5461 C  CA    . HIS B 1 215 ? -0.362  -3.000  -9.016  1.00 21.41  ? 321 HIS B CA    1 
ATOM   5462 C  C     . HIS B 1 215 ? 1.026   -2.907  -9.661  1.00 21.39  ? 321 HIS B C     1 
ATOM   5463 O  O     . HIS B 1 215 ? 1.999   -2.644  -8.953  1.00 23.06  ? 321 HIS B O     1 
ATOM   5464 C  CB    . HIS B 1 215 ? -0.705  -4.501  -8.715  1.00 20.59  ? 321 HIS B CB    1 
ATOM   5465 C  CG    . HIS B 1 215 ? 0.211   -5.189  -7.756  1.00 20.19  ? 321 HIS B CG    1 
ATOM   5466 N  ND1   . HIS B 1 215 ? 0.086   -5.082  -6.387  1.00 20.99  ? 321 HIS B ND1   1 
ATOM   5467 C  CD2   . HIS B 1 215 ? 1.205   -6.097  -7.973  1.00 20.18  ? 321 HIS B CD2   1 
ATOM   5468 C  CE1   . HIS B 1 215 ? 1.028   -5.841  -5.814  1.00 20.75  ? 321 HIS B CE1   1 
ATOM   5469 N  NE2   . HIS B 1 215 ? 1.727   -6.454  -6.768  1.00 20.29  ? 321 HIS B NE2   1 
ATOM   5470 N  N     . HIS B 1 216 ? 1.128   -3.144  -10.949 1.00 22.23  ? 322 HIS B N     1 
ATOM   5471 C  CA    . HIS B 1 216 ? 2.448   -3.216  -11.622 1.00 23.70  ? 322 HIS B CA    1 
ATOM   5472 C  C     . HIS B 1 216 ? 2.950   -1.859  -12.182 1.00 23.93  ? 322 HIS B C     1 
ATOM   5473 O  O     . HIS B 1 216 ? 4.168   -1.589  -12.203 1.00 23.66  ? 322 HIS B O     1 
ATOM   5474 C  CB    . HIS B 1 216 ? 2.450   -4.274  -12.712 1.00 24.88  ? 322 HIS B CB    1 
ATOM   5475 C  CG    . HIS B 1 216 ? 2.432   -5.688  -12.190 1.00 28.24  ? 322 HIS B CG    1 
ATOM   5476 N  ND1   . HIS B 1 216 ? 1.260   -6.361  -11.910 1.00 30.42  ? 322 HIS B ND1   1 
ATOM   5477 C  CD2   . HIS B 1 216 ? 3.436   -6.553  -11.887 1.00 30.21  ? 322 HIS B CD2   1 
ATOM   5478 C  CE1   . HIS B 1 216 ? 1.543   -7.572  -11.420 1.00 32.58  ? 322 HIS B CE1   1 
ATOM   5479 N  NE2   . HIS B 1 216 ? 2.856   -7.711  -11.396 1.00 32.88  ? 322 HIS B NE2   1 
ATOM   5480 N  N     . LEU B 1 217 ? 2.015   -1.021  -12.637 1.00 23.18  ? 323 LEU B N     1 
ATOM   5481 C  CA    . LEU B 1 217 ? 2.319   0.234   -13.190 1.00 22.96  ? 323 LEU B CA    1 
ATOM   5482 C  C     . LEU B 1 217 ? 2.803   1.200   -12.167 1.00 24.02  ? 323 LEU B C     1 
ATOM   5483 O  O     . LEU B 1 217 ? 3.681   2.077   -12.496 1.00 26.04  ? 323 LEU B O     1 
ATOM   5484 C  CB    . LEU B 1 217 ? 1.068   0.839   -13.839 1.00 23.84  ? 323 LEU B CB    1 
ATOM   5485 C  CG    . LEU B 1 217 ? 0.718   0.155   -15.176 1.00 23.54  ? 323 LEU B CG    1 
ATOM   5486 C  CD1   . LEU B 1 217 ? -0.689  0.476   -15.664 1.00 23.13  ? 323 LEU B CD1   1 
ATOM   5487 C  CD2   . LEU B 1 217 ? 1.752   0.418   -16.340 1.00 24.86  ? 323 LEU B CD2   1 
ATOM   5488 N  N     . GLY B 1 218 ? 2.238   1.129   -10.935 1.00 23.60  ? 324 GLY B N     1 
ATOM   5489 C  CA    . GLY B 1 218 ? 2.434   2.189   -9.933  1.00 24.32  ? 324 GLY B CA    1 
ATOM   5490 C  C     . GLY B 1 218 ? 1.486   3.355   -10.059 1.00 25.95  ? 324 GLY B C     1 
ATOM   5491 O  O     . GLY B 1 218 ? 1.844   4.493   -9.776  1.00 25.12  ? 324 GLY B O     1 
ATOM   5492 N  N     . ILE B 1 219 ? 0.268   3.063   -10.491 1.00 28.43  ? 325 ILE B N     1 
ATOM   5493 C  CA    . ILE B 1 219 ? -0.809  3.993   -10.606 1.00 30.47  ? 325 ILE B CA    1 
ATOM   5494 C  C     . ILE B 1 219 ? -1.903  3.277   -9.855  1.00 36.57  ? 325 ILE B C     1 
ATOM   5495 O  O     . ILE B 1 219 ? -2.062  2.032   -9.987  1.00 36.10  ? 325 ILE B O     1 
ATOM   5496 C  CB    . ILE B 1 219 ? -1.369  4.068   -11.998 1.00 33.57  ? 325 ILE B CB    1 
ATOM   5497 C  CG1   . ILE B 1 219 ? -0.388  4.663   -13.001 1.00 33.11  ? 325 ILE B CG1   1 
ATOM   5498 C  CG2   . ILE B 1 219 ? -2.700  4.873   -11.959 1.00 35.85  ? 325 ILE B CG2   1 
ATOM   5499 C  CD1   . ILE B 1 219 ? -0.948  4.567   -14.414 1.00 32.72  ? 325 ILE B CD1   1 
ATOM   5500 N  N     . GLN B 1 220 ? -2.701  4.039   -9.120  1.00 39.81  ? 326 GLN B N     1 
ATOM   5501 C  CA    . GLN B 1 220 ? -3.623  3.452   -8.222  1.00 39.28  ? 326 GLN B CA    1 
ATOM   5502 C  C     . GLN B 1 220 ? -5.040  3.410   -8.746  1.00 38.56  ? 326 GLN B C     1 
ATOM   5503 O  O     . GLN B 1 220 ? -5.551  4.277   -9.478  1.00 33.47  ? 326 GLN B O     1 
ATOM   5504 C  CB    . GLN B 1 220 ? -3.546  4.069   -6.910  1.00 40.06  ? 326 GLN B CB    1 
ATOM   5505 C  CG    . GLN B 1 220 ? -3.510  2.933   -5.927  1.00 49.27  ? 326 GLN B CG    1 
ATOM   5506 C  CD    . GLN B 1 220 ? -4.081  3.253   -4.519  1.00 50.85  ? 326 GLN B CD    1 
ATOM   5507 O  OE1   . GLN B 1 220 ? -4.546  4.355   -4.264  1.00 64.10  ? 326 GLN B OE1   1 
ATOM   5508 N  NE2   . GLN B 1 220 ? -4.095  2.265   -3.645  1.00 47.15  ? 326 GLN B NE2   1 
ATOM   5509 N  N     . ASN B 1 221 ? -5.652  2.279   -8.403  1.00 43.40  ? 327 ASN B N     1 
ATOM   5510 C  CA    . ASN B 1 221 ? -6.976  1.932   -8.923  1.00 47.01  ? 327 ASN B CA    1 
ATOM   5511 C  C     . ASN B 1 221 ? -8.078  2.570   -8.054  1.00 43.12  ? 327 ASN B C     1 
ATOM   5512 O  O     . ASN B 1 221 ? -7.959  2.496   -6.876  1.00 51.68  ? 327 ASN B O     1 
ATOM   5513 C  CB    . ASN B 1 221 ? -7.143  0.361   -8.887  1.00 45.16  ? 327 ASN B CB    1 
ATOM   5514 C  CG    . ASN B 1 221 ? -8.436  -0.102  -9.599  1.00 38.73  ? 327 ASN B CG    1 
ATOM   5515 O  OD1   . ASN B 1 221 ? -9.060  0.742   -10.284 1.00 30.27  ? 327 ASN B OD1   1 
ATOM   5516 N  ND2   . ASN B 1 221 ? -8.877  -1.429  -9.368  1.00 32.61  ? 327 ASN B ND2   1 
ATOM   5517 N  N     . ASN B 1 222 ? -9.164  3.106   -8.589  1.00 39.18  ? 328 ASN B N     1 
ATOM   5518 C  CA    . ASN B 1 222 ? -10.241 3.541   -7.733  1.00 35.27  ? 328 ASN B CA    1 
ATOM   5519 C  C     . ASN B 1 222 ? -11.612 2.816   -7.880  1.00 31.51  ? 328 ASN B C     1 
ATOM   5520 O  O     . ASN B 1 222 ? -12.636 3.243   -7.331  1.00 31.50  ? 328 ASN B O     1 
ATOM   5521 C  CB    . ASN B 1 222 ? -10.324 5.031   -7.810  1.00 42.71  ? 328 ASN B CB    1 
ATOM   5522 C  CG    . ASN B 1 222 ? -11.005 5.489   -9.045  1.00 49.57  ? 328 ASN B CG    1 
ATOM   5523 O  OD1   . ASN B 1 222 ? -12.263 5.712   -8.872  1.00 53.48  ? 328 ASN B OD1   1 
ATOM   5524 N  ND2   . ASN B 1 222 ? -10.259 5.623   -10.306 1.00 41.42  ? 328 ASN B ND2   1 
ATOM   5525 N  N     . PHE B 1 223 ? -11.615 1.637   -8.486  1.00 27.45  ? 329 PHE B N     1 
ATOM   5526 C  CA    . PHE B 1 223 ? -12.841 0.895   -8.748  1.00 25.17  ? 329 PHE B CA    1 
ATOM   5527 C  C     . PHE B 1 223 ? -12.926 -0.291  -7.820  1.00 26.01  ? 329 PHE B C     1 
ATOM   5528 O  O     . PHE B 1 223 ? -11.944 -1.017  -7.605  1.00 25.69  ? 329 PHE B O     1 
ATOM   5529 C  CB    . PHE B 1 223 ? -12.897 0.419   -10.220 1.00 24.95  ? 329 PHE B CB    1 
ATOM   5530 C  CG    . PHE B 1 223 ? -14.093 -0.421  -10.493 1.00 24.11  ? 329 PHE B CG    1 
ATOM   5531 C  CD1   . PHE B 1 223 ? -15.343 0.137   -10.446 1.00 24.36  ? 329 PHE B CD1   1 
ATOM   5532 C  CD2   . PHE B 1 223 ? -13.988 -1.797  -10.632 1.00 24.36  ? 329 PHE B CD2   1 
ATOM   5533 C  CE1   . PHE B 1 223 ? -16.494 -0.643  -10.613 1.00 25.61  ? 329 PHE B CE1   1 
ATOM   5534 C  CE2   . PHE B 1 223 ? -15.129 -2.583  -10.775 1.00 25.65  ? 329 PHE B CE2   1 
ATOM   5535 C  CZ    . PHE B 1 223 ? -16.402 -1.989  -10.779 1.00 25.56  ? 329 PHE B CZ    1 
ATOM   5536 N  N     . ASP B 1 224 ? -14.095 -0.533  -7.241  1.00 26.32  ? 330 ASP B N     1 
ATOM   5537 C  CA    . ASP B 1 224 ? -14.241 -1.620  -6.284  1.00 25.43  ? 330 ASP B CA    1 
ATOM   5538 C  C     . ASP B 1 224 ? -15.199 -2.718  -6.800  1.00 25.67  ? 330 ASP B C     1 
ATOM   5539 O  O     . ASP B 1 224 ? -16.397 -2.633  -6.631  1.00 24.48  ? 330 ASP B O     1 
ATOM   5540 C  CB    . ASP B 1 224 ? -14.727 -1.032  -4.965  1.00 27.41  ? 330 ASP B CB    1 
ATOM   5541 C  CG    . ASP B 1 224 ? -14.781 -2.074  -3.811  1.00 28.50  ? 330 ASP B CG    1 
ATOM   5542 O  OD1   . ASP B 1 224 ? -14.775 -3.308  -4.066  1.00 30.90  ? 330 ASP B OD1   1 
ATOM   5543 O  OD2   . ASP B 1 224 ? -14.813 -1.662  -2.612  1.00 30.57  ? 330 ASP B OD2   1 
ATOM   5544 N  N     . TYR B 1 225 ? -14.643 -3.774  -7.395  1.00 26.09  ? 331 TYR B N     1 
ATOM   5545 C  CA    . TYR B 1 225 ? -15.395 -4.837  -7.961  1.00 27.57  ? 331 TYR B CA    1 
ATOM   5546 C  C     . TYR B 1 225 ? -16.217 -5.587  -6.934  1.00 29.36  ? 331 TYR B C     1 
ATOM   5547 O  O     . TYR B 1 225 ? -17.339 -5.984  -7.217  1.00 31.65  ? 331 TYR B O     1 
ATOM   5548 C  CB    . TYR B 1 225 ? -14.500 -5.781  -8.830  1.00 28.77  ? 331 TYR B CB    1 
ATOM   5549 C  CG    . TYR B 1 225 ? -13.870 -6.921  -8.115  1.00 28.15  ? 331 TYR B CG    1 
ATOM   5550 C  CD1   . TYR B 1 225 ? -14.637 -8.097  -7.814  1.00 29.55  ? 331 TYR B CD1   1 
ATOM   5551 C  CD2   . TYR B 1 225 ? -12.525 -6.847  -7.699  1.00 28.70  ? 331 TYR B CD2   1 
ATOM   5552 C  CE1   . TYR B 1 225 ? -14.083 -9.162  -7.106  1.00 29.94  ? 331 TYR B CE1   1 
ATOM   5553 C  CE2   . TYR B 1 225 ? -11.964 -7.894  -6.967  1.00 28.67  ? 331 TYR B CE2   1 
ATOM   5554 C  CZ    . TYR B 1 225 ? -12.712 -9.045  -6.699  1.00 30.93  ? 331 TYR B CZ    1 
ATOM   5555 O  OH    . TYR B 1 225 ? -12.069 -10.025 -5.960  1.00 33.04  ? 331 TYR B OH    1 
ATOM   5556 N  N     . LYS B 1 226 ? -15.666 -5.796  -5.747  1.00 28.01  ? 332 LYS B N     1 
ATOM   5557 C  CA    . LYS B 1 226 ? -16.360 -6.588  -4.752  1.00 28.27  ? 332 LYS B CA    1 
ATOM   5558 C  C     . LYS B 1 226 ? -17.630 -5.955  -4.285  1.00 27.61  ? 332 LYS B C     1 
ATOM   5559 O  O     . LYS B 1 226 ? -18.623 -6.681  -3.963  1.00 28.00  ? 332 LYS B O     1 
ATOM   5560 C  CB    . LYS B 1 226 ? -15.482 -6.770  -3.469  1.00 28.89  ? 332 LYS B CB    1 
ATOM   5561 C  CG    . LYS B 1 226 ? -14.475 -7.829  -3.691  1.00 29.99  ? 332 LYS B CG    1 
ATOM   5562 C  CD    . LYS B 1 226 ? -13.573 -7.931  -2.525  1.00 33.90  ? 332 LYS B CD    1 
ATOM   5563 C  CE    . LYS B 1 226 ? -12.130 -8.261  -2.882  1.00 36.91  ? 332 LYS B CE    1 
ATOM   5564 N  NZ    . LYS B 1 226 ? -11.579 -8.810  -1.602  1.00 41.62  ? 332 LYS B NZ    1 
ATOM   5565 N  N     . ARG B 1 227 ? -17.583 -4.624  -4.177  1.00 24.93  ? 333 ARG B N     1 
ATOM   5566 C  CA    . ARG B 1 227 ? -18.796 -3.924  -3.909  1.00 26.29  ? 333 ARG B CA    1 
ATOM   5567 C  C     . ARG B 1 227 ? -19.903 -4.225  -5.031  1.00 27.85  ? 333 ARG B C     1 
ATOM   5568 O  O     . ARG B 1 227 ? -21.133 -4.514  -4.711  1.00 27.97  ? 333 ARG B O     1 
ATOM   5569 C  CB    . ARG B 1 227 ? -18.530 -2.459  -3.717  1.00 25.96  ? 333 ARG B CB    1 
ATOM   5570 C  CG    . ARG B 1 227 ? -19.773 -1.610  -3.470  1.00 26.00  ? 333 ARG B CG    1 
ATOM   5571 C  CD    . ARG B 1 227 ? -19.510 -0.125  -3.469  1.00 26.90  ? 333 ARG B CD    1 
ATOM   5572 N  NE    . ARG B 1 227 ? -20.786 0.529   -3.279  1.00 26.49  ? 333 ARG B NE    1 
ATOM   5573 C  CZ    . ARG B 1 227 ? -21.377 0.793   -2.133  1.00 28.63  ? 333 ARG B CZ    1 
ATOM   5574 N  NH1   . ARG B 1 227 ? -20.810 0.470   -0.965  1.00 30.81  ? 333 ARG B NH1   1 
ATOM   5575 N  NH2   . ARG B 1 227 ? -22.596 1.346   -2.130  1.00 29.41  ? 333 ARG B NH2   1 
ATOM   5576 N  N     . PHE B 1 228 ? -19.459 -4.165  -6.285  1.00 28.14  ? 334 PHE B N     1 
ATOM   5577 C  CA    . PHE B 1 228 ? -20.390 -4.342  -7.397  1.00 31.42  ? 334 PHE B CA    1 
ATOM   5578 C  C     . PHE B 1 228 ? -21.092 -5.734  -7.268  1.00 31.01  ? 334 PHE B C     1 
ATOM   5579 O  O     . PHE B 1 228 ? -22.283 -5.852  -7.408  1.00 32.05  ? 334 PHE B O     1 
ATOM   5580 C  CB    . PHE B 1 228 ? -19.685 -4.171  -8.739  1.00 31.93  ? 334 PHE B CB    1 
ATOM   5581 C  CG    . PHE B 1 228 ? -20.576 -4.438  -9.886  1.00 33.81  ? 334 PHE B CG    1 
ATOM   5582 C  CD1   . PHE B 1 228 ? -20.821 -5.734  -10.281 1.00 35.53  ? 334 PHE B CD1   1 
ATOM   5583 C  CD2   . PHE B 1 228 ? -21.286 -3.423  -10.508 1.00 35.34  ? 334 PHE B CD2   1 
ATOM   5584 C  CE1   . PHE B 1 228 ? -21.705 -6.001  -11.313 1.00 34.84  ? 334 PHE B CE1   1 
ATOM   5585 C  CE2   . PHE B 1 228 ? -22.175 -3.706  -11.550 1.00 34.42  ? 334 PHE B CE2   1 
ATOM   5586 C  CZ    . PHE B 1 228 ? -22.368 -4.976  -11.968 1.00 33.09  ? 334 PHE B CZ    1 
ATOM   5587 N  N     . ILE B 1 229 ? -20.331 -6.735  -6.877  1.00 30.70  ? 335 ILE B N     1 
ATOM   5588 C  CA    . ILE B 1 229 ? -20.849 -8.083  -6.746  1.00 30.45  ? 335 ILE B CA    1 
ATOM   5589 C  C     . ILE B 1 229 ? -21.827 -8.183  -5.553  1.00 34.03  ? 335 ILE B C     1 
ATOM   5590 O  O     . ILE B 1 229 ? -22.781 -8.910  -5.595  1.00 31.93  ? 335 ILE B O     1 
ATOM   5591 C  CB    . ILE B 1 229 ? -19.733 -9.116  -6.539  1.00 29.00  ? 335 ILE B CB    1 
ATOM   5592 C  CG1   . ILE B 1 229 ? -18.932 -9.278  -7.787  1.00 29.06  ? 335 ILE B CG1   1 
ATOM   5593 C  CG2   . ILE B 1 229 ? -20.282 -10.445 -6.045  1.00 29.56  ? 335 ILE B CG2   1 
ATOM   5594 C  CD1   . ILE B 1 229 ? -17.792 -10.276 -7.715  1.00 28.89  ? 335 ILE B CD1   1 
ATOM   5595 N  N     . LYS B 1 230 ? -21.610 -7.460  -4.468  1.00 36.69  ? 336 LYS B N     1 
ATOM   5596 C  CA    . LYS B 1 230 ? -22.608 -7.503  -3.394  1.00 39.68  ? 336 LYS B CA    1 
ATOM   5597 C  C     . LYS B 1 230 ? -23.993 -6.992  -3.838  1.00 40.60  ? 336 LYS B C     1 
ATOM   5598 O  O     . LYS B 1 230 ? -24.996 -7.428  -3.272  1.00 45.89  ? 336 LYS B O     1 
ATOM   5599 C  CB    . LYS B 1 230 ? -22.202 -6.662  -2.188  1.00 41.63  ? 336 LYS B CB    1 
ATOM   5600 C  CG    . LYS B 1 230 ? -20.988 -7.118  -1.476  1.00 43.48  ? 336 LYS B CG    1 
ATOM   5601 C  CD    . LYS B 1 230 ? -21.299 -8.219  -0.529  1.00 45.73  ? 336 LYS B CD    1 
ATOM   5602 C  CE    . LYS B 1 230 ? -19.949 -8.846  -0.111  1.00 48.42  ? 336 LYS B CE    1 
ATOM   5603 N  NZ    . LYS B 1 230 ? -20.144 -10.192 0.414   1.00 50.19  ? 336 LYS B NZ    1 
ATOM   5604 N  N     . PHE B 1 231 ? -24.045 -6.049  -4.771  1.00 39.11  ? 337 PHE B N     1 
ATOM   5605 C  CA    . PHE B 1 231 ? -25.278 -5.389  -5.127  1.00 40.85  ? 337 PHE B CA    1 
ATOM   5606 C  C     . PHE B 1 231 ? -25.729 -5.778  -6.552  1.00 43.94  ? 337 PHE B C     1 
ATOM   5607 O  O     . PHE B 1 231 ? -26.472 -5.060  -7.168  1.00 48.23  ? 337 PHE B O     1 
ATOM   5608 C  CB    . PHE B 1 231 ? -25.097 -3.888  -4.985  1.00 40.72  ? 337 PHE B CB    1 
ATOM   5609 C  CG    . PHE B 1 231 ? -24.742 -3.435  -3.573  1.00 41.47  ? 337 PHE B CG    1 
ATOM   5610 C  CD1   . PHE B 1 231 ? -25.553 -3.756  -2.471  1.00 40.86  ? 337 PHE B CD1   1 
ATOM   5611 C  CD2   . PHE B 1 231 ? -23.615 -2.645  -3.324  1.00 39.57  ? 337 PHE B CD2   1 
ATOM   5612 C  CE1   . PHE B 1 231 ? -25.194 -3.334  -1.165  1.00 41.62  ? 337 PHE B CE1   1 
ATOM   5613 C  CE2   . PHE B 1 231 ? -23.308 -2.179  -2.043  1.00 37.72  ? 337 PHE B CE2   1 
ATOM   5614 C  CZ    . PHE B 1 231 ? -24.063 -2.534  -0.976  1.00 39.06  ? 337 PHE B CZ    1 
ATOM   5615 N  N     . ALA B 1 232 ? -25.289 -6.938  -7.051  1.00 45.28  ? 338 ALA B N     1 
ATOM   5616 C  CA    . ALA B 1 232 ? -25.686 -7.457  -8.340  1.00 44.96  ? 338 ALA B CA    1 
ATOM   5617 C  C     . ALA B 1 232 ? -26.797 -8.432  -8.182  1.00 48.29  ? 338 ALA B C     1 
ATOM   5618 O  O     . ALA B 1 232 ? -26.898 -9.117  -7.175  1.00 47.30  ? 338 ALA B O     1 
ATOM   5619 C  CB    . ALA B 1 232 ? -24.536 -8.184  -9.028  1.00 46.89  ? 338 ALA B CB    1 
ATOM   5620 N  N     . ARG B 1 233 ? -27.621 -8.560  -9.220  1.00 51.97  ? 339 ARG B N     1 
ATOM   5621 C  CA    . ARG B 1 233 ? -28.798 -9.369  -9.139  1.00 50.15  ? 339 ARG B CA    1 
ATOM   5622 C  C     . ARG B 1 233 ? -29.297 -9.707  -10.513 1.00 50.86  ? 339 ARG B C     1 
ATOM   5623 O  O     . ARG B 1 233 ? -29.121 -8.923  -11.457 1.00 49.32  ? 339 ARG B O     1 
ATOM   5624 C  CB    . ARG B 1 233 ? -29.827 -8.575  -8.384  1.00 53.41  ? 339 ARG B CB    1 
ATOM   5625 C  CG    . ARG B 1 233 ? -30.729 -9.470  -7.603  1.00 59.17  ? 339 ARG B CG    1 
ATOM   5626 C  CD    . ARG B 1 233 ? -31.669 -8.665  -6.733  1.00 61.18  ? 339 ARG B CD    1 
ATOM   5627 N  NE    . ARG B 1 233 ? -32.951 -9.345  -6.769  1.00 62.85  ? 339 ARG B NE    1 
ATOM   5628 C  CZ    . ARG B 1 233 ? -33.227 -10.464 -6.112  1.00 63.79  ? 339 ARG B CZ    1 
ATOM   5629 N  NH1   . ARG B 1 233 ? -32.336 -11.098 -5.358  1.00 67.41  ? 339 ARG B NH1   1 
ATOM   5630 N  NH2   . ARG B 1 233 ? -34.402 -10.995 -6.269  1.00 64.28  ? 339 ARG B NH2   1 
ATOM   5631 N  N     . VAL B 1 234 ? -29.902 -10.876 -10.656 1.00 51.01  ? 340 VAL B N     1 
ATOM   5632 C  CA    . VAL B 1 234 ? -30.491 -11.253 -11.955 1.00 47.68  ? 340 VAL B CA    1 
ATOM   5633 C  C     . VAL B 1 234 ? -31.950 -10.863 -11.965 1.00 44.39  ? 340 VAL B C     1 
ATOM   5634 O  O     . VAL B 1 234 ? -32.648 -11.273 -11.102 1.00 45.09  ? 340 VAL B O     1 
ATOM   5635 C  CB    . VAL B 1 234 ? -30.333 -12.759 -12.273 1.00 49.35  ? 340 VAL B CB    1 
ATOM   5636 C  CG1   . VAL B 1 234 ? -30.943 -13.103 -13.647 1.00 51.41  ? 340 VAL B CG1   1 
ATOM   5637 C  CG2   . VAL B 1 234 ? -28.869 -13.118 -12.343 1.00 49.69  ? 340 VAL B CG2   1 
ATOM   5638 N  N     . CYS B 1 235 ? -32.371 -10.068 -12.933 1.00 47.12  ? 341 CYS B N     1 
ATOM   5639 C  CA    . CYS B 1 235 ? -33.805 -9.672  -13.164 1.00 51.32  ? 341 CYS B CA    1 
ATOM   5640 C  C     . CYS B 1 235 ? -34.285 -9.912  -14.616 1.00 51.04  ? 341 CYS B C     1 
ATOM   5641 O  O     . CYS B 1 235 ? -33.473 -9.926  -15.557 1.00 51.46  ? 341 CYS B O     1 
ATOM   5642 C  CB    . CYS B 1 235 ? -34.059 -8.192  -12.820 1.00 49.87  ? 341 CYS B CB    1 
ATOM   5643 S  SG    . CYS B 1 235 ? -33.594 -7.696  -11.135 1.00 52.28  ? 341 CYS B SG    1 
ATOM   5644 N  N     . GLU B 1 236 ? -35.599 -10.083 -14.794 1.00 54.08  ? 342 GLU B N     1 
ATOM   5645 C  CA    . GLU B 1 236 ? -36.175 -10.166 -16.147 1.00 59.95  ? 342 GLU B CA    1 
ATOM   5646 C  C     . GLU B 1 236 ? -36.198 -8.778  -16.758 1.00 54.63  ? 342 GLU B C     1 
ATOM   5647 O  O     . GLU B 1 236 ? -36.659 -7.862  -16.137 1.00 53.64  ? 342 GLU B O     1 
ATOM   5648 C  CB    . GLU B 1 236 ? -37.593 -10.773 -16.216 1.00 65.98  ? 342 GLU B CB    1 
ATOM   5649 C  CG    . GLU B 1 236 ? -37.928 -11.166 -17.665 1.00 72.38  ? 342 GLU B CG    1 
ATOM   5650 C  CD    . GLU B 1 236 ? -39.411 -11.231 -18.005 1.00 76.22  ? 342 GLU B CD    1 
ATOM   5651 O  OE1   . GLU B 1 236 ? -40.073 -11.995 -17.275 1.00 79.66  ? 342 GLU B OE1   1 
ATOM   5652 O  OE2   . GLU B 1 236 ? -39.886 -10.572 -18.996 1.00 75.39  ? 342 GLU B OE2   1 
ATOM   5653 N  N     . VAL B 1 237 ? -35.661 -8.641  -17.954 1.00 57.08  ? 343 VAL B N     1 
ATOM   5654 C  CA    . VAL B 1 237 ? -35.737 -7.401  -18.744 1.00 63.05  ? 343 VAL B CA    1 
ATOM   5655 C  C     . VAL B 1 237 ? -35.988 -7.851  -20.214 1.00 69.94  ? 343 VAL B C     1 
ATOM   5656 O  O     . VAL B 1 237 ? -35.173 -8.658  -20.756 1.00 73.05  ? 343 VAL B O     1 
ATOM   5657 C  CB    . VAL B 1 237 ? -34.407 -6.581  -18.660 1.00 62.08  ? 343 VAL B CB    1 
ATOM   5658 C  CG1   . VAL B 1 237 ? -34.510 -5.259  -19.419 1.00 61.86  ? 343 VAL B CG1   1 
ATOM   5659 C  CG2   . VAL B 1 237 ? -33.952 -6.354  -17.210 1.00 63.19  ? 343 VAL B CG2   1 
ATOM   5660 N  N     . ASP B 1 238 ? -37.100 -7.384  -20.819 1.00 73.20  ? 344 ASP B N     1 
ATOM   5661 C  CA    . ASP B 1 238 ? -37.510 -7.739  -22.217 1.00 73.93  ? 344 ASP B CA    1 
ATOM   5662 C  C     . ASP B 1 238 ? -37.389 -9.214  -22.491 1.00 77.49  ? 344 ASP B C     1 
ATOM   5663 O  O     . ASP B 1 238 ? -36.693 -9.648  -23.424 1.00 75.76  ? 344 ASP B O     1 
ATOM   5664 C  CB    . ASP B 1 238 ? -36.736 -6.935  -23.257 1.00 72.30  ? 344 ASP B CB    1 
ATOM   5665 C  CG    . ASP B 1 238 ? -36.876 -5.410  -23.005 1.00 79.53  ? 344 ASP B CG    1 
ATOM   5666 O  OD1   . ASP B 1 238 ? -38.022 -4.920  -22.781 1.00 80.25  ? 344 ASP B OD1   1 
ATOM   5667 O  OD2   . ASP B 1 238 ? -35.859 -4.667  -23.006 1.00 81.46  ? 344 ASP B OD2   1 
ATOM   5668 N  N     . ASN B 1 239 ? -38.046 -9.985  -21.616 1.00 81.06  ? 345 ASN B N     1 
ATOM   5669 C  CA    . ASN B 1 239 ? -38.133 -11.460 -21.714 1.00 84.02  ? 345 ASN B CA    1 
ATOM   5670 C  C     . ASN B 1 239 ? -36.805 -12.235 -21.673 1.00 82.63  ? 345 ASN B C     1 
ATOM   5671 O  O     . ASN B 1 239 ? -36.707 -13.361 -22.147 1.00 84.93  ? 345 ASN B O     1 
ATOM   5672 C  CB    . ASN B 1 239 ? -39.009 -11.831 -22.908 1.00 86.54  ? 345 ASN B CB    1 
ATOM   5673 C  CG    . ASN B 1 239 ? -40.422 -11.271 -22.775 1.00 86.65  ? 345 ASN B CG    1 
ATOM   5674 O  OD1   . ASN B 1 239 ? -41.177 -11.661 -21.872 1.00 94.90  ? 345 ASN B OD1   1 
ATOM   5675 N  ND2   . ASN B 1 239 ? -40.749 -10.297 -23.600 1.00 78.56  ? 345 ASN B ND2   1 
ATOM   5676 N  N     . GLU B 1 240 ? -35.804 -11.651 -21.042 1.00 83.28  ? 346 GLU B N     1 
ATOM   5677 C  CA    . GLU B 1 240 ? -34.489 -12.253 -20.949 1.00 80.90  ? 346 GLU B CA    1 
ATOM   5678 C  C     . GLU B 1 240 ? -33.949 -12.029 -19.531 1.00 75.78  ? 346 GLU B C     1 
ATOM   5679 O  O     . GLU B 1 240 ? -34.064 -10.909 -19.009 1.00 73.90  ? 346 GLU B O     1 
ATOM   5680 C  CB    . GLU B 1 240 ? -33.603 -11.586 -21.983 1.00 83.74  ? 346 GLU B CB    1 
ATOM   5681 C  CG    . GLU B 1 240 ? -32.261 -12.284 -22.155 1.00 85.47  ? 346 GLU B CG    1 
ATOM   5682 C  CD    . GLU B 1 240 ? -31.506 -11.764 -23.360 1.00 80.19  ? 346 GLU B CD    1 
ATOM   5683 O  OE1   . GLU B 1 240 ? -32.116 -11.769 -24.418 1.00 82.79  ? 346 GLU B OE1   1 
ATOM   5684 O  OE2   . GLU B 1 240 ? -30.335 -11.333 -23.265 1.00 71.52  ? 346 GLU B OE2   1 
ATOM   5685 N  N     . LEU B 1 241 ? -33.390 -13.072 -18.911 1.00 67.01  ? 347 LEU B N     1 
ATOM   5686 C  CA    . LEU B 1 241 ? -32.767 -12.883 -17.604 1.00 69.52  ? 347 LEU B CA    1 
ATOM   5687 C  C     . LEU B 1 241 ? -31.349 -12.278 -17.687 1.00 68.16  ? 347 LEU B C     1 
ATOM   5688 O  O     . LEU B 1 241 ? -30.481 -12.807 -18.373 1.00 71.28  ? 347 LEU B O     1 
ATOM   5689 C  CB    . LEU B 1 241 ? -32.718 -14.197 -16.864 1.00 68.58  ? 347 LEU B CB    1 
ATOM   5690 C  CG    . LEU B 1 241 ? -34.079 -14.831 -16.628 1.00 63.71  ? 347 LEU B CG    1 
ATOM   5691 C  CD1   . LEU B 1 241 ? -33.891 -16.150 -15.920 1.00 60.56  ? 347 LEU B CD1   1 
ATOM   5692 C  CD2   . LEU B 1 241 ? -34.953 -13.947 -15.774 1.00 63.13  ? 347 LEU B CD2   1 
ATOM   5693 N  N     . ARG B 1 242 ? -31.143 -11.174 -16.978 1.00 64.19  ? 348 ARG B N     1 
ATOM   5694 C  CA    . ARG B 1 242 ? -29.943 -10.321 -17.086 1.00 59.85  ? 348 ARG B CA    1 
ATOM   5695 C  C     . ARG B 1 242 ? -29.348 -9.870  -15.735 1.00 51.90  ? 348 ARG B C     1 
ATOM   5696 O  O     . ARG B 1 242 ? -30.063 -9.761  -14.733 1.00 45.54  ? 348 ARG B O     1 
ATOM   5697 C  CB    . ARG B 1 242 ? -30.327 -9.069  -17.838 1.00 62.84  ? 348 ARG B CB    1 
ATOM   5698 C  CG    . ARG B 1 242 ? -30.774 -9.371  -19.246 1.00 66.78  ? 348 ARG B CG    1 
ATOM   5699 C  CD    . ARG B 1 242 ? -30.381 -8.240  -20.151 1.00 68.53  ? 348 ARG B CD    1 
ATOM   5700 N  NE    . ARG B 1 242 ? -30.726 -8.575  -21.526 1.00 72.36  ? 348 ARG B NE    1 
ATOM   5701 C  CZ    . ARG B 1 242 ? -31.588 -7.920  -22.307 1.00 72.27  ? 348 ARG B CZ    1 
ATOM   5702 N  NH1   . ARG B 1 242 ? -31.812 -8.411  -23.504 1.00 76.84  ? 348 ARG B NH1   1 
ATOM   5703 N  NH2   . ARG B 1 242 ? -32.257 -6.838  -21.916 1.00 70.37  ? 348 ARG B NH2   1 
ATOM   5704 N  N     . ILE B 1 243 ? -28.060 -9.535  -15.733 1.00 45.19  ? 349 ILE B N     1 
ATOM   5705 C  CA    . ILE B 1 243 ? -27.408 -9.074  -14.515 1.00 40.50  ? 349 ILE B CA    1 
ATOM   5706 C  C     . ILE B 1 243 ? -27.719 -7.600  -14.392 1.00 39.53  ? 349 ILE B C     1 
ATOM   5707 O  O     . ILE B 1 243 ? -27.533 -6.875  -15.347 1.00 38.47  ? 349 ILE B O     1 
ATOM   5708 C  CB    . ILE B 1 243 ? -25.891 -9.294  -14.503 1.00 40.23  ? 349 ILE B CB    1 
ATOM   5709 C  CG1   . ILE B 1 243 ? -25.539 -10.763 -14.798 1.00 38.85  ? 349 ILE B CG1   1 
ATOM   5710 C  CG2   . ILE B 1 243 ? -25.319 -8.917  -13.128 1.00 40.19  ? 349 ILE B CG2   1 
ATOM   5711 C  CD1   . ILE B 1 243 ? -24.085 -11.155 -14.672 1.00 36.26  ? 349 ILE B CD1   1 
ATOM   5712 N  N     . CYS B 1 244 ? -28.197 -7.190  -13.225 1.00 37.12  ? 350 CYS B N     1 
ATOM   5713 C  CA    . CYS B 1 244 ? -28.632 -5.837  -12.946 1.00 39.97  ? 350 CYS B CA    1 
ATOM   5714 C  C     . CYS B 1 244 ? -27.948 -5.399  -11.642 1.00 40.03  ? 350 CYS B C     1 
ATOM   5715 O  O     . CYS B 1 244 ? -27.463 -6.245  -10.875 1.00 41.10  ? 350 CYS B O     1 
ATOM   5716 C  CB    . CYS B 1 244 ? -30.150 -5.814  -12.709 1.00 44.71  ? 350 CYS B CB    1 
ATOM   5717 S  SG    . CYS B 1 244 ? -31.247 -6.368  -14.080 1.00 49.35  ? 350 CYS B SG    1 
ATOM   5718 N  N     . ALA B 1 245 ? -27.942 -4.097  -11.384 1.00 37.48  ? 351 ALA B N     1 
ATOM   5719 C  CA    . ALA B 1 245 ? -27.238 -3.526  -10.262 1.00 37.67  ? 351 ALA B CA    1 
ATOM   5720 C  C     . ALA B 1 245 ? -28.144 -2.653  -9.430  1.00 37.70  ? 351 ALA B C     1 
ATOM   5721 O  O     . ALA B 1 245 ? -29.121 -2.114  -9.964  1.00 36.27  ? 351 ALA B O     1 
ATOM   5722 C  CB    . ALA B 1 245 ? -26.107 -2.687  -10.779 1.00 39.77  ? 351 ALA B CB    1 
ATOM   5723 N  N     . ARG B 1 246 ? -27.848 -2.486  -8.127  1.00 36.86  ? 352 ARG B N     1 
ATOM   5724 C  CA    . ARG B 1 246 ? -28.632 -1.563  -7.317  1.00 37.39  ? 352 ARG B CA    1 
ATOM   5725 C  C     . ARG B 1 246 ? -28.551 -0.187  -7.958  1.00 36.83  ? 352 ARG B C     1 
ATOM   5726 O  O     . ARG B 1 246 ? -27.490 0.223   -8.373  1.00 34.22  ? 352 ARG B O     1 
ATOM   5727 C  CB    . ARG B 1 246 ? -28.148 -1.396  -5.863  1.00 38.74  ? 352 ARG B CB    1 
ATOM   5728 C  CG    . ARG B 1 246 ? -28.885 -2.245  -4.809  1.00 41.00  ? 352 ARG B CG    1 
ATOM   5729 C  CD    . ARG B 1 246 ? -30.351 -1.857  -4.512  1.00 40.65  ? 352 ARG B CD    1 
ATOM   5730 N  NE    . ARG B 1 246 ? -30.576 -0.484  -4.076  1.00 39.37  ? 352 ARG B NE    1 
ATOM   5731 C  CZ    . ARG B 1 246 ? -30.301 -0.021  -2.884  1.00 37.36  ? 352 ARG B CZ    1 
ATOM   5732 N  NH1   . ARG B 1 246 ? -30.591 1.191   -2.604  1.00 39.01  ? 352 ARG B NH1   1 
ATOM   5733 N  NH2   . ARG B 1 246 ? -29.721 -0.740  -1.968  1.00 38.16  ? 352 ARG B NH2   1 
ATOM   5734 N  N     . ASP B 1 247 ? -29.704 0.496   -7.988  1.00 36.78  ? 353 ASP B N     1 
ATOM   5735 C  CA    . ASP B 1 247 ? -29.845 1.876   -8.362  1.00 35.50  ? 353 ASP B CA    1 
ATOM   5736 C  C     . ASP B 1 247 ? -28.739 2.815   -7.873  1.00 37.02  ? 353 ASP B C     1 
ATOM   5737 O  O     . ASP B 1 247 ? -28.187 3.582   -8.646  1.00 37.10  ? 353 ASP B O     1 
ATOM   5738 C  CB    . ASP B 1 247 ? -31.256 2.388   -7.989  1.00 36.25  ? 353 ASP B CB    1 
ATOM   5739 C  CG    . ASP B 1 247 ? -31.640 2.216   -6.485  1.00 36.40  ? 353 ASP B CG    1 
ATOM   5740 O  OD1   . ASP B 1 247 ? -30.904 1.611   -5.647  1.00 35.32  ? 353 ASP B OD1   1 
ATOM   5741 O  OD2   . ASP B 1 247 ? -32.764 2.708   -6.190  1.00 35.96  ? 353 ASP B OD2   1 
ATOM   5742 N  N     . LYS B 1 248 ? -28.401 2.748   -6.587  1.00 37.22  ? 354 LYS B N     1 
ATOM   5743 C  CA    . LYS B 1 248 ? -27.359 3.631   -5.982  1.00 34.49  ? 354 LYS B CA    1 
ATOM   5744 C  C     . LYS B 1 248 ? -25.960 3.416   -6.547  1.00 33.64  ? 354 LYS B C     1 
ATOM   5745 O  O     . LYS B 1 248 ? -25.116 4.228   -6.287  1.00 38.11  ? 354 LYS B O     1 
ATOM   5746 C  CB    . LYS B 1 248 ? -27.294 3.476   -4.441  1.00 33.84  ? 354 LYS B CB    1 
ATOM   5747 C  CG    . LYS B 1 248 ? -26.913 2.064   -4.005  1.00 34.98  ? 354 LYS B CG    1 
ATOM   5748 C  CD    . LYS B 1 248 ? -26.888 1.833   -2.501  1.00 36.12  ? 354 LYS B CD    1 
ATOM   5749 C  CE    . LYS B 1 248 ? -26.578 0.361   -2.310  1.00 37.71  ? 354 LYS B CE    1 
ATOM   5750 N  NZ    . LYS B 1 248 ? -26.286 -0.065  -0.930  1.00 42.32  ? 354 LYS B NZ    1 
ATOM   5751 N  N     . GLU B 1 249 ? -25.690 2.317   -7.249  1.00 32.66  ? 355 GLU B N     1 
ATOM   5752 C  CA    . GLU B 1 249 ? -24.415 2.091   -7.947  1.00 33.14  ? 355 GLU B CA    1 
ATOM   5753 C  C     . GLU B 1 249 ? -24.183 2.845   -9.270  1.00 31.90  ? 355 GLU B C     1 
ATOM   5754 O  O     . GLU B 1 249 ? -23.071 2.757   -9.858  1.00 27.83  ? 355 GLU B O     1 
ATOM   5755 C  CB    . GLU B 1 249 ? -24.263 0.602   -8.247  1.00 37.13  ? 355 GLU B CB    1 
ATOM   5756 C  CG    . GLU B 1 249 ? -24.156 -0.275  -7.008  1.00 42.27  ? 355 GLU B CG    1 
ATOM   5757 C  CD    . GLU B 1 249 ? -23.002 0.182   -6.094  1.00 44.78  ? 355 GLU B CD    1 
ATOM   5758 O  OE1   . GLU B 1 249 ? -21.783 -0.084  -6.440  1.00 55.66  ? 355 GLU B OE1   1 
ATOM   5759 O  OE2   . GLU B 1 249 ? -23.344 0.852   -5.099  1.00 43.34  ? 355 GLU B OE2   1 
ATOM   5760 N  N     . VAL B 1 250 ? -25.197 3.569   -9.755  1.00 30.32  ? 356 VAL B N     1 
ATOM   5761 C  CA    . VAL B 1 250 ? -25.072 4.194   -11.026 1.00 30.85  ? 356 VAL B CA    1 
ATOM   5762 C  C     . VAL B 1 250 ? -23.843 5.143   -11.139 1.00 30.81  ? 356 VAL B C     1 
ATOM   5763 O  O     . VAL B 1 250 ? -23.118 5.080   -12.162 1.00 30.20  ? 356 VAL B O     1 
ATOM   5764 C  CB    . VAL B 1 250 ? -26.382 4.893   -11.452 1.00 31.57  ? 356 VAL B CB    1 
ATOM   5765 C  CG1   . VAL B 1 250 ? -26.792 6.034   -10.531 1.00 30.46  ? 356 VAL B CG1   1 
ATOM   5766 C  CG2   . VAL B 1 250 ? -26.263 5.386   -12.904 1.00 32.87  ? 356 VAL B CG2   1 
ATOM   5767 N  N     . GLY B 1 251 ? -23.612 5.986   -10.133 1.00 29.49  ? 357 GLY B N     1 
ATOM   5768 C  CA    . GLY B 1 251 ? -22.416 6.809   -10.038 1.00 28.38  ? 357 GLY B CA    1 
ATOM   5769 C  C     . GLY B 1 251 ? -21.141 5.982   -10.168 1.00 28.12  ? 357 GLY B C     1 
ATOM   5770 O  O     . GLY B 1 251 ? -20.199 6.353   -10.897 1.00 30.00  ? 357 GLY B O     1 
ATOM   5771 N  N     . ASN B 1 252 ? -21.101 4.837   -9.514  1.00 27.93  ? 358 ASN B N     1 
ATOM   5772 C  CA    . ASN B 1 252 ? -19.864 4.015   -9.521  1.00 27.92  ? 358 ASN B CA    1 
ATOM   5773 C  C     . ASN B 1 252 ? -19.627 3.440   -10.911 1.00 28.29  ? 358 ASN B C     1 
ATOM   5774 O  O     . ASN B 1 252 ? -18.487 3.235   -11.267 1.00 27.54  ? 358 ASN B O     1 
ATOM   5775 C  CB    . ASN B 1 252 ? -19.855 2.878   -8.439  1.00 27.05  ? 358 ASN B CB    1 
ATOM   5776 C  CG    . ASN B 1 252 ? -19.941 3.411   -6.979  1.00 29.49  ? 358 ASN B CG    1 
ATOM   5777 O  OD1   . ASN B 1 252 ? -19.337 4.509   -6.621  1.00 29.75  ? 358 ASN B OD1   1 
ATOM   5778 N  ND2   . ASN B 1 252 ? -20.612 2.613   -6.091  1.00 26.73  ? 358 ASN B ND2   1 
ATOM   5779 N  N     . LEU B 1 253 ? -20.673 3.160   -11.691 1.00 29.39  ? 359 LEU B N     1 
ATOM   5780 C  CA    . LEU B 1 253 ? -20.488 2.636   -13.042 1.00 30.84  ? 359 LEU B CA    1 
ATOM   5781 C  C     . LEU B 1 253 ? -19.999 3.664   -14.032 1.00 29.01  ? 359 LEU B C     1 
ATOM   5782 O  O     . LEU B 1 253 ? -19.100 3.396   -14.803 1.00 26.66  ? 359 LEU B O     1 
ATOM   5783 C  CB    . LEU B 1 253 ? -21.725 1.961   -13.551 1.00 33.94  ? 359 LEU B CB    1 
ATOM   5784 C  CG    . LEU B 1 253 ? -22.378 0.926   -12.628 1.00 37.85  ? 359 LEU B CG    1 
ATOM   5785 C  CD1   . LEU B 1 253 ? -23.358 0.059   -13.398 1.00 40.07  ? 359 LEU B CD1   1 
ATOM   5786 C  CD2   . LEU B 1 253 ? -21.410 0.012   -11.870 1.00 40.83  ? 359 LEU B CD2   1 
ATOM   5787 N  N     . TYR B 1 254 ? -20.499 4.882   -13.941 1.00 29.32  ? 360 TYR B N     1 
ATOM   5788 C  CA    . TYR B 1 254 ? -19.883 5.945   -14.721 1.00 29.71  ? 360 TYR B CA    1 
ATOM   5789 C  C     . TYR B 1 254 ? -18.375 6.048   -14.368 1.00 28.78  ? 360 TYR B C     1 
ATOM   5790 O  O     . TYR B 1 254 ? -17.544 6.150   -15.257 1.00 26.20  ? 360 TYR B O     1 
ATOM   5791 C  CB    . TYR B 1 254 ? -20.620 7.287   -14.544 1.00 31.06  ? 360 TYR B CB    1 
ATOM   5792 C  CG    . TYR B 1 254 ? -21.845 7.460   -15.406 1.00 33.01  ? 360 TYR B CG    1 
ATOM   5793 C  CD1   . TYR B 1 254 ? -21.700 7.853   -16.783 1.00 34.30  ? 360 TYR B CD1   1 
ATOM   5794 C  CD2   . TYR B 1 254 ? -23.150 7.213   -14.923 1.00 32.78  ? 360 TYR B CD2   1 
ATOM   5795 C  CE1   . TYR B 1 254 ? -22.846 7.972   -17.633 1.00 35.18  ? 360 TYR B CE1   1 
ATOM   5796 C  CE2   . TYR B 1 254 ? -24.285 7.390   -15.777 1.00 35.36  ? 360 TYR B CE2   1 
ATOM   5797 C  CZ    . TYR B 1 254 ? -24.119 7.757   -17.138 1.00 33.59  ? 360 TYR B CZ    1 
ATOM   5798 O  OH    . TYR B 1 254 ? -25.173 7.958   -17.959 1.00 34.02  ? 360 TYR B OH    1 
ATOM   5799 N  N     . ASP B 1 255 ? -18.050 5.976   -13.080 1.00 27.85  ? 361 ASP B N     1 
ATOM   5800 C  CA    . ASP B 1 255 ? -16.658 6.016   -12.637 1.00 27.99  ? 361 ASP B CA    1 
ATOM   5801 C  C     . ASP B 1 255 ? -15.784 4.858   -13.114 1.00 26.96  ? 361 ASP B C     1 
ATOM   5802 O  O     . ASP B 1 255 ? -14.597 5.032   -13.389 1.00 26.55  ? 361 ASP B O     1 
ATOM   5803 C  CB    . ASP B 1 255 ? -16.580 6.136   -11.120 1.00 28.89  ? 361 ASP B CB    1 
ATOM   5804 C  CG    . ASP B 1 255 ? -16.773 7.541   -10.648 1.00 31.50  ? 361 ASP B CG    1 
ATOM   5805 O  OD1   . ASP B 1 255 ? -16.706 8.515   -11.464 1.00 37.42  ? 361 ASP B OD1   1 
ATOM   5806 O  OD2   . ASP B 1 255 ? -16.902 7.707   -9.423  1.00 36.56  ? 361 ASP B OD2   1 
ATOM   5807 N  N     . MET B 1 256 ? -16.376 3.688   -13.255 1.00 27.40  ? 362 MET B N     1 
ATOM   5808 C  CA    . MET B 1 256 ? -15.647 2.507   -13.787 1.00 27.51  ? 362 MET B CA    1 
ATOM   5809 C  C     . MET B 1 256 ? -15.170 2.783   -15.203 1.00 27.53  ? 362 MET B C     1 
ATOM   5810 O  O     . MET B 1 256 ? -14.032 2.450   -15.548 1.00 26.72  ? 362 MET B O     1 
ATOM   5811 C  CB    . MET B 1 256 ? -16.549 1.264   -13.849 1.00 28.14  ? 362 MET B CB    1 
ATOM   5812 C  CG    . MET B 1 256 ? -15.730 -0.018  -14.069 1.00 28.11  ? 362 MET B CG    1 
ATOM   5813 S  SD    . MET B 1 256 ? -16.708 -1.449  -14.602 1.00 27.69  ? 362 MET B SD    1 
ATOM   5814 C  CE    . MET B 1 256 ? -16.831 -0.978  -16.363 1.00 30.36  ? 362 MET B CE    1 
ATOM   5815 N  N     . PHE B 1 257 ? -16.023 3.428   -16.009 1.00 28.10  ? 363 PHE B N     1 
ATOM   5816 C  CA    . PHE B 1 257 ? -15.653 3.733   -17.414 1.00 27.70  ? 363 PHE B CA    1 
ATOM   5817 C  C     . PHE B 1 257 ? -14.647 4.904   -17.497 1.00 27.06  ? 363 PHE B C     1 
ATOM   5818 O  O     . PHE B 1 257 ? -13.777 4.947   -18.403 1.00 26.05  ? 363 PHE B O     1 
ATOM   5819 C  CB    . PHE B 1 257 ? -16.897 3.884   -18.334 1.00 28.02  ? 363 PHE B CB    1 
ATOM   5820 C  CG    . PHE B 1 257 ? -17.551 2.573   -18.640 1.00 27.15  ? 363 PHE B CG    1 
ATOM   5821 C  CD1   . PHE B 1 257 ? -17.022 1.745   -19.656 1.00 28.16  ? 363 PHE B CD1   1 
ATOM   5822 C  CD2   . PHE B 1 257 ? -18.694 2.168   -18.010 1.00 26.21  ? 363 PHE B CD2   1 
ATOM   5823 C  CE1   . PHE B 1 257 ? -17.601 0.508   -19.958 1.00 26.50  ? 363 PHE B CE1   1 
ATOM   5824 C  CE2   . PHE B 1 257 ? -19.264 0.926   -18.297 1.00 25.83  ? 363 PHE B CE2   1 
ATOM   5825 C  CZ    . PHE B 1 257 ? -18.704 0.090   -19.248 1.00 26.25  ? 363 PHE B CZ    1 
ATOM   5826 N  N     . HIS B 1 258 ? -14.770 5.822   -16.549 1.00 26.18  ? 364 HIS B N     1 
ATOM   5827 C  CA    . HIS B 1 258 ? -13.832 6.921   -16.399 1.00 25.91  ? 364 HIS B CA    1 
ATOM   5828 C  C     . HIS B 1 258 ? -12.433 6.340   -16.067 1.00 26.38  ? 364 HIS B C     1 
ATOM   5829 O  O     . HIS B 1 258 ? -11.457 6.759   -16.616 1.00 28.72  ? 364 HIS B O     1 
ATOM   5830 C  CB    . HIS B 1 258 ? -14.268 7.934   -15.343 1.00 24.40  ? 364 HIS B CB    1 
ATOM   5831 C  CG    . HIS B 1 258 ? -13.290 9.055   -15.199 1.00 26.28  ? 364 HIS B CG    1 
ATOM   5832 N  ND1   . HIS B 1 258 ? -13.435 10.279  -15.832 1.00 27.58  ? 364 HIS B ND1   1 
ATOM   5833 C  CD2   . HIS B 1 258 ? -12.127 9.135   -14.510 1.00 26.43  ? 364 HIS B CD2   1 
ATOM   5834 C  CE1   . HIS B 1 258 ? -12.403 11.050  -15.532 1.00 27.95  ? 364 HIS B CE1   1 
ATOM   5835 N  NE2   . HIS B 1 258 ? -11.594 10.378  -14.730 1.00 26.22  ? 364 HIS B NE2   1 
ATOM   5836 N  N     . THR B 1 259 ? -12.371 5.371   -15.185 1.00 26.18  ? 365 THR B N     1 
ATOM   5837 C  CA    . THR B 1 259 ? -11.106 4.695   -14.835 1.00 26.99  ? 365 THR B CA    1 
ATOM   5838 C  C     . THR B 1 259 ? -10.435 4.057   -16.043 1.00 26.31  ? 365 THR B C     1 
ATOM   5839 O  O     . THR B 1 259 ? -9.245  4.249   -16.322 1.00 26.05  ? 365 THR B O     1 
ATOM   5840 C  CB    . THR B 1 259 ? -11.406 3.598   -13.722 1.00 26.98  ? 365 THR B CB    1 
ATOM   5841 O  OG1   . THR B 1 259 ? -11.782 4.261   -12.539 1.00 25.75  ? 365 THR B OG1   1 
ATOM   5842 C  CG2   . THR B 1 259 ? -10.248 2.659   -13.423 1.00 26.00  ? 365 THR B CG2   1 
ATOM   5843 N  N     . ARG B 1 260 ? -11.232 3.336   -16.808 1.00 27.77  ? 366 ARG B N     1 
ATOM   5844 C  CA    . ARG B 1 260 ? -10.740 2.710   -18.017 1.00 27.04  ? 366 ARG B CA    1 
ATOM   5845 C  C     . ARG B 1 260 ? -10.133 3.715   -18.948 1.00 27.17  ? 366 ARG B C     1 
ATOM   5846 O  O     . ARG B 1 260 ? -9.045  3.532   -19.434 1.00 26.39  ? 366 ARG B O     1 
ATOM   5847 C  CB    . ARG B 1 260 ? -11.857 1.917   -18.674 1.00 27.91  ? 366 ARG B CB    1 
ATOM   5848 C  CG    . ARG B 1 260 ? -11.526 1.304   -20.020 1.00 27.39  ? 366 ARG B CG    1 
ATOM   5849 C  CD    . ARG B 1 260 ? -12.698 0.423   -20.471 1.00 27.76  ? 366 ARG B CD    1 
ATOM   5850 N  NE    . ARG B 1 260 ? -12.436 -0.157  -21.786 1.00 28.84  ? 366 ARG B NE    1 
ATOM   5851 C  CZ    . ARG B 1 260 ? -12.541 0.498   -22.956 1.00 28.91  ? 366 ARG B CZ    1 
ATOM   5852 N  NH1   . ARG B 1 260 ? -12.910 1.757   -23.012 1.00 29.57  ? 366 ARG B NH1   1 
ATOM   5853 N  NH2   . ARG B 1 260 ? -12.233 -0.098  -24.098 1.00 26.96  ? 366 ARG B NH2   1 
ATOM   5854 N  N     . ASN B 1 261 ? -10.808 4.809   -19.168 1.00 27.69  ? 367 ASN B N     1 
ATOM   5855 C  CA    . ASN B 1 261 ? -10.286 5.825   -20.053 1.00 28.28  ? 367 ASN B CA    1 
ATOM   5856 C  C     . ASN B 1 261 ? -8.970  6.503   -19.514 1.00 28.74  ? 367 ASN B C     1 
ATOM   5857 O  O     . ASN B 1 261 ? -8.013  6.798   -20.283 1.00 25.95  ? 367 ASN B O     1 
ATOM   5858 C  CB    . ASN B 1 261 ? -11.380 6.885   -20.244 1.00 30.01  ? 367 ASN B CB    1 
ATOM   5859 C  CG    . ASN B 1 261 ? -10.968 7.989   -21.198 1.00 32.43  ? 367 ASN B CG    1 
ATOM   5860 O  OD1   . ASN B 1 261 ? -10.998 7.763   -22.400 1.00 34.16  ? 367 ASN B OD1   1 
ATOM   5861 N  ND2   . ASN B 1 261 ? -10.588 9.191   -20.672 1.00 32.61  ? 367 ASN B ND2   1 
ATOM   5862 N  N     . SER B 1 262 ? -8.954  6.767   -18.196 1.00 27.73  ? 368 SER B N     1 
ATOM   5863 C  CA    . SER B 1 262 ? -7.767  7.245   -17.517 1.00 28.72  ? 368 SER B CA    1 
ATOM   5864 C  C     . SER B 1 262 ? -6.536  6.347   -17.658 1.00 26.83  ? 368 SER B C     1 
ATOM   5865 O  O     . SER B 1 262 ? -5.428  6.818   -17.807 1.00 26.35  ? 368 SER B O     1 
ATOM   5866 C  CB    . SER B 1 262 ? -8.041  7.204   -16.010 1.00 33.29  ? 368 SER B CB    1 
ATOM   5867 O  OG    . SER B 1 262 ? -7.771  8.444   -15.507 1.00 37.31  ? 368 SER B OG    1 
ATOM   5868 N  N     . LEU B 1 263 ? -6.741  5.042   -17.531 1.00 24.32  ? 369 LEU B N     1 
ATOM   5869 C  CA    . LEU B 1 263 ? -5.646  4.107   -17.702 1.00 23.89  ? 369 LEU B CA    1 
ATOM   5870 C  C     . LEU B 1 263 ? -5.154  4.090   -19.182 1.00 26.84  ? 369 LEU B C     1 
ATOM   5871 O  O     . LEU B 1 263 ? -3.955  3.966   -19.438 1.00 28.27  ? 369 LEU B O     1 
ATOM   5872 C  CB    . LEU B 1 263 ? -6.110  2.696   -17.277 1.00 22.59  ? 369 LEU B CB    1 
ATOM   5873 C  CG    . LEU B 1 263 ? -6.299  2.483   -15.732 1.00 22.16  ? 369 LEU B CG    1 
ATOM   5874 C  CD1   . LEU B 1 263 ? -7.049  1.171   -15.391 1.00 21.17  ? 369 LEU B CD1   1 
ATOM   5875 C  CD2   . LEU B 1 263 ? -4.917  2.572   -15.041 1.00 21.47  ? 369 LEU B CD2   1 
ATOM   5876 N  N     . HIS B 1 264 ? -6.049  4.254   -20.167 1.00 26.69  ? 370 HIS B N     1 
ATOM   5877 C  CA    . HIS B 1 264 ? -5.539  4.407   -21.566 1.00 26.71  ? 370 HIS B CA    1 
ATOM   5878 C  C     . HIS B 1 264 ? -4.719  5.695   -21.725 1.00 27.11  ? 370 HIS B C     1 
ATOM   5879 O  O     . HIS B 1 264 ? -3.667  5.692   -22.355 1.00 27.14  ? 370 HIS B O     1 
ATOM   5880 C  CB    . HIS B 1 264 ? -6.680  4.305   -22.579 1.00 25.95  ? 370 HIS B CB    1 
ATOM   5881 C  CG    . HIS B 1 264 ? -7.114  2.911   -22.882 1.00 25.79  ? 370 HIS B CG    1 
ATOM   5882 N  ND1   . HIS B 1 264 ? -6.656  2.213   -23.969 1.00 26.83  ? 370 HIS B ND1   1 
ATOM   5883 C  CD2   . HIS B 1 264 ? -7.988  2.089   -22.257 1.00 26.01  ? 370 HIS B CD2   1 
ATOM   5884 C  CE1   . HIS B 1 264 ? -7.229  1.019   -24.015 1.00 26.96  ? 370 HIS B CE1   1 
ATOM   5885 N  NE2   . HIS B 1 264 ? -8.000  0.896   -22.950 1.00 27.01  ? 370 HIS B NE2   1 
ATOM   5886 N  N     . ARG B 1 265 ? -5.184  6.787   -21.128 1.00 28.95  ? 371 ARG B N     1 
ATOM   5887 C  CA    . ARG B 1 265 ? -4.472  8.094   -21.280 1.00 30.19  ? 371 ARG B CA    1 
ATOM   5888 C  C     . ARG B 1 265 ? -3.145  8.070   -20.586 1.00 27.48  ? 371 ARG B C     1 
ATOM   5889 O  O     . ARG B 1 265 ? -2.192  8.514   -21.118 1.00 24.01  ? 371 ARG B O     1 
ATOM   5890 C  CB    . ARG B 1 265 ? -5.219  9.252   -20.636 1.00 36.82  ? 371 ARG B CB    1 
ATOM   5891 C  CG    . ARG B 1 265 ? -6.489  9.686   -21.364 1.00 43.84  ? 371 ARG B CG    1 
ATOM   5892 C  CD    . ARG B 1 265 ? -6.143  10.458  -22.650 1.00 51.10  ? 371 ARG B CD    1 
ATOM   5893 N  NE    . ARG B 1 265 ? -7.250  11.132  -23.368 1.00 53.10  ? 371 ARG B NE    1 
ATOM   5894 C  CZ    . ARG B 1 265 ? -7.117  12.284  -24.019 1.00 57.21  ? 371 ARG B CZ    1 
ATOM   5895 N  NH1   . ARG B 1 265 ? -8.172  12.812  -24.673 1.00 60.13  ? 371 ARG B NH1   1 
ATOM   5896 N  NH2   . ARG B 1 265 ? -5.962  12.947  -24.010 1.00 59.83  ? 371 ARG B NH2   1 
ATOM   5897 N  N     . ARG B 1 266 ? -3.086  7.564   -19.361 1.00 25.50  ? 372 ARG B N     1 
ATOM   5898 C  CA    . ARG B 1 266 ? -1.833  7.548   -18.639 1.00 26.53  ? 372 ARG B CA    1 
ATOM   5899 C  C     . ARG B 1 266 ? -0.852  6.467   -19.078 1.00 25.81  ? 372 ARG B C     1 
ATOM   5900 O  O     . ARG B 1 266 ? 0.398   6.709   -19.137 1.00 26.59  ? 372 ARG B O     1 
ATOM   5901 C  CB    . ARG B 1 266 ? -2.097  7.323   -17.166 1.00 27.27  ? 372 ARG B CB    1 
ATOM   5902 C  CG    . ARG B 1 266 ? -2.913  8.357   -16.523 1.00 29.03  ? 372 ARG B CG    1 
ATOM   5903 C  CD    . ARG B 1 266 ? -3.170  7.958   -15.098 1.00 31.57  ? 372 ARG B CD    1 
ATOM   5904 N  NE    . ARG B 1 266 ? -3.932  9.053   -14.524 1.00 37.27  ? 372 ARG B NE    1 
ATOM   5905 C  CZ    . ARG B 1 266 ? -4.338  9.125   -13.235 1.00 44.47  ? 372 ARG B CZ    1 
ATOM   5906 N  NH1   . ARG B 1 266 ? -4.113  8.060   -12.378 1.00 42.13  ? 372 ARG B NH1   1 
ATOM   5907 N  NH2   . ARG B 1 266 ? -5.002  10.254  -12.832 1.00 43.18  ? 372 ARG B NH2   1 
ATOM   5908 N  N     . ALA B 1 267 ? -1.405  5.274   -19.312 1.00 24.21  ? 373 ALA B N     1 
ATOM   5909 C  CA    . ALA B 1 267 ? -0.561  4.088   -19.575 1.00 24.48  ? 373 ALA B CA    1 
ATOM   5910 C  C     . ALA B 1 267 ? -0.609  3.490   -21.020 1.00 24.04  ? 373 ALA B C     1 
ATOM   5911 O  O     . ALA B 1 267 ? 0.328   3.617   -21.784 1.00 21.31  ? 373 ALA B O     1 
ATOM   5912 C  CB    . ALA B 1 267 ? -0.815  3.004   -18.542 1.00 24.52  ? 373 ALA B CB    1 
ATOM   5913 N  N     . TYR B 1 268 ? -1.712  2.865   -21.377 1.00 23.87  ? 374 TYR B N     1 
ATOM   5914 C  CA    . TYR B 1 268 ? -1.749  2.024   -22.489 1.00 24.14  ? 374 TYR B CA    1 
ATOM   5915 C  C     . TYR B 1 268 ? -1.552  2.782   -23.838 1.00 25.84  ? 374 TYR B C     1 
ATOM   5916 O  O     . TYR B 1 268 ? -1.129  2.176   -24.815 1.00 25.50  ? 374 TYR B O     1 
ATOM   5917 C  CB    . TYR B 1 268 ? -3.145  1.325   -22.543 1.00 25.68  ? 374 TYR B CB    1 
ATOM   5918 C  CG    . TYR B 1 268 ? -3.645  0.683   -21.260 1.00 25.67  ? 374 TYR B CG    1 
ATOM   5919 C  CD1   . TYR B 1 268 ? -2.805  -0.011  -20.421 1.00 24.70  ? 374 TYR B CD1   1 
ATOM   5920 C  CD2   . TYR B 1 268 ? -4.989  0.782   -20.890 1.00 27.68  ? 374 TYR B CD2   1 
ATOM   5921 C  CE1   . TYR B 1 268 ? -3.261  -0.572  -19.263 1.00 24.41  ? 374 TYR B CE1   1 
ATOM   5922 C  CE2   . TYR B 1 268 ? -5.484  0.214   -19.722 1.00 25.51  ? 374 TYR B CE2   1 
ATOM   5923 C  CZ    . TYR B 1 268 ? -4.622  -0.451  -18.891 1.00 25.31  ? 374 TYR B CZ    1 
ATOM   5924 O  OH    . TYR B 1 268 ? -5.103  -1.056  -17.721 1.00 21.67  ? 374 TYR B OH    1 
ATOM   5925 N  N     . GLN B 1 269 ? -1.930  4.062   -23.908 1.00 24.95  ? 375 GLN B N     1 
ATOM   5926 C  CA    . GLN B 1 269 ? -1.669  4.851   -25.075 1.00 25.60  ? 375 GLN B CA    1 
ATOM   5927 C  C     . GLN B 1 269 ? -0.561  5.923   -24.826 1.00 25.39  ? 375 GLN B C     1 
ATOM   5928 O  O     . GLN B 1 269 ? -0.522  6.903   -25.574 1.00 24.33  ? 375 GLN B O     1 
ATOM   5929 C  CB    . GLN B 1 269 ? -2.931  5.558   -25.552 1.00 25.33  ? 375 GLN B CB    1 
ATOM   5930 C  CG    . GLN B 1 269 ? -4.133  4.684   -25.716 1.00 25.30  ? 375 GLN B CG    1 
ATOM   5931 C  CD    . GLN B 1 269 ? -3.967  3.620   -26.816 1.00 26.37  ? 375 GLN B CD    1 
ATOM   5932 O  OE1   . GLN B 1 269 ? -4.652  2.604   -26.821 1.00 26.51  ? 375 GLN B OE1   1 
ATOM   5933 N  NE2   . GLN B 1 269 ? -3.096  3.854   -27.718 1.00 24.29  ? 375 GLN B NE2   1 
ATOM   5934 N  N     . HIS B 1 270 ? 0.327   5.733   -23.859 1.00 24.13  ? 376 HIS B N     1 
ATOM   5935 C  CA    . HIS B 1 270 ? 1.420   6.646   -23.694 1.00 25.23  ? 376 HIS B CA    1 
ATOM   5936 C  C     . HIS B 1 270 ? 2.133   6.747   -25.054 1.00 26.75  ? 376 HIS B C     1 
ATOM   5937 O  O     . HIS B 1 270 ? 2.497   5.724   -25.682 1.00 26.25  ? 376 HIS B O     1 
ATOM   5938 C  CB    . HIS B 1 270 ? 2.371   6.146   -22.618 1.00 24.45  ? 376 HIS B CB    1 
ATOM   5939 C  CG    . HIS B 1 270 ? 3.444   7.111   -22.224 1.00 25.10  ? 376 HIS B CG    1 
ATOM   5940 N  ND1   . HIS B 1 270 ? 4.618   7.251   -22.942 1.00 25.16  ? 376 HIS B ND1   1 
ATOM   5941 C  CD2   . HIS B 1 270 ? 3.538   7.958   -21.154 1.00 23.86  ? 376 HIS B CD2   1 
ATOM   5942 C  CE1   . HIS B 1 270 ? 5.384   8.145   -22.313 1.00 26.24  ? 376 HIS B CE1   1 
ATOM   5943 N  NE2   . HIS B 1 270 ? 4.750   8.586   -21.231 1.00 24.03  ? 376 HIS B NE2   1 
ATOM   5944 N  N     . LYS B 1 271 ? 2.357   7.979   -25.478 1.00 30.07  ? 377 LYS B N     1 
ATOM   5945 C  CA    . LYS B 1 271 ? 2.936   8.265   -26.855 1.00 32.63  ? 377 LYS B CA    1 
ATOM   5946 C  C     . LYS B 1 271 ? 4.278   7.493   -27.080 1.00 30.49  ? 377 LYS B C     1 
ATOM   5947 O  O     . LYS B 1 271 ? 4.605   7.079   -28.215 1.00 27.87  ? 377 LYS B O     1 
ATOM   5948 C  CB    . LYS B 1 271 ? 3.203   9.785   -27.043 1.00 34.72  ? 377 LYS B CB    1 
ATOM   5949 C  CG    . LYS B 1 271 ? 4.222   10.203  -25.955 1.00 40.35  ? 377 LYS B CG    1 
ATOM   5950 C  CD    . LYS B 1 271 ? 4.185   11.637  -25.552 1.00 44.54  ? 377 LYS B CD    1 
ATOM   5951 C  CE    . LYS B 1 271 ? 5.417   11.981  -24.701 1.00 46.25  ? 377 LYS B CE    1 
ATOM   5952 N  NZ    . LYS B 1 271 ? 5.105   11.736  -23.259 1.00 48.96  ? 377 LYS B NZ    1 
ATOM   5953 N  N     . VAL B 1 272 ? 5.059   7.290   -26.040 1.00 26.32  ? 378 VAL B N     1 
ATOM   5954 C  CA    . VAL B 1 272 ? 6.345   6.557   -26.216 1.00 27.34  ? 378 VAL B CA    1 
ATOM   5955 C  C     . VAL B 1 272 ? 6.128   5.041   -26.183 1.00 27.32  ? 378 VAL B C     1 
ATOM   5956 O  O     . VAL B 1 272 ? 6.697   4.294   -26.961 1.00 27.89  ? 378 VAL B O     1 
ATOM   5957 C  CB    . VAL B 1 272 ? 7.397   6.985   -25.179 1.00 27.40  ? 378 VAL B CB    1 
ATOM   5958 C  CG1   . VAL B 1 272 ? 8.677   6.211   -25.347 1.00 28.76  ? 378 VAL B CG1   1 
ATOM   5959 C  CG2   . VAL B 1 272 ? 7.711   8.492   -25.257 1.00 27.01  ? 378 VAL B CG2   1 
ATOM   5960 N  N     . GLY B 1 273 ? 5.225   4.593   -25.331 1.00 28.16  ? 379 GLY B N     1 
ATOM   5961 C  CA    . GLY B 1 273 ? 4.722   3.221   -25.395 1.00 28.38  ? 379 GLY B CA    1 
ATOM   5962 C  C     . GLY B 1 273 ? 4.263   2.824   -26.770 1.00 29.78  ? 379 GLY B C     1 
ATOM   5963 O  O     . GLY B 1 273 ? 4.608   1.743   -27.251 1.00 29.04  ? 379 GLY B O     1 
ATOM   5964 N  N     . ASN B 1 274 ? 3.463   3.681   -27.406 1.00 30.17  ? 380 ASN B N     1 
ATOM   5965 C  CA    . ASN B 1 274 ? 2.901   3.349   -28.759 1.00 29.60  ? 380 ASN B CA    1 
ATOM   5966 C  C     . ASN B 1 274 ? 4.012   3.355   -29.848 1.00 30.16  ? 380 ASN B C     1 
ATOM   5967 O  O     . ASN B 1 274 ? 3.968   2.534   -30.765 1.00 33.09  ? 380 ASN B O     1 
ATOM   5968 C  CB    . ASN B 1 274 ? 1.748   4.293   -29.141 1.00 29.23  ? 380 ASN B CB    1 
ATOM   5969 C  CG    . ASN B 1 274 ? 0.441   3.976   -28.439 1.00 29.39  ? 380 ASN B CG    1 
ATOM   5970 O  OD1   . ASN B 1 274 ? -0.526  4.727   -28.584 1.00 28.80  ? 380 ASN B OD1   1 
ATOM   5971 N  ND2   . ASN B 1 274 ? 0.382   2.890   -27.694 1.00 29.88  ? 380 ASN B ND2   1 
ATOM   5972 N  N     . ILE B 1 275 ? 4.995   4.239   -29.744 1.00 28.13  ? 381 ILE B N     1 
ATOM   5973 C  CA    . ILE B 1 275 ? 6.052   4.289   -30.708 1.00 28.12  ? 381 ILE B CA    1 
ATOM   5974 C  C     . ILE B 1 275 ? 7.015   3.065   -30.587 1.00 29.63  ? 381 ILE B C     1 
ATOM   5975 O  O     . ILE B 1 275 ? 7.541   2.549   -31.588 1.00 29.05  ? 381 ILE B O     1 
ATOM   5976 C  CB    . ILE B 1 275 ? 6.792   5.664   -30.721 1.00 27.49  ? 381 ILE B CB    1 
ATOM   5977 C  CG1   . ILE B 1 275 ? 7.387   5.970   -32.078 1.00 28.49  ? 381 ILE B CG1   1 
ATOM   5978 C  CG2   . ILE B 1 275 ? 7.929   5.751   -29.716 1.00 27.85  ? 381 ILE B CG2   1 
ATOM   5979 C  CD1   . ILE B 1 275 ? 6.382   5.992   -33.224 1.00 28.27  ? 381 ILE B CD1   1 
ATOM   5980 N  N     . ILE B 1 276 ? 7.208   2.568   -29.388 1.00 28.98  ? 382 ILE B N     1 
ATOM   5981 C  CA    . ILE B 1 276 ? 7.936   1.354   -29.215 1.00 31.28  ? 382 ILE B CA    1 
ATOM   5982 C  C     . ILE B 1 276 ? 7.174   0.194   -29.857 1.00 32.63  ? 382 ILE B C     1 
ATOM   5983 O  O     . ILE B 1 276 ? 7.818   -0.648  -30.508 1.00 34.52  ? 382 ILE B O     1 
ATOM   5984 C  CB    . ILE B 1 276 ? 8.328   1.139   -27.752 1.00 32.82  ? 382 ILE B CB    1 
ATOM   5985 C  CG1   . ILE B 1 276 ? 9.450   2.139   -27.445 1.00 36.97  ? 382 ILE B CG1   1 
ATOM   5986 C  CG2   . ILE B 1 276 ? 8.790   -0.276  -27.481 1.00 32.12  ? 382 ILE B CG2   1 
ATOM   5987 C  CD1   . ILE B 1 276 ? 10.213  1.903   -26.177 1.00 38.31  ? 382 ILE B CD1   1 
ATOM   5988 N  N     . ASP B 1 277 ? 5.851   0.149   -29.724 1.00 31.43  ? 383 ASP B N     1 
ATOM   5989 C  CA    . ASP B 1 277 ? 5.091   -0.919  -30.336 1.00 33.97  ? 383 ASP B CA    1 
ATOM   5990 C  C     . ASP B 1 277 ? 5.205   -0.791  -31.894 1.00 36.44  ? 383 ASP B C     1 
ATOM   5991 O  O     . ASP B 1 277 ? 5.176   -1.815  -32.616 1.00 35.45  ? 383 ASP B O     1 
ATOM   5992 C  CB    . ASP B 1 277 ? 3.608   -0.831  -29.963 1.00 34.07  ? 383 ASP B CB    1 
ATOM   5993 C  CG    . ASP B 1 277 ? 3.265   -1.465  -28.538 1.00 34.03  ? 383 ASP B CG    1 
ATOM   5994 O  OD1   . ASP B 1 277 ? 4.043   -2.161  -27.912 1.00 30.21  ? 383 ASP B OD1   1 
ATOM   5995 O  OD2   . ASP B 1 277 ? 2.140   -1.326  -28.076 1.00 34.02  ? 383 ASP B OD2   1 
ATOM   5996 N  N     . THR B 1 278 ? 5.313   0.465   -32.366 1.00 34.96  ? 384 THR B N     1 
ATOM   5997 C  CA    . THR B 1 278 ? 5.410   0.746   -33.795 1.00 35.86  ? 384 THR B CA    1 
ATOM   5998 C  C     . THR B 1 278 ? 6.738   0.240   -34.375 1.00 34.43  ? 384 THR B C     1 
ATOM   5999 O  O     . THR B 1 278 ? 6.763   -0.381  -35.419 1.00 33.87  ? 384 THR B O     1 
ATOM   6000 C  CB    . THR B 1 278 ? 5.209   2.246   -34.086 1.00 35.21  ? 384 THR B CB    1 
ATOM   6001 O  OG1   . THR B 1 278 ? 3.899   2.609   -33.654 1.00 34.74  ? 384 THR B OG1   1 
ATOM   6002 C  CG2   . THR B 1 278 ? 5.357   2.560   -35.589 1.00 36.22  ? 384 THR B CG2   1 
ATOM   6003 N  N     . MET B 1 279 ? 7.806   0.500   -33.657 1.00 32.33  ? 385 MET B N     1 
ATOM   6004 C  CA    . MET B 1 279 ? 9.144   0.096   -34.036 1.00 33.71  ? 385 MET B CA    1 
ATOM   6005 C  C     . MET B 1 279 ? 9.316   -1.421  -34.015 1.00 34.28  ? 385 MET B C     1 
ATOM   6006 O  O     . MET B 1 279 ? 9.936   -2.032  -34.922 1.00 32.40  ? 385 MET B O     1 
ATOM   6007 C  CB    . MET B 1 279 ? 10.202  0.806   -33.170 1.00 32.83  ? 385 MET B CB    1 
ATOM   6008 C  CG    . MET B 1 279 ? 10.277  2.317   -33.476 1.00 32.75  ? 385 MET B CG    1 
ATOM   6009 S  SD    . MET B 1 279 ? 11.391  3.237   -32.390 1.00 36.18  ? 385 MET B SD    1 
ATOM   6010 C  CE    . MET B 1 279 ? 13.013  2.766   -32.927 1.00 34.81  ? 385 MET B CE    1 
ATOM   6011 N  N     . ILE B 1 280 ? 8.750   -2.032  -32.990 1.00 34.50  ? 386 ILE B N     1 
ATOM   6012 C  CA    . ILE B 1 280 ? 8.756   -3.463  -32.934 1.00 35.54  ? 386 ILE B CA    1 
ATOM   6013 C  C     . ILE B 1 280 ? 7.949   -4.075  -34.127 1.00 37.05  ? 386 ILE B C     1 
ATOM   6014 O  O     . ILE B 1 280 ? 8.366   -5.081  -34.696 1.00 32.34  ? 386 ILE B O     1 
ATOM   6015 C  CB    . ILE B 1 280 ? 8.233   -3.956  -31.610 1.00 35.27  ? 386 ILE B CB    1 
ATOM   6016 C  CG1   . ILE B 1 280 ? 9.249   -3.552  -30.540 1.00 35.10  ? 386 ILE B CG1   1 
ATOM   6017 C  CG2   . ILE B 1 280 ? 8.013   -5.470  -31.621 1.00 35.24  ? 386 ILE B CG2   1 
ATOM   6018 C  CD1   . ILE B 1 280 ? 8.741   -3.816  -29.141 1.00 36.48  ? 386 ILE B CD1   1 
ATOM   6019 N  N     . THR B 1 281 ? 6.820   -3.469  -34.481 1.00 36.87  ? 387 THR B N     1 
ATOM   6020 C  CA    . THR B 1 281 ? 6.001   -3.964  -35.561 1.00 38.59  ? 387 THR B CA    1 
ATOM   6021 C  C     . THR B 1 281 ? 6.783   -3.872  -36.937 1.00 40.46  ? 387 THR B C     1 
ATOM   6022 O  O     . THR B 1 281 ? 6.818   -4.813  -37.713 1.00 39.21  ? 387 THR B O     1 
ATOM   6023 C  CB    . THR B 1 281 ? 4.661   -3.205  -35.562 1.00 39.35  ? 387 THR B CB    1 
ATOM   6024 O  OG1   . THR B 1 281 ? 3.839   -3.692  -34.504 1.00 36.58  ? 387 THR B OG1   1 
ATOM   6025 C  CG2   . THR B 1 281 ? 3.869   -3.360  -36.909 1.00 40.57  ? 387 THR B CG2   1 
ATOM   6026 N  N     . ASP B 1 282 ? 7.426   -2.745  -37.154 1.00 41.92  ? 388 ASP B N     1 
ATOM   6027 C  CA    . ASP B 1 282 ? 8.444   -2.550  -38.167 1.00 45.24  ? 388 ASP B CA    1 
ATOM   6028 C  C     . ASP B 1 282 ? 9.534   -3.626  -38.273 1.00 42.73  ? 388 ASP B C     1 
ATOM   6029 O  O     . ASP B 1 282 ? 9.834   -4.131  -39.359 1.00 40.11  ? 388 ASP B O     1 
ATOM   6030 C  CB    . ASP B 1 282 ? 9.192   -1.255  -37.857 1.00 51.41  ? 388 ASP B CB    1 
ATOM   6031 C  CG    . ASP B 1 282 ? 8.986   -0.250  -38.805 1.00 58.64  ? 388 ASP B CG    1 
ATOM   6032 O  OD1   . ASP B 1 282 ? 9.655   -0.398  -39.870 1.00 65.38  ? 388 ASP B OD1   1 
ATOM   6033 O  OD2   . ASP B 1 282 ? 8.196   0.678   -38.461 1.00 67.58  ? 388 ASP B OD2   1 
ATOM   6034 N  N     . ALA B 1 283 ? 10.152  -3.928  -37.150 1.00 38.11  ? 389 ALA B N     1 
ATOM   6035 C  CA    . ALA B 1 283 ? 11.151  -4.946  -37.135 1.00 37.47  ? 389 ALA B CA    1 
ATOM   6036 C  C     . ALA B 1 283 ? 10.526  -6.279  -37.542 1.00 36.92  ? 389 ALA B C     1 
ATOM   6037 O  O     . ALA B 1 283 ? 11.130  -6.968  -38.387 1.00 37.79  ? 389 ALA B O     1 
ATOM   6038 C  CB    . ALA B 1 283 ? 11.817  -5.031  -35.793 1.00 38.88  ? 389 ALA B CB    1 
ATOM   6039 N  N     . PHE B 1 284 ? 9.311   -6.589  -37.060 1.00 34.81  ? 390 PHE B N     1 
ATOM   6040 C  CA    . PHE B 1 284 ? 8.674   -7.829  -37.419 1.00 38.04  ? 390 PHE B CA    1 
ATOM   6041 C  C     . PHE B 1 284 ? 8.397   -7.868  -38.936 1.00 41.29  ? 390 PHE B C     1 
ATOM   6042 O  O     . PHE B 1 284 ? 8.565   -8.904  -39.562 1.00 35.89  ? 390 PHE B O     1 
ATOM   6043 C  CB    . PHE B 1 284 ? 7.354   -8.114  -36.667 1.00 39.63  ? 390 PHE B CB    1 
ATOM   6044 C  CG    . PHE B 1 284 ? 7.504   -8.541  -35.172 1.00 38.45  ? 390 PHE B CG    1 
ATOM   6045 C  CD1   . PHE B 1 284 ? 8.693   -8.395  -34.459 1.00 38.41  ? 390 PHE B CD1   1 
ATOM   6046 C  CD2   . PHE B 1 284 ? 6.410   -9.085  -34.523 1.00 38.76  ? 390 PHE B CD2   1 
ATOM   6047 C  CE1   . PHE B 1 284 ? 8.785   -8.780  -33.092 1.00 40.67  ? 390 PHE B CE1   1 
ATOM   6048 C  CE2   . PHE B 1 284 ? 6.460   -9.484  -33.189 1.00 40.66  ? 390 PHE B CE2   1 
ATOM   6049 C  CZ    . PHE B 1 284 ? 7.651   -9.323  -32.453 1.00 39.36  ? 390 PHE B CZ    1 
ATOM   6050 N  N     . LEU B 1 285 ? 7.942   -6.746  -39.497 1.00 44.60  ? 391 LEU B N     1 
ATOM   6051 C  CA    . LEU B 1 285 ? 7.672   -6.684  -40.935 1.00 45.98  ? 391 LEU B CA    1 
ATOM   6052 C  C     . LEU B 1 285 ? 8.920   -6.974  -41.799 1.00 46.16  ? 391 LEU B C     1 
ATOM   6053 O  O     . LEU B 1 285 ? 8.845   -7.706  -42.733 1.00 55.35  ? 391 LEU B O     1 
ATOM   6054 C  CB    . LEU B 1 285 ? 7.048   -5.365  -41.292 1.00 46.36  ? 391 LEU B CB    1 
ATOM   6055 C  CG    . LEU B 1 285 ? 5.568   -5.219  -40.892 1.00 47.94  ? 391 LEU B CG    1 
ATOM   6056 C  CD1   . LEU B 1 285 ? 5.194   -3.732  -41.010 1.00 48.33  ? 391 LEU B CD1   1 
ATOM   6057 C  CD2   . LEU B 1 285 ? 4.523   -6.085  -41.648 1.00 46.32  ? 391 LEU B CD2   1 
ATOM   6058 N  N     . LYS B 1 286 ? 10.068  -6.483  -41.408 1.00 47.28  ? 392 LYS B N     1 
ATOM   6059 C  CA    . LYS B 1 286 ? 11.322  -6.724  -42.114 1.00 48.60  ? 392 LYS B CA    1 
ATOM   6060 C  C     . LYS B 1 286 ? 12.009  -8.067  -41.825 1.00 50.64  ? 392 LYS B C     1 
ATOM   6061 O  O     . LYS B 1 286 ? 13.145  -8.368  -42.327 1.00 47.94  ? 392 LYS B O     1 
ATOM   6062 C  CB    . LYS B 1 286 ? 12.306  -5.619  -41.776 1.00 46.95  ? 392 LYS B CB    1 
ATOM   6063 C  CG    . LYS B 1 286 ? 11.761  -4.333  -42.269 1.00 50.07  ? 392 LYS B CG    1 
ATOM   6064 C  CD    . LYS B 1 286 ? 12.672  -3.171  -41.941 1.00 52.41  ? 392 LYS B CD    1 
ATOM   6065 C  CE    . LYS B 1 286 ? 11.948  -1.874  -42.370 1.00 54.01  ? 392 LYS B CE    1 
ATOM   6066 N  NZ    . LYS B 1 286 ? 12.801  -0.646  -42.415 1.00 55.60  ? 392 LYS B NZ    1 
ATOM   6067 N  N     . ALA B 1 287 ? 11.402  -8.855  -40.960 1.00 46.18  ? 393 ALA B N     1 
ATOM   6068 C  CA    . ALA B 1 287 ? 11.931  -10.177 -40.724 1.00 45.99  ? 393 ALA B CA    1 
ATOM   6069 C  C     . ALA B 1 287 ? 10.938  -11.215 -41.209 1.00 43.06  ? 393 ALA B C     1 
ATOM   6070 O  O     . ALA B 1 287 ? 11.259  -12.396 -41.179 1.00 42.49  ? 393 ALA B O     1 
ATOM   6071 C  CB    . ALA B 1 287 ? 12.196  -10.373 -39.238 1.00 47.29  ? 393 ALA B CB    1 
ATOM   6072 N  N     . ASP B 1 288 ? 9.733   -10.801 -41.603 1.00 38.03  ? 394 ASP B N     1 
ATOM   6073 C  CA    . ASP B 1 288 ? 8.706   -11.768 -41.835 1.00 42.01  ? 394 ASP B CA    1 
ATOM   6074 C  C     . ASP B 1 288 ? 9.069   -12.827 -42.914 1.00 46.21  ? 394 ASP B C     1 
ATOM   6075 O  O     . ASP B 1 288 ? 8.757   -14.029 -42.762 1.00 45.01  ? 394 ASP B O     1 
ATOM   6076 C  CB    . ASP B 1 288 ? 7.398   -11.083 -42.212 1.00 40.89  ? 394 ASP B CB    1 
ATOM   6077 C  CG    . ASP B 1 288 ? 6.224   -12.025 -42.047 1.00 44.13  ? 394 ASP B CG    1 
ATOM   6078 O  OD1   . ASP B 1 288 ? 6.163   -12.761 -41.021 1.00 45.73  ? 394 ASP B OD1   1 
