data_6TXA
# 
_entry.id   6TXA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6TXA         
WWPDB D_1292106210 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        '6TX0 contains same protein complexed with different nucleotide analogue' 
_pdbx_database_related.db_id          6TX0 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6TXA 
_pdbx_database_status.recvd_initial_deposition_date   2020-01-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Morris, E.R.'   1 0000-0003-1893-7515 
'Kunzelmann, S.' 2 0000-0002-2678-0549 
'Caswell, S.J.'  3 0000-0003-1590-2106 
'Arnold, L.H.'   4 0000-0001-6785-1035 
'Purkiss, A.'    5 0000-0002-5931-3509 
'Kelly, G.'      6 0000-0002-1149-0717 
'Taylor, I.A.'   7 0000-0002-6763-3852 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            11 
_citation.language                  ? 
_citation.page_first                3165 
_citation.page_last                 3165 
_citation.title                     
'Crystal structures of SAMHD1 inhibitor complexes reveal the mechanism of water-mediated dNTP hydrolysis.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-020-16983-2 
_citation.pdbx_database_id_PubMed   32576829 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Morris, E.R.'   1 ? 
primary 'Caswell, S.J.'  2 ? 
primary 'Kunzelmann, S.' 3 ? 
primary 'Arnold, L.H.'   4 ? 
primary 'Purkiss, A.G.'  5 ? 
primary 'Kelly, G.'      6 ? 
primary 'Taylor, I.A.'   7 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   95.200 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6TXA 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     97.782 
_cell.length_a_esd                 ? 
_cell.length_b                     172.897 
_cell.length_b_esd                 ? 
_cell.length_c                     275.886 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        32 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6TXA 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Deoxynucleoside triphosphate triphosphohydrolase SAMHD1' 60207.816 16 3.1.5.- D137N ? ? 
2 non-polymer syn 'FE (III) ION' 55.845    16 ?       ?     ? ? 
3 non-polymer syn 'MAGNESIUM ION' 24.305    48 ?       ?     ? ? 
4 non-polymer syn "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]guanosine" 506.196   32 ? ? ? 
? 
5 non-polymer syn 
;[[(2~{R},3~{S},4~{R},5~{R})-5-[2,6-bis(oxidanylidene)-3~{H}-purin-9-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate
;
524.165   16 ?       ?     ? ? 
6 non-polymer syn 'SULFATE ION' 96.063    15 ?       ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;dNTPase,Dendritic cell-derived IFNG-induced protein,DCIP,Monocyte protein 5,MOP-5,SAM domain and HD domain-containing protein 1,hSAMHD1
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSQIHVDTMKVINDPIHGHIELHPLLVRIINTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVHALGEKQ
PELQISERDVLCVQIAGLCHDLGHGPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGIKPVMEQYGLIPEEDIC
FIKEQIVGPLESPVEDSLWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKFARVCEVDNE
LRICARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGGKKYRISTAIDDMEAYTKLTDNI
FLEILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKREDYESLPKEVASAKPKVLLDVKLKAEDFIVDVINMD
YGMQEKNPIDHVSFYCKTAPNRAIRITKNQVSQLLPEKFAEQLIRVYCKKVDRKSLYAARQYFVQWCADRNFTKPQDGDV
IAPLITPQKKEWNDSTSVQNPTRLREASKSRVQLFKDDPM
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSQIHVDTMKVINDPIHGHIELHPLLVRIINTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVHALGEKQ
PELQISERDVLCVQIAGLCHDLGHGPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGIKPVMEQYGLIPEEDIC
FIKEQIVGPLESPVEDSLWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKFARVCEVDNE
LRICARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGGKKYRISTAIDDMEAYTKLTDNI
FLEILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKREDYESLPKEVASAKPKVLLDVKLKAEDFIVDVINMD
YGMQEKNPIDHVSFYCKTAPNRAIRITKNQVSQLLPEKFAEQLIRVYCKKVDRKSLYAARQYFVQWCADRNFTKPQDGDV
IAPLITPQKKEWNDSTSVQNPTRLREASKSRVQLFKDDPM
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   GLN n 
1 4   ILE n 
1 5   HIS n 
1 6   VAL n 
1 7   ASP n 
1 8   THR n 
1 9   MET n 
1 10  LYS n 
1 11  VAL n 
1 12  ILE n 
1 13  ASN n 
1 14  ASP n 
1 15  PRO n 
1 16  ILE n 
1 17  HIS n 
1 18  GLY n 
1 19  HIS n 
1 20  ILE n 
1 21  GLU n 
1 22  LEU n 
1 23  HIS n 
1 24  PRO n 
1 25  LEU n 
1 26  LEU n 
1 27  VAL n 
1 28  ARG n 
1 29  ILE n 
1 30  ILE n 
1 31  ASN n 
1 32  THR n 
1 33  PRO n 
1 34  GLN n 
1 35  PHE n 
1 36  GLN n 
1 37  ARG n 
1 38  LEU n 
1 39  ARG n 
1 40  TYR n 
1 41  ILE n 
1 42  LYS n 
1 43  GLN n 
1 44  LEU n 
1 45  GLY n 
1 46  GLY n 
1 47  GLY n 
1 48  TYR n 
1 49  TYR n 
1 50  VAL n 
1 51  PHE n 
1 52  PRO n 
1 53  GLY n 
1 54  ALA n 
1 55  SER n 
1 56  HIS n 
1 57  ASN n 
1 58  ARG n 
1 59  PHE n 
1 60  GLU n 
1 61  HIS n 
1 62  SER n 
1 63  LEU n 
1 64  GLY n 
1 65  VAL n 
1 66  GLY n 
1 67  TYR n 
1 68  LEU n 
1 69  ALA n 
1 70  GLY n 
1 71  CYS n 
1 72  LEU n 
1 73  VAL n 
1 74  HIS n 
1 75  ALA n 
1 76  LEU n 
1 77  GLY n 
1 78  GLU n 
1 79  LYS n 
1 80  GLN n 
1 81  PRO n 
1 82  GLU n 
1 83  LEU n 
1 84  GLN n 
1 85  ILE n 
1 86  SER n 
1 87  GLU n 
1 88  ARG n 
1 89  ASP n 
1 90  VAL n 
1 91  LEU n 
1 92  CYS n 
1 93  VAL n 
1 94  GLN n 
1 95  ILE n 
1 96  ALA n 
1 97  GLY n 
1 98  LEU n 
1 99  CYS n 
1 100 HIS n 
1 101 ASP n 
1 102 LEU n 
1 103 GLY n 
1 104 HIS n 
1 105 GLY n 
1 106 PRO n 
1 107 PHE n 
1 108 SER n 
1 109 HIS n 
1 110 MET n 
1 111 PHE n 
1 112 ASP n 
1 113 GLY n 
1 114 ARG n 
1 115 PHE n 
1 116 ILE n 
1 117 PRO n 
1 118 LEU n 
1 119 ALA n 
1 120 ARG n 
1 121 PRO n 
1 122 GLU n 
1 123 VAL n 
1 124 LYS n 
1 125 TRP n 
1 126 THR n 
1 127 HIS n 
1 128 GLU n 
1 129 GLN n 
1 130 GLY n 
1 131 SER n 
1 132 VAL n 
1 133 MET n 
1 134 MET n 
1 135 PHE n 
1 136 GLU n 
1 137 HIS n 
1 138 LEU n 
1 139 ILE n 
1 140 ASN n 
1 141 SER n 
1 142 ASN n 
1 143 GLY n 
1 144 ILE n 
1 145 LYS n 
1 146 PRO n 
1 147 VAL n 
1 148 MET n 
1 149 GLU n 
1 150 GLN n 
1 151 TYR n 
1 152 GLY n 
1 153 LEU n 
1 154 ILE n 
1 155 PRO n 
1 156 GLU n 
1 157 GLU n 
1 158 ASP n 
1 159 ILE n 
1 160 CYS n 
1 161 PHE n 
1 162 ILE n 
1 163 LYS n 
1 164 GLU n 
1 165 GLN n 
1 166 ILE n 
1 167 VAL n 
1 168 GLY n 
1 169 PRO n 
1 170 LEU n 
1 171 GLU n 
1 172 SER n 
1 173 PRO n 
1 174 VAL n 
1 175 GLU n 
1 176 ASP n 
1 177 SER n 
1 178 LEU n 
1 179 TRP n 
1 180 PRO n 
1 181 TYR n 
1 182 LYS n 
1 183 GLY n 
1 184 ARG n 
1 185 PRO n 
1 186 GLU n 
1 187 ASN n 
1 188 LYS n 
1 189 SER n 
1 190 PHE n 
1 191 LEU n 
1 192 TYR n 
1 193 GLU n 
1 194 ILE n 
1 195 VAL n 
1 196 SER n 
1 197 ASN n 
1 198 LYS n 
1 199 ARG n 
1 200 ASN n 
1 201 GLY n 
1 202 ILE n 
1 203 ASP n 
1 204 VAL n 
1 205 ASP n 
1 206 LYS n 
1 207 TRP n 
1 208 ASP n 
1 209 TYR n 
1 210 PHE n 
1 211 ALA n 
1 212 ARG n 
1 213 ASP n 
1 214 CYS n 
1 215 HIS n 
1 216 HIS n 
1 217 LEU n 
1 218 GLY n 
1 219 ILE n 
1 220 GLN n 
1 221 ASN n 
1 222 ASN n 
1 223 PHE n 
1 224 ASP n 
1 225 TYR n 
1 226 LYS n 
1 227 ARG n 
1 228 PHE n 
1 229 ILE n 
1 230 LYS n 
1 231 PHE n 
1 232 ALA n 
1 233 ARG n 
1 234 VAL n 
1 235 CYS n 
1 236 GLU n 
1 237 VAL n 
1 238 ASP n 
1 239 ASN n 
1 240 GLU n 
1 241 LEU n 
1 242 ARG n 
1 243 ILE n 
1 244 CYS n 
1 245 ALA n 
1 246 ARG n 
1 247 ASP n 
1 248 LYS n 
1 249 GLU n 
1 250 VAL n 
1 251 GLY n 
1 252 ASN n 
1 253 LEU n 
1 254 TYR n 
1 255 ASP n 
1 256 MET n 
1 257 PHE n 
1 258 HIS n 
1 259 THR n 
1 260 ARG n 
1 261 ASN n 
1 262 SER n 
1 263 LEU n 
1 264 HIS n 
1 265 ARG n 
1 266 ARG n 
1 267 ALA n 
1 268 TYR n 
1 269 GLN n 
1 270 HIS n 
1 271 LYS n 
1 272 VAL n 
1 273 GLY n 
1 274 ASN n 
1 275 ILE n 
1 276 ILE n 
1 277 ASP n 
1 278 THR n 
1 279 MET n 
1 280 ILE n 
1 281 THR n 
1 282 ASP n 
1 283 ALA n 
1 284 PHE n 
1 285 LEU n 
1 286 LYS n 
1 287 ALA n 
1 288 ASP n 
1 289 ASP n 
1 290 TYR n 
1 291 ILE n 
1 292 GLU n 
1 293 ILE n 
1 294 THR n 
1 295 GLY n 
1 296 ALA n 
1 297 GLY n 
1 298 GLY n 
1 299 LYS n 
1 300 LYS n 
1 301 TYR n 
1 302 ARG n 
1 303 ILE n 
1 304 SER n 
1 305 THR n 
1 306 ALA n 
1 307 ILE n 
1 308 ASP n 
1 309 ASP n 
1 310 MET n 
1 311 GLU n 
1 312 ALA n 
1 313 TYR n 
1 314 THR n 
1 315 LYS n 
1 316 LEU n 
1 317 THR n 
1 318 ASP n 
1 319 ASN n 
1 320 ILE n 
1 321 PHE n 
1 322 LEU n 
1 323 GLU n 
1 324 ILE n 
1 325 LEU n 
1 326 TYR n 
1 327 SER n 
1 328 THR n 
1 329 ASP n 
1 330 PRO n 
1 331 LYS n 
1 332 LEU n 
1 333 LYS n 
1 334 ASP n 
1 335 ALA n 
1 336 ARG n 
1 337 GLU n 
1 338 ILE n 
1 339 LEU n 
1 340 LYS n 
1 341 GLN n 
1 342 ILE n 
1 343 GLU n 
1 344 TYR n 
1 345 ARG n 
1 346 ASN n 
1 347 LEU n 
1 348 PHE n 
1 349 LYS n 
1 350 TYR n 
1 351 VAL n 
1 352 GLY n 
1 353 GLU n 
1 354 THR n 
1 355 GLN n 
1 356 PRO n 
1 357 THR n 
1 358 GLY n 
1 359 GLN n 
1 360 ILE n 
1 361 LYS n 
1 362 ILE n 
1 363 LYS n 
1 364 ARG n 
1 365 GLU n 
1 366 ASP n 
1 367 TYR n 
1 368 GLU n 
1 369 SER n 
1 370 LEU n 
1 371 PRO n 
1 372 LYS n 
1 373 GLU n 
1 374 VAL n 
1 375 ALA n 
1 376 SER n 
1 377 ALA n 
1 378 LYS n 
1 379 PRO n 
1 380 LYS n 
1 381 VAL n 
1 382 LEU n 
1 383 LEU n 
1 384 ASP n 
1 385 VAL n 
1 386 LYS n 
1 387 LEU n 
1 388 LYS n 
1 389 ALA n 
1 390 GLU n 
1 391 ASP n 
1 392 PHE n 
1 393 ILE n 
1 394 VAL n 
1 395 ASP n 
1 396 VAL n 
1 397 ILE n 
1 398 ASN n 
1 399 MET n 
1 400 ASP n 
1 401 TYR n 
1 402 GLY n 
1 403 MET n 
1 404 GLN n 
1 405 GLU n 
1 406 LYS n 
1 407 ASN n 
1 408 PRO n 
1 409 ILE n 
1 410 ASP n 
1 411 HIS n 
1 412 VAL n 
1 413 SER n 
1 414 PHE n 
1 415 TYR n 
1 416 CYS n 
1 417 LYS n 
1 418 THR n 
1 419 ALA n 
1 420 PRO n 
1 421 ASN n 
1 422 ARG n 
1 423 ALA n 
1 424 ILE n 
1 425 ARG n 
1 426 ILE n 
1 427 THR n 
1 428 LYS n 
1 429 ASN n 
1 430 GLN n 
1 431 VAL n 
1 432 SER n 
1 433 GLN n 
1 434 LEU n 
1 435 LEU n 
1 436 PRO n 
1 437 GLU n 
1 438 LYS n 
1 439 PHE n 
1 440 ALA n 
1 441 GLU n 
1 442 GLN n 
1 443 LEU n 
1 444 ILE n 
1 445 ARG n 
1 446 VAL n 
1 447 TYR n 
1 448 CYS n 
1 449 LYS n 
1 450 LYS n 
1 451 VAL n 
1 452 ASP n 
1 453 ARG n 
1 454 LYS n 
1 455 SER n 
1 456 LEU n 
1 457 TYR n 
1 458 ALA n 
1 459 ALA n 
1 460 ARG n 
1 461 GLN n 
1 462 TYR n 
1 463 PHE n 
1 464 VAL n 
1 465 GLN n 
1 466 TRP n 
1 467 CYS n 
1 468 ALA n 
1 469 ASP n 
1 470 ARG n 
1 471 ASN n 
1 472 PHE n 
1 473 THR n 
1 474 LYS n 
1 475 PRO n 
1 476 GLN n 
1 477 ASP n 
1 478 GLY n 
1 479 ASP n 
1 480 VAL n 
1 481 ILE n 
1 482 ALA n 
1 483 PRO n 
1 484 LEU n 
1 485 ILE n 
1 486 THR n 
1 487 PRO n 
1 488 GLN n 
1 489 LYS n 
1 490 LYS n 
1 491 GLU n 
1 492 TRP n 
1 493 ASN n 
1 494 ASP n 
1 495 SER n 
1 496 THR n 
1 497 SER n 
1 498 VAL n 
1 499 GLN n 
1 500 ASN n 
1 501 PRO n 
1 502 THR n 
1 503 ARG n 
1 504 LEU n 
1 505 ARG n 
1 506 GLU n 
1 507 ALA n 
1 508 SER n 
1 509 LYS n 
1 510 SER n 
1 511 ARG n 
1 512 VAL n 
1 513 GLN n 
1 514 LEU n 
1 515 PHE n 
1 516 LYS n 
1 517 ASP n 
1 518 ASP n 
1 519 PRO n 
1 520 MET n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   520 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'SAMHD1, MOP5' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              Rosetta2 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SAMH1_HUMAN 
_struct_ref.pdbx_db_accession          Q9Y3Z3 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;QIHVDTMKVINDPIHGHIELHPLLVRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVHALGEKQPE
LQISERDVLCVQIAGLCHDLGHGPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGIKPVMEQYGLIPEEDICFI
KEQIVGPLESPVEDSLWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKFARVCEVDNELR
ICARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGGKKYRISTAIDDMEAYTKLTDNIFL
EILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKREDYESLPKEVASAKPKVLLDVKLKAEDFIVDVINMDYG
MQEKNPIDHVSFYCKTAPNRAIRITKNQVSQLLPEKFAEQLIRVYCKKVDRKSLYAARQYFVQWCADRNFTKPQDGDVIA
PLITPQKKEWNDSTSVQNPTRLREASKSRVQLFKDDPM
;
_struct_ref.pdbx_align_begin           109 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6TXA A 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
2  1 6TXA B 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
3  1 6TXA C 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
4  1 6TXA D 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
5  1 6TXA E 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
6  1 6TXA F 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
7  1 6TXA G 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
8  1 6TXA H 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
9  1 6TXA I 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
10 1 6TXA J 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
11 1 6TXA K 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
12 1 6TXA L 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
13 1 6TXA M 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
14 1 6TXA N 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
15 1 6TXA O 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
16 1 6TXA P 3 ? 520 ? Q9Y3Z3 109 ? 626 ? 109 626 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  6TXA GLY A 1  ? UNP Q9Y3Z3 ?   ?   'expression tag'      107 1  
1  6TXA SER A 2  ? UNP Q9Y3Z3 ?   ?   'expression tag'      108 2  
1  6TXA ASN A 31 ? UNP Q9Y3Z3 ASP 137 'engineered mutation' 137 3  
2  6TXA GLY B 1  ? UNP Q9Y3Z3 ?   ?   'expression tag'      107 4  
2  6TXA SER B 2  ? UNP Q9Y3Z3 ?   ?   'expression tag'      108 5  
2  6TXA ASN B 31 ? UNP Q9Y3Z3 ASP 137 'engineered mutation' 137 6  
3  6TXA GLY C 1  ? UNP Q9Y3Z3 ?   ?   'expression tag'      107 7  
3  6TXA SER C 2  ? UNP Q9Y3Z3 ?   ?   'expression tag'      108 8  
3  6TXA ASN C 31 ? UNP Q9Y3Z3 ASP 137 'engineered mutation' 137 9  
4  6TXA GLY D 1  ? UNP Q9Y3Z3 ?   ?   'expression tag'      107 10 
4  6TXA SER D 2  ? UNP Q9Y3Z3 ?   ?   'expression tag'      108 11 
4  6TXA ASN D 31 ? UNP Q9Y3Z3 ASP 137 'engineered mutation' 137 12 
5  6TXA GLY E 1  ? UNP Q9Y3Z3 ?   ?   'expression tag'      107 13 
5  6TXA SER E 2  ? UNP Q9Y3Z3 ?   ?   'expression tag'      108 14 
5  6TXA ASN E 31 ? UNP Q9Y3Z3 ASP 137 'engineered mutation' 137 15 
6  6TXA GLY F 1  ? UNP Q9Y3Z3 ?   ?   'expression tag'      107 16 
6  6TXA SER F 2  ? UNP Q9Y3Z3 ?   ?   'expression tag'      108 17 
6  6TXA ASN F 31 ? UNP Q9Y3Z3 ASP 137 'engineered mutation' 137 18 
7  6TXA GLY G 1  ? UNP Q9Y3Z3 ?   ?   'expression tag'      107 19 
7  6TXA SER G 2  ? UNP Q9Y3Z3 ?   ?   'expression tag'      108 20 
7  6TXA ASN G 31 ? UNP Q9Y3Z3 ASP 137 'engineered mutation' 137 21 
8  6TXA GLY H 1  ? UNP Q9Y3Z3 ?   ?   'expression tag'      107 22 
8  6TXA SER H 2  ? UNP Q9Y3Z3 ?   ?   'expression tag'      108 23 
8  6TXA ASN H 31 ? UNP Q9Y3Z3 ASP 137 'engineered mutation' 137 24 
9  6TXA GLY I 1  ? UNP Q9Y3Z3 ?   ?   'expression tag'      107 25 
9  6TXA SER I 2  ? UNP Q9Y3Z3 ?   ?   'expression tag'      108 26 
9  6TXA ASN I 31 ? UNP Q9Y3Z3 ASP 137 'engineered mutation' 137 27 
10 6TXA GLY J 1  ? UNP Q9Y3Z3 ?   ?   'expression tag'      107 28 
10 6TXA SER J 2  ? UNP Q9Y3Z3 ?   ?   'expression tag'      108 29 
10 6TXA ASN J 31 ? UNP Q9Y3Z3 ASP 137 'engineered mutation' 137 30 
11 6TXA GLY K 1  ? UNP Q9Y3Z3 ?   ?   'expression tag'      107 31 
11 6TXA SER K 2  ? UNP Q9Y3Z3 ?   ?   'expression tag'      108 32 
11 6TXA ASN K 31 ? UNP Q9Y3Z3 ASP 137 'engineered mutation' 137 33 
12 6TXA GLY L 1  ? UNP Q9Y3Z3 ?   ?   'expression tag'      107 34 
12 6TXA SER L 2  ? UNP Q9Y3Z3 ?   ?   'expression tag'      108 35 
12 6TXA ASN L 31 ? UNP Q9Y3Z3 ASP 137 'engineered mutation' 137 36 
13 6TXA GLY M 1  ? UNP Q9Y3Z3 ?   ?   'expression tag'      107 37 
13 6TXA SER M 2  ? UNP Q9Y3Z3 ?   ?   'expression tag'      108 38 
13 6TXA ASN M 31 ? UNP Q9Y3Z3 ASP 137 'engineered mutation' 137 39 
14 6TXA GLY N 1  ? UNP Q9Y3Z3 ?   ?   'expression tag'      107 40 
14 6TXA SER N 2  ? UNP Q9Y3Z3 ?   ?   'expression tag'      108 41 
14 6TXA ASN N 31 ? UNP Q9Y3Z3 ASP 137 'engineered mutation' 137 42 
15 6TXA GLY O 1  ? UNP Q9Y3Z3 ?   ?   'expression tag'      107 43 
15 6TXA SER O 2  ? UNP Q9Y3Z3 ?   ?   'expression tag'      108 44 
15 6TXA ASN O 31 ? UNP Q9Y3Z3 ASP 137 'engineered mutation' 137 45 
16 6TXA GLY P 1  ? UNP Q9Y3Z3 ?   ?   'expression tag'      107 46 
16 6TXA SER P 2  ? UNP Q9Y3Z3 ?   ?   'expression tag'      108 47 
16 6TXA ASN P 31 ? UNP Q9Y3Z3 ASP 137 'engineered mutation' 137 48 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'      121.158 
CZF non-polymer         . 
;[[(2~{R},3~{S},4~{R},5~{R})-5-[2,6-bis(oxidanylidene)-3~{H}-purin-9-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate
;
? 'C10 H15 N4 O15 P3' 524.165 
FE  non-polymer         . 'FE (III) ION' ? 'Fe 3'              55.845  
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION' ? 'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'       117.146 
XG4 non-polymer         . "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]guanosine" ? 
'C10 H17 N6 O12 P3' 506.196 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6TXA 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.41 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         49.09 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M Bistris methane-HCl pH 6, 15% (w/v) PEG 3350, 0.15 M Li2SO4.' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 S 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-02-09 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.96861 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I24' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.96861 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I24 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            49.5 
_reflns.entry_id                         6TXA 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.85 
_reflns.d_resolution_low                 146.334 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       140978 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             94.3 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.500 
_reflns.pdbx_Rmerge_I_obs                0.186 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            4 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.220 
_reflns.pdbx_Rpim_I_all                  0.117 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.980 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_CC_star 
_reflns_shell.pdbx_R_split 
2.853 3.201   ? 1.5  ? ? ? ? 7049 67.3 ? ? ? ? 0.577 ? ? ? ? ? ? ? ? 3.4 ? ? ? ? 0.684 0.364 ? 1 1 0.729 ? ? 
8.918 146.334 ? 10.4 ? ? ? ? 7047 99.3 ? ? ? ? 0.049 ? ? ? ? ? ? ? ? 3.3 ? ? ? ? 0.058 0.031 ? 2 1 0.996 ? ? 
# 
_refine.aniso_B[1][1]                            -0.2400 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.4600 
_refine.aniso_B[2][2]                            -0.5300 
_refine.aniso_B[2][3]                            -0.0000 
_refine.aniso_B[3][3]                            0.8400 
_refine.B_iso_max                                175.010 
_refine.B_iso_mean                               54.9950 
_refine.B_iso_min                                10.180 
_refine.correlation_coeff_Fo_to_Fc               0.9110 
_refine.correlation_coeff_Fo_to_Fc_free          0.8930 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : WITH TLS ADDED' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6TXA 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.853 
_refine.ls_d_res_low                             146.243 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     133948 
_refine.ls_number_reflns_R_free                  7029 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    66.4400 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1953 
_refine.ls_R_factor_R_free                       0.2118 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1944 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      6TX0 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.4830 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             49.7240 
_refine.overall_SU_ML                            0.3840 
_refine.overall_SU_R_Cruickshank_DPI             0.4486 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.853 
_refine_hist.d_res_low                        146.243 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               62976 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       7666 
_refine_hist.pdbx_B_iso_mean_ligand           34.38 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        61333 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1643 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.011  0.019  64483  ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  57620  ? r_bond_other_d         ? ? 
'X-RAY DIFFRACTION' ? 1.535  1.951  87789  ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 1.034  2.989  133487 ? r_angle_other_deg      ? ? 
'X-RAY DIFFRACTION' ? 5.143  5.000  7635   ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 35.776 23.977 3118   ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 13.656 15.000 10532  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 14.913 15.000 403    ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.085  0.200  9495   ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.007  0.021  71105  ? r_gen_planes_refined   ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  13246  ? r_gen_planes_other     ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
_refine_ls_restr_ncs.pdbx_ens_id 
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 1   'interatomic distance' ? A 32026 ? ? 1   
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 2   'interatomic distance' ? B 32026 ? ? 1   
'X-RAY DIFFRACTION' 1 ? ? 0.050 ? 0.050 3   'interatomic distance' ? A 31882 ? ? 2   
'X-RAY DIFFRACTION' 2 ? ? 0.050 ? 0.050 4   'interatomic distance' ? C 31882 ? ? 2   
'X-RAY DIFFRACTION' 1 ? ? 0.050 ? 0.050 5   'interatomic distance' ? A 31882 ? ? 3   
'X-RAY DIFFRACTION' 2 ? ? 0.050 ? 0.050 6   'interatomic distance' ? D 31882 ? ? 3   
'X-RAY DIFFRACTION' 1 ? ? 0.050 ? 0.050 7   'interatomic distance' ? A 31962 ? ? 4   
'X-RAY DIFFRACTION' 2 ? ? 0.050 ? 0.050 8   'interatomic distance' ? E 31962 ? ? 4   
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 9   'interatomic distance' ? A 31858 ? ? 5   
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 10  'interatomic distance' ? F 31858 ? ? 5   
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 11  'interatomic distance' ? A 31688 ? ? 6   
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 12  'interatomic distance' ? G 31688 ? ? 6   
'X-RAY DIFFRACTION' 1 ? ? 0.050 ? 0.050 13  'interatomic distance' ? A 31980 ? ? 7   
'X-RAY DIFFRACTION' 2 ? ? 0.050 ? 0.050 14  'interatomic distance' ? H 31980 ? ? 7   
'X-RAY DIFFRACTION' 1 ? ? 0.050 ? 0.050 15  'interatomic distance' ? A 31756 ? ? 8   
'X-RAY DIFFRACTION' 2 ? ? 0.050 ? 0.050 16  'interatomic distance' ? I 31756 ? ? 8   
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 17  'interatomic distance' ? A 31690 ? ? 9   
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 18  'interatomic distance' ? J 31690 ? ? 9   
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 19  'interatomic distance' ? A 31920 ? ? 10  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 20  'interatomic distance' ? K 31920 ? ? 10  
'X-RAY DIFFRACTION' 1 ? ? 0.050 ? 0.050 21  'interatomic distance' ? A 31480 ? ? 11  
'X-RAY DIFFRACTION' 2 ? ? 0.050 ? 0.050 22  'interatomic distance' ? L 31480 ? ? 11  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 23  'interatomic distance' ? A 31534 ? ? 12  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 24  'interatomic distance' ? M 31534 ? ? 12  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 25  'interatomic distance' ? A 31774 ? ? 13  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 26  'interatomic distance' ? N 31774 ? ? 13  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 27  'interatomic distance' ? A 31732 ? ? 14  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 28  'interatomic distance' ? O 31732 ? ? 14  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 29  'interatomic distance' ? A 31778 ? ? 15  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 30  'interatomic distance' ? P 31778 ? ? 15  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 31  'interatomic distance' ? B 31858 ? ? 16  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 32  'interatomic distance' ? C 31858 ? ? 16  
'X-RAY DIFFRACTION' 1 ? ? 0.050 ? 0.050 33  'interatomic distance' ? B 31858 ? ? 17  
'X-RAY DIFFRACTION' 2 ? ? 0.050 ? 0.050 34  'interatomic distance' ? D 31858 ? ? 17  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 35  'interatomic distance' ? B 32038 ? ? 18  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 36  'interatomic distance' ? E 32038 ? ? 18  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 37  'interatomic distance' ? B 31586 ? ? 19  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 38  'interatomic distance' ? F 31586 ? ? 19  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 39  'interatomic distance' ? B 31796 ? ? 20  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 40  'interatomic distance' ? G 31796 ? ? 20  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 41  'interatomic distance' ? B 31982 ? ? 21  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 42  'interatomic distance' ? H 31982 ? ? 21  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 43  'interatomic distance' ? B 31874 ? ? 22  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 44  'interatomic distance' ? I 31874 ? ? 22  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 45  'interatomic distance' ? B 31666 ? ? 23  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 46  'interatomic distance' ? J 31666 ? ? 23  
'X-RAY DIFFRACTION' 1 ? ? 0.050 ? 0.050 47  'interatomic distance' ? B 31722 ? ? 24  
'X-RAY DIFFRACTION' 2 ? ? 0.050 ? 0.050 48  'interatomic distance' ? K 31722 ? ? 24  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 49  'interatomic distance' ? B 31486 ? ? 25  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 50  'interatomic distance' ? L 31486 ? ? 25  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 51  'interatomic distance' ? B 31560 ? ? 26  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 52  'interatomic distance' ? M 31560 ? ? 26  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 53  'interatomic distance' ? B 31772 ? ? 27  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 54  'interatomic distance' ? N 31772 ? ? 27  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 55  'interatomic distance' ? B 31818 ? ? 28  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 56  'interatomic distance' ? O 31818 ? ? 28  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 57  'interatomic distance' ? B 31514 ? ? 29  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 58  'interatomic distance' ? P 31514 ? ? 29  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 59  'interatomic distance' ? C 31784 ? ? 30  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 60  'interatomic distance' ? D 31784 ? ? 30  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 61  'interatomic distance' ? C 31958 ? ? 31  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 62  'interatomic distance' ? E 31958 ? ? 31  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 63  'interatomic distance' ? C 31686 ? ? 32  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 64  'interatomic distance' ? F 31686 ? ? 32  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 65  'interatomic distance' ? C 31602 ? ? 33  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 66  'interatomic distance' ? G 31602 ? ? 33  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 67  'interatomic distance' ? C 32032 ? ? 34  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 68  'interatomic distance' ? H 32032 ? ? 34  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 69  'interatomic distance' ? C 31970 ? ? 35  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 70  'interatomic distance' ? I 31970 ? ? 35  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 71  'interatomic distance' ? C 31796 ? ? 36  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 72  'interatomic distance' ? J 31796 ? ? 36  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 73  'interatomic distance' ? C 31912 ? ? 37  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 74  'interatomic distance' ? K 31912 ? ? 37  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 75  'interatomic distance' ? C 31584 ? ? 38  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 76  'interatomic distance' ? L 31584 ? ? 38  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 77  'interatomic distance' ? C 31630 ? ? 39  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 78  'interatomic distance' ? M 31630 ? ? 39  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 79  'interatomic distance' ? C 31802 ? ? 40  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 80  'interatomic distance' ? N 31802 ? ? 40  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 81  'interatomic distance' ? C 31714 ? ? 41  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 82  'interatomic distance' ? O 31714 ? ? 41  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 83  'interatomic distance' ? C 31620 ? ? 42  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 84  'interatomic distance' ? P 31620 ? ? 42  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 85  'interatomic distance' ? D 31932 ? ? 43  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 86  'interatomic distance' ? E 31932 ? ? 43  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 87  'interatomic distance' ? D 31714 ? ? 44  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 88  'interatomic distance' ? F 31714 ? ? 44  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 89  'interatomic distance' ? D 31850 ? ? 45  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 90  'interatomic distance' ? G 31850 ? ? 45  
'X-RAY DIFFRACTION' 1 ? ? 0.050 ? 0.050 91  'interatomic distance' ? D 31940 ? ? 46  
'X-RAY DIFFRACTION' 2 ? ? 0.050 ? 0.050 92  'interatomic distance' ? H 31940 ? ? 46  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 93  'interatomic distance' ? D 31864 ? ? 47  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 94  'interatomic distance' ? I 31864 ? ? 47  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 95  'interatomic distance' ? D 31826 ? ? 48  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 96  'interatomic distance' ? J 31826 ? ? 48  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 97  'interatomic distance' ? D 31782 ? ? 49  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 98  'interatomic distance' ? K 31782 ? ? 49  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 99  'interatomic distance' ? D 31632 ? ? 50  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 100 'interatomic distance' ? L 31632 ? ? 50  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 101 'interatomic distance' ? D 31766 ? ? 51  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 102 'interatomic distance' ? M 31766 ? ? 51  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 103 'interatomic distance' ? D 31688 ? ? 52  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 104 'interatomic distance' ? N 31688 ? ? 52  
'X-RAY DIFFRACTION' 1 ? ? 0.050 ? 0.050 105 'interatomic distance' ? D 31816 ? ? 53  
'X-RAY DIFFRACTION' 2 ? ? 0.050 ? 0.050 106 'interatomic distance' ? O 31816 ? ? 53  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 107 'interatomic distance' ? D 31620 ? ? 54  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 108 'interatomic distance' ? P 31620 ? ? 54  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 109 'interatomic distance' ? E 31624 ? ? 55  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 110 'interatomic distance' ? F 31624 ? ? 55  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 111 'interatomic distance' ? E 31774 ? ? 56  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 112 'interatomic distance' ? G 31774 ? ? 56  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 113 'interatomic distance' ? E 32042 ? ? 57  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 114 'interatomic distance' ? H 32042 ? ? 57  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 115 'interatomic distance' ? E 31916 ? ? 58  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 116 'interatomic distance' ? I 31916 ? ? 58  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 117 'interatomic distance' ? E 31804 ? ? 59  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 118 'interatomic distance' ? J 31804 ? ? 59  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 119 'interatomic distance' ? E 31852 ? ? 60  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 120 'interatomic distance' ? K 31852 ? ? 60  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 121 'interatomic distance' ? E 31642 ? ? 61  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 122 'interatomic distance' ? L 31642 ? ? 61  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 123 'interatomic distance' ? E 31662 ? ? 62  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 124 'interatomic distance' ? M 31662 ? ? 62  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 125 'interatomic distance' ? E 31876 ? ? 63  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 126 'interatomic distance' ? N 31876 ? ? 63  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 127 'interatomic distance' ? E 31886 ? ? 64  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 128 'interatomic distance' ? O 31886 ? ? 64  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 129 'interatomic distance' ? E 31566 ? ? 65  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 130 'interatomic distance' ? P 31566 ? ? 65  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 131 'interatomic distance' ? F 31826 ? ? 66  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 132 'interatomic distance' ? G 31826 ? ? 66  
'X-RAY DIFFRACTION' 1 ? ? 0.050 ? 0.050 133 'interatomic distance' ? F 31706 ? ? 67  
'X-RAY DIFFRACTION' 2 ? ? 0.050 ? 0.050 134 'interatomic distance' ? H 31706 ? ? 67  
'X-RAY DIFFRACTION' 1 ? ? 0.050 ? 0.050 135 'interatomic distance' ? F 31460 ? ? 68  
'X-RAY DIFFRACTION' 2 ? ? 0.050 ? 0.050 136 'interatomic distance' ? I 31460 ? ? 68  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 137 'interatomic distance' ? F 31696 ? ? 69  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 138 'interatomic distance' ? J 31696 ? ? 69  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 139 'interatomic distance' ? F 31694 ? ? 70  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 140 'interatomic distance' ? K 31694 ? ? 70  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 141 'interatomic distance' ? F 31402 ? ? 71  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 142 'interatomic distance' ? L 31402 ? ? 71  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 143 'interatomic distance' ? F 31578 ? ? 72  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 144 'interatomic distance' ? M 31578 ? ? 72  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 145 'interatomic distance' ? F 31460 ? ? 73  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 146 'interatomic distance' ? N 31460 ? ? 73  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 147 'interatomic distance' ? F 31802 ? ? 74  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 148 'interatomic distance' ? O 31802 ? ? 74  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 149 'interatomic distance' ? F 31748 ? ? 75  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 150 'interatomic distance' ? P 31748 ? ? 75  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 151 'interatomic distance' ? G 31648 ? ? 76  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 152 'interatomic distance' ? H 31648 ? ? 76  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 153 'interatomic distance' ? G 31630 ? ? 77  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 154 'interatomic distance' ? I 31630 ? ? 77  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 155 'interatomic distance' ? G 31668 ? ? 78  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 156 'interatomic distance' ? J 31668 ? ? 78  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 157 'interatomic distance' ? G 31488 ? ? 79  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 158 'interatomic distance' ? K 31488 ? ? 79  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 159 'interatomic distance' ? G 31326 ? ? 80  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 160 'interatomic distance' ? L 31326 ? ? 80  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 161 'interatomic distance' ? G 31632 ? ? 81  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 162 'interatomic distance' ? M 31632 ? ? 81  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 163 'interatomic distance' ? G 31624 ? ? 82  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 164 'interatomic distance' ? N 31624 ? ? 82  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 165 'interatomic distance' ? G 31714 ? ? 83  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 166 'interatomic distance' ? O 31714 ? ? 83  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 167 'interatomic distance' ? G 31690 ? ? 84  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 168 'interatomic distance' ? P 31690 ? ? 84  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 169 'interatomic distance' ? H 31948 ? ? 85  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 170 'interatomic distance' ? I 31948 ? ? 85  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 171 'interatomic distance' ? H 31736 ? ? 86  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 172 'interatomic distance' ? J 31736 ? ? 86  
'X-RAY DIFFRACTION' 1 ? ? 0.050 ? 0.050 173 'interatomic distance' ? H 31864 ? ? 87  
'X-RAY DIFFRACTION' 2 ? ? 0.050 ? 0.050 174 'interatomic distance' ? K 31864 ? ? 87  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 175 'interatomic distance' ? H 31556 ? ? 88  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 176 'interatomic distance' ? L 31556 ? ? 88  
'X-RAY DIFFRACTION' 1 ? ? 0.050 ? 0.050 177 'interatomic distance' ? H 31646 ? ? 89  
'X-RAY DIFFRACTION' 2 ? ? 0.050 ? 0.050 178 'interatomic distance' ? M 31646 ? ? 89  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 179 'interatomic distance' ? H 31920 ? ? 90  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 180 'interatomic distance' ? N 31920 ? ? 90  
'X-RAY DIFFRACTION' 1 ? ? 0.050 ? 0.050 181 'interatomic distance' ? H 31766 ? ? 91  
'X-RAY DIFFRACTION' 2 ? ? 0.050 ? 0.050 182 'interatomic distance' ? O 31766 ? ? 91  
'X-RAY DIFFRACTION' 1 ? ? 0.050 ? 0.050 183 'interatomic distance' ? H 31650 ? ? 92  
'X-RAY DIFFRACTION' 2 ? ? 0.050 ? 0.050 184 'interatomic distance' ? P 31650 ? ? 92  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 185 'interatomic distance' ? I 31698 ? ? 93  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 186 'interatomic distance' ? J 31698 ? ? 93  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 187 'interatomic distance' ? I 31726 ? ? 94  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 188 'interatomic distance' ? K 31726 ? ? 94  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 189 'interatomic distance' ? I 31690 ? ? 95  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 190 'interatomic distance' ? L 31690 ? ? 95  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 191 'interatomic distance' ? I 31734 ? ? 96  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 192 'interatomic distance' ? M 31734 ? ? 96  
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 193 'interatomic distance' ? I 31846 ? ? 97  
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 194 'interatomic distance' ? N 31846 ? ? 97  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 195 'interatomic distance' ? I 31804 ? ? 98  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 196 'interatomic distance' ? O 31804 ? ? 98  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 197 'interatomic distance' ? I 31410 ? ? 99  
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 198 'interatomic distance' ? P 31410 ? ? 99  
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 199 'interatomic distance' ? J 31784 ? ? 100 
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 200 'interatomic distance' ? K 31784 ? ? 100 
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 201 'interatomic distance' ? J 31600 ? ? 101 
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 202 'interatomic distance' ? L 31600 ? ? 101 
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 203 'interatomic distance' ? J 31700 ? ? 102 
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 204 'interatomic distance' ? M 31700 ? ? 102 
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 205 'interatomic distance' ? J 31730 ? ? 103 
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 206 'interatomic distance' ? N 31730 ? ? 103 
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 207 'interatomic distance' ? J 31692 ? ? 104 
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 208 'interatomic distance' ? O 31692 ? ? 104 
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 209 'interatomic distance' ? J 31702 ? ? 105 
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 210 'interatomic distance' ? P 31702 ? ? 105 
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 211 'interatomic distance' ? K 31552 ? ? 106 
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 212 'interatomic distance' ? L 31552 ? ? 106 
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 213 'interatomic distance' ? K 31682 ? ? 107 
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 214 'interatomic distance' ? M 31682 ? ? 107 
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 215 'interatomic distance' ? K 31784 ? ? 108 
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 216 'interatomic distance' ? N 31784 ? ? 108 
'X-RAY DIFFRACTION' 1 ? ? 0.050 ? 0.050 217 'interatomic distance' ? K 31684 ? ? 109 
'X-RAY DIFFRACTION' 2 ? ? 0.050 ? 0.050 218 'interatomic distance' ? O 31684 ? ? 109 
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 219 'interatomic distance' ? K 31512 ? ? 110 
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 220 'interatomic distance' ? P 31512 ? ? 110 
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 221 'interatomic distance' ? L 31574 ? ? 111 
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 222 'interatomic distance' ? M 31574 ? ? 111 
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 223 'interatomic distance' ? L 31582 ? ? 112 
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 224 'interatomic distance' ? N 31582 ? ? 112 
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 225 'interatomic distance' ? L 31664 ? ? 113 
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 226 'interatomic distance' ? O 31664 ? ? 113 
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 227 'interatomic distance' ? L 31334 ? ? 114 
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 228 'interatomic distance' ? P 31334 ? ? 114 
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 229 'interatomic distance' ? M 31674 ? ? 115 
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 230 'interatomic distance' ? N 31674 ? ? 115 
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 231 'interatomic distance' ? M 31592 ? ? 116 
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 232 'interatomic distance' ? O 31592 ? ? 116 
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 233 'interatomic distance' ? M 31474 ? ? 117 
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 234 'interatomic distance' ? P 31474 ? ? 117 
'X-RAY DIFFRACTION' 1 ? ? 0.030 ? 0.050 235 'interatomic distance' ? N 31702 ? ? 118 
'X-RAY DIFFRACTION' 2 ? ? 0.030 ? 0.050 236 'interatomic distance' ? O 31702 ? ? 118 
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 237 'interatomic distance' ? N 31418 ? ? 119 
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 238 'interatomic distance' ? P 31418 ? ? 119 
'X-RAY DIFFRACTION' 1 ? ? 0.040 ? 0.050 239 'interatomic distance' ? O 31624 ? ? 120 
'X-RAY DIFFRACTION' 2 ? ? 0.040 ? 0.050 240 'interatomic distance' ? P 31624 ? ? 120 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.8530 
_refine_ls_shell.d_res_low                        2.9270 
_refine_ls_shell.number_reflns_all                702 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             31 
_refine_ls_shell.number_reflns_R_work             671 
_refine_ls_shell.percent_reflns_obs               4.4800 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.3970 
_refine_ls_shell.R_factor_R_free_error            0.0000 
_refine_ls_shell.R_factor_R_work                  0.3510 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_R_complete                  ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1   1 A 
1   2 B 
2   1 A 
2   2 C 
3   1 A 
3   2 D 
4   1 A 
4   2 E 
5   1 A 
5   2 F 
6   1 A 
6   2 G 
7   1 A 
7   2 H 
8   1 A 
8   2 I 
9   1 A 
9   2 J 
10  1 A 
10  2 K 
11  1 A 
11  2 L 
12  1 A 
12  2 M 
13  1 A 
13  2 N 
14  1 A 
14  2 O 
15  1 A 
15  2 P 
16  1 B 
16  2 C 
17  1 B 
17  2 D 
18  1 B 
18  2 E 
19  1 B 
19  2 F 
20  1 B 
20  2 G 
21  1 B 
21  2 H 
22  1 B 
22  2 I 
23  1 B 
23  2 J 
24  1 B 
24  2 K 
25  1 B 
25  2 L 
26  1 B 
26  2 M 
27  1 B 
27  2 N 
28  1 B 
28  2 O 
29  1 B 
29  2 P 
30  1 C 
30  2 D 
31  1 C 
31  2 E 
32  1 C 
32  2 F 
33  1 C 
33  2 G 
34  1 C 
34  2 H 
35  1 C 
35  2 I 
36  1 C 
36  2 J 
37  1 C 
37  2 K 
38  1 C 
38  2 L 
39  1 C 
39  2 M 
40  1 C 
40  2 N 
41  1 C 
41  2 O 
42  1 C 
42  2 P 
43  1 D 
43  2 E 
44  1 D 
44  2 F 
45  1 D 
45  2 G 
46  1 D 
46  2 H 
47  1 D 
47  2 I 
48  1 D 
48  2 J 
49  1 D 
49  2 K 
50  1 D 
50  2 L 
51  1 D 
51  2 M 
52  1 D 
52  2 N 
53  1 D 
53  2 O 
54  1 D 
54  2 P 
55  1 E 
55  2 F 
56  1 E 
56  2 G 
57  1 E 
57  2 H 
58  1 E 
58  2 I 
59  1 E 
59  2 J 
60  1 E 
60  2 K 
61  1 E 
61  2 L 
62  1 E 
62  2 M 
63  1 E 
63  2 N 
64  1 E 
64  2 O 
65  1 E 
65  2 P 
66  1 F 
66  2 G 
67  1 F 
67  2 H 
68  1 F 
68  2 I 
69  1 F 
69  2 J 
70  1 F 
70  2 K 
71  1 F 
71  2 L 
72  1 F 
72  2 M 
73  1 F 
73  2 N 
74  1 F 
74  2 O 
75  1 F 
75  2 P 
76  1 G 
76  2 H 
77  1 G 
77  2 I 
78  1 G 
78  2 J 
79  1 G 
79  2 K 
80  1 G 
80  2 L 
81  1 G 
81  2 M 
82  1 G 
82  2 N 
83  1 G 
83  2 O 
84  1 G 
84  2 P 
85  1 H 
85  2 I 
86  1 H 
86  2 J 
87  1 H 
87  2 K 
88  1 H 
88  2 L 
89  1 H 
89  2 M 
90  1 H 
90  2 N 
91  1 H 
91  2 O 
92  1 H 
92  2 P 
93  1 I 
93  2 J 
94  1 I 
94  2 K 
95  1 I 
95  2 L 
96  1 I 
96  2 M 
97  1 I 
97  2 N 
98  1 I 
98  2 O 
99  1 I 
99  2 P 
100 1 J 
100 2 K 
101 1 J 
101 2 L 
102 1 J 
102 2 M 
103 1 J 
103 2 N 
104 1 J 
104 2 O 
105 1 J 
105 2 P 
106 1 K 
106 2 L 
107 1 K 
107 2 M 
108 1 K 
108 2 N 
109 1 K 
109 2 O 
110 1 K 
110 2 P 
111 1 L 
111 2 M 
112 1 L 
112 2 N 
113 1 L 
113 2 O 
114 1 L 
114 2 P 
115 1 M 
115 2 N 
116 1 M 
116 2 O 
117 1 M 
117 2 P 
118 1 N 
118 2 O 
119 1 N 
119 2 P 
120 1 O 
120 2 P 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1   1 0 0 A 114 A 599 ? ? ? ? ? ? ? ? ? 
1   2 0 0 B 114 B 599 ? ? ? ? ? ? ? ? ? 
2   1 0 0 A 115 A 599 ? ? ? ? ? ? ? ? ? 
2   2 0 0 C 115 C 599 ? ? ? ? ? ? ? ? ? 
3   1 0 0 A 114 A 599 ? ? ? ? ? ? ? ? ? 
3   2 0 0 D 114 D 599 ? ? ? ? ? ? ? ? ? 
4   1 0 0 A 114 A 599 ? ? ? ? ? ? ? ? ? 
4   2 0 0 E 114 E 599 ? ? ? ? ? ? ? ? ? 
5   1 0 0 A 114 A 598 ? ? ? ? ? ? ? ? ? 
5   2 0 0 F 114 F 598 ? ? ? ? ? ? ? ? ? 
6   1 0 0 A 114 A 597 ? ? ? ? ? ? ? ? ? 
6   2 0 0 G 114 G 597 ? ? ? ? ? ? ? ? ? 
7   1 0 0 A 114 A 599 ? ? ? ? ? ? ? ? ? 
7   2 0 0 H 114 H 599 ? ? ? ? ? ? ? ? ? 
8   1 0 0 A 115 A 598 ? ? ? ? ? ? ? ? ? 
8   2 0 0 I 115 I 598 ? ? ? ? ? ? ? ? ? 
9   1 0 0 A 115 A 597 ? ? ? ? ? ? ? ? ? 
9   2 0 0 J 115 J 597 ? ? ? ? ? ? ? ? ? 
10  1 0 0 A 115 A 599 ? ? ? ? ? ? ? ? ? 
10  2 0 0 K 115 K 599 ? ? ? ? ? ? ? ? ? 
11  1 0 0 A 115 A 599 ? ? ? ? ? ? ? ? ? 
11  2 0 0 L 115 L 599 ? ? ? ? ? ? ? ? ? 
12  1 0 0 A 115 A 599 ? ? ? ? ? ? ? ? ? 
12  2 0 0 M 115 M 599 ? ? ? ? ? ? ? ? ? 
13  1 0 0 A 115 A 599 ? ? ? ? ? ? ? ? ? 
13  2 0 0 N 115 N 599 ? ? ? ? ? ? ? ? ? 
14  1 0 0 A 114 A 599 ? ? ? ? ? ? ? ? ? 
14  2 0 0 O 114 O 599 ? ? ? ? ? ? ? ? ? 
15  1 0 0 A 114 A 598 ? ? ? ? ? ? ? ? ? 
15  2 0 0 P 114 P 598 ? ? ? ? ? ? ? ? ? 
16  1 0 0 B 115 B 599 ? ? ? ? ? ? ? ? ? 
16  2 0 0 C 115 C 599 ? ? ? ? ? ? ? ? ? 
17  1 0 0 B 114 B 599 ? ? ? ? ? ? ? ? ? 
17  2 0 0 D 114 D 599 ? ? ? ? ? ? ? ? ? 
18  1 0 0 B 114 B 599 ? ? ? ? ? ? ? ? ? 
18  2 0 0 E 114 E 599 ? ? ? ? ? ? ? ? ? 
19  1 0 0 B 114 B 597 ? ? ? ? ? ? ? ? ? 
19  2 0 0 F 114 F 597 ? ? ? ? ? ? ? ? ? 
20  1 0 0 B 114 B 598 ? ? ? ? ? ? ? ? ? 
20  2 0 0 G 114 G 598 ? ? ? ? ? ? ? ? ? 
21  1 0 0 B 114 B 599 ? ? ? ? ? ? ? ? ? 
21  2 0 0 H 114 H 599 ? ? ? ? ? ? ? ? ? 
22  1 0 0 B 115 B 599 ? ? ? ? ? ? ? ? ? 
22  2 0 0 I 115 I 599 ? ? ? ? ? ? ? ? ? 
23  1 0 0 B 115 B 597 ? ? ? ? ? ? ? ? ? 
23  2 0 0 J 115 J 597 ? ? ? ? ? ? ? ? ? 
24  1 0 0 B 115 B 598 ? ? ? ? ? ? ? ? ? 
24  2 0 0 K 115 K 598 ? ? ? ? ? ? ? ? ? 
25  1 0 0 B 115 B 598 ? ? ? ? ? ? ? ? ? 
25  2 0 0 L 115 L 598 ? ? ? ? ? ? ? ? ? 
26  1 0 0 B 115 B 599 ? ? ? ? ? ? ? ? ? 
26  2 0 0 M 115 M 599 ? ? ? ? ? ? ? ? ? 
27  1 0 0 B 115 B 599 ? ? ? ? ? ? ? ? ? 
27  2 0 0 N 115 N 599 ? ? ? ? ? ? ? ? ? 
28  1 0 0 B 114 B 599 ? ? ? ? ? ? ? ? ? 
28  2 0 0 O 114 O 599 ? ? ? ? ? ? ? ? ? 
29  1 0 0 B 114 B 597 ? ? ? ? ? ? ? ? ? 
29  2 0 0 P 114 P 597 ? ? ? ? ? ? ? ? ? 
30  1 0 0 C 115 C 598 ? ? ? ? ? ? ? ? ? 
30  2 0 0 D 115 D 598 ? ? ? ? ? ? ? ? ? 
31  1 0 0 C 115 C 599 ? ? ? ? ? ? ? ? ? 
31  2 0 0 E 115 E 599 ? ? ? ? ? ? ? ? ? 
32  1 0 0 C 115 C 598 ? ? ? ? ? ? ? ? ? 
32  2 0 0 F 115 F 598 ? ? ? ? ? ? ? ? ? 
33  1 0 0 C 115 C 597 ? ? ? ? ? ? ? ? ? 
33  2 0 0 G 115 G 597 ? ? ? ? ? ? ? ? ? 
34  1 0 0 C 115 C 599 ? ? ? ? ? ? ? ? ? 
34  2 0 0 H 115 H 599 ? ? ? ? ? ? ? ? ? 
35  1 0 0 C 115 C 599 ? ? ? ? ? ? ? ? ? 
35  2 0 0 I 115 I 599 ? ? ? ? ? ? ? ? ? 
36  1 0 0 C 115 C 598 ? ? ? ? ? ? ? ? ? 
36  2 0 0 J 115 J 598 ? ? ? ? ? ? ? ? ? 
37  1 0 0 C 115 C 599 ? ? ? ? ? ? ? ? ? 
37  2 0 0 K 115 K 599 ? ? ? ? ? ? ? ? ? 
38  1 0 0 C 115 C 599 ? ? ? ? ? ? ? ? ? 
38  2 0 0 L 115 L 599 ? ? ? ? ? ? ? ? ? 
39  1 0 0 C 115 C 599 ? ? ? ? ? ? ? ? ? 
39  2 0 0 M 115 M 599 ? ? ? ? ? ? ? ? ? 
40  1 0 0 C 115 C 599 ? ? ? ? ? ? ? ? ? 
40  2 0 0 N 115 N 599 ? ? ? ? ? ? ? ? ? 
41  1 0 0 C 115 C 599 ? ? ? ? ? ? ? ? ? 
41  2 0 0 O 115 O 599 ? ? ? ? ? ? ? ? ? 
42  1 0 0 C 115 C 598 ? ? ? ? ? ? ? ? ? 
42  2 0 0 P 115 P 598 ? ? ? ? ? ? ? ? ? 
43  1 0 0 D 114 D 599 ? ? ? ? ? ? ? ? ? 
43  2 0 0 E 114 E 599 ? ? ? ? ? ? ? ? ? 
44  1 0 0 D 114 D 598 ? ? ? ? ? ? ? ? ? 
44  2 0 0 F 114 F 598 ? ? ? ? ? ? ? ? ? 
45  1 0 0 D 114 D 598 ? ? ? ? ? ? ? ? ? 
45  2 0 0 G 114 G 598 ? ? ? ? ? ? ? ? ? 
46  1 0 0 D 114 D 599 ? ? ? ? ? ? ? ? ? 
46  2 0 0 H 114 H 599 ? ? ? ? ? ? ? ? ? 
47  1 0 0 D 115 D 599 ? ? ? ? ? ? ? ? ? 
47  2 0 0 I 115 I 599 ? ? ? ? ? ? ? ? ? 
48  1 0 0 D 115 D 597 ? ? ? ? ? ? ? ? ? 
48  2 0 0 J 115 J 597 ? ? ? ? ? ? ? ? ? 
49  1 0 0 D 115 D 599 ? ? ? ? ? ? ? ? ? 
49  2 0 0 K 115 K 599 ? ? ? ? ? ? ? ? ? 
50  1 0 0 D 115 D 599 ? ? ? ? ? ? ? ? ? 
50  2 0 0 L 115 L 599 ? ? ? ? ? ? ? ? ? 
51  1 0 0 D 115 D 599 ? ? ? ? ? ? ? ? ? 
51  2 0 0 M 115 M 599 ? ? ? ? ? ? ? ? ? 
52  1 0 0 D 115 D 599 ? ? ? ? ? ? ? ? ? 
52  2 0 0 N 115 N 599 ? ? ? ? ? ? ? ? ? 
53  1 0 0 D 114 D 599 ? ? ? ? ? ? ? ? ? 
53  2 0 0 O 114 O 599 ? ? ? ? ? ? ? ? ? 
54  1 0 0 D 114 D 598 ? ? ? ? ? ? ? ? ? 
54  2 0 0 P 114 P 598 ? ? ? ? ? ? ? ? ? 
55  1 0 0 E 114 E 597 ? ? ? ? ? ? ? ? ? 
55  2 0 0 F 114 F 597 ? ? ? ? ? ? ? ? ? 
56  1 0 0 E 114 E 598 ? ? ? ? ? ? ? ? ? 
56  2 0 0 G 114 G 598 ? ? ? ? ? ? ? ? ? 
57  1 0 0 E 114 E 599 ? ? ? ? ? ? ? ? ? 
57  2 0 0 H 114 H 599 ? ? ? ? ? ? ? ? ? 
58  1 0 0 E 115 E 599 ? ? ? ? ? ? ? ? ? 
58  2 0 0 I 115 I 599 ? ? ? ? ? ? ? ? ? 
59  1 0 0 E 115 E 597 ? ? ? ? ? ? ? ? ? 
59  2 0 0 J 115 J 597 ? ? ? ? ? ? ? ? ? 
60  1 0 0 E 115 E 598 ? ? ? ? ? ? ? ? ? 
60  2 0 0 K 115 K 598 ? ? ? ? ? ? ? ? ? 
61  1 0 0 E 115 E 598 ? ? ? ? ? ? ? ? ? 
61  2 0 0 L 115 L 598 ? ? ? ? ? ? ? ? ? 
62  1 0 0 E 115 E 599 ? ? ? ? ? ? ? ? ? 
62  2 0 0 M 115 M 599 ? ? ? ? ? ? ? ? ? 
63  1 0 0 E 115 E 599 ? ? ? ? ? ? ? ? ? 
63  2 0 0 N 115 N 599 ? ? ? ? ? ? ? ? ? 
64  1 0 0 E 114 E 599 ? ? ? ? ? ? ? ? ? 
64  2 0 0 O 114 O 599 ? ? ? ? ? ? ? ? ? 
65  1 0 0 E 114 E 597 ? ? ? ? ? ? ? ? ? 
65  2 0 0 P 114 P 597 ? ? ? ? ? ? ? ? ? 
66  1 0 0 F 114 F 598 ? ? ? ? ? ? ? ? ? 
66  2 0 0 G 114 G 598 ? ? ? ? ? ? ? ? ? 
67  1 0 0 F 114 F 598 ? ? ? ? ? ? ? ? ? 
67  2 0 0 H 114 H 598 ? ? ? ? ? ? ? ? ? 
68  1 0 0 F 115 F 597 ? ? ? ? ? ? ? ? ? 
68  2 0 0 I 115 I 597 ? ? ? ? ? ? ? ? ? 
69  1 0 0 F 115 F 598 ? ? ? ? ? ? ? ? ? 
69  2 0 0 J 115 J 598 ? ? ? ? ? ? ? ? ? 
70  1 0 0 F 115 F 597 ? ? ? ? ? ? ? ? ? 
70  2 0 0 K 115 K 597 ? ? ? ? ? ? ? ? ? 
71  1 0 0 F 115 F 597 ? ? ? ? ? ? ? ? ? 
71  2 0 0 L 115 L 597 ? ? ? ? ? ? ? ? ? 
72  1 0 0 F 115 F 598 ? ? ? ? ? ? ? ? ? 
72  2 0 0 M 115 M 598 ? ? ? ? ? ? ? ? ? 
73  1 0 0 F 115 F 597 ? ? ? ? ? ? ? ? ? 
73  2 0 0 N 115 N 597 ? ? ? ? ? ? ? ? ? 
74  1 0 0 F 114 F 598 ? ? ? ? ? ? ? ? ? 
74  2 0 0 O 114 O 598 ? ? ? ? ? ? ? ? ? 
75  1 0 0 F 114 F 598 ? ? ? ? ? ? ? ? ? 
75  2 0 0 P 114 P 598 ? ? ? ? ? ? ? ? ? 
76  1 0 0 G 114 G 597 ? ? ? ? ? ? ? ? ? 
76  2 0 0 H 114 H 597 ? ? ? ? ? ? ? ? ? 
77  1 0 0 G 115 G 597 ? ? ? ? ? ? ? ? ? 
77  2 0 0 I 115 I 597 ? ? ? ? ? ? ? ? ? 
78  1 0 0 G 115 G 597 ? ? ? ? ? ? ? ? ? 
78  2 0 0 J 115 J 597 ? ? ? ? ? ? ? ? ? 
79  1 0 0 G 115 G 597 ? ? ? ? ? ? ? ? ? 
79  2 0 0 K 115 K 597 ? ? ? ? ? ? ? ? ? 
80  1 0 0 G 115 G 597 ? ? ? ? ? ? ? ? ? 
80  2 0 0 L 115 L 597 ? ? ? ? ? ? ? ? ? 
81  1 0 0 G 115 G 598 ? ? ? ? ? ? ? ? ? 
81  2 0 0 M 115 M 598 ? ? ? ? ? ? ? ? ? 
82  1 0 0 G 115 G 598 ? ? ? ? ? ? ? ? ? 
82  2 0 0 N 115 N 598 ? ? ? ? ? ? ? ? ? 
83  1 0 0 G 114 G 598 ? ? ? ? ? ? ? ? ? 
83  2 0 0 O 114 O 598 ? ? ? ? ? ? ? ? ? 
84  1 0 0 G 114 G 598 ? ? ? ? ? ? ? ? ? 
84  2 0 0 P 114 P 598 ? ? ? ? ? ? ? ? ? 
85  1 0 0 H 115 H 598 ? ? ? ? ? ? ? ? ? 
85  2 0 0 I 115 I 598 ? ? ? ? ? ? ? ? ? 
86  1 0 0 H 115 H 597 ? ? ? ? ? ? ? ? ? 
86  2 0 0 J 115 J 597 ? ? ? ? ? ? ? ? ? 
87  1 0 0 H 115 H 599 ? ? ? ? ? ? ? ? ? 
87  2 0 0 K 115 K 599 ? ? ? ? ? ? ? ? ? 
88  1 0 0 H 115 H 599 ? ? ? ? ? ? ? ? ? 
88  2 0 0 L 115 L 599 ? ? ? ? ? ? ? ? ? 
89  1 0 0 H 115 H 599 ? ? ? ? ? ? ? ? ? 
89  2 0 0 M 115 M 599 ? ? ? ? ? ? ? ? ? 
90  1 0 0 H 115 H 599 ? ? ? ? ? ? ? ? ? 
90  2 0 0 N 115 N 599 ? ? ? ? ? ? ? ? ? 
91  1 0 0 H 114 H 599 ? ? ? ? ? ? ? ? ? 
91  2 0 0 O 114 O 599 ? ? ? ? ? ? ? ? ? 
92  1 0 0 H 114 H 598 ? ? ? ? ? ? ? ? ? 
92  2 0 0 P 114 P 598 ? ? ? ? ? ? ? ? ? 
93  1 0 0 I 115 I 597 ? ? ? ? ? ? ? ? ? 
93  2 0 0 J 115 J 597 ? ? ? ? ? ? ? ? ? 
94  1 0 0 I 115 I 599 ? ? ? ? ? ? ? ? ? 
94  2 0 0 K 115 K 599 ? ? ? ? ? ? ? ? ? 
95  1 0 0 I 115 I 599 ? ? ? ? ? ? ? ? ? 
95  2 0 0 L 115 L 599 ? ? ? ? ? ? ? ? ? 
96  1 0 0 I 115 I 599 ? ? ? ? ? ? ? ? ? 
96  2 0 0 M 115 M 599 ? ? ? ? ? ? ? ? ? 
97  1 0 0 I 115 I 599 ? ? ? ? ? ? ? ? ? 
97  2 0 0 N 115 N 599 ? ? ? ? ? ? ? ? ? 
98  1 0 0 I 115 I 599 ? ? ? ? ? ? ? ? ? 
98  2 0 0 O 115 O 599 ? ? ? ? ? ? ? ? ? 
99  1 0 0 I 115 I 597 ? ? ? ? ? ? ? ? ? 
99  2 0 0 P 115 P 597 ? ? ? ? ? ? ? ? ? 
100 1 0 0 J 115 J 598 ? ? ? ? ? ? ? ? ? 
100 2 0 0 K 115 K 598 ? ? ? ? ? ? ? ? ? 
101 1 0 0 J 115 J 598 ? ? ? ? ? ? ? ? ? 
101 2 0 0 L 115 L 598 ? ? ? ? ? ? ? ? ? 
102 1 0 0 J 115 J 598 ? ? ? ? ? ? ? ? ? 
102 2 0 0 M 115 M 598 ? ? ? ? ? ? ? ? ? 
103 1 0 0 J 115 J 598 ? ? ? ? ? ? ? ? ? 
103 2 0 0 N 115 N 598 ? ? ? ? ? ? ? ? ? 
104 1 0 0 J 115 J 598 ? ? ? ? ? ? ? ? ? 
104 2 0 0 O 115 O 598 ? ? ? ? ? ? ? ? ? 
105 1 0 0 J 115 J 598 ? ? ? ? ? ? ? ? ? 
105 2 0 0 P 115 P 598 ? ? ? ? ? ? ? ? ? 
106 1 0 0 K 115 K 599 ? ? ? ? ? ? ? ? ? 
106 2 0 0 L 115 L 599 ? ? ? ? ? ? ? ? ? 
107 1 0 0 K 115 K 599 ? ? ? ? ? ? ? ? ? 
107 2 0 0 M 115 M 599 ? ? ? ? ? ? ? ? ? 
108 1 0 0 K 115 K 599 ? ? ? ? ? ? ? ? ? 
108 2 0 0 N 115 N 599 ? ? ? ? ? ? ? ? ? 
109 1 0 0 K 115 K 599 ? ? ? ? ? ? ? ? ? 
109 2 0 0 O 115 O 599 ? ? ? ? ? ? ? ? ? 
110 1 0 0 K 115 K 597 ? ? ? ? ? ? ? ? ? 
110 2 0 0 P 115 P 597 ? ? ? ? ? ? ? ? ? 
111 1 0 0 L 115 L 599 ? ? ? ? ? ? ? ? ? 
111 2 0 0 M 115 M 599 ? ? ? ? ? ? ? ? ? 
112 1 0 0 L 115 L 598 ? ? ? ? ? ? ? ? ? 
112 2 0 0 N 115 N 598 ? ? ? ? ? ? ? ? ? 
113 1 0 0 L 115 L 599 ? ? ? ? ? ? ? ? ? 
113 2 0 0 O 115 O 599 ? ? ? ? ? ? ? ? ? 
114 1 0 0 L 115 L 597 ? ? ? ? ? ? ? ? ? 
114 2 0 0 P 115 P 597 ? ? ? ? ? ? ? ? ? 
115 1 0 0 M 115 M 599 ? ? ? ? ? ? ? ? ? 
115 2 0 0 N 115 N 599 ? ? ? ? ? ? ? ? ? 
116 1 0 0 M 115 M 599 ? ? ? ? ? ? ? ? ? 
116 2 0 0 O 115 O 599 ? ? ? ? ? ? ? ? ? 
117 1 0 0 M 115 M 598 ? ? ? ? ? ? ? ? ? 
117 2 0 0 P 115 P 598 ? ? ? ? ? ? ? ? ? 
118 1 0 0 N 115 N 599 ? ? ? ? ? ? ? ? ? 
118 2 0 0 O 115 O 599 ? ? ? ? ? ? ? ? ? 
119 1 0 0 N 115 N 597 ? ? ? ? ? ? ? ? ? 
119 2 0 0 P 115 P 597 ? ? ? ? ? ? ? ? ? 
120 1 0 0 O 114 O 598 ? ? ? ? ? ? ? ? ? 
120 2 0 0 P 114 P 598 ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1   ? 
2   ? 
3   ? 
4   ? 
5   ? 
6   ? 
7   ? 
8   ? 
9   ? 
10  ? 
11  ? 
12  ? 
13  ? 
14  ? 
15  ? 
16  ? 
17  ? 
18  ? 
19  ? 
20  ? 
21  ? 
22  ? 
23  ? 
24  ? 
25  ? 
26  ? 
27  ? 
28  ? 
29  ? 
30  ? 
31  ? 
32  ? 
33  ? 
34  ? 
35  ? 
36  ? 
37  ? 
38  ? 
39  ? 
40  ? 
41  ? 
42  ? 
43  ? 
44  ? 
45  ? 
46  ? 
47  ? 
48  ? 
49  ? 
50  ? 
51  ? 
52  ? 
53  ? 
54  ? 
55  ? 
56  ? 
57  ? 
58  ? 
59  ? 
60  ? 
61  ? 
62  ? 
63  ? 
64  ? 
65  ? 
66  ? 
67  ? 
68  ? 
69  ? 
70  ? 
71  ? 
72  ? 
73  ? 
74  ? 
75  ? 
76  ? 
77  ? 
78  ? 
79  ? 
80  ? 
81  ? 
82  ? 
83  ? 
84  ? 
85  ? 
86  ? 
87  ? 
88  ? 
89  ? 
90  ? 
91  ? 
92  ? 
93  ? 
94  ? 
95  ? 
96  ? 
97  ? 
98  ? 
99  ? 
100 ? 
101 ? 
102 ? 
103 ? 
104 ? 
105 ? 
106 ? 
107 ? 
108 ? 
109 ? 
110 ? 
111 ? 
112 ? 
113 ? 
114 ? 
115 ? 
116 ? 
117 ? 
118 ? 
119 ? 
120 ? 
# 
_struct.entry_id                     6TXA 
_struct.title                        
'Crystal structure of tetrameric human D137N-SAMHD1 (residues 109-626) with XTP, dGMPNPP and Mg' 
_struct.pdbx_descriptor              'Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 (E.C.3.1.5.-)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6TXA 
_struct_keywords.text            'triphosphohydrolase, metallo-enzyme, binuclear, HD, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 1 ? 
N  N N 1 ? 
O  N N 1 ? 
P  N N 1 ? 
Q  N N 2 ? 
R  N N 3 ? 
S  N N 3 ? 
T  N N 3 ? 
U  N N 4 ? 
V  N N 5 ? 
W  N N 6 ? 
X  N N 4 ? 
Y  N N 2 ? 
Z  N N 3 ? 
AA N N 3 ? 
BA N N 3 ? 
CA N N 4 ? 
DA N N 5 ? 
EA N N 6 ? 
FA N N 4 ? 
GA N N 4 ? 
HA N N 2 ? 
IA N N 3 ? 
JA N N 3 ? 
KA N N 3 ? 
LA N N 4 ? 
MA N N 5 ? 
NA N N 6 ? 
OA N N 5 ? 
PA N N 4 ? 
QA N N 2 ? 
RA N N 3 ? 
SA N N 3 ? 
TA N N 3 ? 
UA N N 4 ? 
VA N N 6 ? 
WA N N 2 ? 
XA N N 3 ? 
YA N N 3 ? 
ZA N N 3 ? 
AB N N 4 ? 
BB N N 5 ? 
CB N N 6 ? 
DB N N 4 ? 
EB N N 2 ? 
FB N N 3 ? 
GB N N 3 ? 
HB N N 3 ? 
IB N N 4 ? 
JB N N 5 ? 
KB N N 6 ? 
LB N N 4 ? 
MB N N 4 ? 
NB N N 2 ? 
OB N N 3 ? 
PB N N 3 ? 
QB N N 3 ? 
RB N N 4 ? 
SB N N 5 ? 
TB N N 6 ? 
UB N N 4 ? 
VB N N 2 ? 
WB N N 3 ? 
XB N N 3 ? 
YB N N 3 ? 
ZB N N 4 ? 
AC N N 5 ? 
BC N N 6 ? 
CC N N 2 ? 
DC N N 3 ? 
EC N N 3 ? 
FC N N 3 ? 
GC N N 4 ? 
HC N N 6 ? 
IC N N 4 ? 
JC N N 4 ? 
KC N N 5 ? 
LC N N 2 ? 
MC N N 3 ? 
NC N N 3 ? 
OC N N 3 ? 
PC N N 4 ? 
QC N N 5 ? 
RC N N 6 ? 
SC N N 4 ? 
TC N N 4 ? 
UC N N 2 ? 
VC N N 3 ? 
WC N N 3 ? 
XC N N 3 ? 
YC N N 4 ? 
ZC N N 5 ? 
AD N N 6 ? 
BD N N 2 ? 
CD N N 3 ? 
DD N N 3 ? 
ED N N 3 ? 
FD N N 4 ? 
GD N N 5 ? 
HD N N 6 ? 
ID N N 2 ? 
JD N N 3 ? 
KD N N 3 ? 
LD N N 3 ? 
MD N N 4 ? 
ND N N 5 ? 
OD N N 6 ? 
PD N N 4 ? 
QD N N 2 ? 
RD N N 3 ? 
SD N N 3 ? 
TD N N 3 ? 
UD N N 4 ? 
VD N N 5 ? 
WD N N 6 ? 
XD N N 4 ? 
YD N N 4 ? 
ZD N N 2 ? 
AE N N 3 ? 
BE N N 3 ? 
CE N N 3 ? 
DE N N 4 ? 
EE N N 5 ? 
FE N N 6 ? 
GE N N 4 ? 
HE N N 2 ? 
IE N N 3 ? 
JE N N 3 ? 
KE N N 3 ? 
LE N N 4 ? 
ME N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 HIS A 23  ? ASN A 31  ? HIS A 129 ASN A 137 1 ? 9  
HELX_P HELX_P2   AA2 THR A 32  ? ARG A 37  ? THR A 138 ARG A 143 1 ? 6  
HELX_P HELX_P3   AA3 LEU A 38  ? ILE A 41  ? LEU A 144 ILE A 147 5 ? 4  
HELX_P HELX_P4   AA4 LEU A 44  ? VAL A 50  ? LEU A 150 VAL A 156 5 ? 7  
HELX_P HELX_P5   AA5 ASN A 57  ? GLN A 80  ? ASN A 163 GLN A 186 1 ? 24 
HELX_P HELX_P6   AA6 PRO A 81  ? GLN A 84  ? PRO A 187 GLN A 190 5 ? 4  
HELX_P HELX_P7   AA7 SER A 86  ? HIS A 100 ? SER A 192 HIS A 206 1 ? 15 
HELX_P HELX_P8   AA8 SER A 108 ? ARG A 114 ? SER A 214 ARG A 220 1 ? 7  
HELX_P HELX_P9   AA9 ARG A 114 ? ARG A 120 ? ARG A 220 ARG A 226 1 ? 7  
HELX_P HELX_P10  AB1 THR A 126 ? GLY A 143 ? THR A 232 GLY A 249 1 ? 18 
HELX_P HELX_P11  AB2 GLY A 143 ? TYR A 151 ? GLY A 249 TYR A 257 1 ? 9  
HELX_P HELX_P12  AB3 ILE A 154 ? GLY A 168 ? ILE A 260 GLY A 274 1 ? 15 
HELX_P HELX_P13  AB4 PRO A 185 ? ILE A 194 ? PRO A 291 ILE A 300 5 ? 10 
HELX_P HELX_P14  AB5 ASP A 203 ? GLY A 218 ? ASP A 309 GLY A 324 1 ? 16 
HELX_P HELX_P15  AB6 ASP A 224 ? PHE A 231 ? ASP A 330 PHE A 337 1 ? 8  
HELX_P HELX_P16  AB7 GLU A 249 ? ALA A 267 ? GLU A 355 ALA A 373 1 ? 19 
HELX_P HELX_P17  AB8 HIS A 270 ? ASP A 288 ? HIS A 376 ASP A 394 1 ? 19 
HELX_P HELX_P18  AB9 ASP A 289 ? ILE A 291 ? ASP A 395 ILE A 397 5 ? 3  
HELX_P HELX_P19  AC1 ALA A 296 ? GLY A 298 ? ALA A 402 GLY A 404 5 ? 3  
HELX_P HELX_P20  AC2 THR A 305 ? ASP A 308 ? THR A 411 ASP A 414 5 ? 4  
HELX_P HELX_P21  AC3 ASP A 309 ? THR A 314 ? ASP A 415 THR A 420 1 ? 6  
HELX_P HELX_P22  AC4 LYS A 315 ? THR A 317 ? LYS A 421 THR A 423 5 ? 3  
HELX_P HELX_P23  AC5 ASP A 318 ? SER A 327 ? ASP A 424 SER A 433 1 ? 10 
HELX_P HELX_P24  AC6 ASP A 329 ? LYS A 331 ? ASP A 435 LYS A 437 5 ? 3  
HELX_P HELX_P25  AC7 LEU A 332 ? ARG A 345 ? LEU A 438 ARG A 451 1 ? 14 
HELX_P HELX_P26  AC8 LYS A 363 ? GLU A 368 ? LYS A 469 GLU A 474 5 ? 6  
HELX_P HELX_P27  AC9 SER A 369 ? SER A 376 ? SER A 475 SER A 482 1 ? 8  
HELX_P HELX_P28  AD1 LYS A 388 ? GLU A 390 ? LYS A 494 GLU A 496 5 ? 3  
HELX_P HELX_P29  AD2 ASN A 407 ? VAL A 412 ? ASN A 513 VAL A 518 5 ? 6  
HELX_P HELX_P30  AD3 ASP A 452 ? ARG A 470 ? ASP A 558 ARG A 576 1 ? 19 
HELX_P HELX_P31  AD4 ASP A 477 ? ALA A 482 ? ASP A 583 ALA A 588 1 ? 6  
HELX_P HELX_P32  AD5 ILE A 485 ? ASN A 493 ? ILE A 591 ASN A 599 5 ? 9  
HELX_P HELX_P33  AD6 HIS B 23  ? ASN B 31  ? HIS B 129 ASN B 137 1 ? 9  
HELX_P HELX_P34  AD7 THR B 32  ? ARG B 37  ? THR B 138 ARG B 143 1 ? 6  
HELX_P HELX_P35  AD8 LEU B 38  ? ILE B 41  ? LEU B 144 ILE B 147 5 ? 4  
HELX_P HELX_P36  AD9 LEU B 44  ? VAL B 50  ? LEU B 150 VAL B 156 5 ? 7  
HELX_P HELX_P37  AE1 ASN B 57  ? GLN B 80  ? ASN B 163 GLN B 186 1 ? 24 
HELX_P HELX_P38  AE2 PRO B 81  ? GLN B 84  ? PRO B 187 GLN B 190 5 ? 4  
HELX_P HELX_P39  AE3 SER B 86  ? HIS B 100 ? SER B 192 HIS B 206 1 ? 15 
HELX_P HELX_P40  AE4 SER B 108 ? ARG B 114 ? SER B 214 ARG B 220 1 ? 7  
HELX_P HELX_P41  AE5 ARG B 114 ? ARG B 120 ? ARG B 220 ARG B 226 1 ? 7  
HELX_P HELX_P42  AE6 THR B 126 ? GLY B 143 ? THR B 232 GLY B 249 1 ? 18 
HELX_P HELX_P43  AE7 GLY B 143 ? TYR B 151 ? GLY B 249 TYR B 257 1 ? 9  
HELX_P HELX_P44  AE8 ILE B 154 ? GLY B 168 ? ILE B 260 GLY B 274 1 ? 15 
HELX_P HELX_P45  AE9 PRO B 185 ? ILE B 194 ? PRO B 291 ILE B 300 5 ? 10 
HELX_P HELX_P46  AF1 ASP B 203 ? GLY B 218 ? ASP B 309 GLY B 324 1 ? 16 
HELX_P HELX_P47  AF2 ASP B 224 ? PHE B 231 ? ASP B 330 PHE B 337 1 ? 8  
HELX_P HELX_P48  AF3 GLU B 249 ? ALA B 267 ? GLU B 355 ALA B 373 1 ? 19 
HELX_P HELX_P49  AF4 HIS B 270 ? ASP B 288 ? HIS B 376 ASP B 394 1 ? 19 
HELX_P HELX_P50  AF5 ASP B 289 ? ILE B 291 ? ASP B 395 ILE B 397 5 ? 3  
HELX_P HELX_P51  AF6 ALA B 296 ? GLY B 298 ? ALA B 402 GLY B 404 5 ? 3  
HELX_P HELX_P52  AF7 THR B 305 ? ASP B 308 ? THR B 411 ASP B 414 5 ? 4  
HELX_P HELX_P53  AF8 ASP B 309 ? THR B 314 ? ASP B 415 THR B 420 1 ? 6  
HELX_P HELX_P54  AF9 LYS B 315 ? THR B 317 ? LYS B 421 THR B 423 5 ? 3  
HELX_P HELX_P55  AG1 ASP B 318 ? SER B 327 ? ASP B 424 SER B 433 1 ? 10 
HELX_P HELX_P56  AG2 ASP B 329 ? LYS B 331 ? ASP B 435 LYS B 437 5 ? 3  
HELX_P HELX_P57  AG3 LEU B 332 ? ARG B 345 ? LEU B 438 ARG B 451 1 ? 14 
HELX_P HELX_P58  AG4 LYS B 363 ? GLU B 368 ? LYS B 469 GLU B 474 5 ? 6  
HELX_P HELX_P59  AG5 SER B 369 ? SER B 376 ? SER B 475 SER B 482 1 ? 8  
HELX_P HELX_P60  AG6 LYS B 388 ? GLU B 390 ? LYS B 494 GLU B 496 5 ? 3  
HELX_P HELX_P61  AG7 ASN B 407 ? VAL B 412 ? ASN B 513 VAL B 518 5 ? 6  
HELX_P HELX_P62  AG8 ASP B 452 ? ARG B 470 ? ASP B 558 ARG B 576 1 ? 19 
HELX_P HELX_P63  AG9 ASP B 477 ? ALA B 482 ? ASP B 583 ALA B 588 1 ? 6  
HELX_P HELX_P64  AH1 ILE B 485 ? ASN B 493 ? ILE B 591 ASN B 599 5 ? 9  
HELX_P HELX_P65  AH2 HIS C 23  ? ASN C 31  ? HIS C 129 ASN C 137 1 ? 9  
HELX_P HELX_P66  AH3 THR C 32  ? ARG C 37  ? THR C 138 ARG C 143 1 ? 6  
HELX_P HELX_P67  AH4 LEU C 38  ? ILE C 41  ? LEU C 144 ILE C 147 5 ? 4  
HELX_P HELX_P68  AH5 LEU C 44  ? VAL C 50  ? LEU C 150 VAL C 156 5 ? 7  
HELX_P HELX_P69  AH6 ASN C 57  ? GLN C 80  ? ASN C 163 GLN C 186 1 ? 24 
HELX_P HELX_P70  AH7 PRO C 81  ? GLN C 84  ? PRO C 187 GLN C 190 5 ? 4  
HELX_P HELX_P71  AH8 SER C 86  ? HIS C 100 ? SER C 192 HIS C 206 1 ? 15 
HELX_P HELX_P72  AH9 SER C 108 ? ARG C 114 ? SER C 214 ARG C 220 1 ? 7  
HELX_P HELX_P73  AI1 ARG C 114 ? ARG C 120 ? ARG C 220 ARG C 226 1 ? 7  
HELX_P HELX_P74  AI2 THR C 126 ? ASN C 142 ? THR C 232 ASN C 248 1 ? 17 
HELX_P HELX_P75  AI3 GLY C 143 ? TYR C 151 ? GLY C 249 TYR C 257 1 ? 9  
HELX_P HELX_P76  AI4 ILE C 154 ? GLY C 168 ? ILE C 260 GLY C 274 1 ? 15 
HELX_P HELX_P77  AI5 PRO C 185 ? ILE C 194 ? PRO C 291 ILE C 300 5 ? 10 
HELX_P HELX_P78  AI6 ASP C 203 ? GLY C 218 ? ASP C 309 GLY C 324 1 ? 16 
HELX_P HELX_P79  AI7 ASP C 224 ? PHE C 231 ? ASP C 330 PHE C 337 1 ? 8  
HELX_P HELX_P80  AI8 GLU C 249 ? ALA C 267 ? GLU C 355 ALA C 373 1 ? 19 
HELX_P HELX_P81  AI9 HIS C 270 ? ASP C 288 ? HIS C 376 ASP C 394 1 ? 19 
HELX_P HELX_P82  AJ1 ASP C 289 ? ILE C 291 ? ASP C 395 ILE C 397 5 ? 3  
HELX_P HELX_P83  AJ2 ALA C 296 ? GLY C 298 ? ALA C 402 GLY C 404 5 ? 3  
HELX_P HELX_P84  AJ3 THR C 305 ? ASP C 308 ? THR C 411 ASP C 414 5 ? 4  
HELX_P HELX_P85  AJ4 ASP C 309 ? THR C 314 ? ASP C 415 THR C 420 1 ? 6  
HELX_P HELX_P86  AJ5 LYS C 315 ? THR C 317 ? LYS C 421 THR C 423 5 ? 3  
HELX_P HELX_P87  AJ6 ASP C 318 ? SER C 327 ? ASP C 424 SER C 433 1 ? 10 
HELX_P HELX_P88  AJ7 ASP C 329 ? LYS C 331 ? ASP C 435 LYS C 437 5 ? 3  
HELX_P HELX_P89  AJ8 LEU C 332 ? ARG C 345 ? LEU C 438 ARG C 451 1 ? 14 
HELX_P HELX_P90  AJ9 LYS C 363 ? GLU C 368 ? LYS C 469 GLU C 474 5 ? 6  
HELX_P HELX_P91  AK1 SER C 369 ? SER C 376 ? SER C 475 SER C 482 1 ? 8  
HELX_P HELX_P92  AK2 LYS C 388 ? GLU C 390 ? LYS C 494 GLU C 496 5 ? 3  
HELX_P HELX_P93  AK3 ASN C 407 ? VAL C 412 ? ASN C 513 VAL C 518 5 ? 6  
HELX_P HELX_P94  AK4 ASP C 452 ? ARG C 470 ? ASP C 558 ARG C 576 1 ? 19 
HELX_P HELX_P95  AK5 ASP C 477 ? ALA C 482 ? ASP C 583 ALA C 588 1 ? 6  
HELX_P HELX_P96  AK6 ILE C 485 ? ASN C 493 ? ILE C 591 ASN C 599 5 ? 9  
HELX_P HELX_P97  AK7 HIS D 23  ? ASN D 31  ? HIS D 129 ASN D 137 1 ? 9  
HELX_P HELX_P98  AK8 THR D 32  ? ARG D 37  ? THR D 138 ARG D 143 1 ? 6  
HELX_P HELX_P99  AK9 LEU D 38  ? ILE D 41  ? LEU D 144 ILE D 147 5 ? 4  
HELX_P HELX_P100 AL1 LEU D 44  ? VAL D 50  ? LEU D 150 VAL D 156 5 ? 7  
HELX_P HELX_P101 AL2 ASN D 57  ? GLN D 80  ? ASN D 163 GLN D 186 1 ? 24 
HELX_P HELX_P102 AL3 PRO D 81  ? GLN D 84  ? PRO D 187 GLN D 190 5 ? 4  
HELX_P HELX_P103 AL4 SER D 86  ? HIS D 100 ? SER D 192 HIS D 206 1 ? 15 
HELX_P HELX_P104 AL5 SER D 108 ? ARG D 114 ? SER D 214 ARG D 220 1 ? 7  
HELX_P HELX_P105 AL6 ARG D 114 ? ARG D 120 ? ARG D 220 ARG D 226 1 ? 7  
HELX_P HELX_P106 AL7 THR D 126 ? GLY D 143 ? THR D 232 GLY D 249 1 ? 18 
HELX_P HELX_P107 AL8 GLY D 143 ? TYR D 151 ? GLY D 249 TYR D 257 1 ? 9  
HELX_P HELX_P108 AL9 ILE D 154 ? GLY D 168 ? ILE D 260 GLY D 274 1 ? 15 
HELX_P HELX_P109 AM1 PRO D 185 ? ILE D 194 ? PRO D 291 ILE D 300 5 ? 10 
HELX_P HELX_P110 AM2 ASP D 203 ? GLY D 218 ? ASP D 309 GLY D 324 1 ? 16 
HELX_P HELX_P111 AM3 ASP D 224 ? PHE D 231 ? ASP D 330 PHE D 337 1 ? 8  
HELX_P HELX_P112 AM4 GLU D 249 ? ALA D 267 ? GLU D 355 ALA D 373 1 ? 19 
HELX_P HELX_P113 AM5 HIS D 270 ? ASP D 288 ? HIS D 376 ASP D 394 1 ? 19 
HELX_P HELX_P114 AM6 ASP D 289 ? ILE D 291 ? ASP D 395 ILE D 397 5 ? 3  
HELX_P HELX_P115 AM7 ALA D 296 ? GLY D 298 ? ALA D 402 GLY D 404 5 ? 3  
HELX_P HELX_P116 AM8 THR D 305 ? ASP D 308 ? THR D 411 ASP D 414 5 ? 4  
HELX_P HELX_P117 AM9 ASP D 309 ? THR D 314 ? ASP D 415 THR D 420 1 ? 6  
HELX_P HELX_P118 AN1 LYS D 315 ? THR D 317 ? LYS D 421 THR D 423 5 ? 3  
HELX_P HELX_P119 AN2 ASP D 318 ? SER D 327 ? ASP D 424 SER D 433 1 ? 10 
HELX_P HELX_P120 AN3 ASP D 329 ? LYS D 331 ? ASP D 435 LYS D 437 5 ? 3  
HELX_P HELX_P121 AN4 LEU D 332 ? ARG D 345 ? LEU D 438 ARG D 451 1 ? 14 
HELX_P HELX_P122 AN5 LYS D 363 ? GLU D 368 ? LYS D 469 GLU D 474 5 ? 6  
HELX_P HELX_P123 AN6 SER D 369 ? SER D 376 ? SER D 475 SER D 482 1 ? 8  
HELX_P HELX_P124 AN7 LYS D 388 ? GLU D 390 ? LYS D 494 GLU D 496 5 ? 3  
HELX_P HELX_P125 AN8 ASN D 407 ? VAL D 412 ? ASN D 513 VAL D 518 5 ? 6  
HELX_P HELX_P126 AN9 ASP D 452 ? ARG D 470 ? ASP D 558 ARG D 576 1 ? 19 
HELX_P HELX_P127 AO1 ASP D 477 ? ALA D 482 ? ASP D 583 ALA D 588 1 ? 6  
HELX_P HELX_P128 AO2 ILE D 485 ? ASN D 493 ? ILE D 591 ASN D 599 5 ? 9  
HELX_P HELX_P129 AO3 HIS E 23  ? ASN E 31  ? HIS E 129 ASN E 137 1 ? 9  
HELX_P HELX_P130 AO4 THR E 32  ? ARG E 37  ? THR E 138 ARG E 143 1 ? 6  
HELX_P HELX_P131 AO5 LEU E 38  ? ILE E 41  ? LEU E 144 ILE E 147 5 ? 4  
HELX_P HELX_P132 AO6 LEU E 44  ? VAL E 50  ? LEU E 150 VAL E 156 5 ? 7  
HELX_P HELX_P133 AO7 ASN E 57  ? GLN E 80  ? ASN E 163 GLN E 186 1 ? 24 
HELX_P HELX_P134 AO8 PRO E 81  ? GLN E 84  ? PRO E 187 GLN E 190 5 ? 4  
HELX_P HELX_P135 AO9 SER E 86  ? HIS E 100 ? SER E 192 HIS E 206 1 ? 15 
HELX_P HELX_P136 AP1 SER E 108 ? ARG E 114 ? SER E 214 ARG E 220 1 ? 7  
HELX_P HELX_P137 AP2 ARG E 114 ? ARG E 120 ? ARG E 220 ARG E 226 1 ? 7  
HELX_P HELX_P138 AP3 THR E 126 ? GLY E 143 ? THR E 232 GLY E 249 1 ? 18 
HELX_P HELX_P139 AP4 GLY E 143 ? TYR E 151 ? GLY E 249 TYR E 257 1 ? 9  
HELX_P HELX_P140 AP5 ILE E 154 ? GLY E 168 ? ILE E 260 GLY E 274 1 ? 15 
HELX_P HELX_P141 AP6 PRO E 185 ? ILE E 194 ? PRO E 291 ILE E 300 5 ? 10 
HELX_P HELX_P142 AP7 ASP E 203 ? GLY E 218 ? ASP E 309 GLY E 324 1 ? 16 
HELX_P HELX_P143 AP8 ASP E 224 ? PHE E 231 ? ASP E 330 PHE E 337 1 ? 8  
HELX_P HELX_P144 AP9 GLU E 249 ? ALA E 267 ? GLU E 355 ALA E 373 1 ? 19 
HELX_P HELX_P145 AQ1 HIS E 270 ? ASP E 288 ? HIS E 376 ASP E 394 1 ? 19 
HELX_P HELX_P146 AQ2 ASP E 289 ? ILE E 291 ? ASP E 395 ILE E 397 5 ? 3  
HELX_P HELX_P147 AQ3 ALA E 296 ? GLY E 298 ? ALA E 402 GLY E 404 5 ? 3  
HELX_P HELX_P148 AQ4 THR E 305 ? ASP E 308 ? THR E 411 ASP E 414 5 ? 4  
HELX_P HELX_P149 AQ5 ASP E 309 ? THR E 314 ? ASP E 415 THR E 420 1 ? 6  
HELX_P HELX_P150 AQ6 LYS E 315 ? THR E 317 ? LYS E 421 THR E 423 5 ? 3  
HELX_P HELX_P151 AQ7 ASP E 318 ? SER E 327 ? ASP E 424 SER E 433 1 ? 10 
HELX_P HELX_P152 AQ8 ASP E 329 ? LYS E 331 ? ASP E 435 LYS E 437 5 ? 3  
HELX_P HELX_P153 AQ9 LEU E 332 ? ARG E 345 ? LEU E 438 ARG E 451 1 ? 14 
HELX_P HELX_P154 AR1 LYS E 363 ? GLU E 368 ? LYS E 469 GLU E 474 5 ? 6  
HELX_P HELX_P155 AR2 SER E 369 ? SER E 376 ? SER E 475 SER E 482 1 ? 8  
HELX_P HELX_P156 AR3 LYS E 388 ? GLU E 390 ? LYS E 494 GLU E 496 5 ? 3  
HELX_P HELX_P157 AR4 ASN E 407 ? VAL E 412 ? ASN E 513 VAL E 518 5 ? 6  
HELX_P HELX_P158 AR5 ASP E 452 ? ARG E 470 ? ASP E 558 ARG E 576 1 ? 19 
HELX_P HELX_P159 AR6 ASP E 477 ? ALA E 482 ? ASP E 583 ALA E 588 1 ? 6  
HELX_P HELX_P160 AR7 ILE E 485 ? ASN E 493 ? ILE E 591 ASN E 599 5 ? 9  
HELX_P HELX_P161 AR8 HIS F 23  ? ASN F 31  ? HIS F 129 ASN F 137 1 ? 9  
HELX_P HELX_P162 AR9 THR F 32  ? ARG F 37  ? THR F 138 ARG F 143 1 ? 6  
HELX_P HELX_P163 AS1 LEU F 38  ? ILE F 41  ? LEU F 144 ILE F 147 5 ? 4  
HELX_P HELX_P164 AS2 LEU F 44  ? VAL F 50  ? LEU F 150 VAL F 156 5 ? 7  
HELX_P HELX_P165 AS3 ASN F 57  ? GLN F 80  ? ASN F 163 GLN F 186 1 ? 24 
HELX_P HELX_P166 AS4 PRO F 81  ? GLN F 84  ? PRO F 187 GLN F 190 5 ? 4  
HELX_P HELX_P167 AS5 SER F 86  ? HIS F 100 ? SER F 192 HIS F 206 1 ? 15 
HELX_P HELX_P168 AS6 SER F 108 ? ARG F 114 ? SER F 214 ARG F 220 1 ? 7  
HELX_P HELX_P169 AS7 ARG F 114 ? ARG F 120 ? ARG F 220 ARG F 226 1 ? 7  
HELX_P HELX_P170 AS8 THR F 126 ? ASN F 142 ? THR F 232 ASN F 248 1 ? 17 
HELX_P HELX_P171 AS9 GLY F 143 ? TYR F 151 ? GLY F 249 TYR F 257 1 ? 9  
HELX_P HELX_P172 AT1 ILE F 154 ? GLY F 168 ? ILE F 260 GLY F 274 1 ? 15 
HELX_P HELX_P173 AT2 PRO F 185 ? ILE F 194 ? PRO F 291 ILE F 300 5 ? 10 
HELX_P HELX_P174 AT3 ASP F 203 ? GLY F 218 ? ASP F 309 GLY F 324 1 ? 16 
HELX_P HELX_P175 AT4 ASP F 224 ? PHE F 231 ? ASP F 330 PHE F 337 1 ? 8  
HELX_P HELX_P176 AT5 GLU F 249 ? ALA F 267 ? GLU F 355 ALA F 373 1 ? 19 
HELX_P HELX_P177 AT6 HIS F 270 ? ASP F 288 ? HIS F 376 ASP F 394 1 ? 19 
HELX_P HELX_P178 AT7 ASP F 289 ? ILE F 291 ? ASP F 395 ILE F 397 5 ? 3  
HELX_P HELX_P179 AT8 ALA F 296 ? GLY F 298 ? ALA F 402 GLY F 404 5 ? 3  
HELX_P HELX_P180 AT9 THR F 305 ? ASP F 308 ? THR F 411 ASP F 414 5 ? 4  
HELX_P HELX_P181 AU1 ASP F 309 ? THR F 314 ? ASP F 415 THR F 420 1 ? 6  
HELX_P HELX_P182 AU2 LYS F 315 ? THR F 317 ? LYS F 421 THR F 423 5 ? 3  
HELX_P HELX_P183 AU3 ASP F 318 ? SER F 327 ? ASP F 424 SER F 433 1 ? 10 
HELX_P HELX_P184 AU4 ASP F 329 ? LYS F 331 ? ASP F 435 LYS F 437 5 ? 3  
HELX_P HELX_P185 AU5 LEU F 332 ? ARG F 345 ? LEU F 438 ARG F 451 1 ? 14 
HELX_P HELX_P186 AU6 LYS F 363 ? GLU F 368 ? LYS F 469 GLU F 474 5 ? 6  
HELX_P HELX_P187 AU7 SER F 369 ? SER F 376 ? SER F 475 SER F 482 1 ? 8  
HELX_P HELX_P188 AU8 LYS F 388 ? GLU F 390 ? LYS F 494 GLU F 496 5 ? 3  
HELX_P HELX_P189 AU9 ASN F 407 ? VAL F 412 ? ASN F 513 VAL F 518 5 ? 6  
HELX_P HELX_P190 AV1 ASP F 452 ? ARG F 470 ? ASP F 558 ARG F 576 1 ? 19 
HELX_P HELX_P191 AV2 ASP F 477 ? ALA F 482 ? ASP F 583 ALA F 588 1 ? 6  
HELX_P HELX_P192 AV3 ILE F 485 ? LYS F 489 ? ILE F 591 LYS F 595 5 ? 5  
HELX_P HELX_P193 AV4 HIS G 23  ? ASN G 31  ? HIS G 129 ASN G 137 1 ? 9  
HELX_P HELX_P194 AV5 THR G 32  ? ARG G 37  ? THR G 138 ARG G 143 1 ? 6  
HELX_P HELX_P195 AV6 LEU G 38  ? ILE G 41  ? LEU G 144 ILE G 147 5 ? 4  
HELX_P HELX_P196 AV7 LEU G 44  ? VAL G 50  ? LEU G 150 VAL G 156 5 ? 7  
HELX_P HELX_P197 AV8 ASN G 57  ? GLN G 80  ? ASN G 163 GLN G 186 1 ? 24 
HELX_P HELX_P198 AV9 PRO G 81  ? GLN G 84  ? PRO G 187 GLN G 190 5 ? 4  
HELX_P HELX_P199 AW1 SER G 86  ? HIS G 100 ? SER G 192 HIS G 206 1 ? 15 
HELX_P HELX_P200 AW2 SER G 108 ? ARG G 114 ? SER G 214 ARG G 220 1 ? 7  
HELX_P HELX_P201 AW3 ARG G 114 ? ARG G 120 ? ARG G 220 ARG G 226 1 ? 7  
HELX_P HELX_P202 AW4 THR G 126 ? GLY G 143 ? THR G 232 GLY G 249 1 ? 18 
HELX_P HELX_P203 AW5 GLY G 143 ? TYR G 151 ? GLY G 249 TYR G 257 1 ? 9  
HELX_P HELX_P204 AW6 ILE G 154 ? GLY G 168 ? ILE G 260 GLY G 274 1 ? 15 
HELX_P HELX_P205 AW7 PRO G 185 ? ILE G 194 ? PRO G 291 ILE G 300 5 ? 10 
HELX_P HELX_P206 AW8 ASP G 203 ? GLY G 218 ? ASP G 309 GLY G 324 1 ? 16 
HELX_P HELX_P207 AW9 ASP G 224 ? PHE G 231 ? ASP G 330 PHE G 337 1 ? 8  
HELX_P HELX_P208 AX1 GLU G 249 ? ALA G 267 ? GLU G 355 ALA G 373 1 ? 19 
HELX_P HELX_P209 AX2 HIS G 270 ? ASP G 288 ? HIS G 376 ASP G 394 1 ? 19 
HELX_P HELX_P210 AX3 ASP G 289 ? ILE G 291 ? ASP G 395 ILE G 397 5 ? 3  
HELX_P HELX_P211 AX4 ALA G 296 ? GLY G 298 ? ALA G 402 GLY G 404 5 ? 3  
HELX_P HELX_P212 AX5 THR G 305 ? ASP G 308 ? THR G 411 ASP G 414 5 ? 4  
HELX_P HELX_P213 AX6 ASP G 309 ? THR G 314 ? ASP G 415 THR G 420 1 ? 6  
HELX_P HELX_P214 AX7 LYS G 315 ? THR G 317 ? LYS G 421 THR G 423 5 ? 3  
HELX_P HELX_P215 AX8 ASP G 318 ? SER G 327 ? ASP G 424 SER G 433 1 ? 10 
HELX_P HELX_P216 AX9 ASP G 329 ? LYS G 331 ? ASP G 435 LYS G 437 5 ? 3  
HELX_P HELX_P217 AY1 LEU G 332 ? ARG G 345 ? LEU G 438 ARG G 451 1 ? 14 
HELX_P HELX_P218 AY2 LYS G 363 ? GLU G 368 ? LYS G 469 GLU G 474 5 ? 6  
HELX_P HELX_P219 AY3 SER G 369 ? SER G 376 ? SER G 475 SER G 482 1 ? 8  
HELX_P HELX_P220 AY4 LYS G 388 ? GLU G 390 ? LYS G 494 GLU G 496 5 ? 3  
HELX_P HELX_P221 AY5 ASN G 407 ? VAL G 412 ? ASN G 513 VAL G 518 5 ? 6  
HELX_P HELX_P222 AY6 ASP G 452 ? ARG G 470 ? ASP G 558 ARG G 576 1 ? 19 
HELX_P HELX_P223 AY7 ASP G 477 ? ALA G 482 ? ASP G 583 ALA G 588 1 ? 6  
HELX_P HELX_P224 AY8 ILE G 485 ? LYS G 489 ? ILE G 591 LYS G 595 5 ? 5  
HELX_P HELX_P225 AY9 HIS H 23  ? ASN H 31  ? HIS H 129 ASN H 137 1 ? 9  
HELX_P HELX_P226 AZ1 THR H 32  ? ARG H 37  ? THR H 138 ARG H 143 1 ? 6  
HELX_P HELX_P227 AZ2 LEU H 38  ? ILE H 41  ? LEU H 144 ILE H 147 5 ? 4  
HELX_P HELX_P228 AZ3 LEU H 44  ? VAL H 50  ? LEU H 150 VAL H 156 5 ? 7  
HELX_P HELX_P229 AZ4 ASN H 57  ? GLN H 80  ? ASN H 163 GLN H 186 1 ? 24 
HELX_P HELX_P230 AZ5 PRO H 81  ? GLN H 84  ? PRO H 187 GLN H 190 5 ? 4  
HELX_P HELX_P231 AZ6 SER H 86  ? HIS H 100 ? SER H 192 HIS H 206 1 ? 15 
HELX_P HELX_P232 AZ7 SER H 108 ? ARG H 114 ? SER H 214 ARG H 220 1 ? 7  
HELX_P HELX_P233 AZ8 ARG H 114 ? ARG H 120 ? ARG H 220 ARG H 226 1 ? 7  
HELX_P HELX_P234 AZ9 THR H 126 ? ASN H 142 ? THR H 232 ASN H 248 1 ? 17 
HELX_P HELX_P235 BA1 GLY H 143 ? TYR H 151 ? GLY H 249 TYR H 257 1 ? 9  
HELX_P HELX_P236 BA2 ILE H 154 ? GLY H 168 ? ILE H 260 GLY H 274 1 ? 15 
HELX_P HELX_P237 BA3 PRO H 185 ? ILE H 194 ? PRO H 291 ILE H 300 5 ? 10 
HELX_P HELX_P238 BA4 ASP H 203 ? GLY H 218 ? ASP H 309 GLY H 324 1 ? 16 
HELX_P HELX_P239 BA5 ASP H 224 ? PHE H 231 ? ASP H 330 PHE H 337 1 ? 8  
HELX_P HELX_P240 BA6 GLU H 249 ? ALA H 267 ? GLU H 355 ALA H 373 1 ? 19 
HELX_P HELX_P241 BA7 HIS H 270 ? ASP H 288 ? HIS H 376 ASP H 394 1 ? 19 
HELX_P HELX_P242 BA8 ASP H 289 ? ILE H 291 ? ASP H 395 ILE H 397 5 ? 3  
HELX_P HELX_P243 BA9 ALA H 296 ? GLY H 298 ? ALA H 402 GLY H 404 5 ? 3  
HELX_P HELX_P244 BB1 THR H 305 ? ASP H 308 ? THR H 411 ASP H 414 5 ? 4  
HELX_P HELX_P245 BB2 ASP H 309 ? THR H 314 ? ASP H 415 THR H 420 1 ? 6  
HELX_P HELX_P246 BB3 LYS H 315 ? THR H 317 ? LYS H 421 THR H 423 5 ? 3  
HELX_P HELX_P247 BB4 ASP H 318 ? SER H 327 ? ASP H 424 SER H 433 1 ? 10 
HELX_P HELX_P248 BB5 ASP H 329 ? LYS H 331 ? ASP H 435 LYS H 437 5 ? 3  
HELX_P HELX_P249 BB6 LEU H 332 ? ARG H 345 ? LEU H 438 ARG H 451 1 ? 14 
HELX_P HELX_P250 BB7 LYS H 363 ? GLU H 368 ? LYS H 469 GLU H 474 5 ? 6  
HELX_P HELX_P251 BB8 SER H 369 ? SER H 376 ? SER H 475 SER H 482 1 ? 8  
HELX_P HELX_P252 BB9 LYS H 388 ? GLU H 390 ? LYS H 494 GLU H 496 5 ? 3  
HELX_P HELX_P253 BC1 ASN H 407 ? VAL H 412 ? ASN H 513 VAL H 518 5 ? 6  
HELX_P HELX_P254 BC2 ASP H 452 ? ARG H 470 ? ASP H 558 ARG H 576 1 ? 19 
HELX_P HELX_P255 BC3 ASP H 477 ? ALA H 482 ? ASP H 583 ALA H 588 1 ? 6  
HELX_P HELX_P256 BC4 ILE H 485 ? ASN H 493 ? ILE H 591 ASN H 599 5 ? 9  
HELX_P HELX_P257 BC5 HIS I 23  ? ASN I 31  ? HIS I 129 ASN I 137 1 ? 9  
HELX_P HELX_P258 BC6 THR I 32  ? ARG I 37  ? THR I 138 ARG I 143 1 ? 6  
HELX_P HELX_P259 BC7 LEU I 38  ? ILE I 41  ? LEU I 144 ILE I 147 5 ? 4  
HELX_P HELX_P260 BC8 LEU I 44  ? VAL I 50  ? LEU I 150 VAL I 156 5 ? 7  
HELX_P HELX_P261 BC9 ASN I 57  ? GLN I 80  ? ASN I 163 GLN I 186 1 ? 24 
HELX_P HELX_P262 BD1 PRO I 81  ? GLN I 84  ? PRO I 187 GLN I 190 5 ? 4  
HELX_P HELX_P263 BD2 SER I 86  ? HIS I 100 ? SER I 192 HIS I 206 1 ? 15 
HELX_P HELX_P264 BD3 SER I 108 ? ARG I 114 ? SER I 214 ARG I 220 1 ? 7  
HELX_P HELX_P265 BD4 ARG I 114 ? ARG I 120 ? ARG I 220 ARG I 226 1 ? 7  
HELX_P HELX_P266 BD5 THR I 126 ? ASN I 142 ? THR I 232 ASN I 248 1 ? 17 
HELX_P HELX_P267 BD6 GLY I 143 ? TYR I 151 ? GLY I 249 TYR I 257 1 ? 9  
HELX_P HELX_P268 BD7 ILE I 154 ? GLY I 168 ? ILE I 260 GLY I 274 1 ? 15 
HELX_P HELX_P269 BD8 PRO I 185 ? ILE I 194 ? PRO I 291 ILE I 300 5 ? 10 
HELX_P HELX_P270 BD9 ASP I 203 ? GLY I 218 ? ASP I 309 GLY I 324 1 ? 16 
HELX_P HELX_P271 BE1 ASP I 224 ? PHE I 231 ? ASP I 330 PHE I 337 1 ? 8  
HELX_P HELX_P272 BE2 GLU I 249 ? ALA I 267 ? GLU I 355 ALA I 373 1 ? 19 
HELX_P HELX_P273 BE3 HIS I 270 ? ASP I 288 ? HIS I 376 ASP I 394 1 ? 19 
HELX_P HELX_P274 BE4 ASP I 289 ? ILE I 291 ? ASP I 395 ILE I 397 5 ? 3  
HELX_P HELX_P275 BE5 ALA I 296 ? GLY I 298 ? ALA I 402 GLY I 404 5 ? 3  
HELX_P HELX_P276 BE6 THR I 305 ? ASP I 308 ? THR I 411 ASP I 414 5 ? 4  
HELX_P HELX_P277 BE7 ASP I 309 ? THR I 314 ? ASP I 415 THR I 420 1 ? 6  
HELX_P HELX_P278 BE8 LYS I 315 ? THR I 317 ? LYS I 421 THR I 423 5 ? 3  
HELX_P HELX_P279 BE9 ASP I 318 ? SER I 327 ? ASP I 424 SER I 433 1 ? 10 
HELX_P HELX_P280 BF1 ASP I 329 ? LYS I 331 ? ASP I 435 LYS I 437 5 ? 3  
HELX_P HELX_P281 BF2 LEU I 332 ? ARG I 345 ? LEU I 438 ARG I 451 1 ? 14 
HELX_P HELX_P282 BF3 LYS I 363 ? GLU I 368 ? LYS I 469 GLU I 474 5 ? 6  
HELX_P HELX_P283 BF4 SER I 369 ? SER I 376 ? SER I 475 SER I 482 1 ? 8  
HELX_P HELX_P284 BF5 LYS I 388 ? GLU I 390 ? LYS I 494 GLU I 496 5 ? 3  
HELX_P HELX_P285 BF6 ASN I 407 ? VAL I 412 ? ASN I 513 VAL I 518 5 ? 6  
HELX_P HELX_P286 BF7 ASP I 452 ? ARG I 470 ? ASP I 558 ARG I 576 1 ? 19 
HELX_P HELX_P287 BF8 ASP I 477 ? ALA I 482 ? ASP I 583 ALA I 588 1 ? 6  
HELX_P HELX_P288 BF9 ILE I 485 ? ASN I 493 ? ILE I 591 ASN I 599 5 ? 9  
HELX_P HELX_P289 BG1 HIS J 23  ? ASN J 31  ? HIS J 129 ASN J 137 1 ? 9  
HELX_P HELX_P290 BG2 THR J 32  ? ARG J 37  ? THR J 138 ARG J 143 1 ? 6  
HELX_P HELX_P291 BG3 LEU J 38  ? ILE J 41  ? LEU J 144 ILE J 147 5 ? 4  
HELX_P HELX_P292 BG4 LEU J 44  ? VAL J 50  ? LEU J 150 VAL J 156 5 ? 7  
HELX_P HELX_P293 BG5 ASN J 57  ? GLN J 80  ? ASN J 163 GLN J 186 1 ? 24 
HELX_P HELX_P294 BG6 PRO J 81  ? GLN J 84  ? PRO J 187 GLN J 190 5 ? 4  
HELX_P HELX_P295 BG7 SER J 86  ? HIS J 100 ? SER J 192 HIS J 206 1 ? 15 
HELX_P HELX_P296 BG8 SER J 108 ? ARG J 114 ? SER J 214 ARG J 220 1 ? 7  
HELX_P HELX_P297 BG9 ARG J 114 ? ARG J 120 ? ARG J 220 ARG J 226 1 ? 7  
HELX_P HELX_P298 BH1 THR J 126 ? GLY J 143 ? THR J 232 GLY J 249 1 ? 18 
HELX_P HELX_P299 BH2 GLY J 143 ? TYR J 151 ? GLY J 249 TYR J 257 1 ? 9  
HELX_P HELX_P300 BH3 ILE J 154 ? GLY J 168 ? ILE J 260 GLY J 274 1 ? 15 
HELX_P HELX_P301 BH4 PRO J 185 ? ILE J 194 ? PRO J 291 ILE J 300 5 ? 10 
HELX_P HELX_P302 BH5 ASP J 203 ? GLY J 218 ? ASP J 309 GLY J 324 1 ? 16 
HELX_P HELX_P303 BH6 ASP J 224 ? PHE J 231 ? ASP J 330 PHE J 337 1 ? 8  
HELX_P HELX_P304 BH7 GLU J 249 ? ALA J 267 ? GLU J 355 ALA J 373 1 ? 19 
HELX_P HELX_P305 BH8 HIS J 270 ? ASP J 288 ? HIS J 376 ASP J 394 1 ? 19 
HELX_P HELX_P306 BH9 ASP J 289 ? ILE J 291 ? ASP J 395 ILE J 397 5 ? 3  
HELX_P HELX_P307 BI1 ALA J 296 ? GLY J 298 ? ALA J 402 GLY J 404 5 ? 3  
HELX_P HELX_P308 BI2 THR J 305 ? ASP J 308 ? THR J 411 ASP J 414 5 ? 4  
HELX_P HELX_P309 BI3 ASP J 309 ? THR J 314 ? ASP J 415 THR J 420 1 ? 6  
HELX_P HELX_P310 BI4 LYS J 315 ? THR J 317 ? LYS J 421 THR J 423 5 ? 3  
HELX_P HELX_P311 BI5 ASP J 318 ? SER J 327 ? ASP J 424 SER J 433 1 ? 10 
HELX_P HELX_P312 BI6 ASP J 329 ? LYS J 331 ? ASP J 435 LYS J 437 5 ? 3  
HELX_P HELX_P313 BI7 LEU J 332 ? ARG J 345 ? LEU J 438 ARG J 451 1 ? 14 
HELX_P HELX_P314 BI8 LYS J 363 ? GLU J 368 ? LYS J 469 GLU J 474 5 ? 6  
HELX_P HELX_P315 BI9 SER J 369 ? SER J 376 ? SER J 475 SER J 482 1 ? 8  
HELX_P HELX_P316 BJ1 LYS J 388 ? GLU J 390 ? LYS J 494 GLU J 496 5 ? 3  
HELX_P HELX_P317 BJ2 ASN J 407 ? VAL J 412 ? ASN J 513 VAL J 518 5 ? 6  
HELX_P HELX_P318 BJ3 ASP J 452 ? ARG J 470 ? ASP J 558 ARG J 576 1 ? 19 
HELX_P HELX_P319 BJ4 ASP J 477 ? ALA J 482 ? ASP J 583 ALA J 588 1 ? 6  
HELX_P HELX_P320 BJ5 ILE J 485 ? LYS J 489 ? ILE J 591 LYS J 595 5 ? 5  
HELX_P HELX_P321 BJ6 HIS K 23  ? ASN K 31  ? HIS K 129 ASN K 137 1 ? 9  
HELX_P HELX_P322 BJ7 THR K 32  ? ARG K 37  ? THR K 138 ARG K 143 1 ? 6  
HELX_P HELX_P323 BJ8 LEU K 38  ? ILE K 41  ? LEU K 144 ILE K 147 5 ? 4  
HELX_P HELX_P324 BJ9 LEU K 44  ? VAL K 50  ? LEU K 150 VAL K 156 5 ? 7  
HELX_P HELX_P325 BK1 ASN K 57  ? GLN K 80  ? ASN K 163 GLN K 186 1 ? 24 
HELX_P HELX_P326 BK2 PRO K 81  ? GLN K 84  ? PRO K 187 GLN K 190 5 ? 4  
HELX_P HELX_P327 BK3 SER K 86  ? HIS K 100 ? SER K 192 HIS K 206 1 ? 15 
HELX_P HELX_P328 BK4 SER K 108 ? ARG K 114 ? SER K 214 ARG K 220 1 ? 7  
HELX_P HELX_P329 BK5 ARG K 114 ? ARG K 120 ? ARG K 220 ARG K 226 1 ? 7  
HELX_P HELX_P330 BK6 THR K 126 ? GLY K 143 ? THR K 232 GLY K 249 1 ? 18 
HELX_P HELX_P331 BK7 GLY K 143 ? TYR K 151 ? GLY K 249 TYR K 257 1 ? 9  
HELX_P HELX_P332 BK8 ILE K 154 ? GLY K 168 ? ILE K 260 GLY K 274 1 ? 15 
HELX_P HELX_P333 BK9 PRO K 185 ? ILE K 194 ? PRO K 291 ILE K 300 5 ? 10 
HELX_P HELX_P334 BL1 ASP K 203 ? GLY K 218 ? ASP K 309 GLY K 324 1 ? 16 
HELX_P HELX_P335 BL2 ASP K 224 ? PHE K 231 ? ASP K 330 PHE K 337 1 ? 8  
HELX_P HELX_P336 BL3 GLU K 249 ? ALA K 267 ? GLU K 355 ALA K 373 1 ? 19 
HELX_P HELX_P337 BL4 HIS K 270 ? ASP K 288 ? HIS K 376 ASP K 394 1 ? 19 
HELX_P HELX_P338 BL5 ASP K 289 ? ILE K 291 ? ASP K 395 ILE K 397 5 ? 3  
HELX_P HELX_P339 BL6 ALA K 296 ? GLY K 298 ? ALA K 402 GLY K 404 5 ? 3  
HELX_P HELX_P340 BL7 THR K 305 ? ASP K 308 ? THR K 411 ASP K 414 5 ? 4  
HELX_P HELX_P341 BL8 ASP K 309 ? THR K 314 ? ASP K 415 THR K 420 1 ? 6  
HELX_P HELX_P342 BL9 LYS K 315 ? THR K 317 ? LYS K 421 THR K 423 5 ? 3  
HELX_P HELX_P343 BM1 ASP K 318 ? SER K 327 ? ASP K 424 SER K 433 1 ? 10 
HELX_P HELX_P344 BM2 ASP K 329 ? LYS K 331 ? ASP K 435 LYS K 437 5 ? 3  
HELX_P HELX_P345 BM3 LEU K 332 ? ARG K 345 ? LEU K 438 ARG K 451 1 ? 14 
HELX_P HELX_P346 BM4 LYS K 363 ? GLU K 368 ? LYS K 469 GLU K 474 5 ? 6  
HELX_P HELX_P347 BM5 SER K 369 ? SER K 376 ? SER K 475 SER K 482 1 ? 8  
HELX_P HELX_P348 BM6 LYS K 388 ? GLU K 390 ? LYS K 494 GLU K 496 5 ? 3  
HELX_P HELX_P349 BM7 ASN K 407 ? VAL K 412 ? ASN K 513 VAL K 518 5 ? 6  
HELX_P HELX_P350 BM8 ASP K 452 ? ARG K 470 ? ASP K 558 ARG K 576 1 ? 19 
HELX_P HELX_P351 BM9 ASP K 477 ? ALA K 482 ? ASP K 583 ALA K 588 1 ? 6  
HELX_P HELX_P352 BN1 ILE K 485 ? ASN K 493 ? ILE K 591 ASN K 599 5 ? 9  
HELX_P HELX_P353 BN2 HIS L 23  ? ASN L 31  ? HIS L 129 ASN L 137 1 ? 9  
HELX_P HELX_P354 BN3 THR L 32  ? ARG L 37  ? THR L 138 ARG L 143 1 ? 6  
HELX_P HELX_P355 BN4 LEU L 38  ? ILE L 41  ? LEU L 144 ILE L 147 5 ? 4  
HELX_P HELX_P356 BN5 LEU L 44  ? VAL L 50  ? LEU L 150 VAL L 156 5 ? 7  
HELX_P HELX_P357 BN6 ASN L 57  ? GLN L 80  ? ASN L 163 GLN L 186 1 ? 24 
HELX_P HELX_P358 BN7 PRO L 81  ? GLN L 84  ? PRO L 187 GLN L 190 5 ? 4  
HELX_P HELX_P359 BN8 SER L 86  ? HIS L 100 ? SER L 192 HIS L 206 1 ? 15 
HELX_P HELX_P360 BN9 SER L 108 ? ARG L 114 ? SER L 214 ARG L 220 1 ? 7  
HELX_P HELX_P361 BO1 ARG L 114 ? ARG L 120 ? ARG L 220 ARG L 226 1 ? 7  
HELX_P HELX_P362 BO2 THR L 126 ? GLY L 143 ? THR L 232 GLY L 249 1 ? 18 
HELX_P HELX_P363 BO3 GLY L 143 ? TYR L 151 ? GLY L 249 TYR L 257 1 ? 9  
HELX_P HELX_P364 BO4 ILE L 154 ? GLY L 168 ? ILE L 260 GLY L 274 1 ? 15 
HELX_P HELX_P365 BO5 PRO L 185 ? ILE L 194 ? PRO L 291 ILE L 300 5 ? 10 
HELX_P HELX_P366 BO6 ASP L 203 ? GLY L 218 ? ASP L 309 GLY L 324 1 ? 16 
HELX_P HELX_P367 BO7 ASP L 224 ? PHE L 231 ? ASP L 330 PHE L 337 1 ? 8  
HELX_P HELX_P368 BO8 GLU L 249 ? ALA L 267 ? GLU L 355 ALA L 373 1 ? 19 
HELX_P HELX_P369 BO9 HIS L 270 ? ASP L 288 ? HIS L 376 ASP L 394 1 ? 19 
HELX_P HELX_P370 BP1 ASP L 289 ? ILE L 291 ? ASP L 395 ILE L 397 5 ? 3  
HELX_P HELX_P371 BP2 ALA L 296 ? GLY L 298 ? ALA L 402 GLY L 404 5 ? 3  
HELX_P HELX_P372 BP3 THR L 305 ? ASP L 308 ? THR L 411 ASP L 414 5 ? 4  
HELX_P HELX_P373 BP4 ASP L 309 ? THR L 314 ? ASP L 415 THR L 420 1 ? 6  
HELX_P HELX_P374 BP5 LYS L 315 ? THR L 317 ? LYS L 421 THR L 423 5 ? 3  
HELX_P HELX_P375 BP6 ASP L 318 ? SER L 327 ? ASP L 424 SER L 433 1 ? 10 
HELX_P HELX_P376 BP7 ASP L 329 ? LYS L 331 ? ASP L 435 LYS L 437 5 ? 3  
HELX_P HELX_P377 BP8 LEU L 332 ? ARG L 345 ? LEU L 438 ARG L 451 1 ? 14 
HELX_P HELX_P378 BP9 LYS L 363 ? GLU L 368 ? LYS L 469 GLU L 474 5 ? 6  
HELX_P HELX_P379 BQ1 SER L 369 ? SER L 376 ? SER L 475 SER L 482 1 ? 8  
HELX_P HELX_P380 BQ2 LYS L 388 ? GLU L 390 ? LYS L 494 GLU L 496 5 ? 3  
HELX_P HELX_P381 BQ3 ASN L 407 ? VAL L 412 ? ASN L 513 VAL L 518 5 ? 6  
HELX_P HELX_P382 BQ4 ASP L 452 ? ARG L 470 ? ASP L 558 ARG L 576 1 ? 19 
HELX_P HELX_P383 BQ5 ASP L 477 ? ALA L 482 ? ASP L 583 ALA L 588 1 ? 6  
HELX_P HELX_P384 BQ6 ILE L 485 ? ASN L 493 ? ILE L 591 ASN L 599 5 ? 9  
HELX_P HELX_P385 BQ7 HIS M 23  ? ASN M 31  ? HIS M 129 ASN M 137 1 ? 9  
HELX_P HELX_P386 BQ8 THR M 32  ? ARG M 37  ? THR M 138 ARG M 143 1 ? 6  
HELX_P HELX_P387 BQ9 LEU M 38  ? ILE M 41  ? LEU M 144 ILE M 147 5 ? 4  
HELX_P HELX_P388 BR1 LEU M 44  ? VAL M 50  ? LEU M 150 VAL M 156 5 ? 7  
HELX_P HELX_P389 BR2 ASN M 57  ? GLN M 80  ? ASN M 163 GLN M 186 1 ? 24 
HELX_P HELX_P390 BR3 PRO M 81  ? GLN M 84  ? PRO M 187 GLN M 190 5 ? 4  
HELX_P HELX_P391 BR4 SER M 86  ? HIS M 100 ? SER M 192 HIS M 206 1 ? 15 
HELX_P HELX_P392 BR5 SER M 108 ? ARG M 114 ? SER M 214 ARG M 220 1 ? 7  
HELX_P HELX_P393 BR6 ARG M 114 ? ARG M 120 ? ARG M 220 ARG M 226 1 ? 7  
HELX_P HELX_P394 BR7 THR M 126 ? ASN M 142 ? THR M 232 ASN M 248 1 ? 17 
HELX_P HELX_P395 BR8 GLY M 143 ? TYR M 151 ? GLY M 249 TYR M 257 1 ? 9  
HELX_P HELX_P396 BR9 ILE M 154 ? GLY M 168 ? ILE M 260 GLY M 274 1 ? 15 
HELX_P HELX_P397 BS1 PRO M 185 ? ILE M 194 ? PRO M 291 ILE M 300 5 ? 10 
HELX_P HELX_P398 BS2 ASP M 203 ? GLY M 218 ? ASP M 309 GLY M 324 1 ? 16 
HELX_P HELX_P399 BS3 ASP M 224 ? PHE M 231 ? ASP M 330 PHE M 337 1 ? 8  
HELX_P HELX_P400 BS4 GLU M 249 ? ALA M 267 ? GLU M 355 ALA M 373 1 ? 19 
HELX_P HELX_P401 BS5 HIS M 270 ? ASP M 288 ? HIS M 376 ASP M 394 1 ? 19 
HELX_P HELX_P402 BS6 ASP M 289 ? ILE M 291 ? ASP M 395 ILE M 397 5 ? 3  
HELX_P HELX_P403 BS7 ALA M 296 ? GLY M 298 ? ALA M 402 GLY M 404 5 ? 3  
HELX_P HELX_P404 BS8 THR M 305 ? ASP M 308 ? THR M 411 ASP M 414 5 ? 4  
HELX_P HELX_P405 BS9 ASP M 309 ? THR M 314 ? ASP M 415 THR M 420 1 ? 6  
HELX_P HELX_P406 BT1 LYS M 315 ? THR M 317 ? LYS M 421 THR M 423 5 ? 3  
HELX_P HELX_P407 BT2 ASP M 318 ? SER M 327 ? ASP M 424 SER M 433 1 ? 10 
HELX_P HELX_P408 BT3 ASP M 329 ? LYS M 331 ? ASP M 435 LYS M 437 5 ? 3  
HELX_P HELX_P409 BT4 LEU M 332 ? ARG M 345 ? LEU M 438 ARG M 451 1 ? 14 
HELX_P HELX_P410 BT5 LYS M 363 ? GLU M 368 ? LYS M 469 GLU M 474 5 ? 6  
HELX_P HELX_P411 BT6 SER M 369 ? SER M 376 ? SER M 475 SER M 482 1 ? 8  
HELX_P HELX_P412 BT7 LYS M 388 ? GLU M 390 ? LYS M 494 GLU M 496 5 ? 3  
HELX_P HELX_P413 BT8 ASN M 407 ? VAL M 412 ? ASN M 513 VAL M 518 5 ? 6  
HELX_P HELX_P414 BT9 ASP M 452 ? ARG M 470 ? ASP M 558 ARG M 576 1 ? 19 
HELX_P HELX_P415 BU1 ASP M 477 ? ALA M 482 ? ASP M 583 ALA M 588 1 ? 6  
HELX_P HELX_P416 BU2 ILE M 485 ? ASN M 493 ? ILE M 591 ASN M 599 5 ? 9  
HELX_P HELX_P417 BU3 HIS N 23  ? ASN N 31  ? HIS N 129 ASN N 137 1 ? 9  
HELX_P HELX_P418 BU4 THR N 32  ? ARG N 37  ? THR N 138 ARG N 143 1 ? 6  
HELX_P HELX_P419 BU5 LEU N 38  ? ILE N 41  ? LEU N 144 ILE N 147 5 ? 4  
HELX_P HELX_P420 BU6 LEU N 44  ? VAL N 50  ? LEU N 150 VAL N 156 5 ? 7  
HELX_P HELX_P421 BU7 ASN N 57  ? GLN N 80  ? ASN N 163 GLN N 186 1 ? 24 
HELX_P HELX_P422 BU8 PRO N 81  ? GLN N 84  ? PRO N 187 GLN N 190 5 ? 4  
HELX_P HELX_P423 BU9 SER N 86  ? HIS N 100 ? SER N 192 HIS N 206 1 ? 15 
HELX_P HELX_P424 BV1 SER N 108 ? ARG N 114 ? SER N 214 ARG N 220 1 ? 7  
HELX_P HELX_P425 BV2 ARG N 114 ? ARG N 120 ? ARG N 220 ARG N 226 1 ? 7  
HELX_P HELX_P426 BV3 THR N 126 ? GLY N 143 ? THR N 232 GLY N 249 1 ? 18 
HELX_P HELX_P427 BV4 GLY N 143 ? TYR N 151 ? GLY N 249 TYR N 257 1 ? 9  
HELX_P HELX_P428 BV5 ILE N 154 ? GLY N 168 ? ILE N 260 GLY N 274 1 ? 15 
HELX_P HELX_P429 BV6 PRO N 185 ? ILE N 194 ? PRO N 291 ILE N 300 5 ? 10 
HELX_P HELX_P430 BV7 ASP N 203 ? GLY N 218 ? ASP N 309 GLY N 324 1 ? 16 
HELX_P HELX_P431 BV8 ASP N 224 ? PHE N 231 ? ASP N 330 PHE N 337 1 ? 8  
HELX_P HELX_P432 BV9 GLU N 249 ? ALA N 267 ? GLU N 355 ALA N 373 1 ? 19 
HELX_P HELX_P433 BW1 HIS N 270 ? ASP N 288 ? HIS N 376 ASP N 394 1 ? 19 
HELX_P HELX_P434 BW2 ASP N 289 ? ILE N 291 ? ASP N 395 ILE N 397 5 ? 3  
HELX_P HELX_P435 BW3 ALA N 296 ? GLY N 298 ? ALA N 402 GLY N 404 5 ? 3  
HELX_P HELX_P436 BW4 THR N 305 ? ASP N 308 ? THR N 411 ASP N 414 5 ? 4  
HELX_P HELX_P437 BW5 ASP N 309 ? THR N 314 ? ASP N 415 THR N 420 1 ? 6  
HELX_P HELX_P438 BW6 LYS N 315 ? THR N 317 ? LYS N 421 THR N 423 5 ? 3  
HELX_P HELX_P439 BW7 ASP N 318 ? SER N 327 ? ASP N 424 SER N 433 1 ? 10 
HELX_P HELX_P440 BW8 ASP N 329 ? LYS N 331 ? ASP N 435 LYS N 437 5 ? 3  
HELX_P HELX_P441 BW9 LEU N 332 ? ARG N 345 ? LEU N 438 ARG N 451 1 ? 14 
HELX_P HELX_P442 BX1 LYS N 363 ? GLU N 368 ? LYS N 469 GLU N 474 5 ? 6  
HELX_P HELX_P443 BX2 SER N 369 ? SER N 376 ? SER N 475 SER N 482 1 ? 8  
HELX_P HELX_P444 BX3 LYS N 388 ? GLU N 390 ? LYS N 494 GLU N 496 5 ? 3  
HELX_P HELX_P445 BX4 ASN N 407 ? VAL N 412 ? ASN N 513 VAL N 518 5 ? 6  
HELX_P HELX_P446 BX5 ASP N 452 ? ARG N 470 ? ASP N 558 ARG N 576 1 ? 19 
HELX_P HELX_P447 BX6 ASP N 477 ? ALA N 482 ? ASP N 583 ALA N 588 1 ? 6  
HELX_P HELX_P448 BX7 ILE N 485 ? ASN N 493 ? ILE N 591 ASN N 599 5 ? 9  
HELX_P HELX_P449 BX8 HIS O 23  ? ASN O 31  ? HIS O 129 ASN O 137 1 ? 9  
HELX_P HELX_P450 BX9 THR O 32  ? ARG O 37  ? THR O 138 ARG O 143 1 ? 6  
HELX_P HELX_P451 BY1 LEU O 38  ? ILE O 41  ? LEU O 144 ILE O 147 5 ? 4  
HELX_P HELX_P452 BY2 LEU O 44  ? VAL O 50  ? LEU O 150 VAL O 156 5 ? 7  
HELX_P HELX_P453 BY3 ASN O 57  ? GLN O 80  ? ASN O 163 GLN O 186 1 ? 24 
HELX_P HELX_P454 BY4 PRO O 81  ? GLN O 84  ? PRO O 187 GLN O 190 5 ? 4  
HELX_P HELX_P455 BY5 SER O 86  ? HIS O 100 ? SER O 192 HIS O 206 1 ? 15 
HELX_P HELX_P456 BY6 SER O 108 ? ARG O 114 ? SER O 214 ARG O 220 1 ? 7  
HELX_P HELX_P457 BY7 ARG O 114 ? ARG O 120 ? ARG O 220 ARG O 226 1 ? 7  
HELX_P HELX_P458 BY8 THR O 126 ? GLY O 143 ? THR O 232 GLY O 249 1 ? 18 
HELX_P HELX_P459 BY9 GLY O 143 ? TYR O 151 ? GLY O 249 TYR O 257 1 ? 9  
HELX_P HELX_P460 BZ1 ILE O 154 ? GLY O 168 ? ILE O 260 GLY O 274 1 ? 15 
HELX_P HELX_P461 BZ2 PRO O 185 ? ILE O 194 ? PRO O 291 ILE O 300 5 ? 10 
HELX_P HELX_P462 BZ3 ASP O 203 ? GLY O 218 ? ASP O 309 GLY O 324 1 ? 16 
HELX_P HELX_P463 BZ4 ASP O 224 ? PHE O 231 ? ASP O 330 PHE O 337 1 ? 8  
HELX_P HELX_P464 BZ5 GLU O 249 ? ALA O 267 ? GLU O 355 ALA O 373 1 ? 19 
HELX_P HELX_P465 BZ6 HIS O 270 ? ASP O 288 ? HIS O 376 ASP O 394 1 ? 19 
HELX_P HELX_P466 BZ7 ASP O 289 ? ILE O 291 ? ASP O 395 ILE O 397 5 ? 3  
HELX_P HELX_P467 BZ8 ALA O 296 ? GLY O 298 ? ALA O 402 GLY O 404 5 ? 3  
HELX_P HELX_P468 BZ9 THR O 305 ? ASP O 308 ? THR O 411 ASP O 414 5 ? 4  
HELX_P HELX_P469 CA1 ASP O 309 ? THR O 314 ? ASP O 415 THR O 420 1 ? 6  
HELX_P HELX_P470 CA2 LYS O 315 ? THR O 317 ? LYS O 421 THR O 423 5 ? 3  
HELX_P HELX_P471 CA3 ASP O 318 ? SER O 327 ? ASP O 424 SER O 433 1 ? 10 
HELX_P HELX_P472 CA4 ASP O 329 ? LYS O 331 ? ASP O 435 LYS O 437 5 ? 3  
HELX_P HELX_P473 CA5 LEU O 332 ? ARG O 345 ? LEU O 438 ARG O 451 1 ? 14 
HELX_P HELX_P474 CA6 LYS O 363 ? GLU O 368 ? LYS O 469 GLU O 474 5 ? 6  
HELX_P HELX_P475 CA7 SER O 369 ? SER O 376 ? SER O 475 SER O 482 1 ? 8  
HELX_P HELX_P476 CA8 LYS O 388 ? GLU O 390 ? LYS O 494 GLU O 496 5 ? 3  
HELX_P HELX_P477 CA9 ASN O 407 ? VAL O 412 ? ASN O 513 VAL O 518 5 ? 6  
HELX_P HELX_P478 CB1 ASP O 452 ? ARG O 470 ? ASP O 558 ARG O 576 1 ? 19 
HELX_P HELX_P479 CB2 ASP O 477 ? ALA O 482 ? ASP O 583 ALA O 588 1 ? 6  
HELX_P HELX_P480 CB3 ILE O 485 ? ASN O 493 ? ILE O 591 ASN O 599 5 ? 9  
HELX_P HELX_P481 CB4 HIS P 23  ? ASN P 31  ? HIS P 129 ASN P 137 1 ? 9  
HELX_P HELX_P482 CB5 THR P 32  ? ARG P 37  ? THR P 138 ARG P 143 1 ? 6  
HELX_P HELX_P483 CB6 LEU P 38  ? ILE P 41  ? LEU P 144 ILE P 147 5 ? 4  
HELX_P HELX_P484 CB7 LEU P 44  ? VAL P 50  ? LEU P 150 VAL P 156 5 ? 7  
HELX_P HELX_P485 CB8 ASN P 57  ? GLN P 80  ? ASN P 163 GLN P 186 1 ? 24 
HELX_P HELX_P486 CB9 PRO P 81  ? GLN P 84  ? PRO P 187 GLN P 190 5 ? 4  
HELX_P HELX_P487 CC1 SER P 86  ? HIS P 100 ? SER P 192 HIS P 206 1 ? 15 
HELX_P HELX_P488 CC2 SER P 108 ? ARG P 114 ? SER P 214 ARG P 220 1 ? 7  
HELX_P HELX_P489 CC3 ARG P 114 ? ARG P 120 ? ARG P 220 ARG P 226 1 ? 7  
HELX_P HELX_P490 CC4 THR P 126 ? GLY P 143 ? THR P 232 GLY P 249 1 ? 18 
HELX_P HELX_P491 CC5 GLY P 143 ? TYR P 151 ? GLY P 249 TYR P 257 1 ? 9  
HELX_P HELX_P492 CC6 ILE P 154 ? GLY P 168 ? ILE P 260 GLY P 274 1 ? 15 
HELX_P HELX_P493 CC7 PRO P 185 ? ILE P 194 ? PRO P 291 ILE P 300 5 ? 10 
HELX_P HELX_P494 CC8 ASP P 203 ? GLY P 218 ? ASP P 309 GLY P 324 1 ? 16 
HELX_P HELX_P495 CC9 ASP P 224 ? PHE P 231 ? ASP P 330 PHE P 337 1 ? 8  
HELX_P HELX_P496 CD1 GLU P 249 ? ALA P 267 ? GLU P 355 ALA P 373 1 ? 19 
HELX_P HELX_P497 CD2 HIS P 270 ? ASP P 288 ? HIS P 376 ASP P 394 1 ? 19 
HELX_P HELX_P498 CD3 ASP P 289 ? ILE P 291 ? ASP P 395 ILE P 397 5 ? 3  
HELX_P HELX_P499 CD4 ALA P 296 ? GLY P 298 ? ALA P 402 GLY P 404 5 ? 3  
HELX_P HELX_P500 CD5 THR P 305 ? ASP P 308 ? THR P 411 ASP P 414 5 ? 4  
HELX_P HELX_P501 CD6 ASP P 309 ? THR P 314 ? ASP P 415 THR P 420 1 ? 6  
HELX_P HELX_P502 CD7 LYS P 315 ? THR P 317 ? LYS P 421 THR P 423 5 ? 3  
HELX_P HELX_P503 CD8 ASP P 318 ? SER P 327 ? ASP P 424 SER P 433 1 ? 10 
HELX_P HELX_P504 CD9 ASP P 329 ? LYS P 331 ? ASP P 435 LYS P 437 5 ? 3  
HELX_P HELX_P505 CE1 LEU P 332 ? ARG P 345 ? LEU P 438 ARG P 451 1 ? 14 
HELX_P HELX_P506 CE2 LYS P 363 ? GLU P 368 ? LYS P 469 GLU P 474 5 ? 6  
HELX_P HELX_P507 CE3 SER P 369 ? SER P 376 ? SER P 475 SER P 482 1 ? 8  
HELX_P HELX_P508 CE4 LYS P 388 ? GLU P 390 ? LYS P 494 GLU P 496 5 ? 3  
HELX_P HELX_P509 CE5 ASN P 407 ? VAL P 412 ? ASN P 513 VAL P 518 5 ? 6  
HELX_P HELX_P510 CE6 ASP P 452 ? ARG P 470 ? ASP P 558 ARG P 576 1 ? 19 
HELX_P HELX_P511 CE7 ASP P 477 ? ALA P 482 ? ASP P 583 ALA P 588 1 ? 6  
HELX_P HELX_P512 CE8 ILE P 485 ? LYS P 489 ? ILE P 591 LYS P 595 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? A  HIS 61  NE2 ? ? ? 1_555 Q  FE  . FE  ? ? A HIS 167 A FE  701 1_555 ? ? ? ? ? ? ? 2.215 ? 
metalc2   metalc ? ? A  HIS 100 NE2 ? ? ? 1_555 Q  FE  . FE  ? ? A HIS 206 A FE  701 1_555 ? ? ? ? ? ? ? 2.116 ? 
metalc3   metalc ? ? A  ASP 101 OD1 ? ? ? 1_555 R  MG  . MG  ? ? A ASP 207 A MG  702 1_555 ? ? ? ? ? ? ? 2.075 ? 
metalc4   metalc ? ? A  ASP 101 OD2 ? ? ? 1_555 Q  FE  . FE  ? ? A ASP 207 A FE  701 1_555 ? ? ? ? ? ? ? 1.910 ? 
metalc5   metalc ? ? A  ASP 205 OD1 ? ? ? 1_555 Q  FE  . FE  ? ? A ASP 311 A FE  701 1_555 ? ? ? ? ? ? ? 1.828 ? 
metalc6   metalc ? ? B  HIS 61  NE2 ? ? ? 1_555 Y  FE  . FE  ? ? B HIS 167 B FE  701 1_555 ? ? ? ? ? ? ? 2.161 ? 
metalc7   metalc ? ? B  HIS 100 NE2 ? ? ? 1_555 Y  FE  . FE  ? ? B HIS 206 B FE  701 1_555 ? ? ? ? ? ? ? 2.257 ? 
metalc8   metalc ? ? B  ASP 101 OD1 ? ? ? 1_555 Z  MG  . MG  ? ? B ASP 207 B MG  702 1_555 ? ? ? ? ? ? ? 1.855 ? 
metalc9   metalc ? ? B  ASP 101 OD2 ? ? ? 1_555 Y  FE  . FE  ? ? B ASP 207 B FE  701 1_555 ? ? ? ? ? ? ? 1.840 ? 
metalc10  metalc ? ? B  ASP 205 OD1 ? ? ? 1_555 Y  FE  . FE  ? ? B ASP 311 B FE  701 1_555 ? ? ? ? ? ? ? 1.931 ? 
metalc11  metalc ? ? C  HIS 61  NE2 ? ? ? 1_555 HA FE  . FE  ? ? C HIS 167 C FE  702 1_555 ? ? ? ? ? ? ? 2.174 ? 
metalc12  metalc ? ? C  HIS 100 NE2 ? ? ? 1_555 HA FE  . FE  ? ? C HIS 206 C FE  702 1_555 ? ? ? ? ? ? ? 2.136 ? 
metalc13  metalc ? ? C  ASP 101 OD1 ? ? ? 1_555 IA MG  . MG  ? ? C ASP 207 C MG  703 1_555 ? ? ? ? ? ? ? 1.931 ? 
metalc14  metalc ? ? C  ASP 101 OD2 ? ? ? 1_555 HA FE  . FE  ? ? C ASP 207 C FE  702 1_555 ? ? ? ? ? ? ? 1.842 ? 
metalc15  metalc ? ? C  ASP 205 OD1 ? ? ? 1_555 HA FE  . FE  ? ? C ASP 311 C FE  702 1_555 ? ? ? ? ? ? ? 1.887 ? 
metalc16  metalc ? ? D  HIS 61  NE2 ? ? ? 1_555 QA FE  . FE  ? ? D HIS 167 D FE  702 1_555 ? ? ? ? ? ? ? 2.184 ? 
metalc17  metalc ? ? D  HIS 100 NE2 ? ? ? 1_555 QA FE  . FE  ? ? D HIS 206 D FE  702 1_555 ? ? ? ? ? ? ? 2.195 ? 
metalc18  metalc ? ? D  ASP 101 OD1 ? ? ? 1_555 RA MG  . MG  ? ? D ASP 207 D MG  703 1_555 ? ? ? ? ? ? ? 1.902 ? 
metalc19  metalc ? ? D  ASP 101 OD2 ? ? ? 1_555 QA FE  . FE  ? ? D ASP 207 D FE  702 1_555 ? ? ? ? ? ? ? 1.862 ? 
metalc20  metalc ? ? D  ASP 205 OD1 ? ? ? 1_555 QA FE  . FE  ? ? D ASP 311 D FE  702 1_555 ? ? ? ? ? ? ? 1.882 ? 
metalc21  metalc ? ? E  HIS 61  NE2 ? ? ? 1_555 WA FE  . FE  ? ? E HIS 167 E FE  701 1_555 ? ? ? ? ? ? ? 2.132 ? 
metalc22  metalc ? ? E  HIS 100 NE2 ? ? ? 1_555 WA FE  . FE  ? ? E HIS 206 E FE  701 1_555 ? ? ? ? ? ? ? 2.057 ? 
metalc23  metalc ? ? E  ASP 101 OD1 ? ? ? 1_555 XA MG  . MG  ? ? E ASP 207 E MG  702 1_555 ? ? ? ? ? ? ? 1.984 ? 
metalc24  metalc ? ? E  ASP 101 OD2 ? ? ? 1_555 WA FE  . FE  ? ? E ASP 207 E FE  701 1_555 ? ? ? ? ? ? ? 1.872 ? 
metalc25  metalc ? ? E  ASP 205 OD1 ? ? ? 1_555 WA FE  . FE  ? ? E ASP 311 E FE  701 1_555 ? ? ? ? ? ? ? 1.847 ? 
metalc26  metalc ? ? F  HIS 61  NE2 ? ? ? 1_555 EB FE  . FE  ? ? F HIS 167 F FE  701 1_555 ? ? ? ? ? ? ? 2.189 ? 
metalc27  metalc ? ? F  HIS 100 NE2 ? ? ? 1_555 EB FE  . FE  ? ? F HIS 206 F FE  701 1_555 ? ? ? ? ? ? ? 2.259 ? 
metalc28  metalc ? ? F  ASP 101 OD1 ? ? ? 1_555 FB MG  . MG  ? ? F ASP 207 F MG  702 1_555 ? ? ? ? ? ? ? 1.970 ? 
metalc29  metalc ? ? F  ASP 101 OD2 ? ? ? 1_555 EB FE  . FE  ? ? F ASP 207 F FE  701 1_555 ? ? ? ? ? ? ? 1.940 ? 
metalc30  metalc ? ? F  ASP 205 OD1 ? ? ? 1_555 EB FE  . FE  ? ? F ASP 311 F FE  701 1_555 ? ? ? ? ? ? ? 1.854 ? 
metalc31  metalc ? ? G  HIS 61  NE2 ? ? ? 1_555 NB FE  . FE  ? ? G HIS 167 G FE  702 1_555 ? ? ? ? ? ? ? 2.383 ? 
metalc32  metalc ? ? G  HIS 100 NE2 ? ? ? 1_555 NB FE  . FE  ? ? G HIS 206 G FE  702 1_555 ? ? ? ? ? ? ? 2.083 ? 
metalc33  metalc ? ? G  ASP 101 OD1 ? ? ? 1_555 OB MG  . MG  ? ? G ASP 207 G MG  703 1_555 ? ? ? ? ? ? ? 1.947 ? 
metalc34  metalc ? ? G  ASP 101 OD2 ? ? ? 1_555 NB FE  . FE  ? ? G ASP 207 G FE  702 1_555 ? ? ? ? ? ? ? 1.860 ? 
metalc35  metalc ? ? G  ASP 205 OD1 ? ? ? 1_555 NB FE  . FE  ? ? G ASP 311 G FE  702 1_555 ? ? ? ? ? ? ? 1.896 ? 
metalc36  metalc ? ? H  HIS 61  NE2 ? ? ? 1_555 VB FE  . FE  ? ? H HIS 167 H FE  702 1_555 ? ? ? ? ? ? ? 2.256 ? 
metalc37  metalc ? ? H  HIS 100 NE2 ? ? ? 1_555 VB FE  . FE  ? ? H HIS 206 H FE  702 1_555 ? ? ? ? ? ? ? 2.140 ? 
metalc38  metalc ? ? H  ASP 101 OD1 ? ? ? 1_555 WB MG  . MG  ? ? H ASP 207 H MG  703 1_555 ? ? ? ? ? ? ? 2.057 ? 
metalc39  metalc ? ? H  ASP 101 OD2 ? ? ? 1_555 VB FE  . FE  ? ? H ASP 207 H FE  702 1_555 ? ? ? ? ? ? ? 1.923 ? 
metalc40  metalc ? ? H  ASP 205 OD1 ? ? ? 1_555 VB FE  . FE  ? ? H ASP 311 H FE  702 1_555 ? ? ? ? ? ? ? 1.835 ? 
metalc41  metalc ? ? I  HIS 61  NE2 ? ? ? 1_555 CC FE  . FE  ? ? I HIS 167 I FE  701 1_555 ? ? ? ? ? ? ? 2.296 ? 
metalc42  metalc ? ? I  HIS 100 NE2 ? ? ? 1_555 CC FE  . FE  ? ? I HIS 206 I FE  701 1_555 ? ? ? ? ? ? ? 2.075 ? 
metalc43  metalc ? ? I  ASP 101 OD1 ? ? ? 1_555 DC MG  . MG  ? ? I ASP 207 I MG  702 1_555 ? ? ? ? ? ? ? 1.941 ? 
metalc44  metalc ? ? I  ASP 101 OD2 ? ? ? 1_555 CC FE  . FE  ? ? I ASP 207 I FE  701 1_555 ? ? ? ? ? ? ? 1.734 ? 
metalc45  metalc ? ? I  ASP 205 OD1 ? ? ? 1_555 CC FE  . FE  ? ? I ASP 311 I FE  701 1_555 ? ? ? ? ? ? ? 1.998 ? 
metalc46  metalc ? ? J  HIS 61  NE2 ? ? ? 1_555 LC FE  . FE  ? ? J HIS 167 J FE  702 1_555 ? ? ? ? ? ? ? 2.149 ? 
metalc47  metalc ? ? J  HIS 100 NE2 ? ? ? 1_555 LC FE  . FE  ? ? J HIS 206 J FE  702 1_555 ? ? ? ? ? ? ? 2.217 ? 
metalc48  metalc ? ? J  ASP 101 OD1 ? ? ? 1_555 MC MG  . MG  ? ? J ASP 207 J MG  703 1_555 ? ? ? ? ? ? ? 1.986 ? 
metalc49  metalc ? ? J  ASP 101 OD2 ? ? ? 1_555 LC FE  . FE  ? ? J ASP 207 J FE  702 1_555 ? ? ? ? ? ? ? 1.847 ? 
metalc50  metalc ? ? J  ASP 205 OD1 ? ? ? 1_555 LC FE  . FE  ? ? J ASP 311 J FE  702 1_555 ? ? ? ? ? ? ? 1.915 ? 
metalc51  metalc ? ? K  HIS 61  NE2 ? ? ? 1_555 UC FE  . FE  ? ? K HIS 167 K FE  702 1_555 ? ? ? ? ? ? ? 2.500 ? 
metalc52  metalc ? ? K  HIS 100 NE2 ? ? ? 1_555 UC FE  . FE  ? ? K HIS 206 K FE  702 1_555 ? ? ? ? ? ? ? 2.276 ? 
metalc53  metalc ? ? K  ASP 101 OD1 ? ? ? 1_555 VC MG  . MG  ? ? K ASP 207 K MG  703 1_555 ? ? ? ? ? ? ? 1.955 ? 
metalc54  metalc ? ? K  ASP 101 OD2 ? ? ? 1_555 UC FE  . FE  ? ? K ASP 207 K FE  702 1_555 ? ? ? ? ? ? ? 1.996 ? 
metalc55  metalc ? ? K  ASP 205 OD1 ? ? ? 1_555 UC FE  . FE  ? ? K ASP 311 K FE  702 1_555 ? ? ? ? ? ? ? 1.856 ? 
metalc56  metalc ? ? K  ASP 205 OD2 ? ? ? 1_555 UC FE  . FE  ? ? K ASP 311 K FE  702 1_555 ? ? ? ? ? ? ? 2.642 ? 
metalc57  metalc ? ? L  HIS 61  NE2 ? ? ? 1_555 BD FE  . FE  ? ? L HIS 167 L FE  701 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc58  metalc ? ? L  HIS 100 NE2 ? ? ? 1_555 BD FE  . FE  ? ? L HIS 206 L FE  701 1_555 ? ? ? ? ? ? ? 2.206 ? 
metalc59  metalc ? ? L  ASP 101 OD1 ? ? ? 1_555 CD MG  . MG  ? ? L ASP 207 L MG  702 1_555 ? ? ? ? ? ? ? 1.911 ? 
metalc60  metalc ? ? L  ASP 101 OD2 ? ? ? 1_555 BD FE  . FE  ? ? L ASP 207 L FE  701 1_555 ? ? ? ? ? ? ? 1.883 ? 
metalc61  metalc ? ? L  ASP 205 OD1 ? ? ? 1_555 BD FE  . FE  ? ? L ASP 311 L FE  701 1_555 ? ? ? ? ? ? ? 1.901 ? 
metalc62  metalc ? ? M  HIS 61  NE2 ? ? ? 1_555 ID FE  . FE  ? ? M HIS 167 M FE  701 1_555 ? ? ? ? ? ? ? 2.153 ? 
metalc63  metalc ? ? M  HIS 100 NE2 ? ? ? 1_555 ID FE  . FE  ? ? M HIS 206 M FE  701 1_555 ? ? ? ? ? ? ? 2.133 ? 
metalc64  metalc ? ? M  ASP 101 OD1 ? ? ? 1_555 JD MG  . MG  ? ? M ASP 207 M MG  702 1_555 ? ? ? ? ? ? ? 2.008 ? 
metalc65  metalc ? ? M  ASP 101 OD2 ? ? ? 1_555 ID FE  . FE  ? ? M ASP 207 M FE  701 1_555 ? ? ? ? ? ? ? 1.886 ? 
metalc66  metalc ? ? M  ASP 205 OD1 ? ? ? 1_555 ID FE  . FE  ? ? M ASP 311 M FE  701 1_555 ? ? ? ? ? ? ? 1.858 ? 
metalc67  metalc ? ? N  HIS 61  NE2 ? ? ? 1_555 QD FE  . FE  ? ? N HIS 167 N FE  701 1_555 ? ? ? ? ? ? ? 2.264 ? 
metalc68  metalc ? ? N  HIS 100 NE2 ? ? ? 1_555 QD FE  . FE  ? ? N HIS 206 N FE  701 1_555 ? ? ? ? ? ? ? 2.117 ? 
metalc69  metalc ? ? N  ASP 101 OD1 ? ? ? 1_555 RD MG  . MG  ? ? N ASP 207 N MG  702 1_555 ? ? ? ? ? ? ? 1.950 ? 
metalc70  metalc ? ? N  ASP 101 OD2 ? ? ? 1_555 QD FE  . FE  ? ? N ASP 207 N FE  701 1_555 ? ? ? ? ? ? ? 1.923 ? 
metalc71  metalc ? ? N  ASP 205 OD1 ? ? ? 1_555 QD FE  . FE  ? ? N ASP 311 N FE  701 1_555 ? ? ? ? ? ? ? 1.824 ? 
metalc72  metalc ? ? O  HIS 61  NE2 ? ? ? 1_555 ZD FE  . FE  ? ? O HIS 167 O FE  702 1_555 ? ? ? ? ? ? ? 2.357 ? 
metalc73  metalc ? ? O  HIS 100 NE2 ? ? ? 1_555 ZD FE  . FE  ? ? O HIS 206 O FE  702 1_555 ? ? ? ? ? ? ? 2.096 ? 
metalc74  metalc ? ? O  ASP 101 OD1 ? ? ? 1_555 AE MG  . MG  ? ? O ASP 207 O MG  703 1_555 ? ? ? ? ? ? ? 2.040 ? 
metalc75  metalc ? ? O  ASP 101 OD2 ? ? ? 1_555 ZD FE  . FE  ? ? O ASP 207 O FE  702 1_555 ? ? ? ? ? ? ? 1.833 ? 
metalc76  metalc ? ? O  ASP 205 OD1 ? ? ? 1_555 ZD FE  . FE  ? ? O ASP 311 O FE  702 1_555 ? ? ? ? ? ? ? 1.920 ? 
metalc77  metalc ? ? P  HIS 61  NE2 ? ? ? 1_555 HE FE  . FE  ? ? P HIS 167 P FE  702 1_555 ? ? ? ? ? ? ? 2.225 ? 
metalc78  metalc ? ? P  HIS 100 NE2 ? ? ? 1_555 HE FE  . FE  ? ? P HIS 206 P FE  702 1_555 ? ? ? ? ? ? ? 2.062 ? 
metalc79  metalc ? ? P  ASP 101 OD1 ? ? ? 1_555 IE MG  . MG  ? ? P ASP 207 P MG  703 1_555 ? ? ? ? ? ? ? 2.177 ? 
metalc80  metalc ? ? P  ASP 101 OD2 ? ? ? 1_555 HE FE  . FE  ? ? P ASP 207 P FE  702 1_555 ? ? ? ? ? ? ? 1.749 ? 
metalc81  metalc ? ? P  ASP 205 OD1 ? ? ? 1_555 HE FE  . FE  ? ? P ASP 311 P FE  702 1_555 ? ? ? ? ? ? ? 1.976 ? 
metalc82  metalc ? ? Q  FE  .   FE  ? ? ? 1_555 U  XG4 . O2A ? ? A FE  701 A XG4 705 1_555 ? ? ? ? ? ? ? 2.457 ? 
metalc83  metalc ? ? R  MG  .   MG  ? ? ? 1_555 U  XG4 . O1A ? ? A MG  702 A XG4 705 1_555 ? ? ? ? ? ? ? 1.983 ? 
metalc84  metalc ? ? S  MG  .   MG  ? ? ? 1_555 U  XG4 . O2G ? ? A MG  703 A XG4 705 1_555 ? ? ? ? ? ? ? 2.276 ? 
metalc85  metalc ? ? S  MG  .   MG  ? ? ? 1_555 U  XG4 . O2B ? ? A MG  703 A XG4 705 1_555 ? ? ? ? ? ? ? 2.535 ? 
metalc86  metalc ? ? T  MG  .   MG  ? ? ? 1_555 V  CZF . O9  ? ? A MG  704 A CZF 706 1_555 ? ? ? ? ? ? ? 2.258 ? 
metalc87  metalc ? ? T  MG  .   MG  ? ? ? 1_555 GA XG4 . O1B ? ? A MG  704 C XG4 701 1_555 ? ? ? ? ? ? ? 2.057 ? 
metalc88  metalc ? ? T  MG  .   MG  ? ? ? 1_555 V  CZF . O12 ? ? A MG  704 A CZF 706 1_555 ? ? ? ? ? ? ? 2.362 ? 
metalc89  metalc ? ? T  MG  .   MG  ? ? ? 1_555 V  CZF . O14 ? ? A MG  704 A CZF 706 1_555 ? ? ? ? ? ? ? 2.101 ? 
metalc90  metalc ? ? T  MG  .   MG  ? ? ? 1_555 GA XG4 . O1G ? ? A MG  704 C XG4 701 1_555 ? ? ? ? ? ? ? 2.104 ? 
metalc91  metalc ? ? X  XG4 .   O1B ? ? ? 1_555 KA MG  . MG  ? ? A XG4 708 C MG  705 1_555 ? ? ? ? ? ? ? 2.084 ? 
metalc92  metalc ? ? X  XG4 .   O1G ? ? ? 1_555 KA MG  . MG  ? ? A XG4 708 C MG  705 1_555 ? ? ? ? ? ? ? 2.230 ? 
metalc93  metalc ? ? Y  FE  .   FE  ? ? ? 1_555 CA XG4 . O2A ? ? B FE  701 B XG4 705 1_555 ? ? ? ? ? ? ? 2.421 ? 
metalc94  metalc ? ? Z  MG  .   MG  ? ? ? 1_555 CA XG4 . O1A ? ? B MG  702 B XG4 705 1_555 ? ? ? ? ? ? ? 2.109 ? 
metalc95  metalc ? ? AA MG  .   MG  ? ? ? 1_555 CA XG4 . O2B ? ? B MG  703 B XG4 705 1_555 ? ? ? ? ? ? ? 2.679 ? 
metalc96  metalc ? ? AA MG  .   MG  ? ? ? 1_555 CA XG4 . O1G ? ? B MG  703 B XG4 705 1_555 ? ? ? ? ? ? ? 1.930 ? 
metalc97  metalc ? ? BA MG  .   MG  ? ? ? 1_555 DA CZF . O14 ? ? B MG  704 B CZF 706 1_555 ? ? ? ? ? ? ? 2.143 ? 
metalc98  metalc ? ? BA MG  .   MG  ? ? ? 1_555 DA CZF . O9  ? ? B MG  704 B CZF 706 1_555 ? ? ? ? ? ? ? 2.639 ? 
metalc99  metalc ? ? BA MG  .   MG  ? ? ? 1_555 DA CZF . O12 ? ? B MG  704 B CZF 706 1_555 ? ? ? ? ? ? ? 2.012 ? 
metalc100 metalc ? ? BA MG  .   MG  ? ? ? 1_555 PA XG4 . O1B ? ? B MG  704 D XG4 701 1_555 ? ? ? ? ? ? ? 2.068 ? 
metalc101 metalc ? ? BA MG  .   MG  ? ? ? 1_555 PA XG4 . O1G ? ? B MG  704 D XG4 701 1_555 ? ? ? ? ? ? ? 2.371 ? 
metalc102 metalc ? ? FA XG4 .   O1B ? ? ? 1_555 TA MG  . MG  ? ? B XG4 708 D MG  705 1_555 ? ? ? ? ? ? ? 2.125 ? 
metalc103 metalc ? ? FA XG4 .   O1G ? ? ? 1_555 TA MG  . MG  ? ? B XG4 708 D MG  705 1_555 ? ? ? ? ? ? ? 1.921 ? 
metalc104 metalc ? ? HA FE  .   FE  ? ? ? 1_555 LA XG4 . O2A ? ? C FE  702 C XG4 706 1_555 ? ? ? ? ? ? ? 2.308 ? 
metalc105 metalc ? ? IA MG  .   MG  ? ? ? 1_555 LA XG4 . O1A ? ? C MG  703 C XG4 706 1_555 ? ? ? ? ? ? ? 1.854 ? 
metalc106 metalc ? ? JA MG  .   MG  ? ? ? 1_555 LA XG4 . O3G ? ? C MG  704 C XG4 706 1_555 ? ? ? ? ? ? ? 2.236 ? 
metalc107 metalc ? ? JA MG  .   MG  ? ? ? 1_555 LA XG4 . O2B ? ? C MG  704 C XG4 706 1_555 ? ? ? ? ? ? ? 2.238 ? 
metalc108 metalc ? ? KA MG  .   MG  ? ? ? 1_555 MA CZF . O9  ? ? C MG  705 C CZF 707 1_555 ? ? ? ? ? ? ? 1.968 ? 
metalc109 metalc ? ? KA MG  .   MG  ? ? ? 1_555 MA CZF . O14 ? ? C MG  705 C CZF 707 1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc110 metalc ? ? OA CZF .   O9  ? ? ? 1_555 TA MG  . MG  ? ? C CZF 709 D MG  705 1_555 ? ? ? ? ? ? ? 2.405 ? 
metalc111 metalc ? ? OA CZF .   O12 ? ? ? 1_555 TA MG  . MG  ? ? C CZF 709 D MG  705 1_555 ? ? ? ? ? ? ? 2.230 ? 
metalc112 metalc ? ? OA CZF .   O15 ? ? ? 1_555 TA MG  . MG  ? ? C CZF 709 D MG  705 1_555 ? ? ? ? ? ? ? 2.169 ? 
metalc113 metalc ? ? QA FE  .   FE  ? ? ? 1_555 UA XG4 . O2A ? ? D FE  702 D XG4 706 1_555 ? ? ? ? ? ? ? 2.355 ? 
metalc114 metalc ? ? RA MG  .   MG  ? ? ? 1_555 UA XG4 . O1A ? ? D MG  703 D XG4 706 1_555 ? ? ? ? ? ? ? 1.729 ? 
metalc115 metalc ? ? SA MG  .   MG  ? ? ? 1_555 UA XG4 . O2B ? ? D MG  704 D XG4 706 1_555 ? ? ? ? ? ? ? 2.283 ? 
metalc116 metalc ? ? SA MG  .   MG  ? ? ? 1_555 UA XG4 . O1G ? ? D MG  704 D XG4 706 1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc117 metalc ? ? WA FE  .   FE  ? ? ? 1_555 AB XG4 . O2A ? ? E FE  701 E XG4 705 1_555 ? ? ? ? ? ? ? 2.398 ? 
metalc118 metalc ? ? XA MG  .   MG  ? ? ? 1_555 AB XG4 . O1A ? ? E MG  702 E XG4 705 1_555 ? ? ? ? ? ? ? 2.035 ? 
metalc119 metalc ? ? YA MG  .   MG  ? ? ? 1_555 AB XG4 . O1G ? ? E MG  703 E XG4 705 1_555 ? ? ? ? ? ? ? 2.501 ? 
metalc120 metalc ? ? YA MG  .   MG  ? ? ? 1_555 AB XG4 . O2B ? ? E MG  703 E XG4 705 1_555 ? ? ? ? ? ? ? 2.593 ? 
metalc121 metalc ? ? ZA MG  .   MG  ? ? ? 1_555 BB CZF . O12 ? ? E MG  704 E CZF 706 1_555 ? ? ? ? ? ? ? 2.480 ? 
metalc122 metalc ? ? ZA MG  .   MG  ? ? ? 1_555 MB XG4 . O3G ? ? E MG  704 G XG4 701 1_555 ? ? ? ? ? ? ? 2.262 ? 
metalc123 metalc ? ? ZA MG  .   MG  ? ? ? 1_555 BB CZF . O9  ? ? E MG  704 E CZF 706 1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc124 metalc ? ? ZA MG  .   MG  ? ? ? 1_555 BB CZF . O14 ? ? E MG  704 E CZF 706 1_555 ? ? ? ? ? ? ? 1.999 ? 
metalc125 metalc ? ? ZA MG  .   MG  ? ? ? 1_555 MB XG4 . O1B ? ? E MG  704 G XG4 701 1_555 ? ? ? ? ? ? ? 2.225 ? 
metalc126 metalc ? ? DB XG4 .   O1B ? ? ? 1_555 QB MG  . MG  ? ? E XG4 708 G MG  705 1_555 ? ? ? ? ? ? ? 2.059 ? 
metalc127 metalc ? ? DB XG4 .   O1G ? ? ? 1_555 QB MG  . MG  ? ? E XG4 708 G MG  705 1_555 ? ? ? ? ? ? ? 2.068 ? 
metalc128 metalc ? ? EB FE  .   FE  ? ? ? 1_555 IB XG4 . O2A ? ? F FE  701 F XG4 705 1_555 ? ? ? ? ? ? ? 2.226 ? 
metalc129 metalc ? ? FB MG  .   MG  ? ? ? 1_555 IB XG4 . O1A ? ? F MG  702 F XG4 705 1_555 ? ? ? ? ? ? ? 1.946 ? 
metalc130 metalc ? ? GB MG  .   MG  ? ? ? 1_555 IB XG4 . O3G ? ? F MG  703 F XG4 705 1_555 ? ? ? ? ? ? ? 2.251 ? 
metalc131 metalc ? ? GB MG  .   MG  ? ? ? 1_555 IB XG4 . O2B ? ? F MG  703 F XG4 705 1_555 ? ? ? ? ? ? ? 2.521 ? 
metalc132 metalc ? ? HB MG  .   MG  ? ? ? 1_555 JB CZF . O9  ? ? F MG  704 F CZF 706 1_555 ? ? ? ? ? ? ? 2.344 ? 
metalc133 metalc ? ? HB MG  .   MG  ? ? ? 1_555 UB XG4 . O1B ? ? F MG  704 H XG4 701 1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc134 metalc ? ? HB MG  .   MG  ? ? ? 1_555 JB CZF . O12 ? ? F MG  704 F CZF 706 1_555 ? ? ? ? ? ? ? 2.108 ? 
metalc135 metalc ? ? HB MG  .   MG  ? ? ? 1_555 UB XG4 . O1G ? ? F MG  704 H XG4 701 1_555 ? ? ? ? ? ? ? 2.110 ? 
metalc136 metalc ? ? HB MG  .   MG  ? ? ? 1_555 JB CZF . O14 ? ? F MG  704 F CZF 706 1_555 ? ? ? ? ? ? ? 2.626 ? 
metalc137 metalc ? ? LB XG4 .   O1B ? ? ? 1_555 YB MG  . MG  ? ? F XG4 708 H MG  705 1_555 ? ? ? ? ? ? ? 2.052 ? 
metalc138 metalc ? ? LB XG4 .   O1G ? ? ? 1_555 YB MG  . MG  ? ? F XG4 708 H MG  705 1_555 ? ? ? ? ? ? ? 2.511 ? 
metalc139 metalc ? ? NB FE  .   FE  ? ? ? 1_555 RB XG4 . O2A ? ? G FE  702 G XG4 706 1_555 ? ? ? ? ? ? ? 2.320 ? 
metalc140 metalc ? ? OB MG  .   MG  ? ? ? 1_555 RB XG4 . O1A ? ? G MG  703 G XG4 706 1_555 ? ? ? ? ? ? ? 2.185 ? 
metalc141 metalc ? ? PB MG  .   MG  ? ? ? 1_555 RB XG4 . O2B ? ? G MG  704 G XG4 706 1_555 ? ? ? ? ? ? ? 2.457 ? 
metalc142 metalc ? ? PB MG  .   MG  ? ? ? 1_555 RB XG4 . O1G ? ? G MG  704 G XG4 706 1_555 ? ? ? ? ? ? ? 1.993 ? 
metalc143 metalc ? ? QB MG  .   MG  ? ? ? 1_555 SB CZF . O9  ? ? G MG  705 G CZF 707 1_555 ? ? ? ? ? ? ? 2.137 ? 
metalc144 metalc ? ? QB MG  .   MG  ? ? ? 1_555 SB CZF . O12 ? ? G MG  705 G CZF 707 1_555 ? ? ? ? ? ? ? 1.984 ? 
metalc145 metalc ? ? QB MG  .   MG  ? ? ? 1_555 SB CZF . O14 ? ? G MG  705 G CZF 707 1_555 ? ? ? ? ? ? ? 2.173 ? 
metalc146 metalc ? ? VB FE  .   FE  ? ? ? 1_555 ZB XG4 . O2A ? ? H FE  702 H XG4 706 1_555 ? ? ? ? ? ? ? 2.460 ? 
metalc147 metalc ? ? WB MG  .   MG  ? ? ? 1_555 ZB XG4 . O1A ? ? H MG  703 H XG4 706 1_555 ? ? ? ? ? ? ? 1.858 ? 
metalc148 metalc ? ? XB MG  .   MG  ? ? ? 1_555 ZB XG4 . O1G ? ? H MG  704 H XG4 706 1_555 ? ? ? ? ? ? ? 1.885 ? 
metalc149 metalc ? ? XB MG  .   MG  ? ? ? 1_555 ZB XG4 . O2B ? ? H MG  704 H XG4 706 1_555 ? ? ? ? ? ? ? 2.382 ? 
metalc150 metalc ? ? YB MG  .   MG  ? ? ? 1_555 AC CZF . O12 ? ? H MG  705 H CZF 707 1_555 ? ? ? ? ? ? ? 1.752 ? 
metalc151 metalc ? ? YB MG  .   MG  ? ? ? 1_555 AC CZF . O14 ? ? H MG  705 H CZF 707 1_555 ? ? ? ? ? ? ? 2.186 ? 
metalc152 metalc ? ? YB MG  .   MG  ? ? ? 1_555 AC CZF . O9  ? ? H MG  705 H CZF 707 1_555 ? ? ? ? ? ? ? 2.416 ? 
metalc153 metalc ? ? CC FE  .   FE  ? ? ? 1_555 GC XG4 . O2A ? ? I FE  701 I XG4 705 1_555 ? ? ? ? ? ? ? 2.466 ? 
metalc154 metalc ? ? DC MG  .   MG  ? ? ? 1_555 GC XG4 . O1A ? ? I MG  702 I XG4 705 1_555 ? ? ? ? ? ? ? 2.046 ? 
metalc155 metalc ? ? EC MG  .   MG  ? ? ? 1_555 GC XG4 . O2B ? ? I MG  703 I XG4 705 1_555 ? ? ? ? ? ? ? 2.231 ? 
metalc156 metalc ? ? EC MG  .   MG  ? ? ? 1_555 GC XG4 . O1G ? ? I MG  703 I XG4 705 1_555 ? ? ? ? ? ? ? 2.639 ? 
metalc157 metalc ? ? FC MG  .   MG  ? ? ? 1_555 TC XG4 . O1B ? ? I MG  704 K XG4 701 1_555 ? ? ? ? ? ? ? 2.005 ? 
metalc158 metalc ? ? FC MG  .   MG  ? ? ? 1_555 TC XG4 . O1G ? ? I MG  704 K XG4 701 1_555 ? ? ? ? ? ? ? 2.268 ? 
metalc159 metalc ? ? FC MG  .   MG  ? ? ? 1_555 KC CZF . O9  ? ? I MG  704 J CZF 701 1_555 ? ? ? ? ? ? ? 2.596 ? 
metalc160 metalc ? ? FC MG  .   MG  ? ? ? 1_555 KC CZF . O12 ? ? I MG  704 J CZF 701 1_555 ? ? ? ? ? ? ? 2.581 ? 
metalc161 metalc ? ? FC MG  .   MG  ? ? ? 1_555 KC CZF . O14 ? ? I MG  704 J CZF 701 1_555 ? ? ? ? ? ? ? 2.147 ? 
metalc162 metalc ? ? IC XG4 .   O1B ? ? ? 1_555 OC MG  . MG  ? ? I XG4 707 J MG  705 1_555 ? ? ? ? ? ? ? 1.857 ? 
metalc163 metalc ? ? IC XG4 .   O1G ? ? ? 1_555 OC MG  . MG  ? ? I XG4 707 J MG  705 1_555 ? ? ? ? ? ? ? 2.294 ? 
metalc164 metalc ? ? JC XG4 .   O1B ? ? ? 1_555 XC MG  . MG  ? ? I XG4 708 K MG  705 1_555 ? ? ? ? ? ? ? 1.995 ? 
metalc165 metalc ? ? JC XG4 .   O3G ? ? ? 1_555 XC MG  . MG  ? ? I XG4 708 K MG  705 1_555 ? ? ? ? ? ? ? 1.884 ? 
metalc166 metalc ? ? LC FE  .   FE  ? ? ? 1_555 PC XG4 . O2A ? ? J FE  702 J XG4 706 1_555 ? ? ? ? ? ? ? 2.269 ? 
metalc167 metalc ? ? NC MG  .   MG  ? ? ? 1_555 PC XG4 . O2B ? ? J MG  704 J XG4 706 1_555 ? ? ? ? ? ? ? 2.156 ? 
metalc168 metalc ? ? NC MG  .   MG  ? ? ? 1_555 PC XG4 . O3G ? ? J MG  704 J XG4 706 1_555 ? ? ? ? ? ? ? 2.269 ? 
metalc169 metalc ? ? OC MG  .   MG  ? ? ? 1_555 QC CZF . O14 ? ? J MG  705 J CZF 707 1_555 ? ? ? ? ? ? ? 1.837 ? 
metalc170 metalc ? ? OC MG  .   MG  ? ? ? 1_555 QC CZF . O9  ? ? J MG  705 J CZF 707 1_555 ? ? ? ? ? ? ? 1.954 ? 
metalc171 metalc ? ? OC MG  .   MG  ? ? ? 1_555 QC CZF . O12 ? ? J MG  705 J CZF 707 1_555 ? ? ? ? ? ? ? 2.772 ? 
metalc172 metalc ? ? SC XG4 .   O1B ? ? ? 1_555 ED MG  . MG  ? ? J XG4 709 L MG  704 1_555 ? ? ? ? ? ? ? 1.929 ? 
metalc173 metalc ? ? SC XG4 .   O1G ? ? ? 1_555 ED MG  . MG  ? ? J XG4 709 L MG  704 1_555 ? ? ? ? ? ? ? 2.604 ? 
metalc174 metalc ? ? UC FE  .   FE  ? ? ? 1_555 YC XG4 . O2A ? ? K FE  702 K XG4 706 1_555 ? ? ? ? ? ? ? 1.942 ? 
metalc175 metalc ? ? VC MG  .   MG  ? ? ? 1_555 YC XG4 . O1A ? ? K MG  703 K XG4 706 1_555 ? ? ? ? ? ? ? 2.327 ? 
metalc176 metalc ? ? WC MG  .   MG  ? ? ? 1_555 YC XG4 . O1G ? ? K MG  704 K XG4 706 1_555 ? ? ? ? ? ? ? 2.353 ? 
metalc177 metalc ? ? WC MG  .   MG  ? ? ? 1_555 YC XG4 . O2B ? ? K MG  704 K XG4 706 1_555 ? ? ? ? ? ? ? 2.455 ? 
metalc178 metalc ? ? XC MG  .   MG  ? ? ? 1_555 ZC CZF . O12 ? ? K MG  705 K CZF 707 1_555 ? ? ? ? ? ? ? 2.300 ? 
metalc179 metalc ? ? XC MG  .   MG  ? ? ? 1_555 ZC CZF . O9  ? ? K MG  705 K CZF 707 1_555 ? ? ? ? ? ? ? 1.918 ? 
metalc180 metalc ? ? XC MG  .   MG  ? ? ? 1_555 ZC CZF . O14 ? ? K MG  705 K CZF 707 1_555 ? ? ? ? ? ? ? 2.055 ? 
metalc181 metalc ? ? BD FE  .   FE  ? ? ? 1_555 FD XG4 . O2A ? ? L FE  701 L XG4 705 1_555 ? ? ? ? ? ? ? 1.986 ? 
metalc182 metalc ? ? CD MG  .   MG  ? ? ? 1_555 FD XG4 . O1A ? ? L MG  702 L XG4 705 1_555 ? ? ? ? ? ? ? 2.245 ? 
metalc183 metalc ? ? DD MG  .   MG  ? ? ? 1_555 FD XG4 . O1G ? ? L MG  703 L XG4 705 1_555 ? ? ? ? ? ? ? 2.327 ? 
metalc184 metalc ? ? DD MG  .   MG  ? ? ? 1_555 FD XG4 . O2B ? ? L MG  703 L XG4 705 1_555 ? ? ? ? ? ? ? 2.789 ? 
metalc185 metalc ? ? ED MG  .   MG  ? ? ? 1_555 GD CZF . O12 ? ? L MG  704 L CZF 706 1_555 ? ? ? ? ? ? ? 1.992 ? 
metalc186 metalc ? ? ED MG  .   MG  ? ? ? 1_555 GD CZF . O14 ? ? L MG  704 L CZF 706 1_555 ? ? ? ? ? ? ? 2.347 ? 
metalc187 metalc ? ? ED MG  .   MG  ? ? ? 1_555 GD CZF . O9  ? ? L MG  704 L CZF 706 1_555 ? ? ? ? ? ? ? 2.369 ? 
metalc188 metalc ? ? ID FE  .   FE  ? ? ? 1_555 MD XG4 . O2A ? ? M FE  701 M XG4 705 1_555 ? ? ? ? ? ? ? 2.084 ? 
metalc189 metalc ? ? JD MG  .   MG  ? ? ? 1_555 MD XG4 . O1A ? ? M MG  702 M XG4 705 1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc190 metalc ? ? KD MG  .   MG  ? ? ? 1_555 MD XG4 . O1G ? ? M MG  703 M XG4 705 1_555 ? ? ? ? ? ? ? 2.552 ? 
metalc191 metalc ? ? KD MG  .   MG  ? ? ? 1_555 MD XG4 . O2B ? ? M MG  703 M XG4 705 1_555 ? ? ? ? ? ? ? 2.425 ? 
metalc192 metalc ? ? LD MG  .   MG  ? ? ? 1_555 ND CZF . O9  ? ? M MG  704 M CZF 706 1_555 ? ? ? ? ? ? ? 2.514 ? 
metalc193 metalc ? ? LD MG  .   MG  ? ? ? 1_555 ND CZF . O12 ? ? M MG  704 M CZF 706 1_555 ? ? ? ? ? ? ? 2.442 ? 
metalc194 metalc ? ? LD MG  .   MG  ? ? ? 1_555 ND CZF . O14 ? ? M MG  704 M CZF 706 1_555 ? ? ? ? ? ? ? 2.177 ? 
metalc195 metalc ? ? LD MG  .   MG  ? ? ? 1_555 YD XG4 . O1B ? ? M MG  704 O XG4 701 1_555 ? ? ? ? ? ? ? 2.231 ? 
metalc196 metalc ? ? LD MG  .   MG  ? ? ? 1_555 YD XG4 . O1G ? ? M MG  704 O XG4 701 1_555 ? ? ? ? ? ? ? 2.474 ? 
metalc197 metalc ? ? PD XG4 .   O1B ? ? ? 1_555 CE MG  . MG  ? ? M XG4 708 O MG  705 1_555 ? ? ? ? ? ? ? 2.172 ? 
metalc198 metalc ? ? PD XG4 .   O1G ? ? ? 1_555 CE MG  . MG  ? ? M XG4 708 O MG  705 1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc199 metalc ? ? QD FE  .   FE  ? ? ? 1_555 UD XG4 . O2A ? ? N FE  701 N XG4 705 1_555 ? ? ? ? ? ? ? 2.515 ? 
metalc200 metalc ? ? RD MG  .   MG  ? ? ? 1_555 UD XG4 . O1A ? ? N MG  702 N XG4 705 1_555 ? ? ? ? ? ? ? 2.180 ? 
metalc201 metalc ? ? SD MG  .   MG  ? ? ? 1_555 UD XG4 . O1G ? ? N MG  703 N XG4 705 1_555 ? ? ? ? ? ? ? 2.614 ? 
metalc202 metalc ? ? SD MG  .   MG  ? ? ? 1_555 UD XG4 . O2B ? ? N MG  703 N XG4 705 1_555 ? ? ? ? ? ? ? 2.533 ? 
metalc203 metalc ? ? TD MG  .   MG  ? ? ? 1_555 VD CZF . O15 ? ? N MG  704 N CZF 706 1_555 ? ? ? ? ? ? ? 1.970 ? 
metalc204 metalc ? ? TD MG  .   MG  ? ? ? 1_555 VD CZF . O9  ? ? N MG  704 N CZF 706 1_555 ? ? ? ? ? ? ? 2.232 ? 
metalc205 metalc ? ? TD MG  .   MG  ? ? ? 1_555 VD CZF . O12 ? ? N MG  704 N CZF 706 1_555 ? ? ? ? ? ? ? 2.726 ? 
metalc206 metalc ? ? TD MG  .   MG  ? ? ? 1_555 GE XG4 . O1B ? ? N MG  704 P XG4 701 1_555 ? ? ? ? ? ? ? 1.935 ? 
metalc207 metalc ? ? TD MG  .   MG  ? ? ? 1_555 GE XG4 . O1G ? ? N MG  704 P XG4 701 1_555 ? ? ? ? ? ? ? 2.359 ? 
metalc208 metalc ? ? XD XG4 .   O1B ? ? ? 1_555 KE MG  . MG  ? ? N XG4 708 P MG  705 1_555 ? ? ? ? ? ? ? 2.132 ? 
metalc209 metalc ? ? XD XG4 .   O1G ? ? ? 1_555 KE MG  . MG  ? ? N XG4 708 P MG  705 1_555 ? ? ? ? ? ? ? 2.779 ? 
metalc210 metalc ? ? ZD FE  .   FE  ? ? ? 1_555 DE XG4 . O2A ? ? O FE  702 O XG4 706 1_555 ? ? ? ? ? ? ? 2.232 ? 
metalc211 metalc ? ? AE MG  .   MG  ? ? ? 1_555 DE XG4 . O1A ? ? O MG  703 O XG4 706 1_555 ? ? ? ? ? ? ? 2.281 ? 
metalc212 metalc ? ? BE MG  .   MG  ? ? ? 1_555 DE XG4 . O2B ? ? O MG  704 O XG4 706 1_555 ? ? ? ? ? ? ? 2.534 ? 
metalc213 metalc ? ? BE MG  .   MG  ? ? ? 1_555 DE XG4 . O3G ? ? O MG  704 O XG4 706 1_555 ? ? ? ? ? ? ? 2.187 ? 
metalc214 metalc ? ? CE MG  .   MG  ? ? ? 1_555 EE CZF . O9  ? ? O MG  705 O CZF 707 1_555 ? ? ? ? ? ? ? 2.548 ? 
metalc215 metalc ? ? CE MG  .   MG  ? ? ? 1_555 EE CZF . O14 ? ? O MG  705 O CZF 707 1_555 ? ? ? ? ? ? ? 2.049 ? 
metalc216 metalc ? ? CE MG  .   MG  ? ? ? 1_555 EE CZF . O12 ? ? O MG  705 O CZF 707 1_555 ? ? ? ? ? ? ? 2.079 ? 
metalc217 metalc ? ? HE FE  .   FE  ? ? ? 1_555 LE XG4 . O1A ? ? P FE  702 P XG4 706 1_555 ? ? ? ? ? ? ? 2.076 ? 
metalc218 metalc ? ? IE MG  .   MG  ? ? ? 1_555 LE XG4 . O2A ? ? P MG  703 P XG4 706 1_555 ? ? ? ? ? ? ? 2.211 ? 
metalc219 metalc ? ? JE MG  .   MG  ? ? ? 1_555 LE XG4 . O2B ? ? P MG  704 P XG4 706 1_555 ? ? ? ? ? ? ? 2.199 ? 
metalc220 metalc ? ? JE MG  .   MG  ? ? ? 1_555 LE XG4 . O1G ? ? P MG  704 P XG4 706 1_555 ? ? ? ? ? ? ? 2.813 ? 
metalc221 metalc ? ? KE MG  .   MG  ? ? ? 1_555 ME CZF . O14 ? ? P MG  705 P CZF 707 1_555 ? ? ? ? ? ? ? 2.845 ? 
metalc222 metalc ? ? KE MG  .   MG  ? ? ? 1_555 ME CZF . O12 ? ? P MG  705 P CZF 707 1_555 ? ? ? ? ? ? ? 2.083 ? 
metalc223 metalc ? ? KE MG  .   MG  ? ? ? 1_555 ME CZF . O9  ? ? P MG  705 P CZF 707 1_555 ? ? ? ? ? ? ? 2.327 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 5 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 2 ? 
AA6 ? 5 ? 
AA7 ? 2 ? 
AA8 ? 3 ? 
AA9 ? 2 ? 
AB1 ? 5 ? 
AB2 ? 2 ? 
AB3 ? 3 ? 
AB4 ? 2 ? 
AB5 ? 4 ? 
AB6 ? 2 ? 
AB7 ? 3 ? 
AB8 ? 2 ? 
AB9 ? 5 ? 
AC1 ? 2 ? 
AC2 ? 3 ? 
AC3 ? 2 ? 
AC4 ? 5 ? 
AC5 ? 2 ? 
AC6 ? 3 ? 
AC7 ? 2 ? 
AC8 ? 5 ? 
AC9 ? 2 ? 
AD1 ? 3 ? 
AD2 ? 2 ? 
AD3 ? 5 ? 
AD4 ? 2 ? 
AD5 ? 3 ? 
AD6 ? 2 ? 
AD7 ? 5 ? 
AD8 ? 2 ? 
AD9 ? 3 ? 
AE1 ? 2 ? 
AE2 ? 5 ? 
AE3 ? 2 ? 
AE4 ? 3 ? 
AE5 ? 2 ? 
AE6 ? 5 ? 
AE7 ? 2 ? 
AE8 ? 3 ? 
AE9 ? 2 ? 
AF1 ? 4 ? 
AF2 ? 2 ? 
AF3 ? 3 ? 
AF4 ? 2 ? 
AF5 ? 5 ? 
AF6 ? 2 ? 
AF7 ? 3 ? 
AF8 ? 2 ? 
AF9 ? 5 ? 
AG1 ? 2 ? 
AG2 ? 3 ? 
AG3 ? 2 ? 
AG4 ? 5 ? 
AG5 ? 2 ? 
AG6 ? 3 ? 
AG7 ? 2 ? 
AG8 ? 5 ? 
AG9 ? 2 ? 