ATOM   6079 O  OD2   . ASP B 1 288 ? 5.342   -11.985 -42.872 1.00 40.81  ? 394 ASP B OD2   1 
ATOM   6080 N  N     . ASP B 1 289 ? 9.725   -12.341 -43.978 1.00 49.54  ? 395 ASP B N     1 
ATOM   6081 C  CA    . ASP B 1 289 ? 10.187  -13.149 -45.113 1.00 55.73  ? 395 ASP B CA    1 
ATOM   6082 C  C     . ASP B 1 289 ? 11.174  -14.208 -44.687 1.00 55.50  ? 395 ASP B C     1 
ATOM   6083 O  O     . ASP B 1 289 ? 11.169  -15.262 -45.253 1.00 56.41  ? 395 ASP B O     1 
ATOM   6084 C  CB    . ASP B 1 289 ? 10.897  -12.301 -46.210 1.00 59.34  ? 395 ASP B CB    1 
ATOM   6085 C  CG    . ASP B 1 289 ? 9.985   -11.212 -46.856 1.00 60.64  ? 395 ASP B CG    1 
ATOM   6086 O  OD1   . ASP B 1 289 ? 8.731   -11.183 -46.633 1.00 57.06  ? 395 ASP B OD1   1 
ATOM   6087 O  OD2   . ASP B 1 289 ? 10.562  -10.346 -47.576 1.00 63.53  ? 395 ASP B OD2   1 
ATOM   6088 N  N     . TYR B 1 290 ? 11.998  -13.922 -43.689 1.00 54.87  ? 396 TYR B N     1 
ATOM   6089 C  CA    . TYR B 1 290 ? 13.166  -14.710 -43.370 1.00 55.92  ? 396 TYR B CA    1 
ATOM   6090 C  C     . TYR B 1 290 ? 13.078  -15.652 -42.150 1.00 56.23  ? 396 TYR B C     1 
ATOM   6091 O  O     . TYR B 1 290 ? 13.980  -16.412 -41.970 1.00 56.30  ? 396 TYR B O     1 
ATOM   6092 C  CB    . TYR B 1 290 ? 14.365  -13.767 -43.216 1.00 58.19  ? 396 TYR B CB    1 
ATOM   6093 C  CG    . TYR B 1 290 ? 14.448  -12.780 -44.352 1.00 65.12  ? 396 TYR B CG    1 
ATOM   6094 C  CD1   . TYR B 1 290 ? 14.464  -13.225 -45.683 1.00 70.74  ? 396 TYR B CD1   1 
ATOM   6095 C  CD2   . TYR B 1 290 ? 14.441  -11.395 -44.125 1.00 70.42  ? 396 TYR B CD2   1 
ATOM   6096 C  CE1   . TYR B 1 290 ? 14.503  -12.331 -46.739 1.00 71.81  ? 396 TYR B CE1   1 
ATOM   6097 C  CE2   . TYR B 1 290 ? 14.502  -10.499 -45.183 1.00 69.54  ? 396 TYR B CE2   1 
ATOM   6098 C  CZ    . TYR B 1 290 ? 14.526  -10.987 -46.473 1.00 72.39  ? 396 TYR B CZ    1 
ATOM   6099 O  OH    . TYR B 1 290 ? 14.608  -10.146 -47.516 1.00 73.59  ? 396 TYR B OH    1 
ATOM   6100 N  N     . ILE B 1 291 ? 12.037  -15.608 -41.323 1.00 56.45  ? 397 ILE B N     1 
ATOM   6101 C  CA    . ILE B 1 291 ? 11.971  -16.457 -40.139 1.00 51.90  ? 397 ILE B CA    1 
ATOM   6102 C  C     . ILE B 1 291 ? 10.870  -17.492 -40.341 1.00 52.85  ? 397 ILE B C     1 
ATOM   6103 O  O     . ILE B 1 291 ? 9.758   -17.180 -40.813 1.00 51.67  ? 397 ILE B O     1 
ATOM   6104 C  CB    . ILE B 1 291 ? 11.738  -15.615 -38.870 1.00 51.33  ? 397 ILE B CB    1 
ATOM   6105 C  CG1   . ILE B 1 291 ? 13.076  -15.091 -38.376 1.00 49.31  ? 397 ILE B CG1   1 
ATOM   6106 C  CG2   . ILE B 1 291 ? 11.084  -16.412 -37.746 1.00 49.68  ? 397 ILE B CG2   1 
ATOM   6107 C  CD1   . ILE B 1 291 ? 12.951  -13.878 -37.500 1.00 47.85  ? 397 ILE B CD1   1 
ATOM   6108 N  N     . GLU B 1 292 ? 11.203  -18.728 -39.961 1.00 54.59  ? 398 GLU B N     1 
ATOM   6109 C  CA    . GLU B 1 292 ? 10.365  -19.885 -40.222 1.00 60.96  ? 398 GLU B CA    1 
ATOM   6110 C  C     . GLU B 1 292 ? 9.991   -20.638 -38.969 1.00 58.94  ? 398 GLU B C     1 
ATOM   6111 O  O     . GLU B 1 292 ? 10.863  -21.012 -38.199 1.00 61.55  ? 398 GLU B O     1 
ATOM   6112 C  CB    . GLU B 1 292 ? 11.129  -20.857 -41.088 1.00 70.04  ? 398 GLU B CB    1 
ATOM   6113 C  CG    . GLU B 1 292 ? 11.342  -20.377 -42.508 1.00 77.06  ? 398 GLU B CG    1 
ATOM   6114 C  CD    . GLU B 1 292 ? 12.345  -21.202 -43.307 1.00 79.41  ? 398 GLU B CD    1 
ATOM   6115 O  OE1   . GLU B 1 292 ? 12.805  -22.278 -42.870 1.00 86.47  ? 398 GLU B OE1   1 
ATOM   6116 O  OE2   . GLU B 1 292 ? 12.705  -20.700 -44.385 1.00 74.96  ? 398 GLU B OE2   1 
ATOM   6117 N  N     . ILE B 1 293 ? 8.709   -20.893 -38.771 1.00 55.36  ? 399 ILE B N     1 
ATOM   6118 C  CA    . ILE B 1 293 ? 8.243   -21.520 -37.562 1.00 55.53  ? 399 ILE B CA    1 
ATOM   6119 C  C     . ILE B 1 293 ? 7.636   -22.834 -38.004 1.00 53.54  ? 399 ILE B C     1 
ATOM   6120 O  O     . ILE B 1 293 ? 6.742   -22.849 -38.842 1.00 52.40  ? 399 ILE B O     1 
ATOM   6121 C  CB    . ILE B 1 293 ? 7.212   -20.603 -36.824 1.00 56.15  ? 399 ILE B CB    1 
ATOM   6122 C  CG1   . ILE B 1 293 ? 7.905   -19.362 -36.293 1.00 58.00  ? 399 ILE B CG1   1 
ATOM   6123 C  CG2   . ILE B 1 293 ? 6.512   -21.275 -35.637 1.00 55.96  ? 399 ILE B CG2   1 
ATOM   6124 C  CD1   . ILE B 1 293 ? 6.989   -18.158 -36.278 1.00 60.47  ? 399 ILE B CD1   1 
ATOM   6125 N  N     . THR B 1 294 ? 8.084   -23.933 -37.418 1.00 53.20  ? 400 THR B N     1 
ATOM   6126 C  CA    . THR B 1 294 ? 7.566   -25.209 -37.843 1.00 57.13  ? 400 THR B CA    1 
ATOM   6127 C  C     . THR B 1 294 ? 6.216   -25.475 -37.220 1.00 54.31  ? 400 THR B C     1 
ATOM   6128 O  O     . THR B 1 294 ? 6.067   -25.376 -36.015 1.00 55.00  ? 400 THR B O     1 
ATOM   6129 C  CB    . THR B 1 294 ? 8.552   -26.333 -37.534 1.00 61.12  ? 400 THR B CB    1 
ATOM   6130 O  OG1   . THR B 1 294 ? 9.796   -25.983 -38.156 1.00 61.88  ? 400 THR B OG1   1 
ATOM   6131 C  CG2   . THR B 1 294 ? 8.071   -27.646 -38.133 1.00 63.90  ? 400 THR B CG2   1 
ATOM   6132 N  N     . GLY B 1 295 ? 5.258   -25.850 -38.047 1.00 49.09  ? 401 GLY B N     1 
ATOM   6133 C  CA    . GLY B 1 295 ? 3.899   -26.087 -37.616 1.00 49.39  ? 401 GLY B CA    1 
ATOM   6134 C  C     . GLY B 1 295 ? 3.539   -27.536 -37.852 1.00 50.58  ? 401 GLY B C     1 
ATOM   6135 O  O     . GLY B 1 295 ? 4.418   -28.372 -37.871 1.00 48.62  ? 401 GLY B O     1 
ATOM   6136 N  N     . ALA B 1 296 ? 2.244   -27.821 -37.993 1.00 53.64  ? 402 ALA B N     1 
ATOM   6137 C  CA    . ALA B 1 296 ? 1.722   -29.194 -38.057 1.00 58.72  ? 402 ALA B CA    1 
ATOM   6138 C  C     . ALA B 1 296 ? 2.038   -29.855 -39.389 1.00 60.78  ? 402 ALA B C     1 
ATOM   6139 O  O     . ALA B 1 296 ? 1.895   -29.238 -40.434 1.00 59.94  ? 402 ALA B O     1 
ATOM   6140 C  CB    . ALA B 1 296 ? 0.217   -29.226 -37.828 1.00 59.52  ? 402 ALA B CB    1 
ATOM   6141 N  N     . GLY B 1 297 ? 2.463   -31.125 -39.299 1.00 66.04  ? 403 GLY B N     1 
ATOM   6142 C  CA    . GLY B 1 297 ? 2.925   -31.943 -40.421 1.00 63.28  ? 403 GLY B CA    1 
ATOM   6143 C  C     . GLY B 1 297 ? 4.179   -31.357 -41.019 1.00 64.02  ? 403 GLY B C     1 
ATOM   6144 O  O     . GLY B 1 297 ? 4.245   -31.232 -42.239 1.00 68.12  ? 403 GLY B O     1 
ATOM   6145 N  N     . GLY B 1 298 ? 5.138   -30.939 -40.167 1.00 60.69  ? 404 GLY B N     1 
ATOM   6146 C  CA    . GLY B 1 298 ? 6.435   -30.320 -40.573 1.00 59.05  ? 404 GLY B CA    1 
ATOM   6147 C  C     . GLY B 1 298 ? 6.478   -29.028 -41.403 1.00 58.59  ? 404 GLY B C     1 
ATOM   6148 O  O     . GLY B 1 298 ? 7.581   -28.523 -41.642 1.00 57.08  ? 404 GLY B O     1 
ATOM   6149 N  N     . LYS B 1 299 ? 5.321   -28.473 -41.796 1.00 57.70  ? 405 LYS B N     1 
ATOM   6150 C  CA    . LYS B 1 299 ? 5.257   -27.243 -42.622 1.00 60.95  ? 405 LYS B CA    1 
ATOM   6151 C  C     . LYS B 1 299 ? 5.788   -26.012 -41.979 1.00 60.46  ? 405 LYS B C     1 
ATOM   6152 O  O     . LYS B 1 299 ? 5.731   -25.871 -40.781 1.00 56.68  ? 405 LYS B O     1 
ATOM   6153 C  CB    . LYS B 1 299 ? 3.850   -26.823 -42.992 1.00 64.12  ? 405 LYS B CB    1 
ATOM   6154 C  CG    . LYS B 1 299 ? 2.837   -27.893 -43.039 1.00 70.17  ? 405 LYS B CG    1 
ATOM   6155 C  CD    . LYS B 1 299 ? 1.665   -27.410 -43.819 1.00 74.57  ? 405 LYS B CD    1 
ATOM   6156 C  CE    . LYS B 1 299 ? 0.586   -28.464 -43.728 1.00 79.28  ? 405 LYS B CE    1 
ATOM   6157 N  NZ    . LYS B 1 299 ? -0.610  -27.943 -44.426 1.00 83.61  ? 405 LYS B NZ    1 
ATOM   6158 N  N     . LYS B 1 300 ? 6.198   -25.074 -42.811 1.00 61.75  ? 406 LYS B N     1 
ATOM   6159 C  CA    . LYS B 1 300 ? 6.875   -23.894 -42.337 1.00 65.44  ? 406 LYS B CA    1 
ATOM   6160 C  C     . LYS B 1 300 ? 6.005   -22.697 -42.474 1.00 61.92  ? 406 LYS B C     1 
ATOM   6161 O  O     . LYS B 1 300 ? 5.437   -22.510 -43.521 1.00 62.16  ? 406 LYS B O     1 
ATOM   6162 C  CB    . LYS B 1 300 ? 8.157   -23.726 -43.085 1.00 67.97  ? 406 LYS B CB    1 
ATOM   6163 C  CG    . LYS B 1 300 ? 9.080   -24.830 -42.640 1.00 78.68  ? 406 LYS B CG    1 
ATOM   6164 C  CD    . LYS B 1 300 ? 10.528  -24.425 -42.764 1.00 90.20  ? 406 LYS B CD    1 
ATOM   6165 C  CE    . LYS B 1 300 ? 11.342  -24.840 -41.530 1.00 94.26  ? 406 LYS B CE    1 
ATOM   6166 N  NZ    . LYS B 1 300 ? 12.776  -25.017 -41.918 1.00 101.79 ? 406 LYS B NZ    1 
ATOM   6167 N  N     . TYR B 1 301 ? 5.897   -21.915 -41.389 1.00 54.23  ? 407 TYR B N     1 
ATOM   6168 C  CA    . TYR B 1 301 ? 5.112   -20.706 -41.366 1.00 51.32  ? 407 TYR B CA    1 
ATOM   6169 C  C     . TYR B 1 301 ? 5.958   -19.496 -41.047 1.00 49.04  ? 407 TYR B C     1 
ATOM   6170 O  O     . TYR B 1 301 ? 7.114   -19.596 -40.638 1.00 45.83  ? 407 TYR B O     1 
ATOM   6171 C  CB    . TYR B 1 301 ? 3.974   -20.827 -40.378 1.00 50.65  ? 407 TYR B CB    1 
ATOM   6172 C  CG    . TYR B 1 301 ? 3.018   -21.898 -40.738 1.00 50.01  ? 407 TYR B CG    1 
ATOM   6173 C  CD1   . TYR B 1 301 ? 3.312   -23.233 -40.470 1.00 51.63  ? 407 TYR B CD1   1 
ATOM   6174 C  CD2   . TYR B 1 301 ? 1.790   -21.591 -41.319 1.00 51.56  ? 407 TYR B CD2   1 
ATOM   6175 C  CE1   . TYR B 1 301 ? 2.406   -24.253 -40.791 1.00 52.45  ? 407 TYR B CE1   1 
ATOM   6176 C  CE2   . TYR B 1 301 ? 0.865   -22.593 -41.654 1.00 52.05  ? 407 TYR B CE2   1 
ATOM   6177 C  CZ    . TYR B 1 301 ? 1.197   -23.928 -41.398 1.00 52.80  ? 407 TYR B CZ    1 
ATOM   6178 O  OH    . TYR B 1 301 ? 0.360   -24.961 -41.695 1.00 52.23  ? 407 TYR B OH    1 
ATOM   6179 N  N     . ARG B 1 302 ? 5.375   -18.342 -41.320 1.00 49.12  ? 408 ARG B N     1 
ATOM   6180 C  CA    . ARG B 1 302 ? 6.042   -17.121 -40.991 1.00 54.28  ? 408 ARG B CA    1 
ATOM   6181 C  C     . ARG B 1 302 ? 5.319   -16.479 -39.812 1.00 48.38  ? 408 ARG B C     1 
ATOM   6182 O  O     . ARG B 1 302 ? 4.193   -16.891 -39.424 1.00 46.82  ? 408 ARG B O     1 
ATOM   6183 C  CB    . ARG B 1 302 ? 6.109   -16.247 -42.240 1.00 61.99  ? 408 ARG B CB    1 
ATOM   6184 C  CG    . ARG B 1 302 ? 7.094   -16.836 -43.230 1.00 70.52  ? 408 ARG B CG    1 
ATOM   6185 C  CD    . ARG B 1 302 ? 6.640   -16.609 -44.642 1.00 77.79  ? 408 ARG B CD    1 
ATOM   6186 N  NE    . ARG B 1 302 ? 6.848   -15.206 -45.003 1.00 89.33  ? 408 ARG B NE    1 
ATOM   6187 C  CZ    . ARG B 1 302 ? 6.096   -14.504 -45.861 1.00 91.58  ? 408 ARG B CZ    1 
ATOM   6188 N  NH1   . ARG B 1 302 ? 5.024   -15.031 -46.470 1.00 88.95  ? 408 ARG B NH1   1 
ATOM   6189 N  NH2   . ARG B 1 302 ? 6.410   -13.219 -46.106 1.00 88.78  ? 408 ARG B NH2   1 
ATOM   6190 N  N     . ILE B 1 303 ? 5.969   -15.454 -39.271 1.00 43.34  ? 409 ILE B N     1 
ATOM   6191 C  CA    . ILE B 1 303 ? 5.350   -14.645 -38.212 1.00 41.01  ? 409 ILE B CA    1 
ATOM   6192 C  C     . ILE B 1 303 ? 3.887   -14.264 -38.607 1.00 41.64  ? 409 ILE B C     1 
ATOM   6193 O  O     . ILE B 1 303 ? 2.962   -14.424 -37.793 1.00 38.23  ? 409 ILE B O     1 
ATOM   6194 C  CB    . ILE B 1 303 ? 6.190   -13.410 -37.872 1.00 40.26  ? 409 ILE B CB    1 
ATOM   6195 C  CG1   . ILE B 1 303 ? 7.577   -13.801 -37.367 1.00 39.98  ? 409 ILE B CG1   1 
ATOM   6196 C  CG2   . ILE B 1 303 ? 5.488   -12.577 -36.803 1.00 41.84  ? 409 ILE B CG2   1 
ATOM   6197 C  CD1   . ILE B 1 303 ? 8.590   -12.673 -37.293 1.00 39.26  ? 409 ILE B CD1   1 
ATOM   6198 N  N     . SER B 1 304 ? 3.665   -13.829 -39.863 1.00 42.06  ? 410 SER B N     1 
ATOM   6199 C  CA    . SER B 1 304 ? 2.316   -13.388 -40.318 1.00 41.44  ? 410 SER B CA    1 
ATOM   6200 C  C     . SER B 1 304 ? 1.348   -14.517 -40.653 1.00 40.87  ? 410 SER B C     1 
ATOM   6201 O  O     . SER B 1 304 ? 0.145   -14.289 -40.723 1.00 41.25  ? 410 SER B O     1 
ATOM   6202 C  CB    . SER B 1 304 ? 2.423   -12.440 -41.527 1.00 42.40  ? 410 SER B CB    1 
ATOM   6203 O  OG    . SER B 1 304 ? 3.251   -13.027 -42.525 1.00 41.04  ? 410 SER B OG    1 
ATOM   6204 N  N     . THR B 1 305 ? 1.843   -15.728 -40.869 1.00 41.38  ? 411 THR B N     1 
ATOM   6205 C  CA    . THR B 1 305 ? 0.948   -16.848 -41.191 1.00 42.81  ? 411 THR B CA    1 
ATOM   6206 C  C     . THR B 1 305 ? 0.760   -17.810 -40.058 1.00 41.88  ? 411 THR B C     1 
ATOM   6207 O  O     . THR B 1 305 ? -0.142  -18.648 -40.137 1.00 40.30  ? 411 THR B O     1 
ATOM   6208 C  CB    . THR B 1 305 ? 1.432   -17.696 -42.424 1.00 43.87  ? 411 THR B CB    1 
ATOM   6209 O  OG1   . THR B 1 305 ? 2.847   -17.994 -42.304 1.00 42.63  ? 411 THR B OG1   1 
ATOM   6210 C  CG2   . THR B 1 305 ? 1.114   -16.951 -43.711 1.00 44.56  ? 411 THR B CG2   1 
ATOM   6211 N  N     . ALA B 1 306 ? 1.581   -17.711 -39.008 1.00 43.00  ? 412 ALA B N     1 
ATOM   6212 C  CA    . ALA B 1 306 ? 1.502   -18.658 -37.874 1.00 39.66  ? 412 ALA B CA    1 
ATOM   6213 C  C     . ALA B 1 306 ? 0.114   -18.699 -37.266 1.00 37.69  ? 412 ALA B C     1 
ATOM   6214 O  O     . ALA B 1 306 ? -0.235  -19.693 -36.663 1.00 34.17  ? 412 ALA B O     1 
ATOM   6215 C  CB    . ALA B 1 306 ? 2.506   -18.278 -36.817 1.00 40.43  ? 412 ALA B CB    1 
ATOM   6216 N  N     . ILE B 1 307 ? -0.664  -17.629 -37.465 1.00 39.77  ? 413 ILE B N     1 
ATOM   6217 C  CA    . ILE B 1 307 ? -2.057  -17.591 -37.004 1.00 43.67  ? 413 ILE B CA    1 
ATOM   6218 C  C     . ILE B 1 307 ? -2.981  -18.582 -37.634 1.00 46.20  ? 413 ILE B C     1 
ATOM   6219 O  O     . ILE B 1 307 ? -4.069  -18.813 -37.093 1.00 44.44  ? 413 ILE B O     1 
ATOM   6220 C  CB    . ILE B 1 307 ? -2.730  -16.217 -37.145 1.00 44.82  ? 413 ILE B CB    1 
ATOM   6221 C  CG1   . ILE B 1 307 ? -2.651  -15.688 -38.581 1.00 45.59  ? 413 ILE B CG1   1 
ATOM   6222 C  CG2   . ILE B 1 307 ? -2.045  -15.237 -36.228 1.00 46.45  ? 413 ILE B CG2   1 
ATOM   6223 C  CD1   . ILE B 1 307 ? -3.542  -14.451 -38.749 1.00 46.20  ? 413 ILE B CD1   1 
ATOM   6224 N  N     . ASP B 1 308 ? -2.577  -19.127 -38.798 1.00 49.33  ? 414 ASP B N     1 
ATOM   6225 C  CA    . ASP B 1 308 ? -3.349  -20.145 -39.520 1.00 49.57  ? 414 ASP B CA    1 
ATOM   6226 C  C     . ASP B 1 308 ? -3.107  -21.576 -39.050 1.00 51.32  ? 414 ASP B C     1 
ATOM   6227 O  O     . ASP B 1 308 ? -3.872  -22.441 -39.425 1.00 50.74  ? 414 ASP B O     1 
ATOM   6228 C  CB    . ASP B 1 308 ? -3.094  -20.036 -41.016 1.00 50.74  ? 414 ASP B CB    1 
ATOM   6229 C  CG    . ASP B 1 308 ? -3.542  -18.679 -41.592 1.00 52.49  ? 414 ASP B CG    1 
ATOM   6230 O  OD1   . ASP B 1 308 ? -4.623  -18.149 -41.198 1.00 49.29  ? 414 ASP B OD1   1 
ATOM   6231 O  OD2   . ASP B 1 308 ? -2.803  -18.160 -42.458 1.00 59.58  ? 414 ASP B OD2   1 
ATOM   6232 N  N     . ASP B 1 309 ? -2.109  -21.813 -38.183 1.00 51.79  ? 415 ASP B N     1 
ATOM   6233 C  CA    . ASP B 1 309 ? -1.806  -23.152 -37.685 1.00 47.98  ? 415 ASP B CA    1 
ATOM   6234 C  C     . ASP B 1 309 ? -1.453  -23.124 -36.187 1.00 49.74  ? 415 ASP B C     1 
ATOM   6235 O  O     . ASP B 1 309 ? -0.343  -22.684 -35.799 1.00 53.37  ? 415 ASP B O     1 
ATOM   6236 C  CB    . ASP B 1 309 ? -0.639  -23.738 -38.485 1.00 47.17  ? 415 ASP B CB    1 
ATOM   6237 C  CG    . ASP B 1 309 ? -0.302  -25.117 -38.044 1.00 48.10  ? 415 ASP B CG    1 
ATOM   6238 O  OD1   . ASP B 1 309 ? -1.128  -25.998 -38.274 1.00 53.02  ? 415 ASP B OD1   1 
ATOM   6239 O  OD2   . ASP B 1 309 ? 0.746   -25.329 -37.436 1.00 44.74  ? 415 ASP B OD2   1 
ATOM   6240 N  N     . MET B 1 310 ? -2.352  -23.641 -35.345 1.00 46.75  ? 416 MET B N     1 
ATOM   6241 C  CA    . MET B 1 310 ? -2.184  -23.520 -33.885 1.00 44.43  ? 416 MET B CA    1 
ATOM   6242 C  C     . MET B 1 310 ? -0.974  -24.214 -33.309 1.00 43.64  ? 416 MET B C     1 
ATOM   6243 O  O     . MET B 1 310 ? -0.476  -23.801 -32.301 1.00 45.33  ? 416 MET B O     1 
ATOM   6244 C  CB    . MET B 1 310 ? -3.443  -23.962 -33.158 1.00 43.65  ? 416 MET B CB    1 
ATOM   6245 C  CG    . MET B 1 310 ? -4.633  -23.041 -33.390 1.00 43.15  ? 416 MET B CG    1 
ATOM   6246 S  SD    . MET B 1 310 ? -4.352  -21.297 -32.853 1.00 48.20  ? 416 MET B SD    1 
ATOM   6247 C  CE    . MET B 1 310 ? -3.853  -20.465 -34.377 1.00 46.76  ? 416 MET B CE    1 
ATOM   6248 N  N     . GLU B 1 311 ? -0.464  -25.235 -33.957 1.00 45.58  ? 417 GLU B N     1 
ATOM   6249 C  CA    . GLU B 1 311 ? 0.795   -25.852 -33.513 1.00 46.48  ? 417 GLU B CA    1 
ATOM   6250 C  C     . GLU B 1 311 ? 2.022   -24.908 -33.720 1.00 45.35  ? 417 GLU B C     1 
ATOM   6251 O  O     . GLU B 1 311 ? 2.970   -24.880 -32.953 1.00 44.32  ? 417 GLU B O     1 
ATOM   6252 C  CB    . GLU B 1 311 ? 0.971   -27.216 -34.197 1.00 46.85  ? 417 GLU B CB    1 
ATOM   6253 C  CG    . GLU B 1 311 ? 2.210   -27.976 -33.735 1.00 48.29  ? 417 GLU B CG    1 
ATOM   6254 C  CD    . GLU B 1 311 ? 2.342   -29.393 -34.303 1.00 50.08  ? 417 GLU B CD    1 
ATOM   6255 O  OE1   . GLU B 1 311 ? 1.336   -30.101 -34.610 1.00 47.51  ? 417 GLU B OE1   1 
ATOM   6256 O  OE2   . GLU B 1 311 ? 3.514   -29.797 -34.423 1.00 51.50  ? 417 GLU B OE2   1 
ATOM   6257 N  N     . ALA B 1 312 ? 2.006   -24.145 -34.777 1.00 45.85  ? 418 ALA B N     1 
ATOM   6258 C  CA    . ALA B 1 312 ? 3.058   -23.126 -34.983 1.00 45.11  ? 418 ALA B CA    1 
ATOM   6259 C  C     . ALA B 1 312 ? 2.856   -21.914 -34.074 1.00 42.49  ? 418 ALA B C     1 
ATOM   6260 O  O     . ALA B 1 312 ? 3.837   -21.320 -33.639 1.00 38.89  ? 418 ALA B O     1 
ATOM   6261 C  CB    . ALA B 1 312 ? 3.048   -22.627 -36.436 1.00 46.18  ? 418 ALA B CB    1 
ATOM   6262 N  N     . TYR B 1 313 ? 1.583   -21.509 -33.890 1.00 40.36  ? 419 TYR B N     1 
ATOM   6263 C  CA    . TYR B 1 313 ? 1.252   -20.315 -33.176 1.00 39.67  ? 419 TYR B CA    1 
ATOM   6264 C  C     . TYR B 1 313 ? 1.642   -20.512 -31.696 1.00 39.39  ? 419 TYR B C     1 
ATOM   6265 O  O     . TYR B 1 313 ? 2.134   -19.531 -31.056 1.00 37.08  ? 419 TYR B O     1 
ATOM   6266 C  CB    . TYR B 1 313 ? -0.222  -19.958 -33.307 1.00 41.32  ? 419 TYR B CB    1 
ATOM   6267 C  CG    . TYR B 1 313 ? -0.607  -18.526 -32.833 1.00 42.00  ? 419 TYR B CG    1 
ATOM   6268 C  CD1   . TYR B 1 313 ? 0.104   -17.420 -33.255 1.00 43.43  ? 419 TYR B CD1   1 
ATOM   6269 C  CD2   . TYR B 1 313 ? -1.718  -18.304 -32.009 1.00 40.98  ? 419 TYR B CD2   1 
ATOM   6270 C  CE1   . TYR B 1 313 ? -0.257  -16.141 -32.845 1.00 44.39  ? 419 TYR B CE1   1 
ATOM   6271 C  CE2   . TYR B 1 313 ? -2.092  -17.040 -31.599 1.00 42.15  ? 419 TYR B CE2   1 
ATOM   6272 C  CZ    . TYR B 1 313 ? -1.365  -15.947 -32.007 1.00 43.22  ? 419 TYR B CZ    1 
ATOM   6273 O  OH    . TYR B 1 313 ? -1.694  -14.648 -31.617 1.00 41.62  ? 419 TYR B OH    1 
ATOM   6274 N  N     . THR B 1 314 ? 1.526   -21.766 -31.219 1.00 38.96  ? 420 THR B N     1 
ATOM   6275 C  CA    . THR B 1 314 ? 1.954   -22.200 -29.870 1.00 38.85  ? 420 THR B CA    1 
ATOM   6276 C  C     . THR B 1 314 ? 3.364   -21.735 -29.587 1.00 39.20  ? 420 THR B C     1 
ATOM   6277 O  O     . THR B 1 314 ? 3.639   -21.309 -28.491 1.00 39.16  ? 420 THR B O     1 
ATOM   6278 C  CB    . THR B 1 314 ? 1.787   -23.717 -29.650 1.00 38.39  ? 420 THR B CB    1 
ATOM   6279 O  OG1   . THR B 1 314 ? 0.396   -24.044 -29.631 1.00 36.56  ? 420 THR B OG1   1 
ATOM   6280 C  CG2   . THR B 1 314 ? 2.310   -24.163 -28.252 1.00 40.49  ? 420 THR B CG2   1 
ATOM   6281 N  N     . LYS B 1 315 ? 4.232   -21.721 -30.586 1.00 38.98  ? 421 LYS B N     1 
ATOM   6282 C  CA    . LYS B 1 315 ? 5.635   -21.351 -30.381 1.00 39.20  ? 421 LYS B CA    1 
ATOM   6283 C  C     . LYS B 1 315 ? 5.921   -19.908 -30.737 1.00 37.54  ? 421 LYS B C     1 
ATOM   6284 O  O     . LYS B 1 315 ? 7.086   -19.521 -30.872 1.00 36.79  ? 421 LYS B O     1 
ATOM   6285 C  CB    . LYS B 1 315 ? 6.544   -22.319 -31.173 1.00 43.33  ? 421 LYS B CB    1 
ATOM   6286 C  CG    . LYS B 1 315 ? 6.239   -23.807 -30.909 1.00 45.46  ? 421 LYS B CG    1 
ATOM   6287 C  CD    . LYS B 1 315 ? 7.316   -24.756 -31.391 1.00 47.46  ? 421 LYS B CD    1 
ATOM   6288 C  CE    . LYS B 1 315 ? 7.121   -25.007 -32.856 1.00 52.60  ? 421 LYS B CE    1 
ATOM   6289 N  NZ    . LYS B 1 315 ? 7.996   -26.083 -33.454 1.00 56.50  ? 421 LYS B NZ    1 
ATOM   6290 N  N     . LEU B 1 316 ? 4.868   -19.089 -30.855 1.00 37.01  ? 422 LEU B N     1 
ATOM   6291 C  CA    . LEU B 1 316 ? 5.044   -17.709 -31.275 1.00 36.92  ? 422 LEU B CA    1 
ATOM   6292 C  C     . LEU B 1 316 ? 4.790   -16.742 -30.128 1.00 34.98  ? 422 LEU B C     1 
ATOM   6293 O  O     . LEU B 1 316 ? 3.665   -16.539 -29.749 1.00 36.03  ? 422 LEU B O     1 
ATOM   6294 C  CB    . LEU B 1 316 ? 4.175   -17.392 -32.512 1.00 36.47  ? 422 LEU B CB    1 
ATOM   6295 C  CG    . LEU B 1 316 ? 4.335   -15.933 -32.988 1.00 36.59  ? 422 LEU B CG    1 
ATOM   6296 C  CD1   . LEU B 1 316 ? 5.731   -15.605 -33.416 1.00 36.88  ? 422 LEU B CD1   1 
ATOM   6297 C  CD2   . LEU B 1 316 ? 3.344   -15.552 -34.062 1.00 37.79  ? 422 LEU B CD2   1 
ATOM   6298 N  N     . THR B 1 317 ? 5.851   -16.187 -29.558 1.00 35.72  ? 423 THR B N     1 
ATOM   6299 C  CA    . THR B 1 317 ? 5.719   -15.433 -28.310 1.00 33.74  ? 423 THR B CA    1 
ATOM   6300 C  C     . THR B 1 317 ? 6.673   -14.247 -28.359 1.00 34.47  ? 423 THR B C     1 
ATOM   6301 O  O     . THR B 1 317 ? 7.337   -14.033 -29.406 1.00 33.18  ? 423 THR B O     1 
ATOM   6302 C  CB    . THR B 1 317 ? 5.991   -16.294 -27.061 1.00 32.98  ? 423 THR B CB    1 
ATOM   6303 O  OG1   . THR B 1 317 ? 7.374   -16.660 -27.006 1.00 32.41  ? 423 THR B OG1   1 
ATOM   6304 C  CG2   . THR B 1 317 ? 5.063   -17.528 -26.996 1.00 32.40  ? 423 THR B CG2   1 
ATOM   6305 N  N     . ASP B 1 318 ? 6.789   -13.514 -27.246 1.00 32.73  ? 424 ASP B N     1 
ATOM   6306 C  CA    . ASP B 1 318 ? 7.721   -12.401 -27.160 1.00 32.75  ? 424 ASP B CA    1 
ATOM   6307 C  C     . ASP B 1 318 ? 9.200   -12.740 -27.457 1.00 34.08  ? 424 ASP B C     1 
ATOM   6308 O  O     . ASP B 1 318 ? 10.053  -11.836 -27.720 1.00 33.11  ? 424 ASP B O     1 
ATOM   6309 C  CB    . ASP B 1 318 ? 7.684   -11.747 -25.765 1.00 32.19  ? 424 ASP B CB    1 
ATOM   6310 C  CG    . ASP B 1 318 ? 6.396   -10.971 -25.470 1.00 32.90  ? 424 ASP B CG    1 
ATOM   6311 O  OD1   . ASP B 1 318 ? 5.410   -10.990 -26.256 1.00 32.65  ? 424 ASP B OD1   1 
ATOM   6312 O  OD2   . ASP B 1 318 ? 6.389   -10.335 -24.374 1.00 33.56  ? 424 ASP B OD2   1 
ATOM   6313 N  N     . ASN B 1 319 ? 9.522   -14.022 -27.306 1.00 35.12  ? 425 ASN B N     1 
ATOM   6314 C  CA    . ASN B 1 319 ? 10.820  -14.579 -27.691 1.00 37.34  ? 425 ASN B CA    1 
ATOM   6315 C  C     . ASN B 1 319 ? 11.333  -14.167 -29.104 1.00 36.92  ? 425 ASN B C     1 
ATOM   6316 O  O     . ASN B 1 319 ? 12.531  -13.981 -29.334 1.00 34.57  ? 425 ASN B O     1 
ATOM   6317 C  CB    . ASN B 1 319 ? 10.712  -16.064 -27.706 1.00 39.74  ? 425 ASN B CB    1 
ATOM   6318 C  CG    . ASN B 1 319 ? 12.043  -16.696 -27.941 1.00 42.88  ? 425 ASN B CG    1 
ATOM   6319 O  OD1   . ASN B 1 319 ? 12.311  -17.265 -28.968 1.00 38.27  ? 425 ASN B OD1   1 
ATOM   6320 N  ND2   . ASN B 1 319 ? 12.923  -16.502 -26.942 1.00 47.57  ? 425 ASN B ND2   1 
ATOM   6321 N  N     . ILE B 1 320 ? 10.393  -13.999 -30.008 1.00 36.18  ? 426 ILE B N     1 
ATOM   6322 C  CA    . ILE B 1 320 ? 10.722  -13.594 -31.365 1.00 38.59  ? 426 ILE B CA    1 
ATOM   6323 C  C     . ILE B 1 320 ? 11.532  -12.275 -31.452 1.00 37.57  ? 426 ILE B C     1 
ATOM   6324 O  O     . ILE B 1 320 ? 12.369  -12.100 -32.311 1.00 34.41  ? 426 ILE B O     1 
ATOM   6325 C  CB    . ILE B 1 320 ? 9.425   -13.574 -32.195 1.00 42.16  ? 426 ILE B CB    1 
ATOM   6326 C  CG1   . ILE B 1 320 ? 9.713   -13.859 -33.644 1.00 46.86  ? 426 ILE B CG1   1 
ATOM   6327 C  CG2   . ILE B 1 320 ? 8.684   -12.286 -32.081 1.00 42.63  ? 426 ILE B CG2   1 
ATOM   6328 C  CD1   . ILE B 1 320 ? 9.949   -15.323 -33.861 1.00 48.44  ? 426 ILE B CD1   1 
ATOM   6329 N  N     . PHE B 1 321 ? 11.310  -11.363 -30.506 1.00 36.32  ? 427 PHE B N     1 
ATOM   6330 C  CA    . PHE B 1 321 ? 12.067  -10.127 -30.404 1.00 34.94  ? 427 PHE B CA    1 
ATOM   6331 C  C     . PHE B 1 321 ? 13.527  -10.445 -30.207 1.00 36.04  ? 427 PHE B C     1 
ATOM   6332 O  O     . PHE B 1 321 ? 14.403  -9.875  -30.868 1.00 39.52  ? 427 PHE B O     1 
ATOM   6333 C  CB    . PHE B 1 321 ? 11.494  -9.300  -29.212 1.00 36.18  ? 427 PHE B CB    1 
ATOM   6334 C  CG    . PHE B 1 321 ? 12.236  -8.009  -28.856 1.00 34.94  ? 427 PHE B CG    1 
ATOM   6335 C  CD1   . PHE B 1 321 ? 13.343  -8.026  -28.005 1.00 32.75  ? 427 PHE B CD1   1 
ATOM   6336 C  CD2   . PHE B 1 321 ? 11.746  -6.764  -29.274 1.00 33.65  ? 427 PHE B CD2   1 
ATOM   6337 C  CE1   . PHE B 1 321 ? 13.991  -6.837  -27.666 1.00 32.24  ? 427 PHE B CE1   1 
ATOM   6338 C  CE2   . PHE B 1 321 ? 12.406  -5.593  -28.896 1.00 33.88  ? 427 PHE B CE2   1 
ATOM   6339 C  CZ    . PHE B 1 321 ? 13.519  -5.628  -28.065 1.00 32.53  ? 427 PHE B CZ    1 
ATOM   6340 N  N     . LEU B 1 322 ? 13.810  -11.318 -29.259 1.00 37.93  ? 428 LEU B N     1 
ATOM   6341 C  CA    . LEU B 1 322 ? 15.200  -11.664 -28.950 1.00 39.32  ? 428 LEU B CA    1 
ATOM   6342 C  C     . LEU B 1 322 ? 15.864  -12.544 -30.048 1.00 38.89  ? 428 LEU B C     1 
ATOM   6343 O  O     . LEU B 1 322 ? 17.067  -12.383 -30.343 1.00 39.40  ? 428 LEU B O     1 
ATOM   6344 C  CB    . LEU B 1 322 ? 15.272  -12.377 -27.599 1.00 38.37  ? 428 LEU B CB    1 
ATOM   6345 C  CG    . LEU B 1 322 ? 14.889  -11.510 -26.397 1.00 38.94  ? 428 LEU B CG    1 
ATOM   6346 C  CD1   . LEU B 1 322 ? 14.738  -12.356 -25.100 1.00 37.83  ? 428 LEU B CD1   1 
ATOM   6347 C  CD2   . LEU B 1 322 ? 15.892  -10.343 -26.193 1.00 36.49  ? 428 LEU B CD2   1 
ATOM   6348 N  N     . GLU B 1 323 ? 15.082  -13.466 -30.609 1.00 40.10  ? 429 GLU B N     1 
ATOM   6349 C  CA    . GLU B 1 323 ? 15.512  -14.168 -31.812 1.00 45.59  ? 429 GLU B CA    1 
ATOM   6350 C  C     . GLU B 1 323 ? 16.096  -13.199 -32.838 1.00 45.09  ? 429 GLU B C     1 
ATOM   6351 O  O     . GLU B 1 323 ? 17.224  -13.376 -33.285 1.00 49.51  ? 429 GLU B O     1 
ATOM   6352 C  CB    . GLU B 1 323 ? 14.417  -15.040 -32.450 1.00 50.69  ? 429 GLU B CB    1 
ATOM   6353 C  CG    . GLU B 1 323 ? 15.100  -16.255 -33.128 1.00 56.91  ? 429 GLU B CG    1 
ATOM   6354 C  CD    . GLU B 1 323 ? 14.273  -17.094 -34.135 1.00 60.14  ? 429 GLU B CD    1 
ATOM   6355 O  OE1   . GLU B 1 323 ? 13.015  -17.254 -34.021 1.00 60.72  ? 429 GLU B OE1   1 
ATOM   6356 O  OE2   . GLU B 1 323 ? 14.950  -17.674 -35.019 1.00 65.42  ? 429 GLU B OE2   1 
ATOM   6357 N  N     . ILE B 1 324 ? 15.384  -12.118 -33.129 1.00 42.07  ? 430 ILE B N     1 
ATOM   6358 C  CA    . ILE B 1 324 ? 15.872  -11.159 -34.113 1.00 38.88  ? 430 ILE B CA    1 
ATOM   6359 C  C     . ILE B 1 324 ? 17.090  -10.392 -33.580 1.00 40.99  ? 430 ILE B C     1 
ATOM   6360 O  O     . ILE B 1 324 ? 18.132  -10.263 -34.246 1.00 42.63  ? 430 ILE B O     1 
ATOM   6361 C  CB    . ILE B 1 324 ? 14.748  -10.192 -34.493 1.00 35.60  ? 430 ILE B CB    1 
ATOM   6362 C  CG1   . ILE B 1 324 ? 13.654  -10.937 -35.205 1.00 33.62  ? 430 ILE B CG1   1 
ATOM   6363 C  CG2   . ILE B 1 324 ? 15.285  -9.001  -35.275 1.00 34.99  ? 430 ILE B CG2   1 
ATOM   6364 C  CD1   . ILE B 1 324 ? 12.417  -10.151 -35.394 1.00 34.04  ? 430 ILE B CD1   1 
ATOM   6365 N  N     . LEU B 1 325 ? 16.966  -9.882  -32.375 1.00 40.25  ? 431 LEU B N     1 
ATOM   6366 C  CA    . LEU B 1 325 ? 18.033  -9.086  -31.790 1.00 42.37  ? 431 LEU B CA    1 
ATOM   6367 C  C     . LEU B 1 325 ? 19.358  -9.866  -31.668 1.00 42.23  ? 431 LEU B C     1 
ATOM   6368 O  O     . LEU B 1 325 ? 20.422  -9.261  -31.749 1.00 43.75  ? 431 LEU B O     1 
ATOM   6369 C  CB    . LEU B 1 325 ? 17.625  -8.596  -30.367 1.00 41.89  ? 431 LEU B CB    1 
ATOM   6370 C  CG    . LEU B 1 325 ? 18.632  -7.751  -29.579 1.00 40.01  ? 431 LEU B CG    1 
ATOM   6371 C  CD1   . LEU B 1 325 ? 18.695  -6.355  -30.243 1.00 43.10  ? 431 LEU B CD1   1 
ATOM   6372 C  CD2   . LEU B 1 325 ? 18.225  -7.635  -28.110 1.00 39.72  ? 431 LEU B CD2   1 
ATOM   6373 N  N     . TYR B 1 326 ? 19.286  -11.170 -31.418 1.00 41.56  ? 432 TYR B N     1 
ATOM   6374 C  CA    . TYR B 1 326 ? 20.505  -11.955 -31.211 1.00 42.93  ? 432 TYR B CA    1 
ATOM   6375 C  C     . TYR B 1 326 ? 21.022  -12.631 -32.518 1.00 44.89  ? 432 TYR B C     1 
ATOM   6376 O  O     . TYR B 1 326 ? 22.111  -13.184 -32.539 1.00 43.73  ? 432 TYR B O     1 
ATOM   6377 C  CB    . TYR B 1 326 ? 20.309  -13.032 -30.122 1.00 42.38  ? 432 TYR B CB    1 
ATOM   6378 C  CG    . TYR B 1 326 ? 20.006  -12.580 -28.667 1.00 41.22  ? 432 TYR B CG    1 
ATOM   6379 C  CD1   . TYR B 1 326 ? 20.492  -11.352 -28.158 1.00 40.16  ? 432 TYR B CD1   1 
ATOM   6380 C  CD2   . TYR B 1 326 ? 19.263  -13.419 -27.785 1.00 39.71  ? 432 TYR B CD2   1 
ATOM   6381 C  CE1   . TYR B 1 326 ? 20.231  -10.954 -26.839 1.00 39.95  ? 432 TYR B CE1   1 
ATOM   6382 C  CE2   . TYR B 1 326 ? 19.018  -13.041 -26.471 1.00 41.00  ? 432 TYR B CE2   1 
ATOM   6383 C  CZ    . TYR B 1 326 ? 19.499  -11.801 -25.990 1.00 41.73  ? 432 TYR B CZ    1 
ATOM   6384 O  OH    . TYR B 1 326 ? 19.213  -11.393 -24.665 1.00 45.04  ? 432 TYR B OH    1 
ATOM   6385 N  N     . SER B 1 327 ? 20.248  -12.592 -33.593 1.00 47.11  ? 433 SER B N     1 
ATOM   6386 C  CA    . SER B 1 327 ? 20.663  -13.192 -34.866 1.00 49.01  ? 433 SER B CA    1 
ATOM   6387 C  C     . SER B 1 327 ? 21.974  -12.622 -35.476 1.00 52.10  ? 433 SER B C     1 
ATOM   6388 O  O     . SER B 1 327 ? 22.462  -11.499 -35.118 1.00 50.36  ? 433 SER B O     1 
ATOM   6389 C  CB    . SER B 1 327 ? 19.528  -13.101 -35.887 1.00 47.10  ? 433 SER B CB    1 
ATOM   6390 O  OG    . SER B 1 327 ? 19.198  -11.756 -36.171 1.00 47.00  ? 433 SER B OG    1 
ATOM   6391 N  N     . THR B 1 328 ? 22.533  -13.449 -36.379 1.00 57.67  ? 434 THR B N     1 
ATOM   6392 C  CA    . THR B 1 328 ? 23.691  -13.102 -37.264 1.00 56.31  ? 434 THR B CA    1 
ATOM   6393 C  C     . THR B 1 328 ? 23.415  -13.248 -38.772 1.00 55.59  ? 434 THR B C     1 
ATOM   6394 O  O     . THR B 1 328 ? 24.160  -12.702 -39.615 1.00 48.54  ? 434 THR B O     1 
ATOM   6395 C  CB    . THR B 1 328 ? 24.921  -13.959 -36.914 1.00 58.38  ? 434 THR B CB    1 
ATOM   6396 O  OG1   . THR B 1 328 ? 24.528  -15.338 -36.801 1.00 62.30  ? 434 THR B OG1   1 
ATOM   6397 C  CG2   . THR B 1 328 ? 25.533  -13.509 -35.583 1.00 57.83  ? 434 THR B CG2   1 
ATOM   6398 N  N     . ASP B 1 329 ? 22.351  -13.970 -39.140 1.00 55.76  ? 435 ASP B N     1 
ATOM   6399 C  CA    . ASP B 1 329 ? 21.900  -13.975 -40.518 1.00 53.62  ? 435 ASP B CA    1 
ATOM   6400 C  C     . ASP B 1 329 ? 21.959  -12.563 -41.119 1.00 55.68  ? 435 ASP B C     1 
ATOM   6401 O  O     . ASP B 1 329 ? 21.406  -11.631 -40.552 1.00 53.30  ? 435 ASP B O     1 
ATOM   6402 C  CB    . ASP B 1 329 ? 20.490  -14.507 -40.591 1.00 53.36  ? 435 ASP B CB    1 
ATOM   6403 C  CG    . ASP B 1 329 ? 19.966  -14.639 -42.028 1.00 55.53  ? 435 ASP B CG    1 
ATOM   6404 O  OD1   . ASP B 1 329 ? 20.531  -14.093 -42.996 1.00 51.71  ? 435 ASP B OD1   1 
ATOM   6405 O  OD2   . ASP B 1 329 ? 18.936  -15.289 -42.173 1.00 58.30  ? 435 ASP B OD2   1 
ATOM   6406 N  N     . PRO B 1 330 ? 22.627  -12.409 -42.290 1.00 61.97  ? 436 PRO B N     1 
ATOM   6407 C  CA    . PRO B 1 330 ? 22.657  -11.076 -42.922 1.00 60.00  ? 436 PRO B CA    1 
ATOM   6408 C  C     . PRO B 1 330 ? 21.302  -10.588 -43.447 1.00 56.34  ? 436 PRO B C     1 
ATOM   6409 O  O     . PRO B 1 330 ? 21.055  -9.400  -43.499 1.00 58.27  ? 436 PRO B O     1 
ATOM   6410 C  CB    . PRO B 1 330 ? 23.677  -11.244 -44.055 1.00 62.65  ? 436 PRO B CB    1 
ATOM   6411 C  CG    . PRO B 1 330 ? 24.447  -12.500 -43.754 1.00 60.36  ? 436 PRO B CG    1 
ATOM   6412 C  CD    . PRO B 1 330 ? 23.494  -13.373 -43.012 1.00 60.68  ? 436 PRO B CD    1 
ATOM   6413 N  N     . LYS B 1 331 ? 20.406  -11.496 -43.781 1.00 56.63  ? 437 LYS B N     1 
ATOM   6414 C  CA    . LYS B 1 331 ? 19.048  -11.095 -44.201 1.00 61.49  ? 437 LYS B CA    1 
ATOM   6415 C  C     . LYS B 1 331 ? 18.175  -10.456 -43.129 1.00 61.39  ? 437 LYS B C     1 
ATOM   6416 O  O     . LYS B 1 331 ? 17.148  -9.893  -43.485 1.00 56.26  ? 437 LYS B O     1 
ATOM   6417 C  CB    . LYS B 1 331 ? 18.315  -12.287 -44.784 1.00 66.48  ? 437 LYS B CB    1 
ATOM   6418 C  CG    . LYS B 1 331 ? 18.950  -12.633 -46.106 1.00 71.22  ? 437 LYS B CG    1 
ATOM   6419 C  CD    . LYS B 1 331 ? 18.343  -13.814 -46.817 1.00 75.78  ? 437 LYS B CD    1 
ATOM   6420 C  CE    . LYS B 1 331 ? 18.676  -13.721 -48.310 1.00 77.41  ? 437 LYS B CE    1 
ATOM   6421 N  NZ    . LYS B 1 331 ? 19.210  -15.013 -48.799 1.00 81.13  ? 437 LYS B NZ    1 
ATOM   6422 N  N     . LEU B 1 332 ? 18.571  -10.581 -41.858 1.00 56.31  ? 438 LEU B N     1 
ATOM   6423 C  CA    . LEU B 1 332 ? 17.887  -9.945  -40.725 1.00 56.17  ? 438 LEU B CA    1 
ATOM   6424 C  C     . LEU B 1 332 ? 18.558  -8.680  -40.242 1.00 55.09  ? 438 LEU B C     1 
ATOM   6425 O  O     . LEU B 1 332 ? 18.089  -8.089  -39.291 1.00 53.73  ? 438 LEU B O     1 
ATOM   6426 C  CB    . LEU B 1 332 ? 17.783  -10.915 -39.521 1.00 52.29  ? 438 LEU B CB    1 
ATOM   6427 C  CG    . LEU B 1 332 ? 16.903  -12.120 -39.746 1.00 50.79  ? 438 LEU B CG    1 
ATOM   6428 C  CD1   . LEU B 1 332 ? 17.037  -13.124 -38.594 1.00 49.59  ? 438 LEU B CD1   1 
ATOM   6429 C  CD2   . LEU B 1 332 ? 15.452  -11.682 -39.912 1.00 50.37  ? 438 LEU B CD2   1 
ATOM   6430 N  N     . LYS B 1 333 ? 19.631  -8.240  -40.865 1.00 54.57  ? 439 LYS B N     1 
ATOM   6431 C  CA    . LYS B 1 333 ? 20.260  -7.022  -40.391 1.00 54.34  ? 439 LYS B CA    1 
ATOM   6432 C  C     . LYS B 1 333 ? 19.276  -5.825  -40.306 1.00 51.66  ? 439 LYS B C     1 
ATOM   6433 O  O     . LYS B 1 333 ? 19.339  -5.048  -39.362 1.00 49.11  ? 439 LYS B O     1 
ATOM   6434 C  CB    . LYS B 1 333 ? 21.451  -6.635  -41.256 1.00 61.85  ? 439 LYS B CB    1 
ATOM   6435 C  CG    . LYS B 1 333 ? 22.316  -5.561  -40.631 1.00 67.80  ? 439 LYS B CG    1 
ATOM   6436 C  CD    . LYS B 1 333 ? 23.490  -5.202  -41.539 1.00 71.92  ? 439 LYS B CD    1 
ATOM   6437 C  CE    . LYS B 1 333 ? 24.228  -3.967  -41.034 1.00 77.76  ? 439 LYS B CE    1 
ATOM   6438 N  NZ    . LYS B 1 333 ? 24.526  -3.042  -42.167 1.00 81.48  ? 439 LYS B NZ    1 
ATOM   6439 N  N     . ASP B 1 334 ? 18.373  -5.684  -41.275 1.00 48.91  ? 440 ASP B N     1 
ATOM   6440 C  CA    . ASP B 1 334 ? 17.461  -4.551  -41.288 1.00 49.13  ? 440 ASP B CA    1 
ATOM   6441 C  C     . ASP B 1 334 ? 16.573  -4.528  -40.023 1.00 50.01  ? 440 ASP B C     1 
ATOM   6442 O  O     . ASP B 1 334 ? 16.511  -3.517  -39.333 1.00 44.59  ? 440 ASP B O     1 
ATOM   6443 C  CB    . ASP B 1 334 ? 16.569  -4.544  -42.523 1.00 50.25  ? 440 ASP B CB    1 
ATOM   6444 C  CG    . ASP B 1 334 ? 17.260  -3.850  -43.784 1.00 53.28  ? 440 ASP B CG    1 
ATOM   6445 O  OD1   . ASP B 1 334 ? 18.469  -3.507  -43.766 1.00 49.88  ? 440 ASP B OD1   1 
ATOM   6446 O  OD2   . ASP B 1 334 ? 16.571  -3.651  -44.826 1.00 52.71  ? 440 ASP B OD2   1 
ATOM   6447 N  N     . ALA B 1 335 ? 15.891  -5.650  -39.773 1.00 49.06  ? 441 ALA B N     1 
ATOM   6448 C  CA    . ALA B 1 335 ? 15.078  -5.872  -38.571 1.00 47.69  ? 441 ALA B CA    1 
ATOM   6449 C  C     . ALA B 1 335 ? 15.884  -5.658  -37.274 1.00 46.60  ? 441 ALA B C     1 
ATOM   6450 O  O     . ALA B 1 335 ? 15.457  -4.935  -36.398 1.00 44.99  ? 441 ALA B O     1 
ATOM   6451 C  CB    . ALA B 1 335 ? 14.459  -7.251  -38.603 1.00 46.06  ? 441 ALA B CB    1 
ATOM   6452 N  N     . ARG B 1 336 ? 17.055  -6.262  -37.207 1.00 47.43  ? 442 ARG B N     1 
ATOM   6453 C  CA    . ARG B 1 336 ? 17.985  -6.128  -36.111 1.00 46.43  ? 442 ARG B CA    1 
ATOM   6454 C  C     . ARG B 1 336 ? 18.386  -4.663  -35.818 1.00 46.91  ? 442 ARG B C     1 
ATOM   6455 O  O     . ARG B 1 336 ? 18.423  -4.232  -34.664 1.00 42.16  ? 442 ARG B O     1 
ATOM   6456 C  CB    . ARG B 1 336 ? 19.191  -7.028  -36.407 1.00 45.66  ? 442 ARG B CB    1 
ATOM   6457 C  CG    . ARG B 1 336 ? 20.123  -7.326  -35.273 1.00 48.27  ? 442 ARG B CG    1 
ATOM   6458 C  CD    . ARG B 1 336 ? 20.983  -8.581  -35.522 1.00 51.59  ? 442 ARG B CD    1 
ATOM   6459 N  NE    . ARG B 1 336 ? 21.764  -8.485  -36.760 1.00 55.67  ? 442 ARG B NE    1 
ATOM   6460 C  CZ    . ARG B 1 336 ? 21.761  -9.354  -37.791 1.00 56.56  ? 442 ARG B CZ    1 
ATOM   6461 N  NH1   . ARG B 1 336 ? 21.057  -10.489 -37.810 1.00 58.80  ? 442 ARG B NH1   1 
ATOM   6462 N  NH2   . ARG B 1 336 ? 22.499  -9.079  -38.841 1.00 57.28  ? 442 ARG B NH2   1 
ATOM   6463 N  N     . GLU B 1 337 ? 18.674  -3.898  -36.840 1.00 45.71  ? 443 GLU B N     1 
ATOM   6464 C  CA    . GLU B 1 337 ? 19.095  -2.502  -36.638 1.00 49.51  ? 443 GLU B CA    1 
ATOM   6465 C  C     . GLU B 1 337 ? 18.006  -1.669  -35.985 1.00 45.11  ? 443 GLU B C     1 
ATOM   6466 O  O     . GLU B 1 337 ? 18.290  -0.742  -35.224 1.00 46.30  ? 443 GLU B O     1 
ATOM   6467 C  CB    . GLU B 1 337 ? 19.553  -1.837  -37.988 1.00 54.26  ? 443 GLU B CB    1 
ATOM   6468 C  CG    . GLU B 1 337 ? 20.960  -2.291  -38.455 1.00 61.05  ? 443 GLU B CG    1 
ATOM   6469 C  CD    . GLU B 1 337 ? 22.046  -1.922  -37.449 1.00 65.03  ? 443 GLU B CD    1 
ATOM   6470 O  OE1   . GLU B 1 337 ? 21.987  -0.775  -36.952 1.00 63.64  ? 443 GLU B OE1   1 
ATOM   6471 O  OE2   . GLU B 1 337 ? 22.948  -2.763  -37.159 1.00 72.81  ? 443 GLU B OE2   1 
ATOM   6472 N  N     . ILE B 1 338 ? 16.753  -1.966  -36.297 1.00 40.39  ? 444 ILE B N     1 
ATOM   6473 C  CA    . ILE B 1 338 ? 15.660  -1.251  -35.607 1.00 38.54  ? 444 ILE B CA    1 
ATOM   6474 C  C     . ILE B 1 338 ? 15.637  -1.594  -34.102 1.00 36.29  ? 444 ILE B C     1 
ATOM   6475 O  O     . ILE B 1 338 ? 15.583  -0.701  -33.279 1.00 35.08  ? 444 ILE B O     1 
ATOM   6476 C  CB    . ILE B 1 338 ? 14.300  -1.504  -36.288 1.00 37.82  ? 444 ILE B CB    1 
ATOM   6477 C  CG1   . ILE B 1 338 ? 14.312  -0.933  -37.701 1.00 38.82  ? 444 ILE B CG1   1 
ATOM   6478 C  CG2   . ILE B 1 338 ? 13.128  -0.919  -35.501 1.00 35.84  ? 444 ILE B CG2   1 
ATOM   6479 C  CD1   . ILE B 1 338 ? 13.186  -1.509  -38.558 1.00 40.44  ? 444 ILE B CD1   1 
ATOM   6480 N  N     . LEU B 1 339 ? 15.719  -2.881  -33.758 1.00 35.17  ? 445 LEU B N     1 
ATOM   6481 C  CA    . LEU B 1 339 ? 15.746  -3.302  -32.394 1.00 33.79  ? 445 LEU B CA    1 
ATOM   6482 C  C     . LEU B 1 339 ? 16.962  -2.727  -31.660 1.00 36.14  ? 445 LEU B C     1 
ATOM   6483 O  O     . LEU B 1 339 ? 16.806  -2.294  -30.496 1.00 37.01  ? 445 LEU B O     1 
ATOM   6484 C  CB    . LEU B 1 339 ? 15.613  -4.817  -32.225 1.00 31.79  ? 445 LEU B CB    1 
ATOM   6485 C  CG    . LEU B 1 339 ? 14.367  -5.481  -32.850 1.00 32.35  ? 445 LEU B CG    1 
ATOM   6486 C  CD1   . LEU B 1 339 ? 14.223  -6.943  -32.464 1.00 32.59  ? 445 LEU B CD1   1 
ATOM   6487 C  CD2   . LEU B 1 339 ? 13.029  -4.785  -32.602 1.00 31.14  ? 445 LEU B CD2   1 
ATOM   6488 N  N     . LYS B 1 340 ? 18.099  -2.584  -32.321 1.00 36.12  ? 446 LYS B N     1 
ATOM   6489 C  CA    . LYS B 1 340 ? 19.225  -1.926  -31.694 1.00 39.05  ? 446 LYS B CA    1 
ATOM   6490 C  C     . LYS B 1 340 ? 18.950  -0.479  -31.402 1.00 37.86  ? 446 LYS B C     1 
ATOM   6491 O  O     . LYS B 1 340 ? 19.334  0.017   -30.341 1.00 38.16  ? 446 LYS B O     1 
ATOM   6492 C  CB    . LYS B 1 340 ? 20.532  -2.152  -32.492 1.00 44.46  ? 446 LYS B CB    1 
ATOM   6493 C  CG    . LYS B 1 340 ? 21.162  -3.460  -32.096 1.00 49.92  ? 446 LYS B CG    1 
ATOM   6494 C  CD    . LYS B 1 340 ? 21.920  -4.233  -33.157 1.00 55.81  ? 446 LYS B CD    1 
ATOM   6495 C  CE    . LYS B 1 340 ? 22.235  -5.608  -32.475 1.00 62.20  ? 446 LYS B CE    1 
ATOM   6496 N  NZ    . LYS B 1 340 ? 23.301  -6.450  -33.122 1.00 63.98  ? 446 LYS B NZ    1 
ATOM   6497 N  N     . GLN B 1 341 ? 18.262  0.208   -32.303 1.00 38.65  ? 447 GLN B N     1 
ATOM   6498 C  CA    . GLN B 1 341 ? 17.919  1.607   -32.039 1.00 41.26  ? 447 GLN B CA    1 
ATOM   6499 C  C     . GLN B 1 341 ? 17.024  1.757   -30.715 1.00 41.26  ? 447 GLN B C     1 
ATOM   6500 O  O     . GLN B 1 341 ? 17.253  2.657   -29.907 1.00 38.59  ? 447 GLN B O     1 
ATOM   6501 C  CB    . GLN B 1 341 ? 17.373  2.300   -33.300 1.00 43.78  ? 447 GLN B CB    1 
ATOM   6502 C  CG    . GLN B 1 341 ? 18.457  2.593   -34.386 1.00 45.77  ? 447 GLN B CG    1 
ATOM   6503 C  CD    . GLN B 1 341 ? 19.949  2.715   -33.867 1.00 50.51  ? 447 GLN B CD    1 
ATOM   6504 O  OE1   . GLN B 1 341 ? 20.368  3.747   -33.304 1.00 47.14  ? 447 GLN B OE1   1 
ATOM   6505 N  NE2   . GLN B 1 341 ? 20.748  1.644   -34.066 1.00 54.05  ? 447 GLN B NE2   1 
ATOM   6506 N  N     . ILE B 1 342 ? 16.114  0.817   -30.470 1.00 38.96  ? 448 ILE B N     1 
ATOM   6507 C  CA    . ILE B 1 342 ? 15.391  0.747   -29.217 1.00 36.15  ? 448 ILE B CA    1 
ATOM   6508 C  C     . ILE B 1 342 ? 16.310  0.639   -27.983 1.00 35.20  ? 448 ILE B C     1 
ATOM   6509 O  O     . ILE B 1 342 ? 16.146  1.413   -27.058 1.00 31.66  ? 448 ILE B O     1 
ATOM   6510 C  CB    . ILE B 1 342 ? 14.389  -0.421  -29.187 1.00 34.83  ? 448 ILE B CB    1 
ATOM   6511 C  CG1   . ILE B 1 342 ? 13.337  -0.223  -30.283 1.00 33.63  ? 448 ILE B CG1   1 
ATOM   6512 C  CG2   . ILE B 1 342 ? 13.771  -0.540  -27.768 1.00 33.82  ? 448 ILE B CG2   1 
ATOM   6513 C  CD1   . ILE B 1 342 ? 12.283  -1.313  -30.470 1.00 31.96  ? 448 ILE B CD1   1 
ATOM   6514 N  N     . GLU B 1 343 ? 17.279  -0.286  -27.984 1.00 36.22  ? 449 GLU B N     1 
ATOM   6515 C  CA    . GLU B 1 343 ? 18.124  -0.516  -26.819 1.00 35.13  ? 449 GLU B CA    1 
ATOM   6516 C  C     . GLU B 1 343 ? 18.994  0.665   -26.500 1.00 36.26  ? 449 GLU B C     1 
ATOM   6517 O  O     . GLU B 1 343 ? 19.282  0.900   -25.314 1.00 38.59  ? 449 GLU B O     1 
ATOM   6518 C  CB    . GLU B 1 343 ? 19.059  -1.668  -27.052 1.00 38.26  ? 449 GLU B CB    1 
ATOM   6519 C  CG    . GLU B 1 343 ? 18.384  -3.039  -27.056 1.00 41.90  ? 449 GLU B CG    1 
ATOM   6520 C  CD    . GLU B 1 343 ? 19.360  -4.152  -26.591 1.00 43.87  ? 449 GLU B CD    1 
ATOM   6521 O  OE1   . GLU B 1 343 ? 20.384  -4.405  -27.311 1.00 45.08  ? 449 GLU B OE1   1 
ATOM   6522 O  OE2   . GLU B 1 343 ? 19.096  -4.740  -25.494 1.00 39.81  ? 449 GLU B OE2   1 
ATOM   6523 N  N     . TYR B 1 344 ? 19.483  1.382   -27.523 1.00 33.70  ? 450 TYR B N     1 
ATOM   6524 C  CA    . TYR B 1 344 ? 20.286  2.587   -27.300 1.00 33.85  ? 450 TYR B CA    1 
ATOM   6525 C  C     . TYR B 1 344 ? 19.383  3.776   -27.029 1.00 33.50  ? 450 TYR B C     1 
ATOM   6526 O  O     . TYR B 1 344 ? 19.869  4.861   -26.794 1.00 34.53  ? 450 TYR B O     1 
ATOM   6527 C  CB    . TYR B 1 344 ? 21.234  2.919   -28.485 1.00 36.30  ? 450 TYR B CB    1 
ATOM   6528 C  CG    . TYR B 1 344 ? 22.386  1.939   -28.680 1.00 36.45  ? 450 TYR B CG    1 
ATOM   6529 C  CD1   . TYR B 1 344 ? 23.507  2.012   -27.887 1.00 36.43  ? 450 TYR B CD1   1 
ATOM   6530 C  CD2   . TYR B 1 344 ? 22.357  0.990   -29.728 1.00 41.55  ? 450 TYR B CD2   1 
ATOM   6531 C  CE1   . TYR B 1 344 ? 24.560  1.111   -28.021 1.00 39.91  ? 450 TYR B CE1   1 
ATOM   6532 C  CE2   . TYR B 1 344 ? 23.403  0.084   -29.934 1.00 43.96  ? 450 TYR B CE2   1 
ATOM   6533 C  CZ    . TYR B 1 344 ? 24.502  0.138   -29.053 1.00 43.38  ? 450 TYR B CZ    1 
ATOM   6534 O  OH    . TYR B 1 344 ? 25.516  -0.757  -29.218 1.00 44.65  ? 450 TYR B OH    1 
ATOM   6535 N  N     . ARG B 1 345 ? 18.071  3.579   -27.037 1.00 32.52  ? 451 ARG B N     1 
ATOM   6536 C  CA    . ARG B 1 345 ? 17.113  4.644   -26.829 1.00 32.01  ? 451 ARG B CA    1 
ATOM   6537 C  C     . ARG B 1 345 ? 17.190  5.772   -27.909 1.00 32.01  ? 451 ARG B C     1 
ATOM   6538 O  O     . ARG B 1 345 ? 17.049  6.921   -27.567 1.00 28.49  ? 451 ARG B O     1 
ATOM   6539 C  CB    . ARG B 1 345 ? 17.177  5.137   -25.354 1.00 32.93  ? 451 ARG B CB    1 
ATOM   6540 C  CG    . ARG B 1 345 ? 15.889  5.712   -24.694 1.00 33.53  ? 451 ARG B CG    1 
ATOM   6541 C  CD    . ARG B 1 345 ? 14.862  4.612   -24.428 1.00 34.24  ? 451 ARG B CD    1 
ATOM   6542 N  NE    . ARG B 1 345 ? 13.627  5.087   -23.801 1.00 34.69  ? 451 ARG B NE    1 
ATOM   6543 C  CZ    . ARG B 1 345 ? 12.666  4.277   -23.329 1.00 35.16  ? 451 ARG B CZ    1 
ATOM   6544 N  NH1   . ARG B 1 345 ? 12.815  2.952   -23.368 1.00 34.33  ? 451 ARG B NH1   1 
ATOM   6545 N  NH2   . ARG B 1 345 ? 11.572  4.780   -22.743 1.00 34.77  ? 451 ARG B NH2   1 
ATOM   6546 N  N     . ASN B 1 346 ? 17.357  5.404   -29.204 1.00 32.76  ? 452 ASN B N     1 
ATOM   6547 C  CA    . ASN B 1 346 ? 17.184  6.320   -30.327 1.00 34.38  ? 452 ASN B CA    1 
ATOM   6548 C  C     . ASN B 1 346 ? 15.853  6.028   -30.994 1.00 33.11  ? 452 ASN B C     1 
ATOM   6549 O  O     . ASN B 1 346 ? 15.726  5.344   -32.024 1.00 29.61  ? 452 ASN B O     1 
ATOM   6550 C  CB    . ASN B 1 346 ? 18.272  6.200   -31.427 1.00 41.51  ? 452 ASN B CB    1 
ATOM   6551 C  CG    . ASN B 1 346 ? 19.638  6.500   -30.896 1.00 47.29  ? 452 ASN B CG    1 
ATOM   6552 O  OD1   . ASN B 1 346 ? 19.823  7.501   -30.133 1.00 53.04  ? 452 ASN B OD1   1 
ATOM   6553 N  ND2   . ASN B 1 346 ? 20.615  5.580   -31.198 1.00 46.08  ? 452 ASN B ND2   1 
ATOM   6554 N  N     . LEU B 1 347 ? 14.827  6.588   -30.399 1.00 32.01  ? 453 LEU B N     1 
ATOM   6555 C  CA    . LEU B 1 347 ? 13.464  6.340   -30.857 1.00 32.17  ? 453 LEU B CA    1 
ATOM   6556 C  C     . LEU B 1 347 ? 13.051  7.443   -31.817 1.00 30.35  ? 453 LEU B C     1 
ATOM   6557 O  O     . LEU B 1 347 ? 13.633  8.529   -31.829 1.00 30.58  ? 453 LEU B O     1 
ATOM   6558 C  CB    . LEU B 1 347 ? 12.473  6.201   -29.658 1.00 30.95  ? 453 LEU B CB    1 
ATOM   6559 C  CG    . LEU B 1 347 ? 12.909  5.421   -28.422 1.00 31.20  ? 453 LEU B CG    1 
ATOM   6560 C  CD1   . LEU B 1 347 ? 11.869  5.491   -27.323 1.00 31.29  ? 453 LEU B CD1   1 
ATOM   6561 C  CD2   . LEU B 1 347 ? 13.217  3.988   -28.753 1.00 32.55  ? 453 LEU B CD2   1 
ATOM   6562 N  N     . PHE B 1 348 ? 12.039  7.154   -32.599 1.00 30.32  ? 454 PHE B N     1 
ATOM   6563 C  CA    . PHE B 1 348 ? 11.369  8.191   -33.361 1.00 32.15  ? 454 PHE B CA    1 
ATOM   6564 C  C     . PHE B 1 348 ? 10.951  9.289   -32.404 1.00 33.16  ? 454 PHE B C     1 
ATOM   6565 O  O     . PHE B 1 348 ? 10.746  9.026   -31.217 1.00 31.79  ? 454 PHE B O     1 
ATOM   6566 C  CB    . PHE B 1 348 ? 10.190  7.641   -34.174 1.00 32.86  ? 454 PHE B CB    1 
ATOM   6567 C  CG    . PHE B 1 348 ? 10.547  6.466   -35.095 1.00 33.10  ? 454 PHE B CG    1 
ATOM   6568 C  CD1   . PHE B 1 348 ? 11.877  6.212   -35.542 1.00 33.90  ? 454 PHE B CD1   1 
ATOM   6569 C  CD2   . PHE B 1 348 ? 9.533   5.630   -35.590 1.00 33.19  ? 454 PHE B CD2   1 
ATOM   6570 C  CE1   . PHE B 1 348 ? 12.152  5.130   -36.380 1.00 32.84  ? 454 PHE B CE1   1 
ATOM   6571 C  CE2   . PHE B 1 348 ? 9.818   4.539   -36.410 1.00 31.65  ? 454 PHE B CE2   1 
ATOM   6572 C  CZ    . PHE B 1 348 ? 11.118  4.311   -36.828 1.00 31.63  ? 454 PHE B CZ    1 
ATOM   6573 N  N     . LYS B 1 349 ? 10.931  10.512  -32.888 1.00 34.59  ? 455 LYS B N     1 
ATOM   6574 C  CA    . LYS B 1 349 ? 10.626  11.703  -32.089 1.00 38.00  ? 455 LYS B CA    1 
ATOM   6575 C  C     . LYS B 1 349 ? 9.145   12.069  -32.185 1.00 37.90  ? 455 LYS B C     1 
ATOM   6576 O  O     . LYS B 1 349 ? 8.594   12.142  -33.288 1.00 37.35  ? 455 LYS B O     1 
ATOM   6577 C  CB    . LYS B 1 349 ? 11.454  12.917  -32.563 1.00 38.92  ? 455 LYS B CB    1 
ATOM   6578 C  CG    . LYS B 1 349 ? 12.962  12.670  -32.514 1.00 42.77  ? 455 LYS B CG    1 
ATOM   6579 C  CD    . LYS B 1 349 ? 13.520  12.247  -31.131 1.00 44.63  ? 455 LYS B CD    1 
ATOM   6580 C  CE    . LYS B 1 349 ? 13.292  13.353  -30.086 1.00 45.69  ? 455 LYS B CE    1 
ATOM   6581 N  NZ    . LYS B 1 349 ? 13.574  12.796  -28.739 1.00 46.47  ? 455 LYS B NZ    1 
ATOM   6582 N  N     . TYR B 1 350 ? 8.542   12.314  -31.034 1.00 34.49  ? 456 TYR B N     1 
ATOM   6583 C  CA    . TYR B 1 350 ? 7.166   12.783  -30.945 1.00 36.49  ? 456 TYR B CA    1 
ATOM   6584 C  C     . TYR B 1 350 ? 7.085   14.248  -31.345 1.00 35.67  ? 456 TYR B C     1 
ATOM   6585 O  O     . TYR B 1 350 ? 7.788   15.050  -30.819 1.00 35.59  ? 456 TYR B O     1 
ATOM   6586 C  CB    . TYR B 1 350 ? 6.666   12.601  -29.509 1.00 35.50  ? 456 TYR B CB    1 
ATOM   6587 C  CG    . TYR B 1 350 ? 5.271   13.064  -29.201 1.00 37.79  ? 456 TYR B CG    1 
ATOM   6588 C  CD1   . TYR B 1 350 ? 4.137   12.489  -29.811 1.00 37.23  ? 456 TYR B CD1   1 
ATOM   6589 C  CD2   . TYR B 1 350 ? 5.061   14.061  -28.202 1.00 40.11  ? 456 TYR B CD2   1 
ATOM   6590 C  CE1   . TYR B 1 350 ? 2.845   12.915  -29.444 1.00 37.22  ? 456 TYR B CE1   1 
ATOM   6591 C  CE2   . TYR B 1 350 ? 3.784   14.481  -27.838 1.00 38.86  ? 456 TYR B CE2   1 
ATOM   6592 C  CZ    . TYR B 1 350 ? 2.683   13.929  -28.467 1.00 38.43  ? 456 TYR B CZ    1 
ATOM   6593 O  OH    . TYR B 1 350 ? 1.440   14.416  -28.075 1.00 38.42  ? 456 TYR B OH    1 
ATOM   6594 N  N     . VAL B 1 351 ? 6.222   14.572  -32.276 1.00 34.31  ? 457 VAL B N     1 
ATOM   6595 C  CA    . VAL B 1 351 ? 6.101   15.934  -32.779 1.00 36.57  ? 457 VAL B CA    1 
ATOM   6596 C  C     . VAL B 1 351 ? 4.950   16.658  -32.123 1.00 35.31  ? 457 VAL B C     1 
ATOM   6597 O  O     . VAL B 1 351 ? 5.056   17.821  -31.844 1.00 35.61  ? 457 VAL B O     1 
ATOM   6598 C  CB    . VAL B 1 351 ? 5.927   15.915  -34.318 1.00 37.08  ? 457 VAL B CB    1 
ATOM   6599 C  CG1   . VAL B 1 351 ? 5.885   17.305  -34.885 1.00 39.53  ? 457 VAL B CG1   1 
ATOM   6600 C  CG2   . VAL B 1 351 ? 7.079   15.146  -34.957 1.00 37.03  ? 457 VAL B CG2   1 
ATOM   6601 N  N     . GLY B 1 352 ? 3.847   15.963  -31.899 1.00 36.78  ? 458 GLY B N     1 
ATOM   6602 C  CA    . GLY B 1 352 ? 2.684   16.519  -31.205 1.00 36.58  ? 458 GLY B CA    1 
ATOM   6603 C  C     . GLY B 1 352 ? 1.433   15.689  -31.441 1.00 37.78  ? 458 GLY B C     1 
ATOM   6604 O  O     . GLY B 1 352 ? 1.470   14.647  -32.110 1.00 37.62  ? 458 GLY B O     1 
ATOM   6605 N  N     . GLU B 1 353 ? 0.342   16.185  -30.876 1.00 39.46  ? 459 GLU B N     1 
ATOM   6606 C  CA    . GLU B 1 353 ? -0.985  15.604  -30.901 1.00 40.24  ? 459 GLU B CA    1 
ATOM   6607 C  C     . GLU B 1 353 ? -1.983  16.670  -31.332 1.00 41.28  ? 459 GLU B C     1 
ATOM   6608 O  O     . GLU B 1 353 ? -1.817  17.868  -31.049 1.00 39.01  ? 459 GLU B O     1 
ATOM   6609 C  CB    . GLU B 1 353 ? -1.384  15.103  -29.489 1.00 42.90  ? 459 GLU B CB    1 
ATOM   6610 C  CG    . GLU B 1 353 ? -2.653  14.203  -29.431 1.00 46.63  ? 459 GLU B CG    1 
ATOM   6611 C  CD    . GLU B 1 353 ? -2.954  13.680  -28.014 1.00 47.81  ? 459 GLU B CD    1 
ATOM   6612 O  OE1   . GLU B 1 353 ? -3.086  14.491  -27.093 1.00 56.85  ? 459 GLU B OE1   1 
ATOM   6613 O  OE2   . GLU B 1 353 ? -3.023  12.463  -27.773 1.00 45.10  ? 459 GLU B OE2   1 
ATOM   6614 N  N     . THR B 1 354 ? -3.029  16.221  -32.011 1.00 41.44  ? 460 THR B N     1 
ATOM   6615 C  CA    . THR B 1 354 ? -4.152  17.034  -32.380 1.00 43.05  ? 460 THR B CA    1 
ATOM   6616 C  C     . THR B 1 354 ? -5.370  16.145  -32.480 1.00 44.00  ? 460 THR B C     1 
ATOM   6617 O  O     . THR B 1 354 ? -5.249  14.921  -32.514 1.00 44.05  ? 460 THR B O     1 
ATOM   6618 C  CB    . THR B 1 354 ? -3.922  17.783  -33.722 1.00 44.74  ? 460 THR B CB    1 
ATOM   6619 O  OG1   . THR B 1 354 ? -5.006  18.707  -33.940 1.00 44.53  ? 460 THR B OG1   1 
ATOM   6620 C  CG2   . THR B 1 354 ? -3.859  16.825  -34.923 1.00 45.13  ? 460 THR B CG2   1 
ATOM   6621 N  N     . GLN B 1 355 ? -6.537  16.785  -32.529 1.00 45.48  ? 461 GLN B N     1 
ATOM   6622 C  CA    . GLN B 1 355 ? -7.827  16.111  -32.682 1.00 46.36  ? 461 GLN B CA    1 
ATOM   6623 C  C     . GLN B 1 355 ? -8.673  16.754  -33.777 1.00 49.44  ? 461 GLN B C     1 
ATOM   6624 O  O     . GLN B 1 355 ? -8.549  17.962  -33.970 1.00 43.86  ? 461 GLN B O     1 
ATOM   6625 C  CB    . GLN B 1 355 ? -8.625  16.265  -31.398 1.00 44.15  ? 461 GLN B CB    1 
ATOM   6626 C  CG    . GLN B 1 355 ? -8.017  15.661  -30.136 1.00 44.99  ? 461 GLN B CG    1 
ATOM   6627 C  CD    . GLN B 1 355 ? -8.973  15.817  -28.998 1.00 43.14  ? 461 GLN B CD    1 
ATOM   6628 O  OE1   . GLN B 1 355 ? -8.744  16.662  -28.150 1.00 45.60  ? 461 GLN B OE1   1 
ATOM   6629 N  NE2   . GLN B 1 355 ? -10.107 15.067  -29.024 1.00 41.66  ? 461 GLN B NE2   1 
ATOM   6630 N  N     . PRO B 1 356 ? -9.598  15.985  -34.412 1.00 55.11  ? 462 PRO B N     1 
ATOM   6631 C  CA    . PRO B 1 356 ? -10.587 16.599  -35.297 1.00 57.92  ? 462 PRO B CA    1 
ATOM   6632 C  C     . PRO B 1 356 ? -11.562 17.540  -34.574 1.00 61.30  ? 462 PRO B C     1 
ATOM   6633 O  O     . PRO B 1 356 ? -11.369 17.893  -33.414 1.00 58.05  ? 462 PRO B O     1 
ATOM   6634 C  CB    . PRO B 1 356 ? -11.329 15.398  -35.912 1.00 57.62  ? 462 PRO B CB    1 
ATOM   6635 C  CG    . PRO B 1 356 ? -10.599 14.163  -35.500 1.00 57.10  ? 462 PRO B CG    1 
ATOM   6636 C  CD    . PRO B 1 356 ? -9.877  14.553  -34.234 1.00 56.38  ? 462 PRO B CD    1 
ATOM   6637 N  N     . THR B 1 357 ? -12.608 17.942  -35.268 1.00 71.08  ? 463 THR B N     1 
ATOM   6638 C  CA    . THR B 1 357 ? -13.567 18.872  -34.720 1.00 78.02  ? 463 THR B CA    1 
ATOM   6639 C  C     . THR B 1 357 ? -14.970 18.762  -35.368 1.00 87.53  ? 463 THR B C     1 
ATOM   6640 O  O     . THR B 1 357 ? -15.120 18.230  -36.471 1.00 98.71  ? 463 THR B O     1 
ATOM   6641 C  CB    . THR B 1 357 ? -13.027 20.275  -34.901 1.00 78.78  ? 463 THR B CB    1 
ATOM   6642 O  OG1   . THR B 1 357 ? -13.875 21.159  -34.192 1.00 81.11  ? 463 THR B OG1   1 
ATOM   6643 C  CG2   . THR B 1 357 ? -12.982 20.648  -36.370 1.00 83.10  ? 463 THR B CG2   1 
ATOM   6644 N  N     . GLY B 1 358 ? -15.960 19.335  -34.693 1.00 89.50  ? 464 GLY B N     1 
ATOM   6645 C  CA    . GLY B 1 358 ? -17.346 19.214  -35.128 1.00 91.00  ? 464 GLY B CA    1 
ATOM   6646 C  C     . GLY B 1 358 ? -17.750 17.782  -34.900 1.00 90.76  ? 464 GLY B C     1 
ATOM   6647 O  O     . GLY B 1 358 ? -17.480 17.226  -33.846 1.00 98.64  ? 464 GLY B O     1 
ATOM   6648 N  N     . GLN B 1 359 ? -18.373 17.175  -35.897 1.00 89.03  ? 465 GLN B N     1 
ATOM   6649 C  CA    . GLN B 1 359 ? -18.693 15.739  -35.859 1.00 87.61  ? 465 GLN B CA    1 
ATOM   6650 C  C     . GLN B 1 359 ? -17.959 15.055  -37.060 1.00 88.08  ? 465 GLN B C     1 
ATOM   6651 O  O     . GLN B 1 359 ? -18.427 14.041  -37.592 1.00 93.99  ? 465 GLN B O     1 
ATOM   6652 C  CB    . GLN B 1 359 ? -20.223 15.527  -35.818 1.00 79.93  ? 465 GLN B CB    1 
ATOM   6653 N  N     . ILE B 1 360 ? -16.785 15.625  -37.431 1.00 82.47  ? 466 ILE B N     1 
ATOM   6654 C  CA    . ILE B 1 360 ? -15.840 15.075  -38.433 1.00 81.94  ? 466 ILE B CA    1 
ATOM   6655 C  C     . ILE B 1 360 ? -15.208 13.832  -37.782 1.00 76.41  ? 466 ILE B C     1 
ATOM   6656 O  O     . ILE B 1 360 ? -14.993 13.819  -36.578 1.00 82.15  ? 466 ILE B O     1 
ATOM   6657 C  CB    . ILE B 1 360 ? -14.672 16.083  -38.833 1.00 82.38  ? 466 ILE B CB    1 
ATOM   6658 C  CG1   . ILE B 1 360 ? -15.207 17.478  -39.223 1.00 81.70  ? 466 ILE B CG1   1 
ATOM   6659 C  CG2   . ILE B 1 360 ? -13.812 15.496  -39.959 1.00 82.50  ? 466 ILE B CG2   1 
ATOM   6660 C  CD1   . ILE B 1 360 ? -14.169 18.579  -39.260 1.00 84.66  ? 466 ILE B CD1   1 
ATOM   6661 N  N     . LYS B 1 361 ? -14.926 12.801  -38.562 1.00 70.15  ? 467 LYS B N     1 
ATOM   6662 C  CA    . LYS B 1 361 ? -14.258 11.576  -38.088 1.00 71.94  ? 467 LYS B CA    1 
ATOM   6663 C  C     . LYS B 1 361 ? -13.261 11.185  -39.100 1.00 69.07  ? 467 LYS B C     1 
ATOM   6664 O  O     . LYS B 1 361 ? -13.345 11.670  -40.183 1.00 75.00  ? 467 LYS B O     1 
ATOM   6665 C  CB    . LYS B 1 361 ? -15.256 10.427  -37.924 1.00 77.07  ? 467 LYS B CB    1 
ATOM   6666 C  CG    . LYS B 1 361 ? -16.132 10.615  -36.701 1.00 83.40  ? 467 LYS B CG    1 
ATOM   6667 C  CD    . LYS B 1 361 ? -17.621 10.579  -37.005 1.00 88.18  ? 467 LYS B CD    1 
ATOM   6668 C  CE    . LYS B 1 361 ? -18.416 11.066  -35.813 1.00 95.12  ? 467 LYS B CE    1 
ATOM   6669 N  NZ    . LYS B 1 361 ? -19.564 10.121  -35.561 1.00 103.90 ? 467 LYS B NZ    1 
ATOM   6670 N  N     . ILE B 1 362 ? -12.292 10.350  -38.753 1.00 64.89  ? 468 ILE B N     1 
ATOM   6671 C  CA    . ILE B 1 362 ? -11.280 9.889   -39.686 1.00 60.67  ? 468 ILE B CA    1 
ATOM   6672 C  C     . ILE B 1 362 ? -11.465 8.422   -39.845 1.00 66.56  ? 468 ILE B C     1 
ATOM   6673 O  O     . ILE B 1 362 ? -11.313 7.664   -38.893 1.00 66.39  ? 468 ILE B O     1 
ATOM   6674 C  CB    . ILE B 1 362 ? -9.848  10.152  -39.212 1.00 57.65  ? 468 ILE B CB    1 
ATOM   6675 C  CG1   . ILE B 1 362 ? -9.627  11.655  -39.216 1.00 58.49  ? 468 ILE B CG1   1 
ATOM   6676 C  CG2   . ILE B 1 362 ? -8.819  9.411   -40.076 1.00 59.45  ? 468 ILE B CG2   1 
ATOM   6677 C  CD1   . ILE B 1 362 ? -8.191  12.102  -39.279 1.00 61.74  ? 468 ILE B CD1   1 
ATOM   6678 N  N     . LYS B 1 363 ? -11.687 8.013   -41.094 1.00 70.22  ? 469 LYS B N     1 
ATOM   6679 C  CA    . LYS B 1 363 ? -12.056 6.630   -41.431 1.00 66.17  ? 469 LYS B CA    1 
ATOM   6680 C  C     . LYS B 1 363 ? -10.800 5.848   -41.527 1.00 59.68  ? 469 LYS B C     1 
ATOM   6681 O  O     . LYS B 1 363 ? -9.790  6.381   -41.986 1.00 52.92  ? 469 LYS B O     1 
ATOM   6682 C  CB    . LYS B 1 363 ? -12.812 6.590   -42.764 1.00 72.43  ? 469 LYS B CB    1 
ATOM   6683 C  CG    . LYS B 1 363 ? -13.998 7.564   -42.846 1.00 77.62  ? 469 LYS B CG    1 
ATOM   6684 C  CD    . LYS B 1 363 ? -14.275 8.037   -44.270 1.00 84.91  ? 469 LYS B CD    1 
ATOM   6685 C  CE    . LYS B 1 363 ? -15.674 8.592   -44.428 1.00 88.31  ? 469 LYS B CE    1 
ATOM   6686 N  NZ    . LYS B 1 363 ? -16.599 7.640   -45.139 1.00 93.98  ? 469 LYS B NZ    1 
ATOM   6687 N  N     . ARG B 1 364 ? -10.879 4.590   -41.106 1.00 60.52  ? 470 ARG B N     1 
ATOM   6688 C  CA    . ARG B 1 364 ? -9.714  3.691   -41.107 1.00 66.92  ? 470 ARG B CA    1 
ATOM   6689 C  C     . ARG B 1 364 ? -9.043  3.521   -42.489 1.00 69.93  ? 470 ARG B C     1 
ATOM   6690 O  O     . ARG B 1 364 ? -7.845  3.317   -42.542 1.00 69.30  ? 470 ARG B O     1 
ATOM   6691 C  CB    . ARG B 1 364 ? -9.988  2.349   -40.373 1.00 62.83  ? 470 ARG B CB    1 
ATOM   6692 N  N     . GLU B 1 365 ? -9.790  3.645   -43.585 1.00 80.70  ? 471 GLU B N     1 
ATOM   6693 C  CA    . GLU B 1 365 ? -9.218  3.520   -44.973 1.00 85.84  ? 471 GLU B CA    1 
ATOM   6694 C  C     . GLU B 1 365 ? -8.074  4.509   -45.132 1.00 85.88  ? 471 GLU B C     1 
ATOM   6695 O  O     . GLU B 1 365 ? -6.940  4.133   -45.495 1.00 82.48  ? 471 GLU B O     1 
ATOM   6696 C  CB    . GLU B 1 365 ? -10.251 3.795   -46.089 1.00 87.22  ? 471 GLU B CB    1 
ATOM   6697 C  CG    . GLU B 1 365 ? -11.501 2.943   -46.031 1.00 88.17  ? 471 GLU B CG    1 
ATOM   6698 C  CD    . GLU B 1 365 ? -12.592 3.586   -45.167 1.00 90.31  ? 471 GLU B CD    1 
ATOM   6699 O  OE1   . GLU B 1 365 ? -13.149 4.656   -45.566 1.00 90.30  ? 471 GLU B OE1   1 
ATOM   6700 O  OE2   . GLU B 1 365 ? -12.870 3.040   -44.066 1.00 86.07  ? 471 GLU B OE2   1 
ATOM   6701 N  N     . ASP B 1 366 ? -8.386  5.737   -44.735 1.00 78.39  ? 472 ASP B N     1 
ATOM   6702 C  CA    . ASP B 1 366 ? -7.517  6.888   -44.886 1.00 71.64  ? 472 ASP B CA    1 
ATOM   6703 C  C     . ASP B 1 366 ? -6.274  6.912   -44.036 1.00 67.08  ? 472 ASP B C     1 
ATOM   6704 O  O     . ASP B 1 366 ? -5.449  7.776   -44.272 1.00 66.79  ? 472 ASP B O     1 
ATOM   6705 C  CB    . ASP B 1 366 ? -8.312  8.182   -44.666 1.00 66.99  ? 472 ASP B CB    1 
ATOM   6706 C  CG    . ASP B 1 366 ? -9.605  8.159   -45.442 1.00 71.80  ? 472 ASP B CG    1 
ATOM   6707 O  OD1   . ASP B 1 366 ? -9.936  7.039   -45.950 1.00 74.33  ? 472 ASP B OD1   1 
ATOM   6708 O  OD2   . ASP B 1 366 ? -10.256 9.210   -45.603 1.00 67.28  ? 472 ASP B OD2   1 
ATOM   6709 N  N     . TYR B 1 367 ? -6.115  5.998   -43.080 1.00 68.99  ? 473 TYR B N     1 
ATOM   6710 C  CA    . TYR B 1 367 ? -4.943  6.065   -42.175 1.00 68.46  ? 473 TYR B CA    1 
ATOM   6711 C  C     . TYR B 1 367 ? -3.669  6.145   -43.016 1.00 74.65  ? 473 TYR B C     1 
ATOM   6712 O  O     . TYR B 1 367 ? -2.829  7.038   -42.796 1.00 77.05  ? 473 TYR B O     1 
ATOM   6713 C  CB    . TYR B 1 367 ? -4.867  4.901   -41.135 1.00 62.66  ? 473 TYR B CB    1 
ATOM   6714 C  CG    . TYR B 1 367 ? -5.911  4.946   -39.972 1.00 59.46  ? 473 TYR B CG    1 
ATOM   6715 C  CD1   . TYR B 1 367 ? -6.931  5.953   -39.913 1.00 57.91  ? 473 TYR B CD1   1 
ATOM   6716 C  CD2   . TYR B 1 367 ? -5.917  3.969   -38.961 1.00 55.07  ? 473 TYR B CD2   1 
ATOM   6717 C  CE1   . TYR B 1 367 ? -7.883  5.957   -38.919 1.00 55.87  ? 473 TYR B CE1   1 
ATOM   6718 C  CE2   . TYR B 1 367 ? -6.889  3.974   -37.956 1.00 51.67  ? 473 TYR B CE2   1 
ATOM   6719 C  CZ    . TYR B 1 367 ? -7.865  4.974   -37.943 1.00 53.25  ? 473 TYR B CZ    1 
ATOM   6720 O  OH    . TYR B 1 367 ? -8.849  5.089   -36.981 1.00 53.37  ? 473 TYR B OH    1 
ATOM   6721 N  N     . GLU B 1 368 ? -3.572  5.298   -44.038 1.00 70.37  ? 474 GLU B N     1 
ATOM   6722 C  CA    . GLU B 1 368 ? -2.323  5.199   -44.770 1.00 69.15  ? 474 GLU B CA    1 
ATOM   6723 C  C     . GLU B 1 368 ? -1.921  6.441   -45.593 1.00 62.59  ? 474 GLU B C     1 
ATOM   6724 O  O     . GLU B 1 368 ? -0.734  6.637   -45.850 1.00 58.66  ? 474 GLU B O     1 
ATOM   6725 C  CB    . GLU B 1 368 ? -2.340  3.958   -45.609 1.00 76.94  ? 474 GLU B CB    1 
ATOM   6726 C  CG    . GLU B 1 368 ? -2.456  2.715   -44.751 1.00 84.52  ? 474 GLU B CG    1 
ATOM   6727 C  CD    . GLU B 1 368 ? -1.601  1.576   -45.317 1.00 92.53  ? 474 GLU B CD    1 
ATOM   6728 O  OE1   . GLU B 1 368 ? -1.792  1.207   -46.514 1.00 106.70 ? 474 GLU B OE1   1 
ATOM   6729 O  OE2   . GLU B 1 368 ? -0.715  1.066   -44.581 1.00 89.40  ? 474 GLU B OE2   1 
ATOM   6730 N  N     . SER B 1 369 ? -2.881  7.313   -45.908 1.00 57.20  ? 475 SER B N     1 
ATOM   6731 C  CA    . SER B 1 369 ? -2.648  8.578   -46.636 1.00 53.36  ? 475 SER B CA    1 
ATOM   6732 C  C     . SER B 1 369 ? -2.144  9.813   -45.871 1.00 53.05  ? 475 SER B C     1 
ATOM   6733 O  O     . SER B 1 369 ? -1.838  10.931  -46.463 1.00 41.61  ? 475 SER B O     1 
ATOM   6734 C  CB    . SER B 1 369 ? -3.969  8.996   -47.281 1.00 56.62  ? 475 SER B CB    1 
ATOM   6735 O  OG    . SER B 1 369 ? -4.877  9.515   -46.330 1.00 59.80  ? 475 SER B OG    1 
ATOM   6736 N  N     . LEU B 1 370 ? -2.137  9.686   -44.526 1.00 50.47  ? 476 LEU B N     1 
ATOM   6737 C  CA    . LEU B 1 370 ? -1.909  10.843  -43.674 1.00 45.26  ? 476 LEU B CA    1 
ATOM   6738 C  C     . LEU B 1 370 ? -0.464  11.317  -43.744 1.00 40.06  ? 476 LEU B C     1 
ATOM   6739 O  O     . LEU B 1 370 ? -0.256  12.535  -43.738 1.00 40.47  ? 476 LEU B O     1 
ATOM   6740 C  CB    . LEU B 1 370 ? -2.433  10.572  -42.244 1.00 48.24  ? 476 LEU B CB    1 
ATOM   6741 C  CG    . LEU B 1 370 ? -3.978  10.342  -42.048 1.00 51.24  ? 476 LEU B CG    1 
ATOM   6742 C  CD1   . LEU B 1 370 ? -4.433  10.431  -40.601 1.00 52.08  ? 476 LEU B CD1   1 
ATOM   6743 C  CD2   . LEU B 1 370 ? -4.854  11.338  -42.805 1.00 52.81  ? 476 LEU B CD2   1 
ATOM   6744 N  N     . PRO B 1 371 ? 0.513   10.408  -43.824 1.00 37.36  ? 477 PRO B N     1 
ATOM   6745 C  CA    . PRO B 1 371 ? 1.895   10.907  -43.804 1.00 40.93  ? 477 PRO B CA    1 
ATOM   6746 C  C     . PRO B 1 371 ? 2.175   11.774  -45.036 1.00 45.23  ? 477 PRO B C     1 
ATOM   6747 O  O     . PRO B 1 371 ? 2.814   12.834  -44.925 1.00 42.30  ? 477 PRO B O     1 
ATOM   6748 C  CB    . PRO B 1 371 ? 2.778   9.608   -43.768 1.00 39.48  ? 477 PRO B CB    1 
ATOM   6749 C  CG    . PRO B 1 371 ? 1.882   8.553   -43.234 1.00 38.00  ? 477 PRO B CG    1 
ATOM   6750 C  CD    . PRO B 1 371 ? 0.483   8.944   -43.706 1.00 37.54  ? 477 PRO B CD    1 
ATOM   6751 N  N     . LYS B 1 372 ? 1.629   11.359  -46.189 1.00 50.63  ? 478 LYS B N     1 
ATOM   6752 C  CA    . LYS B 1 372 ? 1.755   12.139  -47.415 1.00 51.64  ? 478 LYS B CA    1 
ATOM   6753 C  C     . LYS B 1 372 ? 1.176   13.495  -47.143 1.00 48.97  ? 478 LYS B C     1 
ATOM   6754 O  O     . LYS B 1 372 ? 1.836   14.476  -47.373 1.00 51.45  ? 478 LYS B O     1 
ATOM   6755 C  CB    . LYS B 1 372 ? 0.943   11.553  -48.568 1.00 59.73  ? 478 LYS B CB    1 
ATOM   6756 C  CG    . LYS B 1 372 ? 1.189   10.094  -48.969 1.00 65.66  ? 478 LYS B CG    1 
ATOM   6757 C  CD    . LYS B 1 372 ? -0.051  9.527   -49.706 1.00 68.82  ? 478 LYS B CD    1 
ATOM   6758 C  CE    . LYS B 1 372 ? -0.429  8.128   -49.207 1.00 70.76  ? 478 LYS B CE    1 
ATOM   6759 N  NZ    . LYS B 1 372 ? 0.510   7.035   -49.569 1.00 71.14  ? 478 LYS B NZ    1 
ATOM   6760 N  N     . GLU B 1 373 ? -0.043  13.562  -46.620 1.00 46.68  ? 479 GLU B N     1 
ATOM   6761 C  CA    . GLU B 1 373 ? -0.655  14.870  -46.407 1.00 48.60  ? 479 GLU B CA    1 
ATOM   6762 C  C     . GLU B 1 373 ? 0.215   15.794  -45.553 1.00 50.20  ? 479 GLU B C     1 
ATOM   6763 O  O     . GLU B 1 373 ? 0.301   17.002  -45.840 1.00 49.14  ? 479 GLU B O     1 
ATOM   6764 C  CB    . GLU B 1 373 ? -2.046  14.794  -45.781 1.00 51.66  ? 479 GLU B CB    1 
ATOM   6765 C  CG    . GLU B 1 373 ? -3.136  13.970  -46.465 1.00 53.60  ? 479 GLU B CG    1 
ATOM   6766 C  CD    . GLU B 1 373 ? -4.500  14.188  -45.787 1.00 60.97  ? 479 GLU B CD    1 
ATOM   6767 O  OE1   . GLU B 1 373 ? -4.589  15.056  -44.854 1.00 66.98  ? 479 GLU B OE1   1 
ATOM   6768 O  OE2   . GLU B 1 373 ? -5.486  13.476  -46.120 1.00 58.43  ? 479 GLU B OE2   1 
ATOM   6769 N  N     . VAL B 1 374 ? 0.867   15.243  -44.509 1.00 48.41  ? 480 VAL B N     1 
ATOM   6770 C  CA    . VAL B 1 374 ? 1.720   16.075  -43.632 1.00 46.46  ? 480 VAL B CA    1 
ATOM   6771 C  C     . VAL B 1 374 ? 2.934   16.606  -44.396 1.00 45.61  ? 480 VAL B C     1 
ATOM   6772 O  O     . VAL B 1 374 ? 3.272   17.808  -44.277 1.00 42.51  ? 480 VAL B O     1 
ATOM   6773 C  CB    . VAL B 1 374 ? 2.208   15.336  -42.333 1.00 45.02  ? 480 VAL B CB    1 
ATOM   6774 C  CG1   . VAL B 1 374 ? 3.018   16.285  -41.470 1.00 45.00  ? 480 VAL B CG1   1 
ATOM   6775 C  CG2   . VAL B 1 374 ? 1.014   14.820  -41.503 1.00 44.22  ? 480 VAL B CG2   1 
ATOM   6776 N  N     . ALA B 1 375 ? 3.596   15.675  -45.095 1.00 44.84  ? 481 ALA B N     1 
ATOM   6777 C  CA    . ALA B 1 375 ? 4.722   15.967  -45.983 1.00 51.15  ? 481 ALA B CA    1 
ATOM   6778 C  C     . ALA B 1 375 ? 4.414   17.065  -47.066 1.00 52.07  ? 481 ALA B C     1 
ATOM   6779 O  O     . ALA B 1 375 ? 5.248   17.941  -47.346 1.00 48.90  ? 481 ALA B O     1 
ATOM   6780 C  CB    . ALA B 1 375 ? 5.210   14.684  -46.649 1.00 51.09  ? 481 ALA B CB    1 
ATOM   6781 N  N     . SER B 1 376 ? 3.193   17.033  -47.603 1.00 55.74  ? 482 SER B N     1 
ATOM   6782 C  CA    . SER B 1 376 ? 2.676   18.056  -48.555 1.00 56.41  ? 482 SER B CA    1 
ATOM   6783 C  C     . SER B 1 376 ? 2.198   19.373  -47.924 1.00 60.29  ? 482 SER B C     1 
ATOM   6784 O  O     . SER B 1 376 ? 1.732   20.225  -48.631 1.00 61.28  ? 482 SER B O     1 
ATOM   6785 C  CB    . SER B 1 376 ? 1.494   17.510  -49.345 1.00 52.07  ? 482 SER B CB    1 
ATOM   6786 O  OG    . SER B 1 376 ? 1.640   16.136  -49.632 1.00 51.21  ? 482 SER B OG    1 
ATOM   6787 N  N     . ALA B 1 377 ? 2.222   19.579  -46.616 1.00 65.78  ? 483 ALA B N     1 
ATOM   6788 C  CA    . ALA B 1 377 ? 1.908   20.927  -46.125 1.00 69.04  ? 483 ALA B CA    1 
ATOM   6789 C  C     . ALA B 1 377 ? 2.876   21.945  -46.776 1.00 74.95  ? 483 ALA B C     1 
ATOM   6790 O  O     . ALA B 1 377 ? 4.091   21.710  -46.898 1.00 75.34  ? 483 ALA B O     1 
ATOM   6791 C  CB    . ALA B 1 377 ? 1.952   21.012  -44.603 1.00 69.68  ? 483 ALA B CB    1 
ATOM   6792 N  N     . LYS B 1 378 ? 2.304   23.038  -47.282 1.00 80.51  ? 484 LYS B N     1 
ATOM   6793 C  CA    . LYS B 1 378 ? 3.072   24.140  -47.846 1.00 83.24  ? 484 LYS B CA    1 
ATOM   6794 C  C     . LYS B 1 378 ? 3.300   25.159  -46.707 1.00 88.27  ? 484 LYS B C     1 
ATOM   6795 O  O     . LYS B 1 378 ? 2.458   26.024  -46.482 1.00 80.63  ? 484 LYS B O     1 
ATOM   6796 C  CB    . LYS B 1 378 ? 2.333   24.770  -49.023 1.00 74.10  ? 484 LYS B CB    1 
ATOM   6797 N  N     . PRO B 1 379 ? 4.426   25.026  -45.959 1.00 102.91 ? 485 PRO B N     1 
ATOM   6798 C  CA    . PRO B 1 379 ? 4.767   26.027  -44.920 1.00 104.14 ? 485 PRO B CA    1 
ATOM   6799 C  C     . PRO B 1 379 ? 5.029   27.398  -45.570 1.00 100.60 ? 485 PRO B C     1 
ATOM   6800 O  O     . PRO B 1 379 ? 5.574   27.394  -46.666 1.00 101.99 ? 485 PRO B O     1 
ATOM   6801 C  CB    . PRO B 1 379 ? 6.093   25.498  -44.378 1.00 107.67 ? 485 PRO B CB    1 
ATOM   6802 C  CG    . PRO B 1 379 ? 6.712   24.789  -45.553 1.00 108.04 ? 485 PRO B CG    1 
ATOM   6803 C  CD    . PRO B 1 379 ? 5.567   24.118  -46.230 1.00 103.13 ? 485 PRO B CD    1 
ATOM   6804 N  N     . LYS B 1 380 ? 4.656   28.531  -44.949 1.00 101.07 ? 486 LYS B N     1 
ATOM   6805 C  CA    . LYS B 1 380 ? 4.763   29.857  -45.639 1.00 102.78 ? 486 LYS B CA    1 
ATOM   6806 C  C     . LYS B 1 380 ? 6.231   30.237  -45.954 1.00 110.91 ? 486 LYS B C     1 
ATOM   6807 O  O     . LYS B 1 380 ? 6.872   30.912  -45.152 1.00 106.96 ? 486 LYS B O     1 
ATOM   6808 C  CB    . LYS B 1 380 ? 4.011   30.988  -44.902 1.00 92.13  ? 486 LYS B CB    1 
ATOM   6809 N  N     . VAL B 1 381 ? 6.697   29.762  -47.133 1.00 120.31 ? 487 VAL B N     1 
ATOM   6810 C  CA    . VAL B 1 381 ? 7.987   30.040  -47.833 1.00 123.60 ? 487 VAL B CA    1 
ATOM   6811 C  C     . VAL B 1 381 ? 9.235   29.902  -46.953 1.00 125.98 ? 487 VAL B C     1 
ATOM   6812 O  O     . VAL B 1 381 ? 10.083  30.779  -46.987 1.00 136.42 ? 487 VAL B O     1 
ATOM   6813 C  CB    . VAL B 1 381 ? 8.008   31.451  -48.582 1.00 126.14 ? 487 VAL B CB    1 
ATOM   6814 C  CG1   . VAL B 1 381 ? 9.271   31.660  -49.465 1.00 119.50 ? 487 VAL B CG1   1 
ATOM   6815 C  CG2   . VAL B 1 381 ? 6.740   31.685  -49.424 1.00 120.05 ? 487 VAL B CG2   1 
ATOM   6816 N  N     . LEU B 1 382 ? 9.295   28.873  -46.107 1.00 119.97 ? 488 LEU B N     1 
ATOM   6817 C  CA    . LEU B 1 382 ? 10.351  28.759  -45.086 1.00 113.42 ? 488 LEU B CA    1 
ATOM   6818 C  C     . LEU B 1 382 ? 10.779  27.301  -44.917 1.00 105.97 ? 488 LEU B C     1 
ATOM   6819 O  O     . LEU B 1 382 ? 10.458  26.683  -43.901 1.00 95.39  ? 488 LEU B O     1 
ATOM   6820 C  CB    . LEU B 1 382 ? 9.905   29.399  -43.728 1.00 113.94 ? 488 LEU B CB    1 
ATOM   6821 C  CG    . LEU B 1 382 ? 9.648   30.934  -43.634 1.00 111.81 ? 488 LEU B CG    1 
ATOM   6822 C  CD1   . LEU B 1 382 ? 9.009   31.314  -42.316 1.00 108.95 ? 488 LEU B CD1   1 
ATOM   6823 C  CD2   . LEU B 1 382 ? 10.889  31.790  -43.891 1.00 107.96 ? 488 LEU B CD2   1 
ATOM   6824 N  N     . LEU B 1 383 ? 11.453  26.734  -45.925 1.00 100.08 ? 489 LEU B N     1 
ATOM   6825 C  CA    . LEU B 1 383 ? 12.082  25.410  -45.770 1.00 101.46 ? 489 LEU B CA    1 
ATOM   6826 C  C     . LEU B 1 383 ? 13.419  25.206  -46.466 1.00 97.60  ? 489 LEU B C     1 
ATOM   6827 O  O     . LEU B 1 383 ? 13.487  25.256  -47.677 1.00 103.86 ? 489 LEU B O     1 
ATOM   6828 C  CB    . LEU B 1 383 ? 11.100  24.289  -46.165 1.00 105.00 ? 489 LEU B CB    1 
ATOM   6829 C  CG    . LEU B 1 383 ? 10.001  23.950  -45.121 1.00 104.44 ? 489 LEU B CG    1 
ATOM   6830 C  CD1   . LEU B 1 383 ? 9.384   22.612  -45.453 1.00 103.78 ? 489 LEU B CD1   1 
ATOM   6831 C  CD2   . LEU B 1 383 ? 10.458  23.901  -43.669 1.00 101.58 ? 489 LEU B CD2   1 
ATOM   6832 N  N     . ASP B 1 384 ? 14.447  24.904  -45.669 1.00 90.66  ? 490 ASP B N     1 
ATOM   6833 C  CA    . ASP B 1 384 ? 15.863  24.662  -46.097 1.00 88.97  ? 490 ASP B CA    1 
ATOM   6834 C  C     . ASP B 1 384 ? 16.145  23.226  -46.473 1.00 88.24  ? 490 ASP B C     1 
ATOM   6835 O  O     . ASP B 1 384 ? 17.182  22.949  -47.092 1.00 88.90  ? 490 ASP B O     1 
ATOM   6836 C  CB    . ASP B 1 384 ? 16.874  24.932  -44.972 1.00 90.86  ? 490 ASP B CB    1 
ATOM   6837 C  CG    . ASP B 1 384 ? 16.528  26.125  -44.135 1.00 97.52  ? 490 ASP B CG    1 
ATOM   6838 O  OD1   . ASP B 1 384 ? 16.444  27.190  -44.768 1.00 114.01 ? 490 ASP B OD1   1 
ATOM   6839 O  OD2   . ASP B 1 384 ? 16.343  25.998  -42.886 1.00 89.49  ? 490 ASP B OD2   1 
ATOM   6840 N  N     . VAL B 1 385 ? 15.301  22.318  -45.967 1.00 85.96  ? 491 VAL B N     1 
ATOM   6841 C  CA    . VAL B 1 385 ? 15.322  20.880  -46.279 1.00 84.16  ? 491 VAL B CA    1 
ATOM   6842 C  C     . VAL B 1 385 ? 13.833  20.450  -46.395 1.00 76.28  ? 491 VAL B C     1 
ATOM   6843 O  O     . VAL B 1 385 ? 12.971  21.036  -45.738 1.00 76.75  ? 491 VAL B O     1 
ATOM   6844 C  CB    . VAL B 1 385 ? 16.163  20.055  -45.245 1.00 85.99  ? 491 VAL B CB    1 
ATOM   6845 C  CG1   . VAL B 1 385 ? 15.996  18.542  -45.434 1.00 84.62  ? 491 VAL B CG1   1 
ATOM   6846 C  CG2   . VAL B 1 385 ? 17.655  20.437  -45.350 1.00 83.43  ? 491 VAL B CG2   1 
ATOM   6847 N  N     . LYS B 1 386 ? 13.537  19.536  -47.328 1.00 71.27  ? 492 LYS B N     1 
ATOM   6848 C  CA    . LYS B 1 386 ? 12.242  18.899  -47.429 1.00 68.63  ? 492 LYS B CA    1 
ATOM   6849 C  C     . LYS B 1 386 ? 12.359  17.612  -46.581 1.00 64.41  ? 492 LYS B C     1 
ATOM   6850 O  O     . LYS B 1 386 ? 13.451  17.099  -46.315 1.00 65.98  ? 492 LYS B O     1 
ATOM   6851 C  CB    . LYS B 1 386 ? 11.812  18.625  -48.911 1.00 65.47  ? 492 LYS B CB    1 
ATOM   6852 N  N     . LEU B 1 387 ? 11.202  17.113  -46.173 1.00 58.03  ? 493 LEU B N     1 
ATOM   6853 C  CA    . LEU B 1 387 ? 11.057  15.762  -45.641 1.00 53.23  ? 493 LEU B CA    1 
ATOM   6854 C  C     . LEU B 1 387 ? 10.058  14.983  -46.520 1.00 49.60  ? 493 LEU B C     1 
ATOM   6855 O  O     . LEU B 1 387 ? 9.130   15.577  -47.049 1.00 51.08  ? 493 LEU B O     1 
ATOM   6856 C  CB    . LEU B 1 387 ? 10.532  15.877  -44.180 1.00 54.84  ? 493 LEU B CB    1 
ATOM   6857 C  CG    . LEU B 1 387 ? 11.429  16.486  -43.082 1.00 52.05  ? 493 LEU B CG    1 
ATOM   6858 C  CD1   . LEU B 1 387 ? 10.626  16.986  -41.891 1.00 52.60  ? 493 LEU B CD1   1 
ATOM   6859 C  CD2   . LEU B 1 387 ? 12.507  15.455  -42.710 1.00 50.57  ? 493 LEU B CD2   1 
ATOM   6860 N  N     . LYS B 1 388 ? 10.241  13.679  -46.705 1.00 47.36  ? 494 LYS B N     1 
ATOM   6861 C  CA    . LYS B 1 388 ? 9.350   12.850  -47.522 1.00 47.49  ? 494 LYS B CA    1 
ATOM   6862 C  C     . LYS B 1 388 ? 8.234   12.223  -46.613 1.00 49.52  ? 494 LYS B C     1 
ATOM   6863 O  O     . LYS B 1 388 ? 8.308   12.297  -45.395 1.00 52.42  ? 494 LYS B O     1 
ATOM   6864 C  CB    . LYS B 1 388 ? 10.211  11.778  -48.231 1.00 44.66  ? 494 LYS B CB    1 
ATOM   6865 N  N     . ALA B 1 389 ? 7.251   11.571  -47.192 1.00 47.94  ? 495 ALA B N     1 
ATOM   6866 C  CA    . ALA B 1 389 ? 6.220   10.869  -46.439 1.00 48.09  ? 495 ALA B CA    1 
ATOM   6867 C  C     . ALA B 1 389 ? 6.774   9.685   -45.654 1.00 45.75  ? 495 ALA B C     1 
ATOM   6868 O  O     . ALA B 1 389 ? 6.364   9.488   -44.529 1.00 44.72  ? 495 ALA B O     1 
ATOM   6869 C  CB    . ALA B 1 389 ? 5.069   10.424  -47.355 1.00 47.16  ? 495 ALA B CB    1 
ATOM   6870 N  N     . GLU B 1 390 ? 7.741   8.963   -46.217 1.00 44.73  ? 496 GLU B N     1 
ATOM   6871 C  CA    . GLU B 1 390 ? 8.421   7.859   -45.525 1.00 44.11  ? 496 GLU B CA    1 
ATOM   6872 C  C     . GLU B 1 390 ? 8.982   8.310   -44.140 1.00 46.07  ? 496 GLU B C     1 
ATOM   6873 O  O     . GLU B 1 390 ? 9.360   7.483   -43.337 1.00 49.21  ? 496 GLU B O     1 
ATOM   6874 C  CB    . GLU B 1 390 ? 9.551   7.269   -46.382 1.00 40.66  ? 496 GLU B CB    1 
ATOM   6875 N  N     . ASP B 1 391 ? 9.117   9.616   -43.883 1.00 46.80  ? 497 ASP B N     1 
ATOM   6876 C  CA    . ASP B 1 391 ? 9.755   10.151  -42.637 1.00 44.37  ? 497 ASP B CA    1 
ATOM   6877 C  C     . ASP B 1 391 ? 8.825   10.392  -41.432 1.00 43.09  ? 497 ASP B C     1 
ATOM   6878 O  O     . ASP B 1 391 ? 9.295   10.747  -40.322 1.00 41.26  ? 497 ASP B O     1 
ATOM   6879 C  CB    . ASP B 1 391 ? 10.397  11.518  -42.936 1.00 44.10  ? 497 ASP B CB    1 
ATOM   6880 C  CG    . ASP B 1 391 ? 11.616  11.441  -43.907 1.00 44.12  ? 497 ASP B CG    1 
ATOM   6881 O  OD1   . ASP B 1 391 ? 12.253  10.390  -43.989 1.00 46.05  ? 497 ASP B OD1   1 
ATOM   6882 O  OD2   . ASP B 1 391 ? 11.998  12.458  -44.519 1.00 41.75  ? 497 ASP B OD2   1 
ATOM   6883 N  N     . PHE B 1 392 ? 7.525   10.299  -41.675 1.00 40.76  ? 498 PHE B N     1 
ATOM   6884 C  CA    . PHE B 1 392 ? 6.498   10.662  -40.729 1.00 41.13  ? 498 PHE B CA    1 
ATOM   6885 C  C     . PHE B 1 392 ? 5.773   9.387   -40.331 1.00 40.60  ? 498 PHE B C     1 
ATOM   6886 O  O     . PHE B 1 392 ? 5.620   8.517   -41.139 1.00 40.89  ? 498 PHE B O     1 
ATOM   6887 C  CB    . PHE B 1 392 ? 5.491   11.672  -41.333 1.00 41.49  ? 498 PHE B CB    1 
ATOM   6888 C  CG    . PHE B 1 392 ? 6.042   13.068  -41.474 1.00 43.17  ? 498 PHE B CG    1 
ATOM   6889 C  CD1   . PHE B 1 392 ? 6.116   13.898  -40.383 1.00 42.83  ? 498 PHE B CD1   1 
ATOM   6890 C  CD2   . PHE B 1 392 ? 6.500   13.549  -42.687 1.00 42.40  ? 498 PHE B CD2   1 
ATOM   6891 C  CE1   . PHE B 1 392 ? 6.653   15.179  -40.477 1.00 44.57  ? 498 PHE B CE1   1 
ATOM   6892 C  CE2   . PHE B 1 392 ? 7.026   14.832  -42.810 1.00 40.94  ? 498 PHE B CE2   1 
ATOM   6893 C  CZ    . PHE B 1 392 ? 7.108   15.639  -41.731 1.00 44.89  ? 498 PHE B CZ    1 
ATOM   6894 N  N     . ILE B 1 393 ? 5.345   9.312   -39.068 1.00 40.96  ? 499 ILE B N     1 
ATOM   6895 C  CA    . ILE B 1 393 ? 4.293   8.403   -38.602 1.00 38.57  ? 499 ILE B CA    1 
ATOM   6896 C  C     . ILE B 1 393 ? 3.072   9.186   -38.086 1.00 36.85  ? 499 ILE B C     1 
ATOM   6897 O  O     . ILE B 1 393 ? 3.216   10.183  -37.432 1.00 36.25  ? 499 ILE B O     1 
ATOM   6898 C  CB    . ILE B 1 393 ? 4.864   7.506   -37.519 1.00 37.85  ? 499 ILE B CB    1 
ATOM   6899 C  CG1   . ILE B 1 393 ? 5.822   6.520   -38.203 1.00 40.46  ? 499 ILE B CG1   1 
ATOM   6900 C  CG2   . ILE B 1 393 ? 3.787   6.736   -36.796 1.00 36.27  ? 499 ILE B CG2   1 
ATOM   6901 C  CD1   . ILE B 1 393 ? 6.827   5.955   -37.255 1.00 43.50  ? 499 ILE B CD1   1 
ATOM   6902 N  N     . VAL B 1 394 ? 1.880   8.721   -38.393 1.00 35.82  ? 500 VAL B N     1 
ATOM   6903 C  CA    . VAL B 1 394 ? 0.689   9.349   -37.952 1.00 35.64  ? 500 VAL B CA    1 
ATOM   6904 C  C     . VAL B 1 394 ? -0.122  8.222   -37.295 1.00 37.65  ? 500 VAL B C     1 
ATOM   6905 O  O     . VAL B 1 394 ? -0.482  7.315   -37.974 1.00 33.95  ? 500 VAL B O     1 
ATOM   6906 C  CB    . VAL B 1 394 ? -0.089  10.015  -39.088 1.00 37.08  ? 500 VAL B CB    1 
ATOM   6907 C  CG1   . VAL B 1 394 ? -1.284  10.799  -38.554 1.00 37.33  ? 500 VAL B CG1   1 
ATOM   6908 C  CG2   . VAL B 1 394 ? 0.768   11.034  -39.820 1.00 38.33  ? 500 VAL B CG2   1 
ATOM   6909 N  N     . ASP B 1 395 ? -0.397  8.316   -35.975 1.00 36.20  ? 501 ASP B N     1 
ATOM   6910 C  CA    . ASP B 1 395 ? -1.043  7.237   -35.235 1.00 35.90  ? 501 ASP B CA    1 
ATOM   6911 C  C     . ASP B 1 395 ? -2.412  7.779   -34.828 1.00 34.34  ? 501 ASP B C     1 
ATOM   6912 O  O     . ASP B 1 395 ? -2.488  8.702   -34.097 1.00 35.37  ? 501 ASP B O     1 
ATOM   6913 C  CB    . ASP B 1 395 ? -0.124  6.851   -34.034 1.00 36.33  ? 501 ASP B CB    1 
ATOM   6914 C  CG    . ASP B 1 395 ? -0.457  5.503   -33.421 1.00 36.77  ? 501 ASP B CG    1 
ATOM   6915 O  OD1   . ASP B 1 395 ? -0.936  4.590   -34.140 1.00 42.46  ? 501 ASP B OD1   1 
ATOM   6916 O  OD2   . ASP B 1 395 ? -0.231  5.344   -32.212 1.00 38.48  ? 501 ASP B OD2   1 
ATOM   6917 N  N     . VAL B 1 396 ? -3.472  7.216   -35.347 1.00 33.10  ? 502 VAL B N     1 
ATOM   6918 C  CA    . VAL B 1 396 ? -4.842  7.564   -35.017 1.00 34.40  ? 502 VAL B CA    1 
ATOM   6919 C  C     . VAL B 1 396 ? -5.365  6.615   -33.928 1.00 35.42  ? 502 VAL B C     1 
ATOM   6920 O  O     . VAL B 1 396 ? -5.347  5.410   -34.094 1.00 37.36  ? 502 VAL B O     1 
ATOM   6921 C  CB    . VAL B 1 396 ? -5.759  7.435   -36.263 1.00 33.00  ? 502 VAL B CB    1 
ATOM   6922 C  CG1   . VAL B 1 396 ? -7.166  7.903   -35.963 1.00 33.04  ? 502 VAL B CG1   1 
ATOM   6923 C  CG2   . VAL B 1 396 ? -5.220  8.321   -37.356 1.00 33.37  ? 502 VAL B CG2   1 
ATOM   6924 N  N     . ILE B 1 397 ? -5.834  7.177   -32.830 1.00 36.12  ? 503 ILE B N     1 
ATOM   6925 C  CA    . ILE B 1 397 ? -6.320  6.384   -31.716 1.00 36.68  ? 503 ILE B CA    1 
ATOM   6926 C  C     . ILE B 1 397 ? -7.776  6.711   -31.402 1.00 35.78  ? 503 ILE B C     1 
ATOM   6927 O  O     . ILE B 1 397 ? -8.098  7.849   -31.086 1.00 35.88  ? 503 ILE B O     1 
ATOM   6928 C  CB    . ILE B 1 397 ? -5.448  6.653   -30.468 1.00 39.76  ? 503 ILE B CB    1 
ATOM   6929 C  CG1   . ILE B 1 397 ? -4.029  6.128   -30.685 1.00 42.08  ? 503 ILE B CG1   1 
ATOM   6930 C  CG2   . ILE B 1 397 ? -5.975  5.938   -29.234 1.00 39.54  ? 503 ILE B CG2   1 
ATOM   6931 C  CD1   . ILE B 1 397 ? -3.008  7.070   -30.123 1.00 44.70  ? 503 ILE B CD1   1 
ATOM   6932 N  N     . ASN B 1 398 ? -8.606  5.678   -31.375 1.00 37.51  ? 504 ASN B N     1 
ATOM   6933 C  CA    . ASN B 1 398 ? -10.014 5.759   -30.979 1.00 41.29  ? 504 ASN B CA    1 
ATOM   6934 C  C     . ASN B 1 398 ? -10.134 5.525   -29.513 1.00 41.45  ? 504 ASN B C     1 
ATOM   6935 O  O     . ASN B 1 398 ? -9.782  4.458   -29.079 1.00 42.70  ? 504 ASN B O     1 
ATOM   6936 C  CB    . ASN B 1 398 ? -10.851 4.755   -31.799 1.00 40.72  ? 504 ASN B CB    1 
ATOM   6937 C  CG    . ASN B 1 398 ? -10.673 5.013   -33.277 1.00 42.39  ? 504 ASN B CG    1 
ATOM   6938 O  OD1   . ASN B 1 398 ? -10.881 6.091   -33.734 1.00 44.89  ? 504 ASN B OD1   1 
ATOM   6939 N  ND2   . ASN B 1 398 ? -10.060 4.103   -33.952 1.00 49.74  ? 504 ASN B ND2   1 
ATOM   6940 N  N     . MET B 1 399 ? -10.566 6.556   -28.774 1.00 42.38  ? 505 MET B N     1 
ATOM   6941 C  CA    . MET B 1 399 ? -10.831 6.503   -27.318 1.00 40.21  ? 505 MET B CA    1 
ATOM   6942 C  C     . MET B 1 399 ? -12.355 6.534   -27.117 1.00 41.61  ? 505 MET B C     1 
ATOM   6943 O  O     . MET B 1 399 ? -13.032 7.440   -27.606 1.00 41.54  ? 505 MET B O     1 
ATOM   6944 C  CB    . MET B 1 399 ? -10.207 7.722   -26.600 1.00 38.78  ? 505 MET B CB    1 
ATOM   6945 C  CG    . MET B 1 399 ? -8.690  7.859   -26.728 1.00 40.14  ? 505 MET B CG    1 
ATOM   6946 S  SD    . MET B 1 399 ? -7.661  6.583   -25.877 1.00 41.38  ? 505 MET B SD    1 
ATOM   6947 C  CE    . MET B 1 399 ? -7.397  7.503   -24.373 1.00 40.54  ? 505 MET B CE    1 
ATOM   6948 N  N     . ASP B 1 400 ? -12.901 5.586   -26.362 1.00 39.95  ? 506 ASP B N     1 
ATOM   6949 C  CA    . ASP B 1 400 ? -14.345 5.568   -26.159 1.00 39.84  ? 506 ASP B CA    1 
ATOM   6950 C  C     . ASP B 1 400 ? -14.695 4.823   -24.897 1.00 38.04  ? 506 ASP B C     1 
ATOM   6951 O  O     . ASP B 1 400 ? -13.808 4.336   -24.243 1.00 42.28  ? 506 ASP B O     1 
ATOM   6952 C  CB    . ASP B 1 400 ? -15.047 4.970   -27.428 1.00 39.44  ? 506 ASP B CB    1 
ATOM   6953 C  CG    . ASP B 1 400 ? -14.686 3.525   -27.688 1.00 39.51  ? 506 ASP B CG    1 
ATOM   6954 O  OD1   . ASP B 1 400 ? -14.320 2.801   -26.721 1.00 36.06  ? 506 ASP B OD1   1 
ATOM   6955 O  OD2   . ASP B 1 400 ? -14.737 3.140   -28.887 1.00 42.57  ? 506 ASP B OD2   1 
ATOM   6956 N  N     . TYR B 1 401 ? -15.986 4.715   -24.579 1.00 36.57  ? 507 TYR B N     1 
ATOM   6957 C  CA    . TYR B 1 401 ? -16.475 3.960   -23.407 1.00 35.07  ? 507 TYR B CA    1 
ATOM   6958 C  C     . TYR B 1 401 ? -16.860 2.528   -23.783 1.00 35.11  ? 507 TYR B C     1 
ATOM   6959 O  O     . TYR B 1 401 ? -17.746 1.904   -23.174 1.00 35.44  ? 507 TYR B O     1 
ATOM   6960 C  CB    . TYR B 1 401 ? -17.636 4.748   -22.749 1.00 36.08  ? 507 TYR B CB    1 
ATOM   6961 C  CG    . TYR B 1 401 ? -17.231 5.797   -21.722 1.00 33.51  ? 507 TYR B CG    1 
ATOM   6962 C  CD1   . TYR B 1 401 ? -16.029 6.480   -21.808 1.00 33.35  ? 507 TYR B CD1   1 
ATOM   6963 C  CD2   . TYR B 1 401 ? -18.081 6.106   -20.641 1.00 35.08  ? 507 TYR B CD2   1 
ATOM   6964 C  CE1   . TYR B 1 401 ? -15.672 7.430   -20.851 1.00 33.23  ? 507 TYR B CE1   1 
ATOM   6965 C  CE2   . TYR B 1 401 ? -17.724 7.021   -19.635 1.00 33.06  ? 507 TYR B CE2   1 
ATOM   6966 C  CZ    . TYR B 1 401 ? -16.517 7.673   -19.744 1.00 33.41  ? 507 TYR B CZ    1 
ATOM   6967 O  OH    . TYR B 1 401 ? -16.114 8.582   -18.795 1.00 35.14  ? 507 TYR B OH    1 
ATOM   6968 N  N     . GLY B 1 402 ? -16.153 1.976   -24.769 1.00 37.29  ? 508 GLY B N     1 
ATOM   6969 C  CA    . GLY B 1 402 ? -16.283 0.559   -25.205 1.00 37.43  ? 508 GLY B CA    1 
ATOM   6970 C  C     . GLY B 1 402 ? -17.435 0.216   -26.142 1.00 39.54  ? 508 GLY B C     1 
ATOM   6971 O  O     . GLY B 1 402 ? -17.633 -0.947  -26.427 1.00 39.54  ? 508 GLY B O     1 
ATOM   6972 N  N     . MET B 1 403 ? -18.195 1.200   -26.614 1.00 43.60  ? 509 MET B N     1 
ATOM   6973 C  CA    . MET B 1 403 ? -19.412 0.931   -27.463 1.00 46.46  ? 509 MET B CA    1 
ATOM   6974 C  C     . MET B 1 403 ? -19.568 2.064   -28.489 1.00 45.72  ? 509 MET B C     1 
ATOM   6975 O  O     . MET B 1 403 ? -20.640 2.682   -28.629 1.00 43.91  ? 509 MET B O     1 
ATOM   6976 C  CB    . MET B 1 403 ? -20.660 0.816   -26.569 1.00 50.49  ? 509 MET B CB    1 
ATOM   6977 C  CG    . MET B 1 403 ? -20.805 -0.487  -25.782 1.00 54.64  ? 509 MET B CG    1 
ATOM   6978 S  SD    . MET B 1 403 ? -22.471 -0.466  -25.062 1.00 62.73  ? 509 MET B SD    1 
ATOM   6979 C  CE    . MET B 1 403 ? -23.431 -1.222  -26.396 1.00 58.69  ? 509 MET B CE    1 
ATOM   6980 N  N     . GLN B 1 404 ? -18.431 2.362   -29.148 1.00 46.59  ? 510 GLN B N     1 
ATOM   6981 C  CA    . GLN B 1 404 ? -18.297 3.388   -30.178 1.00 48.09  ? 510 GLN B CA    1 
ATOM   6982 C  C     . GLN B 1 404 ? -18.834 4.648   -29.589 1.00 47.65  ? 510 GLN B C     1 
ATOM   6983 O  O     . GLN B 1 404 ? -18.268 5.109   -28.635 1.00 48.01  ? 510 GLN B O     1 
ATOM   6984 C  CB    . GLN B 1 404 ? -18.947 2.959   -31.525 1.00 47.00  ? 510 GLN B CB    1 
ATOM   6985 C  CG    . GLN B 1 404 ? -18.481 1.572   -32.015 1.00 49.07  ? 510 GLN B CG    1 
ATOM   6986 C  CD    . GLN B 1 404 ? -19.194 0.371   -31.334 1.00 53.15  ? 510 GLN B CD    1 
ATOM   6987 O  OE1   . GLN B 1 404 ? -20.431 0.278   -31.315 1.00 59.78  ? 510 GLN B OE1   1 
ATOM   6988 N  NE2   . GLN B 1 404 ? -18.406 -0.572  -30.784 1.00 56.74  ? 510 GLN B NE2   1 
ATOM   6989 N  N     . GLU B 1 405 ? -19.931 5.196   -30.073 1.00 46.46  ? 511 GLU B N     1 
ATOM   6990 C  CA    . GLU B 1 405 ? -20.356 6.456   -29.529 1.00 49.32  ? 511 GLU B CA    1 
ATOM   6991 C  C     . GLU B 1 405 ? -21.493 6.388   -28.540 1.00 43.97  ? 511 GLU B C     1 
ATOM   6992 O  O     . GLU B 1 405 ? -21.991 7.412   -28.103 1.00 38.71  ? 511 GLU B O     1 
ATOM   6993 C  CB    . GLU B 1 405 ? -20.699 7.375   -30.643 1.00 58.08  ? 511 GLU B CB    1 
ATOM   6994 C  CG    . GLU B 1 405 ? -21.834 6.990   -31.576 1.00 66.75  ? 511 GLU B CG    1 
ATOM   6995 C  CD    . GLU B 1 405 ? -21.712 7.869   -32.815 1.00 87.46  ? 511 GLU B CD    1 
ATOM   6996 O  OE1   . GLU B 1 405 ? -21.161 8.993   -32.642 1.00 97.39  ? 511 GLU B OE1   1 
ATOM   6997 O  OE2   . GLU B 1 405 ? -22.118 7.478   -33.954 1.00 95.60  ? 511 GLU B OE2   1 
ATOM   6998 N  N     . LYS B 1 406 ? -21.901 5.184   -28.184 1.00 42.97  ? 512 LYS B N     1 
ATOM   6999 C  CA    . LYS B 1 406 ? -23.012 5.061   -27.277 1.00 45.67  ? 512 LYS B CA    1 
ATOM   7000 C  C     . LYS B 1 406 ? -22.582 5.182   -25.794 1.00 42.02  ? 512 LYS B C     1 
ATOM   7001 O  O     . LYS B 1 406 ? -21.437 4.925   -25.429 1.00 37.79  ? 512 LYS B O     1 
ATOM   7002 C  CB    . LYS B 1 406 ? -23.653 3.709   -27.474 1.00 51.82  ? 512 LYS B CB    1 
ATOM   7003 C  CG    . LYS B 1 406 ? -24.204 3.472   -28.875 1.00 56.48  ? 512 LYS B CG    1 
ATOM   7004 C  CD    . LYS B 1 406 ? -24.595 1.989   -28.934 1.00 62.06  ? 512 LYS B CD    1 
ATOM   7005 C  CE    . LYS B 1 406 ? -25.489 1.645   -30.094 1.00 66.50  ? 512 LYS B CE    1 
ATOM   7006 N  NZ    . LYS B 1 406 ? -24.897 0.431   -30.714 1.00 72.95  ? 512 LYS B NZ    1 
ATOM   7007 N  N     . ASN B 1 407 ? -23.533 5.533   -24.966 1.00 38.30  ? 513 ASN B N     1 
ATOM   7008 C  CA    . ASN B 1 407 ? -23.371 5.543   -23.549 1.00 36.85  ? 513 ASN B CA    1 
ATOM   7009 C  C     . ASN B 1 407 ? -23.700 4.122   -23.074 1.00 35.96  ? 513 ASN B C     1 
ATOM   7010 O  O     . ASN B 1 407 ? -24.855 3.682   -23.192 1.00 34.50  ? 513 ASN B O     1 
ATOM   7011 C  CB    . ASN B 1 407 ? -24.290 6.594   -22.926 1.00 36.39  ? 513 ASN B CB    1 
ATOM   7012 C  CG    . ASN B 1 407 ? -24.169 6.659   -21.411 1.00 36.94  ? 513 ASN B CG    1 
ATOM   7013 O  OD1   . ASN B 1 407 ? -23.469 5.810   -20.795 1.00 36.01  ? 513 ASN B OD1   1 
ATOM   7014 N  ND2   . ASN B 1 407 ? -24.851 7.643   -20.789 1.00 33.77  ? 513 ASN B ND2   1 
ATOM   7015 N  N     . PRO B 1 408 ? -22.694 3.402   -22.518 1.00 37.15  ? 514 PRO B N     1 
ATOM   7016 C  CA    . PRO B 1 408 ? -22.969 2.010   -22.041 1.00 38.44  ? 514 PRO B CA    1 
ATOM   7017 C  C     . PRO B 1 408 ? -23.907 1.960   -20.858 1.00 37.93  ? 514 PRO B C     1 
ATOM   7018 O  O     . PRO B 1 408 ? -24.606 0.940   -20.670 1.00 40.56  ? 514 PRO B O     1 
ATOM   7019 C  CB    . PRO B 1 408 ? -21.587 1.448   -21.689 1.00 37.93  ? 514 PRO B CB    1 
ATOM   7020 C  CG    . PRO B 1 408 ? -20.742 2.645   -21.423 1.00 37.94  ? 514 PRO B CG    1 
ATOM   7021 C  CD    . PRO B 1 408 ? -21.312 3.826   -22.211 1.00 37.32  ? 514 PRO B CD    1 
ATOM   7022 N  N     . ILE B 1 409 ? -23.995 3.048   -20.098 1.00 37.34  ? 515 ILE B N     1 
ATOM   7023 C  CA    . ILE B 1 409 ? -24.909 3.059   -18.949 1.00 38.11  ? 515 ILE B CA    1 
ATOM   7024 C  C     . ILE B 1 409 ? -26.356 3.072   -19.418 1.00 38.68  ? 515 ILE B C     1 
ATOM   7025 O  O     . ILE B 1 409 ? -27.195 2.703   -18.649 1.00 36.99  ? 515 ILE B O     1 
ATOM   7026 C  CB    . ILE B 1 409 ? -24.636 4.195   -17.942 1.00 38.27  ? 515 ILE B CB    1 
ATOM   7027 C  CG1   . ILE B 1 409 ? -23.143 4.269   -17.543 1.00 38.71  ? 515 ILE B CG1   1 
ATOM   7028 C  CG2   . ILE B 1 409 ? -25.466 4.014   -16.695 1.00 38.13  ? 515 ILE B CG2   1 
ATOM   7029 C  CD1   . ILE B 1 409 ? -22.516 2.917   -17.159 1.00 39.41  ? 515 ILE B CD1   1 
ATOM   7030 N  N     . ASP B 1 410 ? -26.633 3.442   -20.697 1.00 40.74  ? 516 ASP B N     1 
ATOM   7031 C  CA    . ASP B 1 410 ? -27.968 3.310   -21.273 1.00 40.12  ? 516 ASP B CA    1 
ATOM   7032 C  C     . ASP B 1 410 ? -28.350 1.852   -21.492 1.00 42.50  ? 516 ASP B C     1 
ATOM   7033 O  O     . ASP B 1 410 ? -29.524 1.544   -21.689 1.00 48.66  ? 516 ASP B O     1 
ATOM   7034 C  CB    . ASP B 1 410 ? -28.118 4.138   -22.583 1.00 41.07  ? 516 ASP B CB    1 
ATOM   7035 C  CG    . ASP B 1 410 ? -28.153 5.652   -22.334 1.00 41.23  ? 516 ASP B CG    1 
ATOM   7036 O  OD1   . ASP B 1 410 ? -28.425 6.090   -21.220 1.00 41.21  ? 516 ASP B OD1   1 
ATOM   7037 O  OD2   . ASP B 1 410 ? -27.895 6.436   -23.237 1.00 40.06  ? 516 ASP B OD2   1 
ATOM   7038 N  N     . HIS B 1 411 ? -27.380 0.945   -21.452 1.00 43.00  ? 517 HIS B N     1 
ATOM   7039 C  CA    . HIS B 1 411 ? -27.605 -0.454  -21.722 1.00 41.21  ? 517 HIS B CA    1 
ATOM   7040 C  C     . HIS B 1 411 ? -27.324 -1.268  -20.458 1.00 42.83  ? 517 HIS B C     1 
ATOM   7041 O  O     . HIS B 1 411 ? -27.039 -2.457  -20.544 1.00 43.57  ? 517 HIS B O     1 
ATOM   7042 C  CB    . HIS B 1 411 ? -26.722 -0.836  -22.871 1.00 42.94  ? 517 HIS B CB    1 
ATOM   7043 C  CG    . HIS B 1 411 ? -27.017 -0.066  -24.145 1.00 47.78  ? 517 HIS B CG    1 
ATOM   7044 N  ND1   . HIS B 1 411 ? -27.711 -0.621  -25.202 1.00 46.16  ? 517 HIS B ND1   1 
ATOM   7045 C  CD2   . HIS B 1 411 ? -26.677 1.187   -24.540 1.00 48.37  ? 517 HIS B CD2   1 
ATOM   7046 C  CE1   . HIS B 1 411 ? -27.778 0.253   -26.187 1.00 50.83  ? 517 HIS B CE1   1 
ATOM   7047 N  NE2   . HIS B 1 411 ? -27.192 1.374   -25.797 1.00 52.26  ? 517 HIS B NE2   1 
ATOM   7048 N  N     . VAL B 1 412 ? -27.456 -0.625  -19.284 1.00 42.25  ? 518 VAL B N     1 
ATOM   7049 C  CA    . VAL B 1 412 ? -27.500 -1.288  -17.946 1.00 39.51  ? 518 VAL B CA    1 
ATOM   7050 C  C     . VAL B 1 412 ? -28.910 -1.235  -17.355 1.00 38.75  ? 518 VAL B C     1 
ATOM   7051 O  O     . VAL B 1 412 ? -29.611 -0.223  -17.470 1.00 40.69  ? 518 VAL B O     1 
ATOM   7052 C  CB    . VAL B 1 412 ? -26.552 -0.565  -16.965 1.00 38.00  ? 518 VAL B CB    1 
ATOM   7053 C  CG1   . VAL B 1 412 ? -26.649 -1.107  -15.526 1.00 37.17  ? 518 VAL B CG1   1 
ATOM   7054 C  CG2   . VAL B 1 412 ? -25.112 -0.627  -17.464 1.00 38.78  ? 518 VAL B CG2   1 
ATOM   7055 N  N     . SER B 1 413 ? -29.311 -2.299  -16.676 1.00 39.83  ? 519 SER B N     1 
ATOM   7056 C  CA    . SER B 1 413 ? -30.563 -2.282  -15.907 1.00 43.40  ? 519 SER B CA    1 
ATOM   7057 C  C     . SER B 1 413 ? -30.290 -2.251  -14.408 1.00 40.63  ? 519 SER B C     1 
ATOM   7058 O  O     . SER B 1 413 ? -29.376 -2.947  -13.957 1.00 36.22  ? 519 SER B O     1 
ATOM   7059 C  CB    . SER B 1 413 ? -31.405 -3.524  -16.217 1.00 44.75  ? 519 SER B CB    1 
ATOM   7060 O  OG    . SER B 1 413 ? -31.962 -3.323  -17.497 1.00 52.31  ? 519 SER B OG    1 
ATOM   7061 N  N     . PHE B 1 414 ? -31.156 -1.531  -13.672 1.00 39.36  ? 520 PHE B N     1 
ATOM   7062 C  CA    . PHE B 1 414 ? -31.024 -1.310  -12.215 1.00 40.34  ? 520 PHE B CA    1 
ATOM   7063 C  C     . PHE B 1 414 ? -32.228 -1.857  -11.414 1.00 44.20  ? 520 PHE B C     1 
ATOM   7064 O  O     . PHE B 1 414 ? -33.295 -2.138  -11.975 1.00 48.65  ? 520 PHE B O     1 
ATOM   7065 C  CB    . PHE B 1 414 ? -30.825 0.174   -11.971 1.00 37.53  ? 520 PHE B CB    1 
ATOM   7066 C  CG    . PHE B 1 414 ? -29.542 0.776   -12.619 1.00 38.49  ? 520 PHE B CG    1 
ATOM   7067 C  CD1   . PHE B 1 414 ? -29.537 1.309   -13.930 1.00 36.22  ? 520 PHE B CD1   1 
ATOM   7068 C  CD2   . PHE B 1 414 ? -28.358 0.912   -11.876 1.00 38.24  ? 520 PHE B CD2   1 
ATOM   7069 C  CE1   . PHE B 1 414 ? -28.416 1.891   -14.481 1.00 34.07  ? 520 PHE B CE1   1 
ATOM   7070 C  CE2   . PHE B 1 414 ? -27.240 1.540   -12.436 1.00 37.20  ? 520 PHE B CE2   1 
ATOM   7071 C  CZ    . PHE B 1 414 ? -27.273 1.998   -13.752 1.00 36.10  ? 520 PHE B CZ    1 
ATOM   7072 N  N     . TYR B 1 415 ? -32.083 -2.020  -10.101 1.00 47.28  ? 521 TYR B N     1 
ATOM   7073 C  CA    . TYR B 1 415 ? -33.223 -2.366  -9.234  1.00 45.07  ? 521 TYR B CA    1 
ATOM   7074 C  C     . TYR B 1 415 ? -33.166 -1.579  -7.914  1.00 43.57  ? 521 TYR B C     1 
ATOM   7075 O  O     . TYR B 1 415 ? -32.102 -1.104  -7.509  1.00 43.62  ? 521 TYR B O     1 
ATOM   7076 C  CB    . TYR B 1 415 ? -33.316 -3.885  -9.036  1.00 45.02  ? 521 TYR B CB    1 
ATOM   7077 C  CG    . TYR B 1 415 ? -32.215 -4.427  -8.176  1.00 46.98  ? 521 TYR B CG    1 
ATOM   7078 C  CD1   . TYR B 1 415 ? -32.350 -4.433  -6.785  1.00 50.46  ? 521 TYR B CD1   1 
ATOM   7079 C  CD2   . TYR B 1 415 ? -31.017 -4.870  -8.709  1.00 47.69  ? 521 TYR B CD2   1 
ATOM   7080 C  CE1   . TYR B 1 415 ? -31.352 -4.894  -5.965  1.00 48.55  ? 521 TYR B CE1   1 
ATOM   7081 C  CE2   . TYR B 1 415 ? -29.989 -5.307  -7.877  1.00 47.84  ? 521 TYR B CE2   1 
ATOM   7082 C  CZ    . TYR B 1 415 ? -30.192 -5.324  -6.522  1.00 49.30  ? 521 TYR B CZ    1 
ATOM   7083 O  OH    . TYR B 1 415 ? -29.198 -5.753  -5.689  1.00 52.32  ? 521 TYR B OH    1 
ATOM   7084 N  N     . CYS B 1 416 ? -34.335 -1.414  -7.301  1.00 48.07  ? 522 CYS B N     1 
ATOM   7085 C  CA    . CYS B 1 416 ? -34.549 -0.576  -6.091  1.00 49.54  ? 522 CYS B CA    1 
ATOM   7086 C  C     . CYS B 1 416 ? -34.809 -1.471  -4.904  1.00 49.28  ? 522 CYS B C     1 
ATOM   7087 O  O     . CYS B 1 416 ? -35.328 -2.573  -5.020  1.00 44.51  ? 522 CYS B O     1 
ATOM   7088 C  CB    . CYS B 1 416 ? -35.758 0.349   -6.275  1.00 52.15  ? 522 CYS B CB    1 
ATOM   7089 S  SG    . CYS B 1 416 ? -35.566 1.280   -7.847  1.00 68.39  ? 522 CYS B SG    1 
ATOM   7090 N  N     . LYS B 1 417 ? -34.452 -0.947  -3.746  1.00 50.66  ? 523 LYS B N     1 
ATOM   7091 C  CA    . LYS B 1 417 ? -34.473 -1.708  -2.491  1.00 50.83  ? 523 LYS B CA    1 
ATOM   7092 C  C     . LYS B 1 417 ? -35.904 -2.233  -2.218  1.00 49.23  ? 523 LYS B C     1 
ATOM   7093 O  O     . LYS B 1 417 ? -36.080 -3.390  -1.853  1.00 46.13  ? 523 LYS B O     1 
ATOM   7094 C  CB    . LYS B 1 417 ? -33.946 -0.842  -1.324  1.00 51.39  ? 523 LYS B CB    1 
ATOM   7095 C  CG    . LYS B 1 417 ? -33.682 -1.694  -0.072  1.00 57.48  ? 523 LYS B CG    1 
ATOM   7096 C  CD    . LYS B 1 417 ? -33.011 -1.060  1.157   1.00 54.92  ? 523 LYS B CD    1 
ATOM   7097 C  CE    . LYS B 1 417 ? -33.473 0.344   1.453   1.00 54.70  ? 523 LYS B CE    1 
ATOM   7098 N  NZ    . LYS B 1 417 ? -32.895 0.772   2.759   1.00 56.71  ? 523 LYS B NZ    1 
ATOM   7099 N  N     . THR B 1 418 ? -36.908 -1.379  -2.457  1.00 49.75  ? 524 THR B N     1 
ATOM   7100 C  CA    . THR B 1 418 ? -38.322 -1.698  -2.200  1.00 51.02  ? 524 THR B CA    1 
ATOM   7101 C  C     . THR B 1 418 ? -38.971 -2.695  -3.218  1.00 50.56  ? 524 THR B C     1 
ATOM   7102 O  O     . THR B 1 418 ? -39.943 -3.330  -2.880  1.00 51.71  ? 524 THR B O     1 
ATOM   7103 C  CB    . THR B 1 418 ? -39.195 -0.428  -2.081  1.00 49.41  ? 524 THR B CB    1 
ATOM   7104 O  OG1   . THR B 1 418 ? -38.953 0.425   -3.189  1.00 51.90  ? 524 THR B OG1   1 
ATOM   7105 C  CG2   . THR B 1 418 ? -38.882 0.316   -0.819  1.00 46.84  ? 524 THR B CG2   1 
ATOM   7106 N  N     . ALA B 1 419 ? -38.375 -2.895  -4.394  1.00 49.74  ? 525 ALA B N     1 
ATOM   7107 C  CA    . ALA B 1 419 ? -38.909 -3.782  -5.481  1.00 48.38  ? 525 ALA B CA    1 
ATOM   7108 C  C     . ALA B 1 419 ? -37.766 -4.498  -6.221  1.00 47.38  ? 525 ALA B C     1 
ATOM   7109 O  O     . ALA B 1 419 ? -37.435 -4.157  -7.395  1.00 46.37  ? 525 ALA B O     1 
ATOM   7110 C  CB    . ALA B 1 419 ? -39.751 -2.977  -6.464  1.00 46.21  ? 525 ALA B CB    1 
ATOM   7111 N  N     . PRO B 1 420 ? -37.145 -5.455  -5.510  1.00 47.29  ? 526 PRO B N     1 
ATOM   7112 C  CA    . PRO B 1 420 ? -35.905 -6.082  -5.932  1.00 50.21  ? 526 PRO B CA    1 
ATOM   7113 C  C     . PRO B 1 420 ? -35.973 -6.911  -7.206  1.00 50.90  ? 526 PRO B C     1 
ATOM   7114 O  O     . PRO B 1 420 ? -34.917 -7.170  -7.775  1.00 50.34  ? 526 PRO B O     1 
ATOM   7115 C  CB    . PRO B 1 420 ? -35.544 -6.981  -4.787  1.00 48.15  ? 526 PRO B CB    1 
ATOM   7116 C  CG    . PRO B 1 420 ? -36.313 -6.504  -3.630  1.00 48.81  ? 526 PRO B CG    1 
ATOM   7117 C  CD    . PRO B 1 420 ? -37.542 -5.900  -4.173  1.00 47.84  ? 526 PRO B CD    1 
ATOM   7118 N  N     . ASN B 1 421 ? -37.165 -7.312  -7.637  1.00 51.57  ? 527 ASN B N     1 
ATOM   7119 C  CA    . ASN B 1 421 ? -37.270 -8.105  -8.876  1.00 52.95  ? 527 ASN B CA    1 
ATOM   7120 C  C     . ASN B 1 421 ? -37.610 -7.344  -10.097 1.00 49.91  ? 527 ASN B C     1 
ATOM   7121 O  O     . ASN B 1 421 ? -37.691 -7.940  -11.118 1.00 54.75  ? 527 ASN B O     1 
ATOM   7122 C  CB    . ASN B 1 421 ? -38.240 -9.266  -8.699  1.00 53.00  ? 527 ASN B CB    1 
ATOM   7123 C  CG    . ASN B 1 421 ? -37.649 -10.304 -7.794  1.00 54.95  ? 527 ASN B CG    1 
ATOM   7124 O  OD1   . ASN B 1 421 ? -36.566 -10.773 -8.072  1.00 54.46  ? 527 ASN B OD1   1 
ATOM   7125 N  ND2   . ASN B 1 421 ? -38.292 -10.606 -6.687  1.00 51.90  ? 527 ASN B ND2   1 
ATOM   7126 N  N     . ARG B 1 422 ? -37.713 -6.039  -9.999  1.00 48.42  ? 528 ARG B N     1 
ATOM   7127 C  CA    . ARG B 1 422 ? -38.174 -5.223  -11.047 1.00 49.31  ? 528 ARG B CA    1 
ATOM   7128 C  C     . ARG B 1 422 ? -37.116 -4.227  -11.562 1.00 49.29  ? 528 ARG B C     1 
ATOM   7129 O  O     . ARG B 1 422 ? -36.725 -3.257  -10.895 1.00 51.35  ? 528 ARG B O     1 
ATOM   7130 C  CB    . ARG B 1 422 ? -39.327 -4.463  -10.496 1.00 50.21  ? 528 ARG B CB    1 
ATOM   7131 C  CG    . ARG B 1 422 ? -39.881 -3.560  -11.535 1.00 52.55  ? 528 ARG B CG    1 
ATOM   7132 C  CD    . ARG B 1 422 ? -40.981 -2.744  -10.959 1.00 56.69  ? 528 ARG B CD    1 
ATOM   7133 N  NE    . ARG B 1 422 ? -41.182 -1.611  -11.854 1.00 61.80  ? 528 ARG B NE    1 
ATOM   7134 C  CZ    . ARG B 1 422 ? -42.139 -0.700  -11.716 1.00 68.57  ? 528 ARG B CZ    1 
ATOM   7135 N  NH1   . ARG B 1 422 ? -43.047 -0.779  -10.741 1.00 69.98  ? 528 ARG B NH1   1 
ATOM   7136 N  NH2   . ARG B 1 422 ? -42.205 0.290   -12.584 1.00 73.51  ? 528 ARG B NH2   1 
ATOM   7137 N  N     . ALA B 1 423 ? -36.708 -4.436  -12.795 1.00 48.79  ? 529 ALA B N     1 
ATOM   7138 C  CA    . ALA B 1 423 ? -35.684 -3.634  -13.435 1.00 48.78  ? 529 ALA B CA    1 
ATOM   7139 C  C     . ALA B 1 423 ? -36.186 -2.245  -13.926 1.00 51.91  ? 529 ALA B C     1 
ATOM   7140 O  O     . ALA B 1 423 ? -37.363 -2.018  -14.124 1.00 56.23  ? 529 ALA B O     1 
ATOM   7141 C  CB    . ALA B 1 423 ? -35.074 -4.436  -14.556 1.00 48.65  ? 529 ALA B CB    1 
ATOM   7142 N  N     . ILE B 1 424 ? -35.277 -1.297  -14.078 1.00 51.87  ? 530 ILE B N     1 
ATOM   7143 C  CA    . ILE B 1 424 ? -35.606 0.056   -14.503 1.00 49.89  ? 530 ILE B CA    1 
ATOM   7144 C  C     . ILE B 1 424 ? -34.409 0.567   -15.227 1.00 46.71  ? 530 ILE B C     1 
ATOM   7145 O  O     . ILE B 1 424 ? -33.410 -0.079  -15.268 1.00 46.97  ? 530 ILE B O     1 
ATOM   7146 C  CB    . ILE B 1 424 ? -35.927 1.020   -13.319 1.00 52.48  ? 530 ILE B CB    1 
ATOM   7147 C  CG1   . ILE B 1 424 ? -34.698 1.241   -12.437 1.00 53.26  ? 530 ILE B CG1   1 
ATOM   7148 C  CG2   . ILE B 1 424 ? -37.122 0.532   -12.501 1.00 52.55  ? 530 ILE B CG2   1 
ATOM   7149 C  CD1   . ILE B 1 424 ? -34.928 2.071   -11.191 1.00 52.68  ? 530 ILE B CD1   1 
ATOM   7150 N  N     . ARG B 1 425 ? -34.516 1.744   -15.790 1.00 47.62  ? 531 ARG B N     1 
ATOM   7151 C  CA    . ARG B 1 425 ? -33.424 2.412   -16.449 1.00 49.54  ? 531 ARG B CA    1 
ATOM   7152 C  C     . ARG B 1 425 ? -33.161 3.738   -15.766 1.00 45.28  ? 531 ARG B C     1 
ATOM   7153 O  O     . ARG B 1 425 ? -34.014 4.273   -15.096 1.00 44.85  ? 531 ARG B O     1 
ATOM   7154 C  CB    . ARG B 1 425 ? -33.780 2.654   -17.935 1.00 55.00  ? 531 ARG B CB    1 
ATOM   7155 C  CG    . ARG B 1 425 ? -33.823 1.390   -18.779 1.00 62.48  ? 531 ARG B CG    1 
ATOM   7156 C  CD    . ARG B 1 425 ? -32.900 1.524   -20.023 1.00 69.26  ? 531 ARG B CD    1 
ATOM   7157 N  NE    . ARG B 1 425 ? -32.843 0.290   -20.846 1.00 77.69  ? 531 ARG B NE    1 
ATOM   7158 C  CZ    . ARG B 1 425 ? -32.290 -0.893  -20.490 1.00 80.82  ? 531 ARG B CZ    1 
ATOM   7159 N  NH1   . ARG B 1 425 ? -32.326 -1.918  -21.343 1.00 77.46  ? 531 ARG B NH1   1 
ATOM   7160 N  NH2   . ARG B 1 425 ? -31.731 -1.088  -19.291 1.00 86.07  ? 531 ARG B NH2   1 
ATOM   7161 N  N     . ILE B 1 426 ? -31.964 4.266   -15.900 1.00 43.32  ? 532 ILE B N     1 
ATOM   7162 C  CA    . ILE B 1 426 ? -31.638 5.544   -15.311 1.00 43.91  ? 532 ILE B CA    1 
ATOM   7163 C  C     . ILE B 1 426 ? -30.854 6.267   -16.374 1.00 43.82  ? 532 ILE B C     1 
ATOM   7164 O  O     . ILE B 1 426 ? -29.905 5.761   -16.873 1.00 45.06  ? 532 ILE B O     1 
ATOM   7165 C  CB    . ILE B 1 426 ? -30.796 5.387   -14.031 1.00 44.05  ? 532 ILE B CB    1 
ATOM   7166 C  CG1   . ILE B 1 426 ? -31.528 4.524   -13.000 1.00 43.09  ? 532 ILE B CG1   1 
ATOM   7167 C  CG2   . ILE B 1 426 ? -30.491 6.743   -13.404 1.00 43.79  ? 532 ILE B CG2   1 
ATOM   7168 C  CD1   . ILE B 1 426 ? -30.661 4.139   -11.850 1.00 44.35  ? 532 ILE B CD1   1 
ATOM   7169 N  N     . THR B 1 427 ? -31.277 7.454   -16.733 1.00 44.75  ? 533 THR B N     1 
ATOM   7170 C  CA    . THR B 1 427 ? -30.625 8.230   -17.762 1.00 44.04  ? 533 THR B CA    1 
ATOM   7171 C  C     . THR B 1 427 ? -29.588 9.126   -17.077 1.00 43.49  ? 533 THR B C     1 
ATOM   7172 O  O     . THR B 1 427 ? -29.623 9.389   -15.866 1.00 40.87  ? 533 THR B O     1 
ATOM   7173 C  CB    . THR B 1 427 ? -31.626 9.138   -18.516 1.00 43.86  ? 533 THR B CB    1 
ATOM   7174 O  OG1   . THR B 1 427 ? -32.028 10.230  -17.659 1.00 44.80  ? 533 THR B OG1   1 
ATOM   7175 C  CG2   . THR B 1 427 ? -32.878 8.333   -18.980 1.00 43.59  ? 533 THR B CG2   1 
ATOM   7176 N  N     . LYS B 1 428 ? -28.705 9.621   -17.914 1.00 42.64  ? 534 LYS B N     1 
ATOM   7177 C  CA    . LYS B 1 428 ? -27.603 10.509  -17.565 1.00 44.91  ? 534 LYS B CA    1 
ATOM   7178 C  C     . LYS B 1 428 ? -28.033 11.732  -16.778 1.00 45.26  ? 534 LYS B C     1 
ATOM   7179 O  O     . LYS B 1 428 ? -27.445 12.038  -15.724 1.00 45.97  ? 534 LYS B O     1 
ATOM   7180 C  CB    . LYS B 1 428 ? -26.962 10.936  -18.853 1.00 45.41  ? 534 LYS B CB    1 
ATOM   7181 C  CG    . LYS B 1 428 ? -25.618 11.607  -18.855 1.00 46.90  ? 534 LYS B CG    1 
ATOM   7182 C  CD    . LYS B 1 428 ? -25.585 12.135  -20.289 1.00 50.34  ? 534 LYS B CD    1 
ATOM   7183 C  CE    . LYS B 1 428 ? -24.252 12.631  -20.696 1.00 54.06  ? 534 LYS B CE    1 
ATOM   7184 N  NZ    . LYS B 1 428 ? -24.129 14.048  -20.352 1.00 57.55  ? 534 LYS B NZ    1 
ATOM   7185 N  N     . ASN B 1 429 ? -29.081 12.404  -17.245 1.00 48.02  ? 535 ASN B N     1 
ATOM   7186 C  CA    . ASN B 1 429 ? -29.571 13.640  -16.571 1.00 52.17  ? 535 ASN B CA    1 
ATOM   7187 C  C     . ASN B 1 429 ? -30.242 13.383  -15.151 1.00 49.01  ? 535 ASN B C     1 
ATOM   7188 O  O     . ASN B 1 429 ? -30.309 14.304  -14.349 1.00 45.12  ? 535 ASN B O     1 
ATOM   7189 C  CB    . ASN B 1 429 ? -30.364 14.570  -17.533 1.00 57.59  ? 535 ASN B CB    1 
ATOM   7190 C  CG    . ASN B 1 429 ? -31.697 13.969  -17.963 1.00 68.01  ? 535 ASN B CG    1 
ATOM   7191 O  OD1   . ASN B 1 429 ? -32.315 13.231  -17.203 1.00 68.91  ? 535 ASN B OD1   1 
ATOM   7192 N  ND2   . ASN B 1 429 ? -32.141 14.268  -19.209 1.00 80.68  ? 535 ASN B ND2   1 
ATOM   7193 N  N     . GLN B 1 430 ? -30.708 12.160  -14.876 1.00 46.37  ? 536 GLN B N     1 
ATOM   7194 C  CA    . GLN B 1 430 ? -31.105 11.749  -13.548 1.00 44.18  ? 536 GLN B CA    1 
ATOM   7195 C  C     . GLN B 1 430 ? -29.891 11.543  -12.621 1.00 44.01  ? 536 GLN B C     1 
ATOM   7196 O  O     . GLN B 1 430 ? -30.070 11.219  -11.454 1.00 45.10  ? 536 GLN B O     1 
ATOM   7197 C  CB    . GLN B 1 430 ? -31.926 10.449  -13.599 1.00 42.75  ? 536 GLN B CB    1 
ATOM   7198 C  CG    . GLN B 1 430 ? -33.262 10.481  -14.361 1.00 41.62  ? 536 GLN B CG    1 
ATOM   7199 C  CD    . GLN B 1 430 ? -33.951 9.114   -14.322 1.00 41.53  ? 536 GLN B CD    1 
ATOM   7200 O  OE1   . GLN B 1 430 ? -33.682 8.293   -15.146 1.00 40.24  ? 536 GLN B OE1   1 
ATOM   7201 N  NE2   . GLN B 1 430 ? -34.807 8.859   -13.299 1.00 41.68  ? 536 GLN B NE2   1 
ATOM   7202 N  N     . VAL B 1 431 ? -28.667 11.685  -13.117 1.00 41.49  ? 537 VAL B N     1 
ATOM   7203 C  CA    . VAL B 1 431 ? -27.512 11.378  -12.290 1.00 40.85  ? 537 VAL B CA    1 
ATOM   7204 C  C     . VAL B 1 431 ? -26.748 12.648  -11.988 1.00 40.01  ? 537 VAL B C     1 
ATOM   7205 O  O     . VAL B 1 431 ? -26.492 12.931  -10.821 1.00 39.95  ? 537 VAL B O     1 
ATOM   7206 C  CB    . VAL B 1 431 ? -26.514 10.307  -12.899 1.00 41.83  ? 537 VAL B CB    1 
ATOM   7207 C  CG1   . VAL B 1 431 ? -25.369 10.014  -11.926 1.00 41.10  ? 537 VAL B CG1   1 
ATOM   7208 C  CG2   . VAL B 1 431 ? -27.200 8.991   -13.227 1.00 42.92  ? 537 VAL B CG2   1 
ATOM   7209 N  N     . SER B 1 432 ? -26.294 13.365  -13.007 1.00 37.44  ? 538 SER B N     1 
ATOM   7210 C  CA    . SER B 1 432 ? -25.370 14.483  -12.765 1.00 36.57  ? 538 SER B CA    1 
ATOM   7211 C  C     . SER B 1 432 ? -25.199 15.281  -14.054 1.00 34.65  ? 538 SER B C     1 
ATOM   7212 O  O     . SER B 1 432 ? -25.137 14.702  -15.092 1.00 32.28  ? 538 SER B O     1 
ATOM   7213 C  CB    . SER B 1 432 ? -23.987 13.959  -12.247 1.00 34.87  ? 538 SER B CB    1 
ATOM   7214 O  OG    . SER B 1 432 ? -22.960 14.965  -12.104 1.00 32.51  ? 538 SER B OG    1 
ATOM   7215 N  N     . GLN B 1 433 ? -25.088 16.585  -13.906 1.00 36.30  ? 539 GLN B N     1 
ATOM   7216 C  CA    . GLN B 1 433 ? -24.683 17.496  -14.940 1.00 42.40  ? 539 GLN B CA    1 
ATOM   7217 C  C     . GLN B 1 433 ? -23.185 17.519  -15.208 1.00 42.36  ? 539 GLN B C     1 
ATOM   7218 O  O     . GLN B 1 433 ? -22.776 18.168  -16.133 1.00 40.90  ? 539 GLN B O     1 
ATOM   7219 C  CB    . GLN B 1 433 ? -25.090 18.953  -14.580 1.00 48.37  ? 539 GLN B CB    1 
ATOM   7220 C  CG    . GLN B 1 433 ? -26.568 19.181  -14.199 1.00 53.75  ? 539 GLN B CG    1 
ATOM   7221 C  CD    . GLN B 1 433 ? -27.426 18.774  -15.334 1.00 60.63  ? 539 GLN B CD    1 
ATOM   7222 O  OE1   . GLN B 1 433 ? -27.452 19.482  -16.347 1.00 63.35  ? 539 GLN B OE1   1 
ATOM   7223 N  NE2   . GLN B 1 433 ? -28.066 17.570  -15.236 1.00 71.28  ? 539 GLN B NE2   1 
ATOM   7224 N  N     . LEU B 1 434 ? -22.351 16.871  -14.396 1.00 42.07  ? 540 LEU B N     1 
ATOM   7225 C  CA    . LEU B 1 434 ? -20.888 16.915  -14.617 1.00 41.92  ? 540 LEU B CA    1 
ATOM   7226 C  C     . LEU B 1 434 ? -20.324 15.703  -15.436 1.00 40.25  ? 540 LEU B C     1 
ATOM   7227 O  O     . LEU B 1 434 ? -19.143 15.603  -15.694 1.00 42.72  ? 540 LEU B O     1 
ATOM   7228 C  CB    . LEU B 1 434 ? -20.150 17.121  -13.284 1.00 43.04  ? 540 LEU B CB    1 
ATOM   7229 C  CG    . LEU B 1 434 ? -20.746 18.150  -12.319 1.00 45.83  ? 540 LEU B CG    1 
ATOM   7230 C  CD1   . LEU B 1 434 ? -20.208 18.053  -10.880 1.00 50.65  ? 540 LEU B CD1   1 
ATOM   7231 C  CD2   . LEU B 1 434 ? -20.668 19.548  -12.865 1.00 45.25  ? 540 LEU B CD2   1 
ATOM   7232 N  N     . LEU B 1 435 ? -21.172 14.811  -15.877 1.00 38.51  ? 541 LEU B N     1 
ATOM   7233 C  CA    . LEU B 1 435 ? -20.751 13.655  -16.676 1.00 38.99  ? 541 LEU B CA    1 
ATOM   7234 C  C     . LEU B 1 435 ? -20.391 14.085  -18.134 1.00 42.47  ? 541 LEU B C     1 
ATOM   7235 O  O     . LEU B 1 435 ? -20.769 15.185  -18.580 1.00 45.60  ? 541 LEU B O     1 
ATOM   7236 C  CB    . LEU B 1 435 ? -21.899 12.642  -16.733 1.00 38.77  ? 541 LEU B CB    1 
ATOM   7237 C  CG    . LEU B 1 435 ? -22.361 12.188  -15.352 1.00 40.07  ? 541 LEU B CG    1 
ATOM   7238 C  CD1   . LEU B 1 435 ? -23.625 11.365  -15.467 1.00 40.74  ? 541 LEU B CD1   1 
ATOM   7239 C  CD2   . LEU B 1 435 ? -21.245 11.372  -14.733 1.00 39.91  ? 541 LEU B CD2   1 
ATOM   7240 N  N     . PRO B 1 436 ? -19.659 13.244  -18.874 1.00 42.13  ? 542 PRO B N     1 
ATOM   7241 C  CA    . PRO B 1 436 ? -19.281 13.606  -20.264 1.00 46.13  ? 542 PRO B CA    1 
ATOM   7242 C  C     . PRO B 1 436 ? -20.458 13.876  -21.186 1.00 46.34  ? 542 PRO B C     1 
ATOM   7243 O  O     . PRO B 1 436 ? -21.477 13.237  -21.098 1.00 42.99  ? 542 PRO B O     1 
ATOM   7244 C  CB    . PRO B 1 436 ? -18.509 12.364  -20.768 1.00 45.08  ? 542 PRO B CB    1 
ATOM   7245 C  CG    . PRO B 1 436 ? -18.089 11.662  -19.530 1.00 43.80  ? 542 PRO B CG    1 
ATOM   7246 C  CD    . PRO B 1 436 ? -19.178 11.904  -18.524 1.00 42.14  ? 542 PRO B CD    1 
ATOM   7247 N  N     . GLU B 1 437 ? -20.285 14.838  -22.079 1.00 55.86  ? 543 GLU B N     1 
ATOM   7248 C  CA    . GLU B 1 437 ? -21.315 15.195  -23.066 1.00 60.72  ? 543 GLU B CA    1 
ATOM   7249 C  C     . GLU B 1 437 ? -21.199 14.264  -24.317 1.00 53.41  ? 543 GLU B C     1 
ATOM   7250 O  O     . GLU B 1 437 ? -22.202 13.989  -24.927 1.00 48.83  ? 543 GLU B O     1 
ATOM   7251 C  CB    . GLU B 1 437 ? -21.142 16.693  -23.374 1.00 74.19  ? 543 GLU B CB    1 
ATOM   7252 C  CG    . GLU B 1 437 ? -22.323 17.471  -23.971 1.00 85.17  ? 543 GLU B CG    1 
ATOM   7253 C  CD    . GLU B 1 437 ? -21.854 18.334  -25.168 1.00 95.92  ? 543 GLU B CD    1 
ATOM   7254 O  OE1   . GLU B 1 437 ? -21.044 19.286  -24.931 1.00 102.72 ? 543 GLU B OE1   1 
ATOM   7255 O  OE2   . GLU B 1 437 ? -22.253 18.021  -26.339 1.00 103.88 ? 543 GLU B OE2   1 
ATOM   7256 N  N     . LYS B 1 438 ? -19.986 13.773  -24.646 1.00 48.04  ? 544 LYS B N     1 
ATOM   7257 C  CA    . LYS B 1 438 ? -19.732 12.711  -25.636 1.00 47.24  ? 544 LYS B CA    1 
ATOM   7258 C  C     . LYS B 1 438 ? -19.126 11.453  -25.016 1.00 43.06  ? 544 LYS B C     1 
ATOM   7259 O  O     . LYS B 1 438 ? -18.675 11.479  -23.910 1.00 45.99  ? 544 LYS B O     1 
ATOM   7260 C  CB    . LYS B 1 438 ? -18.731 13.251  -26.695 1.00 51.82  ? 544 LYS B CB    1 
ATOM   7261 C  CG    . LYS B 1 438 ? -19.367 13.886  -27.905 1.00 52.18  ? 544 LYS B CG    1 
ATOM   7262 C  CD    . LYS B 1 438 ? -18.582 15.045  -28.481 1.00 59.97  ? 544 LYS B CD    1 
ATOM   7263 C  CE    . LYS B 1 438 ? -19.526 16.131  -29.011 1.00 63.57  ? 544 LYS B CE    1 
ATOM   7264 N  NZ    . LYS B 1 438 ? -19.027 16.626  -30.308 1.00 68.73  ? 544 LYS B NZ    1 
ATOM   7265 N  N     . PHE B 1 439 ? -19.051 10.369  -25.771 1.00 39.46  ? 545 PHE B N     1 
ATOM   7266 C  CA    . PHE B 1 439 ? -18.509 9.046   -25.365 1.00 36.07  ? 545 PHE B CA    1 
ATOM   7267 C  C     . PHE B 1 439 ? -17.483 8.450   -26.311 1.00 34.37  ? 545 PHE B C     1 
ATOM   7268 O  O     . PHE B 1 439 ? -17.085 7.342   -26.151 1.00 35.79  ? 545 PHE B O     1 
ATOM   7269 C  CB    . PHE B 1 439 ? -19.700 8.073   -25.126 1.00 36.11  ? 545 PHE B CB    1 
ATOM   7270 C  CG    . PHE B 1 439 ? -20.589 8.515   -23.951 1.00 37.51  ? 545 PHE B CG    1 
ATOM   7271 C  CD1   . PHE B 1 439 ? -20.248 8.201   -22.629 1.00 38.01  ? 545 PHE B CD1   1 
ATOM   7272 C  CD2   . PHE B 1 439 ? -21.697 9.333   -24.165 1.00 37.83  ? 545 PHE B CD2   1 
ATOM   7273 C  CE1   . PHE B 1 439 ? -20.998 8.656   -21.564 1.00 36.54  ? 545 PHE B CE1   1 
ATOM   7274 C  CE2   . PHE B 1 439 ? -22.451 9.786   -23.112 1.00 38.25  ? 545 PHE B CE2   1 
ATOM   7275 C  CZ    . PHE B 1 439 ? -22.099 9.437   -21.800 1.00 38.23  ? 545 PHE B CZ    1 
ATOM   7276 N  N     . ALA B 1 440 ? -17.016 9.219   -27.284 1.00 35.47  ? 546 ALA B N     1 
ATOM   7277 C  CA    . ALA B 1 440 ? -15.950 8.787   -28.247 1.00 33.93  ? 546 ALA B CA    1 
ATOM   7278 C  C     . ALA B 1 440 ? -15.237 9.985   -28.820 1.00 31.56  ? 546 ALA B C     1 
ATOM   7279 O  O     . ALA B 1 440 ? -15.831 11.023  -28.921 1.00 31.60  ? 546 ALA B O     1 
ATOM   7280 C  CB    . ALA B 1 440 ? -16.499 7.860   -29.329 1.00 32.43  ? 546 ALA B CB    1 
ATOM   7281 N  N     . GLU B 1 441 ? -13.959 9.845   -29.112 1.00 31.35  ? 547 GLU B N     1 
ATOM   7282 C  CA    . GLU B 1 441 ? -13.149 10.900  -29.693 1.00 32.46  ? 547 GLU B CA    1 
ATOM   7283 C  C     . GLU B 1 441 ? -11.927 10.247  -30.361 1.00 33.61  ? 547 GLU B C     1 
ATOM   7284 O  O     . GLU B 1 441 ? -11.670 9.061   -30.143 1.00 34.52  ? 547 GLU B O     1 
ATOM   7285 C  CB    . GLU B 1 441 ? -12.722 11.914  -28.620 1.00 33.82  ? 547 GLU B CB    1 
ATOM   7286 C  CG    . GLU B 1 441 ? -11.772 11.373  -27.533 1.00 35.04  ? 547 GLU B CG    1 
ATOM   7287 C  CD    . GLU B 1 441 ? -11.307 12.446  -26.564 1.00 36.52  ? 547 GLU B CD    1 
ATOM   7288 O  OE1   . GLU B 1 441 ? -11.593 13.645  -26.800 1.00 35.76  ? 547 GLU B OE1   1 
ATOM   7289 O  OE2   . GLU B 1 441 ? -10.735 12.079  -25.516 1.00 38.07  ? 547 GLU B OE2   1 
ATOM   7290 N  N     . GLN B 1 442 ? -11.185 10.980  -31.191 1.00 35.09  ? 548 GLN B N     1 
ATOM   7291 C  CA    . GLN B 1 442 ? -9.974  10.445  -31.793 1.00 36.52  ? 548 GLN B CA    1 
ATOM   7292 C  C     . GLN B 1 442 ? -8.856  11.357  -31.477 1.00 38.11  ? 548 GLN B C     1 
ATOM   7293 O  O     . GLN B 1 442 ? -9.045  12.600  -31.461 1.00 41.81  ? 548 GLN B O     1 
ATOM   7294 C  CB    . GLN B 1 442 ? -10.075 10.355  -33.330 1.00 39.22  ? 548 GLN B CB    1 
ATOM   7295 C  CG    . GLN B 1 442 ? -11.137 9.409   -33.873 1.00 39.89  ? 548 GLN B CG    1 
ATOM   7296 C  CD    . GLN B 1 442 ? -11.194 9.438   -35.396 1.00 46.45  ? 548 GLN B CD    1 
ATOM   7297 O  OE1   . GLN B 1 442 ? -11.670 10.413  -35.998 1.00 47.80  ? 548 GLN B OE1   1 
ATOM   7298 N  NE2   . GLN B 1 442 ? -10.712 8.364   -36.017 1.00 40.39  ? 548 GLN B NE2   1 
ATOM   7299 N  N     . LEU B 1 443 ? -7.710  10.749  -31.168 1.00 37.39  ? 549 LEU B N     1 
ATOM   7300 C  CA    . LEU B 1 443 ? -6.462  11.489  -30.949 1.00 37.36  ? 549 LEU B CA    1 
ATOM   7301 C  C     . LEU B 1 443 ? -5.498  11.153  -32.100 1.00 36.83  ? 549 LEU B C     1 
ATOM   7302 O  O     . LEU B 1 443 ? -5.428  10.003  -32.522 1.00 36.94  ? 549 LEU B O     1 
ATOM   7303 C  CB    . LEU B 1 443 ? -5.806  11.034  -29.653 1.00 37.89  ? 549 LEU B CB    1 
ATOM   7304 C  CG    . LEU B 1 443 ? -6.659  11.101  -28.393 1.00 37.86  ? 549 LEU B CG    1 
ATOM   7305 C  CD1   . LEU B 1 443 ? -5.818  10.638  -27.217 1.00 37.98  ? 549 LEU B CD1   1 
ATOM   7306 C  CD2   . LEU B 1 443 ? -7.231  12.497  -28.106 1.00 38.00  ? 549 LEU B CD2   1 
ATOM   7307 N  N     . ILE B 1 444 ? -4.783  12.155  -32.595 1.00 34.78  ? 550 ILE B N     1 
ATOM   7308 C  CA    . ILE B 1 444 ? -3.866  11.954  -33.673 1.00 34.83  ? 550 ILE B CA    1 
ATOM   7309 C  C     . ILE B 1 444 ? -2.494  12.330  -33.185 1.00 33.86  ? 550 ILE B C     1 
ATOM   7310 O  O     . ILE B 1 444 ? -2.291  13.463  -32.834 1.00 35.49  ? 550 ILE B O     1 
ATOM   7311 C  CB    . ILE B 1 444 ? -4.244  12.787  -34.934 1.00 35.67  ? 550 ILE B CB    1 
ATOM   7312 C  CG1   . ILE B 1 444 ? -5.661  12.464  -35.421 1.00 35.49  ? 550 ILE B CG1   1 
ATOM   7313 C  CG2   . ILE B 1 444 ? -3.311  12.430  -36.059 1.00 36.37  ? 550 ILE B CG2   1 