AH1 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA2 4 5 ? parallel      
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? parallel      
AA6 3 4 ? anti-parallel 
AA6 4 5 ? parallel      
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? parallel      
AB1 3 4 ? anti-parallel 
AB1 4 5 ? parallel      
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? parallel      
AB9 3 4 ? anti-parallel 
AB9 4 5 ? parallel      
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? parallel      
AC4 3 4 ? anti-parallel 
AC4 4 5 ? parallel      
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? parallel      
AC8 3 4 ? anti-parallel 
AC8 4 5 ? parallel      
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? parallel      
AD3 3 4 ? anti-parallel 
AD3 4 5 ? parallel      
AD4 1 2 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? parallel      
AD7 3 4 ? anti-parallel 
AD7 4 5 ? parallel      
AD8 1 2 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? parallel      
AE2 3 4 ? anti-parallel 
AE2 4 5 ? parallel      
AE3 1 2 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE6 2 3 ? parallel      
AE6 3 4 ? anti-parallel 
AE6 4 5 ? parallel      
AE7 1 2 ? anti-parallel 
AE8 1 2 ? anti-parallel 
AE8 2 3 ? anti-parallel 
AE9 1 2 ? anti-parallel 
AF1 1 2 ? anti-parallel 
AF1 2 3 ? parallel      
AF1 3 4 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF3 2 3 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF5 2 3 ? parallel      
AF5 3 4 ? anti-parallel 
AF5 4 5 ? parallel      
AF6 1 2 ? anti-parallel 
AF7 1 2 ? anti-parallel 
AF7 2 3 ? anti-parallel 
AF8 1 2 ? anti-parallel 
AF9 1 2 ? anti-parallel 
AF9 2 3 ? parallel      
AF9 3 4 ? anti-parallel 
AF9 4 5 ? parallel      
AG1 1 2 ? anti-parallel 
AG2 1 2 ? anti-parallel 
AG2 2 3 ? anti-parallel 
AG3 1 2 ? anti-parallel 
AG4 1 2 ? anti-parallel 
AG4 2 3 ? parallel      
AG4 3 4 ? anti-parallel 
AG4 4 5 ? parallel      
AG5 1 2 ? anti-parallel 
AG6 1 2 ? anti-parallel 
AG6 2 3 ? anti-parallel 
AG7 1 2 ? anti-parallel 
AG8 1 2 ? anti-parallel 
AG8 2 3 ? parallel      
AG8 3 4 ? anti-parallel 
AG8 4 5 ? parallel      
AG9 1 2 ? anti-parallel 
AH1 1 2 ? anti-parallel 
AH1 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LYS A 10  ? ASP A 14  ? LYS A 116 ASP A 120 
AA1 2 GLY A 18  ? LEU A 22  ? GLY A 124 LEU A 128 
AA2 1 ALA A 232 ? GLU A 236 ? ALA A 338 GLU A 342 
AA2 2 LEU A 241 ? ARG A 246 ? LEU A 347 ARG A 352 
AA2 3 PHE A 414 ? CYS A 416 ? PHE A 520 CYS A 522 
AA2 4 ALA A 419 ? ILE A 424 ? ALA A 525 ILE A 530 
AA2 5 ALA A 232 ? GLU A 236 ? ALA A 338 GLU A 342 
AA3 1 ILE A 293 ? THR A 294 ? ILE A 399 THR A 400 
AA3 2 LYS A 300 ? TYR A 301 ? LYS A 406 TYR A 407 
AA4 1 LYS A 349 ? THR A 354 ? LYS A 455 THR A 460 
AA4 2 ALA A 440 ? CYS A 448 ? ALA A 546 CYS A 554 
AA4 3 PHE A 392 ? ASP A 400 ? PHE A 498 ASP A 506 
AA5 1 LYS B 10  ? ASP B 14  ? LYS B 116 ASP B 120 
AA5 2 GLY B 18  ? LEU B 22  ? GLY B 124 LEU B 128 
AA6 1 ALA B 232 ? GLU B 236 ? ALA B 338 GLU B 342 
AA6 2 LEU B 241 ? ARG B 246 ? LEU B 347 ARG B 352 
AA6 3 PHE B 414 ? CYS B 416 ? PHE B 520 CYS B 522 
AA6 4 ALA B 419 ? ILE B 424 ? ALA B 525 ILE B 530 
AA6 5 ALA B 232 ? GLU B 236 ? ALA B 338 GLU B 342 
AA7 1 ILE B 293 ? THR B 294 ? ILE B 399 THR B 400 
AA7 2 LYS B 300 ? TYR B 301 ? LYS B 406 TYR B 407 
AA8 1 LYS B 349 ? THR B 354 ? LYS B 455 THR B 460 
AA8 2 ALA B 440 ? CYS B 448 ? ALA B 546 CYS B 554 
AA8 3 PHE B 392 ? ASP B 400 ? PHE B 498 ASP B 506 
AA9 1 LYS C 10  ? ASP C 14  ? LYS C 116 ASP C 120 
AA9 2 GLY C 18  ? LEU C 22  ? GLY C 124 LEU C 128 
AB1 1 ALA C 232 ? GLU C 236 ? ALA C 338 GLU C 342 
AB1 2 LEU C 241 ? ARG C 246 ? LEU C 347 ARG C 352 
AB1 3 PHE C 414 ? CYS C 416 ? PHE C 520 CYS C 522 
AB1 4 ALA C 419 ? ILE C 424 ? ALA C 525 ILE C 530 
AB1 5 ALA C 232 ? GLU C 236 ? ALA C 338 GLU C 342 
AB2 1 ILE C 293 ? THR C 294 ? ILE C 399 THR C 400 
AB2 2 LYS C 300 ? TYR C 301 ? LYS C 406 TYR C 407 
AB3 1 LYS C 349 ? THR C 354 ? LYS C 455 THR C 460 
AB3 2 ALA C 440 ? CYS C 448 ? ALA C 546 CYS C 554 
AB3 3 PHE C 392 ? ASP C 400 ? PHE C 498 ASP C 506 
AB4 1 LYS D 10  ? ASP D 14  ? LYS D 116 ASP D 120 
AB4 2 GLY D 18  ? LEU D 22  ? GLY D 124 LEU D 128 
AB5 1 ALA D 232 ? GLU D 236 ? ALA D 338 GLU D 342 
AB5 2 LEU D 241 ? ARG D 246 ? LEU D 347 ARG D 352 
AB5 3 SER D 413 ? CYS D 416 ? SER D 519 CYS D 522 
AB5 4 ALA D 419 ? ILE D 424 ? ALA D 525 ILE D 530 
AB6 1 ILE D 293 ? THR D 294 ? ILE D 399 THR D 400 
AB6 2 LYS D 300 ? TYR D 301 ? LYS D 406 TYR D 407 
AB7 1 LYS D 349 ? THR D 354 ? LYS D 455 THR D 460 
AB7 2 ALA D 440 ? CYS D 448 ? ALA D 546 CYS D 554 
AB7 3 PHE D 392 ? ASP D 400 ? PHE D 498 ASP D 506 
AB8 1 LYS E 10  ? ASP E 14  ? LYS E 116 ASP E 120 
AB8 2 GLY E 18  ? LEU E 22  ? GLY E 124 LEU E 128 
AB9 1 ALA E 232 ? GLU E 236 ? ALA E 338 GLU E 342 
AB9 2 LEU E 241 ? ARG E 246 ? LEU E 347 ARG E 352 
AB9 3 PHE E 414 ? CYS E 416 ? PHE E 520 CYS E 522 
AB9 4 ALA E 419 ? ILE E 424 ? ALA E 525 ILE E 530 
AB9 5 ALA E 232 ? GLU E 236 ? ALA E 338 GLU E 342 
AC1 1 ILE E 293 ? THR E 294 ? ILE E 399 THR E 400 
AC1 2 LYS E 300 ? TYR E 301 ? LYS E 406 TYR E 407 
AC2 1 LYS E 349 ? THR E 354 ? LYS E 455 THR E 460 
AC2 2 ALA E 440 ? CYS E 448 ? ALA E 546 CYS E 554 
AC2 3 PHE E 392 ? ASP E 400 ? PHE E 498 ASP E 506 
AC3 1 LYS F 10  ? ASP F 14  ? LYS F 116 ASP F 120 
AC3 2 GLY F 18  ? LEU F 22  ? GLY F 124 LEU F 128 
AC4 1 ALA F 232 ? GLU F 236 ? ALA F 338 GLU F 342 
AC4 2 LEU F 241 ? ARG F 246 ? LEU F 347 ARG F 352 
AC4 3 PHE F 414 ? CYS F 416 ? PHE F 520 CYS F 522 
AC4 4 ALA F 419 ? ILE F 424 ? ALA F 525 ILE F 530 
AC4 5 ALA F 232 ? GLU F 236 ? ALA F 338 GLU F 342 
AC5 1 ILE F 293 ? THR F 294 ? ILE F 399 THR F 400 
AC5 2 LYS F 300 ? TYR F 301 ? LYS F 406 TYR F 407 
AC6 1 LYS F 349 ? THR F 354 ? LYS F 455 THR F 460 
AC6 2 ALA F 440 ? CYS F 448 ? ALA F 546 CYS F 554 
AC6 3 PHE F 392 ? ASP F 400 ? PHE F 498 ASP F 506 
AC7 1 LYS G 10  ? ASP G 14  ? LYS G 116 ASP G 120 
AC7 2 GLY G 18  ? LEU G 22  ? GLY G 124 LEU G 128 
AC8 1 ALA G 232 ? GLU G 236 ? ALA G 338 GLU G 342 
AC8 2 LEU G 241 ? ARG G 246 ? LEU G 347 ARG G 352 
AC8 3 PHE G 414 ? CYS G 416 ? PHE G 520 CYS G 522 
AC8 4 ALA G 419 ? ILE G 424 ? ALA G 525 ILE G 530 
AC8 5 ALA G 232 ? GLU G 236 ? ALA G 338 GLU G 342 
AC9 1 ILE G 293 ? THR G 294 ? ILE G 399 THR G 400 
AC9 2 LYS G 300 ? TYR G 301 ? LYS G 406 TYR G 407 
AD1 1 LYS G 349 ? THR G 354 ? LYS G 455 THR G 460 
AD1 2 ALA G 440 ? CYS G 448 ? ALA G 546 CYS G 554 
AD1 3 PHE G 392 ? ASP G 400 ? PHE G 498 ASP G 506 
AD2 1 LYS H 10  ? ASP H 14  ? LYS H 116 ASP H 120 
AD2 2 GLY H 18  ? LEU H 22  ? GLY H 124 LEU H 128 
AD3 1 ALA H 232 ? GLU H 236 ? ALA H 338 GLU H 342 
AD3 2 LEU H 241 ? ARG H 246 ? LEU H 347 ARG H 352 
AD3 3 PHE H 414 ? CYS H 416 ? PHE H 520 CYS H 522 
AD3 4 ALA H 419 ? ILE H 424 ? ALA H 525 ILE H 530 
AD3 5 ALA H 232 ? GLU H 236 ? ALA H 338 GLU H 342 
AD4 1 ILE H 293 ? THR H 294 ? ILE H 399 THR H 400 
AD4 2 LYS H 300 ? TYR H 301 ? LYS H 406 TYR H 407 
AD5 1 LYS H 349 ? THR H 354 ? LYS H 455 THR H 460 
AD5 2 ALA H 440 ? CYS H 448 ? ALA H 546 CYS H 554 
AD5 3 PHE H 392 ? ASP H 400 ? PHE H 498 ASP H 506 
AD6 1 LYS I 10  ? ASP I 14  ? LYS I 116 ASP I 120 
AD6 2 GLY I 18  ? LEU I 22  ? GLY I 124 LEU I 128 
AD7 1 ALA I 232 ? GLU I 236 ? ALA I 338 GLU I 342 
AD7 2 LEU I 241 ? ARG I 246 ? LEU I 347 ARG I 352 
AD7 3 PHE I 414 ? CYS I 416 ? PHE I 520 CYS I 522 
AD7 4 ALA I 419 ? ILE I 424 ? ALA I 525 ILE I 530 
AD7 5 ALA I 232 ? GLU I 236 ? ALA I 338 GLU I 342 
AD8 1 ILE I 293 ? THR I 294 ? ILE I 399 THR I 400 
AD8 2 LYS I 300 ? TYR I 301 ? LYS I 406 TYR I 407 
AD9 1 LYS I 349 ? THR I 354 ? LYS I 455 THR I 460 
AD9 2 ALA I 440 ? CYS I 448 ? ALA I 546 CYS I 554 
AD9 3 PHE I 392 ? ASP I 400 ? PHE I 498 ASP I 506 
AE1 1 LYS J 10  ? ASP J 14  ? LYS J 116 ASP J 120 
AE1 2 GLY J 18  ? LEU J 22  ? GLY J 124 LEU J 128 
AE2 1 ALA J 232 ? GLU J 236 ? ALA J 338 GLU J 342 
AE2 2 LEU J 241 ? ARG J 246 ? LEU J 347 ARG J 352 
AE2 3 PHE J 414 ? CYS J 416 ? PHE J 520 CYS J 522 
AE2 4 ALA J 419 ? ILE J 424 ? ALA J 525 ILE J 530 
AE2 5 ALA J 232 ? GLU J 236 ? ALA J 338 GLU J 342 
AE3 1 ILE J 293 ? THR J 294 ? ILE J 399 THR J 400 
AE3 2 LYS J 300 ? TYR J 301 ? LYS J 406 TYR J 407 
AE4 1 LYS J 349 ? THR J 354 ? LYS J 455 THR J 460 
AE4 2 ALA J 440 ? CYS J 448 ? ALA J 546 CYS J 554 
AE4 3 PHE J 392 ? ASP J 400 ? PHE J 498 ASP J 506 
AE5 1 LYS K 10  ? ASP K 14  ? LYS K 116 ASP K 120 
AE5 2 GLY K 18  ? LEU K 22  ? GLY K 124 LEU K 128 
AE6 1 ALA K 232 ? GLU K 236 ? ALA K 338 GLU K 342 
AE6 2 LEU K 241 ? ARG K 246 ? LEU K 347 ARG K 352 
AE6 3 PHE K 414 ? CYS K 416 ? PHE K 520 CYS K 522 
AE6 4 ALA K 419 ? ILE K 424 ? ALA K 525 ILE K 530 
AE6 5 ALA K 232 ? GLU K 236 ? ALA K 338 GLU K 342 
AE7 1 ILE K 293 ? THR K 294 ? ILE K 399 THR K 400 
AE7 2 LYS K 300 ? TYR K 301 ? LYS K 406 TYR K 407 
AE8 1 LYS K 349 ? THR K 354 ? LYS K 455 THR K 460 
AE8 2 ALA K 440 ? CYS K 448 ? ALA K 546 CYS K 554 
AE8 3 PHE K 392 ? ASP K 400 ? PHE K 498 ASP K 506 
AE9 1 LYS L 10  ? ASP L 14  ? LYS L 116 ASP L 120 
AE9 2 GLY L 18  ? LEU L 22  ? GLY L 124 LEU L 128 
AF1 1 ALA L 232 ? GLU L 236 ? ALA L 338 GLU L 342 
AF1 2 LEU L 241 ? ARG L 246 ? LEU L 347 ARG L 352 
AF1 3 PHE L 414 ? CYS L 416 ? PHE L 520 CYS L 522 
AF1 4 ALA L 419 ? ILE L 424 ? ALA L 525 ILE L 530 
AF2 1 ILE L 293 ? THR L 294 ? ILE L 399 THR L 400 
AF2 2 LYS L 300 ? TYR L 301 ? LYS L 406 TYR L 407 
AF3 1 LYS L 349 ? THR L 354 ? LYS L 455 THR L 460 
AF3 2 ALA L 440 ? CYS L 448 ? ALA L 546 CYS L 554 
AF3 3 PHE L 392 ? ASP L 400 ? PHE L 498 ASP L 506 
AF4 1 LYS M 10  ? ASP M 14  ? LYS M 116 ASP M 120 
AF4 2 GLY M 18  ? LEU M 22  ? GLY M 124 LEU M 128 
AF5 1 ALA M 232 ? GLU M 236 ? ALA M 338 GLU M 342 
AF5 2 LEU M 241 ? ARG M 246 ? LEU M 347 ARG M 352 
AF5 3 PHE M 414 ? CYS M 416 ? PHE M 520 CYS M 522 
AF5 4 ALA M 419 ? ILE M 424 ? ALA M 525 ILE M 530 
AF5 5 ALA M 232 ? GLU M 236 ? ALA M 338 GLU M 342 
AF6 1 ILE M 293 ? THR M 294 ? ILE M 399 THR M 400 
AF6 2 LYS M 300 ? TYR M 301 ? LYS M 406 TYR M 407 
AF7 1 LYS M 349 ? THR M 354 ? LYS M 455 THR M 460 
AF7 2 ALA M 440 ? CYS M 448 ? ALA M 546 CYS M 554 
AF7 3 PHE M 392 ? ASP M 400 ? PHE M 498 ASP M 506 
AF8 1 LYS N 10  ? ASP N 14  ? LYS N 116 ASP N 120 
AF8 2 GLY N 18  ? LEU N 22  ? GLY N 124 LEU N 128 
AF9 1 ALA N 232 ? GLU N 236 ? ALA N 338 GLU N 342 
AF9 2 LEU N 241 ? ARG N 246 ? LEU N 347 ARG N 352 
AF9 3 PHE N 414 ? CYS N 416 ? PHE N 520 CYS N 522 
AF9 4 ALA N 419 ? ILE N 424 ? ALA N 525 ILE N 530 
AF9 5 ALA N 232 ? GLU N 236 ? ALA N 338 GLU N 342 
AG1 1 ILE N 293 ? THR N 294 ? ILE N 399 THR N 400 
AG1 2 LYS N 300 ? TYR N 301 ? LYS N 406 TYR N 407 
AG2 1 LYS N 349 ? THR N 354 ? LYS N 455 THR N 460 
AG2 2 ALA N 440 ? CYS N 448 ? ALA N 546 CYS N 554 
AG2 3 PHE N 392 ? ASP N 400 ? PHE N 498 ASP N 506 
AG3 1 LYS O 10  ? ASP O 14  ? LYS O 116 ASP O 120 
AG3 2 GLY O 18  ? LEU O 22  ? GLY O 124 LEU O 128 
AG4 1 ALA O 232 ? GLU O 236 ? ALA O 338 GLU O 342 
AG4 2 LEU O 241 ? ARG O 246 ? LEU O 347 ARG O 352 
AG4 3 PHE O 414 ? CYS O 416 ? PHE O 520 CYS O 522 
AG4 4 ALA O 419 ? ILE O 424 ? ALA O 525 ILE O 530 
AG4 5 ALA O 232 ? GLU O 236 ? ALA O 338 GLU O 342 
AG5 1 ILE O 293 ? THR O 294 ? ILE O 399 THR O 400 
AG5 2 LYS O 300 ? TYR O 301 ? LYS O 406 TYR O 407 
AG6 1 LYS O 349 ? THR O 354 ? LYS O 455 THR O 460 
AG6 2 ALA O 440 ? CYS O 448 ? ALA O 546 CYS O 554 
AG6 3 PHE O 392 ? ASP O 400 ? PHE O 498 ASP O 506 
AG7 1 LYS P 10  ? ASP P 14  ? LYS P 116 ASP P 120 
AG7 2 GLY P 18  ? LEU P 22  ? GLY P 124 LEU P 128 
AG8 1 ALA P 232 ? GLU P 236 ? ALA P 338 GLU P 342 
AG8 2 LEU P 241 ? ARG P 246 ? LEU P 347 ARG P 352 
AG8 3 PHE P 414 ? CYS P 416 ? PHE P 520 CYS P 522 
AG8 4 ALA P 419 ? ILE P 424 ? ALA P 525 ILE P 530 
AG8 5 ALA P 232 ? GLU P 236 ? ALA P 338 GLU P 342 
AG9 1 ILE P 293 ? THR P 294 ? ILE P 399 THR P 400 
AG9 2 LYS P 300 ? TYR P 301 ? LYS P 406 TYR P 407 
AH1 1 LYS P 349 ? THR P 354 ? LYS P 455 THR P 460 
AH1 2 ALA P 440 ? CYS P 448 ? ALA P 546 CYS P 554 
AH1 3 PHE P 392 ? ASP P 400 ? PHE P 498 ASP P 506 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LYS A 10  ? N LYS A 116 O LEU A 22  ? O LEU A 128 
AA2 1 2 N ARG A 233 ? N ARG A 339 O CYS A 244 ? O CYS A 350 
AA2 2 3 N ALA A 245 ? N ALA A 351 O TYR A 415 ? O TYR A 521 
AA2 3 4 N PHE A 414 ? N PHE A 520 O ILE A 424 ? O ILE A 530 
AA2 4 5 O ASN A 421 ? O ASN A 527 N GLU A 236 ? N GLU A 342 
AA3 1 2 N ILE A 293 ? N ILE A 399 O TYR A 301 ? O TYR A 407 
AA4 1 2 N THR A 354 ? N THR A 460 O ILE A 444 ? O ILE A 550 
AA4 2 3 O LEU A 443 ? O LEU A 549 N ILE A 397 ? N ILE A 503 
AA5 1 2 N LYS B 10  ? N LYS B 116 O LEU B 22  ? O LEU B 128 
AA6 1 2 N ARG B 233 ? N ARG B 339 O CYS B 244 ? O CYS B 350 
AA6 2 3 N ALA B 245 ? N ALA B 351 O TYR B 415 ? O TYR B 521 
AA6 3 4 N PHE B 414 ? N PHE B 520 O ILE B 424 ? O ILE B 530 
AA6 4 5 O ASN B 421 ? O ASN B 527 N GLU B 236 ? N GLU B 342 
AA7 1 2 N ILE B 293 ? N ILE B 399 O TYR B 301 ? O TYR B 407 
AA8 1 2 N THR B 354 ? N THR B 460 O ILE B 444 ? O ILE B 550 
AA8 2 3 O TYR B 447 ? O TYR B 553 N ILE B 393 ? N ILE B 499 
AA9 1 2 N LYS C 10  ? N LYS C 116 O LEU C 22  ? O LEU C 128 
AB1 1 2 N ARG C 233 ? N ARG C 339 O CYS C 244 ? O CYS C 350 
AB1 2 3 N ALA C 245 ? N ALA C 351 O TYR C 415 ? O TYR C 521 
AB1 3 4 N PHE C 414 ? N PHE C 520 O ILE C 424 ? O ILE C 530 
AB1 4 5 O ASN C 421 ? O ASN C 527 N GLU C 236 ? N GLU C 342 
AB2 1 2 N ILE C 293 ? N ILE C 399 O TYR C 301 ? O TYR C 407 
AB3 1 2 N THR C 354 ? N THR C 460 O ILE C 444 ? O ILE C 550 
AB3 2 3 O LEU C 443 ? O LEU C 549 N ILE C 397 ? N ILE C 503 
AB4 1 2 N LYS D 10  ? N LYS D 116 O LEU D 22  ? O LEU D 128 
AB5 1 2 N ARG D 233 ? N ARG D 339 O CYS D 244 ? O CYS D 350 
AB5 2 3 N ALA D 245 ? N ALA D 351 O SER D 413 ? O SER D 519 
AB5 3 4 N PHE D 414 ? N PHE D 520 O ILE D 424 ? O ILE D 530 
AB6 1 2 N ILE D 293 ? N ILE D 399 O TYR D 301 ? O TYR D 407 
AB7 1 2 N THR D 354 ? N THR D 460 O ILE D 444 ? O ILE D 550 
AB7 2 3 O LEU D 443 ? O LEU D 549 N ILE D 397 ? N ILE D 503 
AB8 1 2 N LYS E 10  ? N LYS E 116 O LEU E 22  ? O LEU E 128 
AB9 1 2 N ARG E 233 ? N ARG E 339 O CYS E 244 ? O CYS E 350 
AB9 2 3 N ALA E 245 ? N ALA E 351 O TYR E 415 ? O TYR E 521 
AB9 3 4 N PHE E 414 ? N PHE E 520 O ILE E 424 ? O ILE E 530 
AB9 4 5 O ASN E 421 ? O ASN E 527 N GLU E 236 ? N GLU E 342 
AC1 1 2 N ILE E 293 ? N ILE E 399 O TYR E 301 ? O TYR E 407 
AC2 1 2 N THR E 354 ? N THR E 460 O ILE E 444 ? O ILE E 550 
AC2 2 3 O LEU E 443 ? O LEU E 549 N ILE E 397 ? N ILE E 503 
AC3 1 2 N LYS F 10  ? N LYS F 116 O LEU F 22  ? O LEU F 128 
AC4 1 2 N ARG F 233 ? N ARG F 339 O CYS F 244 ? O CYS F 350 
AC4 2 3 N ALA F 245 ? N ALA F 351 O TYR F 415 ? O TYR F 521 
AC4 3 4 N PHE F 414 ? N PHE F 520 O ILE F 424 ? O ILE F 530 
AC4 4 5 O ASN F 421 ? O ASN F 527 N GLU F 236 ? N GLU F 342 
AC5 1 2 N ILE F 293 ? N ILE F 399 O TYR F 301 ? O TYR F 407 
AC6 1 2 N THR F 354 ? N THR F 460 O ILE F 444 ? O ILE F 550 
AC6 2 3 O LEU F 443 ? O LEU F 549 N ILE F 397 ? N ILE F 503 
AC7 1 2 N LYS G 10  ? N LYS G 116 O LEU G 22  ? O LEU G 128 
AC8 1 2 N ARG G 233 ? N ARG G 339 O CYS G 244 ? O CYS G 350 
AC8 2 3 N ALA G 245 ? N ALA G 351 O TYR G 415 ? O TYR G 521 
AC8 3 4 N PHE G 414 ? N PHE G 520 O ILE G 424 ? O ILE G 530 
AC8 4 5 O ASN G 421 ? O ASN G 527 N GLU G 236 ? N GLU G 342 
AC9 1 2 N ILE G 293 ? N ILE G 399 O TYR G 301 ? O TYR G 407 
AD1 1 2 N THR G 354 ? N THR G 460 O ILE G 444 ? O ILE G 550 
AD1 2 3 O LEU G 443 ? O LEU G 549 N ILE G 397 ? N ILE G 503 
AD2 1 2 N LYS H 10  ? N LYS H 116 O LEU H 22  ? O LEU H 128 
AD3 1 2 N ARG H 233 ? N ARG H 339 O CYS H 244 ? O CYS H 350 
AD3 2 3 N ALA H 245 ? N ALA H 351 O TYR H 415 ? O TYR H 521 
AD3 3 4 N PHE H 414 ? N PHE H 520 O ILE H 424 ? O ILE H 530 
AD3 4 5 O ASN H 421 ? O ASN H 527 N GLU H 236 ? N GLU H 342 
AD4 1 2 N ILE H 293 ? N ILE H 399 O TYR H 301 ? O TYR H 407 
AD5 1 2 N THR H 354 ? N THR H 460 O ILE H 444 ? O ILE H 550 
AD5 2 3 O LEU H 443 ? O LEU H 549 N ILE H 397 ? N ILE H 503 
AD6 1 2 N LYS I 10  ? N LYS I 116 O LEU I 22  ? O LEU I 128 
AD7 1 2 N ARG I 233 ? N ARG I 339 O CYS I 244 ? O CYS I 350 
AD7 2 3 N ALA I 245 ? N ALA I 351 O TYR I 415 ? O TYR I 521 
AD7 3 4 N PHE I 414 ? N PHE I 520 O ILE I 424 ? O ILE I 530 
AD7 4 5 O ASN I 421 ? O ASN I 527 N GLU I 236 ? N GLU I 342 
AD8 1 2 N ILE I 293 ? N ILE I 399 O TYR I 301 ? O TYR I 407 
AD9 1 2 N THR I 354 ? N THR I 460 O ILE I 444 ? O ILE I 550 
AD9 2 3 O LEU I 443 ? O LEU I 549 N ILE I 397 ? N ILE I 503 
AE1 1 2 N LYS J 10  ? N LYS J 116 O LEU J 22  ? O LEU J 128 
AE2 1 2 N ARG J 233 ? N ARG J 339 O CYS J 244 ? O CYS J 350 
AE2 2 3 N ALA J 245 ? N ALA J 351 O TYR J 415 ? O TYR J 521 
AE2 3 4 N PHE J 414 ? N PHE J 520 O ILE J 424 ? O ILE J 530 
AE2 4 5 O ASN J 421 ? O ASN J 527 N GLU J 236 ? N GLU J 342 
AE3 1 2 N ILE J 293 ? N ILE J 399 O TYR J 301 ? O TYR J 407 
AE4 1 2 N THR J 354 ? N THR J 460 O ILE J 444 ? O ILE J 550 
AE4 2 3 O LEU J 443 ? O LEU J 549 N ILE J 397 ? N ILE J 503 
AE5 1 2 N LYS K 10  ? N LYS K 116 O LEU K 22  ? O LEU K 128 
AE6 1 2 N ARG K 233 ? N ARG K 339 O CYS K 244 ? O CYS K 350 
AE6 2 3 N ALA K 245 ? N ALA K 351 O TYR K 415 ? O TYR K 521 
AE6 3 4 N PHE K 414 ? N PHE K 520 O ILE K 424 ? O ILE K 530 
AE6 4 5 O ASN K 421 ? O ASN K 527 N GLU K 236 ? N GLU K 342 
AE7 1 2 N ILE K 293 ? N ILE K 399 O TYR K 301 ? O TYR K 407 
AE8 1 2 N THR K 354 ? N THR K 460 O ILE K 444 ? O ILE K 550 
AE8 2 3 O LEU K 443 ? O LEU K 549 N ILE K 397 ? N ILE K 503 
AE9 1 2 N LYS L 10  ? N LYS L 116 O LEU L 22  ? O LEU L 128 
AF1 1 2 N ARG L 233 ? N ARG L 339 O CYS L 244 ? O CYS L 350 
AF1 2 3 N ALA L 245 ? N ALA L 351 O TYR L 415 ? O TYR L 521 
AF1 3 4 N PHE L 414 ? N PHE L 520 O ILE L 424 ? O ILE L 530 
AF2 1 2 N ILE L 293 ? N ILE L 399 O TYR L 301 ? O TYR L 407 
AF3 1 2 N THR L 354 ? N THR L 460 O ILE L 444 ? O ILE L 550 
AF3 2 3 O LEU L 443 ? O LEU L 549 N ILE L 397 ? N ILE L 503 
AF4 1 2 N LYS M 10  ? N LYS M 116 O LEU M 22  ? O LEU M 128 
AF5 1 2 N ARG M 233 ? N ARG M 339 O CYS M 244 ? O CYS M 350 
AF5 2 3 N ALA M 245 ? N ALA M 351 O TYR M 415 ? O TYR M 521 
AF5 3 4 N PHE M 414 ? N PHE M 520 O ILE M 424 ? O ILE M 530 
AF5 4 5 O ASN M 421 ? O ASN M 527 N GLU M 236 ? N GLU M 342 
AF6 1 2 N ILE M 293 ? N ILE M 399 O TYR M 301 ? O TYR M 407 
AF7 1 2 N THR M 354 ? N THR M 460 O ILE M 444 ? O ILE M 550 
AF7 2 3 O LEU M 443 ? O LEU M 549 N ILE M 397 ? N ILE M 503 
AF8 1 2 N LYS N 10  ? N LYS N 116 O LEU N 22  ? O LEU N 128 
AF9 1 2 N ARG N 233 ? N ARG N 339 O CYS N 244 ? O CYS N 350 
AF9 2 3 N ALA N 245 ? N ALA N 351 O TYR N 415 ? O TYR N 521 
AF9 3 4 N PHE N 414 ? N PHE N 520 O ILE N 424 ? O ILE N 530 
AF9 4 5 O ASN N 421 ? O ASN N 527 N GLU N 236 ? N GLU N 342 
AG1 1 2 N ILE N 293 ? N ILE N 399 O TYR N 301 ? O TYR N 407 
AG2 1 2 N THR N 354 ? N THR N 460 O ILE N 444 ? O ILE N 550 
AG2 2 3 O LEU N 443 ? O LEU N 549 N ILE N 397 ? N ILE N 503 
AG3 1 2 N LYS O 10  ? N LYS O 116 O LEU O 22  ? O LEU O 128 
AG4 1 2 N ARG O 233 ? N ARG O 339 O CYS O 244 ? O CYS O 350 
AG4 2 3 N ALA O 245 ? N ALA O 351 O TYR O 415 ? O TYR O 521 
AG4 3 4 N PHE O 414 ? N PHE O 520 O ILE O 424 ? O ILE O 530 
AG4 4 5 O ASN O 421 ? O ASN O 527 N GLU O 236 ? N GLU O 342 
AG5 1 2 N ILE O 293 ? N ILE O 399 O TYR O 301 ? O TYR O 407 
AG6 1 2 N THR O 354 ? N THR O 460 O ILE O 444 ? O ILE O 550 
AG6 2 3 O TYR O 447 ? O TYR O 553 N ILE O 393 ? N ILE O 499 
AG7 1 2 N LYS P 10  ? N LYS P 116 O LEU P 22  ? O LEU P 128 
AG8 1 2 N ARG P 233 ? N ARG P 339 O CYS P 244 ? O CYS P 350 
AG8 2 3 N ALA P 245 ? N ALA P 351 O TYR P 415 ? O TYR P 521 
AG8 3 4 N PHE P 414 ? N PHE P 520 O ILE P 424 ? O ILE P 530 
AG8 4 5 O ASN P 421 ? O ASN P 527 N GLU P 236 ? N GLU P 342 
AG9 1 2 N ILE P 293 ? N ILE P 399 O TYR P 301 ? O TYR P 407 
AH1 1 2 N THR P 354 ? N THR P 460 O ILE P 444 ? O ILE P 550 
AH1 2 3 O LEU P 443 ? O LEU P 549 N ILE P 397 ? N ILE P 503 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A FE  701 ? 6  'binding site for residue FE A 701'  
AC2 Software A MG  702 ? 3  'binding site for residue MG A 702'  
AC3 Software A MG  703 ? 2  'binding site for residue MG A 703'  
AC4 Software A MG  704 ? 2  'binding site for residue MG A 704'  
AC5 Software A XG4 705 ? 18 'binding site for residue XG4 A 705' 
AC6 Software A CZF 706 ? 14 'binding site for residue CZF A 706' 
AC7 Software A SO4 707 ? 4  'binding site for residue SO4 A 707' 
AC8 Software A XG4 708 ? 17 'binding site for residue XG4 A 708' 
AC9 Software B FE  701 ? 7  'binding site for residue FE B 701'  
AD1 Software B MG  702 ? 5  'binding site for residue MG B 702'  
AD2 Software B MG  703 ? 3  'binding site for residue MG B 703'  
AD3 Software B MG  704 ? 2  'binding site for residue MG B 704'  
AD4 Software B XG4 705 ? 19 'binding site for residue XG4 B 705' 
AD5 Software B CZF 706 ? 14 'binding site for residue CZF B 706' 
AD6 Software B SO4 707 ? 4  'binding site for residue SO4 B 707' 
AD7 Software B XG4 708 ? 19 'binding site for residue XG4 B 708' 
AD8 Software C XG4 701 ? 14 'binding site for residue XG4 C 701' 
AD9 Software C FE  702 ? 7  'binding site for residue FE C 702'  
AE1 Software C MG  703 ? 5  'binding site for residue MG C 703'  
AE2 Software C MG  704 ? 3  'binding site for residue MG C 704'  
AE3 Software C MG  705 ? 2  'binding site for residue MG C 705'  
AE4 Software C XG4 706 ? 19 'binding site for residue XG4 C 706' 
AE5 Software C CZF 707 ? 14 'binding site for residue CZF C 707' 
AE6 Software C SO4 708 ? 4  'binding site for residue SO4 C 708' 
AE7 Software C CZF 709 ? 14 'binding site for residue CZF C 709' 
AE8 Software D XG4 701 ? 17 'binding site for residue XG4 D 701' 
AE9 Software D FE  702 ? 7  'binding site for residue FE D 702'  
AF1 Software D MG  703 ? 5  'binding site for residue MG D 703'  
AF2 Software D MG  704 ? 2  'binding site for residue MG D 704'  
AF3 Software D MG  705 ? 2  'binding site for residue MG D 705'  
AF4 Software D XG4 706 ? 18 'binding site for residue XG4 D 706' 
AF5 Software D SO4 707 ? 4  'binding site for residue SO4 D 707' 
AF6 Software E FE  701 ? 7  'binding site for residue FE E 701'  
AF7 Software E MG  702 ? 5  'binding site for residue MG E 702'  
AF8 Software E MG  703 ? 3  'binding site for residue MG E 703'  
AF9 Software E MG  704 ? 2  'binding site for residue MG E 704'  
AG1 Software E XG4 705 ? 19 'binding site for residue XG4 E 705' 
AG2 Software E CZF 706 ? 14 'binding site for residue CZF E 706' 
AG3 Software E SO4 707 ? 4  'binding site for residue SO4 E 707' 
AG4 Software E XG4 708 ? 15 'binding site for residue XG4 E 708' 
AG5 Software F FE  701 ? 7  'binding site for residue FE F 701'  
AG6 Software F MG  702 ? 6  'binding site for residue MG F 702'  
AG7 Software F MG  703 ? 3  'binding site for residue MG F 703'  
AG8 Software F MG  704 ? 2  'binding site for residue MG F 704'  
AG9 Software F XG4 705 ? 18 'binding site for residue XG4 F 705' 
AH1 Software F CZF 706 ? 15 'binding site for residue CZF F 706' 
AH2 Software F SO4 707 ? 4  'binding site for residue SO4 F 707' 
AH3 Software F XG4 708 ? 16 'binding site for residue XG4 F 708' 
AH4 Software G XG4 701 ? 17 'binding site for residue XG4 G 701' 
AH5 Software G FE  702 ? 7  'binding site for residue FE G 702'  
AH6 Software G MG  703 ? 6  'binding site for residue MG G 703'  
AH7 Software G MG  704 ? 3  'binding site for residue MG G 704'  
AH8 Software G MG  705 ? 2  'binding site for residue MG G 705'  
AH9 Software G XG4 706 ? 18 'binding site for residue XG4 G 706' 
AI1 Software G CZF 707 ? 15 'binding site for residue CZF G 707' 
AI2 Software G SO4 708 ? 4  'binding site for residue SO4 G 708' 
AI3 Software H XG4 701 ? 17 'binding site for residue XG4 H 701' 
AI4 Software H FE  702 ? 7  'binding site for residue FE H 702'  
AI5 Software H MG  703 ? 5  'binding site for residue MG H 703'  
AI6 Software H MG  704 ? 3  'binding site for residue MG H 704'  
AI7 Software H MG  705 ? 2  'binding site for residue MG H 705'  
AI8 Software H XG4 706 ? 18 'binding site for residue XG4 H 706' 
AI9 Software H CZF 707 ? 15 'binding site for residue CZF H 707' 
AJ1 Software H SO4 708 ? 4  'binding site for residue SO4 H 708' 
AJ2 Software I FE  701 ? 7  'binding site for residue FE I 701'  
AJ3 Software I MG  702 ? 5  'binding site for residue MG I 702'  
AJ4 Software I MG  703 ? 2  'binding site for residue MG I 703'  
AJ5 Software I MG  704 ? 2  'binding site for residue MG I 704'  
AJ6 Software I XG4 705 ? 19 'binding site for residue XG4 I 705' 
AJ7 Software I SO4 706 ? 4  'binding site for residue SO4 I 706' 
AJ8 Software I XG4 707 ? 16 'binding site for residue XG4 I 707' 
AJ9 Software I XG4 708 ? 17 'binding site for residue XG4 I 708' 
AK1 Software J CZF 701 ? 14 'binding site for residue CZF J 701' 
AK2 Software J FE  702 ? 7  'binding site for residue FE J 702'  
AK3 Software J MG  703 ? 4  'binding site for residue MG J 703'  
AK4 Software J MG  704 ? 3  'binding site for residue MG J 704'  
AK5 Software J MG  705 ? 2  'binding site for residue MG J 705'  
AK6 Software J XG4 706 ? 18 'binding site for residue XG4 J 706' 
AK7 Software J CZF 707 ? 14 'binding site for residue CZF J 707' 
AK8 Software J SO4 708 ? 4  'binding site for residue SO4 J 708' 
AK9 Software J XG4 709 ? 19 'binding site for residue XG4 J 709' 
AL1 Software K XG4 701 ? 17 'binding site for residue XG4 K 701' 
AL2 Software K FE  702 ? 7  'binding site for residue FE K 702'  
AL3 Software K MG  703 ? 5  'binding site for residue MG K 703'  
AL4 Software K MG  704 ? 3  'binding site for residue MG K 704'  
AL5 Software K MG  705 ? 2  'binding site for residue MG K 705'  
AL6 Software K XG4 706 ? 19 'binding site for residue XG4 K 706' 
AL7 Software K CZF 707 ? 14 'binding site for residue CZF K 707' 
AL8 Software K SO4 708 ? 4  'binding site for residue SO4 K 708' 
AL9 Software L FE  701 ? 7  'binding site for residue FE L 701'  
AM1 Software L MG  702 ? 6  'binding site for residue MG L 702'  
AM2 Software L MG  703 ? 3  'binding site for residue MG L 703'  
AM3 Software L MG  704 ? 2  'binding site for residue MG L 704'  
AM4 Software L XG4 705 ? 19 'binding site for residue XG4 L 705' 
AM5 Software L CZF 706 ? 15 'binding site for residue CZF L 706' 
AM6 Software L SO4 707 ? 4  'binding site for residue SO4 L 707' 
AM7 Software M FE  701 ? 6  'binding site for residue FE M 701'  
AM8 Software M MG  702 ? 4  'binding site for residue MG M 702'  
AM9 Software M MG  703 ? 2  'binding site for residue MG M 703'  
AN1 Software M MG  704 ? 3  'binding site for residue MG M 704'  
AN2 Software M XG4 705 ? 18 'binding site for residue XG4 M 705' 
AN3 Software M CZF 706 ? 15 'binding site for residue CZF M 706' 
AN4 Software M SO4 707 ? 4  'binding site for residue SO4 M 707' 
AN5 Software M XG4 708 ? 16 'binding site for residue XG4 M 708' 
AN6 Software N FE  701 ? 7  'binding site for residue FE N 701'  
AN7 Software N MG  702 ? 5  'binding site for residue MG N 702'  
AN8 Software N MG  703 ? 3  'binding site for residue MG N 703'  
AN9 Software N MG  704 ? 2  'binding site for residue MG N 704'  
AO1 Software N XG4 705 ? 19 'binding site for residue XG4 N 705' 
AO2 Software N CZF 706 ? 14 'binding site for residue CZF N 706' 
AO3 Software N SO4 707 ? 3  'binding site for residue SO4 N 707' 
AO4 Software N XG4 708 ? 17 'binding site for residue XG4 N 708' 
AO5 Software O XG4 701 ? 18 'binding site for residue XG4 O 701' 
AO6 Software O FE  702 ? 7  'binding site for residue FE O 702'  
AO7 Software O MG  703 ? 5  'binding site for residue MG O 703'  
AO8 Software O MG  704 ? 2  'binding site for residue MG O 704'  
AO9 Software O MG  705 ? 2  'binding site for residue MG O 705'  
AP1 Software O XG4 706 ? 19 'binding site for residue XG4 O 706' 
AP2 Software O CZF 707 ? 14 'binding site for residue CZF O 707' 
AP3 Software O SO4 708 ? 4  'binding site for residue SO4 O 708' 
AP4 Software P XG4 701 ? 16 'binding site for residue XG4 P 701' 
AP5 Software P FE  702 ? 7  'binding site for residue FE P 702'  
AP6 Software P MG  703 ? 6  'binding site for residue MG P 703'  
AP7 Software P MG  704 ? 2  'binding site for residue MG P 704'  
AP8 Software P MG  705 ? 2  'binding site for residue MG P 705'  
AP9 Software P XG4 706 ? 19 'binding site for residue XG4 P 706' 
AQ1 Software P CZF 707 ? 15 'binding site for residue CZF P 707' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1    AC1 6  ARG A  58  ? ARG A 164 . ? 1_555 ? 
2    AC1 6  HIS A  61  ? HIS A 167 . ? 1_555 ? 
3    AC1 6  HIS A  100 ? HIS A 206 . ? 1_555 ? 
4    AC1 6  ASP A  101 ? ASP A 207 . ? 1_555 ? 
5    AC1 6  ASP A  205 ? ASP A 311 . ? 1_555 ? 
6    AC1 6  XG4 U  .   ? XG4 A 705 . ? 1_555 ? 
7    AC2 3  ASP A  101 ? ASP A 207 . ? 1_555 ? 
8    AC2 3  HIS A  127 ? HIS A 233 . ? 1_555 ? 
9    AC2 3  XG4 U  .   ? XG4 A 705 . ? 1_555 ? 
10   AC3 2  ASP A  203 ? ASP A 309 . ? 1_555 ? 
11   AC3 2  XG4 U  .   ? XG4 A 705 . ? 1_555 ? 
12   AC4 2  CZF V  .   ? CZF A 706 . ? 1_555 ? 
13   AC4 2  XG4 GA .   ? XG4 C 701 . ? 1_555 ? 
14   AC5 18 GLN A  43  ? GLN A 149 . ? 1_555 ? 
15   AC5 18 LEU A  44  ? LEU A 150 . ? 1_555 ? 
16   AC5 18 ARG A  58  ? ARG A 164 . ? 1_555 ? 
17   AC5 18 HIS A  61  ? HIS A 167 . ? 1_555 ? 
18   AC5 18 ASP A  101 ? ASP A 207 . ? 1_555 ? 
19   AC5 18 HIS A  104 ? HIS A 210 . ? 1_555 ? 
20   AC5 18 HIS A  109 ? HIS A 215 . ? 1_555 ? 
21   AC5 18 HIS A  127 ? HIS A 233 . ? 1_555 ? 
22   AC5 18 ASP A  205 ? ASP A 311 . ? 1_555 ? 
23   AC5 18 LYS A  206 ? LYS A 312 . ? 1_555 ? 
24   AC5 18 TYR A  209 ? TYR A 315 . ? 1_555 ? 
25   AC5 18 ASP A  213 ? ASP A 319 . ? 1_555 ? 
26   AC5 18 ARG A  260 ? ARG A 366 . ? 1_555 ? 
27   AC5 18 TYR A  268 ? TYR A 374 . ? 1_555 ? 
28   AC5 18 GLN A  269 ? GLN A 375 . ? 1_555 ? 
29   AC5 18 FE  Q  .   ? FE  A 701 . ? 1_555 ? 
30   AC5 18 MG  R  .   ? MG  A 702 . ? 1_555 ? 
31   AC5 18 MG  S  .   ? MG  A 703 . ? 1_555 ? 
32   AC6 14 LYS A  10  ? LYS A 116 . ? 1_555 ? 
33   AC6 14 VAL A  11  ? VAL A 117 . ? 1_555 ? 
34   AC6 14 ILE A  12  ? ILE A 118 . ? 1_555 ? 
35   AC6 14 ASN A  31  ? ASN A 137 . ? 1_555 ? 
36   AC6 14 GLN A  36  ? GLN A 142 . ? 1_555 ? 
37   AC6 14 ARG A  39  ? ARG A 145 . ? 1_555 ? 
38   AC6 14 PHE A  59  ? PHE A 165 . ? 1_555 ? 
39   AC6 14 MG  T  .   ? MG  A 704 . ? 1_555 ? 
40   AC6 14 TYR B  49  ? TYR B 155 . ? 1_555 ? 
41   AC6 14 VAL B  50  ? VAL B 156 . ? 1_555 ? 
42   AC6 14 VAL B  272 ? VAL B 378 . ? 1_555 ? 
43   AC6 14 ARG B  345 ? ARG B 451 . ? 1_555 ? 
44   AC6 14 LYS C  417 ? LYS C 523 . ? 1_555 ? 
45   AC6 14 XG4 GA .   ? XG4 C 701 . ? 1_555 ? 
46   AC7 4  ARG A  199 ? ARG A 305 . ? 1_555 ? 
47   AC7 4  ARG A  242 ? ARG A 348 . ? 1_555 ? 
48   AC7 4  HIS A  411 ? HIS A 517 . ? 1_555 ? 
49   AC7 4  ARG A  425 ? ARG A 531 . ? 1_555 ? 
50   AC8 17 ASP A  224 ? ASP A 330 . ? 1_555 ? 
51   AC8 17 ARG A  227 ? ARG A 333 . ? 1_555 ? 
52   AC8 17 ARG A  246 ? ARG A 352 . ? 1_555 ? 
53   AC8 17 LYS A  248 ? LYS A 354 . ? 1_555 ? 
54   AC8 17 ASN A  252 ? ASN A 358 . ? 1_555 ? 
55   AC8 17 LYS A  417 ? LYS A 523 . ? 1_555 ? 
56   AC8 17 VAL C  11  ? VAL C 117 . ? 1_555 ? 
57   AC8 17 ASN C  13  ? ASN C 119 . ? 1_555 ? 
58   AC8 17 MG  KA .   ? MG  C 705 . ? 1_555 ? 
59   AC8 17 CZF MA .   ? CZF C 707 . ? 1_555 ? 
60   AC8 17 VAL D  50  ? VAL D 156 . ? 1_555 ? 
61   AC8 17 PHE D  51  ? PHE D 157 . ? 1_555 ? 
62   AC8 17 GLY D  218 ? GLY D 324 . ? 1_555 ? 
63   AC8 17 ILE D  219 ? ILE D 325 . ? 1_555 ? 
64   AC8 17 ARG D  266 ? ARG D 372 . ? 1_555 ? 
65   AC8 17 HIS D  270 ? HIS D 376 . ? 1_555 ? 
66   AC8 17 LYS D  271 ? LYS D 377 . ? 1_555 ? 
67   AC9 7  ARG B  58  ? ARG B 164 . ? 1_555 ? 
68   AC9 7  HIS B  61  ? HIS B 167 . ? 1_555 ? 
69   AC9 7  HIS B  100 ? HIS B 206 . ? 1_555 ? 
70   AC9 7  ASP B  101 ? ASP B 207 . ? 1_555 ? 
71   AC9 7  ASP B  205 ? ASP B 311 . ? 1_555 ? 
72   AC9 7  MG  Z  .   ? MG  B 702 . ? 1_555 ? 
73   AC9 7  XG4 CA .   ? XG4 B 705 . ? 1_555 ? 
74   AD1 5  HIS B  100 ? HIS B 206 . ? 1_555 ? 
75   AD1 5  ASP B  101 ? ASP B 207 . ? 1_555 ? 
76   AD1 5  HIS B  127 ? HIS B 233 . ? 1_555 ? 
77   AD1 5  FE  Y  .   ? FE  B 701 . ? 1_555 ? 
78   AD1 5  XG4 CA .   ? XG4 B 705 . ? 1_555 ? 
79   AD2 3  ASP B  203 ? ASP B 309 . ? 1_555 ? 
80   AD2 3  LYS B  206 ? LYS B 312 . ? 1_555 ? 
81   AD2 3  XG4 CA .   ? XG4 B 705 . ? 1_555 ? 
82   AD3 2  CZF DA .   ? CZF B 706 . ? 1_555 ? 
83   AD3 2  XG4 PA .   ? XG4 D 701 . ? 1_555 ? 
84   AD4 19 GLN B  43  ? GLN B 149 . ? 1_555 ? 
85   AD4 19 LEU B  44  ? LEU B 150 . ? 1_555 ? 
86   AD4 19 ARG B  58  ? ARG B 164 . ? 1_555 ? 
87   AD4 19 HIS B  61  ? HIS B 167 . ? 1_555 ? 
88   AD4 19 ASP B  101 ? ASP B 207 . ? 1_555 ? 
89   AD4 19 HIS B  104 ? HIS B 210 . ? 1_555 ? 
90   AD4 19 HIS B  109 ? HIS B 215 . ? 1_555 ? 
91   AD4 19 HIS B  127 ? HIS B 233 . ? 1_555 ? 
92   AD4 19 ASP B  205 ? ASP B 311 . ? 1_555 ? 
93   AD4 19 LYS B  206 ? LYS B 312 . ? 1_555 ? 
94   AD4 19 TYR B  209 ? TYR B 315 . ? 1_555 ? 
95   AD4 19 ASP B  213 ? ASP B 319 . ? 1_555 ? 
96   AD4 19 ARG B  260 ? ARG B 366 . ? 1_555 ? 
97   AD4 19 HIS B  264 ? HIS B 370 . ? 1_555 ? 
98   AD4 19 TYR B  268 ? TYR B 374 . ? 1_555 ? 
99   AD4 19 GLN B  269 ? GLN B 375 . ? 1_555 ? 
100  AD4 19 FE  Y  .   ? FE  B 701 . ? 1_555 ? 
101  AD4 19 MG  Z  .   ? MG  B 702 . ? 1_555 ? 
102  AD4 19 MG  AA .   ? MG  B 703 . ? 1_555 ? 
103  AD5 14 TYR A  49  ? TYR A 155 . ? 1_555 ? 
104  AD5 14 VAL A  50  ? VAL A 156 . ? 1_555 ? 
105  AD5 14 VAL A  272 ? VAL A 378 . ? 1_555 ? 
106  AD5 14 ARG A  345 ? ARG A 451 . ? 1_555 ? 
107  AD5 14 LYS B  10  ? LYS B 116 . ? 1_555 ? 
108  AD5 14 VAL B  11  ? VAL B 117 . ? 1_555 ? 
109  AD5 14 ILE B  12  ? ILE B 118 . ? 1_555 ? 
110  AD5 14 ASN B  31  ? ASN B 137 . ? 1_555 ? 
111  AD5 14 GLN B  36  ? GLN B 142 . ? 1_555 ? 
112  AD5 14 ARG B  39  ? ARG B 145 . ? 1_555 ? 
113  AD5 14 PHE B  59  ? PHE B 165 . ? 1_555 ? 
114  AD5 14 MG  BA .   ? MG  B 704 . ? 1_555 ? 
115  AD5 14 LYS D  417 ? LYS D 523 . ? 1_555 ? 
116  AD5 14 XG4 PA .   ? XG4 D 701 . ? 1_555 ? 
117  AD6 4  ARG B  199 ? ARG B 305 . ? 1_555 ? 
118  AD6 4  ARG B  242 ? ARG B 348 . ? 1_555 ? 
119  AD6 4  HIS B  411 ? HIS B 517 . ? 1_555 ? 
120  AD6 4  ARG B  425 ? ARG B 531 . ? 1_555 ? 
121  AD7 19 ASP B  224 ? ASP B 330 . ? 1_555 ? 
122  AD7 19 ARG B  227 ? ARG B 333 . ? 1_555 ? 
123  AD7 19 ARG B  246 ? ARG B 352 . ? 1_555 ? 
124  AD7 19 LYS B  248 ? LYS B 354 . ? 1_555 ? 
125  AD7 19 ASN B  252 ? ASN B 358 . ? 1_555 ? 
126  AD7 19 LYS B  417 ? LYS B 523 . ? 1_555 ? 
127  AD7 19 VAL C  50  ? VAL C 156 . ? 1_555 ? 
128  AD7 19 PHE C  51  ? PHE C 157 . ? 1_555 ? 
129  AD7 19 GLY C  218 ? GLY C 324 . ? 1_555 ? 
130  AD7 19 ILE C  219 ? ILE C 325 . ? 1_555 ? 
131  AD7 19 ARG C  266 ? ARG C 372 . ? 1_555 ? 
132  AD7 19 HIS C  270 ? HIS C 376 . ? 1_555 ? 
133  AD7 19 LYS C  271 ? LYS C 377 . ? 1_555 ? 
134  AD7 19 CZF OA .   ? CZF C 709 . ? 1_555 ? 
135  AD7 19 VAL D  11  ? VAL D 117 . ? 1_555 ? 
136  AD7 19 ILE D  12  ? ILE D 118 . ? 1_555 ? 
137  AD7 19 ASN D  13  ? ASN D 119 . ? 1_555 ? 
138  AD7 19 HIS D  19  ? HIS D 125 . ? 1_555 ? 
139  AD7 19 MG  TA .   ? MG  D 705 . ? 1_555 ? 
140  AD8 14 VAL A  11  ? VAL A 117 . ? 1_555 ? 
141  AD8 14 ASN A  13  ? ASN A 119 . ? 1_555 ? 
142  AD8 14 MG  T  .   ? MG  A 704 . ? 1_555 ? 
143  AD8 14 CZF V  .   ? CZF A 706 . ? 1_555 ? 
144  AD8 14 VAL B  50  ? VAL B 156 . ? 1_555 ? 
145  AD8 14 PHE B  51  ? PHE B 157 . ? 1_555 ? 
146  AD8 14 ARG B  266 ? ARG B 372 . ? 1_555 ? 
147  AD8 14 HIS B  270 ? HIS B 376 . ? 1_555 ? 
148  AD8 14 LYS B  271 ? LYS B 377 . ? 1_555 ? 
149  AD8 14 ARG C  227 ? ARG C 333 . ? 1_555 ? 
150  AD8 14 ARG C  246 ? ARG C 352 . ? 1_555 ? 
151  AD8 14 LYS C  248 ? LYS C 354 . ? 1_555 ? 
152  AD8 14 ASN C  252 ? ASN C 358 . ? 1_555 ? 
153  AD8 14 LYS C  417 ? LYS C 523 . ? 1_555 ? 
154  AD9 7  ARG C  58  ? ARG C 164 . ? 1_555 ? 
155  AD9 7  HIS C  61  ? HIS C 167 . ? 1_555 ? 
156  AD9 7  HIS C  100 ? HIS C 206 . ? 1_555 ? 
157  AD9 7  ASP C  101 ? ASP C 207 . ? 1_555 ? 
158  AD9 7  ASP C  205 ? ASP C 311 . ? 1_555 ? 
159  AD9 7  MG  IA .   ? MG  C 703 . ? 1_555 ? 
160  AD9 7  XG4 LA .   ? XG4 C 706 . ? 1_555 ? 
161  AE1 5  HIS C  100 ? HIS C 206 . ? 1_555 ? 
162  AE1 5  ASP C  101 ? ASP C 207 . ? 1_555 ? 
163  AE1 5  HIS C  127 ? HIS C 233 . ? 1_555 ? 
164  AE1 5  FE  HA .   ? FE  C 702 . ? 1_555 ? 
165  AE1 5  XG4 LA .   ? XG4 C 706 . ? 1_555 ? 
166  AE2 3  ASP C  203 ? ASP C 309 . ? 1_555 ? 
167  AE2 3  LYS C  206 ? LYS C 312 . ? 1_555 ? 
168  AE2 3  XG4 LA .   ? XG4 C 706 . ? 1_555 ? 
169  AE3 2  XG4 X  .   ? XG4 A 708 . ? 1_555 ? 
170  AE3 2  CZF MA .   ? CZF C 707 . ? 1_555 ? 
171  AE4 19 GLN C  43  ? GLN C 149 . ? 1_555 ? 
172  AE4 19 LEU C  44  ? LEU C 150 . ? 1_555 ? 
173  AE4 19 ARG C  58  ? ARG C 164 . ? 1_555 ? 
174  AE4 19 HIS C  61  ? HIS C 167 . ? 1_555 ? 
175  AE4 19 ASP C  101 ? ASP C 207 . ? 1_555 ? 
176  AE4 19 HIS C  104 ? HIS C 210 . ? 1_555 ? 
177  AE4 19 HIS C  109 ? HIS C 215 . ? 1_555 ? 
178  AE4 19 HIS C  127 ? HIS C 233 . ? 1_555 ? 
179  AE4 19 ASP C  205 ? ASP C 311 . ? 1_555 ? 
180  AE4 19 LYS C  206 ? LYS C 312 . ? 1_555 ? 
181  AE4 19 TYR C  209 ? TYR C 315 . ? 1_555 ? 
182  AE4 19 ASP C  213 ? ASP C 319 . ? 1_555 ? 
183  AE4 19 ARG C  260 ? ARG C 366 . ? 1_555 ? 
184  AE4 19 HIS C  264 ? HIS C 370 . ? 1_555 ? 
185  AE4 19 TYR C  268 ? TYR C 374 . ? 1_555 ? 
186  AE4 19 GLN C  269 ? GLN C 375 . ? 1_555 ? 
187  AE4 19 FE  HA .   ? FE  C 702 . ? 1_555 ? 
188  AE4 19 MG  IA .   ? MG  C 703 . ? 1_555 ? 
189  AE4 19 MG  JA .   ? MG  C 704 . ? 1_555 ? 
190  AE5 14 LYS A  417 ? LYS A 523 . ? 1_555 ? 
191  AE5 14 XG4 X  .   ? XG4 A 708 . ? 1_555 ? 
192  AE5 14 LYS C  10  ? LYS C 116 . ? 1_555 ? 
193  AE5 14 VAL C  11  ? VAL C 117 . ? 1_555 ? 
194  AE5 14 ILE C  12  ? ILE C 118 . ? 1_555 ? 
195  AE5 14 ASN C  31  ? ASN C 137 . ? 1_555 ? 
196  AE5 14 GLN C  36  ? GLN C 142 . ? 1_555 ? 
197  AE5 14 ARG C  39  ? ARG C 145 . ? 1_555 ? 
198  AE5 14 PHE C  59  ? PHE C 165 . ? 1_555 ? 
199  AE5 14 MG  KA .   ? MG  C 705 . ? 1_555 ? 
200  AE5 14 TYR D  49  ? TYR D 155 . ? 1_555 ? 
201  AE5 14 VAL D  50  ? VAL D 156 . ? 1_555 ? 
202  AE5 14 VAL D  272 ? VAL D 378 . ? 1_555 ? 
203  AE5 14 ARG D  345 ? ARG D 451 . ? 1_555 ? 
204  AE6 4  ARG C  199 ? ARG C 305 . ? 1_555 ? 
205  AE6 4  ARG C  242 ? ARG C 348 . ? 1_555 ? 
206  AE6 4  HIS C  411 ? HIS C 517 . ? 1_555 ? 
207  AE6 4  ARG C  425 ? ARG C 531 . ? 1_555 ? 
208  AE7 14 LYS B  417 ? LYS B 523 . ? 1_555 ? 
209  AE7 14 XG4 FA .   ? XG4 B 708 . ? 1_555 ? 
210  AE7 14 TYR C  49  ? TYR C 155 . ? 1_555 ? 
211  AE7 14 VAL C  50  ? VAL C 156 . ? 1_555 ? 
212  AE7 14 VAL C  272 ? VAL C 378 . ? 1_555 ? 
213  AE7 14 ARG C  345 ? ARG C 451 . ? 1_555 ? 
214  AE7 14 LYS D  10  ? LYS D 116 . ? 1_555 ? 
215  AE7 14 VAL D  11  ? VAL D 117 . ? 1_555 ? 
216  AE7 14 ILE D  12  ? ILE D 118 . ? 1_555 ? 
217  AE7 14 ASN D  31  ? ASN D 137 . ? 1_555 ? 
218  AE7 14 GLN D  36  ? GLN D 142 . ? 1_555 ? 
219  AE7 14 ARG D  39  ? ARG D 145 . ? 1_555 ? 
220  AE7 14 PHE D  59  ? PHE D 165 . ? 1_555 ? 
221  AE7 14 MG  TA .   ? MG  D 705 . ? 1_555 ? 
222  AE8 17 VAL A  50  ? VAL A 156 . ? 1_555 ? 
223  AE8 17 PHE A  51  ? PHE A 157 . ? 1_555 ? 
224  AE8 17 GLY A  218 ? GLY A 324 . ? 1_555 ? 
225  AE8 17 ARG A  266 ? ARG A 372 . ? 1_555 ? 
226  AE8 17 HIS A  270 ? HIS A 376 . ? 1_555 ? 
227  AE8 17 LYS A  271 ? LYS A 377 . ? 1_555 ? 
228  AE8 17 VAL B  11  ? VAL B 117 . ? 1_555 ? 
229  AE8 17 ASN B  13  ? ASN B 119 . ? 1_555 ? 
230  AE8 17 HIS B  19  ? HIS B 125 . ? 1_555 ? 
231  AE8 17 MG  BA .   ? MG  B 704 . ? 1_555 ? 
232  AE8 17 CZF DA .   ? CZF B 706 . ? 1_555 ? 
233  AE8 17 ASP D  224 ? ASP D 330 . ? 1_555 ? 
234  AE8 17 ARG D  227 ? ARG D 333 . ? 1_555 ? 
235  AE8 17 ARG D  246 ? ARG D 352 . ? 1_555 ? 
236  AE8 17 LYS D  248 ? LYS D 354 . ? 1_555 ? 
237  AE8 17 ASN D  252 ? ASN D 358 . ? 1_555 ? 
238  AE8 17 LYS D  417 ? LYS D 523 . ? 1_555 ? 
239  AE9 7  ARG D  58  ? ARG D 164 . ? 1_555 ? 
240  AE9 7  HIS D  61  ? HIS D 167 . ? 1_555 ? 
241  AE9 7  HIS D  100 ? HIS D 206 . ? 1_555 ? 
242  AE9 7  ASP D  101 ? ASP D 207 . ? 1_555 ? 
243  AE9 7  ASP D  205 ? ASP D 311 . ? 1_555 ? 
244  AE9 7  MG  RA .   ? MG  D 703 . ? 1_555 ? 
245  AE9 7  XG4 UA .   ? XG4 D 706 . ? 1_555 ? 
246  AF1 5  HIS D  100 ? HIS D 206 . ? 1_555 ? 
247  AF1 5  ASP D  101 ? ASP D 207 . ? 1_555 ? 
248  AF1 5  HIS D  127 ? HIS D 233 . ? 1_555 ? 
249  AF1 5  FE  QA .   ? FE  D 702 . ? 1_555 ? 
250  AF1 5  XG4 UA .   ? XG4 D 706 . ? 1_555 ? 
251  AF2 2  ASP D  203 ? ASP D 309 . ? 1_555 ? 
252  AF2 2  XG4 UA .   ? XG4 D 706 . ? 1_555 ? 
253  AF3 2  XG4 FA .   ? XG4 B 708 . ? 1_555 ? 
254  AF3 2  CZF OA .   ? CZF C 709 . ? 1_555 ? 
255  AF4 18 GLN D  43  ? GLN D 149 . ? 1_555 ? 
256  AF4 18 LEU D  44  ? LEU D 150 . ? 1_555 ? 
257  AF4 18 ARG D  58  ? ARG D 164 . ? 1_555 ? 
258  AF4 18 HIS D  61  ? HIS D 167 . ? 1_555 ? 
259  AF4 18 ASP D  101 ? ASP D 207 . ? 1_555 ? 
260  AF4 18 HIS D  109 ? HIS D 215 . ? 1_555 ? 
261  AF4 18 HIS D  127 ? HIS D 233 . ? 1_555 ? 
262  AF4 18 ASP D  205 ? ASP D 311 . ? 1_555 ? 
263  AF4 18 LYS D  206 ? LYS D 312 . ? 1_555 ? 
264  AF4 18 TYR D  209 ? TYR D 315 . ? 1_555 ? 
265  AF4 18 ASP D  213 ? ASP D 319 . ? 1_555 ? 
266  AF4 18 ARG D  260 ? ARG D 366 . ? 1_555 ? 
267  AF4 18 HIS D  264 ? HIS D 370 . ? 1_555 ? 
268  AF4 18 TYR D  268 ? TYR D 374 . ? 1_555 ? 
269  AF4 18 GLN D  269 ? GLN D 375 . ? 1_555 ? 
270  AF4 18 FE  QA .   ? FE  D 702 . ? 1_555 ? 
271  AF4 18 MG  RA .   ? MG  D 703 . ? 1_555 ? 
272  AF4 18 MG  SA .   ? MG  D 704 . ? 1_555 ? 
273  AF5 4  ARG D  199 ? ARG D 305 . ? 1_555 ? 
274  AF5 4  ARG D  242 ? ARG D 348 . ? 1_555 ? 
275  AF5 4  HIS D  411 ? HIS D 517 . ? 1_555 ? 
276  AF5 4  ARG D  425 ? ARG D 531 . ? 1_555 ? 
277  AF6 7  ARG E  58  ? ARG E 164 . ? 1_555 ? 
278  AF6 7  HIS E  61  ? HIS E 167 . ? 1_555 ? 
279  AF6 7  HIS E  100 ? HIS E 206 . ? 1_555 ? 
280  AF6 7  ASP E  101 ? ASP E 207 . ? 1_555 ? 
281  AF6 7  ASP E  205 ? ASP E 311 . ? 1_555 ? 
282  AF6 7  MG  XA .   ? MG  E 702 . ? 1_555 ? 
283  AF6 7  XG4 AB .   ? XG4 E 705 . ? 1_555 ? 
284  AF7 5  HIS E  100 ? HIS E 206 . ? 1_555 ? 
285  AF7 5  ASP E  101 ? ASP E 207 . ? 1_555 ? 
286  AF7 5  HIS E  127 ? HIS E 233 . ? 1_555 ? 
287  AF7 5  FE  WA .   ? FE  E 701 . ? 1_555 ? 
288  AF7 5  XG4 AB .   ? XG4 E 705 . ? 1_555 ? 
289  AF8 3  ASP E  203 ? ASP E 309 . ? 1_555 ? 
290  AF8 3  LYS E  206 ? LYS E 312 . ? 1_555 ? 
291  AF8 3  XG4 AB .   ? XG4 E 705 . ? 1_555 ? 
292  AF9 2  CZF BB .   ? CZF E 706 . ? 1_555 ? 
293  AF9 2  XG4 MB .   ? XG4 G 701 . ? 1_555 ? 
294  AG1 19 GLN E  43  ? GLN E 149 . ? 1_555 ? 
295  AG1 19 LEU E  44  ? LEU E 150 . ? 1_555 ? 
296  AG1 19 ARG E  58  ? ARG E 164 . ? 1_555 ? 
297  AG1 19 HIS E  61  ? HIS E 167 . ? 1_555 ? 
298  AG1 19 ASP E  101 ? ASP E 207 . ? 1_555 ? 
299  AG1 19 HIS E  104 ? HIS E 210 . ? 1_555 ? 
300  AG1 19 HIS E  109 ? HIS E 215 . ? 1_555 ? 
301  AG1 19 HIS E  127 ? HIS E 233 . ? 1_555 ? 
302  AG1 19 ASP E  205 ? ASP E 311 . ? 1_555 ? 
303  AG1 19 LYS E  206 ? LYS E 312 . ? 1_555 ? 
304  AG1 19 TYR E  209 ? TYR E 315 . ? 1_555 ? 
305  AG1 19 ASP E  213 ? ASP E 319 . ? 1_555 ? 
306  AG1 19 ARG E  260 ? ARG E 366 . ? 1_555 ? 
307  AG1 19 HIS E  264 ? HIS E 370 . ? 1_555 ? 
308  AG1 19 TYR E  268 ? TYR E 374 . ? 1_555 ? 
309  AG1 19 GLN E  269 ? GLN E 375 . ? 1_555 ? 
310  AG1 19 FE  WA .   ? FE  E 701 . ? 1_555 ? 
311  AG1 19 MG  XA .   ? MG  E 702 . ? 1_555 ? 
312  AG1 19 MG  YA .   ? MG  E 703 . ? 1_555 ? 
313  AG2 14 LYS E  10  ? LYS E 116 . ? 1_555 ? 
314  AG2 14 VAL E  11  ? VAL E 117 . ? 1_555 ? 
315  AG2 14 ILE E  12  ? ILE E 118 . ? 1_555 ? 
316  AG2 14 ASN E  31  ? ASN E 137 . ? 1_555 ? 
317  AG2 14 GLN E  36  ? GLN E 142 . ? 1_555 ? 
318  AG2 14 ARG E  39  ? ARG E 145 . ? 1_555 ? 
319  AG2 14 PHE E  59  ? PHE E 165 . ? 1_555 ? 
320  AG2 14 MG  ZA .   ? MG  E 704 . ? 1_555 ? 
321  AG2 14 TYR F  49  ? TYR F 155 . ? 1_555 ? 
322  AG2 14 VAL F  50  ? VAL F 156 . ? 1_555 ? 
323  AG2 14 VAL F  272 ? VAL F 378 . ? 1_555 ? 
324  AG2 14 ARG F  345 ? ARG F 451 . ? 1_555 ? 
325  AG2 14 LYS G  417 ? LYS G 523 . ? 1_555 ? 
326  AG2 14 XG4 MB .   ? XG4 G 701 . ? 1_555 ? 
327  AG3 4  ARG E  199 ? ARG E 305 . ? 1_555 ? 
328  AG3 4  ARG E  242 ? ARG E 348 . ? 1_555 ? 
329  AG3 4  HIS E  411 ? HIS E 517 . ? 1_555 ? 
330  AG3 4  ARG E  425 ? ARG E 531 . ? 1_555 ? 
331  AG4 15 ARG E  227 ? ARG E 333 . ? 1_555 ? 
332  AG4 15 ARG E  246 ? ARG E 352 . ? 1_555 ? 
333  AG4 15 LYS E  248 ? LYS E 354 . ? 1_555 ? 
334  AG4 15 ASN E  252 ? ASN E 358 . ? 1_555 ? 
335  AG4 15 LYS E  417 ? LYS E 523 . ? 1_555 ? 
336  AG4 15 VAL G  11  ? VAL G 117 . ? 1_555 ? 
337  AG4 15 ASN G  13  ? ASN G 119 . ? 1_555 ? 
338  AG4 15 MG  QB .   ? MG  G 705 . ? 1_555 ? 
339  AG4 15 CZF SB .   ? CZF G 707 . ? 1_555 ? 
340  AG4 15 VAL H  50  ? VAL H 156 . ? 1_555 ? 
341  AG4 15 PHE H  51  ? PHE H 157 . ? 1_555 ? 
342  AG4 15 ILE H  219 ? ILE H 325 . ? 1_555 ? 
343  AG4 15 ARG H  266 ? ARG H 372 . ? 1_555 ? 
344  AG4 15 HIS H  270 ? HIS H 376 . ? 1_555 ? 
345  AG4 15 LYS H  271 ? LYS H 377 . ? 1_555 ? 
346  AG5 7  ARG F  58  ? ARG F 164 . ? 1_555 ? 
347  AG5 7  HIS F  61  ? HIS F 167 . ? 1_555 ? 
348  AG5 7  HIS F  100 ? HIS F 206 . ? 1_555 ? 
349  AG5 7  ASP F  101 ? ASP F 207 . ? 1_555 ? 
350  AG5 7  ASP F  205 ? ASP F 311 . ? 1_555 ? 
351  AG5 7  MG  FB .   ? MG  F 702 . ? 1_555 ? 
352  AG5 7  XG4 IB .   ? XG4 F 705 . ? 1_555 ? 
353  AG6 6  HIS F  100 ? HIS F 206 . ? 1_555 ? 
354  AG6 6  ASP F  101 ? ASP F 207 . ? 1_555 ? 
355  AG6 6  HIS F  127 ? HIS F 233 . ? 1_555 ? 
356  AG6 6  ASP F  205 ? ASP F 311 . ? 1_555 ? 
357  AG6 6  FE  EB .   ? FE  F 701 . ? 1_555 ? 
358  AG6 6  XG4 IB .   ? XG4 F 705 . ? 1_555 ? 
359  AG7 3  ASP F  203 ? ASP F 309 . ? 1_555 ? 
360  AG7 3  LYS F  206 ? LYS F 312 . ? 1_555 ? 
361  AG7 3  XG4 IB .   ? XG4 F 705 . ? 1_555 ? 
362  AG8 2  CZF JB .   ? CZF F 706 . ? 1_555 ? 
363  AG8 2  XG4 UB .   ? XG4 H 701 . ? 1_555 ? 
364  AG9 18 GLN F  43  ? GLN F 149 . ? 1_555 ? 
365  AG9 18 LEU F  44  ? LEU F 150 . ? 1_555 ? 
366  AG9 18 ARG F  58  ? ARG F 164 . ? 1_555 ? 
367  AG9 18 HIS F  61  ? HIS F 167 . ? 1_555 ? 
368  AG9 18 ASP F  101 ? ASP F 207 . ? 1_555 ? 
369  AG9 18 HIS F  104 ? HIS F 210 . ? 1_555 ? 
370  AG9 18 HIS F  109 ? HIS F 215 . ? 1_555 ? 
371  AG9 18 HIS F  127 ? HIS F 233 . ? 1_555 ? 
372  AG9 18 ASP F  205 ? ASP F 311 . ? 1_555 ? 
373  AG9 18 LYS F  206 ? LYS F 312 . ? 1_555 ? 
374  AG9 18 TYR F  209 ? TYR F 315 . ? 1_555 ? 
375  AG9 18 ASP F  213 ? ASP F 319 . ? 1_555 ? 
376  AG9 18 ARG F  260 ? ARG F 366 . ? 1_555 ? 
377  AG9 18 TYR F  268 ? TYR F 374 . ? 1_555 ? 
378  AG9 18 GLN F  269 ? GLN F 375 . ? 1_555 ? 
379  AG9 18 FE  EB .   ? FE  F 701 . ? 1_555 ? 
380  AG9 18 MG  FB .   ? MG  F 702 . ? 1_555 ? 
381  AG9 18 MG  GB .   ? MG  F 703 . ? 1_555 ? 
382  AH1 15 TYR E  49  ? TYR E 155 . ? 1_555 ? 
383  AH1 15 VAL E  50  ? VAL E 156 . ? 1_555 ? 
384  AH1 15 VAL E  272 ? VAL E 378 . ? 1_555 ? 
385  AH1 15 ARG E  345 ? ARG E 451 . ? 1_555 ? 
386  AH1 15 LYS E  349 ? LYS E 455 . ? 1_555 ? 
387  AH1 15 LYS F  10  ? LYS F 116 . ? 1_555 ? 
388  AH1 15 VAL F  11  ? VAL F 117 . ? 1_555 ? 
389  AH1 15 ILE F  12  ? ILE F 118 . ? 1_555 ? 
390  AH1 15 ASN F  31  ? ASN F 137 . ? 1_555 ? 
391  AH1 15 GLN F  36  ? GLN F 142 . ? 1_555 ? 
392  AH1 15 ARG F  39  ? ARG F 145 . ? 1_555 ? 
393  AH1 15 PHE F  59  ? PHE F 165 . ? 1_555 ? 
394  AH1 15 MG  HB .   ? MG  F 704 . ? 1_555 ? 
395  AH1 15 LYS H  417 ? LYS H 523 . ? 1_555 ? 
396  AH1 15 XG4 UB .   ? XG4 H 701 . ? 1_555 ? 
397  AH2 4  ARG F  199 ? ARG F 305 . ? 1_555 ? 
398  AH2 4  ARG F  242 ? ARG F 348 . ? 1_555 ? 
399  AH2 4  HIS F  411 ? HIS F 517 . ? 1_555 ? 
400  AH2 4  ARG F  425 ? ARG F 531 . ? 1_555 ? 
401  AH3 16 ASP F  224 ? ASP F 330 . ? 1_555 ? 
402  AH3 16 ARG F  227 ? ARG F 333 . ? 1_555 ? 
403  AH3 16 ARG F  246 ? ARG F 352 . ? 1_555 ? 
404  AH3 16 LYS F  248 ? LYS F 354 . ? 1_555 ? 
405  AH3 16 ASN F  252 ? ASN F 358 . ? 1_555 ? 
406  AH3 16 LYS F  417 ? LYS F 523 . ? 1_555 ? 
407  AH3 16 VAL G  50  ? VAL G 156 . ? 1_555 ? 
408  AH3 16 PHE G  51  ? PHE G 157 . ? 1_555 ? 
409  AH3 16 ARG G  266 ? ARG G 372 . ? 1_555 ? 
410  AH3 16 HIS G  270 ? HIS G 376 . ? 1_555 ? 
411  AH3 16 LYS G  271 ? LYS G 377 . ? 1_555 ? 
412  AH3 16 VAL H  11  ? VAL H 117 . ? 1_555 ? 
413  AH3 16 ASN H  13  ? ASN H 119 . ? 1_555 ? 
414  AH3 16 HIS H  19  ? HIS H 125 . ? 1_555 ? 
415  AH3 16 MG  YB .   ? MG  H 705 . ? 1_555 ? 
416  AH3 16 CZF AC .   ? CZF H 707 . ? 1_555 ? 
417  AH4 17 VAL E  11  ? VAL E 117 . ? 1_555 ? 
418  AH4 17 ASN E  13  ? ASN E 119 . ? 1_555 ? 
419  AH4 17 HIS E  19  ? HIS E 125 . ? 1_555 ? 
420  AH4 17 MG  ZA .   ? MG  E 704 . ? 1_555 ? 
421  AH4 17 CZF BB .   ? CZF E 706 . ? 1_555 ? 
422  AH4 17 VAL F  50  ? VAL F 156 . ? 1_555 ? 
423  AH4 17 PHE F  51  ? PHE F 157 . ? 1_555 ? 
424  AH4 17 GLY F  218 ? GLY F 324 . ? 1_555 ? 
425  AH4 17 ARG F  266 ? ARG F 372 . ? 1_555 ? 
426  AH4 17 HIS F  270 ? HIS F 376 . ? 1_555 ? 
427  AH4 17 LYS F  271 ? LYS F 377 . ? 1_555 ? 
428  AH4 17 ASP G  224 ? ASP G 330 . ? 1_555 ? 
429  AH4 17 ARG G  227 ? ARG G 333 . ? 1_555 ? 
430  AH4 17 ARG G  246 ? ARG G 352 . ? 1_555 ? 
431  AH4 17 LYS G  248 ? LYS G 354 . ? 1_555 ? 
432  AH4 17 ASN G  252 ? ASN G 358 . ? 1_555 ? 
433  AH4 17 LYS G  417 ? LYS G 523 . ? 1_555 ? 
434  AH5 7  ARG G  58  ? ARG G 164 . ? 1_555 ? 
435  AH5 7  HIS G  61  ? HIS G 167 . ? 1_555 ? 
436  AH5 7  HIS G  100 ? HIS G 206 . ? 1_555 ? 
437  AH5 7  ASP G  101 ? ASP G 207 . ? 1_555 ? 
438  AH5 7  ASP G  205 ? ASP G 311 . ? 1_555 ? 
439  AH5 7  MG  OB .   ? MG  G 703 . ? 1_555 ? 
440  AH5 7  XG4 RB .   ? XG4 G 706 . ? 1_555 ? 
441  AH6 6  HIS G  100 ? HIS G 206 . ? 1_555 ? 
442  AH6 6  ASP G  101 ? ASP G 207 . ? 1_555 ? 
443  AH6 6  HIS G  127 ? HIS G 233 . ? 1_555 ? 
444  AH6 6  ASP G  205 ? ASP G 311 . ? 1_555 ? 
445  AH6 6  FE  NB .   ? FE  G 702 . ? 1_555 ? 
446  AH6 6  XG4 RB .   ? XG4 G 706 . ? 1_555 ? 
447  AH7 3  ASP G  203 ? ASP G 309 . ? 1_555 ? 
448  AH7 3  LYS G  206 ? LYS G 312 . ? 1_555 ? 
449  AH7 3  XG4 RB .   ? XG4 G 706 . ? 1_555 ? 
450  AH8 2  XG4 DB .   ? XG4 E 708 . ? 1_555 ? 
451  AH8 2  CZF SB .   ? CZF G 707 . ? 1_555 ? 
452  AH9 18 GLN G  43  ? GLN G 149 . ? 1_555 ? 
453  AH9 18 LEU G  44  ? LEU G 150 . ? 1_555 ? 
454  AH9 18 ARG G  58  ? ARG G 164 . ? 1_555 ? 
455  AH9 18 HIS G  61  ? HIS G 167 . ? 1_555 ? 
456  AH9 18 ASP G  101 ? ASP G 207 . ? 1_555 ? 
457  AH9 18 HIS G  104 ? HIS G 210 . ? 1_555 ? 
458  AH9 18 HIS G  109 ? HIS G 215 . ? 1_555 ? 
459  AH9 18 HIS G  127 ? HIS G 233 . ? 1_555 ? 
460  AH9 18 ASP G  205 ? ASP G 311 . ? 1_555 ? 
461  AH9 18 LYS G  206 ? LYS G 312 . ? 1_555 ? 
462  AH9 18 TYR G  209 ? TYR G 315 . ? 1_555 ? 
463  AH9 18 ASP G  213 ? ASP G 319 . ? 1_555 ? 
464  AH9 18 ARG G  260 ? ARG G 366 . ? 1_555 ? 
465  AH9 18 TYR G  268 ? TYR G 374 . ? 1_555 ? 
466  AH9 18 GLN G  269 ? GLN G 375 . ? 1_555 ? 
467  AH9 18 FE  NB .   ? FE  G 702 . ? 1_555 ? 
468  AH9 18 MG  OB .   ? MG  G 703 . ? 1_555 ? 
469  AH9 18 MG  PB .   ? MG  G 704 . ? 1_555 ? 
470  AI1 15 LYS E  417 ? LYS E 523 . ? 1_555 ? 
471  AI1 15 XG4 DB .   ? XG4 E 708 . ? 1_555 ? 
472  AI1 15 LYS G  10  ? LYS G 116 . ? 1_555 ? 
473  AI1 15 VAL G  11  ? VAL G 117 . ? 1_555 ? 
474  AI1 15 ILE G  12  ? ILE G 118 . ? 1_555 ? 
475  AI1 15 ASN G  31  ? ASN G 137 . ? 1_555 ? 
476  AI1 15 GLN G  36  ? GLN G 142 . ? 1_555 ? 
477  AI1 15 ARG G  39  ? ARG G 145 . ? 1_555 ? 
478  AI1 15 PHE G  59  ? PHE G 165 . ? 1_555 ? 
479  AI1 15 MG  QB .   ? MG  G 705 . ? 1_555 ? 
480  AI1 15 TYR H  49  ? TYR H 155 . ? 1_555 ? 
481  AI1 15 VAL H  50  ? VAL H 156 . ? 1_555 ? 
482  AI1 15 VAL H  272 ? VAL H 378 . ? 1_555 ? 
483  AI1 15 ARG H  345 ? ARG H 451 . ? 1_555 ? 
484  AI1 15 LYS H  349 ? LYS H 455 . ? 1_555 ? 
485  AI2 4  ARG G  199 ? ARG G 305 . ? 1_555 ? 
486  AI2 4  ARG G  242 ? ARG G 348 . ? 1_555 ? 
487  AI2 4  HIS G  411 ? HIS G 517 . ? 1_555 ? 
488  AI2 4  ARG G  425 ? ARG G 531 . ? 1_555 ? 
489  AI3 17 VAL E  50  ? VAL E 156 . ? 1_555 ? 
490  AI3 17 PHE E  51  ? PHE E 157 . ? 1_555 ? 
491  AI3 17 GLY E  218 ? GLY E 324 . ? 1_555 ? 
492  AI3 17 ARG E  266 ? ARG E 372 . ? 1_555 ? 
493  AI3 17 HIS E  270 ? HIS E 376 . ? 1_555 ? 
494  AI3 17 LYS E  271 ? LYS E 377 . ? 1_555 ? 
495  AI3 17 VAL F  11  ? VAL F 117 . ? 1_555 ? 
496  AI3 17 ASN F  13  ? ASN F 119 . ? 1_555 ? 
497  AI3 17 HIS F  19  ? HIS F 125 . ? 1_555 ? 
498  AI3 17 MG  HB .   ? MG  F 704 . ? 1_555 ? 
499  AI3 17 CZF JB .   ? CZF F 706 . ? 1_555 ? 
500  AI3 17 ASP H  224 ? ASP H 330 . ? 1_555 ? 
501  AI3 17 ARG H  227 ? ARG H 333 . ? 1_555 ? 
502  AI3 17 ARG H  246 ? ARG H 352 . ? 1_555 ? 
503  AI3 17 LYS H  248 ? LYS H 354 . ? 1_555 ? 
504  AI3 17 ASN H  252 ? ASN H 358 . ? 1_555 ? 
505  AI3 17 LYS H  417 ? LYS H 523 . ? 1_555 ? 
506  AI4 7  ARG H  58  ? ARG H 164 . ? 1_555 ? 
507  AI4 7  HIS H  61  ? HIS H 167 . ? 1_555 ? 
508  AI4 7  HIS H  100 ? HIS H 206 . ? 1_555 ? 
509  AI4 7  ASP H  101 ? ASP H 207 . ? 1_555 ? 
510  AI4 7  ASP H  205 ? ASP H 311 . ? 1_555 ? 
511  AI4 7  MG  WB .   ? MG  H 703 . ? 1_555 ? 
512  AI4 7  XG4 ZB .   ? XG4 H 706 . ? 1_555 ? 
513  AI5 5  HIS H  100 ? HIS H 206 . ? 1_555 ? 
514  AI5 5  ASP H  101 ? ASP H 207 . ? 1_555 ? 
515  AI5 5  HIS H  127 ? HIS H 233 . ? 1_555 ? 
516  AI5 5  FE  VB .   ? FE  H 702 . ? 1_555 ? 
517  AI5 5  XG4 ZB .   ? XG4 H 706 . ? 1_555 ? 
518  AI6 3  ASP H  203 ? ASP H 309 . ? 1_555 ? 
519  AI6 3  LYS H  206 ? LYS H 312 . ? 1_555 ? 
520  AI6 3  XG4 ZB .   ? XG4 H 706 . ? 1_555 ? 
521  AI7 2  XG4 LB .   ? XG4 F 708 . ? 1_555 ? 
522  AI7 2  CZF AC .   ? CZF H 707 . ? 1_555 ? 
523  AI8 18 GLN H  43  ? GLN H 149 . ? 1_555 ? 
524  AI8 18 LEU H  44  ? LEU H 150 . ? 1_555 ? 
525  AI8 18 ARG H  58  ? ARG H 164 . ? 1_555 ? 
526  AI8 18 HIS H  61  ? HIS H 167 . ? 1_555 ? 
527  AI8 18 ASP H  101 ? ASP H 207 . ? 1_555 ? 
528  AI8 18 HIS H  104 ? HIS H 210 . ? 1_555 ? 
529  AI8 18 HIS H  109 ? HIS H 215 . ? 1_555 ? 
530  AI8 18 HIS H  127 ? HIS H 233 . ? 1_555 ? 
531  AI8 18 ASP H  205 ? ASP H 311 . ? 1_555 ? 
532  AI8 18 LYS H  206 ? LYS H 312 . ? 1_555 ? 
533  AI8 18 TYR H  209 ? TYR H 315 . ? 1_555 ? 
534  AI8 18 ASP H  213 ? ASP H 319 . ? 1_555 ? 
535  AI8 18 ARG H  260 ? ARG H 366 . ? 1_555 ? 
536  AI8 18 TYR H  268 ? TYR H 374 . ? 1_555 ? 
537  AI8 18 GLN H  269 ? GLN H 375 . ? 1_555 ? 
538  AI8 18 FE  VB .   ? FE  H 702 . ? 1_555 ? 
539  AI8 18 MG  WB .   ? MG  H 703 . ? 1_555 ? 
540  AI8 18 MG  XB .   ? MG  H 704 . ? 1_555 ? 
541  AI9 15 LYS F  417 ? LYS F 523 . ? 1_555 ? 
542  AI9 15 XG4 LB .   ? XG4 F 708 . ? 1_555 ? 
543  AI9 15 TYR G  49  ? TYR G 155 . ? 1_555 ? 
544  AI9 15 VAL G  50  ? VAL G 156 . ? 1_555 ? 
545  AI9 15 LYS G  271 ? LYS G 377 . ? 1_555 ? 
546  AI9 15 VAL G  272 ? VAL G 378 . ? 1_555 ? 
547  AI9 15 ARG G  345 ? ARG G 451 . ? 1_555 ? 
548  AI9 15 LYS H  10  ? LYS H 116 . ? 1_555 ? 
549  AI9 15 VAL H  11  ? VAL H 117 . ? 1_555 ? 
550  AI9 15 ILE H  12  ? ILE H 118 . ? 1_555 ? 
551  AI9 15 ASN H  31  ? ASN H 137 . ? 1_555 ? 
552  AI9 15 GLN H  36  ? GLN H 142 . ? 1_555 ? 
553  AI9 15 ARG H  39  ? ARG H 145 . ? 1_555 ? 
554  AI9 15 PHE H  59  ? PHE H 165 . ? 1_555 ? 
555  AI9 15 MG  YB .   ? MG  H 705 . ? 1_555 ? 
556  AJ1 4  ARG H  199 ? ARG H 305 . ? 1_555 ? 
557  AJ1 4  ARG H  242 ? ARG H 348 . ? 1_555 ? 
558  AJ1 4  HIS H  411 ? HIS H 517 . ? 1_555 ? 
559  AJ1 4  ARG H  425 ? ARG H 531 . ? 1_555 ? 
560  AJ2 7  ARG I  58  ? ARG I 164 . ? 1_555 ? 
561  AJ2 7  HIS I  61  ? HIS I 167 . ? 1_555 ? 
562  AJ2 7  HIS I  100 ? HIS I 206 . ? 1_555 ? 
563  AJ2 7  ASP I  101 ? ASP I 207 . ? 1_555 ? 
564  AJ2 7  ASP I  205 ? ASP I 311 . ? 1_555 ? 
565  AJ2 7  MG  DC .   ? MG  I 702 . ? 1_555 ? 
566  AJ2 7  XG4 GC .   ? XG4 I 705 . ? 1_555 ? 
567  AJ3 5  HIS I  100 ? HIS I 206 . ? 1_555 ? 
568  AJ3 5  ASP I  101 ? ASP I 207 . ? 1_555 ? 
569  AJ3 5  HIS I  127 ? HIS I 233 . ? 1_555 ? 
570  AJ3 5  FE  CC .   ? FE  I 701 . ? 1_555 ? 
571  AJ3 5  XG4 GC .   ? XG4 I 705 . ? 1_555 ? 
572  AJ4 2  ASP I  203 ? ASP I 309 . ? 1_555 ? 
573  AJ4 2  XG4 GC .   ? XG4 I 705 . ? 1_555 ? 
574  AJ5 2  CZF KC .   ? CZF J 701 . ? 1_555 ? 
575  AJ5 2  XG4 TC .   ? XG4 K 701 . ? 1_555 ? 
576  AJ6 19 GLN I  43  ? GLN I 149 . ? 1_555 ? 
577  AJ6 19 LEU I  44  ? LEU I 150 . ? 1_555 ? 
578  AJ6 19 ARG I  58  ? ARG I 164 . ? 1_555 ? 
579  AJ6 19 HIS I  61  ? HIS I 167 . ? 1_555 ? 
580  AJ6 19 ASP I  101 ? ASP I 207 . ? 1_555 ? 
581  AJ6 19 HIS I  104 ? HIS I 210 . ? 1_555 ? 
582  AJ6 19 HIS I  109 ? HIS I 215 . ? 1_555 ? 
583  AJ6 19 HIS I  127 ? HIS I 233 . ? 1_555 ? 
584  AJ6 19 ASP I  205 ? ASP I 311 . ? 1_555 ? 
585  AJ6 19 LYS I  206 ? LYS I 312 . ? 1_555 ? 
586  AJ6 19 TYR I  209 ? TYR I 315 . ? 1_555 ? 
587  AJ6 19 ASP I  213 ? ASP I 319 . ? 1_555 ? 
588  AJ6 19 ARG I  260 ? ARG I 366 . ? 1_555 ? 
589  AJ6 19 HIS I  264 ? HIS I 370 . ? 1_555 ? 
590  AJ6 19 TYR I  268 ? TYR I 374 . ? 1_555 ? 
591  AJ6 19 GLN I  269 ? GLN I 375 . ? 1_555 ? 
592  AJ6 19 FE  CC .   ? FE  I 701 . ? 1_555 ? 
593  AJ6 19 MG  DC .   ? MG  I 702 . ? 1_555 ? 
594  AJ6 19 MG  EC .   ? MG  I 703 . ? 1_555 ? 
595  AJ7 4  ARG I  199 ? ARG I 305 . ? 1_555 ? 
596  AJ7 4  ARG I  242 ? ARG I 348 . ? 1_555 ? 
597  AJ7 4  HIS I  411 ? HIS I 517 . ? 1_555 ? 
598  AJ7 4  ARG I  425 ? ARG I 531 . ? 1_555 ? 
599  AJ8 16 VAL I  50  ? VAL I 156 . ? 1_555 ? 
600  AJ8 16 PHE I  51  ? PHE I 157 . ? 1_555 ? 
601  AJ8 16 GLY I  218 ? GLY I 324 . ? 1_555 ? 
602  AJ8 16 ILE I  219 ? ILE I 325 . ? 1_555 ? 
603  AJ8 16 ARG I  266 ? ARG I 372 . ? 1_555 ? 
604  AJ8 16 HIS I  270 ? HIS I 376 . ? 1_555 ? 
605  AJ8 16 LYS I  271 ? LYS I 377 . ? 1_555 ? 
606  AJ8 16 VAL J  11  ? VAL J 117 . ? 1_555 ? 
607  AJ8 16 ASN J  13  ? ASN J 119 . ? 1_555 ? 
608  AJ8 16 MG  OC .   ? MG  J 705 . ? 1_555 ? 
609  AJ8 16 CZF QC .   ? CZF J 707 . ? 1_555 ? 
610  AJ8 16 ARG L  227 ? ARG L 333 . ? 1_555 ? 
611  AJ8 16 ARG L  246 ? ARG L 352 . ? 1_555 ? 
612  AJ8 16 LYS L  248 ? LYS L 354 . ? 1_555 ? 
613  AJ8 16 ASN L  252 ? ASN L 358 . ? 1_555 ? 
614  AJ8 16 LYS L  417 ? LYS L 523 . ? 1_555 ? 
615  AJ9 17 ASP I  224 ? ASP I 330 . ? 1_555 ? 
616  AJ9 17 ARG I  227 ? ARG I 333 . ? 1_555 ? 
617  AJ9 17 ARG I  246 ? ARG I 352 . ? 1_555 ? 
618  AJ9 17 LYS I  248 ? LYS I 354 . ? 1_555 ? 
619  AJ9 17 ASN I  252 ? ASN I 358 . ? 1_555 ? 
620  AJ9 17 LYS I  417 ? LYS I 523 . ? 1_555 ? 
621  AJ9 17 VAL K  11  ? VAL K 117 . ? 1_555 ? 
622  AJ9 17 ASN K  13  ? ASN K 119 . ? 1_555 ? 
623  AJ9 17 HIS K  19  ? HIS K 125 . ? 1_555 ? 
624  AJ9 17 MG  XC .   ? MG  K 705 . ? 1_555 ? 
625  AJ9 17 CZF ZC .   ? CZF K 707 . ? 1_555 ? 
626  AJ9 17 VAL L  50  ? VAL L 156 . ? 1_555 ? 
627  AJ9 17 PHE L  51  ? PHE L 157 . ? 1_555 ? 
628  AJ9 17 GLY L  218 ? GLY L 324 . ? 1_555 ? 
629  AJ9 17 ARG L  266 ? ARG L 372 . ? 1_555 ? 
630  AJ9 17 HIS L  270 ? HIS L 376 . ? 1_555 ? 
631  AJ9 17 LYS L  271 ? LYS L 377 . ? 1_555 ? 
632  AK1 14 LYS I  10  ? LYS I 116 . ? 1_555 ? 
633  AK1 14 VAL I  11  ? VAL I 117 . ? 1_555 ? 
634  AK1 14 ILE I  12  ? ILE I 118 . ? 1_555 ? 
635  AK1 14 ASN I  31  ? ASN I 137 . ? 1_555 ? 
636  AK1 14 GLN I  36  ? GLN I 142 . ? 1_555 ? 
637  AK1 14 ARG I  39  ? ARG I 145 . ? 1_555 ? 
638  AK1 14 PHE I  59  ? PHE I 165 . ? 1_555 ? 
639  AK1 14 MG  FC .   ? MG  I 704 . ? 1_555 ? 
640  AK1 14 TYR J  49  ? TYR J 155 . ? 1_555 ? 
641  AK1 14 VAL J  50  ? VAL J 156 . ? 1_555 ? 
642  AK1 14 VAL J  272 ? VAL J 378 . ? 1_555 ? 
643  AK1 14 ARG J  345 ? ARG J 451 . ? 1_555 ? 
644  AK1 14 LYS K  417 ? LYS K 523 . ? 1_555 ? 
645  AK1 14 XG4 TC .   ? XG4 K 701 . ? 1_555 ? 
646  AK2 7  ARG J  58  ? ARG J 164 . ? 1_555 ? 
647  AK2 7  HIS J  61  ? HIS J 167 . ? 1_555 ? 
648  AK2 7  HIS J  100 ? HIS J 206 . ? 1_555 ? 
649  AK2 7  ASP J  101 ? ASP J 207 . ? 1_555 ? 
650  AK2 7  ASP J  205 ? ASP J 311 . ? 1_555 ? 
651  AK2 7  MG  MC .   ? MG  J 703 . ? 1_555 ? 
652  AK2 7  XG4 PC .   ? XG4 J 706 . ? 1_555 ? 
653  AK3 4  ASP J  101 ? ASP J 207 . ? 1_555 ? 
654  AK3 4  HIS J  127 ? HIS J 233 . ? 1_555 ? 
655  AK3 4  FE  LC .   ? FE  J 702 . ? 1_555 ? 
656  AK3 4  XG4 PC .   ? XG4 J 706 . ? 1_555 ? 
657  AK4 3  ASP J  203 ? ASP J 309 . ? 1_555 ? 
658  AK4 3  LYS J  206 ? LYS J 312 . ? 1_555 ? 
659  AK4 3  XG4 PC .   ? XG4 J 706 . ? 1_555 ? 
660  AK5 2  XG4 IC .   ? XG4 I 707 . ? 1_555 ? 
661  AK5 2  CZF QC .   ? CZF J 707 . ? 1_555 ? 
662  AK6 18 GLN J  43  ? GLN J 149 . ? 1_555 ? 
663  AK6 18 LEU J  44  ? LEU J 150 . ? 1_555 ? 
664  AK6 18 ARG J  58  ? ARG J 164 . ? 1_555 ? 
665  AK6 18 HIS J  61  ? HIS J 167 . ? 1_555 ? 
666  AK6 18 ASP J  101 ? ASP J 207 . ? 1_555 ? 
667  AK6 18 HIS J  109 ? HIS J 215 . ? 1_555 ? 
668  AK6 18 HIS J  127 ? HIS J 233 . ? 1_555 ? 
669  AK6 18 ASP J  205 ? ASP J 311 . ? 1_555 ? 
670  AK6 18 LYS J  206 ? LYS J 312 . ? 1_555 ? 
671  AK6 18 TYR J  209 ? TYR J 315 . ? 1_555 ? 
672  AK6 18 ASP J  213 ? ASP J 319 . ? 1_555 ? 
673  AK6 18 ARG J  260 ? ARG J 366 . ? 1_555 ? 
674  AK6 18 HIS J  264 ? HIS J 370 . ? 1_555 ? 
675  AK6 18 TYR J  268 ? TYR J 374 . ? 1_555 ? 
676  AK6 18 GLN J  269 ? GLN J 375 . ? 1_555 ? 
677  AK6 18 FE  LC .   ? FE  J 702 . ? 1_555 ? 
678  AK6 18 MG  MC .   ? MG  J 703 . ? 1_555 ? 
679  AK6 18 MG  NC .   ? MG  J 704 . ? 1_555 ? 
680  AK7 14 TYR I  49  ? TYR I 155 . ? 1_555 ? 
681  AK7 14 VAL I  50  ? VAL I 156 . ? 1_555 ? 
682  AK7 14 VAL I  272 ? VAL I 378 . ? 1_555 ? 
683  AK7 14 ARG I  345 ? ARG I 451 . ? 1_555 ? 
684  AK7 14 XG4 IC .   ? XG4 I 707 . ? 1_555 ? 
685  AK7 14 LYS J  10  ? LYS J 116 . ? 1_555 ? 
686  AK7 14 VAL J  11  ? VAL J 117 . ? 1_555 ? 
687  AK7 14 ILE J  12  ? ILE J 118 . ? 1_555 ? 
688  AK7 14 ASN J  31  ? ASN J 137 . ? 1_555 ? 
689  AK7 14 GLN J  36  ? GLN J 142 . ? 1_555 ? 
690  AK7 14 ARG J  39  ? ARG J 145 . ? 1_555 ? 
691  AK7 14 PHE J  59  ? PHE J 165 . ? 1_555 ? 
692  AK7 14 MG  OC .   ? MG  J 705 . ? 1_555 ? 
693  AK7 14 LYS L  417 ? LYS L 523 . ? 1_555 ? 
694  AK8 4  ARG J  199 ? ARG J 305 . ? 1_555 ? 
695  AK8 4  ARG J  242 ? ARG J 348 . ? 1_555 ? 
696  AK8 4  HIS J  411 ? HIS J 517 . ? 1_555 ? 
697  AK8 4  ARG J  425 ? ARG J 531 . ? 1_555 ? 
698  AK9 19 ASP J  224 ? ASP J 330 . ? 1_555 ? 
699  AK9 19 ARG J  227 ? ARG J 333 . ? 1_555 ? 
700  AK9 19 ARG J  246 ? ARG J 352 . ? 1_555 ? 
701  AK9 19 LYS J  248 ? LYS J 354 . ? 1_555 ? 
702  AK9 19 ASN J  252 ? ASN J 358 . ? 1_555 ? 
703  AK9 19 LYS J  417 ? LYS J 523 . ? 1_555 ? 
704  AK9 19 VAL K  50  ? VAL K 156 . ? 1_555 ? 
705  AK9 19 PHE K  51  ? PHE K 157 . ? 1_555 ? 
706  AK9 19 GLY K  218 ? GLY K 324 . ? 1_555 ? 
707  AK9 19 ILE K  219 ? ILE K 325 . ? 1_555 ? 
708  AK9 19 ARG K  266 ? ARG K 372 . ? 1_555 ? 
709  AK9 19 HIS K  270 ? HIS K 376 . ? 1_555 ? 
710  AK9 19 LYS K  271 ? LYS K 377 . ? 1_555 ? 
711  AK9 19 VAL L  11  ? VAL L 117 . ? 1_555 ? 
712  AK9 19 ILE L  12  ? ILE L 118 . ? 1_555 ? 
713  AK9 19 ASN L  13  ? ASN L 119 . ? 1_555 ? 
714  AK9 19 HIS L  19  ? HIS L 125 . ? 1_555 ? 
715  AK9 19 MG  ED .   ? MG  L 704 . ? 1_555 ? 
716  AK9 19 CZF GD .   ? CZF L 706 . ? 1_555 ? 
717  AL1 17 VAL I  11  ? VAL I 117 . ? 1_555 ? 
718  AL1 17 ASN I  13  ? ASN I 119 . ? 1_555 ? 
719  AL1 17 HIS I  19  ? HIS I 125 . ? 1_555 ? 
720  AL1 17 MG  FC .   ? MG  I 704 . ? 1_555 ? 
721  AL1 17 VAL J  50  ? VAL J 156 . ? 1_555 ? 
722  AL1 17 PHE J  51  ? PHE J 157 . ? 1_555 ? 
723  AL1 17 GLY J  218 ? GLY J 324 . ? 1_555 ? 
724  AL1 17 ARG J  266 ? ARG J 372 . ? 1_555 ? 
725  AL1 17 HIS J  270 ? HIS J 376 . ? 1_555 ? 
726  AL1 17 LYS J  271 ? LYS J 377 . ? 1_555 ? 
727  AL1 17 CZF KC .   ? CZF J 701 . ? 1_555 ? 
728  AL1 17 ASP K  224 ? ASP K 330 . ? 1_555 ? 
729  AL1 17 ARG K  227 ? ARG K 333 . ? 1_555 ? 
730  AL1 17 ARG K  246 ? ARG K 352 . ? 1_555 ? 
731  AL1 17 LYS K  248 ? LYS K 354 . ? 1_555 ? 
732  AL1 17 ASN K  252 ? ASN K 358 . ? 1_555 ? 
733  AL1 17 LYS K  417 ? LYS K 523 . ? 1_555 ? 
734  AL2 7  ARG K  58  ? ARG K 164 . ? 1_555 ? 
735  AL2 7  HIS K  61  ? HIS K 167 . ? 1_555 ? 
736  AL2 7  HIS K  100 ? HIS K 206 . ? 1_555 ? 
737  AL2 7  ASP K  101 ? ASP K 207 . ? 1_555 ? 
738  AL2 7  ASP K  205 ? ASP K 311 . ? 1_555 ? 
739  AL2 7  MG  VC .   ? MG  K 703 . ? 1_555 ? 
740  AL2 7  XG4 YC .   ? XG4 K 706 . ? 1_555 ? 
741  AL3 5  HIS K  100 ? HIS K 206 . ? 1_555 ? 
742  AL3 5  ASP K  101 ? ASP K 207 . ? 1_555 ? 
743  AL3 5  HIS K  127 ? HIS K 233 . ? 1_555 ? 
744  AL3 5  FE  UC .   ? FE  K 702 . ? 1_555 ? 
745  AL3 5  XG4 YC .   ? XG4 K 706 . ? 1_555 ? 
746  AL4 3  ASP K  203 ? ASP K 309 . ? 1_555 ? 
747  AL4 3  LYS K  206 ? LYS K 312 . ? 1_555 ? 
748  AL4 3  XG4 YC .   ? XG4 K 706 . ? 1_555 ? 
749  AL5 2  XG4 JC .   ? XG4 I 708 . ? 1_555 ? 
750  AL5 2  CZF ZC .   ? CZF K 707 . ? 1_555 ? 
751  AL6 19 GLN K  43  ? GLN K 149 . ? 1_555 ? 
752  AL6 19 LEU K  44  ? LEU K 150 . ? 1_555 ? 
753  AL6 19 ARG K  58  ? ARG K 164 . ? 1_555 ? 
754  AL6 19 HIS K  61  ? HIS K 167 . ? 1_555 ? 
755  AL6 19 ASP K  101 ? ASP K 207 . ? 1_555 ? 
756  AL6 19 HIS K  104 ? HIS K 210 . ? 1_555 ? 
757  AL6 19 HIS K  109 ? HIS K 215 . ? 1_555 ? 
758  AL6 19 HIS K  127 ? HIS K 233 . ? 1_555 ? 
759  AL6 19 ASP K  205 ? ASP K 311 . ? 1_555 ? 
760  AL6 19 LYS K  206 ? LYS K 312 . ? 1_555 ? 
761  AL6 19 TYR K  209 ? TYR K 315 . ? 1_555 ? 
762  AL6 19 ASP K  213 ? ASP K 319 . ? 1_555 ? 
763  AL6 19 ARG K  260 ? ARG K 366 . ? 1_555 ? 
764  AL6 19 HIS K  264 ? HIS K 370 . ? 1_555 ? 
765  AL6 19 TYR K  268 ? TYR K 374 . ? 1_555 ? 
766  AL6 19 GLN K  269 ? GLN K 375 . ? 1_555 ? 
767  AL6 19 FE  UC .   ? FE  K 702 . ? 1_555 ? 
768  AL6 19 MG  VC .   ? MG  K 703 . ? 1_555 ? 
769  AL6 19 MG  WC .   ? MG  K 704 . ? 1_555 ? 
770  AL7 14 LYS I  417 ? LYS I 523 . ? 1_555 ? 
771  AL7 14 XG4 JC .   ? XG4 I 708 . ? 1_555 ? 
772  AL7 14 LYS K  10  ? LYS K 116 . ? 1_555 ? 
773  AL7 14 VAL K  11  ? VAL K 117 . ? 1_555 ? 
774  AL7 14 ILE K  12  ? ILE K 118 . ? 1_555 ? 
775  AL7 14 ASN K  31  ? ASN K 137 . ? 1_555 ? 
776  AL7 14 GLN K  36  ? GLN K 142 . ? 1_555 ? 
777  AL7 14 ARG K  39  ? ARG K 145 . ? 1_555 ? 
778  AL7 14 PHE K  59  ? PHE K 165 . ? 1_555 ? 
779  AL7 14 MG  XC .   ? MG  K 705 . ? 1_555 ? 
780  AL7 14 TYR L  49  ? TYR L 155 . ? 1_555 ? 
781  AL7 14 VAL L  50  ? VAL L 156 . ? 1_555 ? 
782  AL7 14 VAL L  272 ? VAL L 378 . ? 1_555 ? 
783  AL7 14 ARG L  345 ? ARG L 451 . ? 1_555 ? 
784  AL8 4  ARG K  199 ? ARG K 305 . ? 1_555 ? 
785  AL8 4  ARG K  242 ? ARG K 348 . ? 1_555 ? 
786  AL8 4  HIS K  411 ? HIS K 517 . ? 1_555 ? 
787  AL8 4  ARG K  425 ? ARG K 531 . ? 1_555 ? 
788  AL9 7  ARG L  58  ? ARG L 164 . ? 1_555 ? 
789  AL9 7  HIS L  61  ? HIS L 167 . ? 1_555 ? 
790  AL9 7  HIS L  100 ? HIS L 206 . ? 1_555 ? 
791  AL9 7  ASP L  101 ? ASP L 207 . ? 1_555 ? 
792  AL9 7  ASP L  205 ? ASP L 311 . ? 1_555 ? 
793  AL9 7  MG  CD .   ? MG  L 702 . ? 1_555 ? 
794  AL9 7  XG4 FD .   ? XG4 L 705 . ? 1_555 ? 
795  AM1 6  HIS L  100 ? HIS L 206 . ? 1_555 ? 
796  AM1 6  ASP L  101 ? ASP L 207 . ? 1_555 ? 
797  AM1 6  HIS L  127 ? HIS L 233 . ? 1_555 ? 
798  AM1 6  ASP L  205 ? ASP L 311 . ? 1_555 ? 
799  AM1 6  FE  BD .   ? FE  L 701 . ? 1_555 ? 
800  AM1 6  XG4 FD .   ? XG4 L 705 . ? 1_555 ? 
801  AM2 3  ASP L  203 ? ASP L 309 . ? 1_555 ? 
802  AM2 3  LYS L  206 ? LYS L 312 . ? 1_555 ? 
803  AM2 3  XG4 FD .   ? XG4 L 705 . ? 1_555 ? 
804  AM3 2  XG4 SC .   ? XG4 J 709 . ? 1_555 ? 
805  AM3 2  CZF GD .   ? CZF L 706 . ? 1_555 ? 
806  AM4 19 GLN L  43  ? GLN L 149 . ? 1_555 ? 
807  AM4 19 LEU L  44  ? LEU L 150 . ? 1_555 ? 
808  AM4 19 ARG L  58  ? ARG L 164 . ? 1_555 ? 
809  AM4 19 HIS L  61  ? HIS L 167 . ? 1_555 ? 
810  AM4 19 ASP L  101 ? ASP L 207 . ? 1_555 ? 
811  AM4 19 HIS L  104 ? HIS L 210 . ? 1_555 ? 
812  AM4 19 HIS L  109 ? HIS L 215 . ? 1_555 ? 
813  AM4 19 HIS L  127 ? HIS L 233 . ? 1_555 ? 
814  AM4 19 ASP L  205 ? ASP L 311 . ? 1_555 ? 
815  AM4 19 LYS L  206 ? LYS L 312 . ? 1_555 ? 
816  AM4 19 TYR L  209 ? TYR L 315 . ? 1_555 ? 
817  AM4 19 ASP L  213 ? ASP L 319 . ? 1_555 ? 
818  AM4 19 ARG L  260 ? ARG L 366 . ? 1_555 ? 
819  AM4 19 HIS L  264 ? HIS L 370 . ? 1_555 ? 
820  AM4 19 TYR L  268 ? TYR L 374 . ? 1_555 ? 
821  AM4 19 GLN L  269 ? GLN L 375 . ? 1_555 ? 
822  AM4 19 FE  BD .   ? FE  L 701 . ? 1_555 ? 
823  AM4 19 MG  CD .   ? MG  L 702 . ? 1_555 ? 
824  AM4 19 MG  DD .   ? MG  L 703 . ? 1_555 ? 
825  AM5 15 LYS J  417 ? LYS J 523 . ? 1_555 ? 
826  AM5 15 XG4 SC .   ? XG4 J 709 . ? 1_555 ? 
827  AM5 15 TYR K  49  ? TYR K 155 . ? 1_555 ? 
828  AM5 15 VAL K  50  ? VAL K 156 . ? 1_555 ? 
829  AM5 15 VAL K  272 ? VAL K 378 . ? 1_555 ? 
830  AM5 15 ARG K  345 ? ARG K 451 . ? 1_555 ? 
831  AM5 15 LYS K  349 ? LYS K 455 . ? 1_555 ? 
832  AM5 15 LYS L  10  ? LYS L 116 . ? 1_555 ? 
833  AM5 15 VAL L  11  ? VAL L 117 . ? 1_555 ? 
834  AM5 15 ILE L  12  ? ILE L 118 . ? 1_555 ? 
835  AM5 15 ASN L  31  ? ASN L 137 . ? 1_555 ? 
836  AM5 15 GLN L  36  ? GLN L 142 . ? 1_555 ? 
837  AM5 15 ARG L  39  ? ARG L 145 . ? 1_555 ? 
838  AM5 15 PHE L  59  ? PHE L 165 . ? 1_555 ? 
839  AM5 15 MG  ED .   ? MG  L 704 . ? 1_555 ? 
840  AM6 4  ARG L  199 ? ARG L 305 . ? 1_555 ? 
841  AM6 4  ARG L  242 ? ARG L 348 . ? 1_555 ? 
842  AM6 4  HIS L  411 ? HIS L 517 . ? 1_555 ? 
843  AM6 4  ARG L  425 ? ARG L 531 . ? 1_555 ? 
844  AM7 6  ARG M  58  ? ARG M 164 . ? 1_555 ? 
845  AM7 6  HIS M  61  ? HIS M 167 . ? 1_555 ? 
846  AM7 6  HIS M  100 ? HIS M 206 . ? 1_555 ? 
847  AM7 6  ASP M  101 ? ASP M 207 . ? 1_555 ? 
848  AM7 6  ASP M  205 ? ASP M 311 . ? 1_555 ? 
849  AM7 6  XG4 MD .   ? XG4 M 705 . ? 1_555 ? 
850  AM8 4  HIS M  100 ? HIS M 206 . ? 1_555 ? 
851  AM8 4  ASP M  101 ? ASP M 207 . ? 1_555 ? 
852  AM8 4  HIS M  127 ? HIS M 233 . ? 1_555 ? 
853  AM8 4  XG4 MD .   ? XG4 M 705 . ? 1_555 ? 
854  AM9 2  ASP M  203 ? ASP M 309 . ? 1_555 ? 
855  AM9 2  XG4 MD .   ? XG4 M 705 . ? 1_555 ? 
856  AN1 3  LYS M  10  ? LYS M 116 . ? 1_555 ? 
857  AN1 3  CZF ND .   ? CZF M 706 . ? 1_555 ? 
858  AN1 3  XG4 YD .   ? XG4 O 701 . ? 1_555 ? 
859  AN2 18 GLN M  43  ? GLN M 149 . ? 1_555 ? 
860  AN2 18 LEU M  44  ? LEU M 150 . ? 1_555 ? 
861  AN2 18 ARG M  58  ? ARG M 164 . ? 1_555 ? 
862  AN2 18 HIS M  61  ? HIS M 167 . ? 1_555 ? 
863  AN2 18 ASP M  101 ? ASP M 207 . ? 1_555 ? 
864  AN2 18 HIS M  104 ? HIS M 210 . ? 1_555 ? 
865  AN2 18 HIS M  109 ? HIS M 215 . ? 1_555 ? 
866  AN2 18 HIS M  127 ? HIS M 233 . ? 1_555 ? 
867  AN2 18 ASP M  205 ? ASP M 311 . ? 1_555 ? 
868  AN2 18 LYS M  206 ? LYS M 312 . ? 1_555 ? 
869  AN2 18 TYR M  209 ? TYR M 315 . ? 1_555 ? 
870  AN2 18 ASP M  213 ? ASP M 319 . ? 1_555 ? 
871  AN2 18 ARG M  260 ? ARG M 366 . ? 1_555 ? 
872  AN2 18 TYR M  268 ? TYR M 374 . ? 1_555 ? 
873  AN2 18 GLN M  269 ? GLN M 375 . ? 1_555 ? 
874  AN2 18 FE  ID .   ? FE  M 701 . ? 1_555 ? 
875  AN2 18 MG  JD .   ? MG  M 702 . ? 1_555 ? 
876  AN2 18 MG  KD .   ? MG  M 703 . ? 1_555 ? 
877  AN3 15 LYS M  10  ? LYS M 116 . ? 1_555 ? 
878  AN3 15 VAL M  11  ? VAL M 117 . ? 1_555 ? 
879  AN3 15 ILE M  12  ? ILE M 118 . ? 1_555 ? 
880  AN3 15 ASN M  31  ? ASN M 137 . ? 1_555 ? 
881  AN3 15 GLN M  36  ? GLN M 142 . ? 1_555 ? 
882  AN3 15 ARG M  39  ? ARG M 145 . ? 1_555 ? 
883  AN3 15 PHE M  59  ? PHE M 165 . ? 1_555 ? 
884  AN3 15 MG  LD .   ? MG  M 704 . ? 1_555 ? 
885  AN3 15 TYR N  49  ? TYR N 155 . ? 1_555 ? 
886  AN3 15 VAL N  50  ? VAL N 156 . ? 1_555 ? 
887  AN3 15 VAL N  272 ? VAL N 378 . ? 1_555 ? 
888  AN3 15 ARG N  345 ? ARG N 451 . ? 1_555 ? 
889  AN3 15 LYS N  349 ? LYS N 455 . ? 1_555 ? 
890  AN3 15 LYS O  417 ? LYS O 523 . ? 1_555 ? 
891  AN3 15 XG4 YD .   ? XG4 O 701 . ? 1_555 ? 
892  AN4 4  ARG M  199 ? ARG M 305 . ? 1_555 ? 
893  AN4 4  ARG M  242 ? ARG M 348 . ? 1_555 ? 
894  AN4 4  HIS M  411 ? HIS M 517 . ? 1_555 ? 
895  AN4 4  ARG M  425 ? ARG M 531 . ? 1_555 ? 
896  AN5 16 ARG M  227 ? ARG M 333 . ? 1_555 ? 
897  AN5 16 ARG M  246 ? ARG M 352 . ? 1_555 ? 
898  AN5 16 LYS M  248 ? LYS M 354 . ? 1_555 ? 
899  AN5 16 ASN M  252 ? ASN M 358 . ? 1_555 ? 
900  AN5 16 LYS M  417 ? LYS M 523 . ? 1_555 ? 
901  AN5 16 VAL O  11  ? VAL O 117 . ? 1_555 ? 
902  AN5 16 ASN O  13  ? ASN O 119 . ? 1_555 ? 
903  AN5 16 HIS O  19  ? HIS O 125 . ? 1_555 ? 
904  AN5 16 MG  CE .   ? MG  O 705 . ? 1_555 ? 
905  AN5 16 CZF EE .   ? CZF O 707 . ? 1_555 ? 
906  AN5 16 VAL P  50  ? VAL P 156 . ? 1_555 ? 
907  AN5 16 PHE P  51  ? PHE P 157 . ? 1_555 ? 
908  AN5 16 GLY P  218 ? GLY P 324 . ? 1_555 ? 
909  AN5 16 ARG P  266 ? ARG P 372 . ? 1_555 ? 
910  AN5 16 HIS P  270 ? HIS P 376 . ? 1_555 ? 
911  AN5 16 LYS P  271 ? LYS P 377 . ? 1_555 ? 
912  AN6 7  ARG N  58  ? ARG N 164 . ? 1_555 ? 
913  AN6 7  HIS N  61  ? HIS N 167 . ? 1_555 ? 
914  AN6 7  HIS N  100 ? HIS N 206 . ? 1_555 ? 
915  AN6 7  ASP N  101 ? ASP N 207 . ? 1_555 ? 
916  AN6 7  ASP N  205 ? ASP N 311 . ? 1_555 ? 
917  AN6 7  MG  RD .   ? MG  N 702 . ? 1_555 ? 
918  AN6 7  XG4 UD .   ? XG4 N 705 . ? 1_555 ? 
919  AN7 5  HIS N  100 ? HIS N 206 . ? 1_555 ? 
920  AN7 5  ASP N  101 ? ASP N 207 . ? 1_555 ? 
921  AN7 5  HIS N  127 ? HIS N 233 . ? 1_555 ? 
922  AN7 5  FE  QD .   ? FE  N 701 . ? 1_555 ? 
923  AN7 5  XG4 UD .   ? XG4 N 705 . ? 1_555 ? 
924  AN8 3  ASP N  203 ? ASP N 309 . ? 1_555 ? 
925  AN8 3  LYS N  206 ? LYS N 312 . ? 1_555 ? 
926  AN8 3  XG4 UD .   ? XG4 N 705 . ? 1_555 ? 
927  AN9 2  CZF VD .   ? CZF N 706 . ? 1_555 ? 
928  AN9 2  XG4 GE .   ? XG4 P 701 . ? 1_555 ? 
929  AO1 19 GLN N  43  ? GLN N 149 . ? 1_555 ? 
930  AO1 19 LEU N  44  ? LEU N 150 . ? 1_555 ? 
931  AO1 19 ARG N  58  ? ARG N 164 . ? 1_555 ? 
932  AO1 19 HIS N  61  ? HIS N 167 . ? 1_555 ? 
933  AO1 19 ASP N  101 ? ASP N 207 . ? 1_555 ? 
934  AO1 19 HIS N  104 ? HIS N 210 . ? 1_555 ? 
935  AO1 19 HIS N  109 ? HIS N 215 . ? 1_555 ? 
936  AO1 19 HIS N  127 ? HIS N 233 . ? 1_555 ? 
937  AO1 19 ASP N  205 ? ASP N 311 . ? 1_555 ? 
938  AO1 19 LYS N  206 ? LYS N 312 . ? 1_555 ? 
939  AO1 19 TYR N  209 ? TYR N 315 . ? 1_555 ? 
940  AO1 19 ASP N  213 ? ASP N 319 . ? 1_555 ? 
941  AO1 19 ARG N  260 ? ARG N 366 . ? 1_555 ? 
942  AO1 19 HIS N  264 ? HIS N 370 . ? 1_555 ? 
943  AO1 19 TYR N  268 ? TYR N 374 . ? 1_555 ? 
944  AO1 19 GLN N  269 ? GLN N 375 . ? 1_555 ? 
945  AO1 19 FE  QD .   ? FE  N 701 . ? 1_555 ? 
946  AO1 19 MG  RD .   ? MG  N 702 . ? 1_555 ? 
947  AO1 19 MG  SD .   ? MG  N 703 . ? 1_555 ? 
948  AO2 14 TYR M  49  ? TYR M 155 . ? 1_555 ? 
949  AO2 14 VAL M  50  ? VAL M 156 . ? 1_555 ? 
950  AO2 14 VAL M  272 ? VAL M 378 . ? 1_555 ? 
951  AO2 14 ARG M  345 ? ARG M 451 . ? 1_555 ? 
952  AO2 14 LYS N  10  ? LYS N 116 . ? 1_555 ? 
953  AO2 14 VAL N  11  ? VAL N 117 . ? 1_555 ? 
954  AO2 14 ILE N  12  ? ILE N 118 . ? 1_555 ? 
955  AO2 14 ASN N  31  ? ASN N 137 . ? 1_555 ? 
956  AO2 14 GLN N  36  ? GLN N 142 . ? 1_555 ? 
957  AO2 14 ARG N  39  ? ARG N 145 . ? 1_555 ? 
958  AO2 14 PHE N  59  ? PHE N 165 . ? 1_555 ? 
959  AO2 14 MG  TD .   ? MG  N 704 . ? 1_555 ? 
960  AO2 14 LYS P  417 ? LYS P 523 . ? 1_555 ? 
961  AO2 14 XG4 GE .   ? XG4 P 701 . ? 1_555 ? 
962  AO3 3  ARG N  199 ? ARG N 305 . ? 1_555 ? 
963  AO3 3  ARG N  242 ? ARG N 348 . ? 1_555 ? 
964  AO3 3  HIS N  411 ? HIS N 517 . ? 1_555 ? 
965  AO4 17 ASP N  224 ? ASP N 330 . ? 1_555 ? 
966  AO4 17 ARG N  227 ? ARG N 333 . ? 1_555 ? 
967  AO4 17 ARG N  246 ? ARG N 352 . ? 1_555 ? 
968  AO4 17 LYS N  248 ? LYS N 354 . ? 1_555 ? 
969  AO4 17 ASN N  252 ? ASN N 358 . ? 1_555 ? 
970  AO4 17 LYS N  417 ? LYS N 523 . ? 1_555 ? 
971  AO4 17 VAL O  50  ? VAL O 156 . ? 1_555 ? 
972  AO4 17 PHE O  51  ? PHE O 157 . ? 1_555 ? 
973  AO4 17 GLY O  218 ? GLY O 324 . ? 1_555 ? 
974  AO4 17 ARG O  266 ? ARG O 372 . ? 1_555 ? 
975  AO4 17 HIS O  270 ? HIS O 376 . ? 1_555 ? 
976  AO4 17 LYS O  271 ? LYS O 377 . ? 1_555 ? 
977  AO4 17 ILE P  12  ? ILE P 118 . ? 1_555 ? 
978  AO4 17 ASN P  13  ? ASN P 119 . ? 1_555 ? 
979  AO4 17 HIS P  19  ? HIS P 125 . ? 1_555 ? 
980  AO4 17 MG  KE .   ? MG  P 705 . ? 1_555 ? 
981  AO4 17 CZF ME .   ? CZF P 707 . ? 1_555 ? 
982  AO5 18 VAL M  11  ? VAL M 117 . ? 1_555 ? 
983  AO5 18 ASN M  13  ? ASN M 119 . ? 1_555 ? 
984  AO5 18 HIS M  19  ? HIS M 125 . ? 1_555 ? 
985  AO5 18 MG  LD .   ? MG  M 704 . ? 1_555 ? 
986  AO5 18 CZF ND .   ? CZF M 706 . ? 1_555 ? 
987  AO5 18 VAL N  50  ? VAL N 156 . ? 1_555 ? 
988  AO5 18 PHE N  51  ? PHE N 157 . ? 1_555 ? 
989  AO5 18 GLY N  218 ? GLY N 324 . ? 1_555 ? 
990  AO5 18 ARG N  266 ? ARG N 372 . ? 1_555 ? 
991  AO5 18 HIS N  270 ? HIS N 376 . ? 1_555 ? 
992  AO5 18 LYS N  271 ? LYS N 377 . ? 1_555 ? 
993  AO5 18 VAL N  272 ? VAL N 378 . ? 1_555 ? 
994  AO5 18 ASP O  224 ? ASP O 330 . ? 1_555 ? 
995  AO5 18 ARG O  227 ? ARG O 333 . ? 1_555 ? 
996  AO5 18 ARG O  246 ? ARG O 352 . ? 1_555 ? 
997  AO5 18 LYS O  248 ? LYS O 354 . ? 1_555 ? 
998  AO5 18 ASN O  252 ? ASN O 358 . ? 1_555 ? 
999  AO5 18 LYS O  417 ? LYS O 523 . ? 1_555 ? 
1000 AO6 7  ARG O  58  ? ARG O 164 . ? 1_555 ? 
1001 AO6 7  HIS O  61  ? HIS O 167 . ? 1_555 ? 
1002 AO6 7  HIS O  100 ? HIS O 206 . ? 1_555 ? 
1003 AO6 7  ASP O  101 ? ASP O 207 . ? 1_555 ? 
1004 AO6 7  ASP O  205 ? ASP O 311 . ? 1_555 ? 
1005 AO6 7  MG  AE .   ? MG  O 703 . ? 1_555 ? 
1006 AO6 7  XG4 DE .   ? XG4 O 706 . ? 1_555 ? 
1007 AO7 5  HIS O  100 ? HIS O 206 . ? 1_555 ? 
1008 AO7 5  ASP O  101 ? ASP O 207 . ? 1_555 ? 
1009 AO7 5  HIS O  127 ? HIS O 233 . ? 1_555 ? 
1010 AO7 5  FE  ZD .   ? FE  O 702 . ? 1_555 ? 
1011 AO7 5  XG4 DE .   ? XG4 O 706 . ? 1_555 ? 
1012 AO8 2  ASP O  203 ? ASP O 309 . ? 1_555 ? 
1013 AO8 2  XG4 DE .   ? XG4 O 706 . ? 1_555 ? 
1014 AO9 2  XG4 PD .   ? XG4 M 708 . ? 1_555 ? 
1015 AO9 2  CZF EE .   ? CZF O 707 . ? 1_555 ? 
1016 AP1 19 GLN O  43  ? GLN O 149 . ? 1_555 ? 
1017 AP1 19 LEU O  44  ? LEU O 150 . ? 1_555 ? 
1018 AP1 19 ARG O  58  ? ARG O 164 . ? 1_555 ? 
1019 AP1 19 HIS O  61  ? HIS O 167 . ? 1_555 ? 
1020 AP1 19 ASP O  101 ? ASP O 207 . ? 1_555 ? 
1021 AP1 19 HIS O  104 ? HIS O 210 . ? 1_555 ? 
1022 AP1 19 HIS O  109 ? HIS O 215 . ? 1_555 ? 
1023 AP1 19 HIS O  127 ? HIS O 233 . ? 1_555 ? 
1024 AP1 19 ASP O  205 ? ASP O 311 . ? 1_555 ? 
1025 AP1 19 LYS O  206 ? LYS O 312 . ? 1_555 ? 
1026 AP1 19 TYR O  209 ? TYR O 315 . ? 1_555 ? 
1027 AP1 19 ASP O  213 ? ASP O 319 . ? 1_555 ? 
1028 AP1 19 ARG O  260 ? ARG O 366 . ? 1_555 ? 
1029 AP1 19 HIS O  264 ? HIS O 370 . ? 1_555 ? 
1030 AP1 19 TYR O  268 ? TYR O 374 . ? 1_555 ? 
1031 AP1 19 GLN O  269 ? GLN O 375 . ? 1_555 ? 
1032 AP1 19 FE  ZD .   ? FE  O 702 . ? 1_555 ? 
1033 AP1 19 MG  AE .   ? MG  O 703 . ? 1_555 ? 
1034 AP1 19 MG  BE .   ? MG  O 704 . ? 1_555 ? 
1035 AP2 14 LYS M  417 ? LYS M 523 . ? 1_555 ? 
1036 AP2 14 XG4 PD .   ? XG4 M 708 . ? 1_555 ? 
1037 AP2 14 LYS O  10  ? LYS O 116 . ? 1_555 ? 
1038 AP2 14 VAL O  11  ? VAL O 117 . ? 1_555 ? 
1039 AP2 14 ILE O  12  ? ILE O 118 . ? 1_555 ? 
1040 AP2 14 ASN O  31  ? ASN O 137 . ? 1_555 ? 
1041 AP2 14 GLN O  36  ? GLN O 142 . ? 1_555 ? 
1042 AP2 14 ARG O  39  ? ARG O 145 . ? 1_555 ? 
1043 AP2 14 PHE O  59  ? PHE O 165 . ? 1_555 ? 
1044 AP2 14 MG  CE .   ? MG  O 705 . ? 1_555 ? 
1045 AP2 14 TYR P  49  ? TYR P 155 . ? 1_555 ? 
1046 AP2 14 VAL P  50  ? VAL P 156 . ? 1_555 ? 
1047 AP2 14 VAL P  272 ? VAL P 378 . ? 1_555 ? 
1048 AP2 14 ARG P  345 ? ARG P 451 . ? 1_555 ? 
1049 AP3 4  ARG O  199 ? ARG O 305 . ? 1_555 ? 
1050 AP3 4  ARG O  242 ? ARG O 348 . ? 1_555 ? 
1051 AP3 4  HIS O  411 ? HIS O 517 . ? 1_555 ? 
1052 AP3 4  ARG O  425 ? ARG O 531 . ? 1_555 ? 
1053 AP4 16 VAL M  50  ? VAL M 156 . ? 1_555 ? 
1054 AP4 16 PHE M  51  ? PHE M 157 . ? 1_555 ? 
1055 AP4 16 ARG M  266 ? ARG M 372 . ? 1_555 ? 
1056 AP4 16 HIS M  270 ? HIS M 376 . ? 1_555 ? 
1057 AP4 16 LYS M  271 ? LYS M 377 . ? 1_555 ? 
1058 AP4 16 VAL N  11  ? VAL N 117 . ? 1_555 ? 
1059 AP4 16 ASN N  13  ? ASN N 119 . ? 1_555 ? 
1060 AP4 16 HIS N  19  ? HIS N 125 . ? 1_555 ? 
1061 AP4 16 MG  TD .   ? MG  N 704 . ? 1_555 ? 
1062 AP4 16 CZF VD .   ? CZF N 706 . ? 1_555 ? 
1063 AP4 16 ASP P  224 ? ASP P 330 . ? 1_555 ? 
1064 AP4 16 ARG P  227 ? ARG P 333 . ? 1_555 ? 
1065 AP4 16 ARG P  246 ? ARG P 352 . ? 1_555 ? 
1066 AP4 16 LYS P  248 ? LYS P 354 . ? 1_555 ? 
1067 AP4 16 ASN P  252 ? ASN P 358 . ? 1_555 ? 
1068 AP4 16 LYS P  417 ? LYS P 523 . ? 1_555 ? 
1069 AP5 7  ARG P  58  ? ARG P 164 . ? 1_555 ? 
1070 AP5 7  HIS P  61  ? HIS P 167 . ? 1_555 ? 
1071 AP5 7  HIS P  100 ? HIS P 206 . ? 1_555 ? 
1072 AP5 7  ASP P  101 ? ASP P 207 . ? 1_555 ? 
1073 AP5 7  ASP P  205 ? ASP P 311 . ? 1_555 ? 
1074 AP5 7  MG  IE .   ? MG  P 703 . ? 1_555 ? 
1075 AP5 7  XG4 LE .   ? XG4 P 706 . ? 1_555 ? 
1076 AP6 6  HIS P  100 ? HIS P 206 . ? 1_555 ? 
1077 AP6 6  ASP P  101 ? ASP P 207 . ? 1_555 ? 
1078 AP6 6  HIS P  127 ? HIS P 233 . ? 1_555 ? 
1079 AP6 6  ASP P  205 ? ASP P 311 . ? 1_555 ? 
1080 AP6 6  FE  HE .   ? FE  P 702 . ? 1_555 ? 
1081 AP6 6  XG4 LE .   ? XG4 P 706 . ? 1_555 ? 
1082 AP7 2  ASP P  203 ? ASP P 309 . ? 1_555 ? 
1083 AP7 2  XG4 LE .   ? XG4 P 706 . ? 1_555 ? 
1084 AP8 2  XG4 XD .   ? XG4 N 708 . ? 1_555 ? 
1085 AP8 2  CZF ME .   ? CZF P 707 . ? 1_555 ? 
1086 AP9 19 GLN P  43  ? GLN P 149 . ? 1_555 ? 
1087 AP9 19 LEU P  44  ? LEU P 150 . ? 1_555 ? 
1088 AP9 19 ARG P  58  ? ARG P 164 . ? 1_555 ? 
1089 AP9 19 HIS P  61  ? HIS P 167 . ? 1_555 ? 
1090 AP9 19 ASP P  101 ? ASP P 207 . ? 1_555 ? 
1091 AP9 19 HIS P  104 ? HIS P 210 . ? 1_555 ? 
1092 AP9 19 HIS P  109 ? HIS P 215 . ? 1_555 ? 
1093 AP9 19 HIS P  127 ? HIS P 233 . ? 1_555 ? 
1094 AP9 19 ASP P  205 ? ASP P 311 . ? 1_555 ? 
1095 AP9 19 LYS P  206 ? LYS P 312 . ? 1_555 ? 
1096 AP9 19 TYR P  209 ? TYR P 315 . ? 1_555 ? 
1097 AP9 19 ASP P  213 ? ASP P 319 . ? 1_555 ? 
1098 AP9 19 ARG P  260 ? ARG P 366 . ? 1_555 ? 
1099 AP9 19 HIS P  264 ? HIS P 370 . ? 1_555 ? 
1100 AP9 19 TYR P  268 ? TYR P 374 . ? 1_555 ? 
1101 AP9 19 GLN P  269 ? GLN P 375 . ? 1_555 ? 
1102 AP9 19 FE  HE .   ? FE  P 702 . ? 1_555 ? 
1103 AP9 19 MG  IE .   ? MG  P 703 . ? 1_555 ? 
1104 AP9 19 MG  JE .   ? MG  P 704 . ? 1_555 ? 
1105 AQ1 15 LYS N  417 ? LYS N 523 . ? 1_555 ? 
1106 AQ1 15 XG4 XD .   ? XG4 N 708 . ? 1_555 ? 
1107 AQ1 15 TYR O  49  ? TYR O 155 . ? 1_555 ? 
1108 AQ1 15 VAL O  50  ? VAL O 156 . ? 1_555 ? 
1109 AQ1 15 VAL O  272 ? VAL O 378 . ? 1_555 ? 
1110 AQ1 15 ARG O  345 ? ARG O 451 . ? 1_555 ? 
1111 AQ1 15 LYS O  349 ? LYS O 455 . ? 1_555 ? 
1112 AQ1 15 LYS P  10  ? LYS P 116 . ? 1_555 ? 
1113 AQ1 15 VAL P  11  ? VAL P 117 . ? 1_555 ? 
1114 AQ1 15 ILE P  12  ? ILE P 118 . ? 1_555 ? 
1115 AQ1 15 ASN P  31  ? ASN P 137 . ? 1_555 ? 
1116 AQ1 15 GLN P  36  ? GLN P 142 . ? 1_555 ? 
1117 AQ1 15 ARG P  39  ? ARG P 145 . ? 1_555 ? 
1118 AQ1 15 PHE P  59  ? PHE P 165 . ? 1_555 ? 
1119 AQ1 15 MG  KE .   ? MG  P 705 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6TXA 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.010227 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000930 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005784 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003640 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
FE 
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . THR A  1 8   ? 82.950  70.104  -40.766  1.00 97.86  ? 114 THR A N     1 
ATOM   2     C  CA    . THR A  1 8   ? 81.880  69.857  -41.793  1.00 92.35  ? 114 THR A CA    1 
ATOM   3     C  C     . THR A  1 8   ? 82.210  68.599  -42.666  1.00 89.87  ? 114 THR A C     1 
ATOM   4     O  O     . THR A  1 8   ? 83.244  67.933  -42.491  1.00 100.80 ? 114 THR A O     1 
ATOM   5     C  CB    . THR A  1 8   ? 81.582  71.158  -42.609  1.00 86.26  ? 114 THR A CB    1 
ATOM   6     O  OG1   . THR A  1 8   ? 80.310  71.047  -43.246  1.00 85.96  ? 114 THR A OG1   1 
ATOM   7     C  CG2   . THR A  1 8   ? 82.680  71.493  -43.631  1.00 81.71  ? 114 THR A CG2   1 
ATOM   8     N  N     . MET A  1 9   ? 81.320  68.274  -43.604  1.00 74.99  ? 115 MET A N     1 
ATOM   9     C  CA    . MET A  1 9   ? 81.405  67.073  -44.464  1.00 64.37  ? 115 MET A CA    1 
ATOM   10    C  C     . MET A  1 9   ? 81.969  67.458  -45.822  1.00 56.58  ? 115 MET A C     1 
ATOM   11    O  O     . MET A  1 9   ? 81.738  68.566  -46.315  1.00 58.13  ? 115 MET A O     1 
ATOM   12    C  CB    . MET A  1 9   ? 79.994  66.497  -44.680  1.00 63.82  ? 115 MET A CB    1 
ATOM   13    C  CG    . MET A  1 9   ? 79.385  65.870  -43.442  1.00 63.67  ? 115 MET A CG    1 
ATOM   14    S  SD    . MET A  1 9   ? 79.807  64.138  -43.159  1.00 62.76  ? 115 MET A SD    1 
ATOM   15    C  CE    . MET A  1 9   ? 79.700  64.013  -41.360  1.00 62.59  ? 115 MET A CE    1 
ATOM   16    N  N     . LYS A  1 10  ? 82.642  66.516  -46.466  1.00 47.10  ? 116 LYS A N     1 
ATOM   17    C  CA    . LYS A  1 10  ? 83.057  66.675  -47.850  1.00 42.76  ? 116 LYS A CA    1 
ATOM   18    C  C     . LYS A  1 10  ? 82.088  65.946  -48.766  1.00 39.47  ? 116 LYS A C     1 
ATOM   19    O  O     . LYS A  1 10  ? 81.747  64.801  -48.531  1.00 39.93  ? 116 LYS A O     1 
ATOM   20    C  CB    . LYS A  1 10  ? 84.439  66.094  -48.052  1.00 41.98  ? 116 LYS A CB    1 
ATOM   21    C  CG    . LYS A  1 10  ? 85.170  66.726  -49.195  1.00 41.26  ? 116 LYS A CG    1 
ATOM   22    C  CD    . LYS A  1 10  ? 86.516  66.096  -49.387  1.00 40.66  ? 116 LYS A CD    1 
ATOM   23    C  CE    . LYS A  1 10  ? 87.441  67.173  -49.829  1.00 40.90  ? 116 LYS A CE    1 
ATOM   24    N  NZ    . LYS A  1 10  ? 88.856  66.765  -49.861  1.00 40.42  ? 116 LYS A NZ    1 
ATOM   25    N  N     . VAL A  1 11  ? 81.678  66.612  -49.837  1.00 35.14  ? 117 VAL A N     1 
ATOM   26    C  CA    . VAL A  1 11  ? 80.816  66.012  -50.830  1.00 32.35  ? 117 VAL A CA    1 
ATOM   27    C  C     . VAL A  1 11  ? 81.622  65.674  -52.070  1.00 29.40  ? 117 VAL A C     1 
ATOM   28    O  O     . VAL A  1 11  ? 82.456  66.454  -52.487  1.00 28.94  ? 117 VAL A O     1 
ATOM   29    C  CB    . VAL A  1 11  ? 79.687  66.972  -51.208  1.00 34.00  ? 117 VAL A CB    1 
ATOM   30    C  CG1   . VAL A  1 11  ? 78.744  66.326  -52.197  1.00 34.61  ? 117 VAL A CG1   1 
ATOM   31    C  CG2   . VAL A  1 11  ? 78.876  67.334  -49.985  1.00 34.54  ? 117 VAL A CG2   1 
ATOM   32    N  N     . ILE A  1 12  ? 81.324  64.528  -52.669  1.00 27.38  ? 118 ILE A N     1 
ATOM   33    C  CA    . ILE A  1 12  ? 82.007  64.050  -53.865  1.00 26.20  ? 118 ILE A CA    1 
ATOM   34    C  C     . ILE A  1 12  ? 81.008  63.420  -54.824  1.00 25.87  ? 118 ILE A C     1 
ATOM   35    O  O     . ILE A  1 12  ? 80.121  62.689  -54.380  1.00 26.01  ? 118 ILE A O     1 
ATOM   36    C  CB    . ILE A  1 12  ? 83.118  63.054  -53.469  1.00 25.41  ? 118 ILE A CB    1 
ATOM   37    C  CG1   . ILE A  1 12  ? 83.971  62.667  -54.650  1.00 24.99  ? 118 ILE A CG1   1 
ATOM   38    C  CG2   . ILE A  1 12  ? 82.542  61.791  -52.835  1.00 25.49  ? 118 ILE A CG2   1 
ATOM   39    C  CD1   . ILE A  1 12  ? 85.276  62.036  -54.190  1.00 25.24  ? 118 ILE A CD1   1 
ATOM   40    N  N     . ASN A  1 13  ? 81.142  63.693  -56.125  1.00 25.77  ? 119 ASN A N     1 
ATOM   41    C  CA    . ASN A  1 13  ? 80.121  63.303  -57.112  1.00 25.57  ? 119 ASN A CA    1 
ATOM   42    C  C     . ASN A  1 13  ? 80.521  62.075  -57.948  1.00 25.07  ? 119 ASN A C     1 
ATOM   43    O  O     . ASN A  1 13  ? 81.246  62.154  -58.967  1.00 26.32  ? 119 ASN A O     1 
ATOM   44    C  CB    . ASN A  1 13  ? 79.790  64.485  -58.026  1.00 26.30  ? 119 ASN A CB    1 
ATOM   45    C  CG    . ASN A  1 13  ? 78.651  64.184  -59.002  1.00 27.03  ? 119 ASN A CG    1 
ATOM   46    O  OD1   . ASN A  1 13  ? 78.275  63.027  -59.194  1.00 28.00  ? 119 ASN A OD1   1 
ATOM   47    N  ND2   . ASN A  1 13  ? 78.085  65.222  -59.587  1.00 28.02  ? 119 ASN A ND2   1 
ATOM   48    N  N     . ASP A  1 14  ? 79.982  60.952  -57.510  1.00 23.58  ? 120 ASP A N     1 
ATOM   49    C  CA    . ASP A  1 14  ? 80.041  59.677  -58.210  1.00 23.06  ? 120 ASP A CA    1 
ATOM   50    C  C     . ASP A  1 14  ? 78.881  59.597  -59.203  1.00 22.23  ? 120 ASP A C     1 
ATOM   51    O  O     . ASP A  1 14  ? 77.757  59.897  -58.840  1.00 21.78  ? 120 ASP A O     1 
ATOM   52    C  CB    . ASP A  1 14  ? 79.906  58.556  -57.180  1.00 23.42  ? 120 ASP A CB    1 
ATOM   53    C  CG    . ASP A  1 14  ? 79.971  57.177  -57.777  1.00 23.90  ? 120 ASP A CG    1 
ATOM   54    O  OD1   . ASP A  1 14  ? 80.917  56.896  -58.541  1.00 23.93  ? 120 ASP A OD1   1 
ATOM   55    O  OD2   . ASP A  1 14  ? 79.096  56.341  -57.458  1.00 24.66  ? 120 ASP A OD2   1 
ATOM   56    N  N     . PRO A  1 15  ? 79.142  59.180  -60.452  1.00 21.55  ? 121 PRO A N     1 
ATOM   57    C  CA    . PRO A  1 15  ? 78.051  59.111  -61.419  1.00 20.99  ? 121 PRO A CA    1 
ATOM   58    C  C     . PRO A  1 15  ? 77.033  58.022  -61.163  1.00 20.19  ? 121 PRO A C     1 
ATOM   59    O  O     . PRO A  1 15  ? 75.971  58.071  -61.753  1.00 20.48  ? 121 PRO A O     1 
ATOM   60    C  CB    . PRO A  1 15  ? 78.777  58.788  -62.728  1.00 21.14  ? 121 PRO A CB    1 
ATOM   61    C  CG    . PRO A  1 15  ? 79.971  58.016  -62.283  1.00 21.09  ? 121 PRO A CG    1 
ATOM   62    C  CD    . PRO A  1 15  ? 80.418  58.820  -61.091  1.00 21.36  ? 121 PRO A CD    1 
ATOM   63    N  N     . ILE A  1 16  ? 77.365  57.022  -60.346  1.00 19.39  ? 122 ILE A N     1 
ATOM   64    C  CA    . ILE A  1 16  ? 76.406  55.981  -60.024  1.00 19.20  ? 122 ILE A CA    1 
ATOM   65    C  C     . ILE A  1 16  ? 75.518  56.418  -58.902  1.00 19.28  ? 122 ILE A C     1 
ATOM   66    O  O     . ILE A  1 16  ? 74.327  56.372  -59.048  1.00 19.27  ? 122 ILE A O     1 
ATOM   67    C  CB    . ILE A  1 16  ? 77.076  54.672  -59.603  1.00 19.17  ? 122 ILE A CB    1 
ATOM   68    C  CG1   . ILE A  1 16  ? 78.073  54.214  -60.664  1.00 19.40  ? 122 ILE A CG1   1 
ATOM   69    C  CG2   . ILE A  1 16  ? 76.040  53.579  -59.389  1.00 18.96  ? 122 ILE A CG2   1 
ATOM   70    C  CD1   . ILE A  1 16  ? 77.565  54.186  -62.098  1.00 19.55  ? 122 ILE A CD1   1 
ATOM   71    N  N     . HIS A  1 17  ? 76.106  56.832  -57.787  1.00 19.32  ? 123 HIS A N     1 
ATOM   72    C  CA    . HIS A  1 17  ? 75.357  57.053  -56.551  1.00 19.54  ? 123 HIS A CA    1 
ATOM   73    C  C     . HIS A  1 17  ? 74.964  58.478  -56.274  1.00 20.44  ? 123 HIS A C     1 
ATOM   74    O  O     . HIS A  1 17  ? 74.135  58.715  -55.383  1.00 22.26  ? 123 HIS A O     1 
ATOM   75    C  CB    . HIS A  1 17  ? 76.138  56.535  -55.365  1.00 19.16  ? 123 HIS A CB    1 
ATOM   76    C  CG    . HIS A  1 17  ? 76.404  55.081  -55.457  1.00 19.13  ? 123 HIS A CG    1 
ATOM   77    N  ND1   . HIS A  1 17  ? 75.384  54.158  -55.618  1.00 19.22  ? 123 HIS A ND1   1 
ATOM   78    C  CD2   . HIS A  1 17  ? 77.571  54.390  -55.466  1.00 19.20  ? 123 HIS A CD2   1 
ATOM   79    C  CE1   . HIS A  1 17  ? 75.936  52.952  -55.685  1.00 19.63  ? 123 HIS A CE1   1 
ATOM   80    N  NE2   . HIS A  1 17  ? 77.257  53.066  -55.603  1.00 19.25  ? 123 HIS A NE2   1 
ATOM   81    N  N     . GLY A  1 18  ? 75.523  59.423  -57.005  1.00 20.62  ? 124 GLY A N     1 
ATOM   82    C  CA    . GLY A  1 18  ? 75.165  60.824  -56.839  1.00 21.47  ? 124 GLY A CA    1 
ATOM   83    C  C     . GLY A  1 18  ? 76.187  61.498  -55.951  1.00 22.13  ? 124 GLY A C     1 
ATOM   84    O  O     . GLY A  1 18  ? 77.354  61.143  -55.983  1.00 21.76  ? 124 GLY A O     1 
ATOM   85    N  N     . HIS A  1 19  ? 75.742  62.486  -55.174  1.00 23.28  ? 125 HIS A N     1 
ATOM   86    C  CA    . HIS A  1 19  ? 76.620  63.227  -54.282  1.00 23.90  ? 125 HIS A CA    1 
ATOM   87    C  C     . HIS A  1 19  ? 76.754  62.497  -52.951  1.00 25.28  ? 125 HIS A C     1 
ATOM   88    O  O     . HIS A  1 19  ? 75.840  62.502  -52.134  1.00 27.03  ? 125 HIS A O     1 
ATOM   89    C  CB    . HIS A  1 19  ? 76.108  64.644  -54.110  1.00 23.63  ? 125 HIS A CB    1 
ATOM   90    C  CG    . HIS A  1 19  ? 76.329  65.493  -55.328  1.00 23.81  ? 125 HIS A CG    1 
ATOM   91    N  ND1   . HIS A  1 19  ? 75.741  65.209  -56.549  1.00 23.53  ? 125 HIS A ND1   1 
ATOM   92    C  CD2   . HIS A  1 19  ? 77.088  66.601  -55.516  1.00 24.28  ? 125 HIS A CD2   1 
ATOM   93    C  CE1   . HIS A  1 19  ? 76.107  66.121  -57.422  1.00 24.27  ? 125 HIS A CE1   1 
ATOM   94    N  NE2   . HIS A  1 19  ? 76.921  66.981  -56.821  1.00 24.69  ? 125 HIS A NE2   1 
ATOM   95    N  N     . ILE A  1 20  ? 77.888  61.835  -52.771  1.00 26.05  ? 126 ILE A N     1 
ATOM   96    C  CA    . ILE A  1 20  ? 78.200  61.126  -51.554  1.00 27.30  ? 126 ILE A CA    1 
ATOM   97    C  C     . ILE A  1 20  ? 78.757  62.113  -50.515  1.00 28.48  ? 126 ILE A C     1 
ATOM   98    O  O     . ILE A  1 20  ? 79.582  62.952  -50.860  1.00 27.81  ? 126 ILE A O     1 
ATOM   99    C  CB    . ILE A  1 20  ? 79.273  60.067  -51.844  1.00 27.39  ? 126 ILE A CB    1 
ATOM   100   C  CG1   . ILE A  1 20  ? 78.715  59.016  -52.783  1.00 27.50  ? 126 ILE A CG1   1 
ATOM   101   C  CG2   . ILE A  1 20  ? 79.700  59.357  -50.563  1.00 27.62  ? 126 ILE A CG2   1 
ATOM   102   C  CD1   . ILE A  1 20  ? 79.828  58.134  -53.369  1.00 27.67  ? 126 ILE A CD1   1 
ATOM   103   N  N     . GLU A  1 21  ? 78.338  61.977  -49.253  1.00 30.48  ? 127 GLU A N     1 
ATOM   104   C  CA    . GLU A  1 21  ? 78.973  62.702  -48.151  1.00 32.17  ? 127 GLU A CA    1 
ATOM   105   C  C     . GLU A  1 21  ? 80.070  61.845  -47.538  1.00 31.48  ? 127 GLU A C     1 
ATOM   106   O  O     . GLU A  1 21  ? 79.880  60.658  -47.311  1.00 32.37  ? 127 GLU A O     1 
ATOM   107   C  CB    . GLU A  1 21  ? 77.952  63.078  -47.091  1.00 34.34  ? 127 GLU A CB    1 
ATOM   108   C  CG    . GLU A  1 21  ? 76.973  64.133  -47.553  1.00 37.75  ? 127 GLU A CG    1 
ATOM   109   C  CD    . GLU A  1 21  ? 75.989  64.596  -46.485  1.00 40.44  ? 127 GLU A CD    1 
ATOM   110   O  OE1   . GLU A  1 21  ? 76.214  64.379  -45.246  1.00 43.78  ? 127 GLU A OE1   1 
ATOM   111   O  OE2   . GLU A  1 21  ? 74.975  65.215  -46.926  1.00 42.52  ? 127 GLU A OE2   1 
ATOM   112   N  N     . LEU A  1 22  ? 81.223  62.457  -47.283  1.00 30.25  ? 128 LEU A N     1 
ATOM   113   C  CA    . LEU A  1 22  ? 82.371  61.763  -46.691  1.00 28.81  ? 128 LEU A CA    1 
ATOM   114   C  C     . LEU A  1 22  ? 82.742  62.406  -45.356  1.00 28.35  ? 128 LEU A C     1 
ATOM   115   O  O     . LEU A  1 22  ? 83.107  63.600  -45.271  1.00 28.47  ? 128 LEU A O     1 
ATOM   116   C  CB    . LEU A  1 22  ? 83.576  61.811  -47.617  1.00 28.41  ? 128 LEU A CB    1 
ATOM   117   C  CG    . LEU A  1 22  ? 83.474  60.994  -48.899  1.00 27.40  ? 128 LEU A CG    1 
ATOM   118   C  CD1   . LEU A  1 22  ? 84.687  61.299  -49.794  1.00 27.07  ? 128 LEU A CD1   1 
ATOM   119   C  CD2   . LEU A  1 22  ? 83.340  59.513  -48.630  1.00 27.04  ? 128 LEU A CD2   1 
ATOM   120   N  N     . HIS A  1 23  ? 82.622  61.600  -44.304  1.00 27.16  ? 129 HIS A N     1 
ATOM   121   C  CA    . HIS A  1 23  ? 83.043  61.995  -42.975  1.00 26.80  ? 129 HIS A CA    1 
ATOM   122   C  C     . HIS A  1 23  ? 84.562  62.284  -42.938  1.00 26.57  ? 129 HIS A C     1 
ATOM   123   O  O     . HIS A  1 23  ? 85.329  61.624  -43.636  1.00 26.50  ? 129 HIS A O     1 
ATOM   124   C  CB    . HIS A  1 23  ? 82.707  60.850  -42.037  1.00 26.47  ? 129 HIS A CB    1 
ATOM   125   C  CG    . HIS A  1 23  ? 82.961  61.142  -40.594  1.00 25.57  ? 129 HIS A CG    1 
ATOM   126   N  ND1   . HIS A  1 23  ? 84.211  61.097  -40.047  1.00 25.20  ? 129 HIS A ND1   1 
ATOM   127   C  CD2   . HIS A  1 23  ? 82.115  61.459  -39.597  1.00 25.14  ? 129 HIS A CD2   1 
ATOM   128   C  CE1   . HIS A  1 23  ? 84.127  61.396  -38.767  1.00 25.37  ? 129 HIS A CE1   1 
ATOM   129   N  NE2   . HIS A  1 23  ? 82.867  61.615  -38.469  1.00 25.44  ? 129 HIS A NE2   1 
ATOM   130   N  N     . PRO A  1 24  ? 84.997  63.271  -42.125  1.00 27.29  ? 130 PRO A N     1 
ATOM   131   C  CA    . PRO A  1 24  ? 86.399  63.695  -42.130  1.00 28.47  ? 130 PRO A CA    1 
ATOM   132   C  C     . PRO A  1 24  ? 87.423  62.585  -41.956  1.00 28.66  ? 130 PRO A C     1 
ATOM   133   O  O     . PRO A  1 24  ? 88.492  62.646  -42.559  1.00 28.92  ? 130 PRO A O     1 
ATOM   134   C  CB    . PRO A  1 24  ? 86.476  64.629  -40.953  1.00 28.79  ? 130 PRO A CB    1 
ATOM   135   C  CG    . PRO A  1 24  ? 85.123  65.217  -40.871  1.00 28.42  ? 130 PRO A CG    1 
ATOM   136   C  CD    . PRO A  1 24  ? 84.181  64.151  -41.273  1.00 27.57  ? 130 PRO A CD    1 
ATOM   137   N  N     . LEU A  1 25  ? 87.100  61.616  -41.108  1.00 28.92  ? 131 LEU A N     1 
ATOM   138   C  CA    . LEU A  1 25  ? 87.907  60.420  -40.919  1.00 30.00  ? 131 LEU A CA    1 
ATOM   139   C  C     . LEU A  1 25  ? 88.076  59.615  -42.201  1.00 30.55  ? 131 LEU A C     1 
ATOM   140   O  O     . LEU A  1 25  ? 89.165  59.114  -42.474  1.00 31.29  ? 131 LEU A O     1 
ATOM   141   C  CB    . LEU A  1 25  ? 87.281  59.522  -39.846  1.00 30.14  ? 131 LEU A CB    1 
ATOM   142   C  CG    . LEU A  1 25  ? 87.925  58.155  -39.574  1.00 30.23  ? 131 LEU A CG    1 
ATOM   143   C  CD1   . LEU A  1 25  ? 89.393  58.304  -39.212  1.00 30.73  ? 131 LEU A CD1   1 
ATOM   144   C  CD2   . LEU A  1 25  ? 87.131  57.462  -38.483  1.00 30.29  ? 131 LEU A CD2   1 
ATOM   145   N  N     . LEU A  1 26  ? 87.001  59.487  -42.974  1.00 30.18  ? 132 LEU A N     1 
ATOM   146   C  CA    . LEU A  1 26  ? 87.062  58.783  -44.257  1.00 29.57  ? 132 LEU A CA    1 
ATOM   147   C  C     . LEU A  1 26  ? 87.925  59.550  -45.250  1.00 28.52  ? 132 LEU A C     1 
ATOM   148   O  O     . LEU A  1 26  ? 88.745  58.951  -45.935  1.00 29.37  ? 132 LEU A O     1 
ATOM   149   C  CB    . LEU A  1 26  ? 85.676  58.553  -44.852  1.00 30.19  ? 132 LEU A CB    1 
ATOM   150   C  CG    . LEU A  1 26  ? 84.656  57.840  -43.948  1.00 30.91  ? 132 LEU A CG    1 
ATOM   151   C  CD1   . LEU A  1 26  ? 83.267  57.799  -44.572  1.00 30.95  ? 132 LEU A CD1   1 
ATOM   152   C  CD2   . LEU A  1 26  ? 85.119  56.430  -43.627  1.00 31.54  ? 132 LEU A CD2   1 
ATOM   153   N  N     . VAL A  1 27  ? 87.761  60.867  -45.295  1.00 27.38  ? 133 VAL A N     1 
ATOM   154   C  CA    . VAL A  1 27  ? 88.567  61.729  -46.163  1.00 27.52  ? 133 VAL A CA    1 
ATOM   155   C  C     . VAL A  1 27  ? 90.040  61.547  -45.865  1.00 27.93  ? 133 VAL A C     1 
ATOM   156   O  O     . VAL A  1 27  ? 90.873  61.507  -46.749  1.00 28.13  ? 133 VAL A O     1 
ATOM   157   C  CB    . VAL A  1 27  ? 88.208  63.215  -45.969  1.00 27.91  ? 133 VAL A CB    1 
ATOM   158   C  CG1   . VAL A  1 27  ? 89.126  64.119  -46.766  1.00 28.13  ? 133 VAL A CG1   1 
ATOM   159   C  CG2   . VAL A  1 27  ? 86.790  63.481  -46.391  1.00 28.17  ? 133 VAL A CG2   1 
ATOM   160   N  N     . ARG A  1 28  ? 90.342  61.436  -44.595  1.00 29.69  ? 134 ARG A N     1 
ATOM   161   C  CA    . ARG A  1 28  ? 91.702  61.297  -44.120  1.00 31.56  ? 134 ARG A CA    1 
ATOM   162   C  C     . ARG A  1 28  ? 92.316  59.956  -44.537  1.00 30.44  ? 134 ARG A C     1 
ATOM   163   O  O     . ARG A  1 28  ? 93.498  59.882  -44.850  1.00 30.30  ? 134 ARG A O     1 
ATOM   164   C  CB    . ARG A  1 28  ? 91.675  61.450  -42.607  1.00 34.39  ? 134 ARG A CB    1 
ATOM   165   C  CG    . ARG A  1 28  ? 92.995  61.817  -42.004  1.00 37.82  ? 134 ARG A CG    1 
ATOM   166   C  CD    . ARG A  1 28  ? 93.426  63.243  -42.286  1.00 41.26  ? 134 ARG A CD    1 
ATOM   167   N  NE    . ARG A  1 28  ? 94.044  63.792  -41.087  1.00 45.11  ? 134 ARG A NE    1 
ATOM   168   C  CZ    . ARG A  1 28  ? 95.191  63.359  -40.563  1.00 47.40  ? 134 ARG A CZ    1 
ATOM   169   N  NH1   . ARG A  1 28  ? 95.897  62.350  -41.068  1.00 46.88  ? 134 ARG A NH1   1 
ATOM   170   N  NH2   . ARG A  1 28  ? 95.653  63.942  -39.449  1.00 49.71  ? 134 ARG A NH2   1 
ATOM   171   N  N     . ILE A  1 29  ? 91.494  58.911  -44.530  1.00 29.57  ? 135 ILE A N     1 
ATOM   172   C  CA    . ILE A  1 29  ? 91.872  57.585  -45.017  1.00 28.75  ? 135 ILE A CA    1 
ATOM   173   C  C     . ILE A  1 29  ? 92.015  57.578  -46.540  1.00 29.08  ? 135 ILE A C     1 
ATOM   174   O  O     . ILE A  1 29  ? 92.942  56.984  -47.079  1.00 28.68  ? 135 ILE A O     1 
ATOM   175   C  CB    . ILE A  1 29  ? 90.845  56.518  -44.581  1.00 27.55  ? 135 ILE A CB    1 
ATOM   176   C  CG1   . ILE A  1 29  ? 90.946  56.296  -43.078  1.00 27.45  ? 135 ILE A CG1   1 
ATOM   177   C  CG2   . ILE A  1 29  ? 91.074  55.186  -45.286  1.00 26.90  ? 135 ILE A CG2   1 
ATOM   178   C  CD1   . ILE A  1 29  ? 89.771  55.548  -42.455  1.00 27.54  ? 135 ILE A CD1   1 
ATOM   179   N  N     . ILE A  1 30  ? 91.075  58.213  -47.222  1.00 29.93  ? 136 ILE A N     1 
ATOM   180   C  CA    . ILE A  1 30  ? 91.093  58.308  -48.685  1.00 30.84  ? 136 ILE A CA    1 
ATOM   181   C  C     . ILE A  1 30  ? 92.343  58.985  -49.220  1.00 31.78  ? 136 ILE A C     1 
ATOM   182   O  O     . ILE A  1 30  ? 92.937  58.508  -50.179  1.00 33.98  ? 136 ILE A O     1 
ATOM   183   C  CB    . ILE A  1 30  ? 89.844  59.067  -49.195  1.00 30.97  ? 136 ILE A CB    1 
ATOM   184   C  CG1   . ILE A  1 30  ? 88.643  58.129  -49.156  1.00 31.13  ? 136 ILE A CG1   1 
ATOM   185   C  CG2   . ILE A  1 30  ? 90.024  59.618  -50.609  1.00 31.48  ? 136 ILE A CG2   1 
ATOM   186   C  CD1   . ILE A  1 30  ? 87.336  58.868  -49.139  1.00 31.56  ? 136 ILE A CD1   1 
ATOM   187   N  N     . ASN A  1 31  ? 92.732  60.097  -48.605  1.00 31.11  ? 137 ASN A N     1 
ATOM   188   C  CA    . ASN A  1 31  ? 93.876  60.885  -49.059  1.00 30.88  ? 137 ASN A CA    1 
ATOM   189   C  C     . ASN A  1 31  ? 95.220  60.340  -48.553  1.00 31.60  ? 137 ASN A C     1 
ATOM   190   O  O     . ASN A  1 31  ? 95.967  61.014  -47.843  1.00 32.45  ? 137 ASN A O     1 
ATOM   191   C  CB    . ASN A  1 31  ? 93.661  62.352  -48.677  1.00 30.81  ? 137 ASN A CB    1 
ATOM   192   C  CG    . ASN A  1 31  ? 92.545  62.995  -49.477  1.00 30.07  ? 137 ASN A CG    1 
ATOM   193   O  OD1   . ASN A  1 31  ? 92.415  62.744  -50.665  1.00 29.43  ? 137 ASN A OD1   1 
ATOM   194   N  ND2   . ASN A  1 31  ? 91.763  63.845  -48.835  1.00 29.60  ? 137 ASN A ND2   1 
ATOM   195   N  N     . THR A  1 32  ? 95.517  59.112  -48.959  1.00 32.21  ? 138 THR A N     1 
ATOM   196   C  CA    . THR A  1 32  ? 96.750  58.425  -48.622  1.00 32.81  ? 138 THR A CA    1 
ATOM   197   C  C     . THR A  1 32  ? 97.238  57.661  -49.854  1.00 33.13  ? 138 THR A C     1 
ATOM   198   O  O     . THR A  1 32  ? 96.425  57.250  -50.674  1.00 33.20  ? 138 THR A O     1 
ATOM   199   C  CB    . THR A  1 32  ? 96.538  57.405  -47.491  1.00 33.25  ? 138 THR A CB    1 
ATOM   200   O  OG1   . THR A  1 32  ? 95.681  56.351  -47.937  1.00 33.54  ? 138 THR A OG1   1 
ATOM   201   C  CG2   . THR A  1 32  ? 95.925  58.065  -46.274  1.00 34.12  ? 138 THR A CG2   1 
ATOM   202   N  N     . PRO A  1 33  ? 98.556  57.429  -49.980  1.00 33.46  ? 139 PRO A N     1 
ATOM   203   C  CA    . PRO A  1 33  ? 99.061  56.651  -51.106  1.00 33.02  ? 139 PRO A CA    1 
ATOM   204   C  C     . PRO A  1 33  ? 98.485  55.258  -51.243  1.00 31.40  ? 139 PRO A C     1 
ATOM   205   O  O     . PRO A  1 33  ? 98.355  54.770  -52.356  1.00 32.04  ? 139 PRO A O     1 
ATOM   206   C  CB    . PRO A  1 33  ? 100.554 56.553  -50.805  1.00 34.86  ? 139 PRO A CB    1 
ATOM   207   C  CG    . PRO A  1 33  ? 100.849 57.809  -50.068  1.00 35.99  ? 139 PRO A CG    1 
ATOM   208   C  CD    . PRO A  1 33  ? 99.663  57.944  -49.157  1.00 35.12  ? 139 PRO A CD    1 
ATOM   209   N  N     . GLN A  1 34  ? 98.125  54.641  -50.127  1.00 30.42  ? 140 GLN A N     1 
ATOM   210   C  CA    . GLN A  1 34  ? 97.667  53.252  -50.118  1.00 30.40  ? 140 GLN A CA    1 
ATOM   211   C  C     . GLN A  1 34  ? 96.277  53.120  -50.746  1.00 29.39  ? 140 GLN A C     1 
ATOM   212   O  O     . GLN A  1 34  ? 95.967  52.091  -51.417  1.00 30.50  ? 140 GLN A O     1 
ATOM   213   C  CB    . GLN A  1 34  ? 97.670  52.696  -48.695  1.00 31.51  ? 140 GLN A CB    1 
ATOM   214   C  CG    . GLN A  1 34  ? 99.065  52.462  -48.102  1.00 32.68  ? 140 GLN A CG    1 
ATOM   215   C  CD    . GLN A  1 34  ? 99.835  53.745  -47.801  1.00 33.77  ? 140 GLN A CD    1 
ATOM   216   O  OE1   . GLN A  1 34  ? 99.254  54.810  -47.508  1.00 34.85  ? 140 GLN A OE1   1 
ATOM   217   N  NE2   . GLN A  1 34  ? 101.157 53.648  -47.893  1.00 34.85  ? 140 GLN A NE2   1 
ATOM   218   N  N     . PHE A  1 35  ? 95.466  54.157  -50.537  1.00 28.31  ? 141 PHE A N     1 
ATOM   219   C  CA    . PHE A  1 35  ? 94.120  54.241  -51.092  1.00 27.83  ? 141 PHE A CA    1 
ATOM   220   C  C     . PHE A  1 35  ? 94.122  54.821  -52.493  1.00 27.16  ? 141 PHE A C     1 
ATOM   221   O  O     . PHE A  1 35  ? 93.504  54.248  -53.385  1.00 26.94  ? 141 PHE A O     1 
ATOM   222   C  CB    . PHE A  1 35  ? 93.191  55.082  -50.203  1.00 28.01  ? 141 PHE A CB    1 
ATOM   223   C  CG    . PHE A  1 35  ? 91.738  54.926  -50.541  1.00 27.35  ? 141 PHE A CG    1 
ATOM   224   C  CD1   . PHE A  1 35  ? 91.160  55.677  -51.551  1.00 27.15  ? 141 PHE A CD1   1 
ATOM   225   C  CD2   . PHE A  1 35  ? 90.954  53.980  -49.884  1.00 27.09  ? 141 PHE A CD2   1 
ATOM   226   C  CE1   . PHE A  1 35  ? 89.822  55.512  -51.887  1.00 26.91  ? 141 PHE A CE1   1 
ATOM   227   C  CE2   . PHE A  1 35  ? 89.609  53.816  -50.210  1.00 26.68  ? 141 PHE A CE2   1 
ATOM   228   C  CZ    . PHE A  1 35  ? 89.047  54.584  -51.213  1.00 26.56  ? 141 PHE A CZ    1 
ATOM   229   N  N     . GLN A  1 36  ? 94.806  55.946  -52.698  1.00 27.49  ? 142 GLN A N     1 
ATOM   230   C  CA    . GLN A  1 36  ? 94.817  56.608  -54.020  1.00 28.22  ? 142 GLN A CA    1 
ATOM   231   C  C     . GLN A  1 36  ? 95.420  55.698  -55.085  1.00 26.89  ? 142 GLN A C     1 
ATOM   232   O  O     . GLN A  1 36  ? 95.112  55.838  -56.264  1.00 25.77  ? 142 GLN A O     1 
ATOM   233   C  CB    . GLN A  1 36  ? 95.561  57.936  -53.983  1.00 30.16  ? 142 GLN A CB    1 
ATOM   234   C  CG    . GLN A  1 36  ? 94.928  58.969  -53.058  1.00 31.78  ? 142 GLN A CG    1 
ATOM   235   C  CD    . GLN A  1 36  ? 93.824  59.795  -53.686  1.00 32.28  ? 142 GLN A CD    1 
ATOM   236   O  OE1   . GLN A  1 36  ? 93.930  60.198  -54.865  1.00 33.74  ? 142 GLN A OE1   1 
ATOM   237   N  NE2   . GLN A  1 36  ? 92.801  60.124  -52.885  1.00 30.90  ? 142 GLN A NE2   1 
ATOM   238   N  N     . ARG A  1 37  ? 96.261  54.763  -54.656  1.00 26.33  ? 143 ARG A N     1 
ATOM   239   C  CA    . ARG A  1 37  ? 96.724  53.648  -55.483  1.00 26.59  ? 143 ARG A CA    1 
ATOM   240   C  C     . ARG A  1 37  ? 95.622  53.031  -56.344  1.00 26.08  ? 143 ARG A C     1 
ATOM   241   O  O     . ARG A  1 37  ? 95.842  52.682  -57.501  1.00 26.95  ? 143 ARG A O     1 
ATOM   242   C  CB    . ARG A  1 37  ? 97.337  52.587  -54.578  1.00 26.66  ? 143 ARG A CB    1 
ATOM   243   C  CG    . ARG A  1 37  ? 97.444  51.216  -55.180  1.00 27.40  ? 143 ARG A CG    1 
ATOM   244   C  CD    . ARG A  1 37  ? 98.211  50.309  -54.272  1.00 28.25  ? 143 ARG A CD    1 
ATOM   245   N  NE    . ARG A  1 37  ? 98.372  49.023  -54.931  1.00 28.71  ? 143 ARG A NE    1 
ATOM   246   C  CZ    . ARG A  1 37  ? 97.500  48.024  -54.839  1.00 29.33  ? 143 ARG A CZ    1 
ATOM   247   N  NH1   . ARG A  1 37  ? 96.384  48.150  -54.087  1.00 29.62  ? 143 ARG A NH1   1 
ATOM   248   N  NH2   . ARG A  1 37  ? 97.760  46.880  -55.485  1.00 29.39  ? 143 ARG A NH2   1 
ATOM   249   N  N     . LEU A  1 38  ? 94.442  52.893  -55.774  1.00 25.54  ? 144 LEU A N     1 
ATOM   250   C  CA    . LEU A  1 38  ? 93.326  52.281  -56.472  1.00 25.61  ? 144 LEU A CA    1 
ATOM   251   C  C     . LEU A  1 38  ? 92.856  53.058  -57.691  1.00 24.96  ? 144 LEU A C     1 
ATOM   252   O  O     . LEU A  1 38  ? 92.121  52.514  -58.502  1.00 25.40  ? 144 LEU A O     1 
ATOM   253   C  CB    . LEU A  1 38  ? 92.147  52.064  -55.514  1.00 26.57  ? 144 LEU A CB    1 
ATOM   254   C  CG    . LEU A  1 38  ? 92.394  51.136  -54.316  1.00 27.39  ? 144 LEU A CG    1 
ATOM   255   C  CD1   . LEU A  1 38  ? 91.127  51.055  -53.466  1.00 27.83  ? 144 LEU A CD1   1 
ATOM   256   C  CD2   . LEU A  1 38  ? 92.809  49.740  -54.753  1.00 27.48  ? 144 LEU A CD2   1 
ATOM   257   N  N     . ARG A  1 39  ? 93.257  54.321  -57.836  1.00 24.61  ? 145 ARG A N     1 
ATOM   258   C  CA    . ARG A  1 39  ? 92.999  55.063  -59.078  1.00 24.78  ? 145 ARG A CA    1 
ATOM   259   C  C     . ARG A  1 39  ? 93.677  54.461  -60.290  1.00 24.32  ? 145 ARG A C     1 
ATOM   260   O  O     . ARG A  1 39  ? 93.280  54.760  -61.415  1.00 25.03  ? 145 ARG A O     1 
ATOM   261   C  CB    . ARG A  1 39  ? 93.452  56.510  -58.963  1.00 25.66  ? 145 ARG A CB    1 
ATOM   262   C  CG    . ARG A  1 39  ? 92.529  57.399  -58.163  1.00 26.21  ? 145 ARG A CG    1 
ATOM   263   C  CD    . ARG A  1 39  ? 93.121  58.787  -58.022  1.00 27.03  ? 145 ARG A CD    1 
ATOM   264   N  NE    . ARG A  1 39  ? 92.305  59.683  -57.204  1.00 27.79  ? 145 ARG A NE    1 
ATOM   265   C  CZ    . ARG A  1 39  ? 91.262  60.383  -57.645  1.00 27.97  ? 145 ARG A CZ    1 
ATOM   266   N  NH1   . ARG A  1 39  ? 90.850  60.277  -58.923  1.00 27.61  ? 145 ARG A NH1   1 
ATOM   267   N  NH2   . ARG A  1 39  ? 90.620  61.197  -56.797  1.00 28.21  ? 145 ARG A NH2   1 
ATOM   268   N  N     . TYR A  1 40  ? 94.711  53.648  -60.063  1.00 23.28  ? 146 TYR A N     1 
ATOM   269   C  CA    . TYR A  1 40  ? 95.531  53.116  -61.133  1.00 22.32  ? 146 TYR A CA    1 
ATOM   270   C  C     . TYR A  1 40  ? 95.372  51.603  -61.282  1.00 22.47  ? 146 TYR A C     1 
ATOM   271   O  O     . TYR A  1 40  ? 96.249  50.934  -61.795  1.00 23.09  ? 146 TYR A O     1 
ATOM   272   C  CB    . TYR A  1 40  ? 96.984  53.540  -60.886  1.00 21.51  ? 146 TYR A CB    1 
ATOM   273   C  CG    . TYR A  1 40  ? 97.098  54.980  -60.396  1.00 21.06  ? 146 TYR A CG    1 
ATOM   274   C  CD1   . TYR A  1 40  ? 96.845  56.065  -61.240  1.00 20.80  ? 146 TYR A CD1   1 
ATOM   275   C  CD2   . TYR A  1 40  ? 97.421  55.257  -59.078  1.00 21.06  ? 146 TYR A CD2   1 
ATOM   276   C  CE1   . TYR A  1 40  ? 96.933  57.384  -60.785  1.00 20.89  ? 146 TYR A CE1   1 
ATOM   277   C  CE2   . TYR A  1 40  ? 97.511  56.571  -58.611  1.00 21.23  ? 146 TYR A CE2   1 
ATOM   278   C  CZ    . TYR A  1 40  ? 97.268  57.643  -59.463  1.00 21.24  ? 146 TYR A CZ    1 
ATOM   279   O  OH    . TYR A  1 40  ? 97.343  58.932  -58.912  1.00 21.72  ? 146 TYR A OH    1 
ATOM   280   N  N     . ILE A  1 41  ? 94.229  51.075  -60.870  1.00 22.73  ? 147 ILE A N     1 
ATOM   281   C  CA    . ILE A  1 41  ? 93.903  49.669  -61.072  1.00 23.57  ? 147 ILE A CA    1 
ATOM   282   C  C     . ILE A  1 41  ? 92.493  49.557  -61.670  1.00 24.47  ? 147 ILE A C     1 
ATOM   283   O  O     . ILE A  1 41  ? 91.523  49.953  -61.035  1.00 23.97  ? 147 ILE A O     1 
ATOM   284   C  CB    . ILE A  1 41  ? 93.966  48.919  -59.735  1.00 23.68  ? 147 ILE A CB    1 
ATOM   285   C  CG1   . ILE A  1 41  ? 95.406  48.927  -59.213  1.00 24.65  ? 147 ILE A CG1   1 
ATOM   286   C  CG2   . ILE A  1 41  ? 93.467  47.488  -59.886  1.00 23.34  ? 147 ILE A CG2   1 
ATOM   287   C  CD1   . ILE A  1 41  ? 95.606  48.315  -57.841  1.00 25.10  ? 147 ILE A CD1   1 
ATOM   288   N  N     . LYS A  1 42  ? 92.372  48.995  -62.869  1.00 26.01  ? 148 LYS A N     1 
ATOM   289   C  CA    . LYS A  1 42  ? 91.075  48.904  -63.527  1.00 26.48  ? 148 LYS A CA    1 
ATOM   290   C  C     . LYS A  1 42  ? 90.218  47.838  -62.885  1.00 25.47  ? 148 LYS A C     1 
ATOM   291   O  O     . LYS A  1 42  ? 90.720  46.821  -62.433  1.00 23.62  ? 148 LYS A O     1 
ATOM   292   C  CB    . LYS A  1 42  ? 91.239  48.653  -65.019  1.00 28.61  ? 148 LYS A CB    1 
ATOM   293   C  CG    . LYS A  1 42  ? 91.809  49.878  -65.689  1.00 31.11  ? 148 LYS A CG    1 
ATOM   294   C  CD    . LYS A  1 42  ? 91.822  49.750  -67.195  1.00 34.07  ? 148 LYS A CD    1 
ATOM   295   C  CE    . LYS A  1 42  ? 92.966  50.615  -67.716  1.00 37.75  ? 148 LYS A CE    1 
ATOM   296   N  NZ    . LYS A  1 42  ? 94.405  50.406  -67.420  1.00 39.38  ? 148 LYS A NZ    1 
ATOM   297   N  N     . GLN A  1 43  ? 88.919  48.102  -62.835  1.00 25.42  ? 149 GLN A N     1 
ATOM   298   C  CA    . GLN A  1 43  ? 87.978  47.227  -62.167  1.00 25.01  ? 149 GLN A CA    1 
ATOM   299   C  C     . GLN A  1 43  ? 87.921  45.897  -62.883  1.00 24.49  ? 149 GLN A C     1 
ATOM   300   O  O     . GLN A  1 43  ? 87.993  44.835  -62.249  1.00 23.55  ? 149 GLN A O     1 
ATOM   301   C  CB    . GLN A  1 43  ? 86.593  47.866  -62.178  1.00 25.46  ? 149 GLN A CB    1 
ATOM   302   C  CG    . GLN A  1 43  ? 85.475  47.080  -61.469  1.00 25.78  ? 149 GLN A CG    1 
ATOM   303   C  CD    . GLN A  1 43  ? 85.494  47.285  -59.986  1.00 25.69  ? 149 GLN A CD    1 
ATOM   304   O  OE1   . GLN A  1 43  ? 86.548  47.573  -59.452  1.00 25.48  ? 149 GLN A OE1   1 
ATOM   305   N  NE2   . GLN A  1 43  ? 84.343  47.176  -59.325  1.00 24.90  ? 149 GLN A NE2   1 
ATOM   306   N  N     . LEU A  1 44  ? 87.784  45.977  -64.212  1.00 24.29  ? 150 LEU A N     1 
ATOM   307   C  CA    . LEU A  1 44  ? 87.568  44.782  -65.022  1.00 23.27  ? 150 LEU A CA    1 
ATOM   308   C  C     . LEU A  1 44  ? 88.793  44.369  -65.807  1.00 23.56  ? 150 LEU A C     1 
ATOM   309   O  O     . LEU A  1 44  ? 88.678  43.693  -66.822  1.00 24.66  ? 150 LEU A O     1 
ATOM   310   C  CB    . LEU A  1 44  ? 86.375  45.013  -65.956  1.00 22.51  ? 150 LEU A CB    1 
ATOM   311   C  CG    . LEU A  1 44  ? 85.088  45.488  -65.266  1.00 21.97  ? 150 LEU A CG    1 
ATOM   312   C  CD1   . LEU A  1 44  ? 83.979  45.609  -66.292  1.00 22.00  ? 150 LEU A CD1   1 
ATOM   313   C  CD2   . LEU A  1 44  ? 84.664  44.579  -64.124  1.00 21.41  ? 150 LEU A CD2   1 
ATOM   314   N  N     . GLY A  1 45  ? 89.970  44.745  -65.316  1.00 23.30  ? 151 GLY A N     1 
ATOM   315   C  CA    . GLY A  1 45  ? 91.240  44.346  -65.917  1.00 22.48  ? 151 GLY A CA    1 
ATOM   316   C  C     . GLY A  1 45  ? 91.265  44.434  -67.431  1.00 21.66  ? 151 GLY A C     1 
ATOM   317   O  O     . GLY A  1 45  ? 91.078  45.509  -68.022  1.00 21.38  ? 151 GLY A O     1 
ATOM   318   N  N     . GLY A  1 46  ? 91.466  43.267  -68.039  1.00 20.90  ? 152 GLY A N     1 
ATOM   319   C  CA    . GLY A  1 46  ? 91.525  43.114  -69.496  1.00 20.68  ? 152 GLY A CA    1 
ATOM   320   C  C     . GLY A  1 46  ? 90.226  43.324  -70.226  1.00 20.52  ? 152 GLY A C     1 
ATOM   321   O  O     . GLY A  1 46  ? 90.226  43.472  -71.452  1.00 21.03  ? 152 GLY A O     1 
ATOM   322   N  N     . GLY A  1 47  ? 89.109  43.346  -69.502  1.00 20.28  ? 153 GLY A N     1 
ATOM   323   C  CA    . GLY A  1 47  ? 87.808  43.693  -70.069  1.00 20.21  ? 153 GLY A CA    1 
ATOM   324   C  C     . GLY A  1 47  ? 87.768  45.019  -70.808  1.00 20.22  ? 153 GLY A C     1 
ATOM   325   O  O     . GLY A  1 47  ? 87.008  45.163  -71.770  1.00 20.22  ? 153 GLY A O     1 
ATOM   326   N  N     . TYR A  1 48  ? 88.581  45.982  -70.386  1.00 20.27  ? 154 TYR A N     1 
ATOM   327   C  CA    . TYR A  1 48  ? 88.707  47.256  -71.112  1.00 20.44  ? 154 TYR A CA    1 
ATOM   328   C  C     . TYR A  1 48  ? 89.069  47.033  -72.582  1.00 20.41  ? 154 TYR A C     1 
ATOM   329   O  O     . TYR A  1 48  ? 88.590  47.761  -73.456  1.00 21.06  ? 154 TYR A O     1 
ATOM   330   C  CB    . TYR A  1 48  ? 89.741  48.167  -70.445  1.00 20.71  ? 154 TYR A CB    1 
ATOM   331   C  CG    . TYR A  1 48  ? 89.949  49.551  -71.053  1.00 20.82  ? 154 TYR A CG    1 
ATOM   332   C  CD1   . TYR A  1 48  ? 88.888  50.316  -71.496  1.00 21.09  ? 154 TYR A CD1   1 
ATOM   333   C  CD2   . TYR A  1 48  ? 91.222  50.124  -71.109  1.00 21.44  ? 154 TYR A CD2   1 
ATOM   334   C  CE1   . TYR A  1 48  ? 89.089  51.588  -72.035  1.00 21.66  ? 154 TYR A CE1   1 
ATOM   335   C  CE2   . TYR A  1 48  ? 91.442  51.380  -71.682  1.00 21.71  ? 154 TYR A CE2   1 
ATOM   336   C  CZ    . TYR A  1 48  ? 90.377  52.114  -72.136  1.00 21.82  ? 154 TYR A CZ    1 
ATOM   337   O  OH    . TYR A  1 48  ? 90.556  53.367  -72.688  1.00 22.14  ? 154 TYR A OH    1 
ATOM   338   N  N     . TYR A  1 49  ? 89.872  45.999  -72.850  1.00 19.95  ? 155 TYR A N     1 
ATOM   339   C  CA    . TYR A  1 49  ? 90.297  45.666  -74.218  1.00 19.68  ? 155 TYR A CA    1 
ATOM   340   C  C     . TYR A  1 49  ? 89.213  44.949  -75.048  1.00 19.11  ? 155 TYR A C     1 
ATOM   341   O  O     . TYR A  1 49  ? 89.439  44.618  -76.215  1.00 19.76  ? 155 TYR A O     1 
ATOM   342   C  CB    . TYR A  1 49  ? 91.645  44.903  -74.184  1.00 19.75  ? 155 TYR A CB    1 
ATOM   343   C  CG    . TYR A  1 49  ? 92.784  45.740  -73.592  1.00 20.19  ? 155 TYR A CG    1 
ATOM   344   C  CD1   . TYR A  1 49  ? 93.003  45.822  -72.214  1.00 20.28  ? 155 TYR A CD1   1 
ATOM   345   C  CD2   . TYR A  1 49  ? 93.623  46.490  -74.426  1.00 20.44  ? 155 TYR A CD2   1 
ATOM   346   C  CE1   . TYR A  1 49  ? 94.023  46.625  -71.688  1.00 20.48  ? 155 TYR A CE1   1 
ATOM   347   C  CE2   . TYR A  1 49  ? 94.649  47.293  -73.903  1.00 20.61  ? 155 TYR A CE2   1 
ATOM   348   C  CZ    . TYR A  1 49  ? 94.840  47.363  -72.535  1.00 20.56  ? 155 TYR A CZ    1 
ATOM   349   O  OH    . TYR A  1 49  ? 95.842  48.157  -72.015  1.00 20.63  ? 155 TYR A OH    1 
ATOM   350   N  N     . VAL A  1 50  ? 88.044  44.725  -74.449  1.00 18.25  ? 156 VAL A N     1 
ATOM   351   C  CA    . VAL A  1 50  ? 86.845  44.258  -75.160  1.00 17.88  ? 156 VAL A CA    1 
ATOM   352   C  C     . VAL A  1 50  ? 85.666  45.235  -75.067  1.00 17.72  ? 156 VAL A C     1 
ATOM   353   O  O     . VAL A  1 50  ? 84.953  45.443  -76.045  1.00 16.93  ? 156 VAL A O     1 
ATOM   354   C  CB    . VAL A  1 50  ? 86.395  42.897  -74.594  1.00 17.53  ? 156 VAL A CB    1 
ATOM   355   C  CG1   . VAL A  1 50  ? 85.099  42.411  -75.249  1.00 17.14  ? 156 VAL A CG1   1 
ATOM   356   C  CG2   . VAL A  1 50  ? 87.492  41.863  -74.797  1.00 17.68  ? 156 VAL A CG2   1 
ATOM   357   N  N     . PHE A  1 51  ? 85.425  45.772  -73.879  1.00 18.36  ? 157 PHE A N     1 
ATOM   358   C  CA    . PHE A  1 51  ? 84.397  46.797  -73.665  1.00 19.39  ? 157 PHE A CA    1 
ATOM   359   C  C     . PHE A  1 51  ? 85.085  48.133  -73.472  1.00 21.11  ? 157 PHE A C     1 
ATOM   360   O  O     . PHE A  1 51  ? 85.557  48.435  -72.378  1.00 21.15  ? 157 PHE A O     1 
ATOM   361   C  CB    . PHE A  1 51  ? 83.599  46.471  -72.422  1.00 18.90  ? 157 PHE A CB    1 
ATOM   362   C  CG    . PHE A  1 51  ? 82.732  45.271  -72.563  1.00 18.75  ? 157 PHE A CG    1 
ATOM   363   C  CD1   . PHE A  1 51  ? 83.230  44.007  -72.346  1.00 18.74  ? 157 PHE A CD1   1 
ATOM   364   C  CD2   . PHE A  1 51  ? 81.404  45.408  -72.904  1.00 18.84  ? 157 PHE A CD2   1 
ATOM   365   C  CE1   . PHE A  1 51  ? 82.426  42.894  -72.468  1.00 18.84  ? 157 PHE A CE1   1 
ATOM   366   C  CE2   . PHE A  1 51  ? 80.584  44.312  -73.051  1.00 18.81  ? 157 PHE A CE2   1 
ATOM   367   C  CZ    . PHE A  1 51  ? 81.094  43.042  -72.821  1.00 18.93  ? 157 PHE A CZ    1 
ATOM   368   N  N     . PRO A  1 52  ? 85.167  48.950  -74.535  1.00 22.96  ? 158 PRO A N     1 
ATOM   369   C  CA    . PRO A  1 52  ? 85.948  50.173  -74.408  1.00 23.68  ? 158 PRO A CA    1 
ATOM   370   C  C     . PRO A  1 52  ? 85.364  51.177  -73.407  1.00 24.29  ? 158 PRO A C     1 
ATOM   371   O  O     . PRO A  1 52  ? 86.034  52.144  -73.055  1.00 24.58  ? 158 PRO A O     1 
ATOM   372   C  CB    . PRO A  1 52  ? 85.956  50.725  -75.828  1.00 23.87  ? 158 PRO A CB    1 
ATOM   373   C  CG    . PRO A  1 52  ? 84.679  50.238  -76.401  1.00 23.64  ? 158 PRO A CG    1 
ATOM   374   C  CD    . PRO A  1 52  ? 84.534  48.858  -75.854  1.00 23.21  ? 158 PRO A CD    1 
ATOM   375   N  N     . GLY A  1 53  ? 84.130  50.957  -72.947  1.00 25.22  ? 159 GLY A N     1 
ATOM   376   C  CA    . GLY A  1 53  ? 83.608  51.788  -71.860  1.00 26.60  ? 159 GLY A CA    1 
ATOM   377   C  C     . GLY A  1 53  ? 84.244  51.576  -70.485  1.00 27.01  ? 159 GLY A C     1 
ATOM   378   O  O     . GLY A  1 53  ? 84.265  52.506  -69.671  1.00 28.57  ? 159 GLY A O     1 
ATOM   379   N  N     . ALA A  1 54  ? 84.798  50.381  -70.266  1.00 26.33  ? 160 ALA A N     1 
ATOM   380   C  CA    . ALA A  1 54  ? 85.228  49.877  -68.953  1.00 25.94  ? 160 ALA A CA    1 
ATOM   381   C  C     . ALA A  1 54  ? 86.609  50.370  -68.471  1.00 25.82  ? 160 ALA A C     1 
ATOM   382   O  O     . ALA A  1 54  ? 87.444  49.603  -67.947  1.00 25.50  ? 160 ALA A O     1 
ATOM   383   C  CB    . ALA A  1 54  ? 85.184  48.357  -68.956  1.00 26.07  ? 160 ALA A CB    1 
ATOM   384   N  N     . SER A  1 55  ? 86.776  51.684  -68.594  1.00 26.22  ? 161 SER A N     1 
ATOM   385   C  CA    . SER A  1 55  ? 87.933  52.448  -68.126  1.00 26.91  ? 161 SER A CA    1 
ATOM   386   C  C     . SER A  1 55  ? 87.950  52.619  -66.602  1.00 26.09  ? 161 SER A C     1 
ATOM   387   O  O     . SER A  1 55  ? 88.978  53.014  -66.047  1.00 26.27  ? 161 SER A O     1 
ATOM   388   C  CB    . SER A  1 55  ? 87.882  53.863  -68.741  1.00 27.88  ? 161 SER A CB    1 
ATOM   389   O  OG    . SER A  1 55  ? 86.673  54.568  -68.381  1.00 28.26  ? 161 SER A OG    1 
ATOM   390   N  N     . HIS A  1 56  ? 86.807  52.388  -65.962  1.00 24.93  ? 162 HIS A N     1 
ATOM   391   C  CA    . HIS A  1 56  ? 86.649  52.595  -64.525  1.00 24.57  ? 162 HIS A CA    1 
ATOM   392   C  C     . HIS A  1 56  ? 87.595  51.765  -63.660  1.00 23.86  ? 162 HIS A C     1 
ATOM   393   O  O     . HIS A  1 56  ? 87.911  50.609  -63.995  1.00 23.79  ? 162 HIS A O     1 
ATOM   394   C  CB    . HIS A  1 56  ? 85.184  52.423  -64.066  1.00 24.61  ? 162 HIS A CB    1 
ATOM   395   C  CG    . HIS A  1 56  ? 84.643  51.027  -64.172  1.00 24.30  ? 162 HIS A CG    1 
ATOM   396   N  ND1   . HIS A  1 56  ? 84.631  50.313  -65.350  1.00 24.52  ? 162 HIS A ND1   1 
ATOM   397   C  CD2   . HIS A  1 56  ? 84.037  50.244  -63.245  1.00 24.10  ? 162 HIS A CD2   1 
ATOM   398   C  CE1   . HIS A  1 56  ? 84.069  49.133  -65.130  1.00 24.36  ? 162 HIS A CE1   1 
ATOM   399   N  NE2   . HIS A  1 56  ? 83.688  49.073  -63.862  1.00 24.08  ? 162 HIS A NE2   1 
ATOM   400   N  N     . ASN A  1 57  ? 88.029  52.405  -62.573  1.00 22.90  ? 163 ASN A N     1 
ATOM   401   C  CA    . ASN A  1 57  ? 89.032  51.910  -61.648  1.00 22.52  ? 163 ASN A CA    1 
ATOM   402   C  C     . ASN A  1 57  ? 88.463  51.592  -60.263  1.00 22.17  ? 163 ASN A C     1 
ATOM   403   O  O     . ASN A  1 57  ? 87.356  51.999  -59.935  1.00 22.20  ? 163 ASN A O     1 
ATOM   404   C  CB    . ASN A  1 57  ? 90.116  52.967  -61.475  1.00 22.95  ? 163 ASN A CB    1 
ATOM   405   C  CG    . ASN A  1 57  ? 90.792  53.322  -62.771  1.00 22.95  ? 163 ASN A CG    1 
ATOM   406   O  OD1   . ASN A  1 57  ? 91.376  52.464  -63.448  1.00 23.00  ? 163 ASN A OD1   1 
ATOM   407   N  ND2   . ASN A  1 57  ? 90.730  54.605  -63.114  1.00 23.12  ? 163 ASN A ND2   1 
ATOM   408   N  N     . ARG A  1 58  ? 89.250  50.883  -59.451  1.00 21.81  ? 164 ARG A N     1 
ATOM   409   C  CA    . ARG A  1 58  ? 88.822  50.434  -58.118  1.00 21.55  ? 164 ARG A CA    1 
ATOM   410   C  C     . ARG A  1 58  ? 88.505  51.571  -57.160  1.00 21.43  ? 164 ARG A C     1 
ATOM   411   O  O     . ARG A  1 58  ? 87.573  51.481  -56.367  1.00 21.12  ? 164 ARG A O     1 
ATOM   412   C  CB    . ARG A  1 58  ? 89.882  49.554  -57.497  1.00 21.58  ? 164 ARG A CB    1 
ATOM   413   C  CG    . ARG A  1 58  ? 89.979  48.178  -58.132  1.00 21.92  ? 164 ARG A CG    1 
ATOM   414   C  CD    . ARG A  1 58  ? 88.964  47.230  -57.528  1.00 22.80  ? 164 ARG A CD    1 
ATOM   415   N  NE    . ARG A  1 58  ? 88.672  46.100  -58.390  1.00 23.71  ? 164 ARG A NE    1 
ATOM   416   C  CZ    . ARG A  1 58  ? 87.687  45.214  -58.202  1.00 25.48  ? 164 ARG A CZ    1 
ATOM   417   N  NH1   . ARG A  1 58  ? 87.566  44.273  -59.097  1.00 25.54  ? 164 ARG A NH1   1 
ATOM   418   N  NH2   . ARG A  1 58  ? 86.810  45.257  -57.163  1.00 26.56  ? 164 ARG A NH2   1 
ATOM   419   N  N     . PHE A  1 59  ? 89.278  52.638  -57.250  1.00 21.17  ? 165 PHE A N     1 
ATOM   420   C  CA    . PHE A  1 59  ? 89.044  53.844  -56.454  1.00 21.10  ? 165 PHE A CA    1 
ATOM   421   C  C     . PHE A  1 59  ? 87.550  54.160  -56.307  1.00 21.61  ? 165 PHE A C     1 
ATOM   422   O  O     . PHE A  1 59  ? 87.020  54.207  -55.185  1.00 22.27  ? 165 PHE A O     1 
ATOM   423   C  CB    . PHE A  1 59  ? 89.741  55.037  -57.102  1.00 20.43  ? 165 PHE A CB    1 
ATOM   424   C  CG    . PHE A  1 59  ? 89.629  56.312  -56.328  1.00 19.59  ? 165 PHE A CG    1 
ATOM   425   C  CD1   . PHE A  1 59  ? 90.395  56.515  -55.203  1.00 19.56  ? 165 PHE A CD1   1 
ATOM   426   C  CD2   . PHE A  1 59  ? 88.792  57.318  -56.737  1.00 19.21  ? 165 PHE A CD2   1 
ATOM   427   C  CE1   . PHE A  1 59  ? 90.338  57.699  -54.489  1.00 19.70  ? 165 PHE A CE1   1 
ATOM   428   C  CE2   . PHE A  1 59  ? 88.706  58.511  -56.039  1.00 19.28  ? 165 PHE A CE2   1 
ATOM   429   C  CZ    . PHE A  1 59  ? 89.485  58.698  -54.905  1.00 19.55  ? 165 PHE A CZ    1 
ATOM   430   N  N     . GLU A  1 60  ? 86.878  54.331  -57.443  1.00 21.60  ? 166 GLU A N     1 
ATOM   431   C  CA    . GLU A  1 60  ? 85.492  54.768  -57.419  1.00 21.89  ? 166 GLU A CA    1 
ATOM   432   C  C     . GLU A  1 60  ? 84.518  53.668  -56.988  1.00 20.04  ? 166 GLU A C     1 
ATOM   433   O  O     . GLU A  1 60  ? 83.513  53.971  -56.363  1.00 19.55  ? 166 GLU A O     1 
ATOM   434   C  CB    . GLU A  1 60  ? 85.071  55.436  -58.735  1.00 24.23  ? 166 GLU A CB    1 
ATOM   435   C  CG    . GLU A  1 60  ? 85.362  54.679  -60.027  1.00 26.02  ? 166 GLU A CG    1 
ATOM   436   C  CD    . GLU A  1 60  ? 86.627  55.167  -60.781  1.00 27.88  ? 166 GLU A CD    1 
ATOM   437   O  OE1   . GLU A  1 60  ? 87.722  55.285  -60.122  1.00 27.27  ? 166 GLU A OE1   1 
ATOM   438   O  OE2   . GLU A  1 60  ? 86.492  55.395  -62.046  1.00 30.07  ? 166 GLU A OE2   1 
ATOM   439   N  N     . HIS A  1 61  ? 84.817  52.410  -57.305  1.00 18.05  ? 167 HIS A N     1 
ATOM   440   C  CA    . HIS A  1 61  ? 84.091  51.262  -56.718  1.00 16.61  ? 167 HIS A CA    1 
ATOM   441   C  C     . HIS A  1 61  ? 84.197  51.311  -55.196  1.00 16.21  ? 167 HIS A C     1 
ATOM   442   O  O     . HIS A  1 61  ? 83.193  51.203  -54.486  1.00 15.73  ? 167 HIS A O     1 
ATOM   443   C  CB    . HIS A  1 61  ? 84.659  49.942  -57.283  1.00 16.02  ? 167 HIS A CB    1 
ATOM   444   C  CG    . HIS A  1 61  ? 84.229  48.716  -56.542  1.00 15.50  ? 167 HIS A CG    1 
ATOM   445   N  ND1   . HIS A  1 61  ? 82.919  48.306  -56.492  1.00 15.03  ? 167 HIS A ND1   1 
ATOM   446   C  CD2   . HIS A  1 61  ? 84.934  47.795  -55.846  1.00 15.32  ? 167 HIS A CD2   1 
ATOM   447   C  CE1   . HIS A  1 61  ? 82.835  47.187  -55.793  1.00 14.78  ? 167 HIS A CE1   1 
ATOM   448   N  NE2   . HIS A  1 61  ? 84.042  46.854  -55.391  1.00 14.94  ? 167 HIS A NE2   1 
ATOM   449   N  N     . SER A  1 62  ? 85.427  51.515  -54.715  1.00 16.11  ? 168 SER A N     1 
ATOM   450   C  CA    . SER A  1 62  ? 85.711  51.577  -53.296  1.00 15.90  ? 168 SER A CA    1 
ATOM   451   C  C     . SER A  1 62  ? 84.889  52.677  -52.616  1.00 15.42  ? 168 SER A C     1 
ATOM   452   O  O     . SER A  1 62  ? 84.257  52.416  -51.587  1.00 15.63  ? 168 SER A O     1 
ATOM   453   C  CB    . SER A  1 62  ? 87.228  51.670  -53.034  1.00 16.30  ? 168 SER A CB    1 
ATOM   454   O  OG    . SER A  1 62  ? 87.851  50.361  -52.930  1.00 16.61  ? 168 SER A OG    1 
ATOM   455   N  N     . LEU A  1 63  ? 84.826  53.871  -53.196  1.00 15.08  ? 169 LEU A N     1 
ATOM   456   C  CA    . LEU A  1 63  ? 83.957  54.937  -52.643  1.00 15.13  ? 169 LEU A CA    1 
ATOM   457   C  C     . LEU A  1 63  ? 82.487  54.504  -52.548  1.00 14.92  ? 169 LEU A C     1 
ATOM   458   O  O     . LEU A  1 63  ? 81.809  54.729  -51.544  1.00 15.05  ? 169 LEU A O     1 
ATOM   459   C  CB    . LEU A  1 63  ? 84.002  56.194  -53.485  1.00 15.31  ? 169 LEU A CB    1 
ATOM   460   C  CG    . LEU A  1 63  ? 85.333  56.935  -53.573  1.00 15.60  ? 169 LEU A CG    1 
ATOM   461   C  CD1   . LEU A  1 63  ? 85.190  58.106  -54.542  1.00 15.86  ? 169 LEU A CD1   1 
ATOM   462   C  CD2   . LEU A  1 63  ? 85.833  57.429  -52.237  1.00 15.68  ? 169 LEU A CD2   1 
ATOM   463   N  N     . GLY A  1 64  ? 82.003  53.882  -53.610  1.00 14.71  ? 170 GLY A N     1 
ATOM   464   C  CA    . GLY A  1 64  ? 80.615  53.461  -53.673  1.00 14.46  ? 170 GLY A CA    1 
ATOM   465   C  C     . GLY A  1 64  ? 80.245  52.377  -52.686  1.00 14.11  ? 170 GLY A C     1 
ATOM   466   O  O     . GLY A  1 64  ? 79.154  52.392  -52.127  1.00 13.81  ? 170 GLY A O     1 
ATOM   467   N  N     . VAL A  1 65  ? 81.157  51.439  -52.462  1.00 13.99  ? 171 VAL A N     1 
ATOM   468   C  CA    . VAL A  1 65  ? 80.898  50.381  -51.496  1.00 14.08  ? 171 VAL A CA    1 
ATOM   469   C  C     . VAL A  1 65  ? 80.857  50.980  -50.099  1.00 14.18  ? 171 VAL A C     1 
ATOM   470   O  O     . VAL A  1 65  ? 80.012  50.610  -49.283  1.00 13.73  ? 171 VAL A O     1 
ATOM   471   C  CB    . VAL A  1 65  ? 81.935  49.255  -51.615  1.00 14.10  ? 171 VAL A CB    1 
ATOM   472   C  CG1   . VAL A  1 65  ? 81.761  48.211  -50.516  1.00 14.21  ? 171 VAL A CG1   1 
ATOM   473   C  CG2   . VAL A  1 65  ? 81.774  48.570  -52.966  1.00 13.97  ? 171 VAL A CG2   1 