ATOM   7314 C  CD1   . ILE B 1 444 ? -6.304  13.527  -36.287 1.00 36.43  ? 550 ILE B CD1   1 
ATOM   7315 N  N     . ARG B 1 445 ? -1.546  11.395  -33.176 1.00 32.59  ? 551 ARG B N     1 
ATOM   7316 C  CA    . ARG B 1 445 ? -0.152  11.704  -32.884 1.00 32.83  ? 551 ARG B CA    1 
ATOM   7317 C  C     . ARG B 1 445 ? 0.736   11.637  -34.115 1.00 31.97  ? 551 ARG B C     1 
ATOM   7318 O  O     . ARG B 1 445 ? 0.592   10.753  -34.939 1.00 33.53  ? 551 ARG B O     1 
ATOM   7319 C  CB    . ARG B 1 445 ? 0.454   10.719  -31.869 1.00 35.70  ? 551 ARG B CB    1 
ATOM   7320 C  CG    . ARG B 1 445 ? -0.006  10.853  -30.447 1.00 37.26  ? 551 ARG B CG    1 
ATOM   7321 C  CD    . ARG B 1 445 ? -1.349  10.178  -30.258 1.00 37.68  ? 551 ARG B CD    1 
ATOM   7322 N  NE    . ARG B 1 445 ? -1.850  10.264  -28.878 1.00 39.89  ? 551 ARG B NE    1 
ATOM   7323 C  CZ    . ARG B 1 445 ? -1.615  9.363   -27.923 1.00 41.77  ? 551 ARG B CZ    1 
ATOM   7324 N  NH1   . ARG B 1 445 ? -0.825  8.308   -28.132 1.00 44.28  ? 551 ARG B NH1   1 
ATOM   7325 N  NH2   . ARG B 1 445 ? -2.165  9.517   -26.719 1.00 39.23  ? 551 ARG B NH2   1 
ATOM   7326 N  N     . VAL B 1 446 ? 1.693   12.548  -34.186 1.00 31.48  ? 552 VAL B N     1 
ATOM   7327 C  CA    . VAL B 1 446 ? 2.655   12.607  -35.271 1.00 31.06  ? 552 VAL B CA    1 
ATOM   7328 C  C     . VAL B 1 446 ? 4.037   12.495  -34.765 1.00 30.63  ? 552 VAL B C     1 
ATOM   7329 O  O     . VAL B 1 446 ? 4.393   13.162  -33.819 1.00 35.59  ? 552 VAL B O     1 
ATOM   7330 C  CB    . VAL B 1 446 ? 2.511   13.907  -36.050 1.00 31.26  ? 552 VAL B CB    1 
ATOM   7331 C  CG1   . VAL B 1 446 ? 3.480   13.971  -37.255 1.00 30.08  ? 552 VAL B CG1   1 
ATOM   7332 C  CG2   . VAL B 1 446 ? 1.075   13.966  -36.537 1.00 31.81  ? 552 VAL B CG2   1 
ATOM   7333 N  N     . TYR B 1 447 ? 4.800   11.615  -35.365 1.00 30.06  ? 553 TYR B N     1 
ATOM   7334 C  CA    . TYR B 1 447 ? 6.206   11.435  -35.038 1.00 31.15  ? 553 TYR B CA    1 
ATOM   7335 C  C     . TYR B 1 447 ? 7.080   11.584  -36.285 1.00 31.79  ? 553 TYR B C     1 
ATOM   7336 O  O     . TYR B 1 447 ? 6.591   11.463  -37.447 1.00 31.09  ? 553 TYR B O     1 
ATOM   7337 C  CB    . TYR B 1 447 ? 6.442   10.043  -34.486 1.00 30.60  ? 553 TYR B CB    1 
ATOM   7338 C  CG    . TYR B 1 447 ? 5.530   9.561   -33.338 1.00 30.55  ? 553 TYR B CG    1 
ATOM   7339 C  CD1   . TYR B 1 447 ? 4.225   9.158   -33.597 1.00 30.55  ? 553 TYR B CD1   1 
ATOM   7340 C  CD2   . TYR B 1 447 ? 6.012   9.425   -32.052 1.00 29.90  ? 553 TYR B CD2   1 
ATOM   7341 C  CE1   . TYR B 1 447 ? 3.435   8.607   -32.638 1.00 31.57  ? 553 TYR B CE1   1 
ATOM   7342 C  CE2   . TYR B 1 447 ? 5.199   8.949   -31.031 1.00 30.67  ? 553 TYR B CE2   1 
ATOM   7343 C  CZ    . TYR B 1 447 ? 3.906   8.481   -31.321 1.00 30.81  ? 553 TYR B CZ    1 
ATOM   7344 O  OH    . TYR B 1 447 ? 3.027   7.997   -30.340 1.00 29.35  ? 553 TYR B OH    1 
ATOM   7345 N  N     . CYS B 1 448 ? 8.361   11.829  -36.045 1.00 33.00  ? 554 CYS B N     1 
ATOM   7346 C  CA    . CYS B 1 448 ? 9.388   11.903  -37.109 1.00 36.05  ? 554 CYS B CA    1 
ATOM   7347 C  C     . CYS B 1 448 ? 10.525  10.893  -36.922 1.00 35.45  ? 554 CYS B C     1 
ATOM   7348 O  O     . CYS B 1 448 ? 11.076  10.777  -35.858 1.00 33.87  ? 554 CYS B O     1 
ATOM   7349 C  CB    . CYS B 1 448 ? 9.974   13.328  -37.215 1.00 37.71  ? 554 CYS B CB    1 
ATOM   7350 S  SG    . CYS B 1 448 ? 11.090  13.605  -38.635 1.00 40.59  ? 554 CYS B SG    1 
ATOM   7351 N  N     . LYS B 1 449 ? 10.916  10.208  -38.000 1.00 35.54  ? 555 LYS B N     1 
ATOM   7352 C  CA    . LYS B 1 449 ? 11.977  9.226   -37.935 1.00 36.94  ? 555 LYS B CA    1 
ATOM   7353 C  C     . LYS B 1 449 ? 13.320  9.857   -38.130 1.00 39.29  ? 555 LYS B C     1 
ATOM   7354 O  O     . LYS B 1 449 ? 14.303  9.176   -37.907 1.00 39.67  ? 555 LYS B O     1 
ATOM   7355 C  CB    . LYS B 1 449 ? 11.859  8.163   -38.978 1.00 37.89  ? 555 LYS B CB    1 
ATOM   7356 C  CG    . LYS B 1 449 ? 10.489  7.632   -39.160 1.00 39.81  ? 555 LYS B CG    1 
ATOM   7357 C  CD    . LYS B 1 449 ? 10.493  6.684   -40.336 1.00 41.21  ? 555 LYS B CD    1 
ATOM   7358 C  CE    . LYS B 1 449 ? 9.392   5.662   -40.224 1.00 43.47  ? 555 LYS B CE    1 
ATOM   7359 N  NZ    . LYS B 1 449 ? 9.600   4.596   -41.248 1.00 48.96  ? 555 LYS B NZ    1 
ATOM   7360 N  N     . LYS B 1 450 ? 13.407  11.087  -38.611 1.00 44.78  ? 556 LYS B N     1 
ATOM   7361 C  CA    . LYS B 1 450 ? 14.696  11.764  -38.611 1.00 48.52  ? 556 LYS B CA    1 
ATOM   7362 C  C     . LYS B 1 450 ? 14.769  12.523  -37.291 1.00 50.17  ? 556 LYS B C     1 
ATOM   7363 O  O     . LYS B 1 450 ? 13.922  13.388  -36.993 1.00 53.54  ? 556 LYS B O     1 
ATOM   7364 C  CB    . LYS B 1 450 ? 14.854  12.701  -39.800 1.00 51.44  ? 556 LYS B CB    1 
ATOM   7365 C  CG    . LYS B 1 450 ? 14.789  12.006  -41.156 1.00 55.55  ? 556 LYS B CG    1 
ATOM   7366 C  CD    . LYS B 1 450 ? 15.355  12.851  -42.282 1.00 58.55  ? 556 LYS B CD    1 
ATOM   7367 C  CE    . LYS B 1 450 ? 15.368  12.068  -43.597 1.00 64.31  ? 556 LYS B CE    1 
ATOM   7368 N  NZ    . LYS B 1 450 ? 16.454  11.024  -43.600 1.00 65.79  ? 556 LYS B NZ    1 
ATOM   7369 N  N     . VAL B 1 451 ? 15.829  12.251  -36.552 1.00 49.34  ? 557 VAL B N     1 
ATOM   7370 C  CA    . VAL B 1 451 ? 15.992  12.755  -35.208 1.00 49.40  ? 557 VAL B CA    1 
ATOM   7371 C  C     . VAL B 1 451 ? 16.874  13.988  -34.944 1.00 49.78  ? 557 VAL B C     1 
ATOM   7372 O  O     . VAL B 1 451 ? 16.868  14.454  -33.836 1.00 51.29  ? 557 VAL B O     1 
ATOM   7373 C  CB    . VAL B 1 451 ? 16.462  11.612  -34.305 1.00 50.14  ? 557 VAL B CB    1 
ATOM   7374 C  CG1   . VAL B 1 451 ? 15.485  10.425  -34.458 1.00 51.90  ? 557 VAL B CG1   1 
ATOM   7375 C  CG2   . VAL B 1 451 ? 17.929  11.225  -34.554 1.00 48.14  ? 557 VAL B CG2   1 
ATOM   7376 N  N     . ASP B 1 452 ? 17.616  14.497  -35.929 1.00 49.07  ? 558 ASP B N     1 
ATOM   7377 C  CA    . ASP B 1 452 ? 18.462  15.701  -35.741 1.00 47.46  ? 558 ASP B CA    1 
ATOM   7378 C  C     . ASP B 1 452 ? 17.631  16.982  -35.642 1.00 49.13  ? 558 ASP B C     1 
ATOM   7379 O  O     . ASP B 1 452 ? 16.485  16.988  -36.057 1.00 46.81  ? 558 ASP B O     1 
ATOM   7380 C  CB    . ASP B 1 452 ? 19.445  15.875  -36.903 1.00 46.90  ? 558 ASP B CB    1 
ATOM   7381 C  CG    . ASP B 1 452 ? 18.739  16.027  -38.223 1.00 46.30  ? 558 ASP B CG    1 
ATOM   7382 O  OD1   . ASP B 1 452 ? 18.293  14.959  -38.689 1.00 45.65  ? 558 ASP B OD1   1 
ATOM   7383 O  OD2   . ASP B 1 452 ? 18.551  17.171  -38.753 1.00 42.76  ? 558 ASP B OD2   1 
ATOM   7384 N  N     . ARG B 1 453 ? 18.242  18.061  -35.124 1.00 50.64  ? 559 ARG B N     1 
ATOM   7385 C  CA    . ARG B 1 453 ? 17.572  19.326  -34.797 1.00 49.35  ? 559 ARG B CA    1 
ATOM   7386 C  C     . ARG B 1 453 ? 16.944  19.999  -35.991 1.00 47.37  ? 559 ARG B C     1 
ATOM   7387 O  O     . ARG B 1 453 ? 15.824  20.503  -35.916 1.00 44.41  ? 559 ARG B O     1 
ATOM   7388 C  CB    . ARG B 1 453 ? 18.563  20.301  -34.176 1.00 55.49  ? 559 ARG B CB    1 
ATOM   7389 C  CG    . ARG B 1 453 ? 18.800  20.104  -32.677 1.00 61.96  ? 559 ARG B CG    1 
ATOM   7390 C  CD    . ARG B 1 453 ? 19.354  21.366  -32.005 1.00 65.91  ? 559 ARG B CD    1 
ATOM   7391 N  NE    . ARG B 1 453 ? 18.474  22.532  -32.204 1.00 70.23  ? 559 ARG B NE    1 
ATOM   7392 C  CZ    . ARG B 1 453 ? 18.546  23.664  -31.514 1.00 69.81  ? 559 ARG B CZ    1 
ATOM   7393 N  NH1   . ARG B 1 453 ? 17.684  24.658  -31.796 1.00 68.55  ? 559 ARG B NH1   1 
ATOM   7394 N  NH2   . ARG B 1 453 ? 19.487  23.817  -30.569 1.00 65.45  ? 559 ARG B NH2   1 
ATOM   7395 N  N     . LYS B 1 454 ? 17.673  20.017  -37.094 1.00 47.57  ? 560 LYS B N     1 
ATOM   7396 C  CA    . LYS B 1 454 ? 17.143  20.513  -38.338 1.00 46.92  ? 560 LYS B CA    1 
ATOM   7397 C  C     . LYS B 1 454 ? 15.873  19.773  -38.766 1.00 45.98  ? 560 LYS B C     1 
ATOM   7398 O  O     . LYS B 1 454 ? 14.824  20.384  -38.871 1.00 47.05  ? 560 LYS B O     1 
ATOM   7399 C  CB    . LYS B 1 454 ? 18.193  20.402  -39.421 1.00 48.27  ? 560 LYS B CB    1 
ATOM   7400 C  CG    . LYS B 1 454 ? 17.819  21.218  -40.618 1.00 52.27  ? 560 LYS B CG    1 
ATOM   7401 C  CD    . LYS B 1 454 ? 18.959  21.319  -41.612 1.00 56.06  ? 560 LYS B CD    1 
ATOM   7402 C  CE    . LYS B 1 454 ? 18.881  22.663  -42.335 1.00 59.98  ? 560 LYS B CE    1 
ATOM   7403 N  NZ    . LYS B 1 454 ? 19.842  22.669  -43.454 1.00 64.34  ? 560 LYS B NZ    1 
ATOM   7404 N  N     . SER B 1 455 ? 15.949  18.465  -38.987 1.00 43.50  ? 561 SER B N     1 
ATOM   7405 C  CA    . SER B 1 455 ? 14.766  17.693  -39.386 1.00 43.53  ? 561 SER B CA    1 
ATOM   7406 C  C     . SER B 1 455 ? 13.573  17.876  -38.459 1.00 42.26  ? 561 SER B C     1 
ATOM   7407 O  O     . SER B 1 455 ? 12.441  17.866  -38.916 1.00 38.71  ? 561 SER B O     1 
ATOM   7408 C  CB    . SER B 1 455 ? 15.059  16.172  -39.425 1.00 44.49  ? 561 SER B CB    1 
ATOM   7409 O  OG    . SER B 1 455 ? 16.271  15.878  -40.076 1.00 47.11  ? 561 SER B OG    1 
ATOM   7410 N  N     . LEU B 1 456 ? 13.836  17.968  -37.141 1.00 42.95  ? 562 LEU B N     1 
ATOM   7411 C  CA    . LEU B 1 456 ? 12.780  18.015  -36.153 1.00 44.59  ? 562 LEU B CA    1 
ATOM   7412 C  C     . LEU B 1 456 ? 12.068  19.377  -36.199 1.00 44.95  ? 562 LEU B C     1 
ATOM   7413 O  O     . LEU B 1 456 ? 10.813  19.433  -36.240 1.00 42.89  ? 562 LEU B O     1 
ATOM   7414 C  CB    . LEU B 1 456 ? 13.317  17.631  -34.740 1.00 49.06  ? 562 LEU B CB    1 
ATOM   7415 C  CG    . LEU B 1 456 ? 12.327  17.726  -33.558 1.00 50.29  ? 562 LEU B CG    1 
ATOM   7416 C  CD1   . LEU B 1 456 ? 11.162  16.788  -33.850 1.00 49.93  ? 562 LEU B CD1   1 
ATOM   7417 C  CD2   . LEU B 1 456 ? 12.911  17.431  -32.149 1.00 52.64  ? 562 LEU B CD2   1 
ATOM   7418 N  N     . TYR B 1 457 ? 12.852  20.462  -36.239 1.00 44.85  ? 563 TYR B N     1 
ATOM   7419 C  CA    . TYR B 1 457 ? 12.312  21.809  -36.433 1.00 47.51  ? 563 TYR B CA    1 
ATOM   7420 C  C     . TYR B 1 457 ? 11.313  21.838  -37.626 1.00 46.40  ? 563 TYR B C     1 
ATOM   7421 O  O     . TYR B 1 457 ? 10.180  22.385  -37.542 1.00 47.23  ? 563 TYR B O     1 
ATOM   7422 C  CB    . TYR B 1 457 ? 13.458  22.814  -36.697 1.00 53.63  ? 563 TYR B CB    1 
ATOM   7423 C  CG    . TYR B 1 457 ? 12.945  24.146  -37.185 1.00 58.15  ? 563 TYR B CG    1 
ATOM   7424 C  CD1   . TYR B 1 457 ? 12.366  25.038  -36.268 1.00 67.85  ? 563 TYR B CD1   1 
ATOM   7425 C  CD2   . TYR B 1 457 ? 12.949  24.492  -38.546 1.00 60.32  ? 563 TYR B CD2   1 
ATOM   7426 C  CE1   . TYR B 1 457 ? 11.815  26.258  -36.691 1.00 69.59  ? 563 TYR B CE1   1 
ATOM   7427 C  CE2   . TYR B 1 457 ? 12.349  25.667  -38.978 1.00 64.94  ? 563 TYR B CE2   1 
ATOM   7428 C  CZ    . TYR B 1 457 ? 11.804  26.563  -38.044 1.00 67.90  ? 563 TYR B CZ    1 
ATOM   7429 O  OH    . TYR B 1 457 ? 11.262  27.781  -38.426 1.00 77.01  ? 563 TYR B OH    1 
ATOM   7430 N  N     . ALA B 1 458 ? 11.757  21.294  -38.747 1.00 40.72  ? 564 ALA B N     1 
ATOM   7431 C  CA    . ALA B 1 458 ? 10.944  21.293  -39.921 1.00 39.98  ? 564 ALA B CA    1 
ATOM   7432 C  C     . ALA B 1 458 ? 9.669   20.485  -39.714 1.00 41.39  ? 564 ALA B C     1 
ATOM   7433 O  O     . ALA B 1 458 ? 8.570   20.952  -40.098 1.00 41.42  ? 564 ALA B O     1 
ATOM   7434 C  CB    . ALA B 1 458 ? 11.721  20.701  -41.069 1.00 39.89  ? 564 ALA B CB    1 
ATOM   7435 N  N     . ALA B 1 459 ? 9.787   19.303  -39.072 1.00 40.54  ? 565 ALA B N     1 
ATOM   7436 C  CA    . ALA B 1 459 ? 8.631   18.450  -38.860 1.00 39.19  ? 565 ALA B CA    1 
ATOM   7437 C  C     . ALA B 1 459 ? 7.557   19.139  -38.077 1.00 38.40  ? 565 ALA B C     1 
ATOM   7438 O  O     . ALA B 1 459 ? 6.374   18.892  -38.337 1.00 38.48  ? 565 ALA B O     1 
ATOM   7439 C  CB    . ALA B 1 459 ? 9.031   17.149  -38.200 1.00 38.81  ? 565 ALA B CB    1 
ATOM   7440 N  N     . ARG B 1 460 ? 7.966   19.971  -37.115 1.00 40.73  ? 566 ARG B N     1 
ATOM   7441 C  CA    . ARG B 1 460 ? 7.030   20.748  -36.332 1.00 43.70  ? 566 ARG B CA    1 
ATOM   7442 C  C     . ARG B 1 460 ? 6.246   21.732  -37.158 1.00 45.60  ? 566 ARG B C     1 
ATOM   7443 O  O     . ARG B 1 460 ? 5.087   21.935  -36.858 1.00 42.23  ? 566 ARG B O     1 
ATOM   7444 C  CB    . ARG B 1 460 ? 7.729   21.483  -35.190 1.00 47.78  ? 566 ARG B CB    1 
ATOM   7445 C  CG    . ARG B 1 460 ? 7.999   20.537  -34.007 1.00 50.71  ? 566 ARG B CG    1 
ATOM   7446 C  CD    . ARG B 1 460 ? 9.190   20.954  -33.204 1.00 52.48  ? 566 ARG B CD    1 
ATOM   7447 N  NE    . ARG B 1 460 ? 9.265   20.312  -31.909 1.00 55.88  ? 566 ARG B NE    1 
ATOM   7448 C  CZ    . ARG B 1 460 ? 10.309  20.412  -31.094 1.00 57.98  ? 566 ARG B CZ    1 
ATOM   7449 N  NH1   . ARG B 1 460 ? 10.289  19.825  -29.908 1.00 60.20  ? 566 ARG B NH1   1 
ATOM   7450 N  NH2   . ARG B 1 460 ? 11.377  21.114  -31.458 1.00 59.70  ? 566 ARG B NH2   1 
ATOM   7451 N  N     . GLN B 1 461 ? 6.879   22.322  -38.189 1.00 46.77  ? 567 GLN B N     1 
ATOM   7452 C  CA    . GLN B 1 461 ? 6.205   23.298  -39.116 1.00 47.15  ? 567 GLN B CA    1 
ATOM   7453 C  C     . GLN B 1 461 ? 5.202   22.578  -40.007 1.00 45.65  ? 567 GLN B C     1 
ATOM   7454 O  O     . GLN B 1 461 ? 4.057   22.954  -40.031 1.00 44.03  ? 567 GLN B O     1 
ATOM   7455 C  CB    . GLN B 1 461 ? 7.217   24.106  -39.996 1.00 47.30  ? 567 GLN B CB    1 
ATOM   7456 C  CG    . GLN B 1 461 ? 8.477   24.611  -39.302 1.00 49.54  ? 567 GLN B CG    1 
ATOM   7457 C  CD    . GLN B 1 461 ? 8.198   25.271  -37.945 1.00 52.31  ? 567 GLN B CD    1 
ATOM   7458 O  OE1   . GLN B 1 461 ? 7.383   26.173  -37.839 1.00 55.88  ? 567 GLN B OE1   1 
ATOM   7459 N  NE2   . GLN B 1 461 ? 8.924   24.831  -36.895 1.00 56.65  ? 567 GLN B NE2   1 
ATOM   7460 N  N     . TYR B 1 462 ? 5.629   21.550  -40.739 1.00 47.44  ? 568 TYR B N     1 
ATOM   7461 C  CA    . TYR B 1 462 ? 4.695   20.758  -41.518 1.00 51.40  ? 568 TYR B CA    1 
ATOM   7462 C  C     . TYR B 1 462 ? 3.462   20.354  -40.641 1.00 51.14  ? 568 TYR B C     1 
ATOM   7463 O  O     . TYR B 1 462 ? 2.306   20.586  -41.030 1.00 51.15  ? 568 TYR B O     1 
ATOM   7464 C  CB    . TYR B 1 462 ? 5.361   19.501  -42.030 1.00 57.74  ? 568 TYR B CB    1 
ATOM   7465 C  CG    . TYR B 1 462 ? 6.392   19.663  -43.137 1.00 64.83  ? 568 TYR B CG    1 
ATOM   7466 C  CD1   . TYR B 1 462 ? 6.007   19.855  -44.466 1.00 72.22  ? 568 TYR B CD1   1 
ATOM   7467 C  CD2   . TYR B 1 462 ? 7.737   19.505  -42.877 1.00 66.79  ? 568 TYR B CD2   1 
ATOM   7468 C  CE1   . TYR B 1 462 ? 6.947   19.972  -45.485 1.00 73.34  ? 568 TYR B CE1   1 
ATOM   7469 C  CE2   . TYR B 1 462 ? 8.675   19.583  -43.894 1.00 69.36  ? 568 TYR B CE2   1 
ATOM   7470 C  CZ    . TYR B 1 462 ? 8.272   19.806  -45.190 1.00 71.25  ? 568 TYR B CZ    1 
ATOM   7471 O  OH    . TYR B 1 462 ? 9.190   19.916  -46.185 1.00 71.96  ? 568 TYR B OH    1 
ATOM   7472 N  N     . PHE B 1 463 ? 3.718   19.806  -39.445 1.00 47.27  ? 569 PHE B N     1 
ATOM   7473 C  CA    . PHE B 1 463 ? 2.658   19.286  -38.598 1.00 46.43  ? 569 PHE B CA    1 
ATOM   7474 C  C     . PHE B 1 463 ? 1.626   20.374  -38.170 1.00 44.77  ? 569 PHE B C     1 
ATOM   7475 O  O     . PHE B 1 463 ? 0.418   20.163  -38.293 1.00 41.39  ? 569 PHE B O     1 
ATOM   7476 C  CB    . PHE B 1 463 ? 3.255   18.555  -37.358 1.00 47.29  ? 569 PHE B CB    1 
ATOM   7477 C  CG    . PHE B 1 463 ? 2.236   18.241  -36.287 1.00 43.71  ? 569 PHE B CG    1 
ATOM   7478 C  CD1   . PHE B 1 463 ? 1.208   17.379  -36.541 1.00 44.32  ? 569 PHE B CD1   1 
ATOM   7479 C  CD2   . PHE B 1 463 ? 2.273   18.868  -35.062 1.00 44.20  ? 569 PHE B CD2   1 
ATOM   7480 C  CE1   . PHE B 1 463 ? 0.221   17.123  -35.597 1.00 43.61  ? 569 PHE B CE1   1 
ATOM   7481 C  CE2   . PHE B 1 463 ? 1.313   18.623  -34.076 1.00 44.42  ? 569 PHE B CE2   1 
ATOM   7482 C  CZ    . PHE B 1 463 ? 0.286   17.741  -34.359 1.00 46.14  ? 569 PHE B CZ    1 
ATOM   7483 N  N     . VAL B 1 464 ? 2.105   21.518  -37.669 1.00 45.74  ? 570 VAL B N     1 
ATOM   7484 C  CA    . VAL B 1 464 ? 1.219   22.628  -37.241 1.00 48.73  ? 570 VAL B CA    1 
ATOM   7485 C  C     . VAL B 1 464 ? 0.486   23.255  -38.459 1.00 52.57  ? 570 VAL B C     1 
ATOM   7486 O  O     . VAL B 1 464 ? -0.715  23.622  -38.337 1.00 49.59  ? 570 VAL B O     1 
ATOM   7487 C  CB    . VAL B 1 464 ? 1.950   23.693  -36.377 1.00 50.58  ? 570 VAL B CB    1 
ATOM   7488 C  CG1   . VAL B 1 464 ? 1.013   24.825  -35.938 1.00 51.81  ? 570 VAL B CG1   1 
ATOM   7489 C  CG2   . VAL B 1 464 ? 2.453   23.055  -35.098 1.00 53.36  ? 570 VAL B CG2   1 
ATOM   7490 N  N     . GLN B 1 465 ? 1.158   23.311  -39.626 1.00 49.62  ? 571 GLN B N     1 
ATOM   7491 C  CA    . GLN B 1 465 ? 0.476   23.735  -40.827 1.00 50.73  ? 571 GLN B CA    1 
ATOM   7492 C  C     . GLN B 1 465 ? -0.622  22.769  -41.130 1.00 49.67  ? 571 GLN B C     1 
ATOM   7493 O  O     . GLN B 1 465 ? -1.751  23.210  -41.383 1.00 49.79  ? 571 GLN B O     1 
ATOM   7494 C  CB    . GLN B 1 465 ? 1.441   23.914  -42.044 1.00 56.14  ? 571 GLN B CB    1 
ATOM   7495 C  CG    . GLN B 1 465 ? 0.914   24.770  -43.243 1.00 54.76  ? 571 GLN B CG    1 
ATOM   7496 C  CD    . GLN B 1 465 ? 0.428   26.175  -42.823 1.00 55.55  ? 571 GLN B CD    1 
ATOM   7497 O  OE1   . GLN B 1 465 ? 1.208   27.006  -42.310 1.00 60.81  ? 571 GLN B OE1   1 
ATOM   7498 N  NE2   . GLN B 1 465 ? -0.884  26.426  -42.982 1.00 51.89  ? 571 GLN B NE2   1 
ATOM   7499 N  N     . TRP B 1 466 ? -0.342  21.461  -41.056 1.00 50.17  ? 572 TRP B N     1 
ATOM   7500 C  CA    . TRP B 1 466 ? -1.369  20.444  -41.403 1.00 50.91  ? 572 TRP B CA    1 
ATOM   7501 C  C     . TRP B 1 466 ? -2.633  20.559  -40.544 1.00 48.33  ? 572 TRP B C     1 
ATOM   7502 O  O     . TRP B 1 466 ? -3.765  20.483  -41.076 1.00 48.20  ? 572 TRP B O     1 
ATOM   7503 C  CB    . TRP B 1 466 ? -0.761  19.069  -41.328 1.00 48.57  ? 572 TRP B CB    1 
ATOM   7504 C  CG    . TRP B 1 466 ? -1.642  17.921  -41.681 1.00 49.83  ? 572 TRP B CG    1 
ATOM   7505 C  CD1   . TRP B 1 466 ? -2.128  17.607  -42.900 1.00 49.01  ? 572 TRP B CD1   1 
ATOM   7506 C  CD2   . TRP B 1 466 ? -2.076  16.876  -40.800 1.00 48.93  ? 572 TRP B CD2   1 
ATOM   7507 N  NE1   . TRP B 1 466 ? -2.852  16.425  -42.848 1.00 48.77  ? 572 TRP B NE1   1 
ATOM   7508 C  CE2   . TRP B 1 466 ? -2.840  15.962  -41.572 1.00 48.99  ? 572 TRP B CE2   1 
ATOM   7509 C  CE3   . TRP B 1 466 ? -1.881  16.613  -39.423 1.00 49.23  ? 572 TRP B CE3   1 
ATOM   7510 C  CZ2   . TRP B 1 466 ? -3.425  14.816  -41.022 1.00 51.18  ? 572 TRP B CZ2   1 
ATOM   7511 C  CZ3   . TRP B 1 466 ? -2.439  15.465  -38.882 1.00 47.47  ? 572 TRP B CZ3   1 
ATOM   7512 C  CH2   . TRP B 1 466 ? -3.223  14.580  -39.676 1.00 50.02  ? 572 TRP B CH2   1 
ATOM   7513 N  N     . CYS B 1 467 ? -2.428  20.761  -39.235 1.00 50.70  ? 573 CYS B N     1 
ATOM   7514 C  CA    . CYS B 1 467 ? -3.529  20.951  -38.290 1.00 54.49  ? 573 CYS B CA    1 
ATOM   7515 C  C     . CYS B 1 467 ? -4.352  22.193  -38.643 1.00 58.01  ? 573 CYS B C     1 
ATOM   7516 O  O     . CYS B 1 467 ? -5.583  22.149  -38.640 1.00 59.07  ? 573 CYS B O     1 
ATOM   7517 C  CB    . CYS B 1 467 ? -3.039  21.158  -36.826 1.00 55.69  ? 573 CYS B CB    1 
ATOM   7518 S  SG    . CYS B 1 467 ? -2.066  19.870  -36.032 1.00 50.76  ? 573 CYS B SG    1 
ATOM   7519 N  N     . ALA B 1 468 ? -3.652  23.312  -38.873 1.00 60.17  ? 574 ALA B N     1 
ATOM   7520 C  CA    . ALA B 1 468 ? -4.257  24.569  -39.403 1.00 59.41  ? 574 ALA B CA    1 
ATOM   7521 C  C     . ALA B 1 468 ? -5.055  24.308  -40.724 1.00 55.93  ? 574 ALA B C     1 
ATOM   7522 O  O     . ALA B 1 468 ? -6.188  24.736  -40.803 1.00 53.02  ? 574 ALA B O     1 
ATOM   7523 C  CB    . ALA B 1 468 ? -3.182  25.652  -39.604 1.00 57.84  ? 574 ALA B CB    1 
ATOM   7524 N  N     . ASP B 1 469 ? -4.485  23.555  -41.688 1.00 51.47  ? 575 ASP B N     1 
ATOM   7525 C  CA    . ASP B 1 469 ? -5.151  23.244  -42.959 1.00 53.44  ? 575 ASP B CA    1 
ATOM   7526 C  C     . ASP B 1 469 ? -6.416  22.384  -42.791 1.00 56.24  ? 575 ASP B C     1 
ATOM   7527 O  O     . ASP B 1 469 ? -7.402  22.673  -43.429 1.00 54.10  ? 575 ASP B O     1 
ATOM   7528 C  CB    . ASP B 1 469 ? -4.223  22.475  -43.906 1.00 56.56  ? 575 ASP B CB    1 
ATOM   7529 C  CG    . ASP B 1 469 ? -2.945  23.288  -44.354 1.00 61.23  ? 575 ASP B CG    1 
ATOM   7530 O  OD1   . ASP B 1 469 ? -2.796  24.514  -44.013 1.00 56.96  ? 575 ASP B OD1   1 
ATOM   7531 O  OD2   . ASP B 1 469 ? -2.091  22.646  -45.067 1.00 58.24  ? 575 ASP B OD2   1 
ATOM   7532 N  N     . ARG B 1 470 ? -6.422  21.337  -41.940 1.00 56.46  ? 576 ARG B N     1 
ATOM   7533 C  CA    . ARG B 1 470 ? -7.572  20.377  -41.883 1.00 51.64  ? 576 ARG B CA    1 
ATOM   7534 C  C     . ARG B 1 470 ? -8.655  20.797  -40.875 1.00 52.42  ? 576 ARG B C     1 
ATOM   7535 O  O     . ARG B 1 470 ? -9.627  20.089  -40.599 1.00 49.58  ? 576 ARG B O     1 
ATOM   7536 C  CB    . ARG B 1 470 ? -7.051  19.039  -41.464 1.00 49.60  ? 576 ARG B CB    1 
ATOM   7537 C  CG    . ARG B 1 470 ? -5.986  18.460  -42.361 1.00 49.18  ? 576 ARG B CG    1 
ATOM   7538 C  CD    . ARG B 1 470 ? -6.598  17.585  -43.417 1.00 49.51  ? 576 ARG B CD    1 
ATOM   7539 N  NE    . ARG B 1 470 ? -7.744  16.783  -42.996 1.00 48.27  ? 576 ARG B NE    1 
ATOM   7540 C  CZ    . ARG B 1 470 ? -7.796  15.454  -43.006 1.00 50.47  ? 576 ARG B CZ    1 
ATOM   7541 N  NH1   . ARG B 1 470 ? -6.797  14.688  -43.427 1.00 54.13  ? 576 ARG B NH1   1 
ATOM   7542 N  NH2   . ARG B 1 470 ? -8.895  14.861  -42.613 1.00 53.22  ? 576 ARG B NH2   1 
ATOM   7543 N  N     . ASN B 1 471 ? -8.442  21.983  -40.324 1.00 57.01  ? 577 ASN B N     1 
ATOM   7544 C  CA    . ASN B 1 471 ? -9.161  22.541  -39.182 1.00 59.26  ? 577 ASN B CA    1 
ATOM   7545 C  C     . ASN B 1 471 ? -9.244  21.638  -37.876 1.00 56.98  ? 577 ASN B C     1 
ATOM   7546 O  O     . ASN B 1 471 ? -10.298 21.439  -37.261 1.00 58.07  ? 577 ASN B O     1 
ATOM   7547 C  CB    . ASN B 1 471 ? -10.505 23.125  -39.643 1.00 59.51  ? 577 ASN B CB    1 
ATOM   7548 C  CG    . ASN B 1 471 ? -10.943 24.276  -38.768 1.00 62.59  ? 577 ASN B CG    1 
ATOM   7549 O  OD1   . ASN B 1 471 ? -10.198 25.212  -38.499 1.00 65.02  ? 577 ASN B OD1   1 
ATOM   7550 N  ND2   . ASN B 1 471 ? -12.145 24.185  -38.278 1.00 67.90  ? 577 ASN B ND2   1 
ATOM   7551 N  N     . PHE B 1 472 ? -8.084  21.137  -37.476 1.00 50.19  ? 578 PHE B N     1 
ATOM   7552 C  CA    . PHE B 1 472 ? -7.921  20.322  -36.274 1.00 45.56  ? 578 PHE B CA    1 
ATOM   7553 C  C     . PHE B 1 472 ? -7.583  21.235  -35.074 1.00 45.41  ? 578 PHE B C     1 
ATOM   7554 O  O     . PHE B 1 472 ? -7.234  22.370  -35.265 1.00 45.12  ? 578 PHE B O     1 
ATOM   7555 C  CB    . PHE B 1 472 ? -6.790  19.335  -36.516 1.00 42.16  ? 578 PHE B CB    1 
ATOM   7556 C  CG    . PHE B 1 472 ? -7.052  18.260  -37.562 1.00 40.64  ? 578 PHE B CG    1 
ATOM   7557 C  CD1   . PHE B 1 472 ? -8.319  17.942  -38.006 1.00 39.43  ? 578 PHE B CD1   1 
ATOM   7558 C  CD2   . PHE B 1 472 ? -5.978  17.449  -37.999 1.00 41.98  ? 578 PHE B CD2   1 
ATOM   7559 C  CE1   . PHE B 1 472 ? -8.508  16.891  -38.903 1.00 41.02  ? 578 PHE B CE1   1 
ATOM   7560 C  CE2   . PHE B 1 472 ? -6.169  16.397  -38.890 1.00 41.21  ? 578 PHE B CE2   1 
ATOM   7561 C  CZ    . PHE B 1 472 ? -7.442  16.115  -39.337 1.00 41.60  ? 578 PHE B CZ    1 
ATOM   7562 N  N     . THR B 1 473 ? -7.651  20.724  -33.841 1.00 46.49  ? 579 THR B N     1 
ATOM   7563 C  CA    . THR B 1 473 ? -7.313  21.519  -32.682 1.00 45.48  ? 579 THR B CA    1 
ATOM   7564 C  C     . THR B 1 473 ? -5.867  22.016  -32.671 1.00 47.77  ? 579 THR B C     1 
ATOM   7565 O  O     . THR B 1 473 ? -4.968  21.527  -33.373 1.00 49.62  ? 579 THR B O     1 
ATOM   7566 C  CB    . THR B 1 473 ? -7.541  20.768  -31.345 1.00 45.73  ? 579 THR B CB    1 
ATOM   7567 O  OG1   . THR B 1 473 ? -6.799  19.542  -31.341 1.00 46.02  ? 579 THR B OG1   1 
ATOM   7568 C  CG2   . THR B 1 473 ? -8.978  20.450  -31.165 1.00 44.86  ? 579 THR B CG2   1 
ATOM   7569 N  N     . LYS B 1 474 ? -5.637  22.989  -31.828 1.00 48.84  ? 580 LYS B N     1 
ATOM   7570 C  CA    . LYS B 1 474 ? -4.338  23.613  -31.775 1.00 50.51  ? 580 LYS B CA    1 
ATOM   7571 C  C     . LYS B 1 474 ? -3.403  22.826  -30.839 1.00 48.99  ? 580 LYS B C     1 
ATOM   7572 O  O     . LYS B 1 474 ? -3.691  22.710  -29.656 1.00 47.68  ? 580 LYS B O     1 
ATOM   7573 C  CB    . LYS B 1 474 ? -4.523  25.013  -31.256 1.00 53.37  ? 580 LYS B CB    1 
ATOM   7574 C  CG    . LYS B 1 474 ? -3.251  25.826  -31.132 1.00 55.37  ? 580 LYS B CG    1 
ATOM   7575 C  CD    . LYS B 1 474 ? -3.510  26.986  -30.179 1.00 57.53  ? 580 LYS B CD    1 
ATOM   7576 C  CE    . LYS B 1 474 ? -2.201  27.496  -29.610 1.00 60.11  ? 580 LYS B CE    1 
ATOM   7577 N  NZ    . LYS B 1 474 ? -2.367  28.231  -28.350 1.00 57.13  ? 580 LYS B NZ    1 
ATOM   7578 N  N     . PRO B 1 475 ? -2.255  22.355  -31.348 1.00 45.92  ? 581 PRO B N     1 
ATOM   7579 C  CA    . PRO B 1 475 ? -1.338  21.719  -30.429 1.00 44.49  ? 581 PRO B CA    1 
ATOM   7580 C  C     . PRO B 1 475 ? -1.000  22.546  -29.192 1.00 43.07  ? 581 PRO B C     1 
ATOM   7581 O  O     . PRO B 1 475 ? -0.800  23.729  -29.305 1.00 46.03  ? 581 PRO B O     1 
ATOM   7582 C  CB    . PRO B 1 475 ? -0.124  21.409  -31.315 1.00 44.45  ? 581 PRO B CB    1 
ATOM   7583 C  CG    . PRO B 1 475 ? -0.676  21.297  -32.714 1.00 43.65  ? 581 PRO B CG    1 
ATOM   7584 C  CD    . PRO B 1 475 ? -1.744  22.343  -32.739 1.00 45.12  ? 581 PRO B CD    1 
ATOM   7585 N  N     . GLN B 1 476 ? -0.962  21.898  -28.030 1.00 44.08  ? 582 GLN B N     1 
ATOM   7586 C  CA    . GLN B 1 476 ? -0.668  22.480  -26.671 1.00 45.22  ? 582 GLN B CA    1 
ATOM   7587 C  C     . GLN B 1 476 ? 0.505   23.417  -26.614 1.00 46.35  ? 582 GLN B C     1 
ATOM   7588 O  O     . GLN B 1 476 ? 0.399   24.520  -26.094 1.00 47.64  ? 582 GLN B O     1 
ATOM   7589 C  CB    . GLN B 1 476 ? -0.459  21.368  -25.625 1.00 43.51  ? 582 GLN B CB    1 
ATOM   7590 C  CG    . GLN B 1 476 ? -1.798  20.796  -25.157 1.00 43.99  ? 582 GLN B CG    1 
ATOM   7591 C  CD    . GLN B 1 476 ? -1.748  19.559  -24.234 1.00 43.49  ? 582 GLN B CD    1 
ATOM   7592 O  OE1   . GLN B 1 476 ? -0.709  19.167  -23.627 1.00 43.18  ? 582 GLN B OE1   1 
ATOM   7593 N  NE2   . GLN B 1 476 ? -2.905  18.924  -24.138 1.00 40.87  ? 582 GLN B NE2   1 
ATOM   7594 N  N     . ASP B 1 477 ? 1.612   22.957  -27.179 1.00 46.13  ? 583 ASP B N     1 
ATOM   7595 C  CA    . ASP B 1 477 ? 2.873   23.748  -27.336 1.00 44.99  ? 583 ASP B CA    1 
ATOM   7596 C  C     . ASP B 1 477 ? 2.963   24.533  -28.690 1.00 44.21  ? 583 ASP B C     1 
ATOM   7597 O  O     . ASP B 1 477 ? 4.049   25.056  -29.007 1.00 41.10  ? 583 ASP B O     1 
ATOM   7598 C  CB    . ASP B 1 477 ? 4.118   22.813  -27.178 1.00 45.68  ? 583 ASP B CB    1 
ATOM   7599 C  CG    . ASP B 1 477 ? 4.179   21.630  -28.282 1.00 47.72  ? 583 ASP B CG    1 
ATOM   7600 O  OD1   . ASP B 1 477 ? 3.229   21.435  -29.100 1.00 52.73  ? 583 ASP B OD1   1 
ATOM   7601 O  OD2   . ASP B 1 477 ? 5.172   20.899  -28.351 1.00 45.26  ? 583 ASP B OD2   1 
ATOM   7602 N  N     . GLY B 1 478 ? 1.854   24.621  -29.448 1.00 42.59  ? 584 GLY B N     1 
ATOM   7603 C  CA    . GLY B 1 478 ? 1.861   25.259  -30.810 1.00 45.62  ? 584 GLY B CA    1 
ATOM   7604 C  C     . GLY B 1 478 ? 2.600   26.630  -30.902 1.00 46.51  ? 584 GLY B C     1 
ATOM   7605 O  O     . GLY B 1 478 ? 3.368   26.858  -31.857 1.00 44.89  ? 584 GLY B O     1 
ATOM   7606 N  N     . ASP B 1 479 ? 2.386   27.515  -29.903 1.00 45.18  ? 585 ASP B N     1 
ATOM   7607 C  CA    . ASP B 1 479 ? 2.975   28.855  -29.899 1.00 48.42  ? 585 ASP B CA    1 
ATOM   7608 C  C     . ASP B 1 479 ? 4.490   28.818  -29.709 1.00 49.22  ? 585 ASP B C     1 
ATOM   7609 O  O     . ASP B 1 479 ? 5.218   29.686  -30.207 1.00 50.76  ? 585 ASP B O     1 
ATOM   7610 C  CB    . ASP B 1 479 ? 2.406   29.717  -28.783 1.00 51.45  ? 585 ASP B CB    1 
ATOM   7611 C  CG    . ASP B 1 479 ? 0.886   29.950  -28.909 1.00 57.13  ? 585 ASP B CG    1 
ATOM   7612 O  OD1   . ASP B 1 479 ? 0.310   30.022  -30.055 1.00 59.82  ? 585 ASP B OD1   1 
ATOM   7613 O  OD2   . ASP B 1 479 ? 0.270   30.054  -27.820 1.00 60.30  ? 585 ASP B OD2   1 
ATOM   7614 N  N     . VAL B 1 480 ? 4.941   27.802  -28.981 1.00 44.58  ? 586 VAL B N     1 
ATOM   7615 C  CA    . VAL B 1 480 ? 6.326   27.548  -28.748 1.00 44.36  ? 586 VAL B CA    1 
ATOM   7616 C  C     . VAL B 1 480 ? 6.978   26.873  -29.943 1.00 45.15  ? 586 VAL B C     1 
ATOM   7617 O  O     . VAL B 1 480 ? 8.012   27.326  -30.388 1.00 47.66  ? 586 VAL B O     1 
ATOM   7618 C  CB    . VAL B 1 480 ? 6.517   26.743  -27.434 1.00 48.48  ? 586 VAL B CB    1 
ATOM   7619 C  CG1   . VAL B 1 480 ? 7.990   26.338  -27.273 1.00 47.48  ? 586 VAL B CG1   1 
ATOM   7620 C  CG2   . VAL B 1 480 ? 5.955   27.536  -26.214 1.00 46.35  ? 586 VAL B CG2   1 
ATOM   7621 N  N     . ILE B 1 481 ? 6.395   25.812  -30.495 1.00 46.36  ? 587 ILE B N     1 
ATOM   7622 C  CA    . ILE B 1 481 ? 7.048   25.071  -31.611 1.00 48.05  ? 587 ILE B CA    1 
ATOM   7623 C  C     . ILE B 1 481 ? 6.909   25.733  -32.988 1.00 49.17  ? 587 ILE B C     1 
ATOM   7624 O  O     . ILE B 1 481 ? 7.736   25.505  -33.872 1.00 50.56  ? 587 ILE B O     1 
ATOM   7625 C  CB    . ILE B 1 481 ? 6.663   23.575  -31.688 1.00 48.19  ? 587 ILE B CB    1 
ATOM   7626 C  CG1   . ILE B 1 481 ? 5.191   23.416  -32.073 1.00 50.49  ? 587 ILE B CG1   1 
ATOM   7627 C  CG2   . ILE B 1 481 ? 6.990   22.891  -30.356 1.00 48.82  ? 587 ILE B CG2   1 
ATOM   7628 C  CD1   . ILE B 1 481 ? 4.710   21.970  -32.222 1.00 52.76  ? 587 ILE B CD1   1 
ATOM   7629 N  N     . ALA B 1 482 ? 5.877   26.538  -33.190 1.00 52.01  ? 588 ALA B N     1 
ATOM   7630 C  CA    . ALA B 1 482 ? 5.665   27.161  -34.533 1.00 52.02  ? 588 ALA B CA    1 
ATOM   7631 C  C     . ALA B 1 482 ? 5.078   28.556  -34.359 1.00 48.67  ? 588 ALA B C     1 
ATOM   7632 O  O     . ALA B 1 482 ? 3.978   28.772  -34.785 1.00 47.63  ? 588 ALA B O     1 
ATOM   7633 C  CB    . ALA B 1 482 ? 4.767   26.270  -35.418 1.00 50.79  ? 588 ALA B CB    1 
ATOM   7634 N  N     . PRO B 1 483 ? 5.828   29.493  -33.739 1.00 50.68  ? 589 PRO B N     1 
ATOM   7635 C  CA    . PRO B 1 483 ? 5.299   30.850  -33.447 1.00 53.63  ? 589 PRO B CA    1 
ATOM   7636 C  C     . PRO B 1 483 ? 4.870   31.636  -34.701 1.00 57.82  ? 589 PRO B C     1 
ATOM   7637 O  O     . PRO B 1 483 ? 3.953   32.487  -34.623 1.00 52.30  ? 589 PRO B O     1 
ATOM   7638 C  CB    . PRO B 1 483 ? 6.472   31.567  -32.751 1.00 52.85  ? 589 PRO B CB    1 
ATOM   7639 C  CG    . PRO B 1 483 ? 7.703   30.774  -33.128 1.00 53.30  ? 589 PRO B CG    1 
ATOM   7640 C  CD    . PRO B 1 483 ? 7.268   29.362  -33.414 1.00 51.49  ? 589 PRO B CD    1 
ATOM   7641 N  N     . LEU B 1 484 ? 5.504   31.322  -35.839 1.00 63.34  ? 590 LEU B N     1 
ATOM   7642 C  CA    . LEU B 1 484 ? 5.134   31.904  -37.143 1.00 68.31  ? 590 LEU B CA    1 
ATOM   7643 C  C     . LEU B 1 484 ? 3.828   31.412  -37.741 1.00 68.51  ? 590 LEU B C     1 
ATOM   7644 O  O     . LEU B 1 484 ? 3.367   32.024  -38.679 1.00 67.10  ? 590 LEU B O     1 
ATOM   7645 C  CB    . LEU B 1 484 ? 6.245   31.645  -38.195 1.00 71.68  ? 590 LEU B CB    1 
ATOM   7646 C  CG    . LEU B 1 484 ? 7.634   32.213  -37.886 1.00 73.82  ? 590 LEU B CG    1 
ATOM   7647 C  CD1   . LEU B 1 484 ? 8.652   31.707  -38.898 1.00 75.10  ? 590 LEU B CD1   1 
ATOM   7648 C  CD2   . LEU B 1 484 ? 7.567   33.726  -37.876 1.00 68.97  ? 590 LEU B CD2   1 
ATOM   7649 N  N     . ILE B 1 485 ? 3.239   30.329  -37.233 1.00 70.65  ? 591 ILE B N     1 
ATOM   7650 C  CA    . ILE B 1 485 ? 2.026   29.747  -37.850 1.00 67.55  ? 591 ILE B CA    1 
ATOM   7651 C  C     . ILE B 1 485 ? 0.750   29.974  -37.035 1.00 71.45  ? 591 ILE B C     1 
ATOM   7652 O  O     . ILE B 1 485 ? -0.265  30.287  -37.630 1.00 78.89  ? 591 ILE B O     1 
ATOM   7653 C  CB    . ILE B 1 485 ? 2.206   28.258  -38.160 1.00 64.25  ? 591 ILE B CB    1 
ATOM   7654 C  CG1   . ILE B 1 485 ? 3.551   28.043  -38.875 1.00 65.71  ? 591 ILE B CG1   1 
ATOM   7655 C  CG2   . ILE B 1 485 ? 1.049   27.761  -38.998 1.00 66.41  ? 591 ILE B CG2   1 
ATOM   7656 C  CD1   . ILE B 1 485 ? 3.841   26.589  -39.267 1.00 64.47  ? 591 ILE B CD1   1 
ATOM   7657 N  N     . THR B 1 486 ? 0.810   29.786  -35.716 1.00 75.21  ? 592 THR B N     1 
ATOM   7658 C  CA    . THR B 1 486 ? -0.387  29.742  -34.856 1.00 75.89  ? 592 THR B CA    1 
ATOM   7659 C  C     . THR B 1 486 ? -1.247  31.048  -34.835 1.00 85.17  ? 592 THR B C     1 
ATOM   7660 O  O     . THR B 1 486 ? -2.469  30.955  -34.643 1.00 81.63  ? 592 THR B O     1 
ATOM   7661 C  CB    . THR B 1 486 ? -0.014  29.290  -33.399 1.00 71.00  ? 592 THR B CB    1 
ATOM   7662 O  OG1   . THR B 1 486 ? 1.090   30.054  -32.901 1.00 65.61  ? 592 THR B OG1   1 
ATOM   7663 C  CG2   . THR B 1 486 ? 0.388   27.855  -33.346 1.00 68.09  ? 592 THR B CG2   1 
ATOM   7664 N  N     . PRO B 1 487 ? -0.608  32.256  -34.974 1.00 97.08  ? 593 PRO B N     1 
ATOM   7665 C  CA    . PRO B 1 487 ? -1.386  33.492  -35.218 1.00 90.88  ? 593 PRO B CA    1 
ATOM   7666 C  C     . PRO B 1 487 ? -2.202  33.555  -36.534 1.00 86.87  ? 593 PRO B C     1 
ATOM   7667 O  O     . PRO B 1 487 ? -3.227  34.215  -36.530 1.00 84.92  ? 593 PRO B O     1 
ATOM   7668 C  CB    . PRO B 1 487 ? -0.342  34.615  -35.157 1.00 92.73  ? 593 PRO B CB    1 
ATOM   7669 C  CG    . PRO B 1 487 ? 0.971   33.979  -34.803 1.00 95.36  ? 593 PRO B CG    1 
ATOM   7670 C  CD    . PRO B 1 487 ? 0.714   32.577  -34.385 1.00 97.73  ? 593 PRO B CD    1 
ATOM   7671 N  N     . GLN B 1 488 ? -1.781  32.876  -37.614 1.00 83.06  ? 594 GLN B N     1 
ATOM   7672 C  CA    . GLN B 1 488 ? -2.513  32.882  -38.914 1.00 83.87  ? 594 GLN B CA    1 
ATOM   7673 C  C     . GLN B 1 488 ? -3.943  32.330  -38.870 1.00 87.28  ? 594 GLN B C     1 
ATOM   7674 O  O     . GLN B 1 488 ? -4.622  32.406  -39.898 1.00 93.01  ? 594 GLN B O     1 
ATOM   7675 C  CB    . GLN B 1 488 ? -1.787  32.066  -40.019 1.00 84.60  ? 594 GLN B CB    1 
ATOM   7676 C  CG    . GLN B 1 488 ? -0.421  32.556  -40.530 1.00 87.58  ? 594 GLN B CG    1 
ATOM   7677 C  CD    . GLN B 1 488 ? 0.381   31.478  -41.340 1.00 95.51  ? 594 GLN B CD    1 
ATOM   7678 O  OE1   . GLN B 1 488 ? 1.445   31.772  -41.909 1.00 97.92  ? 594 GLN B OE1   1 
ATOM   7679 N  NE2   . GLN B 1 488 ? -0.123  30.230  -41.383 1.00 96.42  ? 594 GLN B NE2   1 
ATOM   7680 N  N     . LYS B 1 489 ? -4.385  31.754  -37.737 1.00 84.93  ? 595 LYS B N     1 
ATOM   7681 C  CA    . LYS B 1 489 ? -5.659  30.984  -37.640 1.00 81.58  ? 595 LYS B CA    1 
ATOM   7682 C  C     . LYS B 1 489 ? -6.700  31.588  -36.670 1.00 79.77  ? 595 LYS B C     1 
ATOM   7683 O  O     . LYS B 1 489 ? -6.456  31.644  -35.449 1.00 81.71  ? 595 LYS B O     1 
ATOM   7684 C  CB    . LYS B 1 489 ? -5.330  29.543  -37.227 1.00 81.38  ? 595 LYS B CB    1 
ATOM   7685 C  CG    . LYS B 1 489 ? -6.468  28.505  -37.245 1.00 79.66  ? 595 LYS B CG    1 
ATOM   7686 C  CD    . LYS B 1 489 ? -6.860  28.113  -38.670 1.00 79.81  ? 595 LYS B CD    1 
ATOM   7687 C  CE    . LYS B 1 489 ? -7.546  26.772  -38.702 1.00 78.91  ? 595 LYS B CE    1 
ATOM   7688 N  NZ    . LYS B 1 489 ? -8.746  26.814  -39.554 1.00 78.86  ? 595 LYS B NZ    1 
ATOM   7689 N  N     . LYS B 1 490 ? -7.802  32.071  -37.266 1.00 82.96  ? 596 LYS B N     1 
ATOM   7690 C  CA    . LYS B 1 490 ? -8.880  32.828  -36.588 1.00 80.76  ? 596 LYS B CA    1 
ATOM   7691 C  C     . LYS B 1 490 ? -9.371  31.999  -35.377 1.00 78.27  ? 596 LYS B C     1 
ATOM   7692 O  O     . LYS B 1 490 ? -9.316  32.476  -34.213 1.00 73.30  ? 596 LYS B O     1 
ATOM   7693 C  CB    . LYS B 1 490 ? -10.035 33.149  -37.577 1.00 71.10  ? 596 LYS B CB    1 
ATOM   7694 N  N     . GLU B 1 491 ? -9.749  30.738  -35.682 1.00 73.58  ? 597 GLU B N     1 
ATOM   7695 C  CA    . GLU B 1 491 ? -10.287 29.742  -34.713 1.00 69.98  ? 597 GLU B CA    1 
ATOM   7696 C  C     . GLU B 1 491 ? -9.401  29.506  -33.414 1.00 70.22  ? 597 GLU B C     1 
ATOM   7697 O  O     . GLU B 1 491 ? -9.875  28.908  -32.456 1.00 68.60  ? 597 GLU B O     1 
ATOM   7698 C  CB    . GLU B 1 491 ? -10.648 28.406  -35.459 1.00 60.53  ? 597 GLU B CB    1 
ATOM   7699 N  N     . TRP B 1 492 ? -8.145  29.985  -33.384 1.00 71.50  ? 598 TRP B N     1 
ATOM   7700 C  CA    . TRP B 1 492 ? -7.186  29.727  -32.266 1.00 70.46  ? 598 TRP B CA    1 
ATOM   7701 C  C     . TRP B 1 492 ? -6.807  30.945  -31.354 1.00 77.83  ? 598 TRP B C     1 
ATOM   7702 O  O     . TRP B 1 492 ? -6.250  30.719  -30.272 1.00 80.98  ? 598 TRP B O     1 
ATOM   7703 C  CB    . TRP B 1 492 ? -5.867  29.082  -32.800 1.00 65.48  ? 598 TRP B CB    1 
ATOM   7704 C  CG    . TRP B 1 492 ? -5.959  27.668  -33.492 1.00 58.08  ? 598 TRP B CG    1 
ATOM   7705 C  CD1   . TRP B 1 492 ? -7.049  26.800  -33.513 1.00 53.11  ? 598 TRP B CD1   1 
ATOM   7706 C  CD2   . TRP B 1 492 ? -4.905  26.993  -34.231 1.00 54.21  ? 598 TRP B CD2   1 
ATOM   7707 N  NE1   . TRP B 1 492 ? -6.737  25.663  -34.228 1.00 52.16  ? 598 TRP B NE1   1 
ATOM   7708 C  CE2   . TRP B 1 492 ? -5.437  25.741  -34.661 1.00 52.20  ? 598 TRP B CE2   1 
ATOM   7709 C  CE3   . TRP B 1 492 ? -3.567  27.326  -34.573 1.00 53.21  ? 598 TRP B CE3   1 
ATOM   7710 C  CZ2   . TRP B 1 492 ? -4.685  24.823  -35.407 1.00 53.00  ? 598 TRP B CZ2   1 
ATOM   7711 C  CZ3   . TRP B 1 492 ? -2.816  26.396  -35.329 1.00 51.32  ? 598 TRP B CZ3   1 
ATOM   7712 C  CH2   . TRP B 1 492 ? -3.391  25.169  -35.756 1.00 53.04  ? 598 TRP B CH2   1 
ATOM   7713 N  N     . ASN B 1 493 ? -7.078  32.208  -31.774 1.00 85.92  ? 599 ASN B N     1 
ATOM   7714 C  CA    . ASN B 1 493 ? -6.736  33.441  -30.999 1.00 88.81  ? 599 ASN B CA    1 
ATOM   7715 C  C     . ASN B 1 493 ? -7.985  34.280  -30.705 1.00 88.54  ? 599 ASN B C     1 
ATOM   7716 O  O     . ASN B 1 493 ? -8.793  33.923  -29.858 1.00 93.28  ? 599 ASN B O     1 
ATOM   7717 C  CB    . ASN B 1 493 ? -5.744  34.368  -31.741 1.00 91.01  ? 599 ASN B CB    1 
ATOM   7718 C  CG    . ASN B 1 493 ? -4.590  33.613  -32.386 1.00 94.07  ? 599 ASN B CG    1 
ATOM   7719 O  OD1   . ASN B 1 493 ? -3.990  32.720  -31.800 1.00 92.70  ? 599 ASN B OD1   1 
ATOM   7720 N  ND2   . ASN B 1 493 ? -4.281  33.982  -33.608 1.00 100.96 ? 599 ASN B ND2   1 
HETATM 7721 FE FE    . FE  C 2 .   ? 20.976  -7.291  -6.083  1.00 22.35  ? 701 FE  A FE    1 
HETATM 7722 MG MG    . MG  D 3 .   ? 24.100  -9.548  -6.397  1.00 29.14  ? 702 MG  A MG    1 
HETATM 7723 MG MG    . MG  E 3 .   ? 24.701  -9.253  -0.210  1.00 32.17  ? 703 MG  A MG    1 
HETATM 7724 MG MG    . MG  F 3 .   ? 11.162  11.776  -22.436 1.00 32.45  ? 704 MG  A MG    1 
HETATM 7725 N  N1    . DZ4 G 4 .   ? 15.868  -19.230 -5.561  1.00 31.68  ? 705 DZ4 A N1    1 
HETATM 7726 C  C2    . DZ4 G 4 .   ? 15.210  -18.135 -5.943  1.00 31.49  ? 705 DZ4 A C2    1 
HETATM 7727 N  N3    . DZ4 G 4 .   ? 15.518  -16.852 -5.737  1.00 31.69  ? 705 DZ4 A N3    1 
HETATM 7728 C  C4    . DZ4 G 4 .   ? 16.660  -16.694 -5.052  1.00 30.18  ? 705 DZ4 A C4    1 
HETATM 7729 C  C5    . DZ4 G 4 .   ? 17.436  -17.732 -4.571  1.00 31.76  ? 705 DZ4 A C5    1 
HETATM 7730 C  C6    . DZ4 G 4 .   ? 16.995  -19.047 -4.839  1.00 33.48  ? 705 DZ4 A C6    1 
HETATM 7731 N  N6    . DZ4 G 4 .   ? 17.645  -20.128 -4.437  1.00 38.55  ? 705 DZ4 A N6    1 
HETATM 7732 N  N7    . DZ4 G 4 .   ? 18.533  -17.225 -3.887  1.00 31.53  ? 705 DZ4 A N7    1 
HETATM 7733 C  C8    . DZ4 G 4 .   ? 18.399  -15.913 -3.941  1.00 30.41  ? 705 DZ4 A C8    1 
HETATM 7734 N  N9    . DZ4 G 4 .   ? 17.276  -15.517 -4.641  1.00 29.11  ? 705 DZ4 A N9    1 
HETATM 7735 P  PA    . DZ4 G 4 .   ? 21.303  -10.400 -5.102  1.00 26.37  ? 705 DZ4 A PA    1 
HETATM 7736 P  PB    . DZ4 G 4 .   ? 22.715  -11.069 -2.455  1.00 27.15  ? 705 DZ4 A PB    1 
HETATM 7737 P  PG    . DZ4 G 4 .   ? 22.115  -11.400 0.372   1.00 26.12  ? 705 DZ4 A PG    1 
HETATM 7738 C  "C1'" . DZ4 G 4 .   ? 16.906  -14.111 -4.887  1.00 26.79  ? 705 DZ4 A "C1'" 1 
HETATM 7739 O  O1A   . DZ4 G 4 .   ? 20.419  -9.239  -5.496  1.00 24.83  ? 705 DZ4 A O1A   1 
HETATM 7740 O  O1B   . DZ4 G 4 .   ? 23.905  -10.194 -2.043  1.00 24.43  ? 705 DZ4 A O1B   1 
HETATM 7741 O  O1G   . DZ4 G 4 .   ? 23.184  -10.286 0.499   1.00 26.70  ? 705 DZ4 A O1G   1 
HETATM 7742 C  "C2'" . DZ4 G 4 .   ? 16.325  -13.344 -3.701  1.00 25.67  ? 705 DZ4 A "C2'" 1 
HETATM 7743 O  O2A   . DZ4 G 4 .   ? 22.491  -10.720 -5.986  1.00 25.88  ? 705 DZ4 A O2A   1 
HETATM 7744 O  O2B   . DZ4 G 4 .   ? 22.979  -12.439 -3.050  1.00 26.26  ? 705 DZ4 A O2B   1 
HETATM 7745 O  O2G   . DZ4 G 4 .   ? 20.872  -11.116 1.219   1.00 24.74  ? 705 DZ4 A O2G   1 
HETATM 7746 C  "C3'" . DZ4 G 4 .   ? 16.700  -11.885 -3.997  1.00 24.64  ? 705 DZ4 A "C3'" 1 
HETATM 7747 O  "O3'" . DZ4 G 4 .   ? 15.688  -11.209 -4.753  1.00 23.53  ? 705 DZ4 A "O3'" 1 
HETATM 7748 N  N3A   . DZ4 G 4 .   ? 21.676  -10.254 -3.478  1.00 25.07  ? 705 DZ4 A N3A   1 
HETATM 7749 O  O3B   . DZ4 G 4 .   ? 21.792  -11.381 -1.209  1.00 23.64  ? 705 DZ4 A O3B   1 
HETATM 7750 O  O3G   . DZ4 G 4 .   ? 22.617  -12.798 0.550   1.00 25.72  ? 705 DZ4 A O3G   1 
HETATM 7751 C  "C4'" . DZ4 G 4 .   ? 17.985  -12.021 -4.828  1.00 24.75  ? 705 DZ4 A "C4'" 1 
HETATM 7752 O  "O4'" . DZ4 G 4 .   ? 18.091  -13.393 -5.271  1.00 25.02  ? 705 DZ4 A "O4'" 1 
HETATM 7753 C  "C5'" . DZ4 G 4 .   ? 19.262  -11.707 -4.100  1.00 25.20  ? 705 DZ4 A "C5'" 1 
HETATM 7754 O  "O5'" . DZ4 G 4 .   ? 20.341  -11.689 -5.035  1.00 24.69  ? 705 DZ4 A "O5'" 1 
HETATM 7755 C  C1    . CZF H 5 .   ? 10.783  5.752   -19.080 1.00 29.08  ? 706 CZF A C1    1 
HETATM 7756 C  C2    . CZF H 5 .   ? 15.158  5.370   -20.654 1.00 25.72  ? 706 CZF A C2    1 
HETATM 7757 C  C3    . CZF H 5 .   ? 11.393  7.076   -18.621 1.00 28.55  ? 706 CZF A C3    1 
HETATM 7758 C  C4    . CZF H 5 .   ? 11.142  8.016   -19.809 1.00 28.11  ? 706 CZF A C4    1 
HETATM 7759 C  C5    . CZF H 5 .   ? 13.044  4.669   -19.774 1.00 27.01  ? 706 CZF A C5    1 
HETATM 7760 C  C6    . CZF H 5 .   ? 9.913   7.424   -20.485 1.00 29.68  ? 706 CZF A C6    1 
HETATM 7761 C  C7    . CZF H 5 .   ? 13.490  3.337   -19.759 1.00 26.17  ? 706 CZF A C7    1 
HETATM 7762 C  C8    . CZF H 5 .   ? 9.734   7.787   -21.954 1.00 30.66  ? 706 CZF A C8    1 
HETATM 7763 C  C9    . CZF H 5 .   ? 14.808  2.989   -20.209 1.00 26.44  ? 706 CZF A C9    1 
HETATM 7764 C  C10   . CZF H 5 .   ? 11.492  3.346   -18.953 1.00 26.51  ? 706 CZF A C10   1 
HETATM 7765 N  N1    . CZF H 5 .   ? 15.595  4.072   -20.621 1.00 26.55  ? 706 CZF A N1    1 
HETATM 7766 N  N2    . CZF H 5 .   ? 13.880  5.665   -20.250 1.00 26.60  ? 706 CZF A N2    1 
HETATM 7767 N  N3    . CZF H 5 .   ? 12.474  2.538   -19.267 1.00 26.07  ? 706 CZF A N3    1 
HETATM 7768 N  N4    . CZF H 5 .   ? 11.749  4.662   -19.259 1.00 27.27  ? 706 CZF A N4    1 
HETATM 7769 O  O1    . CZF H 5 .   ? 15.908  6.248   -21.003 1.00 25.86  ? 706 CZF A O1    1 
HETATM 7770 O  O2    . CZF H 5 .   ? 10.679  7.434   -17.446 1.00 27.48  ? 706 CZF A O2    1 
HETATM 7771 O  O3    . CZF H 5 .   ? 10.754  9.335   -19.447 1.00 29.04  ? 706 CZF A O3    1 
HETATM 7772 O  O4    . CZF H 5 .   ? 10.067  5.990   -20.290 1.00 30.37  ? 706 CZF A O4    1 
HETATM 7773 O  O5    . CZF H 5 .   ? 10.981  7.589   -22.698 1.00 32.18  ? 706 CZF A O5    1 
HETATM 7774 O  O6    . CZF H 5 .   ? 15.309  1.869   -20.245 1.00 24.41  ? 706 CZF A O6    1 
HETATM 7775 O  O7    . CZF H 5 .   ? 11.229  9.124   -24.679 1.00 31.84  ? 706 CZF A O7    1 
HETATM 7776 O  O8    . CZF H 5 .   ? 13.234  7.923   -23.621 1.00 29.76  ? 706 CZF A O8    1 
HETATM 7777 O  O9    . CZF H 5 .   ? 12.076  9.902   -22.439 1.00 29.06  ? 706 CZF A O9    1 
HETATM 7778 O  O10   . CZF H 5 .   ? 12.283  11.237  -25.589 1.00 28.15  ? 706 CZF A O10   1 
HETATM 7779 O  O11   . CZF H 5 .   ? 10.216  10.426  -26.508 1.00 29.10  ? 706 CZF A O11   1 
HETATM 7780 O  O12   . CZF H 5 .   ? 10.135  11.393  -24.214 1.00 26.40  ? 706 CZF A O12   1 
HETATM 7781 O  O13   . CZF H 5 .   ? 13.252  13.575  -25.939 1.00 34.77  ? 706 CZF A O13   1 
HETATM 7782 O  O14   . CZF H 5 .   ? 12.545  12.936  -23.716 1.00 33.13  ? 706 CZF A O14   1 
HETATM 7783 O  O15   . CZF H 5 .   ? 14.498  11.697  -24.757 1.00 31.27  ? 706 CZF A O15   1 
HETATM 7784 P  P1    . CZF H 5 .   ? 11.984  8.690   -23.306 1.00 31.23  ? 706 CZF A P1    1 
HETATM 7785 P  P2    . CZF H 5 .   ? 10.860  10.608  -25.244 1.00 31.06  ? 706 CZF A P2    1 
HETATM 7786 P  P3    . CZF H 5 .   ? 13.184  12.442  -24.972 1.00 33.06  ? 706 CZF A P3    1 
HETATM 7787 N  N1    . DZ4 I 4 .   ? 3.204   -17.951 2.414   1.00 26.31  ? 707 DZ4 A N1    1 
HETATM 7788 C  C2    . DZ4 I 4 .   ? 2.572   -17.511 1.304   1.00 25.12  ? 707 DZ4 A C2    1 
HETATM 7789 N  N3    . DZ4 I 4 .   ? 2.460   -18.085 0.111   1.00 25.92  ? 707 DZ4 A N3    1 
HETATM 7790 C  C4    . DZ4 I 4 .   ? 3.112   -19.274 0.089   1.00 26.80  ? 707 DZ4 A C4    1 
HETATM 7791 C  C5    . DZ4 I 4 .   ? 3.808   -19.862 1.146   1.00 27.21  ? 707 DZ4 A C5    1 
HETATM 7792 C  C6    . DZ4 I 4 .   ? 3.837   -19.155 2.372   1.00 27.13  ? 707 DZ4 A C6    1 
HETATM 7793 N  N6    . DZ4 I 4 .   ? 4.460   -19.591 3.454   1.00 25.10  ? 707 DZ4 A N6    1 
HETATM 7794 N  N7    . DZ4 I 4 .   ? 4.354   -21.084 0.769   1.00 26.89  ? 707 DZ4 A N7    1 
HETATM 7795 C  C8    . DZ4 I 4 .   ? 3.966   -21.229 -0.480  1.00 27.19  ? 707 DZ4 A C8    1 
HETATM 7796 N  N9    . DZ4 I 4 .   ? 3.252   -20.149 -0.969  1.00 26.53  ? 707 DZ4 A N9    1 
HETATM 7797 P  PA    . DZ4 I 4 .   ? 2.357   -24.548 -1.117  1.00 27.74  ? 707 DZ4 A PA    1 
HETATM 7798 P  PB    . DZ4 I 4 .   ? 2.579   -27.140 -2.596  1.00 31.99  ? 707 DZ4 A PB    1 
HETATM 7799 P  PG    . DZ4 I 4 .   ? 1.545   -29.609 -1.318  1.00 35.37  ? 707 DZ4 A PG    1 
HETATM 7800 C  "C1'" . DZ4 I 4 .   ? 2.594   -20.018 -2.277  1.00 26.52  ? 707 DZ4 A "C1'" 1 
HETATM 7801 O  O1A   . DZ4 I 4 .   ? 1.352   -24.141 -0.083  1.00 24.76  ? 707 DZ4 A O1A   1 
HETATM 7802 O  O1B   . DZ4 I 4 .   ? 1.891   -27.745 -3.778  1.00 30.88  ? 707 DZ4 A O1B   1 
HETATM 7803 O  O1G   . DZ4 I 4 .   ? 0.288   -29.015 -0.787  1.00 32.99  ? 707 DZ4 A O1G   1 
HETATM 7804 C  "C2'" . DZ4 I 4 .   ? 3.247   -20.710 -3.461  1.00 25.80  ? 707 DZ4 A "C2'" 1 
HETATM 7805 O  O2A   . DZ4 I 4 .   ? 3.816   -24.454 -0.876  1.00 24.59  ? 707 DZ4 A O2A   1 
HETATM 7806 O  O2B   . DZ4 I 4 .   ? 4.074   -26.903 -2.675  1.00 29.79  ? 707 DZ4 A O2B   1 
HETATM 7807 O  O2G   . DZ4 I 4 .   ? 1.346   -30.202 -2.673  1.00 32.20  ? 707 DZ4 A O2G   1 
HETATM 7808 C  "C3'" . DZ4 I 4 .   ? 2.043   -21.144 -4.305  1.00 26.34  ? 707 DZ4 A "C3'" 1 
HETATM 7809 O  "O3'" . DZ4 I 4 .   ? 1.530   -20.089 -5.139  1.00 24.51  ? 707 DZ4 A "O3'" 1 
HETATM 7810 N  N3A   . DZ4 I 4 .   ? 1.730   -25.912 -1.929  1.00 29.05  ? 707 DZ4 A N3A   1 
HETATM 7811 O  O3B   . DZ4 I 4 .   ? 2.557   -28.319 -1.510  1.00 33.17  ? 707 DZ4 A O3B   1 
HETATM 7812 O  O3G   . DZ4 I 4 .   ? 2.190   -30.528 -0.344  1.00 34.31  ? 707 DZ4 A O3G   1 
HETATM 7813 C  "C4'" . DZ4 I 4 .   ? 1.017   -21.508 -3.226  1.00 26.01  ? 707 DZ4 A "C4'" 1 
HETATM 7814 O  "O4'" . DZ4 I 4 .   ? 1.297   -20.616 -2.136  1.00 26.46  ? 707 DZ4 A "O4'" 1 
HETATM 7815 C  "C5'" . DZ4 I 4 .   ? 0.962   -22.934 -2.714  1.00 25.36  ? 707 DZ4 A "C5'" 1 
HETATM 7816 O  "O5'" . DZ4 I 4 .   ? 2.258   -23.437 -2.301  1.00 25.59  ? 707 DZ4 A "O5'" 1 
HETATM 7817 N  N1    . DZ4 J 4 .   ? 0.558   9.022   -14.064 1.00 22.42  ? 701 DZ4 B N1    1 
HETATM 7818 C  C2    . DZ4 J 4 .   ? 1.479   8.180   -13.567 1.00 22.95  ? 701 DZ4 B C2    1 
HETATM 7819 N  N3    . DZ4 J 4 .   ? 2.616   7.743   -14.089 1.00 22.86  ? 701 DZ4 B N3    1 
HETATM 7820 C  C4    . DZ4 J 4 .   ? 2.777   8.230   -15.328 1.00 24.44  ? 701 DZ4 B C4    1 
HETATM 7821 C  C5    . DZ4 J 4 .   ? 1.893   9.079   -15.989 1.00 23.19  ? 701 DZ4 B C5    1 
HETATM 7822 C  C6    . DZ4 J 4 .   ? 0.717   9.500   -15.321 1.00 24.74  ? 701 DZ4 B C6    1 
HETATM 7823 N  N6    . DZ4 J 4 .   ? -0.205  10.356  -15.806 1.00 24.71  ? 701 DZ4 B N6    1 
HETATM 7824 N  N7    . DZ4 J 4 .   ? 2.406   9.388   -17.210 1.00 23.90  ? 701 DZ4 B N7    1 
HETATM 7825 C  C8    . DZ4 J 4 .   ? 3.560   8.767   -17.292 1.00 24.44  ? 701 DZ4 B C8    1 
HETATM 7826 N  N9    . DZ4 J 4 .   ? 3.843   7.995   -16.191 1.00 24.90  ? 701 DZ4 B N9    1 
HETATM 7827 P  PA    . DZ4 J 4 .   ? 6.504   10.796  -18.766 1.00 26.71  ? 701 DZ4 B PA    1 
HETATM 7828 P  PB    . DZ4 J 4 .   ? 8.181   11.332  -21.152 1.00 32.38  ? 701 DZ4 B PB    1 
HETATM 7829 P  PG    . DZ4 J 4 .   ? 8.926   14.136  -21.682 1.00 35.76  ? 701 DZ4 B PG    1 
HETATM 7830 C  "C1'" . DZ4 J 4 .   ? 5.140   7.331   -15.955 1.00 23.98  ? 701 DZ4 B "C1'" 1 
HETATM 7831 O  O1A   . DZ4 J 4 .   ? 6.204   11.664  -17.599 1.00 25.96  ? 701 DZ4 B O1A   1 
HETATM 7832 O  O1B   . DZ4 J 4 .   ? 9.661   11.058  -21.255 1.00 30.47  ? 701 DZ4 B O1B   1 
HETATM 7833 O  O1G   . DZ4 J 4 .   ? 9.268   14.658  -20.325 1.00 30.98  ? 701 DZ4 B O1G   1 
HETATM 7834 C  "C2'" . DZ4 J 4 .   ? 5.777   6.605   -17.132 1.00 23.76  ? 701 DZ4 B "C2'" 1 
HETATM 7835 O  O2A   . DZ4 J 4 .   ? 5.318   10.475  -19.659 1.00 24.11  ? 701 DZ4 B O2A   1 
HETATM 7836 O  O2B   . DZ4 J 4 .   ? 7.168   10.603  -22.005 1.00 26.05  ? 701 DZ4 B O2B   1 
HETATM 7837 O  O2G   . DZ4 J 4 .   ? 10.128  13.567  -22.360 1.00 35.79  ? 701 DZ4 B O2G   1 
HETATM 7838 C  "C3'" . DZ4 J 4 .   ? 7.280   6.701   -16.837 1.00 23.41  ? 701 DZ4 B "C3'" 1 
HETATM 7839 O  "O3'" . DZ4 J 4 .   ? 7.717   5.567   -16.086 1.00 20.68  ? 701 DZ4 B "O3'" 1 
HETATM 7840 N  N3A   . DZ4 J 4 .   ? 7.920   11.335  -19.480 1.00 28.15  ? 701 DZ4 B N3A   1 
HETATM 7841 O  O3B   . DZ4 J 4 .   ? 7.922   12.885  -21.539 1.00 35.38  ? 701 DZ4 B O3B   1 
HETATM 7842 O  O3G   . DZ4 J 4 .   ? 8.107   14.994  -22.535 1.00 34.05  ? 701 DZ4 B O3G   1 
HETATM 7843 C  "C4'" . DZ4 J 4 .   ? 7.402   8.048   -16.138 1.00 23.69  ? 701 DZ4 B "C4'" 1 
HETATM 7844 O  "O4'" . DZ4 J 4 .   ? 6.079   8.382   -15.668 1.00 23.45  ? 701 DZ4 B "O4'" 1 
HETATM 7845 C  "C5'" . DZ4 J 4 .   ? 7.861   9.171   -17.041 1.00 24.35  ? 701 DZ4 B "C5'" 1 
HETATM 7846 O  "O5'" . DZ4 J 4 .   ? 6.843   9.372   -18.055 1.00 25.98  ? 701 DZ4 B "O5'" 1 
HETATM 7847 FE FE    . FE  K 2 .   ? -8.280  -10.345 -20.899 1.00 28.67  ? 702 FE  B FE    1 
HETATM 7848 MG MG    . MG  L 3 .   ? -9.252  -10.372 -24.643 1.00 36.00  ? 703 MG  B MG    1 
HETATM 7849 MG MG    . MG  M 3 .   ? -13.535 -6.671  -23.353 1.00 37.94  ? 704 MG  B MG    1 
HETATM 7850 MG MG    . MG  N 3 .   ? 1.505   -29.603 -4.647  1.00 35.41  ? 705 MG  B MG    1 
HETATM 7851 N  N1    . DZ4 O 4 .   ? -0.700  -0.748  -25.151 1.00 29.56  ? 706 DZ4 B N1    1 
HETATM 7852 C  C2    . DZ4 O 4 .   ? -0.493  -1.431  -24.017 1.00 27.54  ? 706 DZ4 B C2    1 
HETATM 7853 N  N3    . DZ4 O 4 .   ? -1.345  -2.243  -23.389 1.00 30.05  ? 706 DZ4 B N3    1 
HETATM 7854 C  C4    . DZ4 O 4 .   ? -2.569  -2.306  -23.972 1.00 28.93  ? 706 DZ4 B C4    1 
HETATM 7855 C  C5    . DZ4 O 4 .   ? -2.944  -1.628  -25.114 1.00 27.25  ? 706 DZ4 B C5    1 
HETATM 7856 C  C6    . DZ4 O 4 .   ? -1.937  -0.820  -25.713 1.00 28.31  ? 706 DZ4 B C6    1 
HETATM 7857 N  N6    . DZ4 O 4 .   ? -2.136  -0.037  -26.755 1.00 28.74  ? 706 DZ4 B N6    1 
HETATM 7858 N  N7    . DZ4 O 4 .   ? -4.285  -1.875  -25.398 1.00 25.66  ? 706 DZ4 B N7    1 
HETATM 7859 C  C8    . DZ4 O 4 .   ? -4.687  -2.695  -24.478 1.00 27.67  ? 706 DZ4 B C8    1 
HETATM 7860 N  N9    . DZ4 O 4 .   ? -3.700  -2.999  -23.548 1.00 27.86  ? 706 DZ4 B N9    1 
HETATM 7861 P  PA    . DZ4 O 4 .   ? -7.955  -7.872  -22.942 1.00 28.53  ? 706 DZ4 B PA    1 
HETATM 7862 P  PB    . DZ4 O 4 .   ? -10.332 -6.274  -23.709 1.00 30.74  ? 706 DZ4 B PB    1 
HETATM 7863 P  PG    . DZ4 O 4 .   ? -11.763 -3.884  -22.922 1.00 31.77  ? 706 DZ4 B PG    1 
HETATM 7864 C  "C1'" . DZ4 O 4 .   ? -3.885  -3.843  -22.379 1.00 24.65  ? 706 DZ4 B "C1'" 1 
HETATM 7865 O  O1A   . DZ4 O 4 .   ? -7.436  -8.533  -21.649 1.00 26.71  ? 706 DZ4 B O1A   1 
HETATM 7866 O  O1B   . DZ4 O 4 .   ? -11.742 -6.734  -23.915 1.00 29.51  ? 706 DZ4 B O1B   1 
HETATM 7867 O  O1G   . DZ4 O 4 .   ? -13.012 -4.696  -22.924 1.00 30.35  ? 706 DZ4 B O1G   1 
HETATM 7868 C  "C2'" . DZ4 O 4 .   ? -4.803  -3.247  -21.326 1.00 25.31  ? 706 DZ4 B "C2'" 1 
HETATM 7869 O  O2A   . DZ4 O 4 .   ? -7.847  -8.689  -24.170 1.00 28.73  ? 706 DZ4 B O2A   1 
HETATM 7870 O  O2B   . DZ4 O 4 .   ? -9.441  -6.088  -24.906 1.00 27.32  ? 706 DZ4 B O2B   1 
HETATM 7871 O  O2G   . DZ4 O 4 .   ? -11.608 -3.052  -21.740 1.00 30.74  ? 706 DZ4 B O2G   1 
HETATM 7872 C  "C3'" . DZ4 O 4 .   ? -5.277  -4.496  -20.577 1.00 25.06  ? 706 DZ4 B "C3'" 1 
HETATM 7873 O  "O3'" . DZ4 O 4 .   ? -4.344  -5.081  -19.654 1.00 23.96  ? 706 DZ4 B "O3'" 1 
HETATM 7874 N  N3A   . DZ4 O 4 .   ? -9.401  -7.111  -22.694 1.00 27.54  ? 706 DZ4 B N3A   1 
HETATM 7875 O  O3B   . DZ4 O 4 .   ? -10.483 -4.868  -22.997 1.00 30.42  ? 706 DZ4 B O3B   1 
HETATM 7876 O  O3G   . DZ4 O 4 .   ? -11.565 -2.987  -24.146 1.00 31.44  ? 706 DZ4 B O3G   1 
HETATM 7877 C  "C4'" . DZ4 O 4 .   ? -5.460  -5.479  -21.738 1.00 25.26  ? 706 DZ4 B "C4'" 1 
HETATM 7878 O  "O4'" . DZ4 O 4 .   ? -4.561  -5.032  -22.766 1.00 25.25  ? 706 DZ4 B "O4'" 1 
HETATM 7879 C  "C5'" . DZ4 O 4 .   ? -6.857  -5.583  -22.288 1.00 25.57  ? 706 DZ4 B "C5'" 1 
HETATM 7880 O  "O5'" . DZ4 O 4 .   ? -6.910  -6.689  -23.202 1.00 25.80  ? 706 DZ4 B "O5'" 1 
HETATM 7881 C  C1    . CZF P 5 .   ? 2.084   -23.475 -7.752  1.00 28.96  ? 707 CZF B C1    1 
HETATM 7882 C  C2    . CZF P 5 .   ? 0.674   -25.828 -11.398 1.00 33.56  ? 707 CZF B C2    1 
HETATM 7883 C  C3    . CZF P 5 .   ? 0.825   -24.163 -7.229  1.00 29.01  ? 707 CZF B C3    1 
HETATM 7884 C  C4    . CZF P 5 .   ? 1.357   -25.493 -6.681  1.00 29.73  ? 707 CZF B C4    1 
HETATM 7885 C  C5    . CZF P 5 .   ? 1.616   -24.029 -10.228 1.00 30.76  ? 707 CZF B C5    1 
HETATM 7886 C  C6    . CZF P 5 .   ? 2.802   -25.167 -6.318  1.00 30.96  ? 707 CZF B C6    1 
HETATM 7887 C  C7    . CZF P 5 .   ? 1.815   -23.339 -11.421 1.00 30.77  ? 707 CZF B C7    1 
HETATM 7888 C  C8    . CZF P 5 .   ? 3.779   -26.308 -6.199  1.00 33.67  ? 707 CZF B C8    1 
HETATM 7889 C  C9    . CZF P 5 .   ? 1.475   -23.900 -12.663 1.00 31.56  ? 707 CZF B C9    1 
HETATM 7890 C  C10   . CZF P 5 .   ? 2.486   -22.063 -9.835  1.00 28.20  ? 707 CZF B C10   1 
HETATM 7891 N  N1    . CZF P 5 .   ? 0.930   -25.179 -12.590 1.00 32.53  ? 707 CZF B N1    1 
HETATM 7892 N  N2    . CZF P 5 .   ? 1.056   -25.240 -10.227 1.00 30.65  ? 707 CZF B N2    1 
HETATM 7893 N  N3    . CZF P 5 .   ? 2.391   -22.113 -11.143 1.00 31.86  ? 707 CZF B N3    1 
HETATM 7894 N  N4    . CZF P 5 .   ? 2.060   -23.206 -9.208  1.00 29.26  ? 707 CZF B N4    1 
HETATM 7895 O  O1    . CZF P 5 .   ? 0.179   -26.941 -11.371 1.00 35.60  ? 707 CZF B O1    1 
HETATM 7896 O  O2    . CZF P 5 .   ? 0.219   -23.358 -6.249  1.00 28.11  ? 707 CZF B O2    1 
HETATM 7897 O  O3    . CZF P 5 .   ? 0.640   -25.892 -5.536  1.00 27.96  ? 707 CZF B O3    1 
HETATM 7898 O  O4    . CZF P 5 .   ? 3.179   -24.329 -7.426  1.00 29.87  ? 707 CZF B O4    1 
HETATM 7899 O  O5    . CZF P 5 .   ? 3.756   -27.083 -7.418  1.00 36.90  ? 707 CZF B O5    1 
HETATM 7900 O  O6    . CZF P 5 .   ? 1.627   -23.378 -13.757 1.00 32.36  ? 707 CZF B O6    1 
HETATM 7901 O  O7    . CZF P 5 .   ? 4.234   -29.468 -6.917  1.00 37.32  ? 707 CZF B O7    1 
HETATM 7902 O  O8    . CZF P 5 .   ? 2.900   -28.923 -8.915  1.00 38.53  ? 707 CZF B O8    1 
HETATM 7903 O  O9    . CZF P 5 .   ? 1.861   -28.668 -6.588  1.00 32.96  ? 707 CZF B O9    1 
HETATM 7904 O  O10   . CZF P 5 .   ? 3.214   -31.674 -6.682  1.00 36.61  ? 707 CZF B O10   1 
HETATM 7905 O  O11   . CZF P 5 .   ? 5.566   -31.261 -5.885  1.00 35.65  ? 707 CZF B O11   1 
HETATM 7906 O  O12   . CZF P 5 .   ? 3.574   -30.202 -4.665  1.00 33.73  ? 707 CZF B O12   1 
HETATM 7907 O  O13   . CZF P 5 .   ? 2.260   -33.575 -5.539  1.00 42.88  ? 707 CZF B O13   1 
HETATM 7908 O  O14   . CZF P 5 .   ? 1.109   -31.380 -5.237  1.00 36.77  ? 707 CZF B O14   1 
HETATM 7909 O  O15   . CZF P 5 .   ? 1.068   -32.570 -7.411  1.00 38.80  ? 707 CZF B O15   1 
HETATM 7910 P  P1    . CZF P 5 .   ? 3.058   -28.562 -7.482  1.00 39.60  ? 707 CZF B P1    1 
HETATM 7911 P  P2    . CZF P 5 .   ? 4.207   -30.695 -5.903  1.00 34.64  ? 707 CZF B P2    1 
HETATM 7912 P  P3    . CZF P 5 .   ? 1.837   -32.317 -6.209  1.00 38.42  ? 707 CZF B P3    1 
HETATM 7913 O  O     . HOH Q 6 .   ? 6.097   -8.521  -12.926 1.00 49.02  ? 801 HOH A O     1 
HETATM 7914 O  O     . HOH Q 6 .   ? 25.313  -8.179  1.292   1.00 38.96  ? 802 HOH A O     1 
HETATM 7915 O  O     . HOH Q 6 .   ? 15.093  9.410   -25.345 1.00 29.00  ? 803 HOH A O     1 
HETATM 7916 O  O     . HOH Q 6 .   ? 11.139  3.938   -1.435  1.00 33.47  ? 804 HOH A O     1 
HETATM 7917 O  O     . HOH Q 6 .   ? 15.331  -28.206 -2.281  1.00 35.79  ? 805 HOH A O     1 
HETATM 7918 O  O     . HOH Q 6 .   ? 4.329   4.941   -8.609  1.00 39.67  ? 806 HOH A O     1 
HETATM 7919 O  O     . HOH Q 6 .   ? 8.721   -5.284  -12.473 1.00 28.54  ? 807 HOH A O     1 
HETATM 7920 O  O     . HOH Q 6 .   ? 22.725  -8.199  -5.303  1.00 18.46  ? 808 HOH A O     1 
HETATM 7921 O  O     . HOH Q 6 .   ? 26.689  6.699   22.318  1.00 31.56  ? 809 HOH A O     1 
HETATM 7922 O  O     . HOH Q 6 .   ? 22.855  -17.159 3.414   1.00 38.56  ? 810 HOH A O     1 
HETATM 7923 O  O     . HOH Q 6 .   ? 23.263  -7.607  -0.340  1.00 30.52  ? 811 HOH A O     1 
HETATM 7924 O  O     . HOH Q 6 .   ? 25.707  -10.723 0.024   1.00 33.52  ? 812 HOH A O     1 
HETATM 7925 O  O     . HOH Q 6 .   ? 10.899  6.311   -2.722  1.00 34.90  ? 813 HOH A O     1 
HETATM 7926 O  O     . HOH Q 6 .   ? 19.864  -19.330 -3.077  1.00 36.14  ? 814 HOH A O     1 
HETATM 7927 O  O     . HOH Q 6 .   ? -0.885  -25.743 -2.088  1.00 40.20  ? 815 HOH A O     1 
HETATM 7928 O  O     . HOH Q 6 .   ? 16.800  1.755   -23.723 1.00 28.84  ? 816 HOH A O     1 
HETATM 7929 O  O     . HOH Q 6 .   ? 25.909  -8.165  -6.697  1.00 29.53  ? 817 HOH A O     1 
HETATM 7930 O  O     . HOH Q 6 .   ? 23.522  -15.516 -11.777 1.00 32.58  ? 818 HOH A O     1 
HETATM 7931 O  O     . HOH Q 6 .   ? 13.578  -7.950  -6.286  1.00 30.36  ? 819 HOH A O     1 
HETATM 7932 O  O     . HOH Q 6 .   ? 11.446  -13.019 -10.801 1.00 32.04  ? 820 HOH A O     1 
HETATM 7933 O  O     . HOH Q 6 .   ? 21.251  -14.451 -2.421  1.00 40.60  ? 821 HOH A O     1 
HETATM 7934 O  O     . HOH Q 6 .   ? 7.260   -22.200 1.427   1.00 32.70  ? 822 HOH A O     1 
HETATM 7935 O  O     . HOH Q 6 .   ? 14.461  -21.464 -6.326  1.00 35.12  ? 823 HOH A O     1 
HETATM 7936 O  O     . HOH Q 6 .   ? 11.495  -1.151  3.902   1.00 32.56  ? 824 HOH A O     1 
HETATM 7937 O  O     . HOH Q 6 .   ? 23.708  4.995   -23.923 1.00 32.41  ? 825 HOH A O     1 
HETATM 7938 O  O     . HOH Q 6 .   ? 25.420  -13.732 -3.213  1.00 44.17  ? 826 HOH A O     1 
HETATM 7939 O  O     . HOH Q 6 .   ? 25.941  -8.364  -1.625  1.00 35.41  ? 827 HOH A O     1 
HETATM 7940 O  O     . HOH Q 6 .   ? 28.614  -6.638  -26.454 1.00 38.06  ? 828 HOH A O     1 
HETATM 7941 O  O     . HOH Q 6 .   ? 26.814  -4.719  18.708  1.00 30.69  ? 829 HOH A O     1 
HETATM 7942 O  O     . HOH Q 6 .   ? 2.687   -8.241  0.103   1.00 32.98  ? 830 HOH A O     1 
HETATM 7943 O  O     . HOH Q 6 .   ? 25.025  -15.893 9.903   1.00 28.58  ? 831 HOH A O     1 
HETATM 7944 O  O     . HOH Q 6 .   ? 20.155  -16.129 -24.503 1.00 34.79  ? 832 HOH A O     1 
HETATM 7945 O  O     . HOH Q 6 .   ? 2.114   -11.655 4.146   1.00 29.36  ? 833 HOH A O     1 
HETATM 7946 O  O     . HOH Q 6 .   ? 22.847  -4.311  -11.784 1.00 29.99  ? 834 HOH A O     1 
HETATM 7947 O  O     . HOH Q 6 .   ? 23.372  -15.224 -0.759  1.00 45.65  ? 835 HOH A O     1 
HETATM 7948 O  O     . HOH Q 6 .   ? 25.161  -9.986  -4.604  1.00 33.04  ? 836 HOH A O     1 
HETATM 7949 O  O     . HOH Q 6 .   ? 5.076   -25.746 -15.082 1.00 30.87  ? 837 HOH A O     1 
HETATM 7950 O  O     . HOH Q 6 .   ? 8.186   13.163  -25.394 1.00 34.75  ? 838 HOH A O     1 
HETATM 7951 O  O     . HOH Q 6 .   ? 17.693  -15.972 -8.144  1.00 38.23  ? 839 HOH A O     1 
HETATM 7952 O  O     . HOH Q 6 .   ? 28.074  -10.697 5.249   1.00 42.67  ? 840 HOH A O     1 
HETATM 7953 O  O     . HOH Q 6 .   ? 18.942  -14.195 7.390   1.00 29.64  ? 841 HOH A O     1 
HETATM 7954 O  O     . HOH Q 6 .   ? 11.912  -6.761  9.838   1.00 32.27  ? 842 HOH A O     1 
HETATM 7955 O  O     . HOH Q 6 .   ? 4.847   8.057   -7.234  1.00 38.17  ? 843 HOH A O     1 
HETATM 7956 O  O     . HOH Q 6 .   ? 12.051  -1.891  10.709  1.00 27.89  ? 844 HOH A O     1 
HETATM 7957 O  O     . HOH Q 6 .   ? -0.582  -28.977 -4.845  1.00 27.88  ? 845 HOH A O     1 
HETATM 7958 O  O     . HOH Q 6 .   ? 11.771  -4.690  16.692  1.00 39.37  ? 846 HOH A O     1 
HETATM 7959 O  O     . HOH Q 6 .   ? 25.045  -6.061  -3.237  1.00 39.36  ? 847 HOH A O     1 
HETATM 7960 O  O     . HOH Q 6 .   ? 25.574  -27.616 -8.479  1.00 46.14  ? 848 HOH A O     1 
HETATM 7961 O  O     . HOH Q 6 .   ? 10.410  -35.675 -15.637 1.00 41.58  ? 849 HOH A O     1 
HETATM 7962 O  O     . HOH Q 6 .   ? 14.225  -8.201  18.046  1.00 36.21  ? 850 HOH A O     1 
HETATM 7963 O  O     . HOH Q 6 .   ? 28.963  12.538  21.675  1.00 37.07  ? 851 HOH A O     1 
HETATM 7964 O  O     . HOH Q 6 .   ? 0.251   -9.774  0.312   1.00 35.43  ? 852 HOH A O     1 
HETATM 7965 O  O     . HOH Q 6 .   ? 27.243  -6.811  -4.929  1.00 41.46  ? 853 HOH A O     1 
HETATM 7966 O  O     . HOH Q 6 .   ? 14.076  -0.245  10.785  1.00 30.29  ? 854 HOH A O     1 
HETATM 7967 O  O     . HOH Q 6 .   ? 14.641  10.828  -6.701  1.00 31.08  ? 855 HOH A O     1 
HETATM 7968 O  O     . HOH Q 6 .   ? 9.287   -4.600  -9.890  1.00 35.47  ? 856 HOH A O     1 
HETATM 7969 O  O     . HOH Q 6 .   ? 23.073  -23.789 -0.108  1.00 40.27  ? 857 HOH A O     1 
HETATM 7970 O  O     . HOH Q 6 .   ? 20.834  -17.995 3.874   1.00 40.90  ? 858 HOH A O     1 
HETATM 7971 O  O     . HOH Q 6 .   ? 21.194  -18.759 1.847   1.00 38.88  ? 859 HOH A O     1 
HETATM 7972 O  O     . HOH Q 6 .   ? 14.826  9.149   26.844  1.00 41.71  ? 860 HOH A O     1 
HETATM 7973 O  O     . HOH R 6 .   ? 4.019   -23.303 -24.566 1.00 36.81  ? 801 HOH B O     1 
HETATM 7974 O  O     . HOH R 6 .   ? 5.719   14.675  -22.705 1.00 35.46  ? 802 HOH B O     1 
HETATM 7975 O  O     . HOH R 6 .   ? 8.478   -14.853 -40.500 1.00 35.19  ? 803 HOH B O     1 
HETATM 7976 O  O     . HOH R 6 .   ? 11.526  14.947  -19.442 1.00 41.47  ? 804 HOH B O     1 
HETATM 7977 O  O     . HOH R 6 .   ? -18.050 -5.592  -24.388 1.00 36.63  ? 805 HOH B O     1 
HETATM 7978 O  O     . HOH R 6 .   ? 2.948   -26.546 -15.983 1.00 26.90  ? 806 HOH B O     1 
HETATM 7979 O  O     . HOH R 6 .   ? -13.679 -9.482  -26.837 1.00 36.92  ? 807 HOH B O     1 
HETATM 7980 O  O     . HOH R 6 .   ? 0.624   7.172   -30.393 1.00 25.76  ? 808 HOH B O     1 
HETATM 7981 O  O     . HOH R 6 .   ? -17.984 15.659  -22.817 1.00 42.32  ? 809 HOH B O     1 
HETATM 7982 O  O     . HOH R 6 .   ? 2.910   11.341  -19.492 1.00 32.31  ? 810 HOH B O     1 
HETATM 7983 O  O     . HOH R 6 .   ? -12.274 1.240   -26.728 1.00 34.35  ? 811 HOH B O     1 
HETATM 7984 O  O     . HOH R 6 .   ? -9.990  -9.947  -22.451 1.00 32.54  ? 812 HOH B O     1 
HETATM 7985 O  O     . HOH R 6 .   ? 20.863  -6.469  -24.705 1.00 31.31  ? 813 HOH B O     1 
HETATM 7986 O  O     . HOH R 6 .   ? -11.839 -3.619  -7.717  1.00 23.26  ? 814 HOH B O     1 
HETATM 7987 O  O     . HOH R 6 .   ? 9.546   12.356  -17.697 1.00 42.05  ? 815 HOH B O     1 
HETATM 7988 O  O     . HOH R 6 .   ? -1.070  -12.892 -1.628  1.00 34.12  ? 816 HOH B O     1 
HETATM 7989 O  O     . HOH R 6 .   ? 20.587  -9.255  -23.874 1.00 29.48  ? 817 HOH B O     1 
HETATM 7990 O  O     . HOH R 6 .   ? -10.473 -12.249 -24.899 1.00 39.34  ? 818 HOH B O     1 
HETATM 7991 O  O     . HOH R 6 .   ? -16.666 3.365   -9.311  1.00 31.06  ? 819 HOH B O     1 
HETATM 7992 O  O     . HOH R 6 .   ? -15.173 -6.288  -22.901 1.00 38.29  ? 820 HOH B O     1 
HETATM 7993 O  O     . HOH R 6 .   ? -19.414 -15.513 -19.717 1.00 33.71  ? 821 HOH B O     1 
HETATM 7994 O  O     . HOH R 6 .   ? -11.069 -9.176  -24.845 1.00 37.16  ? 822 HOH B O     1 
HETATM 7995 O  O     . HOH R 6 .   ? 12.042  12.266  -20.861 1.00 32.24  ? 823 HOH B O     1 
HETATM 7996 O  O     . HOH R 6 .   ? 5.678   -24.346 -17.678 1.00 33.05  ? 824 HOH B O     1 
HETATM 7997 O  O     . HOH R 6 .   ? -1.971  25.805  -25.872 1.00 36.97  ? 825 HOH B O     1 
HETATM 7998 O  O     . HOH R 6 .   ? -5.904  -32.338 -12.230 1.00 40.81  ? 826 HOH B O     1 
HETATM 7999 O  O     . HOH R 6 .   ? 15.083  8.696   -28.172 1.00 32.31  ? 827 HOH B O     1 
HETATM 8000 O  O     . HOH R 6 .   ? -16.053 -2.513  -23.076 1.00 37.17  ? 828 HOH B O     1 
HETATM 8001 O  O     . HOH R 6 .   ? -13.365 -7.266  -21.384 1.00 35.18  ? 829 HOH B O     1 
HETATM 8002 O  O     . HOH R 6 .   ? 1.068   -27.621 -30.290 1.00 39.84  ? 830 HOH B O     1 
HETATM 8003 O  O     . HOH R 6 .   ? 1.740   -0.276  -7.628  1.00 34.10  ? 831 HOH B O     1 
HETATM 8004 O  O     . HOH R 6 .   ? 5.987   1.034   -13.516 1.00 33.48  ? 832 HOH B O     1 
HETATM 8005 O  O     . HOH R 6 .   ? -19.030 3.786   -26.063 1.00 32.42  ? 833 HOH B O     1 
HETATM 8006 O  O     . HOH R 6 .   ? 2.198   -31.445 -9.715  1.00 36.38  ? 834 HOH B O     1 
HETATM 8007 O  O     . HOH R 6 .   ? -8.637  -1.736  -22.485 1.00 29.41  ? 835 HOH B O     1 
HETATM 8008 O  O     . HOH R 6 .   ? 3.159   -6.304  -19.268 1.00 35.29  ? 836 HOH B O     1 
HETATM 8009 O  O     . HOH R 6 .   ? -18.256 -0.691  -7.296  1.00 28.76  ? 837 HOH B O     1 
HETATM 8010 O  O     . HOH R 6 .   ? -13.806 3.905   -20.975 1.00 27.73  ? 838 HOH B O     1 
HETATM 8011 O  O     . HOH R 6 .   ? 3.633   -26.736 -30.995 1.00 44.29  ? 839 HOH B O     1 
HETATM 8012 O  O     . HOH R 6 .   ? -12.585 -5.016  -4.194  1.00 42.90  ? 840 HOH B O     1 
HETATM 8013 O  O     . HOH R 6 .   ? -4.528  -2.990  -7.471  1.00 32.03  ? 841 HOH B O     1 
HETATM 8014 O  O     . HOH R 6 .   ? -2.838  -10.127 -29.714 1.00 31.52  ? 842 HOH B O     1 
HETATM 8015 O  O     . HOH R 6 .   ? 2.701   -15.019 -6.535  1.00 32.83  ? 843 HOH B O     1 
HETATM 8016 O  O     . HOH R 6 .   ? -13.809 -8.635  -24.011 1.00 43.19  ? 844 HOH B O     1 
HETATM 8017 O  O     . HOH R 6 .   ? -6.516  -16.854 -21.362 1.00 35.25  ? 845 HOH B O     1 
HETATM 8018 O  O     . HOH R 6 .   ? -19.358 7.206   -7.483  1.00 32.50  ? 846 HOH B O     1 
HETATM 8019 O  O     . HOH R 6 .   ? -14.082 -6.525  -25.504 1.00 46.81  ? 847 HOH B O     1 
HETATM 8020 O  O     . HOH R 6 .   ? 15.865  -7.723  -41.829 1.00 34.24  ? 848 HOH B O     1 
HETATM 8021 O  O     . HOH R 6 .   ? -4.481  12.658  -11.345 1.00 33.50  ? 849 HOH B O     1 
HETATM 8022 O  O     . HOH R 6 .   ? -13.928 3.840   -10.659 1.00 29.21  ? 850 HOH B O     1 
HETATM 8023 O  O     . HOH R 6 .   ? -13.202 -10.604 -21.946 1.00 30.35  ? 851 HOH B O     1 
HETATM 8024 O  O     . HOH R 6 .   ? 8.643   -17.139 -30.285 1.00 31.81  ? 852 HOH B O     1 
HETATM 8025 O  O     . HOH R 6 .   ? -1.638  -5.006  -25.070 1.00 35.86  ? 853 HOH B O     1 
HETATM 8026 O  O     . HOH R 6 .   ? -16.480 1.143   -7.286  1.00 32.44  ? 854 HOH B O     1 
HETATM 8027 O  O     . HOH R 6 .   ? 0.950   -3.741  -26.523 1.00 33.41  ? 855 HOH B O     1 
HETATM 8028 O  O     . HOH R 6 .   ? -3.457  -7.551  -16.111 1.00 29.38  ? 856 HOH B O     1 
HETATM 8029 O  O     . HOH R 6 .   ? -10.805 -19.653 -4.494  1.00 39.76  ? 857 HOH B O     1 
HETATM 8030 O  O     . HOH R 6 .   ? -7.894  -3.486  -24.859 1.00 38.78  ? 858 HOH B O     1 
HETATM 8031 O  O     . HOH R 6 .   ? -13.410 -19.136 -8.687  1.00 34.45  ? 859 HOH B O     1 
HETATM 8032 O  O     . HOH R 6 .   ? -13.031 -12.544 -24.370 1.00 40.43  ? 860 HOH B O     1 
HETATM 8033 O  O     . HOH R 6 .   ? -17.453 12.928  -15.699 1.00 37.91  ? 861 HOH B O     1 
HETATM 8034 O  O     . HOH R 6 .   ? -12.625 13.797  -31.879 1.00 34.35  ? 862 HOH B O     1 
HETATM 8035 O  O     . HOH R 6 .   ? 12.786  -6.902  -45.238 1.00 41.79  ? 863 HOH B O     1 
HETATM 8036 O  O     . HOH R 6 .   ? -1.737  -31.714 -13.987 1.00 40.23  ? 864 HOH B O     1 
HETATM 8037 O  O     . HOH R 6 .   ? -10.518 2.859   -25.844 1.00 38.05  ? 865 HOH B O     1 
HETATM 8038 O  O     . HOH R 6 .   ? -2.956  -31.218 -5.534  1.00 41.96  ? 866 HOH B O     1 
HETATM 8039 O  O     . HOH R 6 .   ? -8.919  -2.349  -27.087 1.00 46.81  ? 867 HOH B O     1 
HETATM 8040 O  O     . HOH R 6 .   ? 16.246  3.887   -35.757 1.00 40.21  ? 868 HOH B O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N     . THR A 8   ? 1.1235 1.0681 1.1281 0.0016  0.0598  -0.0109 114 THR A N     
2    C  CA    . THR A 8   ? 1.0620 1.0113 1.0698 0.0033  0.0566  -0.0109 114 THR A CA    
3    C  C     . THR A 8   ? 0.9413 0.8949 0.9501 0.0044  0.0541  -0.0105 114 THR A C     
4    O  O     . THR A 8   ? 0.8644 0.8175 0.8718 0.0040  0.0549  -0.0105 114 THR A O     
5    C  CB    . THR A 8   ? 1.1252 1.0710 1.1297 0.0043  0.0550  -0.0093 114 THR A CB    
6    O  OG1   . THR A 8   ? 1.1576 1.1080 1.1661 0.0055  0.0528  -0.0099 114 THR A OG1   
7    C  CG2   . THR A 8   ? 1.0892 1.0312 1.0876 0.0053  0.0532  -0.0070 114 THR A CG2   
8    N  N     . MET A 9   ? 0.8971 0.8547 0.9083 0.0057  0.0513  -0.0103 115 MET A N     
9    C  CA    . MET A 9   ? 0.8054 0.7673 0.8177 0.0066  0.0488  -0.0101 115 MET A CA    
10   C  C     . MET A 9   ? 0.7055 0.6640 0.7122 0.0072  0.0475  -0.0079 115 MET A C     
11   O  O     . MET A 9   ? 0.7371 0.6908 0.7396 0.0072  0.0478  -0.0066 115 MET A O     
12   C  CB    . MET A 9   ? 0.8193 0.7860 0.8352 0.0076  0.0465  -0.0105 115 MET A CB    
13   C  CG    . MET A 9   ? 0.8781 0.8480 0.8994 0.0071  0.0476  -0.0127 115 MET A CG    
14   S  SD    . MET A 9   ? 0.8451 0.8185 0.8710 0.0061  0.0492  -0.0151 115 MET A SD    
15   C  CE    . MET A 9   ? 0.8640 0.8354 0.8922 0.0046  0.0527  -0.0167 115 MET A CE    
16   N  N     . LYS A 10  ? 0.5926 0.5534 0.5990 0.0075  0.0460  -0.0076 116 LYS A N     
17   C  CA    . LYS A 10  ? 0.5064 0.4650 0.5081 0.0081  0.0441  -0.0056 116 LYS A CA    
18   C  C     . LYS A 10  ? 0.4407 0.4046 0.4448 0.0089  0.0412  -0.0056 116 LYS A C     
19   O  O     . LYS A 10  ? 0.3950 0.3628 0.4028 0.0088  0.0410  -0.0069 116 LYS A O     
20   C  CB    . LYS A 10  ? 0.4999 0.4560 0.4987 0.0075  0.0454  -0.0055 116 LYS A CB    
21   C  CG    . LYS A 10  ? 0.4907 0.4429 0.4836 0.0078  0.0440  -0.0034 116 LYS A CG    
22   C  CD    . LYS A 10  ? 0.4752 0.4243 0.4648 0.0071  0.0456  -0.0033 116 LYS A CD    
23   C  CE    . LYS A 10  ? 0.4562 0.4009 0.4397 0.0074  0.0442  -0.0011 116 LYS A CE    
24   N  NZ    . LYS A 10  ? 0.4606 0.4014 0.4399 0.0068  0.0457  -0.0008 116 LYS A NZ    
25   N  N     . VAL A 11  ? 0.4146 0.3782 0.4163 0.0097  0.0389  -0.0041 117 VAL A N     
26   C  CA    . VAL A 11  ? 0.3905 0.3589 0.3943 0.0103  0.0363  -0.0040 117 VAL A CA    
27   C  C     . VAL A 11  ? 0.3744 0.3425 0.3748 0.0103  0.0345  -0.0027 117 VAL A C     
28   O  O     . VAL A 11  ? 0.3431 0.3072 0.3390 0.0104  0.0341  -0.0011 117 VAL A O     
29   C  CB    . VAL A 11  ? 0.3783 0.3474 0.3825 0.0113  0.0349  -0.0034 117 VAL A CB    
30   C  CG1   . VAL A 11  ? 0.3783 0.3526 0.3846 0.0117  0.0324  -0.0034 117 VAL A CG1   
31   C  CG2   . VAL A 11  ? 0.3713 0.3408 0.3788 0.0113  0.0365  -0.0048 117 VAL A CG2   
32   N  N     . ILE A 12  ? 0.3448 0.3167 0.3472 0.0101  0.0334  -0.0033 118 ILE A N     
33   C  CA    . ILE A 12  ? 0.3461 0.3181 0.3456 0.0100  0.0315  -0.0022 118 ILE A CA    
34   C  C     . ILE A 12  ? 0.3381 0.3148 0.3395 0.0101  0.0291  -0.0022 118 ILE A C     
35   O  O     . ILE A 12  ? 0.3276 0.3078 0.3329 0.0102  0.0291  -0.0035 118 ILE A O     
36   C  CB    . ILE A 12  ? 0.3440 0.3146 0.3426 0.0095  0.0326  -0.0029 118 ILE A CB    
37   C  CG1   . ILE A 12  ? 0.3520 0.3212 0.3464 0.0093  0.0309  -0.0015 118 ILE A CG1   
38   C  CG2   . ILE A 12  ? 0.3438 0.3183 0.3469 0.0094  0.0329  -0.0047 118 ILE A CG2   
39   C  CD1   . ILE A 12  ? 0.3818 0.3481 0.3742 0.0090  0.0324  -0.0019 118 ILE A CD1   
40   N  N     . ASN A 13  ? 0.3253 0.3020 0.3237 0.0101  0.0270  -0.0008 119 ASN A N     
41   C  CA    . ASN A 13  ? 0.3224 0.3034 0.3223 0.0100  0.0249  -0.0007 119 ASN A CA    
42   C  C     . ASN A 13  ? 0.3184 0.3003 0.3168 0.0092  0.0237  -0.0006 119 ASN A C     
43   O  O     . ASN A 13  ? 0.3163 0.2956 0.3106 0.0088  0.0228  0.0005  119 ASN A O     
44   C  CB    . ASN A 13  ? 0.3256 0.3065 0.3236 0.0103  0.0233  0.0006  119 ASN A CB    
45   C  CG    . ASN A 13  ? 0.3235 0.3095 0.3234 0.0101  0.0213  0.0005  119 ASN A CG    
46   O  OD1   . ASN A 13  ? 0.2842 0.2732 0.2859 0.0096  0.0210  -0.0002 119 ASN A OD1   
47   N  ND2   . ASN A 13  ? 0.3371 0.3238 0.3361 0.0105  0.0199  0.0014  119 ASN A ND2   
48   N  N     . ASP A 14  ? 0.3135 0.2987 0.3148 0.0090  0.0234  -0.0018 120 ASP A N     
49   C  CA    . ASP A 14  ? 0.3155 0.3015 0.3155 0.0084  0.0222  -0.0020 120 ASP A CA    
50   C  C     . ASP A 14  ? 0.3004 0.2903 0.3012 0.0079  0.0203  -0.0018 120 ASP A C     
51   O  O     . ASP A 14  ? 0.3049 0.2979 0.3090 0.0082  0.0205  -0.0025 120 ASP A O     
52   C  CB    . ASP A 14  ? 0.3476 0.3342 0.3503 0.0086  0.0233  -0.0037 120 ASP A CB    
53   C  CG    . ASP A 14  ? 0.4024 0.3904 0.4044 0.0081  0.0217  -0.0041 120 ASP A CG    
54   O  OD1   . ASP A 14  ? 0.4761 0.4627 0.4744 0.0075  0.0203  -0.0030 120 ASP A OD1   
55   O  OD2   . ASP A 14  ? 0.3650 0.3553 0.3699 0.0083  0.0216  -0.0055 120 ASP A OD2   
56   N  N     . PRO A 15  ? 0.2726 0.2625 0.2704 0.0070  0.0186  -0.0009 121 PRO A N     
57   C  CA    . PRO A 15  ? 0.2639 0.2577 0.2625 0.0063  0.0170  -0.0008 121 PRO A CA    
58   C  C     . PRO A 15  ? 0.2814 0.2781 0.2825 0.0060  0.0168  -0.0022 121 PRO A C     
59   O  O     . PRO A 15  ? 0.3042 0.3043 0.3071 0.0057  0.0163  -0.0024 121 PRO A O     
60   C  CB    . PRO A 15  ? 0.2593 0.2516 0.2534 0.0052  0.0153  0.0004  121 PRO A CB    
61   C  CG    . PRO A 15  ? 0.2595 0.2476 0.2511 0.0054  0.0159  0.0005  121 PRO A CG    
62   C  CD    . PRO A 15  ? 0.2658 0.2521 0.2590 0.0065  0.0179  0.0002  121 PRO A CD    
63   N  N     . ILE A 16  ? 0.2841 0.2797 0.2858 0.0063  0.0174  -0.0032 122 ILE A N     
64   C  CA    . ILE A 16  ? 0.2729 0.2711 0.2769 0.0062  0.0170  -0.0046 122 ILE A CA    
65   C  C     . ILE A 16  ? 0.2811 0.2812 0.2895 0.0071  0.0185  -0.0058 122 ILE A C     
66   O  O     . ILE A 16  ? 0.2918 0.2950 0.3023 0.0069  0.0182  -0.0064 122 ILE A O     
67   C  CB    . ILE A 16  ? 0.2603 0.2564 0.2631 0.0063  0.0168  -0.0054 122 ILE A CB    
68   C  CG1   . ILE A 16  ? 0.2588 0.2520 0.2566 0.0056  0.0154  -0.0041 122 ILE A CG1   
69   C  CG2   . ILE A 16  ? 0.2517 0.2500 0.2563 0.0062  0.0160  -0.0067 122 ILE A CG2   
70   C  CD1   . ILE A 16  ? 0.2617 0.2563 0.2570 0.0042  0.0137  -0.0031 122 ILE A CD1   
71   N  N     . HIS A 17  ? 0.2635 0.2616 0.2734 0.0079  0.0203  -0.0062 123 HIS A N     
72   C  CA    . HIS A 17  ? 0.2575 0.2569 0.2714 0.0086  0.0217  -0.0076 123 HIS A CA    
73   C  C     . HIS A 17  ? 0.2730 0.2724 0.2880 0.0091  0.0227  -0.0071 123 HIS A C     
74   O  O     . HIS A 17  ? 0.2946 0.2951 0.3129 0.0097  0.0238  -0.0081 123 HIS A O     
75   C  CB    . HIS A 17  ? 0.2473 0.2449 0.2626 0.0091  0.0231  -0.0087 123 HIS A CB    
76   C  CG    . HIS A 17  ? 0.2453 0.2430 0.2599 0.0089  0.0220  -0.0094 123 HIS A CG    
77   N  ND1   . HIS A 17  ? 0.2550 0.2552 0.2707 0.0087  0.0207  -0.0103 123 HIS A ND1   
78   C  CD2   . HIS A 17  ? 0.2573 0.2525 0.2698 0.0090  0.0219  -0.0094 123 HIS A CD2   
79   C  CE1   . HIS A 17  ? 0.2668 0.2660 0.2812 0.0088  0.0197  -0.0108 123 HIS A CE1   
80   N  NE2   . HIS A 17  ? 0.2506 0.2468 0.2632 0.0090  0.0204  -0.0104 123 HIS A NE2   
81   N  N     . GLY A 18  ? 0.2866 0.2847 0.2989 0.0090  0.0221  -0.0055 124 GLY A N     
82   C  CA    . GLY A 18  ? 0.2970 0.2946 0.3097 0.0097  0.0227  -0.0049 124 GLY A CA    
83   C  C     . GLY A 18  ? 0.3065 0.3000 0.3186 0.0102  0.0245  -0.0048 124 GLY A C     
84   O  O     . GLY A 18  ? 0.3302 0.3210 0.3405 0.0099  0.0252  -0.0047 124 GLY A O     
85   N  N     . HIS A 19  ? 0.3112 0.3042 0.3245 0.0109  0.0253  -0.0048 125 HIS A N     
86   C  CA    . HIS A 19  ? 0.3250 0.3138 0.3375 0.0113  0.0273  -0.0048 125 HIS A CA    
87   C  C     . HIS A 19  ? 0.3340 0.3229 0.3495 0.0110  0.0291  -0.0064 125 HIS A C     
88   O  O     . HIS A 19  ? 0.3564 0.3479 0.3753 0.0113  0.0294  -0.0077 125 HIS A O     
89   C  CB    . HIS A 19  ? 0.3121 0.3001 0.3247 0.0121  0.0274  -0.0043 125 HIS A CB    
90   C  CG    . HIS A 19  ? 0.3140 0.3009 0.3234 0.0124  0.0257  -0.0027 125 HIS A CG    
91   N  ND1   . HIS A 19  ? 0.3065 0.2972 0.3161 0.0123  0.0237  -0.0023 125 HIS A ND1   
92   C  CD2   . HIS A 19  ? 0.3144 0.2970 0.3201 0.0127  0.0258  -0.0014 125 HIS A CD2   
93   C  CE1   . HIS A 19  ? 0.3066 0.2956 0.3132 0.0125  0.0225  -0.0009 125 HIS A CE1   
94   N  NE2   . HIS A 19  ? 0.3101 0.2940 0.3141 0.0129  0.0236  -0.0003 125 HIS A NE2   
95   N  N     . ILE A 20  ? 0.3440 0.3304 0.3582 0.0106  0.0303  -0.0066 126 ILE A N     
96   C  CA    . ILE A 20  ? 0.3784 0.3651 0.3956 0.0104  0.0320  -0.0083 126 ILE A CA    
97   C  C     . ILE A 20  ? 0.3738 0.3565 0.3901 0.0101  0.0345  -0.0084 126 ILE A C     
98   O  O     . ILE A 20  ? 0.3785 0.3575 0.3909 0.0101  0.0348  -0.0070 126 ILE A O     
99   C  CB    . ILE A 20  ? 0.4018 0.3904 0.4197 0.0101  0.0312  -0.0091 126 ILE A CB    
100  C  CG1   . ILE A 20  ? 0.4273 0.4128 0.4414 0.0098  0.0313  -0.0081 126 ILE A CG1   
101  C  CG2   . ILE A 20  ? 0.4118 0.4040 0.4304 0.0102  0.0290  -0.0090 126 ILE A CG2   
102  C  CD1   . ILE A 20  ? 0.4154 0.4024 0.4294 0.0097  0.0300  -0.0087 126 ILE A CD1   
103  N  N     . GLU A 21  ? 0.3863 0.3697 0.4061 0.0099  0.0362  -0.0100 127 GLU A N     
104  C  CA    . GLU A 21  ? 0.4163 0.3960 0.4358 0.0094  0.0389  -0.0104 127 GLU A CA    
105  C  C     . GLU A 21  ? 0.4044 0.3837 0.4244 0.0088  0.0403  -0.0114 127 GLU A C     
106  O  O     . GLU A 21  ? 0.3766 0.3592 0.3996 0.0089  0.0397  -0.0127 127 GLU A O     
107  C  CB    . GLU A 21  ? 0.4259 0.4066 0.4489 0.0093  0.0401  -0.0117 127 GLU A CB    
108  C  CG    . GLU A 21  ? 0.4741 0.4537 0.4956 0.0100  0.0392  -0.0106 127 GLU A CG    
109  C  CD    . GLU A 21  ? 0.5578 0.5378 0.5821 0.0100  0.0402  -0.0117 127 GLU A CD    
110  O  OE1   . GLU A 21  ? 0.6722 0.6535 0.7000 0.0094  0.0416  -0.0134 127 GLU A OE1   
111  O  OE2   . GLU A 21  ? 0.6521 0.6312 0.6754 0.0108  0.0394  -0.0109 127 GLU A OE2   
112  N  N     . LEU A 22  ? 0.3980 0.3731 0.4148 0.0084  0.0420  -0.0107 128 LEU A N     
113  C  CA    . LEU A 22  ? 0.3925 0.3669 0.4097 0.0079  0.0438  -0.0118 128 LEU A CA    
114  C  C     . LEU A 22  ? 0.3867 0.3588 0.4051 0.0069  0.0471  -0.0129 128 LEU A C     
115  O  O     . LEU A 22  ? 0.3812 0.3488 0.3959 0.0064  0.0484  -0.0117 128 LEU A O     
116  C  CB    . LEU A 22  ? 0.4010 0.3722 0.4132 0.0079  0.0434  -0.0103 128 LEU A CB    
117  C  CG    . LEU A 22  ? 0.4169 0.3900 0.4275 0.0086  0.0403  -0.0093 128 LEU A CG    
118  C  CD1   . LEU A 22  ? 0.4236 0.3926 0.4286 0.0085  0.0401  -0.0076 128 LEU A CD1   
119  C  CD2   . LEU A 22  ? 0.3986 0.3754 0.4122 0.0089  0.0394  -0.0108 128 LEU A CD2   
120  N  N     . HIS A 23  ? 0.3589 0.3341 0.3821 0.0065  0.0482  -0.0151 129 HIS A N     
121  C  CA    . HIS A 23  ? 0.4113 0.3849 0.4362 0.0053  0.0515  -0.0164 129 HIS A CA    
122  C  C     . HIS A 23  ? 0.4279 0.3974 0.4489 0.0047  0.0537  -0.0159 129 HIS A C     
123  O  O     . HIS A 23  ? 0.4250 0.3945 0.4441 0.0052  0.0527  -0.0154 129 HIS A O     
124  C  CB    . HIS A 23  ? 0.4171 0.3954 0.4483 0.0051  0.0521  -0.0190 129 HIS A CB    
125  C  CG    . HIS A 23  ? 0.4441 0.4217 0.4779 0.0037  0.0554  -0.0207 129 HIS A CG    
126  N  ND1   . HIS A 23  ? 0.4634 0.4393 0.4968 0.0028  0.0581  -0.0215 129 HIS A ND1   
127  C  CD2   . HIS A 23  ? 0.4257 0.4042 0.4628 0.0030  0.0564  -0.0219 129 HIS A CD2   
128  C  CE1   . HIS A 23  ? 0.4608 0.4368 0.4972 0.0014  0.0608  -0.0231 129 HIS A CE1   
129  N  NE2   . HIS A 23  ? 0.4393 0.4169 0.4781 0.0015  0.0597  -0.0234 129 HIS A NE2   
130  N  N     . PRO A 24  ? 0.4526 0.4181 0.4720 0.0034  0.0566  -0.0159 130 PRO A N     
131  C  CA    . PRO A 24  ? 0.4441 0.4050 0.4588 0.0028  0.0584  -0.0150 130 PRO A CA    
132  C  C     . PRO A 24  ? 0.4387 0.4016 0.4554 0.0026  0.0598  -0.0167 130 PRO A C     
133  O  O     . PRO A 24  ? 0.4401 0.4001 0.4528 0.0026  0.0603  -0.0158 130 PRO A O     
134  C  CB    . PRO A 24  ? 0.4577 0.4143 0.4707 0.0013  0.0614  -0.0150 130 PRO A CB    
135  C  CG    . PRO A 24  ? 0.4705 0.4291 0.4869 0.0013  0.0608  -0.0156 130 PRO A CG    
136  C  CD    . PRO A 24  ? 0.4730 0.4368 0.4927 0.0028  0.0575  -0.0158 130 PRO A CD    
137  N  N     . LEU A 25  ? 0.4516 0.4192 0.4744 0.0024  0.0605  -0.0191 131 LEU A N     
138  C  CA    . LEU A 25  ? 0.4440 0.4142 0.4694 0.0027  0.0612  -0.0208 131 LEU A CA    
139  C  C     . LEU A 25  ? 0.4285 0.4000 0.4522 0.0043  0.0579  -0.0199 131 LEU A C     
140  O  O     . LEU A 25  ? 0.4517 0.4224 0.4737 0.0046  0.0584  -0.0202 131 LEU A O     
141  C  CB    . LEU A 25  ? 0.4359 0.4112 0.4685 0.0024  0.0620  -0.0237 131 LEU A CB    
142  C  CG    . LEU A 25  ? 0.4469 0.4257 0.4831 0.0029  0.0625  -0.0259 131 LEU A CG    
143  C  CD1   . LEU A 25  ? 0.4721 0.4480 0.5062 0.0019  0.0659  -0.0264 131 LEU A CD1   
144  C  CD2   . LEU A 25  ? 0.4583 0.4422 0.5018 0.0026  0.0629  -0.0286 131 LEU A CD2   
145  N  N     . LEU A 26  ? 0.3973 0.3705 0.4210 0.0052  0.0548  -0.0189 132 LEU A N     
146  C  CA    . LEU A 26  ? 0.4052 0.3790 0.4265 0.0065  0.0518  -0.0178 132 LEU A CA    
147  C  C     . LEU A 26  ? 0.3889 0.3577 0.4035 0.0064  0.0516  -0.0155 132 LEU A C     
148  O  O     . LEU A 26  ? 0.4014 0.3693 0.4135 0.0070  0.0509  -0.0152 132 LEU A O     
149  C  CB    . LEU A 26  ? 0.4044 0.3813 0.4273 0.0072  0.0487  -0.0173 132 LEU A CB    
150  C  CG    . LEU A 26  ? 0.4299 0.4115 0.4592 0.0073  0.0484  -0.0194 132 LEU A CG    
151  C  CD1   . LEU A 26  ? 0.4446 0.4288 0.4748 0.0079  0.0455  -0.0188 132 LEU A CD1   
152  C  CD2   . LEU A 26  ? 0.4284 0.4131 0.4613 0.0078  0.0484  -0.0216 132 LEU A CD2   
153  N  N     . VAL A 27  ? 0.3920 0.3571 0.4034 0.0057  0.0525  -0.0140 133 VAL A N     
154  C  CA    . VAL A 27  ? 0.3993 0.3592 0.4040 0.0056  0.0524  -0.0118 133 VAL A CA    
155  C  C     . VAL A 27  ? 0.4234 0.3803 0.4256 0.0051  0.0549  -0.0122 133 VAL A C     
156  O  O     . VAL A 27  ? 0.4280 0.3824 0.4257 0.0055  0.0539  -0.0111 133 VAL A O     
157  C  CB    . VAL A 27  ? 0.3895 0.3456 0.3913 0.0051  0.0530  -0.0103 133 VAL A CB    
158  C  CG1   . VAL A 27  ? 0.3900 0.3406 0.3846 0.0051  0.0525  -0.0080 133 VAL A CG1   
159  C  CG2   . VAL A 27  ? 0.3829 0.3415 0.3864 0.0058  0.0505  -0.0096 133 VAL A CG2   
160  N  N     . ARG A 28  ? 0.4486 0.4057 0.4536 0.0041  0.0582  -0.0141 134 ARG A N     
161  C  CA    . ARG A 28  ? 0.4825 0.4379 0.4864 0.0035  0.0609  -0.0151 134 ARG A CA    
162  C  C     . ARG A 28  ? 0.4547 0.4125 0.4596 0.0047  0.0595  -0.0160 134 ARG A C     
163  O  O     . ARG A 28  ? 0.4897 0.4444 0.4903 0.0048  0.0599  -0.0153 134 ARG A O     
164  C  CB    . ARG A 28  ? 0.5346 0.4914 0.5430 0.0022  0.0646  -0.0175 134 ARG A CB    
165  C  CG    . ARG A 28  ? 0.5885 0.5408 0.5942 0.0006  0.0670  -0.0167 134 ARG A CG    
166  C  CD    . ARG A 28  ? 0.5926 0.5380 0.5907 0.0000  0.0684  -0.0148 134 ARG A CD    
167  N  NE    . ARG A 28  ? 0.6399 0.5847 0.6374 -0.0003 0.0708  -0.0160 134 ARG A NE    
168  C  CZ    . ARG A 28  ? 0.7226 0.6663 0.7210 -0.0019 0.0749  -0.0177 134 ARG A CZ    
169  N  NH1   . ARG A 28  ? 0.7133 0.6559 0.7130 -0.0035 0.0771  -0.0181 134 ARG A NH1   
170  N  NH2   . ARG A 28  ? 0.7477 0.6915 0.7458 -0.0020 0.0767  -0.0189 134 ARG A NH2   
171  N  N     . ILE A 29  ? 0.4291 0.3922 0.4393 0.0056  0.0577  -0.0174 135 ILE A N     
172  C  CA    . ILE A 29  ? 0.4274 0.3929 0.4386 0.0069  0.0559  -0.0183 135 ILE A CA    
173  C  C     . ILE A 29  ? 0.4444 0.4075 0.4500 0.0077  0.0527  -0.0159 135 ILE A C     
174  O  O     . ILE A 29  ? 0.4365 0.3983 0.4396 0.0084  0.0522  -0.0160 135 ILE A O     
175  C  CB    . ILE A 29  ? 0.4257 0.3972 0.4436 0.0076  0.0544  -0.0203 135 ILE A CB    
176  C  CG1   . ILE A 29  ? 0.4324 0.4064 0.4559 0.0069  0.0576  -0.0230 135 ILE A CG1   
177  C  CG2   . ILE A 29  ? 0.4059 0.3793 0.4240 0.0092  0.0516  -0.0208 135 ILE A CG2   
178  C  CD1   . ILE A 29  ? 0.4258 0.4055 0.4562 0.0074  0.0564  -0.0251 135 ILE A CD1   
179  N  N     . ILE A 30  ? 0.4257 0.3882 0.4295 0.0076  0.0507  -0.0140 136 ILE A N     
180  C  CA    . ILE A 30  ? 0.4138 0.3745 0.4128 0.0082  0.0478  -0.0118 136 ILE A CA    
181  C  C     . ILE A 30  ? 0.4161 0.3711 0.4086 0.0078  0.0487  -0.0103 136 ILE A C     
182  O  O     . ILE A 30  ? 0.3989 0.3523 0.3876 0.0083  0.0468  -0.0092 136 ILE A O     
183  C  CB    . ILE A 30  ? 0.3942 0.3557 0.3930 0.0081  0.0457  -0.0103 136 ILE A CB    
184  C  CG1   . ILE A 30  ? 0.3985 0.3652 0.4024 0.0087  0.0439  -0.0115 136 ILE A CG1   
185  C  CG2   . ILE A 30  ? 0.3837 0.3424 0.3769 0.0083  0.0433  -0.0079 136 ILE A CG2   
186  C  CD1   . ILE A 30  ? 0.3876 0.3563 0.3931 0.0086  0.0425  -0.0108 136 ILE A CD1   
187  N  N     . ASN A 31  ? 0.4309 0.3826 0.4217 0.0068  0.0515  -0.0100 137 ASN A N     
188  C  CA    . ASN A 31  ? 0.4561 0.4019 0.4401 0.0064  0.0523  -0.0083 137 ASN A CA    
189  C  C     . ASN A 31  ? 0.4712 0.4151 0.4540 0.0062  0.0549  -0.0097 137 ASN A C     
190  O  O     . ASN A 31  ? 0.4797 0.4197 0.4597 0.0052  0.0578  -0.0096 137 ASN A O     
191  C  CB    . ASN A 31  ? 0.4456 0.3878 0.4269 0.0055  0.0534  -0.0070 137 ASN A CB    
192  C  CG    . ASN A 31  ? 0.4529 0.3959 0.4334 0.0060  0.0502  -0.0052 137 ASN A CG    
193  O  OD1   . ASN A 31  ? 0.4484 0.3923 0.4273 0.0067  0.0472  -0.0042 137 ASN A OD1   
194  N  ND2   . ASN A 31  ? 0.4096 0.3524 0.3913 0.0057  0.0507  -0.0049 137 ASN A ND2   
195  N  N     . THR A 32  ? 0.4703 0.4172 0.4553 0.0072  0.0538  -0.0109 138 THR A N     
196  C  CA    . THR A 32  ? 0.4703 0.4159 0.4543 0.0074  0.0556  -0.0123 138 THR A CA    
197  C  C     . THR A 32  ? 0.4905 0.4347 0.4704 0.0085  0.0527  -0.0112 138 THR A C     
198  O  O     . THR A 32  ? 0.4473 0.3933 0.4274 0.0090  0.0493  -0.0102 138 THR A O     
199  C  CB    . THR A 32  ? 0.4667 0.4175 0.4578 0.0079  0.0570  -0.0153 138 THR A CB    
200  O  OG1   . THR A 32  ? 0.4302 0.3855 0.4250 0.0090  0.0538  -0.0158 138 THR A OG1   
201  C  CG2   . THR A 32  ? 0.4797 0.4318 0.4748 0.0067  0.0599  -0.0164 138 THR A CG2   
202  N  N     . PRO A 33  ? 0.5180 0.4590 0.4943 0.0087  0.0540  -0.0115 139 PRO A N     
203  C  CA    . PRO A 33  ? 0.4968 0.4364 0.4695 0.0097  0.0513  -0.0108 139 PRO A CA    
204  C  C     . PRO A 33  ? 0.4596 0.4041 0.4370 0.0110  0.0491  -0.0124 139 PRO A C     
205  O  O     . PRO A 33  ? 0.4431 0.3871 0.4180 0.0117  0.0459  -0.0114 139 PRO A O     
206  C  CB    . PRO A 33  ? 0.5017 0.4374 0.4705 0.0097  0.0538  -0.0115 139 PRO A CB    
207  C  CG    . PRO A 33  ? 0.5240 0.4580 0.4931 0.0084  0.0577  -0.0119 139 PRO A CG    
208  C  CD    . PRO A 33  ? 0.5250 0.4637 0.5007 0.0080  0.0582  -0.0129 139 PRO A CD    
209  N  N     . GLN A 34  ? 0.4407 0.3896 0.4247 0.0113  0.0507  -0.0149 140 GLN A N     
210  C  CA    . GLN A 34  ? 0.4524 0.4057 0.4409 0.0127  0.0486  -0.0166 140 GLN A CA    
211  C  C     . GLN A 34  ? 0.4516 0.4075 0.4414 0.0127  0.0451  -0.0154 140 GLN A C     
212  O  O     . GLN A 34  ? 0.4426 0.3997 0.4322 0.0137  0.0420  -0.0155 140 GLN A O     
213  C  CB    . GLN A 34  ? 0.4584 0.4160 0.4540 0.0129  0.0512  -0.0197 140 GLN A CB    
214  C  CG    . GLN A 34  ? 0.4819 0.4379 0.4770 0.0132  0.0543  -0.0214 140 GLN A CG    
215  C  CD    . GLN A 34  ? 0.4954 0.4473 0.4868 0.0116  0.0578  -0.0205 140 GLN A CD    
216  O  OE1   . GLN A 34  ? 0.4976 0.4492 0.4897 0.0102  0.0592  -0.0198 140 GLN A OE1   
217  N  NE2   . GLN A 34  ? 0.5519 0.5000 0.5389 0.0119  0.0591  -0.0205 140 GLN A NE2   
218  N  N     . PHE A 35  ? 0.4276 0.3839 0.4183 0.0116  0.0457  -0.0143 141 PHE A N     
219  C  CA    . PHE A 35  ? 0.4030 0.3617 0.3950 0.0115  0.0430  -0.0133 141 PHE A CA    
220  C  C     . PHE A 35  ? 0.3838 0.3395 0.3699 0.0112  0.0405  -0.0106 141 PHE A C     
221  O  O     . PHE A 35  ? 0.3881 0.3452 0.3737 0.0116  0.0374  -0.0100 141 PHE A O     
222  C  CB    . PHE A 35  ? 0.3958 0.3567 0.3917 0.0106  0.0445  -0.0135 141 PHE A CB    
223  C  CG    . PHE A 35  ? 0.3817 0.3462 0.3802 0.0108  0.0418  -0.0131 141 PHE A CG    
224  C  CD1   . PHE A 35  ? 0.4080 0.3771 0.4121 0.0115  0.0410  -0.0152 141 PHE A CD1   
225  C  CD2   . PHE A 35  ? 0.3750 0.3384 0.3704 0.0104  0.0398  -0.0109 141 PHE A CD2   
226  C  CE1   . PHE A 35  ? 0.3860 0.3579 0.3918 0.0117  0.0384  -0.0148 141 PHE A CE1   
227  C  CE2   . PHE A 35  ? 0.3730 0.3397 0.3706 0.0105  0.0374  -0.0107 141 PHE A CE2   
228  C  CZ    . PHE A 35  ? 0.3744 0.3452 0.3769 0.0111  0.0368  -0.0126 141 PHE A CZ    
229  N  N     . GLN A 36  ? 0.3710 0.3222 0.3522 0.0105  0.0418  -0.0091 142 GLN A N     
230  C  CA    . GLN A 36  ? 0.3697 0.3179 0.3453 0.0101  0.0395  -0.0066 142 GLN A CA    
231  C  C     . GLN A 36  ? 0.3734 0.3201 0.3452 0.0107  0.0370  -0.0061 142 GLN A C     
232  O  O     . GLN A 36  ? 0.3648 0.3102 0.3329 0.0103  0.0344  -0.0042 142 GLN A O     
233  C  CB    . GLN A 36  ? 0.3603 0.3035 0.3312 0.0093  0.0414  -0.0052 142 GLN A CB    
234  C  CG    . GLN A 36  ? 0.3563 0.2998 0.3292 0.0086  0.0433  -0.0050 142 GLN A CG    
235  C  CD    . GLN A 36  ? 0.3441 0.2895 0.3179 0.0084  0.0410  -0.0036 142 GLN A CD    
236  O  OE1   . GLN A 36  ? 0.3483 0.2922 0.3183 0.0083  0.0386  -0.0018 142 GLN A OE1   
237  N  NE2   . GLN A 36  ? 0.3032 0.2520 0.2821 0.0083  0.0418  -0.0046 142 GLN A NE2   
238  N  N     . ARG A 37  ? 0.3731 0.3199 0.3460 0.0115  0.0378  -0.0079 143 ARG A N     
239  C  CA    . ARG A 37  ? 0.3792 0.3247 0.3491 0.0124  0.0354  -0.0079 143 ARG A CA    
240  C  C     . ARG A 37  ? 0.3640 0.3120 0.3345 0.0124  0.0320  -0.0073 143 ARG A C     
241  O  O     . ARG A 37  ? 0.3603 0.3063 0.3264 0.0124  0.0295  -0.0061 143 ARG A O     
242  C  CB    . ARG A 37  ? 0.4037 0.3509 0.3772 0.0136  0.0370  -0.0106 143 ARG A CB    
243  C  CG    . ARG A 37  ? 0.4165 0.3637 0.3891 0.0149  0.0346  -0.0115 143 ARG A CG    
244  C  CD    . ARG A 37  ? 0.4413 0.3902 0.4178 0.0162  0.0365  -0.0144 143 ARG A CD    
245  N  NE    . ARG A 37  ? 0.4746 0.4226 0.4493 0.0176  0.0339  -0.0151 143 ARG A NE    
246  C  CZ    . ARG A 37  ? 0.4790 0.4300 0.4566 0.0185  0.0315  -0.0160 143 ARG A CZ    
247  N  NH1   . ARG A 37  ? 0.4973 0.4527 0.4803 0.0183  0.0313  -0.0167 143 ARG A NH1   
248  N  NH2   . ARG A 37  ? 0.4969 0.4459 0.4715 0.0197  0.0291  -0.0163 143 ARG A NH2   
249  N  N     . LEU A 38  ? 0.3445 0.2970 0.3204 0.0123  0.0319  -0.0081 144 LEU A N     
250  C  CA    . LEU A 38  ? 0.3414 0.2966 0.3183 0.0123  0.0289  -0.0077 144 LEU A CA    
251  C  C     . LEU A 38  ? 0.3362 0.2903 0.3094 0.0112  0.0270  -0.0053 144 LEU A C     
252  O  O     . LEU A 38  ? 0.3266 0.2822 0.2995 0.0109  0.0245  -0.0048 144 LEU A O     
253  C  CB    . LEU A 38  ? 0.3348 0.2947 0.3181 0.0125  0.0294  -0.0092 144 LEU A CB    
254  C  CG    . LEU A 38  ? 0.3319 0.2938 0.3196 0.0137  0.0307  -0.0119 144 LEU A CG    
255  C  CD1   . LEU A 38  ? 0.3180 0.2846 0.3120 0.0137  0.0311  -0.0132 144 LEU A CD1   
256  C  CD2   . LEU A 38  ? 0.3291 0.2903 0.3153 0.0149  0.0287  -0.0128 144 LEU A CD2   
257  N  N     . ARG A 39  ? 0.3301 0.2813 0.3002 0.0105  0.0281  -0.0038 145 ARG A N     
258  C  CA    . ARG A 39  ? 0.3501 0.2999 0.3162 0.0095  0.0260  -0.0015 145 ARG A CA    
259  C  C     . ARG A 39  ? 0.3590 0.3061 0.3199 0.0094  0.0237  -0.0007 145 ARG A C     
260  O  O     . ARG A 39  ? 0.3481 0.2947 0.3060 0.0085  0.0215  0.0009  145 ARG A O     
261  C  CB    . ARG A 39  ? 0.3827 0.3296 0.3462 0.0090  0.0275  -0.0002 145 ARG A CB    
262  C  CG    . ARG A 39  ? 0.3806 0.3301 0.3483 0.0088  0.0288  -0.0003 145 ARG A CG    
263  C  CD    . ARG A 39  ? 0.3946 0.3402 0.3591 0.0084  0.0304  0.0008  145 ARG A CD    
264  N  NE    . ARG A 39  ? 0.4079 0.3551 0.3758 0.0083  0.0319  0.0006  145 ARG A NE    
265  C  CZ    . ARG A 39  ? 0.3817 0.3312 0.3510 0.0081  0.0305  0.0015  145 ARG A CZ    
266  N  NH1   . ARG A 39  ? 0.3963 0.3472 0.3643 0.0079  0.0276  0.0026  145 ARG A NH1   
267  N  NH2   . ARG A 39  ? 0.3602 0.3104 0.3321 0.0082  0.0320  0.0012  145 ARG A NH2   
268  N  N     . TYR A 40  ? 0.3775 0.3226 0.3373 0.0102  0.0242  -0.0019 146 TYR A N     
269  C  CA    . TYR A 40  ? 0.3830 0.3240 0.3368 0.0102  0.0224  -0.0010 146 TYR A CA    
270  C  C     . TYR A 40  ? 0.3871 0.3289 0.3413 0.0110  0.0206  -0.0022 146 TYR A C     
271  O  O     . TYR A 40  ? 0.3685 0.3068 0.3184 0.0114  0.0196  -0.0022 146 TYR A O     
272  C  CB    . TYR A 40  ? 0.3956 0.3322 0.3461 0.0106  0.0246  -0.0011 146 TYR A CB    
273  C  CG    . TYR A 40  ? 0.4166 0.3521 0.3668 0.0099  0.0266  -0.0001 146 TYR A CG    
274  C  CD1   . TYR A 40  ? 0.4045 0.3385 0.3511 0.0088  0.0251  0.0019  146 TYR A CD1   
275  C  CD2   . TYR A 40  ? 0.4427 0.3788 0.3962 0.0103  0.0300  -0.0014 146 TYR A CD2   
276  C  CE1   . TYR A 40  ? 0.4100 0.3426 0.3559 0.0084  0.0266  0.0029  146 TYR A CE1   
277  C  CE2   . TYR A 40  ? 0.4248 0.3594 0.3775 0.0096  0.0317  -0.0004 146 TYR A CE2   
278  C  CZ    . TYR A 40  ? 0.4267 0.3594 0.3755 0.0087  0.0298  0.0017  146 TYR A CZ    
279  O  OH    . TYR A 40  ? 0.4567 0.3877 0.4043 0.0082  0.0310  0.0028  146 TYR A OH    
280  N  N     . ILE A 41  ? 0.3839 0.3300 0.3429 0.0112  0.0200  -0.0033 147 ILE A N     
281  C  CA    . ILE A 41  ? 0.3621 0.3090 0.3214 0.0119  0.0179  -0.0043 147 ILE A CA    
282  C  C     . ILE A 41  ? 0.3605 0.3107 0.3213 0.0109  0.0158  -0.0036 147 ILE A C     
283  O  O     . ILE A 41  ? 0.3143 0.2684 0.2800 0.0108  0.0167  -0.0043 147 ILE A O     
284  C  CB    . ILE A 41  ? 0.3612 0.3102 0.3255 0.0135  0.0195  -0.0069 147 ILE A CB    
285  C  CG1   . ILE A 41  ? 0.3601 0.3060 0.3229 0.0145  0.0217  -0.0077 147 ILE A CG1   
286  C  CG2   . ILE A 41  ? 0.3473 0.2971 0.3120 0.0144  0.0171  -0.0080 147 ILE A CG2   
287  C  CD1   . ILE A 41  ? 0.3698 0.3180 0.3376 0.0161  0.0233  -0.0104 147 ILE A CD1   
288  N  N     . LYS A 42  ? 0.3810 0.3294 0.3372 0.0099  0.0132  -0.0024 148 LYS A N     
289  C  CA    . LYS A 42  ? 0.3849 0.3359 0.3417 0.0088  0.0113  -0.0017 148 LYS A CA    
290  C  C     . LYS A 42  ? 0.3748 0.3286 0.3354 0.0096  0.0106  -0.0034 148 LYS A C     
291  O  O     . LYS A 42  ? 0.3878 0.3400 0.3478 0.0109  0.0100  -0.0048 148 LYS A O     
292  C  CB    . LYS A 42  ? 0.4161 0.3641 0.3667 0.0074  0.0087  -0.0001 148 LYS A CB    
293  C  CG    . LYS A 42  ? 0.4449 0.3919 0.3931 0.0061  0.0090  0.0017  148 LYS A CG    
294  C  CD    . LYS A 42  ? 0.4925 0.4374 0.4353 0.0043  0.0065  0.0034  148 LYS A CD    
295  C  CE    . LYS A 42  ? 0.5439 0.4840 0.4814 0.0046  0.0050  0.0032  148 LYS A CE    
296  N  NZ    . LYS A 42  ? 0.5806 0.5165 0.5157 0.0060  0.0062  0.0028  148 LYS A NZ    
297  N  N     . GLN A 43  ? 0.3517 0.3097 0.3162 0.0090  0.0108  -0.0035 149 GLN A N     
298  C  CA    . GLN A 43  ? 0.3349 0.2958 0.3030 0.0098  0.0100  -0.0052 149 GLN A CA    
299  C  C     . GLN A 43  ? 0.3418 0.3004 0.3061 0.0098  0.0073  -0.0053 149 GLN A C     
300  O  O     . GLN A 43  ? 0.3354 0.2941 0.3013 0.0112  0.0067  -0.0071 149 GLN A O     
301  C  CB    . GLN A 43  ? 0.3140 0.2792 0.2858 0.0088  0.0103  -0.0048 149 GLN A CB    
302  C  CG    . GLN A 43  ? 0.3109 0.2794 0.2869 0.0094  0.0099  -0.0065 149 GLN A CG    
303  C  CD    . GLN A 43  ? 0.3064 0.2775 0.2884 0.0107  0.0121  -0.0083 149 GLN A CD    
304  O  OE1   . GLN A 43  ? 0.3228 0.2933 0.3061 0.0112  0.0143  -0.0084 149 GLN A OE1   
305  N  NE2   . GLN A 43  ? 0.3100 0.2841 0.2957 0.0113  0.0116  -0.0098 149 GLN A NE2   
306  N  N     . LEU A 44  ? 0.3345 0.2912 0.2937 0.0081  0.0055  -0.0035 150 LEU A N     
307  C  CA    . LEU A 44  ? 0.3339 0.2881 0.2887 0.0075  0.0028  -0.0034 150 LEU A CA    
308  C  C     . LEU A 44  ? 0.3398 0.2885 0.2884 0.0078  0.0015  -0.0029 150 LEU A C     
309  O  O     . LEU A 44  ? 0.3233 0.2693 0.2673 0.0069  -0.0007 -0.0023 150 LEU A O     
310  C  CB    . LEU A 44  ? 0.3243 0.2802 0.2774 0.0051  0.0017  -0.0018 150 LEU A CB    
311  C  CG    . LEU A 44  ? 0.3198 0.2810 0.2785 0.0049  0.0025  -0.0025 150 LEU A CG    
312  C  CD1   . LEU A 44  ? 0.3122 0.2750 0.2690 0.0026  0.0011  -0.0014 150 LEU A CD1   
313  C  CD2   . LEU A 44  ? 0.3203 0.2833 0.2832 0.0066  0.0027  -0.0046 150 LEU A CD2   
314  N  N     . GLY A 45  ? 0.3528 0.2997 0.3012 0.0087  0.0031  -0.0029 151 GLY A N     
315  C  CA    . GLY A 45  ? 0.3837 0.3253 0.3264 0.0090  0.0022  -0.0024 151 GLY A CA    
316  C  C     . GLY A 45  ? 0.3886 0.3271 0.3249 0.0068  0.0000  -0.0005 151 GLY A C     
317  O  O     . GLY A 45  ? 0.3898 0.3296 0.3256 0.0050  0.0003  0.0010  151 GLY A O     
318  N  N     . GLY A 46  ? 0.3966 0.3315 0.3283 0.0069  -0.0022 -0.0006 152 GLY A N     
319  C  CA    . GLY A 46  ? 0.4003 0.3317 0.3254 0.0047  -0.0043 0.0011  152 GLY A CA    
320  C  C     . GLY A 46  ? 0.3761 0.3104 0.3014 0.0023  -0.0051 0.0021  152 GLY A C     
321  O  O     . GLY A 46  ? 0.3814 0.3136 0.3018 0.0000  -0.0066 0.0037  152 GLY A O     
322  N  N     . GLY A 47  ? 0.3536 0.2929 0.2847 0.0026  -0.0043 0.0012  153 GLY A N     
323  C  CA    . GLY A 47  ? 0.3440 0.2870 0.2764 0.0006  -0.0047 0.0019  153 GLY A CA    
324  C  C     . GLY A 47  ? 0.3483 0.2930 0.2803 -0.0014 -0.0041 0.0036  153 GLY A C     
325  O  O     . GLY A 47  ? 0.3428 0.2884 0.2727 -0.0038 -0.0053 0.0046  153 GLY A O     
326  N  N     . TYR A 48  ? 0.3385 0.2832 0.2720 -0.0006 -0.0024 0.0039  154 TYR A N     
327  C  CA    . TYR A 48  ? 0.3422 0.2879 0.2748 -0.0023 -0.0022 0.0055  154 TYR A CA    
328  C  C     . TYR A 48  ? 0.3477 0.2896 0.2735 -0.0045 -0.0043 0.0070  154 TYR A C     
329  O  O     . TYR A 48  ? 0.3410 0.2849 0.2664 -0.0065 -0.0047 0.0082  154 TYR A O     
330  C  CB    . TYR A 48  ? 0.3486 0.2935 0.2825 -0.0009 -0.0004 0.0056  154 TYR A CB    
331  C  CG    . TYR A 48  ? 0.3395 0.2850 0.2728 -0.0021 -0.0001 0.0071  154 TYR A CG    
332  C  CD1   . TYR A 48  ? 0.3463 0.2962 0.2821 -0.0036 -0.0002 0.0078  154 TYR A CD1   
333  C  CD2   . TYR A 48  ? 0.3413 0.2832 0.2719 -0.0014 0.0005  0.0077  154 TYR A CD2   
334  C  CE1   . TYR A 48  ? 0.3432 0.2939 0.2788 -0.0044 0.0000  0.0090  154 TYR A CE1   
335  C  CE2   . TYR A 48  ? 0.3482 0.2906 0.2783 -0.0024 0.0007  0.0090  154 TYR A CE2   
336  C  CZ    . TYR A 48  ? 0.3546 0.3014 0.2872 -0.0038 0.0002  0.0097  154 TYR A CZ    
337  O  OH    . TYR A 48  ? 0.3751 0.3224 0.3074 -0.0044 0.0003  0.0108  154 TYR A OH    
338  N  N     . TYR A 49  ? 0.3578 0.2946 0.2787 -0.0040 -0.0057 0.0068  155 TYR A N     
339  C  CA    . TYR A 49  ? 0.3841 0.3166 0.2981 -0.0061 -0.0077 0.0081  155 TYR A CA    
340  C  C     . TYR A 49  ? 0.3963 0.3295 0.3081 -0.0085 -0.0094 0.0085  155 TYR A C     
341  O  O     . TYR A 49  ? 0.3864 0.3162 0.2922 -0.0107 -0.0112 0.0096  155 TYR A O     
342  C  CB    . TYR A 49  ? 0.3968 0.3229 0.3057 -0.0047 -0.0085 0.0078  155 TYR A CB    
343  C  CG    . TYR A 49  ? 0.4189 0.3438 0.3288 -0.0030 -0.0068 0.0077  155 TYR A CG    
344  C  CD1   . TYR A 49  ? 0.4299 0.3566 0.3448 -0.0003 -0.0047 0.0062  155 TYR A CD1   
345  C  CD2   . TYR A 49  ? 0.4225 0.3448 0.3285 -0.0042 -0.0071 0.0092  155 TYR A CD2   
346  C  CE1   . TYR A 49  ? 0.4355 0.3610 0.3511 0.0009  -0.0029 0.0062  155 TYR A CE1   
347  C  CE2   . TYR A 49  ? 0.4303 0.3516 0.3371 -0.0028 -0.0054 0.0092  155 TYR A CE2   
348  C  CZ    . TYR A 49  ? 0.4391 0.3619 0.3506 -0.0002 -0.0032 0.0077  155 TYR A CZ    
349  O  OH    . TYR A 49  ? 0.4266 0.3477 0.3383 0.0010  -0.0013 0.0076  155 TYR A OH    
350  N  N     . VAL A 50  ? 0.3875 0.3250 0.3038 -0.0081 -0.0089 0.0075  156 VAL A N     
351  C  CA    . VAL A 50  ? 0.3793 0.3184 0.2943 -0.0105 -0.0100 0.0077  156 VAL A CA    
352  C  C     . VAL A 50  ? 0.3701 0.3159 0.2908 -0.0115 -0.0087 0.0078  156 VAL A C     
353  O  O     . VAL A 50  ? 0.3386 0.2863 0.2579 -0.0142 -0.0093 0.0087  156 VAL A O     
354  C  CB    . VAL A 50  ? 0.3802 0.3172 0.2941 -0.0094 -0.0110 0.0065  156 VAL A CB    
355  C  CG1   . VAL A 50  ? 0.3906 0.3292 0.3032 -0.0118 -0.0119 0.0067  156 VAL A CG1   
356  C  CG2   . VAL A 50  ? 0.3931 0.3229 0.3003 -0.0087 -0.0128 0.0066  156 VAL A CG2   
357  N  N     . PHE A 51  ? 0.3717 0.3211 0.2986 -0.0093 -0.0068 0.0068  157 PHE A N     
358  C  CA    . PHE A 51  ? 0.3608 0.3165 0.2937 -0.0096 -0.0053 0.0067  157 PHE A CA    
359  C  C     . PHE A 51  ? 0.3652 0.3222 0.3007 -0.0088 -0.0039 0.0073  157 PHE A C     
360  O  O     . PHE A 51  ? 0.3566 0.3137 0.2953 -0.0064 -0.0025 0.0065  157 PHE A O     
361  C  CB    . PHE A 51  ? 0.3388 0.2973 0.2767 -0.0077 -0.0043 0.0051  157 PHE A CB    
362  C  CG    . PHE A 51  ? 0.3318 0.2900 0.2679 -0.0086 -0.0055 0.0045  157 PHE A CG    
363  C  CD1   . PHE A 51  ? 0.3289 0.2824 0.2614 -0.0076 -0.0069 0.0038  157 PHE A CD1   
364  C  CD2   . PHE A 51  ? 0.3166 0.2791 0.2547 -0.0104 -0.0053 0.0045  157 PHE A CD2   
365  C  CE1   . PHE A 51  ? 0.3200 0.2727 0.2503 -0.0084 -0.0082 0.0033  157 PHE A CE1   
366  C  CE2   . PHE A 51  ? 0.3151 0.2768 0.2507 -0.0115 -0.0065 0.0041  157 PHE A CE2   
367  C  CZ    . PHE A 51  ? 0.3164 0.2729 0.2479 -0.0105 -0.0080 0.0035  157 PHE A CZ    
368  N  N     . PRO A 52  ? 0.3742 0.3323 0.3084 -0.0106 -0.0044 0.0086  158 PRO A N     
369  C  CA    . PRO A 52  ? 0.3899 0.3481 0.3251 -0.0100 -0.0036 0.0093  158 PRO A CA    
370  C  C     . PRO A 52  ? 0.3767 0.3395 0.3182 -0.0086 -0.0017 0.0088  158 PRO A C     
371  O  O     . PRO A 52  ? 0.3966 0.3586 0.3388 -0.0076 -0.0009 0.0092  158 PRO A O     
372  C  CB    . PRO A 52  ? 0.4004 0.3591 0.3326 -0.0128 -0.0050 0.0107  158 PRO A CB    
373  C  CG    . PRO A 52  ? 0.3825 0.3449 0.3159 -0.0146 -0.0055 0.0103  158 PRO A CG    
374  C  CD    . PRO A 52  ? 0.3927 0.3520 0.3243 -0.0137 -0.0058 0.0093  158 PRO A CD    
375  N  N     . GLY A 53  ? 0.3496 0.3166 0.2955 -0.0084 -0.0011 0.0078  159 GLY A N     
376  C  CA    . GLY A 53  ? 0.3389 0.3095 0.2906 -0.0068 0.0007  0.0072  159 GLY A CA    
377  C  C     . GLY A 53  ? 0.3471 0.3158 0.3006 -0.0043 0.0021  0.0061  159 GLY A C     
378  O  O     . GLY A 53  ? 0.3503 0.3212 0.3082 -0.0029 0.0037  0.0055  159 GLY A O     
379  N  N     . ALA A 54  ? 0.3411 0.3059 0.2914 -0.0038 0.0014  0.0056  160 ALA A N     
380  C  CA    . ALA A 54  ? 0.3404 0.3039 0.2929 -0.0016 0.0026  0.0041  160 ALA A CA    
381  C  C     . ALA A 54  ? 0.3475 0.3077 0.2990 -0.0001 0.0037  0.0042  160 ALA A C     
382  O  O     . ALA A 54  ? 0.3175 0.2742 0.2670 0.0010  0.0036  0.0034  160 ALA A O     
383  C  CB    . ALA A 54  ? 0.3566 0.3180 0.3067 -0.0014 0.0012  0.0033  160 ALA A CB    
384  N  N     . SER A 55  ? 0.3328 0.2939 0.2856 -0.0001 0.0048  0.0050  161 SER A N     
385  C  CA    . SER A 55  ? 0.3553 0.3134 0.3073 0.0010  0.0062  0.0051  161 SER A CA    
386  C  C     . SER A 55  ? 0.3247 0.2846 0.2820 0.0028  0.0087  0.0038  161 SER A C     
387  O  O     . SER A 55  ? 0.3112 0.2692 0.2684 0.0036  0.0103  0.0039  161 SER A O     
388  C  CB    . SER A 55  ? 0.3851 0.3430 0.3354 0.0000  0.0059  0.0067  161 SER A CB    
389  O  OG    . SER A 55  ? 0.4249 0.3877 0.3798 -0.0001 0.0065  0.0067  161 SER A OG    
390  N  N     . HIS A 56  ? 0.2970 0.2606 0.2587 0.0032  0.0091  0.0026  162 HIS A N     
391  C  CA    . HIS A 56  ? 0.2968 0.2623 0.2635 0.0046  0.0114  0.0013  162 HIS A CA    
392  C  C     . HIS A 56  ? 0.3175 0.2805 0.2844 0.0060  0.0125  0.0000  162 HIS A C     
393  O  O     . HIS A 56  ? 0.3063 0.2672 0.2706 0.0063  0.0112  -0.0004 162 HIS A O     
394  C  CB    . HIS A 56  ? 0.2941 0.2641 0.2654 0.0045  0.0114  0.0004  162 HIS A CB    
395  C  CG    . HIS A 56  ? 0.2861 0.2568 0.2571 0.0043  0.0098  -0.0003 162 HIS A CG    
396  N  ND1   . HIS A 56  ? 0.2816 0.2509 0.2481 0.0030  0.0076  0.0005  162 HIS A ND1   
397  C  CD2   . HIS A 56  ? 0.2772 0.2497 0.2515 0.0053  0.0101  -0.0020 162 HIS A CD2   
398  C  CE1   . HIS A 56  ? 0.2748 0.2447 0.2417 0.0031  0.0066  -0.0004 162 HIS A CE1   
399  N  NE2   . HIS A 56  ? 0.2673 0.2393 0.2390 0.0045  0.0079  -0.0020 162 HIS A NE2   
400  N  N     . ASN A 57  ? 0.3287 0.2913 0.2978 0.0069  0.0149  -0.0004 163 ASN A N     
401  C  CA    . ASN A 57  ? 0.3340 0.2945 0.3035 0.0083  0.0163  -0.0017 163 ASN A CA    
402  C  C     . ASN A 57  ? 0.3230 0.2869 0.2985 0.0093  0.0178  -0.0037 163 ASN A C     
403  O  O     . ASN A 57  ? 0.3303 0.2976 0.3093 0.0089  0.0179  -0.0039 163 ASN A O     
404  C  CB    . ASN A 57  ? 0.3383 0.2954 0.3054 0.0084  0.0181  -0.0010 163 ASN A CB    
405  C  CG    . ASN A 57  ? 0.3643 0.3183 0.3257 0.0073  0.0165  0.0009  163 ASN A CG    
406  O  OD1   . ASN A 57  ? 0.3972 0.3488 0.3547 0.0071  0.0149  0.0012  163 ASN A OD1   
407  N  ND2   . ASN A 57  ? 0.3475 0.3015 0.3083 0.0066  0.0168  0.0023  163 ASN A ND2   
408  N  N     . ARG A 58  ? 0.3221 0.2849 0.2988 0.0105  0.0191  -0.0053 164 ARG A N     
409  C  CA    . ARG A 58  ? 0.3152 0.2811 0.2977 0.0115  0.0204  -0.0075 164 ARG A CA    
410  C  C     . ARG A 58  ? 0.2999 0.2676 0.2862 0.0113  0.0230  -0.0077 164 ARG A C     
411  O  O     . ARG A 58  ? 0.2984 0.2694 0.2897 0.0117  0.0238  -0.0092 164 ARG A O     
412  C  CB    . ARG A 58  ? 0.3195 0.2840 0.3025 0.0129  0.0211  -0.0092 164 ARG A CB    
413  C  CG    . ARG A 58  ? 0.3240 0.2869 0.3040 0.0135  0.0185  -0.0096 164 ARG A CG    
414  C  CD    . ARG A 58  ? 0.3409 0.3069 0.3249 0.0144  0.0173  -0.0115 164 ARG A CD    
415  N  NE    . ARG A 58  ? 0.3440 0.3088 0.3245 0.0143  0.0141  -0.0110 164 ARG A NE    
416  C  CZ    . ARG A 58  ? 0.3380 0.3050 0.3204 0.0146  0.0124  -0.0120 164 ARG A CZ    
417  N  NH1   . ARG A 58  ? 0.3425 0.3075 0.3204 0.0140  0.0096  -0.0111 164 ARG A NH1   
418  N  NH2   . ARG A 58  ? 0.3218 0.2925 0.3101 0.0152  0.0134  -0.0137 164 ARG A NH2   
419  N  N     . PHE A 59  ? 0.3004 0.2655 0.2840 0.0107  0.0242  -0.0063 165 PHE A N     
420  C  CA    . PHE A 59  ? 0.3130 0.2789 0.2993 0.0105  0.0266  -0.0063 165 PHE A CA    
421  C  C     . PHE A 59  ? 0.3098 0.2796 0.2999 0.0101  0.0261  -0.0063 165 PHE A C     
422  O  O     . PHE A 59  ? 0.2869 0.2594 0.2819 0.0104  0.0276  -0.0078 165 PHE A O     
423  C  CB    . PHE A 59  ? 0.3219 0.2838 0.3034 0.0099  0.0272  -0.0044 165 PHE A CB    
424  C  CG    . PHE A 59  ? 0.3376 0.2991 0.3206 0.0096  0.0296  -0.0042 165 PHE A CG    
425  C  CD1   . PHE A 59  ? 0.3178 0.2777 0.3019 0.0098  0.0325  -0.0053 165 PHE A CD1   
426  C  CD2   . PHE A 59  ? 0.3307 0.2931 0.3136 0.0090  0.0287  -0.0028 165 PHE A CD2   
427  C  CE1   . PHE A 59  ? 0.3346 0.2936 0.3194 0.0094  0.0345  -0.0049 165 PHE A CE1   
428  C  CE2   . PHE A 59  ? 0.3309 0.2923 0.3145 0.0089  0.0306  -0.0025 165 PHE A CE2   
429  C  CZ    . PHE A 59  ? 0.3408 0.3004 0.3253 0.0090  0.0335  -0.0036 165 PHE A CZ    
430  N  N     . GLU A 60  ? 0.2941 0.2645 0.2820 0.0094  0.0239  -0.0048 166 GLU A N     
431  C  CA    . GLU A 60  ? 0.2874 0.2614 0.2782 0.0090  0.0233  -0.0047 166 GLU A CA    
432  C  C     . GLU A 60  ? 0.2771 0.2545 0.2719 0.0095  0.0227  -0.0064 166 GLU A C     
433  O  O     . GLU A 60  ? 0.2669 0.2471 0.2660 0.0096  0.0236  -0.0074 166 GLU A O     
434  C  CB    . GLU A 60  ? 0.2951 0.2691 0.2827 0.0081  0.0212  -0.0028 166 GLU A CB    
435  C  CG    . GLU A 60  ? 0.3272 0.2992 0.3101 0.0076  0.0191  -0.0019 166 GLU A CG    
436  C  CD    . GLU A 60  ? 0.3398 0.3074 0.3177 0.0073  0.0191  -0.0005 166 GLU A CD    
437  O  OE1   . GLU A 60  ? 0.3273 0.2939 0.3013 0.0064  0.0171  0.0007  166 GLU A OE1   
438  O  OE2   . GLU A 60  ? 0.3402 0.3052 0.3177 0.0079  0.0212  -0.0007 166 GLU A OE2   
439  N  N     . HIS A 61  ? 0.2667 0.2435 0.2602 0.0098  0.0213  -0.0071 167 HIS A N     
440  C  CA    . HIS A 61  ? 0.2601 0.2397 0.2570 0.0104  0.0205  -0.0088 167 HIS A CA    
441  C  C     . HIS A 61  ? 0.2568 0.2379 0.2587 0.0112  0.0228  -0.0108 167 HIS A C     
442  O  O     . HIS A 61  ? 0.2608 0.2451 0.2669 0.0113  0.0229  -0.0119 167 HIS A O     
443  C  CB    . HIS A 61  ? 0.2666 0.2444 0.2605 0.0107  0.0185  -0.0091 167 HIS A CB    
444  C  CG    . HIS A 61  ? 0.2659 0.2456 0.2629 0.0117  0.0178  -0.0112 167 HIS A CG    
445  N  ND1   . HIS A 61  ? 0.2502 0.2328 0.2494 0.0115  0.0165  -0.0118 167 HIS A ND1   
446  C  CD2   . HIS A 61  ? 0.2679 0.2469 0.2661 0.0130  0.0180  -0.0129 167 HIS A CD2   
447  C  CE1   . HIS A 61  ? 0.2588 0.2422 0.2603 0.0126  0.0159  -0.0137 167 HIS A CE1   
448  N  NE2   . HIS A 61  ? 0.2618 0.2433 0.2630 0.0136  0.0167  -0.0144 167 HIS A NE2   
449  N  N     . SER A 62  ? 0.2591 0.2380 0.2607 0.0115  0.0248  -0.0111 168 SER A N     
450  C  CA    . SER A 62  ? 0.2633 0.2434 0.2695 0.0121  0.0271  -0.0130 168 SER A CA    
451  C  C     . SER A 62  ? 0.2633 0.2451 0.2725 0.0115  0.0288  -0.0130 168 SER A C     
452  O  O     . SER A 62  ? 0.2811 0.2657 0.2952 0.0118  0.0297  -0.0147 168 SER A O     
453  C  CB    . SER A 62  ? 0.2672 0.2443 0.2717 0.0125  0.0289  -0.0134 168 SER A CB    
454  O  OG    . SER A 62  ? 0.2700 0.2455 0.2716 0.0132  0.0272  -0.0136 168 SER A OG    
455  N  N     . LEU A 63  ? 0.2642 0.2443 0.2707 0.0108  0.0291  -0.0111 169 LEU A N     
456  C  CA    . LEU A 63  ? 0.2667 0.2482 0.2758 0.0104  0.0303  -0.0109 169 LEU A CA    
457  C  C     . LEU A 63  ? 0.2689 0.2541 0.2810 0.0105  0.0288  -0.0115 169 LEU A C     
458  O  O     . LEU A 63  ? 0.2889 0.2761 0.3049 0.0105  0.0300  -0.0126 169 LEU A O     
459  C  CB    . LEU A 63  ? 0.2590 0.2380 0.2642 0.0099  0.0302  -0.0087 169 LEU A CB    
460  C  CG    . LEU A 63  ? 0.2628 0.2374 0.2638 0.0097  0.0315  -0.0076 169 LEU A CG    
461  C  CD1   . LEU A 63  ? 0.2644 0.2367 0.2613 0.0093  0.0306  -0.0054 169 LEU A CD1   
462  C  CD2   . LEU A 63  ? 0.2690 0.2424 0.2720 0.0096  0.0345  -0.0084 169 LEU A CD2   
463  N  N     . GLY A 64  ? 0.2831 0.2692 0.2932 0.0104  0.0263  -0.0109 170 GLY A N     
464  C  CA    . GLY A 64  ? 0.2718 0.2614 0.2844 0.0103  0.0248  -0.0116 170 GLY A CA    
465  C  C     . GLY A 64  ? 0.2748 0.2666 0.2917 0.0110  0.0250  -0.0138 170 GLY A C     
466  O  O     . GLY A 64  ? 0.2704 0.2648 0.2909 0.0110  0.0253  -0.0148 170 GLY A O     
467  N  N     . VAL A 65  ? 0.2760 0.2667 0.2925 0.0116  0.0249  -0.0148 171 VAL A N     
468  C  CA    . VAL A 65  ? 0.2670 0.2599 0.2875 0.0123  0.0247  -0.0171 171 VAL A CA    
469  C  C     . VAL A 65  ? 0.2752 0.2695 0.3005 0.0123  0.0274  -0.0184 171 VAL A C     
470  O  O     . VAL A 65  ? 0.2582 0.2554 0.2877 0.0125  0.0273  -0.0200 171 VAL A O     
471  C  CB    . VAL A 65  ? 0.2720 0.2634 0.2912 0.0132  0.0239  -0.0179 171 VAL A CB    
472  C  CG1   . VAL A 65  ? 0.2733 0.2672 0.2973 0.0142  0.0238  -0.0206 171 VAL A CG1   
473  C  CG2   . VAL A 65  ? 0.2798 0.2698 0.2943 0.0131  0.0210  -0.0167 171 VAL A CG2   
474  N  N     . GLY A 66  ? 0.2855 0.2777 0.3100 0.0120  0.0297  -0.0179 172 GLY A N     
475  C  CA    . GLY A 66  ? 0.2867 0.2795 0.3149 0.0116  0.0324  -0.0190 172 GLY A CA    
476  C  C     . GLY A 66  ? 0.2898 0.2842 0.3196 0.0111  0.0324  -0.0185 172 GLY A C     
477  O  O     . GLY A 66  ? 0.2926 0.2890 0.3267 0.0110  0.0335  -0.0201 172 GLY A O     
478  N  N     . TYR A 67  ? 0.2899 0.2834 0.3164 0.0109  0.0312  -0.0166 173 TYR A N     
479  C  CA    . TYR A 67  ? 0.2852 0.2803 0.3133 0.0106  0.0312  -0.0163 173 TYR A CA    
480  C  C     . TYR A 67  ? 0.3036 0.3022 0.3347 0.0109  0.0295  -0.0177 173 TYR A C     
481  O  O     . TYR A 67  ? 0.3182 0.3184 0.3528 0.0108  0.0304  -0.0188 173 TYR A O     
482  C  CB    . TYR A 67  ? 0.2843 0.2781 0.3085 0.0103  0.0302  -0.0141 173 TYR A CB    
483  C  CG    . TYR A 67  ? 0.2862 0.2823 0.3117 0.0102  0.0293  -0.0139 173 TYR A CG    
484  C  CD1   . TYR A 67  ? 0.2802 0.2762 0.3077 0.0102  0.0309  -0.0141 173 TYR A CD1   
485  C  CD2   . TYR A 67  ? 0.2931 0.2913 0.3177 0.0102  0.0270  -0.0135 173 TYR A CD2   
486  C  CE1   . TYR A 67  ? 0.2806 0.2787 0.3093 0.0103  0.0301  -0.0140 173 TYR A CE1   
487  C  CE2   . TYR A 67  ? 0.2827 0.2831 0.3084 0.0101  0.0264  -0.0133 173 TYR A CE2   
488  C  CZ    . TYR A 67  ? 0.2812 0.2817 0.3092 0.0103  0.0280  -0.0137 173 TYR A CZ    
489  O  OH    . TYR A 67  ? 0.2746 0.2774 0.3038 0.0104  0.0273  -0.0137 173 TYR A OH    
490  N  N     . LEU A 68  ? 0.3090 0.3083 0.3384 0.0111  0.0272  -0.0176 174 LEU A N     
491  C  CA    . LEU A 68  ? 0.2977 0.2998 0.3295 0.0114  0.0256  -0.0190 174 LEU A CA    
492  C  C     . LEU A 68  ? 0.3087 0.3124 0.3453 0.0119  0.0265  -0.0214 174 LEU A C     
493  O  O     . LEU A 68  ? 0.3283 0.3343 0.3680 0.0119  0.0262  -0.0227 174 LEU A O     
494  C  CB    . LEU A 68  ? 0.2878 0.2897 0.3163 0.0115  0.0229  -0.0185 174 LEU A CB    
495  C  CG    . LEU A 68  ? 0.3014 0.3025 0.3255 0.0107  0.0217  -0.0163 174 LEU A CG    
496  C  CD1   . LEU A 68  ? 0.2958 0.2965 0.3165 0.0106  0.0191  -0.0159 174 LEU A CD1   
497  C  CD2   . LEU A 68  ? 0.2944 0.2974 0.3193 0.0103  0.0219  -0.0157 174 LEU A CD2   
498  N  N     . ALA A 69  ? 0.3057 0.3084 0.3430 0.0122  0.0277  -0.0222 175 ALA A N     
499  C  CA    . ALA A 69  ? 0.3165 0.3211 0.3587 0.0126  0.0285  -0.0248 175 ALA A CA    
500  C  C     . ALA A 69  ? 0.3244 0.3303 0.3704 0.0120  0.0306  -0.0256 175 ALA A C     
501  O  O     . ALA A 69  ? 0.3098 0.3182 0.3597 0.0121  0.0303  -0.0273 175 ALA A O     
502  C  CB    . ALA A 69  ? 0.3021 0.3054 0.3445 0.0130  0.0298  -0.0254 175 ALA A CB    
503  N  N     . GLY A 70  ? 0.3418 0.3457 0.3861 0.0113  0.0324  -0.0241 176 GLY A N     
504  C  CA    . GLY A 70  ? 0.3471 0.3512 0.3938 0.0107  0.0343  -0.0244 176 GLY A CA    
505  C  C     . GLY A 70  ? 0.3562 0.3621 0.4036 0.0107  0.0328  -0.0243 176 GLY A C     
506  O  O     . GLY A 70  ? 0.3596 0.3672 0.4107 0.0105  0.0335  -0.0258 176 GLY A O     
507  N  N     . CYS A 71  ? 0.3442 0.3499 0.3881 0.0109  0.0309  -0.0227 177 CYS A N     
508  C  CA    . CYS A 71  ? 0.3470 0.3547 0.3916 0.0109  0.0295  -0.0228 177 CYS A CA    
509  C  C     . CYS A 71  ? 0.3278 0.3383 0.3761 0.0113  0.0284  -0.0251 177 CYS A C     
510  O  O     . CYS A 71  ? 0.3090 0.3210 0.3601 0.0112  0.0288  -0.0262 177 CYS A O     
511  C  CB    . CYS A 71  ? 0.3507 0.3583 0.3913 0.0109  0.0276  -0.0210 177 CYS A CB    
512  S  SG    . CYS A 71  ? 0.3836 0.3885 0.4204 0.0107  0.0285  -0.0185 177 CYS A SG    
513  N  N     . LEU A 72  ? 0.3136 0.3244 0.3617 0.0118  0.0271  -0.0258 178 LEU A N     
514  C  CA    . LEU A 72  ? 0.3207 0.3338 0.3715 0.0122  0.0254  -0.0278 178 LEU A CA    
515  C  C     . LEU A 72  ? 0.3278 0.3425 0.3839 0.0121  0.0271  -0.0300 178 LEU A C     
516  O  O     . LEU A 72  ? 0.3150 0.3314 0.3736 0.0121  0.0266  -0.0313 178 LEU A O     
517  C  CB    . LEU A 72  ? 0.3002 0.3129 0.3493 0.0130  0.0234  -0.0282 178 LEU A CB    
518  C  CG    . LEU A 72  ? 0.3034 0.3182 0.3550 0.0136  0.0214  -0.0303 178 LEU A CG    
519  C  CD1   . LEU A 72  ? 0.2982 0.3142 0.3494 0.0134  0.0200  -0.0304 178 LEU A CD1   
520  C  CD2   . LEU A 72  ? 0.3039 0.3174 0.3524 0.0144  0.0191  -0.0302 178 LEU A CD2   
521  N  N     . VAL A 73  ? 0.3495 0.3633 0.4070 0.0120  0.0292  -0.0305 179 VAL A N     
522  C  CA    . VAL A 73  ? 0.3666 0.3819 0.4292 0.0116  0.0310  -0.0326 179 VAL A CA    
523  C  C     . VAL A 73  ? 0.3816 0.3967 0.4454 0.0108  0.0326  -0.0325 179 VAL A C     
524  O  O     . VAL A 73  ? 0.3580 0.3751 0.4259 0.0106  0.0327  -0.0344 179 VAL A O     
525  C  CB    . VAL A 73  ? 0.3971 0.4115 0.4608 0.0115  0.0331  -0.0332 179 VAL A CB    
526  C  CG1   . VAL A 73  ? 0.4134 0.4246 0.4739 0.0107  0.0354  -0.0312 179 VAL A CG1   
527  C  CG2   . VAL A 73  ? 0.3885 0.4053 0.4580 0.0111  0.0346  -0.0359 179 VAL A CG2   
528  N  N     . HIS A 74  ? 0.4289 0.4417 0.4894 0.0104  0.0335  -0.0303 180 HIS A N     
529  C  CA    . HIS A 74  ? 0.4708 0.4830 0.5321 0.0098  0.0349  -0.0301 180 HIS A CA    
530  C  C     . HIS A 74  ? 0.4548 0.4691 0.5172 0.0101  0.0330  -0.0308 180 HIS A C     