ATOM   474   N  N     . GLY A  1 66  ? 81.762  51.922  -49.849  1.00 14.53  ? 172 GLY A N     1 
ATOM   475   C  CA    . GLY A  1 66  ? 81.737  52.692  -48.618  1.00 14.84  ? 172 GLY A CA    1 
ATOM   476   C  C     . GLY A  1 66  ? 80.414  53.413  -48.444  1.00 14.89  ? 172 GLY A C     1 
ATOM   477   O  O     . GLY A  1 66  ? 79.827  53.400  -47.377  1.00 14.69  ? 172 GLY A O     1 
ATOM   478   N  N     . TYR A  1 67  ? 79.952  54.042  -49.518  1.00 15.34  ? 173 TYR A N     1 
ATOM   479   C  CA    . TYR A  1 67  ? 78.685  54.766  -49.490  1.00 15.93  ? 173 TYR A CA    1 
ATOM   480   C  C     . TYR A  1 67  ? 77.481  53.857  -49.175  1.00 16.32  ? 173 TYR A C     1 
ATOM   481   O  O     . TYR A  1 67  ? 76.661  54.180  -48.309  1.00 16.66  ? 173 TYR A O     1 
ATOM   482   C  CB    . TYR A  1 67  ? 78.452  55.504  -50.800  1.00 16.04  ? 173 TYR A CB    1 
ATOM   483   C  CG    . TYR A  1 67  ? 77.048  56.073  -50.933  1.00 16.17  ? 173 TYR A CG    1 
ATOM   484   C  CD1   . TYR A  1 67  ? 76.664  57.169  -50.177  1.00 16.55  ? 173 TYR A CD1   1 
ATOM   485   C  CD2   . TYR A  1 67  ? 76.097  55.504  -51.803  1.00 16.03  ? 173 TYR A CD2   1 
ATOM   486   C  CE1   . TYR A  1 67  ? 75.383  57.695  -50.269  1.00 16.68  ? 173 TYR A CE1   1 
ATOM   487   C  CE2   . TYR A  1 67  ? 74.836  56.021  -51.919  1.00 16.19  ? 173 TYR A CE2   1 
ATOM   488   C  CZ    . TYR A  1 67  ? 74.471  57.117  -51.150  1.00 16.54  ? 173 TYR A CZ    1 
ATOM   489   O  OH    . TYR A  1 67  ? 73.208  57.667  -51.231  1.00 17.00  ? 173 TYR A OH    1 
ATOM   490   N  N     . LEU A  1 68  ? 77.387  52.740  -49.886  1.00 16.74  ? 174 LEU A N     1 
ATOM   491   C  CA    . LEU A  1 68  ? 76.254  51.834  -49.718  1.00 17.07  ? 174 LEU A CA    1 
ATOM   492   C  C     . LEU A  1 68  ? 76.277  51.136  -48.384  1.00 17.22  ? 174 LEU A C     1 
ATOM   493   O  O     . LEU A  1 68  ? 75.232  50.874  -47.802  1.00 16.83  ? 174 LEU A O     1 
ATOM   494   C  CB    . LEU A  1 68  ? 76.221  50.782  -50.832  1.00 17.48  ? 174 LEU A CB    1 
ATOM   495   C  CG    . LEU A  1 68  ? 75.972  51.304  -52.256  1.00 17.77  ? 174 LEU A CG    1 
ATOM   496   C  CD1   . LEU A  1 68  ? 75.886  50.124  -53.210  1.00 17.78  ? 174 LEU A CD1   1 
ATOM   497   C  CD2   . LEU A  1 68  ? 74.712  52.132  -52.336  1.00 17.89  ? 174 LEU A CD2   1 
ATOM   498   N  N     . ALA A  1 69  ? 77.468  50.840  -47.893  1.00 17.95  ? 175 ALA A N     1 
ATOM   499   C  CA    . ALA A  1 69  ? 77.596  50.286  -46.553  1.00 18.45  ? 175 ALA A CA    1 
ATOM   500   C  C     . ALA A  1 69  ? 76.969  51.226  -45.528  1.00 19.11  ? 175 ALA A C     1 
ATOM   501   O  O     . ALA A  1 69  ? 76.224  50.783  -44.661  1.00 19.86  ? 175 ALA A O     1 
ATOM   502   C  CB    . ALA A  1 69  ? 79.055  50.048  -46.239  1.00 18.54  ? 175 ALA A CB    1 
ATOM   503   N  N     . GLY A  1 70  ? 77.253  52.520  -45.652  1.00 19.64  ? 176 GLY A N     1 
ATOM   504   C  CA    . GLY A  1 70  ? 76.618  53.545  -44.829  1.00 19.79  ? 176 GLY A CA    1 
ATOM   505   C  C     . GLY A  1 70  ? 75.100  53.558  -44.976  1.00 19.86  ? 176 GLY A C     1 
ATOM   506   O  O     . GLY A  1 70  ? 74.373  53.634  -43.992  1.00 18.74  ? 176 GLY A O     1 
ATOM   507   N  N     . CYS A  1 71  ? 74.620  53.477  -46.213  1.00 20.81  ? 177 CYS A N     1 
ATOM   508   C  CA    . CYS A  1 71  ? 73.189  53.531  -46.467  1.00 21.68  ? 177 CYS A CA    1 
ATOM   509   C  C     . CYS A  1 71  ? 72.466  52.432  -45.744  1.00 21.70  ? 177 CYS A C     1 
ATOM   510   O  O     . CYS A  1 71  ? 71.452  52.692  -45.114  1.00 22.56  ? 177 CYS A O     1 
ATOM   511   C  CB    . CYS A  1 71  ? 72.868  53.412  -47.959  1.00 22.40  ? 177 CYS A CB    1 
ATOM   512   S  SG    . CYS A  1 71  ? 73.197  54.927  -48.901  1.00 25.09  ? 177 CYS A SG    1 
ATOM   513   N  N     . LEU A  1 72  ? 72.988  51.214  -45.844  1.00 21.28  ? 178 LEU A N     1 
ATOM   514   C  CA    . LEU A  1 72  ? 72.294  50.048  -45.325  1.00 21.08  ? 178 LEU A CA    1 
ATOM   515   C  C     . LEU A  1 72  ? 72.314  50.044  -43.802  1.00 22.40  ? 178 LEU A C     1 
ATOM   516   O  O     . LEU A  1 72  ? 71.283  49.842  -43.173  1.00 22.42  ? 178 LEU A O     1 
ATOM   517   C  CB    . LEU A  1 72  ? 72.896  48.767  -45.891  1.00 20.26  ? 178 LEU A CB    1 
ATOM   518   C  CG    . LEU A  1 72  ? 72.366  47.440  -45.368  1.00 19.99  ? 178 LEU A CG    1 
ATOM   519   C  CD1   . LEU A  1 72  ? 70.867  47.347  -45.434  1.00 19.87  ? 178 LEU A CD1   1 
ATOM   520   C  CD2   . LEU A  1 72  ? 72.980  46.319  -46.155  1.00 19.84  ? 178 LEU A CD2   1 
ATOM   521   N  N     . VAL A  1 73  ? 73.473  50.292  -43.206  1.00 23.91  ? 179 VAL A N     1 
ATOM   522   C  CA    . VAL A  1 73  ? 73.573  50.308  -41.748  1.00 25.07  ? 179 VAL A CA    1 
ATOM   523   C  C     . VAL A  1 73  ? 72.776  51.456  -41.134  1.00 26.19  ? 179 VAL A C     1 
ATOM   524   O  O     . VAL A  1 73  ? 72.163  51.277  -40.096  1.00 25.81  ? 179 VAL A O     1 
ATOM   525   C  CB    . VAL A  1 73  ? 75.039  50.313  -41.270  1.00 24.75  ? 179 VAL A CB    1 
ATOM   526   C  CG1   . VAL A  1 73  ? 75.693  51.652  -41.464  1.00 24.97  ? 179 VAL A CG1   1 
ATOM   527   C  CG2   . VAL A  1 73  ? 75.127  49.907  -39.814  1.00 24.80  ? 179 VAL A CG2   1 
ATOM   528   N  N     . HIS A  1 74  ? 72.782  52.619  -41.784  1.00 28.80  ? 180 HIS A N     1 
ATOM   529   C  CA    . HIS A  1 74  ? 72.033  53.779  -41.306  1.00 31.55  ? 180 HIS A CA    1 
ATOM   530   C  C     . HIS A  1 74  ? 70.519  53.521  -41.434  1.00 30.12  ? 180 HIS A C     1 
ATOM   531   O  O     . HIS A  1 74  ? 69.746  53.888  -40.556  1.00 29.25  ? 180 HIS A O     1 
ATOM   532   C  CB    . HIS A  1 74  ? 72.492  55.075  -42.012  1.00 35.44  ? 180 HIS A CB    1 
ATOM   533   C  CG    . HIS A  1 74  ? 71.855  56.323  -41.472  1.00 41.32  ? 180 HIS A CG    1 
ATOM   534   N  ND1   . HIS A  1 74  ? 70.629  56.791  -41.923  1.00 46.23  ? 180 HIS A ND1   1 
ATOM   535   C  CD2   . HIS A  1 74  ? 72.267  57.202  -40.519  1.00 44.98  ? 180 HIS A CD2   1 
ATOM   536   C  CE1   . HIS A  1 74  ? 70.319  57.908  -41.276  1.00 47.75  ? 180 HIS A CE1   1 
ATOM   537   N  NE2   . HIS A  1 74  ? 71.288  58.172  -40.407  1.00 47.63  ? 180 HIS A NE2   1 
ATOM   538   N  N     . ALA A  1 75  ? 70.114  52.841  -42.491  1.00 29.38  ? 181 ALA A N     1 
ATOM   539   C  CA    . ALA A  1 75  ? 68.711  52.492  -42.700  1.00 29.32  ? 181 ALA A CA    1 
ATOM   540   C  C     . ALA A  1 75  ? 68.197  51.509  -41.672  1.00 28.69  ? 181 ALA A C     1 
ATOM   541   O  O     . ALA A  1 75  ? 67.101  51.671  -41.169  1.00 29.13  ? 181 ALA A O     1 
ATOM   542   C  CB    . ALA A  1 75  ? 68.516  51.912  -44.096  1.00 29.15  ? 181 ALA A CB    1 
ATOM   543   N  N     . LEU A  1 76  ? 68.977  50.478  -41.383  1.00 27.87  ? 182 LEU A N     1 
ATOM   544   C  CA    . LEU A  1 76  ? 68.597  49.506  -40.367  1.00 27.74  ? 182 LEU A CA    1 
ATOM   545   C  C     . LEU A  1 76  ? 68.429  50.198  -39.030  1.00 28.65  ? 182 LEU A C     1 
ATOM   546   O  O     . LEU A  1 76  ? 67.508  49.879  -38.300  1.00 29.09  ? 182 LEU A O     1 
ATOM   547   C  CB    . LEU A  1 76  ? 69.634  48.400  -40.249  1.00 26.67  ? 182 LEU A CB    1 
ATOM   548   C  CG    . LEU A  1 76  ? 69.739  47.492  -41.473  1.00 25.98  ? 182 LEU A CG    1 
ATOM   549   C  CD1   . LEU A  1 76  ? 70.939  46.576  -41.355  1.00 25.83  ? 182 LEU A CD1   1 
ATOM   550   C  CD2   . LEU A  1 76  ? 68.480  46.660  -41.684  1.00 26.11  ? 182 LEU A CD2   1 
ATOM   551   N  N     . GLY A  1 77  ? 69.303  51.160  -38.746  1.00 29.68  ? 183 GLY A N     1 
ATOM   552   C  CA    . GLY A  1 77  ? 69.248  51.940  -37.525  1.00 31.56  ? 183 GLY A CA    1 
ATOM   553   C  C     . GLY A  1 77  ? 67.992  52.770  -37.354  1.00 32.98  ? 183 GLY A C     1 
ATOM   554   O  O     . GLY A  1 77  ? 67.395  52.773  -36.283  1.00 33.16  ? 183 GLY A O     1 
ATOM   555   N  N     . GLU A  1 78  ? 67.588  53.478  -38.399  1.00 35.69  ? 184 GLU A N     1 
ATOM   556   C  CA    . GLU A  1 78  ? 66.385  54.314  -38.325  1.00 38.88  ? 184 GLU A CA    1 
ATOM   557   C  C     . GLU A  1 78  ? 65.164  53.423  -38.151  1.00 36.10  ? 184 GLU A C     1 
ATOM   558   O  O     . GLU A  1 78  ? 64.354  53.682  -37.286  1.00 35.27  ? 184 GLU A O     1 
ATOM   559   C  CB    . GLU A  1 78  ? 66.188  55.213  -39.554  1.00 46.07  ? 184 GLU A CB    1 
ATOM   560   C  CG    . GLU A  1 78  ? 67.336  56.178  -39.886  1.00 53.38  ? 184 GLU A CG    1 
ATOM   561   C  CD    . GLU A  1 78  ? 67.479  57.387  -38.952  1.00 59.59  ? 184 GLU A CD    1 
ATOM   562   O  OE1   . GLU A  1 78  ? 66.661  58.309  -39.089  1.00 64.98  ? 184 GLU A OE1   1 
ATOM   563   O  OE2   . GLU A  1 78  ? 68.460  57.438  -38.157  1.00 65.15  ? 184 GLU A OE2   1 
ATOM   564   N  N     . LYS A  1 79  ? 65.050  52.371  -38.961  1.00 34.33  ? 185 LYS A N     1 
ATOM   565   C  CA    . LYS A  1 79  ? 63.889  51.465  -38.912  1.00 32.92  ? 185 LYS A CA    1 
ATOM   566   C  C     . LYS A  1 79  ? 63.817  50.691  -37.565  1.00 31.70  ? 185 LYS A C     1 
ATOM   567   O  O     . LYS A  1 79  ? 62.726  50.456  -37.065  1.00 31.89  ? 185 LYS A O     1 
ATOM   568   C  CB    . LYS A  1 79  ? 63.822  50.535  -40.163  1.00 31.80  ? 185 LYS A CB    1 
ATOM   569   N  N     . GLN A  1 80  ? 64.952  50.360  -36.947  1.00 30.33  ? 186 GLN A N     1 
ATOM   570   C  CA    . GLN A  1 80  ? 64.985  49.532  -35.707  1.00 30.14  ? 186 GLN A CA    1 
ATOM   571   C  C     . GLN A  1 80  ? 65.949  50.100  -34.646  1.00 30.07  ? 186 GLN A C     1 
ATOM   572   O  O     . GLN A  1 80  ? 67.109  49.663  -34.543  1.00 29.96  ? 186 GLN A O     1 
ATOM   573   C  CB    . GLN A  1 80  ? 65.374  48.094  -36.038  1.00 30.43  ? 186 GLN A CB    1 
ATOM   574   C  CG    . GLN A  1 80  ? 64.509  47.427  -37.085  1.00 31.24  ? 186 GLN A CG    1 
ATOM   575   C  CD    . GLN A  1 80  ? 64.824  45.951  -37.248  1.00 31.79  ? 186 GLN A CD    1 
ATOM   576   O  OE1   . GLN A  1 80  ? 65.554  45.554  -38.127  1.00 32.71  ? 186 GLN A OE1   1 
ATOM   577   N  NE2   . GLN A  1 80  ? 64.265  45.139  -36.388  1.00 32.55  ? 186 GLN A NE2   1 
ATOM   578   N  N     . PRO A  1 81  ? 65.479  51.077  -33.854  1.00 30.83  ? 187 PRO A N     1 
ATOM   579   C  CA    . PRO A  1 81  ? 66.324  51.652  -32.810  1.00 31.86  ? 187 PRO A CA    1 
ATOM   580   C  C     . PRO A  1 81  ? 66.756  50.654  -31.757  1.00 32.43  ? 187 PRO A C     1 
ATOM   581   O  O     . PRO A  1 81  ? 67.835  50.787  -31.217  1.00 32.89  ? 187 PRO A O     1 
ATOM   582   C  CB    . PRO A  1 81  ? 65.433  52.742  -32.191  1.00 31.65  ? 187 PRO A CB    1 
ATOM   583   C  CG    . PRO A  1 81  ? 64.537  53.135  -33.292  1.00 31.53  ? 187 PRO A CG    1 
ATOM   584   C  CD    . PRO A  1 81  ? 64.228  51.830  -33.991  1.00 31.30  ? 187 PRO A CD    1 
ATOM   585   N  N     . GLU A  1 82  ? 65.922  49.648  -31.505  1.00 33.71  ? 188 GLU A N     1 
ATOM   586   C  CA    . GLU A  1 82  ? 66.252  48.553  -30.584  1.00 35.13  ? 188 GLU A CA    1 
ATOM   587   C  C     . GLU A  1 82  ? 67.623  47.925  -30.793  1.00 35.49  ? 188 GLU A C     1 
ATOM   588   O  O     . GLU A  1 82  ? 68.190  47.382  -29.868  1.00 36.67  ? 188 GLU A O     1 
ATOM   589   C  CB    . GLU A  1 82  ? 65.180  47.453  -30.612  1.00 35.96  ? 188 GLU A CB    1 
ATOM   590   C  CG    . GLU A  1 82  ? 65.004  46.702  -31.935  1.00 36.86  ? 188 GLU A CG    1 
ATOM   591   C  CD    . GLU A  1 82  ? 63.846  47.241  -32.804  1.00 37.94  ? 188 GLU A CD    1 
ATOM   592   O  OE1   . GLU A  1 82  ? 63.531  48.476  -32.751  1.00 39.04  ? 188 GLU A OE1   1 
ATOM   593   O  OE2   . GLU A  1 82  ? 63.267  46.411  -33.553  1.00 36.30  ? 188 GLU A OE2   1 
ATOM   594   N  N     . LEU A  1 83  ? 68.145  47.989  -32.011  1.00 35.35  ? 189 LEU A N     1 
ATOM   595   C  CA    . LEU A  1 83  ? 69.451  47.409  -32.341  1.00 34.86  ? 189 LEU A CA    1 
ATOM   596   C  C     . LEU A  1 83  ? 70.636  48.177  -31.732  1.00 33.77  ? 189 LEU A C     1 
ATOM   597   O  O     . LEU A  1 83  ? 71.727  47.618  -31.590  1.00 33.05  ? 189 LEU A O     1 
ATOM   598   C  CB    . LEU A  1 83  ? 69.616  47.344  -33.850  1.00 35.48  ? 189 LEU A CB    1 
ATOM   599   C  CG    . LEU A  1 83  ? 68.598  46.487  -34.604  1.00 36.28  ? 189 LEU A CG    1 
ATOM   600   C  CD1   . LEU A  1 83  ? 68.765  46.654  -36.107  1.00 36.81  ? 189 LEU A CD1   1 
ATOM   601   C  CD2   . LEU A  1 83  ? 68.686  45.025  -34.256  1.00 36.62  ? 189 LEU A CD2   1 
ATOM   602   N  N     . GLN A  1 84  ? 70.409  49.437  -31.394  1.00 34.01  ? 190 GLN A N     1 
ATOM   603   C  CA    . GLN A  1 84  ? 71.411  50.314  -30.794  1.00 35.82  ? 190 GLN A CA    1 
ATOM   604   C  C     . GLN A  1 84  ? 72.673  50.370  -31.629  1.00 36.68  ? 190 GLN A C     1 
ATOM   605   O  O     . GLN A  1 84  ? 73.769  50.000  -31.200  1.00 37.88  ? 190 GLN A O     1 
ATOM   606   C  CB    . GLN A  1 84  ? 71.697  49.912  -29.344  1.00 37.41  ? 190 GLN A CB    1 
ATOM   607   C  CG    . GLN A  1 84  ? 70.521  50.226  -28.423  1.00 38.80  ? 190 GLN A CG    1 
ATOM   608   C  CD    . GLN A  1 84  ? 70.535  49.529  -27.108  1.00 40.07  ? 190 GLN A CD    1 
ATOM   609   O  OE1   . GLN A  1 84  ? 71.603  49.229  -26.574  1.00 41.46  ? 190 GLN A OE1   1 
ATOM   610   N  NE2   . GLN A  1 84  ? 69.341  49.230  -26.590  1.00 40.90  ? 190 GLN A NE2   1 
ATOM   611   N  N     . ILE A  1 85  ? 72.461  50.796  -32.872  1.00 37.76  ? 191 ILE A N     1 
ATOM   612   C  CA    . ILE A  1 85  ? 73.527  50.976  -33.820  1.00 37.84  ? 191 ILE A CA    1 
ATOM   613   C  C     . ILE A  1 85  ? 74.082  52.340  -33.518  1.00 39.25  ? 191 ILE A C     1 
ATOM   614   O  O     . ILE A  1 85  ? 73.351  53.298  -33.598  1.00 41.37  ? 191 ILE A O     1 
ATOM   615   C  CB    . ILE A  1 85  ? 72.990  50.860  -35.267  1.00 36.24  ? 191 ILE A CB    1 
ATOM   616   C  CG1   . ILE A  1 85  ? 72.626  49.389  -35.555  1.00 34.91  ? 191 ILE A CG1   1 
ATOM   617   C  CG2   . ILE A  1 85  ? 74.040  51.310  -36.290  1.00 37.01  ? 191 ILE A CG2   1 
ATOM   618   C  CD1   . ILE A  1 85  ? 71.823  49.221  -36.833  1.00 34.83  ? 191 ILE A CD1   1 
ATOM   619   N  N     . SER A  1 86  ? 75.354  52.423  -33.154  1.00 40.22  ? 192 SER A N     1 
ATOM   620   C  CA    . SER A  1 86  ? 75.999  53.699  -32.796  1.00 40.91  ? 192 SER A CA    1 
ATOM   621   C  C     . SER A  1 86  ? 76.617  54.375  -34.007  1.00 42.05  ? 192 SER A C     1 
ATOM   622   O  O     . SER A  1 86  ? 76.906  53.717  -34.992  1.00 41.41  ? 192 SER A O     1 
ATOM   623   C  CB    . SER A  1 86  ? 77.090  53.473  -31.753  1.00 41.71  ? 192 SER A CB    1 
ATOM   624   O  OG    . SER A  1 86  ? 78.065  52.559  -32.214  1.00 42.95  ? 192 SER A OG    1 
ATOM   625   N  N     . GLU A  1 87  ? 76.871  55.676  -33.908  1.00 43.78  ? 193 GLU A N     1 
ATOM   626   C  CA    . GLU A  1 87  ? 77.593  56.398  -34.965  1.00 46.30  ? 193 GLU A CA    1 
ATOM   627   C  C     . GLU A  1 87  ? 79.018  55.882  -35.101  1.00 43.12  ? 193 GLU A C     1 
ATOM   628   O  O     . GLU A  1 87  ? 79.669  56.064  -36.121  1.00 43.26  ? 193 GLU A O     1 
ATOM   629   C  CB    . GLU A  1 87  ? 77.630  57.901  -34.721  1.00 52.77  ? 193 GLU A CB    1 
ATOM   630   C  CG    . GLU A  1 87  ? 76.322  58.621  -34.601  1.00 59.93  ? 193 GLU A CG    1 
ATOM   631   C  CD    . GLU A  1 87  ? 76.424  59.864  -33.666  1.00 69.98  ? 193 GLU A CD    1 
ATOM   632   O  OE1   . GLU A  1 87  ? 77.503  60.547  -33.642  1.00 78.81  ? 193 GLU A OE1   1 
ATOM   633   O  OE2   . GLU A  1 87  ? 75.431  60.191  -32.926  1.00 77.87  ? 193 GLU A OE2   1 
ATOM   634   N  N     . ARG A  1 88  ? 79.505  55.237  -34.054  1.00 41.34  ? 194 ARG A N     1 
ATOM   635   C  CA    . ARG A  1 88  ? 80.748  54.510  -34.113  1.00 40.50  ? 194 ARG A CA    1 
ATOM   636   C  C     . ARG A  1 88  ? 80.645  53.270  -35.007  1.00 36.90  ? 194 ARG A C     1 
ATOM   637   O  O     . ARG A  1 88  ? 81.521  53.017  -35.826  1.00 34.42  ? 194 ARG A O     1 
ATOM   638   C  CB    . ARG A  1 88  ? 81.148  54.116  -32.698  1.00 43.43  ? 194 ARG A CB    1 
ATOM   639   C  CG    . ARG A  1 88  ? 82.569  53.562  -32.607  1.00 45.36  ? 194 ARG A CG    1 
ATOM   640   C  CD    . ARG A  1 88  ? 82.845  53.157  -31.172  1.00 45.92  ? 194 ARG A CD    1 
ATOM   641   N  NE    . ARG A  1 88  ? 83.512  51.870  -31.104  1.00 46.16  ? 194 ARG A NE    1 
ATOM   642   C  CZ    . ARG A  1 88  ? 83.585  51.133  -30.011  1.00 48.45  ? 194 ARG A CZ    1 
ATOM   643   N  NH1   . ARG A  1 88  ? 83.032  51.511  -28.869  1.00 50.84  ? 194 ARG A NH1   1 
ATOM   644   N  NH2   . ARG A  1 88  ? 84.207  49.988  -30.068  1.00 48.27  ? 194 ARG A NH2   1 
ATOM   645   N  N     . ASP A  1 89  ? 79.589  52.495  -34.831  1.00 34.92  ? 195 ASP A N     1 
ATOM   646   C  CA    . ASP A  1 89  ? 79.342  51.325  -35.687  1.00 34.31  ? 195 ASP A CA    1 
ATOM   647   C  C     . ASP A  1 89  ? 79.235  51.718  -37.157  1.00 33.17  ? 195 ASP A C     1 
ATOM   648   O  O     . ASP A  1 89  ? 79.776  51.049  -38.019  1.00 33.42  ? 195 ASP A O     1 
ATOM   649   C  CB    . ASP A  1 89  ? 78.046  50.584  -35.287  1.00 33.92  ? 195 ASP A CB    1 
ATOM   650   C  CG    . ASP A  1 89  ? 78.141  49.881  -33.957  1.00 34.90  ? 195 ASP A CG    1 
ATOM   651   O  OD1   . ASP A  1 89  ? 79.232  49.372  -33.607  1.00 37.69  ? 195 ASP A OD1   1 
ATOM   652   O  OD2   . ASP A  1 89  ? 77.110  49.820  -33.254  1.00 34.95  ? 195 ASP A OD2   1 
ATOM   653   N  N     . VAL A  1 90  ? 78.528  52.811  -37.426  1.00 32.01  ? 196 VAL A N     1 
ATOM   654   C  CA    . VAL A  1 90  ? 78.306  53.294  -38.794  1.00 30.30  ? 196 VAL A CA    1 
ATOM   655   C  C     . VAL A  1 90  ? 79.624  53.649  -39.459  1.00 30.17  ? 196 VAL A C     1 
ATOM   656   O  O     . VAL A  1 90  ? 79.888  53.242  -40.586  1.00 29.83  ? 196 VAL A O     1 
ATOM   657   C  CB    . VAL A  1 90  ? 77.353  54.504  -38.817  1.00 29.96  ? 196 VAL A CB    1 
ATOM   658   C  CG1   . VAL A  1 90  ? 77.280  55.142  -40.199  1.00 30.35  ? 196 VAL A CG1   1 
ATOM   659   C  CG2   . VAL A  1 90  ? 75.960  54.080  -38.389  1.00 29.28  ? 196 VAL A CG2   1 
ATOM   660   N  N     . LEU A  1 91  ? 80.443  54.416  -38.755  1.00 29.79  ? 197 LEU A N     1 
ATOM   661   C  CA    . LEU A  1 91  ? 81.753  54.773  -39.268  1.00 30.02  ? 197 LEU A CA    1 
ATOM   662   C  C     . LEU A  1 91  ? 82.616  53.571  -39.582  1.00 29.97  ? 197 LEU A C     1 
ATOM   663   O  O     . LEU A  1 91  ? 83.291  53.548  -40.585  1.00 30.22  ? 197 LEU A O     1 
ATOM   664   C  CB    . LEU A  1 91  ? 82.509  55.673  -38.301  1.00 30.74  ? 197 LEU A CB    1 
ATOM   665   C  CG    . LEU A  1 91  ? 82.431  57.150  -38.625  1.00 31.87  ? 197 LEU A CG    1 
ATOM   666   C  CD1   . LEU A  1 91  ? 83.196  57.938  -37.586  1.00 32.41  ? 197 LEU A CD1   1 
ATOM   667   C  CD2   . LEU A  1 91  ? 83.042  57.441  -39.988  1.00 32.37  ? 197 LEU A CD2   1 
ATOM   668   N  N     . CYS A  1 92  ? 82.595  52.581  -38.711  1.00 30.75  ? 198 CYS A N     1 
ATOM   669   C  CA    . CYS A  1 92  ? 83.395  51.384  -38.914  1.00 31.66  ? 198 CYS A CA    1 
ATOM   670   C  C     . CYS A  1 92  ? 82.961  50.584  -40.137  1.00 30.62  ? 198 CYS A C     1 
ATOM   671   O  O     . CYS A  1 92  ? 83.792  50.073  -40.881  1.00 34.19  ? 198 CYS A O     1 
ATOM   672   C  CB    . CYS A  1 92  ? 83.350  50.493  -37.684  1.00 33.51  ? 198 CYS A CB    1 
ATOM   673   S  SG    . CYS A  1 92  ? 84.158  51.210  -36.255  1.00 38.62  ? 198 CYS A SG    1 
ATOM   674   N  N     . VAL A  1 93  ? 81.657  50.476  -40.326  1.00 29.34  ? 199 VAL A N     1 
ATOM   675   C  CA    . VAL A  1 93  ? 81.083  49.791  -41.484  1.00 28.52  ? 199 VAL A CA    1 
ATOM   676   C  C     . VAL A  1 93  ? 81.472  50.536  -42.766  1.00 27.96  ? 199 VAL A C     1 
ATOM   677   O  O     . VAL A  1 93  ? 81.877  49.909  -43.742  1.00 27.78  ? 199 VAL A O     1 
ATOM   678   C  CB    . VAL A  1 93  ? 79.556  49.673  -41.336  1.00 28.88  ? 199 VAL A CB    1 
ATOM   679   C  CG1   . VAL A  1 93  ? 78.903  49.197  -42.598  1.00 29.02  ? 199 VAL A CG1   1 
ATOM   680   C  CG2   . VAL A  1 93  ? 79.202  48.699  -40.215  1.00 29.03  ? 199 VAL A CG2   1 
ATOM   681   N  N     . GLN A  1 94  ? 81.370  51.863  -42.752  1.00 27.85  ? 200 GLN A N     1 
ATOM   682   C  CA    . GLN A  1 94  ? 81.821  52.695  -43.879  1.00 27.55  ? 200 GLN A CA    1 
ATOM   683   C  C     . GLN A  1 94  ? 83.292  52.518  -44.201  1.00 26.32  ? 200 GLN A C     1 
ATOM   684   O  O     . GLN A  1 94  ? 83.660  52.391  -45.356  1.00 25.07  ? 200 GLN A O     1 
ATOM   685   C  CB    . GLN A  1 94  ? 81.542  54.179  -43.626  1.00 28.37  ? 200 GLN A CB    1 
ATOM   686   C  CG    . GLN A  1 94  ? 80.114  54.584  -43.897  1.00 29.23  ? 200 GLN A CG    1 
ATOM   687   C  CD    . GLN A  1 94  ? 79.891  56.037  -43.572  1.00 30.32  ? 200 GLN A CD    1 
ATOM   688   O  OE1   . GLN A  1 94  ? 79.902  56.435  -42.412  1.00 31.54  ? 200 GLN A OE1   1 
ATOM   689   N  NE2   . GLN A  1 94  ? 79.665  56.847  -44.594  1.00 30.91  ? 200 GLN A NE2   1 
ATOM   690   N  N     . ILE A  1 95  ? 84.134  52.520  -43.172  1.00 25.99  ? 201 ILE A N     1 
ATOM   691   C  CA    . ILE A  1 95  ? 85.565  52.353  -43.365  1.00 26.58  ? 201 ILE A CA    1 
ATOM   692   C  C     . ILE A  1 95  ? 85.861  50.991  -43.990  1.00 27.55  ? 201 ILE A C     1 
ATOM   693   O  O     . ILE A  1 95  ? 86.711  50.884  -44.877  1.00 29.55  ? 201 ILE A O     1 
ATOM   694   C  CB    . ILE A  1 95  ? 86.352  52.546  -42.058  1.00 26.53  ? 201 ILE A CB    1 
ATOM   695   C  CG1   . ILE A  1 95  ? 86.302  53.988  -41.613  1.00 26.56  ? 201 ILE A CG1   1 
ATOM   696   C  CG2   . ILE A  1 95  ? 87.840  52.194  -42.250  1.00 27.43  ? 201 ILE A CG2   1 
ATOM   697   C  CD1   . ILE A  1 95  ? 86.688  54.224  -40.187  1.00 27.35  ? 201 ILE A CD1   1 
ATOM   698   N  N     . ALA A  1 96  ? 85.167  49.961  -43.537  1.00 27.89  ? 202 ALA A N     1 
ATOM   699   C  CA    . ALA A  1 96  ? 85.353  48.631  -44.105  1.00 28.09  ? 202 ALA A CA    1 
ATOM   700   C  C     . ALA A  1 96  ? 84.987  48.622  -45.581  1.00 27.59  ? 202 ALA A C     1 
ATOM   701   O  O     . ALA A  1 96  ? 85.770  48.178  -46.430  1.00 27.64  ? 202 ALA A O     1 
ATOM   702   C  CB    . ALA A  1 96  ? 84.522  47.610  -43.364  1.00 28.24  ? 202 ALA A CB    1 
ATOM   703   N  N     . GLY A  1 97  ? 83.798  49.127  -45.875  1.00 26.50  ? 203 GLY A N     1 
ATOM   704   C  CA    . GLY A  1 97  ? 83.341  49.228  -47.245  1.00 26.03  ? 203 GLY A CA    1 
ATOM   705   C  C     . GLY A  1 97  ? 84.314  49.983  -48.123  1.00 25.88  ? 203 GLY A C     1 
ATOM   706   O  O     . GLY A  1 97  ? 84.628  49.561  -49.229  1.00 25.65  ? 203 GLY A O     1 
ATOM   707   N  N     . LEU A  1 98  ? 84.808  51.093  -47.605  1.00 26.15  ? 204 LEU A N     1 
ATOM   708   C  CA    . LEU A  1 98  ? 85.733  51.942  -48.322  1.00 26.34  ? 204 LEU A CA    1 
ATOM   709   C  C     . LEU A  1 98  ? 87.056  51.224  -48.632  1.00 27.01  ? 204 LEU A C     1 
ATOM   710   O  O     . LEU A  1 98  ? 87.594  51.301  -49.738  1.00 28.20  ? 204 LEU A O     1 
ATOM   711   C  CB    . LEU A  1 98  ? 85.967  53.174  -47.481  1.00 26.25  ? 204 LEU A CB    1 
ATOM   712   C  CG    . LEU A  1 98  ? 86.651  54.375  -48.082  1.00 25.99  ? 204 LEU A CG    1 
ATOM   713   C  CD1   . LEU A  1 98  ? 85.859  54.876  -49.264  1.00 25.76  ? 204 LEU A CD1   1 
ATOM   714   C  CD2   . LEU A  1 98  ? 86.743  55.462  -47.006  1.00 26.57  ? 204 LEU A CD2   1 
ATOM   715   N  N     . CYS A  1 99  ? 87.543  50.471  -47.651  1.00 27.13  ? 205 CYS A N     1 
ATOM   716   C  CA    . CYS A  1 99  ? 88.849  49.800  -47.745  1.00 27.51  ? 205 CYS A CA    1 
ATOM   717   C  C     . CYS A  1 99  ? 88.788  48.327  -48.162  1.00 27.76  ? 205 CYS A C     1 
ATOM   718   O  O     . CYS A  1 99  ? 89.786  47.625  -48.095  1.00 28.11  ? 205 CYS A O     1 
ATOM   719   C  CB    . CYS A  1 99  ? 89.554  49.932  -46.393  1.00 27.26  ? 205 CYS A CB    1 
ATOM   720   S  SG    . CYS A  1 99  ? 89.912  51.664  -45.963  1.00 27.23  ? 205 CYS A SG    1 
ATOM   721   N  N     . HIS A  1 100 ? 87.633  47.856  -48.611  1.00 27.73  ? 206 HIS A N     1 
ATOM   722   C  CA    . HIS A  1 100 ? 87.400  46.409  -48.718  1.00 26.95  ? 206 HIS A CA    1 
ATOM   723   C  C     . HIS A  1 100 ? 88.207  45.775  -49.845  1.00 26.02  ? 206 HIS A C     1 
ATOM   724   O  O     . HIS A  1 100 ? 88.566  44.597  -49.761  1.00 24.15  ? 206 HIS A O     1 
ATOM   725   C  CB    . HIS A  1 100 ? 85.908  46.109  -48.912  1.00 27.26  ? 206 HIS A CB    1 
ATOM   726   C  CG    . HIS A  1 100 ? 85.444  46.259  -50.324  1.00 27.69  ? 206 HIS A CG    1 
ATOM   727   N  ND1   . HIS A  1 100 ? 85.348  47.486  -50.938  1.00 27.83  ? 206 HIS A ND1   1 
ATOM   728   C  CD2   . HIS A  1 100 ? 85.100  45.341  -51.257  1.00 27.54  ? 206 HIS A CD2   1 
ATOM   729   C  CE1   . HIS A  1 100 ? 84.944  47.319  -52.182  1.00 27.59  ? 206 HIS A CE1   1 
ATOM   730   N  NE2   . HIS A  1 100 ? 84.783  46.029  -52.400  1.00 27.22  ? 206 HIS A NE2   1 
ATOM   731   N  N     . ASP A  1 101 ? 88.460  46.560  -50.899  1.00 26.49  ? 207 ASP A N     1 
ATOM   732   C  CA    . ASP A  1 101 ? 89.230  46.074  -52.047  1.00 26.94  ? 207 ASP A CA    1 
ATOM   733   C  C     . ASP A  1 101 ? 90.630  46.686  -52.136  1.00 27.47  ? 207 ASP A C     1 
ATOM   734   O  O     . ASP A  1 101 ? 91.330  46.507  -53.137  1.00 27.45  ? 207 ASP A O     1 
ATOM   735   C  CB    . ASP A  1 101 ? 88.459  46.256  -53.368  1.00 26.17  ? 207 ASP A CB    1 
ATOM   736   C  CG    . ASP A  1 101 ? 87.471  45.101  -53.667  1.00 25.68  ? 207 ASP A CG    1 
ATOM   737   O  OD1   . ASP A  1 101 ? 87.513  43.943  -53.124  1.00 24.76  ? 207 ASP A OD1   1 
ATOM   738   O  OD2   . ASP A  1 101 ? 86.579  45.394  -54.464  1.00 25.75  ? 207 ASP A OD2   1 
ATOM   739   N  N     . LEU A  1 102 ? 91.072  47.320  -51.055  1.00 27.73  ? 208 LEU A N     1 
ATOM   740   C  CA    . LEU A  1 102 ? 92.446  47.877  -50.972  1.00 27.18  ? 208 LEU A CA    1 
ATOM   741   C  C     . LEU A  1 102 ? 93.602  47.024  -51.486  1.00 27.01  ? 208 LEU A C     1 
ATOM   742   O  O     . LEU A  1 102 ? 94.624  47.589  -51.912  1.00 27.52  ? 208 LEU A O     1 
ATOM   743   C  CB    . LEU A  1 102 ? 92.807  48.272  -49.530  1.00 27.05  ? 208 LEU A CB    1 
ATOM   744   C  CG    . LEU A  1 102 ? 92.595  49.730  -49.120  1.00 27.02  ? 208 LEU A CG    1 
ATOM   745   C  CD1   . LEU A  1 102 ? 92.887  49.916  -47.650  1.00 26.61  ? 208 LEU A CD1   1 
ATOM   746   C  CD2   . LEU A  1 102 ? 93.481  50.668  -49.931  1.00 27.76  ? 208 LEU A CD2   1 
ATOM   747   N  N     . GLY A  1 103 ? 93.451  45.699  -51.399  1.00 26.91  ? 209 GLY A N     1 
ATOM   748   C  CA    . GLY A  1 103 ? 94.485  44.747  -51.772  1.00 27.97  ? 209 GLY A CA    1 
ATOM   749   C  C     . GLY A  1 103 ? 94.430  44.125  -53.157  1.00 28.81  ? 209 GLY A C     1 
ATOM   750   O  O     . GLY A  1 103 ? 95.103  43.128  -53.413  1.00 28.63  ? 209 GLY A O     1 
ATOM   751   N  N     . HIS A  1 104 ? 93.647  44.685  -54.063  1.00 30.72  ? 210 HIS A N     1 
ATOM   752   C  CA    . HIS A  1 104 ? 93.642  44.179  -55.438  1.00 33.02  ? 210 HIS A CA    1 
ATOM   753   C  C     . HIS A  1 104 ? 94.945  44.510  -56.116  1.00 33.65  ? 210 HIS A C     1 
ATOM   754   O  O     . HIS A  1 104 ? 95.539  45.566  -55.857  1.00 32.20  ? 210 HIS A O     1 
ATOM   755   C  CB    . HIS A  1 104 ? 92.489  44.746  -56.270  1.00 34.72  ? 210 HIS A CB    1 
ATOM   756   C  CG    . HIS A  1 104 ? 91.321  43.825  -56.362  1.00 35.23  ? 210 HIS A CG    1 
ATOM   757   N  ND1   . HIS A  1 104 ? 91.440  42.520  -56.780  1.00 38.00  ? 210 HIS A ND1   1 
ATOM   758   C  CD2   . HIS A  1 104 ? 90.013  44.020  -56.097  1.00 34.79  ? 210 HIS A CD2   1 
ATOM   759   C  CE1   . HIS A  1 104 ? 90.247  41.952  -56.746  1.00 38.06  ? 210 HIS A CE1   1 
ATOM   760   N  NE2   . HIS A  1 104 ? 89.365  42.836  -56.323  1.00 35.75  ? 210 HIS A NE2   1 
ATOM   761   N  N     . GLY A  1 105 ? 95.373  43.596  -56.981  1.00 34.36  ? 211 GLY A N     1 
ATOM   762   C  CA    . GLY A  1 105 ? 96.613  43.790  -57.728  1.00 34.24  ? 211 GLY A CA    1 
ATOM   763   C  C     . GLY A  1 105 ? 96.398  44.453  -59.072  1.00 33.56  ? 211 GLY A C     1 
ATOM   764   O  O     . GLY A  1 105 ? 95.294  44.872  -59.387  1.00 30.34  ? 211 GLY A O     1 
ATOM   765   N  N     . PRO A  1 106 ? 97.469  44.556  -59.869  1.00 35.21  ? 212 PRO A N     1 
ATOM   766   C  CA    . PRO A  1 106 ? 97.345  45.004  -61.243  1.00 35.36  ? 212 PRO A CA    1 
ATOM   767   C  C     . PRO A  1 106 ? 96.314  44.174  -61.992  1.00 34.00  ? 212 PRO A C     1 
ATOM   768   O  O     . PRO A  1 106 ? 96.317  42.947  -61.894  1.00 33.33  ? 212 PRO A O     1 
ATOM   769   C  CB    . PRO A  1 106 ? 98.746  44.772  -61.820  1.00 35.98  ? 212 PRO A CB    1 
ATOM   770   C  CG    . PRO A  1 106 ? 99.646  44.914  -60.655  1.00 35.95  ? 212 PRO A CG    1 
ATOM   771   C  CD    . PRO A  1 106 ? 98.881  44.438  -59.460  1.00 35.77  ? 212 PRO A CD    1 
ATOM   772   N  N     . PHE A  1 107 ? 95.434  44.870  -62.708  1.00 32.40  ? 213 PHE A N     1 
ATOM   773   C  CA    . PHE A  1 107 ? 94.309  44.271  -63.433  1.00 31.38  ? 213 PHE A CA    1 
ATOM   774   C  C     . PHE A  1 107 ? 93.404  43.411  -62.542  1.00 30.10  ? 213 PHE A C     1 
ATOM   775   O  O     . PHE A  1 107 ? 92.920  42.371  -62.942  1.00 29.75  ? 213 PHE A O     1 
ATOM   776   C  CB    . PHE A  1 107 ? 94.801  43.533  -64.687  1.00 32.25  ? 213 PHE A CB    1 
ATOM   777   C  CG    . PHE A  1 107 ? 95.539  44.422  -65.632  1.00 33.67  ? 213 PHE A CG    1 
ATOM   778   C  CD1   . PHE A  1 107 ? 96.874  44.690  -65.431  1.00 34.22  ? 213 PHE A CD1   1 
ATOM   779   C  CD2   . PHE A  1 107 ? 94.892  45.043  -66.685  1.00 35.18  ? 213 PHE A CD2   1 
ATOM   780   C  CE1   . PHE A  1 107 ? 97.571  45.536  -66.277  1.00 35.16  ? 213 PHE A CE1   1 
ATOM   781   C  CE2   . PHE A  1 107 ? 95.567  45.876  -67.542  1.00 36.53  ? 213 PHE A CE2   1 
ATOM   782   C  CZ    . PHE A  1 107 ? 96.915  46.129  -67.340  1.00 36.25  ? 213 PHE A CZ    1 
ATOM   783   N  N     . SER A  1 108 ? 93.182  43.890  -61.323  1.00 29.35  ? 214 SER A N     1 
ATOM   784   C  CA    . SER A  1 108 ? 92.222  43.323  -60.377  1.00 28.84  ? 214 SER A CA    1 
ATOM   785   C  C     . SER A  1 108 ? 92.274  41.805  -60.227  1.00 27.99  ? 214 SER A C     1 
ATOM   786   O  O     . SER A  1 108 ? 93.187  41.297  -59.568  1.00 28.73  ? 214 SER A O     1 
ATOM   787   C  CB    . SER A  1 108 ? 90.812  43.844  -60.684  1.00 29.07  ? 214 SER A CB    1 
ATOM   788   O  OG    . SER A  1 108 ? 90.659  45.198  -60.294  1.00 29.36  ? 214 SER A OG    1 
ATOM   789   N  N     . HIS A  1 109 ? 91.316  41.089  -60.817  1.00 27.40  ? 215 HIS A N     1 
ATOM   790   C  CA    . HIS A  1 109 ? 91.142  39.656  -60.542  1.00 27.85  ? 215 HIS A CA    1 
ATOM   791   C  C     . HIS A  1 109 ? 92.099  38.808  -61.341  1.00 27.57  ? 215 HIS A C     1 
ATOM   792   O  O     . HIS A  1 109 ? 92.357  37.673  -60.982  1.00 27.33  ? 215 HIS A O     1 
ATOM   793   C  CB    . HIS A  1 109 ? 89.682  39.192  -60.732  1.00 28.08  ? 215 HIS A CB    1 
ATOM   794   C  CG    . HIS A  1 109 ? 88.850  39.266  -59.473  1.00 28.20  ? 215 HIS A CG    1 
ATOM   795   N  ND1   . HIS A  1 109 ? 89.051  38.426  -58.383  1.00 28.24  ? 215 HIS A ND1   1 
ATOM   796   C  CD2   . HIS A  1 109 ? 87.818  40.081  -59.132  1.00 28.04  ? 215 HIS A CD2   1 
ATOM   797   C  CE1   . HIS A  1 109 ? 88.177  38.724  -57.433  1.00 28.26  ? 215 HIS A CE1   1 
ATOM   798   N  NE2   . HIS A  1 109 ? 87.412  39.717  -57.863  1.00 28.15  ? 215 HIS A NE2   1 
ATOM   799   N  N     . MET A  1 110 ? 92.642  39.361  -62.416  1.00 27.50  ? 216 MET A N     1 
ATOM   800   C  CA    . MET A  1 110 ? 93.738  38.724  -63.134  1.00 28.03  ? 216 MET A CA    1 
ATOM   801   C  C     . MET A  1 110 ? 94.883  38.395  -62.189  1.00 28.16  ? 216 MET A C     1 
ATOM   802   O  O     . MET A  1 110 ? 95.459  37.317  -62.271  1.00 29.17  ? 216 MET A O     1 
ATOM   803   C  CB    . MET A  1 110 ? 94.222  39.634  -64.247  1.00 29.00  ? 216 MET A CB    1 
ATOM   804   C  CG    . MET A  1 110 ? 95.194  38.966  -65.201  1.00 30.04  ? 216 MET A CG    1 
ATOM   805   S  SD    . MET A  1 110 ? 96.261  40.184  -65.970  1.00 30.91  ? 216 MET A SD    1 
ATOM   806   C  CE    . MET A  1 110 ? 97.448  40.412  -64.631  1.00 32.12  ? 216 MET A CE    1 
ATOM   807   N  N     . PHE A  1 111 ? 95.194  39.309  -61.281  1.00 27.85  ? 217 PHE A N     1 
ATOM   808   C  CA    . PHE A  1 111 ? 96.316  39.143  -60.343  1.00 28.11  ? 217 PHE A CA    1 
ATOM   809   C  C     . PHE A  1 111 ? 96.123  38.007  -59.357  1.00 27.26  ? 217 PHE A C     1 
ATOM   810   O  O     . PHE A  1 111 ? 96.937  37.108  -59.312  1.00 27.86  ? 217 PHE A O     1 
ATOM   811   C  CB    . PHE A  1 111 ? 96.568  40.434  -59.582  1.00 29.18  ? 217 PHE A CB    1 
ATOM   812   C  CG    . PHE A  1 111 ? 97.962  40.561  -59.070  1.00 30.13  ? 217 PHE A CG    1 
ATOM   813   C  CD1   . PHE A  1 111 ? 99.007  40.831  -59.941  1.00 29.97  ? 217 PHE A CD1   1 
ATOM   814   C  CD2   . PHE A  1 111 ? 98.228  40.438  -57.701  1.00 30.83  ? 217 PHE A CD2   1 
ATOM   815   C  CE1   . PHE A  1 111 ? 100.292 40.966  -59.475  1.00 30.17  ? 217 PHE A CE1   1 
ATOM   816   C  CE2   . PHE A  1 111 ? 99.513  40.585  -57.238  1.00 30.85  ? 217 PHE A CE2   1 
ATOM   817   C  CZ    . PHE A  1 111 ? 100.548 40.844  -58.125  1.00 30.78  ? 217 PHE A CZ    1 
ATOM   818   N  N     . ASP A  1 112 ? 95.059  38.050  -58.571  1.00 26.53  ? 218 ASP A N     1 
ATOM   819   C  CA    . ASP A  1 112 ? 94.819  37.018  -57.550  1.00 26.13  ? 218 ASP A CA    1 
ATOM   820   C  C     . ASP A  1 112 ? 94.239  35.729  -58.134  1.00 24.89  ? 218 ASP A C     1 
ATOM   821   O  O     . ASP A  1 112 ? 94.337  34.674  -57.513  1.00 24.50  ? 218 ASP A O     1 
ATOM   822   C  CB    . ASP A  1 112 ? 93.993  37.569  -56.340  1.00 26.70  ? 218 ASP A CB    1 
ATOM   823   C  CG    . ASP A  1 112 ? 92.503  37.686  -56.597  1.00 27.42  ? 218 ASP A CG    1 
ATOM   824   O  OD1   . ASP A  1 112 ? 92.094  37.779  -57.770  1.00 29.27  ? 218 ASP A OD1   1 
ATOM   825   O  OD2   . ASP A  1 112 ? 91.713  37.701  -55.621  1.00 26.74  ? 218 ASP A OD2   1 
ATOM   826   N  N     . GLY A  1 113 ? 93.673  35.815  -59.331  1.00 24.03  ? 219 GLY A N     1 
ATOM   827   C  CA    . GLY A  1 113 ? 92.991  34.689  -59.963  1.00 24.17  ? 219 GLY A CA    1 
ATOM   828   C  C     . GLY A  1 113 ? 93.788  33.910  -60.985  1.00 24.15  ? 219 GLY A C     1 
ATOM   829   O  O     . GLY A  1 113 ? 93.564  32.726  -61.134  1.00 24.13  ? 219 GLY A O     1 
ATOM   830   N  N     . ARG A  1 114 ? 94.680  34.576  -61.716  1.00 24.46  ? 220 ARG A N     1 
ATOM   831   C  CA    . ARG A  1 114 ? 95.519  33.929  -62.732  1.00 25.37  ? 220 ARG A CA    1 
ATOM   832   C  C     . ARG A  1 114 ? 96.996  33.968  -62.393  1.00 26.88  ? 220 ARG A C     1 
ATOM   833   O  O     . ARG A  1 114 ? 97.629  32.935  -62.339  1.00 27.64  ? 220 ARG A O     1 
ATOM   834   C  CB    . ARG A  1 114 ? 95.308  34.568  -64.098  1.00 25.32  ? 220 ARG A CB    1 
ATOM   835   C  CG    . ARG A  1 114 ? 93.919  34.331  -64.650  1.00 25.60  ? 220 ARG A CG    1 
ATOM   836   C  CD    . ARG A  1 114 ? 93.693  35.098  -65.948  1.00 25.89  ? 220 ARG A CD    1 
ATOM   837   N  NE    . ARG A  1 114 ? 92.346  34.864  -66.462  1.00 25.68  ? 220 ARG A NE    1 
ATOM   838   C  CZ    . ARG A  1 114 ? 91.965  33.748  -67.104  1.00 26.36  ? 220 ARG A CZ    1 
ATOM   839   N  NH1   . ARG A  1 114 ? 92.802  32.732  -67.325  1.00 27.28  ? 220 ARG A NH1   1 
ATOM   840   N  NH2   . ARG A  1 114 ? 90.710  33.639  -67.510  1.00 26.15  ? 220 ARG A NH2   1 
ATOM   841   N  N     . PHE A  1 115 ? 97.534  35.164  -62.164  1.00 28.04  ? 221 PHE A N     1 
ATOM   842   C  CA    . PHE A  1 115 ? 98.981  35.373  -62.008  1.00 29.14  ? 221 PHE A CA    1 
ATOM   843   C  C     . PHE A  1 115 ? 99.604  34.748  -60.772  1.00 29.44  ? 221 PHE A C     1 
ATOM   844   O  O     . PHE A  1 115 ? 100.510 33.946  -60.884  1.00 31.56  ? 221 PHE A O     1 
ATOM   845   C  CB    . PHE A  1 115 ? 99.301  36.858  -62.016  1.00 29.79  ? 221 PHE A CB    1 
ATOM   846   C  CG    . PHE A  1 115 ? 100.755 37.168  -61.818  1.00 31.05  ? 221 PHE A CG    1 
ATOM   847   C  CD1   . PHE A  1 115 ? 101.685 36.816  -62.791  1.00 31.58  ? 221 PHE A CD1   1 
ATOM   848   C  CD2   . PHE A  1 115 ? 101.192 37.815  -60.676  1.00 31.98  ? 221 PHE A CD2   1 
ATOM   849   C  CE1   . PHE A  1 115 ? 103.022 37.099  -62.627  1.00 31.99  ? 221 PHE A CE1   1 
ATOM   850   C  CE2   . PHE A  1 115 ? 102.527 38.110  -60.509  1.00 32.75  ? 221 PHE A CE2   1 
ATOM   851   C  CZ    . PHE A  1 115 ? 103.453 37.757  -61.488  1.00 32.52  ? 221 PHE A CZ    1 
ATOM   852   N  N     . ILE A  1 116 ? 99.146  35.125  -59.595  1.00 29.11  ? 222 ILE A N     1 
ATOM   853   C  CA    . ILE A  1 116 ? 99.746  34.626  -58.363  1.00 29.77  ? 222 ILE A CA    1 
ATOM   854   C  C     . ILE A  1 116 ? 99.632  33.098  -58.256  1.00 30.36  ? 222 ILE A C     1 
ATOM   855   O  O     . ILE A  1 116 ? 100.595 32.447  -57.869  1.00 31.69  ? 222 ILE A O     1 
ATOM   856   C  CB    . ILE A  1 116 ? 99.187  35.363  -57.123  1.00 30.37  ? 222 ILE A CB    1 
ATOM   857   C  CG1   . ILE A  1 116 ? 99.630  36.831  -57.110  1.00 30.25  ? 222 ILE A CG1   1 
ATOM   858   C  CG2   . ILE A  1 116 ? 99.577  34.673  -55.811  1.00 31.19  ? 222 ILE A CG2   1 
ATOM   859   C  CD1   . ILE A  1 116 ? 101.104 37.076  -56.931  1.00 30.53  ? 222 ILE A CD1   1 
ATOM   860   N  N     . PRO A  1 117 ? 98.483  32.516  -58.604  1.00 30.38  ? 223 PRO A N     1 
ATOM   861   C  CA    . PRO A  1 117 ? 98.431  31.057  -58.633  1.00 30.73  ? 223 PRO A CA    1 
ATOM   862   C  C     . PRO A  1 117 ? 99.442  30.367  -59.548  1.00 30.79  ? 223 PRO A C     1 
ATOM   863   O  O     . PRO A  1 117 ? 99.849  29.252  -59.247  1.00 32.02  ? 223 PRO A O     1 
ATOM   864   C  CB    . PRO A  1 117 ? 97.011  30.766  -59.092  1.00 30.41  ? 223 PRO A CB    1 
ATOM   865   C  CG    . PRO A  1 117 ? 96.239  31.878  -58.488  1.00 30.40  ? 223 PRO A CG    1 
ATOM   866   C  CD    . PRO A  1 117 ? 97.134  33.093  -58.590  1.00 30.33  ? 223 PRO A CD    1 
ATOM   867   N  N     . LEU A  1 118 ? 99.836  31.009  -60.646  1.00 29.85  ? 224 LEU A N     1 
ATOM   868   C  CA    . LEU A  1 118 ? 100.869 30.456  -61.535  1.00 30.26  ? 224 LEU A CA    1 
ATOM   869   C  C     . LEU A  1 118 ? 102.267 30.800  -61.060  1.00 31.08  ? 224 LEU A C     1 
ATOM   870   O  O     . LEU A  1 118 ? 103.127 29.946  -61.042  1.00 31.87  ? 224 LEU A O     1 
ATOM   871   C  CB    . LEU A  1 118 ? 100.674 30.923  -62.975  1.00 29.79  ? 224 LEU A CB    1 
ATOM   872   C  CG    . LEU A  1 118 ? 99.383  30.485  -63.671  1.00 29.42  ? 224 LEU A CG    1 
ATOM   873   C  CD1   . LEU A  1 118 ? 99.371  31.014  -65.085  1.00 29.74  ? 224 LEU A CD1   1 
ATOM   874   C  CD2   . LEU A  1 118 ? 99.158  28.994  -63.687  1.00 29.65  ? 224 LEU A CD2   1 
ATOM   875   N  N     . ALA A  1 119 ? 102.486 32.048  -60.680  1.00 31.52  ? 225 ALA A N     1 
ATOM   876   C  CA    . ALA A  1 119 ? 103.804 32.515  -60.249  1.00 33.12  ? 225 ALA A CA    1 
ATOM   877   C  C     . ALA A  1 119 ? 104.260 31.917  -58.936  1.00 34.88  ? 225 ALA A C     1 
ATOM   878   O  O     . ALA A  1 119 ? 105.443 31.687  -58.763  1.00 37.87  ? 225 ALA A O     1 
ATOM   879   C  CB    . ALA A  1 119 ? 103.828 34.029  -60.139  1.00 33.26  ? 225 ALA A CB    1 
ATOM   880   N  N     . ARG A  1 120 ? 103.338 31.682  -58.014  1.00 36.80  ? 226 ARG A N     1 
ATOM   881   C  CA    . ARG A  1 120 ? 103.663 31.185  -56.678  1.00 39.83  ? 226 ARG A CA    1 
ATOM   882   C  C     . ARG A  1 120 ? 102.621 30.180  -56.197  1.00 41.15  ? 226 ARG A C     1 
ATOM   883   O  O     . ARG A  1 120 ? 101.808 30.500  -55.316  1.00 40.27  ? 226 ARG A O     1 
ATOM   884   C  CB    . ARG A  1 120 ? 103.766 32.351  -55.702  1.00 41.18  ? 226 ARG A CB    1 
ATOM   885   C  CG    . ARG A  1 120 ? 104.924 33.271  -56.019  1.00 42.44  ? 226 ARG A CG    1 
ATOM   886   C  CD    . ARG A  1 120 ? 104.978 34.405  -55.012  1.00 44.03  ? 226 ARG A CD    1 
ATOM   887   N  NE    . ARG A  1 120 ? 105.159 33.911  -53.664  1.00 45.75  ? 226 ARG A NE    1 
ATOM   888   C  CZ    . ARG A  1 120 ? 105.153 34.693  -52.579  1.00 47.58  ? 226 ARG A CZ    1 
ATOM   889   N  NH1   . ARG A  1 120 ? 105.009 36.006  -52.672  1.00 47.81  ? 226 ARG A NH1   1 
ATOM   890   N  NH2   . ARG A  1 120 ? 105.307 34.151  -51.379  1.00 48.91  ? 226 ARG A NH2   1 
ATOM   891   N  N     . PRO A  1 121 ? 102.646 28.957  -56.773  1.00 42.30  ? 227 PRO A N     1 
ATOM   892   C  CA    . PRO A  1 121 ? 101.650 27.920  -56.466  1.00 42.71  ? 227 PRO A CA    1 
ATOM   893   C  C     . PRO A  1 121 ? 101.613 27.480  -55.011  1.00 43.76  ? 227 PRO A C     1 
ATOM   894   O  O     . PRO A  1 121 ? 100.582 27.002  -54.555  1.00 42.98  ? 227 PRO A O     1 
ATOM   895   C  CB    . PRO A  1 121 ? 102.086 26.735  -57.335  1.00 42.25  ? 227 PRO A CB    1 
ATOM   896   C  CG    . PRO A  1 121 ? 102.965 27.316  -58.390  1.00 41.66  ? 227 PRO A CG    1 
ATOM   897   C  CD    . PRO A  1 121 ? 103.636 28.486  -57.758  1.00 41.14  ? 227 PRO A CD    1 
ATOM   898   N  N     . GLU A  1 122 ? 102.739 27.617  -54.312  1.00 46.90  ? 228 GLU A N     1 
ATOM   899   C  CA    . GLU A  1 122 ? 102.832 27.292  -52.892  1.00 51.68  ? 228 GLU A CA    1 
ATOM   900   C  C     . GLU A  1 122 ? 101.889 28.110  -51.988  1.00 50.91  ? 228 GLU A C     1 
ATOM   901   O  O     . GLU A  1 122 ? 101.410 27.586  -50.991  1.00 54.10  ? 228 GLU A O     1 
ATOM   902   C  CB    . GLU A  1 122 ? 104.295 27.395  -52.388  1.00 57.23  ? 228 GLU A CB    1 
ATOM   903   C  CG    . GLU A  1 122 ? 104.882 28.808  -52.161  1.00 60.72  ? 228 GLU A CG    1 
ATOM   904   C  CD    . GLU A  1 122 ? 105.555 29.433  -53.380  1.00 61.58  ? 228 GLU A CD    1 
ATOM   905   O  OE1   . GLU A  1 122 ? 105.360 28.940  -54.524  1.00 58.00  ? 228 GLU A OE1   1 
ATOM   906   O  OE2   . GLU A  1 122 ? 106.286 30.446  -53.189  1.00 63.03  ? 228 GLU A OE2   1 
ATOM   907   N  N     . VAL A  1 123 ? 101.611 29.367  -52.350  1.00 48.36  ? 229 VAL A N     1 
ATOM   908   C  CA    . VAL A  1 123 ? 100.877 30.297  -51.482  1.00 48.30  ? 229 VAL A CA    1 
ATOM   909   C  C     . VAL A  1 123 ? 99.370  30.170  -51.687  1.00 47.16  ? 229 VAL A C     1 
ATOM   910   O  O     . VAL A  1 123 ? 98.943  29.851  -52.788  1.00 47.33  ? 229 VAL A O     1 
ATOM   911   C  CB    . VAL A  1 123 ? 101.275 31.768  -51.735  1.00 48.70  ? 229 VAL A CB    1 
ATOM   912   C  CG1   . VAL A  1 123 ? 100.745 32.665  -50.608  1.00 49.70  ? 229 VAL A CG1   1 
ATOM   913   C  CG2   . VAL A  1 123 ? 102.779 31.925  -51.841  1.00 47.86  ? 229 VAL A CG2   1 
ATOM   914   N  N     . LYS A  1 124 ? 98.592  30.398  -50.628  1.00 46.43  ? 230 LYS A N     1 
ATOM   915   C  CA    . LYS A  1 124 ? 97.142  30.598  -50.731  1.00 46.99  ? 230 LYS A CA    1 
ATOM   916   C  C     . LYS A  1 124 ? 96.914  32.075  -50.379  1.00 48.11  ? 230 LYS A C     1 
ATOM   917   O  O     . LYS A  1 124 ? 96.892  32.433  -49.205  1.00 52.34  ? 230 LYS A O     1 
ATOM   918   C  CB    . LYS A  1 124 ? 96.372  29.642  -49.795  1.00 44.64  ? 230 LYS A CB    1 
ATOM   919   N  N     . TRP A  1 125 ? 96.790  32.926  -51.404  1.00 46.94  ? 231 TRP A N     1 
ATOM   920   C  CA    . TRP A  1 125 ? 96.632  34.399  -51.258  1.00 45.62  ? 231 TRP A CA    1 
ATOM   921   C  C     . TRP A  1 125 ? 95.427  34.918  -52.034  1.00 44.69  ? 231 TRP A C     1 
ATOM   922   O  O     . TRP A  1 125 ? 95.172  34.455  -53.136  1.00 48.52  ? 231 TRP A O     1 
ATOM   923   C  CB    . TRP A  1 125 ? 97.881  35.126  -51.771  1.00 45.24  ? 231 TRP A CB    1 
ATOM   924   C  CG    . TRP A  1 125 ? 97.863  36.639  -51.588  1.00 44.17  ? 231 TRP A CG    1 
ATOM   925   C  CD1   . TRP A  1 125 ? 98.210  37.349  -50.467  1.00 44.21  ? 231 TRP A CD1   1 
ATOM   926   C  CD2   . TRP A  1 125 ? 97.506  37.602  -52.567  1.00 42.97  ? 231 TRP A CD2   1 
ATOM   927   N  NE1   . TRP A  1 125 ? 98.082  38.701  -50.689  1.00 43.42  ? 231 TRP A NE1   1 
ATOM   928   C  CE2   . TRP A  1 125 ? 97.652  38.880  -51.972  1.00 43.39  ? 231 TRP A CE2   1 
ATOM   929   C  CE3   . TRP A  1 125 ? 97.074  37.512  -53.883  1.00 42.71  ? 231 TRP A CE3   1 
ATOM   930   C  CZ2   . TRP A  1 125 ? 97.374  40.055  -52.651  1.00 44.44  ? 231 TRP A CZ2   1 
ATOM   931   C  CZ3   . TRP A  1 125 ? 96.798  38.679  -54.564  1.00 44.02  ? 231 TRP A CZ3   1 
ATOM   932   C  CH2   . TRP A  1 125 ? 96.944  39.942  -53.949  1.00 44.94  ? 231 TRP A CH2   1 
ATOM   933   N  N     . THR A  1 126 ? 94.729  35.902  -51.466  1.00 42.12  ? 232 THR A N     1 
ATOM   934   C  CA    . THR A  1 126 ? 93.521  36.504  -52.049  1.00 39.70  ? 232 THR A CA    1 
ATOM   935   C  C     . THR A  1 126 ? 93.567  38.043  -51.981  1.00 38.81  ? 232 THR A C     1 
ATOM   936   O  O     . THR A  1 126 ? 94.358  38.608  -51.221  1.00 38.52  ? 232 THR A O     1 
ATOM   937   C  CB    . THR A  1 126 ? 92.248  36.009  -51.340  1.00 38.88  ? 232 THR A CB    1 
ATOM   938   O  OG1   . THR A  1 126 ? 92.210  36.495  -49.998  1.00 38.33  ? 232 THR A OG1   1 
ATOM   939   C  CG2   . THR A  1 126 ? 92.196  34.499  -51.299  1.00 39.24  ? 232 THR A CG2   1 
ATOM   940   N  N     . HIS A  1 127 ? 92.719  38.710  -52.773  1.00 38.05  ? 233 HIS A N     1 
ATOM   941   C  CA    . HIS A  1 127 ? 92.635  40.185  -52.775  1.00 36.85  ? 233 HIS A CA    1 
ATOM   942   C  C     . HIS A  1 127 ? 92.290  40.689  -51.374  1.00 36.28  ? 233 HIS A C     1 
ATOM   943   O  O     . HIS A  1 127 ? 92.830  41.700  -50.934  1.00 35.47  ? 233 HIS A O     1 
ATOM   944   C  CB    . HIS A  1 127 ? 91.742  40.760  -53.948  1.00 36.82  ? 233 HIS A CB    1 
ATOM   945   C  CG    . HIS A  1 127 ? 90.260  40.910  -53.669  1.00 36.92  ? 233 HIS A CG    1 
ATOM   946   N  ND1   . HIS A  1 127 ? 89.334  39.969  -54.059  1.00 37.44  ? 233 HIS A ND1   1 
ATOM   947   C  CD2   . HIS A  1 127 ? 89.528  41.947  -53.166  1.00 36.74  ? 233 HIS A CD2   1 
ATOM   948   C  CE1   . HIS A  1 127 ? 88.110  40.376  -53.728  1.00 36.72  ? 233 HIS A CE1   1 
ATOM   949   N  NE2   . HIS A  1 127 ? 88.191  41.579  -53.187  1.00 34.49  ? 233 HIS A NE2   1 
ATOM   950   N  N     . GLU A  1 128 ? 91.466  39.922  -50.662  1.00 37.84  ? 234 GLU A N     1 
ATOM   951   C  CA    . GLU A  1 128 ? 90.971  40.289  -49.336  1.00 39.24  ? 234 GLU A CA    1 
ATOM   952   C  C     . GLU A  1 128 ? 92.066  40.266  -48.295  1.00 39.46  ? 234 GLU A C     1 
ATOM   953   O  O     . GLU A  1 128 ? 92.189  41.204  -47.516  1.00 36.74  ? 234 GLU A O     1 
ATOM   954   C  CB    . GLU A  1 128 ? 89.817  39.385  -48.891  1.00 41.71  ? 234 GLU A CB    1 
ATOM   955   C  CG    . GLU A  1 128 ? 88.529  39.533  -49.701  1.00 45.09  ? 234 GLU A CG    1 
ATOM   956   C  CD    . GLU A  1 128 ? 88.368  38.509  -50.813  1.00 48.08  ? 234 GLU A CD    1 
ATOM   957   O  OE1   . GLU A  1 128 ? 89.360  37.866  -51.212  1.00 49.74  ? 234 GLU A OE1   1 
ATOM   958   O  OE2   . GLU A  1 128 ? 87.231  38.370  -51.298  1.00 52.49  ? 234 GLU A OE2   1 
ATOM   959   N  N     . GLN A  1 129 ? 92.867  39.203  -48.283  1.00 41.28  ? 235 GLN A N     1 
ATOM   960   C  CA    . GLN A  1 129 ? 94.000  39.112  -47.352  1.00 41.90  ? 235 GLN A CA    1 
ATOM   961   C  C     . GLN A  1 129 ? 94.918  40.304  -47.552  1.00 39.49  ? 235 GLN A C     1 
ATOM   962   O  O     . GLN A  1 129 ? 95.414  40.875  -46.580  1.00 39.57  ? 235 GLN A O     1 
ATOM   963   C  CB    . GLN A  1 129 ? 94.791  37.816  -47.535  1.00 45.38  ? 235 GLN A CB    1 
ATOM   964   C  CG    . GLN A  1 129 ? 94.150  36.583  -46.918  1.00 49.67  ? 235 GLN A CG    1 
ATOM   965   C  CD    . GLN A  1 129 ? 94.696  35.273  -47.501  1.00 52.86  ? 235 GLN A CD    1 
ATOM   966   O  OE1   . GLN A  1 129 ? 93.945  34.329  -47.762  1.00 55.97  ? 235 GLN A OE1   1 
ATOM   967   N  NE2   . GLN A  1 129 ? 95.990  35.219  -47.724  1.00 53.08  ? 235 GLN A NE2   1 
ATOM   968   N  N     . GLY A  1 130 ? 95.123  40.668  -48.815  1.00 36.56  ? 236 GLY A N     1 
ATOM   969   C  CA    . GLY A  1 130 ? 95.880  41.849  -49.169  1.00 34.47  ? 236 GLY A CA    1 
ATOM   970   C  C     . GLY A  1 130 ? 95.265  43.124  -48.610  1.00 32.68  ? 236 GLY A C     1 
ATOM   971   O  O     . GLY A  1 130 ? 95.974  44.006  -48.145  1.00 31.31  ? 236 GLY A O     1 
ATOM   972   N  N     . SER A  1 131 ? 93.944  43.222  -48.670  1.00 32.35  ? 237 SER A N     1 
ATOM   973   C  CA    . SER A  1 131 ? 93.240  44.390  -48.143  1.00 32.33  ? 237 SER A CA    1 
ATOM   974   C  C     . SER A  1 131 ? 93.474  44.603  -46.646  1.00 32.11  ? 237 SER A C     1 
ATOM   975   O  O     . SER A  1 131 ? 93.740  45.725  -46.200  1.00 31.59  ? 237 SER A O     1 
ATOM   976   C  CB    . SER A  1 131 ? 91.736  44.315  -48.431  1.00 31.55  ? 237 SER A CB    1 
ATOM   977   O  OG    . SER A  1 131 ? 91.495  44.235  -49.818  1.00 30.80  ? 237 SER A OG    1 
ATOM   978   N  N     . VAL A  1 132 ? 93.395  43.521  -45.885  1.00 32.49  ? 238 VAL A N     1 
ATOM   979   C  CA    . VAL A  1 132 ? 93.658  43.583  -44.459  1.00 33.93  ? 238 VAL A CA    1 
ATOM   980   C  C     . VAL A  1 132 ? 95.070  44.095  -44.202  1.00 34.50  ? 238 VAL A C     1 
ATOM   981   O  O     . VAL A  1 132 ? 95.266  45.007  -43.406  1.00 33.69  ? 238 VAL A O     1 
ATOM   982   C  CB    . VAL A  1 132 ? 93.435  42.220  -43.809  1.00 33.95  ? 238 VAL A CB    1 
ATOM   983   C  CG1   . VAL A  1 132 ? 94.013  42.176  -42.399  1.00 34.71  ? 238 VAL A CG1   1 
ATOM   984   C  CG2   . VAL A  1 132 ? 91.943  41.967  -43.737  1.00 33.52  ? 238 VAL A CG2   1 
ATOM   985   N  N     . MET A  1 133 ? 96.043  43.509  -44.884  1.00 37.04  ? 239 MET A N     1 
ATOM   986   C  CA    . MET A  1 133 ? 97.432  43.926  -44.726  1.00 40.12  ? 239 MET A CA    1 
ATOM   987   C  C     . MET A  1 133 ? 97.668  45.363  -45.157  1.00 36.94  ? 239 MET A C     1 
ATOM   988   O  O     . MET A  1 133 ? 98.351  46.120  -44.473  1.00 35.54  ? 239 MET A O     1 
ATOM   989   C  CB    . MET A  1 133 ? 98.353  43.018  -45.526  1.00 45.36  ? 239 MET A CB    1 
ATOM   990   C  CG    . MET A  1 133 ? 98.493  41.625  -44.991  1.00 49.48  ? 239 MET A CG    1 
ATOM   991   S  SD    . MET A  1 133 ? 99.591  40.749  -46.155  1.00 61.58  ? 239 MET A SD    1 
ATOM   992   C  CE    . MET A  1 133 ? 101.195 41.335  -45.584  1.00 61.69  ? 239 MET A CE    1 
ATOM   993   N  N     . MET A  1 134 ? 97.101  45.724  -46.298  1.00 34.00  ? 240 MET A N     1 
ATOM   994   C  CA    . MET A  1 134 ? 97.245  47.064  -46.830  1.00 32.36  ? 240 MET A CA    1 
ATOM   995   C  C     . MET A  1 134 ? 96.499  48.077  -45.952  1.00 32.94  ? 240 MET A C     1 
ATOM   996   O  O     . MET A  1 134 ? 96.924  49.224  -45.849  1.00 31.83  ? 240 MET A O     1 
ATOM   997   C  CB    . MET A  1 134 ? 96.771  47.100  -48.276  1.00 30.79  ? 240 MET A CB    1 
ATOM   998   C  CG    . MET A  1 134 ? 96.881  48.445  -48.977  1.00 30.62  ? 240 MET A CG    1 
ATOM   999   S  SD    . MET A  1 134 ? 98.534  49.111  -49.186  1.00 30.58  ? 240 MET A SD    1 
ATOM   1000  C  CE    . MET A  1 134 ? 99.157  48.123  -50.523  1.00 30.48  ? 240 MET A CE    1 
ATOM   1001  N  N     . PHE A  1 135 ? 95.412  47.652  -45.306  1.00 34.04  ? 241 PHE A N     1 
ATOM   1002  C  CA    . PHE A  1 135 ? 94.701  48.525  -44.370  1.00 34.55  ? 241 PHE A CA    1 
ATOM   1003  C  C     . PHE A  1 135 ? 95.558  48.852  -43.150  1.00 36.71  ? 241 PHE A C     1 
ATOM   1004  O  O     . PHE A  1 135 ? 95.675  50.011  -42.767  1.00 35.38  ? 241 PHE A O     1 
ATOM   1005  C  CB    . PHE A  1 135 ? 93.392  47.880  -43.924  1.00 33.34  ? 241 PHE A CB    1 
ATOM   1006  C  CG    . PHE A  1 135 ? 92.605  48.713  -42.954  1.00 31.85  ? 241 PHE A CG    1 
ATOM   1007  C  CD1   . PHE A  1 135 ? 92.140  49.959  -43.318  1.00 31.44  ? 241 PHE A CD1   1 
ATOM   1008  C  CD2   . PHE A  1 135 ? 92.311  48.240  -41.695  1.00 31.54  ? 241 PHE A CD2   1 
ATOM   1009  C  CE1   . PHE A  1 135 ? 91.395  50.729  -42.429  1.00 31.17  ? 241 PHE A CE1   1 
ATOM   1010  C  CE2   . PHE A  1 135 ? 91.570  48.997  -40.801  1.00 31.70  ? 241 PHE A CE2   1 
ATOM   1011  C  CZ    . PHE A  1 135 ? 91.118  50.250  -41.172  1.00 31.52  ? 241 PHE A CZ    1 
ATOM   1012  N  N     . GLU A  1 136 ? 96.146  47.813  -42.557  1.00 40.26  ? 242 GLU A N     1 
ATOM   1013  C  CA    . GLU A  1 136 ? 97.125  47.945  -41.468  1.00 43.90  ? 242 GLU A CA    1 
ATOM   1014  C  C     . GLU A  1 136 ? 98.235  48.923  -41.871  1.00 44.56  ? 242 GLU A C     1 
ATOM   1015  O  O     . GLU A  1 136 ? 98.504  49.872  -41.140  1.00 45.34  ? 242 GLU A O     1 
ATOM   1016  C  CB    . GLU A  1 136 ? 97.695  46.563  -41.093  1.00 46.68  ? 242 GLU A CB    1 
ATOM   1017  C  CG    . GLU A  1 136 ? 98.691  46.517  -39.921  1.00 49.16  ? 242 GLU A CG    1 
ATOM   1018  C  CD    . GLU A  1 136 ? 98.098  46.809  -38.543  1.00 51.01  ? 242 GLU A CD    1 
ATOM   1019  O  OE1   . GLU A  1 136 ? 96.887  46.615  -38.344  1.00 52.73  ? 242 GLU A OE1   1 
ATOM   1020  O  OE2   . GLU A  1 136 ? 98.855  47.219  -37.633  1.00 52.41  ? 242 GLU A OE2   1 
ATOM   1021  N  N     . HIS A  1 137 ? 98.836  48.715  -43.042  1.00 43.75  ? 243 HIS A N     1 
ATOM   1022  C  CA    . HIS A  1 137 ? 99.906  49.598  -43.531  1.00 42.98  ? 243 HIS A CA    1 
ATOM   1023  C  C     . HIS A  1 137 ? 99.435  51.043  -43.686  1.00 42.54  ? 243 HIS A C     1 
ATOM   1024  O  O     . HIS A  1 137 ? 100.166 51.957  -43.345  1.00 43.31  ? 243 HIS A O     1 
ATOM   1025  C  CB    . HIS A  1 137 ? 100.523 49.075  -44.848  1.00 42.44  ? 243 HIS A CB    1 
ATOM   1026  C  CG    . HIS A  1 137 ? 101.626 49.929  -45.383  1.00 42.11  ? 243 HIS A CG    1 
ATOM   1027  N  ND1   . HIS A  1 137 ? 102.616 50.465  -44.584  1.00 43.14  ? 243 HIS A ND1   1 
ATOM   1028  C  CD2   . HIS A  1 137 ? 101.895 50.347  -46.643  1.00 42.86  ? 243 HIS A CD2   1 
ATOM   1029  C  CE1   . HIS A  1 137 ? 103.441 51.187  -45.328  1.00 44.40  ? 243 HIS A CE1   1 
ATOM   1030  N  NE2   . HIS A  1 137 ? 103.043 51.110  -46.590  1.00 44.22  ? 243 HIS A NE2   1 
ATOM   1031  N  N     . LEU A  1 138 ? 98.217  51.230  -44.177  1.00 43.04  ? 244 LEU A N     1 
ATOM   1032  C  CA    . LEU A  1 138 ? 97.644  52.567  -44.356  1.00 44.14  ? 244 LEU A CA    1 
ATOM   1033  C  C     . LEU A  1 138 ? 97.513  53.298  -43.029  1.00 45.73  ? 244 LEU A C     1 
ATOM   1034  O  O     . LEU A  1 138 ? 97.889  54.464  -42.921  1.00 46.70  ? 244 LEU A O     1 
ATOM   1035  C  CB    . LEU A  1 138 ? 96.266  52.477  -45.012  1.00 43.97  ? 244 LEU A CB    1 
ATOM   1036  C  CG    . LEU A  1 138 ? 95.654  53.759  -45.585  1.00 43.96  ? 244 LEU A CG    1 
ATOM   1037  C  CD1   . LEU A  1 138 ? 94.599  53.396  -46.612  1.00 44.64  ? 244 LEU A CD1   1 
ATOM   1038  C  CD2   . LEU A  1 138 ? 95.014  54.671  -44.540  1.00 44.05  ? 244 LEU A CD2   1 
ATOM   1039  N  N     . ILE A  1 139 ? 96.965  52.599  -42.039  1.00 47.52  ? 245 ILE A N     1 
ATOM   1040  C  CA    . ILE A  1 139 ? 96.725  53.154  -40.709  1.00 47.87  ? 245 ILE A CA    1 
ATOM   1041  C  C     . ILE A  1 139 ? 98.041  53.598  -40.060  1.00 46.52  ? 245 ILE A C     1 
ATOM   1042  O  O     . ILE A  1 139 ? 98.147  54.723  -39.557  1.00 46.20  ? 245 ILE A O     1 
ATOM   1043  C  CB    . ILE A  1 139 ? 96.015  52.110  -39.798  1.00 48.95  ? 245 ILE A CB    1 
ATOM   1044  C  CG1   . ILE A  1 139 ? 94.594  51.790  -40.304  1.00 50.23  ? 245 ILE A CG1   1 
ATOM   1045  C  CG2   . ILE A  1 139 ? 95.936  52.580  -38.345  1.00 49.04  ? 245 ILE A CG2   1 
ATOM   1046  C  CD1   . ILE A  1 139 ? 93.618  52.962  -40.292  1.00 51.60  ? 245 ILE A CD1   1 
ATOM   1047  N  N     . ASN A  1 140 ? 99.035  52.712  -40.096  1.00 45.38  ? 246 ASN A N     1 
ATOM   1048  C  CA    . ASN A  1 140 ? 100.294 52.927  -39.399  1.00 44.26  ? 246 ASN A CA    1 
ATOM   1049  C  C     . ASN A  1 140 ? 101.128 53.987  -40.082  1.00 44.57  ? 246 ASN A C     1 
ATOM   1050  O  O     . ASN A  1 140 ? 101.606 54.909  -39.435  1.00 46.52  ? 246 ASN A O     1 
ATOM   1051  C  CB    . ASN A  1 140 ? 101.083 51.623  -39.289  1.00 43.23  ? 246 ASN A CB    1 
ATOM   1052  C  CG    . ASN A  1 140 ? 100.330 50.547  -38.522  1.00 41.61  ? 246 ASN A CG    1 
ATOM   1053  O  OD1   . ASN A  1 140 ? 99.509  50.838  -37.662  1.00 40.03  ? 246 ASN A OD1   1 
ATOM   1054  N  ND2   . ASN A  1 140 ? 100.609 49.292  -38.845  1.00 41.28  ? 246 ASN A ND2   1 
ATOM   1055  N  N     . SER A  1 141 ? 101.281 53.886  -41.393  1.00 43.82  ? 247 SER A N     1 
ATOM   1056  C  CA    . SER A  1 141 ? 102.099 54.842  -42.117  1.00 43.59  ? 247 SER A CA    1 
ATOM   1057  C  C     . SER A  1 141 ? 101.489 56.262  -42.216  1.00 41.82  ? 247 SER A C     1 
ATOM   1058  O  O     . SER A  1 141 ? 102.194 57.182  -42.572  1.00 43.02  ? 247 SER A O     1 
ATOM   1059  C  CB    . SER A  1 141 ? 102.453 54.289  -43.497  1.00 44.81  ? 247 SER A CB    1 
ATOM   1060  O  OG    . SER A  1 141 ? 101.285 54.220  -44.280  1.00 47.22  ? 247 SER A OG    1 
ATOM   1061  N  N     . ASN A  1 142 ? 100.215 56.456  -41.895  1.00 40.61  ? 248 ASN A N     1 
ATOM   1062  C  CA    . ASN A  1 142 ? 99.589  57.794  -41.988  1.00 41.17  ? 248 ASN A CA    1 
ATOM   1063  C  C     . ASN A  1 142 ? 99.018  58.369  -40.675  1.00 44.15  ? 248 ASN A C     1 
ATOM   1064  O  O     . ASN A  1 142 ? 98.334  59.385  -40.694  1.00 45.68  ? 248 ASN A O     1 
ATOM   1065  C  CB    . ASN A  1 142 ? 98.490  57.765  -43.052  1.00 38.43  ? 248 ASN A CB    1 
ATOM   1066  C  CG    . ASN A  1 142 ? 99.018  57.431  -44.421  1.00 36.23  ? 248 ASN A CG    1 
ATOM   1067  O  OD1   . ASN A  1 142 ? 99.662  58.259  -45.047  1.00 35.39  ? 248 ASN A OD1   1 
ATOM   1068  N  ND2   . ASN A  1 142 ? 98.734  56.225  -44.900  1.00 34.65  ? 248 ASN A ND2   1 
ATOM   1069  N  N     . GLY A  1 143 ? 99.290  57.721  -39.550  1.00 46.18  ? 249 GLY A N     1 
ATOM   1070  C  CA    . GLY A  1 143 ? 98.864  58.210  -38.237  1.00 47.09  ? 249 GLY A CA    1 
ATOM   1071  C  C     . GLY A  1 143 ? 97.362  58.402  -38.109  1.00 46.91  ? 249 GLY A C     1 
ATOM   1072  O  O     . GLY A  1 143 ? 96.882  59.450  -37.656  1.00 48.89  ? 249 GLY A O     1 
ATOM   1073  N  N     . ILE A  1 144 ? 96.632  57.381  -38.514  1.00 46.41  ? 250 ILE A N     1 
ATOM   1074  C  CA    . ILE A  1 144 ? 95.187  57.432  -38.530  1.00 47.21  ? 250 ILE A CA    1 
ATOM   1075  C  C     . ILE A  1 144 ? 94.622  57.163  -37.145  1.00 47.85  ? 250 ILE A C     1 
ATOM   1076  O  O     . ILE A  1 144 ? 93.582  57.725  -36.785  1.00 47.67  ? 250 ILE A O     1 
ATOM   1077  C  CB    . ILE A  1 144 ? 94.626  56.427  -39.571  1.00 47.64  ? 250 ILE A CB    1 
ATOM   1078  C  CG1   . ILE A  1 144 ? 95.129  56.785  -40.986  1.00 48.81  ? 250 ILE A CG1   1 
ATOM   1079  C  CG2   . ILE A  1 144 ? 93.104  56.372  -39.555  1.00 46.48  ? 250 ILE A CG2   1 
ATOM   1080  C  CD1   . ILE A  1 144 ? 94.855  58.210  -41.435  1.00 49.24  ? 250 ILE A CD1   1 
ATOM   1081  N  N     . LYS A  1 145 ? 95.313  56.311  -36.377  1.00 48.06  ? 251 LYS A N     1 
ATOM   1082  C  CA    . LYS A  1 145 ? 94.852  55.901  -35.047  1.00 47.43  ? 251 LYS A CA    1 
ATOM   1083  C  C     . LYS A  1 145 ? 94.440  57.071  -34.121  1.00 47.43  ? 251 LYS A C     1 
ATOM   1084  O  O     . LYS A  1 145 ? 93.397  57.005  -33.498  1.00 46.04  ? 251 LYS A O     1 
ATOM   1085  C  CB    . LYS A  1 145 ? 95.895  55.007  -34.377  1.00 46.55  ? 251 LYS A CB    1 
ATOM   1086  C  CG    . LYS A  1 145 ? 95.912  53.550  -34.812  1.00 45.38  ? 251 LYS A CG    1 
ATOM   1087  C  CD    . LYS A  1 145 ? 96.628  52.713  -33.752  1.00 46.83  ? 251 LYS A CD    1 
ATOM   1088  C  CE    . LYS A  1 145 ? 96.644  51.229  -34.028  1.00 47.66  ? 251 LYS A CE    1 
ATOM   1089  N  NZ    . LYS A  1 145 ? 97.635  50.887  -35.101  1.00 49.67  ? 251 LYS A NZ    1 
ATOM   1090  N  N     . PRO A  1 146 ? 95.253  58.143  -34.034  1.00 48.47  ? 252 PRO A N     1 
ATOM   1091  C  CA    . PRO A  1 146 ? 94.840  59.367  -33.335  1.00 48.67  ? 252 PRO A CA    1 
ATOM   1092  C  C     . PRO A  1 146 ? 93.533  59.972  -33.833  1.00 47.66  ? 252 PRO A C     1 
ATOM   1093  O  O     . PRO A  1 146 ? 92.719  60.430  -33.035  1.00 50.34  ? 252 PRO A O     1 
ATOM   1094  C  CB    . PRO A  1 146 ? 95.967  60.340  -33.640  1.00 50.45  ? 252 PRO A CB    1 
ATOM   1095  C  CG    . PRO A  1 146 ? 97.163  59.489  -33.837  1.00 50.93  ? 252 PRO A CG    1 
ATOM   1096  C  CD    . PRO A  1 146 ? 96.691  58.173  -34.368  1.00 50.15  ? 252 PRO A CD    1 
ATOM   1097  N  N     . VAL A  1 147 ? 93.353  59.971  -35.151  1.00 45.57  ? 253 VAL A N     1 
ATOM   1098  C  CA    . VAL A  1 147 ? 92.172  60.563  -35.772  1.00 44.70  ? 253 VAL A CA    1 
ATOM   1099  C  C     . VAL A  1 147 ? 90.935  59.703  -35.494  1.00 43.53  ? 253 VAL A C     1 
ATOM   1100  O  O     . VAL A  1 147 ? 89.852  60.232  -35.285  1.00 39.86  ? 253 VAL A O     1 
ATOM   1101  C  CB    . VAL A  1 147 ? 92.324  60.745  -37.305  1.00 44.58  ? 253 VAL A CB    1 
ATOM   1102  C  CG1   . VAL A  1 147 ? 91.180  61.582  -37.870  1.00 44.51  ? 253 VAL A CG1   1 
ATOM   1103  C  CG2   . VAL A  1 147 ? 93.653  61.401  -37.673  1.00 44.49  ? 253 VAL A CG2   1 
ATOM   1104  N  N     . MET A  1 148 ? 91.097  58.380  -35.491  1.00 44.34  ? 254 MET A N     1 
ATOM   1105  C  CA    . MET A  1 148 ? 89.994  57.485  -35.145  1.00 44.96  ? 254 MET A CA    1 
ATOM   1106  C  C     . MET A  1 148 ? 89.472  57.799  -33.737  1.00 45.79  ? 254 MET A C     1 
ATOM   1107  O  O     . MET A  1 148 ? 88.260  57.952  -33.534  1.00 45.16  ? 254 MET A O     1 
ATOM   1108  C  CB    . MET A  1 148 ? 90.422  56.023  -35.238  1.00 44.38  ? 254 MET A CB    1 
ATOM   1109  C  CG    . MET A  1 148 ? 90.677  55.564  -36.647  1.00 44.86  ? 254 MET A CG    1 
ATOM   1110  S  SD    . MET A  1 148 ? 91.298  53.926  -36.856  1.00 46.83  ? 254 MET A SD    1 
ATOM   1111  C  CE    . MET A  1 148 ? 89.870  52.965  -36.374  1.00 48.99  ? 254 MET A CE    1 
ATOM   1112  N  N     . GLU A  1 149 ? 90.404  57.921  -32.785  1.00 48.45  ? 255 GLU A N     1 
ATOM   1113  C  CA    . GLU A  1 149 ? 90.083  58.264  -31.400  1.00 49.86  ? 255 GLU A CA    1 
ATOM   1114  C  C     . GLU A  1 149 ? 89.366  59.595  -31.322  1.00 47.75  ? 255 GLU A C     1 
ATOM   1115  O  O     . GLU A  1 149 ? 88.342  59.690  -30.658  1.00 45.34  ? 255 GLU A O     1 
ATOM   1116  C  CB    . GLU A  1 149 ? 91.339  58.291  -30.519  1.00 52.89  ? 255 GLU A CB    1 
ATOM   1117  C  CG    . GLU A  1 149 ? 91.845  56.906  -30.107  1.00 56.17  ? 255 GLU A CG    1 
ATOM   1118  C  CD    . GLU A  1 149 ? 93.287  56.924  -29.562  1.00 61.38  ? 255 GLU A CD    1 
ATOM   1119  O  OE1   . GLU A  1 149 ? 93.867  58.025  -29.349  1.00 66.43  ? 255 GLU A OE1   1 
ATOM   1120  O  OE2   . GLU A  1 149 ? 93.883  55.817  -29.446  1.00 65.75  ? 255 GLU A OE2   1 
ATOM   1121  N  N     . GLN A  1 150 ? 89.888  60.593  -32.030  1.00 46.73  ? 256 GLN A N     1 
ATOM   1122  C  CA    . GLN A  1 150 ? 89.285  61.918  -32.075  1.00 47.87  ? 256 GLN A CA    1 
ATOM   1123  C  C     . GLN A  1 150 ? 87.802  61.880  -32.422  1.00 45.18  ? 256 GLN A C     1 
ATOM   1124  O  O     . GLN A  1 150 ? 87.034  62.668  -31.889  1.00 44.86  ? 256 GLN A O     1 
ATOM   1125  C  CB    . GLN A  1 150 ? 90.017  62.810  -33.087  1.00 52.85  ? 256 GLN A CB    1 
ATOM   1126  C  CG    . GLN A  1 150 ? 89.547  64.270  -33.113  1.00 55.62  ? 256 GLN A CG    1 
ATOM   1127  C  CD    . GLN A  1 150 ? 90.025  65.026  -34.333  1.00 58.48  ? 256 GLN A CD    1 
ATOM   1128  O  OE1   . GLN A  1 150 ? 91.046  64.663  -34.951  1.00 58.98  ? 256 GLN A OE1   1 
ATOM   1129  N  NE2   . GLN A  1 150 ? 89.288  66.083  -34.694  1.00 60.77  ? 256 GLN A NE2   1 
ATOM   1130  N  N     . TYR A  1 151 ? 87.400  60.967  -33.305  1.00 43.09  ? 257 TYR A N     1 
ATOM   1131  C  CA    . TYR A  1 151 ? 85.990  60.826  -33.700  1.00 40.06  ? 257 TYR A CA    1 
ATOM   1132  C  C     . TYR A  1 151 ? 85.277  59.654  -33.003  1.00 40.21  ? 257 TYR A C     1 
ATOM   1133  O  O     . TYR A  1 151 ? 84.329  59.086  -33.546  1.00 43.50  ? 257 TYR A O     1 
ATOM   1134  C  CB    . TYR A  1 151 ? 85.890  60.724  -35.227  1.00 37.79  ? 257 TYR A CB    1 
ATOM   1135  C  CG    . TYR A  1 151 ? 86.288  61.996  -35.931  1.00 36.55  ? 257 TYR A CG    1 
ATOM   1136  C  CD1   . TYR A  1 151 ? 85.439  63.092  -35.955  1.00 36.35  ? 257 TYR A CD1   1 
ATOM   1137  C  CD2   . TYR A  1 151 ? 87.514  62.102  -36.590  1.00 35.99  ? 257 TYR A CD2   1 
ATOM   1138  C  CE1   . TYR A  1 151 ? 85.791  64.269  -36.614  1.00 36.05  ? 257 TYR A CE1   1 
ATOM   1139  C  CE2   . TYR A  1 151 ? 87.891  63.282  -37.237  1.00 35.97  ? 257 TYR A CE2   1 
ATOM   1140  C  CZ    . TYR A  1 151 ? 87.022  64.357  -37.235  1.00 36.22  ? 257 TYR A CZ    1 
ATOM   1141  O  OH    . TYR A  1 151 ? 87.399  65.521  -37.868  1.00 36.98  ? 257 TYR A OH    1 
ATOM   1142  N  N     . GLY A  1 152 ? 85.726  59.295  -31.805  1.00 38.97  ? 258 GLY A N     1 
ATOM   1143  C  CA    . GLY A  1 152 ? 85.000  58.345  -30.974  1.00 38.45  ? 258 GLY A CA    1 
ATOM   1144  C  C     . GLY A  1 152 ? 85.201  56.873  -31.237  1.00 36.52  ? 258 GLY A C     1 
ATOM   1145  O  O     . GLY A  1 152 ? 84.473  56.061  -30.689  1.00 36.67  ? 258 GLY A O     1 
ATOM   1146  N  N     . LEU A  1 153 ? 86.184  56.510  -32.053  1.00 35.39  ? 259 LEU A N     1 
ATOM   1147  C  CA    . LEU A  1 153 ? 86.460  55.093  -32.281  1.00 36.61  ? 259 LEU A CA    1 
ATOM   1148  C  C     . LEU A  1 153 ? 87.458  54.592  -31.254  1.00 37.79  ? 259 LEU A C     1 
ATOM   1149  O  O     . LEU A  1 153 ? 88.174  55.378  -30.625  1.00 38.54  ? 259 LEU A O     1 
ATOM   1150  C  CB    . LEU A  1 153 ? 86.987  54.842  -33.698  1.00 37.03  ? 259 LEU A CB    1 
ATOM   1151  C  CG    . LEU A  1 153 ? 85.888  54.591  -34.759  1.00 37.35  ? 259 LEU A CG    1 
ATOM   1152  C  CD1   . LEU A  1 153 ? 85.057  55.845  -34.980  1.00 38.31  ? 259 LEU A CD1   1 
ATOM   1153  C  CD2   . LEU A  1 153 ? 86.490  54.149  -36.068  1.00 37.19  ? 259 LEU A CD2   1 
ATOM   1154  N  N     . ILE A  1 154 ? 87.509  53.275  -31.105  1.00 39.39  ? 260 ILE A N     1 
ATOM   1155  C  CA    . ILE A  1 154 ? 88.455  52.612  -30.224  1.00 42.78  ? 260 ILE A CA    1 
ATOM   1156  C  C     . ILE A  1 154 ? 89.319  51.663  -31.071  1.00 44.51  ? 260 ILE A C     1 
ATOM   1157  O  O     . ILE A  1 154 ? 88.941  50.523  -31.311  1.00 46.65  ? 260 ILE A O     1 
ATOM   1158  C  CB    . ILE A  1 154 ? 87.698  51.849  -29.119  1.00 44.26  ? 260 ILE A CB    1 
ATOM   1159  C  CG1   . ILE A  1 154 ? 86.847  52.834  -28.315  1.00 45.01  ? 260 ILE A CG1   1 
ATOM   1160  C  CG2   . ILE A  1 154 ? 88.669  51.101  -28.205  1.00 45.82  ? 260 ILE A CG2   1 
ATOM   1161  C  CD1   . ILE A  1 154 ? 85.934  52.190  -27.304  1.00 46.34  ? 260 ILE A CD1   1 
ATOM   1162  N  N     . PRO A  1 155 ? 90.492  52.136  -31.531  1.00 45.30  ? 261 PRO A N     1 
ATOM   1163  C  CA    . PRO A  1 155 ? 91.339  51.377  -32.449  1.00 47.38  ? 261 PRO A CA    1 
ATOM   1164  C  C     . PRO A  1 155 ? 91.564  49.902  -32.111  1.00 51.52  ? 261 PRO A C     1 
ATOM   1165  O  O     . PRO A  1 155 ? 91.521  49.080  -33.007  1.00 54.63  ? 261 PRO A O     1 
ATOM   1166  C  CB    . PRO A  1 155 ? 92.651  52.141  -32.406  1.00 47.24  ? 261 PRO A CB    1 
ATOM   1167  C  CG    . PRO A  1 155 ? 92.223  53.538  -32.212  1.00 46.39  ? 261 PRO A CG    1 
ATOM   1168  C  CD    . PRO A  1 155 ? 91.014  53.499  -31.329  1.00 45.92  ? 261 PRO A CD    1 
ATOM   1169  N  N     . GLU A  1 156 ? 91.792  49.567  -30.846  1.00 57.26  ? 262 GLU A N     1 
ATOM   1170  C  CA    . GLU A  1 156 ? 91.926  48.149  -30.468  1.00 63.06  ? 262 GLU A CA    1 
ATOM   1171  C  C     . GLU A  1 156 ? 90.787  47.302  -30.986  1.00 58.61  ? 262 GLU A C     1 
ATOM   1172  O  O     . GLU A  1 156 ? 90.996  46.404  -31.787  1.00 57.29  ? 262 GLU A O     1 
ATOM   1173  C  CB    . GLU A  1 156 ? 92.129  47.991  -28.950  1.00 72.66  ? 262 GLU A CB    1 
ATOM   1174  C  CG    . GLU A  1 156 ? 93.569  48.348  -28.524  1.00 79.70  ? 262 GLU A CG    1 
ATOM   1175  C  CD    . GLU A  1 156 ? 94.598  47.417  -29.158  1.00 84.81  ? 262 GLU A CD    1 
ATOM   1176  O  OE1   . GLU A  1 156 ? 94.406  46.167  -29.047  1.00 88.57  ? 262 GLU A OE1   1 
ATOM   1177  O  OE2   . GLU A  1 156 ? 95.575  47.926  -29.764  1.00 89.65  ? 262 GLU A OE2   1 
ATOM   1178  N  N     . GLU A  1 157 ? 89.585  47.632  -30.556  1.00 55.31  ? 263 GLU A N     1 
ATOM   1179  C  CA    . GLU A  1 157 ? 88.355  46.888  -30.945  1.00 55.24  ? 263 GLU A CA    1 
ATOM   1180  C  C     . GLU A  1 157 ? 87.977  47.081  -32.395  1.00 52.50  ? 263 GLU A C     1 
ATOM   1181  O  O     . GLU A  1 157 ? 87.656  46.142  -33.073  1.00 56.20  ? 263 GLU A O     1 
ATOM   1182  C  CB    . GLU A  1 157 ? 87.176  47.314  -30.061  1.00 58.29  ? 263 GLU A CB    1 
ATOM   1183  C  CG    . GLU A  1 157 ? 87.281  46.864  -28.620  1.00 63.41  ? 263 GLU A CG    1 
ATOM   1184  C  CD    . GLU A  1 157 ? 86.312  47.572  -27.689  1.00 66.26  ? 263 GLU A CD    1 
ATOM   1185  O  OE1   . GLU A  1 157 ? 85.316  48.186  -28.149  1.00 67.33  ? 263 GLU A OE1   1 
ATOM   1186  O  OE2   . GLU A  1 157 ? 86.573  47.520  -26.481  1.00 68.18  ? 263 GLU A OE2   1 
ATOM   1187  N  N     . ASP A  1 158 ? 87.992  48.322  -32.854  1.00 48.86  ? 264 ASP A N     1 
ATOM   1188  C  CA    . ASP A  1 158 ? 87.408  48.682  -34.163  1.00 44.98  ? 264 ASP A CA    1 
ATOM   1189  C  C     . ASP A  1 158 ? 88.259  48.313  -35.374  1.00 44.72  ? 264 ASP A C     1 
ATOM   1190  O  O     . ASP A  1 158 ? 87.709  47.914  -36.395  1.00 47.12  ? 264 ASP A O     1 
ATOM   1191  C  CB    . ASP A  1 158 ? 87.063  50.147  -34.199  1.00 42.77  ? 264 ASP A CB    1 
ATOM   1192  C  CG    . ASP A  1 158 ? 85.956  50.505  -33.217  1.00 42.37  ? 264 ASP A CG    1 
ATOM   1193  O  OD1   . ASP A  1 158 ? 85.117  49.685  -32.890  1.00 41.67  ? 264 ASP A OD1   1 
ATOM   1194  O  OD2   . ASP A  1 158 ? 85.932  51.703  -32.793  1.00 41.74  ? 264 ASP A OD2   1 
ATOM   1195  N  N     . ILE A  1 159 ? 89.580  48.440  -35.291  1.00 42.64  ? 265 ILE A N     1 
ATOM   1196  C  CA    . ILE A  1 159 ? 90.440  47.995  -36.392  1.00 42.40  ? 265 ILE A CA    1 
ATOM   1197  C  C     . ILE A  1 159 ? 90.313  46.492  -36.595  1.00 42.36  ? 265 ILE A C     1 
ATOM   1198  O  O     . ILE A  1 159 ? 90.441  46.013  -37.709  1.00 43.22  ? 265 ILE A O     1 
ATOM   1199  C  CB    . ILE A  1 159 ? 91.919  48.399  -36.188  1.00 44.33  ? 265 ILE A CB    1 
ATOM   1200  C  CG1   . ILE A  1 159 ? 92.074  49.891  -36.406  1.00 44.45  ? 265 ILE A CG1   1 
ATOM   1201  C  CG2   . ILE A  1 159 ? 92.865  47.628  -37.127  1.00 45.33  ? 265 ILE A CG2   1 
ATOM   1202  C  CD1   . ILE A  1 159 ? 93.385  50.483  -35.942  1.00 45.07  ? 265 ILE A CD1   1 
ATOM   1203  N  N     . CYS A  1 160 ? 90.061  45.748  -35.534  1.00 42.48  ? 266 CYS A N     1 
ATOM   1204  C  CA    . CYS A  1 160 ? 89.760  44.324  -35.659  1.00 42.23  ? 266 CYS A CA    1 
ATOM   1205  C  C     . CYS A  1 160 ? 88.426  44.136  -36.387  1.00 39.29  ? 266 CYS A C     1 
ATOM   1206  O  O     . CYS A  1 160 ? 88.331  43.351  -37.324  1.00 39.57  ? 266 CYS A O     1 
ATOM   1207  C  CB    . CYS A  1 160 ? 89.727  43.648  -34.285  1.00 43.56  ? 266 CYS A CB    1 
ATOM   1208  S  SG    . CYS A  1 160 ? 89.171  41.953  -34.269  1.00 47.75  ? 266 CYS A SG    1 
ATOM   1209  N  N     . PHE A  1 161 ? 87.411  44.875  -35.954  1.00 35.77  ? 267 PHE A N     1 
ATOM   1210  C  CA    . PHE A  1 161 ? 86.074  44.833  -36.549  1.00 33.97  ? 267 PHE A CA    1 
ATOM   1211  C  C     . PHE A  1 161 ? 86.095  45.138  -38.046  1.00 33.19  ? 267 PHE A C     1 
ATOM   1212  O  O     . PHE A  1 161 ? 85.416  44.466  -38.822  1.00 34.61  ? 267 PHE A O     1 
ATOM   1213  C  CB    . PHE A  1 161 ? 85.167  45.835  -35.823  1.00 33.35  ? 267 PHE A CB    1 
ATOM   1214  C  CG    . PHE A  1 161 ? 83.777  45.956  -36.391  1.00 32.60  ? 267 PHE A CG    1 
ATOM   1215  C  CD1   . PHE A  1 161 ? 83.047  44.814  -36.699  1.00 32.29  ? 267 PHE A CD1   1 
ATOM   1216  C  CD2   . PHE A  1 161 ? 83.168  47.212  -36.560  1.00 32.17  ? 267 PHE A CD2   1 
ATOM   1217  C  CE1   . PHE A  1 161 ? 81.763  44.903  -37.180  1.00 32.11  ? 267 PHE A CE1   1 
ATOM   1218  C  CE2   . PHE A  1 161 ? 81.886  47.306  -37.030  1.00 31.90  ? 267 PHE A CE2   1 
ATOM   1219  C  CZ    . PHE A  1 161 ? 81.183  46.156  -37.346  1.00 31.81  ? 267 PHE A CZ    1 
ATOM   1220  N  N     . ILE A  1 162 ? 86.865  46.148  -38.434  1.00 31.20  ? 268 ILE A N     1 
ATOM   1221  C  CA    . ILE A  1 162 ? 87.011  46.516  -39.835  1.00 30.29  ? 268 ILE A CA    1 
ATOM   1222  C  C     . ILE A  1 162 ? 87.662  45.382  -40.638  1.00 30.66  ? 268 ILE A C     1 
ATOM   1223  O  O     . ILE A  1 162 ? 87.163  44.993  -41.676  1.00 28.79  ? 268 ILE A O     1 
ATOM   1224  C  CB    . ILE A  1 162 ? 87.799  47.839  -39.975  1.00 29.45  ? 268 ILE A CB    1 
ATOM   1225  C  CG1   . ILE A  1 162 ? 86.939  48.993  -39.497  1.00 29.50  ? 268 ILE A CG1   1 
ATOM   1226  C  CG2   . ILE A  1 162 ? 88.239  48.087  -41.406  1.00 29.08  ? 268 ILE A CG2   1 
ATOM   1227  C  CD1   . ILE A  1 162 ? 87.697  50.252  -39.138  1.00 29.97  ? 268 ILE A CD1   1 
ATOM   1228  N  N     . LYS A  1 163 ? 88.768  44.853  -40.137  1.00 33.21  ? 269 LYS A N     1 
ATOM   1229  C  CA    . LYS A  1 163 ? 89.450  43.741  -40.799  1.00 36.01  ? 269 LYS A CA    1 
ATOM   1230  C  C     . LYS A  1 163 ? 88.550  42.521  -40.893  1.00 35.09  ? 269 LYS A C     1 
ATOM   1231  O  O     . LYS A  1 163 ? 88.525  41.842  -41.902  1.00 33.63  ? 269 LYS A O     1 
ATOM   1232  C  CB    . LYS A  1 163 ? 90.737  43.367  -40.067  1.00 39.56  ? 269 LYS A CB    1 
ATOM   1233  C  CG    . LYS A  1 163 ? 91.867  44.379  -40.165  1.00 42.31  ? 269 LYS A CG    1 
ATOM   1234  C  CD    . LYS A  1 163 ? 93.022  43.967  -39.268  1.00 45.70  ? 269 LYS A CD    1 
ATOM   1235  C  CE    . LYS A  1 163 ? 94.212  44.904  -39.375  1.00 48.33  ? 269 LYS A CE    1 
ATOM   1236  N  NZ    . LYS A  1 163 ? 95.456  44.261  -38.807  1.00 50.39  ? 269 LYS A NZ    1 
ATOM   1237  N  N     . GLU A  1 164 ? 87.792  42.264  -39.837  1.00 35.38  ? 270 GLU A N     1 
ATOM   1238  C  CA    . GLU A  1 164 ? 86.867  41.129  -39.805  1.00 35.41  ? 270 GLU A CA    1 
ATOM   1239  C  C     . GLU A  1 164 ? 85.738  41.253  -40.834  1.00 33.76  ? 270 GLU A C     1 
ATOM   1240  O  O     . GLU A  1 164 ? 85.302  40.251  -41.410  1.00 33.34  ? 270 GLU A O     1 
ATOM   1241  C  CB    . GLU A  1 164 ? 86.293  40.945  -38.403  1.00 36.35  ? 270 GLU A CB    1 
ATOM   1242  C  CG    . GLU A  1 164 ? 87.245  40.293  -37.405  1.00 38.21  ? 270 GLU A CG    1 
ATOM   1243  C  CD    . GLU A  1 164 ? 86.658  40.202  -35.993  1.00 39.35  ? 270 GLU A CD    1 
ATOM   1244  O  OE1   . GLU A  1 164 ? 85.739  40.982  -35.653  1.00 37.79  ? 270 GLU A OE1   1 
ATOM   1245  O  OE2   . GLU A  1 164 ? 87.125  39.339  -35.218  1.00 41.55  ? 270 GLU A OE2   1 
ATOM   1246  N  N     . GLN A  1 165 ? 85.268  42.475  -41.052  1.00 32.66  ? 271 GLN A N     1 
ATOM   1247  C  CA    . GLN A  1 165 ? 84.274  42.736  -42.096  1.00 32.38  ? 271 GLN A CA    1 
ATOM   1248  C  C     . GLN A  1 165 ? 84.783  42.361  -43.476  1.00 32.17  ? 271 GLN A C     1 
ATOM   1249  O  O     . GLN A  1 165 ? 84.007  41.909  -44.311  1.00 31.68  ? 271 GLN A O     1 
ATOM   1250  C  CB    . GLN A  1 165 ? 83.811  44.204  -42.095  1.00 32.17  ? 271 GLN A CB    1 
ATOM   1251  C  CG    . GLN A  1 165 ? 82.800  44.507  -41.008  1.00 31.69  ? 271 GLN A CG    1 
ATOM   1252  C  CD    . GLN A  1 165 ? 82.477  45.981  -40.900  1.00 32.08  ? 271 GLN A CD    1 
ATOM   1253  O  OE1   . GLN A  1 165 ? 83.336  46.812  -40.663  1.00 32.32  ? 271 GLN A OE1   1 
ATOM   1254  N  NE2   . GLN A  1 165 ? 81.233  46.306  -41.045  1.00 33.76  ? 271 GLN A NE2   1 
ATOM   1255  N  N     . ILE A  1 166 ? 86.080  42.541  -43.695  1.00 32.62  ? 272 ILE A N     1 
ATOM   1256  C  CA    . ILE A  1 166 ? 86.695  42.328  -44.995  1.00 33.69  ? 272 ILE A CA    1 
ATOM   1257  C  C     . ILE A  1 166 ? 86.981  40.844  -45.296  1.00 36.07  ? 272 ILE A C     1 
ATOM   1258  O  O     . ILE A  1 166 ? 86.518  40.326  -46.321  1.00 35.71  ? 272 ILE A O     1 
ATOM   1259  C  CB    . ILE A  1 166 ? 87.954  43.195  -45.133  1.00 32.84  ? 272 ILE A CB    1 
ATOM   1260  C  CG1   . ILE A  1 166 ? 87.540  44.675  -45.090  1.00 33.08  ? 272 ILE A CG1   1 
ATOM   1261  C  CG2   . ILE A  1 166 ? 88.662  42.915  -46.439  1.00 32.93  ? 272 ILE A CG2   1 
ATOM   1262  C  CD1   . ILE A  1 166 ? 88.696  45.652  -44.930  1.00 33.05  ? 272 ILE A CD1   1 
ATOM   1263  N  N     . VAL A  1 167 ? 87.726  40.171  -44.414  1.00 39.01  ? 273 VAL A N     1 
ATOM   1264  C  CA    . VAL A  1 167 ? 88.203  38.787  -44.671  1.00 41.96  ? 273 VAL A CA    1 
ATOM   1265  C  C     . VAL A  1 167 ? 87.484  37.697  -43.914  1.00 45.37  ? 273 VAL A C     1 
ATOM   1266  O  O     . VAL A  1 167 ? 87.761  36.525  -44.144  1.00 47.61  ? 273 VAL A O     1 
ATOM   1267  C  CB    . VAL A  1 167 ? 89.698  38.562  -44.349  1.00 42.28  ? 273 VAL A CB    1 
ATOM   1268  C  CG1   . VAL A  1 167 ? 90.575  39.307  -45.341  1.00 43.26  ? 273 VAL A CG1   1 
ATOM   1269  C  CG2   . VAL A  1 167 ? 90.021  38.932  -42.898  1.00 42.64  ? 273 VAL A CG2   1 
ATOM   1270  N  N     . GLY A  1 168 ? 86.588  38.057  -43.007  1.00 48.18  ? 274 GLY A N     1 
ATOM   1271  C  CA    . GLY A  1 168 ? 85.957  37.067  -42.129  1.00 52.49  ? 274 GLY A CA    1 
ATOM   1272  C  C     . GLY A  1 168 ? 86.755  36.959  -40.838  1.00 56.41  ? 274 GLY A C     1 
ATOM   1273  O  O     . GLY A  1 168 ? 87.518  37.884  -40.516  1.00 57.07  ? 274 GLY A O     1 
ATOM   1274  N  N     . PRO A  1 169 ? 86.586  35.871  -40.088  1.00 60.50  ? 275 PRO A N     1 
ATOM   1275  C  CA    . PRO A  1 169 ? 87.216  35.845  -38.777  1.00 66.14  ? 275 PRO A CA    1 
ATOM   1276  C  C     . PRO A  1 169 ? 88.728  35.687  -38.826  1.00 74.44  ? 275 PRO A C     1 
ATOM   1277  O  O     . PRO A  1 169 ? 89.221  34.826  -39.544  1.00 81.12  ? 275 PRO A O     1 
ATOM   1278  C  CB    . PRO A  1 169 ? 86.560  34.652  -38.075  1.00 64.13  ? 275 PRO A CB    1 
ATOM   1279  C  CG    . PRO A  1 169 ? 85.302  34.407  -38.797  1.00 61.74  ? 275 PRO A CG    1 
ATOM   1280  C  CD    . PRO A  1 169 ? 85.611  34.787  -40.231  1.00 59.89  ? 275 PRO A CD    1 
ATOM   1281  N  N     . LEU A  1 170 ? 89.437  36.521  -38.062  1.00 79.17  ? 276 LEU A N     1 
ATOM   1282  C  CA    . LEU A  1 170 ? 90.875  36.446  -37.969  1.00 83.04  ? 276 LEU A CA    1 
ATOM   1283  C  C     . LEU A  1 170 ? 91.436  35.208  -37.241  1.00 89.33  ? 276 LEU A C     1 
ATOM   1284  O  O     . LEU A  1 170 ? 92.653  35.016  -37.275  1.00 98.16  ? 276 LEU A O     1 
ATOM   1285  C  CB    . LEU A  1 170 ? 91.418  37.783  -37.399  1.00 81.81  ? 276 LEU A CB    1 
ATOM   1286  C  CG    . LEU A  1 170 ? 91.042  39.088  -38.150  1.00 83.05  ? 276 LEU A CG    1 
ATOM   1287  C  CD1   . LEU A  1 170 ? 91.581  40.321  -37.438  1.00 85.17  ? 276 LEU A CD1   1 
ATOM   1288  C  CD2   . LEU A  1 170 ? 91.535  39.036  -39.581  1.00 82.62  ? 276 LEU A CD2   1 
ATOM   1289  N  N     . GLU A  1 171 ? 90.599  34.352  -36.637  1.00 88.97  ? 277 GLU A N     1 
ATOM   1290  C  CA    . GLU A  1 171 ? 91.070  33.050  -36.066  1.00 84.32  ? 277 GLU A CA    1 
ATOM   1291  C  C     . GLU A  1 171 ? 90.042  31.959  -36.333  1.00 78.91  ? 277 GLU A C     1 
ATOM   1292  O  O     . GLU A  1 171 ? 90.341  30.787  -36.183  1.00 76.39  ? 277 GLU A O     1 
ATOM   1293  C  CB    . GLU A  1 171 ? 91.351  33.180  -34.554  1.00 84.76  ? 277 GLU A CB    1 
ATOM   1294  C  CG    . GLU A  1 171 ? 92.422  34.240  -34.186  1.00 82.19  ? 277 GLU A CG    1 
ATOM   1295  C  CD    . GLU A  1 171 ? 92.138  35.001  -32.893  1.00 81.81  ? 277 GLU A CD    1 
ATOM   1296  O  OE1   . GLU A  1 171 ? 93.081  35.233  -32.104  1.00 83.46  ? 277 GLU A OE1   1 
ATOM   1297  O  OE2   . GLU A  1 171 ? 90.973  35.382  -32.673  1.00 77.78  ? 277 GLU A OE2   1 
ATOM   1298  N  N     . LEU A  1 178 ? 80.973  28.210  -31.102  1.00 79.08  ? 284 LEU A N     1 
ATOM   1299  C  CA    . LEU A  1 178 ? 80.867  29.500  -30.582  1.00 81.12  ? 284 LEU A CA    1 
ATOM   1300  C  C     . LEU A  1 178 ? 81.139  30.684  -31.526  1.00 77.87  ? 284 LEU A C     1 
ATOM   1301  O  O     . LEU A  1 178 ? 81.563  30.502  -32.623  1.00 83.94  ? 284 LEU A O     1 
ATOM   1302  C  CB    . LEU A  1 178 ? 81.776  29.527  -29.370  1.00 86.60  ? 284 LEU A CB    1 
ATOM   1303  C  CG    . LEU A  1 178 ? 81.138  28.976  -28.039  1.00 95.70  ? 284 LEU A CG    1 
ATOM   1304  C  CD1   . LEU A  1 178 ? 82.087  29.307  -26.877  1.00 97.78  ? 284 LEU A CD1   1 
ATOM   1305  C  CD2   . LEU A  1 178 ? 79.758  29.579  -27.643  1.00 97.36  ? 284 LEU A CD2   1 
ATOM   1306  N  N     . TRP A  1 179 ? 80.874  31.899  -31.018  1.00 71.56  ? 285 TRP A N     1 
ATOM   1307  C  CA    . TRP A  1 179 ? 80.948  33.137  -31.787  1.00 64.94  ? 285 TRP A CA    1 
ATOM   1308  C  C     . TRP A  1 179 ? 82.391  33.467  -32.215  1.00 62.16  ? 285 TRP A C     1 
ATOM   1309  O  O     . TRP A  1 179 ? 83.211  33.841  -31.363  1.00 60.88  ? 285 TRP A O     1 
ATOM   1310  C  CB    . TRP A  1 179 ? 80.393  34.285  -30.940  1.00 62.42  ? 285 TRP A CB    1 
ATOM   1311  C  CG    . TRP A  1 179 ? 80.416  35.667  -31.592  1.00 59.27  ? 285 TRP A CG    1 
ATOM   1312  C  CD1   . TRP A  1 179 ? 81.062  36.772  -31.137  1.00 57.30  ? 285 TRP A CD1   1 
ATOM   1313  C  CD2   . TRP A  1 179 ? 79.729  36.055  -32.779  1.00 56.09  ? 285 TRP A CD2   1 
ATOM   1314  N  NE1   . TRP A  1 179 ? 80.826  37.831  -31.971  1.00 54.71  ? 285 TRP A NE1   1 
ATOM   1315  C  CE2   . TRP A  1 179 ? 80.008  37.418  -32.986  1.00 54.15  ? 285 TRP A CE2   1 
ATOM   1316  C  CE3   . TRP A  1 179 ? 78.901  35.388  -33.685  1.00 55.13  ? 285 TRP A CE3   1 
ATOM   1317  C  CZ2   . TRP A  1 179 ? 79.506  38.126  -34.062  1.00 54.00  ? 285 TRP A CZ2   1 
ATOM   1318  C  CZ3   . TRP A  1 179 ? 78.401  36.093  -34.750  1.00 54.68  ? 285 TRP A CZ3   1 
ATOM   1319  C  CH2   . TRP A  1 179 ? 78.705  37.442  -34.933  1.00 54.85  ? 285 TRP A CH2   1 
ATOM   1320  N  N     . PRO A  1 180 ? 82.694  33.361  -33.511  1.00 56.39  ? 286 PRO A N     1 
ATOM   1321  C  CA    . PRO A  1 180 ? 84.059  33.535  -33.969  1.00 52.55  ? 286 PRO A CA    1 
ATOM   1322  C  C     . PRO A  1 180 ? 84.640  34.956  -34.026  1.00 48.73  ? 286 PRO A C     1 
ATOM   1323  O  O     . PRO A  1 180 ? 85.827  35.086  -34.272  1.00 51.76  ? 286 PRO A O     1 
ATOM   1324  C  CB    . PRO A  1 180 ? 84.034  32.959  -35.404  1.00 54.22  ? 286 PRO A CB    1 
ATOM   1325  C  CG    . PRO A  1 180 ? 82.650  33.198  -35.876  1.00 55.64  ? 286 PRO A CG    1 
ATOM   1326  C  CD    . PRO A  1 180 ? 81.778  33.108  -34.634  1.00 55.78  ? 286 PRO A CD    1 
ATOM   1327  N  N     . TYR A  1 181 ? 83.853  35.999  -33.812  1.00 44.26  ? 287 TYR A N     1 
ATOM   1328  C  CA    . TYR A  1 181 ? 84.356  37.372  -33.987  1.00 42.96  ? 287 TYR A CA    1 
ATOM   1329  C  C     . TYR A  1 181 ? 84.756  38.023  -32.667  1.00 42.76  ? 287 TYR A C     1 
ATOM   1330  O  O     . TYR A  1 181 ? 84.029  37.932  -31.684  1.00 42.53  ? 287 TYR A O     1 
ATOM   1331  C  CB    . TYR A  1 181 ? 83.330  38.257  -34.715  1.00 41.10  ? 287 TYR A CB    1 
ATOM   1332  C  CG    . TYR A  1 181 ? 83.025  37.833  -36.140  1.00 39.32  ? 287 TYR A CG    1 
ATOM   1333  C  CD1   . TYR A  1 181 ? 83.843  38.200  -37.197  1.00 38.90  ? 287 TYR A CD1   1 
ATOM   1334  C  CD2   . TYR A  1 181 ? 81.908  37.065  -36.431  1.00 38.40  ? 287 TYR A CD2   1 
ATOM   1335  C  CE1   . TYR A  1 181 ? 83.562  37.815  -38.507  1.00 38.37  ? 287 TYR A CE1   1 
ATOM   1336  C  CE2   . TYR A  1 181 ? 81.619  36.668  -37.737  1.00 37.16  ? 287 TYR A CE2   1 
ATOM   1337  C  CZ    . TYR A  1 181 ? 82.440  37.055  -38.765  1.00 37.20  ? 287 TYR A CZ    1 
ATOM   1338  O  OH    . TYR A  1 181 ? 82.152  36.660  -40.052  1.00 38.92  ? 287 TYR A OH    1 
ATOM   1339  N  N     . LYS A  1 182 ? 85.912  38.685  -32.680  1.00 43.71  ? 288 LYS A N     1 
ATOM   1340  C  CA    . LYS A  1 182 ? 86.426  39.451  -31.548  1.00 43.98  ? 288 LYS A CA    1 
ATOM   1341  C  C     . LYS A  1 182 ? 86.046  40.939  -31.636  1.00 44.78  ? 288 LYS A C     1 
ATOM   1342  O  O     . LYS A  1 182 ? 86.052  41.621  -30.630  1.00 47.51  ? 288 LYS A O     1 
ATOM   1343  C  CB    . LYS A  1 182 ? 87.942  39.285  -31.425  1.00 41.73  ? 288 LYS A CB    1 
ATOM   1344  N  N     . GLY A  1 183 ? 85.673  41.429  -32.814  1.00 44.63  ? 289 GLY A N     1 
ATOM   1345  C  CA    . GLY A  1 183 ? 85.441  42.857  -33.031  1.00 43.68  ? 289 GLY A CA    1 
ATOM   1346  C  C     . GLY A  1 183 ? 84.112  43.393  -32.532  1.00 42.41  ? 289 GLY A C     1 
ATOM   1347  O  O     . GLY A  1 183 ? 84.019  44.544  -32.147  1.00 41.06  ? 289 GLY A O     1 
ATOM   1348  N  N     . ARG A  1 184 ? 83.080  42.557  -32.575  1.00 40.82  ? 290 ARG A N     1 
ATOM   1349  C  CA    . ARG A  1 184 ? 81.751  42.916  -32.079  1.00 39.28  ? 290 ARG A CA    1 
ATOM   1350  C  C     . ARG A  1 184 ? 81.030  41.692  -31.521  1.00 42.48  ? 290 ARG A C     1 
ATOM   1351  O  O     . ARG A  1 184 ? 81.276  40.572  -31.953  1.00 43.39  ? 290 ARG A O     1 
ATOM   1352  C  CB    . ARG A  1 184 ? 80.897  43.521  -33.190  1.00 36.24  ? 290 ARG A CB    1 
ATOM   1353  C  CG    . ARG A  1 184 ? 81.255  44.941  -33.594  1.00 35.24  ? 290 ARG A CG    1 
ATOM   1354  C  CD    . ARG A  1 184 ? 80.772  45.956  -32.582  1.00 35.02  ? 290 ARG A CD    1 
ATOM   1355  N  NE    . ARG A  1 184 ? 81.004  47.328  -33.035  1.00 34.25  ? 290 ARG A NE    1 
ATOM   1356  C  CZ    . ARG A  1 184 ? 82.204  47.913  -33.187  1.00 34.32  ? 290 ARG A CZ    1 
ATOM   1357  N  NH1   . ARG A  1 184 ? 82.265  49.152  -33.605  1.00 33.07  ? 290 ARG A NH1   1 
ATOM   1358  N  NH2   . ARG A  1 184 ? 83.384  47.291  -32.945  1.00 36.07  ? 290 ARG A NH2   1 
ATOM   1359  N  N     . PRO A  1 185 ? 80.131  41.898  -30.547  1.00 46.26  ? 291 PRO A N     1 
ATOM   1360  C  CA    . PRO A  1 185 ? 79.351  40.791  -29.976  1.00 48.41  ? 291 PRO A CA    1 
ATOM   1361  C  C     . PRO A  1 185 ? 78.281  40.210  -30.903  1.00 50.43  ? 291 PRO A C     1 
ATOM   1362  O  O     . PRO A  1 185 ? 78.000  40.772  -31.944  1.00 51.26  ? 291 PRO A O     1 
ATOM   1363  C  CB    . PRO A  1 185 ? 78.685  41.427  -28.765  1.00 49.35  ? 291 PRO A CB    1 
ATOM   1364  C  CG    . PRO A  1 185 ? 78.608  42.882  -29.105  1.00 49.34  ? 291 PRO A CG    1 
ATOM   1365  C  CD    . PRO A  1 185 ? 79.867  43.169  -29.850  1.00 47.46  ? 291 PRO A CD    1 
ATOM   1366  N  N     . GLU A  1 186 ? 77.682  39.106  -30.476  1.00 54.48  ? 292 GLU A N     1 
ATOM   1367  C  CA    . GLU A  1 186 ? 76.641  38.388  -31.232  1.00 57.44  ? 292 GLU A CA    1 
ATOM   1368  C  C     . GLU A  1 186 ? 75.389  39.217  -31.543  1.00 51.30  ? 292 GLU A C     1 
ATOM   1369  O  O     . GLU A  1 186 ? 74.707  38.983  -32.551  1.00 46.93  ? 292 GLU A O     1 
ATOM   1370  C  CB    . GLU A  1 186 ? 76.184  37.130  -30.487  1.00 65.71  ? 292 GLU A CB    1 
ATOM   1371  C  CG    . GLU A  1 186 ? 77.236  36.063  -30.278  1.00 71.45  ? 292 GLU A CG    1 
ATOM   1372  C  CD    . GLU A  1 186 ? 76.876  35.060  -29.190  1.00 77.73  ? 292 GLU A CD    1 
ATOM   1373  O  OE1   . GLU A  1 186 ? 75.690  35.038  -28.764  1.00 79.57  ? 292 GLU A OE1   1 
ATOM   1374  O  OE2   . GLU A  1 186 ? 77.756  34.317  -28.735  1.00 86.98  ? 292 GLU A OE2   1 
ATOM   1375  N  N     . ASN A  1 187 ? 75.077  40.153  -30.647  1.00 48.04  ? 293 ASN A N     1 
ATOM   1376  C  CA    . ASN A  1 187 ? 73.923  41.042  -30.803  1.00 48.63  ? 293 ASN A CA    1 
ATOM   1377  C  C     . ASN A  1 187 ? 74.108  42.098  -31.889  1.00 44.28  ? 293 ASN A C     1 
ATOM   1378  O  O     . ASN A  1 187 ? 73.206  42.895  -32.125  1.00 43.53  ? 293 ASN A O     1 
ATOM   1379  C  CB    . ASN A  1 187 ? 73.491  41.693  -29.460  1.00 53.69  ? 293 ASN A CB    1 
ATOM   1380  C  CG    . ASN A  1 187 ? 74.573  42.574  -28.833  1.00 57.37  ? 293 ASN A CG    1 
ATOM   1381  O  OD1   . ASN A  1 187 ? 75.227  43.375  -29.487  1.00 58.68  ? 293 ASN A OD1   1 
ATOM   1382  N  ND2   . ASN A  1 187 ? 74.763  42.413  -27.533  1.00 60.19  ? 293 ASN A ND2   1 
ATOM   1383  N  N     . LYS A  1 188 ? 75.282  42.124  -32.509  1.00 41.86  ? 294 LYS A N     1 
ATOM   1384  C  CA    . LYS A  1 188 ? 75.538  42.948  -33.670  1.00 39.86  ? 294 LYS A CA    1 
ATOM   1385  C  C     . LYS A  1 188 ? 76.149  42.141  -34.827  1.00 37.71  ? 294 LYS A C     1 
ATOM   1386  O  O     . LYS A  1 188 ? 76.907  42.687  -35.624  1.00 36.60  ? 294 LYS A O     1 
ATOM   1387  C  CB    . LYS A  1 188 ? 76.391  44.139  -33.281  1.00 40.12  ? 294 LYS A CB    1 
ATOM   1388  C  CG    . LYS A  1 188 ? 75.583  45.186  -32.544  1.00 40.59  ? 294 LYS A CG    1 
ATOM   1389  C  CD    . LYS A  1 188 ? 76.453  46.375  -32.196  1.00 41.21  ? 294 LYS A CD    1 
ATOM   1390  C  CE    . LYS A  1 188 ? 75.675  47.483  -31.568  1.00 41.70  ? 294 LYS A CE    1 
ATOM   1391  N  NZ    . LYS A  1 188 ? 76.587  48.419  -30.903  1.00 43.39  ? 294 LYS A NZ    1 
ATOM   1392  N  N     . SER A  1 189 ? 75.771  40.865  -34.958  1.00 35.59  ? 295 SER A N     1 
ATOM   1393  C  CA    . SER A  1 189 ? 76.275  40.043  -36.061  1.00 34.49  ? 295 SER A CA    1 
ATOM   1394  C  C     . SER A  1 189 ? 75.845  40.552  -37.432  1.00 32.56  ? 295 SER A C     1 
ATOM   1395  O  O     . SER A  1 189 ? 76.513  40.334  -38.432  1.00 33.16  ? 295 SER A O     1 
ATOM   1396  C  CB    . SER A  1 189 ? 75.839  38.578  -35.937  1.00 35.63  ? 295 SER A CB    1 
ATOM   1397  O  OG    . SER A  1 189 ? 74.509  38.388  -36.281  1.00 36.07  ? 295 SER A OG    1 
ATOM   1398  N  N     . PHE A  1 190 ? 74.697  41.206  -37.472  1.00 30.23  ? 296 PHE A N     1 
ATOM   1399  C  CA    . PHE A  1 190 ? 74.176  41.763  -38.714  1.00 28.48  ? 296 PHE A CA    1 
ATOM   1400  C  C     . PHE A  1 190 ? 75.131  42.730  -39.381  1.00 28.09  ? 296 PHE A C     1 
ATOM   1401  O  O     . PHE A  1 190 ? 75.138  42.827  -40.609  1.00 28.42  ? 296 PHE A O     1 
ATOM   1402  C  CB    . PHE A  1 190 ? 72.808  42.409  -38.518  1.00 27.98  ? 296 PHE A CB    1 
ATOM   1403  C  CG    . PHE A  1 190 ? 72.793  43.542  -37.536  1.00 27.51  ? 296 PHE A CG    1 
ATOM   1404  C  CD1   . PHE A  1 190 ? 73.094  44.831  -37.951  1.00 27.67  ? 296 PHE A CD1   1 
ATOM   1405  C  CD2   . PHE A  1 190 ? 72.415  43.331  -36.231  1.00 27.55  ? 296 PHE A CD2   1 
ATOM   1406  C  CE1   . PHE A  1 190 ? 73.051  45.879  -37.054  1.00 27.77  ? 296 PHE A CE1   1 
ATOM   1407  C  CE2   . PHE A  1 190 ? 72.368  44.392  -35.349  1.00 27.82  ? 296 PHE A CE2   1 
ATOM   1408  C  CZ    . PHE A  1 190 ? 72.723  45.658  -35.745  1.00 27.74  ? 296 PHE A CZ    1 
ATOM   1409  N  N     . LEU A  1 191 ? 75.956  43.426  -38.597  1.00 27.75  ? 297 LEU A N     1 
ATOM   1410  C  CA    . LEU A  1 191 ? 76.959  44.319  -39.176  1.00 28.42  ? 297 LEU A CA    1 
ATOM   1411  C  C     . LEU A  1 191 ? 77.981  43.603  -40.073  1.00 28.80  ? 297 LEU A C     1 
ATOM   1412  O  O     . LEU A  1 191 ? 78.501  44.191  -41.025  1.00 29.89  ? 297 LEU A O     1 
ATOM   1413  C  CB    . LEU A  1 191 ? 77.654  45.121  -38.089  1.00 28.16  ? 297 LEU A CB    1 
ATOM   1414  C  CG    . LEU A  1 191 ? 76.805  46.018  -37.198  1.00 28.25  ? 297 LEU A CG    1 
ATOM   1415  C  CD1   . LEU A  1 191 ? 77.672  46.734  -36.183  1.00 29.12  ? 297 LEU A CD1   1 
ATOM   1416  C  CD2   . LEU A  1 191 ? 76.044  47.044  -38.001  1.00 27.83  ? 297 LEU A CD2   1 
ATOM   1417  N  N     . TYR A  1 192 ? 78.260  42.334  -39.792  1.00 28.56  ? 298 TYR A N     1 
ATOM   1418  C  CA    . TYR A  1 192 ? 79.167  41.550  -40.634  1.00 28.75  ? 298 TYR A CA    1 
ATOM   1419  C  C     . TYR A  1 192 ? 78.591  41.126  -41.986  1.00 29.81  ? 298 TYR A C     1 
ATOM   1420  O  O     . TYR A  1 192 ? 79.331  40.710  -42.875  1.00 29.59  ? 298 TYR A O     1 
ATOM   1421  C  CB    . TYR A  1 192 ? 79.674  40.332  -39.878  1.00 28.55  ? 298 TYR A CB    1 
ATOM   1422  C  CG    . TYR A  1 192 ? 80.602  40.684  -38.734  1.00 28.26  ? 298 TYR A CG    1 
ATOM   1423  C  CD1   . TYR A  1 192 ? 81.913  41.028  -38.959  1.00 28.41  ? 298 TYR A CD1   1 
ATOM   1424  C  CD2   . TYR A  1 192 ? 80.160  40.640  -37.419  1.00 28.27  ? 298 TYR A CD2   1 
ATOM   1425  C  CE1   . TYR A  1 192 ? 82.758  41.352  -37.914  1.00 28.72  ? 298 TYR A CE1   1 
ATOM   1426  C  CE2   . TYR A  1 192 ? 80.984  40.962  -36.356  1.00 28.23  ? 298 TYR A CE2   1 
ATOM   1427  C  CZ    . TYR A  1 192 ? 82.293  41.316  -36.611  1.00 28.61  ? 298 TYR A CZ    1 
ATOM   1428  O  OH    . TYR A  1 192 ? 83.145  41.630  -35.583  1.00 29.46  ? 298 TYR A OH    1 
ATOM   1429  N  N     . GLU A  1 193 ? 77.276  41.229  -42.135  1.00 31.76  ? 299 GLU A N     1 
ATOM   1430  C  CA    . GLU A  1 193 ? 76.596  40.895  -43.388  1.00 33.58  ? 299 GLU A CA    1 
ATOM   1431  C  C     . GLU A  1 193 ? 76.448  42.071  -44.387  1.00 32.84  ? 299 GLU A C     1 
ATOM   1432  O  O     . GLU A  1 193 ? 75.809  41.892  -45.434  1.00 34.70  ? 299 GLU A O     1 
ATOM   1433  C  CB    . GLU A  1 193 ? 75.203  40.345  -43.074  1.00 35.59  ? 299 GLU A CB    1 
ATOM   1434  C  CG    . GLU A  1 193 ? 75.180  39.057  -42.242  1.00 37.48  ? 299 GLU A CG    1 
ATOM   1435  C  CD    . GLU A  1 193 ? 73.769  38.554  -41.946  1.00 39.32  ? 299 GLU A CD    1 
ATOM   1436  O  OE1   . GLU A  1 193 ? 72.842  39.405  -41.785  1.00 41.25  ? 299 GLU A OE1   1 
ATOM   1437  O  OE2   . GLU A  1 193 ? 73.591  37.317  -41.870  1.00 40.34  ? 299 GLU A OE2   1 
ATOM   1438  N  N     . ILE A  1 194 ? 77.034  43.241  -44.113  1.00 30.17  ? 300 ILE A N     1 
ATOM   1439  C  CA    . ILE A  1 194 ? 76.862  44.397  -44.992  1.00 28.13  ? 300 ILE A CA    1 
ATOM   1440  C  C     . ILE A  1 194 ? 77.886  44.474  -46.129  1.00 28.52  ? 300 ILE A C     1 
ATOM   1441  O  O     . ILE A  1 194 ? 77.529  44.527  -47.305  1.00 27.69  ? 300 ILE A O     1 
ATOM   1442  C  CB    . ILE A  1 194 ? 76.848  45.683  -44.162  1.00 26.85  ? 300 ILE A CB    1 
ATOM   1443  C  CG1   . ILE A  1 194 ? 75.569  45.690  -43.320  1.00 26.77  ? 300 ILE A CG1   1 
ATOM   1444  C  CG2   . ILE A  1 194 ? 76.929  46.936  -45.048  1.00 26.24  ? 300 ILE A CG2   1 
ATOM   1445  C  CD1   . ILE A  1 194 ? 75.528  46.765  -42.251  1.00 26.94  ? 300 ILE A CD1   1 
ATOM   1446  N  N     . VAL A  1 195 ? 79.161  44.483  -45.785  1.00 29.31  ? 301 VAL A N     1 
ATOM   1447  C  CA    . VAL A  1 195 ? 80.222  44.706  -46.783  1.00 28.61  ? 301 VAL A CA    1 
ATOM   1448  C  C     . VAL A  1 195 ? 80.590  43.427  -47.531  1.00 29.30  ? 301 VAL A C     1 
ATOM   1449  O  O     . VAL A  1 195 ? 80.796  43.449  -48.743  1.00 29.55  ? 301 VAL A O     1 
ATOM   1450  C  CB    . VAL A  1 195 ? 81.459  45.298  -46.098  1.00 27.66  ? 301 VAL A CB    1 
ATOM   1451  C  CG1   . VAL A  1 195 ? 82.594  45.524  -47.067  1.00 26.87  ? 301 VAL A CG1   1 
ATOM   1452  C  CG2   . VAL A  1 195 ? 81.086  46.615  -45.426  1.00 27.78  ? 301 VAL A CG2   1 
ATOM   1453  N  N     . SER A  1 196 ? 80.697  42.315  -46.810  1.00 31.01  ? 302 SER A N     1 
ATOM   1454  C  CA    . SER A  1 196 ? 81.045  41.030  -47.423  1.00 32.39  ? 302 SER A CA    1 
ATOM   1455  C  C     . SER A  1 196 ? 80.350  39.908  -46.643  1.00 32.96  ? 302 SER A C     1 
ATOM   1456  O  O     . SER A  1 196 ? 80.794  39.485  -45.565  1.00 33.16  ? 302 SER A O     1 
ATOM   1457  C  CB    . SER A  1 196 ? 82.573  40.881  -47.427  1.00 33.53  ? 302 SER A CB    1 
ATOM   1458  O  OG    . SER A  1 196 ? 82.982  39.542  -47.612  1.00 34.04  ? 302 SER A OG    1 
ATOM   1459  N  N     . ASN A  1 197 ? 79.250  39.436  -47.213  1.00 33.05  ? 303 ASN A N     1 
ATOM   1460  C  CA    . ASN A  1 197 ? 78.333  38.520  -46.548  1.00 33.03  ? 303 ASN A CA    1 
ATOM   1461  C  C     . ASN A  1 197 ? 78.812  37.094  -46.787  1.00 33.87  ? 303 ASN A C     1 
ATOM   1462  O  O     . ASN A  1 197 ? 78.654  36.567  -47.888  1.00 32.09  ? 303 ASN A O     1 
ATOM   1463  C  CB    . ASN A  1 197 ? 76.918  38.748  -47.104  1.00 32.79  ? 303 ASN A CB    1 
ATOM   1464  C  CG    . ASN A  1 197 ? 75.863  37.953  -46.370  1.00 32.68  ? 303 ASN A CG    1 
ATOM   1465  O  OD1   . ASN A  1 197 ? 76.074  36.786  -46.031  1.00 34.07  ? 303 ASN A OD1   1 
ATOM   1466  N  ND2   . ASN A  1 197 ? 74.704  38.576  -46.151  1.00 31.77  ? 303 ASN A ND2   1 
ATOM   1467  N  N     . LYS A  1 198 ? 79.370  36.475  -45.768  1.00 36.15  ? 304 LYS A N     1 
ATOM   1468  C  CA    . LYS A  1 198 ? 79.887  35.106  -45.859  1.00 38.58  ? 304 LYS A CA    1 
ATOM   1469  C  C     . LYS A  1 198 ? 78.772  34.066  -45.852  1.00 35.53  ? 304 LYS A C     1 
ATOM   1470  O  O     . LYS A  1 198 ? 78.964  32.971  -46.318  1.00 33.65  ? 304 LYS A O     1 
ATOM   1471  C  CB    . LYS A  1 198 ? 80.831  34.786  -44.678  1.00 45.37  ? 304 LYS A CB    1 
ATOM   1472  C  CG    . LYS A  1 198 ? 81.919  35.822  -44.382  1.00 51.83  ? 304 LYS A CG    1 
ATOM   1473  C  CD    . LYS A  1 198 ? 82.972  35.793  -45.488  1.00 56.62  ? 304 LYS A CD    1 
ATOM   1474  C  CE    . LYS A  1 198 ? 83.948  36.952  -45.340  1.00 60.73  ? 304 LYS A CE    1 
ATOM   1475  N  NZ    . LYS A  1 198 ? 84.918  36.984  -46.459  1.00 64.11  ? 304 LYS A NZ    1 
ATOM   1476  N  N     . ARG A  1 199 ? 77.612  34.421  -45.313  1.00 36.56  ? 305 ARG A N     1 
ATOM   1477  C  CA    . ARG A  1 199 ? 76.514  33.482  -45.134  1.00 38.50  ? 305 ARG A CA    1 
ATOM   1478  C  C     . ARG A  1 199 ? 75.873  33.109  -46.444  1.00 35.21  ? 305 ARG A C     1 
ATOM   1479  O  O     . ARG A  1 199 ? 75.729  31.923  -46.752  1.00 34.78  ? 305 ARG A O     1 
ATOM   1480  C  CB    . ARG A  1 199 ? 75.476  34.135  -44.168  1.00 43.86  ? 305 ARG A CB    1 
ATOM   1481  C  CG    . ARG A  1 199 ? 74.514  33.206  -43.495  1.00 49.76  ? 305 ARG A CG    1 
ATOM   1482  C  CD    . ARG A  1 199 ? 74.096  33.797  -42.119  1.00 55.30  ? 305 ARG A CD    1 
ATOM   1483  N  NE    . ARG A  1 199 ? 75.079  33.825  -41.047  1.00 63.44  ? 305 ARG A NE    1 
ATOM   1484  C  CZ    . ARG A  1 199 ? 75.517  32.744  -40.398  1.00 71.44  ? 305 ARG A CZ    1 
ATOM   1485  N  NH1   . ARG A  1 199 ? 75.150  31.466  -40.707  1.00 72.47  ? 305 ARG A NH1   1 
ATOM   1486  N  NH2   . ARG A  1 199 ? 76.496  32.865  -39.445  1.00 75.81  ? 305 ARG A NH2   1 
ATOM   1487  N  N     . ASN A  1 200 ? 75.509  34.130  -47.225  1.00 31.14  ? 306 ASN A N     1 
ATOM   1488  C  CA    . ASN A  1 200 ? 74.810  33.944  -48.512  1.00 27.85  ? 306 ASN A CA    1 
ATOM   1489  C  C     . ASN A  1 200 ? 75.356  34.759  -49.698  1.00 25.72  ? 306 ASN A C     1 
ATOM   1490  O  O     . ASN A  1 200 ? 75.003  34.471  -50.855  1.00 25.42  ? 306 ASN A O     1 
ATOM   1491  C  CB    . ASN A  1 200 ? 73.321  34.210  -48.318  1.00 27.34  ? 306 ASN A CB    1 
ATOM   1492  C  CG    . ASN A  1 200 ? 73.035  35.601  -47.772  1.00 27.15  ? 306 ASN A CG    1 
ATOM   1493  O  OD1   . ASN A  1 200 ? 73.571  36.580  -48.268  1.00 26.34  ? 306 ASN A OD1   1 
ATOM   1494  N  ND2   . ASN A  1 200 ? 72.176  35.689  -46.762  1.00 28.05  ? 306 ASN A ND2   1 
ATOM   1495  N  N     . GLY A  1 201 ? 76.193  35.765  -49.444  1.00 23.21  ? 307 GLY A N     1 
ATOM   1496  C  CA    . GLY A  1 201 ? 76.768  36.556  -50.532  1.00 22.00  ? 307 GLY A CA    1 
ATOM   1497  C  C     . GLY A  1 201 ? 76.040  37.831  -50.898  1.00 20.45  ? 307 GLY A C     1 
ATOM   1498  O  O     . GLY A  1 201 ? 76.526  38.600  -51.728  1.00 19.95  ? 307 GLY A O     1 
ATOM   1499  N  N     . ILE A  1 202 ? 74.890  38.086  -50.284  1.00 19.54  ? 308 ILE A N     1 
ATOM   1500  C  CA    . ILE A  1 202 ? 74.139  39.316  -50.542  1.00 19.13  ? 308 ILE A CA    1 
ATOM   1501  C  C     . ILE A  1 202 ? 74.776  40.456  -49.771  1.00 18.85  ? 308 ILE A C     1 
ATOM   1502  O  O     . ILE A  1 202 ? 74.560  40.587  -48.565  1.00 19.22  ? 308 ILE A O     1 
ATOM   1503  C  CB    . ILE A  1 202 ? 72.656  39.133  -50.183  1.00 19.21  ? 308 ILE A CB    1 
ATOM   1504  C  CG1   . ILE A  1 202 ? 72.057  37.997  -51.042  1.00 19.31  ? 308 ILE A CG1   1 
ATOM   1505  C  CG2   . ILE A  1 202 ? 71.886  40.426  -50.419  1.00 19.32  ? 308 ILE A CG2   1 
ATOM   1506  C  CD1   . ILE A  1 202 ? 70.753  37.443  -50.550  1.00 19.43  ? 308 ILE A CD1   1 
ATOM   1507  N  N     . ASP A  1 203 ? 75.581  41.260  -50.465  1.00 18.65  ? 309 ASP A N     1 
ATOM   1508  C  CA    . ASP A  1 203 ? 76.350  42.364  -49.844  1.00 18.66  ? 309 ASP A CA    1 
ATOM   1509  C  C     . ASP A  1 203 ? 76.400  43.611  -50.755  1.00 18.26  ? 309 ASP A C     1 
ATOM   1510  O  O     . ASP A  1 203 ? 76.020  43.568  -51.933  1.00 18.48  ? 309 ASP A O     1 
ATOM   1511  C  CB    . ASP A  1 203 ? 77.757  41.903  -49.440  1.00 18.85  ? 309 ASP A CB    1 
ATOM   1512  C  CG    . ASP A  1 203 ? 78.548  41.210  -50.602  1.00 19.39  ? 309 ASP A CG    1 
ATOM   1513  O  OD1   . ASP A  1 203 ? 78.787  41.835  -51.662  1.00 19.50  ? 309 ASP A OD1   1 
ATOM   1514  O  OD2   . ASP A  1 203 ? 78.993  40.036  -50.447  1.00 19.80  ? 309 ASP A OD2   1 
ATOM   1515  N  N     . VAL A  1 204 ? 76.876  44.722  -50.211  1.00 17.19  ? 310 VAL A N     1 
ATOM   1516  C  CA    . VAL A  1 204 ? 76.892  45.959  -50.973  1.00 16.36  ? 310 VAL A CA    1 
ATOM   1517  C  C     . VAL A  1 204 ? 78.059  46.029  -51.980  1.00 16.26  ? 310 VAL A C     1 
ATOM   1518  O  O     . VAL A  1 204 ? 78.005  46.862  -52.876  1.00 16.61  ? 310 VAL A O     1 
ATOM   1519  C  CB    . VAL A  1 204 ? 76.823  47.229  -50.071  1.00 15.93  ? 310 VAL A CB    1 
ATOM   1520  C  CG1   . VAL A  1 204 ? 75.688  47.142  -49.082  1.00 15.84  ? 310 VAL A CG1   1 
ATOM   1521  C  CG2   . VAL A  1 204 ? 78.112  47.491  -49.303  1.00 15.99  ? 310 VAL A CG2   1 
ATOM   1522  N  N     . ASP A  1 205 ? 79.096  45.195  -51.841  1.00 15.83  ? 311 ASP A N     1 
ATOM   1523  C  CA    . ASP A  1 205 ? 80.149  45.084  -52.873  1.00 15.41  ? 311 ASP A CA    1 
ATOM   1524  C  C     . ASP A  1 205 ? 79.437  44.769  -54.190  1.00 14.78  ? 311 ASP A C     1 
ATOM   1525  O  O     . ASP A  1 205 ? 79.605  45.474  -55.180  1.00 14.73  ? 311 ASP A O     1 
ATOM   1526  C  CB    . ASP A  1 205 ? 81.165  43.973  -52.517  1.00 15.63  ? 311 ASP A CB    1 
ATOM   1527  C  CG    . ASP A  1 205 ? 82.422  43.999  -53.381  1.00 16.05  ? 311 ASP A CG    1 
ATOM   1528  O  OD1   . ASP A  1 205 ? 82.954  45.077  -53.765  1.00 16.18  ? 311 ASP A OD1   1 
ATOM   1529  O  OD2   . ASP A  1 205 ? 82.913  42.889  -53.639  1.00 16.71  ? 311 ASP A OD2   1 
ATOM   1530  N  N     . LYS A  1 206 ? 78.580  43.744  -54.161  1.00 14.17  ? 312 LYS A N     1 
ATOM   1531  C  CA    . LYS A  1 206 ? 77.810  43.337  -55.347  1.00 13.69  ? 312 LYS A CA    1 
ATOM   1532  C  C     . LYS A  1 206 ? 76.974  44.470  -55.882  1.00 13.57  ? 312 LYS A C     1 
ATOM   1533  O  O     . LYS A  1 206 ? 76.959  44.716  -57.084  1.00 13.48  ? 312 LYS A O     1 
ATOM   1534  C  CB    . LYS A  1 206 ? 76.922  42.115  -55.079  1.00 13.64  ? 312 LYS A CB    1 
ATOM   1535  C  CG    . LYS A  1 206 ? 77.649  40.784  -55.237  1.00 13.68  ? 312 LYS A CG    1 
ATOM   1536  C  CD    . LYS A  1 206 ? 76.765  39.587  -54.868  1.00 13.72  ? 312 LYS A CD    1 
ATOM   1537  C  CE    . LYS A  1 206 ? 77.573  38.288  -54.699  1.00 13.69  ? 312 LYS A CE    1 
ATOM   1538  N  NZ    . LYS A  1 206 ? 78.533  38.305  -53.553  1.00 13.66  ? 312 LYS A NZ    1 
ATOM   1539  N  N     . TRP A  1 207 ? 76.288  45.167  -54.983  1.00 13.47  ? 313 TRP A N     1 
ATOM   1540  C  CA    . TRP A  1 207 ? 75.297  46.145  -55.416  1.00 13.13  ? 313 TRP A CA    1 
ATOM   1541  C  C     . TRP A  1 207 ? 75.967  47.273  -56.175  1.00 12.58  ? 313 TRP A C     1 
ATOM   1542  O  O     . TRP A  1 207 ? 75.443  47.732  -57.199  1.00 12.61  ? 313 TRP A O     1 
ATOM   1543  C  CB    . TRP A  1 207 ? 74.471  46.686  -54.247  1.00 13.30  ? 313 TRP A CB    1 
ATOM   1544  C  CG    . TRP A  1 207 ? 73.699  45.640  -53.514  1.00 13.58  ? 313 TRP A CG    1 
ATOM   1545  C  CD1   . TRP A  1 207 ? 73.442  44.350  -53.899  1.00 13.64  ? 313 TRP A CD1   1 
ATOM   1546  C  CD2   . TRP A  1 207 ? 73.067  45.811  -52.249  1.00 14.02  ? 313 TRP A CD2   1 
ATOM   1547  N  NE1   . TRP A  1 207 ? 72.703  43.712  -52.938  1.00 13.93  ? 313 TRP A NE1   1 
ATOM   1548  C  CE2   . TRP A  1 207 ? 72.461  44.585  -51.912  1.00 14.10  ? 313 TRP A CE2   1 
ATOM   1549  C  CE3   . TRP A  1 207 ? 72.948  46.897  -51.362  1.00 14.18  ? 313 TRP A CE3   1 
ATOM   1550  C  CZ2   . TRP A  1 207 ? 71.775  44.393  -50.719  1.00 14.37  ? 313 TRP A CZ2   1 
ATOM   1551  C  CZ3   . TRP A  1 207 ? 72.246  46.734  -50.190  1.00 14.27  ? 313 TRP A CZ3   1 
ATOM   1552  C  CH2   . TRP A  1 207 ? 71.655  45.491  -49.874  1.00 14.46  ? 313 TRP A CH2   1 
ATOM   1553  N  N     . ASP A  1 208 ? 77.126  47.697  -55.688  1.00 12.00  ? 314 ASP A N     1 
ATOM   1554  C  CA    . ASP A  1 208 ? 77.851  48.752  -56.353  1.00 11.91  ? 314 ASP A CA    1 
ATOM   1555  C  C     . ASP A  1 208 ? 78.342  48.290  -57.716  1.00 11.92  ? 314 ASP A C     1 
ATOM   1556  O  O     . ASP A  1 208 ? 78.100  48.967  -58.720  1.00 12.15  ? 314 ASP A O     1 
ATOM   1557  C  CB    . ASP A  1 208 ? 79.060  49.231  -55.567  1.00 11.70  ? 314 ASP A CB    1 
ATOM   1558  C  CG    . ASP A  1 208 ? 79.799  50.339  -56.290  1.00 11.47  ? 314 ASP A CG    1 
ATOM   1559  O  OD1   . ASP A  1 208 ? 79.373  51.507  -56.127  1.00 11.27  ? 314 ASP A OD1   1 
ATOM   1560  O  OD2   . ASP A  1 208 ? 80.756  50.049  -57.062  1.00 11.25  ? 314 ASP A OD2   1 
ATOM   1561  N  N     . TYR A  1 209 ? 79.055  47.170  -57.775  1.00 11.83  ? 315 TYR A N     1 
ATOM   1562  C  CA    . TYR A  1 209 ? 79.667  46.785  -59.052  1.00 11.81  ? 315 TYR A CA    1 
ATOM   1563  C  C     . TYR A  1 209 ? 78.645  46.400  -60.122  1.00 12.57  ? 315 TYR A C     1 
ATOM   1564  O  O     . TYR A  1 209 ? 78.919  46.563  -61.305  1.00 12.78  ? 315 TYR A O     1 
ATOM   1565  C  CB    . TYR A  1 209 ? 80.786  45.752  -58.898  1.00 11.14  ? 315 TYR A CB    1 
ATOM   1566  C  CG    . TYR A  1 209 ? 80.418  44.276  -58.781  1.00 10.57  ? 315 TYR A CG    1 
ATOM   1567  C  CD1   . TYR A  1 209 ? 79.926  43.557  -59.869  1.00 10.34  ? 315 TYR A CD1   1 
ATOM   1568  C  CD2   . TYR A  1 209 ? 80.689  43.570  -57.612  1.00 10.32  ? 315 TYR A CD2   1 
ATOM   1569  C  CE1   . TYR A  1 209 ? 79.647  42.194  -59.761  1.00 10.18  ? 315 TYR A CE1   1 
ATOM   1570  C  CE2   . TYR A  1 209 ? 80.432  42.218  -57.503  1.00 10.27  ? 315 TYR A CE2   1 
ATOM   1571  C  CZ    . TYR A  1 209 ? 79.897  41.531  -58.577  1.00 10.24  ? 315 TYR A CZ    1 
ATOM   1572  O  OH    . TYR A  1 209 ? 79.637  40.192  -58.444  1.00 10.27  ? 315 TYR A OH    1 
ATOM   1573  N  N     . PHE A  1 210 ? 77.472  45.907  -59.736  1.00 13.47  ? 316 PHE A N     1 
ATOM   1574  C  CA    . PHE A  1 210 ? 76.413  45.698  -60.725  1.00 14.35  ? 316 PHE A CA    1 
ATOM   1575  C  C     . PHE A  1 210 ? 76.111  47.027  -61.405  1.00 14.38  ? 316 PHE A C     1 
ATOM   1576  O  O     . PHE A  1 210 ? 76.231  47.159  -62.611  1.00 14.27  ? 316 PHE A O     1 
ATOM   1577  C  CB    . PHE A  1 210 ? 75.142  45.169  -60.069  1.00 15.33  ? 316 PHE A CB    1 
ATOM   1578  C  CG    . PHE A  1 210 ? 75.191  43.729  -59.626  1.00 16.13  ? 316 PHE A CG    1 
ATOM   1579  C  CD1   . PHE A  1 210 ? 76.319  42.944  -59.745  1.00 16.59  ? 316 PHE A CD1   1 
ATOM   1580  C  CD2   . PHE A  1 210 ? 74.066  43.190  -59.022  1.00 16.79  ? 316 PHE A CD2   1 
ATOM   1581  C  CE1   . PHE A  1 210 ? 76.318  41.633  -59.285  1.00 17.21  ? 316 PHE A CE1   1 
ATOM   1582  C  CE2   . PHE A  1 210 ? 74.045  41.889  -58.587  1.00 17.18  ? 316 PHE A CE2   1 
ATOM   1583  C  CZ    . PHE A  1 210 ? 75.170  41.109  -58.698  1.00 17.36  ? 316 PHE A CZ    1 
ATOM   1584  N  N     . ALA A  1 211 ? 75.752  48.008  -60.592  1.00 14.59  ? 317 ALA A N     1 
ATOM   1585  C  CA    . ALA A  1 211 ? 75.377  49.329  -61.070  1.00 14.84  ? 317 ALA A CA    1 
ATOM   1586  C  C     . ALA A  1 211 ? 76.517  49.978  -61.842  1.00 14.99  ? 317 ALA A C     1 
ATOM   1587  O  O     . ALA A  1 211 ? 76.300  50.528  -62.917  1.00 15.12  ? 317 ALA A O     1 
ATOM   1588  C  CB    . ALA A  1 211 ? 74.978  50.207  -59.893  1.00 14.87  ? 317 ALA A CB    1 
ATOM   1589  N  N     . ARG A  1 212 ? 77.722  49.889  -61.298  1.00 15.41  ? 318 ARG A N     1 
ATOM   1590  C  CA    . ARG A  1 212 ? 78.869  50.570  -61.867  1.00 16.21  ? 318 ARG A CA    1 
ATOM   1591  C  C     . ARG A  1 212 ? 79.355  49.926  -63.135  1.00 16.21  ? 318 ARG A C     1 
ATOM   1592  O  O     . ARG A  1 212 ? 79.625  50.617  -64.103  1.00 15.78  ? 318 ARG A O     1 
ATOM   1593  C  CB    . ARG A  1 212 ? 80.026  50.595  -60.872  1.00 16.85  ? 318 ARG A CB    1 
ATOM   1594  C  CG    . ARG A  1 212 ? 81.162  51.537  -61.294  1.00 17.49  ? 318 ARG A CG    1 
ATOM   1595  C  CD    . ARG A  1 212 ? 82.170  51.713  -60.170  1.00 17.94  ? 318 ARG A CD    1 
ATOM   1596  N  NE    . ARG A  1 212 ? 81.475  52.203  -58.981  1.00 17.95  ? 318 ARG A NE    1 
ATOM   1597  C  CZ    . ARG A  1 212 ? 81.104  53.453  -58.796  1.00 18.22  ? 318 ARG A CZ    1 
ATOM   1598  N  NH1   . ARG A  1 212 ? 81.396  54.402  -59.721  1.00 18.33  ? 318 ARG A NH1   1 
ATOM   1599  N  NH2   . ARG A  1 212 ? 80.444  53.749  -57.670  1.00 18.51  ? 318 ARG A NH2   1 
ATOM   1600  N  N     . ASP A  1 213 ? 79.517  48.601  -63.110  1.00 16.77  ? 319 ASP A N     1 
ATOM   1601  C  CA    . ASP A  1 213 ? 80.060  47.885  -64.266  1.00 17.30  ? 319 ASP A CA    1 
ATOM   1602  C  C     . ASP A  1 213 ? 79.076  48.045  -65.414  1.00 18.12  ? 319 ASP A C     1 
ATOM   1603  O  O     . ASP A  1 213 ? 79.490  48.375  -66.526  1.00 19.43  ? 319 ASP A O     1 
ATOM   1604  C  CB    . ASP A  1 213 ? 80.360  46.404  -63.981  1.00 17.31  ? 319 ASP A CB    1 
ATOM   1605  C  CG    . ASP A  1 213 ? 81.444  46.190  -62.908  1.00 17.59  ? 319 ASP A CG    1 
ATOM   1606  O  OD1   . ASP A  1 213 ? 82.149  47.182  -62.530  1.00 17.91  ? 319 ASP A OD1   1 
ATOM   1607  O  OD2   . ASP A  1 213 ? 81.568  45.014  -62.435  1.00 17.35  ? 319 ASP A OD2   1 
ATOM   1608  N  N     . CYS A  1 214 ? 77.785  47.878  -65.146  1.00 18.29  ? 320 CYS A N     1 
ATOM   1609  C  CA    . CYS A  1 214 ? 76.756  48.109  -66.170  1.00 18.36  ? 320 CYS A CA    1 
ATOM   1610  C  C     . CYS A  1 214 ? 76.843  49.498  -66.820  1.00 17.96  ? 320 CYS A C     1 
ATOM   1611  O  O     . CYS A  1 214 ? 76.770  49.640  -68.044  1.00 17.98  ? 320 CYS A O     1 
ATOM   1612  C  CB    . CYS A  1 214 ? 75.374  47.891  -65.581  1.00 18.96  ? 320 CYS A CB    1 
ATOM   1613  S  SG    . CYS A  1 214 ? 75.046  46.141  -65.408  1.00 21.13  ? 320 CYS A SG    1 
ATOM   1614  N  N     . HIS A  1 215 ? 77.018  50.515  -65.994  1.00 17.51  ? 321 HIS A N     1 
ATOM   1615  C  CA    . HIS A  1 215 ? 77.069  51.888  -66.479  1.00 17.78  ? 321 HIS A CA    1 
ATOM   1616  C  C     . HIS A  1 215 ? 78.176  52.065  -67.500  1.00 18.38  ? 321 HIS A C     1 
ATOM   1617  O  O     . HIS A  1 215 ? 77.958  52.679  -68.551  1.00 18.40  ? 321 HIS A O     1 
ATOM   1618  C  CB    . HIS A  1 215 ? 77.276  52.810  -65.295  1.00 17.60  ? 321 HIS A CB    1 
ATOM   1619  C  CG    . HIS A  1 215 ? 77.371  54.267  -65.632  1.00 17.71  ? 321 HIS A CG    1 
ATOM   1620  N  ND1   . HIS A  1 215 ? 76.262  55.056  -65.823  1.00 17.72  ? 321 HIS A ND1   1 
ATOM   1621  C  CD2   . HIS A  1 215 ? 78.447  55.091  -65.729  1.00 17.87  ? 321 HIS A CD2   1 
ATOM   1622  C  CE1   . HIS A  1 215 ? 76.658  56.310  -66.003  1.00 18.08  ? 321 HIS A CE1   1 
ATOM   1623  N  NE2   . HIS A  1 215 ? 77.983  56.347  -65.986  1.00 18.14  ? 321 HIS A NE2   1 
ATOM   1624  N  N     . HIS A  1 216 ? 79.341  51.503  -67.187  1.00 19.17  ? 322 HIS A N     1 
ATOM   1625  C  CA    . HIS A  1 216 ? 80.533  51.640  -68.018  1.00 20.38  ? 322 HIS A CA    1 
ATOM   1626  C  C     . HIS A  1 216 ? 80.566  50.579  -69.150  1.00 20.09  ? 322 HIS A C     1 
ATOM   1627  O  O     . HIS A  1 216 ? 81.058  50.863  -70.244  1.00 20.81  ? 322 HIS A O     1 
ATOM   1628  C  CB    . HIS A  1 216 ? 81.830  51.611  -67.147  1.00 21.01  ? 322 HIS A CB    1 
ATOM   1629  C  CG    . HIS A  1 216 ? 82.007  52.820  -66.270  1.00 21.88  ? 322 HIS A CG    1 
ATOM   1630  N  ND1   . HIS A  1 216 ? 81.550  52.880  -64.971  1.00 22.36  ? 322 HIS A ND1   1 
ATOM   1631  C  CD2   . HIS A  1 216 ? 82.579  54.024  -66.513  1.00 22.93  ? 322 HIS A CD2   1 
ATOM   1632  C  CE1   . HIS A  1 216 ? 81.831  54.066  -64.445  1.00 22.83  ? 322 HIS A CE1   1 
ATOM   1633  N  NE2   . HIS A  1 216 ? 82.447  54.786  -65.363  1.00 23.31  ? 322 HIS A NE2   1 
ATOM   1634  N  N     . LEU A  1 217 ? 80.047  49.376  -68.905  1.00 19.40  ? 323 LEU A N     1 
ATOM   1635  C  CA    . LEU A  1 217 ? 80.087  48.320  -69.917  1.00 20.00  ? 323 LEU A CA    1 
ATOM   1636  C  C     . LEU A  1 217 ? 79.209  48.642  -71.116  1.00 21.63  ? 323 LEU A C     1 
ATOM   1637  O  O     . LEU A  1 217 ? 79.596  48.409  -72.289  1.00 23.21  ? 323 LEU A O     1 
ATOM   1638  C  CB    . LEU A  1 217 ? 79.648  46.982  -69.349  1.00 19.52  ? 323 LEU A CB    1 
ATOM   1639  C  CG    . LEU A  1 217 ? 80.644  46.253  -68.467  1.00 19.49  ? 323 LEU A CG    1 
ATOM   1640  C  CD1   . LEU A  1 217 ? 79.961  45.101  -67.752  1.00 19.62  ? 323 LEU A CD1   1 
ATOM   1641  C  CD2   . LEU A  1 217 ? 81.825  45.743  -69.281  1.00 19.54  ? 323 LEU A CD2   1 
ATOM   1642  N  N     . GLY A  1 218 ? 78.048  49.203  -70.812  1.00 22.68  ? 324 GLY A N     1 
ATOM   1643  C  CA    . GLY A  1 218 ? 76.985  49.382  -71.787  1.00 23.91  ? 324 GLY A CA    1 
ATOM   1644  C  C     . GLY A  1 218 ? 76.018  48.224  -71.775  1.00 24.91  ? 324 GLY A C     1 
ATOM   1645  O  O     . GLY A  1 218 ? 75.545  47.793  -72.803  1.00 26.87  ? 324 GLY A O     1 
ATOM   1646  N  N     . ILE A  1 219 ? 75.739  47.718  -70.591  1.00 25.98  ? 325 ILE A N     1 
ATOM   1647  C  CA    . ILE A  1 219 ? 74.707  46.723  -70.360  1.00 27.67  ? 325 ILE A CA    1 
ATOM   1648  C  C     . ILE A  1 219 ? 73.802  47.339  -69.304  1.00 30.11  ? 325 ILE A C     1 
ATOM   1649  O  O     . ILE A  1 219 ? 74.277  48.083  -68.474  1.00 31.06  ? 325 ILE A O     1 
ATOM   1650  C  CB    . ILE A  1 219 ? 75.362  45.453  -69.822  1.00 27.19  ? 325 ILE A CB    1 
ATOM   1651  C  CG1   . ILE A  1 219 ? 76.173  44.809  -70.938  1.00 26.59  ? 325 ILE A CG1   1 
ATOM   1652  C  CG2   . ILE A  1 219 ? 74.324  44.499  -69.237  1.00 27.43  ? 325 ILE A CG2   1 
ATOM   1653  C  CD1   . ILE A  1 219 ? 77.113  43.744  -70.429  1.00 26.71  ? 325 ILE A CD1   1 
ATOM   1654  N  N     . GLN A  1 220 ? 72.501  47.069  -69.349  1.00 31.89  ? 326 GLN A N     1 
ATOM   1655  C  CA    . GLN A  1 220 ? 71.603  47.560  -68.296  1.00 33.75  ? 326 GLN A CA    1 
ATOM   1656  C  C     . GLN A  1 220 ? 71.507  46.490  -67.159  1.00 34.77  ? 326 GLN A C     1 
ATOM   1657  O  O     . GLN A  1 220 ? 71.589  45.260  -67.354  1.00 32.02  ? 326 GLN A O     1 
ATOM   1658  C  CB    . GLN A  1 220 ? 70.227  48.037  -68.846  1.00 34.52  ? 326 GLN A CB    1 
ATOM   1659  N  N     . ASN A  1 221 ? 71.373  47.032  -65.953  1.00 36.47  ? 327 ASN A N     1 
ATOM   1660  C  CA    . ASN A  1 221 ? 71.382  46.288  -64.698  1.00 37.21  ? 327 ASN A CA    1 
ATOM   1661  C  C     . ASN A  1 221 ? 69.926  46.069  -64.310  1.00 39.39  ? 327 ASN A C     1 
ATOM   1662  O  O     . ASN A  1 221 ? 69.116  47.040  -64.268  1.00 43.19  ? 327 ASN A O     1 
ATOM   1663  C  CB    . ASN A  1 221 ? 72.081  47.162  -63.648  1.00 37.08  ? 327 ASN A CB    1 
ATOM   1664  C  CG    . ASN A  1 221 ? 72.001  46.612  -62.247  1.00 35.45  ? 327 ASN A CG    1 
ATOM   1665  O  OD1   . ASN A  1 221 ? 71.807  45.419  -62.044  1.00 35.31  ? 327 ASN A OD1   1 
ATOM   1666  N  ND2   . ASN A  1 221 ? 72.173  47.493  -61.267  1.00 32.58  ? 327 ASN A ND2   1 
ATOM   1667  N  N     . ASN A  1 222 ? 69.594  44.812  -63.990  1.00 38.37  ? 328 ASN A N     1 
ATOM   1668  C  CA    . ASN A  1 222 ? 68.207  44.490  -63.670  1.00 38.48  ? 328 ASN A CA    1 
ATOM   1669  C  C     . ASN A  1 222 ? 67.916  44.349  -62.161  1.00 36.15  ? 328 ASN A C     1 
ATOM   1670  O  O     . ASN A  1 222 ? 66.920  43.786  -61.802  1.00 35.17  ? 328 ASN A O     1 
ATOM   1671  C  CB    . ASN A  1 222 ? 67.815  43.280  -64.545  1.00 41.30  ? 328 ASN A CB    1 
ATOM   1672  C  CG    . ASN A  1 222 ? 66.458  42.661  -64.201  1.00 45.33  ? 328 ASN A CG    1 
ATOM   1673  O  OD1   . ASN A  1 222 ? 66.418  41.555  -63.641  1.00 48.79  ? 328 ASN A OD1   1 
ATOM   1674  N  ND2   . ASN A  1 222 ? 65.346  43.319  -64.588  1.00 46.41  ? 328 ASN A ND2   1 
ATOM   1675  N  N     . PHE A  1 223 ? 68.784  44.880  -61.287  1.00 34.19  ? 329 PHE A N     1 
ATOM   1676  C  CA    . PHE A  1 223 ? 68.658  44.678  -59.817  1.00 31.60  ? 329 PHE A CA    1 
ATOM   1677  C  C     . PHE A  1 223 ? 68.553  45.988  -59.064  1.00 29.29  ? 329 PHE A C     1 
ATOM   1678  O  O     . PHE A  1 223 ? 69.412  46.838  -59.207  1.00 27.59  ? 329 PHE A O     1 
ATOM   1679  C  CB    . PHE A  1 223 ? 69.846  43.916  -59.222  1.00 31.45  ? 329 PHE A CB    1 
ATOM   1680  C  CG    . PHE A  1 223 ? 69.746  43.726  -57.723  1.00 30.46  ? 329 PHE A CG    1 
ATOM   1681  C  CD1   . PHE A  1 223 ? 68.827  42.835  -57.190  1.00 30.14  ? 329 PHE A CD1   1 
ATOM   1682  C  CD2   . PHE A  1 223 ? 70.539  44.456  -56.852  1.00 30.06  ? 329 PHE A CD2   1 
ATOM   1683  C  CE1   . PHE A  1 223 ? 68.724  42.658  -55.815  1.00 30.13  ? 329 PHE A CE1   1 
ATOM   1684  C  CE2   . PHE A  1 223 ? 70.436  44.288  -55.484  1.00 29.85  ? 329 PHE A CE2   1 
ATOM   1685  C  CZ    . PHE A  1 223 ? 69.533  43.393  -54.960  1.00 29.73  ? 329 PHE A CZ    1 
ATOM   1686  N  N     . ASP A  1 224 ? 67.541  46.099  -58.207  1.00 28.11  ? 330 ASP A N     1 
ATOM   1687  C  CA    . ASP A  1 224 ? 67.240  47.335  -57.489  1.00 27.36  ? 330 ASP A CA    1 
ATOM   1688  C  C     . ASP A  1 224 ? 67.678  47.220  -56.044  1.00 27.22  ? 330 ASP A C     1 
ATOM   1689  O  O     . ASP A  1 224 ? 66.957  46.673  -55.220  1.00 26.39  ? 330 ASP A O     1 
ATOM   1690  C  CB    . ASP A  1 224 ? 65.727  47.609  -57.585  1.00 26.76  ? 330 ASP A CB    1 
ATOM   1691  C  CG    . ASP A  1 224 ? 65.350  49.013  -57.185  1.00 26.39  ? 330 ASP A CG    1 
ATOM   1692  O  OD1   . ASP A  1 224 ? 66.151  49.678  -56.467  1.00 26.22  ? 330 ASP A OD1   1 
ATOM   1693  O  OD2   . ASP A  1 224 ? 64.241  49.425  -57.616  1.00 26.40  ? 330 ASP A OD2   1 
ATOM   1694  N  N     . TYR A  1 225 ? 68.874  47.734  -55.740  1.00 27.86  ? 331 TYR A N     1 
ATOM   1695  C  CA    . TYR A  1 225 ? 69.431  47.636  -54.372  1.00 28.30  ? 331 TYR A CA    1 
ATOM   1696  C  C     . TYR A  1 225 ? 68.656  48.517  -53.401  1.00 27.83  ? 331 TYR A C     1 
ATOM   1697  O  O     . TYR A  1 225 ? 68.477  48.158  -52.245  1.00 28.52  ? 331 TYR A O     1 
ATOM   1698  C  CB    . TYR A  1 225 ? 70.931  47.959  -54.332  1.00 29.66  ? 331 TYR A CB    1 
ATOM   1699  C  CG    . TYR A  1 225 ? 71.305  49.432  -54.432  1.00 32.05  ? 331 TYR A CG    1 
ATOM   1700  C  CD1   . TYR A  1 225 ? 71.276  50.265  -53.298  1.00 33.21  ? 331 TYR A CD1   1 
ATOM   1701  C  CD2   . TYR A  1 225 ? 71.715  49.976  -55.663  1.00 33.59  ? 331 TYR A CD2   1 
ATOM   1702  C  CE1   . TYR A  1 225 ? 71.606  51.615  -53.380  1.00 34.27  ? 331 TYR A CE1   1 
ATOM   1703  C  CE2   . TYR A  1 225 ? 72.091  51.317  -55.770  1.00 35.36  ? 331 TYR A CE2   1 
ATOM   1704  C  CZ    . TYR A  1 225 ? 72.011  52.167  -54.638  1.00 36.46  ? 331 TYR A CZ    1 
ATOM   1705  O  OH    . TYR A  1 225 ? 72.357  53.519  -54.747  1.00 38.25  ? 331 TYR A OH    1 
ATOM   1706  N  N     . LYS A  1 226 ? 68.203  49.664  -53.872  1.00 27.29  ? 332 LYS A N     1 
ATOM   1707  C  CA    . LYS A  1 226 ? 67.457  50.584  -53.026  1.00 27.23  ? 332 LYS A CA    1 
ATOM   1708  C  C     . LYS A  1 226 ? 66.194  49.965  -52.470  1.00 25.56  ? 332 LYS A C     1 
ATOM   1709  O  O     . LYS A  1 226 ? 65.849  50.171  -51.301  1.00 24.69  ? 332 LYS A O     1 
ATOM   1710  C  CB    . LYS A  1 226 ? 67.111  51.857  -53.808  1.00 29.49  ? 332 LYS A CB    1 
ATOM   1711  C  CG    . LYS A  1 226 ? 68.319  52.728  -54.098  1.00 31.18  ? 332 LYS A CG    1 
ATOM   1712  C  CD    . LYS A  1 226 ? 67.945  54.231  -54.100  1.00 32.86  ? 332 LYS A CD    1 
ATOM   1713  C  CE    . LYS A  1 226 ? 69.100  55.051  -54.575  1.00 33.75  ? 332 LYS A CE    1 
ATOM   1714  N  NZ    . LYS A  1 226 ? 68.505  56.449  -54.763  1.00 34.28  ? 332 LYS A NZ    1 
ATOM   1715  N  N     . ARG A  1 227 ? 65.518  49.201  -53.314  1.00 24.75  ? 333 ARG A N     1 
ATOM   1716  C  CA    . ARG A  1 227 ? 64.320  48.482  -52.938  1.00 24.77  ? 333 ARG A CA    1 
ATOM   1717  C  C     . ARG A  1 227 ? 64.636  47.437  -51.884  1.00 24.86  ? 333 ARG A C     1 
ATOM   1718  O  O     . ARG A  1 227 ? 63.897  47.289  -50.918  1.00 24.95  ? 333 ARG A O     1 
ATOM   1719  C  CB    . ARG A  1 227 ? 63.691  47.813  -54.165  1.00 24.97  ? 333 ARG A CB    1 
ATOM   1720  C  CG    . ARG A  1 227 ? 62.359  47.134  -53.895  1.00 25.60  ? 333 ARG A CG    1 
ATOM   1721  C  CD    . ARG A  1 227 ? 61.757  46.470  -55.110  1.00 26.57  ? 333 ARG A CD    1 
ATOM   1722  N  NE    . ARG A  1 227 ? 60.767  45.467  -54.748  1.00 27.14  ? 333 ARG A NE    1 
ATOM   1723  C  CZ    . ARG A  1 227 ? 59.487  45.722  -54.457  1.00 27.87  ? 333 ARG A CZ    1 
ATOM   1724  N  NH1   . ARG A  1 227 ? 58.972  46.963  -54.525  1.00 28.37  ? 333 ARG A NH1   1 
ATOM   1725  N  NH2   . ARG A  1 227 ? 58.686  44.713  -54.097  1.00 28.05  ? 333 ARG A NH2   1 
ATOM   1726  N  N     . PHE A  1 228 ? 65.726  46.702  -52.068  1.00 25.14  ? 334 PHE A N     1 
ATOM   1727  C  CA    . PHE A  1 228 ? 66.100  45.672  -51.108  1.00 25.19  ? 334 PHE A CA    1 
ATOM   1728  C  C     . PHE A  1 228 ? 66.328  46.255  -49.718  1.00 25.51  ? 334 PHE A C     1 
ATOM   1729  O  O     . PHE A  1 228 ? 65.937  45.635  -48.717  1.00 25.78  ? 334 PHE A O     1 
ATOM   1730  C  CB    . PHE A  1 228 ? 67.323  44.880  -51.581  1.00 24.80  ? 334 PHE A CB    1 
ATOM   1731  C  CG    . PHE A  1 228 ? 67.720  43.811  -50.641  1.00 25.37  ? 334 PHE A CG    1 
ATOM   1732  C  CD1   . PHE A  1 228 ? 68.565  44.097  -49.582  1.00 25.64  ? 334 PHE A CD1   1 
ATOM   1733  C  CD2   . PHE A  1 228 ? 67.176  42.541  -50.745  1.00 25.85  ? 334 PHE A CD2   1 
ATOM   1734  C  CE1   . PHE A  1 228 ? 68.902  43.121  -48.663  1.00 25.88  ? 334 PHE A CE1   1 
ATOM   1735  C  CE2   . PHE A  1 228 ? 67.488  41.565  -49.827  1.00 26.42  ? 334 PHE A CE2   1 
ATOM   1736  C  CZ    . PHE A  1 228 ? 68.353  41.860  -48.776  1.00 26.41  ? 334 PHE A CZ    1 
ATOM   1737  N  N     . ILE A  1 229 ? 66.945  47.434  -49.671  1.00 26.04  ? 335 ILE A N     1 
ATOM   1738  C  CA    . ILE A  1 229 ? 67.172  48.157  -48.423  1.00 27.27  ? 335 ILE A CA    1 
ATOM   1739  C  C     . ILE A  1 229 ? 65.846  48.544  -47.767  1.00 29.39  ? 335 ILE A C     1 
ATOM   1740  O  O     . ILE A  1 229 ? 65.696  48.396  -46.577  1.00 28.61  ? 335 ILE A O     1 
ATOM   1741  C  CB    . ILE A  1 229 ? 68.079  49.387  -48.632  1.00 26.70  ? 335 ILE A CB    1 
ATOM   1742  C  CG1   . ILE A  1 229 ? 69.486  48.932  -48.969  1.00 26.84  ? 335 ILE A CG1   1 
ATOM   1743  C  CG2   . ILE A  1 229 ? 68.150  50.240  -47.379  1.00 26.90  ? 335 ILE A CG2   1 
ATOM   1744  C  CD1   . ILE A  1 229 ? 70.459  50.035  -49.320  1.00 27.25  ? 335 ILE A CD1   1 
ATOM   1745  N  N     . LYS A  1 230 ? 64.880  49.020  -48.530  1.00 33.49  ? 336 LYS A N     1 
ATOM   1746  C  CA    . LYS A  1 230 ? 63.577  49.337  -47.945  1.00 36.24  ? 336 LYS A CA    1 
ATOM   1747  C  C     . LYS A  1 230 ? 62.886  48.164  -47.280  1.00 36.31  ? 336 LYS A C     1 
ATOM   1748  O  O     . LYS A  1 230 ? 62.107  48.362  -46.368  1.00 38.34  ? 336 LYS A O     1 
ATOM   1749  C  CB    . LYS A  1 230 ? 62.613  49.912  -48.987  1.00 38.86  ? 336 LYS A CB    1 
ATOM   1750  C  CG    . LYS A  1 230 ? 63.039  51.253  -49.552  1.00 41.83  ? 336 LYS A CG    1 
ATOM   1751  C  CD    . LYS A  1 230 ? 62.707  52.349  -48.540  1.00 44.09  ? 336 LYS A CD    1 
ATOM   1752  C  CE    . LYS A  1 230 ? 63.094  53.664  -49.120  1.00 48.60  ? 336 LYS A CE    1 
ATOM   1753  N  NZ    . LYS A  1 230 ? 63.610  54.595  -48.089  1.00 52.68  ? 336 LYS A NZ    1 
ATOM   1754  N  N     . PHE A  1 231 ? 63.132  46.955  -47.758  1.00 36.62  ? 337 PHE A N     1 
ATOM   1755  C  CA    . PHE A  1 231 ? 62.506  45.761  -47.191  1.00 37.25  ? 337 PHE A CA    1 
ATOM   1756  C  C     . PHE A  1 231 ? 63.496  44.870  -46.464  1.00 36.91  ? 337 PHE A C     1 
ATOM   1757  O  O     . PHE A  1 231 ? 63.315  43.658  -46.397  1.00 37.38  ? 337 PHE A O     1 
ATOM   1758  C  CB    . PHE A  1 231 ? 61.762  44.990  -48.291  1.00 39.00  ? 337 PHE A CB    1 
ATOM   1759  C  CG    . PHE A  1 231 ? 60.731  45.819  -48.997  1.00 39.71  ? 337 PHE A CG    1 
ATOM   1760  C  CD1   . PHE A  1 231 ? 59.684  46.398  -48.282  1.00 40.57  ? 337 PHE A CD1   1 
ATOM   1761  C  CD2   . PHE A  1 231 ? 60.819  46.055  -50.349  1.00 38.92  ? 337 PHE A CD2   1 
ATOM   1762  C  CE1   . PHE A  1 231 ? 58.748  47.189  -48.912  1.00 40.06  ? 337 PHE A CE1   1 
ATOM   1763  C  CE2   . PHE A  1 231 ? 59.888  46.843  -50.987  1.00 38.62  ? 337 PHE A CE2   1 
ATOM   1764  C  CZ    . PHE A  1 231 ? 58.856  47.412  -50.280  1.00 39.83  ? 337 PHE A CZ    1 
ATOM   1765  N  N     . ALA A  1 232 ? 64.531  45.472  -45.901  1.00 37.41  ? 338 ALA A N     1 
ATOM   1766  C  CA    . ALA A  1 232 ? 65.514  44.735  -45.138  1.00 37.28  ? 338 ALA A CA    1 
ATOM   1767  C  C     . ALA A  1 232 ? 65.237  44.996  -43.693  1.00 35.92  ? 338 ALA A C     1 
ATOM   1768  O  O     . ALA A  1 232 ? 64.689  46.031  -43.336  1.00 36.48  ? 338 ALA A O     1 
ATOM   1769  C  CB    . ALA A  1 232 ? 66.917  45.183  -45.498  1.00 38.09  ? 338 ALA A CB    1 
ATOM   1770  N  N     . ARG A  1 233 ? 65.615  44.051  -42.847  1.00 36.36  ? 339 ARG A N     1 
ATOM   1771  C  CA    . ARG A  1 233 ? 65.260  44.097  -41.444  1.00 38.00  ? 339 ARG A CA    1 
ATOM   1772  C  C     . ARG A  1 233 ? 66.053  43.049  -40.677  1.00 35.83  ? 339 ARG A C     1 
ATOM   1773  O  O     . ARG A  1 233 ? 66.377  41.990  -41.220  1.00 34.08  ? 339 ARG A O     1 
ATOM   1774  C  CB    . ARG A  1 233 ? 63.766  43.805  -41.325  1.00 41.78  ? 339 ARG A CB    1 
ATOM   1775  C  CG    . ARG A  1 233 ? 63.180  44.147  -39.994  1.00 44.30  ? 339 ARG A CG    1 
ATOM   1776  C  CD    . ARG A  1 233 ? 61.706  43.895  -39.989  1.00 47.62  ? 339 ARG A CD    1 
ATOM   1777  N  NE    . ARG A  1 233 ? 61.241  43.895  -38.620  1.00 52.18  ? 339 ARG A NE    1 
ATOM   1778  C  CZ    . ARG A  1 233 ? 61.063  44.979  -37.861  1.00 54.68  ? 339 ARG A CZ    1 
ATOM   1779  N  NH1   . ARG A  1 233 ? 61.268  46.194  -38.332  1.00 56.56  ? 339 ARG A NH1   1 
ATOM   1780  N  NH2   . ARG A  1 233 ? 60.666  44.840  -36.603  1.00 57.25  ? 339 ARG A NH2   1 
ATOM   1781  N  N     . VAL A  1 234 ? 66.388  43.347  -39.426  1.00 35.46  ? 340 VAL A N     1 
ATOM   1782  C  CA    . VAL A  1 234 ? 67.144  42.435  -38.570  1.00 35.95  ? 340 VAL A CA    1 
ATOM   1783  C  C     . VAL A  1 234 ? 66.182  41.638  -37.708  1.00 36.00  ? 340 VAL A C     1 
ATOM   1784  O  O     . VAL A  1 234 ? 65.323  42.223  -37.084  1.00 35.17  ? 340 VAL A O     1 
ATOM   1785  C  CB    . VAL A  1 234 ? 68.125  43.191  -37.669  1.00 36.15  ? 340 VAL A CB    1 
ATOM   1786  C  CG1   . VAL A  1 234 ? 68.921  42.221  -36.795  1.00 37.01  ? 340 VAL A CG1   1 
ATOM   1787  C  CG2   . VAL A  1 234 ? 69.078  44.015  -38.527  1.00 35.51  ? 340 VAL A CG2   1 
ATOM   1788  N  N     . CYS A  1 235 ? 66.341  40.310  -37.695  1.00 36.07  ? 341 CYS A N     1 
ATOM   1789  C  CA    . CYS A  1 235 ? 65.544  39.399  -36.871  1.00 38.27  ? 341 CYS A CA    1 
ATOM   1790  C  C     . CYS A  1 235 ? 66.447  38.419  -36.181  1.00 41.53  ? 341 CYS A C     1 
ATOM   1791  O  O     . CYS A  1 235 ? 67.577  38.245  -36.596  1.00 41.63  ? 341 CYS A O     1 
ATOM   1792  C  CB    . CYS A  1 235 ? 64.600  38.581  -37.726  1.00 37.59  ? 341 CYS A CB    1 
ATOM   1793  S  SG    . CYS A  1 235 ? 63.574  39.534  -38.824  1.00 36.86  ? 341 CYS A SG    1 