531  O  O     . HIS A 74  ? 0.4665 0.4816 0.5317 0.0097  0.0338  -0.0321 180 HIS A O     
532  C  CB    . HIS A 74  ? 0.5102 0.5195 0.5675 0.0096  0.0358  -0.0277 180 HIS A CB    
533  C  CG    . HIS A 74  ? 0.6512 0.6576 0.7079 0.0088  0.0385  -0.0273 180 HIS A CG    
534  N  ND1   . HIS A 74  ? 0.6998 0.7035 0.7526 0.0088  0.0390  -0.0256 180 HIS A ND1   
535  C  CD2   . HIS A 74  ? 0.7169 0.7226 0.7763 0.0079  0.0409  -0.0285 180 HIS A CD2   
536  C  CE1   . HIS A 74  ? 0.6909 0.6922 0.7438 0.0080  0.0416  -0.0257 180 HIS A CE1   
537  N  NE2   . HIS A 74  ? 0.7238 0.7262 0.7806 0.0074  0.0429  -0.0275 180 HIS A NE2   
538  N  N     . ALA A 75  ? 0.4277 0.4427 0.4876 0.0107  0.0307  -0.0300 181 ALA A N     
539  C  CA    . ALA A 75  ? 0.4171 0.4340 0.4775 0.0109  0.0290  -0.0306 181 ALA A CA    
540  C  C     . ALA A 75  ? 0.4347 0.4539 0.4991 0.0111  0.0282  -0.0331 181 ALA A C     
541  O  O     . ALA A 75  ? 0.4894 0.5096 0.5556 0.0109  0.0281  -0.0341 181 ALA A O     
542  C  CB    . ALA A 75  ? 0.4146 0.4315 0.4711 0.0113  0.0269  -0.0292 181 ALA A CB    
543  N  N     . LEU A 76  ? 0.4075 0.4273 0.4732 0.0114  0.0275  -0.0342 182 LEU A N     
544  C  CA    . LEU A 76  ? 0.3840 0.4061 0.4541 0.0116  0.0268  -0.0368 182 LEU A CA    
545  C  C     . LEU A 76  ? 0.4178 0.4404 0.4921 0.0108  0.0292  -0.0382 182 LEU A C     
546  O  O     . LEU A 76  ? 0.4162 0.4404 0.4933 0.0107  0.0286  -0.0399 182 LEU A O     
547  C  CB    . LEU A 76  ? 0.3622 0.3848 0.4332 0.0123  0.0260  -0.0378 182 LEU A CB    
548  C  CG    . LEU A 76  ? 0.3472 0.3691 0.4142 0.0131  0.0234  -0.0368 182 LEU A CG    
549  C  CD1   . LEU A 76  ? 0.3418 0.3640 0.4099 0.0140  0.0226  -0.0379 182 LEU A CD1   
550  C  CD2   . LEU A 76  ? 0.3622 0.3850 0.4283 0.0134  0.0208  -0.0373 182 LEU A CD2   
551  N  N     . GLY A 77  ? 0.4214 0.4423 0.4957 0.0101  0.0318  -0.0375 183 GLY A N     
552  C  CA    . GLY A 77  ? 0.4365 0.4571 0.5138 0.0090  0.0344  -0.0385 183 GLY A CA    
553  C  C     . GLY A 77  ? 0.4952 0.5151 0.5720 0.0087  0.0347  -0.0381 183 GLY A C     
554  O  O     . GLY A 77  ? 0.5586 0.5794 0.6389 0.0080  0.0354  -0.0398 183 GLY A O     
555  N  N     . GLU A 78  ? 0.5646 0.5830 0.6374 0.0091  0.0341  -0.0360 184 GLU A N     
556  C  CA    . GLU A 78  ? 0.6259 0.6434 0.6981 0.0089  0.0344  -0.0357 184 GLU A CA    
557  C  C     . GLU A 78  ? 0.5914 0.6113 0.6659 0.0092  0.0327  -0.0374 184 GLU A C     
558  O  O     . GLU A 78  ? 0.5755 0.5955 0.6520 0.0087  0.0334  -0.0385 184 GLU A O     
559  C  CB    . GLU A 78  ? 0.7469 0.7630 0.8147 0.0095  0.0338  -0.0333 184 GLU A CB    
560  C  CG    . GLU A 78  ? 0.9449 0.9585 1.0095 0.0094  0.0350  -0.0312 184 GLU A CG    
561  C  CD    . GLU A 78  ? 1.1749 1.1858 1.2402 0.0086  0.0378  -0.0313 184 GLU A CD    
562  O  OE1   . GLU A 78  ? 1.3547 1.3644 1.4207 0.0082  0.0387  -0.0316 184 GLU A OE1   
563  O  OE2   . GLU A 78  ? 1.2570 1.2666 1.3217 0.0082  0.0390  -0.0309 184 GLU A OE2   
564  N  N     . LYS A 79  ? 0.5659 0.5875 0.6395 0.0099  0.0304  -0.0375 185 LYS A N     
565  C  CA    . LYS A 79  ? 0.5701 0.5934 0.6447 0.0102  0.0285  -0.0389 185 LYS A CA    
566  C  C     . LYS A 79  ? 0.5108 0.5361 0.5899 0.0100  0.0280  -0.0415 185 LYS A C     
567  O  O     . LYS A 79  ? 0.4755 0.5019 0.5559 0.0101  0.0269  -0.0428 185 LYS A O     
568  C  CB    . LYS A 79  ? 0.6257 0.6496 0.6969 0.0109  0.0261  -0.0378 185 LYS A CB    
569  C  CG    . LYS A 79  ? 0.7207 0.7435 0.7880 0.0110  0.0262  -0.0357 185 LYS A CG    
570  C  CD    . LYS A 79  ? 0.8239 0.8468 0.8874 0.0114  0.0243  -0.0344 185 LYS A CD    
571  C  CE    . LYS A 79  ? 0.8305 0.8547 0.8943 0.0117  0.0219  -0.0358 185 LYS A CE    
572  N  NZ    . LYS A 79  ? 0.8560 0.8796 0.9165 0.0120  0.0202  -0.0348 185 LYS A NZ    
573  N  N     . GLN A 80  ? 0.4666 0.4924 0.5480 0.0098  0.0288  -0.0423 186 GLN A N     
574  C  CA    . GLN A 80  ? 0.4724 0.5005 0.5587 0.0097  0.0284  -0.0450 186 GLN A CA    
575  C  C     . GLN A 80  ? 0.4872 0.5151 0.5767 0.0086  0.0312  -0.0458 186 GLN A C     
576  O  O     . GLN A 80  ? 0.4748 0.5037 0.5659 0.0089  0.0314  -0.0465 186 GLN A O     
577  C  CB    . GLN A 80  ? 0.4644 0.4940 0.5506 0.0108  0.0257  -0.0457 186 GLN A CB    
578  C  CG    . GLN A 80  ? 0.4853 0.5149 0.5683 0.0116  0.0229  -0.0453 186 GLN A CG    
579  C  CD    . GLN A 80  ? 0.5004 0.5307 0.5827 0.0127  0.0201  -0.0460 186 GLN A CD    
580  O  OE1   . GLN A 80  ? 0.5481 0.5771 0.6264 0.0132  0.0192  -0.0443 186 GLN A OE1   
581  N  NE2   . GLN A 80  ? 0.4605 0.4928 0.5466 0.0131  0.0187  -0.0485 186 GLN A NE2   
582  N  N     . PRO A 81  ? 0.4904 0.5171 0.5810 0.0075  0.0335  -0.0459 187 PRO A N     
583  C  CA    . PRO A 81  ? 0.4797 0.5059 0.5733 0.0061  0.0365  -0.0469 187 PRO A CA    
584  C  C     . PRO A 81  ? 0.4544 0.4838 0.5535 0.0058  0.0363  -0.0497 187 PRO A C     
585  O  O     . PRO A 81  ? 0.4778 0.5075 0.5790 0.0050  0.0384  -0.0503 187 PRO A O     
586  C  CB    . PRO A 81  ? 0.4990 0.5236 0.5928 0.0051  0.0377  -0.0470 187 PRO A CB    
587  C  CG    . PRO A 81  ? 0.5000 0.5233 0.5896 0.0062  0.0361  -0.0452 187 PRO A CG    
588  C  CD    . PRO A 81  ? 0.5019 0.5271 0.5902 0.0075  0.0333  -0.0449 187 PRO A CD    
589  N  N     . GLU A 82  ? 0.4580 0.4899 0.5592 0.0065  0.0337  -0.0513 188 GLU A N     
590  C  CA    . GLU A 82  ? 0.4841 0.5195 0.5907 0.0066  0.0329  -0.0542 188 GLU A CA    
591  C  C     . GLU A 82  ? 0.4934 0.5302 0.6007 0.0075  0.0324  -0.0545 188 GLU A C     
592  O  O     . GLU A 82  ? 0.4696 0.5094 0.5818 0.0075  0.0324  -0.0570 188 GLU A O     
593  C  CB    . GLU A 82  ? 0.5147 0.5521 0.6228 0.0073  0.0298  -0.0559 188 GLU A CB    
594  C  CG    . GLU A 82  ? 0.5236 0.5612 0.6285 0.0092  0.0263  -0.0552 188 GLU A CG    
595  C  CD    . GLU A 82  ? 0.5456 0.5806 0.6447 0.0096  0.0255  -0.0527 188 GLU A CD    
596  O  OE1   . GLU A 82  ? 0.5544 0.5873 0.6515 0.0088  0.0275  -0.0512 188 GLU A OE1   
597  O  OE2   . GLU A 82  ? 0.5725 0.6075 0.6689 0.0108  0.0227  -0.0523 188 GLU A OE2   
598  N  N     . LEU A 83  ? 0.5240 0.5588 0.6265 0.0084  0.0319  -0.0522 189 LEU A N     
599  C  CA    . LEU A 83  ? 0.5326 0.5682 0.6355 0.0093  0.0317  -0.0524 189 LEU A CA    
600  C  C     . LEU A 83  ? 0.5058 0.5411 0.6107 0.0080  0.0353  -0.0527 189 LEU A C     
601  O  O     . LEU A 83  ? 0.4971 0.5337 0.6036 0.0085  0.0356  -0.0536 189 LEU A O     
602  C  CB    . LEU A 83  ? 0.5380 0.5713 0.6349 0.0104  0.0302  -0.0498 189 LEU A CB    
603  C  CG    . LEU A 83  ? 0.5489 0.5824 0.6435 0.0116  0.0267  -0.0496 189 LEU A CG    
604  C  CD1   . LEU A 83  ? 0.5216 0.5525 0.6100 0.0122  0.0256  -0.0468 189 LEU A CD1   
605  C  CD2   . LEU A 83  ? 0.5532 0.5894 0.6512 0.0127  0.0240  -0.0521 189 LEU A CD2   
606  N  N     . GLN A 84  ? 0.5545 0.5878 0.6589 0.0064  0.0381  -0.0519 190 GLN A N     
607  C  CA    . GLN A 84  ? 0.6145 0.6469 0.7202 0.0049  0.0417  -0.0521 190 GLN A CA    
608  C  C     . GLN A 84  ? 0.5863 0.6167 0.6881 0.0055  0.0425  -0.0502 190 GLN A C     
609  O  O     . GLN A 84  ? 0.5580 0.5893 0.6618 0.0053  0.0440  -0.0512 190 GLN A O     
610  C  CB    . GLN A 84  ? 0.7154 0.7520 0.8281 0.0043  0.0424  -0.0556 190 GLN A CB    
611  C  CG    . GLN A 84  ? 0.7579 0.7970 0.8749 0.0039  0.0412  -0.0578 190 GLN A CG    
612  C  CD    . GLN A 84  ? 0.7995 0.8370 0.9173 0.0016  0.0440  -0.0579 190 GLN A CD    
613  O  OE1   . GLN A 84  ? 0.9231 0.9607 1.0434 0.0000  0.0472  -0.0589 190 GLN A OE1   
614  N  NE2   . GLN A 84  ? 0.7806 0.8161 0.8959 0.0016  0.0430  -0.0569 190 GLN A NE2   
615  N  N     . ILE A 85  ? 0.5498 0.5773 0.6459 0.0063  0.0413  -0.0475 191 ILE A N     
616  C  CA    . ILE A 85  ? 0.5077 0.5327 0.5994 0.0067  0.0419  -0.0454 191 ILE A CA    
617  C  C     . ILE A 85  ? 0.4800 0.5018 0.5701 0.0051  0.0454  -0.0443 191 ILE A C     
618  O  O     . ILE A 85  ? 0.4802 0.4999 0.5686 0.0044  0.0460  -0.0432 191 ILE A O     
619  C  CB    . ILE A 85  ? 0.4785 0.5019 0.5651 0.0080  0.0391  -0.0430 191 ILE A CB    
620  C  CG1   . ILE A 85  ? 0.4697 0.4956 0.5572 0.0096  0.0359  -0.0441 191 ILE A CG1   
621  C  CG2   . ILE A 85  ? 0.4987 0.5189 0.5801 0.0081  0.0400  -0.0405 191 ILE A CG2   
622  C  CD1   . ILE A 85  ? 0.4651 0.4898 0.5480 0.0104  0.0331  -0.0422 191 ILE A CD1   
623  N  N     . SER A 86  ? 0.4759 0.4972 0.5666 0.0045  0.0478  -0.0446 192 SER A N     
624  C  CA    . SER A 86  ? 0.4874 0.5051 0.5759 0.0028  0.0513  -0.0436 192 SER A CA    
625  C  C     . SER A 86  ? 0.4946 0.5083 0.5768 0.0033  0.0514  -0.0407 192 SER A C     
626  O  O     . SER A 86  ? 0.4427 0.4568 0.5227 0.0049  0.0490  -0.0397 192 SER A O     
627  C  CB    . SER A 86  ? 0.4740 0.4932 0.5666 0.0015  0.0542  -0.0458 192 SER A CB    
628  O  OG    . SER A 86  ? 0.4609 0.4809 0.5531 0.0025  0.0540  -0.0460 192 SER A OG    
629  N  N     . GLU A 87  ? 0.5268 0.5366 0.6061 0.0020  0.0541  -0.0394 193 GLU A N     
630  C  CA    . GLU A 87  ? 0.5543 0.5599 0.6274 0.0023  0.0545  -0.0367 193 GLU A CA    
631  C  C     . GLU A 87  ? 0.5088 0.5147 0.5816 0.0027  0.0551  -0.0370 193 GLU A C     
632  O  O     . GLU A 87  ? 0.5178 0.5220 0.5863 0.0037  0.0539  -0.0352 193 GLU A O     
633  C  CB    . GLU A 87  ? 0.6103 0.6111 0.6801 0.0008  0.0572  -0.0353 193 GLU A CB    
634  C  CG    . GLU A 87  ? 0.7040 0.7032 0.7726 0.0007  0.0565  -0.0345 193 GLU A CG    
635  C  CD    . GLU A 87  ? 0.8026 0.8024 0.8689 0.0024  0.0531  -0.0328 193 GLU A CD    
636  O  OE1   . GLU A 87  ? 0.8441 0.8434 0.9071 0.0035  0.0516  -0.0312 193 GLU A OE1   
637  O  OE2   . GLU A 87  ? 0.8183 0.8192 0.8861 0.0026  0.0519  -0.0332 193 GLU A OE2   
638  N  N     . ARG A 88  ? 0.5038 0.5122 0.5813 0.0019  0.0571  -0.0395 194 ARG A N     
639  C  CA    . ARG A 88  ? 0.5415 0.5517 0.6203 0.0025  0.0575  -0.0407 194 ARG A CA    
640  C  C     . ARG A 88  ? 0.5189 0.5312 0.5973 0.0047  0.0537  -0.0405 194 ARG A C     
641  O  O     . ARG A 88  ? 0.4687 0.4792 0.5433 0.0056  0.0532  -0.0392 194 ARG A O     
642  C  CB    . ARG A 88  ? 0.5723 0.5863 0.6578 0.0015  0.0595  -0.0440 194 ARG A CB    
643  C  CG    . ARG A 88  ? 0.6121 0.6267 0.6987 0.0013  0.0617  -0.0452 194 ARG A CG    
644  C  CD    . ARG A 88  ? 0.6177 0.6367 0.7116 0.0001  0.0638  -0.0487 194 ARG A CD    
645  N  NE    . ARG A 88  ? 0.6557 0.6778 0.7525 0.0012  0.0638  -0.0507 194 ARG A NE    
646  C  CZ    . ARG A 88  ? 0.6107 0.6384 0.7146 0.0016  0.0635  -0.0540 194 ARG A CZ    
647  N  NH1   . ARG A 88  ? 0.6269 0.6576 0.7358 0.0007  0.0634  -0.0559 194 ARG A NH1   
648  N  NH2   . ARG A 88  ? 0.6524 0.6825 0.7584 0.0029  0.0634  -0.0556 194 ARG A NH2   
649  N  N     . ASP A 89  ? 0.4976 0.5133 0.5794 0.0055  0.0512  -0.0418 195 ASP A N     
650  C  CA    . ASP A 89  ? 0.5034 0.5208 0.5846 0.0075  0.0475  -0.0417 195 ASP A CA    
651  C  C     . ASP A 89  ? 0.4661 0.4801 0.5407 0.0082  0.0457  -0.0385 195 ASP A C     
652  O  O     . ASP A 89  ? 0.4473 0.4606 0.5191 0.0094  0.0441  -0.0377 195 ASP A O     
653  C  CB    . ASP A 89  ? 0.5032 0.5241 0.5884 0.0079  0.0452  -0.0433 195 ASP A CB    
654  C  CG    . ASP A 89  ? 0.5362 0.5611 0.6283 0.0075  0.0462  -0.0466 195 ASP A CG    
655  O  OD1   . ASP A 89  ? 0.5517 0.5781 0.6462 0.0078  0.0472  -0.0482 195 ASP A OD1   
656  O  OD2   . ASP A 89  ? 0.5892 0.6160 0.6847 0.0069  0.0457  -0.0479 195 ASP A OD2   
657  N  N     . VAL A 90  ? 0.4221 0.4339 0.4942 0.0075  0.0460  -0.0368 196 VAL A N     
658  C  CA    . VAL A 90  ? 0.4247 0.4337 0.4910 0.0080  0.0445  -0.0339 196 VAL A CA    
659  C  C     . VAL A 90  ? 0.4430 0.4488 0.5048 0.0081  0.0454  -0.0323 196 VAL A C     
660  O  O     . VAL A 90  ? 0.4097 0.4147 0.4680 0.0092  0.0432  -0.0310 196 VAL A O     
661  C  CB    . VAL A 90  ? 0.3964 0.4035 0.4613 0.0072  0.0452  -0.0326 196 VAL A CB    
662  C  CG1   . VAL A 90  ? 0.3875 0.3913 0.4465 0.0075  0.0444  -0.0297 196 VAL A CG1   
663  C  CG2   . VAL A 90  ? 0.4118 0.4218 0.4798 0.0075  0.0434  -0.0338 196 VAL A CG2   
664  N  N     . LEU A 91  ? 0.4370 0.4406 0.4986 0.0069  0.0487  -0.0324 197 LEU A N     
665  C  CA    . LEU A 91  ? 0.4502 0.4506 0.5078 0.0068  0.0500  -0.0312 197 LEU A CA    
666  C  C     . LEU A 91  ? 0.4090 0.4112 0.4676 0.0080  0.0491  -0.0324 197 LEU A C     
667  O  O     . LEU A 91  ? 0.4129 0.4128 0.4672 0.0086  0.0483  -0.0309 197 LEU A O     
668  C  CB    . LEU A 91  ? 0.4725 0.4707 0.5304 0.0051  0.0540  -0.0317 197 LEU A CB    
669  C  CG    . LEU A 91  ? 0.4862 0.4797 0.5396 0.0041  0.0554  -0.0295 197 LEU A CG    
670  C  CD1   . LEU A 91  ? 0.4887 0.4801 0.5425 0.0024  0.0594  -0.0303 197 LEU A CD1   
671  C  CD2   . LEU A 91  ? 0.4850 0.4748 0.5320 0.0048  0.0542  -0.0267 197 LEU A CD2   
672  N  N     . CYS A 92  ? 0.4025 0.4086 0.4667 0.0083  0.0492  -0.0352 198 CYS A N     
673  C  CA    . CYS A 92  ? 0.4204 0.4283 0.4857 0.0097  0.0479  -0.0365 198 CYS A CA    
674  C  C     . CYS A 92  ? 0.4092 0.4168 0.4713 0.0112  0.0440  -0.0352 198 CYS A C     
675  O  O     . CYS A 92  ? 0.4044 0.4106 0.4634 0.0122  0.0430  -0.0346 198 CYS A O     
676  C  CB    . CYS A 92  ? 0.4542 0.4667 0.5266 0.0099  0.0485  -0.0400 198 CYS A CB    
677  S  SG    . CYS A 92  ? 0.4787 0.4914 0.5547 0.0078  0.0536  -0.0417 198 CYS A SG    
678  N  N     . VAL A 93  ? 0.3718 0.3805 0.4341 0.0113  0.0419  -0.0346 199 VAL A N     
679  C  CA    . VAL A 93  ? 0.3786 0.3870 0.4377 0.0124  0.0384  -0.0334 199 VAL A CA    
680  C  C     . VAL A 93  ? 0.3695 0.3739 0.4221 0.0122  0.0381  -0.0303 199 VAL A C     
681  O  O     . VAL A 93  ? 0.3725 0.3755 0.4214 0.0131  0.0362  -0.0294 199 VAL A O     
682  C  CB    . VAL A 93  ? 0.3759 0.3865 0.4370 0.0124  0.0365  -0.0337 199 VAL A CB    
683  C  CG1   . VAL A 93  ? 0.3774 0.3872 0.4343 0.0132  0.0333  -0.0320 199 VAL A CG1   
684  C  CG2   . VAL A 93  ? 0.3735 0.3881 0.4408 0.0129  0.0360  -0.0368 199 VAL A CG2   
685  N  N     . GLN A 94  ? 0.3450 0.3475 0.3961 0.0110  0.0401  -0.0289 200 GLN A N     
686  C  CA    . GLN A 94  ? 0.3621 0.3608 0.4073 0.0107  0.0401  -0.0262 200 GLN A CA    
687  C  C     . GLN A 94  ? 0.3602 0.3562 0.4022 0.0110  0.0409  -0.0257 200 GLN A C     
688  O  O     . GLN A 94  ? 0.3711 0.3650 0.4085 0.0114  0.0392  -0.0240 200 GLN A O     
689  C  CB    . GLN A 94  ? 0.3672 0.3640 0.4118 0.0096  0.0422  -0.0252 200 GLN A CB    
690  C  CG    . GLN A 94  ? 0.3752 0.3731 0.4201 0.0095  0.0407  -0.0245 200 GLN A CG    
691  C  CD    . GLN A 94  ? 0.4145 0.4101 0.4584 0.0086  0.0427  -0.0235 200 GLN A CD    
692  O  OE1   . GLN A 94  ? 0.4653 0.4605 0.5117 0.0077  0.0452  -0.0247 200 GLN A OE1   
693  N  NE2   . GLN A 94  ? 0.4023 0.3963 0.4427 0.0087  0.0415  -0.0214 200 GLN A NE2   
694  N  N     . ILE A 95  ? 0.3713 0.3676 0.4159 0.0107  0.0434  -0.0274 201 ILE A N     
695  C  CA    . ILE A 95  ? 0.3837 0.3778 0.4258 0.0110  0.0445  -0.0273 201 ILE A CA    
696  C  C     . ILE A 95  ? 0.3549 0.3500 0.3964 0.0125  0.0418  -0.0279 201 ILE A C     
697  O  O     . ILE A 95  ? 0.3557 0.3478 0.3926 0.0129  0.0413  -0.0267 201 ILE A O     
698  C  CB    . ILE A 95  ? 0.4029 0.3977 0.4487 0.0102  0.0481  -0.0294 201 ILE A CB    
699  C  CG1   . ILE A 95  ? 0.4276 0.4193 0.4714 0.0086  0.0510  -0.0281 201 ILE A CG1   
700  C  CG2   . ILE A 95  ? 0.4090 0.4025 0.4533 0.0108  0.0492  -0.0300 201 ILE A CG2   
701  C  CD1   . ILE A 95  ? 0.4525 0.4458 0.5012 0.0073  0.0544  -0.0304 201 ILE A CD1   
702  N  N     . ALA A 96  ? 0.3306 0.3295 0.3767 0.0134  0.0402  -0.0299 202 ALA A N     
703  C  CA    . ALA A 96  ? 0.3561 0.3556 0.4014 0.0149  0.0375  -0.0307 202 ALA A CA    
704  C  C     . ALA A 96  ? 0.3519 0.3491 0.3916 0.0151  0.0345  -0.0281 202 ALA A C     
705  O  O     . ALA A 96  ? 0.3280 0.3232 0.3640 0.0160  0.0329  -0.0275 202 ALA A O     
706  C  CB    . ALA A 96  ? 0.3853 0.3891 0.4364 0.0158  0.0361  -0.0333 202 ALA A CB    
707  N  N     . GLY A 97  ? 0.3531 0.3505 0.3920 0.0143  0.0339  -0.0267 203 GLY A N     
708  C  CA    . GLY A 97  ? 0.3698 0.3655 0.4039 0.0142  0.0315  -0.0244 203 GLY A CA    
709  C  C     . GLY A 97  ? 0.3524 0.3442 0.3810 0.0138  0.0321  -0.0223 203 GLY A C     
710  O  O     . GLY A 97  ? 0.3538 0.3436 0.3780 0.0142  0.0299  -0.0211 203 GLY A O     
711  N  N     . LEU A 98  ? 0.3563 0.3467 0.3850 0.0130  0.0349  -0.0219 204 LEU A N     
712  C  CA    . LEU A 98  ? 0.3497 0.3360 0.3732 0.0125  0.0358  -0.0199 204 LEU A CA    
713  C  C     . LEU A 98  ? 0.3320 0.3164 0.3533 0.0133  0.0358  -0.0203 204 LEU A C     
714  O  O     . LEU A 98  ? 0.3151 0.2964 0.3311 0.0132  0.0347  -0.0185 204 LEU A O     
715  C  CB    . LEU A 98  ? 0.3640 0.3493 0.3885 0.0115  0.0389  -0.0198 204 LEU A CB    
716  C  CG    . LEU A 98  ? 0.3963 0.3770 0.4152 0.0109  0.0399  -0.0176 204 LEU A CG    
717  C  CD1   . LEU A 98  ? 0.4059 0.3855 0.4214 0.0106  0.0380  -0.0153 204 LEU A CD1   
718  C  CD2   . LEU A 98  ? 0.4259 0.4053 0.4462 0.0100  0.0434  -0.0182 204 LEU A CD2   
719  N  N     . CYS A 99  ? 0.3354 0.3218 0.3608 0.0141  0.0367  -0.0228 205 CYS A N     
720  C  CA    . CYS A 99  ? 0.3715 0.3562 0.3953 0.0149  0.0372  -0.0237 205 CYS A CA    
721  C  C     . CYS A 99  ? 0.3765 0.3623 0.4005 0.0165  0.0343  -0.0248 205 CYS A C     
722  O  O     . CYS A 99  ? 0.3755 0.3601 0.3986 0.0176  0.0344  -0.0258 205 CYS A O     
723  C  CB    . CYS A 99  ? 0.3901 0.3761 0.4182 0.0147  0.0408  -0.0258 205 CYS A CB    
724  S  SG    . CYS A 99  ? 0.4069 0.3900 0.4332 0.0127  0.0446  -0.0244 205 CYS A SG    
725  N  N     . HIS A 100 ? 0.3599 0.3475 0.3845 0.0167  0.0316  -0.0246 206 HIS A N     
726  C  CA    . HIS A 100 ? 0.3589 0.3475 0.3840 0.0182  0.0287  -0.0259 206 HIS A CA    
727  C  C     . HIS A 100 ? 0.3675 0.3524 0.3867 0.0189  0.0268  -0.0248 206 HIS A C     
728  O  O     . HIS A 100 ? 0.3677 0.3527 0.3873 0.0204  0.0249  -0.0263 206 HIS A O     
729  C  CB    . HIS A 100 ? 0.3395 0.3303 0.3657 0.0180  0.0263  -0.0257 206 HIS A CB    
730  C  CG    . HIS A 100 ? 0.3251 0.3136 0.3457 0.0173  0.0241  -0.0231 206 HIS A CG    
731  N  ND1   . HIS A 100 ? 0.3109 0.2982 0.3292 0.0159  0.0251  -0.0209 206 HIS A ND1   
732  C  CD2   . HIS A 100 ? 0.3109 0.2979 0.3278 0.0177  0.0209  -0.0225 206 HIS A CD2   
733  C  CE1   . HIS A 100 ? 0.3188 0.3044 0.3324 0.0154  0.0227  -0.0191 206 HIS A CE1   
734  N  NE2   . HIS A 100 ? 0.3090 0.2943 0.3215 0.0164  0.0202  -0.0200 206 HIS A NE2   
735  N  N     . ASP A 101 ? 0.3529 0.3343 0.3667 0.0179  0.0270  -0.0222 207 ASP A N     
736  C  CA    . ASP A 101 ? 0.3412 0.3189 0.3490 0.0182  0.0250  -0.0209 207 ASP A CA    
737  C  C     . ASP A 101 ? 0.3508 0.3252 0.3557 0.0181  0.0273  -0.0204 207 ASP A C     
738  O  O     . ASP A 101 ? 0.3395 0.3102 0.3387 0.0180  0.0261  -0.0188 207 ASP A O     
739  C  CB    . ASP A 101 ? 0.3445 0.3207 0.3477 0.0171  0.0227  -0.0184 207 ASP A CB    
740  C  CG    . ASP A 101 ? 0.3542 0.3317 0.3573 0.0176  0.0193  -0.0188 207 ASP A CG    
741  O  OD1   . ASP A 101 ? 0.3750 0.3530 0.3797 0.0191  0.0181  -0.0208 207 ASP A OD1   
742  O  OD2   . ASP A 101 ? 0.2980 0.2756 0.2988 0.0163  0.0179  -0.0171 207 ASP A OD2   
743  N  N     . LEU A 102 ? 0.3653 0.3409 0.3738 0.0179  0.0306  -0.0216 208 LEU A N     
744  C  CA    . LEU A 102 ? 0.4028 0.3751 0.4083 0.0178  0.0329  -0.0213 208 LEU A CA    
745  C  C     . LEU A 102 ? 0.4194 0.3891 0.4217 0.0193  0.0318  -0.0220 208 LEU A C     
746  O  O     . LEU A 102 ? 0.4375 0.4033 0.4352 0.0191  0.0328  -0.0209 208 LEU A O     
747  C  CB    . LEU A 102 ? 0.4079 0.3821 0.4182 0.0176  0.0367  -0.0232 208 LEU A CB    
748  C  CG    . LEU A 102 ? 0.4063 0.3809 0.4179 0.0159  0.0390  -0.0222 208 LEU A CG    
749  C  CD1   . LEU A 102 ? 0.4191 0.3960 0.4360 0.0157  0.0425  -0.0245 208 LEU A CD1   
750  C  CD2   . LEU A 102 ? 0.3997 0.3697 0.4052 0.0148  0.0399  -0.0197 208 LEU A CD2   
751  N  N     . GLY A 103 ? 0.4195 0.3912 0.4242 0.0209  0.0296  -0.0238 209 GLY A N     
752  C  CA    . GLY A 103 ? 0.4344 0.4036 0.4363 0.0225  0.0282  -0.0246 209 GLY A CA    
753  C  C     . GLY A 103 ? 0.4340 0.3993 0.4291 0.0226  0.0247  -0.0227 209 GLY A C     
754  O  O     . GLY A 103 ? 0.4114 0.3744 0.4040 0.0240  0.0233  -0.0234 209 GLY A O     
755  N  N     . HIS A 104 ? 0.4190 0.3837 0.4114 0.0211  0.0233  -0.0203 210 HIS A N     
756  C  CA    . HIS A 104 ? 0.4143 0.3752 0.4001 0.0209  0.0202  -0.0185 210 HIS A CA    
757  C  C     . HIS A 104 ? 0.4159 0.3721 0.3964 0.0208  0.0212  -0.0175 210 HIS A C     
758  O  O     . HIS A 104 ? 0.4146 0.3702 0.3954 0.0202  0.0242  -0.0172 210 HIS A O     
759  C  CB    . HIS A 104 ? 0.4148 0.3759 0.3984 0.0191  0.0185  -0.0162 210 HIS A CB    
760  C  CG    . HIS A 104 ? 0.4325 0.3960 0.4180 0.0194  0.0159  -0.0169 210 HIS A CG    
761  N  ND1   . HIS A 104 ? 0.4119 0.3734 0.3942 0.0203  0.0129  -0.0172 210 HIS A ND1   
762  C  CD2   . HIS A 104 ? 0.4601 0.4276 0.4500 0.0188  0.0160  -0.0173 210 HIS A CD2   
763  C  CE1   . HIS A 104 ? 0.4705 0.4344 0.4550 0.0203  0.0112  -0.0178 210 HIS A CE1   
764  N  NE2   . HIS A 104 ? 0.4929 0.4606 0.4821 0.0194  0.0130  -0.0179 210 HIS A NE2   
765  N  N     . GLY A 105 ? 0.4126 0.3651 0.3878 0.0215  0.0187  -0.0171 211 GLY A N     
766  C  CA    . GLY A 105 ? 0.3949 0.3425 0.3643 0.0214  0.0191  -0.0160 211 GLY A CA    
767  C  C     . GLY A 105 ? 0.3818 0.3263 0.3450 0.0198  0.0168  -0.0133 211 GLY A C     
768  O  O     . GLY A 105 ? 0.3601 0.3069 0.3243 0.0186  0.0154  -0.0122 211 GLY A O     
769  N  N     . PRO A 106 ? 0.3716 0.3113 0.3287 0.0196  0.0164  -0.0121 212 PRO A N     
770  C  CA    . PRO A 106 ? 0.3857 0.3223 0.3367 0.0178  0.0143  -0.0094 212 PRO A CA    
771  C  C     . PRO A 106 ? 0.3817 0.3188 0.3314 0.0173  0.0110  -0.0089 212 PRO A C     
772  O  O     . PRO A 106 ? 0.3741 0.3105 0.3237 0.0189  0.0093  -0.0104 212 PRO A O     
773  C  CB    . PRO A 106 ? 0.3933 0.3243 0.3381 0.0184  0.0139  -0.0091 212 PRO A CB    
774  C  CG    . PRO A 106 ? 0.3957 0.3271 0.3436 0.0201  0.0169  -0.0113 212 PRO A CG    
775  C  CD    . PRO A 106 ? 0.3949 0.3319 0.3507 0.0209  0.0184  -0.0132 212 PRO A CD    
776  N  N     . PHE A 107 ? 0.3861 0.3243 0.3349 0.0153  0.0101  -0.0070 213 PHE A N     
777  C  CA    . PHE A 107 ? 0.4229 0.3618 0.3703 0.0143  0.0072  -0.0063 213 PHE A CA    
778  C  C     . PHE A 107 ? 0.4051 0.3480 0.3580 0.0155  0.0069  -0.0083 213 PHE A C     
779  O  O     . PHE A 107 ? 0.4352 0.3777 0.3865 0.0154  0.0044  -0.0084 213 PHE A O     
780  C  CB    . PHE A 107 ? 0.4471 0.3805 0.3869 0.0140  0.0044  -0.0054 213 PHE A CB    
781  C  CG    . PHE A 107 ? 0.4664 0.3963 0.4010 0.0126  0.0046  -0.0034 213 PHE A CG    
782  C  CD1   . PHE A 107 ? 0.4591 0.3863 0.3923 0.0136  0.0064  -0.0037 213 PHE A CD1   
783  C  CD2   . PHE A 107 ? 0.4830 0.4128 0.4147 0.0102  0.0032  -0.0013 213 PHE A CD2   
784  C  CE1   . PHE A 107 ? 0.4761 0.4001 0.4046 0.0122  0.0066  -0.0019 213 PHE A CE1   
785  C  CE2   . PHE A 107 ? 0.4970 0.4239 0.4243 0.0089  0.0034  0.0004  213 PHE A CE2   
786  C  CZ    . PHE A 107 ? 0.4798 0.4037 0.4054 0.0099  0.0050  0.0002  213 PHE A CZ    
787  N  N     . SER A 108 ? 0.3826 0.3290 0.3417 0.0166  0.0095  -0.0099 214 SER A N     
788  C  CA    . SER A 108 ? 0.3890 0.3397 0.3539 0.0173  0.0094  -0.0116 214 SER A CA    
789  C  C     . SER A 108 ? 0.3943 0.3437 0.3582 0.0190  0.0068  -0.0131 214 SER A C     
790  O  O     . SER A 108 ? 0.3940 0.3412 0.3571 0.0208  0.0069  -0.0145 214 SER A O     
791  C  CB    . SER A 108 ? 0.3671 0.3208 0.3334 0.0155  0.0090  -0.0102 214 SER A CB    
792  O  OG    . SER A 108 ? 0.3329 0.2887 0.3019 0.0146  0.0116  -0.0095 214 SER A OG    
793  N  N     . HIS A 109 ? 0.4155 0.3658 0.3791 0.0185  0.0045  -0.0130 215 HIS A N     
794  C  CA    . HIS A 109 ? 0.4489 0.3979 0.4118 0.0203  0.0020  -0.0147 215 HIS A CA    
795  C  C     . HIS A 109 ? 0.4549 0.3979 0.4109 0.0211  0.0000  -0.0144 215 HIS A C     
796  O  O     . HIS A 109 ? 0.4264 0.3682 0.3824 0.0232  -0.0016 -0.0162 215 HIS A O     
797  C  CB    . HIS A 109 ? 0.4460 0.3970 0.4096 0.0196  0.0000  -0.0147 215 HIS A CB    
798  C  CG    . HIS A 109 ? 0.4555 0.4120 0.4267 0.0202  0.0013  -0.0164 215 HIS A CG    
799  N  ND1   . HIS A 109 ? 0.4756 0.4340 0.4517 0.0225  0.0016  -0.0190 215 HIS A ND1   
800  C  CD2   . HIS A 109 ? 0.4664 0.4268 0.4412 0.0188  0.0026  -0.0158 215 HIS A CD2   
801  C  CE1   . HIS A 109 ? 0.4771 0.4403 0.4593 0.0224  0.0030  -0.0200 215 HIS A CE1   
802  N  NE2   . HIS A 109 ? 0.4640 0.4283 0.4454 0.0202  0.0036  -0.0181 215 HIS A NE2   
803  N  N     . MET A 110 ? 0.4488 0.3882 0.3990 0.0195  -0.0001 -0.0122 216 MET A N     
804  C  CA    . MET A 110 ? 0.4871 0.4206 0.4310 0.0204  -0.0015 -0.0120 216 MET A CA    
805  C  C     . MET A 110 ? 0.4899 0.4234 0.4368 0.0231  0.0000  -0.0143 216 MET A C     
806  O  O     . MET A 110 ? 0.4861 0.4162 0.4302 0.0250  -0.0017 -0.0155 216 MET A O     
807  C  CB    . MET A 110 ? 0.4920 0.4223 0.4304 0.0183  -0.0012 -0.0095 216 MET A CB    
808  C  CG    . MET A 110 ? 0.4941 0.4178 0.4249 0.0186  -0.0032 -0.0090 216 MET A CG    
809  S  SD    . MET A 110 ? 0.5093 0.4297 0.4359 0.0175  -0.0015 -0.0072 216 MET A SD    
810  C  CE    . MET A 110 ? 0.5238 0.4466 0.4565 0.0202  0.0017  -0.0097 216 MET A CE    
811  N  N     . PHE A 111 ? 0.4707 0.4080 0.4232 0.0233  0.0033  -0.0151 217 PHE A N     
812  C  CA    . PHE A 111 ? 0.4747 0.4121 0.4299 0.0253  0.0054  -0.0170 217 PHE A CA    
813  C  C     . PHE A 111 ? 0.4857 0.4254 0.4455 0.0280  0.0046  -0.0200 217 PHE A C     
814  O  O     . PHE A 111 ? 0.5223 0.4593 0.4804 0.0300  0.0040  -0.0214 217 PHE A O     
815  C  CB    . PHE A 111 ? 0.4657 0.4061 0.4249 0.0244  0.0094  -0.0168 217 PHE A CB    
816  C  CG    . PHE A 111 ? 0.4447 0.3833 0.4037 0.0258  0.0117  -0.0180 217 PHE A CG    
817  C  CD1   . PHE A 111 ? 0.4593 0.3924 0.4114 0.0255  0.0111  -0.0167 217 PHE A CD1   
818  C  CD2   . PHE A 111 ? 0.4513 0.3936 0.4168 0.0272  0.0143  -0.0205 217 PHE A CD2   
819  C  CE1   . PHE A 111 ? 0.4455 0.3766 0.3968 0.0268  0.0133  -0.0178 217 PHE A CE1   
820  C  CE2   . PHE A 111 ? 0.4534 0.3940 0.4185 0.0283  0.0166  -0.0217 217 PHE A CE2   
821  C  CZ    . PHE A 111 ? 0.4529 0.3878 0.4108 0.0281  0.0162  -0.0203 217 PHE A CZ    
822  N  N     . ASP A 112 ? 0.4883 0.4328 0.4538 0.0280  0.0046  -0.0210 218 ASP A N     
823  C  CA    . ASP A 112 ? 0.4857 0.4327 0.4560 0.0305  0.0035  -0.0239 218 ASP A CA    
824  C  C     . ASP A 112 ? 0.5018 0.4460 0.4682 0.0312  -0.0006 -0.0240 218 ASP A C     
825  O  O     . ASP A 112 ? 0.4944 0.4387 0.4625 0.0337  -0.0023 -0.0263 218 ASP A O     
826  C  CB    . ASP A 112 ? 0.4874 0.4410 0.4665 0.0305  0.0057  -0.0256 218 ASP A CB    
827  C  CG    . ASP A 112 ? 0.4897 0.4457 0.4698 0.0283  0.0054  -0.0240 218 ASP A CG    
828  O  OD1   . ASP A 112 ? 0.4986 0.4518 0.4730 0.0266  0.0036  -0.0216 218 ASP A OD1   
829  O  OD2   . ASP A 112 ? 0.5070 0.4679 0.4937 0.0284  0.0070  -0.0253 218 ASP A OD2   
830  N  N     . GLY A 113 ? 0.5041 0.4458 0.4651 0.0291  -0.0024 -0.0215 219 GLY A N     
831  C  CA    . GLY A 113 ? 0.4790 0.4173 0.4351 0.0293  -0.0064 -0.0212 219 GLY A CA    
832  C  C     . GLY A 113 ? 0.4864 0.4181 0.4352 0.0303  -0.0085 -0.0208 219 GLY A C     
833  O  O     . GLY A 113 ? 0.4945 0.4235 0.4410 0.0321  -0.0115 -0.0220 219 GLY A O     
834  N  N     . ARG A 114 ? 0.4629 0.3917 0.4078 0.0293  -0.0072 -0.0194 220 ARG A N     
835  C  CA    . ARG A 114 ? 0.4772 0.3992 0.4144 0.0301  -0.0094 -0.0189 220 ARG A CA    
836  C  C     . ARG A 114 ? 0.4952 0.4158 0.4327 0.0319  -0.0074 -0.0200 220 ARG A C     
837  O  O     . ARG A 114 ? 0.5388 0.4565 0.4748 0.0346  -0.0089 -0.0218 220 ARG A O     
838  C  CB    . ARG A 114 ? 0.4832 0.4014 0.4133 0.0270  -0.0104 -0.0158 220 ARG A CB    
839  C  CG    . ARG A 114 ? 0.5155 0.4343 0.4441 0.0250  -0.0124 -0.0145 220 ARG A CG    
840  C  CD    . ARG A 114 ? 0.5261 0.4418 0.4482 0.0217  -0.0130 -0.0116 220 ARG A CD    
841  N  NE    . ARG A 114 ? 0.5454 0.4622 0.4663 0.0194  -0.0145 -0.0104 220 ARG A NE    
842  C  CZ    . ARG A 114 ? 0.5655 0.4785 0.4814 0.0193  -0.0177 -0.0103 220 ARG A CZ    
843  N  NH1   . ARG A 114 ? 0.5763 0.4903 0.4910 0.0170  -0.0187 -0.0092 220 ARG A NH1   
844  N  NH2   . ARG A 114 ? 0.5527 0.4605 0.4645 0.0215  -0.0200 -0.0114 220 ARG A NH2   
845  N  N     . PHE A 115 ? 0.4870 0.4095 0.4265 0.0307  -0.0040 -0.0192 221 PHE A N     
846  C  CA    . PHE A 115 ? 0.5119 0.4321 0.4502 0.0320  -0.0022 -0.0199 221 PHE A CA    
847  C  C     . PHE A 115 ? 0.5195 0.4423 0.4636 0.0352  -0.0010 -0.0233 221 PHE A C     
848  O  O     . PHE A 115 ? 0.5517 0.4709 0.4929 0.0374  -0.0022 -0.0246 221 PHE A O     
849  C  CB    . PHE A 115 ? 0.5211 0.4424 0.4597 0.0298  0.0009  -0.0182 221 PHE A CB    
850  C  CG    . PHE A 115 ? 0.5133 0.4320 0.4502 0.0309  0.0030  -0.0189 221 PHE A CG    
851  C  CD1   . PHE A 115 ? 0.5485 0.4608 0.4776 0.0308  0.0015  -0.0177 221 PHE A CD1   
852  C  CD2   . PHE A 115 ? 0.5082 0.4309 0.4514 0.0319  0.0066  -0.0207 221 PHE A CD2   
853  C  CE1   . PHE A 115 ? 0.5349 0.4447 0.4622 0.0318  0.0036  -0.0183 221 PHE A CE1   
854  C  CE2   . PHE A 115 ? 0.5168 0.4371 0.4583 0.0327  0.0088  -0.0213 221 PHE A CE2   
855  C  CZ    . PHE A 115 ? 0.5244 0.4382 0.4579 0.0328  0.0073  -0.0201 221 PHE A CZ    
856  N  N     . ILE A 116 ? 0.5305 0.4596 0.4827 0.0355  0.0012  -0.0248 222 ILE A N     
857  C  CA    . ILE A 116 ? 0.5598 0.4921 0.5181 0.0382  0.0028  -0.0281 222 ILE A CA    
858  C  C     . ILE A 116 ? 0.5918 0.5231 0.5502 0.0412  -0.0005 -0.0304 222 ILE A C     
859  O  O     . ILE A 116 ? 0.6140 0.5449 0.5739 0.0439  -0.0002 -0.0328 222 ILE A O     
860  C  CB    . ILE A 116 ? 0.5687 0.5082 0.5359 0.0375  0.0061  -0.0292 222 ILE A CB    
861  C  CG1   . ILE A 116 ? 0.5694 0.5092 0.5363 0.0352  0.0099  -0.0275 222 ILE A CG1   
862  C  CG2   . ILE A 116 ? 0.5614 0.5052 0.5360 0.0403  0.0073  -0.0330 222 ILE A CG2   
863  C  CD1   . ILE A 116 ? 0.5377 0.4752 0.5030 0.0360  0.0124  -0.0282 222 ILE A CD1   
864  N  N     . PRO A 117 ? 0.6036 0.5343 0.5604 0.0408  -0.0038 -0.0297 223 PRO A N     
865  C  CA    . PRO A 117 ? 0.6423 0.5706 0.5976 0.0437  -0.0075 -0.0316 223 PRO A CA    
866  C  C     . PRO A 117 ? 0.6570 0.5780 0.6043 0.0451  -0.0097 -0.0313 223 PRO A C     
867  O  O     . PRO A 117 ? 0.6891 0.6092 0.6374 0.0484  -0.0108 -0.0339 223 PRO A O     
868  C  CB    . PRO A 117 ? 0.6466 0.5745 0.5999 0.0422  -0.0104 -0.0302 223 PRO A CB    
869  C  CG    . PRO A 117 ? 0.6330 0.5668 0.5922 0.0399  -0.0075 -0.0294 223 PRO A CG    
870  C  CD    . PRO A 117 ? 0.6237 0.5574 0.5823 0.0383  -0.0039 -0.0281 223 PRO A CD    
871  N  N     . LEU A 118 ? 0.6205 0.5364 0.5601 0.0426  -0.0101 -0.0282 224 LEU A N     
872  C  CA    . LEU A 118 ? 0.6268 0.5360 0.5590 0.0436  -0.0115 -0.0279 224 LEU A CA    
873  C  C     . LEU A 118 ? 0.6261 0.5357 0.5603 0.0452  -0.0084 -0.0294 224 LEU A C     
874  O  O     . LEU A 118 ? 0.6846 0.5907 0.6163 0.0479  -0.0096 -0.0310 224 LEU A O     
875  C  CB    . LEU A 118 ? 0.6476 0.5516 0.5714 0.0404  -0.0125 -0.0244 224 LEU A CB    
876  C  CG    . LEU A 118 ? 0.6515 0.5536 0.5715 0.0387  -0.0158 -0.0227 224 LEU A CG    
877  C  CD1   . LEU A 118 ? 0.6466 0.5437 0.5585 0.0355  -0.0165 -0.0195 224 LEU A CD1   
878  C  CD2   . LEU A 118 ? 0.6556 0.5540 0.5728 0.0414  -0.0198 -0.0244 224 LEU A CD2   
879  N  N     . ALA A 119 ? 0.6162 0.5299 0.5547 0.0436  -0.0043 -0.0290 225 ALA A N     
880  C  CA    . ALA A 119 ? 0.5649 0.4779 0.5037 0.0446  -0.0013 -0.0300 225 ALA A CA    
881  C  C     . ALA A 119 ? 0.5598 0.4779 0.5067 0.0475  0.0005  -0.0336 225 ALA A C     
882  O  O     . ALA A 119 ? 0.5257 0.4429 0.4727 0.0489  0.0025  -0.0351 225 ALA A O     
883  C  CB    . ALA A 119 ? 0.5599 0.4741 0.4987 0.0415  0.0020  -0.0277 225 ALA A CB    
884  N  N     . ARG A 120 ? 0.5999 0.5237 0.5539 0.0481  0.0002  -0.0353 226 ARG A N     
885  C  CA    . ARG A 120 ? 0.6467 0.5761 0.6093 0.0506  0.0023  -0.0389 226 ARG A CA    
886  C  C     . ARG A 120 ? 0.6869 0.6195 0.6542 0.0527  -0.0004 -0.0411 226 ARG A C     
887  O  O     . ARG A 120 ? 0.7130 0.6520 0.6878 0.0521  0.0009  -0.0421 226 ARG A O     
888  C  CB    . ARG A 120 ? 0.6408 0.5756 0.6095 0.0487  0.0072  -0.0390 226 ARG A CB    
889  C  CG    . ARG A 120 ? 0.6266 0.5585 0.5921 0.0484  0.0103  -0.0386 226 ARG A CG    
890  C  CD    . ARG A 120 ? 0.6157 0.5526 0.5872 0.0468  0.0150  -0.0391 226 ARG A CD    
891  N  NE    . ARG A 120 ? 0.5885 0.5313 0.5686 0.0489  0.0170  -0.0429 226 ARG A NE    
892  C  CZ    . ARG A 120 ? 0.6223 0.5703 0.6088 0.0476  0.0212  -0.0438 226 ARG A CZ    
893  N  NH1   . ARG A 120 ? 0.6281 0.5763 0.6138 0.0443  0.0236  -0.0413 226 ARG A NH1   
894  N  NH2   . ARG A 120 ? 0.6640 0.6172 0.6582 0.0495  0.0228  -0.0474 226 ARG A NH2   
895  N  N     . PRO A 121 ? 0.7573 0.6854 0.7201 0.0552  -0.0045 -0.0419 227 PRO A N     
896  C  CA    . PRO A 121 ? 0.7522 0.6820 0.7179 0.0573  -0.0080 -0.0438 227 PRO A CA    
897  C  C     . PRO A 121 ? 0.7296 0.6664 0.7055 0.0600  -0.0065 -0.0478 227 PRO A C     
898  O  O     . PRO A 121 ? 0.6777 0.6179 0.6581 0.0610  -0.0085 -0.0493 227 PRO A O     
899  C  CB    . PRO A 121 ? 0.7769 0.6992 0.7346 0.0596  -0.0123 -0.0438 227 PRO A CB    
900  C  CG    . PRO A 121 ? 0.7763 0.6928 0.7265 0.0582  -0.0110 -0.0416 227 PRO A CG    
901  C  CD    . PRO A 121 ? 0.7480 0.6690 0.7030 0.0566  -0.0058 -0.0415 227 PRO A CD    
902  N  N     . GLU A 122 ? 0.7916 0.7307 0.7710 0.0609  -0.0029 -0.0496 228 GLU A N     
903  C  CA    . GLU A 122 ? 0.8549 0.8015 0.8446 0.0627  -0.0005 -0.0533 228 GLU A CA    
904  C  C     . GLU A 122 ? 0.9193 0.8733 0.9171 0.0604  0.0023  -0.0535 228 GLU A C     
905  O  O     . GLU A 122 ? 0.9671 0.9272 0.9734 0.0621  0.0031  -0.0568 228 GLU A O     
906  C  CB    . GLU A 122 ? 0.8634 0.8104 0.8544 0.0639  0.0030  -0.0550 228 GLU A CB    
907  C  CG    . GLU A 122 ? 0.8973 0.8452 0.8883 0.0605  0.0079  -0.0532 228 GLU A CG    
908  C  CD    . GLU A 122 ? 1.0081 0.9484 0.9890 0.0590  0.0078  -0.0499 228 GLU A CD    
909  O  OE1   . GLU A 122 ? 0.9565 0.8906 0.9296 0.0592  0.0037  -0.0480 228 GLU A OE1   
910  O  OE2   . GLU A 122 ? 1.0765 1.0170 1.0573 0.0574  0.0120  -0.0493 228 GLU A OE2   
911  N  N     . VAL A 123 ? 0.9284 0.8820 0.9240 0.0566  0.0043  -0.0502 229 VAL A N     
912  C  CA    . VAL A 123 ? 0.9001 0.8602 0.9031 0.0544  0.0069  -0.0503 229 VAL A CA    
913  C  C     . VAL A 123 ? 0.8554 0.8153 0.8572 0.0534  0.0036  -0.0488 229 VAL A C     
914  O  O     . VAL A 123 ? 0.9609 0.9153 0.9554 0.0536  0.0000  -0.0470 229 VAL A O     
915  C  CB    . VAL A 123 ? 0.9185 0.8788 0.9207 0.0511  0.0115  -0.0481 229 VAL A CB    
916  C  CG1   . VAL A 123 ? 0.9059 0.8650 0.9075 0.0521  0.0145  -0.0494 229 VAL A CG1   
917  C  CG2   . VAL A 123 ? 0.9528 0.9080 0.9469 0.0484  0.0102  -0.0439 229 VAL A CG2   
918  N  N     . LYS A 124 ? 0.7627 0.7287 0.7716 0.0524  0.0046  -0.0497 230 LYS A N     
919  C  CA    . LYS A 124 ? 0.7146 0.6807 0.7223 0.0505  0.0025  -0.0476 230 LYS A CA    
920  C  C     . LYS A 124 ? 0.6852 0.6545 0.6958 0.0471  0.0066  -0.0460 230 LYS A C     
921  O  O     . LYS A 124 ? 0.6859 0.6610 0.7043 0.0470  0.0093  -0.0480 230 LYS A O     
922  C  CB    . LYS A 124 ? 0.6584 0.6281 0.6713 0.0524  -0.0005 -0.0501 230 LYS A CB    
923  N  N     . TRP A 125 ? 0.6222 0.5876 0.6263 0.0445  0.0069  -0.0424 231 TRP A N     
924  C  CA    . TRP A 125 ? 0.5996 0.5669 0.6050 0.0414  0.0104  -0.0404 231 TRP A CA    
925  C  C     . TRP A 125 ? 0.5788 0.5455 0.5816 0.0391  0.0087  -0.0378 231 TRP A C     
926  O  O     . TRP A 125 ? 0.6044 0.5674 0.6018 0.0393  0.0052  -0.0365 231 TRP A O     
927  C  CB    . TRP A 125 ? 0.5969 0.5598 0.5966 0.0403  0.0125  -0.0385 231 TRP A CB    
928  C  CG    . TRP A 125 ? 0.6187 0.5833 0.6199 0.0376  0.0164  -0.0370 231 TRP A CG    
929  C  CD1   . TRP A 125 ? 0.6440 0.6129 0.6515 0.0371  0.0206  -0.0386 231 TRP A CD1   
930  C  CD2   . TRP A 125 ? 0.6124 0.5742 0.6084 0.0350  0.0166  -0.0336 231 TRP A CD2   
931  N  NE1   . TRP A 125 ? 0.6357 0.6039 0.6415 0.0344  0.0232  -0.0362 231 TRP A NE1   
932  C  CE2   . TRP A 125 ? 0.6281 0.5922 0.6272 0.0332  0.0208  -0.0332 231 TRP A CE2   
933  C  CE3   . TRP A 125 ? 0.6283 0.5859 0.6174 0.0339  0.0137  -0.0308 231 TRP A CE3   
934  C  CZ2   . TRP A 125 ? 0.6378 0.6001 0.6333 0.0306  0.0217  -0.0302 231 TRP A CZ2   
935  C  CZ3   . TRP A 125 ? 0.6804 0.6366 0.6663 0.0313  0.0149  -0.0280 231 TRP A CZ3   
936  C  CH2   . TRP A 125 ? 0.6863 0.6448 0.6754 0.0298  0.0187  -0.0276 231 TRP A CH2   
937  N  N     . THR A 126 ? 0.5561 0.5264 0.5627 0.0369  0.0112  -0.0370 232 THR A N     
938  C  CA    . THR A 126 ? 0.5413 0.5113 0.5456 0.0345  0.0104  -0.0344 232 THR A CA    
939  C  C     . THR A 126 ? 0.5051 0.4762 0.5102 0.0320  0.0141  -0.0327 232 THR A C     
940  O  O     . THR A 126 ? 0.5048 0.4786 0.5147 0.0321  0.0176  -0.0342 232 THR A O     
941  C  CB    . THR A 126 ? 0.5532 0.5278 0.5631 0.0346  0.0092  -0.0357 232 THR A CB    
942  O  OG1   . THR A 126 ? 0.5588 0.5386 0.5769 0.0352  0.0121  -0.0383 232 THR A OG1   
943  C  CG2   . THR A 126 ? 0.5577 0.5309 0.5661 0.0367  0.0048  -0.0370 232 THR A CG2   
944  N  N     . HIS A 127 ? 0.4634 0.4325 0.4641 0.0298  0.0135  -0.0297 233 HIS A N     
945  C  CA    . HIS A 127 ? 0.4533 0.4233 0.4546 0.0276  0.0167  -0.0280 233 HIS A CA    
946  C  C     . HIS A 127 ? 0.4721 0.4475 0.4813 0.0273  0.0193  -0.0298 233 HIS A C     
947  O  O     . HIS A 127 ? 0.4144 0.3906 0.4256 0.0264  0.0228  -0.0298 233 HIS A O     
948  C  CB    . HIS A 127 ? 0.4390 0.4064 0.4348 0.0254  0.0156  -0.0247 233 HIS A CB    
949  C  CG    . HIS A 127 ? 0.4531 0.4232 0.4509 0.0245  0.0142  -0.0243 233 HIS A CG    
950  N  ND1   . HIS A 127 ? 0.4571 0.4262 0.4525 0.0250  0.0106  -0.0242 233 HIS A ND1   
951  C  CD2   . HIS A 127 ? 0.4356 0.4092 0.4374 0.0232  0.0158  -0.0240 233 HIS A CD2   
952  C  CE1   . HIS A 127 ? 0.4710 0.4432 0.4691 0.0240  0.0103  -0.0240 233 HIS A CE1   
953  N  NE2   . HIS A 127 ? 0.4529 0.4279 0.4550 0.0229  0.0133  -0.0239 233 HIS A NE2   
954  N  N     . GLU A 128 ? 0.4957 0.4745 0.5093 0.0282  0.0176  -0.0315 234 GLU A N     
955  C  CA    . GLU A 128 ? 0.5096 0.4936 0.5309 0.0279  0.0198  -0.0334 234 GLU A CA    
956  C  C     . GLU A 128 ? 0.5044 0.4905 0.5304 0.0288  0.0229  -0.0359 234 GLU A C     
957  O  O     . GLU A 128 ? 0.4889 0.4772 0.5186 0.0275  0.0263  -0.0362 234 GLU A O     
958  C  CB    . GLU A 128 ? 0.4965 0.4835 0.5214 0.0287  0.0172  -0.0349 234 GLU A CB    
959  C  CG    . GLU A 128 ? 0.4898 0.4755 0.5108 0.0274  0.0147  -0.0326 234 GLU A CG    
960  C  CD    . GLU A 128 ? 0.4991 0.4805 0.5135 0.0282  0.0110  -0.0315 234 GLU A CD    
961  O  OE1   . GLU A 128 ? 0.4937 0.4721 0.5049 0.0295  0.0104  -0.0318 234 GLU A OE1   
962  O  OE2   . GLU A 128 ? 0.4823 0.4633 0.4945 0.0276  0.0086  -0.0305 234 GLU A OE2   
963  N  N     . GLN A 129 ? 0.5327 0.5177 0.5583 0.0310  0.0218  -0.0376 235 GLN A N     
964  C  CA    . GLN A 129 ? 0.5460 0.5330 0.5758 0.0319  0.0249  -0.0401 235 GLN A CA    
965  C  C     . GLN A 129 ? 0.5142 0.4984 0.5405 0.0303  0.0283  -0.0383 235 GLN A C     
966  O  O     . GLN A 129 ? 0.5103 0.4967 0.5406 0.0295  0.0320  -0.0395 235 GLN A O     
967  C  CB    . GLN A 129 ? 0.5877 0.5738 0.6172 0.0347  0.0230  -0.0422 235 GLN A CB    
968  C  CG    . GLN A 129 ? 0.6368 0.6256 0.6699 0.0367  0.0194  -0.0444 235 GLN A CG    
969  C  CD    . GLN A 129 ? 0.6776 0.6635 0.7075 0.0395  0.0164  -0.0455 235 GLN A CD    
970  O  OE1   . GLN A 129 ? 0.7048 0.6884 0.7313 0.0405  0.0123  -0.0450 235 GLN A OE1   
971  N  NE2   . GLN A 129 ? 0.7154 0.7007 0.7457 0.0407  0.0184  -0.0469 235 GLN A NE2   
972  N  N     . GLY A 130 ? 0.4820 0.4610 0.5007 0.0297  0.0270  -0.0355 236 GLY A N     
973  C  CA    . GLY A 130 ? 0.4702 0.4462 0.4850 0.0278  0.0299  -0.0334 236 GLY A CA    
974  C  C     . GLY A 130 ? 0.4636 0.4417 0.4812 0.0256  0.0325  -0.0325 236 GLY A C     
975  O  O     . GLY A 130 ? 0.4724 0.4499 0.4902 0.0245  0.0361  -0.0323 236 GLY A O     
976  N  N     . SER A 131 ? 0.4444 0.4248 0.4640 0.0249  0.0309  -0.0319 237 SER A N     
977  C  CA    . SER A 131 ? 0.4651 0.4471 0.4867 0.0229  0.0330  -0.0309 237 SER A CA    
978  C  C     . SER A 131 ? 0.4784 0.4644 0.5070 0.0227  0.0364  -0.0335 237 SER A C     
979  O  O     . SER A 131 ? 0.4750 0.4608 0.5042 0.0211  0.0396  -0.0329 237 SER A O     
980  C  CB    . SER A 131 ? 0.4305 0.4144 0.4531 0.0223  0.0304  -0.0299 237 SER A CB    
981  O  OG    . SER A 131 ? 0.4330 0.4136 0.4493 0.0222  0.0273  -0.0276 237 SER A OG    
982  N  N     . VAL A 132 ? 0.4809 0.4704 0.5147 0.0244  0.0357  -0.0365 238 VAL A N     
983  C  CA    . VAL A 132 ? 0.4785 0.4722 0.5194 0.0243  0.0388  -0.0393 238 VAL A CA    
984  C  C     . VAL A 132 ? 0.4897 0.4817 0.5296 0.0238  0.0426  -0.0398 238 VAL A C     
985  O  O     . VAL A 132 ? 0.4723 0.4656 0.5151 0.0223  0.0462  -0.0404 238 VAL A O     
986  C  CB    . VAL A 132 ? 0.4828 0.4805 0.5292 0.0265  0.0367  -0.0425 238 VAL A CB    
987  C  CG1   . VAL A 132 ? 0.4740 0.4761 0.5277 0.0267  0.0400  -0.0459 238 VAL A CG1   
988  C  CG2   . VAL A 132 ? 0.4778 0.4778 0.5263 0.0265  0.0338  -0.0424 238 VAL A CG2   
989  N  N     . MET A 133 ? 0.5166 0.5053 0.5519 0.0251  0.0417  -0.0395 239 MET A N     
990  C  CA    . MET A 133 ? 0.5500 0.5365 0.5835 0.0248  0.0452  -0.0399 239 MET A CA    
991  C  C     . MET A 133 ? 0.4994 0.4816 0.5275 0.0226  0.0475  -0.0370 239 MET A C     
992  O  O     . MET A 133 ? 0.4888 0.4705 0.5175 0.0213  0.0513  -0.0374 239 MET A O     
993  C  CB    . MET A 133 ? 0.6124 0.5962 0.6423 0.0270  0.0433  -0.0404 239 MET A CB    
994  C  CG    . MET A 133 ? 0.6381 0.6262 0.6739 0.0296  0.0419  -0.0440 239 MET A CG    
995  S  SD    . MET A 133 ? 0.7488 0.7330 0.7795 0.0324  0.0390  -0.0444 239 MET A SD    
996  C  CE    . MET A 133 ? 0.7254 0.7031 0.7461 0.0320  0.0352  -0.0403 239 MET A CE    
997  N  N     . MET A 134 ? 0.4662 0.4452 0.4888 0.0220  0.0449  -0.0340 240 MET A N     
998  C  CA    . MET A 134 ? 0.4677 0.4427 0.4851 0.0201  0.0463  -0.0311 240 MET A CA    
999  C  C     . MET A 134 ? 0.4422 0.4194 0.4633 0.0182  0.0487  -0.0310 240 MET A C     
1000 O  O     . MET A 134 ? 0.3888 0.3634 0.4075 0.0166  0.0516  -0.0299 240 MET A O     
1001 C  CB    . MET A 134 ? 0.4881 0.4599 0.4996 0.0202  0.0427  -0.0283 240 MET A CB    
1002 C  CG    . MET A 134 ? 0.5233 0.4906 0.5286 0.0185  0.0435  -0.0253 240 MET A CG    
1003 S  SD    . MET A 134 ? 0.5392 0.5015 0.5394 0.0183  0.0465  -0.0250 240 MET A SD    
1004 C  CE    . MET A 134 ? 0.5267 0.4846 0.5193 0.0191  0.0425  -0.0228 240 MET A CE    
1005 N  N     . PHE A 135 ? 0.4392 0.4209 0.4659 0.0184  0.0475  -0.0322 241 PHE A N     
1006 C  CA    . PHE A 135 ? 0.4743 0.4584 0.5052 0.0167  0.0499  -0.0326 241 PHE A CA    
1007 C  C     . PHE A 135 ? 0.5151 0.5001 0.5492 0.0159  0.0544  -0.0347 241 PHE A C     
1008 O  O     . PHE A 135 ? 0.4729 0.4561 0.5059 0.0140  0.0572  -0.0337 241 PHE A O     
1009 C  CB    . PHE A 135 ? 0.4568 0.4458 0.4937 0.0173  0.0479  -0.0342 241 PHE A CB    
1010 C  CG    . PHE A 135 ? 0.4372 0.4285 0.4782 0.0156  0.0499  -0.0345 241 PHE A CG    
1011 C  CD1   . PHE A 135 ? 0.4356 0.4241 0.4730 0.0140  0.0505  -0.0319 241 PHE A CD1   
1012 C  CD2   . PHE A 135 ? 0.4292 0.4254 0.4776 0.0156  0.0510  -0.0374 241 PHE A CD2   
1013 C  CE1   . PHE A 135 ? 0.4458 0.4360 0.4866 0.0125  0.0522  -0.0322 241 PHE A CE1   
1014 C  CE2   . PHE A 135 ? 0.4487 0.4467 0.5006 0.0140  0.0528  -0.0378 241 PHE A CE2   
1015 C  CZ    . PHE A 135 ? 0.4675 0.4623 0.5155 0.0125  0.0535  -0.0351 241 PHE A CZ    
1016 N  N     . GLU A 136 ? 0.5389 0.5268 0.5771 0.0173  0.0548  -0.0376 242 GLU A N     
1017 C  CA    . GLU A 136 ? 0.5630 0.5521 0.6043 0.0167  0.0590  -0.0399 242 GLU A CA    
1018 C  C     . GLU A 136 ? 0.5467 0.5303 0.5815 0.0155  0.0618  -0.0381 242 GLU A C     
1019 O  O     . GLU A 136 ? 0.6191 0.6019 0.6543 0.0135  0.0656  -0.0382 242 GLU A O     
1020 C  CB    . GLU A 136 ? 0.5981 0.5909 0.6439 0.0190  0.0582  -0.0431 242 GLU A CB    
1021 C  CG    . GLU A 136 ? 0.6409 0.6363 0.6915 0.0186  0.0626  -0.0462 242 GLU A CG    
1022 C  CD    . GLU A 136 ? 0.6669 0.6667 0.7243 0.0167  0.0654  -0.0481 242 GLU A CD    
1023 O  OE1   . GLU A 136 ? 0.6407 0.6433 0.7016 0.0166  0.0634  -0.0481 242 GLU A OE1   
1024 O  OE2   . GLU A 136 ? 0.7227 0.7230 0.7820 0.0152  0.0699  -0.0496 242 GLU A OE2   
1025 N  N     . HIS A 137 ? 0.5153 0.4949 0.5439 0.0166  0.0600  -0.0365 243 HIS A N     
1026 C  CA    . HIS A 137 ? 0.5171 0.4913 0.5393 0.0156  0.0624  -0.0349 243 HIS A CA    
1027 C  C     . HIS A 137 ? 0.5136 0.4845 0.5321 0.0133  0.0635  -0.0322 243 HIS A C     
1028 O  O     . HIS A 137 ? 0.5556 0.5235 0.5717 0.0117  0.0672  -0.0318 243 HIS A O     
1029 C  CB    . HIS A 137 ? 0.5212 0.4918 0.5375 0.0172  0.0594  -0.0336 243 HIS A CB    
1030 C  CG    . HIS A 137 ? 0.5265 0.4909 0.5351 0.0164  0.0610  -0.0315 243 HIS A CG    
1031 N  ND1   . HIS A 137 ? 0.5795 0.5423 0.5874 0.0157  0.0651  -0.0328 243 HIS A ND1   
1032 C  CD2   . HIS A 137 ? 0.5143 0.4736 0.5154 0.0162  0.0589  -0.0285 243 HIS A CD2   
1033 C  CE1   . HIS A 137 ? 0.5517 0.5086 0.5519 0.0151  0.0654  -0.0305 243 HIS A CE1   
1034 N  NE2   . HIS A 137 ? 0.5380 0.4927 0.5340 0.0154  0.0616  -0.0279 243 HIS A NE2   
1035 N  N     . LEU A 138 ? 0.4958 0.4670 0.5138 0.0133  0.0604  -0.0304 244 LEU A N     
1036 C  CA    . LEU A 138 ? 0.4961 0.4644 0.5108 0.0115  0.0609  -0.0278 244 LEU A CA    
1037 C  C     . LEU A 138 ? 0.4889 0.4588 0.5077 0.0097  0.0646  -0.0291 244 LEU A C     
1038 O  O     . LEU A 138 ? 0.4641 0.4299 0.4789 0.0080  0.0671  -0.0276 244 LEU A O     
1039 C  CB    . LEU A 138 ? 0.4952 0.4646 0.5095 0.0120  0.0569  -0.0260 244 LEU A CB    
1040 C  CG    . LEU A 138 ? 0.5030 0.4699 0.5143 0.0105  0.0566  -0.0234 244 LEU A CG    
1041 C  CD1   . LEU A 138 ? 0.5058 0.4735 0.5158 0.0112  0.0524  -0.0217 244 LEU A CD1   
1042 C  CD2   . LEU A 138 ? 0.4908 0.4600 0.5069 0.0092  0.0590  -0.0244 244 LEU A CD2   
1043 N  N     . ILE A 139 ? 0.4924 0.4680 0.5188 0.0100  0.0649  -0.0317 245 ILE A N     
1044 C  CA    . ILE A 139 ? 0.5395 0.5171 0.5705 0.0082  0.0684  -0.0332 245 ILE A CA    
1045 C  C     . ILE A 139 ? 0.5287 0.5040 0.5583 0.0070  0.0729  -0.0343 245 ILE A C     
1046 O  O     . ILE A 139 ? 0.5414 0.5134 0.5683 0.0049  0.0757  -0.0333 245 ILE A O     
1047 C  CB    . ILE A 139 ? 0.5691 0.5535 0.6088 0.0088  0.0681  -0.0364 245 ILE A CB    
1048 C  CG1   . ILE A 139 ? 0.5592 0.5464 0.6012 0.0099  0.0640  -0.0359 245 ILE A CG1   
1049 C  CG2   . ILE A 139 ? 0.6266 0.6125 0.6705 0.0066  0.0720  -0.0380 245 ILE A CG2   
1050 C  CD1   . ILE A 139 ? 0.5715 0.5559 0.6099 0.0088  0.0630  -0.0331 245 ILE A CD1   
1051 N  N     . ASN A 140 ? 0.5223 0.4993 0.5536 0.0083  0.0735  -0.0364 246 ASN A N     
1052 C  CA    . ASN A 140 ? 0.5310 0.5068 0.5619 0.0073  0.0779  -0.0380 246 ASN A CA    
1053 C  C     . ASN A 140 ? 0.5334 0.5020 0.5554 0.0063  0.0793  -0.0353 246 ASN A C     
1054 O  O     . ASN A 140 ? 0.5497 0.5158 0.5702 0.0044  0.0832  -0.0356 246 ASN A O     
1055 C  CB    . ASN A 140 ? 0.5214 0.5005 0.5556 0.0094  0.0777  -0.0408 246 ASN A CB    
1056 C  CG    . ASN A 140 ? 0.5606 0.5470 0.6039 0.0104  0.0767  -0.0439 246 ASN A CG    
1057 O  OD1   . ASN A 140 ? 0.6006 0.5901 0.6488 0.0089  0.0781  -0.0449 246 ASN A OD1   
1058 N  ND2   . ASN A 140 ? 0.5855 0.5746 0.6311 0.0130  0.0741  -0.0454 246 ASN A ND2   
1059 N  N     . SER A 141 ? 0.5621 0.5270 0.5780 0.0075  0.0761  -0.0328 247 SER A N     
1060 C  CA    . SER A 141 ? 0.5321 0.4901 0.5396 0.0067  0.0773  -0.0305 247 SER A CA    
1061 C  C     . SER A 141 ? 0.5423 0.4958 0.5451 0.0049  0.0773  -0.0276 247 SER A C     
1062 O  O     . SER A 141 ? 0.5828 0.5302 0.5783 0.0041  0.0784  -0.0255 247 SER A O     
1063 C  CB    . SER A 141 ? 0.5517 0.5075 0.5547 0.0087  0.0742  -0.0294 247 SER A CB    
1064 O  OG    . SER A 141 ? 0.6015 0.5561 0.6016 0.0094  0.0699  -0.0269 247 SER A OG    
1065 N  N     . ASN A 142 ? 0.5313 0.4875 0.5379 0.0044  0.0763  -0.0274 248 ASN A N     
1066 C  CA    . ASN A 142 ? 0.5318 0.4839 0.5341 0.0030  0.0762  -0.0247 248 ASN A CA    
1067 C  C     . ASN A 142 ? 0.5565 0.5101 0.5629 0.0010  0.0791  -0.0258 248 ASN A C     
1068 O  O     . ASN A 142 ? 0.5732 0.5245 0.5775 0.0002  0.0784  -0.0240 248 ASN A O     
1069 C  CB    . ASN A 142 ? 0.4967 0.4493 0.4978 0.0042  0.0714  -0.0225 248 ASN A CB    
1070 C  CG    . ASN A 142 ? 0.4769 0.4269 0.4728 0.0056  0.0687  -0.0210 248 ASN A CG    
1071 O  OD1   . ASN A 142 ? 0.4739 0.4184 0.4628 0.0052  0.0684  -0.0187 248 ASN A OD1   
1072 N  ND2   . ASN A 142 ? 0.4536 0.4074 0.4526 0.0074  0.0664  -0.0223 248 ASN A ND2   
1073 N  N     . GLY A 143 ? 0.5404 0.4979 0.5527 0.0003  0.0822  -0.0289 249 GLY A N     
1074 C  CA    . GLY A 143 ? 0.5517 0.5104 0.5677 -0.0016 0.0850  -0.0300 249 GLY A CA    
1075 C  C     . GLY A 143 ? 0.5871 0.5496 0.6079 -0.0014 0.0825  -0.0299 249 GLY A C     
1076 O  O     . GLY A 143 ? 0.5907 0.5523 0.6123 -0.0031 0.0841  -0.0298 249 GLY A O     
1077 N  N     . ILE A 144 ? 0.5778 0.5444 0.6016 0.0006  0.0786  -0.0301 250 ILE A N     
1078 C  CA    . ILE A 144 ? 0.5882 0.5578 0.6156 0.0009  0.0760  -0.0299 250 ILE A CA    
1079 C  C     . ILE A 144 ? 0.5636 0.5381 0.5988 -0.0002 0.0781  -0.0327 250 ILE A C     
1080 O  O     . ILE A 144 ? 0.5711 0.5461 0.6079 -0.0010 0.0776  -0.0322 250 ILE A O     
1081 C  CB    . ILE A 144 ? 0.5900 0.5625 0.6183 0.0033  0.0713  -0.0293 250 ILE A CB    
1082 C  CG1   . ILE A 144 ? 0.5948 0.5622 0.6153 0.0041  0.0692  -0.0264 250 ILE A CG1   
1083 C  CG2   . ILE A 144 ? 0.5912 0.5672 0.6234 0.0037  0.0686  -0.0293 250 ILE A CG2   
1084 C  CD1   . ILE A 144 ? 0.5811 0.5431 0.5957 0.0029  0.0695  -0.0236 250 ILE A CD1   
1085 N  N     . LYS A 145 ? 0.5536 0.5317 0.5935 -0.0003 0.0804  -0.0356 251 LYS A N     
1086 C  CA    . LYS A 145 ? 0.5623 0.5460 0.6104 -0.0012 0.0820  -0.0387 251 LYS A CA    
1087 C  C     . LYS A 145 ? 0.5108 0.4929 0.5594 -0.0038 0.0848  -0.0386 251 LYS A C     
1088 O  O     . LYS A 145 ? 0.5185 0.5042 0.5722 -0.0042 0.0841  -0.0398 251 LYS A O     
1089 C  CB    . LYS A 145 ? 0.6048 0.5921 0.6574 -0.0010 0.0846  -0.0419 251 LYS A CB    
1090 C  CG    . LYS A 145 ? 0.6227 0.6158 0.6807 0.0015  0.0815  -0.0440 251 LYS A CG    
1091 C  CD    . LYS A 145 ? 0.6573 0.6533 0.7190 0.0016  0.0843  -0.0470 251 LYS A CD    
1092 C  CE    . LYS A 145 ? 0.7208 0.7239 0.7903 0.0037  0.0821  -0.0501 251 LYS A CE    
1093 N  NZ    . LYS A 145 ? 0.7938 0.7973 0.8628 0.0056  0.0822  -0.0514 251 LYS A NZ    
1094 N  N     . PRO A 146 ? 0.5403 0.5164 0.5830 -0.0056 0.0878  -0.0372 252 PRO A N     
1095 C  CA    . PRO A 146 ? 0.5279 0.5015 0.5701 -0.0081 0.0902  -0.0368 252 PRO A CA    
1096 C  C     . PRO A 146 ? 0.5233 0.4952 0.5636 -0.0076 0.0871  -0.0345 252 PRO A C     
1097 O  O     . PRO A 146 ? 0.5001 0.4729 0.5433 -0.0090 0.0878  -0.0351 252 PRO A O     
1098 C  CB    . PRO A 146 ? 0.5446 0.5111 0.5793 -0.0099 0.0937  -0.0354 252 PRO A CB    
1099 C  CG    . PRO A 146 ? 0.5480 0.5152 0.5820 -0.0088 0.0945  -0.0363 252 PRO A CG    
1100 C  CD    . PRO A 146 ? 0.5527 0.5255 0.5911 -0.0060 0.0904  -0.0371 252 PRO A CD    
1101 N  N     . VAL A 147 ? 0.5429 0.5123 0.5782 -0.0058 0.0837  -0.0319 253 VAL A N     
1102 C  CA    . VAL A 147 ? 0.5438 0.5120 0.5772 -0.0049 0.0804  -0.0298 253 VAL A CA    
1103 C  C     . VAL A 147 ? 0.5398 0.5146 0.5804 -0.0039 0.0778  -0.0314 253 VAL A C     
1104 O  O     . VAL A 147 ? 0.5619 0.5370 0.6037 -0.0042 0.0767  -0.0310 253 VAL A O     
1105 C  CB    . VAL A 147 ? 0.5264 0.4914 0.5536 -0.0032 0.0773  -0.0270 253 VAL A CB    
1106 C  CG1   . VAL A 147 ? 0.5242 0.4870 0.5485 -0.0028 0.0748  -0.0247 253 VAL A CG1   
1107 C  CG2   . VAL A 147 ? 0.5440 0.5030 0.5643 -0.0040 0.0797  -0.0257 253 VAL A CG2   
1108 N  N     . MET A 148 ? 0.5583 0.5383 0.6037 -0.0026 0.0768  -0.0335 254 MET A N     
1109 C  CA    . MET A 148 ? 0.5594 0.5454 0.6116 -0.0016 0.0745  -0.0353 254 MET A CA    
1110 C  C     . MET A 148 ? 0.5506 0.5387 0.6078 -0.0036 0.0770  -0.0373 254 MET A C     
1111 O  O     . MET A 148 ? 0.5274 0.5171 0.5870 -0.0036 0.0754  -0.0373 254 MET A O     
1112 C  CB    . MET A 148 ? 0.5688 0.5596 0.6252 0.0000  0.0733  -0.0375 254 MET A CB    
1113 C  CG    . MET A 148 ? 0.5823 0.5718 0.6344 0.0021  0.0699  -0.0356 254 MET A CG    
1114 S  SD    . MET A 148 ? 0.6156 0.6090 0.6708 0.0042  0.0688  -0.0379 254 MET A SD    
1115 C  CE    . MET A 148 ? 0.6640 0.6625 0.7238 0.0062  0.0642  -0.0388 254 MET A CE    
1116 N  N     . GLU A 149 ? 0.5780 0.5654 0.6362 -0.0055 0.0811  -0.0388 255 GLU A N     
1117 C  CA    . GLU A 149 ? 0.5850 0.5745 0.6482 -0.0077 0.0839  -0.0410 255 GLU A CA    
1118 C  C     . GLU A 149 ? 0.5646 0.5492 0.6237 -0.0092 0.0845  -0.0390 255 GLU A C     
1119 O  O     . GLU A 149 ? 0.5385 0.5249 0.6012 -0.0101 0.0845  -0.0400 255 GLU A O     
1120 C  CB    . GLU A 149 ? 0.6612 0.6511 0.7261 -0.0096 0.0885  -0.0432 255 GLU A CB    
1121 C  CG    . GLU A 149 ? 0.6962 0.6922 0.7671 -0.0081 0.0881  -0.0460 255 GLU A CG    
1122 C  CD    . GLU A 149 ? 0.7466 0.7438 0.8200 -0.0101 0.0928  -0.0485 255 GLU A CD    
1123 O  OE1   . GLU A 149 ? 0.8018 0.7932 0.8693 -0.0119 0.0960  -0.0471 255 GLU A OE1   
1124 O  OE2   . GLU A 149 ? 0.7587 0.7624 0.8398 -0.0097 0.0932  -0.0518 255 GLU A OE2   
1125 N  N     . GLN A 150 ? 0.5635 0.5417 0.6148 -0.0092 0.0847  -0.0362 256 GLN A N     
1126 C  CA    . GLN A 150 ? 0.5918 0.5644 0.6381 -0.0103 0.0849  -0.0339 256 GLN A CA    
1127 C  C     . GLN A 150 ? 0.6085 0.5830 0.6563 -0.0088 0.0811  -0.0331 256 GLN A C     
1128 O  O     . GLN A 150 ? 0.6299 0.6016 0.6763 -0.0098 0.0815  -0.0323 256 GLN A O     
1129 C  CB    . GLN A 150 ? 0.6243 0.5899 0.6620 -0.0103 0.0855  -0.0312 256 GLN A CB    
1130 C  CG    . GLN A 150 ? 0.6710 0.6309 0.7024 -0.0100 0.0839  -0.0282 256 GLN A CG    
1131 C  CD    . GLN A 150 ? 0.6834 0.6375 0.7067 -0.0093 0.0835  -0.0256 256 GLN A CD    
1132 O  OE1   . GLN A 150 ? 0.6821 0.6363 0.7045 -0.0092 0.0847  -0.0261 256 GLN A OE1   
1133 N  NE2   . GLN A 150 ? 0.6880 0.6373 0.7057 -0.0088 0.0817  -0.0230 256 GLN A NE2   
1134 N  N     . TYR A 151 ? 0.5917 0.5708 0.6425 -0.0066 0.0776  -0.0334 257 TYR A N     
1135 C  CA    . TYR A 151 ? 0.5950 0.5767 0.6482 -0.0054 0.0743  -0.0331 257 TYR A CA    
1136 C  C     . TYR A 151 ? 0.6011 0.5895 0.6623 -0.0053 0.0737  -0.0361 257 TYR A C     
1137 O  O     . TYR A 151 ? 0.5724 0.5637 0.6357 -0.0039 0.0705  -0.0361 257 TYR A O     
1138 C  CB    . TYR A 151 ? 0.5602 0.5416 0.6099 -0.0031 0.0704  -0.0309 257 TYR A CB    
1139 C  CG    . TYR A 151 ? 0.5358 0.5107 0.5778 -0.0032 0.0706  -0.0279 257 TYR A CG    
1140 C  CD1   . TYR A 151 ? 0.5275 0.4991 0.5668 -0.0035 0.0701  -0.0264 257 TYR A CD1   
1141 C  CD2   . TYR A 151 ? 0.5304 0.5023 0.5679 -0.0029 0.0712  -0.0268 257 TYR A CD2   
1142 C  CE1   . TYR A 151 ? 0.5329 0.4984 0.5651 -0.0035 0.0702  -0.0238 257 TYR A CE1   
1143 C  CE2   . TYR A 151 ? 0.5453 0.5110 0.5755 -0.0031 0.0713  -0.0241 257 TYR A CE2   
1144 C  CZ    . TYR A 151 ? 0.5181 0.4807 0.5458 -0.0033 0.0707  -0.0227 257 TYR A CZ    
1145 O  OH    . TYR A 151 ? 0.5925 0.5491 0.6132 -0.0032 0.0705  -0.0201 257 TYR A OH    
1146 N  N     . GLY A 152 ? 0.5896 0.5805 0.6554 -0.0068 0.0767  -0.0387 258 GLY A N     
1147 C  CA    . GLY A 152 ? 0.5618 0.5588 0.6354 -0.0069 0.0763  -0.0417 258 GLY A CA    
1148 C  C     . GLY A 152 ? 0.5631 0.5655 0.6409 -0.0049 0.0740  -0.0434 258 GLY A C     
1149 O  O     . GLY A 152 ? 0.6307 0.6383 0.7148 -0.0045 0.0728  -0.0457 258 GLY A O     
1150 N  N     . LEU A 153 ? 0.5587 0.5597 0.6330 -0.0035 0.0733  -0.0423 259 LEU A N     
1151 C  CA    . LEU A 153 ? 0.5954 0.6011 0.6733 -0.0015 0.0712  -0.0439 259 LEU A CA    
1152 C  C     . LEU A 153 ? 0.6289 0.6373 0.7112 -0.0024 0.0744  -0.0468 259 LEU A C     
1153 O  O     . LEU A 153 ? 0.6125 0.6179 0.6925 -0.0043 0.0782  -0.0466 259 LEU A O     
1154 C  CB    . LEU A 153 ? 0.6002 0.6034 0.6725 0.0004  0.0688  -0.0416 259 LEU A CB    
1155 C  CG    . LEU A 153 ? 0.6235 0.6270 0.6938 0.0023  0.0643  -0.0399 259 LEU A CG    
1156 C  CD1   . LEU A 153 ? 0.6282 0.6293 0.6962 0.0015  0.0637  -0.0381 259 LEU A CD1   
1157 C  CD2   . LEU A 153 ? 0.6226 0.6233 0.6873 0.0038  0.0626  -0.0379 259 LEU A CD2   
1158 N  N     . ILE A 154 ? 0.6377 0.6518 0.7260 -0.0010 0.0728  -0.0494 260 ILE A N     
1159 C  CA    . ILE A 154 ? 0.6206 0.6386 0.7142 -0.0015 0.0755  -0.0526 260 ILE A CA    
1160 C  C     . ILE A 154 ? 0.5865 0.6057 0.6796 0.0009  0.0737  -0.0530 260 ILE A C     
1161 O  O     . ILE A 154 ? 0.5751 0.5982 0.6717 0.0030  0.0703  -0.0543 260 ILE A O     
1162 C  CB    . ILE A 154 ? 0.6260 0.6503 0.7283 -0.0019 0.0752  -0.0560 260 ILE A CB    
1163 C  CG1   . ILE A 154 ? 0.6087 0.6313 0.7112 -0.0045 0.0770  -0.0555 260 ILE A CG1   
1164 C  CG2   . ILE A 154 ? 0.5973 0.6261 0.7057 -0.0024 0.0780  -0.0595 260 ILE A CG2   
1165 C  CD1   . ILE A 154 ? 0.6173 0.6445 0.7258 -0.0042 0.0747  -0.0574 260 ILE A CD1   
1166 N  N     . PRO A 155 ? 0.6006 0.6163 0.6892 0.0006  0.0760  -0.0521 261 PRO A N     
1167 C  CA    . PRO A 155 ? 0.5998 0.6155 0.6864 0.0030  0.0741  -0.0519 261 PRO A CA    
1168 C  C     . PRO A 155 ? 0.6151 0.6368 0.7083 0.0051  0.0725  -0.0553 261 PRO A C     
1169 O  O     . PRO A 155 ? 0.6169 0.6386 0.7084 0.0076  0.0688  -0.0546 261 PRO A O     
1170 C  CB    . PRO A 155 ? 0.6109 0.6224 0.6930 0.0018  0.0780  -0.0512 261 PRO A CB    
1171 C  CG    . PRO A 155 ? 0.6210 0.6276 0.6986 -0.0005 0.0799  -0.0489 261 PRO A CG    
1172 C  CD    . PRO A 155 ? 0.6010 0.6113 0.6844 -0.0017 0.0799  -0.0504 261 PRO A CD    
1173 N  N     . GLU A 156 ? 0.6145 0.6413 0.7151 0.0043  0.0751  -0.0589 262 GLU A N     
1174 C  CA    . GLU A 156 ? 0.6361 0.6686 0.7428 0.0067  0.0730  -0.0620 262 GLU A CA    
1175 C  C     . GLU A 156 ? 0.6735 0.7072 0.7805 0.0089  0.0677  -0.0614 262 GLU A C     