ATOM   1794  N  N     . GLU A  1 236 ? 65.920  37.737  -35.167  1.00 46.79  ? 342 GLU A N     1 
ATOM   1795  C  CA    . GLU A  1 236 ? 66.686  36.696  -34.491  1.00 50.18  ? 342 GLU A CA    1 
ATOM   1796  C  C     . GLU A  1 236 ? 66.612  35.423  -35.310  1.00 48.21  ? 342 GLU A C     1 
ATOM   1797  O  O     . GLU A  1 236 ? 65.537  35.038  -35.738  1.00 47.74  ? 342 GLU A O     1 
ATOM   1798  C  CB    . GLU A  1 236 ? 66.158  36.462  -33.076  1.00 57.35  ? 342 GLU A CB    1 
ATOM   1799  C  CG    . GLU A  1 236 ? 67.047  35.536  -32.240  1.00 62.68  ? 342 GLU A CG    1 
ATOM   1800  C  CD    . GLU A  1 236 ? 66.565  35.341  -30.812  1.00 67.94  ? 342 GLU A CD    1 
ATOM   1801  O  OE1   . GLU A  1 236 ? 65.676  36.101  -30.329  1.00 70.74  ? 342 GLU A OE1   1 
ATOM   1802  O  OE2   . GLU A  1 236 ? 67.106  34.408  -30.159  1.00 74.87  ? 342 GLU A OE2   1 
ATOM   1803  N  N     . VAL A  1 237 ? 67.759  34.799  -35.547  1.00 48.63  ? 343 VAL A N     1 
ATOM   1804  C  CA    . VAL A  1 237 ? 67.858  33.495  -36.213  1.00 51.12  ? 343 VAL A CA    1 
ATOM   1805  C  C     . VAL A  1 237 ? 68.934  32.677  -35.510  1.00 54.71  ? 343 VAL A C     1 
ATOM   1806  O  O     . VAL A  1 237 ? 70.083  33.060  -35.537  1.00 53.86  ? 343 VAL A O     1 
ATOM   1807  C  CB    . VAL A  1 237 ? 68.253  33.628  -37.712  1.00 51.39  ? 343 VAL A CB    1 
ATOM   1808  C  CG1   . VAL A  1 237 ? 68.017  32.299  -38.433  1.00 52.40  ? 343 VAL A CG1   1 
ATOM   1809  C  CG2   . VAL A  1 237 ? 67.482  34.739  -38.395  1.00 51.41  ? 343 VAL A CG2   1 
ATOM   1810  N  N     . ASP A  1 238 ? 68.555  31.564  -34.883  1.00 58.94  ? 344 ASP A N     1 
ATOM   1811  C  CA    . ASP A  1 238 ? 69.505  30.672  -34.182  1.00 60.27  ? 344 ASP A CA    1 
ATOM   1812  C  C     . ASP A  1 238 ? 70.396  31.463  -33.222  1.00 61.13  ? 344 ASP A C     1 
ATOM   1813  O  O     . ASP A  1 238 ? 71.613  31.489  -33.375  1.00 61.44  ? 344 ASP A O     1 
ATOM   1814  C  CB    . ASP A  1 238 ? 70.373  29.883  -35.185  1.00 62.15  ? 344 ASP A CB    1 
ATOM   1815  C  CG    . ASP A  1 238 ? 69.555  29.000  -36.121  1.00 64.99  ? 344 ASP A CG    1 
ATOM   1816  O  OD1   . ASP A  1 238 ? 68.390  28.688  -35.817  1.00 68.43  ? 344 ASP A OD1   1 
ATOM   1817  O  OD2   . ASP A  1 238 ? 70.089  28.618  -37.183  1.00 67.00  ? 344 ASP A OD2   1 
ATOM   1818  N  N     . ASN A  1 239 ? 69.758  32.139  -32.270  1.00 63.18  ? 345 ASN A N     1 
ATOM   1819  C  CA    . ASN A  1 239 ? 70.424  32.870  -31.171  1.00 65.17  ? 345 ASN A CA    1 
ATOM   1820  C  C     . ASN A  1 239 ? 71.407  33.970  -31.627  1.00 60.44  ? 345 ASN A C     1 
ATOM   1821  O  O     . ASN A  1 239 ? 72.389  34.280  -30.949  1.00 62.08  ? 345 ASN A O     1 
ATOM   1822  C  CB    . ASN A  1 239 ? 71.169  31.872  -30.247  1.00 70.18  ? 345 ASN A CB    1 
ATOM   1823  C  CG    . ASN A  1 239 ? 70.265  30.766  -29.727  1.00 74.83  ? 345 ASN A CG    1 
ATOM   1824  O  OD1   . ASN A  1 239 ? 69.090  31.006  -29.384  1.00 82.10  ? 345 ASN A OD1   1 
ATOM   1825  N  ND2   . ASN A  1 239 ? 70.802  29.548  -29.671  1.00 75.21  ? 345 ASN A ND2   1 
ATOM   1826  N  N     . GLU A  1 240 ? 71.082  34.580  -32.754  1.00 55.93  ? 346 GLU A N     1 
ATOM   1827  C  CA    . GLU A  1 240 ? 71.991  35.503  -33.470  1.00 53.03  ? 346 GLU A CA    1 
ATOM   1828  C  C     . GLU A  1 240 ? 71.126  36.493  -34.263  1.00 49.36  ? 346 GLU A C     1 
ATOM   1829  O  O     . GLU A  1 240 ? 70.154  36.073  -34.893  1.00 48.50  ? 346 GLU A O     1 
ATOM   1830  C  CB    . GLU A  1 240 ? 72.881  34.680  -34.411  1.00 52.71  ? 346 GLU A CB    1 
ATOM   1831  C  CG    . GLU A  1 240 ? 74.013  35.460  -35.039  1.00 53.49  ? 346 GLU A CG    1 
ATOM   1832  C  CD    . GLU A  1 240 ? 74.940  34.572  -35.897  1.00 52.29  ? 346 GLU A CD    1 
ATOM   1833  O  OE1   . GLU A  1 240 ? 74.520  33.583  -36.496  1.00 51.74  ? 346 GLU A OE1   1 
ATOM   1834  O  OE2   . GLU A  1 240 ? 76.120  34.819  -36.023  1.00 51.31  ? 346 GLU A OE2   1 
ATOM   1835  N  N     . LEU A  1 241 ? 71.468  37.784  -34.219  1.00 45.45  ? 347 LEU A N     1 
ATOM   1836  C  CA    . LEU A  1 241 ? 70.685  38.806  -34.951  1.00 42.96  ? 347 LEU A CA    1 
ATOM   1837  C  C     . LEU A  1 241 ? 71.195  39.037  -36.386  1.00 42.78  ? 347 LEU A C     1 
ATOM   1838  O  O     . LEU A  1 241 ? 72.232  39.646  -36.567  1.00 44.85  ? 347 LEU A O     1 
ATOM   1839  C  CB    . LEU A  1 241 ? 70.703  40.137  -34.203  1.00 41.70  ? 347 LEU A CB    1 
ATOM   1840  C  CG    . LEU A  1 241 ? 69.865  40.264  -32.950  1.00 42.84  ? 347 LEU A CG    1 
ATOM   1841  C  CD1   . LEU A  1 241 ? 70.079  41.634  -32.340  1.00 43.45  ? 347 LEU A CD1   1 
ATOM   1842  C  CD2   . LEU A  1 241 ? 68.376  40.110  -33.222  1.00 44.04  ? 347 LEU A CD2   1 
ATOM   1843  N  N     . ARG A  1 242 ? 70.440  38.591  -37.392  1.00 42.73  ? 348 ARG A N     1 
ATOM   1844  C  CA    . ARG A  1 242 ? 70.843  38.651  -38.802  1.00 41.83  ? 348 ARG A CA    1 
ATOM   1845  C  C     . ARG A  1 242 ? 69.904  39.515  -39.642  1.00 38.06  ? 348 ARG A C     1 
ATOM   1846  O  O     . ARG A  1 242 ? 68.778  39.786  -39.253  1.00 37.42  ? 348 ARG A O     1 
ATOM   1847  C  CB    . ARG A  1 242 ? 70.857  37.269  -39.402  1.00 45.01  ? 348 ARG A CB    1 
ATOM   1848  C  CG    . ARG A  1 242 ? 71.816  36.322  -38.700  1.00 49.10  ? 348 ARG A CG    1 
ATOM   1849  C  CD    . ARG A  1 242 ? 71.723  34.943  -39.383  1.00 53.30  ? 348 ARG A CD    1 
ATOM   1850  N  NE    . ARG A  1 242 ? 72.428  33.965  -38.571  1.00 58.60  ? 348 ARG A NE    1 
ATOM   1851  C  CZ    . ARG A  1 242 ? 72.264  32.648  -38.633  1.00 62.99  ? 348 ARG A CZ    1 
ATOM   1852  N  NH1   . ARG A  1 242 ? 71.373  32.102  -39.505  1.00 63.21  ? 348 ARG A NH1   1 
ATOM   1853  N  NH2   . ARG A  1 242 ? 72.972  31.878  -37.789  1.00 67.38  ? 348 ARG A NH2   1 
ATOM   1854  N  N     . ILE A  1 243 ? 70.388  39.928  -40.809  1.00 34.44  ? 349 ILE A N     1 
ATOM   1855  C  CA    . ILE A  1 243 ? 69.581  40.654  -41.772  1.00 32.79  ? 349 ILE A CA    1 
ATOM   1856  C  C     . ILE A  1 243 ? 68.664  39.675  -42.478  1.00 32.12  ? 349 ILE A C     1 
ATOM   1857  O  O     . ILE A  1 243 ? 69.086  38.583  -42.866  1.00 31.42  ? 349 ILE A O     1 
ATOM   1858  C  CB    . ILE A  1 243 ? 70.440  41.420  -42.809  1.00 31.44  ? 349 ILE A CB    1 
ATOM   1859  C  CG1   . ILE A  1 243 ? 71.284  42.486  -42.108  1.00 30.54  ? 349 ILE A CG1   1 
ATOM   1860  C  CG2   . ILE A  1 243 ? 69.560  42.114  -43.839  1.00 31.53  ? 349 ILE A CG2   1 
ATOM   1861  C  CD1   . ILE A  1 243 ? 72.272  43.208  -42.997  1.00 30.01  ? 349 ILE A CD1   1 
ATOM   1862  N  N     . CYS A  1 244 ? 67.411  40.088  -42.639  1.00 31.82  ? 350 CYS A N     1 
ATOM   1863  C  CA    . CYS A  1 244 ? 66.390  39.305  -43.318  1.00 31.96  ? 350 CYS A CA    1 
ATOM   1864  C  C     . CYS A  1 244 ? 65.706  40.164  -44.365  1.00 31.43  ? 350 CYS A C     1 
ATOM   1865  O  O     . CYS A  1 244 ? 65.547  41.367  -44.171  1.00 32.10  ? 350 CYS A O     1 
ATOM   1866  C  CB    . CYS A  1 244 ? 65.338  38.848  -42.323  1.00 32.52  ? 350 CYS A CB    1 
ATOM   1867  S  SG    . CYS A  1 244 ? 66.001  37.806  -41.024  1.00 34.43  ? 350 CYS A SG    1 
ATOM   1868  N  N     . ALA A  1 245 ? 65.280  39.533  -45.455  1.00 30.08  ? 351 ALA A N     1 
ATOM   1869  C  CA    . ALA A  1 245 ? 64.533  40.207  -46.504  1.00 29.61  ? 351 ALA A CA    1 
ATOM   1870  C  C     . ALA A  1 245 ? 63.070  39.873  -46.376  1.00 29.03  ? 351 ALA A C     1 
ATOM   1871  O  O     . ALA A  1 245 ? 62.723  38.904  -45.740  1.00 28.25  ? 351 ALA A O     1 
ATOM   1872  C  CB    . ALA A  1 245 ? 65.040  39.770  -47.859  1.00 29.97  ? 351 ALA A CB    1 
ATOM   1873  N  N     . ARG A  1 246 ? 62.204  40.662  -46.990  1.00 29.94  ? 352 ARG A N     1 
ATOM   1874  C  CA    . ARG A  1 246 ? 60.808  40.354  -46.927  1.00 31.34  ? 352 ARG A CA    1 
ATOM   1875  C  C     . ARG A  1 246 ? 60.465  39.161  -47.841  1.00 31.01  ? 352 ARG A C     1 
ATOM   1876  O  O     . ARG A  1 246 ? 61.112  38.954  -48.841  1.00 29.09  ? 352 ARG A O     1 
ATOM   1877  C  CB    . ARG A  1 246 ? 59.953  41.585  -47.207  1.00 32.89  ? 352 ARG A CB    1 
ATOM   1878  C  CG    . ARG A  1 246 ? 58.525  41.292  -46.879  1.00 34.74  ? 352 ARG A CG    1 
ATOM   1879  C  CD    . ARG A  1 246 ? 57.621  42.405  -46.529  1.00 35.21  ? 352 ARG A CD    1 
ATOM   1880  N  NE    . ARG A  1 246 ? 56.323  41.878  -46.877  1.00 35.79  ? 352 ARG A NE    1 
ATOM   1881  C  CZ    . ARG A  1 246 ? 55.307  42.636  -47.284  1.00 40.78  ? 352 ARG A CZ    1 
ATOM   1882  N  NH1   . ARG A  1 246 ? 54.176  42.071  -47.622  1.00 44.04  ? 352 ARG A NH1   1 
ATOM   1883  N  NH2   . ARG A  1 246 ? 55.445  43.969  -47.354  1.00 44.64  ? 352 ARG A NH2   1 
ATOM   1884  N  N     . ASP A  1 247 ? 59.465  38.375  -47.443  1.00 33.08  ? 353 ASP A N     1 
ATOM   1885  C  CA    . ASP A  1 247 ? 58.986  37.203  -48.200  1.00 34.30  ? 353 ASP A CA    1 
ATOM   1886  C  C     . ASP A  1 247 ? 58.821  37.458  -49.701  1.00 34.13  ? 353 ASP A C     1 
ATOM   1887  O  O     . ASP A  1 247 ? 59.247  36.653  -50.519  1.00 33.59  ? 353 ASP A O     1 
ATOM   1888  C  CB    . ASP A  1 247 ? 57.688  36.571  -47.579  1.00 35.27  ? 353 ASP A CB    1 
ATOM   1889  C  CG    . ASP A  1 247 ? 56.541  37.582  -47.314  1.00 35.97  ? 353 ASP A CG    1 
ATOM   1890  O  OD1   . ASP A  1 247 ? 56.680  38.808  -47.561  1.00 35.23  ? 353 ASP A OD1   1 
ATOM   1891  O  OD2   . ASP A  1 247 ? 55.465  37.150  -46.831  1.00 36.77  ? 353 ASP A OD2   1 
ATOM   1892  N  N     . LYS A  1 248 ? 58.235  38.583  -50.055  1.00 34.63  ? 354 LYS A N     1 
ATOM   1893  C  CA    . LYS A  1 248 ? 57.986  38.922  -51.454  1.00 36.20  ? 354 LYS A CA    1 
ATOM   1894  C  C     . LYS A  1 248 ? 59.273  39.147  -52.285  1.00 38.02  ? 354 LYS A C     1 
ATOM   1895  O  O     . LYS A  1 248 ? 59.297  38.900  -53.491  1.00 42.75  ? 354 LYS A O     1 
ATOM   1896  C  CB    . LYS A  1 248 ? 57.038  40.120  -51.557  1.00 36.82  ? 354 LYS A CB    1 
ATOM   1897  C  CG    . LYS A  1 248 ? 57.666  41.438  -51.196  1.00 37.68  ? 354 LYS A CG    1 
ATOM   1898  C  CD    . LYS A  1 248 ? 56.665  42.571  -50.990  1.00 37.41  ? 354 LYS A CD    1 
ATOM   1899  C  CE    . LYS A  1 248 ? 57.437  43.859  -50.614  1.00 37.77  ? 354 LYS A CE    1 
ATOM   1900  N  NZ    . LYS A  1 248 ? 56.498  45.005  -50.435  1.00 37.91  ? 354 LYS A NZ    1 
ATOM   1901  N  N     . GLU A  1 249 ? 60.350  39.584  -51.652  1.00 36.28  ? 355 GLU A N     1 
ATOM   1902  C  CA    . GLU A  1 249 ? 61.607  39.786  -52.368  1.00 34.51  ? 355 GLU A CA    1 
ATOM   1903  C  C     . GLU A  1 249 ? 62.334  38.505  -52.814  1.00 31.75  ? 355 GLU A C     1 
ATOM   1904  O  O     . GLU A  1 249 ? 63.338  38.599  -53.518  1.00 31.41  ? 355 GLU A O     1 
ATOM   1905  C  CB    . GLU A  1 249 ? 62.580  40.612  -51.519  1.00 37.29  ? 355 GLU A CB    1 
ATOM   1906  C  CG    . GLU A  1 249 ? 62.218  42.075  -51.339  1.00 40.41  ? 355 GLU A CG    1 
ATOM   1907  C  CD    . GLU A  1 249 ? 62.097  42.827  -52.658  1.00 43.70  ? 355 GLU A CD    1 
ATOM   1908  O  OE1   . GLU A  1 249 ? 63.175  43.345  -53.186  1.00 48.15  ? 355 GLU A OE1   1 
ATOM   1909  O  OE2   . GLU A  1 249 ? 60.919  42.886  -53.159  1.00 40.11  ? 355 GLU A OE2   1 
ATOM   1910  N  N     . VAL A  1 250 ? 61.881  37.323  -52.409  1.00 29.07  ? 356 VAL A N     1 
ATOM   1911  C  CA    . VAL A  1 250 ? 62.600  36.089  -52.731  1.00 27.94  ? 356 VAL A CA    1 
ATOM   1912  C  C     . VAL A  1 250 ? 62.874  35.978  -54.228  1.00 27.18  ? 356 VAL A C     1 
ATOM   1913  O  O     . VAL A  1 250 ? 63.963  35.591  -54.627  1.00 26.84  ? 356 VAL A O     1 
ATOM   1914  C  CB    . VAL A  1 250 ? 61.892  34.822  -52.193  1.00 27.57  ? 356 VAL A CB    1 
ATOM   1915  C  CG1   . VAL A  1 250 ? 60.577  34.575  -52.909  1.00 27.64  ? 356 VAL A CG1   1 
ATOM   1916  C  CG2   . VAL A  1 250 ? 62.800  33.587  -52.274  1.00 27.49  ? 356 VAL A CG2   1 
ATOM   1917  N  N     . GLY A  1 251 ? 61.901  36.362  -55.046  1.00 26.55  ? 357 GLY A N     1 
ATOM   1918  C  CA    . GLY A  1 251 ? 62.094  36.343  -56.494  1.00 25.85  ? 357 GLY A CA    1 
ATOM   1919  C  C     . GLY A  1 251 ? 63.207  37.255  -56.956  1.00 24.79  ? 357 GLY A C     1 
ATOM   1920  O  O     . GLY A  1 251 ? 64.064  36.859  -57.737  1.00 24.17  ? 357 GLY A O     1 
ATOM   1921  N  N     . ASN A  1 252 ? 63.201  38.481  -56.453  1.00 24.32  ? 358 ASN A N     1 
ATOM   1922  C  CA    . ASN A  1 252 ? 64.221  39.477  -56.797  1.00 23.50  ? 358 ASN A CA    1 
ATOM   1923  C  C     . ASN A  1 252 ? 65.618  39.056  -56.361  1.00 22.40  ? 358 ASN A C     1 
ATOM   1924  O  O     . ASN A  1 252 ? 66.597  39.457  -56.989  1.00 22.19  ? 358 ASN A O     1 
ATOM   1925  C  CB    . ASN A  1 252 ? 63.881  40.837  -56.192  1.00 23.91  ? 358 ASN A CB    1 
ATOM   1926  C  CG    . ASN A  1 252 ? 62.683  41.501  -56.863  1.00 24.36  ? 358 ASN A CG    1 
ATOM   1927  O  OD1   . ASN A  1 252 ? 62.398  41.270  -58.059  1.00 25.07  ? 358 ASN A OD1   1 
ATOM   1928  N  ND2   . ASN A  1 252 ? 61.982  42.341  -56.112  1.00 23.77  ? 358 ASN A ND2   1 
ATOM   1929  N  N     . LEU A  1 253 ? 65.708  38.272  -55.292  1.00 21.55  ? 359 LEU A N     1 
ATOM   1930  C  CA    . LEU A  1 253 ? 66.984  37.735  -54.853  1.00 20.95  ? 359 LEU A CA    1 
ATOM   1931  C  C     . LEU A  1 253 ? 67.509  36.636  -55.760  1.00 20.57  ? 359 LEU A C     1 
ATOM   1932  O  O     . LEU A  1 253 ? 68.695  36.610  -56.030  1.00 19.84  ? 359 LEU A O     1 
ATOM   1933  C  CB    . LEU A  1 253 ? 66.901  37.241  -53.405  1.00 20.77  ? 359 LEU A CB    1 
ATOM   1934  C  CG    . LEU A  1 253 ? 66.814  38.329  -52.352  1.00 20.49  ? 359 LEU A CG    1 
ATOM   1935  C  CD1   . LEU A  1 253 ? 66.737  37.709  -50.982  1.00 20.54  ? 359 LEU A CD1   1 
ATOM   1936  C  CD2   . LEU A  1 253 ? 68.056  39.221  -52.417  1.00 20.30  ? 359 LEU A CD2   1 
ATOM   1937  N  N     . TYR A  1 254 ? 66.653  35.746  -56.248  1.00 20.86  ? 360 TYR A N     1 
ATOM   1938  C  CA    . TYR A  1 254 ? 67.102  34.781  -57.255  1.00 21.44  ? 360 TYR A CA    1 
ATOM   1939  C  C     . TYR A  1 254 ? 67.578  35.531  -58.498  1.00 22.77  ? 360 TYR A C     1 
ATOM   1940  O  O     . TYR A  1 254 ? 68.569  35.126  -59.113  1.00 24.04  ? 360 TYR A O     1 
ATOM   1941  C  CB    . TYR A  1 254 ? 66.030  33.745  -57.641  1.00 20.97  ? 360 TYR A CB    1 
ATOM   1942  C  CG    . TYR A  1 254 ? 65.912  32.555  -56.709  1.00 20.68  ? 360 TYR A CG    1 
ATOM   1943  C  CD1   . TYR A  1 254 ? 66.763  31.458  -56.801  1.00 20.78  ? 360 TYR A CD1   1 
ATOM   1944  C  CD2   . TYR A  1 254 ? 64.924  32.513  -55.762  1.00 20.95  ? 360 TYR A CD2   1 
ATOM   1945  C  CE1   . TYR A  1 254 ? 66.640  30.361  -55.952  1.00 20.92  ? 360 TYR A CE1   1 
ATOM   1946  C  CE2   . TYR A  1 254 ? 64.780  31.425  -54.901  1.00 21.28  ? 360 TYR A CE2   1 
ATOM   1947  C  CZ    . TYR A  1 254 ? 65.641  30.355  -54.995  1.00 21.17  ? 360 TYR A CZ    1 
ATOM   1948  O  OH    . TYR A  1 254 ? 65.477  29.299  -54.106  1.00 21.39  ? 360 TYR A OH    1 
ATOM   1949  N  N     . ASP A  1 255 ? 66.881  36.611  -58.856  1.00 23.34  ? 361 ASP A N     1 
ATOM   1950  C  CA    . ASP A  1 255 ? 67.243  37.430  -60.022  1.00 23.75  ? 361 ASP A CA    1 
ATOM   1951  C  C     . ASP A  1 255 ? 68.540  38.203  -59.804  1.00 22.90  ? 361 ASP A C     1 
ATOM   1952  O  O     . ASP A  1 255 ? 69.226  38.526  -60.766  1.00 23.10  ? 361 ASP A O     1 
ATOM   1953  C  CB    . ASP A  1 255 ? 66.106  38.407  -60.421  1.00 25.13  ? 361 ASP A CB    1 
ATOM   1954  C  CG    . ASP A  1 255 ? 64.960  37.760  -61.228  1.00 26.77  ? 361 ASP A CG    1 
ATOM   1955  O  OD1   . ASP A  1 255 ? 64.866  36.487  -61.358  1.00 28.39  ? 361 ASP A OD1   1 
ATOM   1956  O  OD2   . ASP A  1 255 ? 64.097  38.589  -61.623  1.00 27.70  ? 361 ASP A OD2   1 
ATOM   1957  N  N     . MET A  1 256 ? 68.872  38.509  -58.553  1.00 21.78  ? 362 MET A N     1 
ATOM   1958  C  CA    . MET A  1 256 ? 70.162  39.126  -58.249  1.00 21.17  ? 362 MET A CA    1 
ATOM   1959  C  C     . MET A  1 256 ? 71.303  38.210  -58.678  1.00 20.96  ? 362 MET A C     1 
ATOM   1960  O  O     . MET A  1 256 ? 72.251  38.669  -59.327  1.00 21.33  ? 362 MET A O     1 
ATOM   1961  C  CB    . MET A  1 256 ? 70.304  39.468  -56.768  1.00 21.11  ? 362 MET A CB    1 
ATOM   1962  C  CG    . MET A  1 256 ? 71.458  40.432  -56.481  1.00 21.11  ? 362 MET A CG    1 
ATOM   1963  S  SD    . MET A  1 256 ? 71.997  40.453  -54.762  1.00 21.55  ? 362 MET A SD    1 
ATOM   1964  C  CE    . MET A  1 256 ? 73.167  39.074  -54.791  1.00 21.49  ? 362 MET A CE    1 
ATOM   1965  N  N     . PHE A  1 257 ? 71.215  36.931  -58.320  1.00 20.26  ? 363 PHE A N     1 
ATOM   1966  C  CA    . PHE A  1 257 ? 72.277  36.000  -58.670  1.00 20.20  ? 363 PHE A CA    1 
ATOM   1967  C  C     . PHE A  1 257 ? 72.264  35.647  -60.150  1.00 20.68  ? 363 PHE A C     1 
ATOM   1968  O  O     . PHE A  1 257 ? 73.314  35.324  -60.704  1.00 20.92  ? 363 PHE A O     1 
ATOM   1969  C  CB    . PHE A  1 257 ? 72.258  34.742  -57.790  1.00 19.63  ? 363 PHE A CB    1 
ATOM   1970  C  CG    . PHE A  1 257 ? 72.612  35.008  -56.360  1.00 19.06  ? 363 PHE A CG    1 
ATOM   1971  C  CD1   . PHE A  1 257 ? 73.932  35.117  -55.944  1.00 18.61  ? 363 PHE A CD1   1 
ATOM   1972  C  CD2   . PHE A  1 257 ? 71.617  35.165  -55.432  1.00 19.08  ? 363 PHE A CD2   1 
ATOM   1973  C  CE1   . PHE A  1 257 ? 74.243  35.366  -54.626  1.00 18.59  ? 363 PHE A CE1   1 
ATOM   1974  C  CE2   . PHE A  1 257 ? 71.910  35.418  -54.098  1.00 19.01  ? 363 PHE A CE2   1 
ATOM   1975  C  CZ    . PHE A  1 257 ? 73.229  35.520  -53.700  1.00 18.85  ? 363 PHE A CZ    1 
ATOM   1976  N  N     . HIS A  1 258 ? 71.090  35.707  -60.770  1.00 21.50  ? 364 HIS A N     1 
ATOM   1977  C  CA    . HIS A  1 258 ? 70.967  35.561  -62.220  1.00 22.97  ? 364 HIS A CA    1 
ATOM   1978  C  C     . HIS A  1 258 ? 71.706  36.701  -62.923  1.00 23.52  ? 364 HIS A C     1 
ATOM   1979  O  O     . HIS A  1 258 ? 72.516  36.470  -63.820  1.00 23.86  ? 364 HIS A O     1 
ATOM   1980  C  CB    . HIS A  1 258 ? 69.489  35.561  -62.648  1.00 24.07  ? 364 HIS A CB    1 
ATOM   1981  C  CG    . HIS A  1 258 ? 69.279  35.331  -64.115  1.00 24.98  ? 364 HIS A CG    1 
ATOM   1982  N  ND1   . HIS A  1 258 ? 69.047  34.075  -64.647  1.00 25.45  ? 364 HIS A ND1   1 
ATOM   1983  C  CD2   . HIS A  1 258 ? 69.248  36.198  -65.152  1.00 25.59  ? 364 HIS A CD2   1 
ATOM   1984  C  CE1   . HIS A  1 258 ? 68.833  34.179  -65.944  1.00 26.05  ? 364 HIS A CE1   1 
ATOM   1985  N  NE2   . HIS A  1 258 ? 68.968  35.453  -66.282  1.00 26.47  ? 364 HIS A NE2   1 
ATOM   1986  N  N     . THR A  1 259 ? 71.411  37.923  -62.506  1.00 23.69  ? 365 THR A N     1 
ATOM   1987  C  CA    . THR A  1 259 ? 72.087  39.119  -63.001  1.00 24.00  ? 365 THR A CA    1 
ATOM   1988  C  C     . THR A  1 259 ? 73.603  38.975  -62.900  1.00 22.99  ? 365 THR A C     1 
ATOM   1989  O  O     . THR A  1 259 ? 74.325  39.310  -63.836  1.00 22.01  ? 365 THR A O     1 
ATOM   1990  C  CB    . THR A  1 259 ? 71.601  40.379  -62.241  1.00 25.26  ? 365 THR A CB    1 
ATOM   1991  O  OG1   . THR A  1 259 ? 70.235  40.688  -62.684  1.00 25.58  ? 365 THR A OG1   1 
ATOM   1992  C  CG2   . THR A  1 259 ? 72.506  41.596  -62.482  1.00 26.00  ? 365 THR A CG2   1 
ATOM   1993  N  N     . ARG A  1 260 ? 74.074  38.479  -61.760  1.00 22.55  ? 366 ARG A N     1 
ATOM   1994  C  CA    . ARG A  1 260 ? 75.508  38.260  -61.538  1.00 22.33  ? 366 ARG A CA    1 
ATOM   1995  C  C     . ARG A  1 260 ? 76.078  37.305  -62.569  1.00 23.06  ? 366 ARG A C     1 
ATOM   1996  O  O     . ARG A  1 260 ? 77.082  37.600  -63.213  1.00 22.76  ? 366 ARG A O     1 
ATOM   1997  C  CB    . ARG A  1 260 ? 75.757  37.667  -60.148  1.00 21.39  ? 366 ARG A CB    1 
ATOM   1998  C  CG    . ARG A  1 260 ? 77.222  37.507  -59.817  1.00 20.51  ? 366 ARG A CG    1 
ATOM   1999  C  CD    . ARG A  1 260 ? 77.424  37.397  -58.318  1.00 20.11  ? 366 ARG A CD    1 
ATOM   2000  N  NE    . ARG A  1 260 ? 78.750  36.880  -58.006  1.00 19.64  ? 366 ARG A NE    1 
ATOM   2001  C  CZ    . ARG A  1 260 ? 79.101  35.614  -58.131  1.00 19.52  ? 366 ARG A CZ    1 
ATOM   2002  N  NH1   . ARG A  1 260 ? 78.246  34.684  -58.608  1.00 19.98  ? 366 ARG A NH1   1 
ATOM   2003  N  NH2   . ARG A  1 260 ? 80.315  35.245  -57.754  1.00 19.26  ? 366 ARG A NH2   1 
ATOM   2004  N  N     . ASN A  1 261 ? 75.428  36.155  -62.694  1.00 24.26  ? 367 ASN A N     1 
ATOM   2005  C  CA    . ASN A  1 261 ? 75.866  35.113  -63.600  1.00 25.34  ? 367 ASN A CA    1 
ATOM   2006  C  C     . ASN A  1 261 ? 75.826  35.617  -65.034  1.00 25.57  ? 367 ASN A C     1 
ATOM   2007  O  O     . ASN A  1 261 ? 76.697  35.328  -65.844  1.00 26.31  ? 367 ASN A O     1 
ATOM   2008  C  CB    . ASN A  1 261 ? 74.969  33.880  -63.454  1.00 26.43  ? 367 ASN A CB    1 
ATOM   2009  C  CG    . ASN A  1 261 ? 75.440  32.728  -64.291  1.00 27.34  ? 367 ASN A CG    1 
ATOM   2010  O  OD1   . ASN A  1 261 ? 76.503  32.209  -64.073  1.00 27.32  ? 367 ASN A OD1   1 
ATOM   2011  N  ND2   . ASN A  1 261 ? 74.633  32.329  -65.255  1.00 29.22  ? 367 ASN A ND2   1 
ATOM   2012  N  N     . SER A  1 262 ? 74.813  36.399  -65.328  1.00 25.84  ? 368 SER A N     1 
ATOM   2013  C  CA    . SER A  1 262 ? 74.644  36.994  -66.641  1.00 25.90  ? 368 SER A CA    1 
ATOM   2014  C  C     . SER A  1 262 ? 75.767  37.991  -66.981  1.00 23.77  ? 368 SER A C     1 
ATOM   2015  O  O     . SER A  1 262 ? 76.285  37.983  -68.093  1.00 24.36  ? 368 SER A O     1 
ATOM   2016  C  CB    . SER A  1 262 ? 73.261  37.635  -66.699  1.00 28.19  ? 368 SER A CB    1 
ATOM   2017  O  OG    . SER A  1 262 ? 72.956  38.063  -67.991  1.00 31.15  ? 368 SER A OG    1 
ATOM   2018  N  N     . LEU A  1 263 ? 76.158  38.823  -66.022  1.00 21.90  ? 369 LEU A N     1 
ATOM   2019  C  CA    . LEU A  1 263 ? 77.324  39.722  -66.193  1.00 21.15  ? 369 LEU A CA    1 
ATOM   2020  C  C     . LEU A  1 263 ? 78.639  38.987  -66.388  1.00 21.31  ? 369 LEU A C     1 
ATOM   2021  O  O     . LEU A  1 263 ? 79.520  39.451  -67.117  1.00 20.77  ? 369 LEU A O     1 
ATOM   2022  C  CB    . LEU A  1 263 ? 77.465  40.680  -65.014  1.00 20.31  ? 369 LEU A CB    1 
ATOM   2023  C  CG    . LEU A  1 263 ? 76.433  41.804  -65.013  1.00 19.85  ? 369 LEU A CG    1 
ATOM   2024  C  CD1   . LEU A  1 263 ? 76.505  42.517  -63.657  1.00 20.14  ? 369 LEU A CD1   1 
ATOM   2025  C  CD2   . LEU A  1 263 ? 76.702  42.776  -66.171  1.00 19.51  ? 369 LEU A CD2   1 
ATOM   2026  N  N     . HIS A  1 264 ? 78.776  37.851  -65.721  1.00 21.43  ? 370 HIS A N     1 
ATOM   2027  C  CA    . HIS A  1 264 ? 79.943  36.999  -65.925  1.00 21.20  ? 370 HIS A CA    1 
ATOM   2028  C  C     . HIS A  1 264 ? 79.962  36.411  -67.320  1.00 22.26  ? 370 HIS A C     1 
ATOM   2029  O  O     . HIS A  1 264 ? 81.013  36.393  -67.957  1.00 22.88  ? 370 HIS A O     1 
ATOM   2030  C  CB    . HIS A  1 264 ? 80.037  35.893  -64.871  1.00 20.29  ? 370 HIS A CB    1 
ATOM   2031  C  CG    . HIS A  1 264 ? 80.781  36.317  -63.656  1.00 19.58  ? 370 HIS A CG    1 
ATOM   2032  N  ND1   . HIS A  1 264 ? 82.144  36.315  -63.594  1.00 19.29  ? 370 HIS A ND1   1 
ATOM   2033  C  CD2   . HIS A  1 264 ? 80.356  36.814  -62.471  1.00 19.11  ? 370 HIS A CD2   1 
ATOM   2034  C  CE1   . HIS A  1 264 ? 82.532  36.778  -62.420  1.00 19.14  ? 370 HIS A CE1   1 
ATOM   2035  N  NE2   . HIS A  1 264 ? 81.461  37.089  -61.717  1.00 18.75  ? 370 HIS A NE2   1 
ATOM   2036  N  N     . ARG A  1 265 ? 78.813  35.954  -67.796  1.00 24.27  ? 371 ARG A N     1 
ATOM   2037  C  CA    . ARG A  1 265 ? 78.736  35.337  -69.108  1.00 26.73  ? 371 ARG A CA    1 
ATOM   2038  C  C     . ARG A  1 265 ? 79.009  36.344  -70.187  1.00 25.19  ? 371 ARG A C     1 
ATOM   2039  O  O     . ARG A  1 265 ? 79.834  36.087  -71.062  1.00 25.19  ? 371 ARG A O     1 
ATOM   2040  C  CB    . ARG A  1 265 ? 77.406  34.634  -69.352  1.00 31.40  ? 371 ARG A CB    1 
ATOM   2041  C  CG    . ARG A  1 265 ? 77.384  33.206  -68.814  1.00 36.56  ? 371 ARG A CG    1 
ATOM   2042  C  CD    . ARG A  1 265 ? 76.268  32.383  -69.434  1.00 41.17  ? 371 ARG A CD    1 
ATOM   2043  N  NE    . ARG A  1 265 ? 76.394  30.970  -69.049  1.00 46.21  ? 371 ARG A NE    1 
ATOM   2044  C  CZ    . ARG A  1 265 ? 77.039  30.025  -69.749  1.00 50.58  ? 371 ARG A CZ    1 
ATOM   2045  N  NH1   . ARG A  1 265 ? 77.657  30.287  -70.915  1.00 50.55  ? 371 ARG A NH1   1 
ATOM   2046  N  NH2   . ARG A  1 265 ? 77.057  28.789  -69.273  1.00 54.43  ? 371 ARG A NH2   1 
ATOM   2047  N  N     . ARG A  1 266 ? 78.367  37.498  -70.114  1.00 23.83  ? 372 ARG A N     1 
ATOM   2048  C  CA    . ARG A  1 266 ? 78.519  38.502  -71.156  1.00 23.93  ? 372 ARG A CA    1 
ATOM   2049  C  C     . ARG A  1 266 ? 79.866  39.223  -71.138  1.00 21.31  ? 372 ARG A C     1 
ATOM   2050  O  O     . ARG A  1 266 ? 80.485  39.410  -72.191  1.00 20.52  ? 372 ARG A O     1 
ATOM   2051  C  CB    . ARG A  1 266 ? 77.447  39.552  -71.035  1.00 26.61  ? 372 ARG A CB    1 
ATOM   2052  C  CG    . ARG A  1 266 ? 76.053  39.042  -71.279  1.00 30.09  ? 372 ARG A CG    1 
ATOM   2053  C  CD    . ARG A  1 266 ? 75.037  40.167  -71.073  1.00 32.82  ? 372 ARG A CD    1 
ATOM   2054  N  NE    . ARG A  1 266 ? 73.678  39.623  -71.105  1.00 35.49  ? 372 ARG A NE    1 
ATOM   2055  C  CZ    . ARG A  1 266 ? 72.581  40.272  -70.733  1.00 38.35  ? 372 ARG A CZ    1 
ATOM   2056  N  NH1   . ARG A  1 266 ? 72.672  41.531  -70.267  1.00 40.73  ? 372 ARG A NH1   1 
ATOM   2057  N  NH2   . ARG A  1 266 ? 71.403  39.638  -70.819  1.00 39.73  ? 372 ARG A NH2   1 
ATOM   2058  N  N     . ALA A  1 267 ? 80.300  39.640  -69.944  1.00 19.00  ? 373 ALA A N     1 
ATOM   2059  C  CA    . ALA A  1 267 ? 81.415  40.557  -69.831  1.00 17.56  ? 373 ALA A CA    1 
ATOM   2060  C  C     . ALA A  1 267 ? 82.629  39.971  -69.139  1.00 16.81  ? 373 ALA A C     1 
ATOM   2061  O  O     . ALA A  1 267 ? 83.699  39.868  -69.751  1.00 16.63  ? 373 ALA A O     1 
ATOM   2062  C  CB    . ALA A  1 267 ? 80.983  41.828  -69.136  1.00 17.16  ? 373 ALA A CB    1 
ATOM   2063  N  N     . TYR A  1 268 ? 82.491  39.605  -67.872  1.00 16.31  ? 374 TYR A N     1 
ATOM   2064  C  CA    . TYR A  1 268 ? 83.682  39.317  -67.066  1.00 16.63  ? 374 TYR A CA    1 
ATOM   2065  C  C     . TYR A  1 268 ? 84.445  38.104  -67.582  1.00 17.07  ? 374 TYR A C     1 
ATOM   2066  O  O     . TYR A  1 268 ? 85.681  38.128  -67.613  1.00 17.70  ? 374 TYR A O     1 
ATOM   2067  C  CB    . TYR A  1 268 ? 83.353  39.111  -65.590  1.00 16.43  ? 374 TYR A CB    1 
ATOM   2068  C  CG    . TYR A  1 268 ? 82.460  40.171  -64.961  1.00 16.05  ? 374 TYR A CG    1 
ATOM   2069  C  CD1   . TYR A  1 268 ? 82.655  41.520  -65.199  1.00 15.67  ? 374 TYR A CD1   1 
ATOM   2070  C  CD2   . TYR A  1 268 ? 81.429  39.806  -64.099  1.00 15.80  ? 374 TYR A CD2   1 
ATOM   2071  C  CE1   . TYR A  1 268 ? 81.844  42.473  -64.606  1.00 15.50  ? 374 TYR A CE1   1 
ATOM   2072  C  CE2   . TYR A  1 268 ? 80.610  40.751  -63.499  1.00 15.57  ? 374 TYR A CE2   1 
ATOM   2073  C  CZ    . TYR A  1 268 ? 80.817  42.077  -63.741  1.00 15.50  ? 374 TYR A CZ    1 
ATOM   2074  O  OH    . TYR A  1 268 ? 80.015  43.012  -63.132  1.00 15.10  ? 374 TYR A OH    1 
ATOM   2075  N  N     . GLN A  1 269 ? 83.712  37.065  -67.996  1.00 17.49  ? 375 GLN A N     1 
ATOM   2076  C  CA    . GLN A  1 269 ? 84.297  35.866  -68.606  1.00 18.09  ? 375 GLN A CA    1 
ATOM   2077  C  C     . GLN A  1 269 ? 84.188  35.855  -70.128  1.00 18.21  ? 375 GLN A C     1 
ATOM   2078  O  O     . GLN A  1 269 ? 84.204  34.795  -70.738  1.00 17.91  ? 375 GLN A O     1 
ATOM   2079  C  CB    . GLN A  1 269 ? 83.685  34.574  -68.035  1.00 18.66  ? 375 GLN A CB    1 
ATOM   2080  C  CG    . GLN A  1 269 ? 83.707  34.437  -66.524  1.00 19.02  ? 375 GLN A CG    1 
ATOM   2081  C  CD    . GLN A  1 269 ? 85.067  34.734  -65.940  1.00 19.54  ? 375 GLN A CD    1 
ATOM   2082  O  OE1   . GLN A  1 269 ? 85.146  35.508  -64.997  1.00 20.13  ? 375 GLN A OE1   1 
ATOM   2083  N  NE2   . GLN A  1 269 ? 86.150  34.161  -66.515  1.00 19.37  ? 375 GLN A NE2   1 
ATOM   2084  N  N     . HIS A  1 270 ? 84.189  37.031  -70.739  1.00 18.69  ? 376 HIS A N     1 
ATOM   2085  C  CA    . HIS A  1 270 ? 84.184  37.132  -72.196  1.00 19.01  ? 376 HIS A CA    1 
ATOM   2086  C  C     . HIS A  1 270 ? 85.405  36.434  -72.767  1.00 20.21  ? 376 HIS A C     1 
ATOM   2087  O  O     . HIS A  1 270 ? 86.511  36.635  -72.271  1.00 20.21  ? 376 HIS A O     1 
ATOM   2088  C  CB    . HIS A  1 270 ? 84.155  38.595  -72.636  1.00 18.27  ? 376 HIS A CB    1 
ATOM   2089  C  CG    . HIS A  1 270 ? 83.990  38.770  -74.106  1.00 17.79  ? 376 HIS A CG    1 
ATOM   2090  N  ND1   . HIS A  1 270 ? 85.054  38.957  -74.955  1.00 17.21  ? 376 HIS A ND1   1 
ATOM   2091  C  CD2   . HIS A  1 270 ? 82.885  38.769  -74.885  1.00 17.72  ? 376 HIS A CD2   1 
ATOM   2092  C  CE1   . HIS A  1 270 ? 84.616  39.068  -76.191  1.00 17.23  ? 376 HIS A CE1   1 
ATOM   2093  N  NE2   . HIS A  1 270 ? 83.307  38.954  -76.182  1.00 17.38  ? 376 HIS A NE2   1 
ATOM   2094  N  N     . LYS A  1 271 ? 85.185  35.617  -73.791  1.00 21.94  ? 377 LYS A N     1 
ATOM   2095  C  CA    . LYS A  1 271 ? 86.238  34.752  -74.354  1.00 23.74  ? 377 LYS A CA    1 
ATOM   2096  C  C     . LYS A  1 271 ? 87.547  35.501  -74.680  1.00 22.64  ? 377 LYS A C     1 
ATOM   2097  O  O     . LYS A  1 271 ? 88.629  34.988  -74.445  1.00 21.65  ? 377 LYS A O     1 
ATOM   2098  C  CB    . LYS A  1 271 ? 85.713  33.983  -75.574  1.00 26.74  ? 377 LYS A CB    1 
ATOM   2099  C  CG    . LYS A  1 271 ? 85.349  34.906  -76.732  1.00 30.33  ? 377 LYS A CG    1 
ATOM   2100  C  CD    . LYS A  1 271 ? 84.768  34.184  -77.946  1.00 33.43  ? 377 LYS A CD    1 
ATOM   2101  C  CE    . LYS A  1 271 ? 84.763  35.092  -79.220  1.00 34.99  ? 377 LYS A CE    1 
ATOM   2102  N  NZ    . LYS A  1 271 ? 83.713  36.191  -79.097  1.00 35.10  ? 377 LYS A NZ    1 
ATOM   2103  N  N     . VAL A  1 272 ? 87.429  36.716  -75.194  1.00 21.96  ? 378 VAL A N     1 
ATOM   2104  C  CA    . VAL A  1 272 ? 88.587  37.526  -75.573  1.00 21.75  ? 378 VAL A CA    1 
ATOM   2105  C  C     . VAL A  1 272 ? 89.126  38.317  -74.392  1.00 21.71  ? 378 VAL A C     1 
ATOM   2106  O  O     . VAL A  1 272 ? 90.323  38.565  -74.289  1.00 21.94  ? 378 VAL A O     1 
ATOM   2107  C  CB    . VAL A  1 272 ? 88.249  38.472  -76.743  1.00 21.57  ? 378 VAL A CB    1 
ATOM   2108  C  CG1   . VAL A  1 272 ? 89.473  39.251  -77.205  1.00 21.63  ? 378 VAL A CG1   1 
ATOM   2109  C  CG2   . VAL A  1 272 ? 87.684  37.681  -77.920  1.00 21.55  ? 378 VAL A CG2   1 
ATOM   2110  N  N     . GLY A  1 273 ? 88.245  38.737  -73.506  1.00 22.12  ? 379 GLY A N     1 
ATOM   2111  C  CA    . GLY A  1 273 ? 88.678  39.391  -72.269  1.00 22.63  ? 379 GLY A CA    1 
ATOM   2112  C  C     . GLY A  1 273 ? 89.581  38.468  -71.471  1.00 22.47  ? 379 GLY A C     1 
ATOM   2113  O  O     . GLY A  1 273 ? 90.628  38.896  -70.968  1.00 22.37  ? 379 GLY A O     1 
ATOM   2114  N  N     . ASN A  1 274 ? 89.175  37.205  -71.385  1.00 22.09  ? 380 ASN A N     1 
ATOM   2115  C  CA    . ASN A  1 274 ? 89.954  36.183  -70.711  1.00 22.07  ? 380 ASN A CA    1 
ATOM   2116  C  C     . ASN A  1 274 ? 91.266  35.859  -71.414  1.00 21.46  ? 380 ASN A C     1 
ATOM   2117  O  O     . ASN A  1 274 ? 92.281  35.629  -70.751  1.00 22.52  ? 380 ASN A O     1 
ATOM   2118  C  CB    . ASN A  1 274 ? 89.117  34.904  -70.538  1.00 22.69  ? 380 ASN A CB    1 
ATOM   2119  C  CG    . ASN A  1 274 ? 88.053  35.035  -69.465  1.00 22.68  ? 380 ASN A CG    1 
ATOM   2120  O  OD1   . ASN A  1 274 ? 87.369  34.066  -69.185  1.00 23.86  ? 380 ASN A OD1   1 
ATOM   2121  N  ND2   . ASN A  1 274 ? 87.917  36.211  -68.857  1.00 22.04  ? 380 ASN A ND2   1 
ATOM   2122  N  N     . ILE A  1 275 ? 91.273  35.829  -72.739  1.00 19.95  ? 381 ILE A N     1 
ATOM   2123  C  CA    . ILE A  1 275 ? 92.527  35.545  -73.442  1.00 18.89  ? 381 ILE A CA    1 
ATOM   2124  C  C     . ILE A  1 275 ? 93.503  36.707  -73.310  1.00 18.68  ? 381 ILE A C     1 
ATOM   2125  O  O     . ILE A  1 275 ? 94.703  36.498  -73.250  1.00 19.10  ? 381 ILE A O     1 
ATOM   2126  C  CB    . ILE A  1 275 ? 92.320  35.105  -74.914  1.00 18.23  ? 381 ILE A CB    1 
ATOM   2127  C  CG1   . ILE A  1 275 ? 93.453  34.195  -75.362  1.00 18.27  ? 381 ILE A CG1   1 
ATOM   2128  C  CG2   . ILE A  1 275 ? 92.237  36.277  -75.876  1.00 18.03  ? 381 ILE A CG2   1 
ATOM   2129  C  CD1   . ILE A  1 275 ? 93.531  32.872  -74.629  1.00 18.36  ? 381 ILE A CD1   1 
ATOM   2130  N  N     . ILE A  1 276 ? 92.997  37.927  -73.249  1.00 18.35  ? 382 ILE A N     1 
ATOM   2131  C  CA    . ILE A  1 276 ? 93.857  39.067  -73.007  1.00 18.41  ? 382 ILE A CA    1 
ATOM   2132  C  C     . ILE A  1 276 ? 94.405  39.028  -71.579  1.00 19.48  ? 382 ILE A C     1 
ATOM   2133  O  O     . ILE A  1 276 ? 95.564  39.354  -71.347  1.00 19.53  ? 382 ILE A O     1 
ATOM   2134  C  CB    . ILE A  1 276 ? 93.134  40.371  -73.347  1.00 17.56  ? 382 ILE A CB    1 
ATOM   2135  C  CG1   . ILE A  1 276 ? 93.010  40.451  -74.864  1.00 17.16  ? 382 ILE A CG1   1 
ATOM   2136  C  CG2   . ILE A  1 276 ? 93.912  41.580  -72.830  1.00 17.60  ? 382 ILE A CG2   1 
ATOM   2137  C  CD1   . ILE A  1 276 ? 92.201  41.617  -75.378  1.00 17.14  ? 382 ILE A CD1   1 
ATOM   2138  N  N     . ASP A  1 277 ? 93.574  38.623  -70.631  1.00 20.69  ? 383 ASP A N     1 
ATOM   2139  C  CA    . ASP A  1 277 ? 94.031  38.408  -69.257  1.00 21.76  ? 383 ASP A CA    1 
ATOM   2140  C  C     . ASP A  1 277 ? 95.135  37.346  -69.236  1.00 22.55  ? 383 ASP A C     1 
ATOM   2141  O  O     . ASP A  1 277 ? 96.175  37.591  -68.629  1.00 22.92  ? 383 ASP A O     1 
ATOM   2142  C  CB    . ASP A  1 277 ? 92.878  38.030  -68.297  1.00 22.40  ? 383 ASP A CB    1 
ATOM   2143  C  CG    . ASP A  1 277 ? 92.071  39.270  -67.774  1.00 23.18  ? 383 ASP A CG    1 
ATOM   2144  O  OD1   . ASP A  1 277 ? 92.483  40.447  -68.027  1.00 23.02  ? 383 ASP A OD1   1 
ATOM   2145  O  OD2   . ASP A  1 277 ? 91.011  39.050  -67.091  1.00 24.20  ? 383 ASP A OD2   1 
ATOM   2146  N  N     . THR A  1 278 ? 94.945  36.200  -69.902  1.00 22.85  ? 384 THR A N     1 
ATOM   2147  C  CA    . THR A  1 278 ? 95.992  35.148  -69.901  1.00 23.93  ? 384 THR A CA    1 
ATOM   2148  C  C     . THR A  1 278 ? 97.267  35.657  -70.582  1.00 25.18  ? 384 THR A C     1 
ATOM   2149  O  O     . THR A  1 278 ? 98.354  35.344  -70.122  1.00 26.53  ? 384 THR A O     1 
ATOM   2150  C  CB    . THR A  1 278 ? 95.592  33.791  -70.545  1.00 23.70  ? 384 THR A CB    1 
ATOM   2151  O  OG1   . THR A  1 278 ? 95.277  34.002  -71.899  1.00 24.32  ? 384 THR A OG1   1 
ATOM   2152  C  CG2   . THR A  1 278 ? 94.415  33.099  -69.854  1.00 23.41  ? 384 THR A CG2   1 
ATOM   2153  N  N     . MET A  1 279 ? 97.139  36.452  -71.641  1.00 26.02  ? 385 MET A N     1 
ATOM   2154  C  CA    . MET A  1 279 ? 98.313  37.019  -72.313  1.00 26.99  ? 385 MET A CA    1 
ATOM   2155  C  C     . MET A  1 279 ? 99.055  38.027  -71.451  1.00 28.09  ? 385 MET A C     1 
ATOM   2156  O  O     . MET A  1 279 ? 100.276 38.058  -71.461  1.00 27.67  ? 385 MET A O     1 
ATOM   2157  C  CB    . MET A  1 279 ? 97.943  37.664  -73.659  1.00 26.27  ? 385 MET A CB    1 
ATOM   2158  C  CG    . MET A  1 279 ? 97.676  36.685  -74.757  1.00 26.38  ? 385 MET A CG    1 
ATOM   2159  S  SD    . MET A  1 279 ? 97.033  37.360  -76.261  1.00 27.06  ? 385 MET A SD    1 
ATOM   2160  C  CE    . MET A  1 279 ? 98.510  38.064  -76.950  1.00 27.82  ? 385 MET A CE    1 
ATOM   2161  N  N     . ILE A  1 280 ? 98.333  38.853  -70.713  1.00 29.40  ? 386 ILE A N     1 
ATOM   2162  C  CA    . ILE A  1 280 ? 98.977  39.795  -69.804  1.00 30.86  ? 386 ILE A CA    1 
ATOM   2163  C  C     . ILE A  1 280 ? 99.631  39.046  -68.653  1.00 32.93  ? 386 ILE A C     1 
ATOM   2164  O  O     . ILE A  1 280 ? 100.745 39.364  -68.281  1.00 35.04  ? 386 ILE A O     1 
ATOM   2165  C  CB    . ILE A  1 280 ? 98.001  40.867  -69.293  1.00 30.43  ? 386 ILE A CB    1 
ATOM   2166  C  CG1   . ILE A  1 280 ? 97.601  41.789  -70.450  1.00 30.09  ? 386 ILE A CG1   1 
ATOM   2167  C  CG2   . ILE A  1 280 ? 98.627  41.685  -68.167  1.00 30.52  ? 386 ILE A CG2   1 
ATOM   2168  C  CD1   . ILE A  1 280 ? 96.437  42.713  -70.129  1.00 29.86  ? 386 ILE A CD1   1 
ATOM   2169  N  N     . THR A  1 281 ? 98.931  38.064  -68.091  1.00 35.35  ? 387 THR A N     1 
ATOM   2170  C  CA    . THR A  1 281 ? 99.489  37.191  -67.054  1.00 38.29  ? 387 THR A CA    1 
ATOM   2171  C  C     . THR A  1 281 ? 100.783 36.543  -67.538  1.00 41.67  ? 387 THR A C     1 
ATOM   2172  O  O     . THR A  1 281 ? 101.786 36.530  -66.826  1.00 43.70  ? 387 THR A O     1 
ATOM   2173  C  CB    . THR A  1 281 ? 98.468  36.107  -66.635  1.00 37.80  ? 387 THR A CB    1 
ATOM   2174  O  OG1   . THR A  1 281 ? 97.388  36.724  -65.920  1.00 36.09  ? 387 THR A OG1   1 
ATOM   2175  C  CG2   . THR A  1 281 ? 99.083  35.054  -65.714  1.00 38.56  ? 387 THR A CG2   1 
ATOM   2176  N  N     . ASP A  1 282 ? 100.750 36.025  -68.759  1.00 44.21  ? 388 ASP A N     1 
ATOM   2177  C  CA    . ASP A  1 282 ? 101.905 35.373  -69.375  1.00 45.93  ? 388 ASP A CA    1 
ATOM   2178  C  C     . ASP A  1 282 ? 103.090 36.330  -69.460  1.00 44.14  ? 388 ASP A C     1 
ATOM   2179  O  O     . ASP A  1 282 ? 104.190 35.980  -69.096  1.00 42.94  ? 388 ASP A O     1 
ATOM   2180  C  CB    . ASP A  1 282 ? 101.523 34.884  -70.775  1.00 51.51  ? 388 ASP A CB    1 
ATOM   2181  C  CG    . ASP A  1 282 ? 102.258 33.646  -71.200  1.00 59.28  ? 388 ASP A CG    1 
ATOM   2182  O  OD1   . ASP A  1 282 ? 103.236 33.250  -70.513  1.00 67.92  ? 388 ASP A OD1   1 
ATOM   2183  O  OD2   . ASP A  1 282 ? 101.838 33.063  -72.238  1.00 65.84  ? 388 ASP A OD2   1 
ATOM   2184  N  N     . ALA A  1 283 ? 102.843 37.543  -69.925  1.00 41.98  ? 389 ALA A N     1 
ATOM   2185  C  CA    . ALA A  1 283 ? 103.876 38.577  -69.993  1.00 40.30  ? 389 ALA A CA    1 
ATOM   2186  C  C     . ALA A  1 283 ? 104.415 38.967  -68.625  1.00 38.48  ? 389 ALA A C     1 
ATOM   2187  O  O     . ALA A  1 283 ? 105.576 39.311  -68.505  1.00 39.27  ? 389 ALA A O     1 
ATOM   2188  C  CB    . ALA A  1 283 ? 103.348 39.809  -70.703  1.00 40.62  ? 389 ALA A CB    1 
ATOM   2189  N  N     . PHE A  1 284 ? 103.573 38.933  -67.602  1.00 37.53  ? 390 PHE A N     1 
ATOM   2190  C  CA    . PHE A  1 284 ? 104.014 39.208  -66.232  1.00 36.47  ? 390 PHE A CA    1 
ATOM   2191  C  C     . PHE A  1 284 ? 104.922 38.101  -65.736  1.00 38.39  ? 390 PHE A C     1 
ATOM   2192  O  O     . PHE A  1 284 ? 105.951 38.385  -65.141  1.00 39.03  ? 390 PHE A O     1 
ATOM   2193  C  CB    . PHE A  1 284 ? 102.832 39.351  -65.273  1.00 33.64  ? 390 PHE A CB    1 
ATOM   2194  C  CG    . PHE A  1 284 ? 102.132 40.672  -65.323  1.00 31.70  ? 390 PHE A CG    1 
ATOM   2195  C  CD1   . PHE A  1 284 ? 102.315 41.582  -66.373  1.00 30.76  ? 390 PHE A CD1   1 
ATOM   2196  C  CD2   . PHE A  1 284 ? 101.246 41.003  -64.328  1.00 30.76  ? 390 PHE A CD2   1 
ATOM   2197  C  CE1   . PHE A  1 284 ? 101.654 42.785  -66.397  1.00 30.06  ? 390 PHE A CE1   1 
ATOM   2198  C  CE2   . PHE A  1 284 ? 100.587 42.212  -64.330  1.00 30.64  ? 390 PHE A CE2   1 
ATOM   2199  C  CZ    . PHE A  1 284 ? 100.787 43.093  -65.384  1.00 30.65  ? 390 PHE A CZ    1 
ATOM   2200  N  N     . LEU A  1 285 ? 104.543 36.852  -65.984  1.00 40.51  ? 391 LEU A N     1 
ATOM   2201  C  CA    . LEU A  1 285 ? 105.383 35.712  -65.620  1.00 42.93  ? 391 LEU A CA    1 
ATOM   2202  C  C     . LEU A  1 285 ? 106.769 35.814  -66.261  1.00 45.34  ? 391 LEU A C     1 
ATOM   2203  O  O     . LEU A  1 285 ? 107.775 35.585  -65.591  1.00 49.67  ? 391 LEU A O     1 
ATOM   2204  C  CB    . LEU A  1 285 ? 104.717 34.388  -65.993  1.00 42.74  ? 391 LEU A CB    1 
ATOM   2205  C  CG    . LEU A  1 285 ? 103.456 34.029  -65.194  1.00 41.61  ? 391 LEU A CG    1 
ATOM   2206  C  CD1   . LEU A  1 285 ? 102.693 32.915  -65.892  1.00 41.28  ? 391 LEU A CD1   1 
ATOM   2207  C  CD2   . LEU A  1 285 ? 103.768 33.626  -63.769  1.00 41.80  ? 391 LEU A CD2   1 
ATOM   2208  N  N     . LYS A  1 286 ? 106.824 36.203  -67.531  1.00 45.28  ? 392 LYS A N     1 
ATOM   2209  C  CA    . LYS A  1 286 ? 108.100 36.351  -68.237  1.00 47.06  ? 392 LYS A CA    1 
ATOM   2210  C  C     . LYS A  1 286 ? 108.904 37.553  -67.797  1.00 45.90  ? 392 LYS A C     1 
ATOM   2211  O  O     . LYS A  1 286 ? 110.116 37.537  -67.889  1.00 45.06  ? 392 LYS A O     1 
ATOM   2212  C  CB    . LYS A  1 286 ? 107.888 36.390  -69.749  1.00 49.28  ? 392 LYS A CB    1 
ATOM   2213  C  CG    . LYS A  1 286 ? 107.378 35.071  -70.298  1.00 51.92  ? 392 LYS A CG    1 
ATOM   2214  C  CD    . LYS A  1 286 ? 107.541 34.987  -71.800  1.00 54.61  ? 392 LYS A CD    1 
ATOM   2215  C  CE    . LYS A  1 286 ? 107.280 33.595  -72.366  1.00 60.17  ? 392 LYS A CE    1 
ATOM   2216  N  NZ    . LYS A  1 286 ? 105.870 33.134  -72.091  1.00 64.32  ? 392 LYS A NZ    1 
ATOM   2217  N  N     . ALA A  1 287 ? 108.231 38.588  -67.323  1.00 46.18  ? 393 ALA A N     1 
ATOM   2218  C  CA    . ALA A  1 287 ? 108.897 39.781  -66.802  1.00 46.14  ? 393 ALA A CA    1 
ATOM   2219  C  C     . ALA A  1 287 ? 109.251 39.694  -65.325  1.00 46.21  ? 393 ALA A C     1 
ATOM   2220  O  O     . ALA A  1 287 ? 109.955 40.558  -64.822  1.00 46.57  ? 393 ALA A O     1 
ATOM   2221  C  CB    . ALA A  1 287 ? 108.028 41.002  -67.042  1.00 45.52  ? 393 ALA A CB    1 
ATOM   2222  N  N     . ASP A  1 288 ? 108.765 38.673  -64.635  1.00 47.68  ? 394 ASP A N     1 
ATOM   2223  C  CA    . ASP A  1 288 ? 108.790 38.636  -63.158  1.00 49.23  ? 394 ASP A CA    1 
ATOM   2224  C  C     . ASP A  1 288 ? 110.186 38.781  -62.624  1.00 49.41  ? 394 ASP A C     1 
ATOM   2225  O  O     . ASP A  1 288 ? 110.458 39.677  -61.803  1.00 48.18  ? 394 ASP A O     1 
ATOM   2226  C  CB    . ASP A  1 288 ? 108.184 37.329  -62.628  1.00 49.94  ? 394 ASP A CB    1 
ATOM   2227  C  CG    . ASP A  1 288 ? 107.827 37.401  -61.150  1.00 49.54  ? 394 ASP A CG    1 
ATOM   2228  O  OD1   . ASP A  1 288 ? 107.960 38.472  -60.506  1.00 49.61  ? 394 ASP A OD1   1 
ATOM   2229  O  OD2   . ASP A  1 288 ? 107.393 36.360  -60.624  1.00 47.86  ? 394 ASP A OD2   1 
ATOM   2230  N  N     . ASP A  1 289 ? 111.061 37.908  -63.141  1.00 50.99  ? 395 ASP A N     1 
ATOM   2231  C  CA    . ASP A  1 289 ? 112.452 37.785  -62.691  1.00 53.09  ? 395 ASP A CA    1 
ATOM   2232  C  C     . ASP A  1 289 ? 113.253 39.066  -62.820  1.00 53.43  ? 395 ASP A C     1 
ATOM   2233  O  O     . ASP A  1 289 ? 114.107 39.310  -61.996  1.00 56.12  ? 395 ASP A O     1 
ATOM   2234  C  CB    . ASP A  1 289 ? 113.157 36.670  -63.480  1.00 54.45  ? 395 ASP A CB    1 
ATOM   2235  C  CG    . ASP A  1 289 ? 112.570 35.275  -63.187  1.00 54.39  ? 395 ASP A CG    1 
ATOM   2236  O  OD1   . ASP A  1 289 ? 112.058 35.021  -62.063  1.00 53.01  ? 395 ASP A OD1   1 
ATOM   2237  O  OD2   . ASP A  1 289 ? 112.622 34.427  -64.094  1.00 50.93  ? 395 ASP A OD2   1 
ATOM   2238  N  N     . TYR A  1 290 ? 112.976 39.892  -63.819  1.00 54.83  ? 396 TYR A N     1 
ATOM   2239  C  CA    . TYR A  1 290 ? 113.811 41.056  -64.102  1.00 57.26  ? 396 TYR A CA    1 
ATOM   2240  C  C     . TYR A  1 290 ? 113.233 42.400  -63.660  1.00 58.69  ? 396 TYR A C     1 
ATOM   2241  O  O     . TYR A  1 290 ? 113.856 43.425  -63.894  1.00 61.89  ? 396 TYR A O     1 
ATOM   2242  C  CB    . TYR A  1 290 ? 114.153 41.087  -65.592  1.00 59.15  ? 396 TYR A CB    1 
ATOM   2243  C  CG    . TYR A  1 290 ? 114.402 39.707  -66.152  1.00 59.73  ? 396 TYR A CG    1 
ATOM   2244  C  CD1   . TYR A  1 290 ? 115.611 39.041  -65.941  1.00 60.15  ? 396 TYR A CD1   1 
ATOM   2245  C  CD2   . TYR A  1 290 ? 113.418 39.055  -66.859  1.00 60.52  ? 396 TYR A CD2   1 
ATOM   2246  C  CE1   . TYR A  1 290 ? 115.818 37.766  -66.436  1.00 59.05  ? 396 TYR A CE1   1 
ATOM   2247  C  CE2   . TYR A  1 290 ? 113.613 37.790  -67.373  1.00 61.04  ? 396 TYR A CE2   1 
ATOM   2248  C  CZ    . TYR A  1 290 ? 114.820 37.148  -67.149  1.00 58.66  ? 396 TYR A CZ    1 
ATOM   2249  O  OH    . TYR A  1 290 ? 114.980 35.886  -67.633  1.00 59.25  ? 396 TYR A OH    1 
ATOM   2250  N  N     . ILE A  1 291 ? 112.068 42.413  -63.015  1.00 58.99  ? 397 ILE A N     1 
ATOM   2251  C  CA    . ILE A  1 291 ? 111.501 43.666  -62.490  1.00 57.62  ? 397 ILE A CA    1 
ATOM   2252  C  C     . ILE A  1 291 ? 111.647 43.695  -60.979  1.00 57.31  ? 397 ILE A C     1 
ATOM   2253  O  O     . ILE A  1 291 ? 111.211 42.786  -60.286  1.00 54.42  ? 397 ILE A O     1 
ATOM   2254  C  CB    . ILE A  1 291 ? 110.038 43.870  -62.900  1.00 56.39  ? 397 ILE A CB    1 
ATOM   2255  C  CG1   . ILE A  1 291 ? 109.985 44.358  -64.332  1.00 56.47  ? 397 ILE A CG1   1 
ATOM   2256  C  CG2   . ILE A  1 291 ? 109.364 44.926  -62.041  1.00 55.51  ? 397 ILE A CG2   1 
ATOM   2257  C  CD1   . ILE A  1 291 ? 108.622 44.218  -64.983  1.00 56.04  ? 397 ILE A CD1   1 
ATOM   2258  N  N     . GLU A  1 292 ? 112.257 44.782  -60.513  1.00 58.85  ? 398 GLU A N     1 
ATOM   2259  C  CA    . GLU A  1 292 ? 112.510 45.049  -59.114  1.00 59.86  ? 398 GLU A CA    1 
ATOM   2260  C  C     . GLU A  1 292 ? 111.597 46.170  -58.659  1.00 55.54  ? 398 GLU A C     1 
ATOM   2261  O  O     . GLU A  1 292 ? 111.435 47.150  -59.367  1.00 56.42  ? 398 GLU A O     1 
ATOM   2262  C  CB    . GLU A  1 292 ? 113.952 45.498  -58.907  1.00 66.74  ? 398 GLU A CB    1 
ATOM   2263  C  CG    . GLU A  1 292 ? 115.007 44.417  -59.170  1.00 72.32  ? 398 GLU A CG    1 
ATOM   2264  C  CD    . GLU A  1 292 ? 116.416 44.861  -58.810  1.00 76.59  ? 398 GLU A CD    1 
ATOM   2265  O  OE1   . GLU A  1 292 ? 116.699 46.077  -58.923  1.00 81.12  ? 398 GLU A OE1   1 
ATOM   2266  O  OE2   . GLU A  1 292 ? 117.226 44.037  -58.311  1.00 80.44  ? 398 GLU A OE2   1 
ATOM   2267  N  N     . ILE A  1 293 ? 111.010 46.021  -57.472  1.00 52.15  ? 399 ILE A N     1 
ATOM   2268  C  CA    . ILE A  1 293 ? 110.177 47.054  -56.860  1.00 50.97  ? 399 ILE A CA    1 
ATOM   2269  C  C     . ILE A  1 293 ? 110.690 47.304  -55.441  1.00 51.92  ? 399 ILE A C     1 
ATOM   2270  O  O     . ILE A  1 293 ? 110.758 46.374  -54.631  1.00 52.89  ? 399 ILE A O     1 
ATOM   2271  C  CB    . ILE A  1 293 ? 108.700 46.639  -56.804  1.00 49.22  ? 399 ILE A CB    1 
ATOM   2272  C  CG1   . ILE A  1 293 ? 108.172 46.269  -58.195  1.00 47.53  ? 399 ILE A CG1   1 
ATOM   2273  C  CG2   . ILE A  1 293 ? 107.836 47.766  -56.242  1.00 50.52  ? 399 ILE A CG2   1 
ATOM   2274  C  CD1   . ILE A  1 293 ? 106.986 45.327  -58.160  1.00 47.41  ? 399 ILE A CD1   1 
ATOM   2275  N  N     . THR A  1 294 ? 111.043 48.563  -55.158  1.00 51.56  ? 400 THR A N     1 
ATOM   2276  C  CA    . THR A  1 294 ? 111.605 48.958  -53.868  1.00 50.82  ? 400 THR A CA    1 
ATOM   2277  C  C     . THR A  1 294 ? 110.551 48.854  -52.788  1.00 50.20  ? 400 THR A C     1 
ATOM   2278  O  O     . THR A  1 294 ? 109.487 49.442  -52.912  1.00 49.67  ? 400 THR A O     1 
ATOM   2279  C  CB    . THR A  1 294 ? 112.113 50.404  -53.884  1.00 51.57  ? 400 THR A CB    1 
ATOM   2280  O  OG1   . THR A  1 294 ? 113.069 50.568  -54.925  1.00 56.39  ? 400 THR A OG1   1 
ATOM   2281  C  CG2   . THR A  1 294 ? 112.735 50.834  -52.550  1.00 51.40  ? 400 THR A CG2   1 
ATOM   2282  N  N     . GLY A  1 295 ? 110.872 48.123  -51.726  1.00 50.57  ? 401 GLY A N     1 
ATOM   2283  C  CA    . GLY A  1 295 ? 109.987 47.929  -50.595  1.00 51.26  ? 401 GLY A CA    1 
ATOM   2284  C  C     . GLY A  1 295 ? 110.460 48.630  -49.337  1.00 51.24  ? 401 GLY A C     1 
ATOM   2285  O  O     . GLY A  1 295 ? 111.078 49.686  -49.401  1.00 49.28  ? 401 GLY A O     1 
ATOM   2286  N  N     . ALA A  1 296 ? 110.148 48.027  -48.193  1.00 53.37  ? 402 ALA A N     1 
ATOM   2287  C  CA    . ALA A  1 296 ? 110.456 48.593  -46.889  1.00 56.14  ? 402 ALA A CA    1 
ATOM   2288  C  C     . ALA A  1 296 ? 111.913 48.341  -46.575  1.00 59.15  ? 402 ALA A C     1 
ATOM   2289  O  O     . ALA A  1 296 ? 112.426 47.228  -46.780  1.00 59.01  ? 402 ALA A O     1 
ATOM   2290  C  CB    . ALA A  1 296 ? 109.569 48.000  -45.813  1.00 56.33  ? 402 ALA A CB    1 
ATOM   2291  N  N     . GLY A  1 297 ? 112.574 49.396  -46.089  1.00 62.56  ? 403 GLY A N     1 
ATOM   2292  C  CA    . GLY A  1 297 ? 114.009 49.372  -45.827  1.00 62.30  ? 403 GLY A CA    1 
ATOM   2293  C  C     . GLY A  1 297 ? 114.848 49.207  -47.075  1.00 61.74  ? 403 GLY A C     1 
ATOM   2294  O  O     . GLY A  1 297 ? 115.960 48.711  -46.997  1.00 63.14  ? 403 GLY A O     1 
ATOM   2295  N  N     . GLY A  1 298 ? 114.319 49.608  -48.232  1.00 60.01  ? 404 GLY A N     1 
ATOM   2296  C  CA    . GLY A  1 298 ? 115.018 49.448  -49.492  1.00 59.01  ? 404 GLY A CA    1 
ATOM   2297  C  C     . GLY A  1 298 ? 115.085 48.045  -50.103  1.00 58.58  ? 404 GLY A C     1 
ATOM   2298  O  O     . GLY A  1 298 ? 115.618 47.903  -51.206  1.00 59.77  ? 404 GLY A O     1 
ATOM   2299  N  N     . LYS A  1 299 ? 114.543 47.013  -49.438  1.00 57.65  ? 405 LYS A N     1 
ATOM   2300  C  CA    . LYS A  1 299 ? 114.633 45.634  -49.939  1.00 59.70  ? 405 LYS A CA    1 
ATOM   2301  C  C     . LYS A  1 299 ? 113.999 45.514  -51.330  1.00 62.45  ? 405 LYS A C     1 
ATOM   2302  O  O     . LYS A  1 299 ? 113.052 46.228  -51.643  1.00 66.74  ? 405 LYS A O     1 
ATOM   2303  C  CB    . LYS A  1 299 ? 113.988 44.642  -48.974  1.00 60.16  ? 405 LYS A CB    1 
ATOM   2304  C  CG    . LYS A  1 299 ? 114.607 43.279  -49.245  1.00 63.76  ? 405 LYS A CG    1 
ATOM   2305  C  CD    . LYS A  1 299 ? 114.101 42.130  -48.399  1.00 64.81  ? 405 LYS A CD    1 
ATOM   2306  C  CE    . LYS A  1 299 ? 114.129 40.826  -49.202  1.00 64.45  ? 405 LYS A CE    1 
ATOM   2307  N  NZ    . LYS A  1 299 ? 113.066 39.891  -48.755  1.00 64.29  ? 405 LYS A NZ    1 
ATOM   2308  N  N     . LYS A  1 300 ? 114.539 44.647  -52.186  1.00 65.09  ? 406 LYS A N     1 
ATOM   2309  C  CA    . LYS A  1 300 ? 114.018 44.486  -53.547  1.00 66.23  ? 406 LYS A CA    1 
ATOM   2310  C  C     . LYS A  1 300 ? 112.996 43.358  -53.602  1.00 62.32  ? 406 LYS A C     1 
ATOM   2311  O  O     . LYS A  1 300 ? 113.257 42.232  -53.134  1.00 65.41  ? 406 LYS A O     1 
ATOM   2312  C  CB    . LYS A  1 300 ? 115.147 44.214  -54.544  1.00 73.48  ? 406 LYS A CB    1 
ATOM   2313  C  CG    . LYS A  1 300 ? 116.208 45.301  -54.600  1.00 80.07  ? 406 LYS A CG    1 
ATOM   2314  C  CD    . LYS A  1 300 ? 115.734 46.512  -55.386  1.00 84.18  ? 406 LYS A CD    1 
ATOM   2315  C  CE    . LYS A  1 300 ? 116.717 47.632  -55.332  1.00 89.34  ? 406 LYS A CE    1 
ATOM   2316  N  NZ    . LYS A  1 300 ? 116.252 48.671  -56.296  1.00 92.98  ? 406 LYS A NZ    1 
ATOM   2317  N  N     . TYR A  1 301 ? 111.823 43.663  -54.158  1.00 56.21  ? 407 TYR A N     1 
ATOM   2318  C  CA    . TYR A  1 301 ? 110.776 42.667  -54.391  1.00 53.43  ? 407 TYR A CA    1 
ATOM   2319  C  C     . TYR A  1 301 ? 110.433 42.541  -55.864  1.00 53.32  ? 407 TYR A C     1 
ATOM   2320  O  O     . TYR A  1 301 ? 110.590 43.484  -56.634  1.00 51.64  ? 407 TYR A O     1 
ATOM   2321  C  CB    . TYR A  1 301 ? 109.523 43.017  -53.584  1.00 52.24  ? 407 TYR A CB    1 
ATOM   2322  C  CG    . TYR A  1 301 ? 109.727 42.990  -52.095  1.00 51.50  ? 407 TYR A CG    1 
ATOM   2323  C  CD1   . TYR A  1 301 ? 109.684 41.794  -51.390  1.00 50.71  ? 407 TYR A CD1   1 
ATOM   2324  C  CD2   . TYR A  1 301 ? 110.035 44.156  -51.393  1.00 51.40  ? 407 TYR A CD2   1 
ATOM   2325  C  CE1   . TYR A  1 301 ? 109.829 41.771  -50.009  1.00 51.55  ? 407 TYR A CE1   1 
ATOM   2326  C  CE2   . TYR A  1 301 ? 110.261 44.125  -50.027  1.00 52.29  ? 407 TYR A CE2   1 
ATOM   2327  C  CZ    . TYR A  1 301 ? 110.142 42.933  -49.335  1.00 52.58  ? 407 TYR A CZ    1 
ATOM   2328  O  OH    . TYR A  1 301 ? 110.331 42.903  -47.972  1.00 53.36  ? 407 TYR A OH    1 
ATOM   2329  N  N     . ARG A  1 302 ? 109.977 41.357  -56.243  1.00 54.40  ? 408 ARG A N     1 
ATOM   2330  C  CA    . ARG A  1 302 ? 109.516 41.056  -57.593  1.00 53.64  ? 408 ARG A CA    1 
ATOM   2331  C  C     . ARG A  1 302 ? 108.013 41.290  -57.646  1.00 46.94  ? 408 ARG A C     1 
ATOM   2332  O  O     . ARG A  1 302 ? 107.382 41.523  -56.617  1.00 44.66  ? 408 ARG A O     1 
ATOM   2333  C  CB    . ARG A  1 302 ? 109.853 39.613  -57.965  1.00 59.59  ? 408 ARG A CB    1 
ATOM   2334  C  CG    . ARG A  1 302 ? 111.279 39.427  -58.416  1.00 66.79  ? 408 ARG A CG    1 
ATOM   2335  C  CD    . ARG A  1 302 ? 111.620 37.967  -58.632  1.00 73.81  ? 408 ARG A CD    1 
ATOM   2336  N  NE    . ARG A  1 302 ? 113.103 37.873  -58.648  1.00 80.90  ? 408 ARG A NE    1 
ATOM   2337  C  CZ    . ARG A  1 302 ? 113.838 36.754  -58.644  1.00 90.51  ? 408 ARG A CZ    1 
ATOM   2338  N  NH1   . ARG A  1 302 ? 115.164 36.855  -58.617  1.00 94.37  ? 408 ARG A NH1   1 
ATOM   2339  N  NH2   . ARG A  1 302 ? 113.261 35.553  -58.705  1.00 97.06  ? 408 ARG A NH2   1 
ATOM   2340  N  N     . ILE A  1 303 ? 107.438 41.208  -58.841  1.00 42.61  ? 409 ILE A N     1 
ATOM   2341  C  CA    . ILE A  1 303 ? 105.999 41.380  -59.013  1.00 41.53  ? 409 ILE A CA    1 
ATOM   2342  C  C     . ILE A  1 303 ? 105.263 40.350  -58.165  1.00 40.50  ? 409 ILE A C     1 
ATOM   2343  O  O     . ILE A  1 303 ? 104.368 40.695  -57.415  1.00 39.84  ? 409 ILE A O     1 
ATOM   2344  C  CB    . ILE A  1 303 ? 105.565 41.230  -60.478  1.00 42.69  ? 409 ILE A CB    1 
ATOM   2345  C  CG1   . ILE A  1 303 ? 106.160 42.359  -61.311  1.00 44.00  ? 409 ILE A CG1   1 
ATOM   2346  C  CG2   . ILE A  1 303 ? 104.050 41.286  -60.609  1.00 42.69  ? 409 ILE A CG2   1 
ATOM   2347  C  CD1   . ILE A  1 303 ? 105.905 42.221  -62.810  1.00 44.49  ? 409 ILE A CD1   1 
ATOM   2348  N  N     . SER A  1 304 ? 105.660 39.092  -58.288  1.00 39.54  ? 410 SER A N     1 
ATOM   2349  C  CA    . SER A  1 304 ? 105.044 38.010  -57.528  1.00 38.43  ? 410 SER A CA    1 
ATOM   2350  C  C     . SER A  1 304 ? 105.241 38.079  -56.005  1.00 37.93  ? 410 SER A C     1 
ATOM   2351  O  O     . SER A  1 304 ? 104.435 37.551  -55.261  1.00 38.16  ? 410 SER A O     1 
ATOM   2352  C  CB    . SER A  1 304 ? 105.534 36.654  -58.036  1.00 38.83  ? 410 SER A CB    1 
ATOM   2353  O  OG    . SER A  1 304 ? 106.937 36.608  -58.024  1.00 40.01  ? 410 SER A OG    1 
ATOM   2354  N  N     . THR A  1 305 ? 106.318 38.715  -55.553  1.00 38.12  ? 411 THR A N     1 
ATOM   2355  C  CA    . THR A  1 305 ? 106.645 38.798  -54.121  1.00 37.89  ? 411 THR A CA    1 
ATOM   2356  C  C     . THR A  1 305 ? 106.278 40.117  -53.446  1.00 38.76  ? 411 THR A C     1 
ATOM   2357  O  O     . THR A  1 305 ? 106.433 40.241  -52.222  1.00 38.84  ? 411 THR A O     1 
ATOM   2358  C  CB    . THR A  1 305 ? 108.135 38.522  -53.874  1.00 37.97  ? 411 THR A CB    1 
ATOM   2359  O  OG1   . THR A  1 305 ? 108.922 39.432  -54.643  1.00 37.04  ? 411 THR A OG1   1 
ATOM   2360  C  CG2   . THR A  1 305 ? 108.476 37.089  -54.257  1.00 38.18  ? 411 THR A CG2   1 
ATOM   2361  N  N     . ALA A  1 306 ? 105.793 41.093  -54.209  1.00 38.77  ? 412 ALA A N     1 
ATOM   2362  C  CA    . ALA A  1 306 ? 105.399 42.379  -53.632  1.00 38.38  ? 412 ALA A CA    1 
ATOM   2363  C  C     . ALA A  1 306 ? 104.234 42.249  -52.682  1.00 38.01  ? 412 ALA A C     1 
ATOM   2364  O  O     . ALA A  1 306 ? 104.078 43.054  -51.788  1.00 40.03  ? 412 ALA A O     1 
ATOM   2365  C  CB    . ALA A  1 306 ? 105.089 43.394  -54.709  1.00 38.11  ? 412 ALA A CB    1 
ATOM   2366  N  N     . ILE A  1 307 ? 103.423 41.221  -52.865  1.00 36.96  ? 413 ILE A N     1 
ATOM   2367  C  CA    . ILE A  1 307 ? 102.338 40.910  -51.929  1.00 36.97  ? 413 ILE A CA    1 
ATOM   2368  C  C     . ILE A  1 307 ? 102.802 40.646  -50.494  1.00 39.56  ? 413 ILE A C     1 
ATOM   2369  O  O     . ILE A  1 307 ? 102.012 40.755  -49.560  1.00 42.55  ? 413 ILE A O     1 
ATOM   2370  C  CB    . ILE A  1 307 ? 101.488 39.710  -52.404  1.00 35.89  ? 413 ILE A CB    1 
ATOM   2371  C  CG1   . ILE A  1 307 ? 102.291 38.426  -52.508  1.00 35.32  ? 413 ILE A CG1   1 
ATOM   2372  C  CG2   . ILE A  1 307 ? 100.804 40.039  -53.725  1.00 35.95  ? 413 ILE A CG2   1 
ATOM   2373  C  CD1   . ILE A  1 307 ? 101.457 37.202  -52.824  1.00 35.36  ? 413 ILE A CD1   1 
ATOM   2374  N  N     . ASP A  1 308 ? 104.065 40.279  -50.319  1.00 41.65  ? 414 ASP A N     1 
ATOM   2375  C  CA    . ASP A  1 308 ? 104.609 40.053  -48.995  1.00 42.35  ? 414 ASP A CA    1 
ATOM   2376  C  C     . ASP A  1 308 ? 104.926 41.339  -48.236  1.00 41.47  ? 414 ASP A C     1 
ATOM   2377  O  O     . ASP A  1 308 ? 104.857 41.339  -47.009  1.00 41.58  ? 414 ASP A O     1 
ATOM   2378  C  CB    . ASP A  1 308 ? 105.843 39.170  -49.089  1.00 44.88  ? 414 ASP A CB    1 
ATOM   2379  C  CG    . ASP A  1 308 ? 105.524 37.799  -49.675  1.00 45.81  ? 414 ASP A CG    1 
ATOM   2380  O  OD1   . ASP A  1 308 ? 104.459 37.220  -49.342  1.00 45.02  ? 414 ASP A OD1   1 
ATOM   2381  O  OD2   . ASP A  1 308 ? 106.348 37.314  -50.483  1.00 45.73  ? 414 ASP A OD2   1 
ATOM   2382  N  N     . ASP A  1 309 ? 105.250 42.426  -48.940  1.00 40.26  ? 415 ASP A N     1 
ATOM   2383  C  CA    . ASP A  1 309 ? 105.542 43.709  -48.298  1.00 40.89  ? 415 ASP A CA    1 
ATOM   2384  C  C     . ASP A  1 309 ? 104.723 44.882  -48.883  1.00 40.97  ? 415 ASP A C     1 
ATOM   2385  O  O     . ASP A  1 309 ? 104.901 45.258  -50.035  1.00 41.04  ? 415 ASP A O     1 
ATOM   2386  C  CB    . ASP A  1 309 ? 107.035 43.989  -48.379  1.00 41.93  ? 415 ASP A CB    1 
ATOM   2387  C  CG    . ASP A  1 309 ? 107.399 45.446  -47.999  1.00 43.99  ? 415 ASP A CG    1 
ATOM   2388  O  OD1   . ASP A  1 309 ? 107.029 45.933  -46.904  1.00 46.00  ? 415 ASP A OD1   1 
ATOM   2389  O  OD2   . ASP A  1 309 ? 108.068 46.116  -48.800  1.00 44.82  ? 415 ASP A OD2   1 
ATOM   2390  N  N     . MET A  1 310 ? 103.874 45.480  -48.053  1.00 41.46  ? 416 MET A N     1 
ATOM   2391  C  CA    . MET A  1 310 ? 102.911 46.475  -48.490  1.00 41.59  ? 416 MET A CA    1 
ATOM   2392  C  C     . MET A  1 310 ? 103.499 47.785  -48.964  1.00 43.83  ? 416 MET A C     1 
ATOM   2393  O  O     . MET A  1 310 ? 102.850 48.500  -49.712  1.00 44.92  ? 416 MET A O     1 
ATOM   2394  C  CB    . MET A  1 310 ? 101.900 46.774  -47.376  1.00 40.43  ? 416 MET A CB    1 
ATOM   2395  C  CG    . MET A  1 310 ? 100.993 45.609  -47.048  1.00 39.51  ? 416 MET A CG    1 
ATOM   2396  S  SD    . MET A  1 310 ? 99.932  45.074  -48.415  1.00 37.44  ? 416 MET A SD    1 
ATOM   2397  C  CE    . MET A  1 310 ? 100.791 43.612  -49.001  1.00 37.81  ? 416 MET A CE    1 
ATOM   2398  N  N     . GLU A  1 311 ? 104.705 48.121  -48.544  1.00 47.44  ? 417 GLU A N     1 
ATOM   2399  C  CA    . GLU A  1 311 ? 105.318 49.343  -49.047  1.00 50.43  ? 417 GLU A CA    1 
ATOM   2400  C  C     . GLU A  1 311 ? 105.696 49.178  -50.512  1.00 47.51  ? 417 GLU A C     1 
ATOM   2401  O  O     . GLU A  1 311 ? 105.661 50.150  -51.273  1.00 48.43  ? 417 GLU A O     1 
ATOM   2402  C  CB    . GLU A  1 311 ? 106.529 49.733  -48.219  1.00 56.14  ? 417 GLU A CB    1 
ATOM   2403  C  CG    . GLU A  1 311 ? 106.966 51.174  -48.461  1.00 60.46  ? 417 GLU A CG    1 
ATOM   2404  C  CD    . GLU A  1 311 ? 108.146 51.580  -47.604  1.00 66.63  ? 417 GLU A CD    1 
ATOM   2405  O  OE1   . GLU A  1 311 ? 108.187 51.196  -46.409  1.00 73.02  ? 417 GLU A OE1   1 
ATOM   2406  O  OE2   . GLU A  1 311 ? 109.036 52.284  -48.130  1.00 70.74  ? 417 GLU A OE2   1 
ATOM   2407  N  N     . ALA A  1 312 ? 106.049 47.950  -50.893  1.00 42.56  ? 418 ALA A N     1 
ATOM   2408  C  CA    . ALA A  1 312 ? 106.327 47.626  -52.287  1.00 39.49  ? 418 ALA A CA    1 
ATOM   2409  C  C     . ALA A  1 312 ? 105.041 47.559  -53.085  1.00 36.78  ? 418 ALA A C     1 
ATOM   2410  O  O     . ALA A  1 312 ? 104.927 48.169  -54.148  1.00 35.87  ? 418 ALA A O     1 
ATOM   2411  C  CB    . ALA A  1 312 ? 107.046 46.298  -52.393  1.00 40.06  ? 418 ALA A CB    1 
ATOM   2412  N  N     . TYR A  1 313 ? 104.078 46.811  -52.549  1.00 34.12  ? 419 TYR A N     1 
ATOM   2413  C  CA    . TYR A  1 313 ? 102.770 46.612  -53.186  1.00 32.09  ? 419 TYR A CA    1 
ATOM   2414  C  C     . TYR A  1 313 ? 101.998 47.900  -53.468  1.00 31.76  ? 419 TYR A C     1 
ATOM   2415  O  O     . TYR A  1 313 ? 101.200 47.942  -54.400  1.00 30.75  ? 419 TYR A O     1 
ATOM   2416  C  CB    . TYR A  1 313 ? 101.911 45.706  -52.306  1.00 30.96  ? 419 TYR A CB    1 
ATOM   2417  C  CG    . TYR A  1 313 ? 100.746 45.034  -52.985  1.00 30.30  ? 419 TYR A CG    1 
ATOM   2418  C  CD1   . TYR A  1 313 ? 100.922 44.274  -54.130  1.00 30.64  ? 419 TYR A CD1   1 
ATOM   2419  C  CD2   . TYR A  1 313 ? 99.479  45.095  -52.440  1.00 29.95  ? 419 TYR A CD2   1 
ATOM   2420  C  CE1   . TYR A  1 313 ? 99.855  43.617  -54.728  1.00 30.26  ? 419 TYR A CE1   1 
ATOM   2421  C  CE2   . TYR A  1 313 ? 98.405  44.458  -53.025  1.00 29.74  ? 419 TYR A CE2   1 
ATOM   2422  C  CZ    . TYR A  1 313 ? 98.597  43.710  -54.172  1.00 29.82  ? 419 TYR A CZ    1 
ATOM   2423  O  OH    . TYR A  1 313 ? 97.523  43.077  -54.745  1.00 28.70  ? 419 TYR A OH    1 
ATOM   2424  N  N     . THR A  1 314 ? 102.240 48.933  -52.663  1.00 32.82  ? 420 THR A N     1 
ATOM   2425  C  CA    . THR A  1 314 ? 101.690 50.264  -52.894  1.00 34.53  ? 420 THR A CA    1 
ATOM   2426  C  C     . THR A  1 314 ? 102.074 50.823  -54.273  1.00 36.04  ? 420 THR A C     1 
ATOM   2427  O  O     . THR A  1 314 ? 101.306 51.566  -54.902  1.00 35.74  ? 420 THR A O     1 
ATOM   2428  C  CB    . THR A  1 314 ? 102.133 51.225  -51.765  1.00 35.85  ? 420 THR A CB    1 
ATOM   2429  O  OG1   . THR A  1 314 ? 101.560 50.796  -50.521  1.00 36.63  ? 420 THR A OG1   1 
ATOM   2430  C  CG2   . THR A  1 314 ? 101.647 52.642  -52.012  1.00 36.89  ? 420 THR A CG2   1 
ATOM   2431  N  N     . LYS A  1 315 ? 103.265 50.470  -54.744  1.00 39.23  ? 421 LYS A N     1 
ATOM   2432  C  CA    . LYS A  1 315 ? 103.747 50.938  -56.040  1.00 41.02  ? 421 LYS A CA    1 
ATOM   2433  C  C     . LYS A  1 315 ? 103.466 49.964  -57.196  1.00 37.53  ? 421 LYS A C     1 
ATOM   2434  O  O     . LYS A  1 315 ? 103.831 50.256  -58.332  1.00 36.11  ? 421 LYS A O     1 
ATOM   2435  C  CB    . LYS A  1 315 ? 105.236 51.276  -55.932  1.00 47.35  ? 421 LYS A CB    1 
ATOM   2436  C  CG    . LYS A  1 315 ? 105.509 52.382  -54.911  1.00 53.07  ? 421 LYS A CG    1 
ATOM   2437  C  CD    . LYS A  1 315 ? 106.962 52.881  -54.970  1.00 57.36  ? 421 LYS A CD    1 
ATOM   2438  C  CE    . LYS A  1 315 ? 107.962 51.972  -54.236  1.00 59.46  ? 421 LYS A CE    1 
ATOM   2439  N  NZ    . LYS A  1 315 ? 109.320 52.497  -54.493  1.00 61.26  ? 421 LYS A NZ    1 
ATOM   2440  N  N     . LEU A  1 316 ? 102.787 48.847  -56.920  1.00 35.44  ? 422 LEU A N     1 
ATOM   2441  C  CA    . LEU A  1 316 ? 102.446 47.848  -57.936  1.00 34.08  ? 422 LEU A CA    1 
ATOM   2442  C  C     . LEU A  1 316 ? 101.005 48.009  -58.444  1.00 33.28  ? 422 LEU A C     1 
ATOM   2443  O  O     . LEU A  1 316 ? 100.057 47.588  -57.782  1.00 34.15  ? 422 LEU A O     1 
ATOM   2444  C  CB    . LEU A  1 316 ? 102.621 46.448  -57.366  1.00 33.84  ? 422 LEU A CB    1 
ATOM   2445  C  CG    . LEU A  1 316 ? 102.361 45.294  -58.338  1.00 33.80  ? 422 LEU A CG    1 
ATOM   2446  C  CD1   . LEU A  1 316 ? 103.284 45.367  -59.560  1.00 34.41  ? 422 LEU A CD1   1 
ATOM   2447  C  CD2   . LEU A  1 316 ? 102.506 43.947  -57.645  1.00 34.01  ? 422 LEU A CD2   1 
ATOM   2448  N  N     . THR A  1 317 ? 100.862 48.599  -59.630  1.00 31.49  ? 423 THR A N     1 
ATOM   2449  C  CA    . THR A  1 317 ? 99.577  48.927  -60.230  1.00 30.37  ? 423 THR A CA    1 
ATOM   2450  C  C     . THR A  1 317 ? 99.536  48.505  -61.701  1.00 30.86  ? 423 THR A C     1 
ATOM   2451  O  O     . THR A  1 317 ? 100.429 47.827  -62.177  1.00 31.87  ? 423 THR A O     1 
ATOM   2452  C  CB    . THR A  1 317 ? 99.313  50.439  -60.120  1.00 29.84  ? 423 THR A CB    1 
ATOM   2453  O  OG1   . THR A  1 317 ? 100.320 51.157  -60.818  1.00 29.17  ? 423 THR A OG1   1 
ATOM   2454  C  CG2   . THR A  1 317 ? 99.284  50.869  -58.663  1.00 30.53  ? 423 THR A CG2   1 
ATOM   2455  N  N     . ASP A  1 318 ? 98.492  48.893  -62.427  1.00 31.57  ? 424 ASP A N     1 
ATOM   2456  C  CA    . ASP A  1 318 ? 98.396  48.659  -63.870  1.00 32.78  ? 424 ASP A CA    1 
ATOM   2457  C  C     . ASP A  1 318 ? 99.561  49.248  -64.641  1.00 33.39  ? 424 ASP A C     1 
ATOM   2458  O  O     . ASP A  1 318 ? 99.845  48.794  -65.734  1.00 34.38  ? 424 ASP A O     1 
ATOM   2459  C  CB    . ASP A  1 318 ? 97.109  49.249  -64.452  1.00 34.11  ? 424 ASP A CB    1 
ATOM   2460  C  CG    . ASP A  1 318 ? 95.850  48.466  -64.080  1.00 35.02  ? 424 ASP A CG    1 
ATOM   2461  O  OD1   . ASP A  1 318 ? 95.879  47.579  -63.192  1.00 35.74  ? 424 ASP A OD1   1 
ATOM   2462  O  OD2   . ASP A  1 318 ? 94.797  48.803  -64.702  1.00 37.23  ? 424 ASP A OD2   1 
ATOM   2463  N  N     . ASN A  1 319 ? 100.196 50.278  -64.095  1.00 34.11  ? 425 ASN A N     1 
ATOM   2464  C  CA    . ASN A  1 319 ? 101.464 50.807  -64.609  1.00 34.51  ? 425 ASN A CA    1 
ATOM   2465  C  C     . ASN A  1 319 ? 102.424 49.764  -65.139  1.00 33.72  ? 425 ASN A C     1 
ATOM   2466  O  O     . ASN A  1 319 ? 103.173 49.982  -66.086  1.00 32.30  ? 425 ASN A O     1 
ATOM   2467  C  CB    . ASN A  1 319 ? 102.243 51.497  -63.483  1.00 36.17  ? 425 ASN A CB    1 
ATOM   2468  C  CG    . ASN A  1 319 ? 103.345 52.359  -64.017  1.00 38.11  ? 425 ASN A CG    1 
ATOM   2469  O  OD1   . ASN A  1 319 ? 104.541 52.177  -63.719  1.00 40.29  ? 425 ASN A OD1   1 
ATOM   2470  N  ND2   . ASN A  1 319 ? 102.941 53.298  -64.861  1.00 38.85  ? 425 ASN A ND2   1 
ATOM   2471  N  N     . ILE A  1 320 ? 102.513 48.653  -64.406  1.00 33.23  ? 426 ILE A N     1 
ATOM   2472  C  CA    . ILE A  1 320 ? 103.478 47.615  -64.703  1.00 32.91  ? 426 ILE A CA    1 
ATOM   2473  C  C     . ILE A  1 320 ? 103.365 47.098  -66.140  1.00 31.23  ? 426 ILE A C     1 
ATOM   2474  O  O     . ILE A  1 320 ? 104.358 46.701  -66.725  1.00 32.18  ? 426 ILE A O     1 
ATOM   2475  C  CB    . ILE A  1 320 ? 103.409 46.472  -63.644  1.00 34.07  ? 426 ILE A CB    1 
ATOM   2476  C  CG1   . ILE A  1 320 ? 104.777 45.870  -63.417  1.00 35.18  ? 426 ILE A CG1   1 
ATOM   2477  C  CG2   . ILE A  1 320 ? 102.456 45.360  -64.023  1.00 34.14  ? 426 ILE A CG2   1 
ATOM   2478  C  CD1   . ILE A  1 320 ? 105.678 46.770  -62.602  1.00 36.03  ? 426 ILE A CD1   1 
ATOM   2479  N  N     . PHE A  1 321 ? 102.153 47.112  -66.687  1.00 29.28  ? 427 PHE A N     1 
ATOM   2480  C  CA    . PHE A  1 321 ? 101.884 46.815  -68.094  1.00 28.05  ? 427 PHE A CA    1 
ATOM   2481  C  C     . PHE A  1 321 ? 102.656 47.771  -68.997  1.00 29.81  ? 427 PHE A C     1 
ATOM   2482  O  O     . PHE A  1 321 ? 103.420 47.342  -69.852  1.00 30.85  ? 427 PHE A O     1 
ATOM   2483  C  CB    . PHE A  1 321 ? 100.381 46.938  -68.351  1.00 25.70  ? 427 PHE A CB    1 
ATOM   2484  C  CG    . PHE A  1 321 ? 99.947  46.689  -69.772  1.00 24.30  ? 427 PHE A CG    1 
ATOM   2485  C  CD1   . PHE A  1 321 ? 99.949  47.715  -70.712  1.00 23.57  ? 427 PHE A CD1   1 
ATOM   2486  C  CD2   . PHE A  1 321 ? 99.441  45.466  -70.150  1.00 23.52  ? 427 PHE A CD2   1 
ATOM   2487  C  CE1   . PHE A  1 321 ? 99.517  47.491  -72.007  1.00 22.81  ? 427 PHE A CE1   1 
ATOM   2488  C  CE2   . PHE A  1 321 ? 98.993  45.247  -71.458  1.00 22.60  ? 427 PHE A CE2   1 
ATOM   2489  C  CZ    . PHE A  1 321 ? 99.038  46.255  -72.371  1.00 22.35  ? 427 PHE A CZ    1 
ATOM   2490  N  N     . LEU A  1 322 ? 102.458 49.065  -68.804  1.00 31.46  ? 428 LEU A N     1 
ATOM   2491  C  CA    . LEU A  1 322 ? 103.118 50.055  -69.654  1.00 32.52  ? 428 LEU A CA    1 
ATOM   2492  C  C     . LEU A  1 322 ? 104.624 50.141  -69.426  1.00 35.48  ? 428 LEU A C     1 
ATOM   2493  O  O     . LEU A  1 322 ? 105.364 50.545  -70.333  1.00 36.20  ? 428 LEU A O     1 
ATOM   2494  C  CB    . LEU A  1 322 ? 102.488 51.432  -69.467  1.00 31.48  ? 428 LEU A CB    1 
ATOM   2495  C  CG    . LEU A  1 322 ? 101.071 51.581  -70.031  1.00 29.90  ? 428 LEU A CG    1 
ATOM   2496  C  CD1   . LEU A  1 322 ? 100.509 52.923  -69.668  1.00 29.60  ? 428 LEU A CD1   1 
ATOM   2497  C  CD2   . LEU A  1 322 ? 100.996 51.328  -71.540  1.00 29.54  ? 428 LEU A CD2   1 
ATOM   2498  N  N     . GLU A  1 323 ? 105.066 49.772  -68.223  1.00 38.24  ? 429 GLU A N     1 
ATOM   2499  C  CA    . GLU A  1 323 ? 106.493 49.723  -67.893  1.00 40.24  ? 429 GLU A CA    1 
ATOM   2500  C  C     . GLU A  1 323 ? 107.152 48.679  -68.767  1.00 39.47  ? 429 GLU A C     1 
ATOM   2501  O  O     . GLU A  1 323 ? 108.134 48.971  -69.425  1.00 43.71  ? 429 GLU A O     1 
ATOM   2502  C  CB    . GLU A  1 323 ? 106.696 49.423  -66.401  1.00 43.88  ? 429 GLU A CB    1 
ATOM   2503  C  CG    . GLU A  1 323 ? 108.069 49.772  -65.842  1.00 47.76  ? 429 GLU A CG    1 
ATOM   2504  C  CD    . GLU A  1 323 ? 108.250 49.370  -64.381  1.00 51.77  ? 429 GLU A CD    1 
ATOM   2505  O  OE1   . GLU A  1 323 ? 107.425 49.799  -63.507  1.00 52.23  ? 429 GLU A OE1   1 
ATOM   2506  O  OE2   . GLU A  1 323 ? 109.244 48.632  -64.101  1.00 55.38  ? 429 GLU A OE2   1 
ATOM   2507  N  N     . ILE A  1 324 ? 106.570 47.483  -68.806  1.00 36.88  ? 430 ILE A N     1 
ATOM   2508  C  CA    . ILE A  1 324 ? 107.022 46.400  -69.679  1.00 35.72  ? 430 ILE A CA    1 
ATOM   2509  C  C     . ILE A  1 324 ? 106.952 46.803  -71.138  1.00 37.08  ? 430 ILE A C     1 
ATOM   2510  O  O     . ILE A  1 324 ? 107.902 46.595  -71.878  1.00 37.35  ? 430 ILE A O     1 
ATOM   2511  C  CB    . ILE A  1 324 ? 106.210 45.114  -69.471  1.00 33.75  ? 430 ILE A CB    1 
ATOM   2512  C  CG1   . ILE A  1 324 ? 106.483 44.535  -68.079  1.00 33.42  ? 430 ILE A CG1   1 
ATOM   2513  C  CG2   . ILE A  1 324 ? 106.573 44.054  -70.502  1.00 33.93  ? 430 ILE A CG2   1 
ATOM   2514  C  CD1   . ILE A  1 324 ? 105.438 43.536  -67.625  1.00 33.40  ? 430 ILE A CD1   1 
ATOM   2515  N  N     . LEU A  1 325 ? 105.831 47.375  -71.558  1.00 39.51  ? 431 LEU A N     1 
ATOM   2516  C  CA    . LEU A  1 325 ? 105.629 47.738  -72.970  1.00 41.75  ? 431 LEU A CA    1 
ATOM   2517  C  C     . LEU A  1 325 ? 106.637 48.766  -73.459  1.00 44.34  ? 431 LEU A C     1 
ATOM   2518  O  O     . LEU A  1 325 ? 107.195 48.615  -74.535  1.00 47.72  ? 431 LEU A O     1 
ATOM   2519  C  CB    . LEU A  1 325 ? 104.221 48.261  -73.206  1.00 41.06  ? 431 LEU A CB    1 
ATOM   2520  C  CG    . LEU A  1 325 ? 103.799 48.553  -74.655  1.00 40.96  ? 431 LEU A CG    1 
ATOM   2521  C  CD1   . LEU A  1 325 ? 103.581 47.308  -75.445  1.00 40.44  ? 431 LEU A CD1   1 
ATOM   2522  C  CD2   . LEU A  1 325 ? 102.526 49.364  -74.719  1.00 41.13  ? 431 LEU A CD2   1 
ATOM   2523  N  N     . TYR A  1 326 ? 106.852 49.814  -72.675  1.00 44.65  ? 432 TYR A N     1 
ATOM   2524  C  CA    . TYR A  1 326 ? 107.780 50.877  -73.058  1.00 45.87  ? 432 TYR A CA    1 
ATOM   2525  C  C     . TYR A  1 326 ? 109.261 50.562  -72.826  1.00 48.16  ? 432 TYR A C     1 
ATOM   2526  O  O     . TYR A  1 326 ? 110.105 51.327  -73.288  1.00 50.78  ? 432 TYR A O     1 
ATOM   2527  C  CB    . TYR A  1 326 ? 107.418 52.191  -72.355  1.00 45.55  ? 432 TYR A CB    1 
ATOM   2528  C  CG    . TYR A  1 326 ? 106.030 52.744  -72.651  1.00 45.10  ? 432 TYR A CG    1 
ATOM   2529  C  CD1   . TYR A  1 326 ? 105.395 52.499  -73.866  1.00 44.88  ? 432 TYR A CD1   1 
ATOM   2530  C  CD2   . TYR A  1 326 ? 105.366 53.555  -71.725  1.00 44.43  ? 432 TYR A CD2   1 
ATOM   2531  C  CE1   . TYR A  1 326 ? 104.136 53.011  -74.143  1.00 45.15  ? 432 TYR A CE1   1 
ATOM   2532  C  CE2   . TYR A  1 326 ? 104.120 54.081  -71.983  1.00 44.23  ? 432 TYR A CE2   1 
ATOM   2533  C  CZ    . TYR A  1 326 ? 103.499 53.803  -73.207  1.00 44.77  ? 432 TYR A CZ    1 
ATOM   2534  O  OH    . TYR A  1 326 ? 102.255 54.283  -73.525  1.00 43.53  ? 432 TYR A OH    1 
ATOM   2535  N  N     . SER A  1 327 ? 109.589 49.457  -72.151  1.00 49.09  ? 433 SER A N     1 
ATOM   2536  C  CA    . SER A  1 327 ? 110.981 49.170  -71.802  1.00 51.68  ? 433 SER A CA    1 
ATOM   2537  C  C     . SER A  1 327 ? 111.846 48.844  -73.001  1.00 53.71  ? 433 SER A C     1 
ATOM   2538  O  O     . SER A  1 327 ? 111.355 48.441  -74.053  1.00 50.86  ? 433 SER A O     1 
ATOM   2539  C  CB    . SER A  1 327 ? 111.091 48.014  -70.810  1.00 51.00  ? 433 SER A CB    1 
ATOM   2540  O  OG    . SER A  1 327 ? 110.705 46.798  -71.418  1.00 49.96  ? 433 SER A OG    1 
ATOM   2541  N  N     . THR A  1 328 ? 113.148 49.050  -72.807  1.00 56.11  ? 434 THR A N     1 
ATOM   2542  C  CA    . THR A  1 328 ? 114.196 48.690  -73.764  1.00 57.83  ? 434 THR A CA    1 
ATOM   2543  C  C     . THR A  1 328 ? 115.165 47.624  -73.237  1.00 57.06  ? 434 THR A C     1 
ATOM   2544  O  O     . THR A  1 328 ? 116.012 47.169  -73.981  1.00 57.51  ? 434 THR A O     1 
ATOM   2545  C  CB    . THR A  1 328 ? 114.996 49.953  -74.163  1.00 62.63  ? 434 THR A CB    1 
ATOM   2546  O  OG1   . THR A  1 328 ? 115.433 50.644  -72.982  1.00 68.56  ? 434 THR A OG1   1 
ATOM   2547  C  CG2   . THR A  1 328 ? 114.143 50.900  -75.030  1.00 63.90  ? 434 THR A CG2   1 
ATOM   2548  N  N     . ASP A  1 329 ? 115.042 47.217  -71.974  1.00 59.00  ? 435 ASP A N     1 
ATOM   2549  C  CA    . ASP A  1 329 ? 115.858 46.131  -71.414  1.00 61.00  ? 435 ASP A CA    1 
ATOM   2550  C  C     . ASP A  1 329 ? 115.705 44.860  -72.268  1.00 60.16  ? 435 ASP A C     1 
ATOM   2551  O  O     . ASP A  1 329 ? 114.589 44.409  -72.492  1.00 59.20  ? 435 ASP A O     1 
ATOM   2552  C  CB    . ASP A  1 329 ? 115.439 45.876  -69.965  1.00 62.94  ? 435 ASP A CB    1 
ATOM   2553  C  CG    . ASP A  1 329 ? 116.389 44.949  -69.214  1.00 65.63  ? 435 ASP A CG    1 
ATOM   2554  O  OD1   . ASP A  1 329 ? 117.038 44.073  -69.827  1.00 72.35  ? 435 ASP A OD1   1 
ATOM   2555  O  OD2   . ASP A  1 329 ? 116.412 45.039  -67.982  1.00 63.86  ? 435 ASP A OD2   1 
ATOM   2556  N  N     . PRO A  1 330 ? 116.809 44.291  -72.768  1.00 61.74  ? 436 PRO A N     1 
ATOM   2557  C  CA    . PRO A  1 330 ? 116.658 43.038  -73.522  1.00 60.24  ? 436 PRO A CA    1 
ATOM   2558  C  C     . PRO A  1 330 ? 116.224 41.829  -72.714  1.00 56.98  ? 436 PRO A C     1 
ATOM   2559  O  O     . PRO A  1 330 ? 115.790 40.844  -73.294  1.00 56.78  ? 436 PRO A O     1 
ATOM   2560  C  CB    . PRO A  1 330 ? 118.038 42.814  -74.136  1.00 63.44  ? 436 PRO A CB    1 
ATOM   2561  C  CG    . PRO A  1 330 ? 118.624 44.178  -74.232  1.00 66.58  ? 436 PRO A CG    1 
ATOM   2562  C  CD    . PRO A  1 330 ? 118.151 44.875  -72.958  1.00 65.76  ? 436 PRO A CD    1 
ATOM   2563  N  N     . LYS A  1 331 ? 116.343 41.882  -71.392  1.00 56.86  ? 437 LYS A N     1 
ATOM   2564  C  CA    . LYS A  1 331 ? 115.833 40.802  -70.525  1.00 59.02  ? 437 LYS A CA    1 
ATOM   2565  C  C     . LYS A  1 331 ? 114.317 40.701  -70.582  1.00 55.17  ? 437 LYS A C     1 
ATOM   2566  O  O     . LYS A  1 331 ? 113.769 39.606  -70.457  1.00 51.94  ? 437 LYS A O     1 
ATOM   2567  C  CB    . LYS A  1 331 ? 116.321 40.985  -69.094  1.00 65.64  ? 437 LYS A CB    1 
ATOM   2568  C  CG    . LYS A  1 331 ? 117.814 40.792  -68.950  1.00 74.19  ? 437 LYS A CG    1 
ATOM   2569  C  CD    . LYS A  1 331 ? 118.324 41.098  -67.565  1.00 81.16  ? 437 LYS A CD    1 
ATOM   2570  C  CE    . LYS A  1 331 ? 119.521 40.157  -67.237  1.00 89.28  ? 437 LYS A CE    1 
ATOM   2571  N  NZ    . LYS A  1 331 ? 120.077 40.447  -65.901  1.00 94.71  ? 437 LYS A NZ    1 
ATOM   2572  N  N     . LEU A  1 332 ? 113.653 41.833  -70.798  1.00 54.97  ? 438 LEU A N     1 
ATOM   2573  C  CA    . LEU A  1 332 ? 112.187 41.917  -70.909  1.00 54.32  ? 438 LEU A CA    1 
ATOM   2574  C  C     . LEU A  1 332 ? 111.656 41.769  -72.328  1.00 55.79  ? 438 LEU A C     1 
ATOM   2575  O  O     . LEU A  1 332 ? 110.491 42.035  -72.569  1.00 55.14  ? 438 LEU A O     1 
ATOM   2576  C  CB    . LEU A  1 332 ? 111.700 43.277  -70.365  1.00 52.91  ? 438 LEU A CB    1 
ATOM   2577  C  CG    . LEU A  1 332 ? 111.897 43.580  -68.881  1.00 53.74  ? 438 LEU A CG    1 
ATOM   2578  C  CD1   . LEU A  1 332 ? 111.563 45.037  -68.619  1.00 55.03  ? 438 LEU A CD1   1 
ATOM   2579  C  CD2   . LEU A  1 332 ? 111.031 42.702  -68.023  1.00 52.29  ? 438 LEU A CD2   1 
ATOM   2580  N  N     . LYS A  1 333 ? 112.487 41.354  -73.298  1.00 59.07  ? 439 LYS A N     1 
ATOM   2581  C  CA    . LYS A  1 333 ? 112.045 41.280  -74.700  1.00 59.75  ? 439 LYS A CA    1 
ATOM   2582  C  C     . LYS A  1 333 ? 110.917 40.270  -74.872  1.00 58.55  ? 439 LYS A C     1 
ATOM   2583  O  O     . LYS A  1 333 ? 109.976 40.544  -75.588  1.00 61.66  ? 439 LYS A O     1 
ATOM   2584  C  CB    . LYS A  1 333 ? 113.194 40.973  -75.640  1.00 62.63  ? 439 LYS A CB    1 
ATOM   2585  C  CG    . LYS A  1 333 ? 112.845 40.817  -77.132  1.00 62.23  ? 439 LYS A CG    1 
ATOM   2586  C  CD    . LYS A  1 333 ? 114.113 40.268  -77.854  1.00 63.37  ? 439 LYS A CD    1 
ATOM   2587  C  CE    . LYS A  1 333 ? 114.129 38.888  -78.650  1.00 62.46  ? 439 LYS A CE    1 
ATOM   2588  N  NZ    . LYS A  1 333 ? 114.215 39.065  -80.098  1.00 62.31  ? 439 LYS A NZ    1 
ATOM   2589  N  N     . ASP A  1 334 ? 111.000 39.105  -74.202  1.00 56.46  ? 440 ASP A N     1 
ATOM   2590  C  CA    . ASP A  1 334 ? 109.937 38.103  -74.305  1.00 54.45  ? 440 ASP A CA    1 
ATOM   2591  C  C     . ASP A  1 334 ? 108.580 38.620  -73.817  1.00 51.63  ? 440 ASP A C     1 
ATOM   2592  O  O     . ASP A  1 334 ? 107.554 38.373  -74.457  1.00 51.96  ? 440 ASP A O     1 
ATOM   2593  C  CB    . ASP A  1 334 ? 110.294 36.840  -73.522  1.00 54.48  ? 440 ASP A CB    1 
ATOM   2594  C  CG    . ASP A  1 334 ? 111.223 35.896  -74.304  1.00 52.79  ? 440 ASP A CG    1 
ATOM   2595  O  OD1   . ASP A  1 334 ? 111.793 36.293  -75.339  1.00 50.15  ? 440 ASP A OD1   1 
ATOM   2596  O  OD2   . ASP A  1 334 ? 111.398 34.744  -73.877  1.00 51.68  ? 440 ASP A OD2   1 
ATOM   2597  N  N     . ALA A  1 335 ? 108.586 39.315  -72.685  1.00 48.19  ? 441 ALA A N     1 
ATOM   2598  C  CA    . ALA A  1 335 ? 107.377 39.909  -72.113  1.00 45.98  ? 441 ALA A CA    1 
ATOM   2599  C  C     . ALA A  1 335 ? 106.829 41.031  -72.988  1.00 44.66  ? 441 ALA A C     1 
ATOM   2600  O  O     . ALA A  1 335 ? 105.660 41.038  -73.327  1.00 43.37  ? 441 ALA A O     1 
ATOM   2601  C  CB    . ALA A  1 335 ? 107.663 40.431  -70.718  1.00 45.69  ? 441 ALA A CB    1 
ATOM   2602  N  N     . ARG A  1 336 ? 107.691 41.966  -73.356  1.00 45.57  ? 442 ARG A N     1 
ATOM   2603  C  CA    . ARG A  1 336 ? 107.332 43.087  -74.221  1.00 46.51  ? 442 ARG A CA    1 
ATOM   2604  C  C     . ARG A  1 336 ? 106.743 42.646  -75.560  1.00 46.73  ? 442 ARG A C     1 
ATOM   2605  O  O     . ARG A  1 336 ? 105.899 43.340  -76.107  1.00 46.02  ? 442 ARG A O     1 
ATOM   2606  C  CB    . ARG A  1 336 ? 108.554 43.983  -74.462  1.00 48.20  ? 442 ARG A CB    1 
ATOM   2607  C  CG    . ARG A  1 336 ? 108.306 45.238  -75.298  1.00 50.91  ? 442 ARG A CG    1 
ATOM   2608  C  CD    . ARG A  1 336 ? 109.439 46.259  -75.225  1.00 53.12  ? 442 ARG A CD    1 
ATOM   2609  N  NE    . ARG A  1 336 ? 110.765 45.723  -75.619  1.00 54.76  ? 442 ARG A NE    1 
ATOM   2610  C  CZ    . ARG A  1 336 ? 111.720 45.259  -74.790  1.00 57.10  ? 442 ARG A CZ    1 
ATOM   2611  N  NH1   . ARG A  1 336 ? 112.859 44.795  -75.276  1.00 57.56  ? 442 ARG A NH1   1 
ATOM   2612  N  NH2   . ARG A  1 336 ? 111.554 45.231  -73.473  1.00 62.05  ? 442 ARG A NH2   1 
ATOM   2613  N  N     . GLU A  1 337 ? 107.176 41.507  -76.094  1.00 47.91  ? 443 GLU A N     1 
ATOM   2614  C  CA    . GLU A  1 337 ? 106.635 41.010  -77.367  1.00 49.36  ? 443 GLU A CA    1 
ATOM   2615  C  C     . GLU A  1 337 ? 105.200 40.551  -77.234  1.00 45.43  ? 443 GLU A C     1 
ATOM   2616  O  O     . GLU A  1 337 ? 104.419 40.752  -78.159  1.00 47.58  ? 443 GLU A O     1 
ATOM   2617  C  CB    . GLU A  1 337 ? 107.490 39.886  -77.990  1.00 55.19  ? 443 GLU A CB    1 
ATOM   2618  C  CG    . GLU A  1 337 ? 108.810 40.314  -78.663  1.00 59.14  ? 443 GLU A CG    1 
ATOM   2619  C  CD    . GLU A  1 337 ? 108.686 41.431  -79.698  1.00 61.48  ? 443 GLU A CD    1 
ATOM   2620  O  OE1   . GLU A  1 337 ? 107.632 41.521  -80.356  1.00 63.57  ? 443 GLU A OE1   1 
ATOM   2621  O  OE2   . GLU A  1 337 ? 109.643 42.235  -79.819  1.00 67.09  ? 443 GLU A OE2   1 
ATOM   2622  N  N     . ILE A  1 338 ? 104.845 39.944  -76.102  1.00 42.12  ? 444 ILE A N     1 
ATOM   2623  C  CA    . ILE A  1 338 ? 103.451 39.546  -75.860  1.00 39.42  ? 444 ILE A CA    1 
ATOM   2624  C  C     . ILE A  1 338 ? 102.548 40.770  -75.803  1.00 37.00  ? 444 ILE A C     1 
ATOM   2625  O  O     . ILE A  1 338 ? 101.509 40.795  -76.456  1.00 36.01  ? 444 ILE A O     1 
ATOM   2626  C  CB    . ILE A  1 338 ? 103.272 38.715  -74.576  1.00 39.45  ? 444 ILE A CB    1 
ATOM   2627  C  CG1   . ILE A  1 338 ? 103.934 37.356  -74.751  1.00 40.87  ? 444 ILE A CG1   1 
ATOM   2628  C  CG2   . ILE A  1 338 ? 101.796 38.489  -74.285  1.00 39.61  ? 444 ILE A CG2   1 
ATOM   2629  C  CD1   . ILE A  1 338 ? 103.951 36.468  -73.527  1.00 41.65  ? 444 ILE A CD1   1 
ATOM   2630  N  N     . LEU A  1 339 ? 102.947 41.779  -75.041  1.00 35.27  ? 445 LEU A N     1 
ATOM   2631  C  CA    . LEU A  1 339 ? 102.153 42.996  -74.920  1.00 35.27  ? 445 LEU A CA    1 
ATOM   2632  C  C     . LEU A  1 339 ? 102.064 43.758  -76.230  1.00 37.97  ? 445 LEU A C     1 
ATOM   2633  O  O     . LEU A  1 339 ? 101.039 44.372  -76.514  1.00 39.38  ? 445 LEU A O     1 
ATOM   2634  C  CB    . LEU A  1 339 ? 102.680 43.910  -73.823  1.00 33.83  ? 445 LEU A CB    1 
ATOM   2635  C  CG    . LEU A  1 339 ? 102.802 43.313  -72.416  1.00 33.02  ? 445 LEU A CG    1 
ATOM   2636  C  CD1   . LEU A  1 339 ? 103.095 44.402  -71.420  1.00 33.05  ? 445 LEU A CD1   1 
ATOM   2637  C  CD2   . LEU A  1 339 ? 101.596 42.562  -71.963  1.00 32.60  ? 445 LEU A CD2   1 
ATOM   2638  N  N     . LYS A  1 340 ? 103.120 43.720  -77.042  1.00 42.47  ? 446 LYS A N     1 
ATOM   2639  C  CA    . LYS A  1 340 ? 103.068 44.336  -78.372  1.00 45.55  ? 446 LYS A CA    1 
ATOM   2640  C  C     . LYS A  1 340 ? 102.078 43.585  -79.266  1.00 43.94  ? 446 LYS A C     1 
ATOM   2641  O  O     . LYS A  1 340 ? 101.374 44.211  -80.045  1.00 46.38  ? 446 LYS A O     1 
ATOM   2642  C  CB    . LYS A  1 340 ? 104.443 44.446  -79.015  1.00 50.06  ? 446 LYS A CB    1 
ATOM   2643  C  CG    . LYS A  1 340 ? 105.092 45.829  -78.885  1.00 54.55  ? 446 LYS A CG    1 
ATOM   2644  C  CD    . LYS A  1 340 ? 106.615 45.768  -79.113  1.00 58.02  ? 446 LYS A CD    1 
ATOM   2645  C  CE    . LYS A  1 340 ? 107.205 46.591  -80.383  1.00 60.58  ? 446 LYS A CE    1 
ATOM   2646  N  NZ    . LYS A  1 340 ? 106.382 47.755  -80.918  1.00 61.86  ? 446 LYS A NZ    1 
ATOM   2647  N  N     . GLN A  1 341 ? 102.001 42.259  -79.124  1.00 41.42  ? 447 GLN A N     1 
ATOM   2648  C  CA    . GLN A  1 341 ? 101.015 41.462  -79.859  1.00 40.81  ? 447 GLN A CA    1 
ATOM   2649  C  C     . GLN A  1 341 ? 99.566  41.788  -79.488  1.00 39.06  ? 447 GLN A C     1 
ATOM   2650  O  O     . GLN A  1 341 ? 98.675  41.602  -80.300  1.00 41.45  ? 447 GLN A O     1 
ATOM   2651  C  CB    . GLN A  1 341 ? 101.305 39.938  -79.754  1.00 42.30  ? 447 GLN A CB    1 
ATOM   2652  C  CG    . GLN A  1 341 ? 102.516 39.447  -80.580  1.00 44.41  ? 447 GLN A CG    1 
ATOM   2653  C  CD    . GLN A  1 341 ? 102.637 40.090  -81.994  1.00 44.39  ? 447 GLN A CD    1 
ATOM   2654  O  OE1   . GLN A  1 341 ? 101.975 39.664  -82.933  1.00 44.52  ? 447 GLN A OE1   1 
ATOM   2655  N  NE2   . GLN A  1 341 ? 103.479 41.105  -82.118  1.00 42.75  ? 447 GLN A NE2   1 
ATOM   2656  N  N     . ILE A  1 342 ? 99.325  42.279  -78.282  1.00 36.85  ? 448 ILE A N     1 
ATOM   2657  C  CA    . ILE A  1 342 ? 97.994  42.746  -77.875  1.00 35.69  ? 448 ILE A CA    1 
ATOM   2658  C  C     . ILE A  1 342 ? 97.644  44.069  -78.571  1.00 36.81  ? 448 ILE A C     1 
ATOM   2659  O  O     . ILE A  1 342 ? 96.488  44.281  -78.993  1.00 39.01  ? 448 ILE A O     1 
ATOM   2660  C  CB    . ILE A  1 342 ? 97.887  42.887  -76.341  1.00 34.28  ? 448 ILE A CB    1 
ATOM   2661  C  CG1   . ILE A  1 342 ? 97.898  41.508  -75.683  1.00 33.20  ? 448 ILE A CG1   1 
ATOM   2662  C  CG2   . ILE A  1 342 ? 96.617  43.606  -75.933  1.00 34.88  ? 448 ILE A CG2   1 
ATOM   2663  C  CD1   . ILE A  1 342 ? 98.042  41.512  -74.165  1.00 32.42  ? 448 ILE A CD1   1 
ATOM   2664  N  N     . GLU A  1 343 ? 98.622  44.971  -78.665  1.00 37.54  ? 449 GLU A N     1 
ATOM   2665  C  CA    . GLU A  1 343 ? 98.411  46.248  -79.348  1.00 38.81  ? 449 GLU A CA    1 
ATOM   2666  C  C     . GLU A  1 343 ? 97.963  46.020  -80.787  1.00 35.73  ? 449 GLU A C     1 
ATOM   2667  O  O     . GLU A  1 343 ? 96.951  46.569  -81.222  1.00 33.81  ? 449 GLU A O     1 
ATOM   2668  C  CB    . GLU A  1 343 ? 99.668  47.128  -79.301  1.00 43.54  ? 449 GLU A CB    1 
ATOM   2669  C  CG    . GLU A  1 343 ? 99.880  47.859  -77.996  1.00 48.66  ? 449 GLU A CG    1 
ATOM   2670  C  CD    . GLU A  1 343 ? 100.848 49.051  -78.181  1.00 53.69  ? 449 GLU A CD    1 
ATOM   2671  O  OE1   . GLU A  1 343 ? 101.969 48.831  -78.758  1.00 56.34  ? 449 GLU A OE1   1 
ATOM   2672  O  OE2   . GLU A  1 343 ? 100.533 50.205  -77.706  1.00 56.91  ? 449 GLU A OE2   1 
ATOM   2673  N  N     . TYR A  1 344 ? 98.704  45.165  -81.489  1.00 35.13  ? 450 TYR A N     1 
ATOM   2674  C  CA    . TYR A  1 344 ? 98.455  44.831  -82.902  1.00 35.04  ? 450 TYR A CA    1 
ATOM   2675  C  C     . TYR A  1 344 ? 97.234  43.936  -83.101  1.00 34.22  ? 450 TYR A C     1 
ATOM   2676  O  O     . TYR A  1 344 ? 96.758  43.786  -84.215  1.00 33.44  ? 450 TYR A O     1 
ATOM   2677  C  CB    . TYR A  1 344 ? 99.702  44.164  -83.547  1.00 35.44  ? 450 TYR A CB    1 
ATOM   2678  C  CG    . TYR A  1 344 ? 100.845 45.136  -83.809  1.00 36.02  ? 450 TYR A CG    1 
ATOM   2679  C  CD1   . TYR A  1 344 ? 100.738 46.059  -84.848  1.00 37.00  ? 450 TYR A CD1   1 
ATOM   2680  C  CD2   . TYR A  1 344 ? 102.010 45.159  -83.020  1.00 36.63  ? 450 TYR A CD2   1 
ATOM   2681  C  CE1   . TYR A  1 344 ? 101.752 46.964  -85.111  1.00 37.73  ? 450 TYR A CE1   1 
ATOM   2682  C  CE2   . TYR A  1 344 ? 102.999 46.081  -83.234  1.00 37.92  ? 450 TYR A CE2   1 
ATOM   2683  C  CZ    . TYR A  1 344 ? 102.874 46.973  -84.305  1.00 38.70  ? 450 TYR A CZ    1 
ATOM   2684  O  OH    . TYR A  1 344 ? 103.864 47.880  -84.581  1.00 41.30  ? 450 TYR A OH    1 
ATOM   2685  N  N     . ARG A  1 345 ? 96.763  43.325  -82.016  1.00 33.57  ? 451 ARG A N     1 
ATOM   2686  C  CA    . ARG A  1 345 ? 95.577  42.483  -81.999  1.00 33.51  ? 451 ARG A CA    1 
ATOM   2687  C  C     . ARG A  1 345 ? 95.834  41.106  -82.605  1.00 32.81  ? 451 ARG A C     1 
ATOM   2688  O  O     . ARG A  1 345 ? 94.926  40.521  -83.187  1.00 32.41  ? 451 ARG A O     1 
ATOM   2689  C  CB    . ARG A  1 345 ? 94.356  43.172  -82.645  1.00 34.67  ? 451 ARG A CB    1 
ATOM   2690  C  CG    . ARG A  1 345 ? 92.983  42.733  -82.109  1.00 35.59  ? 451 ARG A CG    1 
ATOM   2691  C  CD    . ARG A  1 345 ? 92.661  43.404  -80.791  1.00 36.89  ? 451 ARG A CD    1 
ATOM   2692  N  NE    . ARG A  1 345 ? 91.363  43.049  -80.189  1.00 35.44  ? 451 ARG A NE    1 
ATOM   2693  C  CZ    . ARG A  1 345 ? 90.943  43.529  -79.007  1.00 34.37  ? 451 ARG A CZ    1 
ATOM   2694  N  NH1   . ARG A  1 345 ? 91.709  44.388  -78.300  1.00 35.28  ? 451 ARG A NH1   1 
ATOM   2695  N  NH2   . ARG A  1 345 ? 89.772  43.164  -78.527  1.00 33.11  ? 451 ARG A NH2   1 
ATOM   2696  N  N     . ASN A  1 346 ? 97.059  40.587  -82.445  1.00 33.62  ? 452 ASN A N     1 
ATOM   2697  C  CA    . ASN A  1 346 ? 97.403  39.197  -82.782  1.00 35.38  ? 452 ASN A CA    1 
ATOM   2698  C  C     . ASN A  1 346 ? 97.252  38.416  -81.508  1.00 33.39  ? 452 ASN A C     1 
ATOM   2699  O  O     . ASN A  1 346 ? 98.223  38.067  -80.845  1.00 35.06  ? 452 ASN A O     1 
ATOM   2700  C  CB    . ASN A  1 346 ? 98.833  39.077  -83.311  1.00 38.25  ? 452 ASN A CB    1 
ATOM   2701  C  CG    . ASN A  1 346 ? 99.041  39.867  -84.591  1.00 42.99  ? 452 ASN A CG    1 
ATOM   2702  O  OD1   . ASN A  1 346 ? 98.191  39.874  -85.497  1.00 47.72  ? 452 ASN A OD1   1 
ATOM   2703  N  ND2   . ASN A  1 346 ? 100.176 40.550  -84.686  1.00 46.80  ? 452 ASN A ND2   1 
ATOM   2704  N  N     . LEU A  1 347 ? 96.003  38.172  -81.155  1.00 30.89  ? 453 LEU A N     1 
ATOM   2705  C  CA    . LEU A  1 347 ? 95.683  37.451  -79.948  1.00 30.27  ? 453 LEU A CA    1 
ATOM   2706  C  C     . LEU A  1 347 ? 95.643  35.983  -80.283  1.00 30.72  ? 453 LEU A C     1 
ATOM   2707  O  O     . LEU A  1 347 ? 95.463  35.607  -81.457  1.00 32.04  ? 453 LEU A O     1 
ATOM   2708  C  CB    . LEU A  1 347 ? 94.328  37.897  -79.394  1.00 29.23  ? 453 LEU A CB    1 
ATOM   2709  C  CG    . LEU A  1 347 ? 94.088  39.412  -79.298  1.00 29.02  ? 453 LEU A CG    1 
ATOM   2710  C  CD1   . LEU A  1 347 ? 92.756  39.713  -78.635  1.00 29.14  ? 453 LEU A CD1   1 
ATOM   2711  C  CD2   . LEU A  1 347 ? 95.223  40.128  -78.583  1.00 29.12  ? 453 LEU A CD2   1 
ATOM   2712  N  N     . PHE A  1 348 ? 95.805  35.157  -79.257  1.00 30.48  ? 454 PHE A N     1 
ATOM   2713  C  CA    . PHE A  1 348 ? 95.624  33.726  -79.414  1.00 30.97  ? 454 PHE A CA    1 
ATOM   2714  C  C     . PHE A  1 348 ? 94.192  33.467  -79.887  1.00 32.66  ? 454 PHE A C     1 
ATOM   2715  O  O     . PHE A  1 348 ? 93.258  34.115  -79.423  1.00 33.90  ? 454 PHE A O     1 
ATOM   2716  C  CB    . PHE A  1 348 ? 95.888  32.978  -78.097  1.00 30.07  ? 454 PHE A CB    1 
ATOM   2717  C  CG    . PHE A  1 348 ? 97.238  33.261  -77.447  1.00 29.62  ? 454 PHE A CG    1 
ATOM   2718  C  CD1   . PHE A  1 348 ? 98.379  33.514  -78.202  1.00 30.05  ? 454 PHE A CD1   1 
ATOM   2719  C  CD2   . PHE A  1 348 ? 97.372  33.215  -76.068  1.00 29.20  ? 454 PHE A CD2   1 
ATOM   2720  C  CE1   . PHE A  1 348 ? 99.606  33.744  -77.585  1.00 30.30  ? 454 PHE A CE1   1 
ATOM   2721  C  CE2   . PHE A  1 348 ? 98.595  33.440  -75.443  1.00 29.35  ? 454 PHE A CE2   1 
ATOM   2722  C  CZ    . PHE A  1 348 ? 99.717  33.712  -76.205  1.00 29.85  ? 454 PHE A CZ    1 
ATOM   2723  N  N     . LYS A  1 349 ? 94.010  32.549  -80.823  1.00 34.80  ? 455 LYS A N     1 
ATOM   2724  C  CA    . LYS A  1 349 ? 92.697  32.373  -81.446  1.00 37.07  ? 455 LYS A CA    1 
ATOM   2725  C  C     . LYS A  1 349 ? 91.787  31.456  -80.643  1.00 35.30  ? 455 LYS A C     1 
ATOM   2726  O  O     . LYS A  1 349 ? 92.209  30.398  -80.191  1.00 34.87  ? 455 LYS A O     1 
ATOM   2727  C  CB    . LYS A  1 349 ? 92.829  31.841  -82.866  1.00 40.43  ? 455 LYS A CB    1 
ATOM   2728  C  CG    . LYS A  1 349 ? 93.462  32.835  -83.832  1.00 44.15  ? 455 LYS A CG    1 
ATOM   2729  C  CD    . LYS A  1 349 ? 92.473  33.959  -84.239  1.00 46.83  ? 455 LYS A CD    1 
ATOM   2730  C  CE    . LYS A  1 349 ? 93.220  35.276  -84.518  1.00 50.67  ? 455 LYS A CE    1 
ATOM   2731  N  NZ    . LYS A  1 349 ? 92.866  36.025  -85.751  1.00 54.10  ? 455 LYS A NZ    1 
ATOM   2732  N  N     . TYR A  1 350 ? 90.538  31.870  -80.492  1.00 32.78  ? 456 TYR A N     1 
ATOM   2733  C  CA    . TYR A  1 350 ? 89.532  31.090  -79.798  1.00 32.99  ? 456 TYR A CA    1 
ATOM   2734  C  C     . TYR A  1 350 ? 89.091  29.958  -80.698  1.00 32.87  ? 456 TYR A C     1 
ATOM   2735  O  O     . TYR A  1 350 ? 88.752  30.184  -81.846  1.00 33.05  ? 456 TYR A O     1 
ATOM   2736  C  CB    . TYR A  1 350 ? 88.346  32.002  -79.450  1.00 33.70  ? 456 TYR A CB    1 
ATOM   2737  C  CG    . TYR A  1 350 ? 87.098  31.334  -78.900  1.00 33.88  ? 456 TYR A CG    1 
ATOM   2738  C  CD1   . TYR A  1 350 ? 87.044  30.832  -77.610  1.00 34.51  ? 456 TYR A CD1   1 
ATOM   2739  C  CD2   . TYR A  1 350 ? 85.944  31.277  -79.656  1.00 34.62  ? 456 TYR A CD2   1 
ATOM   2740  C  CE1   . TYR A  1 350 ? 85.887  30.260  -77.100  1.00 35.08  ? 456 TYR A CE1   1 
ATOM   2741  C  CE2   . TYR A  1 350 ? 84.771  30.707  -79.158  1.00 34.97  ? 456 TYR A CE2   1 
ATOM   2742  C  CZ    . TYR A  1 350 ? 84.751  30.201  -77.885  1.00 35.21  ? 456 TYR A CZ    1 
ATOM   2743  O  OH    . TYR A  1 350 ? 83.583  29.641  -77.423  1.00 35.61  ? 456 TYR A OH    1 
ATOM   2744  N  N     . VAL A  1 351 ? 89.108  28.743  -80.179  1.00 32.93  ? 457 VAL A N     1 
ATOM   2745  C  CA    . VAL A  1 351 ? 88.716  27.562  -80.946  1.00 32.97  ? 457 VAL A CA    1 
ATOM   2746  C  C     . VAL A  1 351 ? 87.254  27.207  -80.675  1.00 33.44  ? 457 VAL A C     1 
ATOM   2747  O  O     . VAL A  1 351 ? 86.482  26.956  -81.614  1.00 35.35  ? 457 VAL A O     1 
ATOM   2748  C  CB    . VAL A  1 351 ? 89.620  26.373  -80.605  1.00 32.75  ? 457 VAL A CB    1 
ATOM   2749  C  CG1   . VAL A  1 351 ? 89.199  25.138  -81.384  1.00 32.66  ? 457 VAL A CG1   1 
ATOM   2750  C  CG2   . VAL A  1 351 ? 91.077  26.720  -80.933  1.00 33.53  ? 457 VAL A CG2   1 
ATOM   2751  N  N     . GLY A  1 352 ? 86.880  27.179  -79.399  1.00 32.72  ? 458 GLY A N     1 
ATOM   2752  C  CA    . GLY A  1 352 ? 85.507  26.891  -78.996  1.00 32.57  ? 458 GLY A CA    1 
ATOM   2753  C  C     . GLY A  1 352 ? 85.329  26.684  -77.501  1.00 32.17  ? 458 GLY A C     1 
ATOM   2754  O  O     . GLY A  1 352 ? 86.282  26.704  -76.736  1.00 31.12  ? 458 GLY A O     1 
ATOM   2755  N  N     . GLU A  1 353 ? 84.084  26.472  -77.106  1.00 32.88  ? 459 GLU A N     1 
ATOM   2756  C  CA    . GLU A  1 353 ? 83.693  26.309  -75.714  1.00 33.40  ? 459 GLU A CA    1 
ATOM   2757  C  C     . GLU A  1 353 ? 82.997  24.972  -75.583  1.00 32.22  ? 459 GLU A C     1 
ATOM   2758  O  O     . GLU A  1 353 ? 82.357  24.514  -76.506  1.00 32.70  ? 459 GLU A O     1 
ATOM   2759  C  CB    . GLU A  1 353 ? 82.757  27.462  -75.299  1.00 35.24  ? 459 GLU A CB    1 
ATOM   2760  C  CG    . GLU A  1 353 ? 82.189  27.409  -73.882  1.00 37.40  ? 459 GLU A CG    1 
ATOM   2761  C  CD    . GLU A  1 353 ? 81.384  28.642  -73.501  1.00 38.93  ? 459 GLU A CD    1 
ATOM   2762  O  OE1   . GLU A  1 353 ? 80.437  28.980  -74.218  1.00 41.80  ? 459 GLU A OE1   1 
ATOM   2763  O  OE2   . GLU A  1 353 ? 81.682  29.290  -72.478  1.00 40.20  ? 459 GLU A OE2   1 
ATOM   2764  N  N     . THR A  1 354 ? 83.131  24.352  -74.423  1.00 31.88  ? 460 THR A N     1 
ATOM   2765  C  CA    . THR A  1 354 ? 82.407  23.115  -74.107  1.00 32.61  ? 460 THR A CA    1 
ATOM   2766  C  C     . THR A  1 354 ? 82.199  22.963  -72.605  1.00 33.49  ? 460 THR A C     1 
ATOM   2767  O  O     . THR A  1 354 ? 82.854  23.624  -71.806  1.00 34.85  ? 460 THR A O     1 
ATOM   2768  C  CB    . THR A  1 354 ? 83.102  21.881  -74.696  1.00 32.16  ? 460 THR A CB    1 
ATOM   2769  O  OG1   . THR A  1 354 ? 82.241  20.741  -74.595  1.00 32.56  ? 460 THR A OG1   1 
ATOM   2770  C  CG2   . THR A  1 354 ? 84.421  21.604  -74.013  1.00 32.38  ? 460 THR A CG2   1 
ATOM   2771  N  N     . GLN A  1 355 ? 81.296  22.064  -72.253  1.00 34.62  ? 461 GLN A N     1 
ATOM   2772  C  CA    . GLN A  1 355 ? 80.949  21.775  -70.865  1.00 37.00  ? 461 GLN A CA    1 
ATOM   2773  C  C     . GLN A  1 355 ? 81.053  20.278  -70.570  1.00 39.29  ? 461 GLN A C     1 
ATOM   2774  O  O     . GLN A  1 355 ? 80.813  19.470  -71.462  1.00 41.80  ? 461 GLN A O     1 
ATOM   2775  C  CB    . GLN A  1 355 ? 79.510  22.178  -70.610  1.00 38.09  ? 461 GLN A CB    1 
ATOM   2776  C  CG    . GLN A  1 355 ? 79.260  23.653  -70.483  1.00 39.30  ? 461 GLN A CG    1 
ATOM   2777  C  CD    . GLN A  1 355 ? 77.810  23.899  -70.136  1.00 41.59  ? 461 GLN A CD    1 
ATOM   2778  O  OE1   . GLN A  1 355 ? 76.988  24.083  -71.034  1.00 44.69  ? 461 GLN A OE1   1 
ATOM   2779  N  NE2   . GLN A  1 355 ? 77.490  23.857  -68.844  1.00 42.23  ? 461 GLN A NE2   1 
ATOM   2780  N  N     . PRO A  1 356 ? 81.367  19.899  -69.323  1.00 40.32  ? 462 PRO A N     1 
ATOM   2781  C  CA    . PRO A  1 356 ? 81.199  18.503  -68.936  1.00 41.66  ? 462 PRO A CA    1 
ATOM   2782  C  C     . PRO A  1 356 ? 79.737  18.069  -68.898  1.00 44.51  ? 462 PRO A C     1 
ATOM   2783  O  O     . PRO A  1 356 ? 78.847  18.921  -68.897  1.00 46.98  ? 462 PRO A O     1 
ATOM   2784  C  CB    . PRO A  1 356 ? 81.813  18.456  -67.534  1.00 41.65  ? 462 PRO A CB    1 
ATOM   2785  C  CG    . PRO A  1 356 ? 82.784  19.576  -67.502  1.00 41.08  ? 462 PRO A CG    1 
ATOM   2786  C  CD    . PRO A  1 356 ? 82.152  20.639  -68.328  1.00 40.27  ? 462 PRO A CD    1 
ATOM   2787  N  N     . THR A  1 357 ? 79.503  16.759  -68.882  1.00 47.92  ? 463 THR A N     1 
ATOM   2788  C  CA    . THR A  1 357 ? 78.153  16.200  -68.705  1.00 50.59  ? 463 THR A CA    1 
ATOM   2789  C  C     . THR A  1 357 ? 78.074  15.309  -67.473  1.00 53.36  ? 463 THR A C     1 
ATOM   2790  O  O     . THR A  1 357 ? 79.099  14.981  -66.860  1.00 52.69  ? 463 THR A O     1 
ATOM   2791  C  CB    . THR A  1 357 ? 77.713  15.381  -69.926  1.00 51.03  ? 463 THR A CB    1 
ATOM   2792  O  OG1   . THR A  1 357 ? 78.765  14.481  -70.279  1.00 49.94  ? 463 THR A OG1   1 
ATOM   2793  C  CG2   . THR A  1 357 ? 77.384  16.299  -71.095  1.00 50.65  ? 463 THR A CG2   1 
ATOM   2794  N  N     . GLY A  1 358 ? 76.849  14.922  -67.141  1.00 58.65  ? 464 GLY A N     1 
ATOM   2795  C  CA    . GLY A  1 358 ? 76.581  14.007  -66.056  1.00 62.57  ? 464 GLY A CA    1 
ATOM   2796  C  C     . GLY A  1 358 ? 76.847  14.896  -64.868  1.00 64.81  ? 464 GLY A C     1 
ATOM   2797  O  O     . GLY A  1 358 ? 76.363  16.040  -64.813  1.00 71.00  ? 464 GLY A O     1 
ATOM   2798  N  N     . GLN A  1 359 ? 77.654  14.382  -63.947  1.00 65.31  ? 465 GLN A N     1 
ATOM   2799  C  CA    . GLN A  1 359 ? 78.135  15.132  -62.823  1.00 66.56  ? 465 GLN A CA    1 
ATOM   2800  C  C     . GLN A  1 359 ? 79.653  14.864  -62.793  1.00 66.27  ? 465 GLN A C     1 
ATOM   2801  O  O     . GLN A  1 359 ? 80.150  14.338  -61.837  1.00 68.32  ? 465 GLN A O     1 
ATOM   2802  C  CB    . GLN A  1 359 ? 77.386  14.553  -61.616  1.00 64.71  ? 465 GLN A CB    1 
ATOM   2803  N  N     . ILE A  1 360 ? 80.365  15.245  -63.856  1.00 65.75  ? 466 ILE A N     1 
ATOM   2804  C  CA    . ILE A  1 360 ? 81.835  15.153  -63.933  1.00 66.44  ? 466 ILE A CA    1 
ATOM   2805  C  C     . ILE A  1 360 ? 82.404  16.552  -63.649  1.00 63.81  ? 466 ILE A C     1 
ATOM   2806  O  O     . ILE A  1 360 ? 82.461  17.387  -64.536  1.00 67.18  ? 466 ILE A O     1 
ATOM   2807  C  CB    . ILE A  1 360 ? 82.320  14.699  -65.350  1.00 69.90  ? 466 ILE A CB    1 
ATOM   2808  C  CG1   . ILE A  1 360 ? 81.665  13.384  -65.810  1.00 74.54  ? 466 ILE A CG1   1 
ATOM   2809  C  CG2   . ILE A  1 360 ? 83.857  14.597  -65.396  1.00 68.07  ? 466 ILE A CG2   1 
ATOM   2810  C  CD1   . ILE A  1 360 ? 81.762  13.182  -67.339  1.00 75.02  ? 466 ILE A CD1   1 
ATOM   2811  N  N     . LYS A  1 361 ? 82.870  16.807  -62.414  1.00 59.02  ? 467 LYS A N     1 
ATOM   2812  C  CA    . LYS A  1 361 ? 83.603  18.066  -62.115  1.00 54.22  ? 467 LYS A CA    1 
ATOM   2813  C  C     . LYS A  1 361 ? 85.059  17.875  -62.541  1.00 51.79  ? 467 LYS A C     1 
ATOM   2814  O  O     . LYS A  1 361 ? 85.635  16.814  -62.337  1.00 50.67  ? 467 LYS A O     1 
ATOM   2815  C  CB    . LYS A  1 361 ? 83.530  18.409  -60.625  1.00 52.17  ? 467 LYS A CB    1 
ATOM   2816  N  N     . ILE A  1 362 ? 85.647  18.875  -63.177  1.00 51.11  ? 468 ILE A N     1 
ATOM   2817  C  CA    . ILE A  1 362 ? 87.089  18.889  -63.448  1.00 52.73  ? 468 ILE A CA    1 
ATOM   2818  C  C     . ILE A  1 362 ? 87.826  19.520  -62.285  1.00 52.96  ? 468 ILE A C     1 
ATOM   2819  O  O     . ILE A  1 362 ? 87.667  20.718  -62.042  1.00 51.24  ? 468 ILE A O     1 
ATOM   2820  C  CB    . ILE A  1 362 ? 87.392  19.668  -64.757  1.00 52.88  ? 468 ILE A CB    1 
ATOM   2821  C  CG1   . ILE A  1 362 ? 86.752  18.920  -65.931  1.00 52.03  ? 468 ILE A CG1   1 
ATOM   2822  C  CG2   . ILE A  1 362 ? 88.894  19.856  -64.950  1.00 52.83  ? 468 ILE A CG2   1 
ATOM   2823  C  CD1   . ILE A  1 362 ? 86.943  19.581  -67.252  1.00 53.64  ? 468 ILE A CD1   1 
ATOM   2824  N  N     . LYS A  1 363 ? 88.650  18.737  -61.584  1.00 55.54  ? 469 LYS A N     1 
ATOM   2825  C  CA    . LYS A  1 363 ? 89.393  19.214  -60.396  1.00 57.54  ? 469 LYS A CA    1 
ATOM   2826  C  C     . LYS A  1 363 ? 90.496  20.207  -60.813  1.00 57.57  ? 469 LYS A C     1 
ATOM   2827  O  O     . LYS A  1 363 ? 91.024  20.111  -61.910  1.00 55.91  ? 469 LYS A O     1 
ATOM   2828  C  CB    . LYS A  1 363 ? 89.950  18.023  -59.599  1.00 56.88  ? 469 LYS A CB    1 
ATOM   2829  N  N     . ARG A  1 364 ? 90.810  21.162  -59.942  1.00 61.22  ? 470 ARG A N     1 
ATOM   2830  C  CA    . ARG A  1 364 ? 91.801  22.224  -60.228  1.00 65.63  ? 470 ARG A CA    1 
ATOM   2831  C  C     . ARG A  1 364 ? 93.221  21.666  -60.497  1.00 65.88  ? 470 ARG A C     1 
ATOM   2832  O  O     . ARG A  1 364 ? 93.953  22.173  -61.346  1.00 64.27  ? 470 ARG A O     1 
ATOM   2833  C  CB    . ARG A  1 364 ? 91.851  23.238  -59.086  1.00 69.73  ? 470 ARG A CB    1 
ATOM   2834  C  CG    . ARG A  1 364 ? 92.829  24.393  -59.351  1.00 73.95  ? 470 ARG A CG    1 
ATOM   2835  C  CD    . ARG A  1 364 ? 92.892  25.427  -58.270  1.00 79.70  ? 470 ARG A CD    1 
ATOM   2836  N  NE    . ARG A  1 364 ? 91.558  25.971  -57.999  1.00 85.18  ? 470 ARG A NE    1 
ATOM   2837  C  CZ    . ARG A  1 364 ? 90.916  26.873  -58.742  1.00 85.45  ? 470 ARG A CZ    1 
ATOM   2838  N  NH1   . ARG A  1 364 ? 91.459  27.348  -59.872  1.00 88.01  ? 470 ARG A NH1   1 
ATOM   2839  N  NH2   . ARG A  1 364 ? 89.699  27.268  -58.358  1.00 82.75  ? 470 ARG A NH2   1 
ATOM   2840  N  N     . GLU A  1 365 ? 93.604  20.666  -59.716  1.00 66.65  ? 471 GLU A N     1 
ATOM   2841  C  CA    . GLU A  1 365 ? 94.793  19.825  -59.946  1.00 65.40  ? 471 GLU A CA    1 
ATOM   2842  C  C     . GLU A  1 365 ? 95.031  19.396  -61.417  1.00 61.35  ? 471 GLU A C     1 
ATOM   2843  O  O     . GLU A  1 365 ? 96.168  19.362  -61.874  1.00 59.88  ? 471 GLU A O     1 
ATOM   2844  C  CB    . GLU A  1 365 ? 94.723  18.582  -59.038  1.00 71.25  ? 471 GLU A CB    1 
ATOM   2845  C  CG    . GLU A  1 365 ? 93.431  17.783  -59.209  1.00 76.61  ? 471 GLU A CG    1 
ATOM   2846  C  CD    . GLU A  1 365 ? 93.251  16.612  -58.276  1.00 79.06  ? 471 GLU A CD    1 
ATOM   2847  O  OE1   . GLU A  1 365 ? 94.127  16.287  -57.441  1.00 80.78  ? 471 GLU A OE1   1 
ATOM   2848  O  OE2   . GLU A  1 365 ? 92.186  15.999  -58.403  1.00 83.85  ? 471 GLU A OE2   1 
ATOM   2849  N  N     . ASP A  1 366 ? 93.958  19.087  -62.142  1.00 59.57  ? 472 ASP A N     1 
ATOM   2850  C  CA    . ASP A  1 366 ? 94.030  18.612  -63.543  1.00 61.53  ? 472 ASP A CA    1 
ATOM   2851  C  C     . ASP A  1 366 ? 94.150  19.692  -64.634  1.00 60.77  ? 472 ASP A C     1 
ATOM   2852  O  O     . ASP A  1 366 ? 94.362  19.359  -65.793  1.00 60.55  ? 472 ASP A O     1 
ATOM   2853  C  CB    . ASP A  1 366 ? 92.791  17.761  -63.874  1.00 62.81  ? 472 ASP A CB    1 
ATOM   2854  C  CG    . ASP A  1 366 ? 92.603  16.587  -62.944  1.00 64.17  ? 472 ASP A CG    1 
ATOM   2855  O  OD1   . ASP A  1 366 ? 93.598  16.082  -62.386  1.00 66.20  ? 472 ASP A OD1   1 
ATOM   2856  O  OD2   . ASP A  1 366 ? 91.441  16.164  -62.793  1.00 64.99  ? 472 ASP A OD2   1 
ATOM   2857  N  N     . TYR A  1 367 ? 94.004  20.965  -64.281  1.00 56.57  ? 473 TYR A N     1 
ATOM   2858  C  CA    . TYR A  1 367 ? 94.044  22.076  -65.265  1.00 53.71  ? 473 TYR A CA    1 
ATOM   2859  C  C     . TYR A  1 367 ? 95.348  22.076  -66.063  1.00 53.35  ? 473 TYR A C     1 
ATOM   2860  O  O     . TYR A  1 367 ? 95.301  22.235  -67.278  1.00 51.41  ? 473 TYR A O     1 
ATOM   2861  C  CB    . TYR A  1 367 ? 93.855  23.459  -64.582  1.00 51.51  ? 473 TYR A CB    1 
ATOM   2862  C  CG    . TYR A  1 367 ? 92.471  23.805  -64.019  1.00 48.62  ? 473 TYR A CG    1 
ATOM   2863  C  CD1   . TYR A  1 367 ? 91.415  22.866  -63.998  1.00 47.92  ? 473 TYR A CD1   1 
ATOM   2864  C  CD2   . TYR A  1 367 ? 92.227  25.070  -63.457  1.00 46.04  ? 473 TYR A CD2   1 
ATOM   2865  C  CE1   . TYR A  1 367 ? 90.167  23.197  -63.459  1.00 45.77  ? 473 TYR A CE1   1 
ATOM   2866  C  CE2   . TYR A  1 367 ? 90.972  25.397  -62.920  1.00 44.05  ? 473 TYR A CE2   1 
ATOM   2867  C  CZ    . TYR A  1 367 ? 89.959  24.453  -62.925  1.00 43.77  ? 473 TYR A CZ    1 
ATOM   2868  O  OH    . TYR A  1 367 ? 88.737  24.762  -62.398  1.00 41.88  ? 473 TYR A OH    1 
ATOM   2869  N  N     . GLU A  1 368 ? 96.488  21.877  -65.387  1.00 52.23  ? 474 GLU A N     1 
ATOM   2870  C  CA    . GLU A  1 368 ? 97.813  21.832  -66.048  1.00 50.85  ? 474 GLU A CA    1 
ATOM   2871  C  C     . GLU A  1 368 ? 97.852  20.800  -67.178  1.00 51.03  ? 474 GLU A C     1 
ATOM   2872  O  O     . GLU A  1 368 ? 98.453  21.060  -68.224  1.00 50.22  ? 474 GLU A O     1 
ATOM   2873  C  CB    . GLU A  1 368 ? 98.946  21.568  -65.034  1.00 49.06  ? 474 GLU A CB    1 
ATOM   2874  N  N     . SER A  1 369 ? 97.174  19.673  -66.981  1.00 51.96  ? 475 SER A N     1 
ATOM   2875  C  CA    . SER A  1 369 ? 97.200  18.540  -67.929  1.00 55.23  ? 475 SER A CA    1 
ATOM   2876  C  C     . SER A  1 369 ? 96.339  18.627  -69.189  1.00 54.50  ? 475 SER A C     1 
ATOM   2877  O  O     . SER A  1 369 ? 96.512  17.829  -70.079  1.00 57.39  ? 475 SER A O     1 
ATOM   2878  C  CB    . SER A  1 369 ? 96.823  17.232  -67.190  1.00 55.32  ? 475 SER A CB    1 
ATOM   2879  O  OG    . SER A  1 369 ? 97.919  16.652  -66.443  1.00 53.81  ? 475 SER A OG    1 
ATOM   2880  N  N     . LEU A  1 370 ? 95.412  19.560  -69.236  1.00 52.69  ? 476 LEU A N     1 
ATOM   2881  C  CA    . LEU A  1 370 ? 94.386  19.595  -70.307  1.00 52.32  ? 476 LEU A CA    1 
ATOM   2882  C  C     . LEU A  1 370 ? 94.899  19.961  -71.698  1.00 52.51  ? 476 LEU A C     1 
ATOM   2883  O  O     . LEU A  1 370 ? 94.412  19.401  -72.671  1.00 55.43  ? 476 LEU A O     1 
ATOM   2884  C  CB    . LEU A  1 370 ? 93.203  20.477  -69.922  1.00 52.15  ? 476 LEU A CB    1 
ATOM   2885  C  CG    . LEU A  1 370 ? 92.356  20.031  -68.739  1.00 54.44  ? 476 LEU A CG    1 
ATOM   2886  C  CD1   . LEU A  1 370 ? 91.216  21.002  -68.522  1.00 53.74  ? 476 LEU A CD1   1 
ATOM   2887  C  CD2   . LEU A  1 370 ? 91.698  18.656  -68.939  1.00 56.81  ? 476 LEU A CD2   1 
ATOM   2888  N  N     . PRO A  1 371 ? 95.868  20.885  -71.810  1.00 51.93  ? 477 PRO A N     1 
ATOM   2889  C  CA    . PRO A  1 371 ? 96.461  21.123  -73.144  1.00 53.14  ? 477 PRO A CA    1 
ATOM   2890  C  C     . PRO A  1 371 ? 97.097  19.867  -73.766  1.00 52.10  ? 477 PRO A C     1 
ATOM   2891  O  O     . PRO A  1 371 ? 96.980  19.649  -74.964  1.00 51.44  ? 477 PRO A O     1 
ATOM   2892  C  CB    . PRO A  1 371 ? 97.534  22.176  -72.859  1.00 54.00  ? 477 PRO A CB    1 
ATOM   2893  C  CG    . PRO A  1 371 ? 96.957  22.954  -71.730  1.00 54.17  ? 477 PRO A CG    1 
ATOM   2894  C  CD    . PRO A  1 371 ? 96.277  21.920  -70.853  1.00 51.70  ? 477 PRO A CD    1 
ATOM   2895  N  N     . LYS A  1 372 ? 97.755  19.044  -72.921  1.00 53.29  ? 478 LYS A N     1 
ATOM   2896  C  CA    . LYS A  1 372 ? 98.294  17.750  -73.308  1.00 55.49  ? 478 LYS A CA    1 
ATOM   2897  C  C     . LYS A  1 372 ? 97.217  16.873  -73.897  1.00 51.53  ? 478 LYS A C     1 
ATOM   2898  O  O     . LYS A  1 372 ? 97.392  16.292  -74.948  1.00 53.29  ? 478 LYS A O     1 
ATOM   2899  C  CB    . LYS A  1 372 ? 98.991  17.074  -72.121  1.00 60.32  ? 478 LYS A CB    1 
ATOM   2900  C  CG    . LYS A  1 372 ? 100.051 18.021  -71.508  1.00 63.49  ? 478 LYS A CG    1 
ATOM   2901  C  CD    . LYS A  1 372 ? 99.656  18.961  -70.396  1.00 63.93  ? 478 LYS A CD    1 
ATOM   2902  C  CE    . LYS A  1 372 ? 100.767 19.951  -70.151  1.00 66.15  ? 478 LYS A CE    1 
ATOM   2903  N  NZ    . LYS A  1 372 ? 101.319 19.702  -68.797  1.00 69.72  ? 478 LYS A NZ    1 
ATOM   2904  N  N     . GLU A  1 373 ? 96.066  16.803  -73.230  1.00 48.53  ? 479 GLU A N     1 
ATOM   2905  C  CA    . GLU A  1 373 ? 94.954  15.962  -73.676  1.00 49.22  ? 479 GLU A CA    1 
ATOM   2906  C  C     . GLU A  1 373 ? 94.390  16.338  -75.035  1.00 47.76  ? 479 GLU A C     1 
ATOM   2907  O  O     . GLU A  1 373 ? 93.969  15.455  -75.782  1.00 49.60  ? 479 GLU A O     1 
ATOM   2908  C  CB    . GLU A  1 373 ? 93.832  15.970  -72.654  1.00 49.82  ? 479 GLU A CB    1 
ATOM   2909  C  CG    . GLU A  1 373 ? 94.169  15.317  -71.327  1.00 50.83  ? 479 GLU A CG    1 
ATOM   2910  C  CD    . GLU A  1 373 ? 92.972  15.193  -70.405  1.00 50.21  ? 479 GLU A CD    1 
ATOM   2911  O  OE1   . GLU A  1 373 ? 91.824  15.332  -70.879  1.00 49.18  ? 479 GLU A OE1   1 
ATOM   2912  O  OE2   . GLU A  1 373 ? 93.177  14.912  -69.216  1.00 52.65  ? 479 GLU A OE2   1 
ATOM   2913  N  N     . VAL A  1 374 ? 94.348  17.632  -75.340  1.00 45.14  ? 480 VAL A N     1 
ATOM   2914  C  CA    . VAL A  1 374 ? 93.783  18.124  -76.614  1.00 42.51  ? 480 VAL A CA    1 
ATOM   2915  C  C     . VAL A  1 374 ? 94.693  17.741  -77.780  1.00 41.52  ? 480 VAL A C     1 
ATOM   2916  O  O     . VAL A  1 374 ? 94.215  17.236  -78.788  1.00 40.25  ? 480 VAL A O     1 
ATOM   2917  C  CB    . VAL A  1 374 ? 93.537  19.656  -76.580  1.00 41.64  ? 480 VAL A CB    1 
ATOM   2918  C  CG1   . VAL A  1 374 ? 93.127  20.197  -77.938  1.00 41.59  ? 480 VAL A CG1   1 
ATOM   2919  C  CG2   . VAL A  1 374 ? 92.461  19.994  -75.576  1.00 41.29  ? 480 VAL A CG2   1 
ATOM   2920  N  N     . ALA A  1 375 ? 95.995  17.987  -77.628  1.00 41.85  ? 481 ALA A N     1 
ATOM   2921  C  CA    . ALA A  1 375 ? 96.999  17.577  -78.618  1.00 42.10  ? 481 ALA A CA    1 
ATOM   2922  C  C     . ALA A  1 375 ? 97.065  16.052  -78.782  1.00 44.04  ? 481 ALA A C     1 
ATOM   2923  O  O     . ALA A  1 375 ? 97.276  15.548  -79.889  1.00 45.53  ? 481 ALA A O     1 
ATOM   2924  C  CB    . ALA A  1 375 ? 98.362  18.129  -78.236  1.00 42.31  ? 481 ALA A CB    1 
ATOM   2925  N  N     . SER A  1 376 ? 96.843  15.324  -77.685  1.00 45.85  ? 482 SER A N     1 
ATOM   2926  C  CA    . SER A  1 376 ? 96.813  13.866  -77.685  1.00 49.25  ? 482 SER A CA    1 
ATOM   2927  C  C     . SER A  1 376 ? 95.632  13.224  -78.394  1.00 50.12  ? 482 SER A C     1 
ATOM   2928  O  O     . SER A  1 376 ? 95.672  12.024  -78.655  1.00 53.34  ? 482 SER A O     1 
ATOM   2929  C  CB    . SER A  1 376 ? 96.833  13.348  -76.253  1.00 53.19  ? 482 SER A CB    1 
ATOM   2930  O  OG    . SER A  1 376 ? 98.036  13.746  -75.621  1.00 58.49  ? 482 SER A OG    1 
ATOM   2931  N  N     . ALA A  1 377 ? 94.575  13.977  -78.680  1.00 50.56  ? 483 ALA A N     1 
ATOM   2932  C  CA    . ALA A  1 377 ? 93.438  13.438  -79.419  1.00 53.32  ? 483 ALA A CA    1 
ATOM   2933  C  C     . ALA A  1 377 ? 93.851  13.077  -80.824  1.00 56.35  ? 483 ALA A C     1 
ATOM   2934  O  O     . ALA A  1 377 ? 94.687  13.749  -81.432  1.00 50.67  ? 483 ALA A O     1 
ATOM   2935  C  CB    . ALA A  1 377 ? 92.289  14.424  -79.450  1.00 53.05  ? 483 ALA A CB    1 
ATOM   2936  N  N     . LYS A  1 378 ? 93.278  11.978  -81.328  1.00 66.34  ? 484 LYS A N     1 
ATOM   2937  C  CA    . LYS A  1 378 ? 93.621  11.448  -82.638  1.00 73.96  ? 484 LYS A CA    1 
ATOM   2938  C  C     . LYS A  1 378 ? 92.349  11.547  -83.471  1.00 76.82  ? 484 LYS A C     1 
ATOM   2939  O  O     . LYS A  1 378 ? 91.568  10.600  -83.520  1.00 77.86  ? 484 LYS A O     1 
ATOM   2940  C  CB    . LYS A  1 378 ? 94.065  9.983   -82.511  1.00 79.51  ? 484 LYS A CB    1 
ATOM   2941  C  CG    . LYS A  1 378 ? 95.112  9.654   -81.459  1.00 82.27  ? 484 LYS A CG    1 
ATOM   2942  C  CD    . LYS A  1 378 ? 96.477  10.277  -81.740  1.00 82.31  ? 484 LYS A CD    1 
ATOM   2943  C  CE    . LYS A  1 378 ? 97.498  9.718   -80.760  1.00 83.30  ? 484 LYS A CE    1 
ATOM   2944  N  NZ    . LYS A  1 378 ? 98.388  10.766  -80.170  1.00 83.96  ? 484 LYS A NZ    1 
ATOM   2945  N  N     . PRO A  1 379 ? 92.120  12.710  -84.123  1.00 80.86  ? 485 PRO A N     1 
ATOM   2946  C  CA    . PRO A  1 379 ? 90.924  12.869  -84.969  1.00 81.97  ? 485 PRO A CA    1 
ATOM   2947  C  C     . PRO A  1 379 ? 91.046  12.123  -86.284  1.00 86.21  ? 485 PRO A C     1 
ATOM   2948  O  O     . PRO A  1 379 ? 92.062  12.260  -86.937  1.00 98.54  ? 485 PRO A O     1 
ATOM   2949  C  CB    . PRO A  1 379 ? 90.873  14.389  -85.212  1.00 80.88  ? 485 PRO A CB    1 
ATOM   2950  C  CG    . PRO A  1 379 ? 92.256  14.819  -85.100  1.00 82.30  ? 485 PRO A CG    1 
ATOM   2951  C  CD    . PRO A  1 379 ? 92.889  13.967  -84.047  1.00 83.05  ? 485 PRO A CD    1 
ATOM   2952  N  N     . LYS A  1 380 ? 90.023  11.388  -86.685  1.00 85.84  ? 486 LYS A N     1 
ATOM   2953  C  CA    . LYS A  1 380 ? 90.079  10.576  -87.915  1.00 87.55  ? 486 LYS A CA    1 
ATOM   2954  C  C     . LYS A  1 380 ? 89.941  11.437  -89.173  1.00 92.68  ? 486 LYS A C     1 
ATOM   2955  O  O     . LYS A  1 380 ? 89.151  11.201  -90.000  1.00 99.01  ? 486 LYS A O     1 
ATOM   2956  C  CB    . LYS A  1 380 ? 89.049  9.437   -87.882  1.00 79.81  ? 486 LYS A CB    1 
ATOM   2957  N  N     . VAL A  1 381 ? 90.943  12.334  -89.359  1.00 97.12  ? 487 VAL A N     1 
ATOM   2958  C  CA    . VAL A  1 381 ? 91.162  13.160  -90.567  1.00 101.14 ? 487 VAL A CA    1 
ATOM   2959  C  C     . VAL A  1 381 ? 92.647  13.485  -90.420  1.00 103.42 ? 487 VAL A C     1 
ATOM   2960  O  O     . VAL A  1 381 ? 92.929  14.358  -89.708  1.00 116.98 ? 487 VAL A O     1 
ATOM   2961  C  CB    . VAL A  1 381 ? 90.464  14.545  -90.377  1.00 106.45 ? 487 VAL A CB    1 
ATOM   2962  C  CG1   . VAL A  1 381 ? 90.985  15.621  -91.375  1.00 101.01 ? 487 VAL A CG1   1 
ATOM   2963  C  CG2   . VAL A  1 381 ? 88.937  14.388  -90.320  1.00 110.35 ? 487 VAL A CG2   1 
ATOM   2964  N  N     . LEU A  1 382 ? 93.512  12.529  -90.725  1.00 99.27  ? 488 LEU A N     1 
ATOM   2965  C  CA    . LEU A  1 382 ? 94.935  12.524  -90.388  1.00 98.19  ? 488 LEU A CA    1 
ATOM   2966  C  C     . LEU A  1 382 ? 95.535  13.854  -90.944  1.00 100.30 ? 488 LEU A C     1 
ATOM   2967  O  O     . LEU A  1 382 ? 95.574  14.080  -92.184  1.00 107.75 ? 488 LEU A O     1 
ATOM   2968  C  CB    . LEU A  1 382 ? 95.692  11.380  -91.026  1.00 96.33  ? 488 LEU A CB    1 
ATOM   2969  C  CG    . LEU A  1 382 ? 95.578  9.948   -90.519  1.00 91.73  ? 488 LEU A CG    1 
ATOM   2970  C  CD1   . LEU A  1 382 ? 96.399  9.000   -91.398  1.00 92.60  ? 488 LEU A CD1   1 
ATOM   2971  C  CD2   . LEU A  1 382 ? 95.961  9.874   -89.056  1.00 86.21  ? 488 LEU A CD2   1 
ATOM   2972  N  N     . LEU A  1 383 ? 96.103  14.701  -90.069  1.00 94.66  ? 489 LEU A N     1 
ATOM   2973  C  CA    . LEU A  1 383 ? 96.179  16.105  -90.288  1.00 96.48  ? 489 LEU A CA    1 
ATOM   2974  C  C     . LEU A  1 383 ? 97.533  16.564  -90.847  1.00 97.02  ? 489 LEU A C     1 
ATOM   2975  O  O     . LEU A  1 383 ? 98.526  15.993  -90.517  1.00 87.80  ? 489 LEU A O     1 
ATOM   2976  C  CB    . LEU A  1 383 ? 96.001  16.795  -88.916  1.00 102.04 ? 489 LEU A CB    1 
ATOM   2977  C  CG    . LEU A  1 383 ? 94.508  16.721  -88.450  1.00 106.49 ? 489 LEU A CG    1 
ATOM   2978  C  CD1   . LEU A  1 383 ? 94.190  16.264  -86.995  1.00 112.24 ? 489 LEU A CD1   1 
ATOM   2979  C  CD2   . LEU A  1 383 ? 93.868  18.146  -88.476  1.00 106.33 ? 489 LEU A CD2   1 
ATOM   2980  N  N     . ASP A  1 384 ? 97.458  17.582  -91.701  1.00 102.24 ? 490 ASP A N     1 
ATOM   2981  C  CA    . ASP A  1 384 ? 98.583  18.047  -92.471  1.00 110.40 ? 490 ASP A CA    1 
ATOM   2982  C  C     . ASP A  1 384 ? 99.566  18.867  -91.645  1.00 106.54 ? 490 ASP A C     1 
ATOM   2983  O  O     . ASP A  1 384 ? 100.820 18.687  -91.910  1.00 120.08 ? 490 ASP A O     1 
ATOM   2984  C  CB    . ASP A  1 384 ? 98.119  19.053  -93.567  1.00 117.07 ? 490 ASP A CB    1 
ATOM   2985  C  CG    . ASP A  1 384 ? 99.329  19.568  -94.383  1.00 125.16 ? 490 ASP A CG    1 
ATOM   2986  O  OD1   . ASP A  1 384 ? 100.058 18.644  -94.817  1.00 131.69 ? 490 ASP A OD1   1 
ATOM   2987  O  OD2   . ASP A  1 384 ? 99.623  20.818  -94.552  1.00 126.29 ? 490 ASP A OD2   1 
ATOM   2988  N  N     . VAL A  1 385 ? 99.059  19.571  -90.560  1.00 94.74  ? 491 VAL A N     1 
ATOM   2989  C  CA    . VAL A  1 385 ? 99.995  20.018  -89.512  1.00 90.96  ? 491 VAL A CA    1 
ATOM   2990  C  C     . VAL A  1 385 ? 99.578  19.368  -88.137  1.00 82.17  ? 491 VAL A C     1 
ATOM   2991  O  O     . VAL A  1 385 ? 98.442  19.274  -87.809  1.00 80.85  ? 491 VAL A O     1 
ATOM   2992  C  CB    . VAL A  1 385 ? 100.010 21.488  -89.379  1.00 95.01  ? 491 VAL A CB    1 
ATOM   2993  C  CG1   . VAL A  1 385 ? 101.007 21.938  -88.232  1.00 96.84  ? 491 VAL A CG1   1 
ATOM   2994  C  CG2   . VAL A  1 385 ? 100.411 22.117  -90.733  1.00 96.36  ? 491 VAL A CG2   1 
ATOM   2995  N  N     . LYS A  1 386 ? 100.631 18.845  -87.437  1.00 74.57  ? 492 LYS A N     1 
ATOM   2996  C  CA    . LYS A  1 386 ? 100.517 18.364  -86.098  1.00 67.26  ? 492 LYS A CA    1 
ATOM   2997  C  C     . LYS A  1 386 ? 100.795 19.547  -85.151  1.00 61.79  ? 492 LYS A C     1 
ATOM   2998  O  O     . LYS A  1 386 ? 101.671 20.363  -85.416  1.00 62.12  ? 492 LYS A O     1 
ATOM   2999  C  CB    . LYS A  1 386 ? 101.495 17.215  -85.851  1.00 63.86  ? 492 LYS A CB    1 
ATOM   3000  N  N     . LEU A  1 387 ? 100.029 19.606  -84.039  1.00 56.14  ? 493 LEU A N     1 
ATOM   3001  C  CA    . LEU A  1 387 ? 100.204 20.646  -83.012  1.00 52.84  ? 493 LEU A CA    1 
ATOM   3002  C  C     . LEU A  1 387 ? 100.605 20.025  -81.674  1.00 51.85  ? 493 LEU A C     1 
ATOM   3003  O  O     . LEU A  1 387 ? 99.977  19.043  -81.231  1.00 53.85  ? 493 LEU A O     1 
ATOM   3004  C  CB    . LEU A  1 387 ? 98.892  21.404  -82.825  1.00 52.71  ? 493 LEU A CB    1 
ATOM   3005  C  CG    . LEU A  1 387 ? 98.372  22.301  -83.956  1.00 53.87  ? 493 LEU A CG    1 
ATOM   3006  C  CD1   . LEU A  1 387 ? 96.967  22.802  -83.686  1.00 54.27  ? 493 LEU A CD1   1 
ATOM   3007  C  CD2   . LEU A  1 387 ? 99.317  23.479  -84.222  1.00 54.96  ? 493 LEU A CD2   1 
ATOM   3008  N  N     . LYS A  1 388 ? 101.608 20.605  -81.015  1.00 49.83  ? 494 LYS A N     1 
ATOM   3009  C  CA    . LYS A  1 388 ? 102.087 20.151  -79.699  1.00 47.97  ? 494 LYS A CA    1 
ATOM   3010  C  C     . LYS A  1 388 ? 101.212 20.761  -78.592  1.00 47.89  ? 494 LYS A C     1 
ATOM   3011  O  O     . LYS A  1 388 ? 100.436 21.687  -78.843  1.00 48.41  ? 494 LYS A O     1 
ATOM   3012  C  CB    . LYS A  1 388 ? 103.582 20.483  -79.488  1.00 45.84  ? 494 LYS A CB    1 
ATOM   3013  N  N     . ALA A  1 389 ? 101.323 20.235  -77.377  1.00 47.94  ? 495 ALA A N     1 
ATOM   3014  C  CA    . ALA A  1 389 ? 100.482 20.673  -76.245  1.00 48.35  ? 495 ALA A CA    1 
ATOM   3015  C  C     . ALA A  1 389 ? 100.694 22.120  -75.796  1.00 47.80  ? 495 ALA A C     1 
ATOM   3016  O  O     . ALA A  1 389 ? 99.780  22.774  -75.340  1.00 49.01  ? 495 ALA A O     1 
ATOM   3017  C  CB    . ALA A  1 389 ? 100.684 19.733  -75.073  1.00 49.04  ? 495 ALA A CB    1 
ATOM   3018  N  N     . GLU A  1 390 ? 101.918 22.601  -75.900  1.00 49.84  ? 496 GLU A N     1 
ATOM   3019  C  CA    . GLU A  1 390 ? 102.260 24.006  -75.608  1.00 52.57  ? 496 GLU A CA    1 
ATOM   3020  C  C     . GLU A  1 390 ? 101.557 25.018  -76.536  1.00 49.95  ? 496 GLU A C     1 
ATOM   3021  O  O     . GLU A  1 390 ? 101.487 26.201  -76.211  1.00 48.83  ? 496 GLU A O     1 
ATOM   3022  C  CB    . GLU A  1 390 ? 103.771 24.195  -75.652  1.00 59.86  ? 496 GLU A CB    1 
ATOM   3023  C  CG    . GLU A  1 390 ? 104.382 24.002  -77.064  1.00 66.17  ? 496 GLU A CG    1 
ATOM   3024  C  CD    . GLU A  1 390 ? 105.883 24.234  -77.080  1.00 66.63  ? 496 GLU A CD    1 
ATOM   3025  O  OE1   . GLU A  1 390 ? 106.586 24.203  -76.026  1.00 66.03  ? 496 GLU A OE1   1 
ATOM   3026  O  OE2   . GLU A  1 390 ? 106.404 24.447  -78.206  1.00 68.99  ? 496 GLU A OE2   1 
ATOM   3027  N  N     . ASP A  1 391 ? 101.069 24.561  -77.691  1.00 48.12  ? 497 ASP A N     1 
ATOM   3028  C  CA    . ASP A  1 391 ? 100.303 25.405  -78.621  1.00 48.07  ? 497 ASP A CA    1 
ATOM   3029  C  C     . ASP A  1 391 ? 98.866  25.693  -78.152  1.00 46.98  ? 497 ASP A C     1 
ATOM   3030  O  O     . ASP A  1 391 ? 98.269  26.683  -78.574  1.00 49.70  ? 497 ASP A O     1 
ATOM   3031  C  CB    . ASP A  1 391 ? 100.250 24.765  -80.026  1.00 49.32  ? 497 ASP A CB    1 
ATOM   3032  C  CG    . ASP A  1 391 ? 101.624 24.532  -80.648  1.00 50.13  ? 497 ASP A CG    1 
ATOM   3033  O  OD1   . ASP A  1 391 ? 102.566 25.314  -80.370  1.00 49.22  ? 497 ASP A OD1   1 
ATOM   3034  O  OD2   . ASP A  1 391 ? 101.719 23.566  -81.448  1.00 54.65  ? 497 ASP A OD2   1 
ATOM   3035  N  N     . PHE A  1 392 ? 98.313  24.831  -77.306  1.00 43.83  ? 498 PHE A N     1 
ATOM   3036  C  CA    . PHE A  1 392 ? 96.959  24.999  -76.760  1.00 39.90  ? 498 PHE A CA    1 
ATOM   3037  C  C     . PHE A  1 392 ? 96.919  25.689  -75.395  1.00 37.97  ? 498 PHE A C     1 
ATOM   3038  O  O     . PHE A  1 392 ? 97.804  25.502  -74.562  1.00 39.05  ? 498 PHE A O     1 
ATOM   3039  C  CB    . PHE A  1 392 ? 96.268  23.642  -76.640  1.00 38.91  ? 498 PHE A CB    1 
ATOM   3040  C  CG    . PHE A  1 392 ? 95.920  23.038  -77.966  1.00 38.45  ? 498 PHE A CG    1 
ATOM   3041  C  CD1   . PHE A  1 392 ? 94.800  23.449  -78.647  1.00 37.67  ? 498 PHE A CD1   1 
ATOM   3042  C  CD2   . PHE A  1 392 ? 96.709  22.046  -78.520  1.00 39.03  ? 498 PHE A CD2   1 
ATOM   3043  C  CE1   . PHE A  1 392 ? 94.460  22.890  -79.868  1.00 38.61  ? 498 PHE A CE1   1 
ATOM   3044  C  CE2   . PHE A  1 392 ? 96.380  21.485  -79.732  1.00 39.55  ? 498 PHE A CE2   1 
ATOM   3045  C  CZ    . PHE A  1 392 ? 95.252  21.884  -80.413  1.00 39.26  ? 498 PHE A CZ    1 
ATOM   3046  N  N     . ILE A  1 393 ? 95.873  26.490  -75.187  1.00 35.92  ? 499 ILE A N     1 
ATOM   3047  C  CA    . ILE A  1 393 ? 95.480  27.008  -73.871  1.00 34.45  ? 499 ILE A CA    1 
ATOM   3048  C  C     . ILE A  1 393 ? 94.088  26.514  -73.582  1.00 33.55  ? 499 ILE A C     1 
ATOM   3049  O  O     . ILE A  1 393 ? 93.222  26.605  -74.430  1.00 32.18  ? 499 ILE A O     1 
ATOM   3050  C  CB    . ILE A  1 393 ? 95.451  28.532  -73.854  1.00 33.48  ? 499 ILE A CB    1 
ATOM   3051  C  CG1   . ILE A  1 393 ? 96.865  29.054  -74.064  1.00 33.85  ? 499 ILE A CG1   1 
ATOM   3052  C  CG2   . ILE A  1 393 ? 94.902  29.043  -72.522  1.00 33.32  ? 499 ILE A CG2   1 
ATOM   3053  C  CD1   . ILE A  1 393 ? 96.921  30.511  -74.365  1.00 34.58  ? 499 ILE A CD1   1 
ATOM   3054  N  N     . VAL A  1 394 ? 93.889  25.991  -72.384  1.00 34.42  ? 500 VAL A N     1 
ATOM   3055  C  CA    . VAL A  1 394 ? 92.566  25.527  -71.963  1.00 35.55  ? 500 VAL A CA    1 
ATOM   3056  C  C     . VAL A  1 394 ? 92.239  26.228  -70.665  1.00 34.59  ? 500 VAL A C     1 
ATOM   3057  O  O     . VAL A  1 394 ? 92.901  26.024  -69.668  1.00 34.57  ? 500 VAL A O     1 
ATOM   3058  C  CB    . VAL A  1 394 ? 92.500  24.012  -71.799  1.00 37.60  ? 500 VAL A CB    1 
ATOM   3059  C  CG1   . VAL A  1 394 ? 91.118  23.566  -71.361  1.00 37.70  ? 500 VAL A CG1   1 
ATOM   3060  C  CG2   . VAL A  1 394 ? 92.840  23.364  -73.118  1.00 38.84  ? 500 VAL A CG2   1 
ATOM   3061  N  N     . ASP A  1 395 ? 91.199  27.053  -70.711  1.00 34.12  ? 501 ASP A N     1 
ATOM   3062  C  CA    . ASP A  1 395 ? 90.788  27.923  -69.628  1.00 35.49  ? 501 ASP A CA    1 
ATOM   3063  C  C     . ASP A  1 395 ? 89.527  27.286  -69.067  1.00 35.26  ? 501 ASP A C     1 
ATOM   3064  O  O     . ASP A  1 395 ? 88.564  27.067  -69.791  1.00 35.07  ? 501 ASP A O     1 
ATOM   3065  C  CB    . ASP A  1 395 ? 90.508  29.304  -70.250  1.00 38.29  ? 501 ASP A CB    1 
ATOM   3066  C  CG    . ASP A  1 395 ? 90.370  30.422  -69.234  1.00 39.44  ? 501 ASP A CG    1 
ATOM   3067  O  OD1   . ASP A  1 395 ? 90.987  30.323  -68.145  1.00 39.75  ? 501 ASP A OD1   1 
ATOM   3068  O  OD2   . ASP A  1 395 ? 89.682  31.421  -69.597  1.00 39.15  ? 501 ASP A OD2   1 
ATOM   3069  N  N     . VAL A  1 396 ? 89.549  26.924  -67.789  1.00 35.69  ? 502 VAL A N     1 
ATOM   3070  C  CA    . VAL A  1 396 ? 88.371  26.330  -67.163  1.00 35.36  ? 502 VAL A CA    1 
ATOM   3071  C  C     . VAL A  1 396 ? 87.788  27.369  -66.227  1.00 35.66  ? 502 VAL A C     1 
ATOM   3072  O  O     . VAL A  1 396 ? 88.518  28.000  -65.460  1.00 36.55  ? 502 VAL A O     1 
ATOM   3073  C  CB    . VAL A  1 396 ? 88.707  25.069  -66.373  1.00 34.99  ? 502 VAL A CB    1 
ATOM   3074  C  CG1   . VAL A  1 396 ? 87.432  24.496  -65.727  1.00 34.19  ? 502 VAL A CG1   1 
ATOM   3075  C  CG2   . VAL A  1 396 ? 89.325  24.040  -67.304  1.00 35.37  ? 502 VAL A CG2   1 
ATOM   3076  N  N     . ILE A  1 397 ? 86.466  27.521  -66.287  1.00 36.17  ? 503 ILE A N     1 
ATOM   3077  C  CA    . ILE A  1 397 ? 85.767  28.608  -65.620  1.00 36.83  ? 503 ILE A CA    1 
ATOM   3078  C  C     . ILE A  1 397 ? 84.595  28.034  -64.841  1.00 36.79  ? 503 ILE A C     1 
ATOM   3079  O  O     . ILE A  1 397 ? 83.745  27.366  -65.420  1.00 35.67  ? 503 ILE A O     1 
ATOM   3080  C  CB    . ILE A  1 397 ? 85.286  29.631  -66.659  1.00 36.66  ? 503 ILE A CB    1 
ATOM   3081  C  CG1   . ILE A  1 397 ? 86.487  30.379  -67.210  1.00 37.06  ? 503 ILE A CG1   1 
ATOM   3082  C  CG2   . ILE A  1 397 ? 84.311  30.634  -66.066  1.00 37.40  ? 503 ILE A CG2   1 
ATOM   3083  C  CD1   . ILE A  1 397 ? 86.224  31.053  -68.528  1.00 38.27  ? 503 ILE A CD1   1 
ATOM   3084  N  N     . ASN A  1 398 ? 84.563  28.316  -63.536  1.00 36.96  ? 504 ASN A N     1 
ATOM   3085  C  CA    . ASN A  1 398 ? 83.475  27.856  -62.677  1.00 37.88  ? 504 ASN A CA    1 
ATOM   3086  C  C     . ASN A  1 398 ? 82.429  28.924  -62.517  1.00 38.33  ? 504 ASN A C     1 
ATOM   3087  O  O     . ASN A  1 398 ? 82.661  29.943  -61.879  1.00 40.02  ? 504 ASN A O     1 
ATOM   3088  C  CB    . ASN A  1 398 ? 83.998  27.459  -61.299  1.00 37.96  ? 504 ASN A CB    1 
ATOM   3089  C  CG    . ASN A  1 398 ? 85.016  26.353  -61.361  1.00 38.42  ? 504 ASN A CG    1 
ATOM   3090  O  OD1   . ASN A  1 398 ? 84.836  25.381  -62.065  1.00 39.29  ? 504 ASN A OD1   1 
ATOM   3091  N  ND2   . ASN A  1 398 ? 86.052  26.498  -60.598  1.00 40.56  ? 504 ASN A ND2   1 
ATOM   3092  N  N     . MET A  1 399 ? 81.263  28.699  -63.112  1.00 38.92  ? 505 MET A N     1 
ATOM   3093  C  CA    . MET A  1 399 ? 80.137  29.601  -62.969  1.00 40.02  ? 505 MET A CA    1 
ATOM   3094  C  C     . MET A  1 399 ? 79.253  29.034  -61.887  1.00 40.06  ? 505 MET A C     1 
ATOM   3095  O  O     . MET A  1 399 ? 78.843  27.878  -61.973  1.00 41.33  ? 505 MET A O     1 
ATOM   3096  C  CB    . MET A  1 399 ? 79.364  29.680  -64.283  1.00 40.61  ? 505 MET A CB    1 
ATOM   3097  C  CG    . MET A  1 399 ? 80.215  30.019  -65.494  1.00 40.28  ? 505 MET A CG    1 
ATOM   3098  S  SD    . MET A  1 399 ? 80.810  31.727  -65.432  1.00 41.40  ? 505 MET A SD    1 
ATOM   3099  C  CE    . MET A  1 399 ? 79.336  32.458  -66.103  1.00 42.29  ? 505 MET A CE    1 
ATOM   3100  N  N     . ASP A  1 400 ? 78.976  29.835  -60.854  1.00 39.66  ? 506 ASP A N     1 
ATOM   3101  C  CA    . ASP A  1 400 ? 78.108  29.417  -59.755  1.00 37.74  ? 506 ASP A CA    1 
ATOM   3102  C  C     . ASP A  1 400 ? 77.285  30.586  -59.254  1.00 36.60  ? 506 ASP A C     1 
ATOM   3103  O  O     . ASP A  1 400 ? 77.369  31.703  -59.794  1.00 35.55  ? 506 ASP A O     1 
ATOM   3104  C  CB    . ASP A  1 400 ? 78.932  28.761  -58.622  1.00 36.36  ? 506 ASP A CB    1 
ATOM   3105  C  CG    . ASP A  1 400 ? 80.008  29.647  -58.036  1.00 35.85  ? 506 ASP A CG    1 
ATOM   3106  O  OD1   . ASP A  1 400 ? 79.883  30.903  -58.055  1.00 36.40  ? 506 ASP A OD1   1 
ATOM   3107  O  OD2   . ASP A  1 400 ? 80.995  29.061  -57.532  1.00 34.54  ? 506 ASP A OD2   1 
ATOM   3108  N  N     . TYR A  1 401 ? 76.479  30.324  -58.227  1.00 37.37  ? 507 TYR A N     1 
ATOM   3109  C  CA    . TYR A  1 401 ? 75.733  31.377  -57.541  1.00 38.16  ? 507 TYR A CA    1 
ATOM   3110  C  C     . TYR A  1 401 ? 76.459  31.791  -56.263  1.00 38.45  ? 507 TYR A C     1 
ATOM   3111  O  O     . TYR A  1 401 ? 75.845  32.165  -55.292  1.00 39.24  ? 507 TYR A O     1 
ATOM   3112  C  CB    . TYR A  1 401 ? 74.307  30.884  -57.278  1.00 37.84  ? 507 TYR A CB    1 
ATOM   3113  C  CG    . TYR A  1 401 ? 73.284  31.173  -58.365  1.00 37.00  ? 507 TYR A CG    1 
ATOM   3114  C  CD1   . TYR A  1 401 ? 73.634  31.239  -59.719  1.00 38.10  ? 507 TYR A CD1   1 
ATOM   3115  C  CD2   . TYR A  1 401 ? 71.958  31.371  -58.040  1.00 36.62  ? 507 TYR A CD2   1 
ATOM   3116  C  CE1   . TYR A  1 401 ? 72.672  31.485  -60.704  1.00 38.58  ? 507 TYR A CE1   1 
ATOM   3117  C  CE2   . TYR A  1 401 ? 71.001  31.621  -58.994  1.00 37.84  ? 507 TYR A CE2   1 
ATOM   3118  C  CZ    . TYR A  1 401 ? 71.371  31.683  -60.330  1.00 38.42  ? 507 TYR A CZ    1 
ATOM   3119  O  OH    . TYR A  1 401 ? 70.357  31.945  -61.212  1.00 40.34  ? 507 TYR A OH    1 
ATOM   3120  N  N     . GLY A  1 402 ? 77.788  31.774  -56.296  1.00 38.49  ? 508 GLY A N     1 
ATOM   3121  C  CA    . GLY A  1 402 ? 78.605  32.277  -55.206  1.00 38.64  ? 508 GLY A CA    1 
ATOM   3122  C  C     . GLY A  1 402 ? 78.919  31.319  -54.085  1.00 39.11  ? 508 GLY A C     1 
ATOM   3123  O  O     . GLY A  1 402 ? 79.710  31.665  -53.223  1.00 37.96  ? 508 GLY A O     1 
ATOM   3124  N  N     . MET A  1 403 ? 78.300  30.137  -54.068  1.00 40.86  ? 509 MET A N     1 
ATOM   3125  C  CA    . MET A  1 403 ? 78.492  29.182  -52.968  1.00 43.89  ? 509 MET A CA    1 
ATOM   3126  C  C     . MET A  1 403 ? 78.653  27.805  -53.553  1.00 46.44  ? 509 MET A C     1 
ATOM   3127  O  O     . MET A  1 403 ? 77.904  26.882  -53.237  1.00 47.84  ? 509 MET A O     1 
ATOM   3128  C  CB    . MET A  1 403 ? 77.334  29.211  -51.985  1.00 44.25  ? 509 MET A CB    1 
ATOM   3129  C  CG    . MET A  1 403 ? 77.211  30.506  -51.214  1.00 44.89  ? 509 MET A CG    1 
ATOM   3130  S  SD    . MET A  1 403 ? 75.832  30.436  -50.072  1.00 47.93  ? 509 MET A SD    1 
ATOM   3131  C  CE    . MET A  1 403 ? 76.454  29.388  -48.749  1.00 47.97  ? 509 MET A CE    1 
ATOM   3132  N  N     . GLN A  1 404 ? 79.665  27.686  -54.419  1.00 49.32  ? 510 GLN A N     1 
ATOM   3133  C  CA    . GLN A  1 404 ? 79.919  26.468  -55.145  1.00 51.54  ? 510 GLN A CA    1 
ATOM   3134  C  C     . GLN A  1 404 ? 78.575  25.841  -55.599  1.00 50.88  ? 510 GLN A C     1 
ATOM   3135  O  O     . GLN A  1 404 ? 77.786  26.527  -56.267  1.00 50.22  ? 510 GLN A O     1 
ATOM   3136  C  CB    . GLN A  1 404 ? 80.789  25.559  -54.333  1.00 55.38  ? 510 GLN A CB    1 
ATOM   3137  C  CG    . GLN A  1 404 ? 82.114  26.075  -53.923  1.00 58.33  ? 510 GLN A CG    1 
ATOM   3138  C  CD    . GLN A  1 404 ? 82.863  24.946  -53.135  1.00 64.88  ? 510 GLN A CD    1 
ATOM   3139  O  OE1   . GLN A  1 404 ? 82.267  24.253  -52.245  1.00 68.23  ? 510 GLN A OE1   1 
ATOM   3140  N  NE2   . GLN A  1 404 ? 84.196  24.745  -53.441  1.00 71.46  ? 510 GLN A NE2   1 
ATOM   3141  N  N     . GLU A  1 405 ? 78.266  24.623  -55.169  1.00 50.69  ? 511 GLU A N     1 
ATOM   3142  C  CA    . GLU A  1 405 ? 77.103  23.902  -55.653  1.00 51.56  ? 511 GLU A CA    1 
ATOM   3143  C  C     . GLU A  1 405 ? 75.807  24.234  -54.937  1.00 47.75  ? 511 GLU A C     1 
ATOM   3144  O  O     . GLU A  1 405 ? 74.757  23.743  -55.327  1.00 49.91  ? 511 GLU A O     1 
ATOM   3145  C  CB    . GLU A  1 405 ? 77.354  22.407  -55.569  1.00 58.27  ? 511 GLU A CB    1 
ATOM   3146  C  CG    . GLU A  1 405 ? 78.445  21.946  -56.506  1.00 69.14  ? 511 GLU A CG    1 
ATOM   3147  C  CD    . GLU A  1 405 ? 78.919  20.514  -56.232  1.00 79.81  ? 511 GLU A CD    1 
ATOM   3148  O  OE1   . GLU A  1 405 ? 78.672  19.950  -55.119  1.00 87.86  ? 511 GLU A OE1   1 
ATOM   3149  O  OE2   . GLU A  1 405 ? 79.578  19.945  -57.150  1.00 88.03  ? 511 GLU A OE2   1 
ATOM   3150  N  N     . LYS A  1 406 ? 75.865  25.087  -53.908  1.00 42.86  ? 512 LYS A N     1 
ATOM   3151  C  CA    . LYS A  1 406 ? 74.702  25.428  -53.086  1.00 40.69  ? 512 LYS A CA    1 
ATOM   3152  C  C     . LYS A  1 406 ? 73.881  26.586  -53.627  1.00 38.31  ? 512 LYS A C     1 
ATOM   3153  O  O     . LYS A  1 406 ? 74.408  27.484  -54.302  1.00 40.23  ? 512 LYS A O     1 
ATOM   3154  C  CB    . LYS A  1 406 ? 75.132  25.798  -51.682  1.00 42.22  ? 512 LYS A CB    1 
ATOM   3155  C  CG    . LYS A  1 406 ? 75.823  24.665  -50.941  1.00 43.59  ? 512 LYS A CG    1 
ATOM   3156  C  CD    . LYS A  1 406 ? 76.316  25.091  -49.567  1.00 44.16  ? 512 LYS A CD    1 
ATOM   3157  C  CE    . LYS A  1 406 ? 77.671  24.489  -49.196  1.00 45.44  ? 512 LYS A CE    1 
ATOM   3158  N  NZ    . LYS A  1 406 ? 77.704  24.035  -47.785  1.00 48.38  ? 512 LYS A NZ    1 
ATOM   3159  N  N     . ASN A  1 407 ? 72.589  26.550  -53.302  1.00 34.94  ? 513 ASN A N     1 
ATOM   3160  C  CA    . ASN A  1 407 ? 71.623  27.599  -53.610  1.00 31.71  ? 513 ASN A CA    1 
ATOM   3161  C  C     . ASN A  1 407 ? 71.740  28.611  -52.474  1.00 31.03  ? 513 ASN A C     1 
ATOM   3162  O  O     . ASN A  1 407 ? 71.357  28.301  -51.356  1.00 32.66  ? 513 ASN A O     1 
ATOM   3163  C  CB    . ASN A  1 407 ? 70.201  26.987  -53.629  1.00 30.34  ? 513 ASN A CB    1 
ATOM   3164  C  CG    . ASN A  1 407 ? 69.130  28.011  -53.827  1.00 29.59  ? 513 ASN A CG    1 
ATOM   3165  O  OD1   . ASN A  1 407 ? 69.395  29.186  -53.632  1.00 30.11  ? 513 ASN A OD1   1 
ATOM   3166  N  ND2   . ASN A  1 407 ? 67.960  27.646  -54.288  1.00 29.17  ? 513 ASN A ND2   1 
ATOM   3167  N  N     . PRO A  1 408 ? 72.233  29.822  -52.742  1.00 30.40  ? 514 PRO A N     1 
ATOM   3168  C  CA    . PRO A  1 408 ? 72.396  30.783  -51.662  1.00 30.84  ? 514 PRO A CA    1 
ATOM   3169  C  C     . PRO A  1 408 ? 71.093  31.274  -51.041  1.00 31.58  ? 514 PRO A C     1 
ATOM   3170  O  O     . PRO A  1 408 ? 71.108  31.744  -49.917  1.00 33.47  ? 514 PRO A O     1 
ATOM   3171  C  CB    . PRO A  1 408 ? 73.149  31.948  -52.311  1.00 30.46  ? 514 PRO A CB    1 
ATOM   3172  C  CG    . PRO A  1 408 ? 72.805  31.864  -53.746  1.00 30.27  ? 514 PRO A CG    1 
ATOM   3173  C  CD    . PRO A  1 408 ? 72.567  30.405  -54.043  1.00 30.48  ? 514 PRO A CD    1 
ATOM   3174  N  N     . ILE A  1 409 ? 69.979  31.143  -51.743  1.00 31.95  ? 515 ILE A N     1 
ATOM   3175  C  CA    . ILE A  1 409 ? 68.688  31.545  -51.198  1.00 32.51  ? 515 ILE A CA    1 
ATOM   3176  C  C     . ILE A  1 409 ? 68.241  30.611  -50.073  1.00 32.59  ? 515 ILE A C     1 
ATOM   3177  O  O     . ILE A  1 409 ? 67.487  31.021  -49.205  1.00 34.16  ? 515 ILE A O     1 
ATOM   3178  C  CB    . ILE A  1 409 ? 67.608  31.613  -52.306  1.00 33.26  ? 515 ILE A CB    1 
ATOM   3179  C  CG1   . ILE A  1 409 ? 68.058  32.543  -53.453  1.00 32.14  ? 515 ILE A CG1   1 
ATOM   3180  C  CG2   . ILE A  1 409 ? 66.273  32.081  -51.744  1.00 33.88  ? 515 ILE A CG2   1 
ATOM   3181  C  CD1   . ILE A  1 409 ? 68.594  33.894  -53.041  1.00 31.88  ? 515 ILE A CD1   1 
ATOM   3182  N  N     . ASP A  1 410 ? 68.720  29.370  -50.079  1.00 32.40  ? 516 ASP A N     1 
ATOM   3183  C  CA    . ASP A  1 410 ? 68.530  28.466  -48.943  1.00 33.11  ? 516 ASP A CA    1 
ATOM   3184  C  C     . ASP A  1 410 ? 69.266  28.948  -47.687  1.00 32.79  ? 516 ASP A C     1 
ATOM   3185  O  O     . ASP A  1 410 ? 68.942  28.507  -46.596  1.00 33.83  ? 516 ASP A O     1 
ATOM   3186  C  CB    . ASP A  1 410 ? 68.931  27.018  -49.281  1.00 33.22  ? 516 ASP A CB    1 
ATOM   3187  C  CG    . ASP A  1 410 ? 67.985  26.351  -50.301  1.00 33.65  ? 516 ASP A CG    1 
ATOM   3188  O  OD1   . ASP A  1 410 ? 66.793  26.748  -50.436  1.00 33.95  ? 516 ASP A OD1   1 
ATOM   3189  O  OD2   . ASP A  1 410 ? 68.448  25.416  -50.989  1.00 33.87  ? 516 ASP A OD2   1 
ATOM   3190  N  N     . HIS A  1 411 ? 70.233  29.850  -47.846  1.00 31.54  ? 517 HIS A N     1 
ATOM   3191  C  CA    . HIS A  1 411 ? 70.893  30.512  -46.723  1.00 31.45  ? 517 HIS A CA    1 
ATOM   3192  C  C     . HIS A  1 411 ? 70.483  31.989  -46.502  1.00 30.15  ? 517 HIS A C     1 
ATOM   3193  O  O     . HIS A  1 411 ? 71.278  32.780  -46.008  1.00 29.85  ? 517 HIS A O     1 
ATOM   3194  C  CB    . HIS A  1 411 ? 72.406  30.356  -46.884  1.00 31.77  ? 517 HIS A CB    1 
ATOM   3195  C  CG    . HIS A  1 411 ? 72.841  28.928  -47.000  1.00 32.17  ? 517 HIS A CG    1 
ATOM   3196  N  ND1   . HIS A  1 411 ? 73.024  28.111  -45.906  1.00 33.10  ? 517 HIS A ND1   1 
ATOM   3197  C  CD2   . HIS A  1 411 ? 73.093  28.160  -48.085  1.00 33.01  ? 517 HIS A CD2   1 
ATOM   3198  C  CE1   . HIS A  1 411 ? 73.380  26.909  -46.304  1.00 33.99  ? 517 HIS A CE1   1 
ATOM   3199  N  NE2   . HIS A  1 411 ? 73.442  26.913  -47.620  1.00 34.02  ? 517 HIS A NE2   1 
ATOM   3200  N  N     . VAL A  1 412 ? 69.241  32.333  -46.840  1.00 28.64  ? 518 VAL A N     1 
ATOM   3201  C  CA    . VAL A  1 412 ? 68.670  33.661  -46.567  1.00 28.23  ? 518 VAL A CA    1 
ATOM   3202  C  C     . VAL A  1 412 ? 67.461  33.457  -45.669  1.00 28.52  ? 518 VAL A C     1 
ATOM   3203  O  O     . VAL A  1 412 ? 66.663  32.524  -45.862  1.00 28.51  ? 518 VAL A O     1 
ATOM   3204  C  CB    . VAL A  1 412 ? 68.198  34.388  -47.860  1.00 27.67  ? 518 VAL A CB    1 
ATOM   3205  C  CG1   . VAL A  1 412 ? 67.591  35.761  -47.582  1.00 27.48  ? 518 VAL A CG1   1 
ATOM   3206  C  CG2   . VAL A  1 412 ? 69.357  34.553  -48.818  1.00 27.60  ? 518 VAL A CG2   1 
ATOM   3207  N  N     . SER A  1 413 ? 67.327  34.352  -44.695  1.00 28.81  ? 519 SER A N     1 
ATOM   3208  C  CA    . SER A  1 413 ? 66.179  34.383  -43.806  1.00 29.40  ? 519 SER A CA    1 
ATOM   3209  C  C     . SER A  1 413 ? 65.197  35.440  -44.304  1.00 27.67  ? 519 SER A C     1 
ATOM   3210  O  O     . SER A  1 413 ? 65.610  36.496  -44.737  1.00 26.64  ? 519 SER A O     1 
ATOM   3211  C  CB    . SER A  1 413 ? 66.637  34.683  -42.378  1.00 31.53  ? 519 SER A CB    1 
ATOM   3212  O  OG    . SER A  1 413 ? 67.284  33.552  -41.823  1.00 34.47  ? 519 SER A OG    1 
ATOM   3213  N  N     . PHE A  1 414 ? 63.907  35.128  -44.231  1.00 27.20  ? 520 PHE A N     1 
ATOM   3214  C  CA    . PHE A  1 414 ? 62.849  36.023  -44.691  1.00 27.00  ? 520 PHE A CA    1 
ATOM   3215  C  C     . PHE A  1 414 ? 61.890  36.408  -43.568  1.00 27.20  ? 520 PHE A C     1 
ATOM   3216  O  O     . PHE A  1 414 ? 61.939  35.817  -42.513  1.00 26.48  ? 520 PHE A O     1 
ATOM   3217  C  CB    . PHE A  1 414 ? 62.091  35.381  -45.857  1.00 26.32  ? 520 PHE A CB    1 
ATOM   3218  C  CG    . PHE A  1 414 ? 62.946  35.149  -47.083  1.00 25.61  ? 520 PHE A CG    1 
ATOM   3219  C  CD1   . PHE A  1 414 ? 63.203  36.179  -48.011  1.00 24.87  ? 520 PHE A CD1   1 
ATOM   3220  C  CD2   . PHE A  1 414 ? 63.617  33.938  -47.279  1.00 25.13  ? 520 PHE A CD2   1 
ATOM   3221  C  CE1   . PHE A  1 414 ? 64.012  35.960  -49.091  1.00 24.10  ? 520 PHE A CE1   1 
ATOM   3222  C  CE2   . PHE A  1 414 ? 64.272  33.693  -48.452  1.00 24.49  ? 520 PHE A CE2   1 
ATOM   3223  C  CZ    . PHE A  1 414 ? 64.539  34.721  -49.323  1.00 24.01  ? 520 PHE A CZ    1 
ATOM   3224  N  N     . TYR A  1 415 ? 61.053  37.422  -43.783  1.00 28.09  ? 521 TYR A N     1 
ATOM   3225  C  CA    . TYR A  1 415 ? 60.009  37.791  -42.819  1.00 30.32  ? 521 TYR A CA    1 
ATOM   3226  C  C     . TYR A  1 415 ? 58.706  38.153  -43.507  1.00 32.92  ? 521 TYR A C     1 
ATOM   3227  O  O     . TYR A  1 415 ? 58.718  38.504  -44.669  1.00 31.34  ? 521 TYR A O     1 
ATOM   3228  C  CB    . TYR A  1 415 ? 60.460  38.939  -41.910  1.00 29.97  ? 521 TYR A CB    1 
ATOM   3229  C  CG    . TYR A  1 415 ? 60.576  40.305  -42.557  1.00 28.99  ? 521 TYR A CG    1 
ATOM   3230  C  CD1   . TYR A  1 415 ? 61.770  40.723  -43.108  1.00 28.42  ? 521 TYR A CD1   1 
ATOM   3231  C  CD2   . TYR A  1 415 ? 59.504  41.199  -42.570  1.00 28.97  ? 521 TYR A CD2   1 
ATOM   3232  C  CE1   . TYR A  1 415 ? 61.905  41.986  -43.687  1.00 28.26  ? 521 TYR A CE1   1 
ATOM   3233  C  CE2   . TYR A  1 415 ? 59.615  42.428  -43.183  1.00 29.23  ? 521 TYR A CE2   1 
ATOM   3234  C  CZ    . TYR A  1 415 ? 60.819  42.829  -43.727  1.00 28.85  ? 521 TYR A CZ    1 
ATOM   3235  O  OH    . TYR A  1 415 ? 60.946  44.059  -44.310  1.00 28.45  ? 521 TYR A OH    1 
ATOM   3236  N  N     . CYS A  1 416 ? 57.589  38.081  -42.765  1.00 38.38  ? 522 CYS A N     1 
ATOM   3237  C  CA    . CYS A  1 416 ? 56.265  38.403  -43.353  1.00 42.95  ? 522 CYS A CA    1 
ATOM   3238  C  C     . CYS A  1 416 ? 55.711  39.675  -42.795  1.00 40.68  ? 522 CYS A C     1 
ATOM   3239  O  O     . CYS A  1 416 ? 56.057  40.071  -41.692  1.00 39.60  ? 522 CYS A O     1 
ATOM   3240  C  CB    . CYS A  1 416 ? 55.287  37.300  -43.083  1.00 48.95  ? 522 CYS A CB    1 
ATOM   3241  S  SG    . CYS A  1 416 ? 56.028  35.742  -43.561  1.00 64.06  ? 522 CYS A SG    1 
ATOM   3242  N  N     . LYS A  1 417 ? 54.823  40.300  -43.568  1.00 39.18  ? 523 LYS A N     1 
ATOM   3243  C  CA    . LYS A  1 417 ? 54.189  41.549  -43.154  1.00 38.94  ? 523 LYS A CA    1 
ATOM   3244  C  C     . LYS A  1 417 ? 53.458  41.345  -41.824  1.00 39.53  ? 523 LYS A C     1 
ATOM   3245  O  O     . LYS A  1 417 ? 53.532  42.187  -40.937  1.00 39.13  ? 523 LYS A O     1 
ATOM   3246  C  CB    . LYS A  1 417 ? 53.203  41.996  -44.222  1.00 37.90  ? 523 LYS A CB    1 
ATOM   3247  C  CG    . LYS A  1 417 ? 52.591  43.377  -44.012  1.00 38.42  ? 523 LYS A CG    1 
ATOM   3248  C  CD    . LYS A  1 417 ? 51.915  43.965  -45.241  1.00 38.37  ? 523 LYS A CD    1 
ATOM   3249  C  CE    . LYS A  1 417 ? 50.844  43.059  -45.862  1.00 38.31  ? 523 LYS A CE    1 
ATOM   3250  N  NZ    . LYS A  1 417 ? 50.112  43.759  -46.921  1.00 37.85  ? 523 LYS A NZ    1 
ATOM   3251  N  N     . THR A  1 418 ? 52.789  40.201  -41.720  1.00 39.47  ? 524 THR A N     1 
ATOM   3252  C  CA    . THR A  1 418 ? 51.983  39.820  -40.575  1.00 40.90  ? 524 THR A CA    1 
ATOM   3253  C  C     . THR A  1 418 ? 52.749  39.533  -39.281  1.00 41.95  ? 524 THR A C     1 
ATOM   3254  O  O     . THR A  1 418 ? 52.156  39.584  -38.226  1.00 41.61  ? 524 THR A O     1 
ATOM   3255  C  CB    . THR A  1 418 ? 51.129  38.575  -40.922  1.00 42.28  ? 524 THR A CB    1 
ATOM   3256  O  OG1   . THR A  1 418 ? 51.932  37.601  -41.569  1.00 40.43  ? 524 THR A OG1   1 
ATOM   3257  C  CG2   . THR A  1 418 ? 50.027  38.909  -41.891  1.00 43.81  ? 524 THR A CG2   1 
ATOM   3258  N  N     . ALA A  1 419 ? 54.045  39.225  -39.370  1.00 43.05  ? 525 ALA A N     1 
ATOM   3259  C  CA    . ALA A  1 419 ? 54.900  38.905  -38.201  1.00 42.03  ? 525 ALA A CA    1 
ATOM   3260  C  C     . ALA A  1 419 ? 56.354  39.260  -38.499  1.00 40.30  ? 525 ALA A C     1 
ATOM   3261  O  O     . ALA A  1 419 ? 57.179  38.380  -38.822  1.00 40.47  ? 525 ALA A O     1 
ATOM   3262  C  CB    . ALA A  1 419 ? 54.795  37.437  -37.853  1.00 42.50  ? 525 ALA A CB    1 
ATOM   3263  N  N     . PRO A  1 420 ? 56.668  40.557  -38.424  1.00 38.23  ? 526 PRO A N     1 
ATOM   3264  C  CA    . PRO A  1 420 ? 57.938  41.050  -38.939  1.00 37.71  ? 526 PRO A CA    1 
ATOM   3265  C  C     . PRO A  1 420 ? 59.173  40.735  -38.115  1.00 37.59  ? 526 PRO A C     1 
ATOM   3266  O  O     . PRO A  1 420 ? 60.274  41.001  -38.597  1.00 36.47  ? 526 PRO A O     1 
ATOM   3267  C  CB    . PRO A  1 420 ? 57.711  42.561  -39.044  1.00 37.55  ? 526 PRO A CB    1 
ATOM   3268  C  CG    . PRO A  1 420 ? 56.634  42.854  -38.094  1.00 38.45  ? 526 PRO A CG    1 
ATOM   3269  C  CD    . PRO A  1 420 ? 55.753  41.650  -38.074  1.00 38.19  ? 526 PRO A CD    1 
ATOM   3270  N  N     . ASN A  1 421 ? 59.018  40.186  -36.912  1.00 39.78  ? 527 ASN A N     1 
ATOM   3271  C  CA    . ASN A  1 421 ? 60.193  39.742  -36.135  1.00 40.66  ? 527 ASN A CA    1 
ATOM   3272  C  C     . ASN A  1 421 ? 60.466  38.258  -36.218  1.00 40.78  ? 527 ASN A C     1 
ATOM   3273  O  O     . ASN A  1 421 ? 61.501  37.790  -35.733  1.00 38.48  ? 527 ASN A O     1 
ATOM   3274  C  CB    . ASN A  1 421 ? 60.033  40.183  -34.687  1.00 40.53  ? 527 ASN A CB    1 
ATOM   3275  C  CG    . ASN A  1 421 ? 60.129  41.684  -34.540  1.00 40.05  ? 527 ASN A CG    1 
ATOM   3276  O  OD1   . ASN A  1 421 ? 60.806  42.348  -35.310  1.00 38.09  ? 527 ASN A OD1   1 
ATOM   3277  N  ND2   . ASN A  1 421 ? 59.445  42.230  -33.554  1.00 43.05  ? 527 ASN A ND2   1 
ATOM   3278  N  N     . ARG A  1 422 ? 59.541  37.529  -36.850  1.00 41.65  ? 528 ARG A N     1 
ATOM   3279  C  CA    . ARG A  1 422 ? 59.647  36.097  -36.992  1.00 42.11  ? 528 ARG A CA    1 
ATOM   3280  C  C     . ARG A  1 422 ? 60.268  35.761  -38.341  1.00 39.22  ? 528 ARG A C     1 
ATOM   3281  O  O     . ARG A  1 422 ? 59.616  35.892  -39.389  1.00 36.83  ? 528 ARG A O     1 
ATOM   3282  C  CB    . ARG A  1 422 ? 58.269  35.441  -36.837  1.00 47.11  ? 528 ARG A CB    1 
ATOM   3283  C  CG    . ARG A  1 422 ? 58.256  33.969  -36.975  1.00 51.09  ? 528 ARG A CG    1 
ATOM   3284  C  CD    . ARG A  1 422 ? 57.417  33.067  -36.131  1.00 55.11  ? 528 ARG A CD    1 
ATOM   3285  N  NE    . ARG A  1 422 ? 57.784  31.741  -36.617  1.00 57.80  ? 528 ARG A NE    1 
ATOM   3286  C  CZ    . ARG A  1 422 ? 56.981  30.880  -37.250  1.00 60.90  ? 528 ARG A CZ    1 
ATOM   3287  N  NH1   . ARG A  1 422 ? 57.474  29.721  -37.651  1.00 63.06  ? 528 ARG A NH1   1 
ATOM   3288  N  NH2   . ARG A  1 422 ? 55.710  31.188  -37.494  1.00 62.70  ? 528 ARG A NH2   1 
ATOM   3289  N  N     . ALA A  1 423 ? 61.497  35.270  -38.257  1.00 37.13  ? 529 ALA A N     1 
ATOM   3290  C  CA    . ALA A  1 423 ? 62.256  34.848  -39.433  1.00 35.77  ? 529 ALA A CA    1 
ATOM   3291  C  C     . ALA A  1 423 ? 61.804  33.498  -39.922  1.00 35.07  ? 529 ALA A C     1 
ATOM   3292  O  O     . ALA A  1 423 ? 61.422  32.666  -39.135  1.00 34.21  ? 529 ALA A O     1 
ATOM   3293  C  CB    . ALA A  1 423 ? 63.738  34.800  -39.117  1.00 35.69  ? 529 ALA A CB    1 
ATOM   3294  N  N     . ILE A  1 424 ? 61.870  33.287  -41.230  1.00 35.74  ? 530 ILE A N     1 
ATOM   3295  C  CA    . ILE A  1 424 ? 61.455  32.031  -41.864  1.00 35.74  ? 530 ILE A CA    1 
ATOM   3296  C  C     . ILE A  1 424 ? 62.393  31.681  -43.013  1.00 36.10  ? 530 ILE A C     1 
ATOM   3297  O  O     . ILE A  1 424 ? 63.245  32.472  -43.378  1.00 35.16  ? 530 ILE A O     1 
ATOM   3298  C  CB    . ILE A  1 424 ? 60.025  32.096  -42.387  1.00 34.40  ? 530 ILE A CB    1 
ATOM   3299  C  CG1   . ILE A  1 424 ? 59.854  33.245  -43.374  1.00 33.92  ? 530 ILE A CG1   1 
ATOM   3300  C  CG2   . ILE A  1 424 ? 59.057  32.260  -41.219  1.00 34.71  ? 530 ILE A CG2   1 
ATOM   3301  C  CD1   . ILE A  1 424 ? 58.511  33.170  -44.131  1.00 34.18  ? 530 ILE A CD1   1 
ATOM   3302  N  N     . ARG A  1 425 ? 62.224  30.481  -43.558  1.00 37.62  ? 531 ARG A N     1 
ATOM   3303  C  CA    . ARG A  1 425 ? 62.959  30.019  -44.721  1.00 39.45  ? 531 ARG A CA    1 
ATOM   3304  C  C     . ARG A  1 425 ? 61.994  29.842  -45.874  1.00 39.22  ? 531 ARG A C     1 
ATOM   3305  O  O     . ARG A  1 425 ? 60.822  29.596  -45.661  1.00 38.23  ? 531 ARG A O     1 
ATOM   3306  C  CB    . ARG A  1 425 ? 63.684  28.706  -44.432  1.00 42.73  ? 531 ARG A CB    1 
ATOM   3307  C  CG    . ARG A  1 425 ? 64.721  28.792  -43.324  1.00 47.90  ? 531 ARG A CG    1 
ATOM   3308  C  CD    . ARG A  1 425 ? 65.997  29.431  -43.798  1.00 52.94  ? 531 ARG A CD    1 
ATOM   3309  N  NE    . ARG A  1 425 ? 66.963  29.581  -42.700  1.00 56.54  ? 531 ARG A NE    1 
ATOM   3310  C  CZ    . ARG A  1 425 ? 68.273  29.793  -42.849  1.00 60.63  ? 531 ARG A CZ    1 
ATOM   3311  N  NH1   . ARG A  1 425 ? 68.855  29.867  -44.049  1.00 62.25  ? 531 ARG A NH1   1 
ATOM   3312  N  NH2   . ARG A  1 425 ? 69.016  30.003  -41.760  1.00 63.37  ? 531 ARG A NH2   1 
ATOM   3313  N  N     . ILE A  1 426 ? 62.499  30.017  -47.094  1.00 39.98  ? 532 ILE A N     1 
ATOM   3314  C  CA    . ILE A  1 426 ? 61.702  29.794  -48.294  1.00 40.10  ? 532 ILE A CA    1 
ATOM   3315  C  C     . ILE A  1 426 ? 62.538  28.894  -49.196  1.00 40.83  ? 532 ILE A C     1 
ATOM   3316  O  O     . ILE A  1 426 ? 63.634  29.256  -49.603  1.00 41.64  ? 532 ILE A O     1 
ATOM   3317  C  CB    . ILE A  1 426 ? 61.320  31.107  -49.023  1.00 39.35  ? 532 ILE A CB    1 
ATOM   3318  C  CG1   . ILE A  1 426 ? 60.485  32.047  -48.136  1.00 39.92  ? 532 ILE A CG1   1 
ATOM   3319  C  CG2   . ILE A  1 426 ? 60.498  30.782  -50.256  1.00 39.21  ? 532 ILE A CG2   1 
ATOM   3320  C  CD1   . ILE A  1 426 ? 60.101  33.410  -48.738  1.00 40.25  ? 532 ILE A CD1   1 
ATOM   3321  N  N     . THR A  1 427 ? 62.005  27.719  -49.514  1.00 42.77  ? 533 THR A N     1 
ATOM   3322  C  CA    . THR A  1 427 ? 62.724  26.752  -50.344  1.00 44.25  ? 533 THR A CA    1 
ATOM   3323  C  C     . THR A  1 427 ? 62.557  27.123  -51.808  1.00 45.40  ? 533 THR A C     1 
ATOM   3324  O  O     . THR A  1 427 ? 61.796  28.029  -52.141  1.00 43.65  ? 533 THR A O     1 
ATOM   3325  C  CB    . THR A  1 427 ? 62.151  25.352  -50.190  1.00 44.90  ? 533 THR A CB    1 
ATOM   3326  O  OG1   . THR A  1 427 ? 60.786  25.346  -50.637  1.00 45.60  ? 533 THR A OG1   1 
ATOM   3327  C  CG2   . THR A  1 427 ? 62.239  24.906  -48.733  1.00 45.34  ? 533 THR A CG2   1 
ATOM   3328  N  N     . LYS A  1 428 ? 63.244  26.400  -52.686  1.00 46.68  ? 534 LYS A N     1 
ATOM   3329  C  CA    . LYS A  1 428 ? 63.117  26.672  -54.107  1.00 47.59  ? 534 LYS A CA    1 
ATOM   3330  C  C     . LYS A  1 428 ? 61.731  26.321  -54.649  1.00 48.95  ? 534 LYS A C     1 
ATOM   3331  O  O     . LYS A  1 428 ? 61.152  27.084  -55.421  1.00 47.22  ? 534 LYS A O     1 
ATOM   3332  C  CB    . LYS A  1 428 ? 64.196  25.922  -54.894  1.00 47.93  ? 534 LYS A CB    1 
ATOM   3333  C  CG    . LYS A  1 428 ? 64.471  26.546  -56.254  1.00 47.08  ? 534 LYS A CG    1 
ATOM   3334  C  CD    . LYS A  1 428 ? 65.421  25.697  -57.056  1.00 47.31  ? 534 LYS A CD    1 
ATOM   3335  C  CE    . LYS A  1 428 ? 64.726  24.502  -57.667  1.00 48.27  ? 534 LYS A CE    1 
ATOM   3336  N  NZ    . LYS A  1 428 ? 65.660  23.849  -58.631  1.00 50.19  ? 534 LYS A NZ    1 
ATOM   3337  N  N     . ASN A  1 429 ? 61.198  25.184  -54.222  1.00 53.26  ? 535 ASN A N     1 
ATOM   3338  C  CA    . ASN A  1 429 ? 59.865  24.702  -54.659  1.00 57.52  ? 535 ASN A CA    1 
ATOM   3339  C  C     . ASN A  1 429 ? 58.722  25.651  -54.331  1.00 54.99  ? 535 ASN A C     1 
ATOM   3340  O  O     . ASN A  1 429 ? 57.728  25.707  -55.066  1.00 54.95  ? 535 ASN A O     1 
ATOM   3341  C  CB    . ASN A  1 429 ? 59.540  23.353  -54.035  1.00 63.65  ? 535 ASN A CB    1 
ATOM   3342  C  CG    . ASN A  1 429 ? 60.511  22.287  -54.466  1.00 70.63  ? 535 ASN A CG    1 
ATOM   3343  O  OD1   . ASN A  1 429 ? 60.976  22.274  -55.634  1.00 71.24  ? 535 ASN A OD1   1 
ATOM   3344  N  ND2   . ASN A  1 429 ? 60.863  21.396  -53.520  1.00 77.59  ? 535 ASN A ND2   1 
ATOM   3345  N  N     . GLN A  1 430 ? 58.870  26.385  -53.231  1.00 51.29  ? 536 GLN A N     1 
ATOM   3346  C  CA    . GLN A  1 430 ? 57.879  27.372  -52.821  1.00 47.72  ? 536 GLN A CA    1 
ATOM   3347  C  C     . GLN A  1 430 ? 57.833  28.601  -53.738  1.00 45.53  ? 536 GLN A C     1 
ATOM   3348  O  O     . GLN A  1 430 ? 56.861  29.348  -53.680  1.00 44.59  ? 536 GLN A O     1 
ATOM   3349  C  CB    . GLN A  1 430 ? 58.133  27.836  -51.365  1.00 47.12  ? 536 GLN A CB    1 
ATOM   3350  C  CG    . GLN A  1 430 ? 57.702  26.858  -50.279  1.00 46.41  ? 536 GLN A CG    1 
ATOM   3351  C  CD    . GLN A  1 430 ? 58.004  27.346  -48.872  1.00 44.84  ? 536 GLN A CD    1 
ATOM   3352  O  OE1   . GLN A  1 430 ? 59.138  27.281  -48.400  1.00 43.77  ? 536 GLN A OE1   1 
ATOM   3353  N  NE2   . GLN A  1 430 ? 56.977  27.767  -48.187  1.00 44.79  ? 536 GLN A NE2   1 
ATOM   3354  N  N     . VAL A  1 431 ? 58.865  28.815  -54.567  1.00 43.79  ? 537 VAL A N     1 
ATOM   3355  C  CA    . VAL A  1 431 ? 58.968  30.023  -55.405  1.00 41.54  ? 537 VAL A CA    1 
ATOM   3356  C  C     . VAL A  1 431 ? 58.551  29.793  -56.858  1.00 40.60  ? 537 VAL A C     1 
ATOM   3357  O  O     . VAL A  1 431 ? 57.617  30.450  -57.345  1.00 42.05  ? 537 VAL A O     1 
ATOM   3358  C  CB    . VAL A  1 431 ? 60.392  30.617  -55.405  1.00 40.44  ? 537 VAL A CB    1 
ATOM   3359  C  CG1   . VAL A  1 431 ? 60.436  31.911  -56.208  1.00 40.11  ? 537 VAL A CG1   1 
ATOM   3360  C  CG2   . VAL A  1 431 ? 60.850  30.916  -53.991  1.00 40.94  ? 537 VAL A CG2   1 
ATOM   3361  N  N     . SER A  1 432 ? 59.263  28.904  -57.550  1.00 38.07  ? 538 SER A N     1 
ATOM   3362  C  CA    . SER A  1 432 ? 59.031  28.685  -58.979  1.00 37.36  ? 538 SER A CA    1 
ATOM   3363  C  C     . SER A  1 432 ? 59.701  27.438  -59.524  1.00 35.81  ? 538 SER A C     1 
ATOM   3364  O  O     . SER A  1 432 ? 60.796  27.091  -59.118  1.00 33.98  ? 538 SER A O     1 
ATOM   3365  C  CB    . SER A  1 432 ? 59.518  29.911  -59.798  1.00 38.50  ? 538 SER A CB    1 
ATOM   3366  O  OG    . SER A  1 432 ? 59.437  29.705  -61.199  1.00 39.18  ? 538 SER A OG    1 
ATOM   3367  N  N     . GLN A  1 433 ? 59.027  26.781  -60.447  1.00 36.10  ? 539 GLN A N     1 
ATOM   3368  C  CA    . GLN A  1 433 ? 59.572  25.700  -61.253  1.00 37.58  ? 539 GLN A CA    1 
ATOM   3369  C  C     . GLN A  1 433 ? 60.483  26.160  -62.382  1.00 37.69  ? 539 GLN A C     1 
ATOM   3370  O  O     . GLN A  1 433 ? 61.188  25.359  -62.974  1.00 39.29  ? 539 GLN A O     1 
ATOM   3371  C  CB    . GLN A  1 433 ? 58.381  24.855  -61.811  1.00 39.07  ? 539 GLN A CB    1 
ATOM   3372  C  CG    . GLN A  1 433 ? 57.580  24.122  -60.744  1.00 39.67  ? 539 GLN A CG    1 
ATOM   3373  C  CD    . GLN A  1 433 ? 58.448  23.091  -60.060  1.00 41.04  ? 539 GLN A CD    1 
ATOM   3374  O  OE1   . GLN A  1 433 ? 59.087  22.249  -60.737  1.00 38.79  ? 539 GLN A OE1   1 
ATOM   3375  N  NE2   . GLN A  1 433 ? 58.516  23.157  -58.698  1.00 45.80  ? 539 GLN A NE2   1 
ATOM   3376  N  N     . LEU A  1 434 ? 60.465  27.446  -62.703  1.00 37.82  ? 540 LEU A N     1 
ATOM   3377  C  CA    . LEU A  1 434 ? 61.338  28.011  -63.759  1.00 38.45  ? 540 LEU A CA    1 
ATOM   3378  C  C     . LEU A  1 434 ? 62.716  28.470  -63.268  1.00 39.38  ? 540 LEU A C     1 
ATOM   3379  O  O     . LEU A  1 434 ? 63.463  29.082  -64.033  1.00 43.20  ? 540 LEU A O     1 
ATOM   3380  C  CB    . LEU A  1 434 ? 60.628  29.169  -64.448  1.00 38.38  ? 540 LEU A CB    1 
ATOM   3381  C  CG    . LEU A  1 434 ? 59.223  28.870  -64.979  1.00 37.96  ? 540 LEU A CG    1 
ATOM   3382  C  CD1   . LEU A  1 434 ? 58.671  30.115  -65.670  1.00 37.27  ? 540 LEU A CD1   1 
ATOM   3383  C  CD2   . LEU A  1 434 ? 59.195  27.677  -65.927  1.00 38.61  ? 540 LEU A CD2   1 
ATOM   3384  N  N     . LEU A  1 435 ? 63.067  28.162  -62.023  1.00 37.66  ? 541 LEU A N     1 
ATOM   3385  C  CA    . LEU A  1 435 ? 64.385  28.489  -61.495  1.00 36.18  ? 541 LEU A CA    1 
ATOM   3386  C  C     . LEU A  1 435 ? 65.390  27.440  -61.921  1.00 35.79  ? 541 LEU A C     1 
ATOM   3387  O  O     . LEU A  1 435 ? 65.001  26.428  -62.467  1.00 35.71  ? 541 LEU A O     1 
ATOM   3388  C  CB    . LEU A  1 435 ? 64.317  28.597  -59.982  1.00 35.88  ? 541 LEU A CB    1 
ATOM   3389  C  CG    . LEU A  1 435 ? 63.557  29.827  -59.503  1.00 35.18  ? 541 LEU A CG    1 
ATOM   3390  C  CD1   . LEU A  1 435 ? 63.232  29.716  -58.030  1.00 35.46  ? 541 LEU A CD1   1 
ATOM   3391  C  CD2   . LEU A  1 435 ? 64.351  31.085  -59.731  1.00 35.28  ? 541 LEU A CD2   1 
ATOM   3392  N  N     . PRO A  1 436 ? 66.693  27.691  -61.710  1.00 35.65  ? 542 PRO A N     1 
ATOM   3393  C  CA    . PRO A  1 436 ? 67.705  26.720  -62.106  1.00 36.91  ? 542 PRO A CA    1 
ATOM   3394  C  C     . PRO A  1 436 ? 67.640  25.411  -61.335  1.00 40.86  ? 542 PRO A C     1 
ATOM   3395  O  O     . PRO A  1 436 ? 67.283  25.405  -60.169  1.00 41.83  ? 542 PRO A O     1 
ATOM   3396  C  CB    . PRO A  1 436 ? 69.015  27.427  -61.783  1.00 35.15  ? 542 PRO A CB    1 
ATOM   3397  C  CG    . PRO A  1 436 ? 68.698  28.859  -61.707  1.00 34.97  ? 542 PRO A CG    1 
ATOM   3398  C  CD    . PRO A  1 436 ? 67.306  28.939  -61.222  1.00 35.38  ? 542 PRO A CD    1 
ATOM   3399  N  N     . GLU A  1 437 ? 68.014  24.322  -62.003  1.00 46.00  ? 543 GLU A N     1 
ATOM   3400  C  CA    . GLU A  1 437 ? 68.036  22.991  -61.400  1.00 48.39  ? 543 GLU A CA    1 
ATOM   3401  C  C     . GLU A  1 437 ? 69.310  22.849  -60.567  1.00 44.77  ? 543 GLU A C     1 
ATOM   3402  O  O     . GLU A  1 437 ? 69.254  22.442  -59.422  1.00 40.87  ? 543 GLU A O     1 
ATOM   3403  C  CB    . GLU A  1 437 ? 67.975  21.948  -62.511  1.00 56.51  ? 543 GLU A CB    1 
ATOM   3404  C  CG    . GLU A  1 437 ? 67.752  20.500  -62.062  1.00 63.27  ? 543 GLU A CG    1 
ATOM   3405  C  CD    . GLU A  1 437 ? 67.718  19.521  -63.251  1.00 68.63  ? 543 GLU A CD    1 
ATOM   3406  O  OE1   . GLU A  1 437 ? 68.245  19.855  -64.360  1.00 71.92  ? 543 GLU A OE1   1 
ATOM   3407  O  OE2   . GLU A  1 437 ? 67.166  18.394  -63.086  1.00 74.13  ? 543 GLU A OE2   1 
ATOM   3408  N  N     . LYS A  1 438 ? 70.441  23.196  -61.173  1.00 43.56  ? 544 LYS A N     1 
ATOM   3409  C  CA    . LYS A  1 438 ? 71.755  23.251  -60.526  1.00 42.42  ? 544 LYS A CA    1 
ATOM   3410  C  C     . LYS A  1 438 ? 72.140  24.699  -60.240  1.00 38.73  ? 544 LYS A C     1 
ATOM   3411  O  O     . LYS A  1 438 ? 71.533  25.631  -60.779  1.00 38.05  ? 544 LYS A O     1 
ATOM   3412  C  CB    . LYS A  1 438 ? 72.820  22.629  -61.444  1.00 44.55  ? 544 LYS A CB    1 
ATOM   3413  C  CG    . LYS A  1 438 ? 72.636  21.172  -61.792  1.00 48.45  ? 544 LYS A CG    1 
ATOM   3414  C  CD    . LYS A  1 438 ? 73.861  20.670  -62.582  1.00 52.00  ? 544 LYS A CD    1 
ATOM   3415  C  CE    . LYS A  1 438 ? 73.828  19.159  -62.811  1.00 56.02  ? 544 LYS A CE    1 
ATOM   3416  N  NZ    . LYS A  1 438 ? 74.767  18.803  -63.912  1.00 58.23  ? 544 LYS A NZ    1 
ATOM   3417  N  N     . PHE A  1 439 ? 73.140  24.888  -59.384  1.00 35.99  ? 545 PHE A N     1 
ATOM   3418  C  CA    . PHE A  1 439 ? 73.674  26.231  -59.088  1.00 34.81  ? 545 PHE A CA    1 
ATOM   3419  C  C     . PHE A  1 439 ? 75.173  26.392  -59.331  1.00 33.28  ? 545 PHE A C     1 
ATOM   3420  O  O     . PHE A  1 439 ? 75.788  27.332  -58.852  1.00 32.35  ? 545 PHE A O     1 
ATOM   3421  C  CB    . PHE A  1 439 ? 73.304  26.647  -57.670  1.00 35.32  ? 545 PHE A CB    1 
ATOM   3422  C  CG    . PHE A  1 439 ? 71.843  26.662  -57.448  1.00 35.29  ? 545 PHE A CG    1 
ATOM   3423  C  CD1   . PHE A  1 439 ? 71.187  25.511  -57.066  1.00 35.73  ? 545 PHE A CD1   1 
ATOM   3424  C  CD2   . PHE A  1 439 ? 71.120  27.806  -57.639  1.00 35.07  ? 545 PHE A CD2   1 
ATOM   3425  C  CE1   . PHE A  1 439 ? 69.824  25.510  -56.848  1.00 35.35  ? 545 PHE A CE1   1 
ATOM   3426  C  CE2   . PHE A  1 439 ? 69.734  27.799  -57.568  1.00 35.02  ? 545 PHE A CE2   1 
ATOM   3427  C  CZ    . PHE A  1 439 ? 69.089  26.658  -57.128  1.00 35.49  ? 545 PHE A CZ    1 
ATOM   3428  N  N     . ALA A  1 440 ? 75.751  25.445  -60.070  1.00 32.03  ? 546 ALA A N     1 
ATOM   3429  C  CA    . ALA A  1 440 ? 77.118  25.559  -60.527  1.00 31.31  ? 546 ALA A CA    1 
ATOM   3430  C  C     . ALA A  1 440 ? 77.316  24.733  -61.792  1.00 31.18  ? 546 ALA A C     1 
ATOM   3431  O  O     . ALA A  1 440 ? 76.654  23.743  -62.011  1.00 32.31  ? 546 ALA A O     1 
ATOM   3432  C  CB    . ALA A  1 440 ? 78.052  25.116  -59.437  1.00 31.46  ? 546 ALA A CB    1 
ATOM   3433  N  N     . GLU A  1 441 ? 78.282  25.164  -62.589  1.00 30.83  ? 547 GLU A N     1 
ATOM   3434  C  CA    . GLU A  1 441 ? 78.695  24.449  -63.789  1.00 30.65  ? 547 GLU A CA    1 
ATOM   3435  C  C     . GLU A  1 441 ? 80.083  24.889  -64.167  1.00 30.85  ? 547 GLU A C     1 
ATOM   3436  O  O     . GLU A  1 441 ? 80.631  25.805  -63.558  1.00 30.34  ? 547 GLU A O     1 
ATOM   3437  C  CB    . GLU A  1 441 ? 77.716  24.705  -64.932  1.00 30.35  ? 547 GLU A CB    1 
ATOM   3438  C  CG    . GLU A  1 441 ? 77.607  26.162  -65.337  1.00 30.20  ? 547 GLU A CG    1 
ATOM   3439  C  CD    . GLU A  1 441 ? 76.620  26.455  -66.450  1.00 30.51  ? 547 GLU A CD    1 
ATOM   3440  O  OE1   . GLU A  1 441 ? 76.137  25.485  -67.081  1.00 30.31  ? 547 GLU A OE1   1 
ATOM   3441  O  OE2   . GLU A  1 441 ? 76.344  27.672  -66.690  1.00 30.71  ? 547 GLU A OE2   1 
ATOM   3442  N  N     . GLN A  1 442 ? 80.645  24.232  -65.176  1.00 32.17  ? 548 GLN A N     1 
ATOM   3443  C  CA    . GLN A  1 442 ? 81.962  24.574  -65.676  1.00 32.98  ? 548 GLN A CA    1 
ATOM   3444  C  C     . GLN A  1 442 ? 81.914  24.877  -67.144  1.00 32.70  ? 548 GLN A C     1 
ATOM   3445  O  O     . GLN A  1 442 ? 81.193  24.238  -67.881  1.00 32.59  ? 548 GLN A O     1 
ATOM   3446  C  CB    . GLN A  1 442 ? 82.915  23.414  -65.418  1.00 34.52  ? 548 GLN A CB    1 
ATOM   3447  C  CG    . GLN A  1 442 ? 83.458  23.412  -64.016  1.00 36.07  ? 548 GLN A CG    1 
ATOM   3448  C  CD    . GLN A  1 442 ? 84.361  22.277  -63.707  1.00 37.86  ? 548 GLN A CD    1 
ATOM   3449  O  OE1   . GLN A  1 442 ? 84.022  21.108  -63.913  1.00 41.16  ? 548 GLN A OE1   1 
ATOM   3450  N  NE2   . GLN A  1 442 ? 85.558  22.608  -63.238  1.00 38.14  ? 548 GLN A NE2   1 
ATOM   3451  N  N     . LEU A  1 443 ? 82.715  25.848  -67.554  1.00 32.55  ? 549 LEU A N     1 
ATOM   3452  C  CA    . LEU A  1 443 ? 82.907  26.167  -68.964  1.00 32.85  ? 549 LEU A CA    1 
ATOM   3453  C  C     . LEU A  1 443 ? 84.354  25.951  -69.296  1.00 31.22  ? 549 LEU A C     1 
ATOM   3454  O  O     . LEU A  1 443 ? 85.231  26.385  -68.548  1.00 31.67  ? 549 LEU A O     1 
ATOM   3455  C  CB    . LEU A  1 443 ? 82.550  27.616  -69.244  1.00 35.10  ? 549 LEU A CB    1 
ATOM   3456  C  CG    . LEU A  1 443 ? 81.139  28.013  -68.853  1.00 38.60  ? 549 LEU A CG    1 
ATOM   3457  C  CD1   . LEU A  1 443 ? 80.865  29.481  -69.183  1.00 39.17  ? 549 LEU A CD1   1 
ATOM   3458  C  CD2   . LEU A  1 443 ? 80.089  27.104  -69.506  1.00 41.13  ? 549 LEU A CD2   1 
ATOM   3459  N  N     . ILE A  1 444 ? 84.592  25.297  -70.424  1.00 28.73  ? 550 ILE A N     1 
ATOM   3460  C  CA    . ILE A  1 444 ? 85.933  25.012  -70.888  1.00 27.44  ? 550 ILE A CA    1 
ATOM   3461  C  C     . ILE A  1 444 ? 86.126  25.681  -72.220  1.00 26.43  ? 550 ILE A C     1 
ATOM   3462  O  O     . ILE A  1 444 ? 85.494  25.315  -73.185  1.00 25.86  ? 550 ILE A O     1 
ATOM   3463  C  CB    . ILE A  1 444 ? 86.173  23.501  -71.039  1.00 27.53  ? 550 ILE A CB    1 
ATOM   3464  C  CG1   . ILE A  1 444 ? 85.855  22.766  -69.743  1.00 27.53  ? 550 ILE A CG1   1 
ATOM   3465  C  CG2   . ILE A  1 444 ? 87.616  23.243  -71.395  1.00 27.74  ? 550 ILE A CG2   1 
ATOM   3466  C  CD1   . ILE A  1 444 ? 85.518  21.324  -69.921  1.00 27.95  ? 550 ILE A CD1   1 
ATOM   3467  N  N     . ARG A  1 445 ? 86.999  26.676  -72.252  1.00 26.50  ? 551 ARG A N     1 
ATOM   3468  C  CA    . ARG A  1 445 ? 87.354  27.383  -73.475  1.00 27.04  ? 551 ARG A CA    1 
ATOM   3469  C  C     . ARG A  1 445 ? 88.720  26.912  -73.911  1.00 26.53  ? 551 ARG A C     1 
ATOM   3470  O  O     . ARG A  1 445 ? 89.628  26.845  -73.103  1.00 26.41  ? 551 ARG A O     1 
ATOM   3471  C  CB    . ARG A  1 445 ? 87.402  28.902  -73.231  1.00 27.79  ? 551 ARG A CB    1 
ATOM   3472  C  CG    . ARG A  1 445 ? 86.053  29.619  -73.255  1.00 28.33  ? 551 ARG A CG    1 
ATOM   3473  C  CD    . ARG A  1 445 ? 85.365  29.538  -71.912  1.00 29.12  ? 551 ARG A CD    1 
ATOM   3474  N  NE    . ARG A  1 445 ? 84.198  30.415  -71.829  1.00 29.48  ? 551 ARG A NE    1 
ATOM   3475  C  CZ    . ARG A  1 445 ? 84.245  31.711  -71.574  1.00 29.85  ? 551 ARG A CZ    1 
ATOM   3476  N  NH1   . ARG A  1 445 ? 85.426  32.354  -71.415  1.00 31.13  ? 551 ARG A NH1   1 
ATOM   3477  N  NH2   . ARG A  1 445 ? 83.106  32.394  -71.520  1.00 29.31  ? 551 ARG A NH2   1 
ATOM   3478  N  N     . VAL A  1 446 ? 88.864  26.617  -75.190  1.00 26.28  ? 552 VAL A N     1 
ATOM   3479  C  CA    . VAL A  1 446 ? 90.133  26.199  -75.758  1.00 26.88  ? 552 VAL A CA    1 
ATOM   3480  C  C     . VAL A  1 446 ? 90.561  27.254  -76.767  1.00 27.11  ? 552 VAL A C     1 
ATOM   3481  O  O     . VAL A  1 446 ? 89.772  27.687  -77.593  1.00 26.95  ? 552 VAL A O     1 
ATOM   3482  C  CB    . VAL A  1 446 ? 90.004  24.833  -76.447  1.00 27.07  ? 552 VAL A CB    1 
ATOM   3483  C  CG1   . VAL A  1 446 ? 91.315  24.423  -77.098  1.00 27.02  ? 552 VAL A CG1   1 
ATOM   3484  C  CG2   . VAL A  1 446 ? 89.555  23.784  -75.455  1.00 27.29  ? 552 VAL A CG2   1 
ATOM   3485  N  N     . TYR A  1 447 ? 91.818  27.666  -76.692  1.00 28.22  ? 553 TYR A N     1 
ATOM   3486  C  CA    . TYR A  1 447 ? 92.393  28.597  -77.653  1.00 29.39  ? 553 TYR A CA    1 
ATOM   3487  C  C     . TYR A  1 447 ? 93.643  27.970  -78.242  1.00 31.46  ? 553 TYR A C     1 
ATOM   3488  O  O     . TYR A  1 447 ? 94.162  27.011  -77.696  1.00 31.92  ? 553 TYR A O     1 
ATOM   3489  C  CB    . TYR A  1 447 ? 92.759  29.932  -76.995  1.00 29.26  ? 553 TYR A CB    1 
ATOM   3490  C  CG    . TYR A  1 447 ? 91.689  30.586  -76.132  1.00 28.64  ? 553 TYR A CG    1 
ATOM   3491  C  CD1   . TYR A  1 447 ? 91.401  30.085  -74.871  1.00 28.86  ? 553 TYR A CD1   1 
ATOM   3492  C  CD2   . TYR A  1 447 ? 91.026  31.744  -76.536  1.00 28.18  ? 553 TYR A CD2   1 
ATOM   3493  C  CE1   . TYR A  1 447 ? 90.465  30.683  -74.041  1.00 29.30  ? 553 TYR A CE1   1 
ATOM   3494  C  CE2   . TYR A  1 447 ? 90.080  32.357  -75.714  1.00 28.07  ? 553 TYR A CE2   1 
ATOM   3495  C  CZ    . TYR A  1 447 ? 89.795  31.812  -74.469  1.00 29.12  ? 553 TYR A CZ    1 
ATOM   3496  O  OH    . TYR A  1 447 ? 88.871  32.352  -73.561  1.00 30.72  ? 553 TYR A OH    1 
ATOM   3497  N  N     . CYS A  1 448 ? 94.132  28.529  -79.344  1.00 33.88  ? 554 CYS A N     1 
ATOM   3498  C  CA    . CYS A  1 448 ? 95.351  28.048  -79.991  1.00 36.57  ? 554 CYS A CA    1 
ATOM   3499  C  C     . CYS A  1 448 ? 96.318  29.192  -80.164  1.00 36.69  ? 554 CYS A C     1 
ATOM   3500  O  O     . CYS A  1 448 ? 95.922  30.238  -80.665  1.00 37.17  ? 554 CYS A O     1 
ATOM   3501  C  CB    . CYS A  1 448 ? 95.003  27.460  -81.361  1.00 38.77  ? 554 CYS A CB    1 
ATOM   3502  S  SG    . CYS A  1 448 ? 96.459  26.939  -82.297  1.00 42.74  ? 554 CYS A SG    1 
ATOM   3503  N  N     . LYS A  1 449 ? 97.575  28.999  -79.768  1.00 36.94  ? 555 LYS A N     1 
ATOM   3504  C  CA    . LYS A  1 449 ? 98.599  30.052  -79.884  1.00 37.56  ? 555 LYS A CA    1 
ATOM   3505  C  C     . LYS A  1 449 ? 99.068  30.301  -81.308  1.00 37.95  ? 555 LYS A C     1 
ATOM   3506  O  O     . LYS A  1 449 ? 99.556  31.391  -81.591  1.00 39.78  ? 555 LYS A O     1 
ATOM   3507  C  CB    . LYS A  1 449 ? 99.810  29.752  -79.005  1.00 38.65  ? 555 LYS A CB    1 
ATOM   3508  C  CG    . LYS A  1 449 ? 99.537  29.836  -77.515  1.00 39.13  ? 555 LYS A CG    1 
ATOM   3509  C  CD    . LYS A  1 449 ? 100.817 29.731  -76.700  1.00 40.18  ? 555 LYS A CD    1 
ATOM   3510  C  CE    . LYS A  1 449 ? 100.510 29.733  -75.213  1.00 42.02  ? 555 LYS A CE    1 
ATOM   3511  N  NZ    . LYS A  1 449 ? 101.650 29.353  -74.356  1.00 43.83  ? 555 LYS A NZ    1 
ATOM   3512  N  N     . LYS A  1 450 ? 98.944  29.317  -82.194  1.00 39.05  ? 556 LYS A N     1 
ATOM   3513  C  CA    . LYS A  1 450 ? 99.266  29.510  -83.598  1.00 42.81  ? 556 LYS A CA    1 
ATOM   3514  C  C     . LYS A  1 450 ? 98.052  30.092  -84.326  1.00 45.51  ? 556 LYS A C     1 
ATOM   3515  O  O     . LYS A  1 450 ? 96.951  29.533  -84.298  1.00 47.03  ? 556 LYS A O     1 
ATOM   3516  C  CB    . LYS A  1 450 ? 99.763  28.215  -84.221  1.00 45.39  ? 556 LYS A CB    1 
ATOM   3517  C  CG    . LYS A  1 450 ? 101.106 27.781  -83.647  1.00 47.86  ? 556 LYS A CG    1 
ATOM   3518  C  CD    . LYS A  1 450 ? 101.692 26.582  -84.353  1.00 50.76  ? 556 LYS A CD    1 
ATOM   3519  C  CE    . LYS A  1 450 ? 103.058 26.239  -83.739  1.00 52.39  ? 556 LYS A CE    1 
ATOM   3520  N  NZ    . LYS A  1 450 ? 103.549 24.907  -84.255  1.00 55.82  ? 556 LYS A NZ    1 
ATOM   3521  N  N     . VAL A  1 451 ? 98.288  31.228  -84.986  1.00 49.61  ? 557 VAL A N     1 
ATOM   3522  C  CA    . VAL A  1 451 ? 97.237  32.100  -85.517  1.00 52.66  ? 557 VAL A CA    1 
ATOM   3523  C  C     . VAL A  1 451 ? 96.799  31.746  -86.950  1.00 51.93  ? 557 VAL A C     1 
ATOM   3524  O  O     . VAL A  1 451 ? 95.629  31.934  -87.286  1.00 58.03  ? 557 VAL A O     1 
ATOM   3525  C  CB    . VAL A  1 451 ? 97.719  33.581  -85.462  1.00 57.18  ? 557 VAL A CB    1 
ATOM   3526  C  CG1   . VAL A  1 451 ? 96.671  34.561  -86.025  1.00 59.22  ? 557 VAL A CG1   1 
ATOM   3527  C  CG2   . VAL A  1 451 ? 98.044  33.973  -84.014  1.00 58.34  ? 557 VAL A CG2   1 
ATOM   3528  N  N     . ASP A  1 452 ? 97.718  31.244  -87.768  1.00 51.02  ? 558 ASP A N     1 
ATOM   3529  C  CA    . ASP A  1 452 ? 97.501  30.971  -89.216  1.00 51.58  ? 558 ASP A CA    1 
ATOM   3530  C  C     . ASP A  1 452 ? 96.314  30.070  -89.592  1.00 49.26  ? 558 ASP A C     1 
ATOM   3531  O  O     . ASP A  1 452 ? 95.856  29.277  -88.787  1.00 47.93  ? 558 ASP A O     1 
ATOM   3532  C  CB    . ASP A  1 452 ? 98.800  30.400  -89.819  1.00 53.29  ? 558 ASP A CB    1 
ATOM   3533  C  CG    . ASP A  1 452 ? 99.194  29.065  -89.205  1.00 52.75  ? 558 ASP A CG    1 
ATOM   3534  O  OD1   . ASP A  1 452 ? 99.583  28.989  -88.016  1.00 51.15  ? 558 ASP A OD1   1 
ATOM   3535  O  OD2   . ASP A  1 452 ? 99.101  28.071  -89.942  1.00 53.40  ? 558 ASP A OD2   1 
ATOM   3536  N  N     . ARG A  1 453 ? 95.844  30.207  -90.840  1.00 48.73  ? 559 ARG A N     1 
ATOM   3537  C  CA    . ARG A  1 453 ? 94.657  29.492  -91.356  1.00 45.95  ? 559 ARG A CA    1 
ATOM   3538  C  C     . ARG A  1 453 ? 94.778  27.957  -91.204  1.00 43.99  ? 559 ARG A C     1 
ATOM   3539  O  O     . ARG A  1 453 ? 93.804  27.298  -90.818  1.00 41.93  ? 559 ARG A O     1 
ATOM   3540  C  CB    . ARG A  1 453 ? 94.355  29.900  -92.812  1.00 45.22  ? 559 ARG A CB    1 
ATOM   3541  N  N     . LYS A  1 454 ? 95.970  27.408  -91.467  1.00 43.93  ? 560 LYS A N     1 
ATOM   3542  C  CA    . LYS A  1 454 ? 96.207  25.951  -91.446  1.00 45.30  ? 560 LYS A CA    1 
ATOM   3543  C  C     . LYS A  1 454 ? 96.167  25.388  -90.017  1.00 46.11  ? 560 LYS A C     1 
ATOM   3544  O  O     . LYS A  1 454 ? 95.553  24.348  -89.785  1.00 47.18  ? 560 LYS A O     1 
ATOM   3545  C  CB    . LYS A  1 454 ? 97.531  25.566  -92.151  1.00 44.26  ? 560 LYS A CB    1 
ATOM   3546  N  N     . SER A  1 455 ? 96.798  26.076  -89.070  1.00 47.06  ? 561 SER A N     1 
ATOM   3547  C  CA    . SER A  1 455 ? 96.855  25.618  -87.666  1.00 48.22  ? 561 SER A CA    1 
ATOM   3548  C  C     . SER A  1 455 ? 95.512  25.725  -86.951  1.00 49.46  ? 561 SER A C     1 
ATOM   3549  O  O     . SER A  1 455 ? 95.172  24.886  -86.121  1.00 49.56  ? 561 SER A O     1 
ATOM   3550  C  CB    . SER A  1 455 ? 97.941  26.388  -86.884  1.00 47.70  ? 561 SER A CB    1 
ATOM   3551  O  OG    . SER A  1 455 ? 99.195  26.169  -87.491  1.00 48.81  ? 561 SER A OG    1 
ATOM   3552  N  N     . LEU A  1 456 ? 94.757  26.763  -87.279  1.00 50.72  ? 562 LEU A N     1 
ATOM   3553  C  CA    . LEU A  1 456 ? 93.421  26.958  -86.720  1.00 48.51  ? 562 LEU A CA    1 
ATOM   3554  C  C     . LEU A  1 456 ? 92.468  25.838  -87.147  1.00 44.82  ? 562 LEU A C     1 
ATOM   3555  O  O     . LEU A  1 456 ? 91.693  25.349  -86.327  1.00 41.01  ? 562 LEU A O     1 
ATOM   3556  C  CB    . LEU A  1 456 ? 92.869  28.324  -87.122  1.00 50.68  ? 562 LEU A CB    1 
ATOM   3557  C  CG    . LEU A  1 456 ? 91.570  28.803  -86.459  1.00 54.01  ? 562 LEU A CG    1 
ATOM   3558  C  CD1   . LEU A  1 456 ? 91.547  28.648  -84.952  1.00 55.29  ? 562 LEU A CD1   1 
ATOM   3559  C  CD2   . LEU A  1 456 ? 91.301  30.267  -86.798  1.00 55.16  ? 562 LEU A CD2   1 
ATOM   3560  N  N     . TYR A  1 457 ? 92.532  25.430  -88.419  1.00 44.55  ? 563 TYR A N     1 
ATOM   3561  C  CA    . TYR A  1 457 ? 91.744  24.277  -88.894  1.00 44.51  ? 563 TYR A CA    1 
ATOM   3562  C  C     . TYR A  1 457 ? 92.087  23.025  -88.072  1.00 43.40  ? 563 TYR A C     1 
ATOM   3563  O  O     . TYR A  1 457 ? 91.191  22.302  -87.609  1.00 43.94  ? 563 TYR A O     1 
ATOM   3564  C  CB    . TYR A  1 457 ? 91.939  23.999  -90.400  1.00 44.97  ? 563 TYR A CB    1 
ATOM   3565  C  CG    . TYR A  1 457 ? 91.189  22.741  -90.883  1.00 45.30  ? 563 TYR A CG    1 
ATOM   3566  C  CD1   . TYR A  1 457 ? 89.823  22.787  -91.183  1.00 46.27  ? 563 TYR A CD1   1 
ATOM   3567  C  CD2   . TYR A  1 457 ? 91.846  21.503  -91.009  1.00 45.18  ? 563 TYR A CD2   1 
ATOM   3568  C  CE1   . TYR A  1 457 ? 89.139  21.655  -91.601  1.00 47.47  ? 563 TYR A CE1   1 
ATOM   3569  C  CE2   . TYR A  1 457 ? 91.175  20.375  -91.427  1.00 46.73  ? 563 TYR A CE2   1 
ATOM   3570  C  CZ    . TYR A  1 457 ? 89.814  20.448  -91.724  1.00 48.49  ? 563 TYR A CZ    1 
ATOM   3571  O  OH    . TYR A  1 457 ? 89.114  19.338  -92.139  1.00 51.03  ? 563 TYR A OH    1 
ATOM   3572  N  N     . ALA A  1 458 ? 93.376  22.791  -87.890  1.00 40.97  ? 564 ALA A N     1 
ATOM   3573  C  CA    . ALA A  1 458 ? 93.848  21.634  -87.148  1.00 40.32  ? 564 ALA A CA    1 
ATOM   3574  C  C     . ALA A  1 458 ? 93.370  21.662  -85.719  1.00 40.41  ? 564 ALA A C     1 
ATOM   3575  O  O     . ALA A  1 458 ? 92.838  20.669  -85.218  1.00 41.25  ? 564 ALA A O     1 
ATOM   3576  C  CB    . ALA A  1 458 ? 95.380  21.575  -87.179  1.00 41.27  ? 564 ALA A CB    1 
ATOM   3577  N  N     . ALA A  1 459 ? 93.566  22.811  -85.081  1.00 40.21  ? 565 ALA A N     1 
ATOM   3578  C  CA    . ALA A  1 459 ? 93.158  23.033  -83.689  1.00 39.76  ? 565 ALA A CA    1 
ATOM   3579  C  C     . ALA A  1 459 ? 91.689  22.689  -83.472  1.00 39.11  ? 565 ALA A C     1 
ATOM   3580  O  O     . ALA A  1 459 ? 91.352  22.013  -82.507  1.00 39.23  ? 565 ALA A O     1 
ATOM   3581  C  CB    . ALA A  1 459 ? 93.430  24.476  -83.283  1.00 39.53  ? 565 ALA A CB    1 
ATOM   3582  N  N     . ARG A  1 460 ? 90.833  23.132  -84.389  1.00 38.03  ? 566 ARG A N     1 
ATOM   3583  C  CA    . ARG A  1 460 ? 89.400  22.818  -84.345  1.00 36.99  ? 566 ARG A CA    1 
ATOM   3584  C  C     . ARG A  1 460 ? 89.106  21.329  -84.365  1.00 36.36  ? 566 ARG A C     1 
ATOM   3585  O  O     . ARG A  1 460 ? 88.187  20.872  -83.686  1.00 36.25  ? 566 ARG A O     1 
ATOM   3586  C  CB    . ARG A  1 460 ? 88.663  23.486  -85.503  1.00 37.93  ? 566 ARG A CB    1 
ATOM   3587  C  CG    . ARG A  1 460 ? 88.412  24.960  -85.287  1.00 39.12  ? 566 ARG A CG    1 
ATOM   3588  C  CD    . ARG A  1 460 ? 88.234  25.724  -86.593  1.00 40.81  ? 566 ARG A CD    1 
ATOM   3589  N  NE    . ARG A  1 460 ? 87.881  27.128  -86.320  1.00 41.99  ? 566 ARG A NE    1 
ATOM   3590  C  CZ    . ARG A  1 460 ? 87.866  28.105  -87.221  1.00 42.92  ? 566 ARG A CZ    1 
ATOM   3591  N  NH1   . ARG A  1 460 ? 88.177  27.877  -88.490  1.00 42.91  ? 566 ARG A NH1   1 
ATOM   3592  N  NH2   . ARG A  1 460 ? 87.514  29.321  -86.839  1.00 45.14  ? 566 ARG A NH2   1 
ATOM   3593  N  N     . GLN A  1 461 ? 89.875  20.580  -85.155  1.00 35.96  ? 567 GLN A N     1 
ATOM   3594  C  CA    . GLN A  1 461 ? 89.688  19.132  -85.251  1.00 35.74  ? 567 GLN A CA    1 
ATOM   3595  C  C     . GLN A  1 461 ? 90.122  18.460  -83.954  1.00 36.33  ? 567 GLN A C     1 
ATOM   3596  O  O     . GLN A  1 461 ? 89.390  17.635  -83.413  1.00 38.13  ? 567 GLN A O     1 
ATOM   3597  C  CB    . GLN A  1 461 ? 90.433  18.538  -86.453  1.00 35.06  ? 567 GLN A CB    1 
ATOM   3598  C  CG    . GLN A  1 461 ? 90.177  19.182  -87.806  1.00 34.36  ? 567 GLN A CG    1 
ATOM   3599  C  CD    . GLN A  1 461 ? 88.716  19.501  -88.095  1.00 32.66  ? 567 GLN A CD    1 
ATOM   3600  O  OE1   . GLN A  1 461 ? 87.849  18.622  -88.077  1.00 31.66  ? 567 GLN A OE1   1 
ATOM   3601  N  NE2   . GLN A  1 461 ? 88.452  20.762  -88.407  1.00 31.00  ? 567 GLN A NE2   1 
ATOM   3602  N  N     . TYR A  1 462 ? 91.295  18.821  -83.445  1.00 36.43  ? 568 TYR A N     1 
ATOM   3603  C  CA    . TYR A  1 462 ? 91.746  18.327  -82.146  1.00 37.97  ? 568 TYR A CA    1 
ATOM   3604  C  C     . TYR A  1 462 ? 90.713  18.589  -81.053  1.00 36.51  ? 568 TYR A C     1 
ATOM   3605  O  O     . TYR A  1 462 ? 90.384  17.703  -80.267  1.00 36.82  ? 568 TYR A O     1 
ATOM   3606  C  CB    . TYR A  1 462 ? 93.061  18.981  -81.756  1.00 41.64  ? 568 TYR A CB    1 
ATOM   3607  C  CG    . TYR A  1 462 ? 94.292  18.502  -82.502  1.00 46.24  ? 568 TYR A CG    1 
ATOM   3608  C  CD1   . TYR A  1 462 ? 94.716  17.166  -82.418  1.00 50.06  ? 568 TYR A CD1   1 
ATOM   3609  C  CD2   . TYR A  1 462 ? 95.058  19.378  -83.249  1.00 47.99  ? 568 TYR A CD2   1 
ATOM   3610  C  CE1   . TYR A  1 462 ? 95.857  16.737  -83.093  1.00 50.90  ? 568 TYR A CE1   1 
ATOM   3611  C  CE2   . TYR A  1 462 ? 96.214  18.971  -83.896  1.00 50.39  ? 568 TYR A CE2   1 
ATOM   3612  C  CZ    . TYR A  1 462 ? 96.621  17.652  -83.804  1.00 51.92  ? 568 TYR A CZ    1 
ATOM   3613  O  OH    . TYR A  1 462 ? 97.778  17.228  -84.395  1.00 56.51  ? 568 TYR A OH    1 
ATOM   3614  N  N     . PHE A  1 463 ? 90.195  19.810  -81.023  1.00 35.38  ? 569 PHE A N     1 
ATOM   3615  C  CA    . PHE A  1 463 ? 89.237  20.235  -80.006  1.00 34.84  ? 569 PHE A CA    1 
ATOM   3616  C  C     . PHE A  1 463 ? 87.929  19.447  -80.074  1.00 36.13  ? 569 PHE A C     1 
ATOM   3617  O  O     . PHE A  1 463 ? 87.502  18.878  -79.071  1.00 37.57  ? 569 PHE A O     1 
ATOM   3618  C  CB    . PHE A  1 463 ? 88.977  21.749  -80.105  1.00 33.53  ? 569 PHE A CB    1 
ATOM   3619  C  CG    . PHE A  1 463 ? 87.816  22.231  -79.275  1.00 33.03  ? 569 PHE A CG    1 
ATOM   3620  C  CD1   . PHE A  1 463 ? 87.832  22.077  -77.892  1.00 32.88  ? 569 PHE A CD1   1 
ATOM   3621  C  CD2   . PHE A  1 463 ? 86.709  22.831  -79.869  1.00 32.42  ? 569 PHE A CD2   1 
ATOM   3622  C  CE1   . PHE A  1 463 ? 86.761  22.510  -77.127  1.00 32.93  ? 569 PHE A CE1   1 
ATOM   3623  C  CE2   . PHE A  1 463 ? 85.638  23.266  -79.096  1.00 32.30  ? 569 PHE A CE2   1 
ATOM   3624  C  CZ    . PHE A  1 463 ? 85.670  23.102  -77.721  1.00 32.59  ? 569 PHE A CZ    1 
ATOM   3625  N  N     . VAL A  1 464 ? 87.296  19.400  -81.243  1.00 37.01  ? 570 VAL A N     1 
ATOM   3626  C  CA    . VAL A  1 464 ? 85.982  18.760  -81.364  1.00 37.82  ? 570 VAL A CA    1 
ATOM   3627  C  C     . VAL A  1 464 ? 86.090  17.262  -81.115  1.00 37.86  ? 570 VAL A C     1 
ATOM   3628  O  O     . VAL A  1 464 ? 85.129  16.643  -80.649  1.00 41.31  ? 570 VAL A O     1 
ATOM   3629  C  CB    . VAL A  1 464 ? 85.309  19.054  -82.723  1.00 39.54  ? 570 VAL A CB    1 
ATOM   3630  C  CG1   . VAL A  1 464 ? 83.988  18.297  -82.880  1.00 40.93  ? 570 VAL A CG1   1 
ATOM   3631  C  CG2   . VAL A  1 464 ? 85.042  20.541  -82.869  1.00 39.85  ? 570 VAL A CG2   1 
ATOM   3632  N  N     . GLN A  1 465 ? 87.253  16.692  -81.414  1.00 36.76  ? 571 GLN A N     1 
ATOM   3633  C  CA    . GLN A  1 465 ? 87.532  15.289  -81.099  1.00 36.49  ? 571 GLN A CA    1 
ATOM   3634  C  C     . GLN A  1 465 ? 87.642  15.129  -79.598  1.00 34.70  ? 571 GLN A C     1 
ATOM   3635  O  O     . GLN A  1 465 ? 86.922  14.336  -79.007  1.00 33.71  ? 571 GLN A O     1 
ATOM   3636  C  CB    . GLN A  1 465 ? 88.821  14.800  -81.788  1.00 37.07  ? 571 GLN A CB    1 
ATOM   3637  C  CG    . GLN A  1 465 ? 89.051  13.291  -81.729  1.00 37.92  ? 571 GLN A CG    1 
ATOM   3638  C  CD    . GLN A  1 465 ? 87.964  12.496  -82.414  1.00 39.17  ? 571 GLN A CD    1 
ATOM   3639  O  OE1   . GLN A  1 465 ? 87.696  12.684  -83.596  1.00 42.27  ? 571 GLN A OE1   1 
ATOM   3640  N  NE2   . GLN A  1 465 ? 87.314  11.633  -81.670  1.00 39.63  ? 571 GLN A NE2   1 
ATOM   3641  N  N     . TRP A  1 466 ? 88.527  15.907  -78.989  1.00 33.46  ? 572 TRP A N     1 
ATOM   3642  C  CA    . TRP A  1 466 ? 88.728  15.888  -77.542  1.00 34.02  ? 572 TRP A CA    1 
ATOM   3643  C  C     . TRP A  1 466 ? 87.420  15.983  -76.756  1.00 36.00  ? 572 TRP A C     1 
ATOM   3644  O  O     . TRP A  1 466 ? 87.281  15.360  -75.698  1.00 36.26  ? 572 TRP A O     1 
ATOM   3645  C  CB    . TRP A  1 466 ? 89.657  17.026  -77.136  1.00 32.86  ? 572 TRP A CB    1 
ATOM   3646  C  CG    . TRP A  1 466 ? 89.910  17.131  -75.665  1.00 31.80  ? 572 TRP A CG    1 
ATOM   3647  C  CD1   . TRP A  1 466 ? 90.587  16.259  -74.888  1.00 31.78  ? 572 TRP A CD1   1 
ATOM   3648  C  CD2   . TRP A  1 466 ? 89.499  18.195  -74.808  1.00 30.73  ? 572 TRP A CD2   1 
ATOM   3649  N  NE1   . TRP A  1 466 ? 90.630  16.703  -73.595  1.00 31.00  ? 572 TRP A NE1   1 
ATOM   3650  C  CE2   . TRP A  1 466 ? 89.974  17.896  -73.519  1.00 30.81  ? 572 TRP A CE2   1 
ATOM   3651  C  CE3   . TRP A  1 466 ? 88.775  19.386  -75.007  1.00 30.17  ? 572 TRP A CE3   1 
ATOM   3652  C  CZ2   . TRP A  1 466 ? 89.739  18.730  -72.430  1.00 31.01  ? 572 TRP A CZ2   1 
ATOM   3653  C  CZ3   . TRP A  1 466 ? 88.550  20.207  -73.917  1.00 29.75  ? 572 TRP A CZ3   1 
ATOM   3654  C  CH2   . TRP A  1 466 ? 89.035  19.879  -72.653  1.00 30.57  ? 572 TRP A CH2   1 
ATOM   3655  N  N     . CYS A  1 467 ? 86.478  16.767  -77.281  1.00 37.65  ? 573 CYS A N     1 
ATOM   3656  C  CA    . CYS A  1 467 ? 85.126  16.859  -76.728  1.00 38.27  ? 573 CYS A CA    1 
ATOM   3657  C  C     . CYS A  1 467 ? 84.380  15.525  -76.820  1.00 39.97  ? 573 CYS A C     1 
ATOM   3658  O  O     . CYS A  1 467 ? 83.762  15.092  -75.852  1.00 41.93  ? 573 CYS A O     1 
ATOM   3659  C  CB    . CYS A  1 467 ? 84.319  17.958  -77.430  1.00 38.32  ? 573 CYS A CB    1 
ATOM   3660  S  SG    . CYS A  1 467 ? 84.858  19.647  -77.139  1.00 36.78  ? 573 CYS A SG    1 
ATOM   3661  N  N     . ALA A  1 468 ? 84.429  14.888  -77.980  1.00 42.18  ? 574 ALA A N     1 
ATOM   3662  C  CA    . ALA A  1 468 ? 83.819  13.567  -78.147  1.00 45.77  ? 574 ALA A CA    1 
ATOM   3663  C  C     . ALA A  1 468 ? 84.509  12.515  -77.263  1.00 47.38  ? 574 ALA A C     1 
ATOM   3664  O  O     . ALA A  1 468 ? 83.843  11.705  -76.636  1.00 50.83  ? 574 ALA A O     1 
ATOM   3665  C  CB    . ALA A  1 468 ? 83.846  13.147  -79.612  1.00 46.11  ? 574 ALA A CB    1 
ATOM   3666  N  N     . ASP A  1 469 ? 85.836  12.561  -77.208  1.00 47.46  ? 575 ASP A N     1 
ATOM   3667  C  CA    . ASP A  1 469 ? 86.647  11.636  -76.404  1.00 48.82  ? 575 ASP A CA    1 
ATOM   3668  C  C     . ASP A  1 469 ? 86.270  11.664  -74.928  1.00 46.00  ? 575 ASP A C     1 
ATOM   3669  O  O     . ASP A  1 469 ? 86.233  10.622  -74.296  1.00 45.49  ? 575 ASP A O     1 
ATOM   3670  C  CB    . ASP A  1 469 ? 88.159  11.918  -76.544  1.00 52.24  ? 575 ASP A CB    1 
ATOM   3671  C  CG    . ASP A  1 469 ? 88.726  11.559  -77.926  1.00 55.46  ? 575 ASP A CG    1 
ATOM   3672  O  OD1   . ASP A  1 469 ? 88.005  10.976  -78.761  1.00 56.85  ? 575 ASP A OD1   1 
ATOM   3673  O  OD2   . ASP A  1 469 ? 89.920  11.863  -78.180  1.00 59.02  ? 575 ASP A OD2   1 
ATOM   3674  N  N     . ARG A  1 470 ? 85.977  12.844  -74.386  1.00 44.41  ? 576 ARG A N     1 
ATOM   3675  C  CA    . ARG A  1 470 ? 85.692  12.984  -72.950  1.00 46.28  ? 576 ARG A CA    1 
ATOM   3676  C  C     . ARG A  1 470 ? 84.207  13.092  -72.600  1.00 46.96  ? 576 ARG A C     1 
ATOM   3677  O  O     . ARG A  1 470 ? 83.842  13.426  -71.462  1.00 47.86  ? 576 ARG A O     1 
ATOM   3678  C  CB    . ARG A  1 470 ? 86.482  14.158  -72.390  1.00 46.88  ? 576 ARG A CB    1 
ATOM   3679  C  CG    . ARG A  1 470 ? 87.815  13.771  -71.797  1.00 49.00  ? 576 ARG A CG    1 
ATOM   3680  C  CD    . ARG A  1 470 ? 88.594  15.021  -71.490  1.00 50.67  ? 576 ARG A CD    1 
ATOM   3681  N  NE    . ARG A  1 470 ? 89.279  15.054  -70.200  1.00 52.18  ? 576 ARG A NE    1 
ATOM   3682  C  CZ    . ARG A  1 470 ? 88.698  15.026  -69.009  1.00 51.54  ? 576 ARG A CZ    1 
ATOM   3683  N  NH1   . ARG A  1 470 ? 87.380  14.861  -68.876  1.00 50.78  ? 576 ARG A NH1   1 
ATOM   3684  N  NH2   . ARG A  1 470 ? 89.466  15.136  -67.927  1.00 52.76  ? 576 ARG A NH2   1 
ATOM   3685  N  N     . ASN A  1 471 ? 83.356  12.761  -73.566  1.00 48.63  ? 577 ASN A N     1 
ATOM   3686  C  CA    . ASN A  1 471 ? 81.902  12.864  -73.444  1.00 48.53  ? 577 ASN A CA    1 
ATOM   3687  C  C     . ASN A  1 471 ? 81.426  14.245  -72.957  1.00 45.97  ? 577 ASN A C     1 
ATOM   3688  O  O     . ASN A  1 471 ? 80.534  14.353  -72.115  1.00 49.80  ? 577 ASN A O     1 
ATOM   3689  C  CB    . ASN A  1 471 ? 81.372  11.725  -72.580  1.00 51.75  ? 577 ASN A CB    1 
ATOM   3690  C  CG    . ASN A  1 471 ? 79.972  11.278  -72.994  1.00 54.68  ? 577 ASN A CG    1 
ATOM   3691  O  OD1   . ASN A  1 471 ? 79.625  11.289  -74.157  1.00 54.28  ? 577 ASN A OD1   1 
ATOM   3692  N  ND2   . ASN A  1 471 ? 79.164  10.877  -72.034  1.00 59.58  ? 577 ASN A ND2   1 
ATOM   3693  N  N     . PHE A  1 472 ? 82.041  15.291  -73.501  1.00 42.14  ? 578 PHE A N     1 
ATOM   3694  C  CA    . PHE A  1 472 ? 81.616  16.677  -73.281  1.00 40.11  ? 578 PHE A CA    1 
ATOM   3695  C  C     . PHE A  1 472 ? 80.500  17.061  -74.249  1.00 38.66  ? 578 PHE A C     1 
ATOM   3696  O  O     . PHE A  1 472 ? 80.160  16.306  -75.140  1.00 39.84  ? 578 PHE A O     1 
ATOM   3697  C  CB    . PHE A  1 472 ? 82.806  17.644  -73.433  1.00 39.27  ? 578 PHE A CB    1 
ATOM   3698  C  CG    . PHE A  1 472 ? 83.874  17.523  -72.363  1.00 38.71  ? 578 PHE A CG    1 
ATOM   3699  C  CD1   . PHE A  1 472 ? 83.662  16.841  -71.159  1.00 39.12  ? 578 PHE A CD1   1 
ATOM   3700  C  CD2   . PHE A  1 472 ? 85.110  18.147  -72.552  1.00 37.65  ? 578 PHE A CD2   1 
ATOM   3701  C  CE1   . PHE A  1 472 ? 84.659  16.780  -70.194  1.00 39.36  ? 578 PHE A CE1   1 
ATOM   3702  C  CE2   . PHE A  1 472 ? 86.104  18.086  -71.594  1.00 36.74  ? 578 PHE A CE2   1 
ATOM   3703  C  CZ    . PHE A  1 472 ? 85.879  17.404  -70.426  1.00 38.03  ? 578 PHE A CZ    1 
ATOM   3704  N  N     . THR A  1 473 ? 79.923  18.242  -74.039  1.00 37.62  ? 579 THR A N     1 
ATOM   3705  C  CA    . THR A  1 473 ? 78.838  18.751  -74.883  1.00 39.11  ? 579 THR A CA    1 
ATOM   3706  C  C     . THR A  1 473 ? 79.377  19.136  -76.236  1.00 40.67  ? 579 THR A C     1 
ATOM   3707  O  O     . THR A  1 473 ? 80.546  19.509  -76.367  1.00 42.75  ? 579 THR A O     1 
ATOM   3708  C  CB    . THR A  1 473 ? 78.127  19.979  -74.281  1.00 39.32  ? 579 THR A CB    1 
ATOM   3709  O  OG1   . THR A  1 473 ? 79.086  20.998  -73.971  1.00 39.99  ? 579 THR A OG1   1 
ATOM   3710  C  CG2   . THR A  1 473 ? 77.347  19.580  -73.016  1.00 39.64  ? 579 THR A CG2   1 
ATOM   3711  N  N     . LYS A  1 474 ? 78.515  19.033  -77.244  1.00 41.07  ? 580 LYS A N     1 
ATOM   3712  C  CA    . LYS A  1 474 ? 78.872  19.401  -78.607  1.00 39.20  ? 580 LYS A CA    1 
ATOM   3713  C  C     . LYS A  1 474 ? 79.073  20.905  -78.672  1.00 37.34  ? 580 LYS A C     1 
ATOM   3714  O  O     . LYS A  1 474 ? 78.191  21.650  -78.266  1.00 35.13  ? 580 LYS A O     1 
ATOM   3715  C  CB    . LYS A  1 474 ? 77.762  19.016  -79.584  1.00 39.58  ? 580 LYS A CB    1 
ATOM   3716  C  CG    . LYS A  1 474 ? 78.197  19.099  -81.043  1.00 40.69  ? 580 LYS A CG    1 
ATOM   3717  C  CD    . LYS A  1 474 ? 77.108  18.620  -82.007  1.00 40.44  ? 580 LYS A CD    1 
ATOM   3718  C  CE    . LYS A  1 474 ? 76.329  19.786  -82.572  1.00 40.04  ? 580 LYS A CE    1 
ATOM   3719  N  NZ    . LYS A  1 474 ? 75.157  19.294  -83.335  1.00 40.49  ? 580 LYS A NZ    1 
ATOM   3720  N  N     . PRO A  1 475 ? 80.236  21.358  -79.175  1.00 36.49  ? 581 PRO A N     1 
ATOM   3721  C  CA    . PRO A  1 475 ? 80.385  22.783  -79.410  1.00 36.47  ? 581 PRO A CA    1 
ATOM   3722  C  C     . PRO A  1 475 ? 79.248  23.326  -80.278  1.00 36.60  ? 581 PRO A C     1 
ATOM   3723  O  O     . PRO A  1 475 ? 78.817  22.658  -81.207  1.00 35.70  ? 581 PRO A O     1 
ATOM   3724  C  CB    . PRO A  1 475 ? 81.723  22.862  -80.148  1.00 36.85  ? 581 PRO A CB    1 
ATOM   3725  C  CG    . PRO A  1 475 ? 82.506  21.730  -79.580  1.00 36.95  ? 581 PRO A CG    1 
ATOM   3726  C  CD    . PRO A  1 475 ? 81.514  20.643  -79.363  1.00 37.06  ? 581 PRO A CD    1 
ATOM   3727  N  N     . GLN A  1 476 ? 78.757  24.518  -79.944  1.00 37.68  ? 582 GLN A N     1 
ATOM   3728  C  CA    . GLN A  1 476 ? 77.620  25.137  -80.656  1.00 39.09  ? 582 GLN A CA    1 
ATOM   3729  C  C     . GLN A  1 476 ? 77.816  25.172  -82.160  1.00 39.22  ? 582 GLN A C     1 
ATOM   3730  O  O     . GLN A  1 476 ? 76.939  24.789  -82.912  1.00 39.38  ? 582 GLN A O     1 
ATOM   3731  C  CB    . GLN A  1 476 ? 77.356  26.556  -80.104  1.00 39.63  ? 582 GLN A CB    1 
ATOM   3732  C  CG    . GLN A  1 476 ? 76.720  26.500  -78.707  1.00 39.79  ? 582 GLN A CG    1 
ATOM   3733  C  CD    . GLN A  1 476 ? 76.561  27.830  -78.046  1.00 39.44  ? 582 GLN A CD    1 
ATOM   3734  O  OE1   . GLN A  1 476 ? 76.826  28.898  -78.638  1.00 39.46  ? 582 GLN A OE1   1 
ATOM   3735  N  NE2   . GLN A  1 476 ? 76.150  27.773  -76.789  1.00 37.66  ? 582 GLN A NE2   1 
ATOM   3736  N  N     . ASP A  1 477 ? 79.004  25.610  -82.555  1.00 40.82  ? 583 ASP A N     1 
ATOM   3737  C  CA    . ASP A  1 477 ? 79.428  25.669  -83.973  1.00 41.74  ? 583 ASP A CA    1 
ATOM   3738  C  C     . ASP A  1 477 ? 80.074  24.378  -84.498  1.00 40.05  ? 583 ASP A C     1 
ATOM   3739  O  O     . ASP A  1 477 ? 80.713  24.396  -85.546  1.00 38.08  ? 583 ASP A O     1 
ATOM   3740  C  CB    . ASP A  1 477 ? 80.369  26.885  -84.185  1.00 44.52  ? 583 ASP A CB    1 
ATOM   3741  C  CG    . ASP A  1 477 ? 81.701  26.791  -83.382  1.00 46.99  ? 583 ASP A CG    1 
ATOM   3742  O  OD1   . ASP A  1 477 ? 81.870  25.937  -82.475  1.00 46.49  ? 583 ASP A OD1   1 
ATOM   3743  O  OD2   . ASP A  1 477 ? 82.591  27.621  -83.664  1.00 50.02  ? 583 ASP A OD2   1 
ATOM   3744  N  N     . GLY A  1 478 ? 79.874  23.256  -83.804  1.00 40.16  ? 584 GLY A N     1 
ATOM   3745  C  CA    . GLY A  1 478 ? 80.681  22.046  -84.007  1.00 40.28  ? 584 GLY A CA    1 
ATOM   3746  C  C     . GLY A  1 478 ? 80.507  21.405  -85.373  1.00 40.65  ? 584 GLY A C     1 
ATOM   3747  O  O     . GLY A  1 478 ? 81.489  20.941  -85.967  1.00 42.20  ? 584 GLY A O     1 
ATOM   3748  N  N     . ASP A  1 479 ? 79.267  21.391  -85.869  1.00 41.28  ? 585 ASP A N     1 
ATOM   3749  C  CA    . ASP A  1 479 ? 78.971  20.832  -87.176  1.00 42.61  ? 585 ASP A CA    1 
ATOM   3750  C  C     . ASP A  1 479 ? 79.618  21.603  -88.315  1.00 42.12  ? 585 ASP A C     1 
ATOM   3751  O  O     . ASP A  1 479 ? 79.861  21.044  -89.388  1.00 43.39  ? 585 ASP A O     1 
ATOM   3752  C  CB    . ASP A  1 479 ? 77.471  20.766  -87.440  1.00 44.61  ? 585 ASP A CB    1 
ATOM   3753  C  CG    . ASP A  1 479 ? 76.753  19.838  -86.488  1.00 47.19  ? 585 ASP A CG    1 
ATOM   3754  O  OD1   . ASP A  1 479 ? 77.279  18.738  -86.179  1.00 50.20  ? 585 ASP A OD1   1 
ATOM   3755  O  OD2   . ASP A  1 479 ? 75.654  20.224  -86.036  1.00 48.16  ? 585 ASP A OD2   1 
ATOM   3756  N  N     . VAL A  1 480 ? 79.870  22.895  -88.086  1.00 39.00  ? 586 VAL A N     1 
ATOM   3757  C  CA    . VAL A  1 480 ? 80.508  23.746  -89.078  1.00 38.15  ? 586 VAL A CA    1 
ATOM   3758  C  C     . VAL A  1 480 ? 82.038  23.608  -89.047  1.00 36.40  ? 586 VAL A C     1 
ATOM   3759  O  O     . VAL A  1 480 ? 82.649  23.359  -90.080  1.00 36.38  ? 586 VAL A O     1 
ATOM   3760  C  CB    . VAL A  1 480 ? 80.068  25.209  -88.888  1.00 38.91  ? 586 VAL A CB    1 
ATOM   3761  C  CG1   . VAL A  1 480 ? 80.878  26.161  -89.772  1.00 40.20  ? 586 VAL A CG1   1 
ATOM   3762  C  CG2   . VAL A  1 480 ? 78.578  25.345  -89.214  1.00 38.77  ? 586 VAL A CG2   1 
ATOM   3763  N  N     . ILE A  1 481 ? 82.640  23.780  -87.874  1.00 35.27  ? 587 ILE A N     1 
ATOM   3764  C  CA    . ILE A  1 481 ? 84.113  23.792  -87.750  1.00 35.76  ? 587 ILE A CA    1 
ATOM   3765  C  C     . ILE A  1 481 ? 84.791  22.440  -87.944  1.00 36.99  ? 587 ILE A C     1 
ATOM   3766  O  O     . ILE A  1 481 ? 85.958  22.396  -88.343  1.00 38.09  ? 587 ILE A O     1 
ATOM   3767  C  CB    . ILE A  1 481 ? 84.631  24.419  -86.419  1.00 34.97  ? 587 ILE A CB    1 
ATOM   3768  C  CG1   . ILE A  1 481 ? 84.084  23.708  -85.171  1.00 33.88  ? 587 ILE A CG1   1 
ATOM   3769  C  CG2   . ILE A  1 481 ? 84.311  25.906  -86.394  1.00 34.98  ? 587 ILE A CG2   1 
ATOM   3770  C  CD1   . ILE A  1 481 ? 84.873  24.007  -83.902  1.00 33.07  ? 587 ILE A CD1   1 
ATOM   3771  N  N     . ALA A  1 482 ? 84.073  21.359  -87.644  1.00 37.27  ? 588 ALA A N     1 
ATOM   3772  C  CA    . ALA A  1 482 ? 84.607  20.008  -87.768  1.00 39.32  ? 588 ALA A CA    1 
ATOM   3773  C  C     . ALA A  1 482 ? 83.492  19.064  -88.218  1.00 41.09  ? 588 ALA A C     1 
ATOM   3774  O  O     . ALA A  1 482 ? 83.028  18.227  -87.437  1.00 43.32  ? 588 ALA A O     1 
ATOM   3775  C  CB    . ALA A  1 482 ? 85.188  19.561  -86.446  1.00 40.12  ? 588 ALA A CB    1 
ATOM   3776  N  N     . PRO A  1 483 ? 83.053  19.198  -89.484  1.00 43.10  ? 589 PRO A N     1 
ATOM   3777  C  CA    . PRO A  1 483 ? 81.901  18.445  -89.982  1.00 43.95  ? 589 PRO A CA    1 
ATOM   3778  C  C     . PRO A  1 483 ? 82.192  16.941  -90.161  1.00 44.90  ? 589 PRO A C     1 
ATOM   3779  O  O     . PRO A  1 483 ? 81.240  16.144  -90.155  1.00 42.22  ? 589 PRO A O     1 
ATOM   3780  C  CB    . PRO A  1 483 ? 81.595  19.109  -91.318  1.00 44.47  ? 589 PRO A CB    1 
ATOM   3781  C  CG    . PRO A  1 483 ? 82.919  19.616  -91.779  1.00 45.30  ? 589 PRO A CG    1 
ATOM   3782  C  CD    . PRO A  1 483 ? 83.745  19.927  -90.558  1.00 44.65  ? 589 PRO A CD    1 
ATOM   3783  N  N     . LEU A  1 484 ? 83.468  16.590  -90.297  1.00 46.82  ? 590 LEU A N     1 
ATOM   3784  C  CA    . LEU A  1 484 ? 83.887  15.202  -90.404  1.00 47.83  ? 590 LEU A CA    1 
ATOM   3785  C  C     . LEU A  1 484 ? 83.932  14.467  -89.054  1.00 47.93  ? 590 LEU A C     1 
ATOM   3786  O  O     . LEU A  1 484 ? 83.891  13.254  -89.029  1.00 48.05  ? 590 LEU A O     1 
ATOM   3787  C  CB    . LEU A  1 484 ? 85.278  15.116  -91.106  1.00 49.06  ? 590 LEU A CB    1 
ATOM   3788  C  CG    . LEU A  1 484 ? 85.249  15.695  -92.545  1.00 50.68  ? 590 LEU A CG    1 
ATOM   3789  C  CD1   . LEU A  1 484 ? 86.613  16.078  -93.071  1.00 52.07  ? 590 LEU A CD1   1 
ATOM   3790  C  CD2   . LEU A  1 484 ? 84.473  14.809  -93.518  1.00 50.39  ? 590 LEU A CD2   1 
ATOM   3791  N  N     . ILE A  1 485 ? 83.999  15.219  -87.951  1.00 49.77  ? 591 ILE A N     1 
ATOM   3792  C  CA    . ILE A  1 485 ? 84.138  14.640  -86.598  1.00 51.08  ? 591 ILE A CA    1 
ATOM   3793  C  C     . ILE A  1 485 ? 82.805  14.482  -85.839  1.00 51.73  ? 591 ILE A C     1 
ATOM   3794  O  O     . ILE A  1 485 ? 82.651  13.521  -85.098  1.00 53.42  ? 591 ILE A O     1 
ATOM   3795  C  CB    . ILE A  1 485 ? 85.156  15.429  -85.759  1.00 51.28  ? 591 ILE A CB    1 
ATOM   3796  C  CG1   . ILE A  1 485 ? 86.531  15.320  -86.435  1.00 54.03  ? 591 ILE A CG1   1 
ATOM   3797  C  CG2   . ILE A  1 485 ? 85.229  14.907  -84.334  1.00 50.35  ? 591 ILE A CG2   1 
ATOM   3798  C  CD1   . ILE A  1 485 ? 87.603  16.238  -85.879  1.00 56.51  ? 591 ILE A CD1   1 
ATOM   3799  N  N     . THR A  1 486 ? 81.862  15.406  -86.014  1.00 51.34  ? 592 THR A N     1 
ATOM   3800  C  CA    . THR A  1 486 ? 80.604  15.377  -85.249  1.00 50.25  ? 592 THR A CA    1 
ATOM   3801  C  C     . THR A  1 486 ? 79.664  14.169  -85.478  1.00 52.80  ? 592 THR A C     1 
ATOM   3802  O  O     . THR A  1 486 ? 78.980  13.759  -84.537  1.00 51.55  ? 592 THR A O     1 
ATOM   3803  C  CB    . THR A  1 486 ? 79.776  16.673  -85.423  1.00 47.70  ? 592 THR A CB    1 
ATOM   3804  O  OG1   . THR A  1 486 ? 79.533  16.896  -86.815  1.00 49.84  ? 592 THR A OG1   1 
ATOM   3805  C  CG2   . THR A  1 486 ? 80.486  17.868  -84.849  1.00 45.52  ? 592 THR A CG2   1 
ATOM   3806  N  N     . PRO A  1 487 ? 79.602  13.605  -86.705  1.00 57.63  ? 593 PRO A N     1 
ATOM   3807  C  CA    . PRO A  1 487 ? 78.750  12.398  -86.802  1.00 58.92  ? 593 PRO A CA    1 
ATOM   3808  C  C     . PRO A  1 487 ? 79.325  11.163  -86.059  1.00 59.70  ? 593 PRO A C     1 
ATOM   3809  O  O     . PRO A  1 487 ? 78.530  10.321  -85.631  1.00 58.12  ? 593 PRO A O     1 
ATOM   3810  C  CB    . PRO A  1 487 ? 78.658  12.148  -88.308  1.00 61.11  ? 593 PRO A CB    1 
ATOM   3811  C  CG    . PRO A  1 487 ? 79.867  12.828  -88.890  1.00 62.41  ? 593 PRO A CG    1 
ATOM   3812  C  CD    . PRO A  1 487 ? 80.109  14.027  -88.036  1.00 59.81  ? 593 PRO A CD    1 
ATOM   3813  N  N     . GLN A  1 488 ? 80.658  11.076  -85.883  1.00 60.59  ? 594 GLN A N     1 
ATOM   3814  C  CA    . GLN A  1 488 ? 81.307  10.013  -85.100  1.00 61.25  ? 594 GLN A CA    1 
ATOM   3815  C  C     . GLN A  1 488 ? 80.614  9.686   -83.764  1.00 63.60  ? 594 GLN A C     1 
ATOM   3816  O  O     . GLN A  1 488 ? 80.500  8.524   -83.397  1.00 62.91  ? 594 GLN A O     1 
ATOM   3817  C  CB    . GLN A  1 488 ? 82.788  10.359  -84.827  1.00 59.05  ? 594 GLN A CB    1 
ATOM   3818  N  N     . LYS A  1 489 ? 80.178  10.714  -83.035  1.00 69.05  ? 595 LYS A N     1 
ATOM   3819  C  CA    . LYS A  1 489 ? 79.561  10.531  -81.714  1.00 70.05  ? 595 LYS A CA    1 
ATOM   3820  C  C     . LYS A  1 489 ? 78.049  10.280  -81.822  1.00 69.86  ? 595 LYS A C     1 
ATOM   3821  O  O     . LYS A  1 489 ? 77.300  11.153  -82.295  1.00 66.03  ? 595 LYS A O     1 
ATOM   3822  C  CB    . LYS A  1 489 ? 79.837  11.764  -80.847  1.00 69.94  ? 595 LYS A CB    1 
ATOM   3823  C  CG    . LYS A  1 489 ? 79.559  11.556  -79.358  1.00 69.99  ? 595 LYS A CG    1 
ATOM   3824  C  CD    . LYS A  1 489 ? 80.840  11.317  -78.588  1.00 68.68  ? 595 LYS A CD    1 
ATOM   3825  C  CE    . LYS A  1 489 ? 80.641  11.495  -77.120  1.00 67.62  ? 595 LYS A CE    1 
ATOM   3826  N  NZ    . LYS A  1 489 ? 80.079  10.236  -76.533  1.00 69.71  ? 595 LYS A NZ    1 
ATOM   3827  N  N     . LYS A  1 490 ? 77.622  9.092   -81.381  1.00 72.16  ? 596 LYS A N     1 
ATOM   3828  C  CA    . LYS A  1 490 ? 76.195  8.681   -81.381  1.00 70.96  ? 596 LYS A CA    1 
ATOM   3829  C  C     . LYS A  1 490 ? 75.347  9.630   -80.531  1.00 68.09  ? 596 LYS A C     1 
ATOM   3830  O  O     . LYS A  1 490 ? 74.253  10.026  -80.941  1.00 63.99  ? 596 LYS A O     1 
ATOM   3831  C  CB    . LYS A  1 490 ? 76.036  7.233   -80.866  1.00 68.08  ? 596 LYS A CB    1 
ATOM   3832  N  N     . GLU A  1 491 ? 75.885  10.011  -79.368  1.00 67.91  ? 597 GLU A N     1 
ATOM   3833  C  CA    . GLU A  1 491 ? 75.196  10.876  -78.413  1.00 68.13  ? 597 GLU A CA    1 
ATOM   3834  C  C     . GLU A  1 491 ? 74.813  12.276  -78.934  1.00 67.40  ? 597 GLU A C     1 
ATOM   3835  O  O     . GLU A  1 491 ? 73.885  12.863  -78.410  1.00 67.86  ? 597 GLU A O     1 
ATOM   3836  C  CB    . GLU A  1 491 ? 76.006  10.991  -77.105  1.00 68.44  ? 597 GLU A CB    1 
ATOM   3837  C  CG    . GLU A  1 491 ? 75.986  9.721   -76.252  1.00 71.40  ? 597 GLU A CG    1 
ATOM   3838  C  CD    . GLU A  1 491 ? 77.137  8.771   -76.471  1.00 74.80  ? 597 GLU A CD    1 
ATOM   3839  O  OE1   . GLU A  1 491 ? 77.719  8.747   -77.580  1.00 77.31  ? 597 GLU A OE1   1 
ATOM   3840  O  OE2   . GLU A  1 491 ? 77.480  8.040   -75.520  1.00 77.95  ? 597 GLU A OE2   1 
ATOM   3841  N  N     . TRP A  1 492 ? 75.513  12.796  -79.945  1.00 69.00  ? 598 TRP A N     1 
ATOM   3842  C  CA    . TRP A  1 492 ? 75.198  14.126  -80.528  1.00 67.78  ? 598 TRP A CA    1 
ATOM   3843  C  C     . TRP A  1 492 ? 74.114  14.128  -81.615  1.00 74.13  ? 598 TRP A C     1 
ATOM   3844  O  O     . TRP A  1 492 ? 73.703  15.188  -82.046  1.00 70.68  ? 598 TRP A O     1 
ATOM   3845  C  CB    . TRP A  1 492 ? 76.474  14.815  -81.062  1.00 63.38  ? 598 TRP A CB    1 
ATOM   3846  C  CG    . TRP A  1 492 ? 77.547  15.121  -79.986  1.00 58.55  ? 598 TRP A CG    1 
ATOM   3847  C  CD1   . TRP A  1 492 ? 77.370  15.122  -78.623  1.00 55.91  ? 598 TRP A CD1   1 
ATOM   3848  C  CD2   . TRP A  1 492 ? 78.914  15.512  -80.203  1.00 54.83  ? 598 TRP A CD2   1 
ATOM   3849  N  NE1   . TRP A  1 492 ? 78.524  15.452  -78.004  1.00 53.73  ? 598 TRP A NE1   1 
ATOM   3850  C  CE2   . TRP A  1 492 ? 79.492  15.708  -78.940  1.00 52.79  ? 598 TRP A CE2   1 
ATOM   3851  C  CE3   . TRP A  1 492 ? 79.701  15.712  -81.341  1.00 53.81  ? 598 TRP A CE3   1 
ATOM   3852  C  CZ2   . TRP A  1 492 ? 80.837  16.096  -78.773  1.00 51.65  ? 598 TRP A CZ2   1 
ATOM   3853  C  CZ3   . TRP A  1 492 ? 81.050  16.100  -81.172  1.00 52.63  ? 598 TRP A CZ3   1 
ATOM   3854  C  CH2   . TRP A  1 492 ? 81.592  16.272  -79.901  1.00 51.79  ? 598 TRP A CH2   1 
ATOM   3855  N  N     . ASN A  1 493 ? 73.627  12.954  -82.045  1.00 84.16  ? 599 ASN A N     1 
ATOM   3856  C  CA    . ASN A  1 493 ? 72.549  12.872  -83.062  1.00 89.45  ? 599 ASN A CA    1 
ATOM   3857  C  C     . ASN A  1 493 ? 71.201  12.569  -82.370  1.00 83.08  ? 599 ASN A C     1 
ATOM   3858  O  O     . ASN A  1 493 ? 70.202  13.138  -82.749  1.00 79.85  ? 599 ASN A O     1 
ATOM   3859  C  CB    . ASN A  1 493 ? 72.849  11.802  -84.091  1.00 96.34  ? 599 ASN A CB    1 
ATOM   3860  C  CG    . ASN A  1 493 ? 74.331  11.823  -84.557  1.00 100.43 ? 599 ASN A CG    1 
ATOM   3861  O  OD1   . ASN A  1 493 ? 74.928  12.893  -84.822  1.00 97.60  ? 599 ASN A OD1   1 
ATOM   3862  N  ND2   . ASN A  1 493 ? 74.924  10.639  -84.632  1.00 105.61 ? 599 ASN A ND2   1 
ATOM   3863  N  N     . THR B  1 8   ? 83.379  40.800  -93.642  1.00 72.23  ? 114 THR B N     1 
ATOM   3864  C  CA    . THR B  1 8   ? 82.250  41.347  -92.796  1.00 67.34  ? 114 THR B CA    1 
ATOM   3865  C  C     . THR B  1 8   ? 82.758  42.512  -91.877  1.00 65.34  ? 114 THR B C     1 
ATOM   3866  O  O     . THR B  1 8   ? 83.935  42.905  -91.897  1.00 70.64  ? 114 THR B O     1 
ATOM   3867  C  CB    . THR B  1 8   ? 81.507  40.201  -92.056  1.00 62.64  ? 114 THR B CB    1 
ATOM   3868  O  OG1   . THR B  1 8   ? 80.223  40.651  -91.634  1.00 59.82  ? 114 THR B OG1   1 
ATOM   3869  C  CG2   . THR B  1 8   ? 82.314  39.633  -90.868  1.00 61.49  ? 114 THR B CG2   1 
ATOM   3870  N  N     . MET B  1 9   ? 81.849  43.078  -91.086  1.00 55.28  ? 115 MET B N     1 
ATOM   3871  C  CA    . MET B  1 9   ? 82.079  44.268  -90.235  1.00 49.26  ? 115 MET B CA    1 
ATOM   3872  C  C     . MET B  1 9   ? 82.325  43.825  -88.800  1.00 44.32  ? 115 MET B C     1 
ATOM   3873  O  O     . MET B  1 9   ? 81.801  42.799  -88.346  1.00 41.60  ? 115 MET B O     1 
ATOM   3874  C  CB    . MET B  1 9   ? 80.810  45.130  -90.241  1.00 48.85  ? 115 MET B CB    1 
ATOM   3875  C  CG    . MET B  1 9   ? 80.511  45.812  -91.563  1.00 48.87  ? 115 MET B CG    1 
ATOM   3876  S  SD    . MET B  1 9   ? 81.193  47.452  -91.639  1.00 49.77  ? 115 MET B SD    1 
ATOM   3877  C  CE    . MET B  1 9   ? 81.225  47.800  -93.402  1.00 53.18  ? 115 MET B CE    1 
ATOM   3878  N  N     . LYS B  1 10  ? 83.094  44.617  -88.069  1.00 39.97  ? 116 LYS B N     1 
ATOM   3879  C  CA    . LYS B  1 10  ? 83.322  44.381  -86.652  1.00 37.04  ? 116 LYS B CA    1 
ATOM   3880  C  C     . LYS B  1 10  ? 82.434  45.277  -85.814  1.00 34.49  ? 116 LYS B C     1 
ATOM   3881  O  O     . LYS B  1 10  ? 82.338  46.460  -86.069  1.00 34.55  ? 116 LYS B O     1 
ATOM   3882  C  CB    . LYS B  1 10  ? 84.768  44.678  -86.304  1.00 37.05  ? 116 LYS B CB    1 
ATOM   3883  C  CG    . LYS B  1 10  ? 85.240  43.906  -85.107  1.00 36.34  ? 116 LYS B CG    1 
ATOM   3884  C  CD    . LYS B  1 10  ? 86.615  44.362  -84.691  1.00 35.22  ? 116 LYS B CD    1 
ATOM   3885  C  CE    . LYS B  1 10  ? 87.308  43.154  -84.172  1.00 35.35  ? 116 LYS B CE    1 
ATOM   3886  N  NZ    . LYS B  1 10  ? 88.713  43.439  -83.804  1.00 36.07  ? 116 LYS B NZ    1 
ATOM   3887  N  N     . VAL B  1 11  ? 81.793  44.702  -84.810  1.00 32.11  ? 117 VAL B N     1 
ATOM   3888  C  CA    . VAL B  1 11  ? 80.918  45.442  -83.924  1.00 29.62  ? 117 VAL B CA    1 
ATOM   3889  C  C     . VAL B  1 11  ? 81.620  45.634  -82.584  1.00 28.19  ? 117 VAL B C     1 
ATOM   3890  O  O     . VAL B  1 11  ? 82.241  44.714  -82.078  1.00 28.18  ? 117 VAL B O     1 
ATOM   3891  C  CB    . VAL B  1 11  ? 79.609  44.701  -83.697  1.00 29.02  ? 117 VAL B CB    1 
ATOM   3892  C  CG1   . VAL B  1 11  ? 78.681  45.516  -82.817  1.00 29.27  ? 117 VAL B CG1   1 
ATOM   3893  C  CG2   . VAL B  1 11  ? 78.920  44.440  -85.012  1.00 29.21  ? 117 VAL B CG2   1 
ATOM   3894  N  N     . ILE B  1 12  ? 81.467  46.820  -82.009  1.00 26.61  ? 118 ILE B N     1 
ATOM   3895  C  CA    . ILE B  1 12  ? 82.070  47.168  -80.731  1.00 25.33  ? 118 ILE B CA    1 
ATOM   3896  C  C     . ILE B  1 12  ? 81.083  47.984  -79.895  1.00 24.92  ? 118 ILE B C     1 
ATOM   3897  O  O     . ILE B  1 12  ? 80.417  48.861  -80.426  1.00 25.33  ? 118 ILE B O     1 
ATOM   3898  C  CB    . ILE B  1 12  ? 83.382  47.939  -80.962  1.00 24.65  ? 118 ILE B CB    1 
ATOM   3899  C  CG1   . ILE B  1 12  ? 84.132  48.130  -79.649  1.00 24.45  ? 118 ILE B CG1   1 
ATOM   3900  C  CG2   . ILE B  1 12  ? 83.133  49.290  -81.655  1.00 24.55  ? 118 ILE B CG2   1 
ATOM   3901  C  CD1   . ILE B  1 12  ? 85.536  48.620  -79.863  1.00 24.67  ? 118 ILE B CD1   1 
ATOM   3902  N  N     . ASN B  1 13  ? 80.986  47.696  -78.601  1.00 24.17  ? 119 ASN B N     1 
ATOM   3903  C  CA    . ASN B  1 13  ? 79.970  48.273  -77.721  1.00 23.67  ? 119 ASN B CA    1 
ATOM   3904  C  C     . ASN B  1 13  ? 80.482  49.405  -76.822  1.00 23.28  ? 119 ASN B C     1 
ATOM   3905  O  O     . ASN B  1 13  ? 81.046  49.198  -75.737  1.00 22.69  ? 119 ASN B O     1 
ATOM   3906  C  CB    . ASN B  1 13  ? 79.301  47.181  -76.885  1.00 24.14  ? 119 ASN B CB    1 
ATOM   3907  C  CG    . ASN B  1 13  ? 78.125  47.699  -76.052  1.00 24.36  ? 119 ASN B CG    1 
ATOM   3908  O  OD1   . ASN B  1 13  ? 77.969  48.900  -75.865  1.00 24.77  ? 119 ASN B OD1   1 
ATOM   3909  N  ND2   . ASN B  1 13  ? 77.310  46.786  -75.557  1.00 24.07  ? 119 ASN B ND2   1 
ATOM   3910  N  N     . ASP B  1 14  ? 80.220  50.611  -77.304  1.00 23.75  ? 120 ASP B N     1 
ATOM   3911  C  CA    . ASP B  1 14  ? 80.431  51.857  -76.580  1.00 24.81  ? 120 ASP B CA    1 
ATOM   3912  C  C     . ASP B  1 14  ? 79.195  52.157  -75.731  1.00 25.16  ? 120 ASP B C     1 
ATOM   3913  O  O     . ASP B  1 14  ? 78.084  52.069  -76.235  1.00 26.17  ? 120 ASP B O     1 
ATOM   3914  C  CB    . ASP B  1 14  ? 80.628  52.974  -77.597  1.00 25.76  ? 120 ASP B CB    1 
ATOM   3915  C  CG    . ASP B  1 14  ? 80.885  54.327  -76.961  1.00 26.56  ? 120 ASP B CG    1 
ATOM   3916  O  OD1   . ASP B  1 14  ? 81.754  54.440  -76.082  1.00 27.76  ? 120 ASP B OD1   1 
ATOM   3917  O  OD2   . ASP B  1 14  ? 80.231  55.306  -77.378  1.00 27.35  ? 120 ASP B OD2   1 
ATOM   3918  N  N     . PRO B  1 15  ? 79.369  52.521  -74.453  1.00 25.05  ? 121 PRO B N     1 
ATOM   3919  C  CA    . PRO B  1 15  ? 78.206  52.812  -73.628  1.00 25.00  ? 121 PRO B CA    1 
ATOM   3920  C  C     . PRO B  1 15  ? 77.453  54.069  -73.985  1.00 24.92  ? 121 PRO B C     1 
ATOM   3921  O  O     . PRO B  1 15  ? 76.330  54.221  -73.532  1.00 26.40  ? 121 PRO B O     1 
ATOM   3922  C  CB    . PRO B  1 15  ? 78.803  52.995  -72.229  1.00 25.33  ? 121 PRO B CB    1 
ATOM   3923  C  CG    . PRO B  1 15  ? 80.166  53.509  -72.506  1.00 25.46  ? 121 PRO B CG    1 
ATOM   3924  C  CD    . PRO B  1 15  ? 80.600  52.633  -73.657  1.00 25.59  ? 121 PRO B CD    1 
ATOM   3925  N  N     . ILE B  1 16  ? 78.058  54.979  -74.733  1.00 24.31  ? 122 ILE B N     1 
ATOM   3926  C  CA    . ILE B  1 16  ? 77.358  56.187  -75.163  1.00 23.74  ? 122 ILE B CA    1 
ATOM   3927  C  C     . ILE B  1 16  ? 76.554  55.904  -76.393  1.00 23.64  ? 122 ILE B C     1 
ATOM   3928  O  O     . ILE B  1 16  ? 75.387  56.171  -76.398  1.00 24.69  ? 122 ILE B O     1 
ATOM   3929  C  CB    . ILE B  1 16  ? 78.309  57.339  -75.481  1.00 23.73  ? 122 ILE B CB    1 
ATOM   3930  C  CG1   . ILE B  1 16  ? 79.250  57.610  -74.297  1.00 24.13  ? 122 ILE B CG1   1 
ATOM   3931  C  CG2   . ILE B  1 16  ? 77.537  58.595  -75.800  1.00 23.59  ? 122 ILE B CG2   1 
ATOM   3932  C  CD1   . ILE B  1 16  ? 78.574  57.746  -72.926  1.00 23.64  ? 122 ILE B CD1   1 
ATOM   3933  N  N     . HIS B  1 17  ? 77.184  55.379  -77.432  1.00 23.37  ? 123 HIS B N     1 
ATOM   3934  C  CA    . HIS B  1 17  ? 76.567  55.293  -78.758  1.00 23.14  ? 123 HIS B CA    1 
ATOM   3935  C  C     . HIS B  1 17  ? 75.958  53.964  -79.111  1.00 23.49  ? 123 HIS B C     1 
ATOM   3936  O  O     . HIS B  1 17  ? 75.237  53.881  -80.119  1.00 24.55  ? 123 HIS B O     1 
ATOM   3937  C  CB    . HIS B  1 17  ? 77.582  55.647  -79.824  1.00 22.75  ? 123 HIS B CB    1 
ATOM   3938  C  CG    . HIS B  1 17  ? 78.099  57.021  -79.685  1.00 22.56  ? 123 HIS B CG    1 
ATOM   3939  N  ND1   . HIS B  1 17  ? 77.278  58.113  -79.633  1.00 22.65  ? 123 HIS B ND1   1 
ATOM   3940  C  CD2   . HIS B  1 17  ? 79.352  57.485  -79.526  1.00 22.84  ? 123 HIS B CD2   1 
ATOM   3941  C  CE1   . HIS B  1 17  ? 78.011  59.205  -79.481  1.00 22.91  ? 123 HIS B CE1   1 
ATOM   3942  N  NE2   . HIS B  1 17  ? 79.271  58.854  -79.411  1.00 22.74  ? 123 HIS B NE2   1 
ATOM   3943  N  N     . GLY B  1 18  ? 76.234  52.937  -78.331  1.00 23.40  ? 124 GLY B N     1 
ATOM   3944  C  CA    . GLY B  1 18  ? 75.641  51.627  -78.569  1.00 24.28  ? 124 GLY B CA    1 
ATOM   3945  C  C     . GLY B  1 18  ? 76.603  50.753  -79.320  1.00 25.09  ? 124 GLY B C     1 
ATOM   3946  O  O     . GLY B  1 18  ? 77.808  50.888  -79.138  1.00 25.17  ? 124 GLY B O     1 
ATOM   3947  N  N     . HIS B  1 19  ? 76.080  49.863  -80.159  1.00 26.11  ? 125 HIS B N     1 
ATOM   3948  C  CA    . HIS B  1 19  ? 76.918  48.963  -80.954  1.00 26.52  ? 125 HIS B CA    1 
ATOM   3949  C  C     . HIS B  1 19  ? 77.338  49.650  -82.249  1.00 25.87  ? 125 HIS B C     1 
ATOM   3950  O  O     . HIS B  1 19  ? 76.552  49.795  -83.168  1.00 25.25  ? 125 HIS B O     1 
ATOM   3951  C  CB    . HIS B  1 19  ? 76.179  47.662  -81.211  1.00 27.91  ? 125 HIS B CB    1 
ATOM   3952  C  CG    . HIS B  1 19  ? 76.078  46.796  -79.998  1.00 29.47  ? 125 HIS B CG    1 
ATOM   3953  N  ND1   . HIS B  1 19  ? 75.401  47.187  -78.858  1.00 30.36  ? 125 HIS B ND1   1 
ATOM   3954  C  CD2   . HIS B  1 19  ? 76.584  45.559  -79.739  1.00 30.26  ? 125 HIS B CD2   1 
ATOM   3955  C  CE1   . HIS B  1 19  ? 75.488  46.217  -77.955  1.00 30.74  ? 125 HIS B CE1   1 
ATOM   3956  N  NE2   . HIS B  1 19  ? 76.204  45.223  -78.462  1.00 30.11  ? 125 HIS B NE2   1 
ATOM   3957  N  N     . ILE B  1 20  ? 78.581  50.100  -82.283  1.00 26.00  ? 126 ILE B N     1 
ATOM   3958  C  CA    . ILE B  1 20  ? 79.164  50.736  -83.438  1.00 26.54  ? 126 ILE B CA    1 
ATOM   3959  C  C     . ILE B  1 20  ? 79.668  49.654  -84.413  1.00 28.23  ? 126 ILE B C     1 
ATOM   3960  O  O     . ILE B  1 20  ? 80.276  48.676  -83.987  1.00 27.17  ? 126 ILE B O     1 
ATOM   3961  C  CB    . ILE B  1 20  ? 80.367  51.577  -82.999  1.00 26.12  ? 126 ILE B CB    1 
ATOM   3962  C  CG1   . ILE B  1 20  ? 79.904  52.715  -82.114  1.00 25.72  ? 126 ILE B CG1   1 
ATOM   3963  C  CG2   . ILE B  1 20  ? 81.090  52.179  -84.207  1.00 26.92  ? 126 ILE B CG2   1 
ATOM   3964  C  CD1   . ILE B  1 20  ? 81.056  53.391  -81.384  1.00 25.81  ? 126 ILE B CD1   1 
ATOM   3965  N  N     . GLU B  1 21  ? 79.434  49.846  -85.715  1.00 30.79  ? 127 GLU B N     1 
ATOM   3966  C  CA    . GLU B  1 21  ? 80.051  49.015  -86.742  1.00 32.30  ? 127 GLU B CA    1 
ATOM   3967  C  C     . GLU B  1 21  ? 81.345  49.656  -87.216  1.00 31.52  ? 127 GLU B C     1 
ATOM   3968  O  O     . GLU B  1 21  ? 81.396  50.851  -87.447  1.00 30.94  ? 127 GLU B O     1 
ATOM   3969  C  CB    . GLU B  1 21  ? 79.104  48.801  -87.915  1.00 35.10  ? 127 GLU B CB    1 
ATOM   3970  C  CG    . GLU B  1 21  ? 77.911  47.920  -87.548  1.00 38.30  ? 127 GLU B CG    1 
ATOM   3971  C  CD    . GLU B  1 21  ? 77.101  47.401  -88.727  1.00 43.28  ? 127 GLU B CD    1 
ATOM   3972  O  OE1   . GLU B  1 21  ? 76.989  48.160  -89.717  1.00 49.07  ? 127 GLU B OE1   1 
ATOM   3973  O  OE2   . GLU B  1 21  ? 76.598  46.232  -88.671  1.00 46.91  ? 127 GLU B OE2   1 
ATOM   3974  N  N     . LEU B  1 22  ? 82.395  48.850  -87.344  1.00 31.06  ? 128 LEU B N     1 
ATOM   3975  C  CA    . LEU B  1 22  ? 83.708  49.316  -87.793  1.00 30.38  ? 128 LEU B CA    1 
ATOM   3976  C  C     . LEU B  1 22  ? 84.116  48.619  -89.086  1.00 30.08  ? 128 LEU B C     1 
ATOM   3977  O  O     . LEU B  1 22  ? 84.261  47.379  -89.152  1.00 28.99  ? 128 LEU B O     1 
ATOM   3978  C  CB    . LEU B  1 22  ? 84.766  49.057  -86.729  1.00 30.59  ? 128 LEU B CB    1 
ATOM   3979  C  CG    . LEU B  1 22  ? 84.659  49.898  -85.450  1.00 30.26  ? 128 LEU B CG    1 
ATOM   3980  C  CD1   . LEU B  1 22  ? 85.678  49.401  -84.423  1.00 29.96  ? 128 LEU B CD1   1 
ATOM   3981  C  CD2   . LEU B  1 22  ? 84.836  51.391  -85.743  1.00 29.77  ? 128 LEU B CD2   1 
ATOM   3982  N  N     . HIS B  1 23  ? 84.271  49.429  -90.127  1.00 30.22  ? 129 HIS B N     1 
ATOM   3983  C  CA    . HIS B  1 23  ? 84.771  48.958  -91.415  1.00 29.77  ? 129 HIS B CA    1 
ATOM   3984  C  C     . HIS B  1 23  ? 86.208  48.398  -91.272  1.00 29.43  ? 129 HIS B C     1 
ATOM   3985  O  O     . HIS B  1 23  ? 86.992  48.915  -90.476  1.00 27.64  ? 129 HIS B O     1 
ATOM   3986  C  CB    . HIS B  1 23  ? 84.775  50.148  -92.370  1.00 29.84  ? 129 HIS B CB    1 
ATOM   3987  C  CG    . HIS B  1 23  ? 85.137  49.804  -93.769  1.00 29.97  ? 129 HIS B CG    1 
ATOM   3988  N  ND1   . HIS B  1 23  ? 86.435  49.612  -94.169  1.00 29.53  ? 129 HIS B ND1   1 
ATOM   3989  C  CD2   . HIS B  1 23  ? 84.375  49.634  -94.874  1.00 30.69  ? 129 HIS B CD2   1 
ATOM   3990  C  CE1   . HIS B  1 23  ? 86.462  49.322  -95.458  1.00 30.04  ? 129 HIS B CE1   1 
ATOM   3991  N  NE2   . HIS B  1 23  ? 85.226  49.337  -95.911  1.00 30.74  ? 129 HIS B NE2   1 
ATOM   3992  N  N     . PRO B  1 24  ? 86.554  47.350  -92.041  1.00 30.81  ? 130 PRO B N     1 
ATOM   3993  C  CA    . PRO B  1 24  ? 87.852  46.677  -91.881  1.00 31.16  ? 130 PRO B CA    1 
ATOM   3994  C  C     . PRO B  1 24  ? 89.067  47.581  -91.910  1.00 30.80  ? 130 PRO B C     1 
ATOM   3995  O  O     . PRO B  1 24  ? 90.025  47.334  -91.186  1.00 30.90  ? 130 PRO B O     1 
ATOM   3996  C  CB    . PRO B  1 24  ? 87.899  45.747  -93.071  1.00 31.58  ? 130 PRO B CB    1 
ATOM   3997  C  CG    . PRO B  1 24  ? 86.481  45.403  -93.320  1.00 32.02  ? 130 PRO B CG    1 
ATOM   3998  C  CD    . PRO B  1 24  ? 85.702  46.626  -93.003  1.00 31.62  ? 130 PRO B CD    1 
ATOM   3999  N  N     . LEU B  1 25  ? 89.031  48.587  -92.774  1.00 30.23  ? 131 LEU B N     1 
ATOM   4000  C  CA    . LEU B  1 25  ? 90.057  49.626  -92.845  1.00 29.55  ? 131 LEU B CA    1 
ATOM   4001  C  C     . LEU B  1 25  ? 90.208  50.389  -91.546  1.00 29.13  ? 131 LEU B C     1 
ATOM   4002  O  O     . LEU B  1 25  ? 91.326  50.685  -91.136  1.00 29.31  ? 131 LEU B O     1 
ATOM   4003  C  CB    . LEU B  1 25  ? 89.738  50.611  -93.973  1.00 29.33  ? 131 LEU B CB    1 
ATOM   4004  C  CG    . LEU B  1 25  ? 90.663  51.813  -94.158  1.00 28.77  ? 131 LEU B CG    1 
ATOM   4005  C  CD1   . LEU B  1 25  ? 92.112  51.395  -94.342  1.00 28.21  ? 131 LEU B CD1   1 
ATOM   4006  C  CD2   . LEU B  1 25  ? 90.169  52.631  -95.353  1.00 28.81  ? 131 LEU B CD2   1 
ATOM   4007  N  N     . LEU B  1 26  ? 89.090  50.713  -90.904  1.00 28.87  ? 132 LEU B N     1 
ATOM   4008  C  CA    . LEU B  1 26  ? 89.119  51.401  -89.607  1.00 28.85  ? 132 LEU B CA    1 
ATOM   4009  C  C     . LEU B  1 26  ? 89.709  50.498  -88.535  1.00 28.52  ? 132 LEU B C     1 
ATOM   4010  O  O     . LEU B  1 26  ? 90.537  50.945  -87.748  1.00 28.53  ? 132 LEU B O     1 
ATOM   4011  C  CB    . LEU B  1 26  ? 87.734  51.873  -89.172  1.00 29.02  ? 132 LEU B CB    1 
ATOM   4012  C  CG    . LEU B  1 26  ? 86.977  52.761  -90.167  1.00 30.07  ? 132 LEU B CG    1 
ATOM   4013  C  CD1   . LEU B  1 26  ? 85.552  53.050  -89.712  1.00 29.84  ? 132 LEU B CD1   1 
ATOM   4014  C  CD2   . LEU B  1 26  ? 87.733  54.066  -90.443  1.00 30.12  ? 132 LEU B CD2   1 
ATOM   4015  N  N     . VAL B  1 27  ? 89.304  49.230  -88.531  1.00 28.37  ? 133 VAL B N     1 
ATOM   4016  C  CA    . VAL B  1 27  ? 89.832  48.246  -87.584  1.00 28.66  ? 133 VAL B CA    1 
ATOM   4017  C  C     . VAL B  1 27  ? 91.342  48.159  -87.700  1.00 29.42  ? 133 VAL B C     1 
ATOM   4018  O  O     . VAL B  1 27  ? 92.059  48.058  -86.723  1.00 29.53  ? 133 VAL B O     1 
ATOM   4019  C  CB    . VAL B  1 27  ? 89.240  46.848  -87.842  1.00 28.74  ? 133 VAL B CB    1 
ATOM   4020  C  CG1   . VAL B  1 27  ? 89.865  45.813  -86.925  1.00 28.71  ? 133 VAL B CG1   1 
ATOM   4021  C  CG2   . VAL B  1 27  ? 87.751  46.835  -87.605  1.00 29.11  ? 133 VAL B CG2   1 
ATOM   4022  N  N     . ARG B  1 28  ? 91.805  48.202  -88.926  1.00 31.27  ? 134 ARG B N     1 
ATOM   4023  C  CA    . ARG B  1 28  ? 93.215  48.089  -89.236  1.00 32.96  ? 134 ARG B CA    1 
ATOM   4024  C  C     . ARG B  1 28  ? 94.006  49.302  -88.733  1.00 31.16  ? 134 ARG B C     1 
ATOM   4025  O  O     . ARG B  1 28  ? 95.139  49.165  -88.286  1.00 31.40  ? 134 ARG B O     1 
ATOM   4026  C  CB    . ARG B  1 28  ? 93.341  47.933  -90.745  1.00 36.13  ? 134 ARG B CB    1 
ATOM   4027  C  CG    . ARG B  1 28  ? 94.635  47.324  -91.187  1.00 39.41  ? 134 ARG B CG    1 
ATOM   4028  C  CD    . ARG B  1 28  ? 94.757  45.842  -90.881  1.00 42.82  ? 134 ARG B CD    1 
ATOM   4029  N  NE    . ARG B  1 28  ? 95.463  45.220  -91.996  1.00 47.67  ? 134 ARG B NE    1 
ATOM   4030  C  CZ    . ARG B  1 28  ? 96.743  45.470  -92.335  1.00 50.84  ? 134 ARG B CZ    1 
ATOM   4031  N  NH1   . ARG B  1 28  ? 97.530  46.269  -91.576  1.00 49.91  ? 134 ARG B NH1   1 
ATOM   4032  N  NH2   . ARG B  1 28  ? 97.263  44.839  -93.382  1.00 52.64  ? 134 ARG B NH2   1 
ATOM   4033  N  N     . ILE B  1 29  ? 93.394  50.478  -88.823  1.00 28.87  ? 135 ILE B N     1 
ATOM   4034  C  CA    . ILE B  1 29  ? 93.947  51.718  -88.278  1.00 27.78  ? 135 ILE B CA    1 
ATOM   4035  C  C     . ILE B  1 29  ? 93.910  51.714  -86.752  1.00 27.41  ? 135 ILE B C     1 
ATOM   4036  O  O     . ILE B  1 29  ? 94.861  52.136  -86.101  1.00 27.14  ? 135 ILE B O     1 
ATOM   4037  C  CB    . ILE B  1 29  ? 93.188  52.949  -88.817  1.00 27.16  ? 135 ILE B CB    1 
ATOM   4038  C  CG1   . ILE B  1 29  ? 93.507  53.135  -90.299  1.00 27.34  ? 135 ILE B CG1   1 
ATOM   4039  C  CG2   . ILE B  1 29  ? 93.564  54.227  -88.069  1.00 26.83  ? 135 ILE B CG2   1 
ATOM   4040  C  CD1   . ILE B  1 29  ? 92.571  54.083  -91.038  1.00 27.39  ? 135 ILE B CD1   1 
ATOM   4041  N  N     . ILE B  1 30  ? 92.794  51.266  -86.190  1.00 27.22  ? 136 ILE B N     1 
ATOM   4042  C  CA    . ILE B  1 30  ? 92.625  51.185  -84.736  1.00 27.04  ? 136 ILE B CA    1 
ATOM   4043  C  C     . ILE B  1 30  ? 93.664  50.299  -84.070  1.00 26.93  ? 136 ILE B C     1 
ATOM   4044  O  O     . ILE B  1 30  ? 94.219  50.667  -83.045  1.00 27.51  ? 136 ILE B O     1 
ATOM   4045  C  CB    . ILE B  1 30  ? 91.212  50.671  -84.384  1.00 27.21  ? 136 ILE B CB    1 
ATOM   4046  C  CG1   . ILE B  1 30  ? 90.206  51.800  -84.549  1.00 26.99  ? 136 ILE B CG1   1 
ATOM   4047  C  CG2   . ILE B  1 30  ? 91.125  50.119  -82.959  1.00 27.05  ? 136 ILE B CG2   1 
ATOM   4048  C  CD1   . ILE B  1 30  ? 88.794  51.297  -84.734  1.00 27.05  ? 136 ILE B CD1   1 
ATOM   4049  N  N     . ASN B  1 31  ? 93.914  49.130  -84.647  1.00 26.58  ? 137 ASN B N     1 
ATOM   4050  C  CA    . ASN B  1 31  ? 94.837  48.148  -84.079  1.00 26.59  ? 137 ASN B CA    1 
ATOM   4051  C  C     . ASN B  1 31  ? 96.307  48.437  -84.418  1.00 27.72  ? 137 ASN B C     1 
ATOM   4052  O  O     . ASN B  1 31  ? 97.001  47.631  -85.048  1.00 27.98  ? 137 ASN B O     1 
ATOM   4053  C  CB    . ASN B  1 31  ? 94.406  46.742  -84.501  1.00 25.92  ? 137 ASN B CB    1 
ATOM   4054  C  CG    . ASN B  1 31  ? 93.093  46.327  -83.828  1.00 24.77  ? 137 ASN B CG    1 
ATOM   4055  O  OD1   . ASN B  1 31  ? 92.881  46.600  -82.680  1.00 23.37  ? 137 ASN B OD1   1 
ATOM   4056  N  ND2   . ASN B  1 31  ? 92.225  45.649  -84.536  1.00 24.23  ? 137 ASN B ND2   1 
ATOM   4057  N  N     . THR B  1 32  ? 96.772  49.596  -83.965  1.00 28.40  ? 138 THR B N     1 
ATOM   4058  C  CA    . THR B  1 32  ? 98.139  50.045  -84.149  1.00 28.95  ? 138 THR B CA    1 
ATOM   4059  C  C     . THR B  1 32  ? 98.609  50.717  -82.858  1.00 29.92  ? 138 THR B C     1 
ATOM   4060  O  O     . THR B  1 32  ? 97.794  51.275  -82.133  1.00 30.05  ? 138 THR B O     1 
ATOM   4061  C  CB    . THR B  1 32  ? 98.249  51.078  -85.286  1.00 27.97  ? 138 THR B CB    1 
ATOM   4062  O  OG1   . THR B  1 32  ? 97.550  52.274  -84.926  1.00 26.79  ? 138 THR B OG1   1 
ATOM   4063  C  CG2   . THR B  1 32  ? 97.677  50.529  -86.573  1.00 27.61  ? 138 THR B CG2   1 
ATOM   4064  N  N     . PRO B  1 33  ? 99.928  50.707  -82.582  1.00 30.44  ? 139 PRO B N     1 
ATOM   4065  C  CA    . PRO B  1 33  ? 100.430 51.389  -81.391  1.00 30.28  ? 139 PRO B CA    1 
ATOM   4066  C  C     . PRO B  1 33  ? 100.098 52.869  -81.302  1.00 29.83  ? 139 PRO B C     1 
ATOM   4067  O  O     . PRO B  1 33  ? 99.935  53.377  -80.208  1.00 29.01  ? 139 PRO B O     1 
ATOM   4068  C  CB    . PRO B  1 33  ? 101.941 51.214  -81.520  1.00 30.34  ? 139 PRO B CB    1 
ATOM   4069  C  CG    . PRO B  1 33  ? 102.086 49.927  -82.221  1.00 30.52  ? 139 PRO B CG    1 
ATOM   4070  C  CD    . PRO B  1 33  ? 101.011 49.999  -83.271  1.00 30.42  ? 139 PRO B CD    1 
ATOM   4071  N  N     . GLN B  1 34  ? 99.986  53.530  -82.443  1.00 30.61  ? 140 GLN B N     1 
ATOM   4072  C  CA    . GLN B  1 34  ? 99.788  54.977  -82.487  1.00 31.51  ? 140 GLN B CA    1 
ATOM   4073  C  C     . GLN B  1 34  ? 98.385  55.364  -82.020  1.00 31.77  ? 140 GLN B C     1 
ATOM   4074  O  O     . GLN B  1 34  ? 98.183  56.435  -81.380  1.00 33.38  ? 140 GLN B O     1 
ATOM   4075  C  CB    . GLN B  1 34  ? 100.056 55.515  -83.902  1.00 31.55  ? 140 GLN B CB    1 
ATOM   4076  C  CG    . GLN B  1 34  ? 101.527 55.480  -84.332  1.00 31.04  ? 140 GLN B CG    1 
ATOM   4077  C  CD    . GLN B  1 34  ? 102.087 54.090  -84.543  1.00 30.73  ? 140 GLN B CD    1 
ATOM   4078  O  OE1   . GLN B  1 34  ? 101.366 53.147  -84.916  1.00 29.81  ? 140 GLN B OE1   1 
ATOM   4079  N  NE2   . GLN B  1 34  ? 103.386 53.946  -84.297  1.00 31.23  ? 140 GLN B NE2   1 
ATOM   4080  N  N     . PHE B  1 35  ? 97.430  54.487  -82.339  1.00 30.65  ? 141 PHE B N     1 
ATOM   4081  C  CA    . PHE B  1 35  ? 96.034  54.652  -81.945  1.00 29.54  ? 141 PHE B CA    1 
ATOM   4082  C  C     . PHE B  1 35  ? 95.770  54.090  -80.558  1.00 28.84  ? 141 PHE B C     1 
ATOM   4083  O  O     . PHE B  1 35  ? 95.168  54.763  -79.735  1.00 29.16  ? 141 PHE B O     1 
ATOM   4084  C  CB    . PHE B  1 35  ? 95.084  53.989  -82.946  1.00 29.24  ? 141 PHE B CB    1 
ATOM   4085  C  CG    . PHE B  1 35  ? 93.655  54.408  -82.776  1.00 28.61  ? 141 PHE B CG    1 
ATOM   4086  C  CD1   . PHE B  1 35  ? 92.834  53.781  -81.853  1.00 28.05  ? 141 PHE B CD1   1 
ATOM   4087  C  CD2   . PHE B  1 35  ? 93.132  55.484  -83.504  1.00 28.74  ? 141 PHE B CD2   1 
ATOM   4088  C  CE1   . PHE B  1 35  ? 91.520  54.190  -81.674  1.00 27.62  ? 141 PHE B CE1   1 
ATOM   4089  C  CE2   . PHE B  1 35  ? 91.813  55.882  -83.333  1.00 27.67  ? 141 PHE B CE2   1 
ATOM   4090  C  CZ    . PHE B  1 35  ? 91.016  55.228  -82.424  1.00 27.25  ? 141 PHE B CZ    1 
ATOM   4091  N  N     . GLN B  1 36  ? 96.212  52.864  -80.289  1.00 27.81  ? 142 GLN B N     1 
ATOM   4092  C  CA    . GLN B  1 36  ? 95.951  52.219  -78.985  1.00 27.04  ? 142 GLN B CA    1 
ATOM   4093  C  C     . GLN B  1 36  ? 96.585  53.012  -77.847  1.00 27.31  ? 142 GLN B C     1 
ATOM   4094  O  O     . GLN B  1 36  ? 96.129  52.941  -76.713  1.00 26.32  ? 142 GLN B O     1 
ATOM   4095  C  CB    . GLN B  1 36  ? 96.434  50.780  -78.956  1.00 27.43  ? 142 GLN B CB    1 
ATOM   4096  C  CG    . GLN B  1 36  ? 95.739  49.877  -79.961  1.00 28.02  ? 142 GLN B CG    1 
ATOM   4097  C  CD    . GLN B  1 36  ? 94.435  49.268  -79.476  1.00 28.28  ? 142 GLN B CD    1 
ATOM   4098  O  OE1   . GLN B  1 36  ? 94.309  48.873  -78.311  1.00 29.51  ? 142 GLN B OE1   1 
ATOM   4099  N  NE2   . GLN B  1 36  ? 93.480  49.119  -80.395  1.00 27.54  ? 142 GLN B NE2   1 
ATOM   4100  N  N     . ARG B  1 37  ? 97.622  53.775  -78.163  1.00 28.81  ? 143 ARG B N     1 
ATOM   4101  C  CA    . ARG B  1 37  ? 98.185  54.799  -77.276  1.00 29.35  ? 143 ARG B CA    1 
ATOM   4102  C  C     . ARG B  1 37  ? 97.122  55.613  -76.543  1.00 28.39  ? 143 ARG B C     1 
ATOM   4103  O  O     . ARG B  1 37  ? 97.266  55.927  -75.367  1.00 28.24  ? 143 ARG B O     1 
ATOM   4104  C  CB    . ARG B  1 37  ? 99.084  55.722  -78.089  1.00 30.33  ? 143 ARG B CB    1 
ATOM   4105  C  CG    . ARG B  1 37  ? 99.362  57.060  -77.470  1.00 31.15  ? 143 ARG B CG    1 
ATOM   4106  C  CD    . ARG B  1 37  ? 100.376 57.806  -78.280  1.00 32.09  ? 143 ARG B CD    1 
ATOM   4107  N  NE    . ARG B  1 37  ? 100.685 59.051  -77.604  1.00 32.86  ? 143 ARG B NE    1 
ATOM   4108  C  CZ    . ARG B  1 37  ? 100.022 60.186  -77.780  1.00 33.76  ? 143 ARG B CZ    1 
ATOM   4109  N  NH1   . ARG B  1 37  ? 99.003  60.253  -78.655  1.00 34.19  ? 143 ARG B NH1   1 
ATOM   4110  N  NH2   . ARG B  1 37  ? 100.403 61.272  -77.094  1.00 34.54  ? 143 ARG B NH2   1 
ATOM   4111  N  N     . LEU B  1 38  ? 96.058  55.957  -77.248  1.00 26.77  ? 144 LEU B N     1 
ATOM   4112  C  CA    . LEU B  1 38  ? 94.996  56.767  -76.678  1.00 25.47  ? 144 LEU B CA    1 
ATOM   4113  C  C     . LEU B  1 38  ? 94.256  56.094  -75.529  1.00 24.58  ? 144 LEU B C     1 
ATOM   4114  O  O     . LEU B  1 38  ? 93.544  56.771  -74.804  1.00 24.57  ? 144 LEU B O     1 
ATOM   4115  C  CB    . LEU B  1 38  ? 93.997  57.182  -77.764  1.00 25.07  ? 144 LEU B CB    1 
ATOM   4116  C  CG    . LEU B  1 38  ? 94.537  58.035  -78.916  1.00 24.72  ? 144 LEU B CG    1 
ATOM   4117  C  CD1   . LEU B  1 38  ? 93.439  58.339  -79.925  1.00 24.50  ? 144 LEU B CD1   1 
ATOM   4118  C  CD2   . LEU B  1 38  ? 95.146  59.339  -78.419  1.00 24.80  ? 144 LEU B CD2   1 
ATOM   4119  N  N     . ARG B  1 39  ? 94.402  54.783  -75.354  1.00 23.71  ? 145 ARG B N     1 
ATOM   4120  C  CA    . ARG B  1 39  ? 93.877  54.113  -74.157  1.00 23.22  ? 145 ARG B CA    1 
ATOM   4121  C  C     . ARG B  1 39  ? 94.511  54.587  -72.872  1.00 23.26  ? 145 ARG B C     1 
ATOM   4122  O  O     . ARG B  1 39  ? 93.940  54.375  -71.803  1.00 23.16  ? 145 ARG B O     1 
ATOM   4123  C  CB    . ARG B  1 39  ? 94.080  52.597  -74.235  1.00 23.09  ? 145 ARG B CB    1 
ATOM   4124  C  CG    . ARG B  1 39  ? 93.096  51.890  -75.151  1.00 22.79  ? 145 ARG B CG    1 
ATOM   4125  C  CD    . ARG B  1 39  ? 93.423  50.429  -75.244  1.00 22.79  ? 145 ARG B CD    1 
ATOM   4126  N  NE    . ARG B  1 39  ? 92.557  49.686  -76.156  1.00 22.42  ? 145 ARG B NE    1 
ATOM   4127  C  CZ    . ARG B  1 39  ? 91.365  49.187  -75.843  1.00 22.23  ? 145 ARG B CZ    1 
ATOM   4128  N  NH1   . ARG B  1 39  ? 90.830  49.386  -74.632  1.00 22.03  ? 145 ARG B NH1   1 
ATOM   4129  N  NH2   . ARG B  1 39  ? 90.682  48.499  -76.755  1.00 22.46  ? 145 ARG B NH2   1 
ATOM   4130  N  N     . TYR B  1 40  ? 95.686  55.197  -72.966  1.00 23.88  ? 146 TYR B N     1 
ATOM   4131  C  CA    . TYR B  1 40  ? 96.463  55.588  -71.802  1.00 24.58  ? 146 TYR B CA    1 
ATOM   4132  C  C     . TYR B  1 40  ? 96.558  57.112  -71.659  1.00 26.13  ? 146 TYR B C     1 
ATOM   4133  O  O     . TYR B  1 40  ? 97.465  57.613  -71.049  1.00 26.70  ? 146 TYR B O     1 
ATOM   4134  C  CB    . TYR B  1 40  ? 97.834  54.906  -71.882  1.00 24.18  ? 146 TYR B CB    1 
ATOM   4135  C  CG    . TYR B  1 40  ? 97.749  53.469  -72.374  1.00 24.23  ? 146 TYR B CG    1 
ATOM   4136  C  CD1   . TYR B  1 40  ? 97.212  52.452  -71.579  1.00 24.26  ? 146 TYR B CD1   1 
ATOM   4137  C  CD2   . TYR B  1 40  ? 98.168  53.127  -73.648  1.00 24.36  ? 146 TYR B CD2   1 
ATOM   4138  C  CE1   . TYR B  1 40  ? 97.120  51.130  -72.039  1.00 24.44  ? 146 TYR B CE1   1 
ATOM   4139  C  CE2   . TYR B  1 40  ? 98.084  51.818  -74.123  1.00 24.72  ? 146 TYR B CE2   1 
ATOM   4140  C  CZ    . TYR B  1 40  ? 97.562  50.812  -73.325  1.00 24.84  ? 146 TYR B CZ    1 
ATOM   4141  O  OH    . TYR B  1 40  ? 97.530  49.513  -73.856  1.00 24.91  ? 146 TYR B OH    1 
ATOM   4142  N  N     . ILE B  1 41  ? 95.587  57.829  -72.195  1.00 28.02  ? 147 ILE B N     1 
ATOM   4143  C  CA    . ILE B  1 41  ? 95.484  59.270  -72.025  1.00 30.37  ? 147 ILE B CA    1 
ATOM   4144  C  C     . ILE B  1 41  ? 94.067  59.646  -71.587  1.00 32.30  ? 147 ILE B C     1 
ATOM   4145  O  O     . ILE B  1 41  ? 93.122  59.422  -72.332  1.00 32.57  ? 147 ILE B O     1 
ATOM   4146  C  CB    . ILE B  1 41  ? 95.844  59.989  -73.337  1.00 31.76  ? 147 ILE B CB    1 
ATOM   4147  C  CG1   . ILE B  1 41  ? 97.308  59.721  -73.684  1.00 32.67  ? 147 ILE B CG1   1 
ATOM   4148  C  CG2   . ILE B  1 41  ? 95.591  61.488  -73.225  1.00 32.06  ? 147 ILE B CG2   1 
ATOM   4149  C  CD1   . ILE B  1 41  ? 97.766  60.267  -75.020  1.00 33.51  ? 147 ILE B CD1   1 
ATOM   4150  N  N     . LYS B  1 42  ? 93.905  60.229  -70.410  1.00 34.09  ? 148 LYS B N     1 
ATOM   4151  C  CA    . LYS B  1 42  ? 92.585  60.562  -69.897  1.00 34.14  ? 148 LYS B CA    1 
ATOM   4152  C  C     . LYS B  1 42  ? 92.014  61.755  -70.615  1.00 31.49  ? 148 LYS B C     1 
ATOM   4153  O  O     . LYS B  1 42  ? 92.732  62.658  -70.998  1.00 30.21  ? 148 LYS B O     1 
ATOM   4154  C  CB    . LYS B  1 42  ? 92.619  60.794  -68.390  1.00 37.39  ? 148 LYS B CB    1 
ATOM   4155  C  CG    . LYS B  1 42  ? 92.889  59.490  -67.672  1.00 39.97  ? 148 LYS B CG    1 
ATOM   4156  C  CD    . LYS B  1 42  ? 92.751  59.645  -66.170  1.00 42.33  ? 148 LYS B CD    1 
ATOM   4157  C  CE    . LYS B  1 42  ? 93.658  58.598  -65.529  1.00 45.18  ? 148 LYS B CE    1 
ATOM   4158  N  NZ    . LYS B  1 42  ? 95.132  58.740  -65.568  1.00 46.24  ? 148 LYS B NZ    1 
ATOM   4159  N  N     . GLN B  1 43  ? 90.701  61.725  -70.820  1.00 29.98  ? 149 GLN B N     1 
ATOM   4160  C  CA    . GLN B  1 43  ? 90.009  62.749  -71.578  1.00 29.68  ? 149 GLN B CA    1 
ATOM   4161  C  C     . GLN B  1 43  ? 90.108  64.066  -70.854  1.00 30.22  ? 149 GLN B C     1 
ATOM   4162  O  O     . GLN B  1 43  ? 90.440  65.100  -71.468  1.00 30.93  ? 149 GLN B O     1 
ATOM   4163  C  CB    . GLN B  1 43  ? 88.548  62.371  -71.731  1.00 29.10  ? 149 GLN B CB    1 
ATOM   4164  C  CG    . GLN B  1 43  ? 87.673  63.337  -72.555  1.00 28.18  ? 149 GLN B CG    1 
ATOM   4165  C  CD    . GLN B  1 43  ? 87.819  63.106  -74.026  1.00 27.53  ? 149 GLN B CD    1 
ATOM   4166  O  OE1   . GLN B  1 43  ? 88.855  62.635  -74.438  1.00 27.43  ? 149 GLN B OE1   1 
ATOM   4167  N  NE2   . GLN B  1 43  ? 86.795  63.402  -74.813  1.00 27.61  ? 149 GLN B NE2   1 
ATOM   4168  N  N     . LEU B  1 44  ? 89.810  64.017  -69.542  1.00 30.22  ? 150 LEU B N     1 
ATOM   4169  C  CA    . LEU B  1 44  ? 89.720  65.236  -68.754  1.00 30.68  ? 150 LEU B CA    1 
ATOM   4170  C  C     . LEU B  1 44  ? 90.905  65.457  -67.843  1.00 30.56  ? 150 LEU B C     1 
ATOM   4171  O  O     . LEU B  1 44  ? 90.792  66.158  -66.838  1.00 32.04  ? 150 LEU B O     1 
ATOM   4172  C  CB    . LEU B  1 44  ? 88.411  65.228  -67.961  1.00 31.13  ? 150 LEU B CB    1 
ATOM   4173  C  CG    . LEU B  1 44  ? 87.144  64.996  -68.798  1.00 30.90  ? 150 LEU B CG    1 
ATOM   4174  C  CD1   . LEU B  1 44  ? 85.914  65.092  -67.916  1.00 29.79  ? 150 LEU B CD1   1 
ATOM   4175  C  CD2   . LEU B  1 44  ? 87.022  65.952  -69.960  1.00 31.90  ? 150 LEU B CD2   1 
ATOM   4176  N  N     . GLY B  1 45  ? 92.047  64.871  -68.200  1.00 29.58  ? 151 GLY B N     1 
ATOM   4177  C  CA    . GLY B  1 45  ? 93.279  65.044  -67.446  1.00 28.67  ? 151 GLY B CA    1 
ATOM   4178  C  C     . GLY B  1 45  ? 93.124  64.987  -65.950  1.00 27.97  ? 151 GLY B C     1 
ATOM   4179  O  O     . GLY B  1 45  ? 92.678  63.957  -65.390  1.00 27.59  ? 151 GLY B O     1 
ATOM   4180  N  N     . GLY B  1 46  ? 93.455  66.123  -65.317  1.00 27.70  ? 152 GLY B N     1 
ATOM   4181  C  CA    . GLY B  1 46  ? 93.380  66.248  -63.850  1.00 27.57  ? 152 GLY B CA    1 
ATOM   4182  C  C     . GLY B  1 46  ? 91.988  66.276  -63.273  1.00 26.70  ? 152 GLY B C     1 
ATOM   4183  O  O     . GLY B  1 46  ? 91.826  66.143  -62.055  1.00 27.10  ? 152 GLY B O     1 
ATOM   4184  N  N     . GLY B  1 47  ? 90.968  66.446  -64.125  1.00 25.34  ? 153 GLY B N     1 
ATOM   4185  C  CA    . GLY B  1 47  ? 89.578  66.342  -63.709  1.00 23.30  ? 153 GLY B CA    1 
ATOM   4186  C  C     . GLY B  1 47  ? 89.218  65.058  -62.986  1.00 21.26  ? 153 GLY B C     1 
ATOM   4187  O  O     . GLY B  1 47  ? 88.340  65.066  -62.116  1.00 20.23  ? 153 GLY B O     1 
ATOM   4188  N  N     . TYR B  1 48  ? 89.891  63.958  -63.324  1.00 19.75  ? 154 TYR B N     1 
ATOM   4189  C  CA    . TYR B  1 48  ? 89.700  62.694  -62.603  1.00 19.23  ? 154 TYR B CA    1 
ATOM   4190  C  C     . TYR B  1 48  ? 89.928  62.864  -61.094  1.00 19.54  ? 154 TYR B C     1 
ATOM   4191  O  O     . TYR B  1 48  ? 89.230  62.244  -60.291  1.00 19.59  ? 154 TYR B O     1 
ATOM   4192  C  CB    . TYR B  1 48  ? 90.627  61.609  -63.157  1.00 18.75  ? 154 TYR B CB    1 
ATOM   4193  C  CG    . TYR B  1 48  ? 90.506  60.212  -62.541  1.00 17.99  ? 154 TYR B CG    1 
ATOM   4194  C  CD1   . TYR B  1 48  ? 89.282  59.658  -62.231  1.00 17.39  ? 154 TYR B CD1   1 
ATOM   4195  C  CD2   . TYR B  1 48  ? 91.641  59.418  -62.359  1.00 17.76  ? 154 TYR B CD2   1 
ATOM   4196  C  CE1   . TYR B  1 48  ? 89.194  58.377  -61.685  1.00 17.19  ? 154 TYR B CE1   1 
ATOM   4197  C  CE2   . TYR B  1 48  ? 91.552  58.129  -61.817  1.00 17.49  ? 154 TYR B CE2   1 
ATOM   4198  C  CZ    . TYR B  1 48  ? 90.327  57.617  -61.470  1.00 17.23  ? 154 TYR B CZ    1 
ATOM   4199  O  OH    . TYR B  1 48  ? 90.220  56.360  -60.909  1.00 17.07  ? 154 TYR B OH    1 
ATOM   4200  N  N     . TYR B  1 49  ? 90.863  63.740  -60.725  1.00 19.79  ? 155 TYR B N     1 
ATOM   4201  C  CA    . TYR B  1 49  ? 91.181  64.007  -59.314  1.00 19.42  ? 155 TYR B CA    1 
ATOM   4202  C  C     . TYR B  1 49  ? 90.160  64.913  -58.607  1.00 19.32  ? 155 TYR B C     1 
ATOM   4203  O  O     . TYR B  1 49  ? 90.301  65.195  -57.412  1.00 19.30  ? 155 TYR B O     1 
ATOM   4204  C  CB    . TYR B  1 49  ? 92.644  64.536  -59.183  1.00 19.38  ? 155 TYR B CB    1 
ATOM   4205  C  CG    . TYR B  1 49  ? 93.675  63.490  -59.658  1.00 19.19  ? 155 TYR B CG    1 
ATOM   4206  C  CD1   . TYR B  1 49  ? 94.149  62.509  -58.785  1.00 19.16  ? 155 TYR B CD1   1 
ATOM   4207  C  CD2   . TYR B  1 49  ? 94.134  63.467  -60.981  1.00 19.09  ? 155 TYR B CD2   1 
ATOM   4208  C  CE1   . TYR B  1 49  ? 95.049  61.533  -59.214  1.00 19.37  ? 155 TYR B CE1   1 
ATOM   4209  C  CE2   . TYR B  1 49  ? 95.004  62.479  -61.426  1.00 19.28  ? 155 TYR B CE2   1 
ATOM   4210  C  CZ    . TYR B  1 49  ? 95.479  61.513  -60.541  1.00 19.44  ? 155 TYR B CZ    1 
ATOM   4211  O  OH    . TYR B  1 49  ? 96.339  60.526  -60.976  1.00 19.52  ? 155 TYR B OH    1 
ATOM   4212  N  N     . VAL B  1 50  ? 89.125  65.338  -59.332  1.00 19.50  ? 156 VAL B N     1 
ATOM   4213  C  CA    . VAL B  1 50  ? 87.956  66.017  -58.752  1.00 19.78  ? 156 VAL B CA    1 
ATOM   4214  C  C     . VAL B  1 50  ? 86.641  65.264  -58.994  1.00 19.67  ? 156 VAL B C     1 
ATOM   4215  O  O     . VAL B  1 50  ? 85.793  65.196  -58.098  1.00 19.51  ? 156 VAL B O     1 
ATOM   4216  C  CB    . VAL B  1 50  ? 87.823  67.428  -59.346  1.00 20.32  ? 156 VAL B CB    1 
ATOM   4217  C  CG1   . VAL B  1 50  ? 86.566  68.142  -58.845  1.00 20.46  ? 156 VAL B CG1   1 
ATOM   4218  C  CG2   . VAL B  1 50  ? 89.048  68.259  -58.970  1.00 20.62  ? 156 VAL B CG2   1 
ATOM   4219  N  N     . PHE B  1 51  ? 86.444  64.768  -60.212  1.00 19.41  ? 157 PHE B N     1 
ATOM   4220  C  CA    . PHE B  1 51  ? 85.281  63.947  -60.547  1.00 19.51  ? 157 PHE B CA    1 
ATOM   4221  C  C     . PHE B  1 51  ? 85.735  62.502  -60.673  1.00 20.14  ? 157 PHE B C     1 
ATOM   4222  O  O     . PHE B  1 51  ? 86.267  62.109  -61.715  1.00 20.88  ? 157 PHE B O     1 
ATOM   4223  C  CB    . PHE B  1 51  ? 84.702  64.397  -61.868  1.00 19.18  ? 157 PHE B CB    1 
ATOM   4224  C  CG    . PHE B  1 51  ? 84.050  65.729  -61.814  1.00 18.68  ? 157 PHE B CG    1 
ATOM   4225  C  CD1   . PHE B  1 51  ? 84.786  66.882  -61.961  1.00 18.71  ? 157 PHE B CD1   1 
ATOM   4226  C  CD2   . PHE B  1 51  ? 82.688  65.829  -61.635  1.00 18.48  ? 157 PHE B CD2   1 
ATOM   4227  C  CE1   . PHE B  1 51  ? 84.182  68.119  -61.915  1.00 18.79  ? 157 PHE B CE1   1 
ATOM   4228  C  CE2   . PHE B  1 51  ? 82.062  67.058  -61.592  1.00 18.56  ? 157 PHE B CE2   1 
ATOM   4229  C  CZ    . PHE B  1 51  ? 82.807  68.207  -61.731  1.00 18.81  ? 157 PHE B CZ    1 
ATOM   4230  N  N     . PRO B  1 52  ? 85.546  61.699  -59.623  1.00 20.60  ? 158 PRO B N     1 
ATOM   4231  C  CA    . PRO B  1 52  ? 86.108  60.359  -59.668  1.00 20.95  ? 158 PRO B CA    1 
ATOM   4232  C  C     . PRO B  1 52  ? 85.476  59.457  -60.731  1.00 20.92  ? 158 PRO B C     1 
ATOM   4233  O  O     . PRO B  1 52  ? 86.000  58.380  -61.005  1.00 20.75  ? 158 PRO B O     1 
ATOM   4234  C  CB    . PRO B  1 52  ? 85.876  59.836  -58.255  1.00 21.54  ? 158 PRO B CB    1 
ATOM   4235  C  CG    . PRO B  1 52  ? 84.619  60.540  -57.829  1.00 21.83  ? 158 PRO B CG    1 
ATOM   4236  C  CD    . PRO B  1 52  ? 84.763  61.924  -58.396  1.00 21.42  ? 158 PRO B CD    1 
ATOM   4237  N  N     . GLY B  1 53  ? 84.376  59.875  -61.332  1.00 21.21  ? 159 GLY B N     1 
ATOM   4238  C  CA    . GLY B  1 53  ? 83.848  59.133  -62.490  1.00 21.55  ? 159 GLY B CA    1 
ATOM   4239  C  C     . GLY B  1 53  ? 84.664  59.215  -63.770  1.00 21.25  ? 159 GLY B C     1 
ATOM   4240  O  O     . GLY B  1 53  ? 84.614  58.286  -64.582  1.00 21.41  ? 159 GLY B O     1 
ATOM   4241  N  N     . ALA B  1 54  ? 85.442  60.298  -63.912  1.00 20.99  ? 160 ALA B N     1 
ATOM   4242  C  CA    . ALA B  1 54  ? 86.085  60.710  -65.176  1.00 21.27  ? 160 ALA B CA    1 
ATOM   4243  C  C     . ALA B  1 54  ? 87.405  59.979  -65.507  1.00 21.71  ? 160 ALA B C     1 
ATOM   4244  O  O     . ALA B  1 54  ? 88.419  60.586  -65.926  1.00 21.55  ? 160 ALA B O     1 
ATOM   4245  C  CB    . ALA B  1 54  ? 86.303  62.205  -65.161  1.00 21.30  ? 160 ALA B CB    1 
ATOM   4246  N  N     . SER B  1 55  ? 87.330  58.655  -65.379  1.00 22.65  ? 161 SER B N     1 
ATOM   4247  C  CA    . SER B  1 55  ? 88.387  57.703  -65.719  1.00 23.27  ? 161 SER B CA    1 
ATOM   4248  C  C     . SER B  1 55  ? 88.546  57.513  -67.231  1.00 22.74  ? 161 SER B C     1 
ATOM   4249  O  O     . SER B  1 55  ? 89.542  56.939  -67.668  1.00 22.50  ? 161 SER B O     1 
ATOM   4250  C  CB    . SER B  1 55  ? 88.026  56.320  -65.124  1.00 24.59  ? 161 SER B CB    1 
ATOM   4251  O  OG    . SER B  1 55  ? 86.756  55.826  -65.628  1.00 25.95  ? 161 SER B OG    1 
ATOM   4252  N  N     . HIS B  1 56  ? 87.538  57.930  -67.995  1.00 22.06  ? 162 HIS B N     1 
ATOM   4253  C  CA    . HIS B  1 56  ? 87.502  57.728  -69.446  1.00 21.29  ? 162 HIS B CA    1 
ATOM   4254  C  C     . HIS B  1 56  ? 88.666  58.361  -70.194  1.00 20.89  ? 162 HIS B C     1 
ATOM   4255  O  O     . HIS B  1 56  ? 89.144  59.450  -69.815  1.00 20.61  ? 162 HIS B O     1 
ATOM   4256  C  CB    . HIS B  1 56  ? 86.154  58.148  -70.064  1.00 20.73  ? 162 HIS B CB    1 
ATOM   4257  C  CG    . HIS B  1 56  ? 85.860  59.622  -70.014  1.00 20.29  ? 162 HIS B CG    1 
ATOM   4258  N  ND1   . HIS B  1 56  ? 85.844  60.345  -68.833  1.00 20.40  ? 162 HIS B ND1   1 
ATOM   4259  C  CD2   . HIS B  1 56  ? 85.509  60.486  -70.999  1.00 20.04  ? 162 HIS B CD2   1 
ATOM   4260  C  CE1   . HIS B  1 56  ? 85.528  61.593  -69.101  1.00 20.39  ? 162 HIS B CE1   1 
ATOM   4261  N  NE2   . HIS B  1 56  ? 85.309  61.705  -70.403  1.00 20.17  ? 162 HIS B NE2   1 
ATOM   4262  N  N     . ASN B  1 57  ? 89.100  57.637  -71.230  1.00 20.74  ? 163 ASN B N     1 
ATOM   4263  C  CA    . ASN B  1 57  ? 90.274  57.939  -72.029  1.00 21.20  ? 163 ASN B CA    1 
ATOM   4264  C  C     . ASN B  1 57  ? 89.932  58.341  -73.468  1.00 22.09  ? 163 ASN B C     1 
ATOM   4265  O  O     . ASN B  1 57  ? 88.811  58.136  -73.926  1.00 22.48  ? 163 ASN B O     1 
ATOM   4266  C  CB    . ASN B  1 57  ? 91.162  56.706  -72.089  1.00 20.88  ? 163 ASN B CB    1 
ATOM   4267  C  CG    . ASN B  1 57  ? 91.620  56.255  -70.724  1.00 20.52  ? 163 ASN B CG    1 
ATOM   4268  O  OD1   . ASN B  1 57  ? 92.264  57.000  -69.977  1.00 19.93  ? 163 ASN B OD1   1 
ATOM   4269  N  ND2   . ASN B  1 57  ? 91.302  55.015  -70.391  1.00 20.78  ? 163 ASN B ND2   1 
ATOM   4270  N  N     . ARG B  1 58  ? 90.919  58.892  -74.175  1.00 22.49  ? 164 ARG B N     1 
ATOM   4271  C  CA    . ARG B  1 58  ? 90.729  59.400  -75.541  1.00 22.93  ? 164 ARG B CA    1 
ATOM   4272  C  C     . ARG B  1 58  ? 90.335  58.331  -76.545  1.00 22.55  ? 164 ARG B C     1 
ATOM   4273  O  O     . ARG B  1 58  ? 89.533  58.577  -77.438  1.00 23.10  ? 164 ARG B O     1 
ATOM   4274  C  CB    . ARG B  1 58  ? 91.997  60.071  -76.028  1.00 23.75  ? 164 ARG B CB    1 
ATOM   4275  C  CG    . ARG B  1 58  ? 92.252  61.418  -75.363  1.00 24.33  ? 164 ARG B CG    1 
ATOM   4276  C  CD    . ARG B  1 58  ? 91.492  62.524  -76.077  1.00 24.95  ? 164 ARG B CD    1 
ATOM   4277  N  NE    . ARG B  1 58  ? 91.313  63.693  -75.240  1.00 25.21  ? 164 ARG B NE    1 
ATOM   4278  C  CZ    . ARG B  1 58  ? 90.532  64.741  -75.529  1.00 26.02  ? 164 ARG B CZ    1 
ATOM   4279  N  NH1   . ARG B  1 58  ? 90.477  65.694  -74.643  1.00 26.46  ? 164 ARG B NH1   1 
ATOM   4280  N  NH2   . ARG B  1 58  ? 89.793  64.846  -76.655  1.00 26.45  ? 164 ARG B NH2   1 
ATOM   4281  N  N     . PHE B  1 59  ? 90.888  57.141  -76.377  1.00 21.80  ? 165 PHE B N     1 
ATOM   4282  C  CA    . PHE B  1 59  ? 90.536  55.990  -77.206  1.00 21.76  ? 165 PHE B CA    1 
ATOM   4283  C  C     . PHE B  1 59  ? 89.042  55.949  -77.533  1.00 22.15  ? 165 PHE B C     1 
ATOM   4284  O  O     . PHE B  1 59  ? 88.647  55.989  -78.714  1.00 22.44  ? 165 PHE B O     1 
ATOM   4285  C  CB    . PHE B  1 59  ? 90.929  54.703  -76.503  1.00 21.30  ? 165 PHE B CB    1 
ATOM   4286  C  CG    . PHE B  1 59  ? 90.684  53.460  -77.310  1.00 21.09  ? 165 PHE B CG    1 
ATOM   4287  C  CD1   . PHE B  1 59  ? 91.524  53.109  -78.334  1.00 21.07  ? 165 PHE B CD1   1 
ATOM   4288  C  CD2   . PHE B  1 59  ? 89.623  52.624  -77.010  1.00 21.10  ? 165 PHE B CD2   1 
ATOM   4289  C  CE1   . PHE B  1 59  ? 91.312  51.954  -79.073  1.00 20.97  ? 165 PHE B CE1   1 
ATOM   4290  C  CE2   . PHE B  1 59  ? 89.405  51.472  -77.736  1.00 21.08  ? 165 PHE B CE2   1 
ATOM   4291  C  CZ    . PHE B  1 59  ? 90.260  51.129  -78.768  1.00 20.92  ? 165 PHE B CZ    1 
ATOM   4292  N  N     . GLU B  1 60  ? 88.222  55.909  -76.487  1.00 22.76  ? 166 GLU B N     1 
ATOM   4293  C  CA    . GLU B  1 60  ? 86.790  55.722  -76.678  1.00 23.58  ? 166 GLU B CA    1 
ATOM   4294  C  C     . GLU B  1 60  ? 86.085  56.970  -77.207  1.00 22.35  ? 166 GLU B C     1 
ATOM   4295  O  O     . GLU B  1 60  ? 85.123  56.846  -77.947  1.00 22.43  ? 166 GLU B O     1 
ATOM   4296  C  CB    . GLU B  1 60  ? 86.106  55.148  -75.429  1.00 25.48  ? 166 GLU B CB    1 
ATOM   4297  C  CG    . GLU B  1 60  ? 86.380  55.850  -74.104  1.00 27.23  ? 166 GLU B CG    1 
ATOM   4298  C  CD    . GLU B  1 60  ? 87.443  55.156  -73.210  1.00 28.41  ? 166 GLU B CD    1 
ATOM   4299  O  OE1   . GLU B  1 60  ? 88.562  54.842  -73.738  1.00 27.23  ? 166 GLU B OE1   1 
ATOM   4300  O  OE2   . GLU B  1 60  ? 87.108  54.978  -71.965  1.00 30.55  ? 166 GLU B OE2   1 
ATOM   4301  N  N     . HIS B  1 61  ? 86.563  58.158  -76.840  1.00 21.28  ? 167 HIS B N     1 
ATOM   4302  C  CA    . HIS B  1 61  ? 86.126  59.411  -77.489  1.00 20.80  ? 167 HIS B CA    1 
ATOM   4303  C  C     . HIS B  1 61  ? 86.398  59.334  -78.993  1.00 20.56  ? 167 HIS B C     1 
ATOM   4304  O  O     . HIS B  1 61  ? 85.521  59.612  -79.813  1.00 20.09  ? 167 HIS B O     1 
ATOM   4305  C  CB    . HIS B  1 61  ? 86.849  60.609  -76.841  1.00 21.04  ? 167 HIS B CB    1 
ATOM   4306  C  CG    . HIS B  1 61  ? 86.736  61.888  -77.613  1.00 21.68  ? 167 HIS B CG    1 
ATOM   4307  N  ND1   . HIS B  1 61  ? 85.534  62.522  -77.810  1.00 22.00  ? 167 HIS B ND1   1 
ATOM   4308  C  CD2   . HIS B  1 61  ? 87.674  62.662  -78.211  1.00 21.99  ? 167 HIS B CD2   1 
ATOM   4309  C  CE1   . HIS B  1 61  ? 85.735  63.628  -78.499  1.00 22.40  ? 167 HIS B CE1   1 
ATOM   4310  N  NE2   . HIS B  1 61  ? 87.023  63.736  -78.758  1.00 21.96  ? 167 HIS B NE2   1 
ATOM   4311  N  N     . SER B  1 62  ? 87.622  58.912  -79.331  1.00 20.52  ? 168 SER B N     1 
ATOM   4312  C  CA    . SER B  1 62  ? 88.058  58.800  -80.705  1.00 20.22  ? 168 SER B CA    1 
ATOM   4313  C  C     . SER B  1 62  ? 87.135  57.852  -81.498  1.00 19.02  ? 168 SER B C     1 
ATOM   4314  O  O     . SER B  1 62  ? 86.687  58.212  -82.586  1.00 18.47  ? 168 SER B O     1 
ATOM   4315  C  CB    . SER B  1 62  ? 89.553  58.432  -80.789  1.00 21.41  ? 168 SER B CB    1 
ATOM   4316  O  OG    . SER B  1 62  ? 90.413  59.578  -80.804  1.00 23.51  ? 168 SER B OG    1 
ATOM   4317  N  N     . LEU B  1 63  ? 86.797  56.689  -80.942  1.00 18.16  ? 169 LEU B N     1 
ATOM   4318  C  CA    . LEU B  1 63  ? 85.823  55.801  -81.607  1.00 17.91  ? 169 LEU B CA    1 
ATOM   4319  C  C     . LEU B  1 63  ? 84.473  56.475  -81.863  1.00 17.89  ? 169 LEU B C     1 
ATOM   4320  O  O     . LEU B  1 63  ? 83.887  56.363  -82.940  1.00 18.35  ? 169 LEU B O     1 
ATOM   4321  C  CB    . LEU B  1 63  ? 85.553  54.553  -80.783  1.00 17.64  ? 169 LEU B CB    1 
ATOM   4322  C  CG    . LEU B  1 63  ? 86.694  53.589  -80.535  1.00 17.62  ? 169 LEU B CG    1 
ATOM   4323  C  CD1   . LEU B  1 63  ? 86.215  52.496  -79.594  1.00 17.58  ? 169 LEU B CD1   1 
ATOM   4324  C  CD2   . LEU B  1 63  ? 87.198  52.998  -81.832  1.00 17.95  ? 169 LEU B CD2   1 
ATOM   4325  N  N     . GLY B  1 64  ? 83.984  57.183  -80.856  1.00 17.24  ? 170 GLY B N     1 
ATOM   4326  C  CA    . GLY B  1 64  ? 82.697  57.840  -80.945  1.00 16.84  ? 170 GLY B CA    1 
ATOM   4327  C  C     . GLY B  1 64  ? 82.643  58.966  -81.955  1.00 16.92  ? 170 GLY B C     1 
ATOM   4328  O  O     . GLY B  1 64  ? 81.642  59.140  -82.643  1.00 17.14  ? 170 GLY B O     1 
ATOM   4329  N  N     . VAL B  1 65  ? 83.725  59.726  -82.065  1.00 16.69  ? 171 VAL B N     1 
ATOM   4330  C  CA    . VAL B  1 65  ? 83.772  60.803  -83.042  1.00 16.72  ? 171 VAL B CA    1 
ATOM   4331  C  C     . VAL B  1 65  ? 83.794  60.209  -84.440  1.00 16.65  ? 171 VAL B C     1 
ATOM   4332  O  O     . VAL B  1 65  ? 83.137  60.713  -85.345  1.00 16.28  ? 171 VAL B O     1 
ATOM   4333  C  CB    . VAL B  1 65  ? 84.967  61.732  -82.785  1.00 16.93  ? 171 VAL B CB    1 
ATOM   4334  C  CG1   . VAL B  1 65  ? 85.116  62.778  -83.888  1.00 17.21  ? 171 VAL B CG1   1 
ATOM   4335  C  CG2   . VAL B  1 65  ? 84.777  62.438  -81.449  1.00 16.77  ? 171 VAL B CG2   1 
ATOM   4336  N  N     . GLY B  1 66  ? 84.538  59.122  -84.596  1.00 16.98  ? 172 GLY B N     1 
ATOM   4337  C  CA    . GLY B  1 66  ? 84.526  58.354  -85.831  1.00 17.60  ? 172 GLY B CA    1 
ATOM   4338  C  C     . GLY B  1 66  ? 83.131  57.878  -86.164  1.00 17.94  ? 172 GLY B C     1 
ATOM   4339  O  O     . GLY B  1 66  ? 82.685  57.986  -87.306  1.00 18.01  ? 172 GLY B O     1 
ATOM   4340  N  N     . TYR B  1 67  ? 82.440  57.351  -85.162  1.00 18.51  ? 173 TYR B N     1 
ATOM   4341  C  CA    . TYR B  1 67  ? 81.073  56.865  -85.351  1.00 18.98  ? 173 TYR B CA    1 
ATOM   4342  C  C     . TYR B  1 67  ? 80.101  57.970  -85.793  1.00 19.24  ? 173 TYR B C     1 
ATOM   4343  O  O     . TYR B  1 67  ? 79.347  57.792  -86.752  1.00 19.37  ? 173 TYR B O     1 
ATOM   4344  C  CB    . TYR B  1 67  ? 80.557  56.194  -84.081  1.00 18.85  ? 173 TYR B CB    1 
ATOM   4345  C  CG    . TYR B  1 67  ? 79.073  55.884  -84.130  1.00 19.25  ? 173 TYR B CG    1 
ATOM   4346  C  CD1   . TYR B  1 67  ? 78.579  54.873  -84.941  1.00 19.68  ? 173 TYR B CD1   1 
ATOM   4347  C  CD2   . TYR B  1 67  ? 78.162  56.612  -83.354  1.00 19.51  ? 173 TYR B CD2   1 
ATOM   4348  C  CE1   . TYR B  1 67  ? 77.235  54.572  -84.985  1.00 20.07  ? 173 TYR B CE1   1 
ATOM   4349  C  CE2   . TYR B  1 67  ? 76.803  56.332  -83.384  1.00 19.69  ? 173 TYR B CE2   1 
ATOM   4350  C  CZ    . TYR B  1 67  ? 76.342  55.316  -84.198  1.00 20.21  ? 173 TYR B CZ    1 
ATOM   4351  O  OH    . TYR B  1 67  ? 74.998  55.026  -84.241  1.00 20.67  ? 173 TYR B OH    1 
ATOM   4352  N  N     . LEU B  1 68  ? 80.123  59.092  -85.084  1.00 19.65  ? 174 LEU B N     1 
ATOM   4353  C  CA    . LEU B  1 68  ? 79.200  60.185  -85.367  1.00 20.62  ? 174 LEU B CA    1 
ATOM   4354  C  C     . LEU B  1 68  ? 79.506  60.854  -86.685  1.00 21.89  ? 174 LEU B C     1 
ATOM   4355  O  O     . LEU B  1 68  ? 78.599  61.296  -87.383  1.00 23.32  ? 174 LEU B O     1 
ATOM   4356  C  CB    . LEU B  1 68  ? 79.216  61.227  -84.254  1.00 20.17  ? 174 LEU B CB    1 
ATOM   4357  C  CG    . LEU B  1 68  ? 78.718  60.783  -82.876  1.00 19.91  ? 174 LEU B CG    1 
ATOM   4358  C  CD1   . LEU B  1 68  ? 78.723  61.963  -81.923  1.00 19.75  ? 174 LEU B CD1   1 
ATOM   4359  C  CD2   . LEU B  1 68  ? 77.340  60.181  -82.947  1.00 19.99  ? 174 LEU B CD2   1 
ATOM   4360  N  N     . ALA B  1 69  ? 80.778  60.928  -87.033  1.00 22.33  ? 175 ALA B N     1 
ATOM   4361  C  CA    . ALA B  1 69  ? 81.157  61.438  -88.335  1.00 23.00  ? 175 ALA B CA    1 
ATOM   4362  C  C     . ALA B  1 69  ? 80.494  60.617  -89.445  1.00 23.64  ? 175 ALA B C     1 
ATOM   4363  O  O     . ALA B  1 69  ? 79.947  61.177  -90.388  1.00 23.71  ? 175 ALA B O     1 
ATOM   4364  C  CB    . ALA B  1 69  ? 82.659  61.413  -88.475  1.00 23.16  ? 175 ALA B CB    1 
ATOM   4365  N  N     . GLY B  1 70  ? 80.522  59.297  -89.301  1.00 24.45  ? 176 GLY B N     1 
ATOM   4366  C  CA    . GLY B  1 70  ? 79.812  58.395  -90.202  1.00 25.58  ? 176 GLY B CA    1 
ATOM   4367  C  C     . GLY B  1 70  ? 78.313  58.653  -90.230  1.00 26.54  ? 176 GLY B C     1 
ATOM   4368  O  O     . GLY B  1 70  ? 77.700  58.696  -91.293  1.00 26.61  ? 176 GLY B O     1 
ATOM   4369  N  N     . CYS B  1 71  ? 77.719  58.828  -89.058  1.00 28.26  ? 177 CYS B N     1 
ATOM   4370  C  CA    . CYS B  1 71  ? 76.277  59.035  -88.966  1.00 30.00  ? 177 CYS B CA    1 
ATOM   4371  C  C     . CYS B  1 71  ? 75.851  60.239  -89.756  1.00 29.96  ? 177 CYS B C     1 
ATOM   4372  O  O     . CYS B  1 71  ? 74.883  60.158  -90.503  1.00 31.90  ? 177 CYS B O     1 
ATOM   4373  C  CB    . CYS B  1 71  ? 75.815  59.226  -87.523  1.00 31.30  ? 177 CYS B CB    1 
ATOM   4374  S  SG    . CYS B  1 71  ? 75.771  57.693  -86.551  1.00 35.62  ? 177 CYS B SG    1 
ATOM   4375  N  N     . LEU B  1 72  ? 76.571  61.346  -89.584  1.00 28.44  ? 178 LEU B N     1 
ATOM   4376  C  CA    . LEU B  1 72  ? 76.161  62.609  -90.166  1.00 27.88  ? 178 LEU B CA    1 
ATOM   4377  C  C     . LEU B  1 72  ? 76.352  62.596  -91.679  1.00 28.92  ? 178 LEU B C     1 
ATOM   4378  O  O     . LEU B  1 72  ? 75.447  62.971  -92.418  1.00 29.17  ? 178 LEU B O     1 
ATOM   4379  C  CB    . LEU B  1 72  ? 76.915  63.768  -89.525  1.00 26.87  ? 178 LEU B CB    1 
ATOM   4380  C  CG    . LEU B  1 72  ? 76.675  65.165  -90.087  1.00 26.82  ? 178 LEU B CG    1 
ATOM   4381  C  CD1   . LEU B  1 72  ? 75.192  65.505  -90.183  1.00 26.94  ? 178 LEU B CD1   1 
ATOM   4382  C  CD2   . LEU B  1 72  ? 77.386  66.167  -89.206  1.00 26.66  ? 178 LEU B CD2   1 
ATOM   4383  N  N     . VAL B  1 73  ? 77.511  62.140  -92.141  1.00 29.77  ? 179 VAL B N     1 
ATOM   4384  C  CA    . VAL B  1 73  ? 77.770  62.094  -93.574  1.00 31.19  ? 179 VAL B CA    1 
ATOM   4385  C  C     . VAL B  1 73  ? 76.857  61.097  -94.288  1.00 32.77  ? 179 VAL B C     1 
ATOM   4386  O  O     . VAL B  1 73  ? 76.409  61.372  -95.389  1.00 33.95  ? 179 VAL B O     1 
ATOM   4387  C  CB    . VAL B  1 73  ? 79.256  61.824  -93.886  1.00 31.04  ? 179 VAL B CB    1 
ATOM   4388  C  CG1   . VAL B  1 73  ? 79.636  60.376  -93.639  1.00 31.10  ? 179 VAL B CG1   1 
ATOM   4389  C  CG2   . VAL B  1 73  ? 79.576  62.207  -95.317  1.00 31.19  ? 179 VAL B CG2   1 
ATOM   4390  N  N     . HIS B  1 74  ? 76.579  59.960  -93.657  1.00 34.77  ? 180 HIS B N     1 
ATOM   4391  C  CA    . HIS B  1 74  ? 75.691  58.950  -94.229  1.00 37.28  ? 180 HIS B CA    1 
ATOM   4392  C  C     . HIS B  1 74  ? 74.244  59.473  -94.273  1.00 36.09  ? 180 HIS B C     1 
ATOM   4393  O  O     . HIS B  1 74  ? 73.525  59.244  -95.235  1.00 37.49  ? 180 HIS B O     1 
ATOM   4394  C  CB    . HIS B  1 74  ? 75.825  57.596  -93.490  1.00 40.52  ? 180 HIS B CB    1 
ATOM   4395  C  CG    . HIS B  1 74  ? 75.045  56.479  -94.129  1.00 45.12  ? 180 HIS B CG    1 
ATOM   4396  N  ND1   . HIS B  1 74  ? 73.714  56.238  -93.828  1.00 47.00  ? 180 HIS B ND1   1 
ATOM   4397  C  CD2   . HIS B  1 74  ? 75.402  55.539  -95.051  1.00 48.01  ? 180 HIS B CD2   1 
ATOM   4398  C  CE1   . HIS B  1 74  ? 73.291  55.192  -94.527  1.00 48.24  ? 180 HIS B CE1   1 
ATOM   4399  N  NE2   . HIS B  1 74  ? 74.290  54.762  -95.284  1.00 49.01  ? 180 HIS B NE2   1 
ATOM   4400  N  N     . ALA B  1 75  ? 73.850  60.223  -93.263  1.00 35.52  ? 181 ALA B N     1 
ATOM   4401  C  CA    . ALA B  1 75  ? 72.513  60.823  -93.213  1.00 34.89  ? 181 ALA B CA    1 
ATOM   4402  C  C     . ALA B  1 75  ? 72.305  61.871  -94.285  1.00 34.08  ? 181 ALA B C     1 
ATOM   4403  O  O     . ALA B  1 75  ? 71.264  61.898  -94.920  1.00 33.64  ? 181 ALA B O     1 
ATOM   4404  C  CB    . ALA B  1 75  ? 72.264  61.445  -91.848  1.00 35.23  ? 181 ALA B CB    1 
ATOM   4405  N  N     . LEU B  1 76  ? 73.286  62.739  -94.469  1.00 34.24  ? 182 LEU B N     1 
ATOM   4406  C  CA    . LEU B  1 76  ? 73.205  63.752  -95.515  1.00 34.55  ? 182 LEU B CA    1 
ATOM   4407  C  C     . LEU B  1 76  ? 73.082  63.091  -96.868  1.00 35.82  ? 182 LEU B C     1 
ATOM   4408  O  O     . LEU B  1 76  ? 72.329  63.559  -97.700  1.00 38.95  ? 182 LEU B O     1 
ATOM   4409  C  CB    . LEU B  1 76  ? 74.432  64.660  -95.496  1.00 33.78  ? 182 LEU B CB    1 
ATOM   4410  C  CG    . LEU B  1 76  ? 74.539  65.545  -94.251  1.00 33.25  ? 182 LEU B CG    1 
ATOM   4411  C  CD1   . LEU B  1 76  ? 75.888  66.225  -94.220  1.00 33.60  ? 182 LEU B CD1   1 
ATOM   4412  C  CD2   . LEU B  1 76  ? 73.452  66.577  -94.177  1.00 33.15  ? 182 LEU B CD2   1 
ATOM   4413  N  N     . GLY B  1 77  ? 73.798  61.987  -97.058  1.00 35.83  ? 183 GLY B N     1 
ATOM   4414  C  CA    . GLY B  1 77  ? 73.753  61.214  -98.287  1.00 37.86  ? 183 GLY B CA    1 
ATOM   4415  C  C     . GLY B  1 77  ? 72.403  60.618  -98.613  1.00 39.82  ? 183 GLY B C     1 
ATOM   4416  O  O     . GLY B  1 77  ? 71.951  60.709  -99.750  1.00 40.78  ? 183 GLY B O     1 
ATOM   4417  N  N     . GLU B  1 78  ? 71.753  60.006  -97.632  1.00 42.57  ? 184 GLU B N     1 
ATOM   4418  C  CA    . GLU B  1 78  ? 70.436  59.403  -97.860  1.00 45.80  ? 184 GLU B CA    1 
ATOM   4419  C  C     . GLU B  1 78  ? 69.429  60.489  -98.172  1.00 44.42  ? 184 GLU B C     1 
ATOM   4420  O  O     . GLU B  1 78  ? 68.697  60.369  -99.135  1.00 42.76  ? 184 GLU B O     1 
ATOM   4421  C  CB    . GLU B  1 78  ? 69.937  58.560  -96.678  1.00 52.38  ? 184 GLU B CB    1 
ATOM   4422  C  CG    . GLU B  1 78  ? 70.847  57.406  -96.233  1.00 60.73  ? 184 GLU B CG    1 
ATOM   4423  C  CD    . GLU B  1 78  ? 70.875  56.186  -97.165  1.00 67.97  ? 184 GLU B CD    1 
ATOM   4424  O  OE1   . GLU B  1 78  ? 69.883  55.430  -97.184  1.00 77.86  ? 184 GLU B OE1   1 
ATOM   4425  O  OE2   . GLU B  1 78  ? 71.914  55.953  -97.835  1.00 73.58  ? 184 GLU B OE2   1 
ATOM   4426  N  N     . LYS B  1 79  ? 69.406  61.554  -97.370  1.00 44.59  ? 185 LYS B N     1 
ATOM   4427  C  CA    . LYS B  1 79  ? 68.435  62.653  -97.547  1.00 44.03  ? 185 LYS B CA    1 
ATOM   4428  C  C     . LYS B  1 79  ? 68.668  63.406  -98.894  1.00 43.79  ? 185 LYS B C     1 
ATOM   4429  O  O     . LYS B  1 79  ? 67.706  63.825  -99.520  1.00 46.31  ? 185 LYS B O     1 
ATOM   4430  C  CB    . LYS B  1 79  ? 68.386  63.592  -96.310  1.00 40.87  ? 185 LYS B CB    1 
ATOM   4431  N  N     . GLN B  1 80  ? 69.913  63.524  -99.364  1.00 42.38  ? 186 GLN B N     1 
ATOM   4432  C  CA    . GLN B  1 80  ? 70.241  64.315  -100.577 1.00 42.45  ? 186 GLN B CA    1 
ATOM   4433  C  C     . GLN B  1 80  ? 71.219  63.582  -101.518 1.00 44.02  ? 186 GLN B C     1 
ATOM   4434  O  O     . GLN B  1 80  ? 72.443  63.807  -101.476 1.00 44.72  ? 186 GLN B O     1 