1176 O  O     . GLU A 156 ? 0.6644 0.6973 0.7689 0.0114  0.0645  -0.0607 262 GLU A O     
1177 C  CB    . GLU A 156 ? 0.6706 0.7092 0.7861 0.0057  0.0759  -0.0663 262 GLU A CB    
1178 N  N     . GLU A 157 ? 0.6862 0.7210 0.7953 0.0077  0.0669  -0.0611 263 GLU A N     
1179 C  CA    . GLU A 157 ? 0.7005 0.7366 0.8102 0.0094  0.0621  -0.0607 263 GLU A CA    
1180 C  C     . GLU A 157 ? 0.6712 0.7023 0.7730 0.0105  0.0591  -0.0569 263 GLU A C     
1181 O  O     . GLU A 157 ? 0.6745 0.7061 0.7753 0.0128  0.0550  -0.0567 263 GLU A O     
1182 C  CB    . GLU A 157 ? 0.7354 0.7733 0.8486 0.0076  0.0624  -0.0612 263 GLU A CB    
1183 C  CG    . GLU A 157 ? 0.7941 0.8375 0.9158 0.0064  0.0647  -0.0650 263 GLU A CG    
1184 C  CD    . GLU A 157 ? 0.8469 0.8910 0.9709 0.0042  0.0653  -0.0651 263 GLU A CD    
1185 O  OE1   . GLU A 157 ? 0.8820 0.9282 1.0104 0.0019  0.0688  -0.0671 263 GLU A OE1   
1186 O  OE2   . GLU A 157 ? 0.8194 0.8619 0.9409 0.0048  0.0623  -0.0633 263 GLU A OE2   
1187 N  N     . ASP A 158 ? 0.5929 0.6191 0.6891 0.0087  0.0609  -0.0540 264 ASP A N     
1188 C  CA    . ASP A 158 ? 0.5601 0.5819 0.6494 0.0093  0.0583  -0.0505 264 ASP A CA    
1189 C  C     . ASP A 158 ? 0.5430 0.5616 0.6264 0.0110  0.0565  -0.0487 264 ASP A C     
1190 O  O     . ASP A 158 ? 0.5411 0.5582 0.6209 0.0123  0.0530  -0.0468 264 ASP A O     
1191 C  CB    . ASP A 158 ? 0.5112 0.5290 0.5967 0.0069  0.0607  -0.0481 264 ASP A CB    
1192 C  CG    . ASP A 158 ? 0.4725 0.4923 0.5618 0.0056  0.0608  -0.0489 264 ASP A CG    
1193 O  OD1   . ASP A 158 ? 0.4495 0.4734 0.5435 0.0066  0.0583  -0.0506 264 ASP A OD1   
1194 O  OD2   . ASP A 158 ? 0.4679 0.4849 0.5554 0.0036  0.0634  -0.0478 264 ASP A OD2   
1195 N  N     . ILE A 159 ? 0.5425 0.5601 0.6250 0.0110  0.0590  -0.0493 265 ILE A N     
1196 C  CA    . ILE A 159 ? 0.5470 0.5619 0.6246 0.0128  0.0574  -0.0481 265 ILE A CA    
1197 C  C     . ILE A 159 ? 0.5385 0.5565 0.6188 0.0154  0.0535  -0.0498 265 ILE A C     
1198 O  O     . ILE A 159 ? 0.5340 0.5496 0.6096 0.0170  0.0503  -0.0481 265 ILE A O     
1199 C  CB    . ILE A 159 ? 0.5347 0.5479 0.6110 0.0121  0.0612  -0.0488 265 ILE A CB    
1200 C  CG1   . ILE A 159 ? 0.5666 0.5748 0.6377 0.0098  0.0640  -0.0461 265 ILE A CG1   
1201 C  CG2   . ILE A 159 ? 0.5092 0.5206 0.5819 0.0142  0.0596  -0.0484 265 ILE A CG2   
1202 C  CD1   . ILE A 159 ? 0.5700 0.5765 0.6403 0.0084  0.0686  -0.0469 265 ILE A CD1   
1203 N  N     . CYS A 160 ? 0.5233 0.5467 0.6112 0.0159  0.0538  -0.0532 266 CYS A N     
1204 C  CA    . CYS A 160 ? 0.5577 0.5843 0.6486 0.0184  0.0500  -0.0552 266 CYS A CA    
1205 C  C     . CYS A 160 ? 0.5245 0.5504 0.6133 0.0190  0.0460  -0.0535 266 CYS A C     
1206 O  O     . CYS A 160 ? 0.5264 0.5514 0.6128 0.0210  0.0423  -0.0530 266 CYS A O     
1207 C  CB    . CYS A 160 ? 0.5550 0.5879 0.6551 0.0186  0.0512  -0.0593 266 CYS A CB    
1208 S  SG    . CYS A 160 ? 0.6264 0.6638 0.7315 0.0214  0.0462  -0.0619 266 CYS A SG    
1209 N  N     . PHE A 161 ? 0.5089 0.5349 0.5984 0.0171  0.0468  -0.0525 267 PHE A N     
1210 C  CA    . PHE A 161 ? 0.4889 0.5141 0.5762 0.0172  0.0436  -0.0508 267 PHE A CA    
1211 C  C     . PHE A 161 ? 0.4796 0.4997 0.5587 0.0177  0.0417  -0.0473 267 PHE A C     
1212 O  O     . PHE A 161 ? 0.4810 0.5007 0.5579 0.0191  0.0380  -0.0467 267 PHE A O     
1213 C  CB    . PHE A 161 ? 0.4974 0.5233 0.5868 0.0150  0.0456  -0.0505 267 PHE A CB    
1214 C  CG    . PHE A 161 ? 0.5030 0.5281 0.5903 0.0150  0.0428  -0.0488 267 PHE A CG    
1215 C  CD1   . PHE A 161 ? 0.4987 0.5249 0.5859 0.0168  0.0387  -0.0492 267 PHE A CD1   
1216 C  CD2   . PHE A 161 ? 0.5131 0.5361 0.5984 0.0131  0.0444  -0.0469 267 PHE A CD2   
1217 C  CE1   . PHE A 161 ? 0.5066 0.5321 0.5917 0.0166  0.0364  -0.0477 267 PHE A CE1   
1218 C  CE2   . PHE A 161 ? 0.5085 0.5309 0.5919 0.0131  0.0421  -0.0454 267 PHE A CE2   
1219 C  CZ    . PHE A 161 ? 0.5187 0.5425 0.6021 0.0147  0.0382  -0.0459 267 PHE A CZ    
1220 N  N     . ILE A 162 ? 0.4686 0.4851 0.5433 0.0165  0.0442  -0.0453 268 ILE A N     
1221 C  CA    . ILE A 162 ? 0.4505 0.4622 0.5176 0.0167  0.0427  -0.0420 268 ILE A CA    
1222 C  C     . ILE A 162 ? 0.4458 0.4566 0.5104 0.0188  0.0400  -0.0422 268 ILE A C     
1223 O  O     . ILE A 162 ? 0.4065 0.4151 0.4665 0.0195  0.0370  -0.0404 268 ILE A O     
1224 C  CB    . ILE A 162 ? 0.4328 0.4407 0.4959 0.0150  0.0462  -0.0401 268 ILE A CB    
1225 C  CG1   . ILE A 162 ? 0.4435 0.4512 0.5073 0.0131  0.0478  -0.0391 268 ILE A CG1   
1226 C  CG2   . ILE A 162 ? 0.4396 0.4429 0.4952 0.0154  0.0448  -0.0372 268 ILE A CG2   
1227 C  CD1   . ILE A 162 ? 0.4516 0.4563 0.5134 0.0112  0.0518  -0.0382 268 ILE A CD1   
1228 N  N     . LYS A 163 ? 0.5021 0.5145 0.5697 0.0198  0.0412  -0.0446 269 LYS A N     
1229 C  CA    . LYS A 163 ? 0.4964 0.5075 0.5614 0.0220  0.0388  -0.0450 269 LYS A CA    
1230 C  C     . LYS A 163 ? 0.4944 0.5076 0.5611 0.0238  0.0347  -0.0462 269 LYS A C     
1231 O  O     . LYS A 163 ? 0.5144 0.5249 0.5763 0.0250  0.0315  -0.0448 269 LYS A O     
1232 C  CB    . LYS A 163 ? 0.5165 0.5293 0.5849 0.0227  0.0413  -0.0475 269 LYS A CB    
1233 C  CG    . LYS A 163 ? 0.5293 0.5388 0.5943 0.0213  0.0450  -0.0462 269 LYS A CG    
1234 C  CD    . LYS A 163 ? 0.5221 0.5342 0.5917 0.0217  0.0481  -0.0493 269 LYS A CD    
1235 C  CE    . LYS A 163 ? 0.5113 0.5192 0.5759 0.0206  0.0513  -0.0477 269 LYS A CE    
1236 N  NZ    . LYS A 163 ? 0.5398 0.5498 0.6085 0.0202  0.0553  -0.0504 269 LYS A NZ    
1237 N  N     . GLU A 164 ? 0.4710 0.4887 0.5444 0.0238  0.0345  -0.0485 270 GLU A N     
1238 C  CA    . GLU A 164 ? 0.4838 0.5033 0.5587 0.0254  0.0305  -0.0497 270 GLU A CA    
1239 C  C     . GLU A 164 ? 0.4601 0.4768 0.5296 0.0250  0.0276  -0.0469 270 GLU A C     
1240 O  O     . GLU A 164 ? 0.4150 0.4308 0.4822 0.0265  0.0239  -0.0468 270 GLU A O     
1241 C  CB    . GLU A 164 ? 0.5165 0.5414 0.5995 0.0252  0.0310  -0.0527 270 GLU A CB    
1242 C  CG    . GLU A 164 ? 0.5179 0.5468 0.6075 0.0262  0.0328  -0.0562 270 GLU A CG    
1243 C  CD    . GLU A 164 ? 0.5281 0.5624 0.6259 0.0252  0.0343  -0.0590 270 GLU A CD    
1244 O  OE1   . GLU A 164 ? 0.5261 0.5605 0.6243 0.0233  0.0351  -0.0579 270 GLU A OE1   
1245 O  OE2   . GLU A 164 ? 0.5439 0.5825 0.6481 0.0263  0.0345  -0.0624 270 GLU A OE2   
1246 N  N     . GLN A 165 ? 0.4406 0.4562 0.5085 0.0228  0.0294  -0.0448 271 GLN A N     
1247 C  CA    . GLN A 165 ? 0.4186 0.4319 0.4816 0.0221  0.0274  -0.0420 271 GLN A CA    
1248 C  C     . GLN A 165 ? 0.4410 0.4498 0.4967 0.0227  0.0256  -0.0398 271 GLN A C     
1249 O  O     . GLN A 165 ? 0.4354 0.4428 0.4875 0.0232  0.0225  -0.0386 271 GLN A O     
1250 C  CB    . GLN A 165 ? 0.4204 0.4328 0.4825 0.0199  0.0301  -0.0402 271 GLN A CB    
1251 C  CG    . GLN A 165 ? 0.4274 0.4433 0.4953 0.0188  0.0316  -0.0416 271 GLN A CG    
1252 C  CD    . GLN A 165 ? 0.4492 0.4634 0.5153 0.0168  0.0341  -0.0396 271 GLN A CD    
1253 O  OE1   . GLN A 165 ? 0.4458 0.4585 0.5085 0.0163  0.0327  -0.0375 271 GLN A OE1   
1254 N  NE2   . GLN A 165 ? 0.4162 0.4306 0.4847 0.0156  0.0378  -0.0402 271 GLN A NE2   
1255 N  N     . ILE A 166 ? 0.4524 0.4592 0.5061 0.0228  0.0275  -0.0393 272 ILE A N     
1256 C  CA    . ILE A 166 ? 0.5010 0.5034 0.5477 0.0233  0.0259  -0.0373 272 ILE A CA    
1257 C  C     . ILE A 166 ? 0.5410 0.5429 0.5868 0.0256  0.0227  -0.0387 272 ILE A C     
1258 O  O     . ILE A 166 ? 0.6083 0.6074 0.6489 0.0260  0.0196  -0.0372 272 ILE A O     
1259 C  CB    . ILE A 166 ? 0.4850 0.4850 0.5295 0.0225  0.0292  -0.0364 272 ILE A CB    
1260 C  CG1   . ILE A 166 ? 0.4531 0.4525 0.4969 0.0203  0.0316  -0.0344 272 ILE A CG1   
1261 C  CG2   . ILE A 166 ? 0.4811 0.4767 0.5190 0.0233  0.0275  -0.0347 272 ILE A CG2   
1262 C  CD1   . ILE A 166 ? 0.4726 0.4691 0.5137 0.0193  0.0349  -0.0333 272 ILE A CD1   
1263 N  N     . VAL A 167 ? 0.5717 0.5760 0.6222 0.0270  0.0234  -0.0415 273 VAL A N     
1264 C  CA    . VAL A 167 ? 0.6123 0.6154 0.6613 0.0294  0.0207  -0.0428 273 VAL A CA    
1265 C  C     . VAL A 167 ? 0.6725 0.6785 0.7256 0.0311  0.0177  -0.0453 273 VAL A C     
1266 O  O     . VAL A 167 ? 0.7599 0.7640 0.8102 0.0330  0.0145  -0.0457 273 VAL A O     
1267 C  CB    . VAL A 167 ? 0.5870 0.5901 0.6376 0.0304  0.0233  -0.0445 273 VAL A CB    
1268 C  CG1   . VAL A 167 ? 0.5562 0.5648 0.6154 0.0311  0.0250  -0.0481 273 VAL A CG1   
1269 C  CG2   . VAL A 167 ? 0.5500 0.5497 0.5961 0.0325  0.0207  -0.0445 273 VAL A CG2   
1270 N  N     . GLY A 168 ? 0.7228 0.7331 0.7820 0.0305  0.0186  -0.0468 274 GLY A N     
1271 C  CA    . GLY A 168 ? 0.7365 0.7504 0.8010 0.0323  0.0162  -0.0499 274 GLY A CA    
1272 C  C     . GLY A 168 ? 0.7301 0.7487 0.8025 0.0329  0.0189  -0.0532 274 GLY A C     
1273 O  O     . GLY A 168 ? 0.7027 0.7214 0.7758 0.0318  0.0226  -0.0530 274 GLY A O     
1274 N  N     . PRO A 169 ? 0.8123 0.8349 0.8906 0.0345  0.0170  -0.0563 275 PRO A N     
1275 C  CA    . PRO A 169 ? 0.8115 0.8395 0.8984 0.0348  0.0195  -0.0599 275 PRO A CA    
1276 C  C     . PRO A 169 ? 0.7667 0.7952 0.8550 0.0360  0.0216  -0.0614 275 PRO A C     
1277 O  O     . PRO A 169 ? 0.8406 0.8663 0.9251 0.0381  0.0193  -0.0614 275 PRO A O     
1278 C  CB    . PRO A 169 ? 0.8295 0.8608 0.9209 0.0368  0.0157  -0.0626 275 PRO A CB    
1279 C  CG    . PRO A 169 ? 0.8291 0.8568 0.9145 0.0368  0.0121  -0.0603 275 PRO A CG    
1280 C  CD    . PRO A 169 ? 0.8259 0.8479 0.9029 0.0361  0.0123  -0.0568 275 PRO A CD    
1281 N  N     . LEU A 178 ? 0.8822 0.9472 1.0224 0.0472  -0.0049 -0.0877 284 LEU A N     
1282 C  CA    . LEU A 178 ? 0.9440 1.0085 1.0832 0.0436  -0.0017 -0.0854 284 LEU A CA    
1283 C  C     . LEU A 178 ? 0.9329 0.9927 1.0651 0.0413  0.0017  -0.0813 284 LEU A C     
1284 O  O     . LEU A 178 ? 0.8806 0.9348 1.0046 0.0421  -0.0001 -0.0785 284 LEU A O     
1285 C  CB    . LEU A 178 ? 1.0282 1.0996 1.1773 0.0418  0.0015  -0.0884 284 LEU A CB    
1286 C  CG    . LEU A 178 ? 1.1229 1.1992 1.2791 0.0426  -0.0011 -0.0919 284 LEU A CG    
1287 C  CD1   . LEU A 178 ? 1.1045 1.1872 1.2699 0.0402  0.0031  -0.0944 284 LEU A CD1   
1288 C  CD2   . LEU A 178 ? 1.1190 1.1921 1.2706 0.0418  -0.0040 -0.0901 284 LEU A CD2   
1289 N  N     . TRP A 179 ? 0.9018 0.9638 1.0372 0.0385  0.0068  -0.0809 285 TRP A N     
1290 C  CA    . TRP A 179 ? 0.8320 0.8899 0.9615 0.0358  0.0101  -0.0770 285 TRP A CA    
1291 C  C     . TRP A 179 ? 0.7814 0.8381 0.9094 0.0360  0.0131  -0.0764 285 TRP A C     
1292 O  O     . TRP A 179 ? 0.7728 0.8336 0.9070 0.0354  0.0163  -0.0786 285 TRP A O     
1293 C  CB    . TRP A 179 ? 0.8392 0.8999 0.9730 0.0327  0.0138  -0.0771 285 TRP A CB    
1294 C  CG    . TRP A 179 ? 0.8490 0.9060 0.9777 0.0298  0.0176  -0.0734 285 TRP A CG    
1295 C  CD1   . TRP A 179 ? 0.8387 0.8968 0.9697 0.0275  0.0226  -0.0733 285 TRP A CD1   
1296 C  CD2   . TRP A 179 ? 0.8512 0.9029 0.9718 0.0290  0.0166  -0.0696 285 TRP A CD2   
1297 N  NE1   . TRP A 179 ? 0.8406 0.8943 0.9654 0.0256  0.0244  -0.0696 285 TRP A NE1   
1298 C  CE2   . TRP A 179 ? 0.8309 0.8809 0.9495 0.0265  0.0209  -0.0674 285 TRP A CE2   
1299 C  CE3   . TRP A 179 ? 0.8206 0.8689 0.9353 0.0302  0.0125  -0.0679 285 TRP A CE3   
1300 C  CZ2   . TRP A 179 ? 0.7811 0.8266 0.8927 0.0254  0.0210  -0.0637 285 TRP A CZ2   
1301 C  CZ3   . TRP A 179 ? 0.7930 0.8370 0.9009 0.0288  0.0129  -0.0644 285 TRP A CZ3   
1302 C  CH2   . TRP A 179 ? 0.7903 0.8331 0.8968 0.0265  0.0171  -0.0623 285 TRP A CH2   
1303 N  N     . PRO A 180 ? 0.7545 0.8057 0.8743 0.0365  0.0122  -0.0733 286 PRO A N     
1304 C  CA    . PRO A 180 ? 0.7271 0.7769 0.8452 0.0370  0.0145  -0.0729 286 PRO A CA    
1305 C  C     . PRO A 180 ? 0.6651 0.7137 0.7819 0.0343  0.0197  -0.0710 286 PRO A C     
1306 O  O     . PRO A 180 ? 0.5883 0.6354 0.7031 0.0347  0.0214  -0.0705 286 PRO A O     
1307 C  CB    . PRO A 180 ? 0.7568 0.8007 0.8663 0.0388  0.0110  -0.0706 286 PRO A CB    
1308 C  CG    . PRO A 180 ? 0.7677 0.8089 0.8726 0.0377  0.0087  -0.0682 286 PRO A CG    
1309 C  CD    . PRO A 180 ? 0.7905 0.8365 0.9022 0.0369  0.0088  -0.0704 286 PRO A CD    
1310 N  N     . TYR A 181 ? 0.6478 0.6972 0.7658 0.0315  0.0222  -0.0699 287 TYR A N     
1311 C  CA    . TYR A 181 ? 0.6502 0.6972 0.7653 0.0289  0.0265  -0.0675 287 TYR A CA    
1312 C  C     . TYR A 181 ? 0.6563 0.7075 0.7782 0.0270  0.0310  -0.0696 287 TYR A C     
1313 O  O     . TYR A 181 ? 0.7287 0.7839 0.8567 0.0261  0.0311  -0.0717 287 TYR A O     
1314 C  CB    . TYR A 181 ? 0.6689 0.7124 0.7785 0.0272  0.0259  -0.0641 287 TYR A CB    
1315 C  CG    . TYR A 181 ? 0.6586 0.6972 0.7602 0.0284  0.0224  -0.0613 287 TYR A CG    
1316 C  CD1   . TYR A 181 ? 0.6741 0.7083 0.7694 0.0284  0.0232  -0.0589 287 TYR A CD1   
1317 C  CD2   . TYR A 181 ? 0.6792 0.7172 0.7791 0.0292  0.0184  -0.0610 287 TYR A CD2   
1318 C  CE1   . TYR A 181 ? 0.6485 0.6783 0.7364 0.0292  0.0202  -0.0563 287 TYR A CE1   
1319 C  CE2   . TYR A 181 ? 0.6420 0.6753 0.7342 0.0299  0.0155  -0.0584 287 TYR A CE2   
1320 C  CZ    . TYR A 181 ? 0.6359 0.6653 0.7224 0.0298  0.0165  -0.0561 287 TYR A CZ    
1321 O  OH    . TYR A 181 ? 0.6397 0.6647 0.7189 0.0304  0.0138  -0.0537 287 TYR A OH    
1322 N  N     . LYS A 182 ? 0.6115 0.6614 0.7321 0.0261  0.0347  -0.0690 288 LYS A N     
1323 C  CA    . LYS A 182 ? 0.6094 0.6621 0.7350 0.0238  0.0395  -0.0705 288 LYS A CA    
1324 C  C     . LYS A 182 ? 0.5912 0.6407 0.7132 0.0208  0.0423  -0.0676 288 LYS A C     
1325 O  O     . LYS A 182 ? 0.6603 0.7121 0.7865 0.0186  0.0454  -0.0688 288 LYS A O     
1326 C  CB    . LYS A 182 ? 0.5638 0.6167 0.6900 0.0244  0.0423  -0.0717 288 LYS A CB    
1327 N  N     . GLY A 183 ? 0.5892 0.6335 0.7036 0.0205  0.0411  -0.0639 289 GLY A N     
1328 C  CA    . GLY A 183 ? 0.5915 0.6324 0.7020 0.0178  0.0441  -0.0612 289 GLY A CA    
1329 C  C     . GLY A 183 ? 0.5876 0.6291 0.6994 0.0163  0.0437  -0.0606 289 GLY A C     
1330 O  O     . GLY A 183 ? 0.5545 0.5941 0.6649 0.0139  0.0467  -0.0592 289 GLY A O     
1331 N  N     . ARG A 184 ? 0.5968 0.6402 0.7103 0.0176  0.0399  -0.0615 290 ARG A N     
1332 C  CA    . ARG A 184 ? 0.6172 0.6618 0.7326 0.0165  0.0390  -0.0616 290 ARG A CA    
1333 C  C     . ARG A 184 ? 0.6638 0.7124 0.7841 0.0184  0.0354  -0.0644 290 ARG A C     
1334 O  O     . ARG A 184 ? 0.6941 0.7432 0.8140 0.0208  0.0327  -0.0653 290 ARG A O     
1335 C  CB    . ARG A 184 ? 0.6042 0.6443 0.7125 0.0162  0.0374  -0.0580 290 ARG A CB    
1336 C  CG    . ARG A 184 ? 0.5986 0.6346 0.7020 0.0143  0.0404  -0.0550 290 ARG A CG    
1337 C  CD    . ARG A 184 ? 0.5792 0.6160 0.6858 0.0119  0.0438  -0.0557 290 ARG A CD    
1338 N  NE    . ARG A 184 ? 0.5323 0.5648 0.6340 0.0101  0.0465  -0.0529 290 ARG A NE    
1339 C  CZ    . ARG A 184 ? 0.5148 0.5448 0.6139 0.0095  0.0493  -0.0520 290 ARG A CZ    
1340 N  NH1   . ARG A 184 ? 0.5184 0.5444 0.6132 0.0079  0.0515  -0.0495 290 ARG A NH1   
1341 N  NH2   . ARG A 184 ? 0.5026 0.5341 0.6035 0.0104  0.0500  -0.0535 290 ARG A NH2   
1342 N  N     . PRO A 185 ? 0.7276 0.7791 0.8525 0.0174  0.0352  -0.0660 291 PRO A N     
1343 C  CA    . PRO A 185 ? 0.7162 0.7715 0.8458 0.0189  0.0316  -0.0687 291 PRO A CA    
1344 C  C     . PRO A 185 ? 0.7031 0.7561 0.8284 0.0198  0.0276  -0.0670 291 PRO A C     
1345 O  O     . PRO A 185 ? 0.7730 0.8221 0.8925 0.0188  0.0280  -0.0640 291 PRO A O     
1346 C  CB    . PRO A 185 ? 0.7037 0.7629 0.8403 0.0169  0.0340  -0.0711 291 PRO A CB    
1347 C  CG    . PRO A 185 ? 0.7045 0.7603 0.8374 0.0143  0.0373  -0.0685 291 PRO A CG    
1348 C  CD    . PRO A 185 ? 0.7121 0.7642 0.8396 0.0145  0.0390  -0.0661 291 PRO A CD    
1349 N  N     . GLU A 186 ? 0.6999 0.7555 0.8283 0.0215  0.0240  -0.0693 292 GLU A N     
1350 C  CA    . GLU A 186 ? 0.7055 0.7590 0.8296 0.0226  0.0198  -0.0681 292 GLU A CA    
1351 C  C     . GLU A 186 ? 0.6931 0.7444 0.8140 0.0209  0.0201  -0.0659 292 GLU A C     
1352 O  O     . GLU A 186 ? 0.6824 0.7308 0.7979 0.0216  0.0172  -0.0641 292 GLU A O     
1353 C  CB    . GLU A 186 ? 0.7431 0.8003 0.8723 0.0243  0.0163  -0.0714 292 GLU A CB    
1354 C  CG    . GLU A 186 ? 0.7547 0.8147 0.8879 0.0266  0.0152  -0.0742 292 GLU A CG    
1355 C  CD    . GLU A 186 ? 0.7614 0.8233 0.8968 0.0289  0.0104  -0.0765 292 GLU A CD    
1356 O  OE1   . GLU A 186 ? 0.8625 0.9259 1.0003 0.0282  0.0091  -0.0776 292 GLU A OE1   
1357 O  OE2   . GLU A 186 ? 0.7805 0.8419 0.9150 0.0314  0.0078  -0.0774 292 GLU A OE2   
1358 N  N     . ASN A 187 ? 0.6766 0.7293 0.8010 0.0187  0.0234  -0.0664 293 ASN A N     
1359 C  CA    . ASN A 187 ? 0.6737 0.7243 0.7954 0.0169  0.0242  -0.0645 293 ASN A CA    
1360 C  C     . ASN A 187 ? 0.6664 0.7125 0.7814 0.0160  0.0261  -0.0608 293 ASN A C     
1361 O  O     . ASN A 187 ? 0.6154 0.6593 0.7271 0.0149  0.0265  -0.0588 293 ASN A O     
1362 C  CB    . ASN A 187 ? 0.6776 0.7310 0.8053 0.0148  0.0269  -0.0664 293 ASN A CB    
1363 C  CG    . ASN A 187 ? 0.6917 0.7456 0.8217 0.0131  0.0315  -0.0666 293 ASN A CG    
1364 O  OD1   . ASN A 187 ? 0.8137 0.8664 0.9418 0.0136  0.0327  -0.0659 293 ASN A OD1   
1365 N  ND2   . ASN A 187 ? 0.6997 0.7547 0.8332 0.0109  0.0340  -0.0676 293 ASN A ND2   
1366 N  N     . LYS A 188 ? 0.6389 0.6837 0.7519 0.0166  0.0274  -0.0600 294 LYS A N     
1367 C  CA    . LYS A 188 ? 0.6320 0.6725 0.7382 0.0162  0.0283  -0.0565 294 LYS A CA    
1368 C  C     . LYS A 188 ? 0.5792 0.6173 0.6803 0.0181  0.0257  -0.0552 294 LYS A C     
1369 O  O     . LYS A 188 ? 0.5174 0.5526 0.6140 0.0178  0.0269  -0.0529 294 LYS A O     
1370 C  CB    . LYS A 188 ? 0.6375 0.6774 0.7447 0.0144  0.0328  -0.0562 294 LYS A CB    
1371 C  CG    . LYS A 188 ? 0.6401 0.6801 0.7490 0.0124  0.0348  -0.0561 294 LYS A CG    
1372 C  CD    . LYS A 188 ? 0.6638 0.7025 0.7731 0.0105  0.0391  -0.0556 294 LYS A CD    
1373 C  CE    . LYS A 188 ? 0.6944 0.7319 0.8035 0.0087  0.0406  -0.0548 294 LYS A CE    
1374 N  NZ    . LYS A 188 ? 0.7567 0.7919 0.8647 0.0069  0.0447  -0.0539 294 LYS A NZ    
1375 N  N     . SER A 189 ? 0.5804 0.6195 0.6818 0.0199  0.0219  -0.0564 295 SER A N     
1376 C  CA    . SER A 189 ? 0.5863 0.6229 0.6827 0.0217  0.0191  -0.0554 295 SER A CA    
1377 C  C     . SER A 189 ? 0.5599 0.5924 0.6488 0.0211  0.0183  -0.0518 295 SER A C     
1378 O  O     . SER A 189 ? 0.5903 0.6200 0.6745 0.0218  0.0176  -0.0502 295 SER A O     
1379 C  CB    . SER A 189 ? 0.5705 0.6087 0.6685 0.0237  0.0149  -0.0575 295 SER A CB    
1380 O  OG    . SER A 189 ? 0.6598 0.6998 0.7604 0.0230  0.0141  -0.0585 295 SER A OG    
1381 N  N     . PHE A 190 ? 0.5152 0.5474 0.6031 0.0199  0.0185  -0.0508 296 PHE A N     
1382 C  CA    . PHE A 190 ? 0.5232 0.5520 0.6046 0.0193  0.0180  -0.0477 296 PHE A CA    
1383 C  C     . PHE A 190 ? 0.5170 0.5432 0.5950 0.0185  0.0205  -0.0454 296 PHE A C     
1384 O  O     . PHE A 190 ? 0.5133 0.5366 0.5855 0.0186  0.0194  -0.0430 296 PHE A O     
1385 C  CB    . PHE A 190 ? 0.5220 0.5511 0.6036 0.0180  0.0184  -0.0471 296 PHE A CB    
1386 C  CG    . PHE A 190 ? 0.4937 0.5244 0.5796 0.0165  0.0218  -0.0478 296 PHE A CG    
1387 C  CD1   . PHE A 190 ? 0.4720 0.5060 0.5641 0.0164  0.0221  -0.0506 296 PHE A CD1   
1388 C  CD2   . PHE A 190 ? 0.5146 0.5433 0.5982 0.0152  0.0245  -0.0457 296 PHE A CD2   
1389 C  CE1   . PHE A 190 ? 0.4521 0.4871 0.5478 0.0149  0.0252  -0.0513 296 PHE A CE1   
1390 C  CE2   . PHE A 190 ? 0.4975 0.5270 0.5845 0.0138  0.0276  -0.0463 296 PHE A CE2   
1391 C  CZ    . PHE A 190 ? 0.4927 0.5253 0.5857 0.0135  0.0280  -0.0491 296 PHE A CZ    
1392 N  N     . LEU A 191 ? 0.4865 0.5137 0.5678 0.0178  0.0237  -0.0461 297 LEU A N     
1393 C  CA    . LEU A 191 ? 0.4910 0.5155 0.5689 0.0171  0.0261  -0.0440 297 LEU A CA    
1394 C  C     . LEU A 191 ? 0.5029 0.5254 0.5772 0.0184  0.0249  -0.0434 297 LEU A C     
1395 O  O     . LEU A 191 ? 0.5300 0.5495 0.5995 0.0179  0.0257  -0.0410 297 LEU A O     
1396 C  CB    . LEU A 191 ? 0.4997 0.5255 0.5818 0.0159  0.0300  -0.0452 297 LEU A CB    
1397 C  CG    . LEU A 191 ? 0.4870 0.5138 0.5721 0.0143  0.0320  -0.0456 297 LEU A CG    
1398 C  CD1   . LEU A 191 ? 0.4939 0.5217 0.5828 0.0131  0.0358  -0.0469 297 LEU A CD1   
1399 C  CD2   . LEU A 191 ? 0.5057 0.5296 0.5860 0.0133  0.0324  -0.0427 297 LEU A CD2   
1400 N  N     . TYR A 192 ? 0.5020 0.5260 0.5785 0.0200  0.0228  -0.0455 298 TYR A N     
1401 C  CA    . TYR A 192 ? 0.4945 0.5162 0.5670 0.0214  0.0212  -0.0449 298 TYR A CA    
1402 C  C     . TYR A 192 ? 0.4726 0.4913 0.5386 0.0217  0.0180  -0.0427 298 TYR A C     
1403 O  O     . TYR A 192 ? 0.4959 0.5120 0.5576 0.0227  0.0166  -0.0418 298 TYR A O     
1404 C  CB    . TYR A 192 ? 0.4996 0.5238 0.5764 0.0233  0.0197  -0.0480 298 TYR A CB    
1405 C  CG    . TYR A 192 ? 0.5105 0.5376 0.5932 0.0231  0.0229  -0.0502 298 TYR A CG    
1406 C  CD1   . TYR A 192 ? 0.4990 0.5246 0.5803 0.0232  0.0250  -0.0498 298 TYR A CD1   
1407 C  CD2   . TYR A 192 ? 0.5231 0.5544 0.6128 0.0225  0.0240  -0.0527 298 TYR A CD2   
1408 C  CE1   . TYR A 192 ? 0.5180 0.5463 0.6046 0.0228  0.0282  -0.0518 298 TYR A CE1   
1409 C  CE2   . TYR A 192 ? 0.5068 0.5408 0.6019 0.0220  0.0272  -0.0548 298 TYR A CE2   
1410 C  CZ    . TYR A 192 ? 0.5037 0.5363 0.5973 0.0221  0.0293  -0.0544 298 TYR A CZ    
1411 O  OH    . TYR A 192 ? 0.4707 0.5059 0.5694 0.0215  0.0327  -0.0565 298 TYR A OH    
1412 N  N     . GLU A 193 ? 0.4765 0.4955 0.5417 0.0210  0.0169  -0.0420 299 GLU A N     
1413 C  CA    . GLU A 193 ? 0.4990 0.5154 0.5583 0.0210  0.0141  -0.0401 299 GLU A CA    
1414 C  C     . GLU A 193 ? 0.4798 0.4937 0.5342 0.0196  0.0154  -0.0370 299 GLU A C     
1415 O  O     . GLU A 193 ? 0.4531 0.4651 0.5026 0.0194  0.0134  -0.0354 299 GLU A O     
1416 C  CB    . GLU A 193 ? 0.5395 0.5576 0.6004 0.0211  0.0119  -0.0412 299 GLU A CB    
1417 C  CG    . GLU A 193 ? 0.5873 0.6062 0.6498 0.0230  0.0089  -0.0436 299 GLU A CG    
1418 C  CD    . GLU A 193 ? 0.6931 0.7143 0.7586 0.0231  0.0072  -0.0453 299 GLU A CD    
1419 O  OE1   . GLU A 193 ? 0.6914 0.7143 0.7594 0.0218  0.0088  -0.0453 299 GLU A OE1   
1420 O  OE2   . GLU A 193 ? 0.8062 0.8271 0.8713 0.0246  0.0040  -0.0467 299 GLU A OE2   
1421 N  N     . ILE A 194 ? 0.4272 0.4410 0.4827 0.0186  0.0187  -0.0362 300 ILE A N     
1422 C  CA    . ILE A 194 ? 0.3787 0.3904 0.4300 0.0173  0.0199  -0.0334 300 ILE A CA    
1423 C  C     . ILE A 194 ? 0.3646 0.3730 0.4105 0.0174  0.0195  -0.0315 300 ILE A C     
1424 O  O     . ILE A 194 ? 0.3532 0.3597 0.3942 0.0169  0.0179  -0.0295 300 ILE A O     
1425 C  CB    . ILE A 194 ? 0.3762 0.3888 0.4307 0.0161  0.0232  -0.0334 300 ILE A CB    
1426 C  CG1   . ILE A 194 ? 0.3905 0.4060 0.4494 0.0159  0.0231  -0.0350 300 ILE A CG1   
1427 C  CG2   . ILE A 194 ? 0.3564 0.3668 0.4068 0.0150  0.0244  -0.0307 300 ILE A CG2   
1428 C  CD1   . ILE A 194 ? 0.4033 0.4197 0.4656 0.0147  0.0263  -0.0354 300 ILE A CD1   
1429 N  N     . VAL A 195 ? 0.3554 0.3630 0.4020 0.0180  0.0208  -0.0321 301 VAL A N     
1430 C  CA    . VAL A 195 ? 0.3534 0.3578 0.3951 0.0179  0.0211  -0.0303 301 VAL A CA    
1431 C  C     . VAL A 195 ? 0.3484 0.3509 0.3864 0.0191  0.0180  -0.0303 301 VAL A C     
1432 O  O     . VAL A 195 ? 0.3537 0.3532 0.3860 0.0187  0.0168  -0.0282 301 VAL A O     
1433 C  CB    . VAL A 195 ? 0.3567 0.3609 0.4006 0.0179  0.0242  -0.0311 301 VAL A CB    
1434 C  CG1   . VAL A 195 ? 0.3595 0.3602 0.3985 0.0181  0.0242  -0.0296 301 VAL A CG1   
1435 C  CG2   . VAL A 195 ? 0.3557 0.3603 0.4012 0.0164  0.0272  -0.0303 301 VAL A CG2   
1436 N  N     . SER A 196 ? 0.3319 0.3358 0.3730 0.0206  0.0168  -0.0328 302 SER A N     
1437 C  CA    . SER A 196 ? 0.3276 0.3297 0.3657 0.0220  0.0136  -0.0332 302 SER A CA    
1438 C  C     . SER A 196 ? 0.3471 0.3520 0.3895 0.0232  0.0116  -0.0358 302 SER A C     
1439 O  O     . SER A 196 ? 0.3482 0.3558 0.3962 0.0243  0.0124  -0.0384 302 SER A O     
1440 C  CB    . SER A 196 ? 0.3321 0.3328 0.3698 0.0232  0.0144  -0.0339 302 SER A CB    
1441 O  OG    . SER A 196 ? 0.3418 0.3406 0.3768 0.0248  0.0112  -0.0346 302 SER A OG    
1442 N  N     . ASN A 197 ? 0.3688 0.3729 0.4083 0.0231  0.0089  -0.0351 303 ASN A N     
1443 C  CA    . ASN A 197 ? 0.3776 0.3838 0.4202 0.0239  0.0068  -0.0372 303 ASN A CA    
1444 C  C     . ASN A 197 ? 0.3920 0.3963 0.4325 0.0260  0.0034  -0.0385 303 ASN A C     
1445 O  O     . ASN A 197 ? 0.3881 0.3889 0.4225 0.0260  0.0009  -0.0371 303 ASN A O     
1446 C  CB    . ASN A 197 ? 0.3638 0.3700 0.4041 0.0225  0.0060  -0.0357 303 ASN A CB    
1447 C  CG    . ASN A 197 ? 0.3680 0.3761 0.4109 0.0231  0.0039  -0.0377 303 ASN A CG    
1448 O  OD1   . ASN A 197 ? 0.3399 0.3481 0.3840 0.0249  0.0015  -0.0397 303 ASN A OD1   
1449 N  ND2   . ASN A 197 ? 0.3195 0.3290 0.3632 0.0218  0.0045  -0.0371 303 ASN A ND2   
1450 N  N     . LYS A 198 ? 0.4452 0.4518 0.4908 0.0277  0.0033  -0.0413 304 LYS A N     
1451 C  CA    . LYS A 198 ? 0.5155 0.5206 0.5600 0.0301  0.0002  -0.0429 304 LYS A CA    
1452 C  C     . LYS A 198 ? 0.5077 0.5126 0.5514 0.0310  -0.0034 -0.0439 304 LYS A C     
1453 O  O     . LYS A 198 ? 0.5353 0.5371 0.5751 0.0325  -0.0066 -0.0442 304 LYS A O     
1454 C  CB    . LYS A 198 ? 0.5636 0.5718 0.6146 0.0318  0.0014  -0.0459 304 LYS A CB    
1455 C  CG    . LYS A 198 ? 0.6583 0.6675 0.7115 0.0311  0.0054  -0.0456 304 LYS A CG    
1456 C  CD    . LYS A 198 ? 0.7258 0.7307 0.7729 0.0310  0.0059  -0.0434 304 LYS A CD    
1457 C  CE    . LYS A 198 ? 0.8187 0.8244 0.8672 0.0293  0.0103  -0.0423 304 LYS A CE    
1458 N  NZ    . LYS A 198 ? 0.8487 0.8503 0.8914 0.0287  0.0114  -0.0400 304 LYS A NZ    
1459 N  N     . ARG A 199 ? 0.4908 0.4984 0.5378 0.0299  -0.0028 -0.0444 305 ARG A N     
1460 C  CA    . ARG A 199 ? 0.5497 0.5574 0.5963 0.0305  -0.0060 -0.0454 305 ARG A CA    
1461 C  C     . ARG A 199 ? 0.5076 0.5107 0.5457 0.0295  -0.0083 -0.0429 305 ARG A C     
1462 O  O     . ARG A 199 ? 0.5376 0.5379 0.5720 0.0308  -0.0119 -0.0435 305 ARG A O     
1463 C  CB    . ARG A 199 ? 0.6047 0.6167 0.6573 0.0294  -0.0041 -0.0465 305 ARG A CB    
1464 C  CG    . ARG A 199 ? 0.7173 0.7305 0.7715 0.0301  -0.0069 -0.0483 305 ARG A CG    
1465 C  CD    . ARG A 199 ? 0.8072 0.8235 0.8653 0.0283  -0.0048 -0.0485 305 ARG A CD    
1466 N  NE    . ARG A 199 ? 1.0158 1.0315 1.0723 0.0285  -0.0078 -0.0491 305 ARG A NE    
1467 C  CZ    . ARG A 199 ? 1.0997 1.1163 1.1562 0.0270  -0.0073 -0.0486 305 ARG A CZ    
1468 N  NH1   . ARG A 199 ? 1.1639 1.1822 1.2222 0.0252  -0.0038 -0.0473 305 ARG A NH1   
1469 N  NH2   . ARG A 199 ? 0.9854 1.0010 1.0399 0.0274  -0.0103 -0.0493 305 ARG A NH2   
1470 N  N     . ASN A 200 ? 0.4508 0.4530 0.4859 0.0273  -0.0063 -0.0403 306 ASN A N     
1471 C  CA    . ASN A 200 ? 0.4369 0.4353 0.4643 0.0260  -0.0080 -0.0380 306 ASN A CA    
1472 C  C     . ASN A 200 ? 0.4009 0.3969 0.4234 0.0243  -0.0065 -0.0350 306 ASN A C     
1473 O  O     . ASN A 200 ? 0.3926 0.3854 0.4087 0.0233  -0.0079 -0.0333 306 ASN A O     
1474 C  CB    . ASN A 200 ? 0.4375 0.4376 0.4658 0.0249  -0.0083 -0.0381 306 ASN A CB    
1475 C  CG    . ASN A 200 ? 0.4317 0.4356 0.4649 0.0235  -0.0048 -0.0378 306 ASN A CG    
1476 O  OD1   . ASN A 200 ? 0.4185 0.4222 0.4507 0.0223  -0.0023 -0.0360 306 ASN A OD1   
1477 N  ND2   . ASN A 200 ? 0.3978 0.4049 0.4360 0.0236  -0.0046 -0.0396 306 ASN A ND2   
1478 N  N     . GLY A 201 ? 0.3853 0.3825 0.4103 0.0241  -0.0036 -0.0346 307 GLY A N     
1479 C  CA    . GLY A 201 ? 0.3774 0.3724 0.3981 0.0228  -0.0022 -0.0321 307 GLY A CA    
1480 C  C     . GLY A 201 ? 0.3767 0.3731 0.3972 0.0205  0.0000  -0.0302 307 GLY A C     
1481 O  O     . GLY A 201 ? 0.3698 0.3644 0.3866 0.0193  0.0009  -0.0279 307 GLY A O     
1482 N  N     . ILE A 202 ? 0.3401 0.3397 0.3646 0.0201  0.0006  -0.0310 308 ILE A N     
1483 C  CA    . ILE A 202 ? 0.3392 0.3402 0.3636 0.0182  0.0026  -0.0293 308 ILE A CA    
1484 C  C     . ILE A 202 ? 0.3399 0.3429 0.3687 0.0180  0.0060  -0.0294 308 ILE A C     
1485 O  O     . ILE A 202 ? 0.3710 0.3768 0.4055 0.0185  0.0072  -0.0311 308 ILE A O     
1486 C  CB    . ILE A 202 ? 0.3356 0.3386 0.3618 0.0178  0.0019  -0.0302 308 ILE A CB    
1487 C  CG1   . ILE A 202 ? 0.3442 0.3444 0.3648 0.0177  -0.0013 -0.0300 308 ILE A CG1   
1488 C  CG2   . ILE A 202 ? 0.3372 0.3418 0.3636 0.0161  0.0040  -0.0288 308 ILE A CG2   
1489 C  CD1   . ILE A 202 ? 0.3301 0.3318 0.3522 0.0177  -0.0024 -0.0313 308 ILE A CD1   
1490 N  N     . ASP A 203 ? 0.3263 0.3275 0.3525 0.0173  0.0073  -0.0275 309 ASP A N     
1491 C  CA    . ASP A 203 ? 0.3039 0.3064 0.3336 0.0171  0.0106  -0.0275 309 ASP A CA    
1492 C  C     . ASP A 203 ? 0.2888 0.2902 0.3154 0.0156  0.0120  -0.0249 309 ASP A C     
1493 O  O     . ASP A 203 ? 0.2741 0.2737 0.2957 0.0148  0.0106  -0.0232 309 ASP A O     
1494 C  CB    . ASP A 203 ? 0.3006 0.3022 0.3315 0.0185  0.0110  -0.0286 309 ASP A CB    
1495 C  CG    . ASP A 203 ? 0.3213 0.3192 0.3465 0.0190  0.0088  -0.0277 309 ASP A CG    
1496 O  OD1   . ASP A 203 ? 0.2973 0.2928 0.3175 0.0179  0.0088  -0.0254 309 ASP A OD1   
1497 O  OD2   . ASP A 203 ? 0.3644 0.3616 0.3899 0.0206  0.0071  -0.0294 309 ASP A OD2   
1498 N  N     . VAL A 204 ? 0.2978 0.3002 0.3273 0.0152  0.0148  -0.0247 310 VAL A N     
1499 C  CA    . VAL A 204 ? 0.2908 0.2923 0.3178 0.0140  0.0163  -0.0225 310 VAL A CA    
1500 C  C     . VAL A 204 ? 0.3013 0.2996 0.3234 0.0138  0.0160  -0.0207 310 VAL A C     
1501 O  O     . VAL A 204 ? 0.2883 0.2857 0.3073 0.0127  0.0162  -0.0187 310 VAL A O     
1502 C  CB    . VAL A 204 ? 0.2963 0.2993 0.3274 0.0137  0.0192  -0.0228 310 VAL A CB    
1503 C  CG1   . VAL A 204 ? 0.3027 0.3087 0.3386 0.0138  0.0194  -0.0246 310 VAL A CG1   
1504 C  CG2   . VAL A 204 ? 0.3033 0.3054 0.3361 0.0142  0.0212  -0.0236 310 VAL A CG2   
1505 N  N     . ASP A 205 ? 0.2936 0.2903 0.3150 0.0148  0.0155  -0.0215 311 ASP A N     
1506 C  CA    . ASP A 205 ? 0.3067 0.3000 0.3231 0.0147  0.0148  -0.0201 311 ASP A CA    
1507 C  C     . ASP A 205 ? 0.3069 0.2988 0.3182 0.0138  0.0125  -0.0185 311 ASP A C     
1508 O  O     . ASP A 205 ? 0.3075 0.2977 0.3150 0.0128  0.0125  -0.0165 311 ASP A O     
1509 C  CB    . ASP A 205 ? 0.3185 0.3106 0.3354 0.0163  0.0143  -0.0217 311 ASP A CB    
1510 C  CG    . ASP A 205 ? 0.3718 0.3600 0.3831 0.0164  0.0133  -0.0205 311 ASP A CG    
1511 O  OD1   . ASP A 205 ? 0.3679 0.3543 0.3769 0.0157  0.0148  -0.0189 311 ASP A OD1   
1512 O  OD2   . ASP A 205 ? 0.4475 0.4341 0.4565 0.0173  0.0108  -0.0211 311 ASP A OD2   
1513 N  N     . LYS A 206 ? 0.3060 0.2986 0.3173 0.0142  0.0103  -0.0194 312 LYS A N     
1514 C  CA    . LYS A 206 ? 0.2974 0.2885 0.3036 0.0131  0.0080  -0.0181 312 LYS A CA    
1515 C  C     . LYS A 206 ? 0.2782 0.2712 0.2844 0.0115  0.0090  -0.0167 312 LYS A C     
1516 O  O     . LYS A 206 ? 0.2680 0.2596 0.2699 0.0103  0.0081  -0.0150 312 LYS A O     
1517 C  CB    . LYS A 206 ? 0.3035 0.2948 0.3096 0.0137  0.0057  -0.0195 312 LYS A CB    
1518 C  CG    . LYS A 206 ? 0.3124 0.3012 0.3171 0.0153  0.0038  -0.0208 312 LYS A CG    
1519 C  CD    . LYS A 206 ? 0.3256 0.3147 0.3301 0.0158  0.0013  -0.0222 312 LYS A CD    
1520 C  CE    . LYS A 206 ? 0.3319 0.3181 0.3342 0.0174  -0.0011 -0.0234 312 LYS A CE    
1521 N  NZ    . LYS A 206 ? 0.3541 0.3420 0.3617 0.0192  0.0001  -0.0253 312 LYS A NZ    
1522 N  N     . TRP A 207 ? 0.2680 0.2640 0.2790 0.0116  0.0106  -0.0175 313 TRP A N     
1523 C  CA    . TRP A 207 ? 0.2746 0.2725 0.2859 0.0104  0.0114  -0.0163 313 TRP A CA    
1524 C  C     . TRP A 207 ? 0.2693 0.2660 0.2782 0.0096  0.0125  -0.0144 313 TRP A C     
1525 O  O     . TRP A 207 ? 0.2789 0.2758 0.2851 0.0084  0.0119  -0.0129 313 TRP A O     
1526 C  CB    . TRP A 207 ? 0.2820 0.2830 0.2987 0.0108  0.0130  -0.0176 313 TRP A CB    
1527 C  CG    . TRP A 207 ? 0.2983 0.3007 0.3175 0.0115  0.0118  -0.0197 313 TRP A CG    
1528 C  CD1   . TRP A 207 ? 0.3088 0.3100 0.3253 0.0117  0.0094  -0.0202 313 TRP A CD1   
1529 C  CD2   . TRP A 207 ? 0.3032 0.3083 0.3278 0.0120  0.0130  -0.0214 313 TRP A CD2   
1530 N  NE1   . TRP A 207 ? 0.3172 0.3202 0.3371 0.0124  0.0088  -0.0222 313 TRP A NE1   
1531 C  CE2   . TRP A 207 ? 0.3161 0.3215 0.3410 0.0126  0.0110  -0.0230 313 TRP A CE2   
1532 C  CE3   . TRP A 207 ? 0.3065 0.3133 0.3351 0.0120  0.0153  -0.0218 313 TRP A CE3   
1533 C  CZ2   . TRP A 207 ? 0.3171 0.3249 0.3467 0.0132  0.0113  -0.0250 313 TRP A CZ2   
1534 C  CZ3   . TRP A 207 ? 0.3139 0.3229 0.3471 0.0125  0.0158  -0.0237 313 TRP A CZ3   
1535 C  CH2   . TRP A 207 ? 0.3171 0.3268 0.3510 0.0131  0.0138  -0.0254 313 TRP A CH2   
1536 N  N     . ASP A 208 ? 0.2734 0.2686 0.2831 0.0103  0.0140  -0.0144 314 ASP A N     
1537 C  CA    . ASP A 208 ? 0.2577 0.2513 0.2650 0.0097  0.0149  -0.0126 314 ASP A CA    
1538 C  C     . ASP A 208 ? 0.2655 0.2564 0.2671 0.0089  0.0131  -0.0112 314 ASP A C     
1539 O  O     . ASP A 208 ? 0.2684 0.2593 0.2674 0.0078  0.0127  -0.0095 314 ASP A O     
1540 C  CB    . ASP A 208 ? 0.2526 0.2449 0.2615 0.0104  0.0170  -0.0130 314 ASP A CB    
1541 C  CG    . ASP A 208 ? 0.2506 0.2409 0.2566 0.0098  0.0179  -0.0111 314 ASP A CG    
1542 O  OD1   . ASP A 208 ? 0.2504 0.2378 0.2522 0.0096  0.0170  -0.0101 314 ASP A OD1   
1543 O  OD2   . ASP A 208 ? 0.2304 0.2217 0.2380 0.0095  0.0193  -0.0105 314 ASP A OD2   
1544 N  N     . TYR A 209 ? 0.2682 0.2568 0.2677 0.0096  0.0118  -0.0118 315 TYR A N     
1545 C  CA    . TYR A 209 ? 0.2717 0.2572 0.2654 0.0088  0.0101  -0.0104 315 TYR A CA    
1546 C  C     . TYR A 209 ? 0.2790 0.2650 0.2697 0.0074  0.0082  -0.0095 315 TYR A C     
1547 O  O     . TYR A 209 ? 0.2774 0.2618 0.2640 0.0061  0.0075  -0.0079 315 TYR A O     
1548 C  CB    . TYR A 209 ? 0.2869 0.2691 0.2785 0.0100  0.0091  -0.0112 315 TYR A CB    
1549 C  CG    . TYR A 209 ? 0.2868 0.2683 0.2775 0.0108  0.0069  -0.0125 315 TYR A CG    
1550 C  CD1   . TYR A 209 ? 0.2919 0.2718 0.2780 0.0097  0.0046  -0.0116 315 TYR A CD1   
1551 C  CD2   . TYR A 209 ? 0.2879 0.2699 0.2821 0.0126  0.0071  -0.0147 315 TYR A CD2   
1552 C  CE1   . TYR A 209 ? 0.2958 0.2744 0.2804 0.0104  0.0024  -0.0128 315 TYR A CE1   
1553 C  CE2   . TYR A 209 ? 0.2859 0.2668 0.2791 0.0136  0.0048  -0.0159 315 TYR A CE2   
1554 C  CZ    . TYR A 209 ? 0.2975 0.2767 0.2859 0.0125  0.0025  -0.0150 315 TYR A CZ    
1555 O  OH    . TYR A 209 ? 0.3106 0.2885 0.2976 0.0134  0.0001  -0.0162 315 TYR A OH    
1556 N  N     . PHE A 210 ? 0.2854 0.2736 0.2780 0.0074  0.0075  -0.0106 316 PHE A N     
1557 C  CA    . PHE A 210 ? 0.2977 0.2867 0.2878 0.0058  0.0062  -0.0098 316 PHE A CA    
1558 C  C     . PHE A 210 ? 0.2944 0.2855 0.2848 0.0045  0.0073  -0.0084 316 PHE A C     
1559 O  O     . PHE A 210 ? 0.2979 0.2880 0.2841 0.0029  0.0063  -0.0069 316 PHE A O     
1560 C  CB    . PHE A 210 ? 0.3241 0.3156 0.3168 0.0059  0.0058  -0.0112 316 PHE A CB    
1561 C  CG    . PHE A 210 ? 0.3319 0.3218 0.3240 0.0071  0.0041  -0.0128 316 PHE A CG    
1562 C  CD1   . PHE A 210 ? 0.3323 0.3185 0.3212 0.0078  0.0028  -0.0129 316 PHE A CD1   
1563 C  CD2   . PHE A 210 ? 0.3646 0.3566 0.3596 0.0075  0.0038  -0.0143 316 PHE A CD2   
1564 C  CE1   . PHE A 210 ? 0.3296 0.3143 0.3181 0.0091  0.0011  -0.0144 316 PHE A CE1   
1565 C  CE2   . PHE A 210 ? 0.3677 0.3580 0.3621 0.0087  0.0020  -0.0158 316 PHE A CE2   
1566 C  CZ    . PHE A 210 ? 0.3595 0.3462 0.3509 0.0096  0.0006  -0.0159 316 PHE A CZ    
1567 N  N     . ALA A 211 ? 0.2765 0.2702 0.2715 0.0051  0.0092  -0.0088 317 ALA A N     
1568 C  CA    . ALA A 211 ? 0.2611 0.2569 0.2566 0.0042  0.0100  -0.0075 317 ALA A CA    
1569 C  C     . ALA A 211 ? 0.2582 0.2515 0.2505 0.0037  0.0101  -0.0059 317 ALA A C     
1570 O  O     . ALA A 211 ? 0.2480 0.2420 0.2382 0.0024  0.0096  -0.0045 317 ALA A O     
1571 C  CB    . ALA A 211 ? 0.2540 0.2525 0.2546 0.0051  0.0119  -0.0083 317 ALA A CB    
1572 N  N     . ARG A 212 ? 0.2497 0.2403 0.2417 0.0048  0.0107  -0.0061 318 ARG A N     
1573 C  CA    . ARG A 212 ? 0.2399 0.2280 0.2293 0.0047  0.0111  -0.0047 318 ARG A CA    
1574 C  C     . ARG A 212 ? 0.2394 0.2246 0.2231 0.0035  0.0092  -0.0035 318 ARG A C     
1575 O  O     . ARG A 212 ? 0.2513 0.2362 0.2325 0.0023  0.0087  -0.0021 318 ARG A O     
1576 C  CB    . ARG A 212 ? 0.2404 0.2266 0.2314 0.0061  0.0127  -0.0054 318 ARG A CB    
1577 C  CG    . ARG A 212 ? 0.2454 0.2290 0.2339 0.0060  0.0135  -0.0040 318 ARG A CG    
1578 C  CD    . ARG A 212 ? 0.2572 0.2390 0.2475 0.0073  0.0155  -0.0049 318 ARG A CD    
1579 N  NE    . ARG A 212 ? 0.2614 0.2458 0.2570 0.0080  0.0173  -0.0062 318 ARG A NE    
1580 C  CZ    . ARG A 212 ? 0.2625 0.2482 0.2601 0.0079  0.0186  -0.0058 318 ARG A CZ    
1581 N  NH1   . ARG A 212 ? 0.2616 0.2496 0.2638 0.0085  0.0200  -0.0070 318 ARG A NH1   
1582 N  NH2   . ARG A 212 ? 0.2712 0.2557 0.2662 0.0073  0.0184  -0.0041 318 ARG A NH2   
1583 N  N     . ASP A 213 ? 0.2343 0.2176 0.2161 0.0038  0.0079  -0.0043 319 ASP A N     
1584 C  CA    . ASP A 213 ? 0.2396 0.2199 0.2157 0.0026  0.0059  -0.0033 319 ASP A CA    
1585 C  C     . ASP A 213 ? 0.2431 0.2254 0.2174 0.0005  0.0049  -0.0024 319 ASP A C     
1586 O  O     . ASP A 213 ? 0.2589 0.2396 0.2294 -0.0008 0.0040  -0.0010 319 ASP A O     
1587 C  CB    . ASP A 213 ? 0.2376 0.2153 0.2116 0.0033  0.0044  -0.0044 319 ASP A CB    
1588 C  CG    . ASP A 213 ? 0.2373 0.2130 0.2127 0.0054  0.0053  -0.0055 319 ASP A CG    
1589 O  OD1   . ASP A 213 ? 0.2593 0.2341 0.2352 0.0058  0.0067  -0.0050 319 ASP A OD1   
1590 O  OD2   . ASP A 213 ? 0.2480 0.2227 0.2238 0.0066  0.0044  -0.0070 319 ASP A OD2   
1591 N  N     . CYS A 214 ? 0.2555 0.2413 0.2328 0.0002  0.0051  -0.0032 320 CYS A N     
1592 C  CA    . CYS A 214 ? 0.2533 0.2414 0.2292 -0.0017 0.0044  -0.0024 320 CYS A CA    
1593 C  C     . CYS A 214 ? 0.2523 0.2424 0.2290 -0.0026 0.0051  -0.0012 320 CYS A C     
1594 O  O     . CYS A 214 ? 0.2513 0.2411 0.2245 -0.0045 0.0041  0.0000  320 CYS A O     
1595 C  CB    . CYS A 214 ? 0.2597 0.2511 0.2388 -0.0016 0.0047  -0.0037 320 CYS A CB    
1596 S  SG    . CYS A 214 ? 0.2985 0.2871 0.2743 -0.0017 0.0028  -0.0047 320 CYS A SG    
1597 N  N     . HIS A 215 ? 0.2539 0.2457 0.2347 -0.0012 0.0067  -0.0014 321 HIS A N     
1598 C  CA    . HIS A 215 ? 0.2645 0.2576 0.2459 -0.0016 0.0073  -0.0003 321 HIS A CA    
1599 C  C     . HIS A 215 ? 0.2739 0.2635 0.2504 -0.0025 0.0062  0.0011  321 HIS A C     
1600 O  O     . HIS A 215 ? 0.2592 0.2502 0.2347 -0.0038 0.0057  0.0021  321 HIS A O     
1601 C  CB    . HIS A 215 ? 0.2742 0.2677 0.2596 0.0002  0.0091  -0.0007 321 HIS A CB    
1602 C  CG    . HIS A 215 ? 0.2746 0.2696 0.2611 0.0002  0.0097  0.0001  321 HIS A CG    
1603 N  ND1   . HIS A 215 ? 0.2660 0.2651 0.2556 0.0000  0.0100  0.0000  321 HIS A ND1   
1604 C  CD2   . HIS A 215 ? 0.2856 0.2780 0.2705 0.0006  0.0100  0.0011  321 HIS A CD2   
1605 C  CE1   . HIS A 215 ? 0.2755 0.2747 0.2654 0.0004  0.0103  0.0008  321 HIS A CE1   
1606 N  NE2   . HIS A 215 ? 0.2764 0.2714 0.2633 0.0007  0.0102  0.0016  321 HIS A NE2   
1607 N  N     . HIS A 216 ? 0.2903 0.2756 0.2640 -0.0018 0.0059  0.0010  322 HIS A N     
1608 C  CA    . HIS A 216 ? 0.3245 0.3060 0.2934 -0.0025 0.0050  0.0024  322 HIS A CA    
1609 C  C     . HIS A 216 ? 0.3482 0.3276 0.3119 -0.0043 0.0030  0.0030  322 HIS A C     
1610 O  O     . HIS A 216 ? 0.3446 0.3223 0.3046 -0.0057 0.0020  0.0043  322 HIS A O     
1611 C  CB    . HIS A 216 ? 0.3324 0.3102 0.3007 -0.0007 0.0058  0.0021  322 HIS A CB    
1612 C  CG    . HIS A 216 ? 0.3577 0.3365 0.3295 0.0005  0.0077  0.0020  322 HIS A CG    
1613 N  ND1   . HIS A 216 ? 0.3728 0.3538 0.3496 0.0018  0.0093  0.0007  322 HIS A ND1   
1614 C  CD2   . HIS A 216 ? 0.3634 0.3410 0.3343 0.0005  0.0082  0.0031  322 HIS A CD2   
1615 C  CE1   . HIS A 216 ? 0.3705 0.3516 0.3490 0.0026  0.0108  0.0010  322 HIS A CE1   
1616 N  NE2   . HIS A 216 ? 0.3841 0.3631 0.3591 0.0018  0.0101  0.0025  322 HIS A NE2   
1617 N  N     . LEU A 217 ? 0.3592 0.3382 0.3223 -0.0044 0.0023  0.0020  323 LEU A N     
1618 C  CA    . LEU A 217 ? 0.3605 0.3369 0.3184 -0.0061 0.0004  0.0025  323 LEU A CA    
1619 C  C     . LEU A 217 ? 0.3625 0.3419 0.3196 -0.0086 -0.0001 0.0032  323 LEU A C     
1620 O  O     . LEU A 217 ? 0.4048 0.3818 0.3568 -0.0106 -0.0015 0.0041  323 LEU A O     
1621 C  CB    . LEU A 217 ? 0.3639 0.3391 0.3215 -0.0053 -0.0001 0.0012  323 LEU A CB    
1622 C  CG    . LEU A 217 ? 0.3666 0.3383 0.3238 -0.0031 -0.0001 0.0003  323 LEU A CG    
1623 C  CD1   . LEU A 217 ? 0.3539 0.3263 0.3129 -0.0021 -0.0006 -0.0012 323 LEU A CD1   
1624 C  CD2   . LEU A 217 ? 0.3689 0.3352 0.3200 -0.0036 -0.0016 0.0012  323 LEU A CD2   
1625 N  N     . GLY A 218 ? 0.3625 0.3469 0.3242 -0.0086 0.0009  0.0027  324 GLY A N     
1626 C  CA    . GLY A 218 ? 0.3683 0.3560 0.3296 -0.0111 0.0005  0.0031  324 GLY A CA    
1627 C  C     . GLY A 218 ? 0.3825 0.3707 0.3428 -0.0120 0.0000  0.0022  324 GLY A C     
1628 O  O     . GLY A 218 ? 0.3834 0.3726 0.3413 -0.0144 -0.0005 0.0026  324 GLY A O     
1629 N  N     . ILE A 219 ? 0.3864 0.3740 0.3487 -0.0102 0.0004  0.0010  325 ILE A N     
1630 C  CA    . ILE A 219 ? 0.3827 0.3703 0.3441 -0.0106 0.0000  0.0000  325 ILE A CA    
1631 C  C     . ILE A 219 ? 0.4117 0.4031 0.3794 -0.0087 0.0014  -0.0011 325 ILE A C     
1632 O  O     . ILE A 219 ? 0.3889 0.3802 0.3597 -0.0066 0.0024  -0.0015 325 ILE A O     
1633 C  CB    . ILE A 219 ? 0.3998 0.3825 0.3581 -0.0094 -0.0013 -0.0004 325 ILE A CB    
1634 C  CG1   . ILE A 219 ? 0.4056 0.3832 0.3569 -0.0110 -0.0031 0.0006  325 ILE A CG1   
1635 C  CG2   . ILE A 219 ? 0.4317 0.4148 0.3907 -0.0089 -0.0016 -0.0018 325 ILE A CG2   
1636 C  CD1   . ILE A 219 ? 0.4043 0.3768 0.3529 -0.0091 -0.0043 0.0000  325 ILE A CD1   
1637 N  N     . GLN A 220 ? 0.4708 0.4652 0.4399 -0.0095 0.0017  -0.0019 326 GLN A N     
1638 C  CA    . GLN A 220 ? 0.4941 0.4926 0.4690 -0.0081 0.0032  -0.0030 326 GLN A CA    
1639 C  C     . GLN A 220 ? 0.4823 0.4798 0.4586 -0.0065 0.0031  -0.0045 326 GLN A C     
1640 O  O     . GLN A 220 ? 0.4083 0.4028 0.3810 -0.0069 0.0017  -0.0049 326 GLN A O     
1641 C  CB    . GLN A 220 ? 0.5827 0.5854 0.5584 -0.0100 0.0037  -0.0030 326 GLN A CB    
1642 C  CG    . GLN A 220 ? 0.6873 0.6947 0.6689 -0.0088 0.0053  -0.0039 326 GLN A CG    
1643 C  CD    . GLN A 220 ? 0.8029 0.8151 0.7861 -0.0104 0.0060  -0.0037 326 GLN A CD    
1644 O  OE1   . GLN A 220 ? 0.9370 0.9522 0.9218 -0.0109 0.0066  -0.0047 326 GLN A OE1   
1645 N  NE2   . GLN A 220 ? 0.8158 0.8291 0.7989 -0.0111 0.0060  -0.0026 326 GLN A NE2   
1646 N  N     . ASN A 221 ? 0.4727 0.4723 0.4544 -0.0044 0.0045  -0.0053 327 ASN A N     
1647 C  CA    . ASN A 221 ? 0.4890 0.4879 0.4729 -0.0026 0.0046  -0.0069 327 ASN A CA    
1648 C  C     . ASN A 221 ? 0.4560 0.4577 0.4417 -0.0030 0.0047  -0.0080 327 ASN A C     
1649 O  O     . ASN A 221 ? 0.4176 0.4230 0.4059 -0.0035 0.0059  -0.0080 327 ASN A O     
1650 C  CB    . ASN A 221 ? 0.4669 0.4667 0.4558 -0.0005 0.0061  -0.0074 327 ASN A CB    
1651 C  CG    . ASN A 221 ? 0.4502 0.4490 0.4414 0.0012  0.0061  -0.0091 327 ASN A CG    
1652 O  OD1   . ASN A 221 ? 0.4003 0.3970 0.3887 0.0011  0.0044  -0.0098 327 ASN A OD1   
1653 N  ND2   . ASN A 221 ? 0.3345 0.3349 0.3308 0.0028  0.0078  -0.0099 327 ASN A ND2   
1654 N  N     . ASN A 222 ? 0.5096 0.5094 0.4939 -0.0026 0.0036  -0.0091 328 ASN A N     
1655 C  CA    . ASN A 222 ? 0.4720 0.4742 0.4577 -0.0029 0.0038  -0.0102 328 ASN A CA    
1656 C  C     . ASN A 222 ? 0.4050 0.4078 0.3949 -0.0008 0.0040  -0.0120 328 ASN A C     
1657 O  O     . ASN A 222 ? 0.4409 0.4448 0.4312 -0.0010 0.0038  -0.0131 328 ASN A O     
1658 C  CB    . ASN A 222 ? 0.5784 0.5782 0.5580 -0.0049 0.0021  -0.0098 328 ASN A CB    
1659 C  CG    . ASN A 222 ? 0.6900 0.6851 0.6663 -0.0040 0.0001  -0.0105 328 ASN A CG    
1660 O  OD1   . ASN A 222 ? 0.7679 0.7631 0.7452 -0.0032 -0.0003 -0.0119 328 ASN A OD1   
1661 N  ND2   . ASN A 222 ? 0.5454 0.5365 0.5180 -0.0039 -0.0010 -0.0096 328 ASN A ND2   
1662 N  N     . PHE A 223 ? 0.3580 0.3603 0.3510 0.0009  0.0047  -0.0124 329 PHE A N     
1663 C  CA    . PHE A 223 ? 0.3404 0.3435 0.3378 0.0027  0.0051  -0.0141 329 PHE A CA    
1664 C  C     . PHE A 223 ? 0.3264 0.3329 0.3293 0.0035  0.0073  -0.0144 329 PHE A C     
1665 O  O     . PHE A 223 ? 0.3386 0.3454 0.3420 0.0034  0.0084  -0.0132 329 PHE A O     
1666 C  CB    . PHE A 223 ? 0.3405 0.3406 0.3377 0.0042  0.0043  -0.0146 329 PHE A CB    
1667 C  CG    . PHE A 223 ? 0.3475 0.3488 0.3496 0.0060  0.0049  -0.0165 329 PHE A CG    
1668 C  CD1   . PHE A 223 ? 0.3536 0.3553 0.3564 0.0064  0.0038  -0.0180 329 PHE A CD1   
1669 C  CD2   . PHE A 223 ? 0.3410 0.3431 0.3472 0.0072  0.0066  -0.0168 329 PHE A CD2   
1670 C  CE1   . PHE A 223 ? 0.3336 0.3368 0.3413 0.0079  0.0043  -0.0198 329 PHE A CE1   
1671 C  CE2   . PHE A 223 ? 0.3274 0.3310 0.3386 0.0086  0.0073  -0.0186 329 PHE A CE2   
1672 C  CZ    . PHE A 223 ? 0.3264 0.3306 0.3384 0.0090  0.0060  -0.0201 329 PHE A CZ    
1673 N  N     . ASP A 224 ? 0.3016 0.3102 0.3083 0.0042  0.0080  -0.0158 330 ASP A N     
1674 C  CA    . ASP A 224 ? 0.3014 0.3128 0.3128 0.0049  0.0101  -0.0161 330 ASP A CA    
1675 C  C     . ASP A 224 ? 0.3001 0.3115 0.3159 0.0065  0.0109  -0.0175 330 ASP A C     
1676 O  O     . ASP A 224 ? 0.2982 0.3107 0.3164 0.0070  0.0108  -0.0190 330 ASP A O     
1677 C  CB    . ASP A 224 ? 0.2937 0.3081 0.3061 0.0041  0.0105  -0.0164 330 ASP A CB    
1678 C  CG    . ASP A 224 ? 0.2977 0.3148 0.3146 0.0048  0.0125  -0.0166 330 ASP A CG    
1679 O  OD1   . ASP A 224 ? 0.2929 0.3096 0.3127 0.0059  0.0136  -0.0169 330 ASP A OD1   
1680 O  OD2   . ASP A 224 ? 0.3202 0.3398 0.3375 0.0042  0.0130  -0.0166 330 ASP A OD2   
1681 N  N     . TYR A 225 ? 0.3098 0.3200 0.3268 0.0072  0.0118  -0.0171 331 TYR A N     
1682 C  CA    . TYR A 225 ? 0.3216 0.3316 0.3424 0.0086  0.0127  -0.0185 331 TYR A CA    
1683 C  C     . TYR A 225 ? 0.3218 0.3342 0.3472 0.0090  0.0143  -0.0195 331 TYR A C     
1684 O  O     . TYR A 225 ? 0.3415 0.3546 0.3702 0.0097  0.0146  -0.0212 331 TYR A O     
1685 C  CB    . TYR A 225 ? 0.3393 0.3471 0.3596 0.0090  0.0135  -0.0178 331 TYR A CB    
1686 C  CG    . TYR A 225 ? 0.3440 0.3523 0.3662 0.0091  0.0156  -0.0170 331 TYR A CG    
1687 C  CD1   . TYR A 225 ? 0.3488 0.3582 0.3755 0.0098  0.0174  -0.0181 331 TYR A CD1   
1688 C  CD2   . TYR A 225 ? 0.3447 0.3522 0.3639 0.0083  0.0157  -0.0150 331 TYR A CD2   
1689 C  CE1   . TYR A 225 ? 0.3452 0.3544 0.3731 0.0098  0.0193  -0.0173 331 TYR A CE1   
1690 C  CE2   . TYR A 225 ? 0.3303 0.3380 0.3509 0.0084  0.0175  -0.0143 331 TYR A CE2   
1691 C  CZ    . TYR A 225 ? 0.3564 0.3647 0.3811 0.0092  0.0192  -0.0154 331 TYR A CZ    
1692 O  OH    . TYR A 225 ? 0.3433 0.3511 0.3687 0.0093  0.0208  -0.0146 331 TYR A OH    
1693 N  N     . LYS A 226 ? 0.3369 0.3507 0.3626 0.0085  0.0154  -0.0186 332 LYS A N     
1694 C  CA    . LYS A 226 ? 0.3187 0.3344 0.3484 0.0089  0.0170  -0.0194 332 LYS A CA    
1695 C  C     . LYS A 226 ? 0.3243 0.3417 0.3555 0.0090  0.0163  -0.0209 332 LYS A C     
1696 O  O     . LYS A 226 ? 0.3194 0.3377 0.3544 0.0096  0.0173  -0.0223 332 LYS A O     
1697 C  CB    . LYS A 226 ? 0.3118 0.3287 0.3411 0.0085  0.0179  -0.0181 332 LYS A CB    
1698 C  CG    . LYS A 226 ? 0.3475 0.3626 0.3761 0.0087  0.0188  -0.0168 332 LYS A CG    
1699 C  CD    . LYS A 226 ? 0.3668 0.3830 0.3956 0.0087  0.0197  -0.0158 332 LYS A CD    
1700 C  CE    . LYS A 226 ? 0.3879 0.4019 0.4146 0.0086  0.0200  -0.0142 332 LYS A CE    
1701 N  NZ    . LYS A 226 ? 0.4315 0.4461 0.4588 0.0090  0.0209  -0.0134 332 LYS A NZ    
1702 N  N     . ARG A 227 ? 0.3212 0.3389 0.3493 0.0082  0.0148  -0.0207 333 ARG A N     
1703 C  CA    . ARG A 227 ? 0.3324 0.3511 0.3610 0.0082  0.0139  -0.0221 333 ARG A CA    
1704 C  C     . ARG A 227 ? 0.3453 0.3630 0.3760 0.0091  0.0131  -0.0239 333 ARG A C     
1705 O  O     . ARG A 227 ? 0.3172 0.3361 0.3512 0.0097  0.0134  -0.0255 333 ARG A O     
1706 C  CB    . ARG A 227 ? 0.3373 0.3558 0.3614 0.0070  0.0123  -0.0215 333 ARG A CB    
1707 C  CG    . ARG A 227 ? 0.3240 0.3432 0.3479 0.0068  0.0114  -0.0229 333 ARG A CG    
1708 C  CD    . ARG A 227 ? 0.3220 0.3405 0.3407 0.0054  0.0099  -0.0222 333 ARG A CD    
1709 N  NE    . ARG A 227 ? 0.3225 0.3411 0.3410 0.0054  0.0089  -0.0238 333 ARG A NE    
1710 C  CZ    . ARG A 227 ? 0.3189 0.3396 0.3388 0.0053  0.0098  -0.0246 333 ARG A CZ    
1711 N  NH1   . ARG A 227 ? 0.3378 0.3611 0.3594 0.0050  0.0115  -0.0240 333 ARG A NH1   
1712 N  NH2   . ARG A 227 ? 0.3286 0.3490 0.3483 0.0054  0.0088  -0.0261 333 ARG A NH2   
1713 N  N     . PHE A 228 ? 0.3419 0.3575 0.3709 0.0094  0.0122  -0.0236 334 PHE A N     
1714 C  CA    . PHE A 228 ? 0.3322 0.3471 0.3630 0.0104  0.0111  -0.0253 334 PHE A CA    
1715 C  C     . PHE A 228 ? 0.3323 0.3486 0.3685 0.0111  0.0130  -0.0265 334 PHE A C     
1716 O  O     . PHE A 228 ? 0.3099 0.3271 0.3492 0.0117  0.0127  -0.0284 334 PHE A O     
1717 C  CB    . PHE A 228 ? 0.3665 0.3789 0.3945 0.0107  0.0099  -0.0248 334 PHE A CB    
1718 C  CG    . PHE A 228 ? 0.3930 0.4049 0.4234 0.0120  0.0090  -0.0266 334 PHE A CG    
1719 C  CD1   . PHE A 228 ? 0.3845 0.3974 0.4195 0.0128  0.0107  -0.0276 334 PHE A CD1   
1720 C  CD2   . PHE A 228 ? 0.4338 0.4445 0.4620 0.0124  0.0065  -0.0276 334 PHE A CD2   
1721 C  CE1   . PHE A 228 ? 0.4065 0.4197 0.4445 0.0139  0.0100  -0.0296 334 PHE A CE1   
1722 C  CE2   . PHE A 228 ? 0.4184 0.4291 0.4494 0.0138  0.0054  -0.0295 334 PHE A CE2   
1723 C  CZ    . PHE A 228 ? 0.4153 0.4275 0.4514 0.0146  0.0072  -0.0306 334 PHE A CZ    
1724 N  N     . ILE A 229 ? 0.3670 0.3833 0.4042 0.0110  0.0151  -0.0255 335 ILE A N     
1725 C  CA    . ILE A 229 ? 0.3757 0.3927 0.4176 0.0115  0.0171  -0.0265 335 ILE A CA    
1726 C  C     . ILE A 229 ? 0.3815 0.4004 0.4261 0.0114  0.0177  -0.0276 335 ILE A C     
1727 O  O     . ILE A 229 ? 0.4133 0.4331 0.4618 0.0117  0.0183  -0.0292 335 ILE A O     
1728 C  CB    . ILE A 229 ? 0.3489 0.3650 0.3907 0.0113  0.0191  -0.0251 335 ILE A CB    
1729 C  CG1   . ILE A 229 ? 0.3568 0.3710 0.3967 0.0115  0.0189  -0.0244 335 ILE A CG1   
1730 C  CG2   . ILE A 229 ? 0.3560 0.3727 0.4022 0.0115  0.0212  -0.0261 335 ILE A CG2   
1731 C  CD1   . ILE A 229 ? 0.3647 0.3773 0.4038 0.0113  0.0207  -0.0230 335 ILE A CD1   
1732 N  N     . LYS A 230 ? 0.3912 0.4110 0.4339 0.0109  0.0174  -0.0267 336 LYS A N     
1733 C  CA    . LYS A 230 ? 0.3930 0.4143 0.4381 0.0109  0.0180  -0.0279 336 LYS A CA    
1734 C  C     . LYS A 230 ? 0.3963 0.4183 0.4429 0.0112  0.0165  -0.0299 336 LYS A C     
1735 O  O     . LYS A 230 ? 0.3776 0.4006 0.4273 0.0114  0.0171  -0.0313 336 LYS A O     
1736 C  CB    . LYS A 230 ? 0.3935 0.4159 0.4363 0.0104  0.0179  -0.0269 336 LYS A CB    
1737 C  CG    . LYS A 230 ? 0.4327 0.4550 0.4748 0.0102  0.0192  -0.0252 336 LYS A CG    
1738 C  CD    . LYS A 230 ? 0.4659 0.4883 0.5112 0.0107  0.0212  -0.0255 336 LYS A CD    
1739 C  CE    . LYS A 230 ? 0.5107 0.5326 0.5544 0.0107  0.0221  -0.0237 336 LYS A CE    
1740 N  NZ    . LYS A 230 ? 0.5347 0.5555 0.5811 0.0112  0.0240  -0.0240 336 LYS A NZ    
1741 N  N     . PHE A 231 ? 0.3767 0.3978 0.4205 0.0112  0.0143  -0.0300 337 PHE A N     
1742 C  CA    . PHE A 231 ? 0.3667 0.3881 0.4111 0.0115  0.0126  -0.0318 337 PHE A CA    
1743 C  C     . PHE A 231 ? 0.3980 0.4188 0.4444 0.0124  0.0116  -0.0332 337 PHE A C     
1744 O  O     . PHE A 231 ? 0.4493 0.4696 0.4947 0.0128  0.0093  -0.0343 337 PHE A O     
1745 C  CB    . PHE A 231 ? 0.3547 0.3753 0.3942 0.0109  0.0107  -0.0311 337 PHE A CB    
1746 C  CG    . PHE A 231 ? 0.3774 0.3991 0.4152 0.0101  0.0117  -0.0301 337 PHE A CG    
1747 C  CD1   . PHE A 231 ? 0.4048 0.4282 0.4453 0.0101  0.0129  -0.0310 337 PHE A CD1   
1748 C  CD2   . PHE A 231 ? 0.3786 0.3998 0.4121 0.0092  0.0114  -0.0283 337 PHE A CD2   
1749 C  CE1   . PHE A 231 ? 0.3868 0.4115 0.4260 0.0095  0.0137  -0.0302 337 PHE A CE1   
1750 C  CE2   . PHE A 231 ? 0.3920 0.4147 0.4244 0.0084  0.0123  -0.0275 337 PHE A CE2   
1751 C  CZ    . PHE A 231 ? 0.3909 0.4155 0.4262 0.0087  0.0135  -0.0286 337 PHE A CZ    
1752 N  N     . ALA A 232 ? 0.3593 0.3800 0.4083 0.0127  0.0132  -0.0331 338 ALA A N     
1753 C  CA    . ALA A 232 ? 0.3741 0.3948 0.4256 0.0136  0.0126  -0.0346 338 ALA A CA    
1754 C  C     . ALA A 232 ? 0.3888 0.4114 0.4459 0.0138  0.0137  -0.0367 338 ALA A C     
1755 O  O     . ALA A 232 ? 0.3825 0.4058 0.4416 0.0132  0.0156  -0.0365 338 ALA A O     
1756 C  CB    . ALA A 232 ? 0.3602 0.3798 0.4114 0.0137  0.0139  -0.0335 338 ALA A CB    
1757 N  N     . ARG A 233 ? 0.4184 0.4418 0.4783 0.0146  0.0124  -0.0387 339 ARG A N     
1758 C  CA    . ARG A 233 ? 0.4263 0.4516 0.4917 0.0146  0.0132  -0.0409 339 ARG A CA    
1759 C  C     . ARG A 233 ? 0.4366 0.4629 0.5053 0.0156  0.0122  -0.0429 339 ARG A C     
1760 O  O     . ARG A 233 ? 0.4299 0.4552 0.4962 0.0165  0.0100  -0.0430 339 ARG A O     
1761 C  CB    . ARG A 233 ? 0.4704 0.4963 0.5354 0.0145  0.0118  -0.0418 339 ARG A CB    
1762 C  CG    . ARG A 233 ? 0.5000 0.5275 0.5694 0.0140  0.0133  -0.0432 339 ARG A CG    
1763 C  CD    . ARG A 233 ? 0.5195 0.5473 0.5879 0.0140  0.0117  -0.0440 339 ARG A CD    
1764 N  NE    . ARG A 233 ? 0.5244 0.5539 0.5978 0.0140  0.0119  -0.0464 339 ARG A NE    
1765 C  CZ    . ARG A 233 ? 0.5023 0.5325 0.5790 0.0132  0.0143  -0.0468 339 ARG A CZ    
1766 N  NH1   . ARG A 233 ? 0.5271 0.5588 0.6081 0.0131  0.0142  -0.0491 339 ARG A NH1   
1767 N  NH2   . ARG A 233 ? 0.5136 0.5429 0.5887 0.0126  0.0165  -0.0450 339 ARG A NH2   
1768 N  N     . VAL A 234 ? 0.4618 0.4900 0.5359 0.0154  0.0140  -0.0446 340 VAL A N     
1769 C  CA    . VAL A 234 ? 0.4756 0.5055 0.5538 0.0163  0.0132  -0.0469 340 VAL A CA    
1770 C  C     . VAL A 234 ? 0.4525 0.4840 0.5334 0.0168  0.0111  -0.0493 340 VAL A C     
1771 O  O     . VAL A 234 ? 0.3798 0.4123 0.4630 0.0159  0.0121  -0.0499 340 VAL A O     
1772 C  CB    . VAL A 234 ? 0.5157 0.5468 0.5984 0.0157  0.0164  -0.0477 340 VAL A CB    
1773 C  CG1   . VAL A 234 ? 0.5001 0.5336 0.5878 0.0167  0.0156  -0.0504 340 VAL A CG1   
1774 C  CG2   . VAL A 234 ? 0.5094 0.5384 0.5888 0.0154  0.0182  -0.0453 340 VAL A CG2   
1775 N  N     . CYS A 235 ? 0.4648 0.4964 0.5453 0.0181  0.0080  -0.0505 341 CYS A N     
1776 C  CA    . CYS A 235 ? 0.5371 0.5704 0.6206 0.0189  0.0056  -0.0532 341 CYS A CA    
1777 C  C     . CYS A 235 ? 0.5549 0.5901 0.6426 0.0203  0.0042  -0.0556 341 CYS A C     
1778 O  O     . CYS A 235 ? 0.5512 0.5856 0.6379 0.0211  0.0042  -0.0551 341 CYS A O     
1779 C  CB    . CYS A 235 ? 0.5272 0.5583 0.6053 0.0193  0.0023  -0.0525 341 CYS A CB    
1780 S  SG    . CYS A 235 ? 0.5199 0.5491 0.5932 0.0178  0.0036  -0.0501 341 CYS A SG    
1781 N  N     . GLU A 236 ? 0.6051 0.6427 0.6976 0.0207  0.0029  -0.0584 342 GLU A N     
1782 C  CA    . GLU A 236 ? 0.6263 0.6661 0.7229 0.0223  0.0008  -0.0610 342 GLU A CA    
1783 C  C     . GLU A 236 ? 0.5654 0.6026 0.6570 0.0241  -0.0031 -0.0608 342 GLU A C     
1784 O  O     . GLU A 236 ? 0.6196 0.6549 0.7072 0.0241  -0.0053 -0.0603 342 GLU A O     
1785 C  CB    . GLU A 236 ? 0.6927 0.7361 0.7960 0.0222  0.0004  -0.0642 342 GLU A CB    
1786 C  CG    . GLU A 236 ? 0.8200 0.8664 0.9288 0.0238  -0.0007 -0.0671 342 GLU A CG    
1787 C  CD    . GLU A 236 ? 0.9055 0.9559 1.0214 0.0237  -0.0014 -0.0704 342 GLU A CD    
1788 O  OE1   . GLU A 236 ? 1.0245 1.0747 1.1402 0.0231  -0.0025 -0.0709 342 GLU A OE1   
1789 O  OE2   . GLU A 236 ? 1.0097 1.0634 1.1314 0.0244  -0.0009 -0.0727 342 GLU A OE2   
1790 N  N     . VAL A 237 ? 0.5589 0.5958 0.6504 0.0256  -0.0041 -0.0612 343 VAL A N     
1791 C  CA    . VAL A 237 ? 0.6005 0.6347 0.6874 0.0275  -0.0082 -0.0612 343 VAL A CA    
1792 C  C     . VAL A 237 ? 0.6403 0.6769 0.7322 0.0294  -0.0092 -0.0639 343 VAL A C     
1793 O  O     . VAL A 237 ? 0.6215 0.6592 0.7155 0.0293  -0.0066 -0.0636 343 VAL A O     
1794 C  CB    . VAL A 237 ? 0.6282 0.6579 0.7070 0.0272  -0.0081 -0.0579 343 VAL A CB    
1795 C  CG1   . VAL A 237 ? 0.6431 0.6694 0.7166 0.0290  -0.0123 -0.0579 343 VAL A CG1   
1796 C  CG2   . VAL A 237 ? 0.6137 0.6416 0.6881 0.0252  -0.0066 -0.0554 343 VAL A CG2   
1797 N  N     . ASP A 238 ? 0.7387 0.7763 0.8325 0.0312  -0.0129 -0.0664 344 ASP A N     
1798 C  CA    . ASP A 238 ? 0.7516 0.7922 0.8512 0.0333  -0.0143 -0.0695 344 ASP A CA    
1799 C  C     . ASP A 238 ? 0.7946 0.8399 0.9021 0.0324  -0.0104 -0.0710 344 ASP A C     
1800 O  O     . ASP A 238 ? 0.8278 0.8740 0.9370 0.0333  -0.0093 -0.0715 344 ASP A O     
1801 C  CB    . ASP A 238 ? 0.7858 0.8234 0.8812 0.0354  -0.0163 -0.0689 344 ASP A CB    
1802 C  CG    . ASP A 238 ? 0.8555 0.8875 0.9419 0.0360  -0.0198 -0.0670 344 ASP A CG    
1803 O  OD1   . ASP A 238 ? 0.8527 0.8839 0.9380 0.0366  -0.0231 -0.0681 344 ASP A OD1   
1804 O  OD2   . ASP A 238 ? 0.9239 0.9522 1.0042 0.0357  -0.0192 -0.0643 344 ASP A OD2   
1805 N  N     . ASN A 239 ? 0.8585 0.9065 0.9701 0.0304  -0.0080 -0.0716 345 ASN A N     
1806 C  CA    . ASN A 239 ? 0.9154 0.9677 1.0344 0.0291  -0.0039 -0.0730 345 ASN A CA    
1807 C  C     . ASN A 239 ? 0.8598 0.9112 0.9776 0.0280  0.0000  -0.0709 345 ASN A C     
1808 O  O     . ASN A 239 ? 0.8779 0.9325 1.0012 0.0275  0.0029  -0.0724 345 ASN A O     
1809 C  CB    . ASN A 239 ? 0.9816 1.0386 1.1083 0.0307  -0.0054 -0.0770 345 ASN A CB    
1810 C  CG    . ASN A 239 ? 1.0732 1.1317 1.2023 0.0313  -0.0088 -0.0792 345 ASN A CG    
1811 O  OD1   . ASN A 239 ? 1.1080 1.1682 1.2399 0.0294  -0.0073 -0.0797 345 ASN A OD1   
1812 N  ND2   . ASN A 239 ? 1.0438 1.1012 1.1711 0.0338  -0.0134 -0.0805 345 ASN A ND2   
1813 N  N     . GLU A 240 ? 0.8060 0.8530 0.9163 0.0274  0.0003  -0.0676 346 GLU A N     
1814 C  CA    . GLU A 240 ? 0.7467 0.7920 0.8545 0.0264  0.0037  -0.0652 346 GLU A CA    
1815 C  C     . GLU A 240 ? 0.6745 0.7168 0.7770 0.0245  0.0051  -0.0620 346 GLU A C     
1816 O  O     . GLU A 240 ? 0.6256 0.6655 0.7233 0.0247  0.0026  -0.0609 346 GLU A O     
1817 C  CB    . GLU A 240 ? 0.7287 0.7715 0.8323 0.0283  0.0018  -0.0645 346 GLU A CB    
1818 C  CG    . GLU A 240 ? 0.7463 0.7875 0.8476 0.0276  0.0049  -0.0625 346 GLU A CG    
1819 C  CD    . GLU A 240 ? 0.7295 0.7688 0.8279 0.0298  0.0029  -0.0625 346 GLU A CD    
1820 O  OE1   . GLU A 240 ? 0.7714 0.8132 0.8742 0.0316  0.0012  -0.0653 346 GLU A OE1   