ATOM   4435  C  CB    . GLN B  1 80  ? 70.836  65.667  -100.180 1.00 40.57  ? 186 GLN B CB    1 
ATOM   4436  C  CG    . GLN B  1 80  ? 69.983  66.488  -99.239  1.00 39.72  ? 186 GLN B CG    1 
ATOM   4437  C  CD    . GLN B  1 80  ? 70.505  67.862  -98.996  1.00 39.41  ? 186 GLN B CD    1 
ATOM   4438  O  OE1   . GLN B  1 80  ? 71.194  68.121  -98.016  1.00 38.56  ? 186 GLN B OE1   1 
ATOM   4439  N  NE2   . GLN B  1 80  ? 70.175  68.758  -99.897  1.00 39.93  ? 186 GLN B NE2   1 
ATOM   4440  N  N     . PRO B  1 81  ? 70.684  62.690  -102.377 1.00 43.59  ? 187 PRO B N     1 
ATOM   4441  C  CA    . PRO B  1 81  ? 71.542  61.970  -103.313 1.00 43.67  ? 187 PRO B CA    1 
ATOM   4442  C  C     . PRO B  1 81  ? 72.265  62.870  -104.295 1.00 44.37  ? 187 PRO B C     1 
ATOM   4443  O  O     . PRO B  1 81  ? 73.368  62.552  -104.701 1.00 42.93  ? 187 PRO B O     1 
ATOM   4444  C  CB    . PRO B  1 81  ? 70.561  61.047  -104.042 1.00 43.66  ? 187 PRO B CB    1 
ATOM   4445  C  CG    . PRO B  1 81  ? 69.463  60.838  -103.070 1.00 42.80  ? 187 PRO B CG    1 
ATOM   4446  C  CD    . PRO B  1 81  ? 69.311  62.173  -102.401 1.00 43.20  ? 187 PRO B CD    1 
ATOM   4447  N  N     . GLU B  1 82  ? 71.651  64.002  -104.636 1.00 46.25  ? 188 GLU B N     1 
ATOM   4448  C  CA    . GLU B  1 82  ? 72.268  65.008  -105.508 1.00 46.86  ? 188 GLU B CA    1 
ATOM   4449  C  C     . GLU B  1 82  ? 73.685  65.402  -105.122 1.00 45.29  ? 188 GLU B C     1 
ATOM   4450  O  O     . GLU B  1 82  ? 74.444  65.837  -105.969 1.00 48.03  ? 188 GLU B O     1 
ATOM   4451  C  CB    . GLU B  1 82  ? 71.402  66.271  -105.602 1.00 50.92  ? 188 GLU B CB    1 
ATOM   4452  C  CG    . GLU B  1 82  ? 71.195  67.067  -104.300 1.00 55.58  ? 188 GLU B CG    1 
ATOM   4453  C  CD    . GLU B  1 82  ? 69.895  66.752  -103.562 1.00 60.36  ? 188 GLU B CD    1 
ATOM   4454  O  OE1   . GLU B  1 82  ? 69.370  65.585  -103.671 1.00 66.23  ? 188 GLU B OE1   1 
ATOM   4455  O  OE2   . GLU B  1 82  ? 69.400  67.681  -102.879 1.00 59.91  ? 188 GLU B OE2   1 
ATOM   4456  N  N     . LEU B  1 83  ? 74.042  65.266  -103.849 1.00 44.45  ? 189 LEU B N     1 
ATOM   4457  C  CA    . LEU B  1 83  ? 75.372  65.625  -103.363 1.00 45.50  ? 189 LEU B CA    1 
ATOM   4458  C  C     . LEU B  1 83  ? 76.484  64.674  -103.842 1.00 47.59  ? 189 LEU B C     1 
ATOM   4459  O  O     . LEU B  1 83  ? 77.671  65.046  -103.837 1.00 47.19  ? 189 LEU B O     1 
ATOM   4460  C  CB    . LEU B  1 83  ? 75.367  65.662  -101.845 1.00 45.37  ? 189 LEU B CB    1 
ATOM   4461  C  CG    . LEU B  1 83  ? 74.429  66.691  -101.203 1.00 45.68  ? 189 LEU B CG    1 
ATOM   4462  C  CD1   . LEU B  1 83  ? 74.386  66.496  -99.690  1.00 45.59  ? 189 LEU B CD1   1 
ATOM   4463  C  CD2   . LEU B  1 83  ? 74.809  68.111  -101.515 1.00 45.11  ? 189 LEU B CD2   1 
ATOM   4464  N  N     . GLN B  1 84  ? 76.090  63.460  -104.223 1.00 51.18  ? 190 GLN B N     1 
ATOM   4465  C  CA    . GLN B  1 84  ? 77.005  62.437  -104.720 1.00 51.05  ? 190 GLN B CA    1 
ATOM   4466  C  C     . GLN B  1 84  ? 78.130  62.176  -103.741 1.00 48.70  ? 190 GLN B C     1 
ATOM   4467  O  O     . GLN B  1 84  ? 79.307  62.348  -104.033 1.00 47.26  ? 190 GLN B O     1 
ATOM   4468  C  CB    . GLN B  1 84  ? 77.524  62.795  -106.128 1.00 53.46  ? 190 GLN B CB    1 
ATOM   4469  C  CG    . GLN B  1 84  ? 76.413  62.632  -107.165 1.00 54.84  ? 190 GLN B CG    1 
ATOM   4470  C  CD    . GLN B  1 84  ? 76.651  63.216  -108.491 1.00 56.06  ? 190 GLN B CD    1 
ATOM   4471  O  OE1   . GLN B  1 84  ? 77.372  64.191  -108.615 1.00 59.74  ? 190 GLN B OE1   1 
ATOM   4472  N  NE2   . GLN B  1 84  ? 76.012  62.642  -109.490 1.00 57.18  ? 190 GLN B NE2   1 
ATOM   4473  N  N     . ILE B  1 85  ? 77.710  61.789  -102.551 1.00 47.56  ? 191 ILE B N     1 
ATOM   4474  C  CA    . ILE B  1 85  ? 78.602  61.435  -101.475 1.00 46.30  ? 191 ILE B CA    1 
ATOM   4475  C  C     . ILE B  1 85  ? 78.940  59.989  -101.746 1.00 44.27  ? 191 ILE B C     1 
ATOM   4476  O  O     . ILE B  1 85  ? 78.046  59.172  -101.775 1.00 43.48  ? 191 ILE B O     1 
ATOM   4477  C  CB    . ILE B  1 85  ? 77.917  61.625  -100.104 1.00 47.25  ? 191 ILE B CB    1 
ATOM   4478  C  CG1   . ILE B  1 85  ? 77.727  63.119  -99.826  1.00 46.95  ? 191 ILE B CG1   1 
ATOM   4479  C  CG2   . ILE B  1 85  ? 78.750  61.023  -98.985  1.00 47.88  ? 191 ILE B CG2   1 
ATOM   4480  C  CD1   . ILE B  1 85  ? 76.831  63.432  -98.646  1.00 47.71  ? 191 ILE B CD1   1 
ATOM   4481  N  N     . SER B  1 86  ? 80.213  59.684  -101.962 1.00 44.59  ? 192 SER B N     1 
ATOM   4482  C  CA    . SER B  1 86  ? 80.662  58.318  -102.264 1.00 46.11  ? 192 SER B CA    1 
ATOM   4483  C  C     . SER B  1 86  ? 81.002  57.547  -100.998 1.00 47.10  ? 192 SER B C     1 
ATOM   4484  O  O     . SER B  1 86  ? 81.279  58.138  -99.980  1.00 46.35  ? 192 SER B O     1 
ATOM   4485  C  CB    . SER B  1 86  ? 81.892  58.340  -103.167 1.00 45.79  ? 192 SER B CB    1 
ATOM   4486  O  OG    . SER B  1 86  ? 82.953  59.064  -102.580 1.00 44.84  ? 192 SER B OG    1 
ATOM   4487  N  N     . GLU B  1 87  ? 81.032  56.221  -101.091 1.00 47.91  ? 193 GLU B N     1 
ATOM   4488  C  CA    . GLU B  1 87  ? 81.493  55.375  -99.990  1.00 49.00  ? 193 GLU B CA    1 
ATOM   4489  C  C     . GLU B  1 87  ? 82.954  55.638  -99.659  1.00 43.53  ? 193 GLU B C     1 
ATOM   4490  O  O     . GLU B  1 87  ? 83.426  55.346  -98.574  1.00 41.72  ? 193 GLU B O     1 
ATOM   4491  C  CB    . GLU B  1 87  ? 81.275  53.893  -100.272 1.00 56.04  ? 193 GLU B CB    1 
ATOM   4492  C  CG    . GLU B  1 87  ? 79.766  53.544  -100.297 1.00 64.77  ? 193 GLU B CG    1 
ATOM   4493  C  CD    . GLU B  1 87  ? 79.451  52.094  -100.397 1.00 72.67  ? 193 GLU B CD    1 
ATOM   4494  O  OE1   . GLU B  1 87  ? 80.227  51.348  -101.049 1.00 80.47  ? 193 GLU B OE1   1 
ATOM   4495  O  OE2   . GLU B  1 87  ? 78.381  51.705  -99.838  1.00 78.15  ? 193 GLU B OE2   1 
ATOM   4496  N  N     . ARG B  1 88  ? 83.663  56.183  -100.623 1.00 41.70  ? 194 ARG B N     1 
ATOM   4497  C  CA    . ARG B  1 88  ? 85.002  56.680  -100.406 1.00 42.05  ? 194 ARG B CA    1 
ATOM   4498  C  C     . ARG B  1 88  ? 85.009  57.919  -99.509  1.00 40.97  ? 194 ARG B C     1 
ATOM   4499  O  O     . ARG B  1 88  ? 85.812  58.021  -98.588  1.00 40.22  ? 194 ARG B O     1 
ATOM   4500  C  CB    . ARG B  1 88  ? 85.632  56.989  -101.758 1.00 42.32  ? 194 ARG B CB    1 
ATOM   4501  C  CG    . ARG B  1 88  ? 87.126  57.268  -101.667 1.00 41.63  ? 194 ARG B CG    1 
ATOM   4502  C  CD    . ARG B  1 88  ? 87.654  57.610  -103.046 1.00 41.19  ? 194 ARG B CD    1 
ATOM   4503  N  NE    . ARG B  1 88  ? 88.531  58.776  -103.005 1.00 40.70  ? 194 ARG B NE    1 
ATOM   4504  C  CZ    . ARG B  1 88  ? 88.845  59.498  -104.057 1.00 40.27  ? 194 ARG B CZ    1 
ATOM   4505  N  NH1   . ARG B  1 88  ? 88.359  59.222  -105.265 1.00 41.00  ? 194 ARG B NH1   1 
ATOM   4506  N  NH2   . ARG B  1 88  ? 89.658  60.509  -103.904 1.00 40.16  ? 194 ARG B NH2   1 
ATOM   4507  N  N     . ASP B  1 89  ? 84.137  58.869  -99.798  1.00 40.83  ? 195 ASP B N     1 
ATOM   4508  C  CA    . ASP B  1 89  ? 83.993  60.068  -98.957  1.00 41.19  ? 195 ASP B CA    1 
ATOM   4509  C  C     . ASP B  1 89  ? 83.637  59.705  -97.521  1.00 38.73  ? 195 ASP B C     1 
ATOM   4510  O  O     . ASP B  1 89  ? 84.180  60.273  -96.587  1.00 37.84  ? 195 ASP B O     1 
ATOM   4511  C  CB    . ASP B  1 89  ? 82.911  61.019  -99.498  1.00 43.17  ? 195 ASP B CB    1 
ATOM   4512  C  CG    . ASP B  1 89  ? 83.290  61.690  -100.800 1.00 45.91  ? 195 ASP B CG    1 
ATOM   4513  O  OD1   . ASP B  1 89  ? 84.482  61.996  -101.009 1.00 49.42  ? 195 ASP B OD1   1 
ATOM   4514  O  OD2   . ASP B  1 89  ? 82.373  61.934  -101.611 1.00 48.40  ? 195 ASP B OD2   1 
ATOM   4515  N  N     . VAL B  1 90  ? 82.724  58.754  -97.358  1.00 36.62  ? 196 VAL B N     1 
ATOM   4516  C  CA    . VAL B  1 90  ? 82.254  58.328  -96.030  1.00 35.75  ? 196 VAL B CA    1 
ATOM   4517  C  C     . VAL B  1 90  ? 83.398  57.744  -95.223  1.00 34.31  ? 196 VAL B C     1 
ATOM   4518  O  O     . VAL B  1 90  ? 83.589  58.102  -94.065  1.00 33.32  ? 196 VAL B O     1 
ATOM   4519  C  CB    . VAL B  1 90  ? 81.111  57.297  -96.145  1.00 36.79  ? 196 VAL B CB    1 
ATOM   4520  C  CG1   . VAL B  1 90  ? 80.762  56.677  -94.801  1.00 36.71  ? 196 VAL B CG1   1 
ATOM   4521  C  CG2   . VAL B  1 90  ? 79.874  57.962  -96.727  1.00 37.64  ? 196 VAL B CG2   1 
ATOM   4522  N  N     . LEU B  1 91  ? 84.151  56.844  -95.836  1.00 34.27  ? 197 LEU B N     1 
ATOM   4523  C  CA    . LEU B  1 91  ? 85.303  56.261  -95.175  1.00 34.16  ? 197 LEU B CA    1 
ATOM   4524  C  C     . LEU B  1 91  ? 86.316  57.293  -94.739  1.00 32.79  ? 197 LEU B C     1 
ATOM   4525  O  O     . LEU B  1 91  ? 86.853  57.200  -93.657  1.00 31.61  ? 197 LEU B O     1 
ATOM   4526  C  CB    . LEU B  1 91  ? 86.002  55.240  -96.060  1.00 35.53  ? 197 LEU B CB    1 
ATOM   4527  C  CG    . LEU B  1 91  ? 85.627  53.798  -95.777  1.00 37.46  ? 197 LEU B CG    1 
ATOM   4528  C  CD1   . LEU B  1 91  ? 86.348  52.871  -96.723  1.00 37.56  ? 197 LEU B CD1   1 
ATOM   4529  C  CD2   . LEU B  1 91  ? 85.995  53.410  -94.341  1.00 38.55  ? 197 LEU B CD2   1 
ATOM   4530  N  N     . CYS B  1 92  ? 86.579  58.269  -95.589  1.00 32.77  ? 198 CYS B N     1 
ATOM   4531  C  CA    . CYS B  1 92  ? 87.546  59.305  -95.265  1.00 33.73  ? 198 CYS B CA    1 
ATOM   4532  C  C     . CYS B  1 92  ? 87.112  60.171  -94.093  1.00 33.08  ? 198 CYS B C     1 
ATOM   4533  O  O     . CYS B  1 92  ? 87.923  60.532  -93.248  1.00 33.63  ? 198 CYS B O     1 
ATOM   4534  C  CB    . CYS B  1 92  ? 87.812  60.188  -96.479  1.00 35.05  ? 198 CYS B CB    1 
ATOM   4535  S  SG    . CYS B  1 92  ? 88.683  59.322  -97.793  1.00 37.27  ? 198 CYS B SG    1 
ATOM   4536  N  N     . VAL B  1 93  ? 85.831  60.511  -94.061  1.00 32.34  ? 199 VAL B N     1 
ATOM   4537  C  CA    . VAL B  1 93  ? 85.252  61.293  -92.970  1.00 31.50  ? 199 VAL B CA    1 
ATOM   4538  C  C     . VAL B  1 93  ? 85.347  60.498  -91.660  1.00 30.22  ? 199 VAL B C     1 
ATOM   4539  O  O     . VAL B  1 93  ? 85.737  61.048  -90.632  1.00 29.89  ? 199 VAL B O     1 
ATOM   4540  C  CB    . VAL B  1 93  ? 83.800  61.675  -93.294  1.00 32.32  ? 199 VAL B CB    1 
ATOM   4541  C  CG1   . VAL B  1 93  ? 83.095  62.269  -92.096  1.00 32.78  ? 199 VAL B CG1   1 
ATOM   4542  C  CG2   . VAL B  1 93  ? 83.750  62.683  -94.424  1.00 33.17  ? 199 VAL B CG2   1 
ATOM   4543  N  N     . GLN B  1 94  ? 85.013  59.207  -91.709  1.00 28.76  ? 200 GLN B N     1 
ATOM   4544  C  CA    . GLN B  1 94  ? 85.168  58.319  -90.549  1.00 27.22  ? 200 GLN B CA    1 
ATOM   4545  C  C     . GLN B  1 94  ? 86.600  58.231  -90.053  1.00 26.30  ? 200 GLN B C     1 
ATOM   4546  O  O     . GLN B  1 94  ? 86.843  58.298  -88.857  1.00 25.73  ? 200 GLN B O     1 
ATOM   4547  C  CB    . GLN B  1 94  ? 84.665  56.910  -90.859  1.00 27.33  ? 200 GLN B CB    1 
ATOM   4548  C  CG    . GLN B  1 94  ? 83.162  56.770  -90.763  1.00 27.52  ? 200 GLN B CG    1 
ATOM   4549  C  CD    . GLN B  1 94  ? 82.722  55.381  -91.137  1.00 28.20  ? 200 GLN B CD    1 
ATOM   4550  O  OE1   . GLN B  1 94  ? 82.826  54.971  -92.293  1.00 29.40  ? 200 GLN B OE1   1 
ATOM   4551  N  NE2   . GLN B  1 94  ? 82.220  54.647  -90.164  1.00 28.50  ? 200 GLN B NE2   1 
ATOM   4552  N  N     . ILE B  1 95  ? 87.542  58.075  -90.971  1.00 26.14  ? 201 ILE B N     1 
ATOM   4553  C  CA    . ILE B  1 95  ? 88.953  57.985  -90.608  1.00 25.68  ? 201 ILE B CA    1 
ATOM   4554  C  C     . ILE B  1 95  ? 89.409  59.275  -89.933  1.00 25.08  ? 201 ILE B C     1 
ATOM   4555  O  O     . ILE B  1 95  ? 90.148  59.232  -88.953  1.00 25.26  ? 201 ILE B O     1 
ATOM   4556  C  CB    . ILE B  1 95  ? 89.846  57.651  -91.820  1.00 26.00  ? 201 ILE B CB    1 
ATOM   4557  C  CG1   . ILE B  1 95  ? 89.578  56.227  -92.285  1.00 26.38  ? 201 ILE B CG1   1 
ATOM   4558  C  CG2   . ILE B  1 95  ? 91.319  57.732  -91.467  1.00 25.96  ? 201 ILE B CG2   1 
ATOM   4559  C  CD1   . ILE B  1 95  ? 90.087  55.904  -93.661  1.00 26.59  ? 201 ILE B CD1   1 
ATOM   4560  N  N     . ALA B  1 96  ? 88.967  60.412  -90.448  1.00 24.56  ? 202 ALA B N     1 
ATOM   4561  C  CA    . ALA B  1 96  ? 89.319  61.690  -89.841  1.00 24.53  ? 202 ALA B CA    1 
ATOM   4562  C  C     . ALA B  1 96  ? 88.782  61.771  -88.420  1.00 24.54  ? 202 ALA B C     1 
ATOM   4563  O  O     . ALA B  1 96  ? 89.518  62.070  -87.481  1.00 24.34  ? 202 ALA B O     1 
ATOM   4564  C  CB    . ALA B  1 96  ? 88.775  62.841  -90.665  1.00 24.52  ? 202 ALA B CB    1 
ATOM   4565  N  N     . GLY B  1 97  ? 87.498  61.487  -88.278  1.00 24.43  ? 203 GLY B N     1 
ATOM   4566  C  CA    . GLY B  1 97  ? 86.864  61.472  -86.970  1.00 24.63  ? 203 GLY B CA    1 
ATOM   4567  C  C     . GLY B  1 97  ? 87.577  60.563  -85.996  1.00 24.74  ? 203 GLY B C     1 
ATOM   4568  O  O     . GLY B  1 97  ? 87.828  60.930  -84.854  1.00 24.64  ? 203 GLY B O     1 
ATOM   4569  N  N     . LEU B  1 98  ? 87.924  59.379  -86.469  1.00 24.96  ? 204 LEU B N     1 
ATOM   4570  C  CA    . LEU B  1 98  ? 88.594  58.389  -85.658  1.00 25.73  ? 204 LEU B CA    1 
ATOM   4571  C  C     . LEU B  1 98  ? 89.978  58.859  -85.185  1.00 26.07  ? 204 LEU B C     1 
ATOM   4572  O  O     . LEU B  1 98  ? 90.358  58.699  -84.023  1.00 24.65  ? 204 LEU B O     1 
ATOM   4573  C  CB    . LEU B  1 98  ? 88.706  57.130  -86.489  1.00 27.01  ? 204 LEU B CB    1 
ATOM   4574  C  CG    . LEU B  1 98  ? 89.094  55.827  -85.823  1.00 28.44  ? 204 LEU B CG    1 
ATOM   4575  C  CD1   . LEU B  1 98  ? 88.082  55.484  -84.741  1.00 29.24  ? 204 LEU B CD1   1 
ATOM   4576  C  CD2   . LEU B  1 98  ? 89.083  54.737  -86.881  1.00 29.29  ? 204 LEU B CD2   1 
ATOM   4577  N  N     . CYS B  1 99  ? 90.702  59.507  -86.089  1.00 27.70  ? 205 CYS B N     1 
ATOM   4578  C  CA    . CYS B  1 99  ? 92.087  59.936  -85.837  1.00 28.47  ? 205 CYS B CA    1 
ATOM   4579  C  C     . CYS B  1 99  ? 92.238  61.400  -85.413  1.00 28.91  ? 205 CYS B C     1 
ATOM   4580  O  O     . CYS B  1 99  ? 93.345  61.912  -85.356  1.00 29.92  ? 205 CYS B O     1 
ATOM   4581  C  CB    . CYS B  1 99  ? 92.914  59.672  -87.100  1.00 27.95  ? 205 CYS B CB    1 
ATOM   4582  S  SG    . CYS B  1 99  ? 93.013  57.913  -87.513  1.00 28.54  ? 205 CYS B SG    1 
ATOM   4583  N  N     . HIS B  1 100 ? 91.139  62.071  -85.092  1.00 28.50  ? 206 HIS B N     1 
ATOM   4584  C  CA    . HIS B  1 100 ? 91.153  63.534  -84.992  1.00 28.62  ? 206 HIS B CA    1 
ATOM   4585  C  C     . HIS B  1 100 ? 91.919  64.018  -83.770  1.00 28.62  ? 206 HIS B C     1 
ATOM   4586  O  O     . HIS B  1 100 ? 92.488  65.118  -83.790  1.00 29.25  ? 206 HIS B O     1 
ATOM   4587  C  CB    . HIS B  1 100 ? 89.727  64.093  -84.963  1.00 28.78  ? 206 HIS B CB    1 
ATOM   4588  C  CG    . HIS B  1 100 ? 89.080  64.031  -83.618  1.00 28.44  ? 206 HIS B CG    1 
ATOM   4589  N  ND1   . HIS B  1 100 ? 88.699  62.845  -83.038  1.00 27.38  ? 206 HIS B ND1   1 
ATOM   4590  C  CD2   . HIS B  1 100 ? 88.795  64.999  -82.721  1.00 28.66  ? 206 HIS B CD2   1 
ATOM   4591  C  CE1   . HIS B  1 100 ? 88.188  63.089  -81.846  1.00 27.95  ? 206 HIS B CE1   1 
ATOM   4592  N  NE2   . HIS B  1 100 ? 88.234  64.389  -81.633  1.00 28.69  ? 206 HIS B NE2   1 
ATOM   4593  N  N     . ASP B  1 101 ? 91.907  63.204  -82.704  1.00 27.98  ? 207 ASP B N     1 
ATOM   4594  C  CA    . ASP B  1 101 ? 92.614  63.554  -81.467  1.00 26.98  ? 207 ASP B CA    1 
ATOM   4595  C  C     . ASP B  1 101 ? 93.861  62.705  -81.231  1.00 26.54  ? 207 ASP B C     1 
ATOM   4596  O  O     . ASP B  1 101 ? 94.459  62.764  -80.154  1.00 26.02  ? 207 ASP B O     1 
ATOM   4597  C  CB    . ASP B  1 101 ? 91.670  63.517  -80.247  1.00 25.54  ? 207 ASP B CB    1 
ATOM   4598  C  CG    . ASP B  1 101 ? 90.874  64.832  -80.048  1.00 24.84  ? 207 ASP B CG    1 
ATOM   4599  O  OD1   . ASP B  1 101 ? 91.179  65.960  -80.565  1.00 23.74  ? 207 ASP B OD1   1 
ATOM   4600  O  OD2   . ASP B  1 101 ? 89.864  64.716  -79.371  1.00 24.69  ? 207 ASP B OD2   1 
ATOM   4601  N  N     . LEU B  1 102 ? 94.308  62.001  -82.261  1.00 26.28  ? 208 LEU B N     1 
ATOM   4602  C  CA    . LEU B  1 102 ? 95.566  61.210  -82.194  1.00 25.82  ? 208 LEU B CA    1 
ATOM   4603  C  C     . LEU B  1 102 ? 96.785  61.846  -81.541  1.00 26.00  ? 208 LEU B C     1 
ATOM   4604  O  O     . LEU B  1 102 ? 97.635  61.113  -81.007  1.00 25.30  ? 208 LEU B O     1 
ATOM   4605  C  CB    . LEU B  1 102 ? 96.013  60.744  -83.591  1.00 25.06  ? 208 LEU B CB    1 
ATOM   4606  C  CG    . LEU B  1 102 ? 95.603  59.349  -84.042  1.00 24.91  ? 208 LEU B CG    1 
ATOM   4607  C  CD1   . LEU B  1 102 ? 96.021  59.102  -85.457  1.00 24.88  ? 208 LEU B CD1   1 
ATOM   4608  C  CD2   . LEU B  1 102 ? 96.201  58.270  -83.138  1.00 24.76  ? 208 LEU B CD2   1 
ATOM   4609  N  N     . GLY B  1 103 ? 96.878  63.174  -81.626  1.00 26.84  ? 209 GLY B N     1 
ATOM   4610  C  CA    . GLY B  1 103 ? 98.012  63.934  -81.121  1.00 28.00  ? 209 GLY B CA    1 
ATOM   4611  C  C     . GLY B  1 103 ? 97.903  64.563  -79.746  1.00 29.06  ? 209 GLY B C     1 
ATOM   4612  O  O     . GLY B  1 103 ? 98.705  65.425  -79.401  1.00 29.55  ? 209 GLY B O     1 
ATOM   4613  N  N     . HIS B  1 104 ? 96.936  64.148  -78.940  1.00 30.13  ? 210 HIS B N     1 
ATOM   4614  C  CA    . HIS B  1 104 ? 96.858  64.652  -77.567  1.00 31.19  ? 210 HIS B CA    1 
ATOM   4615  C  C     . HIS B  1 104 ? 97.993  64.105  -76.755  1.00 30.48  ? 210 HIS B C     1 
ATOM   4616  O  O     . HIS B  1 104 ? 98.418  62.962  -76.958  1.00 29.14  ? 210 HIS B O     1 
ATOM   4617  C  CB    . HIS B  1 104 ? 95.534  64.315  -76.885  1.00 32.20  ? 210 HIS B CB    1 
ATOM   4618  C  CG    . HIS B  1 104 ? 94.548  65.434  -76.922  1.00 33.45  ? 210 HIS B CG    1 
ATOM   4619  N  ND1   . HIS B  1 104 ? 94.850  66.703  -76.480  1.00 35.63  ? 210 HIS B ND1   1 
ATOM   4620  C  CD2   . HIS B  1 104 ? 93.269  65.475  -77.333  1.00 33.02  ? 210 HIS B CD2   1 
ATOM   4621  C  CE1   . HIS B  1 104 ? 93.786  67.477  -76.641  1.00 35.34  ? 210 HIS B CE1   1 
ATOM   4622  N  NE2   . HIS B  1 104 ? 92.819  66.760  -77.170  1.00 33.26  ? 210 HIS B NE2   1 
ATOM   4623  N  N     . GLY B  1 105 ? 98.476  64.940  -75.833  1.00 30.81  ? 211 GLY B N     1 
ATOM   4624  C  CA    . GLY B  1 105 ? 99.566  64.529  -74.956  1.00 31.01  ? 211 GLY B CA    1 
ATOM   4625  C  C     . GLY B  1 105 ? 99.086  63.931  -73.652  1.00 29.92  ? 211 GLY B C     1 
ATOM   4626  O  O     . GLY B  1 105 ? 97.900  63.729  -73.471  1.00 29.32  ? 211 GLY B O     1 
ATOM   4627  N  N     . PRO B  1 106 ? 100.020 63.647  -72.737  1.00 29.56  ? 212 PRO B N     1 
ATOM   4628  C  CA    . PRO B  1 106 ? 99.664  63.256  -71.388  1.00 28.36  ? 212 PRO B CA    1 
ATOM   4629  C  C     . PRO B  1 106 ? 98.722  64.261  -70.759  1.00 27.20  ? 212 PRO B C     1 
ATOM   4630  O  O     . PRO B  1 106 ? 98.952  65.460  -70.843  1.00 26.69  ? 212 PRO B O     1 
ATOM   4631  C  CB    . PRO B  1 106 ? 101.005 63.226  -70.655  1.00 29.05  ? 212 PRO B CB    1 
ATOM   4632  C  CG    . PRO B  1 106 ? 102.001 62.914  -71.713  1.00 29.87  ? 212 PRO B CG    1 
ATOM   4633  C  CD    . PRO B  1 106 ? 101.468 63.508  -72.985  1.00 30.01  ? 212 PRO B CD    1 
ATOM   4634  N  N     . PHE B  1 107 ? 97.654  63.743  -70.156  1.00 26.68  ? 213 PHE B N     1 
ATOM   4635  C  CA    . PHE B  1 107 ? 96.572  64.540  -69.561  1.00 25.79  ? 213 PHE B CA    1 
ATOM   4636  C  C     . PHE B  1 107 ? 95.946  65.534  -70.543  1.00 25.72  ? 213 PHE B C     1 
ATOM   4637  O  O     . PHE B  1 107 ? 95.612  66.644  -70.190  1.00 25.61  ? 213 PHE B O     1 
ATOM   4638  C  CB    . PHE B  1 107 ? 97.045  65.191  -68.253  1.00 25.60  ? 213 PHE B CB    1 
ATOM   4639  C  CG    . PHE B  1 107 ? 97.496  64.193  -67.238  1.00 25.31  ? 213 PHE B CG    1 
ATOM   4640  C  CD1   . PHE B  1 107 ? 98.770  63.677  -67.284  1.00 25.47  ? 213 PHE B CD1   1 
ATOM   4641  C  CD2   . PHE B  1 107 ? 96.639  63.734  -66.266  1.00 25.37  ? 213 PHE B CD2   1 
ATOM   4642  C  CE1   . PHE B  1 107 ? 99.182  62.723  -66.371  1.00 25.62  ? 213 PHE B CE1   1 
ATOM   4643  C  CE2   . PHE B  1 107 ? 97.027  62.791  -65.348  1.00 25.62  ? 213 PHE B CE2   1 
ATOM   4644  C  CZ    . PHE B  1 107 ? 98.287  62.269  -65.410  1.00 25.68  ? 213 PHE B CZ    1 
ATOM   4645  N  N     . SER B  1 108 ? 95.784  65.090  -71.783  1.00 26.43  ? 214 SER B N     1 
ATOM   4646  C  CA    . SER B  1 108 ? 95.053  65.807  -72.828  1.00 27.33  ? 214 SER B CA    1 
ATOM   4647  C  C     . SER B  1 108 ? 95.392  67.296  -72.953  1.00 29.04  ? 214 SER B C     1 
ATOM   4648  O  O     . SER B  1 108 ? 96.447  67.626  -73.494  1.00 29.99  ? 214 SER B O     1 
ATOM   4649  C  CB    . SER B  1 108 ? 93.549  65.550  -72.694  1.00 26.82  ? 214 SER B CB    1 
ATOM   4650  O  OG    . SER B  1 108 ? 93.205  64.243  -73.114  1.00 25.93  ? 214 SER B OG    1 
ATOM   4651  N  N     . HIS B  1 109 ? 94.515  68.174  -72.476  1.00 31.06  ? 215 HIS B N     1 
ATOM   4652  C  CA    . HIS B  1 109 ? 94.624  69.611  -72.745  1.00 32.85  ? 215 HIS B CA    1 
ATOM   4653  C  C     . HIS B  1 109 ? 95.616  70.285  -71.825  1.00 33.84  ? 215 HIS B C     1 
ATOM   4654  O  O     . HIS B  1 109 ? 96.111  71.355  -72.134  1.00 35.15  ? 215 HIS B O     1 
ATOM   4655  C  CB    . HIS B  1 109 ? 93.258  70.331  -72.720  1.00 33.89  ? 215 HIS B CB    1 
ATOM   4656  C  CG    . HIS B  1 109 ? 92.578  70.395  -74.064  1.00 35.65  ? 215 HIS B CG    1 
ATOM   4657  N  ND1   . HIS B  1 109 ? 93.042  71.173  -75.109  1.00 36.84  ? 215 HIS B ND1   1 
ATOM   4658  C  CD2   . HIS B  1 109 ? 91.468  69.778  -74.537  1.00 36.99  ? 215 HIS B CD2   1 
ATOM   4659  C  CE1   . HIS B  1 109 ? 92.247  71.028  -76.163  1.00 36.45  ? 215 HIS B CE1   1 
ATOM   4660  N  NE2   . HIS B  1 109 ? 91.280  70.194  -75.842  1.00 36.06  ? 215 HIS B NE2   1 
ATOM   4661  N  N     . MET B  1 110 ? 95.923  69.656  -70.707  1.00 35.29  ? 216 MET B N     1 
ATOM   4662  C  CA    . MET B  1 110 ? 97.021  70.093  -69.856  1.00 36.96  ? 216 MET B CA    1 
ATOM   4663  C  C     . MET B  1 110 ? 98.312  70.202  -70.656  1.00 38.35  ? 216 MET B C     1 
ATOM   4664  O  O     . MET B  1 110 ? 99.057  71.166  -70.492  1.00 42.76  ? 216 MET B O     1 
ATOM   4665  C  CB    . MET B  1 110 ? 97.211  69.123  -68.703  1.00 37.02  ? 216 MET B CB    1 
ATOM   4666  C  CG    . MET B  1 110 ? 98.135  69.658  -67.624  1.00 38.06  ? 216 MET B CG    1 
ATOM   4667  S  SD    . MET B  1 110 ? 98.872  68.258  -66.741  1.00 40.26  ? 216 MET B SD    1 
ATOM   4668  C  CE    . MET B  1 110 ? 100.186 67.793  -67.958  1.00 41.67  ? 216 MET B CE    1 
ATOM   4669  N  N     . PHE B  1 111 ? 98.560  69.241  -71.531  1.00 37.85  ? 217 PHE B N     1 
ATOM   4670  C  CA    . PHE B  1 111 ? 99.790  69.196  -72.334  1.00 38.08  ? 217 PHE B CA    1 
ATOM   4671  C  C     . PHE B  1 111 ? 99.916  70.339  -73.322  1.00 37.14  ? 217 PHE B C     1 
ATOM   4672  O  O     . PHE B  1 111 ? 100.877 71.075  -73.263  1.00 37.07  ? 217 PHE B O     1 
ATOM   4673  C  CB    . PHE B  1 111 ? 99.890  67.870  -73.092  1.00 38.05  ? 217 PHE B CB    1 
ATOM   4674  C  CG    . PHE B  1 111 ? 101.287 67.490  -73.447  1.00 37.17  ? 217 PHE B CG    1 
ATOM   4675  C  CD1   . PHE B  1 111 ? 102.164 67.046  -72.468  1.00 37.07  ? 217 PHE B CD1   1 
ATOM   4676  C  CD2   . PHE B  1 111 ? 101.719 67.551  -74.758  1.00 36.74  ? 217 PHE B CD2   1 
ATOM   4677  C  CE1   . PHE B  1 111 ? 103.445 66.680  -72.785  1.00 37.17  ? 217 PHE B CE1   1 
ATOM   4678  C  CE2   . PHE B  1 111 ? 103.008 67.176  -75.082  1.00 37.17  ? 217 PHE B CE2   1 
ATOM   4679  C  CZ    . PHE B  1 111 ? 103.871 66.740  -74.091  1.00 37.74  ? 217 PHE B CZ    1 
ATOM   4680  N  N     . ASP B  1 112 ? 98.962  70.484  -74.223  1.00 37.52  ? 218 ASP B N     1 
ATOM   4681  C  CA    . ASP B  1 112 ? 99.029  71.528  -75.251  1.00 40.18  ? 218 ASP B CA    1 
ATOM   4682  C  C     . ASP B  1 112 ? 98.623  72.907  -74.723  1.00 39.96  ? 218 ASP B C     1 
ATOM   4683  O  O     . ASP B  1 112 ? 98.979  73.923  -75.318  1.00 44.06  ? 218 ASP B O     1 
ATOM   4684  C  CB    . ASP B  1 112 ? 98.262  71.120  -76.552  1.00 41.61  ? 218 ASP B CB    1 
ATOM   4685  C  CG    . ASP B  1 112 ? 96.756  71.273  -76.471  1.00 42.62  ? 218 ASP B CG    1 
ATOM   4686  O  OD1   . ASP B  1 112 ? 96.206  71.272  -75.360  1.00 46.54  ? 218 ASP B OD1   1 
ATOM   4687  O  OD2   . ASP B  1 112 ? 96.095  71.384  -77.532  1.00 42.32  ? 218 ASP B OD2   1 
ATOM   4688  N  N     . GLY B  1 113 ? 97.915  72.935  -73.600  1.00 37.90  ? 219 GLY B N     1 
ATOM   4689  C  CA    . GLY B  1 113 ? 97.377  74.170  -73.037  1.00 37.40  ? 219 GLY B CA    1 
ATOM   4690  C  C     . GLY B  1 113 ? 98.188  74.803  -71.922  1.00 37.44  ? 219 GLY B C     1 
ATOM   4691  O  O     . GLY B  1 113 ? 98.171  76.016  -71.789  1.00 36.81  ? 219 GLY B O     1 
ATOM   4692  N  N     . ARG B  1 114 ? 98.855  73.993  -71.101  1.00 38.56  ? 220 ARG B N     1 
ATOM   4693  C  CA    . ARG B  1 114 ? 99.680  74.492  -69.993  1.00 40.41  ? 220 ARG B CA    1 
ATOM   4694  C  C     . ARG B  1 114 ? 101.152 74.180  -70.153  1.00 42.65  ? 220 ARG B C     1 
ATOM   4695  O  O     . ARG B  1 114 ? 101.966 75.082  -70.124  1.00 47.90  ? 220 ARG B O     1 
ATOM   4696  C  CB    . ARG B  1 114 ? 99.202  73.919  -68.663  1.00 40.48  ? 220 ARG B CB    1 
ATOM   4697  C  CG    . ARG B  1 114 ? 97.817  74.412  -68.272  1.00 41.51  ? 220 ARG B CG    1 
ATOM   4698  C  CD    . ARG B  1 114 ? 97.300  73.696  -67.037  1.00 42.44  ? 220 ARG B CD    1 
ATOM   4699  N  NE    . ARG B  1 114 ? 95.992  74.198  -66.650  1.00 43.59  ? 220 ARG B NE    1 
ATOM   4700  C  CZ    . ARG B  1 114 ? 95.764  75.353  -66.009  1.00 45.68  ? 220 ARG B CZ    1 
ATOM   4701  N  NH1   . ARG B  1 114 ? 96.727  76.171  -65.685  1.00 48.71  ? 220 ARG B NH1   1 
ATOM   4702  N  NH2   . ARG B  1 114 ? 94.514  75.709  -65.740  1.00 45.20  ? 220 ARG B NH2   1 
ATOM   4703  N  N     . PHE B  1 115 ? 101.487 72.904  -70.333  1.00 42.66  ? 221 PHE B N     1 
ATOM   4704  C  CA    . PHE B  1 115 ? 102.881 72.435  -70.328  1.00 42.39  ? 221 PHE B CA    1 
ATOM   4705  C  C     . PHE B  1 115 ? 103.745 72.928  -71.482  1.00 44.78  ? 221 PHE B C     1 
ATOM   4706  O  O     . PHE B  1 115 ? 104.763 73.552  -71.260  1.00 47.80  ? 221 PHE B O     1 
ATOM   4707  C  CB    . PHE B  1 115 ? 102.924 70.919  -70.301  1.00 40.99  ? 221 PHE B CB    1 
ATOM   4708  C  CG    . PHE B  1 115 ? 104.310 70.349  -70.339  1.00 41.17  ? 221 PHE B CG    1 
ATOM   4709  C  CD1   . PHE B  1 115 ? 105.167 70.531  -69.261  1.00 41.63  ? 221 PHE B CD1   1 
ATOM   4710  C  CD2   . PHE B  1 115 ? 104.755 69.622  -71.438  1.00 40.82  ? 221 PHE B CD2   1 
ATOM   4711  C  CE1   . PHE B  1 115 ? 106.443 70.004  -69.277  1.00 41.29  ? 221 PHE B CE1   1 
ATOM   4712  C  CE2   . PHE B  1 115 ? 106.019 69.092  -71.455  1.00 41.32  ? 221 PHE B CE2   1 
ATOM   4713  C  CZ    . PHE B  1 115 ? 106.873 69.273  -70.366  1.00 41.85  ? 221 PHE B CZ    1 
ATOM   4714  N  N     . ILE B  1 116 ? 103.360 72.629  -72.706  1.00 46.29  ? 222 ILE B N     1 
ATOM   4715  C  CA    . ILE B  1 116 ? 104.175 73.001  -73.859  1.00 47.37  ? 222 ILE B CA    1 
ATOM   4716  C  C     . ILE B  1 116 ? 104.361 74.519  -73.963  1.00 49.47  ? 222 ILE B C     1 
ATOM   4717  O  O     . ILE B  1 116 ? 105.465 74.979  -74.231  1.00 50.13  ? 222 ILE B O     1 
ATOM   4718  C  CB    . ILE B  1 116 ? 103.627 72.369  -75.169  1.00 46.10  ? 222 ILE B CB    1 
ATOM   4719  C  CG1   . ILE B  1 116 ? 103.810 70.843  -75.142  1.00 44.46  ? 222 ILE B CG1   1 
ATOM   4720  C  CG2   . ILE B  1 116 ? 104.271 72.960  -76.415  1.00 46.96  ? 222 ILE B CG2   1 
ATOM   4721  C  CD1   . ILE B  1 116 ? 105.228 70.337  -75.159  1.00 44.40  ? 222 ILE B CD1   1 
ATOM   4722  N  N     . PRO B  1 117 ? 103.297 75.307  -73.736  1.00 49.60  ? 223 PRO B N     1 
ATOM   4723  C  CA    . PRO B  1 117 ? 103.514 76.750  -73.707  1.00 50.14  ? 223 PRO B CA    1 
ATOM   4724  C  C     . PRO B  1 117 ? 104.523 77.252  -72.671  1.00 50.59  ? 223 PRO B C     1 
ATOM   4725  O  O     . PRO B  1 117 ? 105.158 78.271  -72.913  1.00 52.34  ? 223 PRO B O     1 
ATOM   4726  C  CB    . PRO B  1 117 ? 102.127 77.291  -73.404  1.00 49.41  ? 223 PRO B CB    1 
ATOM   4727  C  CG    . PRO B  1 117 ? 101.240 76.332  -74.098  1.00 49.45  ? 223 PRO B CG    1 
ATOM   4728  C  CD    . PRO B  1 117 ? 101.876 74.983  -73.905  1.00 48.42  ? 223 PRO B CD    1 
ATOM   4729  N  N     . LEU B  1 118 ? 104.666 76.561  -71.542  1.00 50.08  ? 224 LEU B N     1 
ATOM   4730  C  CA    . LEU B  1 118 ? 105.671 76.927  -70.536  1.00 50.74  ? 224 LEU B CA    1 
ATOM   4731  C  C     . LEU B  1 118 ? 107.028 76.328  -70.849  1.00 51.84  ? 224 LEU B C     1 
ATOM   4732  O  O     . LEU B  1 118 ? 108.028 77.022  -70.763  1.00 58.15  ? 224 LEU B O     1 
ATOM   4733  C  CB    . LEU B  1 118 ? 105.238 76.513  -69.130  1.00 50.55  ? 224 LEU B CB    1 
ATOM   4734  C  CG    . LEU B  1 118 ? 103.974 77.190  -68.581  1.00 50.79  ? 224 LEU B CG    1 
ATOM   4735  C  CD1   . LEU B  1 118 ? 103.720 76.671  -67.176  1.00 49.85  ? 224 LEU B CD1   1 
ATOM   4736  C  CD2   . LEU B  1 118 ? 104.028 78.710  -68.587  1.00 52.02  ? 224 LEU B CD2   1 
ATOM   4737  N  N     . ALA B  1 119 ? 107.061 75.057  -71.217  1.00 50.73  ? 225 ALA B N     1 
ATOM   4738  C  CA    . ALA B  1 119 ? 108.314 74.362  -71.500  1.00 51.80  ? 225 ALA B CA    1 
ATOM   4739  C  C     . ALA B  1 119 ? 109.023 74.863  -72.745  1.00 49.83  ? 225 ALA B C     1 
ATOM   4740  O  O     . ALA B  1 119 ? 110.234 74.869  -72.779  1.00 47.80  ? 225 ALA B O     1 
ATOM   4741  C  CB    . ALA B  1 119 ? 108.072 72.862  -71.624  1.00 54.40  ? 225 ALA B CB    1 
ATOM   4742  N  N     . ARG B  1 120 ? 108.265 75.245  -73.764  1.00 49.98  ? 226 ARG B N     1 
ATOM   4743  C  CA    . ARG B  1 120 ? 108.826 75.663  -75.051  1.00 50.69  ? 226 ARG B CA    1 
ATOM   4744  C  C     . ARG B  1 120 ? 108.043 76.833  -75.640  1.00 51.09  ? 226 ARG B C     1 
ATOM   4745  O  O     . ARG B  1 120 ? 107.292 76.659  -76.606  1.00 50.37  ? 226 ARG B O     1 
ATOM   4746  C  CB    . ARG B  1 120 ? 108.828 74.489  -76.018  1.00 49.45  ? 226 ARG B CB    1 
ATOM   4747  C  CG    . ARG B  1 120 ? 109.749 73.370  -75.573  1.00 49.46  ? 226 ARG B CG    1 
ATOM   4748  C  CD    . ARG B  1 120 ? 109.742 72.245  -76.571  1.00 50.62  ? 226 ARG B CD    1 
ATOM   4749  N  NE    . ARG B  1 120 ? 110.146 72.687  -77.900  1.00 51.81  ? 226 ARG B NE    1 
ATOM   4750  C  CZ    . ARG B  1 120 ? 110.131 71.916  -78.980  1.00 52.29  ? 226 ARG B CZ    1 
ATOM   4751  N  NH1   . ARG B  1 120 ? 109.738 70.656  -78.918  1.00 52.02  ? 226 ARG B NH1   1 
ATOM   4752  N  NH2   . ARG B  1 120 ? 110.506 72.416  -80.137  1.00 54.58  ? 226 ARG B NH2   1 
ATOM   4753  N  N     . PRO B  1 121 ? 108.220 78.037  -75.055  1.00 51.61  ? 227 PRO B N     1 
ATOM   4754  C  CA    . PRO B  1 121 ? 107.473 79.235  -75.458  1.00 52.95  ? 227 PRO B CA    1 
ATOM   4755  C  C     . PRO B  1 121 ? 107.682 79.660  -76.903  1.00 57.26  ? 227 PRO B C     1 
ATOM   4756  O  O     . PRO B  1 121 ? 106.816 80.316  -77.466  1.00 61.06  ? 227 PRO B O     1 
ATOM   4757  C  CB    . PRO B  1 121 ? 108.016 80.326  -74.531  1.00 52.59  ? 227 PRO B CB    1 
ATOM   4758  C  CG    . PRO B  1 121 ? 108.642 79.614  -73.392  1.00 52.06  ? 227 PRO B CG    1 
ATOM   4759  C  CD    . PRO B  1 121 ? 109.164 78.334  -73.957  1.00 52.07  ? 227 PRO B CD    1 
ATOM   4760  N  N     . GLU B  1 122 ? 108.835 79.314  -77.472  1.00 63.22  ? 228 GLU B N     1 
ATOM   4761  C  CA    . GLU B  1 122 ? 109.144 79.604  -78.873  1.00 67.34  ? 228 GLU B CA    1 
ATOM   4762  C  C     . GLU B  1 122 ? 108.175 78.962  -79.883  1.00 67.26  ? 228 GLU B C     1 
ATOM   4763  O  O     . GLU B  1 122 ? 107.910 79.556  -80.920  1.00 71.90  ? 228 GLU B O     1 
ATOM   4764  C  CB    . GLU B  1 122 ? 110.611 79.229  -79.218  1.00 70.93  ? 228 GLU B CB    1 
ATOM   4765  C  CG    . GLU B  1 122 ? 110.955 77.735  -79.395  1.00 71.37  ? 228 GLU B CG    1 
ATOM   4766  C  CD    . GLU B  1 122 ? 111.362 77.008  -78.105  1.00 71.84  ? 228 GLU B CD    1 
ATOM   4767  O  OE1   . GLU B  1 122 ? 111.132 77.539  -76.985  1.00 71.92  ? 228 GLU B OE1   1 
ATOM   4768  O  OE2   . GLU B  1 122 ? 111.918 75.883  -78.222  1.00 67.31  ? 228 GLU B OE2   1 
ATOM   4769  N  N     . VAL B  1 123 ? 107.635 77.781  -79.565  1.00 64.66  ? 229 VAL B N     1 
ATOM   4770  C  CA    . VAL B  1 123 ? 106.846 76.989  -80.518  1.00 62.32  ? 229 VAL B CA    1 
ATOM   4771  C  C     . VAL B  1 123 ? 105.372 77.392  -80.469  1.00 60.78  ? 229 VAL B C     1 
ATOM   4772  O  O     . VAL B  1 123 ? 104.891 77.793  -79.423  1.00 60.80  ? 229 VAL B O     1 
ATOM   4773  C  CB    . VAL B  1 123 ? 106.939 75.475  -80.236  1.00 62.11  ? 229 VAL B CB    1 
ATOM   4774  C  CG1   . VAL B  1 123 ? 106.393 74.685  -81.425  1.00 64.37  ? 229 VAL B CG1   1 
ATOM   4775  C  CG2   . VAL B  1 123 ? 108.367 75.045  -79.960  1.00 61.90  ? 229 VAL B CG2   1 
ATOM   4776  N  N     . LYS B  1 124 ? 104.684 77.302  -81.607  1.00 59.51  ? 230 LYS B N     1 
ATOM   4777  C  CA    . LYS B  1 124 ? 103.224 77.368  -81.673  1.00 56.45  ? 230 LYS B CA    1 
ATOM   4778  C  C     . LYS B  1 124 ? 102.782 75.955  -82.077  1.00 55.25  ? 230 LYS B C     1 
ATOM   4779  O  O     . LYS B  1 124 ? 102.833 75.597  -83.251  1.00 57.13  ? 230 LYS B O     1 
ATOM   4780  C  CB    . LYS B  1 124 ? 102.739 78.438  -82.670  1.00 55.00  ? 230 LYS B CB    1 
ATOM   4781  N  N     . TRP B  1 125 ? 102.392 75.144  -81.080  1.00 52.71  ? 231 TRP B N     1 
ATOM   4782  C  CA    . TRP B  1 125 ? 101.992 73.728  -81.263  1.00 50.76  ? 231 TRP B CA    1 
ATOM   4783  C  C     . TRP B  1 125 ? 100.634 73.441  -80.637  1.00 49.53  ? 231 TRP B C     1 
ATOM   4784  O  O     . TRP B  1 125 ? 100.337 73.953  -79.565  1.00 50.51  ? 231 TRP B O     1 
ATOM   4785  C  CB    . TRP B  1 125 ? 103.023 72.799  -80.612  1.00 50.91  ? 231 TRP B CB    1 
ATOM   4786  C  CG    . TRP B  1 125 ? 102.760 71.307  -80.813  1.00 50.96  ? 231 TRP B CG    1 
ATOM   4787  C  CD1   . TRP B  1 125 ? 103.101 70.538  -81.899  1.00 52.55  ? 231 TRP B CD1   1 
ATOM   4788  C  CD2   . TRP B  1 125 ? 102.128 70.434  -79.896  1.00 50.56  ? 231 TRP B CD2   1 
ATOM   4789  N  NE1   . TRP B  1 125 ? 102.715 69.239  -81.707  1.00 51.57  ? 231 TRP B NE1   1 
ATOM   4790  C  CE2   . TRP B  1 125 ? 102.113 69.147  -80.486  1.00 51.43  ? 231 TRP B CE2   1 
ATOM   4791  C  CE3   . TRP B  1 125 ? 101.567 70.610  -78.639  1.00 50.86  ? 231 TRP B CE3   1 
ATOM   4792  C  CZ2   . TRP B  1 125 ? 101.554 68.042  -79.856  1.00 53.17  ? 231 TRP B CZ2   1 
ATOM   4793  C  CZ3   . TRP B  1 125 ? 101.011 69.513  -78.009  1.00 51.84  ? 231 TRP B CZ3   1 
ATOM   4794  C  CH2   . TRP B  1 125 ? 101.006 68.235  -78.622  1.00 53.57  ? 231 TRP B CH2   1 
ATOM   4795  N  N     . THR B  1 126 ? 99.844  72.591  -81.295  1.00 47.15  ? 232 THR B N     1 
ATOM   4796  C  CA    . THR B  1 126 ? 98.487  72.216  -80.860  1.00 43.64  ? 232 THR B CA    1 
ATOM   4797  C  C     . THR B  1 126 ? 98.269  70.697  -80.940  1.00 42.16  ? 232 THR B C     1 
ATOM   4798  O  O     . THR B  1 126 ? 99.028  69.995  -81.605  1.00 42.40  ? 232 THR B O     1 
ATOM   4799  C  CB    . THR B  1 126 ? 97.412  72.929  -81.708  1.00 42.12  ? 232 THR B CB    1 
ATOM   4800  O  OG1   . THR B  1 126 ? 97.443  72.448  -83.046  1.00 41.58  ? 232 THR B OG1   1 
ATOM   4801  C  CG2   . THR B  1 126 ? 97.633  74.417  -81.736  1.00 42.60  ? 232 THR B CG2   1 
ATOM   4802  N  N     . HIS B  1 127 ? 97.231  70.199  -80.260  1.00 43.89  ? 233 HIS B N     1 
ATOM   4803  C  CA    . HIS B  1 127 ? 96.890  68.754  -80.282  1.00 42.88  ? 233 HIS B CA    1 
ATOM   4804  C  C     . HIS B  1 127 ? 96.626  68.313  -81.722  1.00 42.38  ? 233 HIS B C     1 
ATOM   4805  O  O     . HIS B  1 127 ? 97.029  67.218  -82.108  1.00 41.62  ? 233 HIS B O     1 
ATOM   4806  C  CB    . HIS B  1 127 ? 95.781  68.358  -79.231  1.00 40.74  ? 233 HIS B CB    1 
ATOM   4807  C  CG    . HIS B  1 127 ? 94.336  68.469  -79.685  1.00 39.67  ? 233 HIS B CG    1 
ATOM   4808  N  ND1   . HIS B  1 127 ? 93.549  69.566  -79.394  1.00 40.15  ? 233 HIS B ND1   1 
ATOM   4809  C  CD2   . HIS B  1 127 ? 93.499  67.569  -80.281  1.00 37.88  ? 233 HIS B CD2   1 
ATOM   4810  C  CE1   . HIS B  1 127 ? 92.323  69.372  -79.867  1.00 39.27  ? 233 HIS B CE1   1 
ATOM   4811  N  NE2   . HIS B  1 127 ? 92.260  68.164  -80.412  1.00 36.84  ? 233 HIS B NE2   1 
ATOM   4812  N  N     . GLU B  1 128 ? 96.036  69.209  -82.517  1.00 42.84  ? 234 GLU B N     1 
ATOM   4813  C  CA    . GLU B  1 128 ? 95.646  68.924  -83.891  1.00 44.67  ? 234 GLU B CA    1 
ATOM   4814  C  C     . GLU B  1 128 ? 96.839  68.747  -84.798  1.00 47.41  ? 234 GLU B C     1 
ATOM   4815  O  O     . GLU B  1 128 ? 96.886  67.797  -85.568  1.00 51.78  ? 234 GLU B O     1 
ATOM   4816  C  CB    . GLU B  1 128 ? 94.725  70.012  -84.455  1.00 46.15  ? 234 GLU B CB    1 
ATOM   4817  C  CG    . GLU B  1 128 ? 93.347  70.104  -83.801  1.00 46.96  ? 234 GLU B CG    1 
ATOM   4818  C  CD    . GLU B  1 128 ? 93.231  71.138  -82.714  1.00 48.75  ? 234 GLU B CD    1 
ATOM   4819  O  OE1   . GLU B  1 128 ? 94.274  71.607  -82.190  1.00 52.61  ? 234 GLU B OE1   1 
ATOM   4820  O  OE2   . GLU B  1 128 ? 92.076  71.468  -82.365  1.00 50.14  ? 234 GLU B OE2   1 
ATOM   4821  N  N     . GLN B  1 129 ? 97.812  69.649  -84.704  1.00 48.70  ? 235 GLN B N     1 
ATOM   4822  C  CA    . GLN B  1 129 ? 99.047  69.529  -85.492  1.00 49.49  ? 235 GLN B CA    1 
ATOM   4823  C  C     . GLN B  1 129 ? 99.708  68.199  -85.204  1.00 46.83  ? 235 GLN B C     1 
ATOM   4824  O  O     . GLN B  1 129 ? 100.204 67.540  -86.122  1.00 48.17  ? 235 GLN B O     1 
ATOM   4825  C  CB    . GLN B  1 129 ? 100.019 70.668  -85.207  1.00 53.22  ? 235 GLN B CB    1 
ATOM   4826  C  CG    . GLN B  1 129 ? 99.677  71.993  -85.886  1.00 56.94  ? 235 GLN B CG    1 
ATOM   4827  C  CD    . GLN B  1 129 ? 100.371 73.188  -85.230  1.00 59.55  ? 235 GLN B CD    1 
ATOM   4828  O  OE1   . GLN B  1 129 ? 99.775  74.250  -85.045  1.00 60.50  ? 235 GLN B OE1   1 
ATOM   4829  N  NE2   . GLN B  1 129 ? 101.628 73.007  -84.857  1.00 62.50  ? 235 GLN B NE2   1 
ATOM   4830  N  N     . GLY B  1 130 ? 99.697  67.813  -83.935  1.00 45.30  ? 236 GLY B N     1 
ATOM   4831  C  CA    . GLY B  1 130 ? 100.188 66.518  -83.510  1.00 44.46  ? 236 GLY B CA    1 
ATOM   4832  C  C     . GLY B  1 130 ? 99.424  65.367  -84.153  1.00 43.31  ? 236 GLY B C     1 
ATOM   4833  O  O     . GLY B  1 130 ? 100.007 64.370  -84.545  1.00 45.26  ? 236 GLY B O     1 
ATOM   4834  N  N     . SER B  1 131 ? 98.110  65.506  -84.247  1.00 41.84  ? 237 SER B N     1 
ATOM   4835  C  CA    . SER B  1 131 ? 97.273  64.479  -84.867  1.00 40.69  ? 237 SER B CA    1 
ATOM   4836  C  C     . SER B  1 131 ? 97.634  64.218  -86.330  1.00 39.89  ? 237 SER B C     1 
ATOM   4837  O  O     . SER B  1 131 ? 97.745  63.063  -86.760  1.00 42.14  ? 237 SER B O     1 
ATOM   4838  C  CB    . SER B  1 131 ? 95.788  64.823  -84.750  1.00 39.85  ? 237 SER B CB    1 
ATOM   4839  O  OG    . SER B  1 131 ? 95.407  64.953  -83.397  1.00 38.57  ? 237 SER B OG    1 
ATOM   4840  N  N     . VAL B  1 132 ? 97.840  65.293  -87.082  1.00 38.43  ? 238 VAL B N     1 
ATOM   4841  C  CA    . VAL B  1 132 ? 98.252  65.172  -88.470  1.00 37.87  ? 238 VAL B CA    1 
ATOM   4842  C  C     . VAL B  1 132 ? 99.568  64.413  -88.570  1.00 36.85  ? 238 VAL B C     1 
ATOM   4843  O  O     . VAL B  1 132 ? 99.690  63.479  -89.347  1.00 34.80  ? 238 VAL B O     1 
ATOM   4844  C  CB    . VAL B  1 132 ? 98.358  66.551  -89.117  1.00 38.27  ? 238 VAL B CB    1 
ATOM   4845  C  CG1   . VAL B  1 132 ? 99.130  66.507  -90.432  1.00 40.27  ? 238 VAL B CG1   1 
ATOM   4846  C  CG2   . VAL B  1 132 ? 96.985  67.092  -89.354  1.00 37.57  ? 238 VAL B CG2   1 
ATOM   4847  N  N     . MET B  1 133 ? 100.544 64.816  -87.766  1.00 38.12  ? 239 MET B N     1 
ATOM   4848  C  CA    . MET B  1 133 ? 101.848 64.164  -87.764  1.00 39.92  ? 239 MET B CA    1 
ATOM   4849  C  C     . MET B  1 133 ? 101.769 62.714  -87.336  1.00 36.83  ? 239 MET B C     1 
ATOM   4850  O  O     . MET B  1 133 ? 102.384 61.840  -87.944  1.00 36.83  ? 239 MET B O     1 
ATOM   4851  C  CB    . MET B  1 133 ? 102.808 64.901  -86.861  1.00 44.27  ? 239 MET B CB    1 
ATOM   4852  C  CG    . MET B  1 133 ? 103.246 66.249  -87.433  1.00 49.65  ? 239 MET B CG    1 
ATOM   4853  S  SD    . MET B  1 133 ? 104.396 67.050  -86.338  1.00 58.45  ? 239 MET B SD    1 
ATOM   4854  C  CE    . MET B  1 133 ? 105.878 66.025  -86.474  1.00 57.74  ? 239 MET B CE    1 
ATOM   4855  N  N     . MET B  1 134 ? 101.018 62.465  -86.277  1.00 35.17  ? 240 MET B N     1 
ATOM   4856  C  CA    . MET B  1 134 ? 100.855 61.123  -85.750  1.00 33.00  ? 240 MET B CA    1 
ATOM   4857  C  C     . MET B  1 134 ? 100.050 60.259  -86.719  1.00 31.17  ? 240 MET B C     1 
ATOM   4858  O  O     . MET B  1 134 ? 100.269 59.056  -86.789  1.00 30.57  ? 240 MET B O     1 
ATOM   4859  C  CB    . MET B  1 134 ? 100.216 61.184  -84.365  1.00 32.60  ? 240 MET B CB    1 
ATOM   4860  C  CG    . MET B  1 134 ? 100.026 59.847  -83.677  1.00 33.46  ? 240 MET B CG    1 
ATOM   4861  S  SD    . MET B  1 134 ? 101.499 58.890  -83.306  1.00 35.08  ? 240 MET B SD    1 
ATOM   4862  C  CE    . MET B  1 134 ? 102.113 59.764  -81.875  1.00 35.29  ? 240 MET B CE    1 
ATOM   4863  N  N     . PHE B  1 135 ? 99.142  60.862  -87.481  1.00 30.27  ? 241 PHE B N     1 
ATOM   4864  C  CA    . PHE B  1 135 ? 98.397  60.125  -88.506  1.00 30.58  ? 241 PHE B CA    1 
ATOM   4865  C  C     . PHE B  1 135 ? 99.323  59.639  -89.619  1.00 32.91  ? 241 PHE B C     1 
ATOM   4866  O  O     . PHE B  1 135 ? 99.276  58.471  -89.999  1.00 33.19  ? 241 PHE B O     1 
ATOM   4867  C  CB    . PHE B  1 135 ? 97.292  60.989  -89.093  1.00 29.99  ? 241 PHE B CB    1 
ATOM   4868  C  CG    . PHE B  1 135 ? 96.488  60.303  -90.158  1.00 29.46  ? 241 PHE B CG    1 
ATOM   4869  C  CD1   . PHE B  1 135 ? 95.771  59.161  -89.879  1.00 28.67  ? 241 PHE B CD1   1 
ATOM   4870  C  CD2   . PHE B  1 135 ? 96.442  60.813  -91.447  1.00 30.20  ? 241 PHE B CD2   1 
ATOM   4871  C  CE1   . PHE B  1 135 ? 95.018  58.537  -90.855  1.00 28.28  ? 241 PHE B CE1   1 
ATOM   4872  C  CE2   . PHE B  1 135 ? 95.692  60.181  -92.429  1.00 29.74  ? 241 PHE B CE2   1 
ATOM   4873  C  CZ    . PHE B  1 135 ? 94.986  59.045  -92.137  1.00 28.64  ? 241 PHE B CZ    1 
ATOM   4874  N  N     . GLU B  1 136 ? 100.155 60.554  -90.129  1.00 35.90  ? 242 GLU B N     1 
ATOM   4875  C  CA    . GLU B  1 136 ? 101.213 60.238  -91.092  1.00 37.30  ? 242 GLU B CA    1 
ATOM   4876  C  C     . GLU B  1 136 ? 102.075 59.080  -90.575  1.00 34.87  ? 242 GLU B C     1 
ATOM   4877  O  O     . GLU B  1 136 ? 102.255 58.091  -91.279  1.00 33.57  ? 242 GLU B O     1 
ATOM   4878  C  CB    . GLU B  1 136 ? 102.059 61.492  -91.380  1.00 41.51  ? 242 GLU B CB    1 
ATOM   4879  C  CG    . GLU B  1 136 ? 103.188 61.351  -92.422  1.00 46.29  ? 242 GLU B CG    1 
ATOM   4880  C  CD    . GLU B  1 136 ? 102.722 61.154  -93.866  1.00 50.63  ? 242 GLU B CD    1 
ATOM   4881  O  OE1   . GLU B  1 136 ? 101.578 61.549  -94.207  1.00 57.16  ? 242 GLU B OE1   1 
ATOM   4882  O  OE2   . GLU B  1 136 ? 103.505 60.609  -94.677  1.00 53.57  ? 242 GLU B OE2   1 
ATOM   4883  N  N     . HIS B  1 137 ? 102.562 59.187  -89.340  1.00 33.59  ? 243 HIS B N     1 
ATOM   4884  C  CA    . HIS B  1 137 ? 103.391 58.133  -88.738  1.00 33.58  ? 243 HIS B CA    1 
ATOM   4885  C  C     . HIS B  1 137 ? 102.656 56.801  -88.655  1.00 32.72  ? 243 HIS B C     1 
ATOM   4886  O  O     . HIS B  1 137 ? 103.249 55.766  -88.918  1.00 32.76  ? 243 HIS B O     1 
ATOM   4887  C  CB    . HIS B  1 137 ? 103.927 58.547  -87.351  1.00 34.02  ? 243 HIS B CB    1 
ATOM   4888  C  CG    . HIS B  1 137 ? 104.794 57.513  -86.699  1.00 34.66  ? 243 HIS B CG    1 
ATOM   4889  N  ND1   . HIS B  1 137 ? 105.765 56.816  -87.386  1.00 36.03  ? 243 HIS B ND1   1 
ATOM   4890  C  CD2   . HIS B  1 137 ? 104.834 57.053  -85.430  1.00 34.23  ? 243 HIS B CD2   1 
ATOM   4891  C  CE1   . HIS B  1 137 ? 106.363 55.968  -86.566  1.00 35.82  ? 243 HIS B CE1   1 
ATOM   4892  N  NE2   . HIS B  1 137 ? 105.821 56.096  -85.366  1.00 35.20  ? 243 HIS B NE2   1 
ATOM   4893  N  N     . LEU B  1 138 ? 101.374 56.835  -88.312  1.00 32.77  ? 244 LEU B N     1 
ATOM   4894  C  CA    . LEU B  1 138 ? 100.559 55.622  -88.215  1.00 33.60  ? 244 LEU B CA    1 
ATOM   4895  C  C     . LEU B  1 138 ? 100.458 54.913  -89.554  1.00 35.57  ? 244 LEU B C     1 
ATOM   4896  O  O     . LEU B  1 138 ? 100.634 53.696  -89.629  1.00 35.13  ? 244 LEU B O     1 
ATOM   4897  C  CB    . LEU B  1 138 ? 99.153  55.961  -87.724  1.00 33.00  ? 244 LEU B CB    1 
ATOM   4898  C  CG    . LEU B  1 138 ? 98.259  54.810  -87.239  1.00 32.16  ? 244 LEU B CG    1 
ATOM   4899  C  CD1   . LEU B  1 138 ? 97.177  55.361  -86.331  1.00 31.91  ? 244 LEU B CD1   1 
ATOM   4900  C  CD2   . LEU B  1 138 ? 97.594  54.020  -88.358  1.00 31.80  ? 244 LEU B CD2   1 
ATOM   4901  N  N     . ILE B  1 139 ? 100.163 55.688  -90.593  1.00 38.33  ? 245 ILE B N     1 
ATOM   4902  C  CA    . ILE B  1 139 ? 99.992  55.170  -91.949  1.00 40.32  ? 245 ILE B CA    1 
ATOM   4903  C  C     . ILE B  1 139 ? 101.274 54.493  -92.442  1.00 40.48  ? 245 ILE B C     1 
ATOM   4904  O  O     . ILE B  1 139 ? 101.241 53.363  -92.940  1.00 39.42  ? 245 ILE B O     1 
ATOM   4905  C  CB    . ILE B  1 139 ? 99.586  56.313  -92.926  1.00 42.85  ? 245 ILE B CB    1 
ATOM   4906  C  CG1   . ILE B  1 139 ? 98.199  56.884  -92.592  1.00 44.77  ? 245 ILE B CG1   1 
ATOM   4907  C  CG2   . ILE B  1 139 ? 99.585  55.848  -94.372  1.00 43.85  ? 245 ILE B CG2   1 
ATOM   4908  C  CD1   . ILE B  1 139 ? 97.029  55.897  -92.711  1.00 46.27  ? 245 ILE B CD1   1 
ATOM   4909  N  N     . ASN B  1 140 ? 102.396 55.192  -92.283  1.00 41.27  ? 246 ASN B N     1 
ATOM   4910  C  CA    . ASN B  1 140 ? 103.676 54.751  -92.832  1.00 41.18  ? 246 ASN B CA    1 
ATOM   4911  C  C     . ASN B  1 140 ? 104.225 53.567  -92.064  1.00 41.28  ? 246 ASN B C     1 
ATOM   4912  O  O     . ASN B  1 140 ? 104.604 52.571  -92.657  1.00 42.34  ? 246 ASN B O     1 
ATOM   4913  C  CB    . ASN B  1 140 ? 104.686 55.891  -92.833  1.00 42.00  ? 246 ASN B CB    1 
ATOM   4914  C  CG    . ASN B  1 140 ? 104.232 57.074  -93.669  1.00 43.16  ? 246 ASN B CG    1 
ATOM   4915  O  OD1   . ASN B  1 140 ? 103.463 56.928  -94.629  1.00 42.63  ? 246 ASN B OD1   1 
ATOM   4916  N  ND2   . ASN B  1 140 ? 104.700 58.268  -93.289  1.00 44.68  ? 246 ASN B ND2   1 
ATOM   4917  N  N     . SER B  1 141 ? 104.234 53.655  -90.743  1.00 41.03  ? 247 SER B N     1 
ATOM   4918  C  CA    . SER B  1 141 ? 104.780 52.577  -89.935  1.00 40.78  ? 247 SER B CA    1 
ATOM   4919  C  C     . SER B  1 141 ? 103.923 51.291  -89.920  1.00 38.31  ? 247 SER B C     1 
ATOM   4920  O  O     . SER B  1 141 ? 104.409 50.264  -89.493  1.00 39.17  ? 247 SER B O     1 
ATOM   4921  C  CB    . SER B  1 141 ? 105.061 53.071  -88.519  1.00 41.97  ? 247 SER B CB    1 
ATOM   4922  O  OG    . SER B  1 141 ? 103.835 53.355  -87.877  1.00 46.84  ? 247 SER B OG    1 
ATOM   4923  N  N     . ASN B  1 142 ? 102.681 51.320  -90.394  1.00 36.67  ? 248 ASN B N     1 
ATOM   4924  C  CA    . ASN B  1 142 ? 101.825 50.111  -90.390  1.00 36.39  ? 248 ASN B CA    1 
ATOM   4925  C  C     . ASN B  1 142 ? 101.326 49.630  -91.762  1.00 36.51  ? 248 ASN B C     1 
ATOM   4926  O  O     . ASN B  1 142 ? 100.475 48.748  -91.829  1.00 37.89  ? 248 ASN B O     1 
ATOM   4927  C  CB    . ASN B  1 142 ? 100.629 50.343  -89.456  1.00 34.29  ? 248 ASN B CB    1 
ATOM   4928  C  CG    . ASN B  1 142 ? 101.039 50.592  -88.038  1.00 32.71  ? 248 ASN B CG    1 
ATOM   4929  O  OD1   . ASN B  1 142 ? 101.450 49.676  -87.349  1.00 31.57  ? 248 ASN B OD1   1 
ATOM   4930  N  ND2   . ASN B  1 142 ? 100.913 51.833  -87.586  1.00 31.63  ? 248 ASN B ND2   1 
ATOM   4931  N  N     . GLY B  1 143 ? 101.832 50.210  -92.836  1.00 37.10  ? 249 GLY B N     1 
ATOM   4932  C  CA    . GLY B  1 143 ? 101.478 49.785  -94.197  1.00 39.60  ? 249 GLY B CA    1 
ATOM   4933  C  C     . GLY B  1 143 ? 100.000 49.861  -94.499  1.00 40.20  ? 249 GLY B C     1 
ATOM   4934  O  O     . GLY B  1 143 ? 99.404  48.921  -95.022  1.00 40.72  ? 249 GLY B O     1 
ATOM   4935  N  N     . ILE B  1 144 ? 99.420  50.998  -94.169  1.00 40.79  ? 250 ILE B N     1 
ATOM   4936  C  CA    . ILE B  1 144 ? 97.990  51.208  -94.330  1.00 42.07  ? 250 ILE B CA    1 
ATOM   4937  C  C     . ILE B  1 144 ? 97.673  51.580  -95.764  1.00 42.99  ? 250 ILE B C     1 
ATOM   4938  O  O     . ILE B  1 144 ? 96.605  51.218  -96.257  1.00 40.70  ? 250 ILE B O     1 
ATOM   4939  C  CB    . ILE B  1 144 ? 97.503  52.301  -93.341  1.00 43.58  ? 250 ILE B CB    1 
ATOM   4940  C  CG1   . ILE B  1 144 ? 97.761  51.874  -91.890  1.00 43.81  ? 250 ILE B CG1   1 
ATOM   4941  C  CG2   . ILE B  1 144 ? 96.035  52.624  -93.532  1.00 44.06  ? 250 ILE B CG2   1 
ATOM   4942  C  CD1   . ILE B  1 144 ? 97.190  50.511  -91.493  1.00 43.39  ? 250 ILE B CD1   1 
ATOM   4943  N  N     . LYS B  1 145 ? 98.593  52.291  -96.426  1.00 45.15  ? 251 LYS B N     1 
ATOM   4944  C  CA    . LYS B  1 145 ? 98.385  52.770  -97.798  1.00 43.67  ? 251 LYS B CA    1 
ATOM   4945  C  C     . LYS B  1 145 ? 97.883  51.687  -98.786  1.00 41.15  ? 251 LYS B C     1 
ATOM   4946  O  O     . LYS B  1 145 ? 96.957  51.939  -99.534  1.00 39.41  ? 251 LYS B O     1 
ATOM   4947  C  CB    . LYS B  1 145 ? 99.641  53.457  -98.321  1.00 45.06  ? 251 LYS B CB    1 
ATOM   4948  C  CG    . LYS B  1 145 ? 99.852  54.894  -97.889  1.00 45.88  ? 251 LYS B CG    1 
ATOM   4949  C  CD    . LYS B  1 145 ? 100.929 55.524  -98.772  1.00 49.55  ? 251 LYS B CD    1 
ATOM   4950  C  CE    . LYS B  1 145 ? 101.093 57.029  -98.585  1.00 51.21  ? 251 LYS B CE    1 
ATOM   4951  N  NZ    . LYS B  1 145 ? 101.882 57.295  -97.352  1.00 52.30  ? 251 LYS B NZ    1 
ATOM   4952  N  N     . PRO B  1 146 ? 98.496  50.485  -98.789  1.00 40.14  ? 252 PRO B N     1 
ATOM   4953  C  CA    . PRO B  1 146 ? 97.957  49.350  -99.548  1.00 40.96  ? 252 PRO B CA    1 
ATOM   4954  C  C     . PRO B  1 146 ? 96.513  48.996  -99.223  1.00 41.91  ? 252 PRO B C     1 
ATOM   4955  O  O     . PRO B  1 146 ? 95.732  48.687  -100.117 1.00 42.74  ? 252 PRO B O     1 
ATOM   4956  C  CB    . PRO B  1 146 ? 98.847  48.194  -99.116  1.00 41.35  ? 252 PRO B CB    1 
ATOM   4957  C  CG    . PRO B  1 146 ? 100.144 48.821  -98.775  1.00 41.45  ? 252 PRO B CG    1 
ATOM   4958  C  CD    . PRO B  1 146 ? 99.854  50.200  -98.285  1.00 40.43  ? 252 PRO B CD    1 
ATOM   4959  N  N     . VAL B  1 147 ? 96.176  49.039  -97.942  1.00 43.46  ? 253 VAL B N     1 
ATOM   4960  C  CA    . VAL B  1 147 ? 94.840  48.678  -97.469  1.00 44.12  ? 253 VAL B CA    1 
ATOM   4961  C  C     . VAL B  1 147 ? 93.826  49.748  -97.882  1.00 43.83  ? 253 VAL B C     1 
ATOM   4962  O  O     . VAL B  1 147 ? 92.700  49.427  -98.221  1.00 45.42  ? 253 VAL B O     1 
ATOM   4963  C  CB    . VAL B  1 147 ? 94.775  48.478  -95.932  1.00 44.68  ? 253 VAL B CB    1 
ATOM   4964  C  CG1   . VAL B  1 147 ? 93.448  47.853  -95.532  1.00 44.75  ? 253 VAL B CG1   1 
ATOM   4965  C  CG2   . VAL B  1 147 ? 95.899  47.595  -95.416  1.00 44.71  ? 253 VAL B CG2   1 
ATOM   4966  N  N     . MET B  1 148 ? 94.219  51.016  -97.846  1.00 42.29  ? 254 MET B N     1 
ATOM   4967  C  CA    . MET B  1 148 ? 93.355  52.101  -98.314  1.00 43.33  ? 254 MET B CA    1 
ATOM   4968  C  C     . MET B  1 148 ? 92.960  51.874  -99.776  1.00 46.95  ? 254 MET B C     1 
ATOM   4969  O  O     . MET B  1 148 ? 91.775  51.941  -100.127 1.00 50.65  ? 254 MET B O     1 
ATOM   4970  C  CB    . MET B  1 148 ? 94.022  53.458  -98.145  1.00 42.56  ? 254 MET B CB    1 
ATOM   4971  C  CG    . MET B  1 148 ? 94.171  53.860  -96.691  1.00 43.72  ? 254 MET B CG    1 
ATOM   4972  S  SD    . MET B  1 148 ? 95.113  55.363  -96.386  1.00 45.61  ? 254 MET B SD    1 
ATOM   4973  C  CE    . MET B  1 148 ? 93.919  56.563  -96.997  1.00 46.45  ? 254 MET B CE    1 
ATOM   4974  N  N     . GLU B  1 149 ? 93.959  51.573  -100.610 1.00 49.84  ? 255 GLU B N     1 
ATOM   4975  C  CA    . GLU B  1 149 ? 93.748  51.277  -102.031 1.00 51.93  ? 255 GLU B CA    1 
ATOM   4976  C  C     . GLU B  1 149 ? 92.816  50.101  -102.206 1.00 48.88  ? 255 GLU B C     1 
ATOM   4977  O  O     . GLU B  1 149 ? 91.882  50.179  -102.986 1.00 48.27  ? 255 GLU B O     1 
ATOM   4978  C  CB    . GLU B  1 149 ? 95.078  51.014  -102.754 1.00 58.18  ? 255 GLU B CB    1 
ATOM   4979  C  CG    . GLU B  1 149 ? 95.870  52.285  -103.086 1.00 64.42  ? 255 GLU B CG    1 
ATOM   4980  C  CD    . GLU B  1 149 ? 97.337  52.013  -103.457 1.00 69.66  ? 255 GLU B CD    1 
ATOM   4981  O  OE1   . GLU B  1 149 ? 97.734  50.836  -103.625 1.00 72.71  ? 255 GLU B OE1   1 
ATOM   4982  O  OE2   . GLU B  1 149 ? 98.129  52.982  -103.516 1.00 74.62  ? 255 GLU B OE2   1 
ATOM   4983  N  N     . GLN B  1 150 ? 93.058  49.033  -101.451 1.00 46.42  ? 256 GLN B N     1 
ATOM   4984  C  CA    . GLN B  1 150 ? 92.219  47.836  -101.484 1.00 46.03  ? 256 GLN B CA    1 
ATOM   4985  C  C     . GLN B  1 150 ? 90.742  48.150  -101.319 1.00 42.71  ? 256 GLN B C     1 
ATOM   4986  O  O     . GLN B  1 150 ? 89.914  47.508  -101.943 1.00 45.20  ? 256 GLN B O     1 
ATOM   4987  C  CB    . GLN B  1 150 ? 92.659  46.839  -100.420 1.00 49.13  ? 256 GLN B CB    1 
ATOM   4988  C  CG    . GLN B  1 150 ? 91.937  45.502  -100.417 1.00 53.03  ? 256 GLN B CG    1 
ATOM   4989  C  CD    . GLN B  1 150 ? 92.212  44.706  -99.130  1.00 57.10  ? 256 GLN B CD    1 
ATOM   4990  O  OE1   . GLN B  1 150 ? 93.193  44.954  -98.398  1.00 61.68  ? 256 GLN B OE1   1 
ATOM   4991  N  NE2   . GLN B  1 150 ? 91.318  43.761  -98.823  1.00 58.18  ? 256 GLN B NE2   1 
ATOM   4992  N  N     . TYR B  1 151 ? 90.413  49.131  -100.485 1.00 39.83  ? 257 TYR B N     1 
ATOM   4993  C  CA    . TYR B  1 151 ? 89.014  49.539  -100.261 1.00 38.80  ? 257 TYR B CA    1 
ATOM   4994  C  C     . TYR B  1 151 ? 88.616  50.808  -101.026 1.00 38.85  ? 257 TYR B C     1 
ATOM   4995  O  O     . TYR B  1 151 ? 87.730  51.538  -100.608 1.00 39.31  ? 257 TYR B O     1 
ATOM   4996  C  CB    . TYR B  1 151 ? 88.749  49.672  -98.751  1.00 37.08  ? 257 TYR B CB    1 
ATOM   4997  C  CG    . TYR B  1 151 ? 88.822  48.355  -98.019  1.00 35.89  ? 257 TYR B CG    1 
ATOM   4998  C  CD1   . TYR B  1 151 ? 87.791  47.425  -98.126  1.00 36.06  ? 257 TYR B CD1   1 
ATOM   4999  C  CD2   . TYR B  1 151 ? 89.916  48.029  -97.225  1.00 35.21  ? 257 TYR B CD2   1 
ATOM   5000  C  CE1   . TYR B  1 151 ? 87.852  46.201  -97.453  1.00 35.87  ? 257 TYR B CE1   1 
ATOM   5001  C  CE2   . TYR B  1 151 ? 89.990  46.808  -96.553  1.00 34.94  ? 257 TYR B CE2   1 
ATOM   5002  C  CZ    . TYR B  1 151 ? 88.967  45.892  -96.688  1.00 34.97  ? 257 TYR B CZ    1 
ATOM   5003  O  OH    . TYR B  1 151 ? 89.024  44.691  -96.032  1.00 33.53  ? 257 TYR B OH    1 
ATOM   5004  N  N     . GLY B  1 152 ? 89.260  51.060  -102.158 1.00 38.90  ? 258 GLY B N     1 
ATOM   5005  C  CA    . GLY B  1 152 ? 88.834  52.116  -103.074 1.00 38.10  ? 258 GLY B CA    1 
ATOM   5006  C  C     . GLY B  1 152 ? 89.268  53.528  -102.771 1.00 37.38  ? 258 GLY B C     1 
ATOM   5007  O  O     . GLY B  1 152 ? 88.772  54.454  -103.396 1.00 36.98  ? 258 GLY B O     1 
ATOM   5008  N  N     . LEU B  1 153 ? 90.191  53.718  -101.834 1.00 37.22  ? 259 LEU B N     1 
ATOM   5009  C  CA    . LEU B  1 153 ? 90.686  55.064  -101.553 1.00 38.45  ? 259 LEU B CA    1 
ATOM   5010  C  C     . LEU B  1 153 ? 91.879  55.370  -102.440 1.00 39.89  ? 259 LEU B C     1 
ATOM   5011  O  O     . LEU B  1 153 ? 92.511  54.465  -102.992 1.00 40.77  ? 259 LEU B O     1 
ATOM   5012  C  CB    . LEU B  1 153 ? 91.072  55.226  -100.079 1.00 38.45  ? 259 LEU B CB    1 
ATOM   5013  C  CG    . LEU B  1 153 ? 89.923  55.673  -99.149  1.00 38.41  ? 259 LEU B CG    1 
ATOM   5014  C  CD1   . LEU B  1 153 ? 88.854  54.593  -99.053  1.00 38.29  ? 259 LEU B CD1   1 
ATOM   5015  C  CD2   . LEU B  1 153 ? 90.453  56.001  -97.770  1.00 38.22  ? 259 LEU B CD2   1 
ATOM   5016  N  N     . ILE B  1 154 ? 92.180  56.656  -102.568 1.00 41.07  ? 260 ILE B N     1 
ATOM   5017  C  CA    . ILE B  1 154 ? 93.315  57.140  -103.334 1.00 41.08  ? 260 ILE B CA    1 
ATOM   5018  C  C     . ILE B  1 154 ? 94.238  57.926  -102.386 1.00 40.79  ? 260 ILE B C     1 
ATOM   5019  O  O     . ILE B  1 154 ? 94.042  59.119  -102.172 1.00 40.23  ? 260 ILE B O     1 
ATOM   5020  C  CB    . ILE B  1 154 ? 92.826  58.017  -104.500 1.00 41.42  ? 260 ILE B CB    1 
ATOM   5021  C  CG1   . ILE B  1 154 ? 91.893  57.191  -105.402 1.00 40.77  ? 260 ILE B CG1   1 
ATOM   5022  C  CG2   . ILE B  1 154 ? 94.014  58.580  -105.294 1.00 42.84  ? 260 ILE B CG2   1 
ATOM   5023  C  CD1   . ILE B  1 154 ? 91.245  58.014  -106.503 1.00 41.04  ? 260 ILE B CD1   1 
ATOM   5024  N  N     . PRO B  1 155 ? 95.252  57.254  -101.807 1.00 41.11  ? 261 PRO B N     1 
ATOM   5025  C  CA    . PRO B  1 155 ? 96.100  57.856  -100.776 1.00 42.76  ? 261 PRO B CA    1 
ATOM   5026  C  C     . PRO B  1 155 ? 96.618  59.265  -101.059 1.00 46.27  ? 261 PRO B C     1 
ATOM   5027  O  O     . PRO B  1 155 ? 96.613  60.086  -100.159 1.00 49.44  ? 261 PRO B O     1 
ATOM   5028  C  CB    . PRO B  1 155 ? 97.251  56.874  -100.673 1.00 42.40  ? 261 PRO B CB    1 
ATOM   5029  C  CG    . PRO B  1 155 ? 96.602  55.560  -100.936 1.00 41.60  ? 261 PRO B CG    1 
ATOM   5030  C  CD    . PRO B  1 155 ? 95.547  55.821  -101.979 1.00 40.92  ? 261 PRO B CD    1 
ATOM   5031  N  N     . GLU B  1 156 ? 97.048  59.554  -102.281 1.00 49.43  ? 262 GLU B N     1 
ATOM   5032  C  CA    . GLU B  1 156 ? 97.499  60.911  -102.622 1.00 51.02  ? 262 GLU B CA    1 
ATOM   5033  C  C     . GLU B  1 156 ? 96.458  61.961  -102.214 1.00 51.00  ? 262 GLU B C     1 
ATOM   5034  O  O     . GLU B  1 156 ? 96.724  62.810  -101.376 1.00 48.62  ? 262 GLU B O     1 
ATOM   5035  C  CB    . GLU B  1 156 ? 97.823  61.032  -104.128 1.00 51.80  ? 262 GLU B CB    1 
ATOM   5036  N  N     . GLU B  1 157 ? 95.261  61.851  -102.787 1.00 54.03  ? 263 GLU B N     1 
ATOM   5037  C  CA    . GLU B  1 157 ? 94.172  62.799  -102.547 1.00 55.40  ? 263 GLU B CA    1 
ATOM   5038  C  C     . GLU B  1 157 ? 93.581  62.684  -101.153 1.00 51.82  ? 263 GLU B C     1 
ATOM   5039  O  O     . GLU B  1 157 ? 93.354  63.691  -100.497 1.00 52.51  ? 263 GLU B O     1 
ATOM   5040  C  CB    . GLU B  1 157 ? 93.041  62.595  -103.552 1.00 58.97  ? 263 GLU B CB    1 
ATOM   5041  C  CG    . GLU B  1 157 ? 93.360  62.975  -104.981 1.00 64.04  ? 263 GLU B CG    1 
ATOM   5042  C  CD    . GLU B  1 157 ? 92.083  63.022  -105.841 1.00 67.91  ? 263 GLU B CD    1 
ATOM   5043  O  OE1   . GLU B  1 157 ? 91.273  62.074  -105.670 1.00 70.32  ? 263 GLU B OE1   1 
ATOM   5044  O  OE2   . GLU B  1 157 ? 91.875  63.968  -106.694 1.00 73.73  ? 263 GLU B OE2   1 
ATOM   5045  N  N     . ASP B  1 158 ? 93.321  61.460  -100.709 1.00 47.95  ? 264 ASP B N     1 
ATOM   5046  C  CA    . ASP B  1 158 ? 92.544  61.230  -99.490  1.00 44.15  ? 264 ASP B CA    1 
ATOM   5047  C  C     . ASP B  1 158 ? 93.289  61.453  -98.180  1.00 44.74  ? 264 ASP B C     1 
ATOM   5048  O  O     . ASP B  1 158 ? 92.695  61.945  -97.227  1.00 46.88  ? 264 ASP B O     1 
ATOM   5049  C  CB    . ASP B  1 158 ? 91.945  59.829  -99.506  1.00 40.68  ? 264 ASP B CB    1 
ATOM   5050  C  CG    . ASP B  1 158 ? 90.920  59.655  -100.595 1.00 39.89  ? 264 ASP B CG    1 
ATOM   5051  O  OD1   . ASP B  1 158 ? 90.251  60.666  -100.996 1.00 39.07  ? 264 ASP B OD1   1 
ATOM   5052  O  OD2   . ASP B  1 158 ? 90.724  58.497  -101.044 1.00 39.15  ? 264 ASP B OD2   1 
ATOM   5053  N  N     . ILE B  1 159 ? 94.568  61.095  -98.113  1.00 44.51  ? 265 ILE B N     1 
ATOM   5054  C  CA    . ILE B  1 159 ? 95.359  61.387  -96.912  1.00 44.58  ? 265 ILE B CA    1 
ATOM   5055  C  C     . ILE B  1 159 ? 95.463  62.890  -96.688  1.00 44.69  ? 265 ILE B C     1 
ATOM   5056  O  O     . ILE B  1 159 ? 95.531  63.338  -95.561  1.00 44.31  ? 265 ILE B O     1 
ATOM   5057  C  CB    . ILE B  1 159 ? 96.754  60.727  -96.943  1.00 44.97  ? 265 ILE B CB    1 
ATOM   5058  C  CG1   . ILE B  1 159 ? 96.600  59.220  -96.727  1.00 45.14  ? 265 ILE B CG1   1 
ATOM   5059  C  CG2   . ILE B  1 159 ? 97.676  61.303  -95.870  1.00 45.08  ? 265 ILE B CG2   1 
ATOM   5060  C  CD1   . ILE B  1 159 ? 97.834  58.399  -97.044  1.00 46.59  ? 265 ILE B CD1   1 
ATOM   5061  N  N     . CYS B  1 160 ? 95.477  63.665  -97.762  1.00 46.24  ? 266 CYS B N     1 
ATOM   5062  C  CA    . CYS B  1 160 ? 95.415  65.119  -97.642  1.00 47.39  ? 266 CYS B CA    1 
ATOM   5063  C  C     . CYS B  1 160 ? 94.055  65.541  -97.080  1.00 44.82  ? 266 CYS B C     1 
ATOM   5064  O  O     . CYS B  1 160 ? 93.983  66.333  -96.151  1.00 45.97  ? 266 CYS B O     1 
ATOM   5065  C  CB    . CYS B  1 160 ? 95.676  65.779  -99.004  1.00 50.58  ? 266 CYS B CB    1 
ATOM   5066  S  SG    . CYS B  1 160 ? 95.411  67.563  -99.058  1.00 53.72  ? 266 CYS B SG    1 
ATOM   5067  N  N     . PHE B  1 161 ? 92.987  64.990  -97.647  1.00 41.17  ? 267 PHE B N     1 
ATOM   5068  C  CA    . PHE B  1 161 ? 91.613  65.267  -97.214  1.00 37.95  ? 267 PHE B CA    1 
ATOM   5069  C  C     . PHE B  1 161 ? 91.396  64.972  -95.735  1.00 35.84  ? 267 PHE B C     1 
ATOM   5070  O  O     . PHE B  1 161 ? 90.756  65.750  -95.033  1.00 34.78  ? 267 PHE B O     1 
ATOM   5071  C  CB    . PHE B  1 161 ? 90.640  64.430  -98.060  1.00 37.38  ? 267 PHE B CB    1 
ATOM   5072  C  CG    . PHE B  1 161 ? 89.190  64.562  -97.671  1.00 36.06  ? 267 PHE B CG    1 
ATOM   5073  C  CD1   . PHE B  1 161 ? 88.638  65.818  -97.431  1.00 36.28  ? 267 PHE B CD1   1 
ATOM   5074  C  CD2   . PHE B  1 161 ? 88.362  63.435  -97.602  1.00 35.73  ? 267 PHE B CD2   1 
ATOM   5075  C  CE1   . PHE B  1 161 ? 87.311  65.952  -97.108  1.00 36.60  ? 267 PHE B CE1   1 
ATOM   5076  C  CE2   . PHE B  1 161 ? 87.029  63.572  -97.284  1.00 36.49  ? 267 PHE B CE2   1 
ATOM   5077  C  CZ    . PHE B  1 161 ? 86.502  64.828  -97.033  1.00 36.79  ? 267 PHE B CZ    1 
ATOM   5078  N  N     . ILE B  1 162 ? 91.926  63.844  -95.275  1.00 33.80  ? 268 ILE B N     1 
ATOM   5079  C  CA    . ILE B  1 162 ? 91.832  63.456  -93.872  1.00 31.82  ? 268 ILE B CA    1 
ATOM   5080  C  C     . ILE B  1 162 ? 92.568  64.457  -92.981  1.00 32.93  ? 268 ILE B C     1 
ATOM   5081  O  O     . ILE B  1 162 ? 92.022  64.931  -92.000  1.00 34.73  ? 268 ILE B O     1 
ATOM   5082  C  CB    . ILE B  1 162 ? 92.338  62.017  -93.670  1.00 30.21  ? 268 ILE B CB    1 
ATOM   5083  C  CG1   . ILE B  1 162 ? 91.337  61.039  -94.278  1.00 29.66  ? 268 ILE B CG1   1 
ATOM   5084  C  CG2   . ILE B  1 162 ? 92.538  61.695  -92.204  1.00 30.10  ? 268 ILE B CG2   1 
ATOM   5085  C  CD1   . ILE B  1 162 ? 91.881  59.657  -94.554  1.00 30.03  ? 268 ILE B CD1   1 
ATOM   5086  N  N     . LYS B  1 163 ? 93.800  64.781  -93.330  1.00 34.70  ? 269 LYS B N     1 
ATOM   5087  C  CA    . LYS B  1 163 ? 94.586  65.758  -92.572  1.00 35.94  ? 269 LYS B CA    1 
ATOM   5088  C  C     . LYS B  1 163 ? 93.902  67.118  -92.565  1.00 37.85  ? 269 LYS B C     1 
ATOM   5089  O  O     . LYS B  1 163 ? 93.872  67.791  -91.553  1.00 38.51  ? 269 LYS B O     1 
ATOM   5090  C  CB    . LYS B  1 163 ? 95.992  65.898  -93.146  1.00 36.33  ? 269 LYS B CB    1 
ATOM   5091  C  CG    . LYS B  1 163 ? 96.903  64.698  -92.918  1.00 36.10  ? 269 LYS B CG    1 
ATOM   5092  C  CD    . LYS B  1 163 ? 98.221  64.899  -93.674  1.00 36.47  ? 269 LYS B CD    1 
ATOM   5093  C  CE    . LYS B  1 163 ? 99.200  63.774  -93.461  1.00 35.96  ? 269 LYS B CE    1 
ATOM   5094  N  NZ    . LYS B  1 163 ? 100.565 64.134  -93.891  1.00 36.85  ? 269 LYS B NZ    1 
ATOM   5095  N  N     . GLU B  1 164 ? 93.338  67.504  -93.697  1.00 40.52  ? 270 GLU B N     1 
ATOM   5096  C  CA    . GLU B  1 164 ? 92.639  68.783  -93.817  1.00 42.17  ? 270 GLU B CA    1 
ATOM   5097  C  C     . GLU B  1 164 ? 91.384  68.863  -92.936  1.00 41.25  ? 270 GLU B C     1 
ATOM   5098  O  O     . GLU B  1 164 ? 91.061  69.925  -92.400  1.00 39.80  ? 270 GLU B O     1 
ATOM   5099  C  CB    . GLU B  1 164 ? 92.272  69.061  -95.276  1.00 43.99  ? 270 GLU B CB    1 
ATOM   5100  C  CG    . GLU B  1 164 ? 93.435  69.532  -96.145  1.00 45.80  ? 270 GLU B CG    1 
ATOM   5101  C  CD    . GLU B  1 164 ? 93.052  69.727  -97.605  1.00 46.61  ? 270 GLU B CD    1 
ATOM   5102  O  OE1   . GLU B  1 164 ? 92.055  69.119  -98.065  1.00 45.52  ? 270 GLU B OE1   1 
ATOM   5103  O  OE2   . GLU B  1 164 ? 93.749  70.496  -98.301  1.00 49.74  ? 270 GLU B OE2   1 
ATOM   5104  N  N     . GLN B  1 165 ? 90.683  67.740  -92.798  1.00 39.67  ? 271 GLN B N     1 
ATOM   5105  C  CA    . GLN B  1 165 ? 89.541  67.663  -91.891  1.00 38.78  ? 271 GLN B CA    1 
ATOM   5106  C  C     . GLN B  1 165 ? 89.932  67.944  -90.456  1.00 38.83  ? 271 GLN B C     1 
ATOM   5107  O  O     . GLN B  1 165 ? 89.144  68.536  -89.708  1.00 40.81  ? 271 GLN B O     1 
ATOM   5108  C  CB    . GLN B  1 165 ? 88.833  66.301  -91.971  1.00 37.84  ? 271 GLN B CB    1 
ATOM   5109  C  CG    . GLN B  1 165 ? 87.927  66.165  -93.177  1.00 37.88  ? 271 GLN B CG    1 
ATOM   5110  C  CD    . GLN B  1 165 ? 87.367  64.780  -93.347  1.00 37.44  ? 271 GLN B CD    1 
ATOM   5111  O  OE1   . GLN B  1 165 ? 88.091  63.812  -93.493  1.00 37.60  ? 271 GLN B OE1   1 
ATOM   5112  N  NE2   . GLN B  1 165 ? 86.067  64.687  -93.361  1.00 37.52  ? 271 GLN B NE2   1 
ATOM   5113  N  N     . ILE B  1 166 ? 91.143  67.543  -90.082  1.00 37.80  ? 272 ILE B N     1 
ATOM   5114  C  CA    . ILE B  1 166 ? 91.619  67.658  -88.714  1.00 38.52  ? 272 ILE B CA    1 
ATOM   5115  C  C     . ILE B  1 166 ? 92.120  69.065  -88.362  1.00 41.63  ? 272 ILE B C     1 
ATOM   5116  O  O     . ILE B  1 166 ? 91.630  69.663  -87.393  1.00 42.02  ? 272 ILE B O     1 
ATOM   5117  C  CB    . ILE B  1 166 ? 92.677  66.578  -88.439  1.00 36.67  ? 272 ILE B CB    1 
ATOM   5118  C  CG1   . ILE B  1 166 ? 92.024  65.190  -88.559  1.00 35.60  ? 272 ILE B CG1   1 
ATOM   5119  C  CG2   . ILE B  1 166 ? 93.256  66.738  -87.049  1.00 36.15  ? 272 ILE B CG2   1 
ATOM   5120  C  CD1   . ILE B  1 166 ? 92.994  64.032  -88.593  1.00 34.93  ? 272 ILE B CD1   1 
ATOM   5121  N  N     . VAL B  1 167 ? 93.075  69.592  -89.134  1.00 44.48  ? 273 VAL B N     1 
ATOM   5122  C  CA    . VAL B  1 167 ? 93.754  70.874  -88.796  1.00 47.74  ? 273 VAL B CA    1 
ATOM   5123  C  C     . VAL B  1 167 ? 93.333  72.071  -89.614  1.00 52.47  ? 273 VAL B C     1 
ATOM   5124  O  O     . VAL B  1 167 ? 93.779  73.175  -89.330  1.00 55.36  ? 273 VAL B O     1 
ATOM   5125  C  CB    . VAL B  1 167 ? 95.290  70.830  -88.934  1.00 48.28  ? 273 VAL B CB    1 
ATOM   5126  C  CG1   . VAL B  1 167 ? 95.904  69.942  -87.886  1.00 48.21  ? 273 VAL B CG1   1 
ATOM   5127  C  CG2   . VAL B  1 167 ? 95.721  70.410  -90.349  1.00 50.53  ? 273 VAL B CG2   1 
ATOM   5128  N  N     . GLY B  1 168 ? 92.506  71.869  -90.628  1.00 58.69  ? 274 GLY B N     1 
ATOM   5129  C  CA    . GLY B  1 168 ? 92.169  72.942  -91.560  1.00 64.84  ? 274 GLY B CA    1 
ATOM   5130  C  C     . GLY B  1 168 ? 93.122  72.908  -92.736  1.00 69.83  ? 274 GLY B C     1 
ATOM   5131  O  O     . GLY B  1 168 ? 93.746  71.876  -92.989  1.00 68.59  ? 274 GLY B O     1 
ATOM   5132  N  N     . PRO B  1 169 ? 93.233  74.017  -93.476  1.00 77.31  ? 275 PRO B N     1 
ATOM   5133  C  CA    . PRO B  1 169 ? 94.051  73.941  -94.689  1.00 79.66  ? 275 PRO B CA    1 
ATOM   5134  C  C     . PRO B  1 169 ? 95.529  73.873  -94.394  1.00 79.61  ? 275 PRO B C     1 
ATOM   5135  O  O     . PRO B  1 169 ? 96.046  74.639  -93.604  1.00 81.46  ? 275 PRO B O     1 
ATOM   5136  C  CB    . PRO B  1 169 ? 93.693  75.230  -95.442  1.00 83.53  ? 275 PRO B CB    1 
ATOM   5137  C  CG    . PRO B  1 169 ? 92.383  75.676  -94.863  1.00 84.91  ? 275 PRO B CG    1 
ATOM   5138  C  CD    . PRO B  1 169 ? 92.435  75.260  -93.414  1.00 81.69  ? 275 PRO B CD    1 
ATOM   5139  N  N     . LEU B  1 170 ? 96.232  72.960  -95.063  1.00 78.19  ? 276 LEU B N     1 
ATOM   5140  C  CA    . LEU B  1 170 ? 97.727  73.043  -95.113  1.00 76.56  ? 276 LEU B CA    1 
ATOM   5141  C  C     . LEU B  1 170 ? 98.193  74.232  -96.001  1.00 72.52  ? 276 LEU B C     1 
ATOM   5142  O  O     . LEU B  1 170 ? 99.342  74.543  -96.069  1.00 69.26  ? 276 LEU B O     1 
ATOM   5143  C  CB    . LEU B  1 170 ? 98.351  71.727  -95.468  1.00 77.95  ? 276 LEU B CB    1 
ATOM   5144  C  CG    . LEU B  1 170 ? 97.927  70.490  -94.591  1.00 78.61  ? 276 LEU B CG    1 
ATOM   5145  C  CD1   . LEU B  1 170 ? 98.466  69.140  -95.074  1.00 79.48  ? 276 LEU B CD1   1 
ATOM   5146  C  CD2   . LEU B  1 170 ? 98.186  70.701  -93.076  1.00 79.94  ? 276 LEU B CD2   1 
ATOM   5147  N  N     . LEU B  1 178 ? 90.231  82.513  -102.841 1.00 88.53  ? 284 LEU B N     1 
ATOM   5148  C  CA    . LEU B  1 178 ? 89.915  81.263  -103.441 1.00 89.46  ? 284 LEU B CA    1 
ATOM   5149  C  C     . LEU B  1 178 ? 89.813  80.061  -102.476 1.00 88.09  ? 284 LEU B C     1 
ATOM   5150  O  O     . LEU B  1 178 ? 90.121  80.163  -101.320 1.00 88.91  ? 284 LEU B O     1 
ATOM   5151  C  CB    . LEU B  1 178 ? 90.984  81.028  -104.498 1.00 89.38  ? 284 LEU B CB    1 
ATOM   5152  C  CG    . LEU B  1 178 ? 90.746  81.744  -105.858 1.00 90.62  ? 284 LEU B CG    1 
ATOM   5153  C  CD1   . LEU B  1 178 ? 91.804  81.216  -106.856 1.00 88.44  ? 284 LEU B CD1   1 
ATOM   5154  C  CD2   . LEU B  1 178 ? 89.355  81.558  -106.525 1.00 88.36  ? 284 LEU B CD2   1 
ATOM   5155  N  N     . TRP B  1 179 ? 89.401  78.915  -103.033 1.00 81.14  ? 285 TRP B N     1 
ATOM   5156  C  CA    . TRP B  1 179 ? 89.178  77.677  -102.290 1.00 74.03  ? 285 TRP B CA    1 
ATOM   5157  C  C     . TRP B  1 179 ? 90.479  77.102  -101.713 1.00 67.75  ? 285 TRP B C     1 
ATOM   5158  O  O     . TRP B  1 179 ? 91.313  76.594  -102.469 1.00 66.34  ? 285 TRP B O     1 
ATOM   5159  C  CB    . TRP B  1 179 ? 88.536  76.643  -103.218 1.00 76.91  ? 285 TRP B CB    1 
ATOM   5160  C  CG    . TRP B  1 179 ? 88.234  75.286  -102.602 1.00 78.85  ? 285 TRP B CG    1 
ATOM   5161  C  CD1   . TRP B  1 179 ? 88.735  74.079  -102.999 1.00 78.94  ? 285 TRP B CD1   1 
ATOM   5162  C  CD2   . TRP B  1 179 ? 87.360  75.017  -101.508 1.00 78.08  ? 285 TRP B CD2   1 
ATOM   5163  N  NE1   . TRP B  1 179 ? 88.225  73.079  -102.217 1.00 77.18  ? 285 TRP B NE1   1 
ATOM   5164  C  CE2   . TRP B  1 179 ? 87.374  73.626  -101.300 1.00 75.52  ? 285 TRP B CE2   1 
ATOM   5165  C  CE3   . TRP B  1 179 ? 86.559  75.817  -100.689 1.00 78.44  ? 285 TRP B CE3   1 
ATOM   5166  C  CZ2   . TRP B  1 179 ? 86.634  73.017  -100.307 1.00 75.58  ? 285 TRP B CZ2   1 
ATOM   5167  C  CZ3   . TRP B  1 179 ? 85.810  75.206  -99.710  1.00 77.02  ? 285 TRP B CZ3   1 
ATOM   5168  C  CH2   . TRP B  1 179 ? 85.858  73.822  -99.524  1.00 76.55  ? 285 TRP B CH2   1 
ATOM   5169  N  N     . PRO B  1 180 ? 90.646  77.150  -100.389 1.00 63.56  ? 286 PRO B N     1 
ATOM   5170  C  CA    . PRO B  1 180 ? 91.909  76.745  -99.782  1.00 60.82  ? 286 PRO B CA    1 
ATOM   5171  C  C     . PRO B  1 180 ? 92.222  75.246  -99.689  1.00 58.15  ? 286 PRO B C     1 
ATOM   5172  O  O     . PRO B  1 180 ? 93.331  74.911  -99.311  1.00 55.52  ? 286 PRO B O     1 
ATOM   5173  C  CB    . PRO B  1 180 ? 91.815  77.319  -98.353  1.00 61.49  ? 286 PRO B CB    1 
ATOM   5174  C  CG    . PRO B  1 180 ? 90.358  77.322  -98.047  1.00 63.13  ? 286 PRO B CG    1 
ATOM   5175  C  CD    . PRO B  1 180 ? 89.662  77.555  -99.367  1.00 64.17  ? 286 PRO B CD    1 
ATOM   5176  N  N     . TYR B  1 181 ? 91.291  74.353  -100.013 1.00 57.42  ? 287 TYR B N     1 
ATOM   5177  C  CA    . TYR B  1 181 ? 91.528  72.915  -99.804  1.00 52.95  ? 287 TYR B CA    1 
ATOM   5178  C  C     . TYR B  1 181 ? 91.958  72.204  -101.083 1.00 51.54  ? 287 TYR B C     1 
ATOM   5179  O  O     . TYR B  1 181 ? 91.377  72.420  -102.147 1.00 52.16  ? 287 TYR B O     1 
ATOM   5180  C  CB    . TYR B  1 181 ? 90.284  72.226  -99.222  1.00 50.27  ? 287 TYR B CB    1 
ATOM   5181  C  CG    . TYR B  1 181 ? 89.888  72.697  -97.836  1.00 48.29  ? 287 TYR B CG    1 
ATOM   5182  C  CD1   . TYR B  1 181 ? 90.499  72.192  -96.695  1.00 47.13  ? 287 TYR B CD1   1 
ATOM   5183  C  CD2   . TYR B  1 181 ? 88.889  73.646  -97.665  1.00 48.92  ? 287 TYR B CD2   1 
ATOM   5184  C  CE1   . TYR B  1 181 ? 90.131  72.622  -95.429  1.00 47.59  ? 287 TYR B CE1   1 
ATOM   5185  C  CE2   . TYR B  1 181 ? 88.517  74.087  -96.394  1.00 48.55  ? 287 TYR B CE2   1 
ATOM   5186  C  CZ    . TYR B  1 181 ? 89.125  73.570  -95.285  1.00 47.47  ? 287 TYR B CZ    1 
ATOM   5187  O  OH    . TYR B  1 181 ? 88.753  74.011  -94.038  1.00 46.69  ? 287 TYR B OH    1 
ATOM   5188  N  N     . LYS B  1 182 ? 92.975  71.352  -100.948 1.00 50.59  ? 288 LYS B N     1 
ATOM   5189  C  CA    . LYS B  1 182 ? 93.473  70.506  -102.031 1.00 50.17  ? 288 LYS B CA    1 
ATOM   5190  C  C     . LYS B  1 182 ? 92.837  69.109  -102.017 1.00 49.81  ? 288 LYS B C     1 
ATOM   5191  O  O     . LYS B  1 182 ? 92.838  68.440  -103.028 1.00 53.96  ? 288 LYS B O     1 
ATOM   5192  C  CB    . LYS B  1 182 ? 95.001  70.408  -101.973 1.00 47.77  ? 288 LYS B CB    1 
ATOM   5193  N  N     . GLY B  1 183 ? 92.251  68.691  -100.900 1.00 48.54  ? 289 GLY B N     1 
ATOM   5194  C  CA    . GLY B  1 183 ? 91.753  67.319  -100.738 1.00 46.29  ? 289 GLY B CA    1 
ATOM   5195  C  C     . GLY B  1 183 ? 90.420  67.030  -101.391 1.00 44.76  ? 289 GLY B C     1 
ATOM   5196  O  O     . GLY B  1 183 ? 90.178  65.910  -101.808 1.00 42.61  ? 289 GLY B O     1 
ATOM   5197  N  N     . ARG B  1 184 ? 89.550  68.031  -101.452 1.00 46.08  ? 290 ARG B N     1 
ATOM   5198  C  CA    . ARG B  1 184 ? 88.253  67.912  -102.114 1.00 48.92  ? 290 ARG B CA    1 
ATOM   5199  C  C     . ARG B  1 184 ? 87.825  69.245  -102.724 1.00 52.06  ? 290 ARG B C     1 
ATOM   5200  O  O     . ARG B  1 184 ? 88.197  70.300  -102.238 1.00 53.59  ? 290 ARG B O     1 
ATOM   5201  C  CB    . ARG B  1 184 ? 87.176  67.462  -101.124 1.00 47.34  ? 290 ARG B CB    1 
ATOM   5202  C  CG    . ARG B  1 184 ? 87.229  66.000  -100.723 1.00 45.92  ? 290 ARG B CG    1 
ATOM   5203  C  CD    . ARG B  1 184 ? 86.707  65.084  -101.794 1.00 45.18  ? 290 ARG B CD    1 
ATOM   5204  N  NE    . ARG B  1 184 ? 86.636  63.700  -101.350 1.00 43.91  ? 290 ARG B NE    1 
ATOM   5205  C  CZ    . ARG B  1 184 ? 87.684  62.917  -101.076 1.00 43.32  ? 290 ARG B CZ    1 
ATOM   5206  N  NH1   . ARG B  1 184 ? 88.941  63.361  -101.179 1.00 43.47  ? 290 ARG B NH1   1 
ATOM   5207  N  NH2   . ARG B  1 184 ? 87.481  61.676  -100.681 1.00 42.48  ? 290 ARG B NH2   1 
ATOM   5208  N  N     . PRO B  1 185 ? 87.030  69.199  -103.804 1.00 56.19  ? 291 PRO B N     1 
ATOM   5209  C  CA    . PRO B  1 185 ? 86.521  70.420  -104.438 1.00 60.55  ? 291 PRO B CA    1 
ATOM   5210  C  C     . PRO B  1 185 ? 85.460  71.175  -103.630 1.00 62.12  ? 291 PRO B C     1 
ATOM   5211  O  O     . PRO B  1 185 ? 84.961  70.668  -102.642 1.00 64.62  ? 291 PRO B O     1 
ATOM   5212  C  CB    . PRO B  1 185 ? 85.908  69.909  -105.732 1.00 61.95  ? 291 PRO B CB    1 
ATOM   5213  C  CG    . PRO B  1 185 ? 85.553  68.490  -105.439 1.00 59.55  ? 291 PRO B CG    1 
ATOM   5214  C  CD    . PRO B  1 185 ? 86.633  67.989  -104.555 1.00 56.77  ? 291 PRO B CD    1 
ATOM   5215  N  N     . GLU B  1 186 ? 85.111  72.365  -104.101 1.00 64.89  ? 292 GLU B N     1 
ATOM   5216  C  CA    . GLU B  1 186 ? 84.126  73.249  -103.460 1.00 68.85  ? 292 GLU B CA    1 
ATOM   5217  C  C     . GLU B  1 186 ? 82.720  72.639  -103.337 1.00 65.61  ? 292 GLU B C     1 
ATOM   5218  O  O     . GLU B  1 186 ? 81.957  72.985  -102.420 1.00 64.92  ? 292 GLU B O     1 
ATOM   5219  C  CB    . GLU B  1 186 ? 83.981  74.564  -104.218 1.00 77.56  ? 292 GLU B CB    1 
ATOM   5220  C  CG    . GLU B  1 186 ? 85.213  75.440  -104.278 1.00 84.66  ? 292 GLU B CG    1 
ATOM   5221  C  CD    . GLU B  1 186 ? 85.057  76.630  -105.202 1.00 91.61  ? 292 GLU B CD    1 
ATOM   5222  O  OE1   . GLU B  1 186 ? 84.056  76.695  -105.957 1.00 99.51  ? 292 GLU B OE1   1 
ATOM   5223  O  OE2   . GLU B  1 186 ? 85.899  77.526  -105.204 1.00 93.67  ? 292 GLU B OE2   1 
ATOM   5224  N  N     . ASN B  1 187 ? 82.370  71.767  -104.284 1.00 61.16  ? 293 ASN B N     1 
ATOM   5225  C  CA    . ASN B  1 187 ? 81.075  71.090  -104.294 1.00 60.38  ? 293 ASN B CA    1 
ATOM   5226  C  C     . ASN B  1 187 ? 80.940  70.015  -103.213 1.00 57.68  ? 293 ASN B C     1 
ATOM   5227  O  O     . ASN B  1 187 ? 79.888  69.373  -103.107 1.00 57.77  ? 293 ASN B O     1 
ATOM   5228  C  CB    . ASN B  1 187 ? 80.717  70.510  -105.691 1.00 59.80  ? 293 ASN B CB    1 
ATOM   5229  C  CG    . ASN B  1 187 ? 81.696  69.467  -106.197 1.00 57.60  ? 293 ASN B CG    1 
ATOM   5230  O  OD1   . ASN B  1 187 ? 82.116  68.568  -105.484 1.00 55.40  ? 293 ASN B OD1   1 
ATOM   5231  N  ND2   . ASN B  1 187 ? 82.072  69.591  -107.458 1.00 60.56  ? 293 ASN B ND2   1 
ATOM   5232  N  N     . LYS B  1 188 ? 82.008  69.792  -102.450 1.00 53.68  ? 294 LYS B N     1 
ATOM   5233  C  CA    . LYS B  1 188 ? 81.958  68.950  -101.275 1.00 52.34  ? 294 LYS B CA    1 
ATOM   5234  C  C     . LYS B  1 188 ? 82.546  69.636  -100.040 1.00 50.41  ? 294 LYS B C     1 
ATOM   5235  O  O     . LYS B  1 188 ? 83.102  68.971  -99.166  1.00 52.93  ? 294 LYS B O     1 
ATOM   5236  C  CB    . LYS B  1 188 ? 82.655  67.627  -101.583 1.00 52.49  ? 294 LYS B CB    1 
ATOM   5237  C  CG    . LYS B  1 188 ? 81.788  66.726  -102.438 1.00 52.56  ? 294 LYS B CG    1 
ATOM   5238  C  CD    . LYS B  1 188 ? 82.488  65.425  -102.702 1.00 53.49  ? 294 LYS B CD    1 
ATOM   5239  C  CE    . LYS B  1 188 ? 81.578  64.470  -103.432 1.00 55.51  ? 294 LYS B CE    1 
ATOM   5240  N  NZ    . LYS B  1 188 ? 82.384  63.362  -104.006 1.00 58.84  ? 294 LYS B NZ    1 
ATOM   5241  N  N     . SER B  1 189 ? 82.377  70.956  -99.935  1.00 47.72  ? 295 SER B N     1 
ATOM   5242  C  CA    . SER B  1 189 ? 82.886  71.690  -98.762  1.00 46.46  ? 295 SER B CA    1 
ATOM   5243  C  C     . SER B  1 189 ? 82.213  71.268  -97.464  1.00 44.33  ? 295 SER B C     1 
ATOM   5244  O  O     . SER B  1 189 ? 82.794  71.370  -96.391  1.00 44.36  ? 295 SER B O     1 
ATOM   5245  C  CB    . SER B  1 189 ? 82.727  73.201  -98.921  1.00 47.58  ? 295 SER B CB    1 
ATOM   5246  O  OG    . SER B  1 189 ? 81.399  73.613  -98.740  1.00 49.10  ? 295 SER B OG    1 
ATOM   5247  N  N     . PHE B  1 190 ? 80.975  70.820  -97.568  1.00 41.65  ? 296 PHE B N     1 
ATOM   5248  C  CA    . PHE B  1 190 ? 80.225  70.367  -96.401  1.00 39.51  ? 296 PHE B CA    1 
ATOM   5249  C  C     . PHE B  1 190 ? 80.916  69.250  -95.643  1.00 38.50  ? 296 PHE B C     1 
ATOM   5250  O  O     . PHE B  1 190 ? 80.761  69.162  -94.426  1.00 40.93  ? 296 PHE B O     1 
ATOM   5251  C  CB    . PHE B  1 190 ? 78.798  69.963  -96.764  1.00 38.59  ? 296 PHE B CB    1 
ATOM   5252  C  CG    . PHE B  1 190 ? 78.705  68.844  -97.760  1.00 37.68  ? 296 PHE B CG    1 
ATOM   5253  C  CD1   . PHE B  1 190 ? 78.732  67.533  -97.344  1.00 38.40  ? 296 PHE B CD1   1 
ATOM   5254  C  CD2   . PHE B  1 190 ? 78.524  69.112  -99.097  1.00 38.11  ? 296 PHE B CD2   1 
ATOM   5255  C  CE1   . PHE B  1 190 ? 78.620  66.500  -98.252  1.00 39.13  ? 296 PHE B CE1   1 
ATOM   5256  C  CE2   . PHE B  1 190 ? 78.406  68.091  -100.009 1.00 38.57  ? 296 PHE B CE2   1 
ATOM   5257  C  CZ    . PHE B  1 190 ? 78.481  66.770  -99.586  1.00 38.65  ? 296 PHE B CZ    1 
ATOM   5258  N  N     . LEU B  1 191 ? 81.695  68.422  -96.332  1.00 36.89  ? 297 LEU B N     1 
ATOM   5259  C  CA    . LEU B  1 191 ? 82.452  67.371  -95.652  1.00 35.89  ? 297 LEU B CA    1 
ATOM   5260  C  C     . LEU B  1 191 ? 83.472  67.908  -94.633  1.00 37.64  ? 297 LEU B C     1 
ATOM   5261  O  O     . LEU B  1 191 ? 83.762  67.243  -93.629  1.00 39.83  ? 297 LEU B O     1 
ATOM   5262  C  CB    . LEU B  1 191 ? 83.135  66.454  -96.661  1.00 34.44  ? 297 LEU B CB    1 
ATOM   5263  C  CG    . LEU B  1 191 ? 82.247  65.713  -97.659  1.00 33.78  ? 297 LEU B CG    1 
ATOM   5264  C  CD1   . LEU B  1 191 ? 83.093  64.865  -98.579  1.00 33.61  ? 297 LEU B CD1   1 
ATOM   5265  C  CD2   . LEU B  1 191 ? 81.223  64.840  -96.968  1.00 33.49  ? 297 LEU B CD2   1 
ATOM   5266  N  N     . TYR B  1 192 ? 83.997  69.110  -94.866  1.00 38.39  ? 298 TYR B N     1 
ATOM   5267  C  CA    . TYR B  1 192 ? 84.919  69.728  -93.909  1.00 39.38  ? 298 TYR B CA    1 
ATOM   5268  C  C     . TYR B  1 192 ? 84.267  70.257  -92.630  1.00 38.36  ? 298 TYR B C     1 
ATOM   5269  O  O     . TYR B  1 192 ? 84.957  70.547  -91.659  1.00 36.78  ? 298 TYR B O     1 
ATOM   5270  C  CB    . TYR B  1 192 ? 85.718  70.834  -94.583  1.00 41.21  ? 298 TYR B CB    1 
ATOM   5271  C  CG    . TYR B  1 192 ? 86.701  70.322  -95.611  1.00 42.89  ? 298 TYR B CG    1 
ATOM   5272  C  CD1   . TYR B  1 192 ? 87.899  69.752  -95.232  1.00 43.65  ? 298 TYR B CD1   1 
ATOM   5273  C  CD2   . TYR B  1 192 ? 86.433  70.432  -96.973  1.00 44.06  ? 298 TYR B CD2   1 
ATOM   5274  C  CE1   . TYR B  1 192 ? 88.798  69.281  -96.182  1.00 44.77  ? 298 TYR B CE1   1 
ATOM   5275  C  CE2   . TYR B  1 192 ? 87.327  69.970  -97.924  1.00 44.87  ? 298 TYR B CE2   1 
ATOM   5276  C  CZ    . TYR B  1 192 ? 88.513  69.395  -97.523  1.00 45.61  ? 298 TYR B CZ    1 
ATOM   5277  O  OH    . TYR B  1 192 ? 89.416  68.939  -98.447  1.00 47.90  ? 298 TYR B OH    1 
ATOM   5278  N  N     . GLU B  1 193 ? 82.949  70.382  -92.638  1.00 39.99  ? 299 GLU B N     1 
ATOM   5279  C  CA    . GLU B  1 193 ? 82.188  70.830  -91.467  1.00 42.62  ? 299 GLU B CA    1 
ATOM   5280  C  C     . GLU B  1 193 ? 81.730  69.707  -90.508  1.00 40.91  ? 299 GLU B C     1 
ATOM   5281  O  O     . GLU B  1 193 ? 81.004  69.997  -89.551  1.00 43.01  ? 299 GLU B O     1 
ATOM   5282  C  CB    . GLU B  1 193 ? 80.960  71.616  -91.941  1.00 46.69  ? 299 GLU B CB    1 
ATOM   5283  C  CG    . GLU B  1 193 ? 81.245  72.876  -92.744  1.00 51.45  ? 299 GLU B CG    1 
ATOM   5284  C  CD    . GLU B  1 193 ? 79.976  73.620  -93.173  1.00 54.90  ? 299 GLU B CD    1 
ATOM   5285  O  OE1   . GLU B  1 193 ? 78.958  72.945  -93.472  1.00 58.46  ? 299 GLU B OE1   1 
ATOM   5286  O  OE2   . GLU B  1 193 ? 80.004  74.873  -93.259  1.00 59.10  ? 299 GLU B OE2   1 
ATOM   5287  N  N     . ILE B  1 194 ? 82.132  68.456  -90.725  1.00 38.99  ? 300 ILE B N     1 
ATOM   5288  C  CA    . ILE B  1 194 ? 81.652  67.346  -89.886  1.00 36.90  ? 300 ILE B CA    1 
ATOM   5289  C  C     . ILE B  1 194 ? 82.500  67.101  -88.631  1.00 36.46  ? 300 ILE B C     1 
ATOM   5290  O  O     . ILE B  1 194 ? 82.005  67.125  -87.514  1.00 35.72  ? 300 ILE B O     1 
ATOM   5291  C  CB    . ILE B  1 194 ? 81.516  66.077  -90.730  1.00 36.32  ? 300 ILE B CB    1 
ATOM   5292  C  CG1   . ILE B  1 194 ? 80.363  66.290  -91.714  1.00 36.52  ? 300 ILE B CG1   1 
ATOM   5293  C  CG2   . ILE B  1 194 ? 81.260  64.844  -89.858  1.00 35.97  ? 300 ILE B CG2   1 
ATOM   5294  C  CD1   . ILE B  1 194 ? 80.257  65.237  -92.803  1.00 36.86  ? 300 ILE B CD1   1 
ATOM   5295  N  N     . VAL B  1 195 ? 83.778  66.866  -88.816  1.00 38.12  ? 301 VAL B N     1 
ATOM   5296  C  CA    . VAL B  1 195 ? 84.663  66.466  -87.712  1.00 39.70  ? 301 VAL B CA    1 
ATOM   5297  C  C     . VAL B  1 195 ? 85.164  67.665  -86.912  1.00 43.98  ? 301 VAL B C     1 
ATOM   5298  O  O     . VAL B  1 195 ? 85.224  67.616  -85.685  1.00 46.88  ? 301 VAL B O     1 
ATOM   5299  C  CB    . VAL B  1 195 ? 85.849  65.658  -88.258  1.00 38.60  ? 301 VAL B CB    1 
ATOM   5300  C  CG1   . VAL B  1 195 ? 86.808  65.246  -87.169  1.00 36.97  ? 301 VAL B CG1   1 
ATOM   5301  C  CG2   . VAL B  1 195 ? 85.339  64.433  -89.001  1.00 38.61  ? 301 VAL B CG2   1 
ATOM   5302  N  N     . SER B  1 196 ? 85.551  68.735  -87.598  1.00 48.45  ? 302 SER B N     1 
ATOM   5303  C  CA    . SER B  1 196 ? 86.047  69.945  -86.936  1.00 49.94  ? 302 SER B CA    1 
ATOM   5304  C  C     . SER B  1 196 ? 85.648  71.165  -87.780  1.00 52.71  ? 302 SER B C     1 
ATOM   5305  O  O     . SER B  1 196 ? 86.277  71.488  -88.789  1.00 59.21  ? 302 SER B O     1 
ATOM   5306  C  CB    . SER B  1 196 ? 87.559  69.821  -86.758  1.00 50.62  ? 302 SER B CB    1 
ATOM   5307  O  OG    . SER B  1 196 ? 88.166  71.074  -86.493  1.00 50.72  ? 302 SER B OG    1 
ATOM   5308  N  N     . ASN B  1 197 ? 84.589  71.829  -87.338  1.00 52.87  ? 303 ASN B N     1 
ATOM   5309  C  CA    . ASN B  1 197 ? 83.920  72.870  -88.102  1.00 51.81  ? 303 ASN B CA    1 
ATOM   5310  C  C     . ASN B  1 197 ? 84.607  74.202  -87.809  1.00 53.20  ? 303 ASN B C     1 
ATOM   5311  O  O     . ASN B  1 197 ? 84.429  74.769  -86.730  1.00 54.85  ? 303 ASN B O     1 
ATOM   5312  C  CB    . ASN B  1 197 ? 82.438  72.905  -87.710  1.00 49.79  ? 303 ASN B CB    1 
ATOM   5313  C  CG    . ASN B  1 197 ? 81.622  73.862  -88.550  1.00 48.94  ? 303 ASN B CG    1 
ATOM   5314  O  OD1   . ASN B  1 197 ? 82.064  74.960  -88.853  1.00 50.15  ? 303 ASN B OD1   1 
ATOM   5315  N  ND2   . ASN B  1 197 ? 80.407  73.452  -88.911  1.00 48.61  ? 303 ASN B ND2   1 
ATOM   5316  N  N     . LYS B  1 198 ? 85.371  74.695  -88.779  1.00 53.57  ? 304 LYS B N     1 
ATOM   5317  C  CA    . LYS B  1 198 ? 86.102  75.950  -88.627  1.00 56.39  ? 304 LYS B CA    1 
ATOM   5318  C  C     . LYS B  1 198 ? 85.191  77.170  -88.753  1.00 52.89  ? 304 LYS B C     1 
ATOM   5319  O  O     . LYS B  1 198 ? 85.524  78.224  -88.273  1.00 52.01  ? 304 LYS B O     1 
ATOM   5320  C  CB    . LYS B  1 198 ? 87.214  76.070  -89.676  1.00 64.45  ? 304 LYS B CB    1 
ATOM   5321  C  CG    . LYS B  1 198 ? 88.154  74.877  -89.808  1.00 70.37  ? 304 LYS B CG    1 
ATOM   5322  C  CD    . LYS B  1 198 ? 89.039  74.730  -88.586  1.00 76.53  ? 304 LYS B CD    1 
ATOM   5323  C  CE    . LYS B  1 198 ? 89.827  73.430  -88.621  1.00 80.58  ? 304 LYS B CE    1 
ATOM   5324  N  NZ    . LYS B  1 198 ? 90.636  73.235  -87.393  1.00 82.23  ? 304 LYS B NZ    1 
ATOM   5325  N  N     . ARG B  1 199 ? 84.047  77.018  -89.404  1.00 52.56  ? 305 ARG B N     1 
ATOM   5326  C  CA    . ARG B  1 199 ? 83.146  78.123  -89.701  1.00 54.30  ? 305 ARG B CA    1 
ATOM   5327  C  C     . ARG B  1 199 ? 82.466  78.624  -88.429  1.00 50.94  ? 305 ARG B C     1 
ATOM   5328  O  O     . ARG B  1 199 ? 82.503  79.824  -88.121  1.00 52.99  ? 305 ARG B O     1 
ATOM   5329  C  CB    . ARG B  1 199 ? 82.101  77.664  -90.733  1.00 60.12  ? 305 ARG B CB    1 
ATOM   5330  C  CG    . ARG B  1 199 ? 81.388  78.786  -91.476  1.00 67.24  ? 305 ARG B CG    1 
ATOM   5331  C  CD    . ARG B  1 199 ? 80.709  78.319  -92.751  1.00 73.73  ? 305 ARG B CD    1 
ATOM   5332  N  NE    . ARG B  1 199 ? 81.658  77.655  -93.666  1.00 80.52  ? 305 ARG B NE    1 
ATOM   5333  C  CZ    . ARG B  1 199 ? 82.472  78.289  -94.524  1.00 87.83  ? 305 ARG B CZ    1 
ATOM   5334  N  NH1   . ARG B  1 199 ? 82.525  79.628  -94.592  1.00 90.49  ? 305 ARG B NH1   1 
ATOM   5335  N  NH2   . ARG B  1 199 ? 83.298  77.625  -95.315  1.00 92.00  ? 305 ARG B NH2   1 
ATOM   5336  N  N     . ASN B  1 200 ? 81.849  77.694  -87.698  1.00 46.84  ? 306 ASN B N     1 
ATOM   5337  C  CA    . ASN B  1 200 ? 81.056  78.006  -86.509  1.00 43.23  ? 306 ASN B CA    1 
ATOM   5338  C  C     . ASN B  1 200 ? 81.305  77.122  -85.268  1.00 41.34  ? 306 ASN B C     1 
ATOM   5339  O  O     . ASN B  1 200 ? 80.863  77.471  -84.148  1.00 39.90  ? 306 ASN B O     1 
ATOM   5340  C  CB    . ASN B  1 200 ? 79.572  78.003  -86.867  1.00 42.00  ? 306 ASN B CB    1 
ATOM   5341  C  CG    . ASN B  1 200 ? 79.108  76.684  -87.456  1.00 40.64  ? 306 ASN B CG    1 
ATOM   5342  O  OD1   . ASN B  1 200 ? 79.404  75.630  -86.911  1.00 40.54  ? 306 ASN B OD1   1 
ATOM   5343  N  ND2   . ASN B  1 200 ? 78.371  76.744  -88.567  1.00 39.28  ? 306 ASN B ND2   1 
ATOM   5344  N  N     . GLY B  1 201 ? 81.979  75.984  -85.436  1.00 39.73  ? 307 GLY B N     1 
ATOM   5345  C  CA    . GLY B  1 201 ? 82.286  75.118  -84.299  1.00 37.09  ? 307 GLY B CA    1 
ATOM   5346  C  C     . GLY B  1 201 ? 81.296  73.989  -84.028  1.00 34.01  ? 307 GLY B C     1 
ATOM   5347  O  O     . GLY B  1 201 ? 81.546  73.156  -83.157  1.00 32.28  ? 307 GLY B O     1 
ATOM   5348  N  N     . ILE B  1 202 ? 80.198  73.933  -84.776  1.00 31.39  ? 308 ILE B N     1 
ATOM   5349  C  CA    . ILE B  1 202 ? 79.225  72.860  -84.616  1.00 29.70  ? 308 ILE B CA    1 
ATOM   5350  C  C     . ILE B  1 202 ? 79.742  71.613  -85.334  1.00 28.33  ? 308 ILE B C     1 
ATOM   5351  O  O     . ILE B  1 202 ? 79.642  71.511  -86.557  1.00 27.49  ? 308 ILE B O     1 
ATOM   5352  C  CB    . ILE B  1 202 ? 77.844  73.283  -85.148  1.00 29.66  ? 308 ILE B CB    1 
ATOM   5353  C  CG1   . ILE B  1 202 ? 77.345  74.491  -84.371  1.00 29.73  ? 308 ILE B CG1   1 
ATOM   5354  C  CG2   . ILE B  1 202 ? 76.847  72.144  -84.989  1.00 29.21  ? 308 ILE B CG2   1 
ATOM   5355  C  CD1   . ILE B  1 202 ? 76.232  75.277  -84.995  1.00 29.96  ? 308 ILE B CD1   1 
ATOM   5356  N  N     . ASP B  1 203 ? 80.310  70.691  -84.557  1.00 27.52  ? 309 ASP B N     1 
ATOM   5357  C  CA    . ASP B  1 203 ? 80.932  69.467  -85.086  1.00 27.20  ? 309 ASP B CA    1 
ATOM   5358  C  C     . ASP B  1 203 ? 80.667  68.240  -84.198  1.00 25.13  ? 309 ASP B C     1 
ATOM   5359  O  O     . ASP B  1 203 ? 80.164  68.356  -83.079  1.00 24.44  ? 309 ASP B O     1 
ATOM   5360  C  CB    . ASP B  1 203 ? 82.445  69.679  -85.322  1.00 28.46  ? 309 ASP B CB    1 
ATOM   5361  C  CG    . ASP B  1 203 ? 83.205  70.229  -84.073  1.00 29.55  ? 309 ASP B CG    1 
ATOM   5362  O  OD1   . ASP B  1 203 ? 83.208  69.578  -83.000  1.00 30.20  ? 309 ASP B OD1   1 
ATOM   5363  O  OD2   . ASP B  1 203 ? 83.857  71.300  -84.164  1.00 30.39  ? 309 ASP B OD2   1 
ATOM   5364  N  N     . VAL B  1 204 ? 81.001  67.062  -84.698  1.00 23.60  ? 310 VAL B N     1 
ATOM   5365  C  CA    . VAL B  1 204 ? 80.711  65.843  -83.959  1.00 22.80  ? 310 VAL B CA    1 
ATOM   5366  C  C     . VAL B  1 204 ? 81.718  65.572  -82.823  1.00 22.66  ? 310 VAL B C     1 
ATOM   5367  O  O     . VAL B  1 204 ? 81.414  64.776  -81.952  1.00 22.66  ? 310 VAL B O     1 
ATOM   5368  C  CB    . VAL B  1 204 ? 80.528  64.603  -84.888  1.00 22.41  ? 310 VAL B CB    1 
ATOM   5369  C  CG1   . VAL B  1 204 ? 79.542  64.890  -86.001  1.00 22.14  ? 310 VAL B CG1   1 
ATOM   5370  C  CG2   . VAL B  1 204 ? 81.825  64.120  -85.505  1.00 22.58  ? 310 VAL B CG2   1 
ATOM   5371  N  N     . ASP B  1 205 ? 82.897  66.211  -82.830  1.00 22.68  ? 311 ASP B N     1 
ATOM   5372  C  CA    . ASP B  1 205 ? 83.825  66.150  -81.688  1.00 22.82  ? 311 ASP B CA    1 
ATOM   5373  C  C     . ASP B  1 205 ? 83.028  66.592  -80.454  1.00 23.31  ? 311 ASP B C     1 
ATOM   5374  O  O     . ASP B  1 205 ? 82.951  65.873  -79.455  1.00 23.26  ? 311 ASP B O     1 
ATOM   5375  C  CB    . ASP B  1 205 ? 85.049  67.056  -81.902  1.00 23.01  ? 311 ASP B CB    1 
ATOM   5376  C  CG    . ASP B  1 205 ? 86.177  66.819  -80.898  1.00 23.28  ? 311 ASP B CG    1 
ATOM   5377  O  OD1   . ASP B  1 205 ? 86.461  65.668  -80.471  1.00 22.64  ? 311 ASP B OD1   1 
ATOM   5378  O  OD2   . ASP B  1 205 ? 86.826  67.820  -80.569  1.00 24.35  ? 311 ASP B OD2   1 
ATOM   5379  N  N     . LYS B  1 206 ? 82.375  67.749  -80.566  1.00 23.94  ? 312 LYS B N     1 
ATOM   5380  C  CA    . LYS B  1 206 ? 81.559  68.297  -79.474  1.00 23.60  ? 312 LYS B CA    1 
ATOM   5381  C  C     . LYS B  1 206 ? 80.479  67.338  -79.054  1.00 23.00  ? 312 LYS B C     1 
ATOM   5382  O  O     . LYS B  1 206 ? 80.284  67.111  -77.859  1.00 23.85  ? 312 LYS B O     1 
ATOM   5383  C  CB    . LYS B  1 206 ? 80.933  69.657  -79.834  1.00 24.59  ? 312 LYS B CB    1 
ATOM   5384  C  CG    . LYS B  1 206 ? 81.867  70.840  -79.567  1.00 25.41  ? 312 LYS B CG    1 
ATOM   5385  C  CD    . LYS B  1 206 ? 81.272  72.171  -80.021  1.00 26.12  ? 312 LYS B CD    1 
ATOM   5386  C  CE    . LYS B  1 206 ? 82.295  73.307  -80.084  1.00 26.28  ? 312 LYS B CE    1 
ATOM   5387  N  NZ    . LYS B  1 206 ? 83.348  73.116  -81.111  1.00 26.27  ? 312 LYS B NZ    1 
ATOM   5388  N  N     . TRP B  1 207 ? 79.787  66.763  -80.036  1.00 22.02  ? 313 TRP B N     1 
ATOM   5389  C  CA    . TRP B  1 207 ? 78.602  65.985  -79.729  1.00 21.41  ? 313 TRP B CA    1 
ATOM   5390  C  C     . TRP B  1 207 ? 78.962  64.762  -78.910  1.00 21.74  ? 313 TRP B C     1 
ATOM   5391  O  O     . TRP B  1 207 ? 78.248  64.420  -77.948  1.00 21.73  ? 313 TRP B O     1 
ATOM   5392  C  CB    . TRP B  1 207 ? 77.839  65.589  -80.988  1.00 20.64  ? 313 TRP B CB    1 
ATOM   5393  C  CG    . TRP B  1 207 ? 77.349  66.738  -81.802  1.00 20.28  ? 313 TRP B CG    1 
ATOM   5394  C  CD1   . TRP B  1 207 ? 77.277  68.061  -81.432  1.00 20.13  ? 313 TRP B CD1   1 
ATOM   5395  C  CD2   . TRP B  1 207 ? 76.848  66.662  -83.128  1.00 20.09  ? 313 TRP B CD2   1 
ATOM   5396  N  NE1   . TRP B  1 207 ? 76.774  68.810  -82.464  1.00 20.33  ? 313 TRP B NE1   1 
ATOM   5397  C  CE2   . TRP B  1 207 ? 76.504  67.976  -83.517  1.00 20.40  ? 313 TRP B CE2   1 
ATOM   5398  C  CE3   . TRP B  1 207 ? 76.645  65.607  -84.028  1.00 19.88  ? 313 TRP B CE3   1 
ATOM   5399  C  CZ2   . TRP B  1 207 ? 76.012  68.267  -84.788  1.00 20.59  ? 313 TRP B CZ2   1 
ATOM   5400  C  CZ3   . TRP B  1 207 ? 76.123  65.894  -85.287  1.00 20.07  ? 313 TRP B CZ3   1 
ATOM   5401  C  CH2   . TRP B  1 207 ? 75.798  67.207  -85.647  1.00 20.44  ? 313 TRP B CH2   1 
ATOM   5402  N  N     . ASP B  1 208 ? 80.077  64.133  -79.265  1.00 22.40  ? 314 ASP B N     1 
ATOM   5403  C  CA    . ASP B  1 208 ? 80.513  62.965  -78.538  1.00 23.10  ? 314 ASP B CA    1 
ATOM   5404  C  C     . ASP B  1 208 ? 80.920  63.353  -77.109  1.00 23.17  ? 314 ASP B C     1 
ATOM   5405  O  O     . ASP B  1 208 ? 80.448  62.741  -76.150  1.00 23.82  ? 314 ASP B O     1 
ATOM   5406  C  CB    . ASP B  1 208 ? 81.701  62.280  -79.182  1.00 23.91  ? 314 ASP B CB    1 
ATOM   5407  C  CG    . ASP B  1 208 ? 82.157  61.074  -78.388  1.00 24.48  ? 314 ASP B CG    1 
ATOM   5408  O  OD1   . ASP B  1 208 ? 82.789  61.223  -77.254  1.00 25.38  ? 314 ASP B OD1   1 
ATOM   5409  O  OD2   . ASP B  1 208 ? 81.916  60.018  -78.867  1.00 24.90  ? 314 ASP B OD2   1 
ATOM   5410  N  N     . TYR B  1 209 ? 81.812  64.329  -76.958  1.00 22.71  ? 315 TYR B N     1 
ATOM   5411  C  CA    . TYR B  1 209 ? 82.333  64.606  -75.619  1.00 22.26  ? 315 TYR B CA    1 
ATOM   5412  C  C     . TYR B  1 209 ? 81.285  65.183  -74.663  1.00 22.98  ? 315 TYR B C     1 
ATOM   5413  O  O     . TYR B  1 209 ? 81.388  64.990  -73.456  1.00 23.48  ? 315 TYR B O     1 
ATOM   5414  C  CB    . TYR B  1 209 ? 83.627  65.426  -75.627  1.00 21.66  ? 315 TYR B CB    1 
ATOM   5415  C  CG    . TYR B  1 209 ? 83.552  66.935  -75.769  1.00 21.52  ? 315 TYR B CG    1 
ATOM   5416  C  CD1   . TYR B  1 209 ? 83.082  67.743  -74.730  1.00 21.46  ? 315 TYR B CD1   1 
ATOM   5417  C  CD2   . TYR B  1 209 ? 84.069  67.573  -76.893  1.00 21.67  ? 315 TYR B CD2   1 
ATOM   5418  C  CE1   . TYR B  1 209 ? 83.071  69.134  -74.843  1.00 21.59  ? 315 TYR B CE1   1 
ATOM   5419  C  CE2   . TYR B  1 209 ? 84.068  68.951  -77.017  1.00 21.84  ? 315 TYR B CE2   1 
ATOM   5420  C  CZ    . TYR B  1 209 ? 83.566  69.726  -76.009  1.00 21.89  ? 315 TYR B CZ    1 
ATOM   5421  O  OH    . TYR B  1 209 ? 83.568  71.089  -76.159  1.00 22.34  ? 315 TYR B OH    1 
ATOM   5422  N  N     . PHE B  1 210 ? 80.269  65.874  -75.176  1.00 23.84  ? 316 PHE B N     1 
ATOM   5423  C  CA    . PHE B  1 210 ? 79.161  66.283  -74.312  1.00 24.11  ? 316 PHE B CA    1 
ATOM   5424  C  C     . PHE B  1 210 ? 78.551  65.037  -73.682  1.00 23.06  ? 316 PHE B C     1 
ATOM   5425  O  O     . PHE B  1 210 ? 78.508  64.901  -72.460  1.00 22.33  ? 316 PHE B O     1 
ATOM   5426  C  CB    . PHE B  1 210 ? 78.080  67.020  -75.098  1.00 25.67  ? 316 PHE B CB    1 
ATOM   5427  C  CG    . PHE B  1 210 ? 78.445  68.426  -75.519  1.00 27.22  ? 316 PHE B CG    1 
ATOM   5428  C  CD1   . PHE B  1 210 ? 79.687  68.997  -75.269  1.00 27.69  ? 316 PHE B CD1   1 
ATOM   5429  C  CD2   . PHE B  1 210 ? 77.519  69.161  -76.236  1.00 28.51  ? 316 PHE B CD2   1 
ATOM   5430  C  CE1   . PHE B  1 210 ? 79.973  70.276  -75.704  1.00 28.57  ? 316 PHE B CE1   1 
ATOM   5431  C  CE2   . PHE B  1 210 ? 77.801  70.425  -76.677  1.00 28.97  ? 316 PHE B CE2   1 
ATOM   5432  C  CZ    . PHE B  1 210 ? 79.026  70.989  -76.411  1.00 29.16  ? 316 PHE B CZ    1 
ATOM   5433  N  N     . ALA B  1 211 ? 78.115  64.126  -74.543  1.00 22.62  ? 317 ALA B N     1 
ATOM   5434  C  CA    . ALA B  1 211 ? 77.462  62.905  -74.121  1.00 22.53  ? 317 ALA B CA    1 
ATOM   5435  C  C     . ALA B  1 211 ? 78.372  62.068  -73.227  1.00 21.85  ? 317 ALA B C     1 
ATOM   5436  O  O     . ALA B  1 211 ? 77.938  61.578  -72.187  1.00 22.62  ? 317 ALA B O     1 
ATOM   5437  C  CB    . ALA B  1 211 ? 77.044  62.098  -75.345  1.00 22.66  ? 317 ALA B CB    1 
ATOM   5438  N  N     . ARG B  1 212 ? 79.624  61.931  -73.632  1.00 20.80  ? 318 ARG B N     1 
ATOM   5439  C  CA    . ARG B  1 212 ? 80.553  61.057  -72.950  1.00 20.24  ? 318 ARG B CA    1 
ATOM   5440  C  C     . ARG B  1 212 ? 81.007  61.627  -71.620  1.00 20.31  ? 318 ARG B C     1 
ATOM   5441  O  O     . ARG B  1 212 ? 81.041  60.906  -70.633  1.00 20.01  ? 318 ARG B O     1 
ATOM   5442  C  CB    . ARG B  1 212 ? 81.792  60.813  -73.806  1.00 19.90  ? 318 ARG B CB    1 
ATOM   5443  C  CG    . ARG B  1 212 ? 82.683  59.684  -73.267  1.00 19.18  ? 318 ARG B CG    1 
ATOM   5444  C  CD    . ARG B  1 212 ? 83.771  59.336  -74.283  1.00 18.39  ? 318 ARG B CD    1 
ATOM   5445  N  NE    . ARG B  1 212 ? 83.144  58.962  -75.546  1.00 17.78  ? 318 ARG B NE    1 
ATOM   5446  C  CZ    . ARG B  1 212 ? 82.573  57.797  -75.799  1.00 17.16  ? 318 ARG B CZ    1 
ATOM   5447  N  NH1   . ARG B  1 212 ? 82.583  56.824  -74.863  1.00 16.94  ? 318 ARG B NH1   1 
ATOM   5448  N  NH2   . ARG B  1 212 ? 82.006  57.611  -76.989  1.00 16.94  ? 318 ARG B NH2   1 
ATOM   5449  N  N     . ASP B  1 213 ? 81.403  62.896  -71.614  1.00 20.66  ? 319 ASP B N     1 
ATOM   5450  C  CA    . ASP B  1 213 ? 81.922  63.517  -70.397  1.00 21.10  ? 319 ASP B CA    1 
ATOM   5451  C  C     . ASP B  1 213 ? 80.812  63.547  -69.362  1.00 21.48  ? 319 ASP B C     1 
ATOM   5452  O  O     . ASP B  1 213 ? 81.034  63.160  -68.215  1.00 21.70  ? 319 ASP B O     1 
ATOM   5453  C  CB    . ASP B  1 213 ? 82.513  64.927  -70.623  1.00 21.43  ? 319 ASP B CB    1 
ATOM   5454  C  CG    . ASP B  1 213 ? 83.736  64.929  -71.568  1.00 21.76  ? 319 ASP B CG    1 
ATOM   5455  O  OD1   . ASP B  1 213 ? 84.290  63.833  -71.873  1.00 22.25  ? 319 ASP B OD1   1 
ATOM   5456  O  OD2   . ASP B  1 213 ? 84.127  66.049  -72.008  1.00 21.58  ? 319 ASP B OD2   1 
ATOM   5457  N  N     . CYS B  1 214 ? 79.607  63.940  -69.776  1.00 21.84  ? 320 CYS B N     1 
ATOM   5458  C  CA    . CYS B  1 214 ? 78.443  63.902  -68.873  1.00 22.14  ? 320 CYS B CA    1 
ATOM   5459  C  C     . CYS B  1 214 ? 78.213  62.522  -68.235  1.00 21.61  ? 320 CYS B C     1 
ATOM   5460  O  O     . CYS B  1 214 ? 77.979  62.405  -67.029  1.00 21.85  ? 320 CYS B O     1 
ATOM   5461  C  CB    . CYS B  1 214 ? 77.199  64.357  -69.610  1.00 22.68  ? 320 CYS B CB    1 
ATOM   5462  S  SG    . CYS B  1 214 ? 77.191  66.137  -69.785  1.00 24.97  ? 320 CYS B SG    1 
ATOM   5463  N  N     . HIS B  1 215 ? 78.296  61.487  -69.046  1.00 21.08  ? 321 HIS B N     1 
ATOM   5464  C  CA    . HIS B  1 215 ? 78.049  60.129  -68.576  1.00 20.71  ? 321 HIS B CA    1 
ATOM   5465  C  C     . HIS B  1 215 ? 78.987  59.766  -67.438  1.00 21.32  ? 321 HIS B C     1 
ATOM   5466  O  O     . HIS B  1 215 ? 78.557  59.208  -66.436  1.00 21.82  ? 321 HIS B O     1 
ATOM   5467  C  CB    . HIS B  1 215 ? 78.222  59.171  -69.749  1.00 20.09  ? 321 HIS B CB    1 
ATOM   5468  C  CG    . HIS B  1 215 ? 78.023  57.730  -69.423  1.00 19.71  ? 321 HIS B CG    1 
ATOM   5469  N  ND1   . HIS B  1 215 ? 76.784  57.140  -69.355  1.00 19.72  ? 321 HIS B ND1   1 
ATOM   5470  C  CD2   . HIS B  1 215 ? 78.911  56.733  -69.224  1.00 19.60  ? 321 HIS B CD2   1 
ATOM   5471  C  CE1   . HIS B  1 215 ? 76.929  55.843  -69.108  1.00 19.78  ? 321 HIS B CE1   1 
ATOM   5472  N  NE2   . HIS B  1 215 ? 78.217  55.572  -69.020  1.00 19.63  ? 321 HIS B NE2   1 
ATOM   5473  N  N     . HIS B  1 216 ? 80.255  60.113  -67.609  1.00 22.42  ? 322 HIS B N     1 
ATOM   5474  C  CA    . HIS B  1 216 ? 81.309  59.781  -66.647  1.00 23.35  ? 322 HIS B CA    1 
ATOM   5475  C  C     . HIS B  1 216 ? 81.397  60.827  -65.506  1.00 22.56  ? 322 HIS B C     1 
ATOM   5476  O  O     . HIS B  1 216 ? 81.703  60.474  -64.370  1.00 21.57  ? 322 HIS B O     1 
ATOM   5477  C  CB    . HIS B  1 216 ? 82.682  59.574  -67.365  1.00 24.49  ? 322 HIS B CB    1 
ATOM   5478  C  CG    . HIS B  1 216 ? 82.739  58.344  -68.227  1.00 26.19  ? 322 HIS B CG    1 
ATOM   5479  N  ND1   . HIS B  1 216 ? 82.422  58.353  -69.573  1.00 28.00  ? 322 HIS B ND1   1 
ATOM   5480  C  CD2   . HIS B  1 216 ? 83.059  57.058  -67.927  1.00 27.83  ? 322 HIS B CD2   1 
ATOM   5481  C  CE1   . HIS B  1 216 ? 82.546  57.126  -70.069  1.00 30.24  ? 322 HIS B CE1   1 
ATOM   5482  N  NE2   . HIS B  1 216 ? 82.917  56.317  -69.083  1.00 29.98  ? 322 HIS B NE2   1 
ATOM   5483  N  N     . LEU B  1 217 ? 81.128  62.100  -65.796  1.00 22.18  ? 323 LEU B N     1 
ATOM   5484  C  CA    . LEU B  1 217 ? 81.240  63.143  -64.772  1.00 22.52  ? 323 LEU B CA    1 
ATOM   5485  C  C     . LEU B  1 217 ? 80.190  62.987  -63.684  1.00 24.31  ? 323 LEU B C     1 
ATOM   5486  O  O     . LEU B  1 217 ? 80.481  63.158  -62.471  1.00 25.83  ? 323 LEU B O     1 
ATOM   5487  C  CB    . LEU B  1 217 ? 81.102  64.536  -65.374  1.00 21.44  ? 323 LEU B CB    1 
ATOM   5488  C  CG    . LEU B  1 217 ? 82.295  65.079  -66.130  1.00 20.81  ? 323 LEU B CG    1 
ATOM   5489  C  CD1   . LEU B  1 217 ? 81.905  66.320  -66.902  1.00 20.81  ? 323 LEU B CD1   1 
ATOM   5490  C  CD2   . LEU B  1 217 ? 83.452  65.379  -65.182  1.00 20.40  ? 323 LEU B CD2   1 
ATOM   5491  N  N     . GLY B  1 218 ? 78.982  62.633  -64.128  1.00 25.11  ? 324 GLY B N     1 
ATOM   5492  C  CA    . GLY B  1 218 ? 77.809  62.665  -63.284  1.00 25.66  ? 324 GLY B CA    1 
ATOM   5493  C  C     . GLY B  1 218 ? 77.077  63.982  -63.396  1.00 26.50  ? 324 GLY B C     1 
ATOM   5494  O  O     . GLY B  1 218 ? 76.580  64.513  -62.420  1.00 28.18  ? 324 GLY B O     1 
ATOM   5495  N  N     . ILE B  1 219 ? 77.012  64.498  -64.602  1.00 27.33  ? 325 ILE B N     1 
ATOM   5496  C  CA    . ILE B  1 219 ? 76.201  65.649  -64.954  1.00 28.84  ? 325 ILE B CA    1 
ATOM   5497  C  C     . ILE B  1 219 ? 75.315  65.179  -66.089  1.00 29.54  ? 325 ILE B C     1 
ATOM   5498  O  O     . ILE B  1 219 ? 75.745  64.351  -66.868  1.00 30.29  ? 325 ILE B O     1 
ATOM   5499  C  CB    . ILE B  1 219 ? 77.121  66.779  -65.422  1.00 29.71  ? 325 ILE B CB    1 
ATOM   5500  C  CG1   . ILE B  1 219 ? 77.883  67.311  -64.209  1.00 30.62  ? 325 ILE B CG1   1 
ATOM   5501  C  CG2   . ILE B  1 219 ? 76.345  67.883  -66.110  1.00 29.49  ? 325 ILE B CG2   1 
ATOM   5502  C  CD1   . ILE B  1 219 ? 79.044  68.197  -64.567  1.00 31.21  ? 325 ILE B CD1   1 
ATOM   5503  N  N     . GLN B  1 220 ? 74.088  65.672  -66.188  1.00 30.39  ? 326 GLN B N     1 
ATOM   5504  C  CA    . GLN B  1 220 ? 73.241  65.340  -67.349  1.00 30.51  ? 326 GLN B CA    1 
ATOM   5505  C  C     . GLN B  1 220 ? 73.458  66.385  -68.475  1.00 30.98  ? 326 GLN B C     1 
ATOM   5506  O  O     . GLN B  1 220 ? 73.724  67.583  -68.256  1.00 29.16  ? 326 GLN B O     1 
ATOM   5507  C  CB    . GLN B  1 220 ? 71.748  65.097  -66.961  1.00 30.37  ? 326 GLN B CB    1 
ATOM   5508  N  N     . ASN B  1 221 ? 73.377  65.876  -69.691  1.00 33.89  ? 327 ASN B N     1 
ATOM   5509  C  CA    . ASN B  1 221 ? 73.659  66.605  -70.929  1.00 36.91  ? 327 ASN B CA    1 
ATOM   5510  C  C     . ASN B  1 221 ? 72.320  67.075  -71.486  1.00 40.91  ? 327 ASN B C     1 
ATOM   5511  O  O     . ASN B  1 221 ? 71.373  66.279  -71.633  1.00 44.87  ? 327 ASN B O     1 
ATOM   5512  C  CB    . ASN B  1 221 ? 74.323  65.610  -71.905  1.00 35.95  ? 327 ASN B CB    1 
ATOM   5513  C  CG    . ASN B  1 221 ? 74.510  66.163  -73.290  1.00 35.29  ? 327 ASN B CG    1 
ATOM   5514  O  OD1   . ASN B  1 221 ? 74.556  67.376  -73.498  1.00 34.39  ? 327 ASN B OD1   1 
ATOM   5515  N  ND2   . ASN B  1 221 ? 74.629  65.267  -74.254  1.00 36.27  ? 327 ASN B ND2   1 
ATOM   5516  N  N     . ASN B  1 222 ? 72.252  68.354  -71.824  1.00 43.63  ? 328 ASN B N     1 
ATOM   5517  C  CA    . ASN B  1 222 ? 71.008  68.941  -72.311  1.00 45.84  ? 328 ASN B CA    1 
ATOM   5518  C  C     . ASN B  1 222 ? 70.939  69.120  -73.839  1.00 43.89  ? 328 ASN B C     1 
ATOM   5519  O  O     . ASN B  1 222 ? 70.125  69.862  -74.307  1.00 45.17  ? 328 ASN B O     1 
ATOM   5520  C  CB    . ASN B  1 222 ? 70.779  70.223  -71.477  1.00 51.97  ? 328 ASN B CB    1 
ATOM   5521  C  CG    . ASN B  1 222 ? 69.627  71.106  -71.978  1.00 59.10  ? 328 ASN B CG    1 
ATOM   5522  O  OD1   . ASN B  1 222 ? 69.883  72.181  -72.532  1.00 64.10  ? 328 ASN B OD1   1 
ATOM   5523  N  ND2   . ASN B  1 222 ? 68.358  70.692  -71.733  1.00 63.14  ? 328 ASN B ND2   1 
ATOM   5524  N  N     . PHE B  1 223 ? 71.795  68.429  -74.610  1.00 41.94  ? 329 PHE B N     1 
ATOM   5525  C  CA    . PHE B  1 223 ? 71.882  68.631  -76.083  1.00 39.45  ? 329 PHE B CA    1 
ATOM   5526  C  C     . PHE B  1 223 ? 71.621  67.360  -76.858  1.00 37.83  ? 329 PHE B C     1 
ATOM   5527  O  O     . PHE B  1 223 ? 72.295  66.372  -76.620  1.00 38.18  ? 329 PHE B O     1 
ATOM   5528  C  CB    . PHE B  1 223 ? 73.249  69.162  -76.529  1.00 37.67  ? 329 PHE B CB    1 
ATOM   5529  C  CG    . PHE B  1 223 ? 73.353  69.357  -78.025  1.00 37.16  ? 329 PHE B CG    1 
ATOM   5530  C  CD1   . PHE B  1 223 ? 72.678  70.391  -78.651  1.00 36.65  ? 329 PHE B CD1   1 
ATOM   5531  C  CD2   . PHE B  1 223 ? 74.094  68.487  -78.811  1.00 36.43  ? 329 PHE B CD2   1 
ATOM   5532  C  CE1   . PHE B  1 223 ? 72.759  70.570  -80.029  1.00 35.68  ? 329 PHE B CE1   1 
ATOM   5533  C  CE2   . PHE B  1 223 ? 74.177  68.660  -80.187  1.00 35.65  ? 329 PHE B CE2   1 
ATOM   5534  C  CZ    . PHE B  1 223 ? 73.507  69.704  -80.795  1.00 35.49  ? 329 PHE B CZ    1 
ATOM   5535  N  N     . ASP B  1 224 ? 70.709  67.423  -77.829  1.00 36.08  ? 330 ASP B N     1 
ATOM   5536  C  CA    . ASP B  1 224 ? 70.272  66.242  -78.577  1.00 35.27  ? 330 ASP B CA    1 
ATOM   5537  C  C     . ASP B  1 224 ? 70.905  66.259  -79.970  1.00 35.27  ? 330 ASP B C     1 
ATOM   5538  O  O     . ASP B  1 224 ? 70.393  66.919  -80.871  1.00 35.27  ? 330 ASP B O     1 
ATOM   5539  C  CB    . ASP B  1 224 ? 68.749  66.243  -78.673  1.00 35.03  ? 330 ASP B CB    1 
ATOM   5540  C  CG    . ASP B  1 224 ? 68.188  64.903  -79.134  1.00 35.25  ? 330 ASP B CG    1 
ATOM   5541  O  OD1   . ASP B  1 224 ? 68.932  64.113  -79.755  1.00 34.59  ? 330 ASP B OD1   1 
ATOM   5542  O  OD2   . ASP B  1 224 ? 67.008  64.598  -78.894  1.00 35.93  ? 330 ASP B OD2   1 
ATOM   5543  N  N     . TYR B  1 225 ? 72.019  65.540  -80.136  1.00 35.34  ? 331 TYR B N     1 
ATOM   5544  C  CA    . TYR B  1 225 ? 72.729  65.522  -81.420  1.00 36.52  ? 331 TYR B CA    1 
ATOM   5545  C  C     . TYR B  1 225 ? 71.938  64.788  -82.496  1.00 36.93  ? 331 TYR B C     1 
ATOM   5546  O  O     . TYR B  1 225 ? 71.963  65.160  -83.669  1.00 39.85  ? 331 TYR B O     1 
ATOM   5547  C  CB    . TYR B  1 225 ? 74.149  64.946  -81.310  1.00 37.05  ? 331 TYR B CB    1 
ATOM   5548  C  CG    . TYR B  1 225 ? 74.252  63.438  -81.185  1.00 37.29  ? 331 TYR B CG    1 
ATOM   5549  C  CD1   . TYR B  1 225 ? 74.205  62.614  -82.323  1.00 37.10  ? 331 TYR B CD1   1 
ATOM   5550  C  CD2   . TYR B  1 225 ? 74.408  62.827  -79.917  1.00 38.02  ? 331 TYR B CD2   1 
ATOM   5551  C  CE1   . TYR B  1 225 ? 74.278  61.226  -82.226  1.00 38.30  ? 331 TYR B CE1   1 
ATOM   5552  C  CE2   . TYR B  1 225 ? 74.506  61.446  -79.792  1.00 38.93  ? 331 TYR B CE2   1 
ATOM   5553  C  CZ    . TYR B  1 225 ? 74.432  60.634  -80.956  1.00 39.62  ? 331 TYR B CZ    1 
ATOM   5554  O  OH    . TYR B  1 225 ? 74.522  59.226  -80.835  1.00 40.67  ? 331 TYR B OH    1 
ATOM   5555  N  N     . LYS B  1 226 ? 71.235  63.739  -82.089  1.00 34.98  ? 332 LYS B N     1 
ATOM   5556  C  CA    . LYS B  1 226 ? 70.446  62.950  -83.022  1.00 34.12  ? 332 LYS B CA    1 
ATOM   5557  C  C     . LYS B  1 226 ? 69.390  63.783  -83.727  1.00 33.04  ? 332 LYS B C     1 
ATOM   5558  O  O     . LYS B  1 226 ? 69.156  63.628  -84.931  1.00 32.50  ? 332 LYS B O     1 
ATOM   5559  C  CB    . LYS B  1 226 ? 69.792  61.777  -82.304  1.00 34.96  ? 332 LYS B CB    1 
ATOM   5560  C  CG    . LYS B  1 226 ? 70.785  60.707  -81.902  1.00 35.91  ? 332 LYS B CG    1 
ATOM   5561  C  CD    . LYS B  1 226 ? 70.076  59.522  -81.320  1.00 37.18  ? 332 LYS B CD    1 
ATOM   5562  C  CE    . LYS B  1 226 ? 71.025  58.381  -81.021  1.00 37.87  ? 332 LYS B CE    1 
ATOM   5563  N  NZ    . LYS B  1 226 ? 70.450  57.402  -80.074  1.00 38.34  ? 332 LYS B NZ    1 
ATOM   5564  N  N     . ARG B  1 227 ? 68.764  64.663  -82.957  1.00 32.41  ? 333 ARG B N     1 
ATOM   5565  C  CA    . ARG B  1 227 ? 67.766  65.577  -83.464  1.00 32.52  ? 333 ARG B CA    1 
ATOM   5566  C  C     . ARG B  1 227 ? 68.381  66.543  -84.462  1.00 33.17  ? 333 ARG B C     1 
ATOM   5567  O  O     . ARG B  1 227 ? 67.800  66.809  -85.501  1.00 34.59  ? 333 ARG B O     1 
ATOM   5568  C  CB    . ARG B  1 227 ? 67.127  66.351  -82.311  1.00 32.29  ? 333 ARG B CB    1 
ATOM   5569  C  CG    . ARG B  1 227 ? 65.981  67.256  -82.711  1.00 32.40  ? 333 ARG B CG    1 
ATOM   5570  C  CD    . ARG B  1 227 ? 65.379  68.014  -81.544  1.00 32.47  ? 333 ARG B CD    1 
ATOM   5571  N  NE    . ARG B  1 227 ? 64.627  69.175  -82.020  1.00 32.94  ? 333 ARG B NE    1 
ATOM   5572  C  CZ    . ARG B  1 227 ? 63.365  69.162  -82.464  1.00 33.70  ? 333 ARG B CZ    1 
ATOM   5573  N  NH1   . ARG B  1 227 ? 62.634  68.055  -82.471  1.00 33.49  ? 333 ARG B NH1   1 
ATOM   5574  N  NH2   . ARG B  1 227 ? 62.824  70.289  -82.892  1.00 34.51  ? 333 ARG B NH2   1 
ATOM   5575  N  N     . PHE B  1 228 ? 69.553  67.076  -84.147  1.00 33.24  ? 334 PHE B N     1 
ATOM   5576  C  CA    . PHE B  1 228 ? 70.211  68.016  -85.041  1.00 34.02  ? 334 PHE B CA    1 
ATOM   5577  C  C     . PHE B  1 228 ? 70.493  67.386  -86.408  1.00 34.78  ? 334 PHE B C     1 
ATOM   5578  O  O     . PHE B  1 228 ? 70.336  68.054  -87.443  1.00 36.13  ? 334 PHE B O     1 
ATOM   5579  C  CB    . PHE B  1 228 ? 71.488  68.586  -84.427  1.00 34.77  ? 334 PHE B CB    1 
ATOM   5580  C  CG    . PHE B  1 228 ? 72.165  69.564  -85.301  1.00 37.40  ? 334 PHE B CG    1 
ATOM   5581  C  CD1   . PHE B  1 228 ? 73.065  69.125  -86.270  1.00 39.70  ? 334 PHE B CD1   1 
ATOM   5582  C  CD2   . PHE B  1 228 ? 71.861  70.900  -85.236  1.00 38.49  ? 334 PHE B CD2   1 
ATOM   5583  C  CE1   . PHE B  1 228 ? 73.671  70.022  -87.129  1.00 39.94  ? 334 PHE B CE1   1 
ATOM   5584  C  CE2   . PHE B  1 228 ? 72.444  71.805  -86.108  1.00 39.59  ? 334 PHE B CE2   1 
ATOM   5585  C  CZ    . PHE B  1 228 ? 73.345  71.351  -87.058  1.00 40.15  ? 334 PHE B CZ    1 
ATOM   5586  N  N     . ILE B  1 229 ? 70.895  66.117  -86.396  1.00 34.87  ? 335 ILE B N     1 
ATOM   5587  C  CA    . ILE B  1 229 ? 71.136  65.357  -87.617  1.00 35.31  ? 335 ILE B CA    1 
ATOM   5588  C  C     . ILE B  1 229 ? 69.840  65.198  -88.426  1.00 36.10  ? 335 ILE B C     1 
ATOM   5589  O  O     . ILE B  1 229 ? 69.857  65.358  -89.626  1.00 36.19  ? 335 ILE B O     1 
ATOM   5590  C  CB    . ILE B  1 229 ? 71.778  63.987  -87.320  1.00 34.86  ? 335 ILE B CB    1 
ATOM   5591  C  CG1   . ILE B  1 229 ? 73.190  64.185  -86.824  1.00 34.49  ? 335 ILE B CG1   1 
ATOM   5592  C  CG2   . ILE B  1 229 ? 71.841  63.123  -88.573  1.00 34.97  ? 335 ILE B CG2   1 
ATOM   5593  C  CD1   . ILE B  1 229 ? 73.905  62.932  -86.365  1.00 34.22  ? 335 ILE B CD1   1 
ATOM   5594  N  N     . LYS B  1 230 ? 68.723  64.905  -87.781  1.00 36.74  ? 336 LYS B N     1 
ATOM   5595  C  CA    . LYS B  1 230 ? 67.466  64.815  -88.513  1.00 37.88  ? 336 LYS B CA    1 
ATOM   5596  C  C     . LYS B  1 230 ? 67.071  66.085  -89.240  1.00 39.35  ? 336 LYS B C     1 
ATOM   5597  O  O     . LYS B  1 230 ? 66.377  66.019  -90.244  1.00 41.10  ? 336 LYS B O     1 
ATOM   5598  C  CB    . LYS B  1 230 ? 66.298  64.446  -87.592  1.00 39.02  ? 336 LYS B CB    1 
ATOM   5599  C  CG    . LYS B  1 230 ? 66.394  63.061  -86.973  1.00 39.37  ? 336 LYS B CG    1 
ATOM   5600  C  CD    . LYS B  1 230 ? 65.979  62.028  -87.999  1.00 39.06  ? 336 LYS B CD    1 
ATOM   5601  C  CE    . LYS B  1 230 ? 65.252  60.827  -87.401  1.00 39.17  ? 336 LYS B CE    1 
ATOM   5602  N  NZ    . LYS B  1 230 ? 65.604  59.684  -88.251  1.00 40.35  ? 336 LYS B NZ    1 
ATOM   5603  N  N     . PHE B  1 231 ? 67.469  67.239  -88.724  1.00 41.42  ? 337 PHE B N     1 
ATOM   5604  C  CA    . PHE B  1 231 ? 67.129  68.515  -89.344  1.00 44.81  ? 337 PHE B CA    1 
ATOM   5605  C  C     . PHE B  1 231 ? 68.339  69.212  -89.951  1.00 46.42  ? 337 PHE B C     1 
ATOM   5606  O  O     . PHE B  1 231 ? 68.378  70.430  -90.025  1.00 49.42  ? 337 PHE B O     1 
ATOM   5607  C  CB    . PHE B  1 231 ? 66.412  69.413  -88.329  1.00 45.76  ? 337 PHE B CB    1 
ATOM   5608  C  CG    . PHE B  1 231 ? 65.177  68.787  -87.756  1.00 45.36  ? 337 PHE B CG    1 
ATOM   5609  C  CD1   . PHE B  1 231 ? 64.133  68.390  -88.587  1.00 45.77  ? 337 PHE B CD1   1 
ATOM   5610  C  CD2   . PHE B  1 231 ? 65.070  68.552  -86.403  1.00 43.84  ? 337 PHE B CD2   1 
ATOM   5611  C  CE1   . PHE B  1 231 ? 63.014  67.775  -88.076  1.00 44.97  ? 337 PHE B CE1   1 
ATOM   5612  C  CE2   . PHE B  1 231 ? 63.952  67.944  -85.878  1.00 43.69  ? 337 PHE B CE2   1 
ATOM   5613  C  CZ    . PHE B  1 231 ? 62.925  67.545  -86.714  1.00 43.95  ? 337 PHE B CZ    1 
ATOM   5614  N  N     . ALA B  1 232 ? 69.310  68.433  -90.399  1.00 46.71  ? 338 ALA B N     1 
ATOM   5615  C  CA    . ALA B  1 232 ? 70.483  68.980  -91.041  1.00 46.41  ? 338 ALA B CA    1 
ATOM   5616  C  C     . ALA B  1 232 ? 70.325  68.762  -92.517  1.00 45.88  ? 338 ALA B C     1 
ATOM   5617  O  O     . ALA B  1 232 ? 69.654  67.837  -92.944  1.00 45.80  ? 338 ALA B O     1 
ATOM   5618  C  CB    . ALA B  1 232 ? 71.735  68.295  -90.532  1.00 47.38  ? 338 ALA B CB    1 
ATOM   5619  N  N     . ARG B  1 233 ? 70.949  69.622  -93.301  1.00 47.59  ? 339 ARG B N     1 
ATOM   5620  C  CA    . ARG B  1 233 ? 70.756  69.633  -94.737  1.00 48.78  ? 339 ARG B CA    1 
ATOM   5621  C  C     . ARG B  1 233 ? 71.818  70.512  -95.395  1.00 47.73  ? 339 ARG B C     1 
ATOM   5622  O  O     . ARG B  1 233 ? 72.252  71.502  -94.804  1.00 47.70  ? 339 ARG B O     1 
ATOM   5623  C  CB    . ARG B  1 233 ? 69.367  70.176  -95.021  1.00 50.82  ? 339 ARG B CB    1 
ATOM   5624  C  CG    . ARG B  1 233 ? 68.893  69.930  -96.416  1.00 53.76  ? 339 ARG B CG    1 
ATOM   5625  C  CD    . ARG B  1 233 ? 67.469  70.410  -96.567  1.00 55.89  ? 339 ARG B CD    1 
ATOM   5626  N  NE    . ARG B  1 233 ? 67.164  70.482  -97.981  1.00 59.32  ? 339 ARG B NE    1 
ATOM   5627  C  CZ    . ARG B  1 233 ? 66.905  69.436  -98.761  1.00 63.65  ? 339 ARG B CZ    1 
ATOM   5628  N  NH1   . ARG B  1 233 ? 66.863  68.195  -98.278  1.00 63.07  ? 339 ARG B NH1   1 
ATOM   5629  N  NH2   . ARG B  1 233 ? 66.669  69.632  -100.057 1.00 70.35  ? 339 ARG B NH2   1 
ATOM   5630  N  N     . VAL B  1 234 ? 72.234  70.151  -96.603  1.00 46.86  ? 340 VAL B N     1 
ATOM   5631  C  CA    . VAL B  1 234 ? 73.230  70.921  -97.353  1.00 47.32  ? 340 VAL B CA    1 
ATOM   5632  C  C     . VAL B  1 234 ? 72.527  71.867  -98.311  1.00 47.83  ? 340 VAL B C     1 
ATOM   5633  O  O     . VAL B  1 234 ? 71.661  71.434  -99.035  1.00 46.01  ? 340 VAL B O     1 
ATOM   5634  C  CB    . VAL B  1 234 ? 74.171  70.004  -98.145  1.00 47.83  ? 340 VAL B CB    1 
ATOM   5635  C  CG1   . VAL B  1 234 ? 75.215  70.800  -98.895  1.00 48.75  ? 340 VAL B CG1   1 
ATOM   5636  C  CG2   . VAL B  1 234 ? 74.871  69.045  -97.206  1.00 46.88  ? 340 VAL B CG2   1 
ATOM   5637  N  N     . CYS B  1 235 ? 72.909  73.142  -98.290  1.00 49.68  ? 341 CYS B N     1 
ATOM   5638  C  CA    . CYS B  1 235 ? 72.376  74.177  -99.185  1.00 52.97  ? 341 CYS B CA    1 
ATOM   5639  C  C     . CYS B  1 235 ? 73.501  74.991  -99.747  1.00 55.27  ? 341 CYS B C     1 
ATOM   5640  O  O     . CYS B  1 235 ? 74.599  74.966  -99.209  1.00 55.38  ? 341 CYS B O     1 
ATOM   5641  C  CB    . CYS B  1 235 ? 71.491  75.151  -98.442  1.00 53.52  ? 341 CYS B CB    1 
ATOM   5642  S  SG    . CYS B  1 235 ? 70.191  74.375  -97.464  1.00 55.45  ? 341 CYS B SG    1 
ATOM   5643  N  N     . GLU B  1 236 ? 73.222  75.741  -100.813 1.00 58.65  ? 342 GLU B N     1 
ATOM   5644  C  CA    . GLU B  1 236 ? 74.228  76.619  -101.387 1.00 63.43  ? 342 GLU B CA    1 
ATOM   5645  C  C     . GLU B  1 236 ? 74.296  77.893  -100.575 1.00 63.94  ? 342 GLU B C     1 
ATOM   5646  O  O     . GLU B  1 236 ? 73.257  78.470  -100.263 1.00 66.51  ? 342 GLU B O     1 
ATOM   5647  C  CB    . GLU B  1 236 ? 73.899  76.930  -102.849 1.00 69.22  ? 342 GLU B CB    1 
ATOM   5648  C  CG    . GLU B  1 236 ? 75.032  77.677  -103.578 1.00 74.60  ? 342 GLU B CG    1 
ATOM   5649  C  CD    . GLU B  1 236 ? 74.922  77.712  -105.084 1.00 78.72  ? 342 GLU B CD    1 
ATOM   5650  O  OE1   . GLU B  1 236 ? 74.196  76.861  -105.650 1.00 82.71  ? 342 GLU B OE1   1 
ATOM   5651  O  OE2   . GLU B  1 236 ? 75.589  78.598  -105.673 1.00 85.13  ? 342 GLU B OE2   1 
ATOM   5652  N  N     . VAL B  1 237 ? 75.510  78.304  -100.206 1.00 66.26  ? 343 VAL B N     1 
ATOM   5653  C  CA    . VAL B  1 237 ? 75.754  79.571  -99.508  1.00 70.26  ? 343 VAL B CA    1 
ATOM   5654  C  C     . VAL B  1 237 ? 77.033  80.183  -100.080 1.00 75.54  ? 343 VAL B C     1 
ATOM   5655  O  O     . VAL B  1 237 ? 78.112  79.607  -99.922  1.00 77.59  ? 343 VAL B O     1 
ATOM   5656  C  CB    . VAL B  1 237 ? 75.949  79.387  -97.989  1.00 69.32  ? 343 VAL B CB    1 
ATOM   5657  C  CG1   . VAL B  1 237 ? 75.873  80.722  -97.271  1.00 70.62  ? 343 VAL B CG1   1 
ATOM   5658  C  CG2   . VAL B  1 237 ? 74.903  78.455  -97.404  1.00 68.86  ? 343 VAL B CG2   1 
ATOM   5659  N  N     . ASP B  1 238 ? 76.921  81.341  -100.737 1.00 80.41  ? 344 ASP B N     1 
ATOM   5660  C  CA    . ASP B  1 238 ? 78.066  82.036  -101.339 1.00 82.17  ? 344 ASP B CA    1 
ATOM   5661  C  C     . ASP B  1 238 ? 78.896  81.093  -102.209 1.00 80.84  ? 344 ASP B C     1 
ATOM   5662  O  O     . ASP B  1 238 ? 80.081  80.861  -101.928 1.00 76.73  ? 344 ASP B O     1 
ATOM   5663  C  CB    . ASP B  1 238 ? 78.958  82.683  -100.257 1.00 87.83  ? 344 ASP B CB    1 
ATOM   5664  C  CG    . ASP B  1 238 ? 78.223  83.707  -99.401  1.00 95.33  ? 344 ASP B CG    1 
ATOM   5665  O  OD1   . ASP B  1 238 ? 77.154  84.210  -99.815  1.00 99.54  ? 344 ASP B OD1   1 
ATOM   5666  O  OD2   . ASP B  1 238 ? 78.739  84.003  -98.299  1.00 98.69  ? 344 ASP B OD2   1 
ATOM   5667  N  N     . ASN B  1 239 ? 78.246  80.517  -103.222 1.00 81.64  ? 345 ASN B N     1 
ATOM   5668  C  CA    . ASN B  1 239 ? 78.923  79.678  -104.251 1.00 82.72  ? 345 ASN B CA    1 
ATOM   5669  C  C     . ASN B  1 239 ? 79.637  78.434  -103.708 1.00 80.49  ? 345 ASN B C     1 
ATOM   5670  O  O     . ASN B  1 239 ? 80.608  77.955  -104.286 1.00 79.49  ? 345 ASN B O     1 
ATOM   5671  C  CB    . ASN B  1 239 ? 79.897  80.527  -105.090 1.00 84.25  ? 345 ASN B CB    1 
ATOM   5672  C  CG    . ASN B  1 239 ? 79.233  81.755  -105.696 1.00 88.15  ? 345 ASN B CG    1 
ATOM   5673  O  OD1   . ASN B  1 239 ? 78.098  81.690  -106.170 1.00 91.97  ? 345 ASN B OD1   1 
ATOM   5674  N  ND2   . ASN B  1 239 ? 79.940  82.879  -105.700 1.00 90.48  ? 345 ASN B ND2   1 
ATOM   5675  N  N     . GLU B  1 240 ? 79.100  77.906  -102.612 1.00 77.63  ? 346 GLU B N     1 
ATOM   5676  C  CA    . GLU B  1 240 ? 79.742  76.841  -101.826 1.00 72.53  ? 346 GLU B CA    1 
ATOM   5677  C  C     . GLU B  1 240 ? 78.644  76.031  -101.134 1.00 65.52  ? 346 GLU B C     1 
ATOM   5678  O  O     . GLU B  1 240 ? 77.691  76.622  -100.612 1.00 68.37  ? 346 GLU B O     1 
ATOM   5679  C  CB    . GLU B  1 240 ? 80.663  77.497  -100.797 1.00 73.98  ? 346 GLU B CB    1 
ATOM   5680  C  CG    . GLU B  1 240 ? 81.559  76.557  -100.024 1.00 75.71  ? 346 GLU B CG    1 
ATOM   5681  C  CD    . GLU B  1 240 ? 82.512  77.293  -99.081  1.00 76.31  ? 346 GLU B CD    1 
ATOM   5682  O  OE1   . GLU B  1 240 ? 82.236  78.444  -98.635  1.00 78.55  ? 346 GLU B OE1   1 
ATOM   5683  O  OE2   . GLU B  1 240 ? 83.497  76.724  -98.648  1.00 74.04  ? 346 GLU B OE2   1 
ATOM   5684  N  N     . LEU B  1 241 ? 78.761  74.693  -101.146 1.00 59.97  ? 347 LEU B N     1 
ATOM   5685  C  CA    . LEU B  1 241 ? 77.729  73.841  -100.506 1.00 58.11  ? 347 LEU B CA    1 
ATOM   5686  C  C     . LEU B  1 241 ? 78.028  73.544  -99.026  1.00 56.16  ? 347 LEU B C     1 
ATOM   5687  O  O     . LEU B  1 241 ? 78.932  72.769  -98.732  1.00 56.55  ? 347 LEU B O     1 
ATOM   5688  C  CB    . LEU B  1 241 ? 77.598  72.520  -101.259 1.00 57.42  ? 347 LEU B CB    1 
ATOM   5689  C  CG    . LEU B  1 241 ? 76.880  72.531  -102.598 1.00 58.19  ? 347 LEU B CG    1 
ATOM   5690  C  CD1   . LEU B  1 241 ? 77.023  71.153  -103.238 1.00 59.31  ? 347 LEU B CD1   1 
ATOM   5691  C  CD2   . LEU B  1 241 ? 75.421  72.943  -102.480 1.00 57.14  ? 347 LEU B CD2   1 
ATOM   5692  N  N     . ARG B  1 242 ? 77.249  74.126  -98.110  1.00 54.71  ? 348 ARG B N     1 
ATOM   5693  C  CA    . ARG B  1 242 ? 77.470  73.988  -96.663  1.00 55.54  ? 348 ARG B CA    1 
ATOM   5694  C  C     . ARG B  1 242 ? 76.313  73.325  -95.941  1.00 52.37  ? 348 ARG B C     1 
ATOM   5695  O  O     . ARG B  1 242 ? 75.206  73.256  -96.458  1.00 53.90  ? 348 ARG B O     1 
ATOM   5696  C  CB    . ARG B  1 242 ? 77.660  75.365  -96.045  1.00 60.13  ? 348 ARG B CB    1 
ATOM   5697  C  CG    . ARG B  1 242 ? 78.836  76.128  -96.623  1.00 64.70  ? 348 ARG B CG    1 
ATOM   5698  C  CD    . ARG B  1 242 ? 78.911  77.486  -95.966  1.00 69.22  ? 348 ARG B CD    1 
ATOM   5699  N  NE    . ARG B  1 242 ? 79.888  78.322  -96.652  1.00 76.93  ? 348 ARG B NE    1 
ATOM   5700  C  CZ    . ARG B  1 242 ? 79.953  79.645  -96.582  1.00 85.42  ? 348 ARG B CZ    1 
ATOM   5701  N  NH1   . ARG B  1 242 ? 79.075  80.348  -95.859  1.00 85.41  ? 348 ARG B NH1   1 
ATOM   5702  N  NH2   . ARG B  1 242 ? 80.898  80.267  -97.286  1.00 91.73  ? 348 ARG B NH2   1 
ATOM   5703  N  N     . ILE B  1 243 ? 76.580  72.838  -94.735  1.00 48.27  ? 349 ILE B N     1 
ATOM   5704  C  CA    . ILE B  1 243 ? 75.551  72.268  -93.875  1.00 45.36  ? 349 ILE B CA    1 
ATOM   5705  C  C     . ILE B  1 243 ? 74.742  73.395  -93.268  1.00 46.73  ? 349 ILE B C     1 
ATOM   5706  O  O     . ILE B  1 243 ? 75.297  74.401  -92.821  1.00 50.82  ? 349 ILE B O     1 
ATOM   5707  C  CB    . ILE B  1 243 ? 76.144  71.375  -92.760  1.00 42.33  ? 349 ILE B CB    1 
ATOM   5708  C  CG1   . ILE B  1 243 ? 76.880  70.183  -93.372  1.00 41.15  ? 349 ILE B CG1   1 
ATOM   5709  C  CG2   . ILE B  1 243 ? 75.046  70.847  -91.849  1.00 41.62  ? 349 ILE B CG2   1 
ATOM   5710  C  CD1   . ILE B  1 243 ? 77.613  69.304  -92.398  1.00 40.83  ? 349 ILE B CD1   1 
ATOM   5711  N  N     . CYS B  1 244 ? 73.431  73.205  -93.254  1.00 47.20  ? 350 CYS B N     1 
ATOM   5712  C  CA    . CYS B  1 244 ? 72.486  74.153  -92.677  1.00 47.75  ? 350 CYS B CA    1 
ATOM   5713  C  C     . CYS B  1 244 ? 71.549  73.434  -91.727  1.00 46.09  ? 350 CYS B C     1 
ATOM   5714  O  O     . CYS B  1 244 ? 71.209  72.282  -91.954  1.00 43.01  ? 350 CYS B O     1 
ATOM   5715  C  CB    . CYS B  1 244 ? 71.646  74.784  -93.786  1.00 49.03  ? 350 CYS B CB    1 
ATOM   5716  S  SG    . CYS B  1 244 ? 72.609  75.685  -94.988  1.00 49.69  ? 350 CYS B SG    1 
ATOM   5717  N  N     . ALA B  1 245 ? 71.117  74.130  -90.693  1.00 47.16  ? 351 ALA B N     1 
ATOM   5718  C  CA    . ALA B  1 245 ? 70.157  73.610  -89.730  1.00 48.87  ? 351 ALA B CA    1 
ATOM   5719  C  C     . ALA B  1 245 ? 68.796  74.195  -90.017  1.00 48.81  ? 351 ALA B C     1 
ATOM   5720  O  O     . ALA B  1 245 ? 68.695  75.204  -90.679  1.00 49.94  ? 351 ALA B O     1 
ATOM   5721  C  CB    . ALA B  1 245 ? 70.576  73.971  -88.324  1.00 49.37  ? 351 ALA B CB    1 
ATOM   5722  N  N     . ARG B  1 246 ? 67.744  73.571  -89.511  1.00 48.27  ? 352 ARG B N     1 
ATOM   5723  C  CA    . ARG B  1 246 ? 66.440  74.119  -89.730  1.00 49.70  ? 352 ARG B CA    1 
ATOM   5724  C  C     . ARG B  1 246 ? 66.208  75.354  -88.843  1.00 48.05  ? 352 ARG B C     1 
ATOM   5725  O  O     . ARG B  1 246 ? 66.768  75.452  -87.772  1.00 43.82  ? 352 ARG B O     1 
ATOM   5726  C  CB    . ARG B  1 246 ? 65.355  73.061  -89.570  1.00 51.99  ? 352 ARG B CB    1 
ATOM   5727  C  CG    . ARG B  1 246 ? 64.067  73.603  -90.120  1.00 55.81  ? 352 ARG B CG    1 
ATOM   5728  C  CD    . ARG B  1 246 ? 63.023  72.613  -90.482  1.00 57.23  ? 352 ARG B CD    1 
ATOM   5729  N  NE    . ARG B  1 246 ? 61.796  73.377  -90.302  1.00 59.71  ? 352 ARG B NE    1 
ATOM   5730  C  CZ    . ARG B  1 246 ? 60.627  72.853  -90.008  1.00 66.13  ? 352 ARG B CZ    1 
ATOM   5731  N  NH1   . ARG B  1 246 ? 60.475  71.534  -89.881  1.00 69.49  ? 352 ARG B NH1   1 
ATOM   5732  N  NH2   . ARG B  1 246 ? 59.590  73.652  -89.848  1.00 71.60  ? 352 ARG B NH2   1 
ATOM   5733  N  N     . ASP B  1 247 ? 65.408  76.302  -89.340  1.00 49.10  ? 353 ASP B N     1 
ATOM   5734  C  CA    . ASP B  1 247 ? 65.051  77.541  -88.620  1.00 47.82  ? 353 ASP B CA    1 
ATOM   5735  C  C     . ASP B  1 247 ? 64.683  77.328  -87.155  1.00 47.48  ? 353 ASP B C     1 
ATOM   5736  O  O     . ASP B  1 247 ? 65.154  78.060  -86.285  1.00 48.22  ? 353 ASP B O     1 
ATOM   5737  C  CB    . ASP B  1 247 ? 63.952  78.378  -89.366  1.00 45.51  ? 353 ASP B CB    1 
ATOM   5738  C  CG    . ASP B  1 247 ? 62.684  77.558  -89.773  1.00 43.97  ? 353 ASP B CG    1 
ATOM   5739  O  OD1   . ASP B  1 247 ? 62.593  76.336  -89.529  1.00 41.12  ? 353 ASP B OD1   1 
ATOM   5740  O  OD2   . ASP B  1 247 ? 61.752  78.134  -90.356  1.00 43.90  ? 353 ASP B OD2   1 
ATOM   5741  N  N     . LYS B  1 248 ? 63.875  76.308  -86.879  1.00 46.29  ? 354 LYS B N     1 
ATOM   5742  C  CA    . LYS B  1 248 ? 63.427  76.047  -85.514  1.00 44.77  ? 354 LYS B CA    1 
ATOM   5743  C  C     . LYS B  1 248 ? 64.554  75.615  -84.551  1.00 42.10  ? 354 LYS B C     1 
ATOM   5744  O  O     . LYS B  1 248 ? 64.481  75.875  -83.346  1.00 41.34  ? 354 LYS B O     1 
ATOM   5745  C  CB    . LYS B  1 248 ? 62.280  75.030  -85.521  1.00 45.95  ? 354 LYS B CB    1 
ATOM   5746  C  CG    . LYS B  1 248 ? 62.709  73.606  -85.801  1.00 47.62  ? 354 LYS B CG    1 
ATOM   5747  C  CD    . LYS B  1 248 ? 61.549  72.685  -86.173  1.00 49.05  ? 354 LYS B CD    1 
ATOM   5748  C  CE    . LYS B  1 248 ? 62.099  71.284  -86.478  1.00 50.13  ? 354 LYS B CE    1 
ATOM   5749  N  NZ    . LYS B  1 248 ? 61.005  70.316  -86.783  1.00 50.19  ? 354 LYS B NZ    1 
ATOM   5750  N  N     . GLU B  1 249 ? 65.606  74.993  -85.068  1.00 39.74  ? 355 GLU B N     1 
ATOM   5751  C  CA    . GLU B  1 249 ? 66.724  74.599  -84.215  1.00 39.24  ? 355 GLU B CA    1 
ATOM   5752  C  C     . GLU B  1 249 ? 67.597  75.734  -83.679  1.00 36.88  ? 355 GLU B C     1 
ATOM   5753  O  O     . GLU B  1 249 ? 68.480  75.473  -82.864  1.00 35.88  ? 355 GLU B O     1 
ATOM   5754  C  CB    . GLU B  1 249 ? 67.638  73.607  -84.962  1.00 42.06  ? 355 GLU B CB    1 
ATOM   5755  C  CG    . GLU B  1 249 ? 67.062  72.218  -85.182  1.00 43.75  ? 355 GLU B CG    1 
ATOM   5756  C  CD    . GLU B  1 249 ? 66.670  71.520  -83.885  1.00 44.05  ? 355 GLU B CD    1 
ATOM   5757  O  OE1   . GLU B  1 249 ? 67.544  70.823  -83.274  1.00 43.08  ? 355 GLU B OE1   1 
ATOM   5758  O  OE2   . GLU B  1 249 ? 65.460  71.671  -83.514  1.00 44.56  ? 355 GLU B OE2   1 
ATOM   5759  N  N     . VAL B  1 250 ? 67.399  76.969  -84.117  1.00 35.61  ? 356 VAL B N     1 
ATOM   5760  C  CA    . VAL B  1 250 ? 68.282  78.070  -83.699  1.00 35.28  ? 356 VAL B CA    1 
ATOM   5761  C  C     . VAL B  1 250 ? 68.393  78.139  -82.180  1.00 33.34  ? 356 VAL B C     1 
ATOM   5762  O  O     . VAL B  1 250 ? 69.477  78.336  -81.654  1.00 32.08  ? 356 VAL B O     1 
ATOM   5763  C  CB    . VAL B  1 250 ? 67.868  79.432  -84.305  1.00 36.58  ? 356 VAL B CB    1 
ATOM   5764  C  CG1   . VAL B  1 250 ? 66.537  79.905  -83.739  1.00 38.59  ? 356 VAL B CG1   1 
ATOM   5765  C  CG2   . VAL B  1 250 ? 68.959  80.487  -84.108  1.00 36.36  ? 356 VAL B CG2   1 
ATOM   5766  N  N     . GLY B  1 251 ? 67.288  77.936  -81.485  1.00 33.41  ? 357 GLY B N     1 
ATOM   5767  C  CA    . GLY B  1 251 ? 67.295  77.932  -80.029  1.00 34.33  ? 357 GLY B CA    1 
ATOM   5768  C  C     . GLY B  1 251 ? 68.185  76.847  -79.448  1.00 34.49  ? 357 GLY B C     1 
ATOM   5769  O  O     . GLY B  1 251 ? 69.010  77.106  -78.569  1.00 33.91  ? 357 GLY B O     1 
ATOM   5770  N  N     . ASN B  1 252 ? 68.020  75.626  -79.966  1.00 34.40  ? 358 ASN B N     1 
ATOM   5771  C  CA    . ASN B  1 252 ? 68.821  74.491  -79.514  1.00 33.24  ? 358 ASN B CA    1 
ATOM   5772  C  C     . ASN B  1 252 ? 70.307  74.658  -79.784  1.00 32.48  ? 358 ASN B C     1 
ATOM   5773  O  O     . ASN B  1 252 ? 71.119  74.102  -79.056  1.00 31.39  ? 358 ASN B O     1 
ATOM   5774  C  CB    . ASN B  1 252 ? 68.320  73.194  -80.172  1.00 33.33  ? 358 ASN B CB    1 
ATOM   5775  C  CG    . ASN B  1 252 ? 66.994  72.722  -79.630  1.00 33.39  ? 358 ASN B CG    1 
ATOM   5776  O  OD1   . ASN B  1 252 ? 66.635  72.999  -78.473  1.00 34.97  ? 358 ASN B OD1   1 
ATOM   5777  N  ND2   . ASN B  1 252 ? 66.271  71.986  -80.447  1.00 32.55  ? 358 ASN B ND2   1 
ATOM   5778  N  N     . LEU B  1 253 ? 70.649  75.403  -80.825  1.00 32.82  ? 359 LEU B N     1 
ATOM   5779  C  CA    . LEU B  1 253 ? 72.039  75.711  -81.116  1.00 33.85  ? 359 LEU B CA    1 
ATOM   5780  C  C     . LEU B  1 253 ? 72.641  76.705  -80.145  1.00 33.15  ? 359 LEU B C     1 
ATOM   5781  O  O     . LEU B  1 253 ? 73.779  76.526  -79.744  1.00 32.83  ? 359 LEU B O     1 
ATOM   5782  C  CB    . LEU B  1 253 ? 72.210  76.189  -82.556  1.00 35.32  ? 359 LEU B CB    1 
ATOM   5783  C  CG    . LEU B  1 253 ? 72.060  75.109  -83.618  1.00 36.18  ? 359 LEU B CG    1 
ATOM   5784  C  CD1   . LEU B  1 253 ? 72.220  75.731  -84.992  1.00 37.27  ? 359 LEU B CD1   1 
ATOM   5785  C  CD2   . LEU B  1 253 ? 73.103  74.015  -83.415  1.00 36.26  ? 359 LEU B CD2   1 
ATOM   5786  N  N     . TYR B  1 254 ? 71.901  77.735  -79.747  1.00 33.25  ? 360 TYR B N     1 
ATOM   5787  C  CA    . TYR B  1 254 ? 72.397  78.616  -78.682  1.00 33.48  ? 360 TYR B CA    1 
ATOM   5788  C  C     . TYR B  1 254 ? 72.597  77.805  -77.405  1.00 34.95  ? 360 TYR B C     1 
ATOM   5789  O  O     . TYR B  1 254 ? 73.568  78.033  -76.681  1.00 35.13  ? 360 TYR B O     1 
ATOM   5790  C  CB    . TYR B  1 254 ? 71.485  79.823  -78.403  1.00 32.43  ? 360 TYR B CB    1 
ATOM   5791  C  CG    . TYR B  1 254 ? 71.673  81.009  -79.326  1.00 31.60  ? 360 TYR B CG    1 
ATOM   5792  C  CD1   . TYR B  1 254 ? 72.683  81.940  -79.124  1.00 31.51  ? 360 TYR B CD1   1 
ATOM   5793  C  CD2   . TYR B  1 254 ? 70.817  81.211  -80.389  1.00 31.74  ? 360 TYR B CD2   1 
ATOM   5794  C  CE1   . TYR B  1 254 ? 72.846  83.029  -79.978  1.00 32.36  ? 360 TYR B CE1   1 
ATOM   5795  C  CE2   . TYR B  1 254 ? 70.968  82.295  -81.245  1.00 32.20  ? 360 TYR B CE2   1 
ATOM   5796  C  CZ    . TYR B  1 254 ? 71.983  83.201  -81.044  1.00 32.59  ? 360 TYR B CZ    1 
ATOM   5797  O  OH    . TYR B  1 254 ? 72.120  84.261  -81.929  1.00 34.11  ? 360 TYR B OH    1 
ATOM   5798  N  N     . ASP B  1 255 ? 71.687  76.869  -77.139  1.00 36.78  ? 361 ASP B N     1 
ATOM   5799  C  CA    . ASP B  1 255 ? 71.761  76.009  -75.949  1.00 37.97  ? 361 ASP B CA    1 
ATOM   5800  C  C     . ASP B  1 255 ? 72.919  75.019  -76.031  1.00 38.54  ? 361 ASP B C     1 
ATOM   5801  O  O     . ASP B  1 255 ? 73.428  74.583  -75.005  1.00 39.64  ? 361 ASP B O     1 
ATOM   5802  C  CB    . ASP B  1 255 ? 70.436  75.258  -75.686  1.00 38.84  ? 361 ASP B CB    1 
ATOM   5803  C  CG    . ASP B  1 255 ? 69.338  76.138  -75.003  1.00 38.92  ? 361 ASP B CG    1 
ATOM   5804  O  OD1   . ASP B  1 255 ? 69.448  77.375  -74.884  1.00 40.65  ? 361 ASP B OD1   1 
ATOM   5805  O  OD2   . ASP B  1 255 ? 68.240  75.631  -74.799  1.00 37.36  ? 361 ASP B OD2   1 
ATOM   5806  N  N     . MET B  1 256 ? 73.333  74.648  -77.234  1.00 38.72  ? 362 MET B N     1 
ATOM   5807  C  CA    . MET B  1 256 ? 74.524  73.810  -77.401  1.00 38.14  ? 362 MET B CA    1 
ATOM   5808  C  C     . MET B  1 256 ? 75.751  74.513  -76.841  1.00 36.55  ? 362 MET B C     1 
ATOM   5809  O  O     . MET B  1 256 ? 76.526  73.906  -76.099  1.00 34.88  ? 362 MET B O     1 
ATOM   5810  C  CB    . MET B  1 256 ? 74.769  73.434  -78.869  1.00 39.21  ? 362 MET B CB    1 
ATOM   5811  C  CG    . MET B  1 256 ? 75.751  72.284  -79.039  1.00 38.82  ? 362 MET B CG    1 
ATOM   5812  S  SD    . MET B  1 256 ? 76.461  72.159  -80.688  1.00 38.73  ? 362 MET B SD    1 
ATOM   5813  C  CE    . MET B  1 256 ? 77.857  73.297  -80.520  1.00 38.94  ? 362 MET B CE    1 
ATOM   5814  N  N     . PHE B  1 257 ? 75.929  75.781  -77.187  1.00 36.76  ? 363 PHE B N     1 
ATOM   5815  C  CA    . PHE B  1 257 ? 77.093  76.520  -76.714  1.00 38.32  ? 363 PHE B CA    1 
ATOM   5816  C  C     . PHE B  1 257 ? 76.973  76.884  -75.248  1.00 39.95  ? 363 PHE B C     1 
ATOM   5817  O  O     . PHE B  1 257 ? 77.992  77.022  -74.572  1.00 44.59  ? 363 PHE B O     1 
ATOM   5818  C  CB    . PHE B  1 257 ? 77.403  77.751  -77.570  1.00 39.09  ? 363 PHE B CB    1 
ATOM   5819  C  CG    . PHE B  1 257 ? 77.810  77.425  -78.979  1.00 39.22  ? 363 PHE B CG    1 
ATOM   5820  C  CD1   . PHE B  1 257 ? 76.829  77.311  -79.925  1.00 40.18  ? 363 PHE B CD1   1 
ATOM   5821  C  CD2   . PHE B  1 257 ? 79.128  77.223  -79.343  1.00 39.19  ? 363 PHE B CD2   1 
ATOM   5822  C  CE1   . PHE B  1 257 ? 77.157  77.003  -81.263  1.00 41.59  ? 363 PHE B CE1   1 
ATOM   5823  C  CE2   . PHE B  1 257 ? 79.461  76.900  -80.615  1.00 41.49  ? 363 PHE B CE2   1 
ATOM   5824  C  CZ    . PHE B  1 257 ? 78.519  76.798  -81.591  1.00 42.12  ? 363 PHE B CZ    1 
ATOM   5825  N  N     . HIS B  1 258 ? 75.742  77.036  -74.758  1.00 39.76  ? 364 HIS B N     1 
ATOM   5826  C  CA    . HIS B  1 258 ? 75.484  77.206  -73.327  1.00 39.53  ? 364 HIS B CA    1 
ATOM   5827  C  C     . HIS B  1 258 ? 75.926  75.963  -72.569  1.00 37.64  ? 364 HIS B C     1 
ATOM   5828  O  O     . HIS B  1 258 ? 76.654  76.062  -71.583  1.00 39.26  ? 364 HIS B O     1 
ATOM   5829  C  CB    . HIS B  1 258 ? 73.988  77.479  -73.071  1.00 40.53  ? 364 HIS B CB    1 
ATOM   5830  C  CG    . HIS B  1 258 ? 73.653  77.736  -71.628  1.00 39.91  ? 364 HIS B CG    1 
ATOM   5831  N  ND1   . HIS B  1 258 ? 73.643  79.005  -71.056  1.00 40.13  ? 364 HIS B ND1   1 
ATOM   5832  C  CD2   . HIS B  1 258 ? 73.342  76.874  -70.633  1.00 39.06  ? 364 HIS B CD2   1 
ATOM   5833  C  CE1   . HIS B  1 258 ? 73.365  78.895  -69.779  1.00 40.59  ? 364 HIS B CE1   1 
ATOM   5834  N  NE2   . HIS B  1 258 ? 73.170  77.619  -69.497  1.00 41.16  ? 364 HIS B NE2   1 
ATOM   5835  N  N     . THR B  1 259 ? 75.474  74.808  -73.028  1.00 35.34  ? 365 THR B N     1 
ATOM   5836  C  CA    . THR B  1 259 ? 75.875  73.515  -72.473  1.00 34.66  ? 365 THR B CA    1 
ATOM   5837  C  C     . THR B  1 259 ? 77.393  73.401  -72.395  1.00 33.81  ? 365 THR B C     1 
ATOM   5838  O  O     . THR B  1 259 ? 77.931  72.961  -71.384  1.00 33.01  ? 365 THR B O     1 
ATOM   5839  C  CB    . THR B  1 259 ? 75.278  72.345  -73.302  1.00 35.05  ? 365 THR B CB    1 
ATOM   5840  O  OG1   . THR B  1 259 ? 73.864  72.247  -73.078  1.00 37.29  ? 365 THR B OG1   1 
ATOM   5841  C  CG2   . THR B  1 259 ? 75.905  71.004  -72.930  1.00 34.49  ? 365 THR B CG2   1 
ATOM   5842  N  N     . ARG B  1 260 ? 78.069  73.797  -73.469  1.00 33.23  ? 366 ARG B N     1 
ATOM   5843  C  CA    . ARG B  1 260 ? 79.535  73.766  -73.525  1.00 32.56  ? 366 ARG B CA    1 
ATOM   5844  C  C     . ARG B  1 260 ? 80.138  74.617  -72.422  1.00 32.42  ? 366 ARG B C     1 
ATOM   5845  O  O     . ARG B  1 260 ? 80.997  74.160  -71.667  1.00 32.17  ? 366 ARG B O     1 
ATOM   5846  C  CB    . ARG B  1 260 ? 80.038  74.285  -74.865  1.00 33.03  ? 366 ARG B CB    1 
ATOM   5847  C  CG    . ARG B  1 260 ? 81.538  74.169  -75.019  1.00 33.56  ? 366 ARG B CG    1 
ATOM   5848  C  CD    . ARG B  1 260 ? 81.924  74.240  -76.500  1.00 34.97  ? 366 ARG B CD    1 
ATOM   5849  N  NE    . ARG B  1 260 ? 83.348  74.503  -76.643  1.00 36.83  ? 366 ARG B NE    1 
ATOM   5850  C  CZ    . ARG B  1 260 ? 83.933  75.672  -76.392  1.00 39.32  ? 366 ARG B CZ    1 
ATOM   5851  N  NH1   . ARG B  1 260 ? 83.196  76.745  -76.071  1.00 41.71  ? 366 ARG B NH1   1 
ATOM   5852  N  NH2   . ARG B  1 260 ? 85.237  75.777  -76.471  1.00 40.32  ? 366 ARG B NH2   1 
ATOM   5853  N  N     . ASN B  1 261 ? 79.687  75.864  -72.362  1.00 32.59  ? 367 ASN B N     1 
ATOM   5854  C  CA    . ASN B  1 261 ? 80.190  76.832  -71.402  1.00 33.25  ? 367 ASN B CA    1 
ATOM   5855  C  C     . ASN B  1 261 ? 79.901  76.353  -69.987  1.00 33.37  ? 367 ASN B C     1 
ATOM   5856  O  O     . ASN B  1 261 ? 80.715  76.494  -69.081  1.00 33.08  ? 367 ASN B O     1 
ATOM   5857  C  CB    . ASN B  1 261 ? 79.537  78.195  -71.634  1.00 33.61  ? 367 ASN B CB    1 
ATOM   5858  C  CG    . ASN B  1 261 ? 80.099  79.258  -70.734  1.00 34.61  ? 367 ASN B CG    1 
ATOM   5859  O  OD1   . ASN B  1 261 ? 81.287  79.586  -70.809  1.00 37.23  ? 367 ASN B OD1   1 
ATOM   5860  N  ND2   . ASN B  1 261 ? 79.268  79.796  -69.867  1.00 34.70  ? 367 ASN B ND2   1 
ATOM   5861  N  N     . SER B  1 262 ? 78.739  75.759  -69.819  1.00 33.79  ? 368 SER B N     1 
ATOM   5862  C  CA    . SER B  1 262 ? 78.321  75.218  -68.541  1.00 33.46  ? 368 SER B CA    1 
ATOM   5863  C  C     . SER B  1 262 ? 79.203  74.047  -68.084  1.00 32.03  ? 368 SER B C     1 
ATOM   5864  O  O     . SER B  1 262 ? 79.583  73.979  -66.919  1.00 32.91  ? 368 SER B O     1 
ATOM   5865  C  CB    . SER B  1 262 ? 76.847  74.825  -68.648  1.00 34.22  ? 368 SER B CB    1 
ATOM   5866  O  OG    . SER B  1 262 ? 76.326  74.479  -67.401  1.00 36.48  ? 368 SER B OG    1 
ATOM   5867  N  N     . LEU B  1 263 ? 79.552  73.146  -68.995  1.00 30.65  ? 369 LEU B N     1 
ATOM   5868  C  CA    . LEU B  1 263 ? 80.515  72.057  -68.698  1.00 29.73  ? 369 LEU B CA    1 
ATOM   5869  C  C     . LEU B  1 263 ? 81.905  72.558  -68.346  1.00 31.15  ? 369 LEU B C     1 
ATOM   5870  O  O     . LEU B  1 263 ? 82.596  71.957  -67.528  1.00 31.79  ? 369 LEU B O     1 
ATOM   5871  C  CB    . LEU B  1 263 ? 80.627  71.078  -69.868  1.00 28.05  ? 369 LEU B CB    1 
ATOM   5872  C  CG    . LEU B  1 263 ? 79.450  70.156  -70.036  1.00 27.39  ? 369 LEU B CG    1 
ATOM   5873  C  CD1   . LEU B  1 263 ? 79.534  69.433  -71.361  1.00 27.25  ? 369 LEU B CD1   1 
ATOM   5874  C  CD2   . LEU B  1 263 ? 79.386  69.155  -68.898  1.00 27.07  ? 369 LEU B CD2   1 
ATOM   5875  N  N     . HIS B  1 264 ? 82.317  73.644  -68.981  1.00 33.21  ? 370 HIS B N     1 
ATOM   5876  C  CA    . HIS B  1 264 ? 83.583  74.277  -68.637  1.00 34.73  ? 370 HIS B CA    1 
ATOM   5877  C  C     . HIS B  1 264 ? 83.544  74.868  -67.241  1.00 36.01  ? 370 HIS B C     1 
ATOM   5878  O  O     . HIS B  1 264 ? 84.503  74.708  -66.482  1.00 36.20  ? 370 HIS B O     1 
ATOM   5879  C  CB    . HIS B  1 264 ? 83.993  75.333  -69.662  1.00 34.83  ? 370 HIS B CB    1 
ATOM   5880  C  CG    . HIS B  1 264 ? 84.791  74.773  -70.780  1.00 35.01  ? 370 HIS B CG    1 
ATOM   5881  N  ND1   . HIS B  1 264 ? 86.142  74.537  -70.669  1.00 34.98  ? 370 HIS B ND1   1 
ATOM   5882  C  CD2   . HIS B  1 264 ? 84.426  74.343  -72.015  1.00 35.26  ? 370 HIS B CD2   1 
ATOM   5883  C  CE1   . HIS B  1 264 ? 86.580  74.001  -71.795  1.00 35.51  ? 370 HIS B CE1   1 
ATOM   5884  N  NE2   . HIS B  1 264 ? 85.561  73.874  -72.628  1.00 35.35  ? 370 HIS B NE2   1 
ATOM   5885  N  N     . ARG B  1 265 ? 82.441  75.530  -66.903  1.00 37.94  ? 371 ARG B N     1 
ATOM   5886  C  CA    . ARG B  1 265 ? 82.327  76.164  -65.603  1.00 40.89  ? 371 ARG B CA    1 
ATOM   5887  C  C     . ARG B  1 265 ? 82.285  75.143  -64.505  1.00 37.20  ? 371 ARG B C     1 
ATOM   5888  O  O     . ARG B  1 265 ? 83.024  75.259  -63.538  1.00 36.06  ? 371 ARG B O     1 
ATOM   5889  C  CB    . ARG B  1 265 ? 81.125  77.100  -65.518  1.00 46.84  ? 371 ARG B CB    1 
ATOM   5890  C  CG    . ARG B  1 265 ? 81.437  78.501  -66.042  1.00 54.16  ? 371 ARG B CG    1 
ATOM   5891  C  CD    . ARG B  1 265 ? 80.444  79.532  -65.563  1.00 64.00  ? 371 ARG B CD    1 
ATOM   5892  N  NE    . ARG B  1 265 ? 80.889  80.880  -65.920  1.00 72.69  ? 371 ARG B NE    1 
ATOM   5893  C  CZ    . ARG B  1 265 ? 81.612  81.708  -65.152  1.00 78.34  ? 371 ARG B CZ    1 
ATOM   5894  N  NH1   . ARG B  1 265 ? 82.045  81.359  -63.938  1.00 80.06  ? 371 ARG B NH1   1 
ATOM   5895  N  NH2   . ARG B  1 265 ? 81.897  82.909  -65.620  1.00 80.84  ? 371 ARG B NH2   1 
ATOM   5896  N  N     . ARG B  1 266 ? 81.462  74.122  -64.665  1.00 34.11  ? 372 ARG B N     1 
ATOM   5897  C  CA    . ARG B  1 266 ? 81.312  73.117  -63.617  1.00 33.38  ? 372 ARG B CA    1 
ATOM   5898  C  C     . ARG B  1 266 ? 82.494  72.166  -63.496  1.00 31.29  ? 372 ARG B C     1 
ATOM   5899  O  O     . ARG B  1 266 ? 82.941  71.882  -62.382  1.00 31.20  ? 372 ARG B O     1 
ATOM   5900  C  CB    . ARG B  1 266 ? 80.082  72.279  -63.869  1.00 34.71  ? 372 ARG B CB    1 
ATOM   5901  C  CG    . ARG B  1 266 ? 78.783  73.040  -63.789  1.00 36.05  ? 372 ARG B CG    1 
ATOM   5902  C  CD    . ARG B  1 266 ? 77.622  72.108  -64.110  1.00 36.52  ? 372 ARG B CD    1 
ATOM   5903  N  NE    . ARG B  1 266 ? 76.374  72.849  -64.239  1.00 38.14  ? 372 ARG B NE    1 
ATOM   5904  C  CZ    . ARG B  1 266 ? 75.250  72.369  -64.766  1.00 39.75  ? 372 ARG B CZ    1 
ATOM   5905  N  NH1   . ARG B  1 266 ? 75.193  71.119  -65.220  1.00 41.17  ? 372 ARG B NH1   1 
ATOM   5906  N  NH2   . ARG B  1 266 ? 74.174  73.149  -64.854  1.00 40.57  ? 372 ARG B NH2   1 
ATOM   5907  N  N     . ALA B  1 267 ? 82.984  71.667  -64.627  1.00 28.85  ? 373 ALA B N     1 
ATOM   5908  C  CA    . ALA B  1 267 ? 83.930  70.566  -64.623  1.00 27.18  ? 373 ALA B CA    1 
ATOM   5909  C  C     . ALA B  1 267 ? 85.299  70.909  -65.159  1.00 25.91  ? 373 ALA B C     1 
ATOM   5910  O  O     . ALA B  1 267 ? 86.286  70.828  -64.424  1.00 26.79  ? 373 ALA B O     1 
ATOM   5911  C  CB    . ALA B  1 267 ? 83.357  69.378  -65.386  1.00 26.87  ? 373 ALA B CB    1 
ATOM   5912  N  N     . TYR B  1 268 ? 85.383  71.282  -66.427  1.00 24.25  ? 374 TYR B N     1 
ATOM   5913  C  CA    . TYR B  1 268 ? 86.693  71.342  -67.085  1.00 23.90  ? 374 TYR B CA    1 
ATOM   5914  C  C     . TYR B  1 268 ? 87.594  72.404  -66.467  1.00 24.92  ? 374 TYR B C     1 
ATOM   5915  O  O     . TYR B  1 268 ? 88.795  72.158  -66.283  1.00 25.98  ? 374 TYR B O     1 
ATOM   5916  C  CB    . TYR B  1 268 ? 86.580  71.585  -68.585  1.00 23.23  ? 374 TYR B CB    1 
ATOM   5917  C  CG    . TYR B  1 268 ? 85.594  70.700  -69.328  1.00 22.45  ? 374 TYR B CG    1 
ATOM   5918  C  CD1   . TYR B  1 268 ? 85.501  69.338  -69.075  1.00 21.91  ? 374 TYR B CD1   1 
ATOM   5919  C  CD2   . TYR B  1 268 ? 84.760  71.231  -70.300  1.00 22.11  ? 374 TYR B CD2   1 
ATOM   5920  C  CE1   . TYR B  1 268 ? 84.602  68.542  -69.805  1.00 21.29  ? 374 TYR B CE1   1 
ATOM   5921  C  CE2   . TYR B  1 268 ? 83.862  70.437  -71.005  1.00 21.88  ? 374 TYR B CE2   1 
ATOM   5922  C  CZ    . TYR B  1 268 ? 83.804  69.090  -70.755  1.00 21.39  ? 374 TYR B CZ    1 
ATOM   5923  O  OH    . TYR B  1 268 ? 82.925  68.309  -71.462  1.00 21.42  ? 374 TYR B OH    1 
ATOM   5924  N  N     . GLN B  1 269 ? 87.013  73.564  -66.136  1.00 25.59  ? 375 GLN B N     1 
ATOM   5925  C  CA    . GLN B  1 269 ? 87.730  74.647  -65.447  1.00 25.30  ? 375 GLN B CA    1 
ATOM   5926  C  C     . GLN B  1 269 ? 87.439  74.692  -63.950  1.00 24.49  ? 375 GLN B C     1 
ATOM   5927  O  O     . GLN B  1 269 ? 87.566  75.746  -63.332  1.00 24.05  ? 375 GLN B O     1 
ATOM   5928  C  CB    . GLN B  1 269 ? 87.433  76.021  -66.070  1.00 26.00  ? 375 GLN B CB    1 
ATOM   5929  C  CG    . GLN B  1 269 ? 87.667  76.136  -67.563  1.00 26.35  ? 375 GLN B CG    1 
ATOM   5930  C  CD    . GLN B  1 269 ? 89.012  75.586  -67.986  1.00 26.70  ? 375 GLN B CD    1 
ATOM   5931  O  OE1   . GLN B  1 269 ? 89.063  74.798  -68.918  1.00 27.42  ? 375 GLN B OE1   1 
ATOM   5932  N  NE2   . GLN B  1 269 ? 90.091  75.962  -67.288  1.00 26.42  ? 375 GLN B NE2   1 
ATOM   5933  N  N     . HIS B  1 270 ? 87.157  73.544  -63.354  1.00 23.96  ? 376 HIS B N     1 
ATOM   5934  C  CA    . HIS B  1 270 ? 86.965  73.464  -61.914  1.00 24.53  ? 376 HIS B CA    1 
ATOM   5935  C  C     . HIS B  1 270 ? 88.205  73.951  -61.186  1.00 26.36  ? 376 HIS B C     1 
ATOM   5936  O  O     . HIS B  1 270 ? 89.307  73.558  -61.544  1.00 27.05  ? 376 HIS B O     1 
ATOM   5937  C  CB    . HIS B  1 270 ? 86.618  72.037  -61.495  1.00 23.34  ? 376 HIS B CB    1 
ATOM   5938  C  CG    . HIS B  1 270 ? 86.249  71.911  -60.058  1.00 22.25  ? 376 HIS B CG    1 
ATOM   5939  N  ND1   . HIS B  1 270 ? 87.152  71.547  -59.090  1.00 21.81  ? 376 HIS B ND1   1 
ATOM   5940  C  CD2   . HIS B  1 270 ? 85.080  72.106  -59.425  1.00 21.89  ? 376 HIS B CD2   1 
ATOM   5941  C  CE1   . HIS B  1 270 ? 86.554  71.523  -57.919  1.00 21.98  ? 376 HIS B CE1   1 
ATOM   5942  N  NE2   . HIS B  1 270 ? 85.290  71.854  -58.094  1.00 22.03  ? 376 HIS B NE2   1 
ATOM   5943  N  N     . LYS B  1 271 ? 88.017  74.798  -60.192  1.00 28.61  ? 377 LYS B N     1 
ATOM   5944  C  CA    . LYS B  1 271 ? 89.133  75.483  -59.502  1.00 30.31  ? 377 LYS B CA    1 
ATOM   5945  C  C     . LYS B  1 271 ? 90.232  74.519  -59.016  1.00 29.53  ? 377 LYS B C     1 
ATOM   5946  O  O     . LYS B  1 271 ? 91.411  74.830  -59.111  1.00 30.01  ? 377 LYS B O     1 
ATOM   5947  C  CB    . LYS B  1 271 ? 88.598  76.340  -58.342  1.00 32.84  ? 377 LYS B CB    1 
ATOM   5948  C  CG    . LYS B  1 271 ? 87.939  75.514  -57.246  1.00 35.77  ? 377 LYS B CG    1 
ATOM   5949  C  CD    . LYS B  1 271 ? 87.300  76.389  -56.164  1.00 38.66  ? 377 LYS B CD    1 
ATOM   5950  C  CE    . LYS B  1 271 ? 86.847  75.587  -54.907  1.00 39.23  ? 377 LYS B CE    1 
ATOM   5951  N  NZ    . LYS B  1 271 ? 85.790  74.570  -55.152  1.00 39.13  ? 377 LYS B NZ    1 
ATOM   5952  N  N     . VAL B  1 272 ? 89.836  73.345  -58.533  1.00 28.50  ? 378 VAL B N     1 
ATOM   5953  C  CA    . VAL B  1 272 ? 90.783  72.352  -58.026  1.00 28.50  ? 378 VAL B CA    1 
ATOM   5954  C  C     . VAL B  1 272 ? 91.311  71.467  -59.144  1.00 29.00  ? 378 VAL B C     1 
ATOM   5955  O  O     . VAL B  1 272 ? 92.450  71.009  -59.108  1.00 29.75  ? 378 VAL B O     1 
ATOM   5956  C  CB    . VAL B  1 272 ? 90.143  71.491  -56.920  1.00 28.01  ? 378 VAL B CB    1 
ATOM   5957  C  CG1   . VAL B  1 272 ? 91.153  70.518  -56.323  1.00 27.69  ? 378 VAL B CG1   1 
ATOM   5958  C  CG2   . VAL B  1 272 ? 89.581  72.376  -55.811  1.00 28.47  ? 378 VAL B CG2   1 
ATOM   5959  N  N     . GLY B  1 273 ? 90.480  71.197  -60.135  1.00 29.38  ? 379 GLY B N     1 
ATOM   5960  C  CA    . GLY B  1 273 ? 90.931  70.468  -61.320  1.00 30.21  ? 379 GLY B CA    1 
ATOM   5961  C  C     . GLY B  1 273 ? 92.069  71.206  -61.990  1.00 30.86  ? 379 GLY B C     1 
ATOM   5962  O  O     . GLY B  1 273 ? 93.062  70.603  -62.378  1.00 31.12  ? 379 GLY B O     1 
ATOM   5963  N  N     . ASN B  1 274 ? 91.915  72.522  -62.108  1.00 29.93  ? 380 ASN B N     1 
ATOM   5964  C  CA    . ASN B  1 274 ? 92.936  73.387  -62.673  1.00 29.80  ? 380 ASN B CA    1 
ATOM   5965  C  C     . ASN B  1 274 ? 94.188  73.476  -61.820  1.00 29.97  ? 380 ASN B C     1 
ATOM   5966  O  O     . ASN B  1 274 ? 95.298  73.514  -62.359  1.00 31.76  ? 380 ASN B O     1 
ATOM   5967  C  CB    . ASN B  1 274 ? 92.363  74.785  -62.931  1.00 29.39  ? 380 ASN B CB    1 
ATOM   5968  C  CG    . ASN B  1 274 ? 91.438  74.833  -64.128  1.00 28.87  ? 380 ASN B CG    1 
ATOM   5969  O  OD1   . ASN B  1 274 ? 90.975  75.904  -64.477  1.00 28.76  ? 380 ASN B OD1   1 
ATOM   5970  N  ND2   . ASN B  1 274 ? 91.172  73.678  -64.767  1.00 27.98  ? 380 ASN B ND2   1 
ATOM   5971  N  N     . ILE B  1 275 ? 94.050  73.517  -60.504  1.00 29.61  ? 381 ILE B N     1 
ATOM   5972  C  CA    . ILE B  1 275 ? 95.242  73.578  -59.658  1.00 31.27  ? 381 ILE B CA    1 
ATOM   5973  C  C     . ILE B  1 275 ? 96.008  72.254  -59.695  1.00 32.27  ? 381 ILE B C     1 
ATOM   5974  O  O     . ILE B  1 275 ? 97.224  72.243  -59.619  1.00 32.73  ? 381 ILE B O     1 
ATOM   5975  C  CB    . ILE B  1 275 ? 94.946  74.059  -58.217  1.00 31.61  ? 381 ILE B CB    1 
ATOM   5976  C  CG1   . ILE B  1 275 ? 96.173  74.758  -57.612  1.00 32.64  ? 381 ILE B CG1   1 
ATOM   5977  C  CG2   . ILE B  1 275 ? 94.546  72.930  -57.290  1.00 31.04  ? 381 ILE B CG2   1 
ATOM   5978  C  CD1   . ILE B  1 275 ? 96.564  76.046  -58.327  1.00 33.18  ? 381 ILE B CD1   1 
ATOM   5979  N  N     . ILE B  1 276 ? 95.297  71.144  -59.833  1.00 33.57  ? 382 ILE B N     1 
ATOM   5980  C  CA    . ILE B  1 276 ? 95.958  69.869  -59.998  1.00 34.89  ? 382 ILE B CA    1 
ATOM   5981  C  C     . ILE B  1 276 ? 96.657  69.794  -61.352  1.00 36.95  ? 382 ILE B C     1 
ATOM   5982  O  O     . ILE B  1 276 ? 97.754  69.256  -61.455  1.00 36.64  ? 382 ILE B O     1 
ATOM   5983  C  CB    . ILE B  1 276 ? 94.972  68.718  -59.757  1.00 33.65  ? 382 ILE B CB    1 
ATOM   5984  C  CG1   . ILE B  1 276 ? 94.671  68.669  -58.264  1.00 32.93  ? 382 ILE B CG1   1 
ATOM   5985  C  CG2   . ILE B  1 276 ? 95.542  67.382  -60.226  1.00 33.87  ? 382 ILE B CG2   1 
ATOM   5986  C  CD1   . ILE B  1 276 ? 93.610  67.682  -57.860  1.00 33.86  ? 382 ILE B CD1   1 
ATOM   5987  N  N     . ASP B  1 277 ? 96.028  70.336  -62.383  1.00 40.80  ? 383 ASP B N     1 
ATOM   5988  C  CA    . ASP B  1 277 ? 96.662  70.448  -63.696  1.00 45.11  ? 383 ASP B CA    1 
ATOM   5989  C  C     . ASP B  1 277 ? 97.938  71.291  -63.581  1.00 45.42  ? 383 ASP B C     1 
ATOM   5990  O  O     . ASP B  1 277 ? 98.977  70.848  -64.076  1.00 46.74  ? 383 ASP B O     1 
ATOM   5991  C  CB    . ASP B  1 277 ? 95.715  71.031  -64.774  1.00 48.74  ? 383 ASP B CB    1 
ATOM   5992  C  CG    . ASP B  1 277 ? 94.748  69.968  -65.402  1.00 53.18  ? 383 ASP B CG    1 
ATOM   5993  O  OD1   . ASP B  1 277 ? 94.889  68.756  -65.142  1.00 58.89  ? 383 ASP B OD1   1 
ATOM   5994  O  OD2   . ASP B  1 277 ? 93.835  70.332  -66.187  1.00 57.08  ? 383 ASP B OD2   1 
ATOM   5995  N  N     . THR B  1 278 ? 97.889  72.463  -62.919  1.00 43.24  ? 384 THR B N     1 
ATOM   5996  C  CA    . THR B  1 278 ? 99.107  73.294  -62.793  1.00 40.12  ? 384 THR B CA    1 
ATOM   5997  C  C     . THR B  1 278 ? 100.181 72.571  -61.990  1.00 36.74  ? 384 THR B C     1 
ATOM   5998  O  O     . THR B  1 278 ? 101.350 72.668  -62.319  1.00 36.69  ? 384 THR B O     1 
ATOM   5999  C  CB    . THR B  1 278 ? 98.893  74.714  -62.175  1.00 39.81  ? 384 THR B CB    1 
ATOM   6000  O  OG1   . THR B  1 278 ? 98.395  74.574  -60.852  1.00 41.64  ? 384 THR B OG1   1 
ATOM   6001  C  CG2   . THR B  1 278 ? 97.943  75.609  -62.976  1.00 39.37  ? 384 THR B CG2   1 
ATOM   6002  N  N     . MET B  1 279 ? 99.794  71.822  -60.960  1.00 33.91  ? 385 MET B N     1 
ATOM   6003  C  CA    . MET B  1 279 ? 100.758 71.057  -60.154  1.00 33.23  ? 385 MET B CA    1 
ATOM   6004  C  C     . MET B  1 279 ? 101.389 69.921  -60.950  1.00 33.15  ? 385 MET B C     1 
ATOM   6005  O  O     . MET B  1 279 ? 102.574 69.661  -60.809  1.00 33.73  ? 385 MET B O     1 
ATOM   6006  C  CB    . MET B  1 279 ? 100.139 70.534  -58.874  1.00 32.65  ? 385 MET B CB    1 
ATOM   6007  C  CG    . MET B  1 279 ? 99.994  71.667  -57.811  1.00 32.64  ? 385 MET B CG    1 
ATOM   6008  S  SD    . MET B  1 279 ? 99.005  71.103  -56.345  1.00 31.92  ? 385 MET B SD    1 
ATOM   6009  C  CE    . MET B  1 279 ? 100.202 70.088  -55.532  1.00 32.30  ? 385 MET B CE    1 
ATOM   6010  N  N     . ILE B  1 280 ? 100.619 69.231  -61.772  1.00 33.99  ? 386 ILE B N     1 
ATOM   6011  C  CA    . ILE B  1 280 ? 101.177 68.178  -62.613  1.00 35.37  ? 386 ILE B CA    1 
ATOM   6012  C  C     . ILE B  1 280 ? 102.080 68.781  -63.682  1.00 36.12  ? 386 ILE B C     1 
ATOM   6013  O  O     . ILE B  1 280 ? 103.149 68.257  -63.936  1.00 36.44  ? 386 ILE B O     1 
ATOM   6014  C  CB    . ILE B  1 280 ? 100.082 67.298  -63.246  1.00 35.88  ? 386 ILE B CB    1 
ATOM   6015  C  CG1   . ILE B  1 280 ? 99.403  66.471  -62.151  1.00 35.55  ? 386 ILE B CG1   1 
ATOM   6016  C  CG2   . ILE B  1 280 ? 100.674 66.367  -64.315  1.00 35.97  ? 386 ILE B CG2   1 
ATOM   6017  C  CD1   . ILE B  1 280 ? 98.124  65.780  -62.623  1.00 35.86  ? 386 ILE B CD1   1 
ATOM   6018  N  N     . THR B  1 281 ? 101.639 69.869  -64.307  1.00 37.64  ? 387 THR B N     1 
ATOM   6019  C  CA    . THR B  1 281 ? 102.460 70.614  -65.267  1.00 40.11  ? 387 THR B CA    1 
ATOM   6020  C  C     . THR B  1 281 ? 103.793 71.016  -64.636  1.00 43.32  ? 387 THR B C     1 
ATOM   6021  O  O     . THR B  1 281 ? 104.857 70.836  -65.233  1.00 44.68  ? 387 THR B O     1 
ATOM   6022  C  CB    . THR B  1 281 ? 101.715 71.866  -65.786  1.00 39.03  ? 387 THR B CB    1 
ATOM   6023  O  OG1   . THR B  1 281 ? 100.625 71.445  -66.629  1.00 39.11  ? 387 THR B OG1   1 
ATOM   6024  C  CG2   . THR B  1 281 ? 102.614 72.763  -66.631  1.00 39.00  ? 387 THR B CG2   1 
ATOM   6025  N  N     . ASP B  1 282 ? 103.718 71.541  -63.421  1.00 46.89  ? 388 ASP B N     1 
ATOM   6026  C  CA    . ASP B  1 282 ? 104.897 71.971  -62.673  1.00 49.36  ? 388 ASP B CA    1 
ATOM   6027  C  C     . ASP B  1 282 ? 105.866 70.815  -62.465  1.00 46.37  ? 388 ASP B C     1 
ATOM   6028  O  O     . ASP B  1 282 ? 107.053 70.951  -62.702  1.00 49.72  ? 388 ASP B O     1 
ATOM   6029  C  CB    . ASP B  1 282 ? 104.460 72.539  -61.314  1.00 54.13  ? 388 ASP B CB    1 
ATOM   6030  C  CG    . ASP B  1 282 ? 105.357 73.626  -60.803  1.00 58.36  ? 388 ASP B CG    1 
ATOM   6031  O  OD1   . ASP B  1 282 ? 106.463 73.833  -61.382  1.00 63.37  ? 388 ASP B OD1   1 
ATOM   6032  O  OD2   . ASP B  1 282 ? 104.930 74.241  -59.782  1.00 60.77  ? 388 ASP B OD2   1 
ATOM   6033  N  N     . ALA B  1 283 ? 105.349 69.674  -62.044  1.00 43.08  ? 389 ALA B N     1 
ATOM   6034  C  CA    . ALA B  1 283 ? 106.157 68.468  -61.871  1.00 42.33  ? 389 ALA B CA    1 
ATOM   6035  C  C     . ALA B  1 283 ? 106.766 67.974  -63.173  1.00 41.74  ? 389 ALA B C     1 
ATOM   6036  O  O     . ALA B  1 283 ? 107.845 67.411  -63.167  1.00 44.20  ? 389 ALA B O     1 
ATOM   6037  C  CB    . ALA B  1 283 ? 105.322 67.357  -61.243  1.00 42.40  ? 389 ALA B CB    1 
ATOM   6038  N  N     . PHE B  1 284 ? 106.066 68.151  -64.286  1.00 39.81  ? 390 PHE B N     1 
ATOM   6039  C  CA    . PHE B  1 284 ? 106.599 67.783  -65.601  1.00 38.86  ? 390 PHE B CA    1 
ATOM   6040  C  C     . PHE B  1 284 ? 107.745 68.692  -65.979  1.00 40.60  ? 390 PHE B C     1 
ATOM   6041  O  O     . PHE B  1 284 ? 108.765 68.211  -66.459  1.00 42.33  ? 390 PHE B O     1 
ATOM   6042  C  CB    . PHE B  1 284 ? 105.530 67.851  -66.691  1.00 37.30  ? 390 PHE B CB    1 
ATOM   6043  C  CG    . PHE B  1 284 ? 104.604 66.665  -66.723  1.00 35.63  ? 390 PHE B CG    1 
ATOM   6044  C  CD1   . PHE B  1 284 ? 104.501 65.747  -65.653  1.00 34.49  ? 390 PHE B CD1   1 
ATOM   6045  C  CD2   . PHE B  1 284 ? 103.804 66.466  -67.830  1.00 34.76  ? 390 PHE B CD2   1 
ATOM   6046  C  CE1   . PHE B  1 284 ? 103.631 64.699  -65.727  1.00 33.81  ? 390 PHE B CE1   1 
ATOM   6047  C  CE2   . PHE B  1 284 ? 102.930 65.413  -67.881  1.00 33.81  ? 390 PHE B CE2   1 
ATOM   6048  C  CZ    . PHE B  1 284 ? 102.849 64.535  -66.838  1.00 33.40  ? 390 PHE B CZ    1 
ATOM   6049  N  N     . LEU B  1 285 ? 107.583 69.997  -65.763  1.00 41.09  ? 391 LEU B N     1 
ATOM   6050  C  CA    . LEU B  1 285 ? 108.660 70.954  -66.020  1.00 40.99  ? 391 LEU B CA    1 
ATOM   6051  C  C     . LEU B  1 285 ? 109.923 70.591  -65.231  1.00 41.58  ? 391 LEU B C     1 
ATOM   6052  O  O     . LEU B  1 285 ? 111.020 70.618  -65.777  1.00 43.11  ? 391 LEU B O     1 
ATOM   6053  C  CB    . LEU B  1 285 ? 108.218 72.379  -65.708  1.00 41.06  ? 391 LEU B CB    1 
ATOM   6054  C  CG    . LEU B  1 285 ? 107.144 72.962  -66.636  1.00 41.52  ? 391 LEU B CG    1 
ATOM   6055  C  CD1   . LEU B  1 285 ? 106.531 74.209  -66.028  1.00 42.07  ? 391 LEU B CD1   1 
ATOM   6056  C  CD2   . LEU B  1 285 ? 107.671 73.293  -68.018  1.00 42.82  ? 391 LEU B CD2   1 
ATOM   6057  N  N     . LYS B  1 286 ? 109.763 70.216  -63.969  1.00 43.25  ? 392 LYS B N     1 
ATOM   6058  C  CA    . LYS B  1 286 ? 110.896 69.833  -63.125  1.00 47.41  ? 392 LYS B CA    1 
ATOM   6059  C  C     . LYS B  1 286 ? 111.500 68.493  -63.480  1.00 47.81  ? 392 LYS B C     1 
ATOM   6060  O  O     . LYS B  1 286 ? 112.671 68.275  -63.251  1.00 48.71  ? 392 LYS B O     1 
ATOM   6061  C  CB    . LYS B  1 286 ? 110.513 69.861  -61.646  1.00 51.51  ? 392 LYS B CB    1 
ATOM   6062  C  CG    . LYS B  1 286 ? 110.209 71.278  -61.155  1.00 55.17  ? 392 LYS B CG    1 
ATOM   6063  C  CD    . LYS B  1 286 ? 110.329 71.397  -59.647  1.00 58.29  ? 392 LYS B CD    1 
ATOM   6064  C  CE    . LYS B  1 286 ? 110.180 72.819  -59.151  1.00 62.23  ? 392 LYS B CE    1 
ATOM   6065  N  NZ    . LYS B  1 286 ? 108.888 73.488  -59.529  1.00 63.45  ? 392 LYS B NZ    1 
ATOM   6066  N  N     . ALA B  1 287 ? 110.702 67.600  -64.034  1.00 48.58  ? 393 ALA B N     1 
ATOM   6067  C  CA    . ALA B  1 287 ? 111.182 66.288  -64.488  1.00 48.29  ? 393 ALA B CA    1 
ATOM   6068  C  C     . ALA B  1 287 ? 111.709 66.289  -65.915  1.00 48.88  ? 393 ALA B C     1 
ATOM   6069  O  O     . ALA B  1 287 ? 112.292 65.298  -66.344  1.00 48.32  ? 393 ALA B O     1 
ATOM   6070  C  CB    . ALA B  1 287 ? 110.069 65.257  -64.371  1.00 47.04  ? 393 ALA B CB    1 
ATOM   6071  N  N     . ASP B  1 288 ? 111.505 67.381  -66.647  1.00 51.26  ? 394 ASP B N     1 
ATOM   6072  C  CA    . ASP B  1 288 ? 111.710 67.395  -68.107  1.00 53.27  ? 394 ASP B CA    1 
ATOM   6073  C  C     . ASP B  1 288 ? 113.110 66.984  -68.477  1.00 56.29  ? 394 ASP B C     1 
ATOM   6074  O  O     . ASP B  1 288 ? 113.299 66.055  -69.272  1.00 60.39  ? 394 ASP B O     1 
ATOM   6075  C  CB    . ASP B  1 288 ? 111.434 68.793  -68.686  1.00 53.32  ? 394 ASP B CB    1 
ATOM   6076  C  CG    . ASP B  1 288 ? 111.254 68.794  -70.190  1.00 52.40  ? 394 ASP B CG    1 
ATOM   6077  O  OD1   . ASP B  1 288 ? 111.254 67.724  -70.829  1.00 50.36  ? 394 ASP B OD1   1 
ATOM   6078  O  OD2   . ASP B  1 288 ? 111.096 69.893  -70.742  1.00 53.19  ? 394 ASP B OD2   1 
ATOM   6079  N  N     . ASP B  1 289 ? 114.069 67.666  -67.852  1.00 58.63  ? 395 ASP B N     1 
ATOM   6080  C  CA    . ASP B  1 289 ? 115.497 67.525  -68.119  1.00 59.64  ? 395 ASP B CA    1 
ATOM   6081  C  C     . ASP B  1 289 ? 116.022 66.118  -67.934  1.00 61.72  ? 395 ASP B C     1 
ATOM   6082  O  O     . ASP B  1 289 ? 116.904 65.709  -68.667  1.00 67.88  ? 395 ASP B O     1 
ATOM   6083  C  CB    . ASP B  1 289 ? 116.312 68.485  -67.241  1.00 60.70  ? 395 ASP B CB    1 
ATOM   6084  C  CG    . ASP B  1 289 ? 116.024 69.970  -67.581  1.00 58.74  ? 395 ASP B CG    1 
ATOM   6085  O  OD1   . ASP B  1 289 ? 115.720 70.300  -68.754  1.00 54.97  ? 395 ASP B OD1   1 
ATOM   6086  O  OD2   . ASP B  1 289 ? 116.080 70.812  -66.655  1.00 59.67  ? 395 ASP B OD2   1 
ATOM   6087  N  N     . TYR B  1 290 ? 115.476 65.359  -66.987  1.00 61.85  ? 396 TYR B N     1 
ATOM   6088  C  CA    . TYR B  1 290 ? 116.037 64.062  -66.633  1.00 64.82  ? 396 TYR B CA    1 
ATOM   6089  C  C     . TYR B  1 290 ? 115.267 62.856  -67.158  1.00 63.31  ? 396 TYR B C     1 
ATOM   6090  O  O     . TYR B  1 290 ? 115.643 61.721  -66.864  1.00 66.91  ? 396 TYR B O     1 
ATOM   6091  C  CB    . TYR B  1 290 ? 116.181 63.975  -65.122  1.00 69.69  ? 396 TYR B CB    1 
ATOM   6092  C  CG    . TYR B  1 290 ? 116.626 65.278  -64.502  1.00 75.04  ? 396 TYR B CG    1 
ATOM   6093  C  CD1   . TYR B  1 290 ? 117.951 65.690  -64.549  1.00 79.20  ? 396 TYR B CD1   1 
ATOM   6094  C  CD2   . TYR B  1 290 ? 115.706 66.107  -63.902  1.00 79.59  ? 396 TYR B CD2   1 
ATOM   6095  C  CE1   . TYR B  1 290 ? 118.346 66.903  -64.012  1.00 86.77  ? 396 TYR B CE1   1 
ATOM   6096  C  CE2   . TYR B  1 290 ? 116.075 67.314  -63.344  1.00 85.63  ? 396 TYR B CE2   1 
ATOM   6097  C  CZ    . TYR B  1 290 ? 117.392 67.710  -63.401  1.00 90.86  ? 396 TYR B CZ    1 
ATOM   6098  O  OH    . TYR B  1 290 ? 117.754 68.890  -62.828  1.00 98.99  ? 396 TYR B OH    1 
ATOM   6099  N  N     . ILE B  1 291 ? 114.206 63.064  -67.939  1.00 61.97  ? 397 ILE B N     1 
ATOM   6100  C  CA    . ILE B  1 291 ? 113.478 61.944  -68.551  1.00 61.60  ? 397 ILE B CA    1 
ATOM   6101  C  C     . ILE B  1 291 ? 113.806 61.883  -70.032  1.00 59.07  ? 397 ILE B C     1 
ATOM   6102  O  O     . ILE B  1 291 ? 113.628 62.861  -70.758  1.00 57.60  ? 397 ILE B O     1 
ATOM   6103  C  CB    . ILE B  1 291 ? 111.966 62.035  -68.326  1.00 62.33  ? 397 ILE B CB    1 
ATOM   6104  C  CG1   . ILE B  1 291 ? 111.647 61.571  -66.908  1.00 61.07  ? 397 ILE B CG1   1 
ATOM   6105  C  CG2   . ILE B  1 291 ? 111.231 61.090  -69.268  1.00 63.33  ? 397 ILE B CG2   1 
ATOM   6106  C  CD1   . ILE B  1 291 ? 110.275 61.968  -66.411  1.00 60.45  ? 397 ILE B CD1   1 
ATOM   6107  N  N     . GLU B  1 292 ? 114.254 60.707  -70.449  1.00 58.79  ? 398 GLU B N     1 
ATOM   6108  C  CA    . GLU B  1 292 ? 114.658 60.418  -71.812  1.00 57.82  ? 398 GLU B CA    1 
ATOM   6109  C  C     . GLU B  1 292 ? 113.640 59.477  -72.422  1.00 51.99  ? 398 GLU B C     1 
ATOM   6110  O  O     . GLU B  1 292 ? 113.196 58.535  -71.756  1.00 53.71  ? 398 GLU B O     1 
ATOM   6111  C  CB    . GLU B  1 292 ? 116.011 59.696  -71.826  1.00 64.54  ? 398 GLU B CB    1 
ATOM   6112  C  CG    . GLU B  1 292 ? 117.208 60.454  -71.265  1.00 68.38  ? 398 GLU B CG    1 
ATOM   6113  C  CD    . GLU B  1 292 ? 118.348 59.499  -70.854  1.00 70.40  ? 398 GLU B CD    1 
ATOM   6114  O  OE1   . GLU B  1 292 ? 118.507 58.434  -71.512  1.00 72.05  ? 398 GLU B OE1   1 
ATOM   6115  O  OE2   . GLU B  1 292 ? 119.070 59.789  -69.863  1.00 71.81  ? 398 GLU B OE2   1 
ATOM   6116  N  N     . ILE B  1 293 ? 113.259 59.735  -73.671  1.00 47.21  ? 399 ILE B N     1 
ATOM   6117  C  CA    . ILE B  1 293 ? 112.358 58.858  -74.418  1.00 46.64  ? 399 ILE B CA    1 
ATOM   6118  C  C     . ILE B  1 293 ? 112.999 58.536  -75.756  1.00 47.63  ? 399 ILE B C     1 
ATOM   6119  O  O     . ILE B  1 293 ? 113.307 59.445  -76.528  1.00 44.95  ? 399 ILE B O     1 
ATOM   6120  C  CB    . ILE B  1 293 ? 110.977 59.508  -74.655  1.00 45.38  ? 399 ILE B CB    1 
ATOM   6121  C  CG1   . ILE B  1 293 ? 110.336 59.975  -73.343  1.00 44.07  ? 399 ILE B CG1   1 
ATOM   6122  C  CG2   . ILE B  1 293 ? 110.039 58.488  -75.277  1.00 45.10  ? 399 ILE B CG2   1 
ATOM   6123  C  CD1   . ILE B  1 293 ? 109.342 61.102  -73.545  1.00 42.43  ? 399 ILE B CD1   1 
ATOM   6124  N  N     . THR B  1 294 ? 113.196 57.239  -76.028  1.00 52.22  ? 400 THR B N     1 
ATOM   6125  C  CA    . THR B  1 294 ? 113.823 56.762  -77.256  1.00 54.70  ? 400 THR B CA    1 
ATOM   6126  C  C     . THR B  1 294 ? 112.930 57.044  -78.447  1.00 54.20  ? 400 THR B C     1 
ATOM   6127  O  O     . THR B  1 294 ? 111.776 56.635  -78.456  1.00 55.06  ? 400 THR B O     1 
ATOM   6128  C  CB    . THR B  1 294 ? 114.083 55.256  -77.209  1.00 59.37  ? 400 THR B CB    1 
ATOM   6129  O  OG1   . THR B  1 294 ? 114.998 55.011  -76.126  1.00 63.69  ? 400 THR B OG1   1 
ATOM   6130  C  CG2   . THR B  1 294 ? 114.807 54.759  -78.491  1.00 61.59  ? 400 THR B CG2   1 
ATOM   6131  N  N     . GLY B  1 295 ? 113.488 57.720  -79.447  1.00 55.16  ? 401 GLY B N     1 
ATOM   6132  C  CA    . GLY B  1 295 ? 112.758 58.071  -80.652  1.00 57.08  ? 401 GLY B CA    1 
ATOM   6133  C  C     . GLY B  1 295 ? 113.259 57.303  -81.873  1.00 59.37  ? 401 GLY B C     1 
ATOM   6134  O  O     . GLY B  1 295 ? 113.696 56.154  -81.776  1.00 59.58  ? 401 GLY B O     1 
ATOM   6135  N  N     . ALA B  1 296 ? 113.167 57.953  -83.027  1.00 63.04  ? 402 ALA B N     1 
ATOM   6136  C  CA    . ALA B  1 296 ? 113.513 57.355  -84.305  1.00 63.80  ? 402 ALA B CA    1 
ATOM   6137  C  C     . ALA B  1 296 ? 115.038 57.407  -84.447  1.00 63.64  ? 402 ALA B C     1 
ATOM   6138  O  O     . ALA B  1 296 ? 115.689 58.432  -84.140  1.00 61.38  ? 402 ALA B O     1 
ATOM   6139  C  CB    . ALA B  1 296 ? 112.874 58.098  -85.449  1.00 64.30  ? 402 ALA B CB    1 
ATOM   6140  N  N     . GLY B  1 297 ? 115.581 56.268  -84.899  1.00 64.50  ? 403 GLY B N     1 
ATOM   6141  C  CA    . GLY B  1 297 ? 117.015 56.091  -85.011  1.00 67.33  ? 403 GLY B CA    1 
ATOM   6142  C  C     . GLY B  1 297 ? 117.734 56.092  -83.675  1.00 67.95  ? 403 GLY B C     1 
ATOM   6143  O  O     . GLY B  1 297 ? 118.913 56.408  -83.623  1.00 70.44  ? 403 GLY B O     1 
ATOM   6144  N  N     . GLY B  1 298 ? 117.024 55.757  -82.589  1.00 65.77  ? 404 GLY B N     1 
ATOM   6145  C  CA    . GLY B  1 298 ? 117.595 55.792  -81.266  1.00 65.96  ? 404 GLY B CA    1 
ATOM   6146  C  C     . GLY B  1 298 ? 117.831 57.147  -80.602  1.00 65.65  ? 404 GLY B C     1 
ATOM   6147  O  O     . GLY B  1 298 ? 118.259 57.187  -79.450  1.00 67.88  ? 404 GLY B O     1 
ATOM   6148  N  N     . LYS B  1 299 ? 117.530 58.266  -81.285  1.00 65.00  ? 405 LYS B N     1 
ATOM   6149  C  CA    . LYS B  1 299 ? 117.795 59.608  -80.729  1.00 69.10  ? 405 LYS B CA    1 
ATOM   6150  C  C     . LYS B  1 299 ? 117.021 59.792  -79.408  1.00 68.50  ? 405 LYS B C     1 
ATOM   6151  O  O     . LYS B  1 299 ? 115.938 59.234  -79.230  1.00 71.22  ? 405 LYS B O     1 
ATOM   6152  C  CB    . LYS B  1 299 ? 117.421 60.694  -81.720  1.00 71.82  ? 405 LYS B CB    1 
ATOM   6153  C  CG    . LYS B  1 299 ? 118.265 60.669  -82.964  1.00 77.23  ? 405 LYS B CG    1 
ATOM   6154  C  CD    . LYS B  1 299 ? 117.762 61.647  -83.999  1.00 81.38  ? 405 LYS B CD    1 
ATOM   6155  C  CE    . LYS B  1 299 ? 118.242 63.044  -83.695  1.00 84.81  ? 405 LYS B CE    1 
ATOM   6156  N  NZ    . LYS B  1 299 ? 117.852 63.890  -84.855  1.00 87.50  ? 405 LYS B NZ    1 
ATOM   6157  N  N     . LYS B  1 300 ? 117.590 60.547  -78.465  1.00 66.93  ? 406 LYS B N     1 
ATOM   6158  C  CA    . LYS B  1 300 ? 116.938 60.777  -77.177  1.00 65.51  ? 406 LYS B CA    1 
ATOM   6159  C  C     . LYS B  1 300 ? 116.112 62.061  -77.213  1.00 60.41  ? 406 LYS B C     1 
ATOM   6160  O  O     . LYS B  1 300 ? 116.609 63.132  -77.613  1.00 57.72  ? 406 LYS B O     1 
ATOM   6161  C  CB    . LYS B  1 300 ? 117.963 60.858  -76.044  1.00 72.18  ? 406 LYS B CB    1 
ATOM   6162  C  CG    . LYS B  1 300 ? 118.801 59.609  -75.872  1.00 77.97  ? 406 LYS B CG    1 
ATOM   6163  C  CD    . LYS B  1 300 ? 118.064 58.495  -75.170  1.00 78.82  ? 406 LYS B CD    1 
ATOM   6164  C  CE    . LYS B  1 300 ? 118.954 57.249  -75.216  1.00 82.20  ? 406 LYS B CE    1 
ATOM   6165  N  NZ    . LYS B  1 300 ? 118.385 56.138  -74.439  1.00 83.51  ? 406 LYS B NZ    1 
ATOM   6166  N  N     . TYR B  1 301 ? 114.848 61.946  -76.805  1.00 60.51  ? 407 TYR B N     1 
ATOM   6167  C  CA    . TYR B  1 301 ? 113.957 63.094  -76.669  1.00 59.66  ? 407 TYR B CA    1 
ATOM   6168  C  C     . TYR B  1 301 ? 113.467 63.268  -75.242  1.00 57.98  ? 407 TYR B C     1 
ATOM   6169  O  O     . TYR B  1 301 ? 113.372 62.310  -74.482  1.00 54.90  ? 407 TYR B O     1 
ATOM   6170  C  CB    . TYR B  1 301 ? 112.772 62.972  -77.621  1.00 59.14  ? 407 TYR B CB    1 
ATOM   6171  C  CG    . TYR B  1 301 ? 113.151 62.974  -79.079  1.00 60.47  ? 407 TYR B CG    1 
ATOM   6172  C  CD1   . TYR B  1 301 ? 113.398 64.159  -79.757  1.00 62.01  ? 407 TYR B CD1   1 
ATOM   6173  C  CD2   . TYR B  1 301 ? 113.343 61.777  -79.767  1.00 63.46  ? 407 TYR B CD2   1 
ATOM   6174  C  CE1   . TYR B  1 301 ? 113.672 64.173  -81.113  1.00 64.35  ? 407 TYR B CE1   1 
ATOM   6175  C  CE2   . TYR B  1 301 ? 113.725 61.773  -81.099  1.00 66.37  ? 407 TYR B CE2   1 
ATOM   6176  C  CZ    . TYR B  1 301 ? 113.877 62.971  -81.776  1.00 66.04  ? 407 TYR B CZ    1 
ATOM   6177  O  OH    . TYR B  1 301 ? 114.220 62.964  -83.108  1.00 67.07  ? 407 TYR B OH    1 
ATOM   6178  N  N     . ARG B  1 302 ? 113.195 64.514  -74.884  1.00 59.31  ? 408 ARG B N     1 
ATOM   6179  C  CA    . ARG B  1 302 ? 112.637 64.886  -73.594  1.00 63.18  ? 408 ARG B CA    1 
ATOM   6180  C  C     . ARG B  1 302 ? 111.131 64.938  -73.715  1.00 60.64  ? 408 ARG B C     1 
ATOM   6181  O  O     . ARG B  1 302 ? 110.596 64.826  -74.811  1.00 58.61  ? 408 ARG B O     1 
ATOM   6182  C  CB    . ARG B  1 302 ? 113.202 66.244  -73.148  1.00 70.11  ? 408 ARG B CB    1 
ATOM   6183  C  CG    . ARG B  1 302 ? 114.572 66.155  -72.520  1.00 75.11  ? 408 ARG B CG    1 
ATOM   6184  C  CD    . ARG B  1 302 ? 115.126 67.536  -72.247  1.00 81.87  ? 408 ARG B CD    1 
ATOM   6185  N  NE    . ARG B  1 302 ? 116.570 67.441  -72.008  1.00 91.80  ? 408 ARG B NE    1 
ATOM   6186  C  CZ    . ARG B  1 302 ? 117.411 68.471  -71.917  1.00 100.27 ? 408 ARG B CZ    1 
ATOM   6187  N  NH1   . ARG B  1 302 ? 116.966 69.720  -72.031  1.00 105.88 ? 408 ARG B NH1   1 
ATOM   6188  N  NH2   . ARG B  1 302 ? 118.698 68.245  -71.691  1.00 102.14 ? 408 ARG B NH2   1 
ATOM   6189  N  N     . ILE B  1 303 ? 110.444 65.129  -72.592  1.00 57.73  ? 409 ILE B N     1 
ATOM   6190  C  CA    . ILE B  1 303 ? 108.977 65.231  -72.596  1.00 53.37  ? 409 ILE B CA    1 
ATOM   6191  C  C     . ILE B  1 303 ? 108.555 66.369  -73.502  1.00 49.95  ? 409 ILE B C     1 
ATOM   6192  O  O     . ILE B  1 303 ? 107.712 66.194  -74.356  1.00 46.65  ? 409 ILE B O     1 
ATOM   6193  C  CB    . ILE B  1 303 ? 108.415 65.458  -71.186  1.00 53.91  ? 409 ILE B CB    1 
ATOM   6194  C  CG1   . ILE B  1 303 ? 108.711 64.248  -70.299  1.00 55.48  ? 409 ILE B CG1   1 
ATOM   6195  C  CG2   . ILE B  1 303 ? 106.913 65.689  -71.232  1.00 52.72  ? 409 ILE B CG2   1 
ATOM   6196  C  CD1   . ILE B  1 303 ? 108.267 64.419  -68.854  1.00 56.70  ? 409 ILE B CD1   1 
ATOM   6197  N  N     . SER B  1 304 ? 109.158 67.534  -73.312  1.00 48.54  ? 410 SER B N     1 
ATOM   6198  C  CA    . SER B  1 304 ? 108.844 68.714  -74.123  1.00 47.03  ? 410 SER B CA    1 
ATOM   6199  C  C     . SER B  1 304 ? 109.201 68.598  -75.609  1.00 45.82  ? 410 SER B C     1 
ATOM   6200  O  O     . SER B  1 304 ? 108.598 69.260  -76.433  1.00 44.54  ? 410 SER B O     1 
ATOM   6201  C  CB    . SER B  1 304 ? 109.517 69.952  -73.532  1.00 47.11  ? 410 SER B CB    1 
ATOM   6202  O  OG    . SER B  1 304 ? 110.896 69.735  -73.382  1.00 49.43  ? 410 SER B OG    1 
ATOM   6203  N  N     . THR B  1 305 ? 110.191 67.775  -75.943  1.00 46.46  ? 411 THR B N     1 
ATOM   6204  C  CA    . THR B  1 305 ? 110.662 67.623  -77.331  1.00 47.62  ? 411 THR B CA    1 
ATOM   6205  C  C     . THR B  1 305 ? 110.149 66.392  -78.063  1.00 46.64  ? 411 THR B C     1 
ATOM   6206  O  O     . THR B  1 305 ? 110.414 66.241  -79.256  1.00 48.84  ? 411 THR B O     1 
ATOM   6207  C  CB    . THR B  1 305 ? 112.198 67.629  -77.398  1.00 48.98  ? 411 THR B CB    1 
ATOM   6208  O  OG1   . THR B  1 305 ? 112.711 66.604  -76.551  1.00 49.60  ? 411 THR B OG1   1 
ATOM   6209  C  CG2   . THR B  1 305 ? 112.745 68.975  -76.958  1.00 50.50  ? 411 THR B CG2   1 
ATOM   6210  N  N     . ALA B  1 306 ? 109.412 65.525  -77.380  1.00 43.56  ? 412 ALA B N     1 
ATOM   6211  C  CA    . ALA B  1 306 ? 108.855 64.327  -78.016  1.00 41.80  ? 412 ALA B CA    1 
ATOM   6212  C  C     . ALA B  1 306 ? 107.862 64.658  -79.088  1.00 40.89  ? 412 ALA B C     1 
ATOM   6213  O  O     . ALA B  1 306 ? 107.668 63.890  -80.005  1.00 39.47  ? 412 ALA B O     1 
ATOM   6214  C  CB    . ALA B  1 306 ? 108.249 63.393  -76.994  1.00 42.25  ? 412 ALA B CB    1 
ATOM   6215  N  N     . ILE B  1 307 ? 107.229 65.815  -78.986  1.00 42.28  ? 413 ILE B N     1 
ATOM   6216  C  CA    . ILE B  1 307 ? 106.330 66.312  -80.035  1.00 44.63  ? 413 ILE B CA    1 
ATOM   6217  C  C     . ILE B  1 307 ? 106.997 66.478  -81.401  1.00 47.21  ? 413 ILE B C     1 
ATOM   6218  O  O     . ILE B  1 307 ? 106.313 66.505  -82.421  1.00 47.90  ? 413 ILE B O     1 
ATOM   6219  C  CB    . ILE B  1 307 ? 105.664 67.647  -79.636  1.00 44.34  ? 413 ILE B CB    1 
ATOM   6220  C  CG1   . ILE B  1 307 ? 106.663 68.767  -79.427  1.00 45.06  ? 413 ILE B CG1   1 
ATOM   6221  C  CG2   . ILE B  1 307 ? 104.788 67.456  -78.406  1.00 43.78  ? 413 ILE B CG2   1 
ATOM   6222  C  CD1   . ILE B  1 307 ? 106.034 70.123  -79.196  1.00 45.12  ? 413 ILE B CD1   1 
ATOM   6223  N  N     . ASP B  1 308 ? 108.318 66.613  -81.425  1.00 49.64  ? 414 ASP B N     1 
ATOM   6224  C  CA    . ASP B  1 308 ? 109.044 66.730  -82.672  1.00 52.16  ? 414 ASP B CA    1 
ATOM   6225  C  C     . ASP B  1 308 ? 109.210 65.405  -83.412  1.00 53.46  ? 414 ASP B C     1 
ATOM   6226  O  O     . ASP B  1 308 ? 109.291 65.415  -84.636  1.00 56.14  ? 414 ASP B O     1 
ATOM   6227  C  CB    . ASP B  1 308 ? 110.395 67.379  -82.419  1.00 52.97  ? 414 ASP B CB    1 
ATOM   6228  C  CG    . ASP B  1 308 ? 110.259 68.784  -81.862  1.00 53.85  ? 414 ASP B CG    1 
ATOM   6229  O  OD1   . ASP B  1 308 ? 109.356 69.546  -82.309  1.00 51.72  ? 414 ASP B OD1   1 
ATOM   6230  O  OD2   . ASP B  1 308 ? 111.063 69.114  -80.958  1.00 56.65  ? 414 ASP B OD2   1 
ATOM   6231  N  N     . ASP B  1 309 ? 109.250 64.287  -82.693  1.00 54.62  ? 415 ASP B N     1 
ATOM   6232  C  CA    . ASP B  1 309 ? 109.365 62.969  -83.323  1.00 55.97  ? 415 ASP B CA    1 
ATOM   6233  C  C     . ASP B  1 309 ? 108.302 61.964  -82.840  1.00 52.98  ? 415 ASP B C     1 
ATOM   6234  O  O     . ASP B  1 309 ? 108.289 61.564  -81.680  1.00 50.05  ? 415 ASP B O     1 
ATOM   6235  C  CB    . ASP B  1 309 ? 110.775 62.418  -83.089  1.00 60.88  ? 415 ASP B CB    1 
ATOM   6236  C  CG    . ASP B  1 309 ? 110.919 60.944  -83.445  1.00 65.02  ? 415 ASP B CG    1 
ATOM   6237  O  OD1   . ASP B  1 309 ? 110.585 60.527  -84.590  1.00 66.07  ? 415 ASP B OD1   1 
ATOM   6238  O  OD2   . ASP B  1 309 ? 111.374 60.176  -82.588  1.00 70.19  ? 415 ASP B OD2   1 
ATOM   6239  N  N     . MET B  1 310 ? 107.460 61.518  -83.753  1.00 51.56  ? 416 MET B N     1 
ATOM   6240  C  CA    . MET B  1 310 ? 106.295 60.707  -83.447  1.00 49.84  ? 416 MET B CA    1 
ATOM   6241  C  C     . MET B  1 310 ? 106.593 59.317  -82.932  1.00 49.26  ? 416 MET B C     1 
ATOM   6242  O  O     . MET B  1 310 ? 105.750 58.730  -82.270  1.00 50.01  ? 416 MET B O     1 
ATOM   6243  C  CB    . MET B  1 310 ? 105.370 60.588  -84.658  1.00 49.21  ? 416 MET B CB    1 
ATOM   6244  C  CG    . MET B  1 310 ? 104.747 61.894  -85.075  1.00 49.36  ? 416 MET B CG    1 
ATOM   6245  S  SD    . MET B  1 310 ? 103.647 62.618  -83.835  1.00 49.28  ? 416 MET B SD    1 
ATOM   6246  C  CE    . MET B  1 310 ? 104.670 63.910  -83.139  1.00 50.63  ? 416 MET B CE    1 
ATOM   6247  N  N     . GLU B  1 311 ? 107.762 58.776  -83.224  1.00 50.74  ? 417 GLU B N     1 
ATOM   6248  C  CA    . GLU B  1 311 ? 108.095 57.470  -82.676  1.00 51.97  ? 417 GLU B CA    1 
ATOM   6249  C  C     . GLU B  1 311 ? 108.323 57.565  -81.176  1.00 49.21  ? 417 GLU B C     1 
ATOM   6250  O  O     . GLU B  1 311 ? 108.039 56.621  -80.442  1.00 46.57  ? 417 GLU B O     1 
ATOM   6251  C  CB    . GLU B  1 311 ? 109.311 56.881  -83.374  1.00 55.02  ? 417 GLU B CB    1 
ATOM   6252  C  CG    . GLU B  1 311 ? 109.486 55.393  -83.112  1.00 55.86  ? 417 GLU B CG    1 
ATOM   6253  C  CD    . GLU B  1 311 ? 110.658 54.811  -83.888  1.00 56.69  ? 417 GLU B CD    1 
ATOM   6254  O  OE1   . GLU B  1 311 ? 110.872 55.205  -85.074  1.00 56.57  ? 417 GLU B OE1   1 
ATOM   6255  O  OE2   . GLU B  1 311 ? 111.367 53.955  -83.303  1.00 59.92  ? 417 GLU B OE2   1 
ATOM   6256  N  N     . ALA B  1 312 ? 108.853 58.723  -80.742  1.00 48.82  ? 418 ALA B N     1 
ATOM   6257  C  CA    . ALA B  1 312 ? 109.037 58.989  -79.324  1.00 48.84  ? 418 ALA B CA    1 
ATOM   6258  C  C     . ALA B  1 312 ? 107.678 59.290  -78.668  1.00 46.47  ? 418 ALA B C     1 
ATOM   6259  O  O     . ALA B  1 312 ? 107.337 58.716  -77.638  1.00 48.46  ? 418 ALA B O     1 
ATOM   6260  C  CB    . ALA B  1 312 ? 109.953 60.158  -79.123  1.00 50.60  ? 418 ALA B CB    1 
ATOM   6261  N  N     . TYR B  1 313 ? 106.933 60.192  -79.296  1.00 42.91  ? 419 TYR B N     1 
ATOM   6262  C  CA    . TYR B  1 313 ? 105.619 60.625  -78.806  1.00 40.92  ? 419 TYR B CA    1 
ATOM   6263  C  C     . TYR B  1 313 ? 104.598 59.498  -78.629  1.00 40.29  ? 419 TYR B C     1 
ATOM   6264  O  O     . TYR B  1 313 ? 103.703 59.604  -77.795  1.00 41.66  ? 419 TYR B O     1 
ATOM   6265  C  CB    . TYR B  1 313 ? 105.028 61.664  -79.761  1.00 40.01  ? 419 TYR B CB    1 
ATOM   6266  C  CG    . TYR B  1 313 ? 103.931 62.535  -79.210  1.00 39.37  ? 419 TYR B CG    1 
ATOM   6267  C  CD1   . TYR B  1 313 ? 104.109 63.258  -78.039  1.00 39.65  ? 419 TYR B CD1   1 
ATOM   6268  C  CD2   . TYR B  1 313 ? 102.749 62.697  -79.892  1.00 38.74  ? 419 TYR B CD2   1 
ATOM   6269  C  CE1   . TYR B  1 313 ? 103.114 64.108  -77.565  1.00 39.65  ? 419 TYR B CE1   1 
ATOM   6270  C  CE2   . TYR B  1 313 ? 101.745 63.530  -79.421  1.00 38.33  ? 419 TYR B CE2   1 
ATOM   6271  C  CZ    . TYR B  1 313 ? 101.929 64.235  -78.261  1.00 38.27  ? 419 TYR B CZ    1 
ATOM   6272  O  OH    . TYR B  1 313 ? 100.927 65.050  -77.810  1.00 37.20  ? 419 TYR B OH    1 
ATOM   6273  N  N     . THR B  1 314 ? 104.744 58.432  -79.415  1.00 39.00  ? 420 THR B N     1 
ATOM   6274  C  CA    . THR B  1 314 ? 103.938 57.220  -79.266  1.00 37.92  ? 420 THR B CA    1 
ATOM   6275  C  C     . THR B  1 314 ? 104.062 56.612  -77.854  1.00 37.98  ? 420 THR B C     1 
ATOM   6276  O  O     . THR B  1 314 ? 103.109 56.025  -77.329  1.00 39.51  ? 420 THR B O     1 
ATOM   6277  C  CB    . THR B  1 314 ? 104.337 56.185  -80.345  1.00 37.73  ? 420 THR B CB    1 
ATOM   6278  O  OG1   . THR B  1 314 ? 103.986 56.707  -81.632  1.00 39.70  ? 420 THR B OG1   1 
ATOM   6279  C  CG2   . THR B  1 314 ? 103.577 54.880  -80.174  1.00 36.87  ? 420 THR B CG2   1 
ATOM   6280  N  N     . LYS B  1 315 ? 105.233 56.756  -77.249  1.00 38.69  ? 421 LYS B N     1 
ATOM   6281  C  CA    . LYS B  1 315 ? 105.477 56.225  -75.916  1.00 38.90  ? 421 LYS B CA    1 
ATOM   6282  C  C     . LYS B  1 315 ? 105.241 57.242  -74.788  1.00 37.25  ? 421 LYS B C     1 
ATOM   6283  O  O     . LYS B  1 315 ? 105.421 56.901  -73.622  1.00 38.07  ? 421 LYS B O     1 
ATOM   6284  C  CB    . LYS B  1 315 ? 106.891 55.628  -75.856  1.00 41.33  ? 421 LYS B CB    1 
ATOM   6285  C  CG    . LYS B  1 315 ? 107.143 54.541  -76.885  1.00 43.19  ? 421 LYS B CG    1 
ATOM   6286  C  CD    . LYS B  1 315 ? 108.431 53.772  -76.633  1.00 45.20  ? 421 LYS B CD    1 
ATOM   6287  C  CE    . LYS B  1 315 ? 109.653 54.494  -77.240  1.00 48.83  ? 421 LYS B CE    1 
ATOM   6288  N  NZ    . LYS B  1 315 ? 110.890 53.674  -76.977  1.00 51.54  ? 421 LYS B NZ    1 
ATOM   6289  N  N     . LEU B  1 316 ? 104.802 58.457  -75.125  1.00 35.62  ? 422 LEU B N     1 
ATOM   6290  C  CA    . LEU B  1 316 ? 104.511 59.507  -74.140  1.00 35.19  ? 422 LEU B CA    1 
ATOM   6291  C  C     . LEU B  1 316 ? 103.031 59.609  -73.797  1.00 34.15  ? 422 LEU B C     1 
ATOM   6292  O  O     . LEU B  1 316 ? 102.258 60.188  -74.559  1.00 34.52  ? 422 LEU B O     1 
ATOM   6293  C  CB    . LEU B  1 316 ? 105.010 60.855  -74.670  1.00 35.89  ? 422 LEU B CB    1 
ATOM   6294  C  CG    . LEU B  1 316 ? 104.849 62.043  -73.720  1.00 35.98  ? 422 LEU B CG    1 
ATOM   6295  C  CD1   . LEU B  1 316 ? 105.607 61.825  -72.431  1.00 35.94  ? 422 LEU B CD1   1 
ATOM   6296  C  CD2   . LEU B  1 316 ? 105.304 63.331  -74.363  1.00 36.43  ? 422 LEU B CD2   1 
ATOM   6297  N  N     . THR B  1 317 ? 102.657 59.066  -72.642  1.00 33.02  ? 423 THR B N     1 
ATOM   6298  C  CA    . THR B  1 317 ? 101.250 58.978  -72.205  1.00 31.56  ? 423 THR B CA    1 
ATOM   6299  C  C     . THR B  1 317 ? 101.118 59.413  -70.738  1.00 33.00  ? 423 THR B C     1 
ATOM   6300  O  O     . THR B  1 317 ? 102.060 59.912  -70.149  1.00 35.79  ? 423 THR B O     1 
ATOM   6301  C  CB    . THR B  1 317 ? 100.734 57.541  -72.368  1.00 30.22  ? 423 THR B CB    1 
ATOM   6302  O  OG1   . THR B  1 317 ? 101.518 56.657  -71.560  1.00 29.64  ? 423 THR B OG1   1 
ATOM   6303  C  CG2   . THR B  1 317 ? 100.818 57.101  -73.802  1.00 30.33  ? 423 THR B CG2   1 
ATOM   6304  N  N     . ASP B  1 318 ? 99.942  59.228  -70.157  1.00 34.28  ? 424 ASP B N     1 
ATOM   6305  C  CA    . ASP B  1 318 ? 99.722  59.495  -68.722  1.00 35.28  ? 424 ASP B CA    1 
ATOM   6306  C  C     . ASP B  1 318 ? 100.638 58.699  -67.831  1.00 34.20  ? 424 ASP B C     1 
ATOM   6307  O  O     . ASP B  1 318 ? 100.860 59.098  -66.706  1.00 32.63  ? 424 ASP B O     1 
ATOM   6308  C  CB    . ASP B  1 318 ? 98.274  59.156  -68.307  1.00 38.06  ? 424 ASP B CB    1 
ATOM   6309  C  CG    . ASP B  1 318 ? 97.247  60.144  -68.811  1.00 40.43  ? 424 ASP B CG    1 
ATOM   6310  O  OD1   . ASP B  1 318 ? 97.538  61.001  -69.664  1.00 41.94  ? 424 ASP B OD1   1 
ATOM   6311  O  OD2   . ASP B  1 318 ? 96.103  60.020  -68.309  1.00 45.01  ? 424 ASP B OD2   1 
ATOM   6312  N  N     . ASN B  1 319 ? 101.133 57.564  -68.313  1.00 34.88  ? 425 ASN B N     1 
ATOM   6313  C  CA    . ASN B  1 319 ? 102.205 56.811  -67.650  1.00 35.03  ? 425 ASN B CA    1 
ATOM   6314  C  C     . ASN B  1 319 ? 103.266 57.657  -66.991  1.00 33.07  ? 425 ASN B C     1 
ATOM   6315  O  O     . ASN B  1 319 ? 103.830 57.313  -65.956  1.00 32.39  ? 425 ASN B O     1 
ATOM   6316  C  CB    . ASN B  1 319 ? 102.960 55.965  -68.670  1.00 37.11  ? 425 ASN B CB    1 
ATOM   6317  C  CG    . ASN B  1 319 ? 103.804 54.910  -67.992  1.00 39.21  ? 425 ASN B CG    1 
ATOM   6318  O  OD1   . ASN B  1 319 ? 103.242 54.124  -67.202  1.00 39.15  ? 425 ASN B OD1   1 
ATOM   6319  N  ND2   . ASN B  1 319 ? 105.167 54.916  -68.230  1.00 40.04  ? 425 ASN B ND2   1 
ATOM   6320  N  N     . ILE B  1 320 ? 103.650 58.718  -67.683  1.00 31.43  ? 426 ILE B N     1 
ATOM   6321  C  CA    . ILE B  1 320 ? 104.746 59.572  -67.255  1.00 31.15  ? 426 ILE B CA    1 
ATOM   6322  C  C     . ILE B  1 320 ? 104.552 60.107  -65.837  1.00 30.78  ? 426 ILE B C     1 
ATOM   6323  O  O     . ILE B  1 320 ? 105.520 60.311  -65.130  1.00 31.06  ? 426 ILE B O     1 
ATOM   6324  C  CB    . ILE B  1 320 ? 105.018 60.710  -68.295  1.00 30.79  ? 426 ILE B CB    1 
ATOM   6325  C  CG1   . ILE B  1 320 ? 106.488 61.021  -68.354  1.00 31.70  ? 426 ILE B CG1   1 
ATOM   6326  C  CG2   . ILE B  1 320 ? 104.241 61.980  -68.011  1.00 30.35  ? 426 ILE B CG2   1 
ATOM   6327  C  CD1   . ILE B  1 320 ? 107.244 59.958  -69.153  1.00 32.47  ? 426 ILE B CD1   1 
ATOM   6328  N  N     . PHE B  1 321 ? 103.299 60.322  -65.442  1.00 30.33  ? 427 PHE B N     1 
ATOM   6329  C  CA    . PHE B  1 321 ? 102.915 60.680  -64.078  1.00 30.37  ? 427 PHE B CA    1 
ATOM   6330  C  C     . PHE B  1 321 ? 103.378 59.605  -63.098  1.00 30.82  ? 427 PHE B C     1 
ATOM   6331  O  O     . PHE B  1 321 ? 104.099 59.891  -62.151  1.00 31.89  ? 427 PHE B O     1 
ATOM   6332  C  CB    . PHE B  1 321 ? 101.397 60.831  -64.013  1.00 29.27  ? 427 PHE B CB    1 
ATOM   6333  C  CG    . PHE B  1 321 ? 100.840 61.173  -62.650  1.00 28.22  ? 427 PHE B CG    1 
ATOM   6334  C  CD1   . PHE B  1 321 ? 100.536 60.178  -61.735  1.00 27.70  ? 427 PHE B CD1   1 
ATOM   6335  C  CD2   . PHE B  1 321 ? 100.537 62.498  -62.320  1.00 28.01  ? 427 PHE B CD2   1 
ATOM   6336  C  CE1   . PHE B  1 321 ? 100.042 60.499  -60.487  1.00 27.57  ? 427 PHE B CE1   1 
ATOM   6337  C  CE2   . PHE B  1 321 ? 99.980  62.799  -61.093  1.00 28.03  ? 427 PHE B CE2   1 
ATOM   6338  C  CZ    . PHE B  1 321 ? 99.746  61.806  -60.169  1.00 27.90  ? 427 PHE B CZ    1 
ATOM   6339  N  N     . LEU B  1 322 ? 102.967 58.364  -63.335  1.00 31.00  ? 428 LEU B N     1 
ATOM   6340  C  CA    . LEU B  1 322 ? 103.325 57.285  -62.422  1.00 31.72  ? 428 LEU B CA    1 
ATOM   6341  C  C     . LEU B  1 322 ? 104.796 56.910  -62.464  1.00 33.29  ? 428 LEU B C     1 
ATOM   6342  O  O     . LEU B  1 322 ? 105.328 56.384  -61.476  1.00 33.49  ? 428 LEU B O     1 
ATOM   6343  C  CB    . LEU B  1 322 ? 102.470 56.048  -62.704  1.00 31.61  ? 428 LEU B CB    1 
ATOM   6344  C  CG    . LEU B  1 322 ? 100.996 56.153  -62.315  1.00 30.50  ? 428 LEU B CG    1 
ATOM   6345  C  CD1   . LEU B  1 322 ? 100.383 54.777  -62.617  1.00 30.02  ? 428 LEU B CD1   1 
ATOM   6346  C  CD2   . LEU B  1 322 ? 100.787 56.445  -60.831  1.00 30.47  ? 428 LEU B CD2   1 
ATOM   6347  N  N     . GLU B  1 323 ? 105.447 57.178  -63.602  1.00 33.84  ? 429 GLU B N     1 
ATOM   6348  C  CA    . GLU B  1 323 ? 106.888 56.951  -63.753  1.00 34.28  ? 429 GLU B CA    1 
ATOM   6349  C  C     . GLU B  1 323 ? 107.616 57.858  -62.791  1.00 32.59  ? 429 GLU B C     1 
ATOM   6350  O  O     . GLU B  1 323 ? 108.438 57.382  -62.017  1.00 32.35  ? 429 GLU B O     1 
ATOM   6351  C  CB    . GLU B  1 323 ? 107.324 57.195  -65.203  1.00 36.68  ? 429 GLU B CB    1 
ATOM   6352  C  CG    . GLU B  1 323 ? 108.667 56.616  -65.613  1.00 39.26  ? 429 GLU B CG    1 
ATOM   6353  C  CD    . GLU B  1 323 ? 109.035 56.961  -67.064  1.00 40.81  ? 429 GLU B CD    1 
ATOM   6354  O  OE1   . GLU B  1 323 ? 108.250 56.661  -68.012  1.00 43.18  ? 429 GLU B OE1   1 
ATOM   6355  O  OE2   . GLU B  1 323 ? 110.138 57.506  -67.295  1.00 41.33  ? 429 GLU B OE2   1 
ATOM   6356  N  N     . ILE B  1 324 ? 107.270 59.146  -62.808  1.00 30.90  ? 430 ILE B N     1 
ATOM   6357  C  CA    . ILE B  1 324 ? 107.814 60.132  -61.877  1.00 30.45  ? 430 ILE B CA    1 
ATOM   6358  C  C     . ILE B  1 324 ? 107.489 59.762  -60.443  1.00 31.83  ? 430 ILE B C     1 
ATOM   6359  O  O     . ILE B  1 324 ? 108.362 59.792  -59.594  1.00 32.92  ? 430 ILE B O     1 
ATOM   6360  C  CB    . ILE B  1 324 ? 107.279 61.548  -62.161  1.00 29.32  ? 430 ILE B CB    1 
ATOM   6361  C  CG1   . ILE B  1 324 ? 107.833 62.052  -63.512  1.00 29.17  ? 430 ILE B CG1   1 
ATOM   6362  C  CG2   . ILE B  1 324 ? 107.698 62.529  -61.093  1.00 29.87  ? 430 ILE B CG2   1 
ATOM   6363  C  CD1   . ILE B  1 324 ? 107.023 63.230  -64.070  1.00 28.82  ? 430 ILE B CD1   1 
ATOM   6364  N  N     . LEU B  1 325 ? 106.236 59.416  -60.166  1.00 33.61  ? 431 LEU B N     1 
ATOM   6365  C  CA    . LEU B  1 325 ? 105.797 59.126  -58.797  1.00 35.60  ? 431 LEU B CA    1 
ATOM   6366  C  C     . LEU B  1 325 ? 106.513 57.930  -58.198  1.00 38.74  ? 431 LEU B C     1 
ATOM   6367  O  O     . LEU B  1 325 ? 106.961 57.996  -57.053  1.00 40.86  ? 431 LEU B O     1 
ATOM   6368  C  CB    . LEU B  1 325 ? 104.297 58.882  -58.738  1.00 35.29  ? 431 LEU B CB    1 
ATOM   6369  C  CG    . LEU B  1 325 ? 103.656 58.715  -57.340  1.00 33.78  ? 431 LEU B CG    1 
ATOM   6370  C  CD1   . LEU B  1 325 ? 103.616 60.038  -56.570  1.00 33.12  ? 431 LEU B CD1   1 
ATOM   6371  C  CD2   . LEU B  1 325 ? 102.257 58.118  -57.465  1.00 32.55  ? 431 LEU B CD2   1 
ATOM   6372  N  N     . TYR B  1 326 ? 106.621 56.849  -58.959  1.00 41.57  ? 432 TYR B N     1 
ATOM   6373  C  CA    . TYR B  1 326 ? 107.273 55.640  -58.468  1.00 44.71  ? 432 TYR B CA    1 
ATOM   6374  C  C     . TYR B  1 326 ? 108.805 55.661  -58.508  1.00 47.46  ? 432 TYR B C     1 
ATOM   6375  O  O     . TYR B  1 326 ? 109.421 54.756  -57.942  1.00 51.36  ? 432 TYR B O     1 
ATOM   6376  C  CB    . TYR B  1 326 ? 106.764 54.404  -59.230  1.00 44.88  ? 432 TYR B CB    1 
ATOM   6377  C  CG    . TYR B  1 326 ? 105.279 54.123  -59.125  1.00 45.95  ? 432 TYR B CG    1 
ATOM   6378  C  CD1   . TYR B  1 326 ? 104.539 54.499  -58.003  1.00 45.70  ? 432 TYR B CD1   1 
ATOM   6379  C  CD2   . TYR B  1 326 ? 104.616 53.432  -60.144  1.00 47.62  ? 432 TYR B CD2   1 
ATOM   6380  C  CE1   . TYR B  1 326 ? 103.181 54.219  -57.911  1.00 46.12  ? 432 TYR B CE1   1 
ATOM   6381  C  CE2   . TYR B  1 326 ? 103.256 53.150  -60.057  1.00 48.67  ? 432 TYR B CE2   1 
ATOM   6382  C  CZ    . TYR B  1 326 ? 102.550 53.544  -58.923  1.00 47.29  ? 432 TYR B CZ    1 
ATOM   6383  O  OH    . TYR B  1 326 ? 101.208 53.289  -58.816  1.00 47.94  ? 432 TYR B OH    1 
ATOM   6384  N  N     . SER B  1 327 ? 109.419 56.667  -59.130  1.00 48.07  ? 433 SER B N     1 
ATOM   6385  C  CA    . SER B  1 327 ? 110.878 56.675  -59.296  1.00 47.99  ? 433 SER B CA    1 
ATOM   6386  C  C     . SER B  1 327 ? 111.625 56.854  -57.985  1.00 47.66  ? 433 SER B C     1 
ATOM   6387  O  O     . SER B  1 327 ? 111.092 57.375  -57.017  1.00 49.90  ? 433 SER B O     1 
ATOM   6388  C  CB    . SER B  1 327 ? 111.332 57.764  -60.266  1.00 47.75  ? 433 SER B CB    1 
ATOM   6389  O  OG    . SER B  1 327 ? 111.110 59.034  -59.709  1.00 48.73  ? 433 SER B OG    1 
ATOM   6390  N  N     . THR B  1 328 ? 112.875 56.399  -58.005  1.00 48.17  ? 434 THR B N     1 
ATOM   6391  C  CA    . THR B  1 328 ? 113.838 56.578  -56.915  1.00 48.83  ? 434 THR B CA    1 
ATOM   6392  C  C     . THR B  1 328 ? 115.062 57.423  -57.341  1.00 50.20  ? 434 THR B C     1 
ATOM   6393  O  O     . THR B  1 328 ? 115.893 57.745  -56.506  1.00 51.42  ? 434 THR B O     1 
ATOM   6394  C  CB    . THR B  1 328 ? 114.326 55.221  -56.375  1.00 47.89  ? 434 THR B CB    1 
ATOM   6395  O  OG1   . THR B  1 328 ? 114.750 54.401  -57.455  1.00 49.25  ? 434 THR B OG1   1 
ATOM   6396  C  CG2   . THR B  1 328 ? 113.214 54.487  -55.637  1.00 46.77  ? 434 THR B CG2   1 
ATOM   6397  N  N     . ASP B  1 329 ? 115.173 57.786  -58.619  1.00 50.89  ? 435 ASP B N     1 
ATOM   6398  C  CA    . ASP B  1 329 ? 116.205 58.691  -59.096  1.00 53.63  ? 435 ASP B CA    1 
ATOM   6399  C  C     . ASP B  1 329 ? 116.205 60.000  -58.290  1.00 56.57  ? 435 ASP B C     1 
ATOM   6400  O  O     . ASP B  1 329 ? 115.178 60.660  -58.198  1.00 59.94  ? 435 ASP B O     1 
ATOM   6401  C  CB    . ASP B  1 329 ? 115.995 58.972  -60.590  1.00 53.62  ? 435 ASP B CB    1 
ATOM   6402  C  CG    . ASP B  1 329 ? 117.177 59.689  -61.250  1.00 55.02  ? 435 ASP B CG    1 
ATOM   6403  O  OD1   . ASP B  1 329 ? 117.906 60.448  -60.580  1.00 58.08  ? 435 ASP B OD1   1 
ATOM   6404  O  OD2   . ASP B  1 329 ? 117.301 59.463  -62.473  1.00 55.22  ? 435 ASP B OD2   1 
ATOM   6405  N  N     . PRO B  1 330 ? 117.349 60.367  -57.679  1.00 61.84  ? 436 PRO B N     1 
ATOM   6406  C  CA    . PRO B  1 330 ? 117.354 61.638  -56.952  1.00 64.47  ? 436 PRO B CA    1 
ATOM   6407  C  C     . PRO B  1 330 ? 117.242 62.886  -57.812  1.00 62.37  ? 436 PRO B C     1 
ATOM   6408  O  O     . PRO B  1 330 ? 116.940 63.952  -57.278  1.00 61.99  ? 436 PRO B O     1 
ATOM   6409  C  CB    . PRO B  1 330 ? 118.690 61.613  -56.212  1.00 68.80  ? 436 PRO B CB    1 
ATOM   6410  C  CG    . PRO B  1 330 ? 119.028 60.163  -56.083  1.00 68.49  ? 436 PRO B CG    1 
ATOM   6411  C  CD    . PRO B  1 330 ? 118.530 59.548  -57.341  1.00 66.01  ? 436 PRO B CD    1 
ATOM   6412  N  N     . LYS B  1 331 ? 117.490 62.775  -59.119  1.00 61.80  ? 437 LYS B N     1 
ATOM   6413  C  CA    . LYS B  1 331 ? 117.295 63.907  -60.033  1.00 65.53  ? 437 LYS B CA    1 
ATOM   6414  C  C     . LYS B  1 331 ? 115.831 64.304  -60.143  1.00 62.34  ? 437 LYS B C     1 
ATOM   6415  O  O     . LYS B  1 331 ? 115.517 65.482  -60.323  1.00 65.02  ? 437 LYS B O     1 
ATOM   6416  C  CB    . LYS B  1 331 ? 117.882 63.598  -61.405  1.00 67.69  ? 437 LYS B CB    1 
ATOM   6417  C  CG    . LYS B  1 331 ? 119.394 63.486  -61.387  1.00 72.35  ? 437 LYS B CG    1 
ATOM   6418  C  CD    . LYS B  1 331 ? 119.948 63.056  -62.730  1.00 73.30  ? 437 LYS B CD    1 
ATOM   6419  C  CE    . LYS B  1 331 ? 121.389 63.539  -62.870  1.00 76.40  ? 437 LYS B CE    1 
ATOM   6420  N  NZ    . LYS B  1 331 ? 121.895 63.344  -64.247  1.00 80.25  ? 437 LYS B NZ    1 
ATOM   6421  N  N     . LEU B  1 332 ? 114.939 63.320  -59.999  1.00 58.52  ? 438 LEU B N     1 
ATOM   6422  C  CA    . LEU B  1 332 ? 113.483 63.526  -60.051  1.00 56.28  ? 438 LEU B CA    1 
ATOM   6423  C  C     . LEU B  1 332 ? 112.844 63.813  -58.691  1.00 56.25  ? 438 LEU B C     1 
ATOM   6424  O  O     . LEU B  1 332 ? 111.633 63.799  -58.598  1.00 53.68  ? 438 LEU B O     1 
ATOM   6425  C  CB    . LEU B  1 332 ? 112.812 62.288  -60.648  1.00 54.87  ? 438 LEU B CB    1 
ATOM   6426  C  CG    . LEU B  1 332 ? 113.072 61.946  -62.111  1.00 54.21  ? 438 LEU B CG    1 
ATOM   6427  C  CD1   . LEU B  1 332 ? 112.465 60.581  -62.430  1.00 52.35  ? 438 LEU B CD1   1 
ATOM   6428  C  CD2   . LEU B  1 332 ? 112.538 63.002  -63.076  1.00 54.38  ? 438 LEU B CD2   1 
ATOM   6429  N  N     . LYS B  1 333 ? 113.624 64.081  -57.646  1.00 58.79  ? 439 LYS B N     1 
ATOM   6430  C  CA    . LYS B  1 333 ? 113.053 64.284  -56.303  1.00 57.22  ? 439 LYS B CA    1 
ATOM   6431  C  C     . LYS B  1 333 ? 112.139 65.493  -56.252  1.00 55.36  ? 439 LYS B C     1 
ATOM   6432  O  O     . LYS B  1 333 ? 111.087 65.421  -55.651  1.00 52.81  ? 439 LYS B O     1 
ATOM   6433  C  CB    . LYS B  1 333 ? 114.132 64.372  -55.219  1.00 61.56  ? 439 LYS B CB    1 
ATOM   6434  C  CG    . LYS B  1 333 ? 113.577 64.462  -53.804  1.00 64.71  ? 439 LYS B CG    1 
ATOM   6435  C  CD    . LYS B  1 333 ? 114.641 64.853  -52.801  1.00 67.27  ? 439 LYS B CD    1 
ATOM   6436  C  CE    . LYS B  1 333 ? 113.986 65.434  -51.562  1.00 69.07  ? 439 LYS B CE    1 
ATOM   6437  N  NZ    . LYS B  1 333 ? 114.925 66.370  -50.923  1.00 70.44  ? 439 LYS B NZ    1 
ATOM   6438  N  N     . ASP B  1 334 ? 112.518 66.591  -56.892  1.00 58.85  ? 440 ASP B N     1 
ATOM   6439  C  CA    . ASP B  1 334 ? 111.675 67.802  -56.920  1.00 63.29  ? 440 ASP B CA    1 
ATOM   6440  C  C     . ASP B  1 334 ? 110.307 67.546  -57.562  1.00 60.88  ? 440 ASP B C     1 
ATOM   6441  O  O     . ASP B  1 334 ? 109.283 68.003  -57.040  1.00 63.32  ? 440 ASP B O     1 
ATOM   6442  C  CB    . ASP B  1 334 ? 112.357 68.946  -57.682  1.00 69.12  ? 440 ASP B CB    1 
ATOM   6443  C  CG    . ASP B  1 334 ? 113.386 69.699  -56.864  1.00 73.21  ? 440 ASP B CG    1 
ATOM   6444  O  OD1   . ASP B  1 334 ? 113.792 69.227  -55.793  1.00 79.42  ? 440 ASP B OD1   1 
ATOM   6445  O  OD2   . ASP B  1 334 ? 113.787 70.806  -57.297  1.00 75.22  ? 440 ASP B OD2   1 
ATOM   6446  N  N     . ALA B  1 335 ? 110.305 66.838  -58.692  1.00 57.44  ? 441 ALA B N     1 
ATOM   6447  C  CA    . ALA B  1 335 ? 109.071 66.488  -59.393  1.00 54.86  ? 441 ALA B CA    1 
ATOM   6448  C  C     . ALA B  1 335 ? 108.219 65.513  -58.596  1.00 53.16  ? 441 ALA B C     1 
ATOM   6449  O  O     . ALA B  1 335 ? 107.044 65.742  -58.390  1.00 52.59  ? 441 ALA B O     1 
ATOM   6450  C  CB    . ALA B  1 335 ? 109.403 65.903  -60.755  1.00 55.38  ? 441 ALA B CB    1 
ATOM   6451  N  N     . ARG B  1 336 ? 108.832 64.435  -58.134  1.00 53.93  ? 442 ARG B N     1 
ATOM   6452  C  CA    . ARG B  1 336 ? 108.165 63.418  -57.314  1.00 54.07  ? 442 ARG B CA    1 
ATOM   6453  C  C     . ARG B  1 336 ? 107.531 63.992  -56.058  1.00 55.77  ? 442 ARG B C     1 
ATOM   6454  O  O     . ARG B  1 336 ? 106.512 63.489  -55.623  1.00 56.68  ? 442 ARG B O     1 
ATOM   6455  C  CB    . ARG B  1 336 ? 109.152 62.302  -56.947  1.00 57.47  ? 442 ARG B CB    1 
ATOM   6456  C  CG    . ARG B  1 336 ? 108.572 61.136  -56.152  1.00 61.71  ? 442 ARG B CG    1 
ATOM   6457  C  CD    . ARG B  1 336 ? 109.498 59.914  -56.090  1.00 68.73  ? 442 ARG B CD    1 
ATOM   6458  N  NE    . ARG B  1 336 ? 110.825 60.192  -55.534  1.00 83.01  ? 442 ARG B NE    1 
ATOM   6459  C  CZ    . ARG B  1 336 ? 111.953 60.450  -56.244  1.00 93.09  ? 442 ARG B CZ    1 
ATOM   6460  N  NH1   . ARG B  1 336 ? 111.951 60.470  -57.578  1.00 95.26  ? 442 ARG B NH1   1 
ATOM   6461  N  NH2   . ARG B  1 336 ? 113.115 60.676  -55.626  1.00 95.76  ? 442 ARG B NH2   1 
ATOM   6462  N  N     . GLU B  1 337 ? 108.115 65.031  -55.469  1.00 60.92  ? 443 GLU B N     1 
ATOM   6463  C  CA    . GLU B  1 337 ? 107.542 65.647  -54.261  1.00 64.28  ? 443 GLU B CA    1 
ATOM   6464  C  C     . GLU B  1 337 ? 106.242 66.377  -54.560  1.00 58.73  ? 443 GLU B C     1 
ATOM   6465  O  O     . GLU B  1 337 ? 105.338 66.350  -53.736  1.00 59.67  ? 443 GLU B O     1 
ATOM   6466  C  CB    . GLU B  1 337 ? 108.521 66.604  -53.545  1.00 71.18  ? 443 GLU B CB    1 
ATOM   6467  C  CG    . GLU B  1 337 ? 109.650 65.953  -52.732  1.00 75.53  ? 443 GLU B CG    1 
ATOM   6468  C  CD    . GLU B  1 337 ? 109.183 64.919  -51.701  1.00 77.30  ? 443 GLU B CD    1 
ATOM   6469  O  OE1   . GLU B  1 337 ? 108.051 65.055  -51.163  1.00 75.10  ? 443 GLU B OE1   1 
ATOM   6470  O  OE2   . GLU B  1 337 ? 109.966 63.968  -51.443  1.00 77.80  ? 443 GLU B OE2   1 
ATOM   6471  N  N     . ILE B  1 338 ? 106.145 67.019  -55.720  1.00 51.28  ? 444 ILE B N     1 
ATOM   6472  C  CA    . ILE B  1 338 ? 104.893 67.676  -56.120  1.00 45.51  ? 444 ILE B CA    1 
ATOM   6473  C  C     . ILE B  1 338 ? 103.781 66.653  -56.287  1.00 43.62  ? 444 ILE B C     1 
ATOM   6474  O  O     . ILE B  1 338 ? 102.683 66.840  -55.755  1.00 42.88  ? 444 ILE B O     1 
ATOM   6475  C  CB    . ILE B  1 338 ? 105.027 68.511  -57.403  1.00 43.30  ? 444 ILE B CB    1 
ATOM   6476  C  CG1   . ILE B  1 338 ? 105.922 69.716  -57.140  1.00 43.27  ? 444 ILE B CG1   1 
ATOM   6477  C  CG2   . ILE B  1 338 ? 103.681 69.023  -57.846  1.00 43.15  ? 444 ILE B CG2   1 
ATOM   6478  C  CD1   . ILE B  1 338 ? 106.256 70.575  -58.334  1.00 42.99  ? 444 ILE B CD1   1 
ATOM   6479  N  N     . LEU B  1 339 ? 104.060 65.575  -57.010  1.00 43.25  ? 445 LEU B N     1 
ATOM   6480  C  CA    . LEU B  1 339 ? 103.060 64.532  -57.228  1.00 42.40  ? 445 LEU B CA    1 
ATOM   6481  C  C     . LEU B  1 339 ? 102.682 63.821  -55.941  1.00 44.06  ? 445 LEU B C     1 
ATOM   6482  O  O     . LEU B  1 339 ? 101.539 63.420  -55.783  1.00 43.42  ? 445 LEU B O     1 
ATOM   6483  C  CB    . LEU B  1 339 ? 103.524 63.515  -58.265  1.00 41.28  ? 445 LEU B CB    1 
ATOM   6484  C  CG    . LEU B  1 339 ? 103.925 64.042  -59.642  1.00 41.10  ? 445 LEU B CG    1 
ATOM   6485  C  CD1   . LEU B  1 339 ? 104.136 62.841  -60.566  1.00 40.33  ? 445 LEU B CD1   1 
ATOM   6486  C  CD2   . LEU B  1 339 ? 102.919 65.019  -60.226  1.00 40.90  ? 445 LEU B CD2   1 
ATOM   6487  N  N     . LYS B  1 340 ? 103.627 63.668  -55.013  1.00 48.62  ? 446 LYS B N     1 
ATOM   6488  C  CA    . LYS B  1 340 ? 103.312 63.092  -53.702  1.00 53.82  ? 446 LYS B CA    1 
ATOM   6489  C  C     . LYS B  1 340 ? 102.394 64.033  -52.922  1.00 55.80  ? 446 LYS B C     1 
ATOM   6490  O  O     . LYS B  1 340 ? 101.504 63.558  -52.234  1.00 58.02  ? 446 LYS B O     1 
ATOM   6491  C  CB    . LYS B  1 340 ? 104.563 62.734  -52.909  1.00 56.84  ? 446 LYS B CB    1 
ATOM   6492  C  CG    . LYS B  1 340 ? 104.947 61.256  -52.955  1.00 60.15  ? 446 LYS B CG    1 
ATOM   6493  C  CD    . LYS B  1 340 ? 106.233 61.059  -52.105  1.00 62.90  ? 446 LYS B CD    1 
ATOM   6494  C  CE    . LYS B  1 340 ? 106.294 60.119  -50.806  1.00 64.95  ? 446 LYS B CE    1 
ATOM   6495  N  NZ    . LYS B  1 340 ? 106.407 60.892  -49.503  1.00 67.14  ? 446 LYS B NZ    1 
ATOM   6496  N  N     . GLN B  1 341 ? 102.586 65.348  -53.061  1.00 56.43  ? 447 GLN B N     1 
ATOM   6497  C  CA    . GLN B  1 341 ? 101.695 66.327  -52.432  1.00 57.87  ? 447 GLN B CA    1 
ATOM   6498  C  C     . GLN B  1 341 ? 100.256 66.273  -52.962  1.00 55.75  ? 447 GLN B C     1 
ATOM   6499  O  O     . GLN B  1 341 ? 99.331  66.627  -52.243  1.00 61.58  ? 447 GLN B O     1 
ATOM   6500  C  CB    . GLN B  1 341 ? 102.267 67.774  -52.496  1.00 61.36  ? 447 GLN B CB    1 
ATOM   6501  C  CG    . GLN B  1 341 ? 103.458 68.043  -51.550  1.00 65.12  ? 447 GLN B CG    1 
ATOM   6502  C  CD    . GLN B  1 341 ? 103.303 67.416  -50.133  1.00 67.99  ? 447 GLN B CD    1 
ATOM   6503  O  OE1   . GLN B  1 341 ? 102.633 67.969  -49.261  1.00 66.82  ? 447 GLN B OE1   1 
ATOM   6504  N  NE2   . GLN B  1 341 ? 103.916 66.251  -49.917  1.00 70.53  ? 447 GLN B NE2   1 
ATOM   6505  N  N     . ILE B  1 342 ? 100.063 65.822  -54.197  1.00 50.45  ? 448 ILE B N     1 
ATOM   6506  C  CA    . ILE B  1 342 ? 98.722  65.607  -54.744  1.00 46.39  ? 448 ILE B CA    1 
ATOM   6507  C  C     . ILE B  1 342 ? 98.055  64.376  -54.109  1.00 44.72  ? 448 ILE B C     1 
ATOM   6508  O  O     . ILE B  1 342 ? 96.842  64.388  -53.813  1.00 45.45  ? 448 ILE B O     1 
ATOM   6509  C  CB    . ILE B  1 342 ? 98.756  65.479  -56.284  1.00 46.34  ? 448 ILE B CB    1 
ATOM   6510  C  CG1   . ILE B  1 342 ? 99.101  66.820  -56.924  1.00 45.97  ? 448 ILE B CG1   1 
ATOM   6511  C  CG2   . ILE B  1 342 ? 97.396  65.033  -56.823  1.00 46.43  ? 448 ILE B CG2   1 
ATOM   6512  C  CD1   . ILE B  1 342 ? 99.395  66.757  -58.418  1.00 46.03  ? 448 ILE B CD1   1 
ATOM   6513  N  N     . GLU B  1 343 ? 98.829  63.315  -53.925  1.00 42.94  ? 449 GLU B N     1 
ATOM   6514  C  CA    . GLU B  1 343 ? 98.312  62.102  -53.275  1.00 41.67  ? 449 GLU B CA    1 
ATOM   6515  C  C     . GLU B  1 343 ? 97.763  62.411  -51.902  1.00 38.21  ? 449 GLU B C     1 
ATOM   6516  O  O     . GLU B  1 343 ? 96.628  62.065  -51.588  1.00 36.87  ? 449 GLU B O     1 
ATOM   6517  C  CB    . GLU B  1 343 ? 99.390  60.986  -53.205  1.00 44.78  ? 449 GLU B CB    1 
ATOM   6518  C  CG    . GLU B  1 343 ? 99.544  60.238  -54.540  1.00 48.71  ? 449 GLU B CG    1 
ATOM   6519  C  CD    . GLU B  1 343 ? 99.989  58.784  -54.412  1.00 49.57  ? 449 GLU B CD    1 
ATOM   6520  O  OE1   . GLU B  1 343 ? 100.904 58.522  -53.602  1.00 50.05  ? 449 GLU B OE1   1 
ATOM   6521  O  OE2   . GLU B  1 343 ? 99.402  57.968  -55.140  1.00 46.30  ? 449 GLU B OE2   1 
ATOM   6522  N  N     . TYR B  1 344 ? 98.571  63.115  -51.117  1.00 37.47  ? 450 TYR B N     1 
ATOM   6523  C  CA    . TYR B  1 344 ? 98.234  63.499  -49.720  1.00 37.58  ? 450 TYR B CA    1 
ATOM   6524  C  C     . TYR B  1 344 ? 97.197  64.608  -49.645  1.00 35.58  ? 450 TYR B C     1 
ATOM   6525  O  O     . TYR B  1 344 ? 96.636  64.851  -48.597  1.00 31.76  ? 450 TYR B O     1 
ATOM   6526  C  CB    . TYR B  1 344 ? 99.505  63.885  -48.921  1.00 39.66  ? 450 TYR B CB    1 
ATOM   6527  C  CG    . TYR B  1 344 ? 100.400 62.696  -48.582  1.00 39.82  ? 450 TYR B CG    1 
ATOM   6528  C  CD1   . TYR B  1 344 ? 100.014 61.783  -47.609  1.00 39.33  ? 450 TYR B CD1   1 
ATOM   6529  C  CD2   . TYR B  1 344 ? 101.631 62.484  -49.241  1.00 39.71  ? 450 TYR B CD2   1 
ATOM   6530  C  CE1   . TYR B  1 344 ? 100.806 60.685  -47.308  1.00 39.42  ? 450 TYR B CE1   1 
ATOM   6531  C  CE2   . TYR B  1 344 ? 102.410 61.386  -48.961  1.00 39.26  ? 450 TYR B CE2   1 
ATOM   6532  C  CZ    . TYR B  1 344 ? 101.997 60.487  -48.001  1.00 39.10  ? 450 TYR B CZ    1 
ATOM   6533  O  OH    . TYR B  1 344 ? 102.744 59.386  -47.687  1.00 38.14  ? 450 TYR B OH    1 
ATOM   6534  N  N     . ARG B  1 345 ? 96.976  65.288  -50.756  1.00 36.64  ? 451 ARG B N     1 
ATOM   6535  C  CA    . ARG B  1 345 ? 95.964  66.344  -50.905  1.00 36.64  ? 451 ARG B CA    1 
ATOM   6536  C  C     . ARG B  1 345 ? 96.402  67.649  -50.248  1.00 37.05  ? 451 ARG B C     1 
ATOM   6537  O  O     . ARG B  1 345 ? 95.559  68.390  -49.763  1.00 38.32  ? 451 ARG B O     1 
ATOM   6538  C  CB    . ARG B  1 345 ? 94.575  65.886  -50.409  1.00 35.63  ? 451 ARG B CB    1 
ATOM   6539  C  CG    . ARG B  1 345 ? 93.397  66.568  -51.144  1.00 34.44  ? 451 ARG B CG    1 
ATOM   6540  C  CD    . ARG B  1 345 ? 93.113  65.864  -52.470  1.00 34.34  ? 451 ARG B CD    1 
ATOM   6541  N  NE    . ARG B  1 345 ? 92.009  66.457  -53.240  1.00 34.81  ? 451 ARG B NE    1 
ATOM   6542  C  CZ    . ARG B  1 345 ? 91.657  66.050  -54.471  1.00 35.31  ? 451 ARG B CZ    1 
ATOM   6543  N  NH1   . ARG B  1 345 ? 92.319  65.034  -55.074  1.00 36.29  ? 451 ARG B NH1   1 
ATOM   6544  N  NH2   . ARG B  1 345 ? 90.632  66.615  -55.079  1.00 33.73  ? 451 ARG B NH2   1 
ATOM   6545  N  N     . ASN B  1 346 ? 97.706  67.934  -50.274  1.00 37.79  ? 452 ASN B N     1 
ATOM   6546  C  CA    . ASN B  1 346 ? 98.263  69.244  -49.887  1.00 40.27  ? 452 ASN B CA    1 
ATOM   6547  C  C     . ASN B  1 346 ? 98.392  70.034  -51.152  1.00 40.31  ? 452 ASN B C     1 
ATOM   6548  O  O     . ASN B  1 346 ? 99.471  70.201  -51.699  1.00 41.93  ? 452 ASN B O     1 
ATOM   6549  C  CB    . ASN B  1 346 ? 99.626  69.104  -49.202  1.00 43.17  ? 452 ASN B CB    1 
ATOM   6550  C  CG    . ASN B  1 346 ? 99.554  68.292  -47.927  1.00 48.23  ? 452 ASN B CG    1 
ATOM   6551  O  OD1   . ASN B  1 346 ? 98.624  68.469  -47.114  1.00 56.18  ? 452 ASN B OD1   1 
ATOM   6552  N  ND2   . ASN B  1 346 ? 100.520 67.377  -47.741  1.00 47.98  ? 452 ASN B ND2   1 
ATOM   6553  N  N     . LEU B  1 347 ? 97.255  70.489  -51.635  1.00 40.42  ? 453 LEU B N     1 
ATOM   6554  C  CA    . LEU B  1 347 ? 97.205  71.265  -52.865  1.00 40.07  ? 453 LEU B CA    1 
ATOM   6555  C  C     . LEU B  1 347 ? 97.359  72.718  -52.477  1.00 40.45  ? 453 LEU B C     1 
ATOM   6556  O  O     . LEU B  1 347 ? 97.103  73.106  -51.338  1.00 37.94  ? 453 LEU B O     1 
ATOM   6557  C  CB    . LEU B  1 347 ? 95.864  71.049  -53.584  1.00 39.40  ? 453 LEU B CB    1 
ATOM   6558  C  CG    . LEU B  1 347 ? 95.368  69.605  -53.709  1.00 39.42  ? 453 LEU B CG    1 
ATOM   6559  C  CD1   . LEU B  1 347 ? 94.124  69.509  -54.550  1.00 38.65  ? 453 LEU B CD1   1 
ATOM   6560  C  CD2   . LEU B  1 347 ? 96.437  68.710  -54.316  1.00 41.16  ? 453 LEU B CD2   1 
ATOM   6561  N  N     . PHE B  1 348 ? 97.768  73.500  -53.459  1.00 42.37  ? 454 PHE B N     1 
ATOM   6562  C  CA    . PHE B  1 348 ? 97.812  74.958  -53.284  1.00 45.07  ? 454 PHE B CA    1 
ATOM   6563  C  C     . PHE B  1 348 ? 96.396  75.444  -52.973  1.00 47.47  ? 454 PHE B C     1 
ATOM   6564  O  O     . PHE B  1 348 ? 95.439  74.964  -53.587  1.00 48.22  ? 454 PHE B O     1 
ATOM   6565  C  CB    . PHE B  1 348 ? 98.367  75.650  -54.543  1.00 45.50  ? 454 PHE B CB    1 
ATOM   6566  C  CG    . PHE B  1 348 ? 99.735  75.131  -54.984  1.00 45.67  ? 454 PHE B CG    1 
ATOM   6567  C  CD1   . PHE B  1 348 ? 100.712 74.679  -54.058  1.00 46.32  ? 454 PHE B CD1   1 
ATOM   6568  C  CD2   . PHE B  1 348 ? 100.066 75.109  -56.358  1.00 45.78  ? 454 PHE B CD2   1 
ATOM   6569  C  CE1   . PHE B  1 348 ? 101.931 74.235  -54.522  1.00 47.83  ? 454 PHE B CE1   1 
ATOM   6570  C  CE2   . PHE B  1 348 ? 101.305 74.671  -56.773  1.00 47.04  ? 454 PHE B CE2   1 
ATOM   6571  C  CZ    . PHE B  1 348 ? 102.233 74.227  -55.882  1.00 47.76  ? 454 PHE B CZ    1 
ATOM   6572  N  N     . LYS B  1 349 ? 96.250  76.378  -52.066  1.00 50.75  ? 455 LYS B N     1 
ATOM   6573  C  CA    . LYS B  1 349 ? 94.907  76.790  -51.627  1.00 52.47  ? 455 LYS B CA    1 
ATOM   6574  C  C     . LYS B  1 349 ? 94.299  77.853  -52.535  1.00 50.45  ? 455 LYS B C     1 
ATOM   6575  O  O     . LYS B  1 349 ? 94.956  78.814  -52.919  1.00 46.83  ? 455 LYS B O     1 
ATOM   6576  C  CB    . LYS B  1 349 ? 94.929  77.329  -50.198  1.00 57.48  ? 455 LYS B CB    1 
ATOM   6577  C  CG    . LYS B  1 349 ? 95.268  76.279  -49.151  1.00 62.54  ? 455 LYS B CG    1 
ATOM   6578  C  CD    . LYS B  1 349 ? 94.091  75.337  -48.864  1.00 65.80  ? 455 LYS B CD    1 
ATOM   6579  C  CE    . LYS B  1 349 ? 94.542  73.878  -48.596  1.00 69.20  ? 455 LYS B CE    1 
ATOM   6580  N  NZ    . LYS B  1 349 ? 93.382  73.021  -48.859  1.00 71.19  ? 455 LYS B NZ    1 
ATOM   6581  N  N     . TYR B  1 350 ? 93.026  77.660  -52.860  1.00 48.95  ? 456 TYR B N     1 
ATOM   6582  C  CA    . TYR B  1 350 ? 92.276  78.592  -53.681  1.00 46.73  ? 456 TYR B CA    1 
ATOM   6583  C  C     . TYR B  1 350 ? 91.925  79.803  -52.832  1.00 47.58  ? 456 TYR B C     1 
ATOM   6584  O  O     . TYR B  1 350 ? 91.399  79.654  -51.745  1.00 50.07  ? 456 TYR B O     1 
ATOM   6585  C  CB    . TYR B  1 350 ? 91.011  77.910  -54.198  1.00 43.25  ? 456 TYR B CB    1 
ATOM   6586  C  CG    . TYR B  1 350 ? 89.985  78.779  -54.901  1.00 42.42  ? 456 TYR B CG    1 
ATOM   6587  C  CD1   . TYR B  1 350 ? 90.193  79.259  -56.176  1.00 41.90  ? 456 TYR B CD1   1 
ATOM   6588  C  CD2   . TYR B  1 350 ? 88.764  79.058  -54.299  1.00 43.07  ? 456 TYR B CD2   1 
ATOM   6589  C  CE1   . TYR B  1 350 ? 89.229  80.028  -56.830  1.00 41.94  ? 456 TYR B CE1   1 
ATOM   6590  C  CE2   . TYR B  1 350 ? 87.792  79.819  -54.939  1.00 42.61  ? 456 TYR B CE2   1 
ATOM   6591  C  CZ    . TYR B  1 350 ? 88.027  80.300  -56.202  1.00 41.93  ? 456 TYR B CZ    1 
ATOM   6592  O  OH    . TYR B  1 350 ? 87.054  81.045  -56.817  1.00 39.73  ? 456 TYR B OH    1 
ATOM   6593  N  N     . VAL B  1 351 ? 92.228  80.992  -53.330  1.00 48.72  ? 457 VAL B N     1 
ATOM   6594  C  CA    . VAL B  1 351 ? 91.954  82.226  -52.618  1.00 50.07  ? 457 VAL B CA    1 
ATOM   6595  C  C     . VAL B  1 351 ? 90.628  82.837  -53.074  1.00 50.97  ? 457 VAL B C     1 
ATOM   6596  O  O     . VAL B  1 351 ? 89.798  83.237  -52.242  1.00 54.73  ? 457 VAL B O     1 
ATOM   6597  C  CB    . VAL B  1 351 ? 93.095  83.232  -52.820  1.00 50.75  ? 457 VAL B CB    1 
ATOM   6598  C  CG1   . VAL B  1 351 ? 92.793  84.560  -52.103  1.00 52.49  ? 457 VAL B CG1   1 
ATOM   6599  C  CG2   . VAL B  1 351 ? 94.401  82.650  -52.305  1.00 50.48  ? 457 VAL B CG2   1 
ATOM   6600  N  N     . GLY B  1 352 ? 90.441  82.916  -54.391  1.00 50.22  ? 458 GLY B N     1 
ATOM   6601  C  CA    . GLY B  1 352 ? 89.202  83.440  -54.967  1.00 49.99  ? 458 GLY B CA    1 
ATOM   6602  C  C     . GLY B  1 352 ? 89.255  83.656  -56.466  1.00 49.35  ? 458 GLY B C     1 
ATOM   6603  O  O     . GLY B  1 352 ? 90.286  83.457  -57.095  1.00 50.55  ? 458 GLY B O     1 
ATOM   6604  N  N     . GLU B  1 353 ? 88.127  84.080  -57.023  1.00 49.05  ? 459 GLU B N     1 
ATOM   6605  C  CA    . GLU B  1 353 ? 87.966  84.291  -58.450  1.00 50.26  ? 459 GLU B CA    1 
ATOM   6606  C  C     . GLU B  1 353 ? 87.543  85.725  -58.672  1.00 50.80  ? 459 GLU B C     1 
ATOM   6607  O  O     . GLU B  1 353 ? 86.876  86.304  -57.838  1.00 50.11  ? 459 GLU B O     1 
ATOM   6608  C  CB    . GLU B  1 353 ? 86.906  83.318  -58.995  1.00 51.74  ? 459 GLU B CB    1 
ATOM   6609  C  CG    . GLU B  1 353 ? 86.551  83.438  -60.480  1.00 53.66  ? 459 GLU B CG    1 
ATOM   6610  C  CD    . GLU B  1 353 ? 85.593  82.325  -60.934  1.00 55.70  ? 459 GLU B CD    1 
ATOM   6611  O  OE1   . GLU B  1 353 ? 84.561  82.027  -60.294  1.00 57.28  ? 459 GLU B OE1   1 
ATOM   6612  O  OE2   . GLU B  1 353 ? 85.911  81.657  -61.928  1.00 57.75  ? 459 GLU B OE2   1 
ATOM   6613  N  N     . THR B  1 354 ? 87.937  86.293  -59.801  1.00 54.62  ? 460 THR B N     1 
ATOM   6614  C  CA    . THR B  1 354 ? 87.489  87.628  -60.202  1.00 57.36  ? 460 THR B CA    1 
ATOM   6615  C  C     . THR B  1 354 ? 87.530  87.800  -61.714  1.00 57.19  ? 460 THR B C     1 
ATOM   6616  O  O     . THR B  1 354 ? 88.160  87.019  -62.424  1.00 59.10  ? 460 THR B O     1 
ATOM   6617  C  CB    . THR B  1 354 ? 88.309  88.735  -59.513  1.00 60.11  ? 460 THR B CB    1 
ATOM   6618  O  OG1   . THR B  1 354 ? 87.688  90.013  -59.724  1.00 65.33  ? 460 THR B OG1   1 
ATOM   6619  C  CG2   . THR B  1 354 ? 89.749  88.760  -60.014  1.00 61.50  ? 460 THR B CG2   1 
ATOM   6620  N  N     . GLN B  1 355 ? 86.854  88.840  -62.178  1.00 58.83  ? 461 GLN B N     1 
ATOM   6621  C  CA    . GLN B  1 355 ? 86.752  89.164  -63.594  1.00 63.30  ? 461 GLN B CA    1 
ATOM   6622  C  C     . GLN B  1 355 ? 87.148  90.607  -63.868  1.00 63.81  ? 461 GLN B C     1 
ATOM   6623  O  O     . GLN B  1 355 ? 86.933  91.462  -63.018  1.00 62.73  ? 461 GLN B O     1 
ATOM   6624  C  CB    . GLN B  1 355 ? 85.311  89.015  -64.042  1.00 65.12  ? 461 GLN B CB    1 
ATOM   6625  C  CG    . GLN B  1 355 ? 84.809  87.595  -64.192  1.00 65.08  ? 461 GLN B CG    1 
ATOM   6626  C  CD    . GLN B  1 355 ? 83.399  87.595  -64.689  1.00 67.73  ? 461 GLN B CD    1 
ATOM   6627  O  OE1   . GLN B  1 355 ? 82.450  87.614  -63.896  1.00 68.76  ? 461 GLN B OE1   1 
ATOM   6628  N  NE2   . GLN B  1 355 ? 83.236  87.647  -65.978  1.00 68.82  ? 461 GLN B NE2   1 
ATOM   6629  N  N     . PRO B  1 356 ? 87.704  90.898  -65.059  1.00 64.80  ? 462 PRO B N     1 
ATOM   6630  C  CA    . PRO B  1 356 ? 87.833  92.293  -65.465  1.00 70.05  ? 462 PRO B CA    1 
ATOM   6631  C  C     . PRO B  1 356 ? 86.485  92.970  -65.713  1.00 77.21  ? 462 PRO B C     1 
ATOM   6632  O  O     . PRO B  1 356 ? 85.477  92.287  -65.842  1.00 76.09  ? 462 PRO B O     1 
ATOM   6633  C  CB    . PRO B  1 356 ? 88.645  92.205  -66.752  1.00 69.03  ? 462 PRO B CB    1 
ATOM   6634  C  CG    . PRO B  1 356 ? 89.398  90.935  -66.642  1.00 66.89  ? 462 PRO B CG    1 
ATOM   6635  C  CD    . PRO B  1 356 ? 88.479  90.009  -65.931  1.00 65.01  ? 462 PRO B CD    1 
ATOM   6636  N  N     . THR B  1 357 ? 86.486  94.301  -65.751  1.00 86.27  ? 463 THR B N     1 
ATOM   6637  C  CA    . THR B  1 357 ? 85.291  95.084  -66.103  1.00 88.16  ? 463 THR B CA    1 
ATOM   6638  C  C     . THR B  1 357 ? 85.554  95.970  -67.311  1.00 87.65  ? 463 THR B C     1 
ATOM   6639  O  O     . THR B  1 357 ? 86.702  96.116  -67.769  1.00 82.17  ? 463 THR B O     1 
ATOM   6640  C  CB    . THR B  1 357 ? 84.828  95.980  -64.943  1.00 87.57  ? 463 THR B CB    1 
ATOM   6641  O  OG1   . THR B  1 357 ? 85.944  96.680  -64.424  1.00 91.07  ? 463 THR B OG1   1 
ATOM   6642  C  CG2   . THR B  1 357 ? 84.201  95.154  -63.837  1.00 83.76  ? 463 THR B CG2   1 
ATOM   6643  N  N     . GLY B  1 358 ? 84.470  96.567  -67.814  1.00 91.43  ? 464 GLY B N     1 
ATOM   6644  C  CA    . GLY B  1 358 ? 84.528  97.470  -68.940  1.00 95.72  ? 464 GLY B CA    1 
ATOM   6645  C  C     . GLY B  1 358 ? 84.784  96.494  -70.059  1.00 95.08  ? 464 GLY B C     1 
ATOM   6646  O  O     . GLY B  1 358 ? 84.110  95.453  -70.156  1.00 101.02 ? 464 GLY B O     1 
ATOM   6647  N  N     . GLN B  1 359 ? 85.784  96.808  -70.870  1.00 91.66  ? 465 GLN B N     1 
ATOM   6648  C  CA    . GLN B  1 359 ? 86.268  95.931  -71.896  1.00 90.47  ? 465 GLN B CA    1 
ATOM   6649  C  C     . GLN B  1 359 ? 87.799  95.933  -71.722  1.00 89.72  ? 465 GLN B C     1 
ATOM   6650  O  O     . GLN B  1 359 ? 88.512  96.362  -72.610  1.00 100.34 ? 465 GLN B O     1 
ATOM   6651  C  CB    . GLN B  1 359 ? 85.805  96.570  -73.209  1.00 89.39  ? 465 GLN B CB    1 
ATOM   6652  N  N     . ILE B  1 360 ? 88.288  95.486  -70.560  1.00 86.19  ? 466 ILE B N     1 
ATOM   6653  C  CA    . ILE B  1 360 ? 89.734  95.355  -70.287  1.00 86.73  ? 466 ILE B CA    1 
ATOM   6654  C  C     . ILE B  1 360 ? 90.146  93.895  -70.483  1.00 82.03  ? 466 ILE B C     1 
ATOM   6655  O  O     . ILE B  1 360 ? 89.953  93.095  -69.585  1.00 81.93  ? 466 ILE B O     1 
ATOM   6656  C  CB    . ILE B  1 360 ? 90.097  95.797  -68.826  1.00 91.29  ? 466 ILE B CB    1 
ATOM   6657  C  CG1   . ILE B  1 360 ? 89.615  97.223  -68.509  1.00 96.80  ? 466 ILE B CG1   1 
ATOM   6658  C  CG2   . ILE B  1 360 ? 91.611  95.691  -68.587  1.00 90.75  ? 466 ILE B CG2   1 
ATOM   6659  C  CD1   . ILE B  1 360 ? 89.531  97.532  -67.016  1.00 100.59 ? 466 ILE B CD1   1 
ATOM   6660  N  N     . LYS B  1 361 ? 90.709  93.533  -71.634  1.00 77.90  ? 467 LYS B N     1 
ATOM   6661  C  CA    . LYS B  1 361 ? 91.222  92.147  -71.844  1.00 72.90  ? 467 LYS B CA    1 
ATOM   6662  C  C     . LYS B  1 361 ? 92.619  92.060  -71.247  1.00 71.38  ? 467 LYS B C     1 
ATOM   6663  O  O     . LYS B  1 361 ? 93.401  92.976  -71.392  1.00 81.51  ? 467 LYS B O     1 
ATOM   6664  C  CB    . LYS B  1 361 ? 91.235  91.758  -73.331  1.00 68.97  ? 467 LYS B CB    1 
ATOM   6665  N  N     . ILE B  1 362 ? 92.922  90.987  -70.544  1.00 66.33  ? 468 ILE B N     1 
ATOM   6666  C  CA    . ILE B  1 362 ? 94.288  90.702  -70.073  1.00 65.58  ? 468 ILE B CA    1 
ATOM   6667  C  C     . ILE B  1 362 ? 95.034  89.913  -71.155  1.00 67.36  ? 468 ILE B C     1 
ATOM   6668  O  O     . ILE B  1 362 ? 94.679  88.764  -71.412  1.00 65.83  ? 468 ILE B O     1 
ATOM   6669  C  CB    . ILE B  1 362 ? 94.270  89.907  -68.759  1.00 63.21  ? 468 ILE B CB    1 
ATOM   6670  C  CG1   . ILE B  1 362 ? 93.655  90.782  -67.674  1.00 64.59  ? 468 ILE B CG1   1 
ATOM   6671  C  CG2   . ILE B  1 362 ? 95.672  89.475  -68.367  1.00 62.50  ? 468 ILE B CG2   1 
ATOM   6672  C  CD1   . ILE B  1 362 ? 93.569  90.159  -66.299  1.00 64.54  ? 468 ILE B CD1   1 
ATOM   6673  N  N     . LYS B  1 363 ? 96.076  90.513  -71.742  1.00 67.25  ? 469 LYS B N     1 
ATOM   6674  C  CA    . LYS B  1 363 ? 96.863  89.871  -72.807  1.00 64.02  ? 469 LYS B CA    1 
ATOM   6675  C  C     . LYS B  1 363 ? 97.695  88.703  -72.253  1.00 62.89  ? 469 LYS B C     1 
ATOM   6676  O  O     . LYS B  1 363 ? 98.084  88.729  -71.095  1.00 60.09  ? 469 LYS B O     1 
ATOM   6677  C  CB    . LYS B  1 363 ? 97.738  90.900  -73.545  1.00 62.28  ? 469 LYS B CB    1 
ATOM   6678  N  N     . ARG B  1 364 ? 97.931  87.675  -73.072  1.00 66.18  ? 470 ARG B N     1 
ATOM   6679  C  CA    . ARG B  1 364 ? 98.658  86.458  -72.644  1.00 70.73  ? 470 ARG B CA    1 
ATOM   6680  C  C     . ARG B  1 364 ? 100.104 86.735  -72.186  1.00 72.97  ? 470 ARG B C     1 
ATOM   6681  O  O     . ARG B  1 364 ? 100.603 86.130  -71.241  1.00 65.19  ? 470 ARG B O     1 
ATOM   6682  C  CB    . ARG B  1 364 ? 98.644  85.412  -73.753  1.00 74.71  ? 470 ARG B CB    1 
ATOM   6683  C  CG    . ARG B  1 364 ? 99.349  84.106  -73.386  1.00 80.27  ? 470 ARG B CG    1 
ATOM   6684  C  CD    . ARG B  1 364 ? 99.215  83.085  -74.533  1.00 84.85  ? 470 ARG B CD    1 
ATOM   6685  N  NE    . ARG B  1 364 ? 97.795  82.776  -74.772  1.00 88.95  ? 470 ARG B NE    1 
ATOM   6686  C  CZ    . ARG B  1 364 ? 97.030  82.008  -73.994  1.00 89.66  ? 470 ARG B CZ    1 
ATOM   6687  N  NH1   . ARG B  1 364 ? 97.529  81.392  -72.925  1.00 92.30  ? 470 ARG B NH1   1 
ATOM   6688  N  NH2   . ARG B  1 364 ? 95.755  81.830  -74.308  1.00 86.34  ? 470 ARG B NH2   1 
ATOM   6689  N  N     . GLU B  1 365 ? 100.772 87.617  -72.915  1.00 81.35  ? 471 GLU B N     1 
ATOM   6690  C  CA    . GLU B  1 365 ? 102.069 88.220  -72.532  1.00 85.55  ? 471 GLU B CA    1 
ATOM   6691  C  C     . GLU B  1 365 ? 102.183 88.649  -71.047  1.00 84.81  ? 471 GLU B C     1 
ATOM   6692  O  O     . GLU B  1 365 ? 103.235 88.477  -70.440  1.00 83.44  ? 471 GLU B O     1 
ATOM   6693  C  CB    . GLU B  1 365 ? 102.358 89.420  -73.451  1.00 91.79  ? 471 GLU B CB    1 
ATOM   6694  C  CG    . GLU B  1 365 ? 101.225 90.459  -73.468  1.00 98.58  ? 471 GLU B CG    1 
ATOM   6695  C  CD    . GLU B  1 365 ? 101.398 91.601  -74.430  1.00 106.26 ? 471 GLU B CD    1 
ATOM   6696  O  OE1   . GLU B  1 365 ? 102.572 92.003  -74.652  1.00 112.14 ? 471 GLU B OE1   1 
ATOM   6697  O  OE2   . GLU B  1 365 ? 100.386 92.122  -74.958  1.00 113.35 ? 471 GLU B OE2   1 
ATOM   6698  N  N     . ASP B  1 366 ? 101.103 89.182  -70.475  1.00 86.79  ? 472 ASP B N     1 
ATOM   6699  C  CA    . ASP B  1 366 ? 101.084 89.687  -69.086  1.00 86.41  ? 472 ASP B CA    1 
ATOM   6700  C  C     . ASP B  1 366 ? 100.855 88.647  -67.975  1.00 83.97  ? 472 ASP B C     1 
ATOM   6701  O  O     . ASP B  1 366 ? 100.984 88.983  -66.792  1.00 83.08  ? 472 ASP B O     1 
ATOM   6702  C  CB    . ASP B  1 366 ? 99.998  90.764  -68.930  1.00 87.73  ? 472 ASP B CB    1 
ATOM   6703  C  CG    . ASP B  1 366 ? 100.164 91.924  -69.893  1.00 89.38  ? 472 ASP B CG    1 
ATOM   6704  O  OD1   . ASP B  1 366 ? 101.311 92.210  -70.317  1.00 91.06  ? 472 ASP B OD1   1 
ATOM   6705  O  OD2   . ASP B  1 366 ? 99.136  92.553  -70.205  1.00 85.04  ? 472 ASP B OD2   1 
ATOM   6706  N  N     . TYR B  1 367 ? 100.505 87.404  -68.334  1.00 80.70  ? 473 TYR B N     1 
ATOM   6707  C  CA    . TYR B  1 367 ? 100.198 86.352  -67.344  1.00 73.90  ? 473 TYR B CA    1 
ATOM   6708  C  C     . TYR B  1 367 ? 101.365 86.137  -66.368  1.00 74.12  ? 473 TYR B C     1 
ATOM   6709  O  O     . TYR B  1 367 ? 101.135 86.031  -65.169  1.00 71.32  ? 473 TYR B O     1 
ATOM   6710  C  CB    . TYR B  1 367 ? 99.843  85.009  -68.026  1.00 70.00  ? 473 TYR B CB    1 
ATOM   6711  C  CG    . TYR B  1 367 ? 98.496  84.907  -68.781  1.00 68.25  ? 473 TYR B CG    1 
ATOM   6712  C  CD1   . TYR B  1 367 ? 97.657  86.010  -68.959  1.00 69.71  ? 473 TYR B CD1   1 
ATOM   6713  C  CD2   . TYR B  1 367 ? 98.096  83.687  -69.360  1.00 67.33  ? 473 TYR B CD2   1 
ATOM   6714  C  CE1   . TYR B  1 367 ? 96.463  85.909  -69.667  1.00 70.24  ? 473 TYR B CE1   1 
ATOM   6715  C  CE2   . TYR B  1 367 ? 96.909  83.570  -70.070  1.00 66.04  ? 473 TYR B CE2   1 
ATOM   6716  C  CZ    . TYR B  1 367 ? 96.091  84.678  -70.226  1.00 67.70  ? 473 TYR B CZ    1 
ATOM   6717  O  OH    . TYR B  1 367 ? 94.897  84.602  -70.919  1.00 68.16  ? 473 TYR B OH    1 
ATOM   6718  N  N     . GLU B  1 368 ? 102.605 86.092  -66.885  1.00 75.10  ? 474 GLU B N     1 
ATOM   6719  C  CA    . GLU B  1 368 ? 103.815 85.923  -66.061  1.00 73.19  ? 474 GLU B CA    1 
ATOM   6720  C  C     . GLU B  1 368 ? 103.904 86.953  -64.929  1.00 77.16  ? 474 GLU B C     1 
ATOM   6721  O  O     . GLU B  1 368 ? 104.300 86.623  -63.816  1.00 78.24  ? 474 GLU B O     1 
ATOM   6722  C  CB    . GLU B  1 368 ? 105.093 85.942  -66.912  1.00 67.82  ? 474 GLU B CB    1 
ATOM   6723  N  N     . SER B  1 369 ? 103.482 88.184  -65.214  1.00 80.79  ? 475 SER B N     1 
ATOM   6724  C  CA    . SER B  1 369 ? 103.622 89.325  -64.284  1.00 82.56  ? 475 SER B CA    1 
ATOM   6725  C  C     . SER B  1 369 ? 102.597 89.446  -63.152  1.00 80.47  ? 475 SER B C     1 
ATOM   6726  O  O     . SER B  1 369 ? 102.803 90.246  -62.230  1.00 82.37  ? 475 SER B O     1 
ATOM   6727  C  CB    . SER B  1 369 ? 103.601 90.645  -65.062  1.00 85.00  ? 475 SER B CB    1 
ATOM   6728  O  OG    . SER B  1 369 ? 102.276 91.098  -65.274  1.00 86.01  ? 475 SER B OG    1 
ATOM   6729  N  N     . LEU B  1 370 ? 101.493 88.703  -63.233  1.00 78.69  ? 476 LEU B N     1 
ATOM   6730  C  CA    . LEU B  1 370 ? 100.361 88.909  -62.318  1.00 75.96  ? 476 LEU B CA    1 
ATOM   6731  C  C     . LEU B  1 370 ? 100.595 88.508  -60.860  1.00 73.30  ? 476 LEU B C     1 
ATOM   6732  O  O     . LEU B  1 370 ? 100.086 89.171  -59.973  1.00 74.01  ? 476 LEU B O     1 
ATOM   6733  C  CB    . LEU B  1 370 ? 99.089  88.241  -62.852  1.00 73.29  ? 476 LEU B CB    1 
ATOM   6734  C  CG    . LEU B  1 370 ? 98.505  88.794  -64.148  1.00 74.34  ? 476 LEU B CG    1 
ATOM   6735  C  CD1   . LEU B  1 370 ? 97.356  87.932  -64.614  1.00 71.55  ? 476 LEU B CD1   1 
ATOM   6736  C  CD2   . LEU B  1 370 ? 98.051  90.226  -64.017  1.00 77.61  ? 476 LEU B CD2   1 
ATOM   6737  N  N     . PRO B  1 371 ? 101.345 87.423  -60.597  1.00 72.15  ? 477 PRO B N     1 
ATOM   6738  C  CA    . PRO B  1 371 ? 101.714 87.135  -59.203  1.00 72.16  ? 477 PRO B CA    1 
ATOM   6739  C  C     . PRO B  1 371 ? 102.469 88.274  -58.506  1.00 75.05  ? 477 PRO B C     1 
ATOM   6740  O  O     . PRO B  1 371 ? 102.221 88.534  -57.332  1.00 70.95  ? 477 PRO B O     1 
ATOM   6741  C  CB    . PRO B  1 371 ? 102.600 85.893  -59.334  1.00 71.61  ? 477 PRO B CB    1 
ATOM   6742  C  CG    . PRO B  1 371 ? 102.073 85.204  -60.538  1.00 71.07  ? 477 PRO B CG    1 
ATOM   6743  C  CD    . PRO B  1 371 ? 101.690 86.295  -61.482  1.00 72.70  ? 477 PRO B CD    1 
ATOM   6744  N  N     . LYS B  1 372 ? 103.370 88.939  -59.238  1.00 81.36  ? 478 LYS B N     1 
ATOM   6745  C  CA    . LYS B  1 372 ? 104.076 90.139  -58.767  1.00 81.64  ? 478 LYS B CA    1 
ATOM   6746  C  C     . LYS B  1 372 ? 103.077 91.208  -58.350  1.00 84.32  ? 478 LYS B C     1 
ATOM   6747  O  O     . LYS B  1 372 ? 103.200 91.770  -57.277  1.00 89.02  ? 478 LYS B O     1 
ATOM   6748  C  CB    . LYS B  1 372 ? 105.041 90.683  -59.834  1.00 77.40  ? 478 LYS B CB    1 
ATOM   6749  N  N     . GLU B  1 373 ? 102.067 91.451  -59.176  1.00 84.27  ? 479 GLU B N     1 
ATOM   6750  C  CA    . GLU B  1 373 ? 101.065 92.484  -58.889  1.00 85.62  ? 479 GLU B CA    1 
ATOM   6751  C  C     . GLU B  1 373 ? 100.250 92.240  -57.623  1.00 89.45  ? 479 GLU B C     1 
ATOM   6752  O  O     . GLU B  1 373 ? 99.889  93.197  -56.936  1.00 95.12  ? 479 GLU B O     1 
ATOM   6753  C  CB    . GLU B  1 373 ? 100.088 92.650  -60.050  1.00 85.00  ? 479 GLU B CB    1 
ATOM   6754  C  CG    . GLU B  1 373 ? 100.711 93.122  -61.348  1.00 87.20  ? 479 GLU B CG    1 
ATOM   6755  C  CD    . GLU B  1 373 ? 99.683  93.463  -62.406  1.00 89.10  ? 479 GLU B CD    1 
ATOM   6756  O  OE1   . GLU B  1 373 ? 98.476  93.538  -62.098  1.00 87.14  ? 479 GLU B OE1   1 
ATOM   6757  O  OE2   . GLU B  1 373 ? 100.086 93.675  -63.562  1.00 94.91  ? 479 GLU B OE2   1 
ATOM   6758  N  N     . VAL B  1 374 ? 99.946  90.976  -57.331  1.00 90.01  ? 480 VAL B N     1 
ATOM   6759  C  CA    . VAL B  1 374 ? 99.135  90.614  -56.157  1.00 87.92  ? 480 VAL B CA    1 
ATOM   6760  C  C     . VAL B  1 374 ? 99.918  90.860  -54.869  1.00 84.69  ? 480 VAL B C     1 
ATOM   6761  O  O     . VAL B  1 374 ? 99.394  91.459  -53.931  1.00 85.86  ? 480 VAL B O     1 
ATOM   6762  C  CB    . VAL B  1 374 ? 98.632  89.147  -56.229  1.00 87.13  ? 480 VAL B CB    1 
ATOM   6763  C  CG1   . VAL B  1 374 ? 97.940  88.713  -54.938  1.00 84.54  ? 480 VAL B CG1   1 
ATOM   6764  C  CG2   . VAL B  1 374 ? 97.662  88.983  -57.380  1.00 87.00  ? 480 VAL B CG2   1 
ATOM   6765  N  N     . ALA B  1 375 ? 101.165 90.391  -54.836  1.00 82.14  ? 481 ALA B N     1 
ATOM   6766  C  CA    . ALA B  1 375 ? 102.076 90.645  -53.711  1.00 81.14  ? 481 ALA B CA    1 
ATOM   6767  C  C     . ALA B  1 375 ? 102.377 92.145  -53.531  1.00 79.59  ? 481 ALA B C     1 
ATOM   6768  O  O     . ALA B  1 375 ? 102.523 92.625  -52.411  1.00 76.13  ? 481 ALA B O     1 
ATOM   6769  C  CB    . ALA B  1 375 ? 103.363 89.856  -53.890  1.00 82.11  ? 481 ALA B CB    1 
ATOM   6770  N  N     . SER B  1 376 ? 102.441 92.873  -54.645  1.00 78.02  ? 482 SER B N     1 
ATOM   6771  C  CA    . SER B  1 376 ? 102.660 94.321  -54.645  1.00 77.53  ? 482 SER B CA    1 
ATOM   6772  C  C     . SER B  1 376 ? 101.516 95.168  -54.104  1.00 77.57  ? 482 SER B C     1 
ATOM   6773  O  O     . SER B  1 376 ? 101.720 96.343  -53.832  1.00 83.65  ? 482 SER B O     1 
ATOM   6774  C  CB    . SER B  1 376 ? 102.970 94.798  -56.055  1.00 76.46  ? 482 SER B CB    1 
ATOM   6775  O  OG    . SER B  1 376 ? 104.156 94.190  -56.517  1.00 75.22  ? 482 SER B OG    1 
ATOM   6776  N  N     . ALA B  1 377 ? 100.319 94.609  -53.977  1.00 76.83  ? 483 ALA B N     1 
ATOM   6777  C  CA    . ALA B  1 377 ? 99.199  95.344  -53.394  1.00 79.13  ? 483 ALA B CA    1 
ATOM   6778  C  C     . ALA B  1 377 ? 99.470  95.646  -51.934  1.00 81.99  ? 483 ALA B C     1 
ATOM   6779  O  O     . ALA B  1 377 ? 100.086 94.846  -51.231  1.00 81.33  ? 483 ALA B O     1 
ATOM   6780  C  CB    . ALA B  1 377 ? 97.907  94.570  -53.535  1.00 76.79  ? 483 ALA B CB    1 
ATOM   6781  N  N     . LYS B  1 378 ? 99.035  96.826  -51.499  1.00 85.68  ? 484 LYS B N     1 
ATOM   6782  C  CA    . LYS B  1 378 ? 99.287  97.313  -50.153  1.00 89.27  ? 484 LYS B CA    1 
ATOM   6783  C  C     . LYS B  1 378 ? 97.929  97.437  -49.480  1.00 94.90  ? 484 LYS B C     1 
ATOM   6784  O  O     . LYS B  1 378 ? 97.332  98.508  -49.530  1.00 102.69 ? 484 LYS B O     1 
ATOM   6785  C  CB    . LYS B  1 378 ? 100.005 98.671  -50.197  1.00 87.36  ? 484 LYS B CB    1 
ATOM   6786  N  N     . PRO B  1 379 ? 97.417  96.347  -48.880  1.00 97.66  ? 485 PRO B N     1 
ATOM   6787  C  CA    . PRO B  1 379 ? 96.099  96.408  -48.214  1.00 95.51  ? 485 PRO B CA    1 
ATOM   6788  C  C     . PRO B  1 379 ? 96.161  97.136  -46.887  1.00 96.88  ? 485 PRO B C     1 
ATOM   6789  O  O     . PRO B  1 379 ? 97.024  96.828  -46.088  1.00 99.29  ? 485 PRO B O     1 
ATOM   6790  C  CB    . PRO B  1 379 ? 95.749  94.924  -47.992  1.00 94.14  ? 485 PRO B CB    1 
ATOM   6791  C  CG    . PRO B  1 379 ? 97.056  94.252  -47.905  1.00 95.92  ? 485 PRO B CG    1 
ATOM   6792  C  CD    . PRO B  1 379 ? 97.974  94.981  -48.855  1.00 98.32  ? 485 PRO B CD    1 
ATOM   6793  N  N     . LYS B  1 380 ? 95.242  98.064  -46.638  1.00 94.80  ? 486 LYS B N     1 
ATOM   6794  C  CA    . LYS B  1 380 ? 95.288  98.888  -45.409  1.00 90.91  ? 486 LYS B CA    1 
ATOM   6795  C  C     . LYS B  1 380 ? 94.798  98.086  -44.185  1.00 94.09  ? 486 LYS B C     1 
ATOM   6796  O  O     . LYS B  1 380 ? 93.814  98.457  -43.547  1.00 91.89  ? 486 LYS B O     1 
ATOM   6797  C  CB    . LYS B  1 380 ? 94.476  100.179 -45.597  1.00 82.11  ? 486 LYS B CB    1 
ATOM   6798  N  N     . VAL B  1 381 ? 95.483  96.977  -43.890  1.00 98.51  ? 487 VAL B N     1 
ATOM   6799  C  CA    . VAL B  1 381 ? 95.123  96.031  -42.823  1.00 102.49 ? 487 VAL B CA    1 
ATOM   6800  C  C     . VAL B  1 381 ? 96.374  95.387  -42.260  1.00 102.97 ? 487 VAL B C     1 
ATOM   6801  O  O     . VAL B  1 381 ? 97.251  94.982  -43.025  1.00 105.00 ? 487 VAL B O     1 
ATOM   6802  C  CB    . VAL B  1 381 ? 94.238  94.869  -43.347  1.00 107.24 ? 487 VAL B CB    1 
ATOM   6803  C  CG1   . VAL B  1 381 ? 94.015  93.778  -42.281  1.00 105.67 ? 487 VAL B CG1   1 
ATOM   6804  C  CG2   . VAL B  1 381 ? 92.913  95.389  -43.905  1.00 109.25 ? 487 VAL B CG2   1 
ATOM   6805  N  N     . LEU B  1 382 ? 96.442  95.239  -40.935  1.00 106.13 ? 488 LEU B N     1 
ATOM   6806  C  CA    . LEU B  1 382 ? 97.623  94.665  -40.268  1.00 111.89 ? 488 LEU B CA    1 
ATOM   6807  C  C     . LEU B  1 382 ? 97.735  93.172  -40.564  1.00 111.90 ? 488 LEU B C     1 
ATOM   6808  O  O     . LEU B  1 382 ? 96.849  92.402  -40.199  1.00 123.89 ? 488 LEU B O     1 
ATOM   6809  C  CB    . LEU B  1 382 ? 97.571  94.870  -38.750  1.00 117.85 ? 488 LEU B CB    1 
ATOM   6810  C  CG    . LEU B  1 382 ? 98.030  96.242  -38.169  1.00 123.21 ? 488 LEU B CG    1 
ATOM   6811  C  CD1   . LEU B  1 382 ? 98.094  96.147  -36.641  1.00 123.22 ? 488 LEU B CD1   1 
ATOM   6812  C  CD2   . LEU B  1 382 ? 99.365  96.767  -38.727  1.00 122.31 ? 488 LEU B CD2   1 
ATOM   6813  N  N     . LEU B  1 383 ? 98.830  92.791  -41.231  1.00 103.45 ? 489 LEU B N     1 
ATOM   6814  C  CA    . LEU B  1 383 ? 99.085  91.414  -41.598  1.00 99.21  ? 489 LEU B CA    1 
ATOM   6815  C  C     . LEU B  1 383 ? 100.052 90.732  -40.673  1.00 93.79  ? 489 LEU B C     1 
ATOM   6816  O  O     . LEU B  1 383 ? 100.974 91.349  -40.238  1.00 92.21  ? 489 LEU B O     1 
ATOM   6817  C  CB    . LEU B  1 383 ? 99.656  91.384  -43.031  1.00 101.24 ? 489 LEU B CB    1 
ATOM   6818  C  CG    . LEU B  1 383 ? 98.730  91.896  -44.122  1.00 102.79 ? 489 LEU B CG    1 
ATOM   6819  C  CD1   . LEU B  1 383 ? 99.476  91.938  -45.440  1.00 103.03 ? 489 LEU B CD1   1 
ATOM   6820  C  CD2   . LEU B  1 383 ? 97.449  91.084  -44.246  1.00 103.96 ? 489 LEU B CD2   1 
ATOM   6821  N  N     . ASP B  1 384 ? 99.838  89.464  -40.438  1.00 90.42  ? 490 ASP B N     1 
ATOM   6822  C  CA    . ASP B  1 384 ? 100.716 88.618  -39.600  1.00 88.56  ? 490 ASP B CA    1 
ATOM   6823  C  C     . ASP B  1 384 ? 102.008 88.273  -40.380  1.00 87.41  ? 490 ASP B C     1 
ATOM   6824  O  O     . ASP B  1 384 ? 103.080 88.188  -39.808  1.00 90.14  ? 490 ASP B O     1 
ATOM   6825  C  CB    . ASP B  1 384 ? 100.074 87.302  -39.161  1.00 90.52  ? 490 ASP B CB    1 
ATOM   6826  C  CG    . ASP B  1 384 ? 98.677  87.446  -38.596  1.00 92.94  ? 490 ASP B CG    1 
ATOM   6827  O  OD1   . ASP B  1 384 ? 98.442  88.450  -37.916  1.00 100.68 ? 490 ASP B OD1   1 
ATOM   6828  O  OD2   . ASP B  1 384 ? 97.824  86.545  -38.810  1.00 88.51  ? 490 ASP B OD2   1 
ATOM   6829  N  N     . VAL B  1 385 ? 101.868 88.045  -41.679  1.00 86.48  ? 491 VAL B N     1 
ATOM   6830  C  CA    . VAL B  1 385 ? 102.906 87.591  -42.588  1.00 86.76  ? 491 VAL B CA    1 
ATOM   6831  C  C     . VAL B  1 385 ? 102.946 88.442  -43.850  1.00 85.23  ? 491 VAL B C     1 
ATOM   6832  O  O     . VAL B  1 385 ? 101.881 88.813  -44.367  1.00 84.77  ? 491 VAL B O     1 
ATOM   6833  C  CB    . VAL B  1 385 ? 102.636 86.099  -43.022  1.00 89.26  ? 491 VAL B CB    1 
ATOM   6834  C  CG1   . VAL B  1 385 ? 103.738 85.590  -43.928  1.00 90.64  ? 491 VAL B CG1   1 
ATOM   6835  C  CG2   . VAL B  1 385 ? 102.449 85.187  -41.816  1.00 88.42  ? 491 VAL B CG2   1 
ATOM   6836  N  N     . LYS B  1 386 ? 104.129 88.765  -44.369  1.00 82.67  ? 492 LYS B N     1 
ATOM   6837  C  CA    . LYS B  1 386 ? 104.283 89.348  -45.728  1.00 79.03  ? 492 LYS B CA    1 
ATOM   6838  C  C     . LYS B  1 386 ? 104.515 88.191  -46.690  1.00 80.55  ? 492 LYS B C     1 
ATOM   6839  O  O     . LYS B  1 386 ? 105.222 87.246  -46.338  1.00 83.21  ? 492 LYS B O     1 
ATOM   6840  C  CB    . LYS B  1 386 ? 105.447 90.363  -45.788  1.00 74.82  ? 492 LYS B CB    1 
ATOM   6841  N  N     . LEU B  1 387 ? 103.914 88.239  -47.875  1.00 82.89  ? 493 LEU B N     1 
ATOM   6842  C  CA    . LEU B  1 387 ? 104.033 87.158  -48.893  1.00 84.44  ? 493 LEU B CA    1 
ATOM   6843  C  C     . LEU B  1 387 ? 104.698 87.668  -50.170  1.00 85.02  ? 493 LEU B C     1 
ATOM   6844  O  O     . LEU B  1 387 ? 104.312 88.721  -50.685  1.00 84.40  ? 493 LEU B O     1 
ATOM   6845  C  CB    . LEU B  1 387 ? 102.640 86.617  -49.258  1.00 86.82  ? 493 LEU B CB    1 
ATOM   6846  C  CG    . LEU B  1 387 ? 101.844 85.852  -48.194  1.00 86.52  ? 493 LEU B CG    1 
ATOM   6847  C  CD1   . LEU B  1 387 ? 100.430 85.579  -48.720  1.00 85.16  ? 493 LEU B CD1   1 
ATOM   6848  C  CD2   . LEU B  1 387 ? 102.543 84.537  -47.786  1.00 85.97  ? 493 LEU B CD2   1 
ATOM   6849  N  N     . LYS B  1 388 ? 105.671 86.906  -50.670  1.00 85.27  ? 494 LYS B N     1 
ATOM   6850  C  CA    . LYS B  1 388 ? 106.403 87.245  -51.906  1.00 81.28  ? 494 LYS B CA    1 
ATOM   6851  C  C     . LYS B  1 388 ? 105.602 86.767  -53.129  1.00 78.63  ? 494 LYS B C     1 
ATOM   6852  O  O     . LYS B  1 388 ? 104.659 85.993  -52.998  1.00 72.95  ? 494 LYS B O     1 
ATOM   6853  C  CB    . LYS B  1 388 ? 107.839 86.657  -51.893  1.00 77.01  ? 494 LYS B CB    1 
ATOM   6854  N  N     . ALA B  1 389 ? 105.979 87.232  -54.310  1.00 81.18  ? 495 ALA B N     1 
ATOM   6855  C  CA    . ALA B  1 389 ? 105.254 86.926  -55.560  1.00 81.62  ? 495 ALA B CA    1 
ATOM   6856  C  C     . ALA B  1 389 ? 105.288 85.451  -55.974  1.00 81.38  ? 495 ALA B C     1 
ATOM   6857  O  O     . ALA B  1 389 ? 104.337 84.954  -56.564  1.00 80.70  ? 495 ALA B O     1 
ATOM   6858  C  CB    . ALA B  1 389 ? 105.791 87.782  -56.690  1.00 83.46  ? 495 ALA B CB    1 
ATOM   6859  N  N     . GLU B  1 390 ? 106.391 84.768  -55.679  1.00 84.02  ? 496 GLU B N     1 
ATOM   6860  C  CA    . GLU B  1 390 ? 106.506 83.324  -55.911  1.00 85.36  ? 496 GLU B CA    1 
ATOM   6861  C  C     . GLU B  1 390 ? 105.505 82.467  -55.114  1.00 82.07  ? 496 GLU B C     1 
ATOM   6862  O  O     . GLU B  1 390 ? 105.283 81.311  -55.457  1.00 75.96  ? 496 GLU B O     1 
ATOM   6863  C  CB    . GLU B  1 390 ? 107.954 82.881  -55.590  1.00 90.15  ? 496 GLU B CB    1 
ATOM   6864  C  CG    . GLU B  1 390 ? 108.340 82.992  -54.118  1.00 94.41  ? 496 GLU B CG    1 
ATOM   6865  C  CD    . GLU B  1 390 ? 109.790 83.216  -53.802  1.00 96.35  ? 496 GLU B CD    1 
ATOM   6866  O  OE1   . GLU B  1 390 ? 110.644 83.134  -54.696  1.00 103.89 ? 496 GLU B OE1   1 
ATOM   6867  O  OE2   . GLU B  1 390 ? 110.051 83.456  -52.617  1.00 94.35  ? 496 GLU B OE2   1 
ATOM   6868  N  N     . ASP B  1 391 ? 104.930 83.029  -54.049  1.00 83.95  ? 497 ASP B N     1 
ATOM   6869  C  CA    . ASP B  1 391 ? 103.890 82.354  -53.251  1.00 81.15  ? 497 ASP B CA    1 
ATOM   6870  C  C     . ASP B  1 391 ? 102.520 82.297  -53.939  1.00 76.77  ? 497 ASP B C     1 
ATOM   6871  O  O     . ASP B  1 391 ? 101.711 81.424  -53.628  1.00 72.54  ? 497 ASP B O     1 
ATOM   6872  C  CB    . ASP B  1 391 ? 103.730 83.028  -51.870  1.00 80.16  ? 497 ASP B CB    1 
ATOM   6873  C  CG    . ASP B  1 391 ? 105.021 83.028  -51.038  1.00 81.50  ? 497 ASP B CG    1 
ATOM   6874  O  OD1   . ASP B  1 391 ? 105.824 82.059  -51.177  1.00 82.38  ? 497 ASP B OD1   1 
ATOM   6875  O  OD2   . ASP B  1 391 ? 105.208 83.979  -50.239  1.00 82.11  ? 497 ASP B OD2   1 
ATOM   6876  N  N     . PHE B  1 392 ? 102.261 83.231  -54.857  1.00 74.53  ? 498 PHE B N     1 
ATOM   6877  C  CA    . PHE B  1 392 ? 100.988 83.290  -55.593  1.00 71.92  ? 498 PHE B CA    1 
ATOM   6878  C  C     . PHE B  1 392 ? 101.025 82.591  -56.960  1.00 68.06  ? 498 PHE B C     1 
ATOM   6879  O  O     . PHE B  1 392 ? 102.049 82.594  -57.644  1.00 67.38  ? 498 PHE B O     1 
ATOM   6880  C  CB    . PHE B  1 392 ? 100.573 84.739  -55.798  1.00 75.18  ? 498 PHE B CB    1 
ATOM   6881  C  CG    . PHE B  1 392 ? 100.152 85.426  -54.538  1.00 78.48  ? 498 PHE B CG    1 
ATOM   6882  C  CD1   . PHE B  1 392 ? 98.889  85.222  -54.014  1.00 77.61  ? 498 PHE B CD1   1 
ATOM   6883  C  CD2   . PHE B  1 392 ? 101.019 86.278  -53.872  1.00 82.42  ? 498 PHE B CD2   1 
ATOM   6884  C  CE1   . PHE B  1 392 ? 98.494  85.864  -52.851  1.00 77.20  ? 498 PHE B CE1   1 
ATOM   6885  C  CE2   . PHE B  1 392 ? 100.628 86.921  -52.708  1.00 81.78  ? 498 PHE B CE2   1 
ATOM   6886  C  CZ    . PHE B  1 392 ? 99.365  86.720  -52.196  1.00 79.25  ? 498 PHE B CZ    1 
ATOM   6887  N  N     . ILE B  1 393 ? 99.896  81.983  -57.330  1.00 62.62  ? 499 ILE B N     1 
ATOM   6888  C  CA    . ILE B  1 393 ? 99.615  81.529  -58.691  1.00 57.48  ? 499 ILE B CA    1 
ATOM   6889  C  C     . ILE B  1 393 ? 98.378  82.230  -59.168  1.00 54.24  ? 499 ILE B C     1 
ATOM   6890  O  O     . ILE B  1 393 ? 97.390  82.296  -58.447  1.00 50.36  ? 499 ILE B O     1 
ATOM   6891  C  CB    . ILE B  1 393 ? 99.329  80.019  -58.730  1.00 55.74  ? 499 ILE B CB    1 
ATOM   6892  C  CG1   . ILE B  1 393 ? 100.585 79.264  -58.321  1.00 56.28  ? 499 ILE B CG1   1 
ATOM   6893  C  CG2   . ILE B  1 393 ? 98.887  79.585  -60.129  1.00 55.13  ? 499 ILE B CG2   1 
ATOM   6894  C  CD1   . ILE B  1 393 ? 100.361 77.839  -58.042  1.00 56.43  ? 499 ILE B CD1   1 
ATOM   6895  N  N     . VAL B  1 394 ? 98.419  82.753  -60.384  1.00 54.90  ? 500 VAL B N     1 
ATOM   6896  C  CA    . VAL B  1 394 ? 97.261  83.417  -60.978  1.00 53.60  ? 500 VAL B CA    1 
ATOM   6897  C  C     . VAL B  1 394 ? 96.985  82.757  -62.307  1.00 52.72  ? 500 VAL B C     1 
ATOM   6898  O  O     . VAL B  1 394 ? 97.800  82.812  -63.207  1.00 52.58  ? 500 VAL B O     1 
ATOM   6899  C  CB    . VAL B  1 394 ? 97.488  84.919  -61.150  1.00 54.51  ? 500 VAL B CB    1 
ATOM   6900  C  CG1   . VAL B  1 394 ? 96.283  85.594  -61.780  1.00 54.13  ? 500 VAL B CG1   1 
ATOM   6901  C  CG2   . VAL B  1 394 ? 97.755  85.534  -59.793  1.00 55.57  ? 500 VAL B CG2   1 
ATOM   6902  N  N     . ASP B  1 395 ? 95.822  82.130  -62.397  1.00 51.47  ? 501 ASP B N     1 
ATOM   6903  C  CA    . ASP B  1 395 ? 95.404  81.319  -63.533  1.00 50.81  ? 501 ASP B CA    1 
ATOM   6904  C  C     . ASP B  1 395 ? 94.356  82.154  -64.257  1.00 47.86  ? 501 ASP B C     1 
ATOM   6905  O  O     . ASP B  1 395 ? 93.359  82.542  -63.665  1.00 46.45  ? 501 ASP B O     1 
ATOM   6906  C  CB    . ASP B  1 395 ? 94.815  80.017  -62.962  1.00 53.67  ? 501 ASP B CB    1 
ATOM   6907  C  CG    . ASP B  1 395 ? 94.629  78.924  -63.982  1.00 54.60  ? 501 ASP B CG    1 
ATOM   6908  O  OD1   . ASP B  1 395 ? 95.390  78.895  -64.975  1.00 51.67  ? 501 ASP B OD1   1 
ATOM   6909  O  OD2   . ASP B  1 395 ? 93.686  78.081  -63.746  1.00 58.65  ? 501 ASP B OD2   1 
ATOM   6910  N  N     . VAL B  1 396 ? 94.600  82.485  -65.508  1.00 47.49  ? 502 VAL B N     1 
ATOM   6911  C  CA    . VAL B  1 396 ? 93.642  83.260  -66.286  1.00 47.19  ? 502 VAL B CA    1 
ATOM   6912  C  C     . VAL B  1 396 ? 93.010  82.338  -67.305  1.00 46.78  ? 502 VAL B C     1 
ATOM   6913  O  O     . VAL B  1 396 ? 93.707  81.588  -67.971  1.00 49.95  ? 502 VAL B O     1 
ATOM   6914  C  CB    . VAL B  1 396 ? 94.282  84.455  -66.991  1.00 48.60  ? 502 VAL B CB    1 
ATOM   6915  C  CG1   . VAL B  1 396 ? 93.253  85.228  -67.797  1.00 50.26  ? 502 VAL B CG1   1 
ATOM   6916  C  CG2   . VAL B  1 396 ? 94.935  85.368  -65.985  1.00 48.77  ? 502 VAL B CG2   1 
ATOM   6917  N  N     . ILE B  1 397 ? 91.691  82.425  -67.431  1.00 45.11  ? 503 ILE B N     1 
ATOM   6918  C  CA    . ILE B  1 397 ? 90.899  81.483  -68.206  1.00 43.99  ? 503 ILE B CA    1 
ATOM   6919  C  C     . ILE B  1 397 ? 89.955  82.232  -69.117  1.00 42.37  ? 503 ILE B C     1 
ATOM   6920  O  O     . ILE B  1 397 ? 89.174  83.053  -68.644  1.00 40.19  ? 503 ILE B O     1 
ATOM   6921  C  CB    . ILE B  1 397 ? 90.110  80.565  -67.243  1.00 45.40  ? 503 ILE B CB    1 
ATOM   6922  C  CG1   . ILE B  1 397 ? 91.077  79.618  -66.546  1.00 45.52  ? 503 ILE B CG1   1 
ATOM   6923  C  CG2   . ILE B  1 397 ? 89.037  79.753  -67.960  1.00 45.05  ? 503 ILE B CG2   1 
ATOM   6924  C  CD1   . ILE B  1 397 ? 90.522  79.043  -65.276  1.00 45.23  ? 503 ILE B CD1   1 
ATOM   6925  N  N     . ASN B  1 398 ? 90.023  81.947  -70.412  1.00 42.61  ? 504 ASN B N     1 
ATOM   6926  C  CA    . ASN B  1 398 ? 89.143  82.582  -71.402  1.00 42.78  ? 504 ASN B CA    1 
ATOM   6927  C  C     . ASN B  1 398 ? 87.941  81.705  -71.685  1.00 40.65  ? 504 ASN B C     1 
ATOM   6928  O  O     . ASN B  1 398 ? 88.069  80.673  -72.306  1.00 42.07  ? 504 ASN B O     1 
ATOM   6929  C  CB    . ASN B  1 398 ? 89.870  82.885  -72.703  1.00 43.91  ? 504 ASN B CB    1 
ATOM   6930  C  CG    . ASN B  1 398 ? 91.068  83.777  -72.504  1.00 45.17  ? 504 ASN B CG    1 
ATOM   6931  O  OD1   . ASN B  1 398 ? 91.013  84.761  -71.814  1.00 44.24  ? 504 ASN B OD1   1 
ATOM   6932  N  ND2   . ASN B  1 398 ? 92.185  83.419  -73.114  1.00 46.45  ? 504 ASN B ND2   1 
ATOM   6933  N  N     . MET B  1 399 ? 86.775  82.130  -71.231  1.00 39.13  ? 505 MET B N     1 
ATOM   6934  C  CA    . MET B  1 399 ? 85.532  81.437  -71.521  1.00 39.27  ? 505 MET B CA    1 
ATOM   6935  C  C     . MET B  1 399 ? 84.891  82.143  -72.703  1.00 39.89  ? 505 MET B C     1 
ATOM   6936  O  O     . MET B  1 399 ? 84.681  83.350  -72.647  1.00 40.31  ? 505 MET B O     1 
ATOM   6937  C  CB    . MET B  1 399 ? 84.588  81.501  -70.322  1.00 40.34  ? 505 MET B CB    1 
ATOM   6938  C  CG    . MET B  1 399 ? 85.208  81.067  -69.019  1.00 40.78  ? 505 MET B CG    1 
ATOM   6939  S  SD    . MET B  1 399 ? 85.468  79.330  -68.935  1.00 40.75  ? 505 MET B SD    1 
ATOM   6940  C  CE    . MET B  1 399 ? 83.793  78.849  -68.488  1.00 40.83  ? 505 MET B CE    1 
ATOM   6941  N  N     . ASP B  1 400 ? 84.591  81.397  -73.759  1.00 40.86  ? 506 ASP B N     1 
ATOM   6942  C  CA    . ASP B  1 400 ? 83.906  81.944  -74.935  1.00 41.58  ? 506 ASP B CA    1 
ATOM   6943  C  C     . ASP B  1 400 ? 82.937  80.937  -75.528  1.00 41.02  ? 506 ASP B C     1 
ATOM   6944  O  O     . ASP B  1 400 ? 82.763  79.852  -74.988  1.00 41.69  ? 506 ASP B O     1 
ATOM   6945  C  CB    . ASP B  1 400 ? 84.927  82.447  -75.981  1.00 43.66  ? 506 ASP B CB    1 
ATOM   6946  C  CG    . ASP B  1 400 ? 85.896  81.363  -76.461  1.00 44.91  ? 506 ASP B CG    1 
ATOM   6947  O  OD1   . ASP B  1 400 ? 85.546  80.146  -76.457  1.00 46.54  ? 506 ASP B OD1   1 
ATOM   6948  O  OD2   . ASP B  1 400 ? 87.023  81.761  -76.861  1.00 44.11  ? 506 ASP B OD2   1 
ATOM   6949  N  N     . TYR B  1 401 ? 82.299  81.318  -76.623  1.00 41.57  ? 507 TYR B N     1 
ATOM   6950  C  CA    . TYR B  1 401 ? 81.449  80.415  -77.396  1.00 42.08  ? 507 TYR B CA    1 
ATOM   6951  C  C     . TYR B  1 401 ? 82.220  79.868  -78.597  1.00 43.30  ? 507 TYR B C     1 
ATOM   6952  O  O     . TYR B  1 401 ? 81.651  79.615  -79.642  1.00 44.34  ? 507 TYR B O     1 
ATOM   6953  C  CB    . TYR B  1 401 ? 80.165  81.147  -77.811  1.00 41.59  ? 507 TYR B CB    1 
ATOM   6954  C  CG    . TYR B  1 401 ? 79.006  81.075  -76.832  1.00 40.76  ? 507 TYR B CG    1 
ATOM   6955  C  CD1   . TYR B  1 401 ? 79.193  80.962  -75.446  1.00 39.71  ? 507 TYR B CD1   1 
ATOM   6956  C  CD2   . TYR B  1 401 ? 77.703  81.116  -77.302  1.00 40.22  ? 507 TYR B CD2   1 
ATOM   6957  C  CE1   . TYR B  1 401 ? 78.098  80.912  -74.578  1.00 38.55  ? 507 TYR B CE1   1 
ATOM   6958  C  CE2   . TYR B  1 401 ? 76.617  81.045  -76.452  1.00 39.15  ? 507 TYR B CE2   1 
ATOM   6959  C  CZ    . TYR B  1 401 ? 76.811  80.945  -75.103  1.00 38.58  ? 507 TYR B CZ    1 
ATOM   6960  O  OH    . TYR B  1 401 ? 75.691  80.862  -74.331  1.00 37.62  ? 507 TYR B OH    1 
ATOM   6961  N  N     . GLY B  1 402 ? 83.518  79.646  -78.426  1.00 45.08  ? 508 GLY B N     1 
ATOM   6962  C  CA    . GLY B  1 402 ? 84.341  79.009  -79.444  1.00 46.34  ? 508 GLY B CA    1 
ATOM   6963  C  C     . GLY B  1 402 ? 84.938  79.908  -80.505  1.00 47.60  ? 508 GLY B C     1 
ATOM   6964  O  O     . GLY B  1 402 ? 85.749  79.431  -81.270  1.00 47.56  ? 508 GLY B O     1 
ATOM   6965  N  N     . MET B  1 403 ? 84.532  81.179  -80.570  1.00 49.66  ? 509 MET B N     1 
ATOM   6966  C  CA    . MET B  1 403 ? 85.008  82.081  -81.623  1.00 50.48  ? 509 MET B CA    1 
ATOM   6967  C  C     . MET B  1 403 ? 85.330  83.416  -81.012  1.00 54.03  ? 509 MET B C     1 
ATOM   6968  O  O     . MET B  1 403 ? 84.791  84.454  -81.394  1.00 56.11  ? 509 MET B O     1 
ATOM   6969  C  CB    . MET B  1 403 ? 83.966  82.247  -82.725  1.00 50.36  ? 509 MET B CB    1 
ATOM   6970  C  CG    . MET B  1 403 ? 83.738  80.989  -83.540  1.00 50.18  ? 509 MET B CG    1 
ATOM   6971  S  SD    . MET B  1 403 ? 82.500  81.283  -84.794  1.00 50.98  ? 509 MET B SD    1 
ATOM   6972  C  CE    . MET B  1 403 ? 83.446  82.215  -86.040  1.00 54.29  ? 509 MET B CE    1 
ATOM   6973  N  N     . GLN B  1 404 ? 86.250  83.367  -80.048  1.00 57.00  ? 510 GLN B N     1 
ATOM   6974  C  CA    . GLN B  1 404 ? 86.621  84.524  -79.266  1.00 59.18  ? 510 GLN B CA    1 
ATOM   6975  C  C     . GLN B  1 404 ? 85.390  85.377  -78.969  1.00 58.95  ? 510 GLN B C     1 
ATOM   6976  O  O     . GLN B  1 404 ? 84.416  84.841  -78.393  1.00 54.66  ? 510 GLN B O     1 
ATOM   6977  C  CB    . GLN B  1 404 ? 87.733  85.274  -79.989  1.00 62.91  ? 510 GLN B CB    1 
ATOM   6978  C  CG    . GLN B  1 404 ? 88.985  84.508  -80.309  1.00 64.69  ? 510 GLN B CG    1 
ATOM   6979  C  CD    . GLN B  1 404 ? 88.936  83.877  -81.712  1.00 67.70  ? 510 GLN B CD    1 
ATOM   6980  O  OE1   . GLN B  1 404 ? 87.977  83.180  -81.961  1.00 73.60  ? 510 GLN B OE1   1 
ATOM   6981  N  NE2   . GLN B  1 404 ? 89.924  84.125  -82.620  1.00 69.60  ? 510 GLN B NE2   1 
ATOM   6982  N  N     . GLU B  1 405 ? 85.339  86.632  -79.406  1.00 62.49  ? 511 GLU B N     1 
ATOM   6983  C  CA    . GLU B  1 405 ? 84.268  87.546  -79.040  1.00 63.80  ? 511 GLU B CA    1 
ATOM   6984  C  C     . GLU B  1 405 ? 83.020  87.438  -79.894  1.00 62.78  ? 511 GLU B C     1 
ATOM   6985  O  O     . GLU B  1 405 ? 82.027  88.100  -79.588  1.00 60.19  ? 511 GLU B O     1 
ATOM   6986  C  CB    . GLU B  1 405 ? 84.773  88.970  -79.048  1.00 65.80  ? 511 GLU B CB    1 
ATOM   6987  C  CG    . GLU B  1 405 ? 85.803  89.221  -77.961  1.00 67.81  ? 511 GLU B CG    1 
ATOM   6988  C  CD    . GLU B  1 405 ? 86.213  90.695  -77.858  1.00 73.16  ? 511 GLU B CD    1 
ATOM   6989  O  OE1   . GLU B  1 405 ? 86.176  91.413  -78.897  1.00 81.80  ? 511 GLU B OE1   1 
ATOM   6990  O  OE2   . GLU B  1 405 ? 86.599  91.174  -76.748  1.00 72.54  ? 511 GLU B OE2   1 
ATOM   6991  N  N     . LYS B  1 406 ? 83.039  86.583  -80.920  1.00 62.18  ? 512 LYS B N     1 
ATOM   6992  C  CA    . LYS B  1 406 ? 81.921  86.444  -81.855  1.00 59.77  ? 512 LYS B CA    1 
ATOM   6993  C  C     . LYS B  1 406 ? 80.863  85.448  -81.420  1.00 56.22  ? 512 LYS B C     1 
ATOM   6994  O  O     . LYS B  1 406 ? 81.153  84.475  -80.714  1.00 56.12  ? 512 LYS B O     1 
ATOM   6995  C  CB    . LYS B  1 406 ? 82.433  85.990  -83.224  1.00 61.44  ? 512 LYS B CB    1 
ATOM   6996  C  CG    . LYS B  1 406 ? 83.370  86.975  -83.878  1.00 65.84  ? 512 LYS B CG    1 
ATOM   6997  C  CD    . LYS B  1 406 ? 83.976  86.397  -85.141  1.00 69.29  ? 512 LYS B CD    1 
ATOM   6998  C  CE    . LYS B  1 406 ? 84.570  87.480  -85.981  1.00 72.71  ? 512 LYS B CE    1 
ATOM   6999  N  NZ    . LYS B  1 406 ? 85.221  86.799  -87.115  1.00 76.32  ? 512 LYS B NZ    1 
ATOM   7000  N  N     . ASN B  1 407 ? 79.642  85.708  -81.884  1.00 51.69  ? 513 ASN B N     1 
ATOM   7001  C  CA    . ASN B  1 407 ? 78.481  84.844  -81.699  1.00 47.92  ? 513 ASN B CA    1 
ATOM   7002  C  C     . ASN B  1 407 ? 78.544  83.830  -82.838  1.00 46.18  ? 513 ASN B C     1 
ATOM   7003  O  O     . ASN B  1 407 ? 78.344  84.193  -83.983  1.00 48.89  ? 513 ASN B O     1 
ATOM   7004  C  CB    . ASN B  1 407 ? 77.199  85.698  -81.827  1.00 47.76  ? 513 ASN B CB    1 
ATOM   7005  C  CG    . ASN B  1 407 ? 75.947  84.872  -81.761  1.00 46.91  ? 513 ASN B CG    1 
ATOM   7006  O  OD1   . ASN B  1 407 ? 76.022  83.666  -81.945  1.00 46.25  ? 513 ASN B OD1   1 
ATOM   7007  N  ND2   . ASN B  1 407 ? 74.818  85.446  -81.420  1.00 44.97  ? 513 ASN B ND2   1 
ATOM   7008  N  N     . PRO B  1 408 ? 78.789  82.545  -82.532  1.00 42.82  ? 514 PRO B N     1 
ATOM   7009  C  CA    . PRO B  1 408 ? 78.901  81.567  -83.600  1.00 41.11  ? 514 PRO B CA    1 
ATOM   7010  C  C     . PRO B  1 408 ? 77.609  81.307  -84.368  1.00 40.23  ? 514 PRO B C     1 
ATOM   7011  O  O     . PRO B  1 408 ? 77.669  80.835  -85.492  1.00 39.09  ? 514 PRO B O     1 
ATOM   7012  C  CB    . PRO B  1 408 ? 79.362  80.303  -82.883  1.00 40.60  ? 514 PRO B CB    1 
ATOM   7013  C  CG    . PRO B  1 408 ? 78.908  80.452  -81.507  1.00 41.24  ? 514 PRO B CG    1 
ATOM   7014  C  CD    . PRO B  1 408 ? 78.875  81.918  -81.207  1.00 42.31  ? 514 PRO B CD    1 
ATOM   7015  N  N     . ILE B  1 409 ? 76.464  81.634  -83.790  1.00 40.73  ? 515 ILE B N     1 
ATOM   7016  C  CA    . ILE B  1 409 ? 75.190  81.460  -84.480  1.00 41.71  ? 515 ILE B CA    1 
ATOM   7017  C  C     . ILE B  1 409 ? 75.039  82.446  -85.635  1.00 44.23  ? 515 ILE B C     1 
ATOM   7018  O  O     . ILE B  1 409 ? 74.325  82.169  -86.592  1.00 45.37  ? 515 ILE B O     1 
ATOM   7019  C  CB    . ILE B  1 409 ? 73.998  81.588  -83.501  1.00 40.85  ? 515 ILE B CB    1 
ATOM   7020  C  CG1   . ILE B  1 409 ? 74.145  80.607  -82.320  1.00 39.80  ? 515 ILE B CG1   1 
ATOM   7021  C  CG2   . ILE B  1 409 ? 72.674  81.351  -84.218  1.00 40.89  ? 515 ILE B CG2   1 
ATOM   7022  C  CD1   . ILE B  1 409 ? 74.490  79.178  -82.695  1.00 39.12  ? 515 ILE B CD1   1 
ATOM   7023  N  N     . ASP B  1 410 ? 75.723  83.588  -85.558  1.00 46.87  ? 516 ASP B N     1 
ATOM   7024  C  CA    . ASP B  1 410 ? 75.812  84.505  -86.699  1.00 49.35  ? 516 ASP B CA    1 
ATOM   7025  C  C     . ASP B  1 410 ? 76.594  83.897  -87.865  1.00 48.98  ? 516 ASP B C     1 
ATOM   7026  O  O     . ASP B  1 410 ? 76.475  84.385  -88.975  1.00 51.79  ? 516 ASP B O     1 
ATOM   7027  C  CB    . ASP B  1 410 ? 76.413  85.862  -86.290  1.00 53.30  ? 516 ASP B CB    1 
ATOM   7028  C  CG    . ASP B  1 410 ? 75.491  86.685  -85.367  1.00 56.63  ? 516 ASP B CG    1 
ATOM   7029  O  OD1   . ASP B  1 410 ? 74.251  86.501  -85.363  1.00 59.91  ? 516 ASP B OD1   1 
ATOM   7030  O  OD2   . ASP B  1 410 ? 76.031  87.530  -84.623  1.00 59.38  ? 516 ASP B OD2   1 
ATOM   7031  N  N     . HIS B  1 411 ? 77.366  82.843  -87.619  1.00 48.19  ? 517 HIS B N     1 
ATOM   7032  C  CA    . HIS B  1 411 ? 78.026  82.072  -88.676  1.00 47.29  ? 517 HIS B CA    1 
ATOM   7033  C  C     . HIS B  1 411 ? 77.396  80.686  -88.959  1.00 43.10  ? 517 HIS B C     1 
ATOM   7034  O  O     . HIS B  1 411 ? 78.095  79.763  -89.368  1.00 40.52  ? 517 HIS B O     1 
ATOM   7035  C  CB    . HIS B  1 411 ? 79.517  81.963  -88.345  1.00 49.82  ? 517 HIS B CB    1 
ATOM   7036  C  CG    . HIS B  1 411 ? 80.175  83.290  -88.152  1.00 53.75  ? 517 HIS B CG    1 
ATOM   7037  N  ND1   . HIS B  1 411 ? 80.617  84.073  -89.198  1.00 57.12  ? 517 HIS B ND1   1 
ATOM   7038  C  CD2   . HIS B  1 411 ? 80.432  84.001  -87.027  1.00 55.54  ? 517 HIS B CD2   1 
ATOM   7039  C  CE1   . HIS B  1 411 ? 81.113  85.203  -88.728  1.00 57.97  ? 517 HIS B CE1   1 
ATOM   7040  N  NE2   . HIS B  1 411 ? 81.027  85.177  -87.412  1.00 56.96  ? 517 HIS B NE2   1 
ATOM   7041  N  N     . VAL B  1 412 ? 76.085  80.562  -88.767  1.00 41.47  ? 518 VAL B N     1 
ATOM   7042  C  CA    . VAL B  1 412 ? 75.325  79.356  -89.123  1.00 39.82  ? 518 VAL B CA    1 
ATOM   7043  C  C     . VAL B  1 412 ? 74.282  79.747  -90.147  1.00 39.04  ? 518 VAL B C     1 
ATOM   7044  O  O     . VAL B  1 412 ? 73.642  80.805  -90.034  1.00 38.93  ? 518 VAL B O     1 
ATOM   7045  C  CB    . VAL B  1 412 ? 74.596  78.720  -87.895  1.00 38.80  ? 518 VAL B CB    1 
ATOM   7046  C  CG1   . VAL B  1 412 ? 73.794  77.470  -88.256  1.00 38.41  ? 518 VAL B CG1   1 
ATOM   7047  C  CG2   . VAL B  1 412 ? 75.586  78.369  -86.815  1.00 37.75  ? 518 VAL B CG2   1 
ATOM   7048  N  N     . SER B  1 413 ? 74.108  78.878  -91.136  1.00 38.91  ? 519 SER B N     1 
ATOM   7049  C  CA    . SER B  1 413 ? 73.087  79.042  -92.160  1.00 39.77  ? 519 SER B CA    1 
ATOM   7050  C  C     . SER B  1 413 ? 71.889  78.176  -91.790  1.00 38.98  ? 519 SER B C     1 
ATOM   7051  O  O     . SER B  1 413 ? 72.060  77.061  -91.319  1.00 39.99  ? 519 SER B O     1 
ATOM   7052  C  CB    . SER B  1 413 ? 73.646  78.652  -93.528  1.00 40.48  ? 519 SER B CB    1 
ATOM   7053  O  OG    . SER B  1 413 ? 74.582  79.623  -93.984  1.00 42.01  ? 519 SER B OG    1 
ATOM   7054  N  N     . PHE B  1 414 ? 70.683  78.701  -92.004  1.00 37.50  ? 520 PHE B N     1 
ATOM   7055  C  CA    . PHE B  1 414 ? 69.444  78.004  -91.678  1.00 36.31  ? 520 PHE B CA    1 
ATOM   7056  C  C     . PHE B  1 414 ? 68.567  77.781  -92.902  1.00 37.96  ? 520 PHE B C     1 
ATOM   7057  O  O     . PHE B  1 414 ? 68.833  78.350  -93.942  1.00 38.73  ? 520 PHE B O     1 
ATOM   7058  C  CB    . PHE B  1 414 ? 68.685  78.778  -90.593  1.00 34.85  ? 520 PHE B CB    1 
ATOM   7059  C  CG    . PHE B  1 414 ? 69.420  78.869  -89.277  1.00 33.34  ? 520 PHE B CG    1 
ATOM   7060  C  CD1   . PHE B  1 414 ? 69.382  77.822  -88.341  1.00 31.82  ? 520 PHE B CD1   1 
ATOM   7061  C  CD2   . PHE B  1 414 ? 70.258  79.946  -88.993  1.00 32.98  ? 520 PHE B CD2   1 
ATOM   7062  C  CE1   . PHE B  1 414 ? 70.086  77.909  -87.164  1.00 30.97  ? 520 PHE B CE1   1 
ATOM   7063  C  CE2   . PHE B  1 414 ? 70.811  80.088  -87.743  1.00 32.41  ? 520 PHE B CE2   1 
ATOM   7064  C  CZ    . PHE B  1 414 ? 70.793  79.040  -86.859  1.00 31.43  ? 520 PHE B CZ    1 
ATOM   7065  N  N     . TYR B  1 415 ? 67.540  76.941  -92.789  1.00 41.07  ? 521 TYR B N     1 
ATOM   7066  C  CA    . TYR B  1 415 ? 66.556  76.758  -93.876  1.00 43.41  ? 521 TYR B CA    1 
ATOM   7067  C  C     . TYR B  1 415 ? 65.140  76.637  -93.335  1.00 46.81  ? 521 TYR B C     1 
ATOM   7068  O  O     . TYR B  1 415 ? 64.967  76.294  -92.177  1.00 46.82  ? 521 TYR B O     1 
ATOM   7069  C  CB    . TYR B  1 415 ? 66.885  75.543  -94.742  1.00 42.20  ? 521 TYR B CB    1 
ATOM   7070  C  CG    . TYR B  1 415 ? 66.699  74.182  -94.095  1.00 40.03  ? 521 TYR B CG    1 
ATOM   7071  C  CD1   . TYR B  1 415 ? 67.738  73.567  -93.420  1.00 38.97  ? 521 TYR B CD1   1 
ATOM   7072  C  CD2   . TYR B  1 415 ? 65.502  73.486  -94.202  1.00 39.00  ? 521 TYR B CD2   1 
ATOM   7073  C  CE1   . TYR B  1 415 ? 67.590  72.303  -92.852  1.00 37.82  ? 521 TYR B CE1   1 
ATOM   7074  C  CE2   . TYR B  1 415 ? 65.333  72.253  -93.606  1.00 37.59  ? 521 TYR B CE2   1 