1821 O  OE2   . GLU A 240 ? 0.7269 0.7623 0.8190 0.0296  0.0030  -0.0598 346 GLU A OE2   
1822 N  N     . LEU A 241 ? 0.6076 0.6500 0.7109 0.0227  0.0091  -0.0608 347 LEU A N     
1823 C  CA    . LEU A 241 ? 0.6043 0.6438 0.7026 0.0211  0.0105  -0.0578 347 LEU A CA    
1824 C  C     . LEU A 241 ? 0.5979 0.6337 0.6893 0.0214  0.0102  -0.0549 347 LEU A C     
1825 O  O     . LEU A 241 ? 0.6693 0.7047 0.7606 0.0216  0.0118  -0.0544 347 LEU A O     
1826 C  CB    . LEU A 241 ? 0.5902 0.6309 0.6916 0.0191  0.0145  -0.0575 347 LEU A CB    
1827 C  CG    . LEU A 241 ? 0.6135 0.6577 0.7215 0.0184  0.0149  -0.0604 347 LEU A CG    
1828 C  CD1   . LEU A 241 ? 0.6505 0.6948 0.7605 0.0163  0.0190  -0.0598 347 LEU A CD1   
1829 C  CD2   . LEU A 241 ? 0.6296 0.6739 0.7370 0.0187  0.0120  -0.0611 347 LEU A CD2   
1830 N  N     . ARG A 242 ? 0.5718 0.6049 0.6575 0.0213  0.0082  -0.0530 348 ARG A N     
1831 C  CA    . ARG A 242 ? 0.5278 0.5573 0.6066 0.0217  0.0071  -0.0504 348 ARG A CA    
1832 C  C     . ARG A 242 ? 0.4773 0.5046 0.5511 0.0202  0.0078  -0.0477 348 ARG A C     
1833 O  O     . ARG A 242 ? 0.4379 0.4660 0.5125 0.0194  0.0079  -0.0479 348 ARG A O     
1834 C  CB    . ARG A 242 ? 0.5947 0.6229 0.6709 0.0234  0.0030  -0.0513 348 ARG A CB    
1835 C  CG    . ARG A 242 ? 0.6592 0.6893 0.7396 0.0252  0.0018  -0.0539 348 ARG A CG    
1836 C  CD    . ARG A 242 ? 0.7323 0.7592 0.8074 0.0269  -0.0015 -0.0534 348 ARG A CD    
1837 N  NE    . ARG A 242 ? 0.8455 0.8740 0.9245 0.0289  -0.0028 -0.0560 348 ARG A NE    
1838 C  CZ    . ARG A 242 ? 0.8338 0.8624 0.9133 0.0309  -0.0065 -0.0581 348 ARG A CZ    
1839 N  NH1   . ARG A 242 ? 0.7915 0.8181 0.8673 0.0312  -0.0097 -0.0579 348 ARG A NH1   
1840 N  NH2   . ARG A 242 ? 0.8560 0.8865 0.9396 0.0328  -0.0073 -0.0604 348 ARG A NH2   
1841 N  N     . ILE A 243 ? 0.4522 0.4767 0.5207 0.0200  0.0081  -0.0452 349 ILE A N     
1842 C  CA    . ILE A 243 ? 0.4224 0.4452 0.4864 0.0187  0.0088  -0.0427 349 ILE A CA    
1843 C  C     . ILE A 243 ? 0.4242 0.4454 0.4838 0.0191  0.0055  -0.0424 349 ILE A C     
1844 O  O     . ILE A 243 ? 0.4508 0.4703 0.5076 0.0201  0.0031  -0.0425 349 ILE A O     
1845 C  CB    . ILE A 243 ? 0.4203 0.4410 0.4806 0.0181  0.0104  -0.0402 349 ILE A CB    
1846 C  CG1   . ILE A 243 ? 0.4278 0.4496 0.4921 0.0179  0.0136  -0.0406 349 ILE A CG1   
1847 C  CG2   . ILE A 243 ? 0.4412 0.4609 0.4980 0.0168  0.0112  -0.0379 349 ILE A CG2   
1848 C  CD1   . ILE A 243 ? 0.4218 0.4415 0.4829 0.0170  0.0157  -0.0381 349 ILE A CD1   
1849 N  N     . CYS A 244 ? 0.4048 0.4264 0.4636 0.0181  0.0055  -0.0420 350 CYS A N     
1850 C  CA    . CYS A 244 ? 0.4151 0.4352 0.4696 0.0182  0.0028  -0.0418 350 CYS A CA    
1851 C  C     . CYS A 244 ? 0.4063 0.4255 0.4569 0.0167  0.0040  -0.0395 350 CYS A C     
1852 O  O     . CYS A 244 ? 0.4116 0.4318 0.4640 0.0159  0.0068  -0.0386 350 CYS A O     
1853 C  CB    . CYS A 244 ? 0.4494 0.4714 0.5075 0.0185  0.0017  -0.0441 350 CYS A CB    
1854 S  SG    . CYS A 244 ? 0.5243 0.5482 0.5882 0.0203  0.0000  -0.0474 350 CYS A SG    
1855 N  N     . ALA A 245 ? 0.3999 0.4171 0.4452 0.0164  0.0020  -0.0386 351 ALA A N     
1856 C  CA    . ALA A 245 ? 0.3942 0.4108 0.4356 0.0150  0.0028  -0.0365 351 ALA A CA    
1857 C  C     . ALA A 245 ? 0.4009 0.4177 0.4409 0.0146  0.0016  -0.0372 351 ALA A C     
1858 O  O     . ALA A 245 ? 0.3980 0.4141 0.4377 0.0153  -0.0007 -0.0388 351 ALA A O     
1859 C  CB    . ALA A 245 ? 0.3957 0.4094 0.4312 0.0148  0.0014  -0.0348 351 ALA A CB    
1860 N  N     . ARG A 246 ? 0.3752 0.3926 0.4139 0.0134  0.0031  -0.0360 352 ARG A N     
1861 C  CA    . ARG A 246 ? 0.3645 0.3817 0.4009 0.0129  0.0021  -0.0365 352 ARG A CA    
1862 C  C     . ARG A 246 ? 0.3574 0.3717 0.3877 0.0127  -0.0006 -0.0361 352 ARG A C     
1863 O  O     . ARG A 246 ? 0.3295 0.3421 0.3562 0.0123  -0.0009 -0.0345 352 ARG A O     
1864 C  CB    . ARG A 246 ? 0.3697 0.3882 0.4051 0.0116  0.0041  -0.0352 352 ARG A CB    
1865 C  CG    . ARG A 246 ? 0.3849 0.4057 0.4249 0.0117  0.0059  -0.0363 352 ARG A CG    
1866 C  CD    . ARG A 246 ? 0.4020 0.4231 0.4427 0.0119  0.0046  -0.0382 352 ARG A CD    
1867 N  NE    . ARG A 246 ? 0.3837 0.4035 0.4192 0.0111  0.0032  -0.0379 352 ARG A NE    
1868 C  CZ    . ARG A 246 ? 0.3668 0.3874 0.4005 0.0102  0.0045  -0.0371 352 ARG A CZ    
1869 N  NH1   . ARG A 246 ? 0.3554 0.3781 0.3923 0.0101  0.0069  -0.0367 352 ARG A NH1   
1870 N  NH2   . ARG A 246 ? 0.4059 0.4252 0.4347 0.0094  0.0032  -0.0370 352 ARG A NH2   
1871 N  N     . ASP A 247 ? 0.3597 0.3733 0.3890 0.0130  -0.0027 -0.0376 353 ASP A N     
1872 C  CA    . ASP A 247 ? 0.3573 0.3676 0.3801 0.0127  -0.0054 -0.0373 353 ASP A CA    
1873 C  C     . ASP A 247 ? 0.3253 0.3340 0.3421 0.0110  -0.0048 -0.0350 353 ASP A C     
1874 O  O     . ASP A 247 ? 0.2995 0.3052 0.3115 0.0108  -0.0065 -0.0341 353 ASP A O     
1875 C  CB    . ASP A 247 ? 0.3788 0.3889 0.4013 0.0128  -0.0069 -0.0391 353 ASP A CB    
1876 C  CG    . ASP A 247 ? 0.3901 0.4027 0.4146 0.0119  -0.0046 -0.0392 353 ASP A CG    
1877 O  OD1   . ASP A 247 ? 0.3969 0.4116 0.4235 0.0112  -0.0019 -0.0381 353 ASP A OD1   
1878 O  OD2   . ASP A 247 ? 0.4709 0.4833 0.4950 0.0119  -0.0057 -0.0406 353 ASP A OD2   
1879 N  N     . LYS A 248 ? 0.3194 0.3303 0.3370 0.0098  -0.0024 -0.0342 354 LYS A N     
1880 C  CA    . LYS A 248 ? 0.3449 0.3552 0.3576 0.0081  -0.0017 -0.0322 354 LYS A CA    
1881 C  C     . LYS A 248 ? 0.3629 0.3724 0.3743 0.0078  -0.0011 -0.0304 354 LYS A C     
1882 O  O     . LYS A 248 ? 0.3880 0.3964 0.3946 0.0063  -0.0011 -0.0288 354 LYS A O     
1883 C  CB    . LYS A 248 ? 0.3499 0.3633 0.3647 0.0072  0.0008  -0.0319 354 LYS A CB    
1884 C  CG    . LYS A 248 ? 0.3535 0.3697 0.3741 0.0079  0.0032  -0.0317 354 LYS A CG    
1885 C  CD    . LYS A 248 ? 0.3555 0.3746 0.3782 0.0073  0.0055  -0.0316 354 LYS A CD    
1886 C  CE    . LYS A 248 ? 0.3648 0.3857 0.3930 0.0082  0.0075  -0.0316 354 LYS A CE    
1887 N  NZ    . LYS A 248 ? 0.3742 0.3976 0.4044 0.0079  0.0098  -0.0312 354 LYS A NZ    
1888 N  N     . GLU A 249 ? 0.3434 0.3535 0.3587 0.0091  -0.0006 -0.0306 355 GLU A N     
1889 C  CA    . GLU A 249 ? 0.3773 0.3861 0.3910 0.0089  -0.0004 -0.0290 355 GLU A CA    
1890 C  C     . GLU A 249 ? 0.3799 0.3848 0.3888 0.0093  -0.0031 -0.0288 355 GLU A C     
1891 O  O     . GLU A 249 ? 0.3807 0.3841 0.3876 0.0092  -0.0030 -0.0275 355 GLU A O     
1892 C  CB    . GLU A 249 ? 0.4302 0.4409 0.4499 0.0102  0.0012  -0.0295 355 GLU A CB    
1893 C  CG    . GLU A 249 ? 0.4843 0.4981 0.5083 0.0099  0.0040  -0.0293 355 GLU A CG    
1894 C  CD    . GLU A 249 ? 0.5440 0.5584 0.5650 0.0084  0.0052  -0.0273 355 GLU A CD    
1895 O  OE1   . GLU A 249 ? 0.6330 0.6466 0.6526 0.0080  0.0058  -0.0257 355 GLU A OE1   
1896 O  OE2   . GLU A 249 ? 0.5626 0.5781 0.5824 0.0075  0.0054  -0.0274 355 GLU A OE2   
1897 N  N     . VAL A 250 ? 0.3531 0.3559 0.3597 0.0098  -0.0055 -0.0301 356 VAL A N     
1898 C  CA    . VAL A 250 ? 0.3385 0.3374 0.3408 0.0104  -0.0082 -0.0300 356 VAL A CA    
1899 C  C     . VAL A 250 ? 0.3243 0.3202 0.3199 0.0089  -0.0086 -0.0279 356 VAL A C     
1900 O  O     . VAL A 250 ? 0.3564 0.3499 0.3500 0.0094  -0.0095 -0.0273 356 VAL A O     
1901 C  CB    . VAL A 250 ? 0.3537 0.3505 0.3542 0.0113  -0.0111 -0.0318 356 VAL A CB    
1902 C  CG1   . VAL A 250 ? 0.3380 0.3337 0.3337 0.0096  -0.0115 -0.0315 356 VAL A CG1   
1903 C  CG2   . VAL A 250 ? 0.3598 0.3524 0.3566 0.0126  -0.0140 -0.0320 356 VAL A CG2   
1904 N  N     . GLY A 251 ? 0.3125 0.3084 0.3045 0.0068  -0.0079 -0.0269 357 GLY A N     
1905 C  CA    . GLY A 251 ? 0.3155 0.3093 0.3016 0.0049  -0.0079 -0.0249 357 GLY A CA    
1906 C  C     . GLY A 251 ? 0.3208 0.3163 0.3095 0.0049  -0.0060 -0.0235 357 GLY A C     
1907 O  O     . GLY A 251 ? 0.3280 0.3207 0.3126 0.0044  -0.0068 -0.0222 357 GLY A O     
1908 N  N     . ASN A 252 ? 0.3129 0.3123 0.3078 0.0055  -0.0037 -0.0238 358 ASN A N     
1909 C  CA    . ASN A 252 ? 0.3268 0.3274 0.3236 0.0054  -0.0019 -0.0225 358 ASN A CA    
1910 C  C     . ASN A 252 ? 0.3283 0.3266 0.3254 0.0070  -0.0029 -0.0227 358 ASN A C     
1911 O  O     . ASN A 252 ? 0.3420 0.3392 0.3374 0.0066  -0.0025 -0.0213 358 ASN A O     
1912 C  CB    . ASN A 252 ? 0.3120 0.3170 0.3148 0.0056  0.0008  -0.0225 358 ASN A CB    
1913 C  CG    . ASN A 252 ? 0.3095 0.3170 0.3121 0.0042  0.0020  -0.0223 358 ASN A CG    
1914 O  OD1   . ASN A 252 ? 0.2960 0.3028 0.2940 0.0024  0.0017  -0.0212 358 ASN A OD1   
1915 N  ND2   . ASN A 252 ? 0.3140 0.3246 0.3218 0.0049  0.0035  -0.0234 358 ASN A ND2   
1916 N  N     . LEU A 253 ? 0.3206 0.3183 0.3199 0.0088  -0.0043 -0.0245 359 LEU A N     
1917 C  CA    . LEU A 253 ? 0.3340 0.3298 0.3339 0.0104  -0.0053 -0.0250 359 LEU A CA    
1918 C  C     . LEU A 253 ? 0.3290 0.3199 0.3219 0.0102  -0.0079 -0.0243 359 LEU A C     
1919 O  O     . LEU A 253 ? 0.3182 0.3073 0.3097 0.0106  -0.0081 -0.0235 359 LEU A O     
1920 C  CB    . LEU A 253 ? 0.3565 0.3537 0.3615 0.0124  -0.0059 -0.0274 359 LEU A CB    
1921 C  CG    . LEU A 253 ? 0.3641 0.3658 0.3762 0.0126  -0.0031 -0.0281 359 LEU A CG    
1922 C  CD1   . LEU A 253 ? 0.3694 0.3728 0.3870 0.0144  -0.0035 -0.0306 359 LEU A CD1   
1923 C  CD2   . LEU A 253 ? 0.3759 0.3788 0.3900 0.0123  -0.0005 -0.0268 359 LEU A CD2   
1924 N  N     . TYR A 254 ? 0.3355 0.3241 0.3237 0.0094  -0.0099 -0.0244 360 TYR A N     
1925 C  CA    . TYR A 254 ? 0.3571 0.3406 0.3377 0.0088  -0.0122 -0.0233 360 TYR A CA    
1926 C  C     . TYR A 254 ? 0.3583 0.3414 0.3359 0.0068  -0.0107 -0.0210 360 TYR A C     
1927 O  O     . TYR A 254 ? 0.3412 0.3210 0.3153 0.0070  -0.0117 -0.0201 360 TYR A O     
1928 C  CB    . TYR A 254 ? 0.3702 0.3507 0.3451 0.0078  -0.0144 -0.0236 360 TYR A CB    
1929 C  CG    . TYR A 254 ? 0.3814 0.3598 0.3564 0.0099  -0.0172 -0.0256 360 TYR A CG    
1930 C  CD1   . TYR A 254 ? 0.3819 0.3555 0.3529 0.0113  -0.0200 -0.0259 360 TYR A CD1   
1931 C  CD2   . TYR A 254 ? 0.3887 0.3697 0.3678 0.0108  -0.0173 -0.0274 360 TYR A CD2   
1932 C  CE1   . TYR A 254 ? 0.4050 0.3769 0.3764 0.0136  -0.0228 -0.0279 360 TYR A CE1   
1933 C  CE2   . TYR A 254 ? 0.4128 0.3920 0.3923 0.0129  -0.0201 -0.0294 360 TYR A CE2   
1934 C  CZ    . TYR A 254 ? 0.4188 0.3936 0.3946 0.0144  -0.0229 -0.0297 360 TYR A CZ    
1935 O  OH    . TYR A 254 ? 0.4394 0.4125 0.4156 0.0166  -0.0259 -0.0318 360 TYR A OH    
1936 N  N     . ASP A 255 ? 0.3528 0.3393 0.3321 0.0051  -0.0084 -0.0201 361 ASP A N     
1937 C  CA    . ASP A 255 ? 0.3401 0.3269 0.3172 0.0032  -0.0071 -0.0181 361 ASP A CA    
1938 C  C     . ASP A 255 ? 0.3230 0.3106 0.3033 0.0043  -0.0058 -0.0176 361 ASP A C     
1939 O  O     . ASP A 255 ? 0.2725 0.2581 0.2493 0.0033  -0.0058 -0.0160 361 ASP A O     
1940 C  CB    . ASP A 255 ? 0.3454 0.3362 0.3245 0.0016  -0.0050 -0.0177 361 ASP A CB    
1941 C  CG    . ASP A 255 ? 0.3800 0.3694 0.3535 -0.0005 -0.0059 -0.0173 361 ASP A CG    
1942 O  OD1   . ASP A 255 ? 0.4136 0.3983 0.3807 -0.0011 -0.0081 -0.0170 361 ASP A OD1   
1943 O  OD2   . ASP A 255 ? 0.4046 0.3974 0.3798 -0.0017 -0.0042 -0.0172 361 ASP A OD2   
1944 N  N     . MET A 256 ? 0.3373 0.3274 0.3239 0.0062  -0.0047 -0.0189 362 MET A N     
1945 C  CA    . MET A 256 ? 0.3541 0.3445 0.3435 0.0073  -0.0034 -0.0186 362 MET A CA    
1946 C  C     . MET A 256 ? 0.3566 0.3427 0.3420 0.0081  -0.0053 -0.0184 362 MET A C     
1947 O  O     . MET A 256 ? 0.3822 0.3671 0.3662 0.0078  -0.0046 -0.0171 362 MET A O     
1948 C  CB    . MET A 256 ? 0.3683 0.3618 0.3650 0.0092  -0.0020 -0.0204 362 MET A CB    
1949 C  CG    . MET A 256 ? 0.3587 0.3532 0.3584 0.0098  0.0000  -0.0198 362 MET A CG    
1950 S  SD    . MET A 256 ? 0.3731 0.3698 0.3800 0.0119  0.0012  -0.0220 362 MET A SD    
1951 C  CE    . MET A 256 ? 0.3731 0.3660 0.3774 0.0137  -0.0013 -0.0230 362 MET A CE    
1952 N  N     . PHE A 257 ? 0.3432 0.3268 0.3267 0.0093  -0.0078 -0.0197 363 PHE A N     
1953 C  CA    . PHE A 257 ? 0.3427 0.3217 0.3221 0.0104  -0.0099 -0.0197 363 PHE A CA    
1954 C  C     . PHE A 257 ? 0.3525 0.3273 0.3239 0.0084  -0.0112 -0.0178 363 PHE A C     
1955 O  O     . PHE A 257 ? 0.3461 0.3174 0.3140 0.0087  -0.0121 -0.0171 363 PHE A O     
1956 C  CB    . PHE A 257 ? 0.3206 0.2982 0.3010 0.0126  -0.0122 -0.0219 363 PHE A CB    
1957 C  CG    . PHE A 257 ? 0.3226 0.3037 0.3106 0.0148  -0.0109 -0.0238 363 PHE A CG    
1958 C  CD1   . PHE A 257 ? 0.3231 0.3036 0.3127 0.0162  -0.0104 -0.0241 363 PHE A CD1   
1959 C  CD2   . PHE A 257 ? 0.3256 0.3106 0.3191 0.0152  -0.0101 -0.0253 363 PHE A CD2   
1960 C  CE1   . PHE A 257 ? 0.3227 0.3067 0.3196 0.0179  -0.0088 -0.0259 363 PHE A CE1   
1961 C  CE2   . PHE A 257 ? 0.3235 0.3118 0.3240 0.0168  -0.0086 -0.0270 363 PHE A CE2   
1962 C  CZ    . PHE A 257 ? 0.3203 0.3082 0.3226 0.0181  -0.0079 -0.0273 363 PHE A CZ    
1963 N  N     . HIS A 258 ? 0.3569 0.3320 0.3254 0.0062  -0.0113 -0.0171 364 HIS A N     
1964 C  CA    . HIS A 258 ? 0.3649 0.3367 0.3262 0.0038  -0.0121 -0.0152 364 HIS A CA    
1965 C  C     . HIS A 258 ? 0.3504 0.3236 0.3124 0.0027  -0.0102 -0.0136 364 HIS A C     
1966 O  O     . HIS A 258 ? 0.3616 0.3312 0.3185 0.0018  -0.0111 -0.0123 364 HIS A O     
1967 C  CB    . HIS A 258 ? 0.3583 0.3310 0.3172 0.0016  -0.0122 -0.0150 364 HIS A CB    
1968 C  CG    . HIS A 258 ? 0.3638 0.3336 0.3156 -0.0011 -0.0127 -0.0132 364 HIS A CG    
1969 N  ND1   . HIS A 258 ? 0.3944 0.3591 0.3390 -0.0022 -0.0150 -0.0130 364 HIS A ND1   
1970 C  CD2   . HIS A 258 ? 0.3702 0.3415 0.3211 -0.0033 -0.0111 -0.0115 364 HIS A CD2   
1971 C  CE1   . HIS A 258 ? 0.3965 0.3597 0.3359 -0.0050 -0.0148 -0.0113 364 HIS A CE1   
1972 N  NE2   . HIS A 258 ? 0.3584 0.3256 0.3016 -0.0057 -0.0125 -0.0104 364 HIS A NE2   
1973 N  N     . THR A 259 ? 0.3438 0.3220 0.3118 0.0027  -0.0076 -0.0136 365 THR A N     
1974 C  CA    . THR A 259 ? 0.3437 0.3233 0.3128 0.0019  -0.0058 -0.0121 365 THR A CA    
1975 C  C     . THR A 259 ? 0.3441 0.3207 0.3123 0.0034  -0.0062 -0.0120 365 THR A C     
1976 O  O     . THR A 259 ? 0.3772 0.3513 0.3414 0.0023  -0.0065 -0.0105 365 THR A O     
1977 C  CB    . THR A 259 ? 0.3313 0.3163 0.3075 0.0024  -0.0031 -0.0125 365 THR A CB    
1978 O  OG1   . THR A 259 ? 0.3170 0.3048 0.2935 0.0008  -0.0026 -0.0125 365 THR A OG1   
1979 C  CG2   . THR A 259 ? 0.3320 0.3185 0.3098 0.0021  -0.0013 -0.0112 365 THR A CG2   
1980 N  N     . ARG A 260 ? 0.3287 0.3056 0.3008 0.0059  -0.0063 -0.0136 366 ARG A N     
1981 C  CA    . ARG A 260 ? 0.3305 0.3048 0.3022 0.0075  -0.0067 -0.0138 366 ARG A CA    
1982 C  C     . ARG A 260 ? 0.3436 0.3121 0.3076 0.0070  -0.0092 -0.0130 366 ARG A C     
1983 O  O     . ARG A 260 ? 0.3288 0.2950 0.2902 0.0068  -0.0091 -0.0120 366 ARG A O     
1984 C  CB    . ARG A 260 ? 0.3114 0.2871 0.2883 0.0101  -0.0066 -0.0161 366 ARG A CB    
1985 C  CG    . ARG A 260 ? 0.3085 0.2817 0.2853 0.0121  -0.0070 -0.0167 366 ARG A CG    
1986 C  CD    . ARG A 260 ? 0.3076 0.2835 0.2910 0.0144  -0.0063 -0.0190 366 ARG A CD    
1987 N  NE    . ARG A 260 ? 0.3091 0.2828 0.2926 0.0164  -0.0067 -0.0200 366 ARG A NE    
1988 C  CZ    . ARG A 260 ? 0.3377 0.3074 0.3172 0.0177  -0.0094 -0.0206 366 ARG A CZ    
1989 N  NH1   . ARG A 260 ? 0.3722 0.3389 0.3469 0.0174  -0.0122 -0.0206 366 ARG A NH1   
1990 N  NH2   . ARG A 260 ? 0.3485 0.3167 0.3285 0.0195  -0.0094 -0.0214 366 ARG A NH2   
1991 N  N     . ASN A 261 ? 0.3637 0.3298 0.3239 0.0068  -0.0115 -0.0135 367 ASN A N     
1992 C  CA    . ASN A 261 ? 0.3974 0.3575 0.3498 0.0062  -0.0140 -0.0127 367 ASN A CA    
1993 C  C     . ASN A 261 ? 0.3882 0.3467 0.3353 0.0032  -0.0137 -0.0104 367 ASN A C     
1994 O  O     . ASN A 261 ? 0.4156 0.3698 0.3577 0.0029  -0.0148 -0.0094 367 ASN A O     
1995 C  CB    . ASN A 261 ? 0.4099 0.3675 0.3590 0.0065  -0.0166 -0.0137 367 ASN A CB    
1996 C  CG    . ASN A 261 ? 0.4456 0.3961 0.3863 0.0063  -0.0195 -0.0132 367 ASN A CG    
1997 O  OD1   . ASN A 261 ? 0.4923 0.4398 0.4323 0.0086  -0.0209 -0.0140 367 ASN A OD1   
1998 N  ND2   . ASN A 261 ? 0.4473 0.3950 0.3815 0.0036  -0.0205 -0.0119 367 ASN A ND2   
1999 N  N     . SER A 262 ? 0.3685 0.3305 0.3167 0.0011  -0.0124 -0.0097 368 SER A N     
2000 C  CA    . SER A 262 ? 0.3817 0.3439 0.3268 -0.0017 -0.0116 -0.0078 368 SER A CA    
2001 C  C     . SER A 262 ? 0.3590 0.3216 0.3053 -0.0016 -0.0102 -0.0067 368 SER A C     
2002 O  O     . SER A 262 ? 0.3534 0.3134 0.2950 -0.0033 -0.0107 -0.0052 368 SER A O     
2003 C  CB    . SER A 262 ? 0.3815 0.3492 0.3307 -0.0031 -0.0096 -0.0077 368 SER A CB    
2004 O  OG    . SER A 262 ? 0.4607 0.4273 0.4048 -0.0059 -0.0102 -0.0067 368 SER A OG    
2005 N  N     . LEU A 263 ? 0.3565 0.3226 0.3094 0.0002  -0.0084 -0.0075 369 LEU A N     
2006 C  CA    . LEU A 263 ? 0.3456 0.3119 0.2996 0.0005  -0.0070 -0.0066 369 LEU A CA    
2007 C  C     . LEU A 263 ? 0.3476 0.3083 0.2973 0.0018  -0.0086 -0.0066 369 LEU A C     
2008 O  O     . LEU A 263 ? 0.3311 0.2895 0.2776 0.0010  -0.0086 -0.0053 369 LEU A O     
2009 C  CB    . LEU A 263 ? 0.3446 0.3153 0.3059 0.0021  -0.0047 -0.0074 369 LEU A CB    
2010 C  CG    . LEU A 263 ? 0.3492 0.3251 0.3148 0.0010  -0.0029 -0.0072 369 LEU A CG    
2011 C  CD1   . LEU A 263 ? 0.3434 0.3230 0.3162 0.0029  -0.0009 -0.0085 369 LEU A CD1   
2012 C  CD2   . LEU A 263 ? 0.3701 0.3468 0.3343 -0.0008 -0.0020 -0.0054 369 LEU A CD2   
2013 N  N     . HIS A 264 ? 0.3390 0.2974 0.2883 0.0038  -0.0102 -0.0081 370 HIS A N     
2014 C  CA    . HIS A 264 ? 0.3622 0.3151 0.3068 0.0050  -0.0119 -0.0081 370 HIS A CA    
2015 C  C     . HIS A 264 ? 0.3701 0.3181 0.3063 0.0027  -0.0139 -0.0066 370 HIS A C     
2016 O  O     . HIS A 264 ? 0.3393 0.2834 0.2712 0.0024  -0.0145 -0.0056 370 HIS A O     
2017 C  CB    . HIS A 264 ? 0.3638 0.3154 0.3100 0.0079  -0.0134 -0.0103 370 HIS A CB    
2018 C  CG    . HIS A 264 ? 0.3634 0.3182 0.3166 0.0103  -0.0115 -0.0118 370 HIS A CG    
2019 N  ND1   . HIS A 264 ? 0.3523 0.3049 0.3053 0.0121  -0.0113 -0.0122 370 HIS A ND1   
2020 C  CD2   . HIS A 264 ? 0.3471 0.3072 0.3075 0.0111  -0.0096 -0.0130 370 HIS A CD2   
2021 C  CE1   . HIS A 264 ? 0.3433 0.2997 0.3031 0.0138  -0.0093 -0.0137 370 HIS A CE1   
2022 N  NE2   . HIS A 264 ? 0.3695 0.3303 0.3339 0.0133  -0.0083 -0.0142 370 HIS A NE2   
2023 N  N     . ARG A 265 ? 0.3732 0.3211 0.3068 0.0009  -0.0150 -0.0063 371 ARG A N     
2024 C  CA    . ARG A 265 ? 0.4041 0.3471 0.3294 -0.0016 -0.0168 -0.0049 371 ARG A CA    
2025 C  C     . ARG A 265 ? 0.4024 0.3463 0.3261 -0.0042 -0.0156 -0.0030 371 ARG A C     
2026 O  O     . ARG A 265 ? 0.3929 0.3323 0.3109 -0.0052 -0.0167 -0.0019 371 ARG A O     
2027 C  CB    . ARG A 265 ? 0.4489 0.3921 0.3718 -0.0034 -0.0177 -0.0050 371 ARG A CB    
2028 C  CG    . ARG A 265 ? 0.5006 0.4406 0.4218 -0.0014 -0.0200 -0.0066 371 ARG A CG    
2029 C  CD    . ARG A 265 ? 0.5362 0.4684 0.4493 -0.0010 -0.0228 -0.0063 371 ARG A CD    
2030 N  NE    . ARG A 265 ? 0.5596 0.4878 0.4695 0.0004  -0.0255 -0.0076 371 ARG A NE    
2031 C  CZ    . ARG A 265 ? 0.5896 0.5108 0.4907 -0.0006 -0.0282 -0.0070 371 ARG A CZ    
2032 N  NH1   . ARG A 265 ? 0.5906 0.5084 0.4852 -0.0036 -0.0284 -0.0051 371 ARG A NH1   
2033 N  NH2   . ARG A 265 ? 0.6170 0.5346 0.5155 0.0011  -0.0308 -0.0083 371 ARG A NH2   
2034 N  N     . ARG A 266 ? 0.4212 0.3710 0.3501 -0.0052 -0.0133 -0.0027 372 ARG A N     
2035 C  CA    . ARG A 266 ? 0.4307 0.3818 0.3584 -0.0077 -0.0123 -0.0010 372 ARG A CA    
2036 C  C     . ARG A 266 ? 0.3973 0.3481 0.3265 -0.0066 -0.0114 -0.0004 372 ARG A C     
2037 O  O     . ARG A 266 ? 0.3769 0.3257 0.3021 -0.0084 -0.0117 0.0009  372 ARG A O     
2038 C  CB    . ARG A 266 ? 0.4676 0.4252 0.4004 -0.0090 -0.0103 -0.0009 372 ARG A CB    
2039 C  CG    . ARG A 266 ? 0.4859 0.4446 0.4176 -0.0104 -0.0109 -0.0014 372 ARG A CG    
2040 C  CD    . ARG A 266 ? 0.5264 0.4918 0.4641 -0.0111 -0.0086 -0.0015 372 ARG A CD    
2041 N  NE    . ARG A 266 ? 0.5800 0.5466 0.5166 -0.0127 -0.0089 -0.0020 372 ARG A NE    
2042 C  CZ    . ARG A 266 ? 0.6455 0.6175 0.5861 -0.0137 -0.0072 -0.0022 372 ARG A CZ    
2043 N  NH1   . ARG A 266 ? 0.6863 0.6633 0.6329 -0.0130 -0.0053 -0.0021 372 ARG A NH1   
2044 N  NH2   . ARG A 266 ? 0.6134 0.5858 0.5521 -0.0151 -0.0076 -0.0027 372 ARG A NH2   
2045 N  N     . ALA A 267 ? 0.3815 0.3345 0.3164 -0.0038 -0.0101 -0.0016 373 ALA A N     
2046 C  CA    . ALA A 267 ? 0.3771 0.3303 0.3140 -0.0027 -0.0088 -0.0012 373 ALA A CA    
2047 C  C     . ALA A 267 ? 0.3660 0.3151 0.3019 -0.0001 -0.0094 -0.0021 373 ALA A C     
2048 O  O     . ALA A 267 ? 0.3336 0.2783 0.2646 -0.0003 -0.0103 -0.0013 373 ALA A O     
2049 C  CB    . ALA A 267 ? 0.3730 0.3321 0.3172 -0.0021 -0.0062 -0.0015 373 ALA A CB    
2050 N  N     . TYR A 268 ? 0.3522 0.3031 0.2928 0.0023  -0.0088 -0.0038 374 TYR A N     
2051 C  CA    . TYR A 268 ? 0.3533 0.3021 0.2949 0.0049  -0.0085 -0.0049 374 TYR A CA    
2052 C  C     . TYR A 268 ? 0.3760 0.3185 0.3111 0.0056  -0.0112 -0.0051 374 TYR A C     
2053 O  O     . TYR A 268 ? 0.3502 0.2900 0.2845 0.0073  -0.0111 -0.0055 374 TYR A O     
2054 C  CB    . TYR A 268 ? 0.3336 0.2860 0.2821 0.0073  -0.0074 -0.0070 374 TYR A CB    
2055 C  CG    . TYR A 268 ? 0.3100 0.2684 0.2648 0.0067  -0.0052 -0.0071 374 TYR A CG    
2056 C  CD1   . TYR A 268 ? 0.3068 0.2674 0.2631 0.0055  -0.0033 -0.0058 374 TYR A CD1   
2057 C  CD2   . TYR A 268 ? 0.2928 0.2544 0.2520 0.0075  -0.0052 -0.0087 374 TYR A CD2   
2058 C  CE1   . TYR A 268 ? 0.3052 0.2709 0.2669 0.0050  -0.0015 -0.0059 374 TYR A CE1   
2059 C  CE2   . TYR A 268 ? 0.2851 0.2518 0.2498 0.0071  -0.0032 -0.0088 374 TYR A CE2   
2060 C  CZ    . TYR A 268 ? 0.2853 0.2539 0.2511 0.0058  -0.0014 -0.0075 374 TYR A CZ    
2061 O  OH    . TYR A 268 ? 0.2738 0.2471 0.2448 0.0056  0.0004  -0.0076 374 TYR A OH    
2062 N  N     . GLN A 269 ? 0.3867 0.3266 0.3173 0.0046  -0.0134 -0.0050 375 GLN A N     
2063 C  CA    . GLN A 269 ? 0.4022 0.3354 0.3256 0.0050  -0.0162 -0.0049 375 GLN A CA    
2064 C  C     . GLN A 269 ? 0.4124 0.3420 0.3285 0.0018  -0.0174 -0.0029 375 GLN A C     
2065 O  O     . GLN A 269 ? 0.4274 0.3516 0.3370 0.0015  -0.0199 -0.0027 375 GLN A O     
2066 C  CB    . GLN A 269 ? 0.4167 0.3483 0.3393 0.0064  -0.0183 -0.0065 375 GLN A CB    
2067 C  CG    . GLN A 269 ? 0.4208 0.3567 0.3512 0.0093  -0.0173 -0.0087 375 GLN A CG    
2068 C  CD    . GLN A 269 ? 0.4287 0.3638 0.3614 0.0121  -0.0166 -0.0099 375 GLN A CD    
2069 O  OE1   . GLN A 269 ? 0.4488 0.3882 0.3885 0.0139  -0.0149 -0.0114 375 GLN A OE1   
2070 N  NE2   . GLN A 269 ? 0.4494 0.3791 0.3764 0.0124  -0.0179 -0.0093 375 GLN A NE2   
2071 N  N     . HIS A 270 ? 0.4140 0.3463 0.3309 -0.0004 -0.0158 -0.0013 376 HIS A N     
2072 C  CA    . HIS A 270 ? 0.3996 0.3287 0.3097 -0.0036 -0.0169 0.0004  376 HIS A CA    
2073 C  C     . HIS A 270 ? 0.4179 0.3402 0.3219 -0.0027 -0.0187 0.0007  376 HIS A C     
2074 O  O     . HIS A 270 ? 0.4412 0.3629 0.3470 -0.0006 -0.0178 0.0002  376 HIS A O     
2075 C  CB    . HIS A 270 ? 0.3912 0.3245 0.3040 -0.0056 -0.0149 0.0018  376 HIS A CB    
2076 C  CG    . HIS A 270 ? 0.3850 0.3163 0.2919 -0.0092 -0.0159 0.0036  376 HIS A CG    
2077 N  ND1   . HIS A 270 ? 0.3927 0.3189 0.2937 -0.0101 -0.0170 0.0047  376 HIS A ND1   
2078 C  CD2   . HIS A 270 ? 0.3752 0.3092 0.2817 -0.0122 -0.0157 0.0044  376 HIS A CD2   
2079 C  CE1   . HIS A 270 ? 0.3830 0.3090 0.2803 -0.0135 -0.0175 0.0061  376 HIS A CE1   
2080 N  NE2   . HIS A 270 ? 0.3905 0.3214 0.2911 -0.0149 -0.0167 0.0059  376 HIS A NE2   
2081 N  N     . LYS A 271 ? 0.4225 0.3393 0.3189 -0.0043 -0.0210 0.0013  377 LYS A N     
2082 C  CA    . LYS A 271 ? 0.4419 0.3512 0.3314 -0.0034 -0.0231 0.0014  377 LYS A CA    
2083 C  C     . LYS A 271 ? 0.4272 0.3354 0.3158 -0.0036 -0.0222 0.0024  377 LYS A C     
2084 O  O     . LYS A 271 ? 0.4293 0.3331 0.3154 -0.0015 -0.0229 0.0019  377 LYS A O     
2085 C  CB    . LYS A 271 ? 0.4712 0.3749 0.3519 -0.0061 -0.0256 0.0024  377 LYS A CB    
2086 C  CG    . LYS A 271 ? 0.4971 0.4028 0.3763 -0.0102 -0.0247 0.0043  377 LYS A CG    
2087 C  CD    . LYS A 271 ? 0.5338 0.4373 0.4073 -0.0136 -0.0261 0.0052  377 LYS A CD    
2088 C  CE    . LYS A 271 ? 0.5480 0.4531 0.4195 -0.0178 -0.0253 0.0070  377 LYS A CE    
2089 N  NZ    . LYS A 271 ? 0.5578 0.4711 0.4365 -0.0187 -0.0230 0.0069  377 LYS A NZ    
2090 N  N     . VAL A 272 ? 0.4150 0.3269 0.3053 -0.0061 -0.0206 0.0038  378 VAL A N     
2091 C  CA    . VAL A 272 ? 0.4122 0.3228 0.3012 -0.0064 -0.0198 0.0048  378 VAL A CA    
2092 C  C     . VAL A 272 ? 0.4143 0.3289 0.3104 -0.0036 -0.0174 0.0039  378 VAL A C     
2093 O  O     . VAL A 272 ? 0.4022 0.3141 0.2973 -0.0021 -0.0171 0.0038  378 VAL A O     
2094 C  CB    . VAL A 272 ? 0.4146 0.3268 0.3018 -0.0102 -0.0195 0.0067  378 VAL A CB    
2095 C  CG1   . VAL A 272 ? 0.4149 0.3252 0.3004 -0.0102 -0.0191 0.0076  378 VAL A CG1   
2096 C  CG2   . VAL A 272 ? 0.4189 0.3267 0.2984 -0.0132 -0.0218 0.0077  378 VAL A CG2   
2097 N  N     . GLY A 273 ? 0.4064 0.3272 0.3096 -0.0030 -0.0158 0.0031  379 GLY A N     
2098 C  CA    . GLY A 273 ? 0.4033 0.3277 0.3133 -0.0003 -0.0136 0.0019  379 GLY A CA    
2099 C  C     . GLY A 273 ? 0.4189 0.3398 0.3284 0.0027  -0.0141 0.0003  379 GLY A C     
2100 O  O     . GLY A 273 ? 0.3784 0.2989 0.2896 0.0044  -0.0126 0.0000  379 GLY A O     
2101 N  N     . ASN A 274 ? 0.4299 0.3480 0.3369 0.0036  -0.0162 -0.0006 380 ASN A N     
2102 C  CA    . ASN A 274 ? 0.4498 0.3649 0.3567 0.0070  -0.0170 -0.0024 380 ASN A CA    
2103 C  C     . ASN A 274 ? 0.4607 0.3694 0.3612 0.0074  -0.0181 -0.0018 380 ASN A C     
2104 O  O     . ASN A 274 ? 0.4693 0.3769 0.3713 0.0101  -0.0174 -0.0031 380 ASN A O     
2105 C  CB    . ASN A 274 ? 0.4535 0.3670 0.3591 0.0080  -0.0194 -0.0036 380 ASN A CB    
2106 C  CG    . ASN A 274 ? 0.4546 0.3742 0.3677 0.0090  -0.0182 -0.0050 380 ASN A CG    
2107 O  OD1   . ASN A 274 ? 0.5361 0.4550 0.4486 0.0096  -0.0200 -0.0061 380 ASN A OD1   
2108 N  ND2   . ASN A 274 ? 0.4181 0.3432 0.3378 0.0091  -0.0153 -0.0052 380 ASN A ND2   
2109 N  N     . ILE A 275 ? 0.4764 0.3810 0.3698 0.0047  -0.0196 0.0000  381 ILE A N     
2110 C  CA    . ILE A 275 ? 0.5062 0.4043 0.3931 0.0049  -0.0208 0.0005  381 ILE A CA    
2111 C  C     . ILE A 275 ? 0.5473 0.4467 0.4362 0.0051  -0.0184 0.0011  381 ILE A C     
2112 O  O     . ILE A 275 ? 0.5763 0.4719 0.4628 0.0069  -0.0184 0.0006  381 ILE A O     
2113 C  CB    . ILE A 275 ? 0.5154 0.4081 0.3936 0.0019  -0.0233 0.0021  381 ILE A CB    
2114 C  CG1   . ILE A 275 ? 0.5323 0.4168 0.4028 0.0031  -0.0255 0.0020  381 ILE A CG1   
2115 C  CG2   . ILE A 275 ? 0.5028 0.3972 0.3797 -0.0016 -0.0225 0.0042  381 ILE A CG2   
2116 C  CD1   . ILE A 275 ? 0.5183 0.4002 0.3891 0.0068  -0.0268 0.0000  381 ILE A CD1   
2117 N  N     . ILE A 276 ? 0.5531 0.4578 0.4463 0.0034  -0.0165 0.0020  382 ILE A N     
2118 C  CA    . ILE A 276 ? 0.5515 0.4577 0.4471 0.0038  -0.0142 0.0024  382 ILE A CA    
2119 C  C     . ILE A 276 ? 0.5366 0.4448 0.4378 0.0072  -0.0123 0.0004  382 ILE A C     
2120 O  O     . ILE A 276 ? 0.5152 0.4212 0.4155 0.0084  -0.0112 0.0002  382 ILE A O     
2121 C  CB    . ILE A 276 ? 0.5858 0.4971 0.4846 0.0013  -0.0128 0.0038  382 ILE A CB    
2122 C  CG1   . ILE A 276 ? 0.6082 0.5165 0.5006 -0.0019 -0.0146 0.0058  382 ILE A CG1   
2123 C  CG2   . ILE A 276 ? 0.5930 0.5062 0.4951 0.0020  -0.0103 0.0040  382 ILE A CG2   
2124 C  CD1   . ILE A 276 ? 0.6127 0.5258 0.5078 -0.0044 -0.0136 0.0071  382 ILE A CD1   
2125 N  N     . ASP A 277 ? 0.4967 0.4088 0.4034 0.0086  -0.0119 -0.0011 383 ASP A N     
2126 C  CA    . ASP A 277 ? 0.5122 0.4264 0.4244 0.0117  -0.0101 -0.0032 383 ASP A CA    
2127 C  C     . ASP A 277 ? 0.5274 0.4361 0.4356 0.0141  -0.0116 -0.0045 383 ASP A C     
2128 O  O     . ASP A 277 ? 0.4634 0.3721 0.3740 0.0164  -0.0099 -0.0059 383 ASP A O     
2129 C  CB    . ASP A 277 ? 0.5293 0.4485 0.4479 0.0127  -0.0097 -0.0047 383 ASP A CB    
2130 C  CG    . ASP A 277 ? 0.5418 0.4674 0.4667 0.0115  -0.0073 -0.0042 383 ASP A CG    
2131 O  OD1   . ASP A 277 ? 0.5220 0.4484 0.4471 0.0103  -0.0055 -0.0029 383 ASP A OD1   
2132 O  OD2   . ASP A 277 ? 0.5369 0.4664 0.4664 0.0118  -0.0072 -0.0052 383 ASP A OD2   
2133 N  N     . THR A 278 ? 0.5301 0.4339 0.4319 0.0136  -0.0146 -0.0041 384 THR A N     
2134 C  CA    . THR A 278 ? 0.5408 0.4389 0.4381 0.0159  -0.0165 -0.0052 384 THR A CA    
2135 C  C     . THR A 278 ? 0.5290 0.4228 0.4217 0.0158  -0.0159 -0.0044 384 THR A C     
2136 O  O     . THR A 278 ? 0.4940 0.3857 0.3868 0.0184  -0.0154 -0.0059 384 THR A O     
2137 C  CB    . THR A 278 ? 0.5580 0.4514 0.4490 0.0151  -0.0201 -0.0048 384 THR A CB    
2138 O  OG1   . THR A 278 ? 0.5400 0.4373 0.4354 0.0156  -0.0205 -0.0059 384 THR A OG1   
2139 C  CG2   . THR A 278 ? 0.5503 0.4369 0.4357 0.0176  -0.0223 -0.0059 384 THR A CG2   
2140 N  N     . MET A 279 ? 0.5417 0.4343 0.4306 0.0127  -0.0159 -0.0021 385 MET A N     
2141 C  CA    . MET A 279 ? 0.5445 0.4327 0.4284 0.0122  -0.0156 -0.0010 385 MET A CA    
2142 C  C     . MET A 279 ? 0.5387 0.4300 0.4276 0.0134  -0.0123 -0.0016 385 MET A C     
2143 O  O     . MET A 279 ? 0.5296 0.4175 0.4160 0.0148  -0.0116 -0.0020 385 MET A O     
2144 C  CB    . MET A 279 ? 0.5680 0.4547 0.4469 0.0083  -0.0166 0.0015  385 MET A CB    
2145 C  CG    . MET A 279 ? 0.5690 0.4510 0.4411 0.0067  -0.0199 0.0023  385 MET A CG    
2146 S  SD    . MET A 279 ? 0.6216 0.5025 0.4885 0.0019  -0.0211 0.0050  385 MET A SD    
2147 C  CE    . MET A 279 ? 0.5929 0.4682 0.4534 0.0012  -0.0213 0.0063  385 MET A CE    
2148 N  N     . ILE A 280 ? 0.5274 0.4252 0.4232 0.0129  -0.0101 -0.0016 386 ILE A N     
2149 C  CA    . ILE A 280 ? 0.5113 0.4120 0.4120 0.0141  -0.0069 -0.0023 386 ILE A CA    
2150 C  C     . ILE A 280 ? 0.5017 0.4024 0.4055 0.0176  -0.0060 -0.0050 386 ILE A C     
2151 O  O     . ILE A 280 ? 0.4854 0.3850 0.3895 0.0188  -0.0040 -0.0056 386 ILE A O     
2152 C  CB    . ILE A 280 ? 0.4957 0.4030 0.4030 0.0129  -0.0050 -0.0019 386 ILE A CB    
2153 C  CG1   . ILE A 280 ? 0.5213 0.4285 0.4255 0.0098  -0.0055 0.0004  386 ILE A CG1   
2154 C  CG2   . ILE A 280 ? 0.4823 0.3922 0.3945 0.0143  -0.0016 -0.0029 386 ILE A CG2   
2155 C  CD1   . ILE A 280 ? 0.5256 0.4393 0.4359 0.0085  -0.0042 0.0009  386 ILE A CD1   
2156 N  N     . THR A 281 ? 0.5002 0.4022 0.4063 0.0191  -0.0074 -0.0066 387 THR A N     
2157 C  CA    . THR A 281 ? 0.5597 0.4620 0.4691 0.0225  -0.0069 -0.0093 387 THR A CA    
2158 C  C     . THR A 281 ? 0.5770 0.4727 0.4802 0.0241  -0.0080 -0.0098 387 THR A C     
2159 O  O     . THR A 281 ? 0.5625 0.4582 0.4676 0.0262  -0.0060 -0.0114 387 THR A O     
2160 C  CB    . THR A 281 ? 0.5587 0.4635 0.4714 0.0236  -0.0088 -0.0108 387 THR A CB    
2161 O  OG1   . THR A 281 ? 0.5707 0.4822 0.4906 0.0228  -0.0068 -0.0109 387 THR A OG1   
2162 C  CG2   . THR A 281 ? 0.5637 0.4678 0.4784 0.0273  -0.0094 -0.0136 387 THR A CG2   
2163 N  N     . ASP A 282 ? 0.6032 0.4935 0.4989 0.0229  -0.0110 -0.0084 388 ASP A N     
2164 C  CA    . ASP A 282 ? 0.6376 0.5208 0.5258 0.0235  -0.0123 -0.0081 388 ASP A CA    
2165 C  C     . ASP A 282 ? 0.5891 0.4708 0.4757 0.0232  -0.0098 -0.0074 388 ASP A C     
2166 O  O     . ASP A 282 ? 0.6031 0.4818 0.4882 0.0254  -0.0092 -0.0088 388 ASP A O     
2167 C  CB    . ASP A 282 ? 0.6772 0.5555 0.5575 0.0210  -0.0155 -0.0060 388 ASP A CB    
2168 C  CG    . ASP A 282 ? 0.7375 0.6108 0.6134 0.0229  -0.0186 -0.0072 388 ASP A CG    
2169 O  OD1   . ASP A 282 ? 0.8062 0.6745 0.6782 0.0249  -0.0191 -0.0080 388 ASP A OD1   
2170 O  OD2   . ASP A 282 ? 0.7670 0.6417 0.6440 0.0226  -0.0204 -0.0074 388 ASP A OD2   
2171 N  N     . ALA A 283 ? 0.5570 0.4407 0.4439 0.0204  -0.0086 -0.0054 389 ALA A N     
2172 C  CA    . ALA A 283 ? 0.5512 0.4338 0.4369 0.0198  -0.0063 -0.0046 389 ALA A CA    
2173 C  C     . ALA A 283 ? 0.5581 0.4442 0.4501 0.0222  -0.0029 -0.0068 389 ALA A C     
2174 O  O     . ALA A 283 ? 0.5335 0.4166 0.4234 0.0235  -0.0015 -0.0075 389 ALA A O     
2175 C  CB    . ALA A 283 ? 0.5448 0.4296 0.4305 0.0166  -0.0057 -0.0022 389 ALA A CB    
2176 N  N     . PHE A 284 ? 0.5878 0.4801 0.4875 0.0229  -0.0016 -0.0081 390 PHE A N     
2177 C  CA    . PHE A 284 ? 0.5854 0.4814 0.4915 0.0249  0.0017  -0.0102 390 PHE A CA    
2178 C  C     . PHE A 284 ? 0.5630 0.4566 0.4686 0.0281  0.0013  -0.0127 390 PHE A C     
2179 O  O     . PHE A 284 ? 0.4851 0.3788 0.3923 0.0296  0.0039  -0.0141 390 PHE A O     
2180 C  CB    . PHE A 284 ? 0.6029 0.5061 0.5175 0.0251  0.0029  -0.0113 390 PHE A CB    
2181 C  CG    . PHE A 284 ? 0.5936 0.5004 0.5109 0.0225  0.0046  -0.0095 390 PHE A CG    
2182 C  CD1   . PHE A 284 ? 0.5863 0.4906 0.4985 0.0200  0.0040  -0.0068 390 PHE A CD1   
2183 C  CD2   . PHE A 284 ? 0.6186 0.5317 0.5437 0.0228  0.0064  -0.0105 390 PHE A CD2   
2184 C  CE1   . PHE A 284 ? 0.5926 0.5004 0.5076 0.0180  0.0054  -0.0053 390 PHE A CE1   
2185 C  CE2   . PHE A 284 ? 0.6523 0.5687 0.5799 0.0206  0.0078  -0.0090 390 PHE A CE2   
2186 C  CZ    . PHE A 284 ? 0.6243 0.5380 0.5468 0.0183  0.0072  -0.0064 390 PHE A CZ    
2187 N  N     . LEU A 285 ? 0.5844 0.4758 0.4877 0.0293  -0.0019 -0.0134 391 LEU A N     
2188 C  CA    . LEU A 285 ? 0.5932 0.4818 0.4956 0.0327  -0.0028 -0.0159 391 LEU A CA    
2189 C  C     . LEU A 285 ? 0.5945 0.4769 0.4902 0.0332  -0.0024 -0.0155 391 LEU A C     
2190 O  O     . LEU A 285 ? 0.5847 0.4670 0.4822 0.0356  -0.0006 -0.0177 391 LEU A O     
2191 C  CB    . LEU A 285 ? 0.5850 0.4716 0.4852 0.0337  -0.0067 -0.0164 391 LEU A CB    
2192 C  CG    . LEU A 285 ? 0.5876 0.4804 0.4955 0.0346  -0.0069 -0.0180 391 LEU A CG    
2193 C  CD1   . LEU A 285 ? 0.5938 0.4836 0.4977 0.0348  -0.0111 -0.0177 391 LEU A CD1   
2194 C  CD2   . LEU A 285 ? 0.5822 0.4792 0.4974 0.0379  -0.0051 -0.0213 391 LEU A CD2   
2195 N  N     . LYS A 286 ? 0.5873 0.4650 0.4758 0.0307  -0.0038 -0.0129 392 LYS A N     
2196 C  CA    . LYS A 286 ? 0.6205 0.4920 0.5021 0.0307  -0.0035 -0.0122 392 LYS A CA    
2197 C  C     . LYS A 286 ? 0.6389 0.5115 0.5217 0.0299  0.0001  -0.0118 392 LYS A C     
2198 O  O     . LYS A 286 ? 0.6598 0.5271 0.5366 0.0297  0.0005  -0.0111 392 LYS A O     
2199 C  CB    . LYS A 286 ? 0.6517 0.5177 0.5250 0.0281  -0.0067 -0.0095 392 LYS A CB    
2200 C  CG    . LYS A 286 ? 0.6555 0.5187 0.5260 0.0292  -0.0104 -0.0102 392 LYS A CG    
2201 C  CD    . LYS A 286 ? 0.7235 0.5813 0.5858 0.0264  -0.0135 -0.0076 392 LYS A CD    
2202 C  CE    . LYS A 286 ? 0.7747 0.6291 0.6335 0.0274  -0.0172 -0.0082 392 LYS A CE    
2203 N  NZ    . LYS A 286 ? 0.8255 0.6772 0.6841 0.0315  -0.0176 -0.0109 392 LYS A NZ    
2204 N  N     . ALA A 287 ? 0.6511 0.5300 0.5410 0.0291  0.0028  -0.0119 393 ALA A N     
2205 C  CA    . ALA A 287 ? 0.5980 0.4779 0.4892 0.0285  0.0065  -0.0117 393 ALA A CA    
2206 C  C     . ALA A 287 ? 0.5615 0.4462 0.4603 0.0308  0.0097  -0.0146 393 ALA A C     
2207 O  O     . ALA A 287 ? 0.5252 0.4106 0.4253 0.0306  0.0131  -0.0149 393 ALA A O     
2208 C  CB    . ALA A 287 ? 0.5919 0.4746 0.4844 0.0254  0.0071  -0.0093 393 ALA A CB    
2209 N  N     . ASP A 288 ? 0.5761 0.4643 0.4801 0.0328  0.0088  -0.0168 394 ASP A N     
2210 C  CA    . ASP A 288 ? 0.6157 0.5097 0.5281 0.0345  0.0119  -0.0194 394 ASP A CA    
2211 C  C     . ASP A 288 ? 0.6607 0.5531 0.5729 0.0363  0.0149  -0.0215 394 ASP A C     
2212 O  O     . ASP A 288 ? 0.7195 0.6157 0.6367 0.0361  0.0188  -0.0225 394 ASP A O     
2213 C  CB    . ASP A 288 ? 0.6087 0.5063 0.5261 0.0366  0.0098  -0.0216 394 ASP A CB    
2214 C  CG    . ASP A 288 ? 0.6078 0.5127 0.5349 0.0375  0.0128  -0.0239 394 ASP A CG    
2215 O  OD1   . ASP A 288 ? 0.6200 0.5282 0.5504 0.0354  0.0154  -0.0229 394 ASP A OD1   
2216 O  OD2   . ASP A 288 ? 0.5922 0.4992 0.5236 0.0403  0.0126  -0.0269 394 ASP A OD2   
2217 N  N     . ASP A 289 ? 0.6929 0.5796 0.5991 0.0380  0.0131  -0.0220 395 ASP A N     
2218 C  CA    . ASP A 289 ? 0.7493 0.6335 0.6539 0.0398  0.0155  -0.0238 395 ASP A CA    
2219 C  C     . ASP A 289 ? 0.7503 0.6326 0.6520 0.0378  0.0188  -0.0223 395 ASP A C     
2220 O  O     . ASP A 289 ? 0.7904 0.6735 0.6941 0.0388  0.0222  -0.0241 395 ASP A O     
2221 C  CB    . ASP A 289 ? 0.7686 0.6460 0.6658 0.0418  0.0125  -0.0242 395 ASP A CB    
2222 C  CG    . ASP A 289 ? 0.8396 0.7183 0.7400 0.0450  0.0100  -0.0269 395 ASP A CG    
2223 O  OD1   . ASP A 289 ? 0.8193 0.7044 0.7281 0.0466  0.0114  -0.0294 395 ASP A OD1   
2224 O  OD2   . ASP A 289 ? 0.9501 0.8230 0.8439 0.0462  0.0064  -0.0266 395 ASP A OD2   
2225 N  N     . TYR A 290 ? 0.7469 0.6266 0.6438 0.0349  0.0176  -0.0190 396 TYR A N     
2226 C  CA    . TYR A 290 ? 0.7336 0.6095 0.6253 0.0330  0.0196  -0.0172 396 TYR A CA    
2227 C  C     . TYR A 290 ? 0.7212 0.6008 0.6164 0.0306  0.0223  -0.0158 396 TYR A C     
2228 O  O     . TYR A 290 ? 0.6685 0.5447 0.5593 0.0291  0.0239  -0.0143 396 TYR A O     
2229 C  CB    . TYR A 290 ? 0.7520 0.6212 0.6345 0.0315  0.0161  -0.0145 396 TYR A CB    
2230 C  CG    . TYR A 290 ? 0.8391 0.7043 0.7177 0.0338  0.0130  -0.0157 396 TYR A CG    
2231 C  CD1   . TYR A 290 ? 0.8800 0.7431 0.7580 0.0366  0.0144  -0.0183 396 TYR A CD1   
2232 C  CD2   . TYR A 290 ? 0.8801 0.7435 0.7557 0.0331  0.0087  -0.0144 396 TYR A CD2   
2233 C  CE1   . TYR A 290 ? 0.8801 0.7393 0.7546 0.0389  0.0115  -0.0196 396 TYR A CE1   
2234 C  CE2   . TYR A 290 ? 0.8765 0.7357 0.7482 0.0353  0.0058  -0.0155 396 TYR A CE2   
2235 C  CZ    . TYR A 290 ? 0.9100 0.7670 0.7812 0.0383  0.0072  -0.0181 396 TYR A CZ    
2236 O  OH    . TYR A 290 ? 0.9455 0.7985 0.8132 0.0407  0.0044  -0.0195 396 TYR A OH    
2237 N  N     . ILE A 291 ? 0.7013 0.5872 0.6037 0.0301  0.0227  -0.0161 397 ILE A N     
2238 C  CA    . ILE A 291 ? 0.7365 0.6256 0.6421 0.0280  0.0253  -0.0149 397 ILE A CA    
2239 C  C     . ILE A 291 ? 0.7113 0.6055 0.6245 0.0291  0.0292  -0.0176 397 ILE A C     
2240 O  O     . ILE A 291 ? 0.7631 0.6613 0.6820 0.0311  0.0289  -0.0200 397 ILE A O     
2241 C  CB    . ILE A 291 ? 0.7733 0.6655 0.6809 0.0262  0.0227  -0.0129 397 ILE A CB    
2242 C  CG1   . ILE A 291 ? 0.7492 0.6363 0.6490 0.0241  0.0202  -0.0098 397 ILE A CG1   
2243 C  CG2   . ILE A 291 ? 0.7484 0.6458 0.6622 0.0249  0.0254  -0.0128 397 ILE A CG2   
2244 C  CD1   . ILE A 291 ? 0.7150 0.6040 0.6152 0.0227  0.0169  -0.0082 397 ILE A CD1   
2245 N  N     . GLU A 292 ? 0.7035 0.5975 0.6168 0.0278  0.0328  -0.0171 398 GLU A N     
2246 C  CA    . GLU A 292 ? 0.7326 0.6309 0.6524 0.0283  0.0371  -0.0196 398 GLU A CA    
2247 C  C     . GLU A 292 ? 0.6696 0.5713 0.5932 0.0262  0.0392  -0.0184 398 GLU A C     
2248 O  O     . GLU A 292 ? 0.6265 0.5251 0.5456 0.0243  0.0395  -0.0160 398 GLU A O     
2249 C  CB    . GLU A 292 ? 0.8199 0.7144 0.7361 0.0288  0.0404  -0.0206 398 GLU A CB    
2250 C  CG    . GLU A 292 ? 0.9725 0.8664 0.8891 0.0318  0.0402  -0.0235 398 GLU A CG    
2251 C  CD    . GLU A 292 ? 1.0816 0.9692 0.9911 0.0322  0.0420  -0.0236 398 GLU A CD    
2252 O  OE1   . GLU A 292 ? 1.1299 1.0157 1.0373 0.0304  0.0454  -0.0227 398 GLU A OE1   
2253 O  OE2   . GLU A 292 ? 1.0655 0.9498 0.9715 0.0342  0.0402  -0.0247 398 GLU A OE2   
2254 N  N     . ILE A 293 ? 0.6414 0.5495 0.5733 0.0266  0.0406  -0.0203 399 ILE A N     
2255 C  CA    . ILE A 293 ? 0.6750 0.5864 0.6108 0.0247  0.0425  -0.0194 399 ILE A CA    
2256 C  C     . ILE A 293 ? 0.6454 0.5593 0.5859 0.0249  0.0473  -0.0220 399 ILE A C     
2257 O  O     . ILE A 293 ? 0.6211 0.5387 0.5670 0.0268  0.0481  -0.0249 399 ILE A O     
2258 C  CB    . ILE A 293 ? 0.7140 0.6306 0.6554 0.0246  0.0399  -0.0193 399 ILE A CB    
2259 C  CG1   . ILE A 293 ? 0.6982 0.6120 0.6344 0.0240  0.0354  -0.0167 399 ILE A CG1   
2260 C  CG2   . ILE A 293 ? 0.7276 0.6479 0.6735 0.0228  0.0419  -0.0186 399 ILE A CG2   
2261 C  CD1   . ILE A 293 ? 0.7227 0.6403 0.6630 0.0251  0.0323  -0.0176 399 ILE A CD1   
2262 N  N     . THR A 294 ? 0.6579 0.5699 0.5964 0.0231  0.0504  -0.0209 400 THR A N     
2263 C  CA    . THR A 294 ? 0.6665 0.5806 0.6090 0.0229  0.0552  -0.0232 400 THR A CA    
2264 C  C     . THR A 294 ? 0.6181 0.5388 0.5692 0.0224  0.0564  -0.0245 400 THR A C     
2265 O  O     . THR A 294 ? 0.6250 0.5467 0.5768 0.0209  0.0555  -0.0226 400 THR A O     
2266 C  CB    . THR A 294 ? 0.7281 0.6372 0.6649 0.0210  0.0582  -0.0216 400 THR A CB    
2267 O  OG1   . THR A 294 ? 0.7363 0.6388 0.6643 0.0211  0.0564  -0.0198 400 THR A OG1   
2268 C  CG2   . THR A 294 ? 0.7723 0.6826 0.7120 0.0210  0.0633  -0.0243 400 THR A CG2   
2269 N  N     . GLY A 295 ? 0.5949 0.5201 0.5525 0.0237  0.0586  -0.0278 401 GLY A N     
2270 C  CA    . GLY A 295 ? 0.6390 0.5708 0.6052 0.0234  0.0598  -0.0295 401 GLY A CA    
2271 C  C     . GLY A 295 ? 0.6831 0.6164 0.6524 0.0223  0.0651  -0.0314 401 GLY A C     
2272 O  O     . GLY A 295 ? 0.8424 0.7708 0.8061 0.0211  0.0677  -0.0304 401 GLY A O     
2273 N  N     . ALA A 296 ? 0.7299 0.6697 0.7079 0.0227  0.0667  -0.0342 402 ALA A N     
2274 C  CA    . ALA A 296 ? 0.7655 0.7075 0.7475 0.0211  0.0719  -0.0361 402 ALA A CA    
2275 C  C     . ALA A 296 ? 0.7913 0.7323 0.7726 0.0221  0.0751  -0.0386 402 ALA A C     
2276 O  O     . ALA A 296 ? 0.8091 0.7518 0.7922 0.0247  0.0736  -0.0407 402 ALA A O     
2277 C  CB    . ALA A 296 ? 0.7587 0.7083 0.7506 0.0212  0.0723  -0.0385 402 ALA A CB    
2278 N  N     . GLY A 297 ? 0.8165 0.7547 0.7950 0.0200  0.0797  -0.0384 403 GLY A N     
2279 C  CA    . GLY A 297 ? 0.7949 0.7312 0.7715 0.0204  0.0835  -0.0405 403 GLY A CA    
2280 C  C     . GLY A 297 ? 0.8330 0.7632 0.8013 0.0219  0.0812  -0.0391 403 GLY A C     
2281 O  O     . GLY A 297 ? 0.8465 0.7775 0.8158 0.0240  0.0817  -0.0416 403 GLY A O     
2282 N  N     . GLY A 298 ? 0.8887 0.8132 0.8495 0.0209  0.0785  -0.0353 404 GLY A N     
2283 C  CA    . GLY A 298 ? 0.8642 0.7822 0.8163 0.0220  0.0758  -0.0335 404 GLY A CA    
2284 C  C     . GLY A 298 ? 0.8565 0.7753 0.8090 0.0250  0.0716  -0.0343 404 GLY A C     
2285 O  O     . GLY A 298 ? 0.8692 0.7824 0.8142 0.0256  0.0694  -0.0327 404 GLY A O     
2286 N  N     . LYS A 299 ? 0.8056 0.7310 0.7662 0.0267  0.0702  -0.0368 405 LYS A N     
2287 C  CA    . LYS A 299 ? 0.8050 0.7310 0.7660 0.0297  0.0661  -0.0378 405 LYS A CA    
2288 C  C     . LYS A 299 ? 0.8161 0.7389 0.7722 0.0297  0.0610  -0.0347 405 LYS A C     
2289 O  O     . LYS A 299 ? 0.8697 0.7927 0.8254 0.0278  0.0598  -0.0323 405 LYS A O     
2290 C  CB    . LYS A 299 ? 0.8089 0.7425 0.7795 0.0314  0.0653  -0.0409 405 LYS A CB    
2291 C  CG    . LYS A 299 ? 0.8508 0.7885 0.8274 0.0315  0.0702  -0.0444 405 LYS A CG    
2292 C  CD    . LYS A 299 ? 0.8868 0.8326 0.8738 0.0330  0.0698  -0.0477 405 LYS A CD    
2293 C  CE    . LYS A 299 ? 0.9605 0.9107 0.9536 0.0313  0.0754  -0.0500 405 LYS A CE    
2294 N  NZ    . LYS A 299 ? 0.9944 0.9524 0.9975 0.0333  0.0757  -0.0542 405 LYS A NZ    
2295 N  N     . LYS A 300 ? 0.8195 0.7400 0.7726 0.0320  0.0577  -0.0351 406 LYS A N     
2296 C  CA    . LYS A 300 ? 0.7986 0.7150 0.7456 0.0318  0.0530  -0.0321 406 LYS A CA    
2297 C  C     . LYS A 300 ? 0.6959 0.6159 0.6471 0.0336  0.0490  -0.0330 406 LYS A C     
2298 O  O     . LYS A 300 ? 0.6505 0.5732 0.6057 0.0362  0.0489  -0.0360 406 LYS A O     
2299 C  CB    . LYS A 300 ? 0.8987 0.8083 0.8373 0.0327  0.0523  -0.0314 406 LYS A CB    
2300 C  CG    . LYS A 300 ? 1.0255 0.9307 0.9588 0.0304  0.0559  -0.0299 406 LYS A CG    
2301 C  CD    . LYS A 300 ? 1.1473 1.0451 1.0713 0.0309  0.0547  -0.0286 406 LYS A CD    
2302 C  CE    . LYS A 300 ? 1.2342 1.1320 1.1591 0.0338  0.0555  -0.0319 406 LYS A CE    
2303 N  NZ    . LYS A 300 ? 1.2808 1.1708 1.1963 0.0340  0.0555  -0.0309 406 LYS A NZ    
2304 N  N     . TYR A 301 ? 0.6195 0.5397 0.5699 0.0323  0.0460  -0.0304 407 TYR A N     
2305 C  CA    . TYR A 301 ? 0.5734 0.4965 0.5270 0.0337  0.0419  -0.0309 407 TYR A CA    
2306 C  C     . TYR A 301 ? 0.5662 0.4844 0.5125 0.0332  0.0376  -0.0280 407 TYR A C     
2307 O  O     . TYR A 301 ? 0.5484 0.4616 0.4879 0.0315  0.0375  -0.0253 407 TYR A O     
2308 C  CB    . TYR A 301 ? 0.5689 0.4980 0.5296 0.0325  0.0424  -0.0310 407 TYR A CB    
2309 C  CG    . TYR A 301 ? 0.5609 0.4954 0.5294 0.0329  0.0464  -0.0341 407 TYR A CG    
2310 C  CD1   . TYR A 301 ? 0.5619 0.4960 0.5304 0.0310  0.0510  -0.0340 407 TYR A CD1   
2311 C  CD2   . TYR A 301 ? 0.5632 0.5030 0.5389 0.0351  0.0456  -0.0373 407 TYR A CD2   
2312 C  CE1   . TYR A 301 ? 0.5648 0.5038 0.5404 0.0312  0.0549  -0.0370 407 TYR A CE1   
2313 C  CE2   . TYR A 301 ? 0.5472 0.4924 0.5307 0.0354  0.0494  -0.0404 407 TYR A CE2   
2314 C  CZ    . TYR A 301 ? 0.5662 0.5110 0.5495 0.0334  0.0541  -0.0402 407 TYR A CZ    
2315 O  OH    . TYR A 301 ? 0.5962 0.5465 0.5871 0.0333  0.0578  -0.0433 407 TYR A OH    
2316 N  N     . ARG A 302 ? 0.6199 0.5391 0.5673 0.0348  0.0338  -0.0286 408 ARG A N     
2317 C  CA    . ARG A 302 ? 0.6838 0.5988 0.6248 0.0342  0.0296  -0.0260 408 ARG A CA    
2318 C  C     . ARG A 302 ? 0.6533 0.5722 0.5978 0.0329  0.0276  -0.0247 408 ARG A C     
2319 O  O     . ARG A 302 ? 0.5619 0.4866 0.5140 0.0328  0.0292  -0.0262 408 ARG A O     
2320 C  CB    . ARG A 302 ? 0.7735 0.6856 0.7117 0.0369  0.0267  -0.0275 408 ARG A CB    
2321 C  CG    . ARG A 302 ? 0.9187 0.8256 0.8514 0.0376  0.0286  -0.0279 408 ARG A CG    
2322 C  CD    . ARG A 302 ? 1.0456 0.9521 0.9793 0.0410  0.0282  -0.0311 408 ARG A CD    
2323 N  NE    . ARG A 302 ? 1.1778 1.0811 1.1075 0.0423  0.0233  -0.0305 408 ARG A NE    
2324 C  CZ    . ARG A 302 ? 1.1861 1.0909 1.1187 0.0452  0.0209  -0.0330 408 ARG A CZ    
2325 N  NH1   . ARG A 302 ? 1.1651 1.0657 1.0925 0.0459  0.0164  -0.0320 408 ARG A NH1   
2326 N  NH2   . ARG A 302 ? 1.1726 1.0830 1.1132 0.0473  0.0230  -0.0365 408 ARG A NH2   
2327 N  N     . ILE A 303 ? 0.6397 0.5551 0.5786 0.0316  0.0243  -0.0220 409 ILE A N     
2328 C  CA    . ILE A 303 ? 0.5983 0.5168 0.5396 0.0304  0.0220  -0.0208 409 ILE A CA    
2329 C  C     . ILE A 303 ? 0.5903 0.5139 0.5387 0.0324  0.0210  -0.0235 409 ILE A C     
2330 O  O     . ILE A 303 ? 0.5909 0.5197 0.5453 0.0316  0.0219  -0.0238 409 ILE A O     
2331 C  CB    . ILE A 303 ? 0.5985 0.5125 0.5326 0.0292  0.0181  -0.0182 409 ILE A CB    
2332 C  CG1   . ILE A 303 ? 0.5880 0.4974 0.5155 0.0272  0.0188  -0.0155 409 ILE A CG1   
2333 C  CG2   . ILE A 303 ? 0.6010 0.5185 0.5378 0.0280  0.0160  -0.0171 409 ILE A CG2   
2334 C  CD1   . ILE A 303 ? 0.5796 0.4834 0.4990 0.0265  0.0151  -0.0135 409 ILE A CD1   
2335 N  N     . SER A 304 ? 0.5620 0.4842 0.5099 0.0351  0.0194  -0.0256 410 SER A N     
2336 C  CA    . SER A 304 ? 0.5395 0.4660 0.4935 0.0372  0.0180  -0.0283 410 SER A CA    
2337 C  C     . SER A 304 ? 0.5418 0.4740 0.5042 0.0385  0.0215  -0.0314 410 SER A C     
2338 O  O     . SER A 304 ? 0.5569 0.4938 0.5256 0.0397  0.0207  -0.0334 410 SER A O     
2339 C  CB    . SER A 304 ? 0.5504 0.4732 0.5007 0.0398  0.0145  -0.0294 410 SER A CB    
2340 O  OG    . SER A 304 ? 0.6197 0.5388 0.5666 0.0413  0.0158  -0.0304 410 SER A OG    
2341 N  N     . THR A 305 ? 0.5073 0.4392 0.4700 0.0380  0.0254  -0.0319 411 THR A N     
2342 C  CA    . THR A 305 ? 0.5171 0.4546 0.4879 0.0388  0.0291  -0.0349 411 THR A CA    
2343 C  C     . THR A 305 ? 0.5240 0.4646 0.4982 0.0361  0.0325  -0.0338 411 THR A C     
2344 O  O     . THR A 305 ? 0.5579 0.5037 0.5394 0.0364  0.0354  -0.0362 411 THR A O     
2345 C  CB    . THR A 305 ? 0.5213 0.4571 0.4913 0.0404  0.0318  -0.0370 411 THR A CB    
2346 O  OG1   . THR A 305 ? 0.5388 0.4686 0.5009 0.0389  0.0329  -0.0345 411 THR A OG1   
2347 C  CG2   . THR A 305 ? 0.5102 0.4452 0.4802 0.0439  0.0289  -0.0394 411 THR A CG2   
2348 N  N     . ALA A 306 ? 0.5044 0.4419 0.4736 0.0337  0.0322  -0.0305 412 ALA A N     
2349 C  CA    . ALA A 306 ? 0.5254 0.4651 0.4970 0.0312  0.0353  -0.0293 412 ALA A CA    
2350 C  C     . ALA A 306 ? 0.5650 0.5110 0.5445 0.0310  0.0355  -0.0306 412 ALA A C     
2351 O  O     . ALA A 306 ? 0.5423 0.4911 0.5257 0.0295  0.0387  -0.0308 412 ALA A O     
2352 C  CB    . ALA A 306 ? 0.5366 0.4722 0.5016 0.0289  0.0341  -0.0256 412 ALA A CB    
2353 N  N     . ILE A 307 ? 0.5557 0.5037 0.5373 0.0324  0.0320  -0.0314 413 ILE A N     
2354 C  CA    . ILE A 307 ? 0.5864 0.5404 0.5757 0.0325  0.0319  -0.0330 413 ILE A CA    
2355 C  C     . ILE A 307 ? 0.6042 0.5633 0.6013 0.0336  0.0350  -0.0365 413 ILE A C     
2356 O  O     . ILE A 307 ? 0.5992 0.5633 0.6028 0.0332  0.0356  -0.0376 413 ILE A O     
2357 C  CB    . ILE A 307 ? 0.6185 0.5732 0.6081 0.0340  0.0274  -0.0334 413 ILE A CB    
2358 C  CG1   . ILE A 307 ? 0.6517 0.6045 0.6399 0.0370  0.0254  -0.0354 413 ILE A CG1   
2359 C  CG2   . ILE A 307 ? 0.6404 0.5916 0.6238 0.0324  0.0245  -0.0299 413 ILE A CG2   
2360 C  CD1   . ILE A 307 ? 0.6970 0.6513 0.6870 0.0387  0.0213  -0.0365 413 ILE A CD1   
2361 N  N     . ASP A 308 ? 0.6201 0.5780 0.6167 0.0350  0.0368  -0.0383 414 ASP A N     
2362 C  CA    . ASP A 308 ? 0.6407 0.6033 0.6445 0.0360  0.0402  -0.0418 414 ASP A CA    
2363 C  C     . ASP A 308 ? 0.6188 0.5818 0.6236 0.0336  0.0453  -0.0415 414 ASP A C     
2364 O  O     . ASP A 308 ? 0.6370 0.6041 0.6479 0.0339  0.0485  -0.0443 414 ASP A O     
2365 C  CB    . ASP A 308 ? 0.6794 0.6408 0.6827 0.0389  0.0398  -0.0443 414 ASP A CB    
2366 C  CG    . ASP A 308 ? 0.6815 0.6426 0.6844 0.0415  0.0349  -0.0452 414 ASP A CG    
2367 O  OD1   . ASP A 308 ? 0.6977 0.6628 0.7054 0.0419  0.0328  -0.0459 414 ASP A OD1   
2368 O  OD2   . ASP A 308 ? 0.7331 0.6897 0.7305 0.0432  0.0331  -0.0451 414 ASP A OD2   
2369 N  N     . ASP A 309 ? 0.5830 0.5417 0.5818 0.0314  0.0460  -0.0383 415 ASP A N     
2370 C  CA    . ASP A 309 ? 0.5945 0.5526 0.5931 0.0291  0.0506  -0.0377 415 ASP A CA    
2371 C  C     . ASP A 309 ? 0.5506 0.5069 0.5462 0.0265  0.0503  -0.0343 415 ASP A C     
2372 O  O     . ASP A 309 ? 0.5346 0.4857 0.5227 0.0259  0.0485  -0.0314 415 ASP A O     
2373 C  CB    . ASP A 309 ? 0.6058 0.5588 0.5984 0.0293  0.0528  -0.0375 415 ASP A CB    
2374 C  CG    . ASP A 309 ? 0.5991 0.5511 0.5912 0.0269  0.0576  -0.0371 415 ASP A CG    
2375 O  OD1   . ASP A 309 ? 0.6123 0.5687 0.6108 0.0267  0.0609  -0.0397 415 ASP A OD1   
2376 O  OD2   . ASP A 309 ? 0.6244 0.5713 0.6097 0.0253  0.0579  -0.0342 415 ASP A OD2   
2377 N  N     . MET A 310 ? 0.5477 0.5081 0.5488 0.0251  0.0520  -0.0348 416 MET A N     
2378 C  CA    . MET A 310 ? 0.5438 0.5031 0.5428 0.0231  0.0510  -0.0318 416 MET A CA    
2379 C  C     . MET A 310 ? 0.5494 0.5033 0.5415 0.0212  0.0527  -0.0291 416 MET A C     
2380 O  O     . MET A 310 ? 0.5107 0.4624 0.4992 0.0201  0.0508  -0.0263 416 MET A O     
2381 C  CB    . MET A 310 ? 0.5127 0.4773 0.5189 0.0221  0.0523  -0.0330 416 MET A CB    
2382 C  CG    . MET A 310 ? 0.5303 0.4999 0.5424 0.0238  0.0494  -0.0349 416 MET A CG    
2383 S  SD    . MET A 310 ? 0.5437 0.5114 0.5516 0.0245  0.0439  -0.0325 416 MET A SD    
2384 C  CE    . MET A 310 ? 0.5945 0.5598 0.5992 0.0272  0.0413  -0.0337 416 MET A CE    
2385 N  N     . GLU A 311 ? 0.5867 0.5383 0.5770 0.0209  0.0563  -0.0299 417 GLU A N     
2386 C  CA    . GLU A 311 ? 0.5578 0.5035 0.5408 0.0192  0.0577  -0.0273 417 GLU A CA    
2387 C  C     . GLU A 311 ? 0.5241 0.4646 0.4993 0.0200  0.0543  -0.0251 417 GLU A C     
2388 O  O     . GLU A 311 ? 0.5024 0.4387 0.4717 0.0187  0.0534  -0.0222 417 GLU A O     
2389 C  CB    . GLU A 311 ? 0.5994 0.5438 0.5822 0.0187  0.0625  -0.0290 417 GLU A CB    
2390 C  CG    . GLU A 311 ? 0.6242 0.5624 0.5996 0.0168  0.0643  -0.0264 417 GLU A CG    
2391 C  CD    . GLU A 311 ? 0.6739 0.6107 0.6490 0.0158  0.0695  -0.0280 417 GLU A CD    
2392 O  OE1   . GLU A 311 ? 0.6894 0.6309 0.6713 0.0155  0.0726  -0.0308 417 GLU A OE1   
2393 O  OE2   . GLU A 311 ? 0.6804 0.6111 0.6479 0.0152  0.0703  -0.0263 417 GLU A OE2   
2394 N  N     . ALA A 312 ? 0.4882 0.4289 0.4634 0.0221  0.0523  -0.0265 418 ALA A N     
2395 C  CA    . ALA A 312 ? 0.5097 0.4458 0.4779 0.0227  0.0488  -0.0245 418 ALA A CA    
2396 C  C     . ALA A 312 ? 0.4936 0.4309 0.4617 0.0224  0.0446  -0.0226 418 ALA A C     
2397 O  O     . ALA A 312 ? 0.4544 0.3876 0.4161 0.0217  0.0422  -0.0199 418 ALA A O     
2398 C  CB    . ALA A 312 ? 0.5094 0.4451 0.4774 0.0252  0.0477  -0.0267 418 ALA A CB    
2399 N  N     . TYR A 313 ? 0.4845 0.4273 0.4595 0.0231  0.0437  -0.0242 419 TYR A N     
2400 C  CA    . TYR A 313 ? 0.4953 0.4396 0.4708 0.0230  0.0399  -0.0229 419 TYR A CA    
2401 C  C     . TYR A 313 ? 0.4831 0.4265 0.4565 0.0207  0.0399  -0.0201 419 TYR A C     
2402 O  O     . TYR A 313 ? 0.4947 0.4366 0.4645 0.0202  0.0368  -0.0179 419 TYR A O     
2403 C  CB    . TYR A 313 ? 0.4956 0.4460 0.4790 0.0241  0.0392  -0.0254 419 TYR A CB    
2404 C  CG    . TYR A 313 ? 0.5053 0.4568 0.4885 0.0245  0.0349  -0.0245 419 TYR A CG    
2405 C  CD1   . TYR A 313 ? 0.5369 0.4845 0.5141 0.0252  0.0314  -0.0232 419 TYR A CD1   
2406 C  CD2   . TYR A 313 ? 0.5068 0.4630 0.4955 0.0241  0.0342  -0.0249 419 TYR A CD2   
2407 C  CE1   . TYR A 313 ? 0.5225 0.4708 0.4992 0.0254  0.0276  -0.0224 419 TYR A CE1   
2408 C  CE2   . TYR A 313 ? 0.4943 0.4513 0.4826 0.0244  0.0305  -0.0242 419 TYR A CE2   
2409 C  CZ    . TYR A 313 ? 0.5200 0.4730 0.5022 0.0250  0.0272  -0.0230 419 TYR A CZ    
2410 O  OH    . TYR A 313 ? 0.5351 0.4885 0.5162 0.0250  0.0235  -0.0222 419 TYR A OH    
2411 N  N     . THR A 314 ? 0.4509 0.3948 0.4261 0.0194  0.0436  -0.0202 420 THR A N     
2412 C  CA    . THR A 314 ? 0.4416 0.3842 0.4148 0.0175  0.0441  -0.0178 420 THR A CA    
2413 C  C     . THR A 314 ? 0.4429 0.3803 0.4081 0.0168  0.0420  -0.0149 420 THR A C     
2414 O  O     . THR A 314 ? 0.4275 0.3647 0.3912 0.0158  0.0402  -0.0128 420 THR A O     
2415 C  CB    . THR A 314 ? 0.4574 0.3998 0.4321 0.0163  0.0486  -0.0184 420 THR A CB    
2416 O  OG1   . THR A 314 ? 0.4655 0.4134 0.4481 0.0165  0.0503  -0.0209 420 THR A OG1   
2417 C  CG2   . THR A 314 ? 0.4517 0.3916 0.4233 0.0144  0.0491  -0.0158 420 THR A CG2   
2418 N  N     . LYS A 315 ? 0.4491 0.3824 0.4094 0.0176  0.0419  -0.0149 421 LYS A N     
2419 C  CA    . LYS A 315 ? 0.4825 0.4104 0.4349 0.0168  0.0401  -0.0123 421 LYS A CA    
2420 C  C     . LYS A 315 ? 0.4894 0.4164 0.4391 0.0176  0.0360  -0.0116 421 LYS A C     
2421 O  O     . LYS A 315 ? 0.4585 0.3808 0.4014 0.0172  0.0343  -0.0098 421 LYS A O     
2422 C  CB    . LYS A 315 ? 0.5229 0.4459 0.4705 0.0168  0.0427  -0.0124 421 LYS A CB    
2423 C  CG    . LYS A 315 ? 0.5611 0.4846 0.5111 0.0159  0.0471  -0.0133 421 LYS A CG    
2424 C  CD    . LYS A 315 ? 0.5939 0.5117 0.5377 0.0154  0.0497  -0.0128 421 LYS A CD    
2425 C  CE    . LYS A 315 ? 0.6352 0.5523 0.5790 0.0170  0.0511  -0.0152 421 LYS A CE    
2426 N  NZ    . LYS A 315 ? 0.6759 0.5893 0.6166 0.0164  0.0551  -0.0157 421 LYS A NZ    
2427 N  N     . LEU A 316 ? 0.4878 0.4190 0.4423 0.0186  0.0343  -0.0130 422 LEU A N     
2428 C  CA    . LEU A 316 ? 0.4698 0.3998 0.4215 0.0194  0.0305  -0.0127 422 LEU A CA    
2429 C  C     . LEU A 316 ? 0.4453 0.3778 0.3982 0.0184  0.0278  -0.0112 422 LEU A C     
2430 O  O     . LEU A 316 ? 0.4112 0.3484 0.3699 0.0186  0.0278  -0.0124 422 LEU A O     
2431 C  CB    . LEU A 316 ? 0.4885 0.4203 0.4436 0.0216  0.0303  -0.0156 422 LEU A CB    
2432 C  CG    . LEU A 316 ? 0.5069 0.4373 0.4591 0.0226  0.0261  -0.0153 422 LEU A CG    
2433 C  CD1   . LEU A 316 ? 0.5105 0.4347 0.4544 0.0223  0.0245  -0.0136 422 LEU A CD1   
2434 C  CD2   . LEU A 316 ? 0.5003 0.4331 0.4567 0.0250  0.0255  -0.0183 422 LEU A CD2   
2435 N  N     . THR A 317 ? 0.4465 0.3761 0.3939 0.0171  0.0257  -0.0087 423 THR A N     
2436 C  CA    . THR A 317 ? 0.4393 0.3714 0.3878 0.0158  0.0236  -0.0072 423 THR A CA    
2437 C  C     . THR A 317 ? 0.4329 0.3618 0.3754 0.0150  0.0202  -0.0054 423 THR A C     
2438 O  O     . THR A 317 ? 0.4776 0.4025 0.4155 0.0157  0.0193  -0.0056 423 THR A O     
2439 C  CB    . THR A 317 ? 0.4550 0.3878 0.4042 0.0143  0.0254  -0.0057 423 THR A CB    
2440 O  OG1   . THR A 317 ? 0.4563 0.3842 0.3990 0.0134  0.0254  -0.0039 423 THR A OG1   
2441 C  CG2   . THR A 317 ? 0.4472 0.3826 0.4018 0.0147  0.0290  -0.0074 423 THR A CG2   
2442 N  N     . ASP A 318 ? 0.3962 0.3269 0.3386 0.0136  0.0183  -0.0038 424 ASP A N     
2443 C  CA    . ASP A 318 ? 0.4227 0.3506 0.3594 0.0125  0.0152  -0.0020 424 ASP A CA    
2444 C  C     . ASP A 318 ? 0.4568 0.3793 0.3867 0.0118  0.0150  -0.0005 424 ASP A C     
2445 O  O     . ASP A 318 ? 0.4873 0.4066 0.4119 0.0110  0.0125  0.0006  424 ASP A O     
2446 C  CB    . ASP A 318 ? 0.3941 0.3251 0.3321 0.0108  0.0137  -0.0006 424 ASP A CB    
2447 C  CG    . ASP A 318 ? 0.4026 0.3380 0.3454 0.0111  0.0127  -0.0017 424 ASP A CG    
2448 O  OD1   . ASP A 318 ? 0.3789 0.3155 0.3248 0.0128  0.0133  -0.0038 424 ASP A OD1   
2449 O  OD2   . ASP A 318 ? 0.3710 0.3091 0.3147 0.0097  0.0115  -0.0005 424 ASP A OD2   
2450 N  N     . ASN A 319 ? 0.4946 0.4160 0.4246 0.0118  0.0177  -0.0003 425 ASN A N     
2451 C  CA    . ASN A 319 ? 0.5238 0.4400 0.4477 0.0114  0.0181  0.0007  425 ASN A CA    
2452 C  C     . ASN A 319 ? 0.5147 0.4263 0.4337 0.0123  0.0171  0.0001  425 ASN A C     
2453 O  O     . ASN A 319 ? 0.5068 0.4139 0.4195 0.0115  0.0158  0.0016  425 ASN A O     
2454 C  CB    . ASN A 319 ? 0.5507 0.4664 0.4762 0.0118  0.0217  0.0001  425 ASN A CB    
2455 C  CG    . ASN A 319 ? 0.6284 0.5385 0.5474 0.0113  0.0222  0.0014  425 ASN A CG    
2456 O  OD1   . ASN A 319 ? 0.6355 0.5440 0.5509 0.0098  0.0206  0.0036  425 ASN A OD1   
2457 N  ND2   . ASN A 319 ? 0.5988 0.5058 0.5160 0.0124  0.0243  0.0001  425 ASN A ND2   
2458 N  N     . ILE A 320 ? 0.4965 0.4094 0.4186 0.0141  0.0177  -0.0020 426 ILE A N     
2459 C  CA    . ILE A 320 ? 0.5117 0.4206 0.4298 0.0154  0.0166  -0.0029 426 ILE A CA    
2460 C  C     . ILE A 320 ? 0.4912 0.3967 0.4031 0.0144  0.0129  -0.0013 426 ILE A C     
2461 O  O     . ILE A 320 ? 0.4797 0.3801 0.3859 0.0147  0.0121  -0.0011 426 ILE A O     
2462 C  CB    . ILE A 320 ? 0.5619 0.4739 0.4853 0.0176  0.0172  -0.0056 426 ILE A CB    
2463 C  CG1   . ILE A 320 ? 0.6004 0.5089 0.5214 0.0195  0.0179  -0.0073 426 ILE A CG1   
2464 C  CG2   . ILE A 320 ? 0.5796 0.4938 0.5045 0.0177  0.0142  -0.0059 426 ILE A CG2   
2465 C  CD1   . ILE A 320 ? 0.6299 0.5378 0.5518 0.0198  0.0218