ATOM   7075  C  CZ    . TYR B  1 415 ? 66.380  71.662  -92.945  1.00 37.34  ? 521 TYR B CZ    1 
ATOM   7076  O  OH    . TYR B  1 415 ? 66.226  70.430  -92.369  1.00 38.74  ? 521 TYR B OH    1 
ATOM   7077  N  N     . CYS B  1 416 ? 64.133  76.884  -94.167  1.00 52.49  ? 522 CYS B N     1 
ATOM   7078  C  CA    . CYS B  1 416 ? 62.721  76.768  -93.747  1.00 58.65  ? 522 CYS B CA    1 
ATOM   7079  C  C     . CYS B  1 416 ? 62.016  75.614  -94.363  1.00 55.40  ? 522 CYS B C     1 
ATOM   7080  O  O     . CYS B  1 416 ? 62.408  75.169  -95.421  1.00 54.33  ? 522 CYS B O     1 
ATOM   7081  C  CB    . CYS B  1 416 ? 61.964  78.035  -94.102  1.00 67.82  ? 522 CYS B CB    1 
ATOM   7082  S  SG    . CYS B  1 416 ? 62.895  79.450  -93.514  1.00 84.71  ? 522 CYS B SG    1 
ATOM   7083  N  N     . LYS B  1 417 ? 60.965  75.153  -93.727  1.00 56.33  ? 523 LYS B N     1 
ATOM   7084  C  CA    . LYS B  1 417 ? 60.168  74.026  -94.226  1.00 58.55  ? 523 LYS B CA    1 
ATOM   7085  C  C     . LYS B  1 417 ? 59.642  74.341  -95.616  1.00 58.65  ? 523 LYS B C     1 
ATOM   7086  O  O     . LYS B  1 417 ? 59.656  73.517  -96.500  1.00 61.59  ? 523 LYS B O     1 
ATOM   7087  C  CB    . LYS B  1 417 ? 58.994  73.756  -93.274  1.00 59.55  ? 523 LYS B CB    1 
ATOM   7088  C  CG    . LYS B  1 417 ? 58.227  72.479  -93.573  1.00 60.76  ? 523 LYS B CG    1 
ATOM   7089  C  CD    . LYS B  1 417 ? 57.267  72.107  -92.431  1.00 61.51  ? 523 LYS B CD    1 
ATOM   7090  C  CE    . LYS B  1 417 ? 56.148  73.131  -92.294  1.00 61.17  ? 523 LYS B CE    1 
ATOM   7091  N  NZ    . LYS B  1 417 ? 55.053  72.589  -91.429  1.00 61.46  ? 523 LYS B NZ    1 
ATOM   7092  N  N     . THR B  1 418 ? 59.182  75.582  -95.770  1.00 57.60  ? 524 THR B N     1 
ATOM   7093  C  CA    . THR B  1 418 ? 58.578  76.104  -96.995  1.00 55.87  ? 524 THR B CA    1 
ATOM   7094  C  C     . THR B  1 418 ? 59.534  76.267  -98.177  1.00 54.75  ? 524 THR B C     1 
ATOM   7095  O  O     . THR B  1 418 ? 59.066  76.320  -99.297  1.00 55.03  ? 524 THR B O     1 
ATOM   7096  C  CB    . THR B  1 418 ? 57.887  77.440  -96.713  1.00 56.27  ? 524 THR B CB    1 
ATOM   7097  O  OG1   . THR B  1 418 ? 58.761  78.279  -95.945  1.00 57.44  ? 524 THR B OG1   1 
ATOM   7098  C  CG2   . THR B  1 418 ? 56.591  77.204  -95.927  1.00 55.38  ? 524 THR B CG2   1 
ATOM   7099  N  N     . ALA B  1 419 ? 60.844  76.354  -97.934  1.00 54.44  ? 525 ALA B N     1 
ATOM   7100  C  CA    . ALA B  1 419 ? 61.868  76.510  -98.994  1.00 52.88  ? 525 ALA B CA    1 
ATOM   7101  C  C     . ALA B  1 419 ? 63.196  75.903  -98.543  1.00 50.11  ? 525 ALA B C     1 
ATOM   7102  O  O     . ALA B  1 419 ? 64.125  76.627  -98.125  1.00 48.92  ? 525 ALA B O     1 
ATOM   7103  C  CB    . ALA B  1 419 ? 62.062  77.966  -99.328  1.00 54.85  ? 525 ALA B CB    1 
ATOM   7104  N  N     . PRO B  1 420 ? 63.281  74.566  -98.602  1.00 48.14  ? 526 PRO B N     1 
ATOM   7105  C  CA    . PRO B  1 420 ? 64.376  73.860  -97.963  1.00 47.35  ? 526 PRO B CA    1 
ATOM   7106  C  C     . PRO B  1 420 ? 65.738  73.951  -98.642  1.00 48.63  ? 526 PRO B C     1 
ATOM   7107  O  O     . PRO B  1 420 ? 66.723  73.494  -98.067  1.00 46.12  ? 526 PRO B O     1 
ATOM   7108  C  CB    . PRO B  1 420 ? 63.889  72.413  -97.902  1.00 45.67  ? 526 PRO B CB    1 
ATOM   7109  C  CG    . PRO B  1 420 ? 62.881  72.311  -98.953  1.00 46.02  ? 526 PRO B CG    1 
ATOM   7110  C  CD    . PRO B  1 420 ? 62.238  73.654  -99.078  1.00 47.02  ? 526 PRO B CD    1 
ATOM   7111  N  N     . ASN B  1 421 ? 65.808  74.513  -99.846  1.00 50.86  ? 527 ASN B N     1 
ATOM   7112  C  CA    . ASN B  1 421 ? 67.090  74.734  -100.515 1.00 53.95  ? 527 ASN B CA    1 
ATOM   7113  C  C     . ASN B  1 421 ? 67.627  76.148  -100.379 1.00 53.97  ? 527 ASN B C     1 
ATOM   7114  O  O     . ASN B  1 421 ? 68.776  76.419  -100.741 1.00 54.10  ? 527 ASN B O     1 
ATOM   7115  C  CB    . ASN B  1 421 ? 66.990  74.330  -101.971 1.00 57.16  ? 527 ASN B CB    1 
ATOM   7116  C  CG    . ASN B  1 421 ? 66.802  72.833  -102.132 1.00 58.19  ? 527 ASN B CG    1 
ATOM   7117  O  OD1   . ASN B  1 421 ? 67.287  72.055  -101.310 1.00 60.44  ? 527 ASN B OD1   1 
ATOM   7118  N  ND2   . ASN B  1 421 ? 66.101  72.425  -103.186 1.00 60.59  ? 527 ASN B ND2   1 
ATOM   7119  N  N     . ARG B  1 422 ? 66.797  77.025  -99.830  1.00 52.68  ? 528 ARG B N     1 
ATOM   7120  C  CA    . ARG B  1 422 ? 67.129  78.426  -99.670  1.00 52.01  ? 528 ARG B CA    1 
ATOM   7121  C  C     . ARG B  1 422 ? 67.652  78.687  -98.281  1.00 48.01  ? 528 ARG B C     1 
ATOM   7122  O  O     . ARG B  1 422 ? 66.886  78.672  -97.305  1.00 46.30  ? 528 ARG B O     1 
ATOM   7123  C  CB    . ARG B  1 422 ? 65.912  79.315  -99.964  1.00 55.40  ? 528 ARG B CB    1 
ATOM   7124  C  CG    . ARG B  1 422 ? 66.388  80.738  -100.176 1.00 57.38  ? 528 ARG B CG    1 
ATOM   7125  C  CD    . ARG B  1 422 ? 65.380  81.853  -100.028 1.00 57.80  ? 528 ARG B CD    1 
ATOM   7126  N  NE    . ARG B  1 422 ? 66.139  83.001  -99.519  1.00 61.00  ? 528 ARG B NE    1 
ATOM   7127  C  CZ    . ARG B  1 422 ? 65.704  84.247  -99.393  1.00 66.58  ? 528 ARG B CZ    1 
ATOM   7128  N  NH1   . ARG B  1 422 ? 64.479  84.561  -99.784  1.00 70.13  ? 528 ARG B NH1   1 
ATOM   7129  N  NH2   . ARG B  1 422 ? 66.528  85.165  -98.893  1.00 68.26  ? 528 ARG B NH2   1 
ATOM   7130  N  N     . ALA B  1 423 ? 68.955  78.928  -98.207  1.00 47.20  ? 529 ALA B N     1 
ATOM   7131  C  CA    . ALA B  1 423 ? 69.645  79.231  -96.955  1.00 47.90  ? 529 ALA B CA    1 
ATOM   7132  C  C     . ALA B  1 423 ? 69.386  80.643  -96.501  1.00 49.36  ? 529 ALA B C     1 
ATOM   7133  O  O     . ALA B  1 423 ? 69.235  81.527  -97.318  1.00 50.24  ? 529 ALA B O     1 
ATOM   7134  C  CB    . ALA B  1 423 ? 71.139  79.029  -97.113  1.00 47.81  ? 529 ALA B CB    1 
ATOM   7135  N  N     . ILE B  1 424 ? 69.344  80.846  -95.190  1.00 51.61  ? 530 ILE B N     1 
ATOM   7136  C  CA    . ILE B  1 424 ? 69.099  82.161  -94.587  1.00 51.76  ? 530 ILE B CA    1 
ATOM   7137  C  C     . ILE B  1 424 ? 69.936  82.350  -93.340  1.00 51.57  ? 530 ILE B C     1 
ATOM   7138  O  O     . ILE B  1 424 ? 70.591  81.424  -92.895  1.00 51.18  ? 530 ILE B O     1 
ATOM   7139  C  CB    . ILE B  1 424 ? 67.619  82.348  -94.226  1.00 52.06  ? 530 ILE B CB    1 
ATOM   7140  C  CG1   . ILE B  1 424 ? 67.145  81.245  -93.280  1.00 52.30  ? 530 ILE B CG1   1 
ATOM   7141  C  CG2   . ILE B  1 424 ? 66.765  82.343  -95.483  1.00 53.11  ? 530 ILE B CG2   1 
ATOM   7142  C  CD1   . ILE B  1 424 ? 65.796  81.442  -92.670  1.00 53.64  ? 530 ILE B CD1   1 
ATOM   7143  N  N     . ARG B  1 425 ? 69.917  83.560  -92.797  1.00 54.10  ? 531 ARG B N     1 
ATOM   7144  C  CA    . ARG B  1 425 ? 70.609  83.890  -91.549  1.00 58.16  ? 531 ARG B CA    1 
ATOM   7145  C  C     . ARG B  1 425 ? 69.557  84.249  -90.514  1.00 57.92  ? 531 ARG B C     1 
ATOM   7146  O  O     . ARG B  1 425 ? 68.465  84.701  -90.859  1.00 61.36  ? 531 ARG B O     1 
ATOM   7147  C  CB    . ARG B  1 425 ? 71.558  85.064  -91.746  1.00 63.33  ? 531 ARG B CB    1 
ATOM   7148  C  CG    . ARG B  1 425 ? 72.680  84.793  -92.747  1.00 69.40  ? 531 ARG B CG    1 
ATOM   7149  C  CD    . ARG B  1 425 ? 73.779  83.894  -92.211  1.00 73.41  ? 531 ARG B CD    1 
ATOM   7150  N  NE    . ARG B  1 425 ? 74.995  84.048  -93.021  1.00 78.05  ? 531 ARG B NE    1 
ATOM   7151  C  CZ    . ARG B  1 425 ? 76.117  83.372  -92.835  1.00 81.40  ? 531 ARG B CZ    1 
ATOM   7152  N  NH1   . ARG B  1 425 ? 77.156  83.638  -93.598  1.00 81.67  ? 531 ARG B NH1   1 
ATOM   7153  N  NH2   . ARG B  1 425 ? 76.235  82.482  -91.828  1.00 86.63  ? 531 ARG B NH2   1 
ATOM   7154  N  N     . ILE B  1 426 ? 69.873  84.007  -89.247  1.00 56.23  ? 532 ILE B N     1 
ATOM   7155  C  CA    . ILE B  1 426 ? 68.989  84.378  -88.147  1.00 55.16  ? 532 ILE B CA    1 
ATOM   7156  C  C     . ILE B  1 426 ? 69.863  85.125  -87.142  1.00 55.79  ? 532 ILE B C     1 
ATOM   7157  O  O     . ILE B  1 426 ? 70.830  84.573  -86.612  1.00 57.32  ? 532 ILE B O     1 
ATOM   7158  C  CB    . ILE B  1 426 ? 68.312  83.154  -87.480  1.00 53.59  ? 532 ILE B CB    1 
ATOM   7159  C  CG1   . ILE B  1 426 ? 67.432  82.362  -88.471  1.00 52.84  ? 532 ILE B CG1   1 
ATOM   7160  C  CG2   . ILE B  1 426 ? 67.425  83.628  -86.341  1.00 55.83  ? 532 ILE B CG2   1 
ATOM   7161  C  CD1   . ILE B  1 426 ? 66.748  81.091  -87.934  1.00 52.84  ? 532 ILE B CD1   1 
ATOM   7162  N  N     . THR B  1 427 ? 69.519  86.374  -86.870  1.00 57.71  ? 533 THR B N     1 
ATOM   7163  C  CA    . THR B  1 427 ? 70.290  87.204  -85.947  1.00 62.36  ? 533 THR B CA    1 
ATOM   7164  C  C     . THR B  1 427 ? 69.912  86.887  -84.520  1.00 65.78  ? 533 THR B C     1 
ATOM   7165  O  O     . THR B  1 427 ? 68.976  86.133  -84.285  1.00 68.61  ? 533 THR B O     1 
ATOM   7166  C  CB    . THR B  1 427 ? 70.008  88.688  -86.157  1.00 63.72  ? 533 THR B CB    1 
ATOM   7167  O  OG1   . THR B  1 427 ? 68.630  88.937  -85.873  1.00 65.46  ? 533 THR B OG1   1 
ATOM   7168  C  CG2   . THR B  1 427 ? 70.340  89.099  -87.582  1.00 64.94  ? 533 THR B CG2   1 
ATOM   7169  N  N     . LYS B  1 428 ? 70.611  87.490  -83.563  1.00 67.21  ? 534 LYS B N     1 
ATOM   7170  C  CA    . LYS B  1 428 ? 70.281  87.262  -82.161  1.00 66.40  ? 534 LYS B CA    1 
ATOM   7171  C  C     . LYS B  1 428 ? 68.924  87.843  -81.781  1.00 66.83  ? 534 LYS B C     1 
ATOM   7172  O  O     . LYS B  1 428 ? 68.135  87.200  -81.093  1.00 63.60  ? 534 LYS B O     1 
ATOM   7173  C  CB    . LYS B  1 428 ? 71.375  87.818  -81.252  1.00 67.95  ? 534 LYS B CB    1 
ATOM   7174  C  CG    . LYS B  1 428 ? 71.378  87.170  -79.874  1.00 67.67  ? 534 LYS B CG    1 
ATOM   7175  C  CD    . LYS B  1 428 ? 72.380  87.791  -78.943  1.00 68.30  ? 534 LYS B CD    1 
ATOM   7176  C  CE    . LYS B  1 428 ? 71.921  89.130  -78.429  1.00 71.80  ? 534 LYS B CE    1 
ATOM   7177  N  NZ    . LYS B  1 428 ? 72.777  89.593  -77.308  1.00 74.58  ? 534 LYS B NZ    1 
ATOM   7178  N  N     . ASN B  1 429 ? 68.651  89.062  -82.258  1.00 68.62  ? 535 ASN B N     1 
ATOM   7179  C  CA    . ASN B  1 429 ? 67.365  89.758  -81.950  1.00 68.76  ? 535 ASN B CA    1 
ATOM   7180  C  C     . ASN B  1 429 ? 66.136  89.032  -82.433  1.00 65.23  ? 535 ASN B C     1 
ATOM   7181  O  O     . ASN B  1 429 ? 65.068  89.153  -81.827  1.00 66.56  ? 535 ASN B O     1 
ATOM   7182  C  CB    . ASN B  1 429 ? 67.377  91.156  -82.517  1.00 72.03  ? 535 ASN B CB    1 
ATOM   7183  C  CG    . ASN B  1 429 ? 68.443  92.014  -81.830  1.00 73.04  ? 535 ASN B CG    1 
ATOM   7184  O  OD1   . ASN B  1 429 ? 68.739  91.864  -80.628  1.00 66.34  ? 535 ASN B OD1   1 
ATOM   7185  N  ND2   . ASN B  1 429 ? 69.077  92.892  -82.611  1.00 78.58  ? 535 ASN B ND2   1 
ATOM   7186  N  N     . GLN B  1 430 ? 66.281  88.286  -83.518  1.00 61.42  ? 536 GLN B N     1 
ATOM   7187  C  CA    . GLN B  1 430 ? 65.187  87.468  -84.059  1.00 57.74  ? 536 GLN B CA    1 
ATOM   7188  C  C     . GLN B  1 430 ? 64.822  86.277  -83.167  1.00 54.35  ? 536 GLN B C     1 
ATOM   7189  O  O     . GLN B  1 430 ? 63.755  85.708  -83.351  1.00 52.93  ? 536 GLN B O     1 
ATOM   7190  C  CB    . GLN B  1 430 ? 65.523  86.964  -85.476  1.00 57.65  ? 536 GLN B CB    1 
ATOM   7191  C  CG    . GLN B  1 430 ? 65.392  87.992  -86.592  1.00 57.71  ? 536 GLN B CG    1 
ATOM   7192  C  CD    . GLN B  1 430 ? 65.758  87.425  -87.970  1.00 57.38  ? 536 GLN B CD    1 
ATOM   7193  O  OE1   . GLN B  1 430 ? 66.928  87.318  -88.308  1.00 56.03  ? 536 GLN B OE1   1 
ATOM   7194  N  NE2   . GLN B  1 430 ? 64.757  87.035  -88.765  1.00 57.85  ? 536 GLN B NE2   1 
ATOM   7195  N  N     . VAL B  1 431 ? 65.693  85.897  -82.226  1.00 53.29  ? 537 VAL B N     1 
ATOM   7196  C  CA    . VAL B  1 431 ? 65.482  84.698  -81.388  1.00 56.01  ? 537 VAL B CA    1 
ATOM   7197  C  C     . VAL B  1 431 ? 64.947  85.013  -79.995  1.00 57.36  ? 537 VAL B C     1 
ATOM   7198  O  O     . VAL B  1 431 ? 63.860  84.534  -79.628  1.00 56.40  ? 537 VAL B O     1 
ATOM   7199  C  CB    . VAL B  1 431 ? 66.768  83.856  -81.230  1.00 56.49  ? 537 VAL B CB    1 
ATOM   7200  C  CG1   . VAL B  1 431 ? 66.490  82.590  -80.440  1.00 56.04  ? 537 VAL B CG1   1 
ATOM   7201  C  CG2   . VAL B  1 431 ? 67.323  83.470  -82.595  1.00 57.42  ? 537 VAL B CG2   1 
ATOM   7202  N  N     . SER B  1 432 ? 65.718  85.773  -79.217  1.00 56.37  ? 538 SER B N     1 
ATOM   7203  C  CA    . SER B  1 432 ? 65.354  86.041  -77.816  1.00 53.61  ? 538 SER B CA    1 
ATOM   7204  C  C     . SER B  1 432 ? 66.168  87.173  -77.198  1.00 52.92  ? 538 SER B C     1 
ATOM   7205  O  O     . SER B  1 432 ? 67.371  87.304  -77.472  1.00 53.27  ? 538 SER B O     1 
ATOM   7206  C  CB    . SER B  1 432 ? 65.536  84.765  -76.964  1.00 52.83  ? 538 SER B CB    1 
ATOM   7207  O  OG    . SER B  1 432 ? 65.343  85.005  -75.579  1.00 52.50  ? 538 SER B OG    1 
ATOM   7208  N  N     . GLN B  1 433 ? 65.521  87.934  -76.340  1.00 53.44  ? 539 GLN B N     1 
ATOM   7209  C  CA    . GLN B  1 433 ? 66.166  88.942  -75.511  1.00 53.45  ? 539 GLN B CA    1 
ATOM   7210  C  C     . GLN B  1 433 ? 66.868  88.334  -74.268  1.00 48.68  ? 539 GLN B C     1 
ATOM   7211  O  O     . GLN B  1 433 ? 67.651  89.004  -73.608  1.00 44.14  ? 539 GLN B O     1 
ATOM   7212  C  CB    . GLN B  1 433 ? 65.118  89.990  -75.041  1.00 57.85  ? 539 GLN B CB    1 
ATOM   7213  C  CG    . GLN B  1 433 ? 64.481  90.788  -76.162  1.00 61.34  ? 539 GLN B CG    1 
ATOM   7214  C  CD    . GLN B  1 433 ? 65.496  91.636  -76.884  1.00 64.65  ? 539 GLN B CD    1 
ATOM   7215  O  OE1   . GLN B  1 433 ? 66.250  92.378  -76.255  1.00 67.86  ? 539 GLN B OE1   1 
ATOM   7216  N  NE2   . GLN B  1 433 ? 65.539  91.517  -78.211  1.00 66.75  ? 539 GLN B NE2   1 
ATOM   7217  N  N     . LEU B  1 434 ? 66.583  87.069  -73.955  1.00 47.08  ? 540 LEU B N     1 
ATOM   7218  C  CA    . LEU B  1 434 ? 67.206  86.390  -72.820  1.00 45.85  ? 540 LEU B CA    1 
ATOM   7219  C  C     . LEU B  1 434 ? 68.523  85.667  -73.136  1.00 46.08  ? 540 LEU B C     1 
ATOM   7220  O  O     . LEU B  1 434 ? 69.045  84.918  -72.302  1.00 46.02  ? 540 LEU B O     1 
ATOM   7221  C  CB    . LEU B  1 434 ? 66.220  85.393  -72.211  1.00 44.75  ? 540 LEU B CB    1 
ATOM   7222  C  CG    . LEU B  1 434 ? 64.837  85.946  -71.854  1.00 44.14  ? 540 LEU B CG    1 
ATOM   7223  C  CD1   . LEU B  1 434 ? 63.958  84.826  -71.340  1.00 44.43  ? 540 LEU B CD1   1 
ATOM   7224  C  CD2   . LEU B  1 434 ? 64.931  87.123  -70.900  1.00 44.09  ? 540 LEU B CD2   1 
ATOM   7225  N  N     . LEU B  1 435 ? 69.071  85.884  -74.329  1.00 46.86  ? 541 LEU B N     1 
ATOM   7226  C  CA    . LEU B  1 435 ? 70.360  85.307  -74.702  1.00 46.60  ? 541 LEU B CA    1 
ATOM   7227  C  C     . LEU B  1 435 ? 71.485  86.151  -74.143  1.00 46.64  ? 541 LEU B C     1 
ATOM   7228  O  O     . LEU B  1 435 ? 71.227  87.228  -73.630  1.00 47.64  ? 541 LEU B O     1 
ATOM   7229  C  CB    . LEU B  1 435 ? 70.451  85.208  -76.211  1.00 47.36  ? 541 LEU B CB    1 
ATOM   7230  C  CG    . LEU B  1 435 ? 69.535  84.122  -76.784  1.00 47.98  ? 541 LEU B CG    1 
ATOM   7231  C  CD1   . LEU B  1 435 ? 69.400  84.283  -78.292  1.00 49.18  ? 541 LEU B CD1   1 
ATOM   7232  C  CD2   . LEU B  1 435 ? 70.059  82.727  -76.461  1.00 47.55  ? 541 LEU B CD2   1 
ATOM   7233  N  N     . PRO B  1 436 ? 72.733  85.663  -74.203  1.00 47.26  ? 542 PRO B N     1 
ATOM   7234  C  CA    . PRO B  1 436 ? 73.851  86.433  -73.658  1.00 51.10  ? 542 PRO B CA    1 
ATOM   7235  C  C     . PRO B  1 436 ? 74.124  87.726  -74.413  1.00 57.78  ? 542 PRO B C     1 
ATOM   7236  O  O     . PRO B  1 436 ? 73.915  87.785  -75.626  1.00 61.59  ? 542 PRO B O     1 
ATOM   7237  C  CB    . PRO B  1 436 ? 75.045  85.503  -73.830  1.00 49.61  ? 542 PRO B CB    1 
ATOM   7238  C  CG    . PRO B  1 436 ? 74.472  84.151  -73.942  1.00 48.14  ? 542 PRO B CG    1 
ATOM   7239  C  CD    . PRO B  1 436 ? 73.157  84.323  -74.624  1.00 47.44  ? 542 PRO B CD    1 
ATOM   7240  N  N     . GLU B  1 437 ? 74.609  88.732  -73.689  1.00 64.69  ? 543 GLU B N     1 
ATOM   7241  C  CA    . GLU B  1 437 ? 74.932  90.033  -74.265  1.00 69.78  ? 543 GLU B CA    1 
ATOM   7242  C  C     . GLU B  1 437 ? 76.295  89.945  -74.944  1.00 65.75  ? 543 GLU B C     1 
ATOM   7243  O  O     . GLU B  1 437 ? 76.441  90.360  -76.082  1.00 62.28  ? 543 GLU B O     1 
ATOM   7244  C  CB    . GLU B  1 437 ? 74.943  91.071  -73.137  1.00 79.40  ? 543 GLU B CB    1 
ATOM   7245  C  CG    . GLU B  1 437 ? 75.044  92.531  -73.547  1.00 88.63  ? 543 GLU B CG    1 
ATOM   7246  C  CD    . GLU B  1 437 ? 74.726  93.455  -72.307  1.00 94.43  ? 543 GLU B CD    1 
ATOM   7247  O  OE1   . GLU B  1 437 ? 74.296  92.994  -71.200  1.00 89.42  ? 543 GLU B OE1   1 
ATOM   7248  O  OE2   . GLU B  1 437 ? 74.915  94.695  -72.399  1.00 102.13 ? 543 GLU B OE2   1 
ATOM   7249  N  N     . LYS B  1 438 ? 77.277  89.397  -74.223  1.00 63.19  ? 544 LYS B N     1 
ATOM   7250  C  CA    . LYS B  1 438 ? 78.622  89.112  -74.731  1.00 59.54  ? 544 LYS B CA    1 
ATOM   7251  C  C     . LYS B  1 438 ? 78.771  87.618  -75.001  1.00 54.61  ? 544 LYS B C     1 
ATOM   7252  O  O     . LYS B  1 438 ? 77.951  86.809  -74.549  1.00 52.65  ? 544 LYS B O     1 
ATOM   7253  C  CB    . LYS B  1 438 ? 79.674  89.540  -73.701  1.00 61.49  ? 544 LYS B CB    1 
ATOM   7254  C  CG    . LYS B  1 438 ? 79.727  91.029  -73.409  1.00 66.95  ? 544 LYS B CG    1 
ATOM   7255  C  CD    . LYS B  1 438 ? 80.797  91.386  -72.395  1.00 72.59  ? 544 LYS B CD    1 
ATOM   7256  C  CE    . LYS B  1 438 ? 80.714  92.882  -72.067  1.00 78.57  ? 544 LYS B CE    1 
ATOM   7257  N  NZ    . LYS B  1 438 ? 81.731  93.309  -71.076  1.00 82.26  ? 544 LYS B NZ    1 
ATOM   7258  N  N     . PHE B  1 439 ? 79.813  87.246  -75.741  1.00 50.85  ? 545 PHE B N     1 
ATOM   7259  C  CA    . PHE B  1 439 ? 80.130  85.830  -76.001  1.00 47.50  ? 545 PHE B CA    1 
ATOM   7260  C  C     . PHE B  1 439 ? 81.548  85.418  -75.611  1.00 44.65  ? 545 PHE B C     1 
ATOM   7261  O  O     . PHE B  1 439 ? 82.049  84.387  -76.035  1.00 43.52  ? 545 PHE B O     1 
ATOM   7262  C  CB    . PHE B  1 439 ? 79.854  85.488  -77.460  1.00 48.38  ? 545 PHE B CB    1 
ATOM   7263  C  CG    . PHE B  1 439 ? 78.448  85.740  -77.846  1.00 49.40  ? 545 PHE B CG    1 
ATOM   7264  C  CD1   . PHE B  1 439 ? 78.060  86.989  -78.276  1.00 51.23  ? 545 PHE B CD1   1 
ATOM   7265  C  CD2   . PHE B  1 439 ? 77.510  84.754  -77.757  1.00 49.28  ? 545 PHE B CD2   1 
ATOM   7266  C  CE1   . PHE B  1 439 ? 76.752  87.238  -78.652  1.00 52.39  ? 545 PHE B CE1   1 
ATOM   7267  C  CE2   . PHE B  1 439 ? 76.168  85.008  -77.973  1.00 49.21  ? 545 PHE B CE2   1 
ATOM   7268  C  CZ    . PHE B  1 439 ? 75.795  86.230  -78.467  1.00 50.63  ? 545 PHE B CZ    1 
ATOM   7269  N  N     . ALA B  1 440 ? 82.187  86.229  -74.780  1.00 42.97  ? 546 ALA B N     1 
ATOM   7270  C  CA    . ALA B  1 440 ? 83.484  85.910  -74.221  1.00 42.54  ? 546 ALA B CA    1 
ATOM   7271  C  C     . ALA B  1 440 ? 83.727  86.701  -72.966  1.00 43.39  ? 546 ALA B C     1 
ATOM   7272  O  O     . ALA B  1 440 ? 83.198  87.810  -72.791  1.00 47.82  ? 546 ALA B O     1 
ATOM   7273  C  CB    . ALA B  1 440 ? 84.581  86.192  -75.207  1.00 43.08  ? 546 ALA B CB    1 
ATOM   7274  N  N     . GLU B  1 441 ? 84.517  86.123  -72.066  1.00 43.07  ? 547 GLU B N     1 
ATOM   7275  C  CA    . GLU B  1 441 ? 84.929  86.783  -70.841  1.00 44.39  ? 547 GLU B CA    1 
ATOM   7276  C  C     . GLU B  1 441 ? 86.172  86.111  -70.325  1.00 45.98  ? 547 GLU B C     1 
ATOM   7277  O  O     . GLU B  1 441 ? 86.612  85.099  -70.860  1.00 47.29  ? 547 GLU B O     1 
ATOM   7278  C  CB    . GLU B  1 441 ? 83.814  86.714  -69.811  1.00 44.52  ? 547 GLU B CB    1 
ATOM   7279  C  CG    . GLU B  1 441 ? 83.405  85.287  -69.419  1.00 44.98  ? 547 GLU B CG    1 
ATOM   7280  C  CD    . GLU B  1 441 ? 82.227  85.198  -68.481  1.00 45.44  ? 547 GLU B CD    1 
ATOM   7281  O  OE1   . GLU B  1 441 ? 81.834  86.260  -67.915  1.00 48.13  ? 547 GLU B OE1   1 
ATOM   7282  O  OE2   . GLU B  1 441 ? 81.760  84.035  -68.295  1.00 44.69  ? 547 GLU B OE2   1 
ATOM   7283  N  N     . GLN B  1 442 ? 86.732  86.679  -69.262  1.00 48.84  ? 548 GLN B N     1 
ATOM   7284  C  CA    . GLN B  1 442 ? 87.908  86.125  -68.614  1.00 50.78  ? 548 GLN B CA    1 
ATOM   7285  C  C     . GLN B  1 442 ? 87.632  85.869  -67.158  1.00 51.23  ? 548 GLN B C     1 
ATOM   7286  O  O     . GLN B  1 442 ? 86.933  86.637  -66.516  1.00 53.11  ? 548 GLN B O     1 
ATOM   7287  C  CB    . GLN B  1 442 ? 89.059  87.093  -68.752  1.00 53.49  ? 548 GLN B CB    1 
ATOM   7288  C  CG    . GLN B  1 442 ? 89.745  86.998  -70.097  1.00 55.71  ? 548 GLN B CG    1 
ATOM   7289  C  CD    . GLN B  1 442 ? 90.940  87.915  -70.206  1.00 58.28  ? 548 GLN B CD    1 
ATOM   7290  O  OE1   . GLN B  1 442 ? 90.819  89.121  -70.024  1.00 63.70  ? 548 GLN B OE1   1 
ATOM   7291  N  NE2   . GLN B  1 442 ? 92.100  87.349  -70.512  1.00 59.16  ? 548 GLN B NE2   1 
ATOM   7292  N  N     . LEU B  1 443 ? 88.185  84.775  -66.656  1.00 51.17  ? 549 LEU B N     1 
ATOM   7293  C  CA    . LEU B  1 443 ? 88.131  84.452  -65.237  1.00 51.41  ? 549 LEU B CA    1 
ATOM   7294  C  C     . LEU B  1 443 ? 89.530  84.406  -64.716  1.00 48.83  ? 549 LEU B C     1 
ATOM   7295  O  O     . LEU B  1 443 ? 90.393  83.796  -65.336  1.00 48.00  ? 549 LEU B O     1 
ATOM   7296  C  CB    . LEU B  1 443 ? 87.472  83.095  -65.007  1.00 52.93  ? 549 LEU B CB    1 
ATOM   7297  C  CG    . LEU B  1 443 ? 86.078  82.954  -65.584  1.00 54.10  ? 549 LEU B CG    1 
ATOM   7298  C  CD1   . LEU B  1 443 ? 85.513  81.567  -65.291  1.00 53.33  ? 549 LEU B CD1   1 
ATOM   7299  C  CD2   . LEU B  1 443 ? 85.144  84.032  -65.078  1.00 55.96  ? 549 LEU B CD2   1 
ATOM   7300  N  N     . ILE B  1 444 ? 89.735  85.034  -63.563  1.00 46.49  ? 550 ILE B N     1 
ATOM   7301  C  CA    . ILE B  1 444 ? 91.037  85.081  -62.926  1.00 45.38  ? 550 ILE B CA    1 
ATOM   7302  C  C     . ILE B  1 444 ? 90.919  84.410  -61.580  1.00 42.94  ? 550 ILE B C     1 
ATOM   7303  O  O     . ILE B  1 444 ? 90.239  84.903  -60.707  1.00 41.56  ? 550 ILE B O     1 
ATOM   7304  C  CB    . ILE B  1 444 ? 91.514  86.523  -62.734  1.00 46.69  ? 550 ILE B CB    1 
ATOM   7305  C  CG1   . ILE B  1 444 ? 91.514  87.275  -64.064  1.00 47.79  ? 550 ILE B CG1   1 
ATOM   7306  C  CG2   . ILE B  1 444 ? 92.917  86.535  -62.165  1.00 47.77  ? 550 ILE B CG2   1 
ATOM   7307  C  CD1   . ILE B  1 444 ? 91.431  88.771  -63.904  1.00 48.20  ? 550 ILE B CD1   1 
ATOM   7308  N  N     . ARG B  1 445 ? 91.587  83.278  -61.435  1.00 42.07  ? 551 ARG B N     1 
ATOM   7309  C  CA    . ARG B  1 445 ? 91.638  82.541  -60.182  1.00 41.97  ? 551 ARG B CA    1 
ATOM   7310  C  C     . ARG B  1 445 ? 92.999  82.768  -59.566  1.00 42.00  ? 551 ARG B C     1 
ATOM   7311  O  O     . ARG B  1 445 ? 94.010  82.660  -60.245  1.00 43.06  ? 551 ARG B O     1 
ATOM   7312  C  CB    . ARG B  1 445 ? 91.450  81.030  -60.412  1.00 41.78  ? 551 ARG B CB    1 
ATOM   7313  C  CG    . ARG B  1 445 ? 90.015  80.556  -60.614  1.00 41.33  ? 551 ARG B CG    1 
ATOM   7314  C  CD    . ARG B  1 445 ? 89.532  80.744  -62.025  1.00 41.63  ? 551 ARG B CD    1 
ATOM   7315  N  NE    . ARG B  1 445 ? 88.248  80.083  -62.248  1.00 40.39  ? 551 ARG B NE    1 
ATOM   7316  C  CZ    . ARG B  1 445 ? 88.073  78.801  -62.525  1.00 40.21  ? 551 ARG B CZ    1 
ATOM   7317  N  NH1   . ARG B  1 445 ? 86.838  78.378  -62.693  1.00 39.81  ? 551 ARG B NH1   1 
ATOM   7318  N  NH2   . ARG B  1 445 ? 89.076  77.989  -62.777  1.00 42.82  ? 551 ARG B NH2   1 
ATOM   7319  N  N     . VAL B  1 446 ? 93.024  83.057  -58.277  1.00 42.92  ? 552 VAL B N     1 
ATOM   7320  C  CA    . VAL B  1 446 ? 94.262  83.240  -57.542  1.00 46.03  ? 552 VAL B CA    1 
ATOM   7321  C  C     . VAL B  1 446 ? 94.367  82.134  -56.504  1.00 46.64  ? 552 VAL B C     1 
ATOM   7322  O  O     . VAL B  1 446 ? 93.409  81.858  -55.797  1.00 48.55  ? 552 VAL B O     1 
ATOM   7323  C  CB    . VAL B  1 446 ? 94.280  84.623  -56.859  1.00 47.76  ? 552 VAL B CB    1 
ATOM   7324  C  CG1   . VAL B  1 446 ? 95.535  84.803  -56.029  1.00 48.97  ? 552 VAL B CG1   1 
ATOM   7325  C  CG2   . VAL B  1 446 ? 94.170  85.723  -57.900  1.00 49.07  ? 552 VAL B CG2   1 
ATOM   7326  N  N     . TYR B  1 447 ? 95.529  81.513  -56.418  1.00 47.60  ? 553 TYR B N     1 
ATOM   7327  C  CA    . TYR B  1 447 ? 95.797  80.510  -55.392  1.00 49.23  ? 553 TYR B CA    1 
ATOM   7328  C  C     . TYR B  1 447 ? 97.048  80.927  -54.629  1.00 54.06  ? 553 TYR B C     1 
ATOM   7329  O  O     . TYR B  1 447 ? 97.792  81.783  -55.088  1.00 54.88  ? 553 TYR B O     1 
ATOM   7330  C  CB    . TYR B  1 447 ? 96.022  79.114  -56.008  1.00 47.45  ? 553 TYR B CB    1 
ATOM   7331  C  CG    . TYR B  1 447 ? 94.987  78.641  -57.010  1.00 44.38  ? 553 TYR B CG    1 
ATOM   7332  C  CD1   . TYR B  1 447 ? 94.947  79.177  -58.298  1.00 44.52  ? 553 TYR B CD1   1 
ATOM   7333  C  CD2   . TYR B  1 447 ? 94.087  77.612  -56.704  1.00 41.42  ? 553 TYR B CD2   1 
ATOM   7334  C  CE1   . TYR B  1 447 ? 94.016  78.744  -59.230  1.00 43.34  ? 553 TYR B CE1   1 
ATOM   7335  C  CE2   . TYR B  1 447 ? 93.152  77.171  -57.649  1.00 40.16  ? 553 TYR B CE2   1 
ATOM   7336  C  CZ    . TYR B  1 447 ? 93.118  77.751  -58.911  1.00 41.13  ? 553 TYR B CZ    1 
ATOM   7337  O  OH    . TYR B  1 447 ? 92.227  77.375  -59.920  1.00 40.56  ? 553 TYR B OH    1 
ATOM   7338  N  N     . CYS B  1 448 ? 97.270  80.309  -53.478  1.00 59.15  ? 554 CYS B N     1 
ATOM   7339  C  CA    . CYS B  1 448 ? 98.442  80.598  -52.650  1.00 62.71  ? 554 CYS B CA    1 
ATOM   7340  C  C     . CYS B  1 448 ? 99.162  79.299  -52.351  1.00 61.60  ? 554 CYS B C     1 
ATOM   7341  O  O     . CYS B  1 448 ? 98.528  78.343  -51.917  1.00 58.04  ? 554 CYS B O     1 
ATOM   7342  C  CB    . CYS B  1 448 ? 98.034  81.269  -51.343  1.00 67.20  ? 554 CYS B CB    1 
ATOM   7343  S  SG    . CYS B  1 448 ? 99.380  81.536  -50.202  1.00 76.86  ? 554 CYS B SG    1 
ATOM   7344  N  N     . LYS B  1 449 ? 100.482 79.271  -52.564  1.00 63.46  ? 555 LYS B N     1 
ATOM   7345  C  CA    . LYS B  1 449 ? 101.282 78.067  -52.312  1.00 63.81  ? 555 LYS B CA    1 
ATOM   7346  C  C     . LYS B  1 449 ? 101.495 77.764  -50.833  1.00 66.35  ? 555 LYS B C     1 
ATOM   7347  O  O     . LYS B  1 449 ? 101.734 76.606  -50.490  1.00 70.38  ? 555 LYS B O     1 
ATOM   7348  C  CB    . LYS B  1 449 ? 102.638 78.144  -53.005  1.00 63.89  ? 555 LYS B CB    1 
ATOM   7349  C  CG    . LYS B  1 449 ? 102.568 78.088  -54.525  1.00 64.58  ? 555 LYS B CG    1 
ATOM   7350  C  CD    . LYS B  1 449 ? 103.949 77.947  -55.146  1.00 66.27  ? 555 LYS B CD    1 
ATOM   7351  C  CE    . LYS B  1 449 ? 103.863 78.002  -56.665  1.00 66.79  ? 555 LYS B CE    1 
ATOM   7352  N  NZ    . LYS B  1 449 ? 104.994 77.351  -57.391  1.00 66.58  ? 555 LYS B NZ    1 
ATOM   7353  N  N     . LYS B  1 450 ? 101.421 78.775  -49.968  1.00 69.35  ? 556 LYS B N     1 
ATOM   7354  C  CA    . LYS B  1 450 ? 101.504 78.552  -48.534  1.00 70.26  ? 556 LYS B CA    1 
ATOM   7355  C  C     . LYS B  1 450 ? 100.121 78.212  -47.981  1.00 67.49  ? 556 LYS B C     1 
ATOM   7356  O  O     . LYS B  1 450 ? 99.151  78.949  -48.164  1.00 62.69  ? 556 LYS B O     1 
ATOM   7357  C  CB    . LYS B  1 450 ? 102.128 79.756  -47.838  1.00 73.78  ? 556 LYS B CB    1 
ATOM   7358  C  CG    . LYS B  1 450 ? 103.604 79.922  -48.208  1.00 77.40  ? 556 LYS B CG    1 
ATOM   7359  C  CD    . LYS B  1 450 ? 104.267 81.035  -47.424  1.00 80.51  ? 556 LYS B CD    1 
ATOM   7360  C  CE    . LYS B  1 450 ? 105.734 81.162  -47.783  1.00 82.67  ? 556 LYS B CE    1 
ATOM   7361  N  NZ    . LYS B  1 450 ? 106.348 82.389  -47.203  1.00 85.58  ? 556 LYS B NZ    1 
ATOM   7362  N  N     . VAL B  1 451 ? 100.049 77.065  -47.306  1.00 69.35  ? 557 VAL B N     1 
ATOM   7363  C  CA    . VAL B  1 451 ? 98.805  76.406  -46.918  1.00 71.99  ? 557 VAL B CA    1 
ATOM   7364  C  C     . VAL B  1 451 ? 98.236  76.866  -45.563  1.00 74.27  ? 557 VAL B C     1 
ATOM   7365  O  O     . VAL B  1 451 ? 97.014  76.903  -45.395  1.00 78.16  ? 557 VAL B O     1 
ATOM   7366  C  CB    . VAL B  1 451 ? 98.986  74.871  -46.939  1.00 76.51  ? 557 VAL B CB    1 
ATOM   7367  C  CG1   . VAL B  1 451 ? 97.733  74.101  -46.505  1.00 77.86  ? 557 VAL B CG1   1 
ATOM   7368  C  CG2   . VAL B  1 451 ? 99.387  74.417  -48.355  1.00 79.24  ? 557 VAL B CG2   1 
ATOM   7369  N  N     . ASP B  1 452 ? 99.120  77.204  -44.623  1.00 75.02  ? 558 ASP B N     1 
ATOM   7370  C  CA    . ASP B  1 452 ? 98.759  77.527  -43.209  1.00 74.68  ? 558 ASP B CA    1 
ATOM   7371  C  C     . ASP B  1 452 ? 97.715  78.631  -42.982  1.00 75.15  ? 558 ASP B C     1 
ATOM   7372  O  O     . ASP B  1 452 ? 97.519  79.479  -43.835  1.00 73.10  ? 558 ASP B O     1 
ATOM   7373  C  CB    . ASP B  1 452 ? 100.048 77.854  -42.434  1.00 76.14  ? 558 ASP B CB    1 
ATOM   7374  C  CG    . ASP B  1 452 ? 100.754 79.103  -42.973  1.00 79.51  ? 558 ASP B CG    1 
ATOM   7375  O  OD1   . ASP B  1 452 ? 101.306 79.086  -44.105  1.00 84.42  ? 558 ASP B OD1   1 
ATOM   7376  O  OD2   . ASP B  1 452 ? 100.740 80.114  -42.248  1.00 78.45  ? 558 ASP B OD2   1 
ATOM   7377  N  N     . ARG B  1 453 ? 97.071  78.601  -41.813  1.00 79.76  ? 559 ARG B N     1 
ATOM   7378  C  CA    . ARG B  1 453 ? 95.979  79.531  -41.444  1.00 81.41  ? 559 ARG B CA    1 
ATOM   7379  C  C     . ARG B  1 453 ? 96.381  81.017  -41.583  1.00 77.12  ? 559 ARG B C     1 
ATOM   7380  O  O     . ARG B  1 453 ? 95.596  81.827  -42.098  1.00 75.28  ? 559 ARG B O     1 
ATOM   7381  C  CB    . ARG B  1 453 ? 95.428  79.223  -40.032  1.00 79.89  ? 559 ARG B CB    1 
ATOM   7382  N  N     . LYS B  1 454 ? 97.610  81.354  -41.163  1.00 72.26  ? 560 LYS B N     1 
ATOM   7383  C  CA    . LYS B  1 454 ? 98.096  82.750  -41.144  1.00 69.55  ? 560 LYS B CA    1 
ATOM   7384  C  C     . LYS B  1 454 ? 98.345  83.280  -42.567  1.00 69.59  ? 560 LYS B C     1 
ATOM   7385  O  O     . LYS B  1 454 ? 97.953  84.408  -42.878  1.00 70.88  ? 560 LYS B O     1 
ATOM   7386  C  CB    . LYS B  1 454 ? 99.362  82.912  -40.276  1.00 67.17  ? 560 LYS B CB    1 
ATOM   7387  N  N     . SER B  1 455 ? 98.966  82.468  -43.423  1.00 69.64  ? 561 SER B N     1 
ATOM   7388  C  CA    . SER B  1 455 ? 99.296  82.886  -44.797  1.00 71.56  ? 561 SER B CA    1 
ATOM   7389  C  C     . SER B  1 455 ? 98.059  82.998  -45.694  1.00 71.77  ? 561 SER B C     1 
ATOM   7390  O  O     . SER B  1 455 ? 97.988  83.870  -46.564  1.00 65.88  ? 561 SER B O     1 
ATOM   7391  C  CB    . SER B  1 455 ? 100.317 81.915  -45.431  1.00 74.01  ? 561 SER B CB    1 
ATOM   7392  O  OG    . SER B  1 455 ? 101.498 81.924  -44.652  1.00 74.82  ? 561 SER B OG    1 
ATOM   7393  N  N     . LEU B  1 456 ? 97.094  82.114  -45.473  1.00 74.78  ? 562 LEU B N     1 
ATOM   7394  C  CA    . LEU B  1 456 ? 95.843  82.142  -46.208  1.00 75.32  ? 562 LEU B CA    1 
ATOM   7395  C  C     . LEU B  1 456 ? 95.046  83.413  -45.919  1.00 73.36  ? 562 LEU B C     1 
ATOM   7396  O  O     . LEU B  1 456 ? 94.489  84.014  -46.849  1.00 77.22  ? 562 LEU B O     1 
ATOM   7397  C  CB    . LEU B  1 456 ? 94.999  80.901  -45.888  1.00 77.10  ? 562 LEU B CB    1 
ATOM   7398  C  CG    . LEU B  1 456 ? 93.746  80.635  -46.727  1.00 81.08  ? 562 LEU B CG    1 
ATOM   7399  C  CD1   . LEU B  1 456 ? 94.015  80.739  -48.239  1.00 85.49  ? 562 LEU B CD1   1 
ATOM   7400  C  CD2   . LEU B  1 456 ? 93.182  79.254  -46.386  1.00 80.18  ? 562 LEU B CD2   1 
ATOM   7401  N  N     . TYR B  1 457 ? 95.005  83.832  -44.646  1.00 69.97  ? 563 TYR B N     1 
ATOM   7402  C  CA    . TYR B  1 457 ? 94.370  85.113  -44.289  1.00 69.30  ? 563 TYR B CA    1 
ATOM   7403  C  C     . TYR B  1 457 ? 95.029  86.270  -45.053  1.00 68.39  ? 563 TYR B C     1 
ATOM   7404  O  O     . TYR B  1 457 ? 94.351  87.125  -45.628  1.00 64.61  ? 563 TYR B O     1 
ATOM   7405  C  CB    . TYR B  1 457 ? 94.406  85.384  -42.766  1.00 68.99  ? 563 TYR B CB    1 
ATOM   7406  C  CG    . TYR B  1 457 ? 93.833  86.759  -42.382  1.00 70.09  ? 563 TYR B CG    1 
ATOM   7407  C  CD1   . TYR B  1 457 ? 92.458  86.968  -42.268  1.00 69.03  ? 563 TYR B CD1   1 
ATOM   7408  C  CD2   . TYR B  1 457 ? 94.680  87.853  -42.160  1.00 72.94  ? 563 TYR B CD2   1 
ATOM   7409  C  CE1   . TYR B  1 457 ? 91.937  88.208  -41.941  1.00 69.62  ? 563 TYR B CE1   1 
ATOM   7410  C  CE2   . TYR B  1 457 ? 94.167  89.108  -41.835  1.00 71.93  ? 563 TYR B CE2   1 
ATOM   7411  C  CZ    . TYR B  1 457 ? 92.793  89.278  -41.724  1.00 70.34  ? 563 TYR B CZ    1 
ATOM   7412  O  OH    . TYR B  1 457 ? 92.305  90.524  -41.413  1.00 69.15  ? 563 TYR B OH    1 
ATOM   7413  N  N     . ALA B  1 458 ? 96.354  86.275  -45.054  1.00 71.73  ? 564 ALA B N     1 
ATOM   7414  C  CA    . ALA B  1 458 ? 97.121  87.331  -45.708  1.00 74.41  ? 564 ALA B CA    1 
ATOM   7415  C  C     . ALA B  1 458 ? 96.845  87.347  -47.199  1.00 74.33  ? 564 ALA B C     1 
ATOM   7416  O  O     . ALA B  1 458 ? 96.566  88.413  -47.763  1.00 73.05  ? 564 ALA B O     1 
ATOM   7417  C  CB    . ALA B  1 458 ? 98.606  87.114  -45.474  1.00 76.43  ? 564 ALA B CB    1 
ATOM   7418  N  N     . ALA B  1 459 ? 96.921  86.168  -47.811  1.00 72.31  ? 565 ALA B N     1 
ATOM   7419  C  CA    . ALA B  1 459 ? 96.679  86.000  -49.241  1.00 69.73  ? 565 ALA B CA    1 
ATOM   7420  C  C     . ALA B  1 459 ? 95.337  86.591  -49.661  1.00 65.49  ? 565 ALA B C     1 
ATOM   7421  O  O     . ALA B  1 459 ? 95.259  87.301  -50.659  1.00 63.93  ? 565 ALA B O     1 
ATOM   7422  C  CB    . ALA B  1 459 ? 96.747  84.518  -49.625  1.00 71.20  ? 565 ALA B CB    1 
ATOM   7423  N  N     . ARG B  1 460 ? 94.301  86.315  -48.875  1.00 61.81  ? 566 ARG B N     1 
ATOM   7424  C  CA    . ARG B  1 460 ? 92.963  86.865  -49.115  1.00 60.60  ? 566 ARG B CA    1 
ATOM   7425  C  C     . ARG B  1 460 ? 92.930  88.391  -49.123  1.00 60.84  ? 566 ARG B C     1 
ATOM   7426  O  O     . ARG B  1 460 ? 92.207  88.989  -49.919  1.00 64.44  ? 566 ARG B O     1 
ATOM   7427  C  CB    . ARG B  1 460 ? 91.974  86.359  -48.073  1.00 59.92  ? 566 ARG B CB    1 
ATOM   7428  C  CG    . ARG B  1 460 ? 91.511  84.942  -48.350  1.00 60.01  ? 566 ARG B CG    1 
ATOM   7429  C  CD    . ARG B  1 460 ? 91.022  84.191  -47.125  1.00 58.40  ? 566 ARG B CD    1 
ATOM   7430  N  NE    . ARG B  1 460 ? 90.481  82.889  -47.534  1.00 57.93  ? 566 ARG B NE    1 
ATOM   7431  C  CZ    . ARG B  1 460 ? 90.108  81.904  -46.719  1.00 57.44  ? 566 ARG B CZ    1 
ATOM   7432  N  NH1   . ARG B  1 460 ? 90.174  82.055  -45.413  1.00 58.73  ? 566 ARG B NH1   1 
ATOM   7433  N  NH2   . ARG B  1 460 ? 89.678  80.770  -47.240  1.00 58.54  ? 566 ARG B NH2   1 
ATOM   7434  N  N     . GLN B  1 461 ? 93.700  89.007  -48.231  1.00 60.45  ? 567 GLN B N     1 
ATOM   7435  C  CA    . GLN B  1 461 ? 93.755  90.466  -48.152  1.00 60.48  ? 567 GLN B CA    1 
ATOM   7436  C  C     . GLN B  1 461 ? 94.475  91.038  -49.371  1.00 59.42  ? 567 GLN B C     1 
ATOM   7437  O  O     . GLN B  1 461 ? 93.975  91.965  -49.999  1.00 57.64  ? 567 GLN B O     1 
ATOM   7438  C  CB    . GLN B  1 461 ? 94.423  90.943  -46.853  1.00 62.69  ? 567 GLN B CB    1 
ATOM   7439  C  CG    . GLN B  1 461 ? 93.868  90.376  -45.556  1.00 63.57  ? 567 GLN B CG    1 
ATOM   7440  C  CD    . GLN B  1 461 ? 92.359  90.316  -45.469  1.00 64.52  ? 567 GLN B CD    1 
ATOM   7441  O  OE1   . GLN B  1 461 ? 91.665  91.324  -45.600  1.00 68.94  ? 567 GLN B OE1   1 
ATOM   7442  N  NE2   . GLN B  1 461 ? 91.844  89.131  -45.198  1.00 64.50  ? 567 GLN B NE2   1 
ATOM   7443  N  N     . TYR B  1 462 ? 95.629  90.471  -49.713  1.00 59.73  ? 568 TYR B N     1 
ATOM   7444  C  CA    . TYR B  1 462 ? 96.334  90.862  -50.934  1.00 61.84  ? 568 TYR B CA    1 
ATOM   7445  C  C     . TYR B  1 462 ? 95.430  90.761  -52.162  1.00 60.90  ? 568 TYR B C     1 
ATOM   7446  O  O     . TYR B  1 462 ? 95.373  91.678  -52.980  1.00 62.32  ? 568 TYR B O     1 
ATOM   7447  C  CB    . TYR B  1 462 ? 97.560  89.983  -51.154  1.00 64.47  ? 568 TYR B CB    1 
ATOM   7448  C  CG    . TYR B  1 462 ? 98.738  90.255  -50.244  1.00 68.42  ? 568 TYR B CG    1 
ATOM   7449  C  CD1   . TYR B  1 462 ? 99.402  91.489  -50.267  1.00 72.78  ? 568 TYR B CD1   1 
ATOM   7450  C  CD2   . TYR B  1 462 ? 99.224  89.269  -49.393  1.00 72.40  ? 568 TYR B CD2   1 
ATOM   7451  C  CE1   . TYR B  1 462 ? 100.501 91.725  -49.452  1.00 77.02  ? 568 TYR B CE1   1 
ATOM   7452  C  CE2   . TYR B  1 462 ? 100.321 89.497  -48.572  1.00 77.44  ? 568 TYR B CE2   1 
ATOM   7453  C  CZ    . TYR B  1 462 ? 100.960 90.726  -48.606  1.00 79.90  ? 568 TYR B CZ    1 
ATOM   7454  O  OH    . TYR B  1 462 ? 102.042 90.947  -47.793  1.00 82.45  ? 568 TYR B OH    1 
ATOM   7455  N  N     . PHE B  1 463 ? 94.718  89.646  -52.270  1.00 59.53  ? 569 PHE B N     1 
ATOM   7456  C  CA    . PHE B  1 463 ? 93.850  89.379  -53.413  1.00 59.62  ? 569 PHE B CA    1 
ATOM   7457  C  C     . PHE B  1 463 ? 92.701  90.378  -53.524  1.00 60.30  ? 569 PHE B C     1 
ATOM   7458  O  O     . PHE B  1 463 ? 92.522  90.995  -54.571  1.00 61.36  ? 569 PHE B O     1 
ATOM   7459  C  CB    . PHE B  1 463 ? 93.325  87.929  -53.360  1.00 59.91  ? 569 PHE B CB    1 
ATOM   7460  C  CG    . PHE B  1 463 ? 92.230  87.638  -54.351  1.00 62.95  ? 569 PHE B CG    1 
ATOM   7461  C  CD1   . PHE B  1 463 ? 92.463  87.763  -55.718  1.00 64.38  ? 569 PHE B CD1   1 
ATOM   7462  C  CD2   . PHE B  1 463 ? 90.967  87.245  -53.920  1.00 65.05  ? 569 PHE B CD2   1 
ATOM   7463  C  CE1   . PHE B  1 463 ? 91.452  87.512  -56.625  1.00 64.64  ? 569 PHE B CE1   1 
ATOM   7464  C  CE2   . PHE B  1 463 ? 89.953  86.989  -54.830  1.00 65.13  ? 569 PHE B CE2   1 
ATOM   7465  C  CZ    . PHE B  1 463 ? 90.196  87.126  -56.184  1.00 64.00  ? 569 PHE B CZ    1 
ATOM   7466  N  N     . VAL B  1 464 ? 91.932  90.552  -52.454  1.00 62.72  ? 570 VAL B N     1 
ATOM   7467  C  CA    . VAL B  1 464 ? 90.741  91.410  -52.508  1.00 63.96  ? 570 VAL B CA    1 
ATOM   7468  C  C     . VAL B  1 464 ? 91.141  92.863  -52.731  1.00 66.26  ? 570 VAL B C     1 
ATOM   7469  O  O     . VAL B  1 464 ? 90.377  93.633  -53.320  1.00 71.77  ? 570 VAL B O     1 
ATOM   7470  C  CB    . VAL B  1 464 ? 89.849  91.259  -51.260  1.00 63.34  ? 570 VAL B CB    1 
ATOM   7471  C  CG1   . VAL B  1 464 ? 88.670  92.230  -51.280  1.00 64.74  ? 570 VAL B CG1   1 
ATOM   7472  C  CG2   . VAL B  1 464 ? 89.310  89.836  -51.168  1.00 63.83  ? 570 VAL B CG2   1 
ATOM   7473  N  N     . GLN B  1 465 ? 92.334  93.231  -52.269  1.00 65.55  ? 571 GLN B N     1 
ATOM   7474  C  CA    . GLN B  1 465 ? 92.890  94.557  -52.531  1.00 67.87  ? 571 GLN B CA    1 
ATOM   7475  C  C     . GLN B  1 465 ? 93.234  94.673  -54.000  1.00 69.17  ? 571 GLN B C     1 
ATOM   7476  O  O     . GLN B  1 465 ? 92.751  95.569  -54.679  1.00 72.55  ? 571 GLN B O     1 
ATOM   7477  C  CB    . GLN B  1 465 ? 94.137  94.827  -51.666  1.00 69.68  ? 571 GLN B CB    1 
ATOM   7478  C  CG    . GLN B  1 465 ? 94.645  96.270  -51.680  1.00 68.67  ? 571 GLN B CG    1 
ATOM   7479  C  CD    . GLN B  1 465 ? 93.613  97.249  -51.138  1.00 65.69  ? 571 GLN B CD    1 
ATOM   7480  O  OE1   . GLN B  1 465 ? 93.160  97.125  -50.007  1.00 61.07  ? 571 GLN B OE1   1 
ATOM   7481  N  NE2   . GLN B  1 465 ? 93.219  98.202  -51.961  1.00 66.85  ? 571 GLN B NE2   1 
ATOM   7482  N  N     . TRP B  1 466 ? 94.045  93.743  -54.487  1.00 69.87  ? 572 TRP B N     1 
ATOM   7483  C  CA    . TRP B  1 466 ? 94.445  93.702  -55.896  1.00 71.26  ? 572 TRP B CA    1 
ATOM   7484  C  C     . TRP B  1 466 ? 93.265  93.823  -56.852  1.00 71.26  ? 572 TRP B C     1 
ATOM   7485  O  O     . TRP B  1 466 ? 93.386  94.445  -57.913  1.00 74.89  ? 572 TRP B O     1 
ATOM   7486  C  CB    . TRP B  1 466 ? 95.213  92.414  -56.176  1.00 70.79  ? 572 TRP B CB    1 
ATOM   7487  C  CG    . TRP B  1 466 ? 95.643  92.239  -57.595  1.00 70.15  ? 572 TRP B CG    1 
ATOM   7488  C  CD1   . TRP B  1 466 ? 96.567  92.972  -58.270  1.00 69.38  ? 572 TRP B CD1   1 
ATOM   7489  C  CD2   . TRP B  1 466 ? 95.171  91.247  -58.509  1.00 72.51  ? 572 TRP B CD2   1 
ATOM   7490  N  NE1   . TRP B  1 466 ? 96.704  92.501  -59.549  1.00 71.62  ? 572 TRP B NE1   1 
ATOM   7491  C  CE2   . TRP B  1 466 ? 95.855  91.442  -59.723  1.00 72.61  ? 572 TRP B CE2   1 
ATOM   7492  C  CE3   . TRP B  1 466 ? 94.238  90.206  -58.420  1.00 71.56  ? 572 TRP B CE3   1 
ATOM   7493  C  CZ2   . TRP B  1 466 ? 95.645  90.640  -60.839  1.00 71.06  ? 572 TRP B CZ2   1 
ATOM   7494  C  CZ3   . TRP B  1 466 ? 94.022  89.409  -59.526  1.00 71.34  ? 572 TRP B CZ3   1 
ATOM   7495  C  CH2   . TRP B  1 466 ? 94.730  89.632  -60.727  1.00 71.80  ? 572 TRP B CH2   1 
ATOM   7496  N  N     . CYS B  1 467 ? 92.136  93.222  -56.469  1.00 69.46  ? 573 CYS B N     1 
ATOM   7497  C  CA    . CYS B  1 467 ? 90.877  93.357  -57.204  1.00 69.22  ? 573 CYS B CA    1 
ATOM   7498  C  C     . CYS B  1 467 ? 90.372  94.802  -57.210  1.00 69.67  ? 573 CYS B C     1 
ATOM   7499  O  O     . CYS B  1 467 ? 89.985  95.324  -58.254  1.00 69.75  ? 573 CYS B O     1 
ATOM   7500  C  CB    . CYS B  1 467 ? 89.800  92.432  -56.629  1.00 67.75  ? 573 CYS B CB    1 
ATOM   7501  S  SG    . CYS B  1 467 ? 90.081  90.662  -56.841  1.00 65.28  ? 573 CYS B SG    1 
ATOM   7502  N  N     . ALA B  1 468 ? 90.370  95.442  -56.048  1.00 70.28  ? 574 ALA B N     1 
ATOM   7503  C  CA    . ALA B  1 468 ? 89.984  96.850  -55.957  1.00 72.73  ? 574 ALA B CA    1 
ATOM   7504  C  C     . ALA B  1 468 ? 90.954  97.754  -56.733  1.00 72.51  ? 574 ALA B C     1 
ATOM   7505  O  O     . ALA B  1 468 ? 90.522  98.657  -57.448  1.00 71.04  ? 574 ALA B O     1 
ATOM   7506  C  CB    . ALA B  1 468 ? 89.878  97.284  -54.507  1.00 75.48  ? 574 ALA B CB    1 
ATOM   7507  N  N     . ASP B  1 469 ? 92.252  97.476  -56.600  1.00 75.01  ? 575 ASP B N     1 
ATOM   7508  C  CA    . ASP B  1 469 ? 93.306  98.238  -57.274  1.00 77.83  ? 575 ASP B CA    1 
ATOM   7509  C  C     . ASP B  1 469 ? 93.148  98.248  -58.788  1.00 79.60  ? 575 ASP B C     1 
ATOM   7510  O  O     . ASP B  1 469 ? 93.383  99.270  -59.411  1.00 80.90  ? 575 ASP B O     1 
ATOM   7511  C  CB    . ASP B  1 469 ? 94.716  97.698  -56.922  1.00 80.31  ? 575 ASP B CB    1 
ATOM   7512  C  CG    . ASP B  1 469 ? 95.136  97.982  -55.471  1.00 81.30  ? 575 ASP B CG    1 
ATOM   7513  O  OD1   . ASP B  1 469 ? 94.412  98.689  -54.738  1.00 80.27  ? 575 ASP B OD1   1 
ATOM   7514  O  OD2   . ASP B  1 469 ? 96.209  97.492  -55.063  1.00 82.49  ? 575 ASP B OD2   1 
ATOM   7515  N  N     . ARG B  1 470 ? 92.736  97.127  -59.377  1.00 80.71  ? 576 ARG B N     1 
ATOM   7516  C  CA    . ARG B  1 470 ? 92.641  97.015  -60.842  1.00 83.18  ? 576 ARG B CA    1 
ATOM   7517  C  C     . ARG B  1 470 ? 91.217  97.160  -61.400  1.00 82.37  ? 576 ARG B C     1 
ATOM   7518  O  O     . ARG B  1 470 ? 90.963  96.869  -62.582  1.00 78.67  ? 576 ARG B O     1 
ATOM   7519  C  CB    . ARG B  1 470 ? 93.278  95.711  -61.292  1.00 86.53  ? 576 ARG B CB    1 
ATOM   7520  C  CG    . ARG B  1 470 ? 94.730  95.856  -61.692  1.00 89.89  ? 576 ARG B CG    1 
ATOM   7521  C  CD    . ARG B  1 470 ? 95.312  94.474  -61.907  1.00 91.68  ? 576 ARG B CD    1 
ATOM   7522  N  NE    . ARG B  1 470 ? 96.143  94.300  -63.088  1.00 94.40  ? 576 ARG B NE    1 
ATOM   7523  C  CZ    . ARG B  1 470 ? 95.740  94.422  -64.350  1.00 96.85  ? 576 ARG B CZ    1 
ATOM   7524  N  NH1   . ARG B  1 470 ? 94.498  94.813  -64.657  1.00 96.73  ? 576 ARG B NH1   1 
ATOM   7525  N  NH2   . ARG B  1 470 ? 96.609  94.167  -65.327  1.00 98.09  ? 576 ARG B NH2   1 
ATOM   7526  N  N     . ASN B  1 471 ? 90.313  97.648  -60.561  1.00 84.29  ? 577 ASN B N     1 
ATOM   7527  C  CA    . ASN B  1 471 ? 88.898  97.801  -60.897  1.00 86.35  ? 577 ASN B CA    1 
ATOM   7528  C  C     . ASN B  1 471 ? 88.252  96.518  -61.437  1.00 84.68  ? 577 ASN B C     1 
ATOM   7529  O  O     . ASN B  1 471 ? 87.478  96.546  -62.393  1.00 83.98  ? 577 ASN B O     1 
ATOM   7530  C  CB    . ASN B  1 471 ? 88.704  98.998  -61.850  1.00 88.89  ? 577 ASN B CB    1 
ATOM   7531  C  CG    . ASN B  1 471 ? 87.398  99.706  -61.655  1.00 93.42  ? 577 ASN B CG    1 
ATOM   7532  O  OD1   . ASN B  1 471 ? 86.876  99.789  -60.516  1.00 99.84  ? 577 ASN B OD1   1 
ATOM   7533  N  ND2   . ASN B  1 471 ? 86.853  100.222 -62.735  1.00 97.47  ? 577 ASN B ND2   1 
ATOM   7534  N  N     . PHE B  1 472 ? 88.591  95.394  -60.819  1.00 80.05  ? 578 PHE B N     1 
ATOM   7535  C  CA    . PHE B  1 472 ? 87.963  94.098  -61.098  1.00 74.93  ? 578 PHE B CA    1 
ATOM   7536  C  C     . PHE B  1 472 ? 86.675  93.936  -60.286  1.00 72.41  ? 578 PHE B C     1 
ATOM   7537  O  O     . PHE B  1 472 ? 86.358  94.756  -59.442  1.00 73.97  ? 578 PHE B O     1 
ATOM   7538  C  CB    . PHE B  1 472 ? 88.933  92.941  -60.791  1.00 73.68  ? 578 PHE B CB    1 
ATOM   7539  C  CG    . PHE B  1 472 ? 90.143  92.852  -61.696  1.00 72.31  ? 578 PHE B CG    1 
ATOM   7540  C  CD1   . PHE B  1 472 ? 90.224  93.535  -62.914  1.00 73.08  ? 578 PHE B CD1   1 
ATOM   7541  C  CD2   . PHE B  1 472 ? 91.209  92.024  -61.339  1.00 69.99  ? 578 PHE B CD2   1 
ATOM   7542  C  CE1   . PHE B  1 472 ? 91.340  93.404  -63.733  1.00 72.94  ? 578 PHE B CE1   1 
ATOM   7543  C  CE2   . PHE B  1 472 ? 92.326  91.894  -62.146  1.00 68.98  ? 578 PHE B CE2   1 
ATOM   7544  C  CZ    . PHE B  1 472 ? 92.385  92.586  -63.346  1.00 71.79  ? 578 PHE B CZ    1 
ATOM   7545  N  N     . THR B  1 473 ? 85.936  92.869  -60.573  1.00 69.30  ? 579 THR B N     1 
ATOM   7546  C  CA    . THR B  1 473 ? 84.676  92.571  -59.884  1.00 66.68  ? 579 THR B CA    1 
ATOM   7547  C  C     . THR B  1 473 ? 84.960  92.120  -58.472  1.00 63.32  ? 579 THR B C     1 
ATOM   7548  O  O     . THR B  1 473 ? 86.015  91.555  -58.191  1.00 58.57  ? 579 THR B O     1 
ATOM   7549  C  CB    . THR B  1 473 ? 83.847  91.475  -60.587  1.00 68.58  ? 579 THR B CB    1 
ATOM   7550  O  OG1   . THR B  1 473 ? 84.648  90.300  -60.769  1.00 71.17  ? 579 THR B OG1   1 
ATOM   7551  C  CG2   . THR B  1 473 ? 83.323  91.981  -61.934  1.00 70.54  ? 579 THR B CG2   1 
ATOM   7552  N  N     . LYS B  1 474 ? 83.998  92.384  -57.594  1.00 63.63  ? 580 LYS B N     1 
ATOM   7553  C  CA    . LYS B  1 474 ? 84.097  91.980  -56.197  1.00 62.37  ? 580 LYS B CA    1 
ATOM   7554  C  C     . LYS B  1 474 ? 84.037  90.468  -56.110  1.00 57.56  ? 580 LYS B C     1 
ATOM   7555  O  O     . LYS B  1 474 ? 83.100  89.880  -56.647  1.00 58.62  ? 580 LYS B O     1 
ATOM   7556  C  CB    . LYS B  1 474 ? 82.947  92.568  -55.377  1.00 64.95  ? 580 LYS B CB    1 
ATOM   7557  C  CG    . LYS B  1 474 ? 83.151  92.429  -53.870  1.00 65.40  ? 580 LYS B CG    1 
ATOM   7558  C  CD    . LYS B  1 474 ? 82.053  93.102  -53.058  1.00 65.23  ? 580 LYS B CD    1 
ATOM   7559  C  CE    . LYS B  1 474 ? 81.006  92.085  -52.627  1.00 65.26  ? 580 LYS B CE    1 
ATOM   7560  N  NZ    . LYS B  1 474 ? 79.824  92.733  -52.032  1.00 67.28  ? 580 LYS B NZ    1 
ATOM   7561  N  N     . PRO B  1 475 ? 85.018  89.834  -55.455  1.00 53.74  ? 581 PRO B N     1 
ATOM   7562  C  CA    . PRO B  1 475 ? 84.883  88.406  -55.210  1.00 53.84  ? 581 PRO B CA    1 
ATOM   7563  C  C     . PRO B  1 475 ? 83.559  88.070  -54.532  1.00 56.10  ? 581 PRO B C     1 
ATOM   7564  O  O     . PRO B  1 475 ? 83.124  88.814  -53.662  1.00 56.35  ? 581 PRO B O     1 
ATOM   7565  C  CB    . PRO B  1 475 ? 86.068  88.089  -54.303  1.00 53.10  ? 581 PRO B CB    1 
ATOM   7566  C  CG    . PRO B  1 475 ? 87.109  89.062  -54.738  1.00 53.33  ? 581 PRO B CG    1 
ATOM   7567  C  CD    . PRO B  1 475 ? 86.355  90.321  -55.087  1.00 53.50  ? 581 PRO B CD    1 
ATOM   7568  N  N     . GLN B  1 476 ? 82.915  86.978  -54.952  1.00 57.72  ? 582 GLN B N     1 
ATOM   7569  C  CA    . GLN B  1 476 ? 81.597  86.579  -54.425  1.00 56.16  ? 582 GLN B CA    1 
ATOM   7570  C  C     . GLN B  1 476 ? 81.582  86.514  -52.905  1.00 57.32  ? 582 GLN B C     1 
ATOM   7571  O  O     . GLN B  1 476 ? 80.681  87.071  -52.265  1.00 60.10  ? 582 GLN B O     1 
ATOM   7572  C  CB    . GLN B  1 476 ? 81.162  85.226  -55.003  1.00 52.84  ? 582 GLN B CB    1 
ATOM   7573  C  CG    . GLN B  1 476 ? 80.850  85.236  -56.478  1.00 51.38  ? 582 GLN B CG    1 
ATOM   7574  C  CD    . GLN B  1 476 ? 80.795  83.829  -57.070  1.00 51.38  ? 582 GLN B CD    1 
ATOM   7575  O  OE1   . GLN B  1 476 ? 80.629  82.818  -56.341  1.00 47.98  ? 582 GLN B OE1   1 
ATOM   7576  N  NE2   . GLN B  1 476 ? 80.970  83.743  -58.412  1.00 51.04  ? 582 GLN B NE2   1 
ATOM   7577  N  N     . ASP B  1 477 ? 82.609  85.878  -52.350  1.00 57.78  ? 583 ASP B N     1 
ATOM   7578  C  CA    . ASP B  1 477 ? 82.804  85.760  -50.897  1.00 59.09  ? 583 ASP B CA    1 
ATOM   7579  C  C     . ASP B  1 477 ? 83.594  86.922  -50.261  1.00 60.75  ? 583 ASP B C     1 
ATOM   7580  O  O     . ASP B  1 477 ? 84.067  86.809  -49.134  1.00 61.25  ? 583 ASP B O     1 
ATOM   7581  C  CB    . ASP B  1 477 ? 83.463  84.396  -50.557  1.00 58.97  ? 583 ASP B CB    1 
ATOM   7582  C  CG    . ASP B  1 477 ? 84.882  84.226  -51.148  1.00 62.25  ? 583 ASP B CG    1 
ATOM   7583  O  OD1   . ASP B  1 477 ? 85.350  85.040  -52.023  1.00 68.48  ? 583 ASP B OD1   1 
ATOM   7584  O  OD2   . ASP B  1 477 ? 85.547  83.244  -50.729  1.00 63.16  ? 583 ASP B OD2   1 
ATOM   7585  N  N     . GLY B  1 478 ? 83.693  88.048  -50.956  1.00 61.57  ? 584 GLY B N     1 
ATOM   7586  C  CA    . GLY B  1 478 ? 84.653  89.111  -50.622  1.00 61.70  ? 584 GLY B CA    1 
ATOM   7587  C  C     . GLY B  1 478 ? 84.410  89.789  -49.300  1.00 63.79  ? 584 GLY B C     1 
ATOM   7588  O  O     . GLY B  1 478 ? 85.357  90.086  -48.577  1.00 60.15  ? 584 GLY B O     1 
ATOM   7589  N  N     . ASP B  1 479 ? 83.135  90.023  -48.980  1.00 68.91  ? 585 ASP B N     1 
ATOM   7590  C  CA    . ASP B  1 479 ? 82.764  90.651  -47.705  1.00 70.12  ? 585 ASP B CA    1 
ATOM   7591  C  C     . ASP B  1 479 ? 83.100  89.783  -46.510  1.00 69.04  ? 585 ASP B C     1 
ATOM   7592  O  O     . ASP B  1 479 ? 83.278  90.302  -45.414  1.00 67.93  ? 585 ASP B O     1 
ATOM   7593  C  CB    . ASP B  1 479 ? 81.265  90.961  -47.669  1.00 70.90  ? 585 ASP B CB    1 
ATOM   7594  C  CG    . ASP B  1 479 ? 80.861  91.990  -48.693  1.00 75.77  ? 585 ASP B CG    1 
ATOM   7595  O  OD1   . ASP B  1 479 ? 81.602  92.980  -48.912  1.00 83.44  ? 585 ASP B OD1   1 
ATOM   7596  O  OD2   . ASP B  1 479 ? 79.791  91.800  -49.291  1.00 77.18  ? 585 ASP B OD2   1 
ATOM   7597  N  N     . VAL B  1 480 ? 83.160  88.468  -46.717  1.00 70.09  ? 586 VAL B N     1 
ATOM   7598  C  CA    . VAL B  1 480 ? 83.497  87.528  -45.655  1.00 69.92  ? 586 VAL B CA    1 
ATOM   7599  C  C     . VAL B  1 480 ? 85.013  87.403  -45.475  1.00 72.84  ? 586 VAL B C     1 
ATOM   7600  O  O     . VAL B  1 480 ? 85.512  87.558  -44.363  1.00 77.85  ? 586 VAL B O     1 
ATOM   7601  C  CB    . VAL B  1 480 ? 82.846  86.155  -45.920  1.00 68.43  ? 586 VAL B CB    1 
ATOM   7602  C  CG1   . VAL B  1 480 ? 83.344  85.101  -44.939  1.00 68.26  ? 586 VAL B CG1   1 
ATOM   7603  C  CG2   . VAL B  1 480 ? 81.322  86.275  -45.841  1.00 67.49  ? 586 VAL B CG2   1 
ATOM   7604  N  N     . ILE B  1 481 ? 85.735  87.115  -46.559  1.00 73.12  ? 587 ILE B N     1 
ATOM   7605  C  CA    . ILE B  1 481 ? 87.189  86.853  -46.479  1.00 73.06  ? 587 ILE B CA    1 
ATOM   7606  C  C     . ILE B  1 481 ? 88.051  88.075  -46.179  1.00 75.87  ? 587 ILE B C     1 
ATOM   7607  O  O     . ILE B  1 481 ? 89.139  87.934  -45.620  1.00 78.88  ? 587 ILE B O     1 
ATOM   7608  C  CB    . ILE B  1 481 ? 87.763  86.124  -47.722  1.00 72.48  ? 587 ILE B CB    1 
ATOM   7609  C  CG1   . ILE B  1 481 ? 87.528  86.906  -49.035  1.00 76.55  ? 587 ILE B CG1   1 
ATOM   7610  C  CG2   . ILE B  1 481 ? 87.197  84.719  -47.822  1.00 69.62  ? 587 ILE B CG2   1 
ATOM   7611  C  CD1   . ILE B  1 481 ? 88.413  86.466  -50.193  1.00 77.91  ? 587 ILE B CD1   1 
ATOM   7612  N  N     . ALA B  1 482 ? 87.574  89.255  -46.566  1.00 77.83  ? 588 ALA B N     1 
ATOM   7613  C  CA    . ALA B  1 482 ? 88.309  90.504  -46.362  1.00 80.12  ? 588 ALA B CA    1 
ATOM   7614  C  C     . ALA B  1 482 ? 87.324  91.629  -46.068  1.00 81.71  ? 588 ALA B C     1 
ATOM   7615  O  O     . ALA B  1 482 ? 87.119  92.518  -46.894  1.00 82.55  ? 588 ALA B O     1 
ATOM   7616  C  CB    . ALA B  1 482 ? 89.137  90.825  -47.594  1.00 81.71  ? 588 ALA B CB    1 
ATOM   7617  N  N     . PRO B  1 483 ? 86.695  91.591  -44.877  1.00 85.16  ? 589 PRO B N     1 
ATOM   7618  C  CA    . PRO B  1 483 ? 85.626  92.534  -44.537  1.00 84.95  ? 589 PRO B CA    1 
ATOM   7619  C  C     . PRO B  1 483 ? 86.132  93.963  -44.307  1.00 86.94  ? 589 PRO B C     1 
ATOM   7620  O  O     . PRO B  1 483 ? 85.352  94.913  -44.428  1.00 86.69  ? 589 PRO B O     1 
ATOM   7621  C  CB    . PRO B  1 483 ? 85.043  91.940  -43.258  1.00 85.19  ? 589 PRO B CB    1 
ATOM   7622  C  CG    . PRO B  1 483 ? 86.185  91.230  -42.622  1.00 85.92  ? 589 PRO B CG    1 
ATOM   7623  C  CD    . PRO B  1 483 ? 87.088  90.769  -43.718  1.00 86.61  ? 589 PRO B CD    1 
ATOM   7624  N  N     . LEU B  1 484 ? 87.421  94.100  -43.991  1.00 86.94  ? 590 LEU B N     1 
ATOM   7625  C  CA    . LEU B  1 484 ? 88.046  95.400  -43.791  1.00 87.05  ? 590 LEU B CA    1 
ATOM   7626  C  C     . LEU B  1 484 ? 88.419  96.084  -45.112  1.00 85.40  ? 590 LEU B C     1 
ATOM   7627  O  O     . LEU B  1 484 ? 88.597  97.296  -45.132  1.00 87.09  ? 590 LEU B O     1 
ATOM   7628  C  CB    . LEU B  1 484 ? 89.289  95.244  -42.890  1.00 88.23  ? 590 LEU B CB    1 
ATOM   7629  C  CG    . LEU B  1 484 ? 89.010  94.638  -41.502  1.00 89.55  ? 590 LEU B CG    1 
ATOM   7630  C  CD1   . LEU B  1 484 ? 90.308  94.198  -40.846  1.00 90.80  ? 590 LEU B CD1   1 
ATOM   7631  C  CD2   . LEU B  1 484 ? 88.255  95.618  -40.603  1.00 89.17  ? 590 LEU B CD2   1 
ATOM   7632  N  N     . ILE B  1 485 ? 88.515  95.320  -46.212  1.00 81.94  ? 591 ILE B N     1 
ATOM   7633  C  CA    . ILE B  1 485 ? 88.932  95.851  -47.519  1.00 76.22  ? 591 ILE B CA    1 
ATOM   7634  C  C     . ILE B  1 485 ? 87.775  96.221  -48.456  1.00 75.53  ? 591 ILE B C     1 
ATOM   7635  O  O     . ILE B  1 485 ? 87.893  97.181  -49.206  1.00 76.56  ? 591 ILE B O     1 
ATOM   7636  C  CB    . ILE B  1 485 ? 89.917  94.892  -48.212  1.00 71.92  ? 591 ILE B CB    1 
ATOM   7637  C  CG1   . ILE B  1 485 ? 91.200  94.802  -47.335  1.00 71.04  ? 591 ILE B CG1   1 
ATOM   7638  C  CG2   . ILE B  1 485 ? 90.268  95.372  -49.632  1.00 71.06  ? 591 ILE B CG2   1 
ATOM   7639  C  CD1   . ILE B  1 485 ? 92.143  93.687  -47.784  1.00 72.60  ? 591 ILE B CD1   1 
ATOM   7640  N  N     . THR B  1 486 ? 86.668  95.479  -48.426  1.00 76.14  ? 592 THR B N     1 
ATOM   7641  C  CA    . THR B  1 486 ? 85.549  95.718  -49.352  1.00 78.06  ? 592 THR B CA    1 
ATOM   7642  C  C     . THR B  1 486 ? 84.819  97.078  -49.239  1.00 82.74  ? 592 THR B C     1 
ATOM   7643  O  O     . THR B  1 486 ? 84.353  97.594  -50.263  1.00 82.08  ? 592 THR B O     1 
ATOM   7644  C  CB    . THR B  1 486 ? 84.489  94.594  -49.310  1.00 75.52  ? 592 THR B CB    1 
ATOM   7645  O  OG1   . THR B  1 486 ? 84.026  94.433  -47.973  1.00 78.75  ? 592 THR B OG1   1 
ATOM   7646  C  CG2   . THR B  1 486 ? 85.056  93.275  -49.799  1.00 73.62  ? 592 THR B CG2   1 
ATOM   7647  N  N     . PRO B  1 487 ? 84.691  97.660  -48.027  1.00 91.59  ? 593 PRO B N     1 
ATOM   7648  C  CA    . PRO B  1 487 ? 84.075  99.005  -48.032  1.00 95.12  ? 593 PRO B CA    1 
ATOM   7649  C  C     . PRO B  1 487 ? 84.950  100.109 -48.679  1.00 97.31  ? 593 PRO B C     1 
ATOM   7650  O  O     . PRO B  1 487 ? 84.390  101.071 -49.196  1.00 96.62  ? 593 PRO B O     1 
ATOM   7651  C  CB    . PRO B  1 487 ? 83.820  99.287  -46.549  1.00 98.11  ? 593 PRO B CB    1 
ATOM   7652  C  CG    . PRO B  1 487 ? 84.772  98.412  -45.819  1.00 99.05  ? 593 PRO B CG    1 
ATOM   7653  C  CD    . PRO B  1 487 ? 84.920  97.176  -46.651  1.00 94.96  ? 593 PRO B CD    1 
ATOM   7654  N  N     . GLN B  1 488 ? 86.283  99.953  -48.670  1.00 101.80 ? 594 GLN B N     1 
ATOM   7655  C  CA    . GLN B  1 488 ? 87.219  100.877 -49.344  1.00 105.07 ? 594 GLN B CA    1 
ATOM   7656  C  C     . GLN B  1 488 ? 86.784  101.304 -50.760  1.00 111.11 ? 594 GLN B C     1 
ATOM   7657  O  O     . GLN B  1 488 ? 86.925  102.466 -51.123  1.00 117.09 ? 594 GLN B O     1 
ATOM   7658  C  CB    . GLN B  1 488 ? 88.637  100.260 -49.431  1.00 102.28 ? 594 GLN B CB    1 
ATOM   7659  C  CG    . GLN B  1 488 ? 89.544  100.869 -50.506  1.00 97.43  ? 594 GLN B CG    1 
ATOM   7660  C  CD    . GLN B  1 488 ? 90.751  100.056 -50.874  1.00 91.06  ? 594 GLN B CD    1 
ATOM   7661  O  OE1   . GLN B  1 488 ? 91.812  100.618 -51.110  1.00 87.19  ? 594 GLN B OE1   1 
ATOM   7662  N  NE2   . GLN B  1 488 ? 90.601  98.732  -50.960  1.00 86.23  ? 594 GLN B NE2   1 
ATOM   7663  N  N     . LYS B  1 489 ? 86.272  100.355 -51.555  1.00 111.27 ? 595 LYS B N     1 
ATOM   7664  C  CA    . LYS B  1 489 ? 85.895  100.632 -52.945  1.00 107.33 ? 595 LYS B CA    1 
ATOM   7665  C  C     . LYS B  1 489 ? 84.443  101.149 -53.035  1.00 104.91 ? 595 LYS B C     1 
ATOM   7666  O  O     . LYS B  1 489 ? 83.493  100.432 -52.674  1.00 100.61 ? 595 LYS B O     1 
ATOM   7667  C  CB    . LYS B  1 489 ? 86.055  99.367  -53.784  1.00 105.79 ? 595 LYS B CB    1 
ATOM   7668  C  CG    . LYS B  1 489 ? 86.019  99.597  -55.288  1.00 106.13 ? 595 LYS B CG    1 
ATOM   7669  C  CD    . LYS B  1 489 ? 87.397  99.594  -55.912  1.00 105.67 ? 595 LYS B CD    1 
ATOM   7670  C  CE    . LYS B  1 489 ? 87.302  99.249  -57.404  1.00 105.12 ? 595 LYS B CE    1 
ATOM   7671  N  NZ    . LYS B  1 489 ? 86.530  99.996  -58.375  1.00 103.98 ? 595 LYS B NZ    1 
ATOM   7672  N  N     . LYS B  1 490 ? 84.297  102.393 -53.521  1.00 105.95 ? 596 LYS B N     1 
ATOM   7673  C  CA    . LYS B  1 490 ? 82.988  103.044 -53.711  1.00 106.04 ? 596 LYS B CA    1 
ATOM   7674  C  C     . LYS B  1 490 ? 82.098  102.248 -54.673  1.00 105.19 ? 596 LYS B C     1 
ATOM   7675  O  O     . LYS B  1 490 ? 80.904  102.060 -54.411  1.00 102.50 ? 596 LYS B O     1 
ATOM   7676  C  CB    . LYS B  1 490 ? 83.165  104.485 -54.237  1.00 103.10 ? 596 LYS B CB    1 
ATOM   7677  N  N     . GLU B  1 491 ? 82.700  101.756 -55.748  1.00 106.46 ? 597 GLU B N     1 
ATOM   7678  C  CA    . GLU B  1 491 ? 81.994  101.029 -56.807  1.00 105.15 ? 597 GLU B CA    1 
ATOM   7679  C  C     . GLU B  1 491 ? 81.318  99.720  -56.349  1.00 98.65  ? 597 GLU B C     1 
ATOM   7680  O  O     . GLU B  1 491 ? 80.362  99.295  -56.990  1.00 95.36  ? 597 GLU B O     1 
ATOM   7681  C  CB    . GLU B  1 491 ? 82.934  100.723 -57.994  1.00 107.52 ? 597 GLU B CB    1 
ATOM   7682  C  CG    . GLU B  1 491 ? 83.672  101.851 -58.675  1.00 110.55 ? 597 GLU B CG    1 
ATOM   7683  C  CD    . GLU B  1 491 ? 82.900  102.618 -59.729  1.00 113.24 ? 597 GLU B CD    1 
ATOM   7684  O  OE1   . GLU B  1 491 ? 81.679  102.440 -59.900  1.00 121.97 ? 597 GLU B OE1   1 
ATOM   7685  O  OE2   . GLU B  1 491 ? 83.540  103.425 -60.402  1.00 111.30 ? 597 GLU B OE2   1 
ATOM   7686  N  N     . TRP B  1 492 ? 81.769  99.092  -55.251  1.00 94.49  ? 598 TRP B N     1 
ATOM   7687  C  CA    . TRP B  1 492 ? 81.159  97.852  -54.736  1.00 90.37  ? 598 TRP B CA    1 
ATOM   7688  C  C     . TRP B  1 492 ? 79.961  98.058  -53.790  1.00 97.11  ? 598 TRP B C     1 
ATOM   7689  O  O     . TRP B  1 492 ? 79.327  97.076  -53.401  1.00 97.17  ? 598 TRP B O     1 
ATOM   7690  C  CB    . TRP B  1 492 ? 82.214  96.953  -54.051  1.00 82.91  ? 598 TRP B CB    1 
ATOM   7691  C  CG    . TRP B  1 492 ? 83.344  96.449  -54.971  1.00 77.76  ? 598 TRP B CG    1 
ATOM   7692  C  CD1   . TRP B  1 492 ? 83.352  96.463  -56.348  1.00 76.77  ? 598 TRP B CD1   1 
ATOM   7693  C  CD2   . TRP B  1 492 ? 84.584  95.830  -54.580  1.00 72.59  ? 598 TRP B CD2   1 
ATOM   7694  N  NE1   . TRP B  1 492 ? 84.512  95.923  -56.819  1.00 72.69  ? 598 TRP B NE1   1 
ATOM   7695  C  CE2   . TRP B  1 492 ? 85.288  95.520  -55.762  1.00 70.21  ? 598 TRP B CE2   1 
ATOM   7696  C  CE3   . TRP B  1 492 ? 85.168  95.511  -53.352  1.00 71.51  ? 598 TRP B CE3   1 
ATOM   7697  C  CZ2   . TRP B  1 492 ? 86.552  94.907  -55.750  1.00 67.99  ? 598 TRP B CZ2   1 
ATOM   7698  C  CZ3   . TRP B  1 492 ? 86.429  94.894  -53.337  1.00 69.41  ? 598 TRP B CZ3   1 
ATOM   7699  C  CH2   . TRP B  1 492 ? 87.100  94.602  -54.538  1.00 68.95  ? 598 TRP B CH2   1 
ATOM   7700  N  N     . ASN B  1 493 ? 79.630  99.304  -53.422  1.00 100.41 ? 599 ASN B N     1 
ATOM   7701  C  CA    . ASN B  1 493 ? 78.461  99.581  -52.558  1.00 98.89  ? 599 ASN B CA    1 
ATOM   7702  C  C     . ASN B  1 493 ? 77.264  100.069 -53.386  1.00 92.44  ? 599 ASN B C     1 
ATOM   7703  O  O     . ASN B  1 493 ? 76.155  99.675  -53.110  1.00 90.02  ? 599 ASN B O     1 
ATOM   7704  C  CB    . ASN B  1 493 ? 78.809  100.604 -51.483  1.00 102.45 ? 599 ASN B CB    1 
ATOM   7705  C  CG    . ASN B  1 493 ? 80.178  100.339 -50.829  1.00 104.65 ? 599 ASN B CG    1 
ATOM   7706  O  OD1   . ASN B  1 493 ? 80.531  99.195  -50.487  1.00 96.79  ? 599 ASN B OD1   1 
ATOM   7707  N  ND2   . ASN B  1 493 ? 80.955  101.404 -50.672  1.00 111.27 ? 599 ASN B ND2   1 
ATOM   7708  N  N     . MET C  1 9   ? 54.675  51.688  -42.475  1.00 85.40  ? 115 MET C N     1 
ATOM   7709  C  CA    . MET C  1 9   ? 54.878  52.654  -43.609  1.00 82.23  ? 115 MET C CA    1 
ATOM   7710  C  C     . MET C  1 9   ? 54.588  51.967  -44.930  1.00 69.16  ? 115 MET C C     1 
ATOM   7711  O  O     . MET C  1 9   ? 54.848  50.788  -45.085  1.00 68.04  ? 115 MET C O     1 
ATOM   7712  C  CB    . MET C  1 9   ? 56.308  53.212  -43.676  1.00 95.36  ? 115 MET C CB    1 
ATOM   7713  C  CG    . MET C  1 9   ? 56.673  54.052  -42.455  1.00 110.40 ? 115 MET C CG    1 
ATOM   7714  S  SD    . MET C  1 9   ? 56.337  55.812  -42.672  1.00 124.07 ? 115 MET C SD    1 
ATOM   7715  C  CE    . MET C  1 9   ? 56.407  56.286  -40.884  1.00 114.82 ? 115 MET C CE    1 
ATOM   7716  N  N     . LYS C  1 10  ? 54.038  52.722  -45.868  1.00 58.11  ? 116 LYS C N     1 
ATOM   7717  C  CA    . LYS C  1 10  ? 53.777  52.218  -47.208  1.00 48.99  ? 116 LYS C CA    1 
ATOM   7718  C  C     . LYS C  1 10  ? 54.852  52.661  -48.167  1.00 42.88  ? 116 LYS C C     1 
ATOM   7719  O  O     . LYS C  1 10  ? 55.210  53.824  -48.193  1.00 40.82  ? 116 LYS C O     1 
ATOM   7720  C  CB    . LYS C  1 10  ? 52.441  52.734  -47.703  1.00 45.39  ? 116 LYS C CB    1 
ATOM   7721  C  CG    . LYS C  1 10  ? 51.807  51.818  -48.706  1.00 44.80  ? 116 LYS C CG    1 
ATOM   7722  C  CD    . LYS C  1 10  ? 50.387  52.220  -48.977  1.00 44.14  ? 116 LYS C CD    1 
ATOM   7723  C  CE    . LYS C  1 10  ? 49.529  50.988  -49.036  1.00 44.61  ? 116 LYS C CE    1 
ATOM   7724  N  NZ    . LYS C  1 10  ? 48.149  51.406  -49.381  1.00 46.16  ? 116 LYS C NZ    1 
ATOM   7725  N  N     . VAL C  1 11  ? 55.351  51.743  -48.969  1.00 39.11  ? 117 VAL C N     1 
ATOM   7726  C  CA    . VAL C  1 11  ? 56.346  52.059  -49.984  1.00 38.14  ? 117 VAL C CA    1 
ATOM   7727  C  C     . VAL C  1 11  ? 55.680  52.039  -51.346  1.00 37.10  ? 117 VAL C C     1 
ATOM   7728  O  O     . VAL C  1 11  ? 54.882  51.153  -51.634  1.00 38.76  ? 117 VAL C O     1 
ATOM   7729  C  CB    . VAL C  1 11  ? 57.485  51.044  -49.976  1.00 38.48  ? 117 VAL C CB    1 
ATOM   7730  C  CG1   . VAL C  1 11  ? 58.540  51.424  -50.981  1.00 39.14  ? 117 VAL C CG1   1 
ATOM   7731  C  CG2   . VAL C  1 11  ? 58.103  50.941  -48.592  1.00 39.55  ? 117 VAL C CG2   1 
ATOM   7732  N  N     . ILE C  1 12  ? 56.049  52.992  -52.195  1.00 35.27  ? 118 ILE C N     1 
ATOM   7733  C  CA    . ILE C  1 12  ? 55.477  53.132  -53.532  1.00 33.61  ? 118 ILE C CA    1 
ATOM   7734  C  C     . ILE C  1 12  ? 56.578  53.499  -54.524  1.00 32.50  ? 118 ILE C C     1 
ATOM   7735  O  O     . ILE C  1 12  ? 57.424  54.329  -54.209  1.00 33.50  ? 118 ILE C O     1 
ATOM   7736  C  CB    . ILE C  1 12  ? 54.355  54.181  -53.516  1.00 33.17  ? 118 ILE C CB    1 
ATOM   7737  C  CG1   . ILE C  1 12  ? 53.620  54.224  -54.842  1.00 33.45  ? 118 ILE C CG1   1 
ATOM   7738  C  CG2   . ILE C  1 12  ? 54.877  55.574  -53.189  1.00 32.70  ? 118 ILE C CG2   1 
ATOM   7739  C  CD1   . ILE C  1 12  ? 52.307  54.968  -54.747  1.00 34.15  ? 118 ILE C CD1   1 
ATOM   7740  N  N     . ASN C  1 13  ? 56.562  52.887  -55.714  1.00 30.18  ? 119 ASN C N     1 
ATOM   7741  C  CA    . ASN C  1 13  ? 57.654  53.021  -56.680  1.00 28.73  ? 119 ASN C CA    1 
ATOM   7742  C  C     . ASN C  1 13  ? 57.351  53.983  -57.837  1.00 28.22  ? 119 ASN C C     1 
ATOM   7743  O  O     . ASN C  1 13  ? 56.726  53.632  -58.859  1.00 29.47  ? 119 ASN C O     1 
ATOM   7744  C  CB    . ASN C  1 13  ? 58.056  51.651  -57.219  1.00 28.53  ? 119 ASN C CB    1 
ATOM   7745  C  CG    . ASN C  1 13  ? 59.302  51.709  -58.119  1.00 28.40  ? 119 ASN C CG    1 
ATOM   7746  O  OD1   . ASN C  1 13  ? 59.687  52.772  -58.592  1.00 29.02  ? 119 ASN C OD1   1 
ATOM   7747  N  ND2   . ASN C  1 13  ? 59.915  50.567  -58.355  1.00 28.37  ? 119 ASN C ND2   1 
ATOM   7748  N  N     . ASP C  1 14  ? 57.860  55.192  -57.658  1.00 27.10  ? 120 ASP C N     1 
ATOM   7749  C  CA    . ASP C  1 14  ? 57.876  56.241  -58.665  1.00 27.05  ? 120 ASP C CA    1 
ATOM   7750  C  C     . ASP C  1 14  ? 59.120  56.079  -59.535  1.00 26.67  ? 120 ASP C C     1 
ATOM   7751  O  O     . ASP C  1 14  ? 60.206  55.897  -59.006  1.00 26.50  ? 120 ASP C O     1 
ATOM   7752  C  CB    . ASP C  1 14  ? 57.933  57.591  -57.954  1.00 27.10  ? 120 ASP C CB    1 
ATOM   7753  C  CG    . ASP C  1 14  ? 57.930  58.774  -58.893  1.00 27.11  ? 120 ASP C CG    1 
ATOM   7754  O  OD1   . ASP C  1 14  ? 57.067  58.839  -59.785  1.00 27.90  ? 120 ASP C OD1   1 
ATOM   7755  O  OD2   . ASP C  1 14  ? 58.776  59.673  -58.715  1.00 26.61  ? 120 ASP C OD2   1 
ATOM   7756  N  N     . PRO C  1 15  ? 58.978  56.155  -60.870  1.00 26.61  ? 121 PRO C N     1 
ATOM   7757  C  CA    . PRO C  1 15  ? 60.149  55.988  -61.719  1.00 26.87  ? 121 PRO C CA    1 
ATOM   7758  C  C     . PRO C  1 15  ? 61.155  57.122  -61.659  1.00 27.03  ? 121 PRO C C     1 
ATOM   7759  O  O     . PRO C  1 15  ? 62.270  56.931  -62.112  1.00 29.32  ? 121 PRO C O     1 
ATOM   7760  C  CB    . PRO C  1 15  ? 59.557  55.962  -63.129  1.00 26.86  ? 121 PRO C CB    1 
ATOM   7761  C  CG    . PRO C  1 15  ? 58.334  56.788  -63.004  1.00 26.87  ? 121 PRO C CG    1 
ATOM   7762  C  CD    . PRO C  1 15  ? 57.771  56.319  -61.691  1.00 26.79  ? 121 PRO C CD    1 
ATOM   7763  N  N     . ILE C  1 16  ? 60.761  58.295  -61.161  1.00 25.86  ? 122 ILE C N     1 
ATOM   7764  C  CA    . ILE C  1 16  ? 61.696  59.391  -61.024  1.00 25.32  ? 122 ILE C CA    1 
ATOM   7765  C  C     . ILE C  1 16  ? 62.471  59.273  -59.754  1.00 23.61  ? 122 ILE C C     1 
ATOM   7766  O  O     . ILE C  1 16  ? 63.669  59.295  -59.795  1.00 23.59  ? 122 ILE C O     1 
ATOM   7767  C  CB    . ILE C  1 16  ? 61.000  60.757  -61.022  1.00 27.07  ? 122 ILE C CB    1 
ATOM   7768  C  CG1   . ILE C  1 16  ? 60.102  60.912  -62.251  1.00 28.47  ? 122 ILE C CG1   1 
ATOM   7769  C  CG2   . ILE C  1 16  ? 62.035  61.891  -60.994  1.00 27.61  ? 122 ILE C CG2   1 
ATOM   7770  C  CD1   . ILE C  1 16  ? 60.772  60.589  -63.591  1.00 29.15  ? 122 ILE C CD1   1 
ATOM   7771  N  N     . HIS C  1 17  ? 61.782  59.153  -58.632  1.00 22.58  ? 123 HIS C N     1 
ATOM   7772  C  CA    . HIS C  1 17  ? 62.411  59.267  -57.312  1.00 21.76  ? 123 HIS C CA    1 
ATOM   7773  C  C     . HIS C  1 17  ? 62.759  57.967  -56.641  1.00 21.87  ? 123 HIS C C     1 
ATOM   7774  O  O     . HIS C  1 17  ? 63.494  57.981  -55.651  1.00 22.94  ? 123 HIS C O     1 
ATOM   7775  C  CB    . HIS C  1 17  ? 61.519  60.061  -56.381  1.00 20.97  ? 123 HIS C CB    1 
ATOM   7776  C  CG    . HIS C  1 17  ? 61.283  61.441  -56.866  1.00 20.09  ? 123 HIS C CG    1 
ATOM   7777  N  ND1   . HIS C  1 17  ? 62.324  62.304  -57.155  1.00 19.38  ? 123 HIS C ND1   1 
ATOM   7778  C  CD2   . HIS C  1 17  ? 60.132  62.091  -57.160  1.00 19.84  ? 123 HIS C CD2   1 
ATOM   7779  C  CE1   . HIS C  1 17  ? 61.798  63.446  -57.578  1.00 19.52  ? 123 HIS C CE1   1 
ATOM   7780  N  NE2   . HIS C  1 17  ? 60.477  63.342  -57.594  1.00 19.85  ? 123 HIS C NE2   1 
ATOM   7781  N  N     . GLY C  1 18  ? 62.261  56.857  -57.154  1.00 21.65  ? 124 GLY C N     1 
ATOM   7782  C  CA    . GLY C  1 18  ? 62.591  55.549  -56.600  1.00 22.06  ? 124 GLY C CA    1 
ATOM   7783  C  C     . GLY C  1 18  ? 61.493  55.101  -55.668  1.00 22.25  ? 124 GLY C C     1 
ATOM   7784  O  O     . GLY C  1 18  ? 60.335  55.424  -55.902  1.00 22.66  ? 124 GLY C O     1 
ATOM   7785  N  N     . HIS C  1 19  ? 61.857  54.364  -54.615  1.00 22.00  ? 125 HIS C N     1 
ATOM   7786  C  CA    . HIS C  1 19  ? 60.891  53.890  -53.637  1.00 21.81  ? 125 HIS C CA    1 
ATOM   7787  C  C     . HIS C  1 19  ? 60.642  54.946  -52.572  1.00 21.98  ? 125 HIS C C     1 
ATOM   7788  O  O     . HIS C  1 19  ? 61.463  55.168  -51.709  1.00 22.47  ? 125 HIS C O     1 
ATOM   7789  C  CB    . HIS C  1 19  ? 61.352  52.569  -53.045  1.00 21.77  ? 125 HIS C CB    1 
ATOM   7790  C  CG    . HIS C  1 19  ? 61.228  51.422  -53.999  1.00 21.81  ? 125 HIS C CG    1 
ATOM   7791  N  ND1   . HIS C  1 19  ? 61.921  51.367  -55.185  1.00 21.84  ? 125 HIS C ND1   1 
ATOM   7792  C  CD2   . HIS C  1 19  ? 60.473  50.297  -53.953  1.00 21.76  ? 125 HIS C CD2   1 
ATOM   7793  C  CE1   . HIS C  1 19  ? 61.611  50.244  -55.816  1.00 22.02  ? 125 HIS C CE1   1 
ATOM   7794  N  NE2   . HIS C  1 19  ? 60.723  49.585  -55.098  1.00 21.65  ? 125 HIS C NE2   1 
ATOM   7795  N  N     . ILE C  1 20  ? 59.505  55.619  -52.683  1.00 22.24  ? 126 ILE C N     1 
ATOM   7796  C  CA    . ILE C  1 20  ? 59.081  56.622  -51.733  1.00 22.88  ? 126 ILE C CA    1 
ATOM   7797  C  C     . ILE C  1 20  ? 58.416  55.938  -50.528  1.00 24.17  ? 126 ILE C C     1 
ATOM   7798  O  O     . ILE C  1 20  ? 57.620  55.017  -50.712  1.00 24.23  ? 126 ILE C O     1 
ATOM   7799  C  CB    . ILE C  1 20  ? 58.061  57.545  -52.399  1.00 22.52  ? 126 ILE C CB    1 
ATOM   7800  C  CG1   . ILE C  1 20  ? 58.717  58.317  -53.525  1.00 22.35  ? 126 ILE C CG1   1 
ATOM   7801  C  CG2   . ILE C  1 20  ? 57.477  58.547  -51.400  1.00 22.89  ? 126 ILE C CG2   1 
ATOM   7802  C  CD1   . ILE C  1 20  ? 57.685  59.017  -54.413  1.00 22.71  ? 126 ILE C CD1   1 
ATOM   7803  N  N     . GLU C  1 21  ? 58.711  56.411  -49.317  1.00 25.85  ? 127 GLU C N     1 
ATOM   7804  C  CA    . GLU C  1 21  ? 57.960  55.990  -48.123  1.00 27.69  ? 127 GLU C CA    1 
ATOM   7805  C  C     . GLU C  1 21  ? 56.819  56.955  -47.864  1.00 27.42  ? 127 GLU C C     1 
ATOM   7806  O  O     . GLU C  1 21  ? 56.999  58.157  -47.942  1.00 28.35  ? 127 GLU C O     1 
ATOM   7807  C  CB    . GLU C  1 21  ? 58.870  55.910  -46.906  1.00 29.96  ? 127 GLU C CB    1 
ATOM   7808  C  CG    . GLU C  1 21  ? 59.923  54.837  -46.989  1.00 32.74  ? 127 GLU C CG    1 
ATOM   7809  C  CD    . GLU C  1 21  ? 60.622  54.509  -45.673  1.00 34.77  ? 127 GLU C CD    1 
ATOM   7810  O  OE1   . GLU C  1 21  ? 60.313  55.088  -44.595  1.00 37.24  ? 127 GLU C OE1   1 
ATOM   7811  O  OE2   . GLU C  1 21  ? 61.501  53.621  -45.750  1.00 36.54  ? 127 GLU C OE2   1 
ATOM   7812  N  N     . LEU C  1 22  ? 55.642  56.419  -47.566  1.00 26.90  ? 128 LEU C N     1 
ATOM   7813  C  CA    . LEU C  1 22  ? 54.444  57.223  -47.286  1.00 26.05  ? 128 LEU C CA    1 
ATOM   7814  C  C     . LEU C  1 22  ? 53.956  56.962  -45.852  1.00 26.09  ? 128 LEU C C     1 
ATOM   7815  O  O     . LEU C  1 22  ? 53.558  55.849  -45.501  1.00 26.69  ? 128 LEU C O     1 
ATOM   7816  C  CB    . LEU C  1 22  ? 53.327  56.915  -48.268  1.00 25.40  ? 128 LEU C CB    1 
ATOM   7817  C  CG    . LEU C  1 22  ? 53.562  57.370  -49.704  1.00 25.19  ? 128 LEU C CG    1 
ATOM   7818  C  CD1   . LEU C  1 22  ? 52.452  56.864  -50.623  1.00 25.25  ? 128 LEU C CD1   1 
ATOM   7819  C  CD2   . LEU C  1 22  ? 53.684  58.878  -49.826  1.00 24.84  ? 128 LEU C CD2   1 
ATOM   7820  N  N     . HIS C  1 23  ? 53.989  58.019  -45.054  1.00 25.51  ? 129 HIS C N     1 
ATOM   7821  C  CA    . HIS C  1 23  ? 53.384  58.042  -43.747  1.00 24.93  ? 129 HIS C CA    1 
ATOM   7822  C  C     . HIS C  1 23  ? 51.911  57.730  -43.748  1.00 24.45  ? 129 HIS C C     1 
ATOM   7823  O  O     . HIS C  1 23  ? 51.225  58.165  -44.655  1.00 23.86  ? 129 HIS C O     1 
ATOM   7824  C  CB    . HIS C  1 23  ? 53.690  59.387  -43.098  1.00 25.29  ? 129 HIS C CB    1 
ATOM   7825  C  CG    . HIS C  1 23  ? 53.316  59.476  -41.663  1.00 25.86  ? 129 HIS C CG    1 
ATOM   7826  N  ND1   . HIS C  1 23  ? 52.021  59.643  -41.247  1.00 25.66  ? 129 HIS C ND1   1 
ATOM   7827  C  CD2   . HIS C  1 23  ? 54.078  59.434  -40.552  1.00 26.96  ? 129 HIS C CD2   1 
ATOM   7828  C  CE1   . HIS C  1 23  ? 51.995  59.700  -39.934  1.00 26.99  ? 129 HIS C CE1   1 
ATOM   7829  N  NE2   . HIS C  1 23  ? 53.230  59.598  -39.482  1.00 27.36  ? 129 HIS C NE2   1 
ATOM   7830  N  N     . PRO C  1 24  ? 51.394  56.990  -42.739  1.00 24.65  ? 130 PRO C N     1 
ATOM   7831  C  CA    . PRO C  1 24  ? 49.975  56.567  -42.745  1.00 24.58  ? 130 PRO C CA    1 
ATOM   7832  C  C     . PRO C  1 24  ? 48.971  57.675  -42.968  1.00 24.48  ? 130 PRO C C     1 
ATOM   7833  O  O     . PRO C  1 24  ? 47.961  57.449  -43.622  1.00 24.47  ? 130 PRO C O     1 
ATOM   7834  C  CB    . PRO C  1 24  ? 49.798  55.983  -41.376  1.00 24.75  ? 130 PRO C CB    1 
ATOM   7835  C  CG    . PRO C  1 24  ? 51.118  55.416  -41.062  1.00 25.09  ? 130 PRO C CG    1 
ATOM   7836  C  CD    . PRO C  1 24  ? 52.124  56.381  -41.614  1.00 24.85  ? 130 PRO C CD    1 
ATOM   7837  N  N     . LEU C  1 25  ? 49.235  58.831  -42.388  1.00 24.69  ? 131 LEU C N     1 
ATOM   7838  C  CA    . LEU C  1 25  ? 48.438  60.044  -42.603  1.00 25.31  ? 131 LEU C CA    1 
ATOM   7839  C  C     . LEU C  1 25  ? 48.395  60.468  -44.057  1.00 25.58  ? 131 LEU C C     1 
ATOM   7840  O  O     . LEU C  1 25  ? 47.346  60.865  -44.550  1.00 25.95  ? 131 LEU C O     1 
ATOM   7841  C  CB    . LEU C  1 25  ? 48.975  61.193  -41.749  1.00 25.39  ? 131 LEU C CB    1 
ATOM   7842  C  CG    . LEU C  1 25  ? 48.296  62.550  -41.887  1.00 25.12  ? 131 LEU C CG    1 
ATOM   7843  C  CD1   . LEU C  1 25  ? 46.819  62.490  -41.639  1.00 25.24  ? 131 LEU C CD1   1 
ATOM   7844  C  CD2   . LEU C  1 25  ? 48.885  63.556  -40.905  1.00 25.07  ? 131 LEU C CD2   1 
ATOM   7845  N  N     . LEU C  1 26  ? 49.533  60.395  -44.736  1.00 25.56  ? 132 LEU C N     1 
ATOM   7846  C  CA    . LEU C  1 26  ? 49.603  60.723  -46.167  1.00 25.66  ? 132 LEU C CA    1 
ATOM   7847  C  C     . LEU C  1 26  ? 48.812  59.708  -46.986  1.00 26.13  ? 132 LEU C C     1 
ATOM   7848  O  O     . LEU C  1 26  ? 48.066  60.094  -47.876  1.00 26.94  ? 132 LEU C O     1 
ATOM   7849  C  CB    . LEU C  1 26  ? 51.037  60.782  -46.674  1.00 25.80  ? 132 LEU C CB    1 
ATOM   7850  C  CG    . LEU C  1 26  ? 51.981  61.728  -45.936  1.00 26.28  ? 132 LEU C CG    1 
ATOM   7851  C  CD1   . LEU C  1 26  ? 53.431  61.605  -46.419  1.00 25.79  ? 132 LEU C CD1   1 
ATOM   7852  C  CD2   . LEU C  1 26  ? 51.520  63.177  -46.006  1.00 26.58  ? 132 LEU C CD2   1 
ATOM   7853  N  N     . VAL C  1 27  ? 48.956  58.425  -46.660  1.00 26.27  ? 133 VAL C N     1 
ATOM   7854  C  CA    . VAL C  1 27  ? 48.219  57.357  -47.331  1.00 26.81  ? 133 VAL C CA    1 
ATOM   7855  C  C     . VAL C  1 27  ? 46.724  57.607  -47.233  1.00 28.59  ? 133 VAL C C     1 
ATOM   7856  O  O     . VAL C  1 27  ? 45.970  57.406  -48.171  1.00 28.73  ? 133 VAL C O     1 
ATOM   7857  C  CB    . VAL C  1 27  ? 48.526  55.984  -46.711  1.00 26.35  ? 133 VAL C CB    1 
ATOM   7858  C  CG1   . VAL C  1 27  ? 47.637  54.886  -47.295  1.00 27.08  ? 133 VAL C CG1   1 
ATOM   7859  C  CG2   . VAL C  1 27  ? 49.978  55.624  -46.918  1.00 26.50  ? 133 VAL C CG2   1 
ATOM   7860  N  N     . ARG C  1 28  ? 46.316  58.055  -46.066  1.00 31.57  ? 134 ARG C N     1 
ATOM   7861  C  CA    . ARG C  1 28  ? 44.923  58.299  -45.771  1.00 34.13  ? 134 ARG C CA    1 
ATOM   7862  C  C     . ARG C  1 28  ? 44.372  59.480  -46.582  1.00 32.66  ? 134 ARG C C     1 
ATOM   7863  O  O     . ARG C  1 28  ? 43.218  59.452  -47.006  1.00 33.62  ? 134 ARG C O     1 
ATOM   7864  C  CB    . ARG C  1 28  ? 44.817  58.558  -44.273  1.00 37.18  ? 134 ARG C CB    1 
ATOM   7865  C  CG    . ARG C  1 28  ? 43.479  58.389  -43.692  1.00 39.90  ? 134 ARG C CG    1 
ATOM   7866  C  CD    . ARG C  1 28  ? 43.051  56.956  -43.577  1.00 43.00  ? 134 ARG C CD    1 
ATOM   7867  N  NE    . ARG C  1 28  ? 41.899  57.001  -42.687  1.00 47.23  ? 134 ARG C NE    1 
ATOM   7868  C  CZ    . ARG C  1 28  ? 40.682  57.508  -42.983  1.00 50.45  ? 134 ARG C CZ    1 
ATOM   7869  N  NH1   . ARG C  1 28  ? 40.438  58.017  -44.210  1.00 51.10  ? 134 ARG C NH1   1 
ATOM   7870  N  NH2   . ARG C  1 28  ? 39.761  57.536  -42.046  1.00 52.93  ? 134 ARG C NH2   1 
ATOM   7871  N  N     . ILE C  1 29  ? 45.210  60.496  -46.783  1.00 29.92  ? 135 ILE C N     1 
ATOM   7872  C  CA    . ILE C  1 29  ? 44.895  61.639  -47.634  1.00 29.21  ? 135 ILE C CA    1 
ATOM   7873  C  C     . ILE C  1 29  ? 44.883  61.243  -49.104  1.00 29.60  ? 135 ILE C C     1 
ATOM   7874  O  O     . ILE C  1 29  ? 44.015  61.669  -49.860  1.00 30.15  ? 135 ILE C O     1 
ATOM   7875  C  CB    . ILE C  1 29  ? 45.905  62.791  -47.411  1.00 28.36  ? 135 ILE C CB    1 
ATOM   7876  C  CG1   . ILE C  1 29  ? 45.663  63.408  -46.029  1.00 29.12  ? 135 ILE C CG1   1 
ATOM   7877  C  CG2   . ILE C  1 29  ? 45.766  63.883  -48.457  1.00 27.62  ? 135 ILE C CG2   1 
ATOM   7878  C  CD1   . ILE C  1 29  ? 46.785  64.304  -45.523  1.00 29.27  ? 135 ILE C CD1   1 
ATOM   7879  N  N     . ILE C  1 30  ? 45.869  60.453  -49.512  1.00 29.97  ? 136 ILE C N     1 
ATOM   7880  C  CA    . ILE C  1 30  ? 45.976  59.977  -50.896  1.00 29.32  ? 136 ILE C CA    1 
ATOM   7881  C  C     . ILE C  1 30  ? 44.756  59.179  -51.338  1.00 29.06  ? 136 ILE C C     1 
ATOM   7882  O  O     . ILE C  1 30  ? 44.256  59.387  -52.436  1.00 29.44  ? 136 ILE C O     1 
ATOM   7883  C  CB    . ILE C  1 30  ? 47.246  59.117  -51.075  1.00 28.65  ? 136 ILE C CB    1 
ATOM   7884  C  CG1   . ILE C  1 30  ? 48.457  60.023  -51.180  1.00 28.18  ? 136 ILE C CG1   1 
ATOM   7885  C  CG2   . ILE C  1 30  ? 47.174  58.214  -52.307  1.00 28.81  ? 136 ILE C CG2   1 
ATOM   7886  C  CD1   . ILE C  1 30  ? 49.747  59.313  -50.842  1.00 28.14  ? 136 ILE C CD1   1 
ATOM   7887  N  N     . ASN C  1 31  ? 44.299  58.267  -50.489  1.00 28.42  ? 137 ASN C N     1 
ATOM   7888  C  CA    . ASN C  1 31  ? 43.185  57.385  -50.815  1.00 28.83  ? 137 ASN C CA    1 
ATOM   7889  C  C     . ASN C  1 31  ? 41.805  58.034  -50.599  1.00 29.63  ? 137 ASN C C     1 
ATOM   7890  O  O     . ASN C  1 31  ? 40.989  57.566  -49.811  1.00 29.70  ? 137 ASN C O     1 
ATOM   7891  C  CB    . ASN C  1 31  ? 43.337  56.071  -50.041  1.00 28.43  ? 137 ASN C CB    1 
ATOM   7892  C  CG    . ASN C  1 31  ? 44.499  55.242  -50.540  1.00 27.54  ? 137 ASN C CG    1 
ATOM   7893  O  OD1   . ASN C  1 31  ? 44.728  55.174  -51.748  1.00 27.82  ? 137 ASN C OD1   1 
ATOM   7894  N  ND2   . ASN C  1 31  ? 45.224  54.599  -49.636  1.00 26.14  ? 137 ASN C ND2   1 
ATOM   7895  N  N     . THR C  1 32  ? 41.571  59.111  -51.334  1.00 30.38  ? 138 THR C N     1 
ATOM   7896  C  CA    . THR C  1 32  ? 40.325  59.855  -51.306  1.00 31.54  ? 138 THR C CA    1 
ATOM   7897  C  C     . THR C  1 32  ? 39.961  60.273  -52.728  1.00 33.60  ? 138 THR C C     1 
ATOM   7898  O  O     . THR C  1 32  ? 40.849  60.458  -53.549  1.00 35.91  ? 138 THR C O     1 
ATOM   7899  C  CB    . THR C  1 32  ? 40.461  61.139  -50.463  1.00 30.72  ? 138 THR C CB    1 
ATOM   7900  O  OG1   . THR C  1 32  ? 41.369  62.045  -51.086  1.00 29.98  ? 138 THR C OG1   1 
ATOM   7901  C  CG2   . THR C  1 32  ? 40.956  60.823  -49.064  1.00 30.04  ? 138 THR C CG2   1 
ATOM   7902  N  N     . PRO C  1 33  ? 38.667  60.453  -53.030  1.00 35.62  ? 139 PRO C N     1 
ATOM   7903  C  CA    . PRO C  1 33  ? 38.274  60.910  -54.364  1.00 35.61  ? 139 PRO C CA    1 
ATOM   7904  C  C     . PRO C  1 33  ? 38.888  62.224  -54.803  1.00 35.41  ? 139 PRO C C     1 
ATOM   7905  O  O     . PRO C  1 33  ? 39.120  62.408  -55.987  1.00 37.82  ? 139 PRO C O     1 
ATOM   7906  C  CB    . PRO C  1 33  ? 36.762  61.075  -54.234  1.00 36.32  ? 139 PRO C CB    1 
ATOM   7907  C  CG    . PRO C  1 33  ? 36.385  60.050  -53.235  1.00 36.75  ? 139 PRO C CG    1 
ATOM   7908  C  CD    . PRO C  1 33  ? 37.479  60.165  -52.207  1.00 36.41  ? 139 PRO C CD    1 
ATOM   7909  N  N     . GLN C  1 34  ? 39.159  63.111  -53.856  1.00 34.77  ? 140 GLN C N     1 
ATOM   7910  C  CA    . GLN C  1 34  ? 39.639  64.459  -54.167  1.00 34.36  ? 140 GLN C CA    1 
ATOM   7911  C  C     . GLN C  1 34  ? 41.083  64.428  -54.685  1.00 33.17  ? 140 GLN C C     1 
ATOM   7912  O  O     . GLN C  1 34  ? 41.473  65.246  -55.565  1.00 33.14  ? 140 GLN C O     1 
ATOM   7913  C  CB    . GLN C  1 34  ? 39.527  65.361  -52.933  1.00 35.00  ? 140 GLN C CB    1 
ATOM   7914  C  CG    . GLN C  1 34  ? 38.103  65.736  -52.538  1.00 35.25  ? 140 GLN C CG    1 
ATOM   7915  C  CD    . GLN C  1 34  ? 37.267  64.569  -52.008  1.00 35.31  ? 140 GLN C CD    1 
ATOM   7916  O  OE1   . GLN C  1 34  ? 37.798  63.623  -51.400  1.00 34.95  ? 140 GLN C OE1   1 
ATOM   7917  N  NE2   . GLN C  1 34  ? 35.959  64.632  -52.238  1.00 35.20  ? 140 GLN C NE2   1 
ATOM   7918  N  N     . PHE C  1 35  ? 41.854  63.485  -54.134  1.00 31.78  ? 141 PHE C N     1 
ATOM   7919  C  CA    . PHE C  1 35  ? 43.240  63.264  -54.527  1.00 30.71  ? 141 PHE C CA    1 
ATOM   7920  C  C     . PHE C  1 35  ? 43.345  62.333  -55.724  1.00 30.44  ? 141 PHE C C     1 
ATOM   7921  O  O     . PHE C  1 35  ? 44.047  62.644  -56.671  1.00 33.80  ? 141 PHE C O     1 
ATOM   7922  C  CB    . PHE C  1 35  ? 44.070  62.689  -53.374  1.00 30.05  ? 141 PHE C CB    1 
ATOM   7923  C  CG    . PHE C  1 35  ? 45.552  62.755  -53.614  1.00 29.79  ? 141 PHE C CG    1 
ATOM   7924  C  CD1   . PHE C  1 35  ? 46.262  63.921  -53.324  1.00 30.17  ? 141 PHE C CD1   1 
ATOM   7925  C  CD2   . PHE C  1 35  ? 46.234  61.689  -54.186  1.00 28.83  ? 141 PHE C CD2   1 
ATOM   7926  C  CE1   . PHE C  1 35  ? 47.628  63.996  -53.550  1.00 29.49  ? 141 PHE C CE1   1 
ATOM   7927  C  CE2   . PHE C  1 35  ? 47.600  61.770  -54.428  1.00 28.38  ? 141 PHE C CE2   1 
ATOM   7928  C  CZ    . PHE C  1 35  ? 48.297  62.930  -54.097  1.00 28.63  ? 141 PHE C CZ    1 
ATOM   7929  N  N     . GLN C  1 36  ? 42.663  61.194  -55.695  1.00 29.04  ? 142 GLN C N     1 
ATOM   7930  C  CA    . GLN C  1 36  ? 42.745  60.208  -56.790  1.00 29.08  ? 142 GLN C CA    1 
ATOM   7931  C  C     . GLN C  1 36  ? 42.260  60.807  -58.105  1.00 28.45  ? 142 GLN C C     1 
ATOM   7932  O  O     . GLN C  1 36  ? 42.669  60.366  -59.177  1.00 28.70  ? 142 GLN C O     1 
ATOM   7933  C  CB    . GLN C  1 36  ? 41.984  58.936  -56.478  1.00 31.25  ? 142 GLN C CB    1 
ATOM   7934  C  CG    . GLN C  1 36  ? 42.519  58.185  -55.262  1.00 33.58  ? 142 GLN C CG    1 
ATOM   7935  C  CD    . GLN C  1 36  ? 43.647  57.226  -55.550  1.00 35.41  ? 142 GLN C CD    1 
ATOM   7936  O  OE1   . GLN C  1 36  ? 43.633  56.528  -56.593  1.00 39.14  ? 142 GLN C OE1   1 
ATOM   7937  N  NE2   . GLN C  1 36  ? 44.586  57.117  -54.601  1.00 34.88  ? 142 GLN C NE2   1 
ATOM   7938  N  N     . ARG C  1 37  ? 41.407  61.820  -58.012  1.00 27.55  ? 143 ARG C N     1 
ATOM   7939  C  CA    . ARG C  1 37  ? 41.043  62.683  -59.143  1.00 27.02  ? 143 ARG C CA    1 
ATOM   7940  C  C     . ARG C  1 37  ? 42.234  63.058  -60.025  1.00 26.38  ? 143 ARG C C     1 
ATOM   7941  O  O     . ARG C  1 37  ? 42.127  63.094  -61.242  1.00 26.57  ? 143 ARG C O     1 
ATOM   7942  C  CB    . ARG C  1 37  ? 40.369  63.943  -58.603  1.00 26.70  ? 143 ARG C CB    1 
ATOM   7943  C  CG    . ARG C  1 37  ? 40.345  65.108  -59.541  1.00 26.54  ? 143 ARG C CG    1 
ATOM   7944  C  CD    . ARG C  1 37  ? 39.516  66.220  -58.970  1.00 26.88  ? 143 ARG C CD    1 
ATOM   7945  N  NE    . ARG C  1 37  ? 39.439  67.304  -59.922  1.00 27.12  ? 143 ARG C NE    1 
ATOM   7946  C  CZ    . ARG C  1 37  ? 40.319  68.291  -60.014  1.00 27.77  ? 143 ARG C CZ    1 
ATOM   7947  N  NH1   . ARG C  1 37  ? 41.367  68.355  -59.157  1.00 28.26  ? 143 ARG C NH1   1 
ATOM   7948  N  NH2   . ARG C  1 37  ? 40.141  69.236  -60.955  1.00 27.97  ? 143 ARG C NH2   1 
ATOM   7949  N  N     . LEU C  1 38  ? 43.360  63.344  -59.399  1.00 25.35  ? 144 LEU C N     1 
ATOM   7950  C  CA    . LEU C  1 38  ? 44.554  63.757  -60.113  1.00 24.67  ? 144 LEU C CA    1 
ATOM   7951  C  C     . LEU C  1 38  ? 45.117  62.684  -61.043  1.00 24.95  ? 144 LEU C C     1 
ATOM   7952  O  O     . LEU C  1 38  ? 45.934  63.010  -61.898  1.00 26.02  ? 144 LEU C O     1 
ATOM   7953  C  CB    . LEU C  1 38  ? 45.644  64.212  -59.141  1.00 23.73  ? 144 LEU C CB    1 
ATOM   7954  C  CG    . LEU C  1 38  ? 45.323  65.409  -58.247  1.00 23.60  ? 144 LEU C CG    1 
ATOM   7955  C  CD1   . LEU C  1 38  ? 46.478  65.727  -57.303  1.00 23.06  ? 144 LEU C CD1   1 
ATOM   7956  C  CD2   . LEU C  1 38  ? 44.958  66.658  -59.058  1.00 23.96  ? 144 LEU C CD2   1 
ATOM   7957  N  N     . ARG C  1 39  ? 44.703  61.427  -60.895  1.00 24.35  ? 145 ARG C N     1 
ATOM   7958  C  CA    . ARG C  1 39  ? 45.054  60.397  -61.874  1.00 24.27  ? 145 ARG C CA    1 
ATOM   7959  C  C     . ARG C  1 39  ? 44.501  60.659  -63.261  1.00 24.70  ? 145 ARG C C     1 
ATOM   7960  O  O     . ARG C  1 39  ? 44.993  60.084  -64.229  1.00 25.44  ? 145 ARG C O     1 
ATOM   7961  C  CB    . ARG C  1 39  ? 44.556  59.019  -61.437  1.00 24.50  ? 145 ARG C CB    1 
ATOM   7962  C  CG    . ARG C  1 39  ? 45.398  58.383  -60.340  1.00 24.66  ? 145 ARG C CG    1 
ATOM   7963  C  CD    . ARG C  1 39  ? 44.771  57.077  -59.910  1.00 25.30  ? 145 ARG C CD    1 
ATOM   7964  N  NE    . ARG C  1 39  ? 45.494  56.427  -58.811  1.00 25.73  ? 145 ARG C NE    1 
ATOM   7965  C  CZ    . ARG C  1 39  ? 46.558  55.647  -58.945  1.00 26.01  ? 145 ARG C CZ    1 
ATOM   7966  N  NH1   . ARG C  1 39  ? 47.086  55.412  -60.153  1.00 26.56  ? 145 ARG C NH1   1 
ATOM   7967  N  NH2   . ARG C  1 39  ? 47.097  55.089  -57.862  1.00 25.86  ? 145 ARG C NH2   1 
ATOM   7968  N  N     . TYR C  1 40  ? 43.474  61.498  -63.349  1.00 25.50  ? 146 TYR C N     1 
ATOM   7969  C  CA    . TYR C  1 40  ? 42.766  61.738  -64.592  1.00 26.33  ? 146 TYR C CA    1 
ATOM   7970  C  C     . TYR C  1 40  ? 42.960  63.164  -65.107  1.00 27.52  ? 146 TYR C C     1 
ATOM   7971  O  O     . TYR C  1 40  ? 42.134  63.684  -65.836  1.00 28.32  ? 146 TYR C O     1 
ATOM   7972  C  CB    . TYR C  1 40  ? 41.278  61.389  -64.381  1.00 26.49  ? 146 TYR C CB    1 
ATOM   7973  C  CG    . TYR C  1 40  ? 41.094  60.121  -63.555  1.00 26.14  ? 146 TYR C CG    1 
ATOM   7974  C  CD1   . TYR C  1 40  ? 41.402  58.856  -64.072  1.00 25.65  ? 146 TYR C CD1   1 
ATOM   7975  C  CD2   . TYR C  1 40  ? 40.645  60.194  -62.251  1.00 26.16  ? 146 TYR C CD2   1 
ATOM   7976  C  CE1   . TYR C  1 40  ? 41.239  57.699  -63.302  1.00 25.63  ? 146 TYR C CE1   1 
ATOM   7977  C  CE2   . TYR C  1 40  ? 40.483  59.032  -61.478  1.00 26.35  ? 146 TYR C CE2   1 
ATOM   7978  C  CZ    . TYR C  1 40  ? 40.778  57.784  -62.003  1.00 25.99  ? 146 TYR C CZ    1 
ATOM   7979  O  OH    . TYR C  1 40  ? 40.585  56.691  -61.152  1.00 26.94  ? 146 TYR C OH    1 
ATOM   7980  N  N     . ILE C  1 41  ? 44.072  63.781  -64.740  1.00 29.45  ? 147 ILE C N     1 
ATOM   7981  C  CA    . ILE C  1 41  ? 44.437  65.098  -65.262  1.00 31.86  ? 147 ILE C CA    1 
ATOM   7982  C  C     . ILE C  1 41  ? 45.900  65.050  -65.744  1.00 33.09  ? 147 ILE C C     1 
ATOM   7983  O  O     . ILE C  1 41  ? 46.803  64.838  -64.941  1.00 31.96  ? 147 ILE C O     1 
ATOM   7984  C  CB    . ILE C  1 41  ? 44.273  66.165  -64.178  1.00 32.73  ? 147 ILE C CB    1 
ATOM   7985  C  CG1   . ILE C  1 41  ? 42.803  66.286  -63.798  1.00 34.09  ? 147 ILE C CG1   1 
ATOM   7986  C  CG2   . ILE C  1 41  ? 44.803  67.505  -64.651  1.00 33.02  ? 147 ILE C CG2   1 
ATOM   7987  C  CD1   . ILE C  1 41  ? 42.479  67.234  -62.647  1.00 35.05  ? 147 ILE C CD1   1 
ATOM   7988  N  N     . LYS C  1 42  ? 46.134  65.286  -67.032  1.00 34.92  ? 148 LYS C N     1 
ATOM   7989  C  CA    . LYS C  1 42  ? 47.490  65.209  -67.568  1.00 35.69  ? 148 LYS C CA    1 
ATOM   7990  C  C     . LYS C  1 42  ? 48.304  66.409  -67.152  1.00 34.97  ? 148 LYS C C     1 
ATOM   7991  O  O     . LYS C  1 42  ? 47.777  67.508  -67.027  1.00 35.86  ? 148 LYS C O     1 
ATOM   7992  C  CB    . LYS C  1 42  ? 47.469  65.064  -69.083  1.00 38.22  ? 148 LYS C CB    1 
ATOM   7993  C  CG    . LYS C  1 42  ? 46.936  63.705  -69.464  1.00 41.43  ? 148 LYS C CG    1 
ATOM   7994  C  CD    . LYS C  1 42  ? 47.057  63.435  -70.944  1.00 42.65  ? 148 LYS C CD    1 
ATOM   7995  C  CE    . LYS C  1 42  ? 45.957  62.467  -71.337  1.00 44.38  ? 148 LYS C CE    1 
ATOM   7996  N  NZ    . LYS C  1 42  ? 44.501  62.768  -71.250  1.00 46.28  ? 148 LYS C NZ    1 
ATOM   7997  N  N     . GLN C  1 43  ? 49.590  66.175  -66.913  1.00 33.43  ? 149 GLN C N     1 
ATOM   7998  C  CA    . GLN C  1 43  ? 50.482  67.202  -66.413  1.00 31.30  ? 149 GLN C CA    1 
ATOM   7999  C  C     . GLN C  1 43  ? 50.627  68.295  -67.438  1.00 30.54  ? 149 GLN C C     1 
ATOM   8000  O  O     . GLN C  1 43  ? 50.518  69.487  -67.111  1.00 28.38  ? 149 GLN C O     1 
ATOM   8001  C  CB    . GLN C  1 43  ? 51.850  66.593  -66.126  1.00 30.88  ? 149 GLN C CB    1 
ATOM   8002  C  CG    . GLN C  1 43  ? 52.913  67.546  -65.544  1.00 31.03  ? 149 GLN C CG    1 
ATOM   8003  C  CD    . GLN C  1 43  ? 52.759  67.715  -64.074  1.00 30.06  ? 149 GLN C CD    1 
ATOM   8004  O  OE1   . GLN C  1 43  ? 51.662  67.574  -63.582  1.00 29.89  ? 149 GLN C OE1   1 
ATOM   8005  N  NE2   . GLN C  1 43  ? 53.853  68.005  -63.360  1.00 29.57  ? 149 GLN C NE2   1 
ATOM   8006  N  N     . LEU C  1 44  ? 50.881  67.874  -68.679  1.00 31.63  ? 150 LEU C N     1 
ATOM   8007  C  CA    . LEU C  1 44  ? 51.193  68.805  -69.753  1.00 33.15  ? 150 LEU C CA    1 
ATOM   8008  C  C     . LEU C  1 44  ? 50.044  69.010  -70.718  1.00 33.49  ? 150 LEU C C     1 
ATOM   8009  O  O     . LEU C  1 44  ? 50.262  69.417  -71.846  1.00 34.62  ? 150 LEU C O     1 
ATOM   8010  C  CB    . LEU C  1 44  ? 52.450  68.337  -70.483  1.00 33.62  ? 150 LEU C CB    1 
ATOM   8011  C  CG    . LEU C  1 44  ? 53.669  68.092  -69.573  1.00 33.72  ? 150 LEU C CG    1 
ATOM   8012  C  CD1   . LEU C  1 44  ? 54.893  67.743  -70.402  1.00 33.57  ? 150 LEU C CD1   1 
ATOM   8013  C  CD2   . LEU C  1 44  ? 54.006  69.275  -68.675  1.00 34.30  ? 150 LEU C CD2   1 
ATOM   8014  N  N     . GLY C  1 45  ? 48.821  68.774  -70.258  1.00 32.24  ? 151 GLY C N     1 
ATOM   8015  C  CA    . GLY C  1 45  ? 47.614  69.010  -71.042  1.00 30.83  ? 151 GLY C CA    1 
ATOM   8016  C  C     . GLY C  1 45  ? 47.718  68.564  -72.490  1.00 29.21  ? 151 GLY C C     1 
ATOM   8017  O  O     . GLY C  1 45  ? 47.926  67.370  -72.778  1.00 27.14  ? 151 GLY C O     1 
ATOM   8018  N  N     . GLY C  1 46  ? 47.606  69.556  -73.378  1.00 29.24  ? 152 GLY C N     1 
ATOM   8019  C  CA    . GLY C  1 46  ? 47.678  69.340  -74.826  1.00 29.91  ? 152 GLY C CA    1 
ATOM   8020  C  C     . GLY C  1 46  ? 49.042  68.925  -75.363  1.00 29.62  ? 152 GLY C C     1 
ATOM   8021  O  O     . GLY C  1 46  ? 49.151  68.465  -76.493  1.00 30.99  ? 152 GLY C O     1 
ATOM   8022  N  N     . GLY C  1 47  ? 50.082  69.096  -74.557  1.00 28.46  ? 153 GLY C N     1 
ATOM   8023  C  CA    . GLY C  1 47  ? 51.428  68.634  -74.896  1.00 27.13  ? 153 GLY C CA    1 
ATOM   8024  C  C     . GLY C  1 47  ? 51.516  67.160  -75.246  1.00 26.43  ? 153 GLY C C     1 
ATOM   8025  O  O     . GLY C  1 47  ? 52.361  66.773  -76.058  1.00 25.91  ? 153 GLY C O     1 
ATOM   8026  N  N     . TYR C  1 48  ? 50.650  66.329  -74.665  1.00 26.27  ? 154 TYR C N     1 
ATOM   8027  C  CA    . TYR C  1 48  ? 50.579  64.909  -75.041  1.00 26.08  ? 154 TYR C CA    1 
ATOM   8028  C  C     . TYR C  1 48  ? 50.356  64.742  -76.547  1.00 27.48  ? 154 TYR C C     1 
ATOM   8029  O  O     . TYR C  1 48  ? 50.897  63.818  -77.159  1.00 29.02  ? 154 TYR C O     1 
ATOM   8030  C  CB    . TYR C  1 48  ? 49.480  64.186  -74.262  1.00 25.34  ? 154 TYR C CB    1 
ATOM   8031  C  CG    . TYR C  1 48  ? 49.305  62.690  -74.514  1.00 24.35  ? 154 TYR C CG    1 
ATOM   8032  C  CD1   . TYR C  1 48  ? 50.385  61.853  -74.648  1.00 23.90  ? 154 TYR C CD1   1 
ATOM   8033  C  CD2   . TYR C  1 48  ? 48.027  62.108  -74.560  1.00 24.64  ? 154 TYR C CD2   1 
ATOM   8034  C  CE1   . TYR C  1 48  ? 50.209  60.474  -74.864  1.00 23.87  ? 154 TYR C CE1   1 
ATOM   8035  C  CE2   . TYR C  1 48  ? 47.857  60.736  -74.772  1.00 24.56  ? 154 TYR C CE2   1 
ATOM   8036  C  CZ    . TYR C  1 48  ? 48.963  59.920  -74.893  1.00 24.05  ? 154 TYR C CZ    1 
ATOM   8037  O  OH    . TYR C  1 48  ? 48.827  58.559  -75.065  1.00 23.96  ? 154 TYR C OH    1 
ATOM   8038  N  N     . TYR C  1 49  ? 49.590  65.659  -77.147  1.00 28.96  ? 155 TYR C N     1 
ATOM   8039  C  CA    . TYR C  1 49  ? 49.290  65.625  -78.579  1.00 30.63  ? 155 TYR C CA    1 
ATOM   8040  C  C     . TYR C  1 49  ? 50.460  66.121  -79.469  1.00 31.12  ? 155 TYR C C     1 
ATOM   8041  O  O     . TYR C  1 49  ? 50.338  66.157  -80.693  1.00 31.93  ? 155 TYR C O     1 
ATOM   8042  C  CB    . TYR C  1 49  ? 47.959  66.350  -78.860  1.00 32.22  ? 155 TYR C CB    1 
ATOM   8043  C  CG    . TYR C  1 49  ? 46.761  65.692  -78.177  1.00 34.09  ? 155 TYR C CG    1 
ATOM   8044  C  CD1   . TYR C  1 49  ? 46.076  64.632  -78.777  1.00 34.39  ? 155 TYR C CD1   1 
ATOM   8045  C  CD2   . TYR C  1 49  ? 46.323  66.119  -76.907  1.00 34.13  ? 155 TYR C CD2   1 
ATOM   8046  C  CE1   . TYR C  1 49  ? 44.969  64.032  -78.136  1.00 33.71  ? 155 TYR C CE1   1 
ATOM   8047  C  CE2   . TYR C  1 49  ? 45.215  65.520  -76.289  1.00 33.17  ? 155 TYR C CE2   1 
ATOM   8048  C  CZ    . TYR C  1 49  ? 44.560  64.467  -76.901  1.00 33.08  ? 155 TYR C CZ    1 
ATOM   8049  O  OH    . TYR C  1 49  ? 43.468  63.871  -76.302  1.00 33.21  ? 155 TYR C OH    1 
ATOM   8050  N  N     . VAL C  1 50  ? 51.573  66.498  -78.847  1.00 31.37  ? 156 VAL C N     1 
ATOM   8051  C  CA    . VAL C  1 50  ? 52.836  66.777  -79.537  1.00 32.06  ? 156 VAL C CA    1 
ATOM   8052  C  C     . VAL C  1 50  ? 53.987  65.869  -79.094  1.00 31.00  ? 156 VAL C C     1 
ATOM   8053  O  O     . VAL C  1 50  ? 54.781  65.423  -79.921  1.00 29.94  ? 156 VAL C O     1 
ATOM   8054  C  CB    . VAL C  1 50  ? 53.257  68.248  -79.296  1.00 32.64  ? 156 VAL C CB    1 
ATOM   8055  C  CG1   . VAL C  1 50  ? 54.613  68.567  -79.923  1.00 31.63  ? 156 VAL C CG1   1 
ATOM   8056  C  CG2   . VAL C  1 50  ? 52.179  69.203  -79.815  1.00 33.67  ? 156 VAL C CG2   1 
ATOM   8057  N  N     . PHE C  1 51  ? 54.116  65.654  -77.791  1.00 30.88  ? 157 PHE C N     1 
ATOM   8058  C  CA    . PHE C  1 51  ? 55.103  64.725  -77.229  1.00 30.37  ? 157 PHE C CA    1 
ATOM   8059  C  C     . PHE C  1 51  ? 54.383  63.474  -76.770  1.00 31.08  ? 157 PHE C C     1 
ATOM   8060  O  O     . PHE C  1 51  ? 53.813  63.461  -75.678  1.00 31.04  ? 157 PHE C O     1 
ATOM   8061  C  CB    . PHE C  1 51  ? 55.797  65.364  -76.048  1.00 29.31  ? 157 PHE C CB    1 
ATOM   8062  C  CG    . PHE C  1 51  ? 56.696  66.487  -76.415  1.00 28.54  ? 157 PHE C CG    1 
ATOM   8063  C  CD1   . PHE C  1 51  ? 56.199  67.762  -76.568  1.00 28.59  ? 157 PHE C CD1   1 
ATOM   8064  C  CD2   . PHE C  1 51  ? 58.042  66.273  -76.589  1.00 28.28  ? 157 PHE C CD2   1 
ATOM   8065  C  CE1   . PHE C  1 51  ? 57.038  68.813  -76.887  1.00 28.62  ? 157 PHE C CE1   1 
ATOM   8066  C  CE2   . PHE C  1 51  ? 58.891  67.322  -76.905  1.00 28.43  ? 157 PHE C CE2   1 
ATOM   8067  C  CZ    . PHE C  1 51  ? 58.388  68.598  -77.043  1.00 28.31  ? 157 PHE C CZ    1 
ATOM   8068  N  N     . PRO C  1 52  ? 54.386  62.419  -77.583  1.00 32.45  ? 158 PRO C N     1 
ATOM   8069  C  CA    . PRO C  1 52  ? 53.573  61.261  -77.226  1.00 33.05  ? 158 PRO C CA    1 
ATOM   8070  C  C     . PRO C  1 52  ? 54.043  60.548  -75.953  1.00 33.65  ? 158 PRO C C     1 
ATOM   8071  O  O     . PRO C  1 52  ? 53.326  59.698  -75.431  1.00 33.09  ? 158 PRO C O     1 
ATOM   8072  C  CB    . PRO C  1 52  ? 53.709  60.354  -78.452  1.00 33.35  ? 158 PRO C CB    1 
ATOM   8073  C  CG    . PRO C  1 52  ? 55.063  60.681  -78.996  1.00 33.35  ? 158 PRO C CG    1 
ATOM   8074  C  CD    . PRO C  1 52  ? 55.173  62.180  -78.807  1.00 33.60  ? 158 PRO C CD    1 
ATOM   8075  N  N     . GLY C  1 53  ? 55.229  60.883  -75.444  1.00 34.35  ? 159 GLY C N     1 
ATOM   8076  C  CA    . GLY C  1 53  ? 55.635  60.353  -74.141  1.00 33.33  ? 159 GLY C CA    1 
ATOM   8077  C  C     . GLY C  1 53  ? 54.891  60.905  -72.937  1.00 31.88  ? 159 GLY C C     1 
ATOM   8078  O  O     . GLY C  1 53  ? 54.782  60.215  -71.916  1.00 32.25  ? 159 GLY C O     1 
ATOM   8079  N  N     . ALA C  1 54  ? 54.342  62.123  -73.080  1.00 30.77  ? 160 ALA C N     1 
ATOM   8080  C  CA    . ALA C  1 54  ? 53.812  62.940  -71.979  1.00 30.21  ? 160 ALA C CA    1 
ATOM   8081  C  C     . ALA C  1 54  ? 52.387  62.583  -71.516  1.00 30.02  ? 160 ALA C C     1 
ATOM   8082  O  O     . ALA C  1 54  ? 51.520  63.458  -71.285  1.00 29.97  ? 160 ALA C O     1 
ATOM   8083  C  CB    . ALA C  1 54  ? 53.891  64.401  -72.366  1.00 30.54  ? 160 ALA C CB    1 
ATOM   8084  N  N     . SER C  1 55  ? 52.202  61.276  -71.315  1.00 29.82  ? 161 SER C N     1 
ATOM   8085  C  CA    . SER C  1 55  ? 50.990  60.656  -70.779  1.00 29.11  ? 161 SER C CA    1 
ATOM   8086  C  C     . SER C  1 55  ? 50.826  60.874  -69.284  1.00 27.58  ? 161 SER C C     1 
ATOM   8087  O  O     . SER C  1 55  ? 49.737  60.631  -68.747  1.00 27.31  ? 161 SER C O     1 
ATOM   8088  C  CB    . SER C  1 55  ? 51.070  59.130  -71.009  1.00 30.27  ? 161 SER C CB    1 
ATOM   8089  O  OG    . SER C  1 55  ? 52.232  58.542  -70.358  1.00 31.58  ? 161 SER C OG    1 
ATOM   8090  N  N     . HIS C  1 56  ? 51.913  61.266  -68.612  1.00 26.17  ? 162 HIS C N     1 
ATOM   8091  C  CA    . HIS C  1 56  ? 51.933  61.428  -67.158  1.00 25.29  ? 162 HIS C CA    1 
ATOM   8092  C  C     . HIS C  1 56  ? 50.928  62.435  -66.630  1.00 25.06  ? 162 HIS C C     1 
ATOM   8093  O  O     . HIS C  1 56  ? 50.661  63.467  -67.276  1.00 26.20  ? 162 HIS C O     1 
ATOM   8094  C  CB    . HIS C  1 56  ? 53.359  61.714  -66.633  1.00 24.72  ? 162 HIS C CB    1 
ATOM   8095  C  CG    . HIS C  1 56  ? 53.929  63.045  -67.035  1.00 23.78  ? 162 HIS C CG    1 
ATOM   8096  N  ND1   . HIS C  1 56  ? 54.063  63.438  -68.342  1.00 23.63  ? 162 HIS C ND1   1 
ATOM   8097  C  CD2   . HIS C  1 56  ? 54.460  64.046  -66.291  1.00 22.85  ? 162 HIS C CD2   1 
ATOM   8098  C  CE1   . HIS C  1 56  ? 54.626  64.633  -68.384  1.00 23.28  ? 162 HIS C CE1   1 
ATOM   8099  N  NE2   . HIS C  1 56  ? 54.891  65.019  -67.150  1.00 22.49  ? 162 HIS C NE2   1 
ATOM   8100  N  N     . ASN C  1 57  ? 50.383  62.088  -65.462  1.00 24.17  ? 163 ASN C N     1 
ATOM   8101  C  CA    . ASN C  1 57  ? 49.300  62.800  -64.792  1.00 23.89  ? 163 ASN C CA    1 
ATOM   8102  C  C     . ASN C  1 57  ? 49.750  63.471  -63.492  1.00 24.20  ? 163 ASN C C     1 
ATOM   8103  O  O     . ASN C  1 57  ? 50.825  63.173  -62.970  1.00 23.86  ? 163 ASN C O     1 
ATOM   8104  C  CB    . ASN C  1 57  ? 48.190  61.818  -64.453  1.00 23.07  ? 163 ASN C CB    1 
ATOM   8105  C  CG    . ASN C  1 57  ? 47.622  61.144  -65.677  1.00 22.69  ? 163 ASN C CG    1 
ATOM   8106  O  OD1   . ASN C  1 57  ? 47.122  61.792  -66.597  1.00 21.83  ? 163 ASN C OD1   1 
ATOM   8107  N  ND2   . ASN C  1 57  ? 47.677  59.826  -65.690  1.00 22.42  ? 163 ASN C ND2   1 
ATOM   8108  N  N     . ARG C  1 58  ? 48.905  64.364  -62.969  1.00 23.92  ? 164 ARG C N     1 
ATOM   8109  C  CA    . ARG C  1 58  ? 49.221  65.145  -61.767  1.00 23.45  ? 164 ARG C CA    1 
ATOM   8110  C  C     . ARG C  1 58  ? 49.431  64.297  -60.520  1.00 23.40  ? 164 ARG C C     1 
ATOM   8111  O  O     . ARG C  1 58  ? 50.291  64.595  -59.698  1.00 23.07  ? 164 ARG C O     1 
ATOM   8112  C  CB    . ARG C  1 58  ? 48.120  66.144  -61.490  1.00 23.44  ? 164 ARG C CB    1 
ATOM   8113  C  CG    . ARG C  1 58  ? 48.114  67.310  -62.478  1.00 23.29  ? 164 ARG C CG    1 
ATOM   8114  C  CD    . ARG C  1 58  ? 49.090  68.393  -62.046  1.00 23.05  ? 164 ARG C CD    1 
ATOM   8115  N  NE    . ARG C  1 58  ? 49.467  69.257  -63.135  1.00 22.75  ? 164 ARG C NE    1 
ATOM   8116  C  CZ    . ARG C  1 58  ? 50.451  70.166  -63.099  1.00 23.52  ? 164 ARG C CZ    1 
ATOM   8117  N  NH1   . ARG C  1 58  ? 50.664  70.848  -64.194  1.00 24.37  ? 164 ARG C NH1   1 
ATOM   8118  N  NH2   . ARG C  1 58  ? 51.242  70.393  -62.029  1.00 23.32  ? 164 ARG C NH2   1 
ATOM   8119  N  N     . PHE C  1 59  ? 48.650  63.234  -60.403  1.00 23.65  ? 165 PHE C N     1 
ATOM   8120  C  CA    . PHE C  1 59  ? 48.797  62.280  -59.310  1.00 24.14  ? 165 PHE C CA    1 
ATOM   8121  C  C     . PHE C  1 59  ? 50.263  62.024  -58.942  1.00 23.61  ? 165 PHE C C     1 
ATOM   8122  O  O     . PHE C  1 59  ? 50.686  62.276  -57.806  1.00 23.37  ? 165 PHE C O     1 
ATOM   8123  C  CB    . PHE C  1 59  ? 48.137  60.952  -59.692  1.00 25.13  ? 165 PHE C CB    1 
ATOM   8124  C  CG    . PHE C  1 59  ? 48.158  59.922  -58.605  1.00 25.69  ? 165 PHE C CG    1 
ATOM   8125  C  CD1   . PHE C  1 59  ? 47.276  60.025  -57.542  1.00 26.54  ? 165 PHE C CD1   1 
ATOM   8126  C  CD2   . PHE C  1 59  ? 49.001  58.857  -58.654  1.00 25.58  ? 165 PHE C CD2   1 
ATOM   8127  C  CE1   . PHE C  1 59  ? 47.232  59.064  -56.542  1.00 26.63  ? 165 PHE C CE1   1 
ATOM   8128  C  CE2   . PHE C  1 59  ? 48.989  57.889  -57.655  1.00 26.20  ? 165 PHE C CE2   1 
ATOM   8129  C  CZ    . PHE C  1 59  ? 48.100  58.005  -56.589  1.00 26.49  ? 165 PHE C CZ    1 
ATOM   8130  N  N     . GLU C  1 60  ? 51.031  61.569  -59.926  1.00 23.54  ? 166 GLU C N     1 
ATOM   8131  C  CA    . GLU C  1 60  ? 52.408  61.167  -59.666  1.00 23.52  ? 166 GLU C CA    1 
ATOM   8132  C  C     . GLU C  1 60  ? 53.355  62.344  -59.446  1.00 21.90  ? 166 GLU C C     1 
ATOM   8133  O  O     . GLU C  1 60  ? 54.292  62.223  -58.673  1.00 21.45  ? 166 GLU C O     1 
ATOM   8134  C  CB    . GLU C  1 60  ? 52.937  60.181  -60.716  1.00 25.27  ? 166 GLU C CB    1 
ATOM   8135  C  CG    . GLU C  1 60  ? 52.773  60.573  -62.182  1.00 26.97  ? 166 GLU C CG    1 
ATOM   8136  C  CD    . GLU C  1 60  ? 51.571  59.900  -62.898  1.00 28.32  ? 166 GLU C CD    1 
ATOM   8137  O  OE1   . GLU C  1 60  ? 50.424  59.946  -62.336  1.00 27.66  ? 166 GLU C OE1   1 
ATOM   8138  O  OE2   . GLU C  1 60  ? 51.831  59.356  -64.043  1.00 29.93  ? 166 GLU C OE2   1 
ATOM   8139  N  N     . HIS C  1 61  ? 53.107  63.474  -60.103  1.00 20.89  ? 167 HIS C N     1 
ATOM   8140  C  CA    . HIS C  1 61  ? 53.796  64.741  -59.771  1.00 20.41  ? 167 HIS C CA    1 
ATOM   8141  C  C     . HIS C  1 61  ? 53.552  65.088  -58.305  1.00 19.56  ? 167 HIS C C     1 
ATOM   8142  O  O     . HIS C  1 61  ? 54.491  65.385  -57.558  1.00 18.53  ? 167 HIS C O     1 
ATOM   8143  C  CB    . HIS C  1 61  ? 53.305  65.860  -60.711  1.00 20.92  ? 167 HIS C CB    1 
ATOM   8144  C  CG    . HIS C  1 61  ? 53.687  67.242  -60.276  1.00 21.37  ? 167 HIS C CG    1 
ATOM   8145  N  ND1   . HIS C  1 61  ? 54.999  67.659  -60.212  1.00 21.55  ? 167 HIS C ND1   1 
ATOM   8146  C  CD2   . HIS C  1 61  ? 52.933  68.308  -59.911  1.00 21.56  ? 167 HIS C CD2   1 
ATOM   8147  C  CE1   . HIS C  1 61  ? 55.034  68.921  -59.823  1.00 21.68  ? 167 HIS C CE1   1 
ATOM   8148  N  NE2   . HIS C  1 61  ? 53.797  69.338  -59.633  1.00 21.62  ? 167 HIS C NE2   1 
ATOM   8149  N  N     . SER C  1 62  ? 52.275  65.008  -57.903  1.00 19.31  ? 168 SER C N     1 
ATOM   8150  C  CA    . SER C  1 62  ? 51.863  65.322  -56.553  1.00 18.89  ? 168 SER C CA    1 
ATOM   8151  C  C     . SER C  1 62  ? 52.604  64.440  -55.531  1.00 18.14  ? 168 SER C C     1 
ATOM   8152  O  O     . SER C  1 62  ? 53.140  64.959  -54.553  1.00 17.66  ? 168 SER C O     1 
ATOM   8153  C  CB    . SER C  1 62  ? 50.331  65.290  -56.421  1.00 19.50  ? 168 SER C CB    1 
ATOM   8154  O  OG    . SER C  1 62  ? 49.712  66.557  -56.713  1.00 20.33  ? 168 SER C OG    1 
ATOM   8155  N  N     . LEU C  1 63  ? 52.697  63.135  -55.774  1.00 17.63  ? 169 LEU C N     1 
ATOM   8156  C  CA    . LEU C  1 63  ? 53.494  62.259  -54.886  1.00 17.32  ? 169 LEU C CA    1 
ATOM   8157  C  C     . LEU C  1 63  ? 54.958  62.704  -54.773  1.00 17.16  ? 169 LEU C C     1 
ATOM   8158  O  O     . LEU C  1 63  ? 55.538  62.752  -53.690  1.00 17.16  ? 169 LEU C O     1 
ATOM   8159  C  CB    . LEU C  1 63  ? 53.499  60.826  -55.371  1.00 17.52  ? 169 LEU C CB    1 
ATOM   8160  C  CG    . LEU C  1 63  ? 52.173  60.078  -55.392  1.00 17.95  ? 169 LEU C CG    1 
ATOM   8161  C  CD1   . LEU C  1 63  ? 52.354  58.706  -56.011  1.00 18.14  ? 169 LEU C CD1   1 
ATOM   8162  C  CD2   . LEU C  1 63  ? 51.570  59.935  -54.027  1.00 18.16  ? 169 LEU C CD2   1 
ATOM   8163  N  N     . GLY C  1 64  ? 55.549  63.033  -55.909  1.00 17.00  ? 170 GLY C N     1 
ATOM   8164  C  CA    . GLY C  1 64  ? 56.946  63.434  -55.955  1.00 16.73  ? 170 GLY C CA    1 
ATOM   8165  C  C     . GLY C  1 64  ? 57.238  64.739  -55.252  1.00 16.64  ? 170 GLY C C     1 
ATOM   8166  O  O     . GLY C  1 64  ? 58.273  64.884  -54.609  1.00 16.41  ? 170 GLY C O     1 
ATOM   8167  N  N     . VAL C  1 65  ? 56.327  65.698  -55.363  1.00 16.70  ? 171 VAL C N     1 
ATOM   8168  C  CA    . VAL C  1 65  ? 56.509  66.974  -54.683  1.00 16.87  ? 171 VAL C CA    1 
ATOM   8169  C  C     . VAL C  1 65  ? 56.413  66.754  -53.183  1.00 17.31  ? 171 VAL C C     1 
ATOM   8170  O  O     . VAL C  1 65  ? 57.182  67.333  -52.414  1.00 17.40  ? 171 VAL C O     1 
ATOM   8171  C  CB    . VAL C  1 65  ? 55.517  68.018  -55.185  1.00 16.77  ? 171 VAL C CB    1 
ATOM   8172  C  CG1   . VAL C  1 65  ? 55.608  69.313  -54.383  1.00 16.71  ? 171 VAL C CG1   1 
ATOM   8173  C  CG2   . VAL C  1 65  ? 55.811  68.330  -56.648  1.00 16.93  ? 171 VAL C CG2   1 
ATOM   8174  N  N     . GLY C  1 66  ? 55.473  65.901  -52.779  1.00 17.73  ? 172 GLY C N     1 
ATOM   8175  C  CA    . GLY C  1 66  ? 55.370  65.479  -51.395  1.00 18.07  ? 172 GLY C CA    1 
ATOM   8176  C  C     . GLY C  1 66  ? 56.658  64.840  -50.921  1.00 18.48  ? 172 GLY C C     1 
ATOM   8177  O  O     . GLY C  1 66  ? 57.144  65.139  -49.831  1.00 18.31  ? 172 GLY C O     1 
ATOM   8178  N  N     . TYR C  1 67  ? 57.207  63.959  -51.746  1.00 19.21  ? 173 TYR C N     1 
ATOM   8179  C  CA    . TYR C  1 67  ? 58.457  63.287  -51.412  1.00 20.16  ? 173 TYR C CA    1 
ATOM   8180  C  C     . TYR C  1 67  ? 59.639  64.250  -51.237  1.00 20.54  ? 173 TYR C C     1 
ATOM   8181  O  O     . TYR C  1 67  ? 60.371  64.171  -50.252  1.00 20.09  ? 173 TYR C O     1 
ATOM   8182  C  CB    . TYR C  1 67  ? 58.797  62.226  -52.461  1.00 20.53  ? 173 TYR C CB    1 
ATOM   8183  C  CG    . TYR C  1 67  ? 60.191  61.652  -52.304  1.00 20.87  ? 173 TYR C CG    1 
ATOM   8184  C  CD1   . TYR C  1 67  ? 60.480  60.795  -51.254  1.00 21.27  ? 173 TYR C CD1   1 
ATOM   8185  C  CD2   . TYR C  1 67  ? 61.212  61.966  -53.211  1.00 21.08  ? 173 TYR C CD2   1 
ATOM   8186  C  CE1   . TYR C  1 67  ? 61.765  60.292  -51.070  1.00 21.55  ? 173 TYR C CE1   1 
ATOM   8187  C  CE2   . TYR C  1 67  ? 62.481  61.433  -53.069  1.00 21.36  ? 173 TYR C CE2   1 
ATOM   8188  C  CZ    . TYR C  1 67  ? 62.755  60.596  -51.981  1.00 21.54  ? 173 TYR C CZ    1 
ATOM   8189  O  OH    . TYR C  1 67  ? 64.004  60.059  -51.797  1.00 21.54  ? 173 TYR C OH    1 
ATOM   8190  N  N     . LEU C  1 68  ? 59.817  65.141  -52.198  1.00 21.37  ? 174 LEU C N     1 
ATOM   8191  C  CA    . LEU C  1 68  ? 60.942  66.077  -52.175  1.00 22.31  ? 174 LEU C CA    1 
ATOM   8192  C  C     . LEU C  1 68  ? 60.803  67.095  -51.070  1.00 23.30  ? 174 LEU C C     1 
ATOM   8193  O  O     . LEU C  1 68  ? 61.795  67.513  -50.486  1.00 24.50  ? 174 LEU C O     1 
ATOM   8194  C  CB    . LEU C  1 68  ? 61.096  66.800  -53.511  1.00 22.29  ? 174 LEU C CB    1 
ATOM   8195  C  CG    . LEU C  1 68  ? 61.480  65.922  -54.708  1.00 22.60  ? 174 LEU C CG    1 
ATOM   8196  C  CD1   . LEU C  1 68  ? 61.670  66.821  -55.930  1.00 22.83  ? 174 LEU C CD1   1 
ATOM   8197  C  CD2   . LEU C  1 68  ? 62.741  65.091  -54.439  1.00 22.63  ? 174 LEU C CD2   1 
ATOM   8198  N  N     . ALA C  1 69  ? 59.578  67.496  -50.781  1.00 23.47  ? 175 ALA C N     1 
ATOM   8199  C  CA    . ALA C  1 69  ? 59.338  68.375  -49.651  1.00 23.73  ? 175 ALA C CA    1 
ATOM   8200  C  C     . ALA C  1 69  ? 59.861  67.739  -48.361  1.00 24.39  ? 175 ALA C C     1 
ATOM   8201  O  O     . ALA C  1 69  ? 60.528  68.393  -47.572  1.00 24.36  ? 175 ALA C O     1 
ATOM   8202  C  CB    . ALA C  1 69  ? 57.865  68.677  -49.544  1.00 23.65  ? 175 ALA C CB    1 
ATOM   8203  N  N     . GLY C  1 70  ? 59.573  66.451  -48.177  1.00 24.96  ? 176 GLY C N     1 
ATOM   8204  C  CA    . GLY C  1 70  ? 60.120  65.674  -47.070  1.00 25.77  ? 176 GLY C CA    1 
ATOM   8205  C  C     . GLY C  1 70  ? 61.645  65.641  -47.077  1.00 26.86  ? 176 GLY C C     1 
ATOM   8206  O  O     . GLY C  1 70  ? 62.283  65.824  -46.049  1.00 28.80  ? 176 GLY C O     1 
ATOM   8207  N  N     . CYS C  1 71  ? 62.233  65.409  -48.241  1.00 26.67  ? 177 CYS C N     1 
ATOM   8208  C  CA    . CYS C  1 71  ? 63.685  65.311  -48.353  1.00 26.48  ? 177 CYS C CA    1 
ATOM   8209  C  C     . CYS C  1 71  ? 64.354  66.566  -47.872  1.00 25.99  ? 177 CYS C C     1 
ATOM   8210  O  O     . CYS C  1 71  ? 65.305  66.485  -47.110  1.00 27.07  ? 177 CYS C O     1 
ATOM   8211  C  CB    . CYS C  1 71  ? 64.135  65.047  -49.784  1.00 27.12  ? 177 CYS C CB    1 
ATOM   8212  S  SG    . CYS C  1 71  ? 63.860  63.370  -50.377  1.00 29.00  ? 177 CYS C SG    1 
ATOM   8213  N  N     . LEU C  1 72  ? 63.856  67.709  -48.320  1.00 25.44  ? 178 LEU C N     1 
ATOM   8214  C  CA    . LEU C  1 72  ? 64.514  68.977  -48.054  1.00 25.69  ? 178 LEU C CA    1 
ATOM   8215  C  C     . LEU C  1 72  ? 64.359  69.368  -46.588  1.00 26.75  ? 178 LEU C C     1 
ATOM   8216  O  O     . LEU C  1 72  ? 65.338  69.730  -45.941  1.00 26.58  ? 178 LEU C O     1 
ATOM   8217  C  CB    . LEU C  1 72  ? 63.972  70.073  -48.975  1.00 24.92  ? 178 LEU C CB    1 
ATOM   8218  C  CG    . LEU C  1 72  ? 64.487  71.491  -48.760  1.00 24.00  ? 178 LEU C CG    1 
ATOM   8219  C  CD1   . LEU C  1 72  ? 66.007  71.567  -48.708  1.00 24.00  ? 178 LEU C CD1   1 
ATOM   8220  C  CD2   . LEU C  1 72  ? 63.962  72.368  -49.866  1.00 23.32  ? 178 LEU C CD2   1 
ATOM   8221  N  N     . VAL C  1 73  ? 63.144  69.265  -46.055  1.00 28.17  ? 179 VAL C N     1 
ATOM   8222  C  CA    . VAL C  1 73  ? 62.918  69.623  -44.660  1.00 30.39  ? 179 VAL C CA    1 
ATOM   8223  C  C     . VAL C  1 73  ? 63.639  68.672  -43.703  1.00 32.25  ? 179 VAL C C     1 
ATOM   8224  O  O     . VAL C  1 73  ? 64.159  69.113  -42.693  1.00 30.91  ? 179 VAL C O     1 
ATOM   8225  C  CB    . VAL C  1 73  ? 61.413  69.727  -44.324  1.00 29.67  ? 179 VAL C CB    1 
ATOM   8226  C  CG1   . VAL C  1 73  ? 60.757  68.355  -44.214  1.00 29.43  ? 179 VAL C CG1   1 
ATOM   8227  C  CG2   . VAL C  1 73  ? 61.209  70.504  -43.039  1.00 29.48  ? 179 VAL C CG2   1 
ATOM   8228  N  N     . HIS C  1 74  ? 63.678  67.384  -44.037  1.00 35.52  ? 180 HIS C N     1 
ATOM   8229  C  CA    . HIS C  1 74  ? 64.368  66.388  -43.218  1.00 40.37  ? 180 HIS C CA    1 
ATOM   8230  C  C     . HIS C  1 74  ? 65.885  66.619  -43.270  1.00 40.00  ? 180 HIS C C     1 
ATOM   8231  O  O     . HIS C  1 74  ? 66.569  66.490  -42.263  1.00 42.94  ? 180 HIS C O     1 
ATOM   8232  C  CB    . HIS C  1 74  ? 63.956  64.951  -43.618  1.00 45.69  ? 180 HIS C CB    1 
ATOM   8233  C  CG    . HIS C  1 74  ? 64.529  63.878  -42.741  1.00 55.63  ? 180 HIS C CG    1 
ATOM   8234  N  ND1   . HIS C  1 74  ? 65.789  63.328  -42.954  1.00 61.65  ? 180 HIS C ND1   1 
ATOM   8235  C  CD2   . HIS C  1 74  ? 64.027  63.254  -41.647  1.00 60.93  ? 180 HIS C CD2   1 
ATOM   8236  C  CE1   . HIS C  1 74  ? 66.037  62.408  -42.036  1.00 61.66  ? 180 HIS C CE1   1 
ATOM   8237  N  NE2   . HIS C  1 74  ? 64.987  62.343  -41.230  1.00 66.17  ? 180 HIS C NE2   1 
ATOM   8238  N  N     . ALA C  1 75  ? 66.398  67.017  -44.423  1.00 39.12  ? 181 ALA C N     1 
ATOM   8239  C  CA    . ALA C  1 75  ? 67.820  67.309  -44.585  1.00 38.22  ? 181 ALA C CA    1 
ATOM   8240  C  C     . ALA C  1 75  ? 68.252  68.524  -43.788  1.00 38.50  ? 181 ALA C C     1 
ATOM   8241  O  O     . ALA C  1 75  ? 69.298  68.499  -43.149  1.00 40.77  ? 181 ALA C O     1 
ATOM   8242  C  CB    . ALA C  1 75  ? 68.151  67.523  -46.046  1.00 37.79  ? 181 ALA C CB    1 
ATOM   8243  N  N     . LEU C  1 76  ? 67.462  69.589  -43.842  1.00 38.65  ? 182 LEU C N     1 
ATOM   8244  C  CA    . LEU C  1 76  ? 67.767  70.782  -43.071  1.00 39.91  ? 182 LEU C CA    1 
ATOM   8245  C  C     . LEU C  1 76  ? 67.796  70.457  -41.594  1.00 41.05  ? 182 LEU C C     1 
ATOM   8246  O  O     . LEU C  1 76  ? 68.647  70.955  -40.881  1.00 40.58  ? 182 LEU C O     1 
ATOM   8247  C  CB    . LEU C  1 76  ? 66.741  71.878  -43.337  1.00 40.28  ? 182 LEU C CB    1 
ATOM   8248  C  CG    . LEU C  1 76  ? 66.760  72.447  -44.751  1.00 41.31  ? 182 LEU C CG    1 
ATOM   8249  C  CD1   . LEU C  1 76  ? 65.561  73.342  -44.971  1.00 42.18  ? 182 LEU C CD1   1 
ATOM   8250  C  CD2   . LEU C  1 76  ? 68.049  73.213  -45.029  1.00 41.89  ? 182 LEU C CD2   1 
ATOM   8251  N  N     . GLY C  1 77  ? 66.880  69.592  -41.161  1.00 42.60  ? 183 GLY C N     1 
ATOM   8252  C  CA    . GLY C  1 77  ? 66.799  69.148  -39.781  1.00 44.62  ? 183 GLY C CA    1 
ATOM   8253  C  C     . GLY C  1 77  ? 68.012  68.394  -39.289  1.00 45.91  ? 183 GLY C C     1 
ATOM   8254  O  O     . GLY C  1 77  ? 68.498  68.672  -38.192  1.00 47.74  ? 183 GLY C O     1 
ATOM   8255  N  N     . GLU C  1 78  ? 68.506  67.445  -40.078  1.00 47.82  ? 184 GLU C N     1 
ATOM   8256  C  CA    . GLU C  1 78  ? 69.679  66.669  -39.671  1.00 51.39  ? 184 GLU C CA    1 
ATOM   8257  C  C     . GLU C  1 78  ? 70.891  67.582  -39.603  1.00 48.19  ? 184 GLU C C     1 
ATOM   8258  O  O     . GLU C  1 78  ? 71.604  67.555  -38.618  1.00 48.99  ? 184 GLU C O     1 
ATOM   8259  C  CB    . GLU C  1 78  ? 69.989  65.488  -40.613  1.00 56.32  ? 184 GLU C CB    1 
ATOM   8260  C  CG    . GLU C  1 78  ? 68.877  64.463  -40.818  1.00 64.65  ? 184 GLU C CG    1 
ATOM   8261  C  CD    . GLU C  1 78  ? 68.623  63.523  -39.618  1.00 74.75  ? 184 GLU C CD    1 
ATOM   8262  O  OE1   . GLU C  1 78  ? 69.449  62.616  -39.379  1.00 88.50  ? 184 GLU C OE1   1 
ATOM   8263  O  OE2   . GLU C  1 78  ? 67.563  63.656  -38.946  1.00 77.12  ? 184 GLU C OE2   1 
ATOM   8264  N  N     . LYS C  1 79  ? 71.108  68.397  -40.637  1.00 44.04  ? 185 LYS C N     1 
ATOM   8265  C  CA    . LYS C  1 79  ? 72.277  69.285  -40.701  1.00 41.24  ? 185 LYS C CA    1 
ATOM   8266  C  C     . LYS C  1 79  ? 72.229  70.375  -39.585  1.00 39.49  ? 185 LYS C C     1 
ATOM   8267  O  O     . LYS C  1 79  ? 73.270  70.736  -39.051  1.00 39.50  ? 185 LYS C O     1 
ATOM   8268  C  CB    . LYS C  1 79  ? 72.488  69.869  -42.128  1.00 40.32  ? 185 LYS C CB    1 
ATOM   8269  N  N     . GLN C  1 80  ? 71.043  70.848  -39.193  1.00 38.70  ? 186 GLN C N     1 
ATOM   8270  C  CA    . GLN C  1 80  ? 70.905  71.959  -38.221  1.00 39.90  ? 186 GLN C CA    1 
ATOM   8271  C  C     . GLN C  1 80  ? 69.825  71.687  -37.153  1.00 41.16  ? 186 GLN C C     1 
ATOM   8272  O  O     . GLN C  1 80  ? 68.670  72.131  -37.279  1.00 40.71  ? 186 GLN C O     1 
ATOM   8273  C  CB    . GLN C  1 80  ? 70.583  73.269  -38.948  1.00 38.90  ? 186 GLN C CB    1 
ATOM   8274  C  CG    . GLN C  1 80  ? 71.569  73.646  -40.043  1.00 37.84  ? 186 GLN C CG    1 
ATOM   8275  C  CD    . GLN C  1 80  ? 71.295  75.022  -40.605  1.00 36.88  ? 186 GLN C CD    1 
ATOM   8276  O  OE1   . GLN C  1 80  ? 70.643  75.171  -41.632  1.00 35.48  ? 186 GLN C OE1   1 
ATOM   8277  N  NE2   . GLN C  1 80  ? 71.790  76.039  -39.929  1.00 36.42  ? 186 GLN C NE2   1 
ATOM   8278  N  N     . PRO C  1 81  ? 70.188  70.945  -36.091  1.00 42.22  ? 187 PRO C N     1 
ATOM   8279  C  CA    . PRO C  1 81  ? 69.232  70.660  -35.028  1.00 42.78  ? 187 PRO C CA    1 
ATOM   8280  C  C     . PRO C  1 81  ? 68.737  71.906  -34.311  1.00 42.85  ? 187 PRO C C     1 
ATOM   8281  O  O     . PRO C  1 81  ? 67.598  71.925  -33.863  1.00 42.54  ? 187 PRO C O     1 
ATOM   8282  C  CB    . PRO C  1 81  ? 70.023  69.770  -34.069  1.00 43.41  ? 187 PRO C CB    1 
ATOM   8283  C  CG    . PRO C  1 81  ? 71.030  69.108  -34.935  1.00 43.47  ? 187 PRO C CG    1 
ATOM   8284  C  CD    . PRO C  1 81  ? 71.433  70.181  -35.904  1.00 43.74  ? 187 PRO C CD    1 
ATOM   8285  N  N     . GLU C  1 82  ? 69.575  72.938  -34.247  1.00 44.02  ? 188 GLU C N     1 
ATOM   8286  C  CA    . GLU C  1 82  ? 69.193  74.231  -33.680  1.00 46.81  ? 188 GLU C CA    1 
ATOM   8287  C  C     . GLU C  1 82  ? 67.870  74.797  -34.182  1.00 47.67  ? 188 GLU C C     1 
ATOM   8288  O  O     . GLU C  1 82  ? 67.241  75.570  -33.482  1.00 51.05  ? 188 GLU C O     1 
ATOM   8289  C  CB    . GLU C  1 82  ? 70.295  75.289  -33.894  1.00 48.41  ? 188 GLU C CB    1 
ATOM   8290  C  CG    . GLU C  1 82  ? 70.621  75.662  -35.336  1.00 50.42  ? 188 GLU C CG    1 
ATOM   8291  C  CD    . GLU C  1 82  ? 71.842  74.911  -35.909  1.00 52.89  ? 188 GLU C CD    1 
ATOM   8292  O  OE1   . GLU C  1 82  ? 72.104  73.735  -35.515  1.00 55.50  ? 188 GLU C OE1   1 
ATOM   8293  O  OE2   . GLU C  1 82  ? 72.524  75.514  -36.790  1.00 50.60  ? 188 GLU C OE2   1 
ATOM   8294  N  N     . LEU C  1 83  ? 67.457  74.418  -35.381  1.00 49.42  ? 189 LEU C N     1 
ATOM   8295  C  CA    . LEU C  1 83  ? 66.201  74.897  -35.965  1.00 49.58  ? 189 LEU C CA    1 
ATOM   8296  C  C     . LEU C  1 83  ? 64.946  74.352  -35.295  1.00 50.65  ? 189 LEU C C     1 
ATOM   8297  O  O     . LEU C  1 83  ? 63.861  74.948  -35.416  1.00 47.58  ? 189 LEU C O     1 
ATOM   8298  C  CB    . LEU C  1 83  ? 66.172  74.553  -37.460  1.00 46.45  ? 189 LEU C CB    1 
ATOM   8299  C  CG    . LEU C  1 83  ? 67.272  75.182  -38.313  1.00 44.23  ? 189 LEU C CG    1 
ATOM   8300  C  CD1   . LEU C  1 83  ? 67.240  74.626  -39.712  1.00 43.71  ? 189 LEU C CD1   1 
ATOM   8301  C  CD2   . LEU C  1 83  ? 67.125  76.687  -38.354  1.00 43.94  ? 189 LEU C CD2   1 
ATOM   8302  N  N     . GLN C  1 84  ? 65.100  73.209  -34.617  1.00 53.47  ? 190 GLN C N     1 
ATOM   8303  C  CA    . GLN C  1 84  ? 64.011  72.542  -33.910  1.00 55.41  ? 190 GLN C CA    1 
ATOM   8304  C  C     . GLN C  1 84  ? 62.829  72.298  -34.833  1.00 53.14  ? 190 GLN C C     1 
ATOM   8305  O  O     . GLN C  1 84  ? 61.713  72.774  -34.620  1.00 54.45  ? 190 GLN C O     1 
ATOM   8306  C  CB    . GLN C  1 84  ? 63.611  73.323  -32.654  1.00 59.27  ? 190 GLN C CB    1 
ATOM   8307  C  CG    . GLN C  1 84  ? 64.693  73.232  -31.573  1.00 62.54  ? 190 GLN C CG    1 
ATOM   8308  C  CD    . GLN C  1 84  ? 64.166  73.575  -30.184  1.00 66.35  ? 190 GLN C CD    1 
ATOM   8309  O  OE1   . GLN C  1 84  ? 63.441  74.558  -30.083  1.00 70.39  ? 190 GLN C OE1   1 
ATOM   8310  N  NE2   . GLN C  1 84  ? 64.491  72.766  -29.124  1.00 65.57  ? 190 GLN C NE2   1 
ATOM   8311  N  N     . ILE C  1 85  ? 63.130  71.557  -35.886  1.00 48.88  ? 191 ILE C N     1 
ATOM   8312  C  CA    . ILE C  1 85  ? 62.153  71.145  -36.859  1.00 45.23  ? 191 ILE C CA    1 
ATOM   8313  C  C     . ILE C  1 85  ? 61.540  69.898  -36.239  1.00 41.47  ? 191 ILE C C     1 
ATOM   8314  O  O     . ILE C  1 85  ? 62.255  68.951  -35.992  1.00 39.56  ? 191 ILE C O     1 
ATOM   8315  C  CB    . ILE C  1 85  ? 62.824  70.837  -38.216  1.00 45.29  ? 191 ILE C CB    1 
ATOM   8316  C  CG1   . ILE C  1 85  ? 63.304  72.119  -38.857  1.00 44.33  ? 191 ILE C CG1   1 
ATOM   8317  C  CG2   . ILE C  1 85  ? 61.854  70.165  -39.168  1.00 45.19  ? 191 ILE C CG2   1 
ATOM   8318  C  CD1   . ILE C  1 85  ? 64.222  71.946  -40.054  1.00 44.10  ? 191 ILE C CD1   1 
ATOM   8319  N  N     . SER C  1 86  ? 60.238  69.920  -35.987  1.00 40.72  ? 192 SER C N     1 
ATOM   8320  C  CA    . SER C  1 86  ? 59.538  68.787  -35.374  1.00 43.43  ? 192 SER C CA    1 
ATOM   8321  C  C     . SER C  1 86  ? 59.016  67.806  -36.395  1.00 43.48  ? 192 SER C C     1 
ATOM   8322  O  O     . SER C  1 86  ? 58.839  68.173  -37.543  1.00 45.25  ? 192 SER C O     1 
ATOM   8323  C  CB    . SER C  1 86  ? 58.358  69.282  -34.526  1.00 45.67  ? 192 SER C CB    1 
ATOM   8324  O  OG    . SER C  1 86  ? 57.443  70.030  -35.303  1.00 48.03  ? 192 SER C OG    1 
ATOM   8325  N  N     . GLU C  1 87  ? 58.723  66.583  -35.983  1.00 44.19  ? 193 GLU C N     1 
ATOM   8326  C  CA    . GLU C  1 87  ? 58.081  65.598  -36.874  1.00 44.81  ? 193 GLU C CA    1 
ATOM   8327  C  C     . GLU C  1 87  ? 56.700  66.050  -37.276  1.00 42.60  ? 193 GLU C C     1 
ATOM   8328  O  O     . GLU C  1 87  ? 56.153  65.595  -38.273  1.00 42.35  ? 193 GLU C O     1 
ATOM   8329  C  CB    . GLU C  1 87  ? 57.990  64.213  -36.208  1.00 47.85  ? 193 GLU C CB    1 
ATOM   8330  C  CG    . GLU C  1 87  ? 59.332  63.577  -35.858  1.00 51.56  ? 193 GLU C CG    1 
ATOM   8331  C  CD    . GLU C  1 87  ? 59.349  62.838  -34.474  1.00 55.25  ? 193 GLU C CD    1 
ATOM   8332  O  OE1   . GLU C  1 87  ? 58.360  62.083  -34.321  1.00 59.81  ? 193 GLU C OE1   1 
ATOM   8333  O  OE2   . GLU C  1 87  ? 60.271  63.085  -33.597  1.00 55.21  ? 193 GLU C OE2   1 
ATOM   8334  N  N     . ARG C  1 88  ? 56.127  66.954  -36.492  1.00 41.38  ? 194 ARG C N     1 
ATOM   8335  C  CA    . ARG C  1 88  ? 54.910  67.635  -36.876  1.00 40.43  ? 194 ARG C CA    1 
ATOM   8336  C  C     . ARG C  1 88  ? 55.133  68.581  -38.055  1.00 39.80  ? 194 ARG C C     1 
ATOM   8337  O  O     . ARG C  1 88  ? 54.349  68.601  -38.993  1.00 38.68  ? 194 ARG C O     1 
ATOM   8338  C  CB    . ARG C  1 88  ? 54.385  68.397  -35.668  1.00 40.17  ? 194 ARG C CB    1 
ATOM   8339  C  CG    . ARG C  1 88  ? 52.999  68.981  -35.867  1.00 40.48  ? 194 ARG C CG    1 
ATOM   8340  C  CD    . ARG C  1 88  ? 52.596  69.747  -34.631  1.00 41.24  ? 194 ARG C CD    1 
ATOM   8341  N  NE    . ARG C  1 88  ? 51.932  70.979  -34.962  1.00 41.58  ? 194 ARG C NE    1 
ATOM   8342  C  CZ    . ARG C  1 88  ? 51.775  71.992  -34.126  1.00 42.35  ? 194 ARG C CZ    1 
ATOM   8343  N  NH1   . ARG C  1 88  ? 52.223  71.933  -32.868  1.00 43.58  ? 194 ARG C NH1   1 
ATOM   8344  N  NH2   . ARG C  1 88  ? 51.171  73.078  -34.553  1.00 42.01  ? 194 ARG C NH2   1 
ATOM   8345  N  N     . ASP C  1 89  ? 56.190  69.384  -37.988  1.00 39.65  ? 195 ASP C N     1 
ATOM   8346  C  CA    . ASP C  1 89  ? 56.541  70.287  -39.091  1.00 38.52  ? 195 ASP C CA    1 
ATOM   8347  C  C     . ASP C  1 89  ? 56.790  69.507  -40.383  1.00 36.63  ? 195 ASP C C     1 
ATOM   8348  O  O     . ASP C  1 89  ? 56.351  69.917  -41.446  1.00 35.91  ? 195 ASP C O     1 
ATOM   8349  C  CB    . ASP C  1 89  ? 57.793  71.107  -38.774  1.00 40.33  ? 195 ASP C CB    1 
ATOM   8350  C  CG    . ASP C  1 89  ? 57.582  72.142  -37.683  1.00 42.09  ? 195 ASP C CG    1 
ATOM   8351  O  OD1   . ASP C  1 89  ? 56.476  72.724  -37.583  1.00 42.25  ? 195 ASP C OD1   1 
ATOM   8352  O  OD2   . ASP C  1 89  ? 58.559  72.397  -36.935  1.00 43.24  ? 195 ASP C OD2   1 
ATOM   8353  N  N     . VAL C  1 90  ? 57.493  68.385  -40.277  1.00 35.29  ? 196 VAL C N     1 
ATOM   8354  C  CA    . VAL C  1 90  ? 57.844  67.557  -41.440  1.00 35.34  ? 196 VAL C CA    1 
ATOM   8355  C  C     . VAL C  1 90  ? 56.589  67.026  -42.113  1.00 34.58  ? 196 VAL C C     1 
ATOM   8356  O  O     . VAL C  1 90  ? 56.447  67.110  -43.329  1.00 33.28  ? 196 VAL C O     1 
ATOM   8357  C  CB    . VAL C  1 90  ? 58.758  66.378  -41.036  1.00 35.37  ? 196 VAL C CB    1 
ATOM   8358  C  CG1   . VAL C  1 90  ? 58.952  65.386  -42.167  1.00 35.29  ? 196 VAL C CG1   1 
ATOM   8359  C  CG2   . VAL C  1 90  ? 60.113  66.911  -40.612  1.00 36.23  ? 196 VAL C CG2   1 
ATOM   8360  N  N     . LEU C  1 91  ? 55.685  66.471  -41.314  1.00 33.40  ? 197 LEU C N     1 
ATOM   8361  C  CA    . LEU C  1 91  ? 54.430  65.980  -41.849  1.00 32.15  ? 197 LEU C CA    1 
ATOM   8362  C  C     . LEU C  1 91  ? 53.627  67.049  -42.544  1.00 31.36  ? 197 LEU C C     1 
ATOM   8363  O  O     . LEU C  1 91  ? 53.057  66.796  -43.583  1.00 31.12  ? 197 LEU C O     1 
ATOM   8364  C  CB    . LEU C  1 91  ? 53.571  65.357  -40.764  1.00 31.67  ? 197 LEU C CB    1 
ATOM   8365  C  CG    . LEU C  1 91  ? 53.643  63.847  -40.672  1.00 31.85  ? 197 LEU C CG    1 
ATOM   8366  C  CD1   . LEU C  1 91  ? 52.718  63.371  -39.574  1.00 32.51  ? 197 LEU C CD1   1 
ATOM   8367  C  CD2   . LEU C  1 91  ? 53.174  63.205  -41.980  1.00 31.76  ? 197 LEU C CD2   1 
ATOM   8368  N  N     . CYS C  1 92  ? 53.580  68.238  -41.970  1.00 30.47  ? 198 CYS C N     1 
ATOM   8369  C  CA    . CYS C  1 92  ? 52.829  69.331  -42.573  1.00 30.57  ? 198 CYS C CA    1 
ATOM   8370  C  C     . CYS C  1 92  ? 53.400  69.770  -43.909  1.00 30.73  ? 198 CYS C C     1 
ATOM   8371  O  O     . CYS C  1 92  ? 52.654  70.058  -44.837  1.00 31.86  ? 198 CYS C O     1 
ATOM   8372  C  CB    . CYS C  1 92  ? 52.776  70.533  -41.625  1.00 30.38  ? 198 CYS C CB    1 
ATOM   8373  S  SG    . CYS C  1 92  ? 51.782  70.225  -40.157  1.00 29.20  ? 198 CYS C SG    1 
ATOM   8374  N  N     . VAL C  1 93  ? 54.719  69.833  -43.992  1.00 30.24  ? 199 VAL C N     1 
ATOM   8375  C  CA    . VAL C  1 93  ? 55.413  70.185  -45.232  1.00 29.36  ? 199 VAL C CA    1 
ATOM   8376  C  C     . VAL C  1 93  ? 55.134  69.118  -46.302  1.00 28.35  ? 199 VAL C C     1 
ATOM   8377  O  O     . VAL C  1 93  ? 54.834  69.461  -47.440  1.00 27.58  ? 199 VAL C O     1 
ATOM   8378  C  CB    . VAL C  1 93  ? 56.924  70.342  -44.973  1.00 29.55  ? 199 VAL C CB    1 
ATOM   8379  C  CG1   . VAL C  1 93  ? 57.698  70.464  -46.253  1.00 29.91  ? 199 VAL C CG1   1 
ATOM   8380  C  CG2   . VAL C  1 93  ? 57.204  71.559  -44.135  1.00 29.97  ? 199 VAL C CG2   1 
ATOM   8381  N  N     . GLN C  1 94  ? 55.209  67.844  -45.920  1.00 27.79  ? 200 GLN C N     1 
ATOM   8382  C  CA    . GLN C  1 94  ? 54.861  66.739  -46.823  1.00 28.24  ? 200 GLN C CA    1 
ATOM   8383  C  C     . GLN C  1 94  ? 53.424  66.814  -47.321  1.00 28.64  ? 200 GLN C C     1 
ATOM   8384  O  O     . GLN C  1 94  ? 53.169  66.624  -48.505  1.00 29.22  ? 200 GLN C O     1 
ATOM   8385  C  CB    . GLN C  1 94  ? 55.076  65.378  -46.156  1.00 28.21  ? 200 GLN C CB    1 
ATOM   8386  C  CG    . GLN C  1 94  ? 56.529  64.935  -46.185  1.00 28.60  ? 200 GLN C CG    1 
ATOM   8387  C  CD    . GLN C  1 94  ? 56.677  63.612  -45.433  1.00 28.41  ? 200 GLN C CD    1 
ATOM   8388  O  OE1   . GLN C  1 94  ? 56.558  63.549  -44.236  1.00 27.53  ? 200 GLN C OE1   1 
ATOM   8389  N  NE2   . GLN C  1 94  ? 57.017  62.577  -46.141  1.00 28.82  ? 200 GLN C NE2   1 
ATOM   8390  N  N     . ILE C  1 95  ? 52.491  67.083  -46.416  1.00 28.48  ? 201 ILE C N     1 
ATOM   8391  C  CA    . ILE C  1 95  ? 51.086  67.184  -46.785  1.00 28.21  ? 201 ILE C CA    1 
ATOM   8392  C  C     . ILE C  1 95  ? 50.873  68.321  -47.766  1.00 27.64  ? 201 ILE C C     1 
ATOM   8393  O  O     . ILE C  1 95  ? 50.115  68.182  -48.722  1.00 27.60  ? 201 ILE C O     1 
ATOM   8394  C  CB    . ILE C  1 95  ? 50.171  67.339  -45.544  1.00 28.30  ? 201 ILE C CB    1 
ATOM   8395  C  CG1   . ILE C  1 9